data_1SVA
# 
_entry.id   1SVA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SVA         
WWPDB D_1000176529 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SVA 
_pdbx_database_status.recvd_initial_deposition_date   1995-11-27 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stehle, T.'     1 
'Gamblin, S.J.'  2 
'Harrison, S.C.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The structure of simian virus 40 refined at 3.1 A resolution.' Structure 4   165 182 1996 STRUE6 UK 0969-2126 2005 ? 
8805523 '10.1016/S0969-2126(96)00020-2' 
1       'Structure of Simian Virus 40 at 3.8-A Resolution'              Nature    354 278 ?   1991 NATUAS UK 0028-0836 0006 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Stehle, T.'       1  
primary 'Gamblin, S.J.'    2  
primary 'Yan, Y.'          3  
primary 'Harrison, S.C.'   4  
1       'Liddington, R.C.' 5  
1       'Yan, Y.'          6  
1       'Moulai, J.'       7  
1       'Sahli, R.'        8  
1       'Benjamin, T.L.'   9  
1       'Harrison, S.C.'   10 
# 
_cell.entry_id           1SVA 
_cell.length_a           558.000 
_cell.length_b           558.000 
_cell.length_c           558.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              720 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SVA 
_symmetry.space_group_name_H-M             'I 2 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                197 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'SIMIAN VIRUS 40' 
_entity.formula_weight             39818.969 
_entity.pdbx_number_of_molecules   6 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APTKRKGSCPGAAPKKPKEPVQVPKLVIKGGIEVLGVKTGVDSFTEVECFLNPQMGNPDEHQKGLSKSLAAEKQFTDDSP
DKEQLPCYSVARIPLPNINEDLTCGNILMWEAVTVKTEVIGVTAMLNLHSGTQKTHENGAGKPIQGSNFHFFAVGGEPLE
LQGVLANYRTKYPAQTVTPKNATVDSQQMNTDHKAVLDKDNAYPVECWVPDPSKNENTRYFGTYTGGENVPPVLHITNTA
TTVLLDEQGVGPLCKADSLYVSAVDICGLFTNTSGTQQWKGLPRYFKITLRKRSVKNPYPISFLLSDLINRRTQRVDGQP
MIGMSSQVEEVRVYEDTEELPGDPDMIRYIDEFGQTTTRMQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APTKRKGSCPGAAPKKPKEPVQVPKLVIKGGIEVLGVKTGVDSFTEVECFLNPQMGNPDEHQKGLSKSLAAEKQFTDDSP
DKEQLPCYSVARIPLPNINEDLTCGNILMWEAVTVKTEVIGVTAMLNLHSGTQKTHENGAGKPIQGSNFHFFAVGGEPLE
LQGVLANYRTKYPAQTVTPKNATVDSQQMNTDHKAVLDKDNAYPVECWVPDPSKNENTRYFGTYTGGENVPPVLHITNTA
TTVLLDEQGVGPLCKADSLYVSAVDICGLFTNTSGTQQWKGLPRYFKITLRKRSVKNPYPISFLLSDLINRRTQRVDGQP
MIGMSSQVEEVRVYEDTEELPGDPDMIRYIDEFGQTTTRMQ
;
_entity_poly.pdbx_strand_id                 1,2,3,4,5,6 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   THR n 
1 4   LYS n 
1 5   ARG n 
1 6   LYS n 
1 7   GLY n 
1 8   SER n 
1 9   CYS n 
1 10  PRO n 
1 11  GLY n 
1 12  ALA n 
1 13  ALA n 
1 14  PRO n 
1 15  LYS n 
1 16  LYS n 
1 17  PRO n 
1 18  LYS n 
1 19  GLU n 
1 20  PRO n 
1 21  VAL n 
1 22  GLN n 
1 23  VAL n 
1 24  PRO n 
1 25  LYS n 
1 26  LEU n 
1 27  VAL n 
1 28  ILE n 
1 29  LYS n 
1 30  GLY n 
1 31  GLY n 
1 32  ILE n 
1 33  GLU n 
1 34  VAL n 
1 35  LEU n 
1 36  GLY n 
1 37  VAL n 
1 38  LYS n 
1 39  THR n 
1 40  GLY n 
1 41  VAL n 
1 42  ASP n 
1 43  SER n 
1 44  PHE n 
1 45  THR n 
1 46  GLU n 
1 47  VAL n 
1 48  GLU n 
1 49  CYS n 
1 50  PHE n 
1 51  LEU n 
1 52  ASN n 
1 53  PRO n 
1 54  GLN n 
1 55  MET n 
1 56  GLY n 
1 57  ASN n 
1 58  PRO n 
1 59  ASP n 
1 60  GLU n 
1 61  HIS n 
1 62  GLN n 
1 63  LYS n 
1 64  GLY n 
1 65  LEU n 
1 66  SER n 
1 67  LYS n 
1 68  SER n 
1 69  LEU n 
1 70  ALA n 
1 71  ALA n 
1 72  GLU n 
1 73  LYS n 
1 74  GLN n 
1 75  PHE n 
1 76  THR n 
1 77  ASP n 
1 78  ASP n 
1 79  SER n 
1 80  PRO n 
1 81  ASP n 
1 82  LYS n 
1 83  GLU n 
1 84  GLN n 
1 85  LEU n 
1 86  PRO n 
1 87  CYS n 
1 88  TYR n 
1 89  SER n 
1 90  VAL n 
1 91  ALA n 
1 92  ARG n 
1 93  ILE n 
1 94  PRO n 
1 95  LEU n 
1 96  PRO n 
1 97  ASN n 
1 98  ILE n 
1 99  ASN n 
1 100 GLU n 
1 101 ASP n 
1 102 LEU n 
1 103 THR n 
1 104 CYS n 
1 105 GLY n 
1 106 ASN n 
1 107 ILE n 
1 108 LEU n 
1 109 MET n 
1 110 TRP n 
1 111 GLU n 
1 112 ALA n 
1 113 VAL n 
1 114 THR n 
1 115 VAL n 
1 116 LYS n 
1 117 THR n 
1 118 GLU n 
1 119 VAL n 
1 120 ILE n 
1 121 GLY n 
1 122 VAL n 
1 123 THR n 
1 124 ALA n 
1 125 MET n 
1 126 LEU n 
1 127 ASN n 
1 128 LEU n 
1 129 HIS n 
1 130 SER n 
1 131 GLY n 
1 132 THR n 
1 133 GLN n 
1 134 LYS n 
1 135 THR n 
1 136 HIS n 
1 137 GLU n 
1 138 ASN n 
1 139 GLY n 
1 140 ALA n 
1 141 GLY n 
1 142 LYS n 
1 143 PRO n 
1 144 ILE n 
1 145 GLN n 
1 146 GLY n 
1 147 SER n 
1 148 ASN n 
1 149 PHE n 
1 150 HIS n 
1 151 PHE n 
1 152 PHE n 
1 153 ALA n 
1 154 VAL n 
1 155 GLY n 
1 156 GLY n 
1 157 GLU n 
1 158 PRO n 
1 159 LEU n 
1 160 GLU n 
1 161 LEU n 
1 162 GLN n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 ALA n 
1 167 ASN n 
1 168 TYR n 
1 169 ARG n 
1 170 THR n 
1 171 LYS n 
1 172 TYR n 
1 173 PRO n 
1 174 ALA n 
1 175 GLN n 
1 176 THR n 
1 177 VAL n 
1 178 THR n 
1 179 PRO n 
1 180 LYS n 
1 181 ASN n 
1 182 ALA n 
1 183 THR n 
1 184 VAL n 
1 185 ASP n 
1 186 SER n 
1 187 GLN n 
1 188 GLN n 
1 189 MET n 
1 190 ASN n 
1 191 THR n 
1 192 ASP n 
1 193 HIS n 
1 194 LYS n 
1 195 ALA n 
1 196 VAL n 
1 197 LEU n 
1 198 ASP n 
1 199 LYS n 
1 200 ASP n 
1 201 ASN n 
1 202 ALA n 
1 203 TYR n 
1 204 PRO n 
1 205 VAL n 
1 206 GLU n 
1 207 CYS n 
1 208 TRP n 
1 209 VAL n 
1 210 PRO n 
1 211 ASP n 
1 212 PRO n 
1 213 SER n 
1 214 LYS n 
1 215 ASN n 
1 216 GLU n 
1 217 ASN n 
1 218 THR n 
1 219 ARG n 
1 220 TYR n 
1 221 PHE n 
1 222 GLY n 
1 223 THR n 
1 224 TYR n 
1 225 THR n 
1 226 GLY n 
1 227 GLY n 
1 228 GLU n 
1 229 ASN n 
1 230 VAL n 
1 231 PRO n 
1 232 PRO n 
1 233 VAL n 
1 234 LEU n 
1 235 HIS n 
1 236 ILE n 
1 237 THR n 
1 238 ASN n 
1 239 THR n 
1 240 ALA n 
1 241 THR n 
1 242 THR n 
1 243 VAL n 
1 244 LEU n 
1 245 LEU n 
1 246 ASP n 
1 247 GLU n 
1 248 GLN n 
1 249 GLY n 
1 250 VAL n 
1 251 GLY n 
1 252 PRO n 
1 253 LEU n 
1 254 CYS n 
1 255 LYS n 
1 256 ALA n 
1 257 ASP n 
1 258 SER n 
1 259 LEU n 
1 260 TYR n 
1 261 VAL n 
1 262 SER n 
1 263 ALA n 
1 264 VAL n 
1 265 ASP n 
1 266 ILE n 
1 267 CYS n 
1 268 GLY n 
1 269 LEU n 
1 270 PHE n 
1 271 THR n 
1 272 ASN n 
1 273 THR n 
1 274 SER n 
1 275 GLY n 
1 276 THR n 
1 277 GLN n 
1 278 GLN n 
1 279 TRP n 
1 280 LYS n 
1 281 GLY n 
1 282 LEU n 
1 283 PRO n 
1 284 ARG n 
1 285 TYR n 
1 286 PHE n 
1 287 LYS n 
1 288 ILE n 
1 289 THR n 
1 290 LEU n 
1 291 ARG n 
1 292 LYS n 
1 293 ARG n 
1 294 SER n 
1 295 VAL n 
1 296 LYS n 
1 297 ASN n 
1 298 PRO n 
1 299 TYR n 
1 300 PRO n 
1 301 ILE n 
1 302 SER n 
1 303 PHE n 
1 304 LEU n 
1 305 LEU n 
1 306 SER n 
1 307 ASP n 
1 308 LEU n 
1 309 ILE n 
1 310 ASN n 
1 311 ARG n 
1 312 ARG n 
1 313 THR n 
1 314 GLN n 
1 315 ARG n 
1 316 VAL n 
1 317 ASP n 
1 318 GLY n 
1 319 GLN n 
1 320 PRO n 
1 321 MET n 
1 322 ILE n 
1 323 GLY n 
1 324 MET n 
1 325 SER n 
1 326 SER n 
1 327 GLN n 
1 328 VAL n 
1 329 GLU n 
1 330 GLU n 
1 331 VAL n 
1 332 ARG n 
1 333 VAL n 
1 334 TYR n 
1 335 GLU n 
1 336 ASP n 
1 337 THR n 
1 338 GLU n 
1 339 GLU n 
1 340 LEU n 
1 341 PRO n 
1 342 GLY n 
1 343 ASP n 
1 344 PRO n 
1 345 ASP n 
1 346 MET n 
1 347 ILE n 
1 348 ARG n 
1 349 TYR n 
1 350 ILE n 
1 351 ASP n 
1 352 GLU n 
1 353 PHE n 
1 354 GLY n 
1 355 GLN n 
1 356 THR n 
1 357 THR n 
1 358 THR n 
1 359 ARG n 
1 360 MET n 
1 361 GLN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Simian virus 40' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      10633 
_entity_src_nat.genus                      Polyomavirus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COA1_SV40 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03087 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKMAPTKRKGSCPGAAPKKPKEPVQVPKLVIKGGIEVLGVKTGVDSFTEVECFLNPQMGNPDEHQKGLSKSLAAEKQFTD
DSPDKEQLPCYSVARIPLPNINEDLTCGNILMWEAVTVKTEVIGVTAMLNLHSGTQKTHENGAGKPIQGSNFHFFAVGGE
PLELQGVLANYRTKYPAQTVTPKNATVDSQQMNTDHKAVLDKDNAYPVECWVPDPSKNENTRYFGTYTGGENVPPVLHIT
NTATTVLLDEQGVGPLCKADSLYVSAVDICGLFTNTSGTQQWKGLPRYFKITLRKRSVKNPYPISFLLSDLINRRTQRVD
GQPMIGMSSQVEEVRVYEDTEELPGDPDMIRYIDEFGQTTTRMQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SVA 1 1 ? 361 ? P03087 4 ? 364 ? 1 361 
2 1 1SVA 2 1 ? 361 ? P03087 4 ? 364 ? 1 361 
3 1 1SVA 3 1 ? 361 ? P03087 4 ? 364 ? 1 361 
4 1 1SVA 4 1 ? 361 ? P03087 4 ? 364 ? 1 361 
5 1 1SVA 5 1 ? 361 ? P03087 4 ? 364 ? 1 361 
6 1 1SVA 6 1 ? 361 ? P03087 4 ? 364 ? 1 361 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SVA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.entry_id                     1SVA 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             12.0 
_reflns.d_resolution_high            3.1 
_reflns.number_obs                   402347 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         80.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1SVA 
_refine.ls_number_reflns_obs                     402347 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             12.0 
_refine.ls_d_res_high                            3.1 
_refine.ls_percent_reflns_obs                    80.2 
_refine.ls_R_factor_obs                          0.257 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.257 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15983 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               15983 
_refine_hist.d_res_high                       3.1 
_refine_hist.d_res_low                        12.0 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given    ? 1.00000000  0.00000000  0.00000000  0.00000000  1.00000000  0.00000000 0.00000000  0.00000000 1.00000000 0.00000 
0.00000 0.00000 
2 generate ? 0.30901699  -0.80901699 0.50000000  0.80901699  0.50000000  0.30901699 -0.50000000 0.30901699 0.80901699 0.00000 
0.00000 0.00000 
3 generate ? -0.80901699 -0.50000000 0.30901699  0.50000000  -0.30901699 0.80901699 -0.30901699 0.80901699 0.50000000 0.00000 
0.00000 0.00000 
4 generate ? -0.80901699 0.50000000  -0.30901699 -0.50000000 -0.30901699 0.80901699 0.30901699  0.80901699 0.50000000 0.00000 
0.00000 0.00000 
5 generate ? 0.30901699  0.80901699  -0.50000000 -0.80901699 0.50000000  0.30901699 0.50000000  0.30901699 0.80901699 0.00000 
0.00000 0.00000 
# 
_struct.entry_id                  1SVA 
_struct.title                     'SIMIAN VIRUS 40' 
_struct.pdbx_descriptor           'SIMIAN VIRUS 40' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SVA 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'VIRUS COAT PROTEIN, Icosahedral virus, Virus' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 32  ? GLY A 36  ? ILE 1 32  GLY 1 36  5 ? 5  
HELX_P HELX_P2  2  LYS A 82  ? GLN A 84  ? LYS 1 82  GLN 1 84  5 ? 3  
HELX_P HELX_P3  3  VAL A 122 ? LEU A 126 ? VAL 1 122 LEU 1 126 5 ? 5  
HELX_P HELX_P4  4  VAL A 184 ? GLN A 187 ? VAL 1 184 GLN 1 187 5 ? 4  
HELX_P HELX_P5  5  THR A 191 ? HIS A 193 ? THR 1 191 HIS 1 193 5 ? 3  
HELX_P HELX_P6  6  VAL A 205 ? CYS A 207 ? VAL 1 205 CYS 1 207 5 ? 3  
HELX_P HELX_P7  7  GLY A 323 ? SER A 325 ? GLY 1 323 SER 1 325 5 ? 3  
HELX_P HELX_P8  8  ILE B 32  ? GLY B 36  ? ILE 2 32  GLY 2 36  5 ? 5  
HELX_P HELX_P9  9  LYS B 82  ? GLN B 84  ? LYS 2 82  GLN 2 84  5 ? 3  
HELX_P HELX_P10 10 ILE B 98  ? ASP B 101 ? ILE 2 98  ASP 2 101 5 ? 4  
HELX_P HELX_P11 11 VAL B 122 ? LEU B 126 ? VAL 2 122 LEU 2 126 5 ? 5  
HELX_P HELX_P12 12 VAL B 184 ? SER B 186 ? VAL 2 184 SER 2 186 5 ? 3  
HELX_P HELX_P13 13 THR B 191 ? HIS B 193 ? THR 2 191 HIS 2 193 5 ? 3  
HELX_P HELX_P14 14 VAL B 205 ? CYS B 207 ? VAL 2 205 CYS 2 207 5 ? 3  
HELX_P HELX_P15 15 ILE B 301 ? ARG B 311 ? ILE 2 301 ARG 2 311 1 ? 11 
HELX_P HELX_P16 16 ILE C 32  ? GLY C 36  ? ILE 3 32  GLY 3 36  5 ? 5  
HELX_P HELX_P17 17 PHE C 75  ? ASP C 77  ? PHE 3 75  ASP 3 77  5 ? 3  
HELX_P HELX_P18 18 LYS C 82  ? GLN C 84  ? LYS 3 82  GLN 3 84  5 ? 3  
HELX_P HELX_P19 19 VAL C 122 ? LEU C 126 ? VAL 3 122 LEU 3 126 5 ? 5  
HELX_P HELX_P20 20 VAL C 184 ? GLN C 187 ? VAL 3 184 GLN 3 187 5 ? 4  
HELX_P HELX_P21 21 VAL C 205 ? CYS C 207 ? VAL 3 205 CYS 3 207 5 ? 3  
HELX_P HELX_P22 22 SER C 302 ? ARG C 312 ? SER 3 302 ARG 3 312 1 ? 11 
HELX_P HELX_P23 23 GLY C 323 ? SER C 325 ? GLY 3 323 SER 3 325 5 ? 3  
HELX_P HELX_P24 24 ILE D 32  ? GLY D 36  ? ILE 4 32  GLY 4 36  5 ? 5  
HELX_P HELX_P25 25 PHE D 75  ? ASP D 77  ? PHE 4 75  ASP 4 77  5 ? 3  
HELX_P HELX_P26 26 VAL D 122 ? LEU D 126 ? VAL 4 122 LEU 4 126 5 ? 5  
HELX_P HELX_P27 27 VAL D 184 ? GLN D 187 ? VAL 4 184 GLN 4 187 5 ? 4  
HELX_P HELX_P28 28 VAL D 205 ? CYS D 207 ? VAL 4 205 CYS 4 207 5 ? 3  
HELX_P HELX_P29 29 ILE D 301 ? ARG D 312 ? ILE 4 301 ARG 4 312 1 ? 12 
HELX_P HELX_P30 30 GLY D 323 ? SER D 325 ? GLY 4 323 SER 4 325 5 ? 3  
HELX_P HELX_P31 31 ILE E 32  ? GLY E 36  ? ILE 5 32  GLY 5 36  5 ? 5  
HELX_P HELX_P32 32 LYS E 82  ? GLN E 84  ? LYS 5 82  GLN 5 84  5 ? 3  
HELX_P HELX_P33 33 THR E 123 ? LEU E 126 ? THR 5 123 LEU 5 126 5 ? 4  
HELX_P HELX_P34 34 VAL E 184 ? GLN E 187 ? VAL 5 184 GLN 5 187 5 ? 4  
HELX_P HELX_P35 35 PRO E 212 ? LYS E 214 ? PRO 5 212 LYS 5 214 5 ? 3  
HELX_P HELX_P36 36 ILE E 301 ? ARG E 312 ? ILE 5 301 ARG 5 312 1 ? 12 
HELX_P HELX_P37 37 GLY E 323 ? SER E 325 ? GLY 5 323 SER 5 325 5 ? 3  
HELX_P HELX_P38 38 ILE F 32  ? GLY F 36  ? ILE 6 32  GLY 6 36  5 ? 5  
HELX_P HELX_P39 39 PHE F 75  ? ASP F 77  ? PHE 6 75  ASP 6 77  5 ? 3  
HELX_P HELX_P40 40 LYS F 82  ? GLN F 84  ? LYS 6 82  GLN 6 84  5 ? 3  
HELX_P HELX_P41 41 VAL F 122 ? LEU F 126 ? VAL 6 122 LEU 6 126 5 ? 5  
HELX_P HELX_P42 42 VAL F 184 ? GLN F 187 ? VAL 6 184 GLN 6 187 5 ? 4  
HELX_P HELX_P43 43 PRO F 212 ? LYS F 214 ? PRO 6 212 LYS 6 214 5 ? 3  
HELX_P HELX_P44 44 ILE F 301 ? ARG F 312 ? ILE 6 301 ARG 6 312 1 ? 12 
HELX_P HELX_P45 45 GLY F 323 ? SER F 325 ? GLY 6 323 SER 6 325 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3 ? 
B  ? 5 ? 
C  ? 3 ? 
D  ? 5 ? 
E  ? 2 ? 
F  ? 2 ? 
G  ? 2 ? 
H  ? 5 ? 
I  ? 3 ? 
J  ? 5 ? 
K  ? 2 ? 
L  ? 4 ? 
M  ? 3 ? 
N  ? 5 ? 
O  ? 3 ? 
P  ? 3 ? 
Q  ? 5 ? 
R  ? 3 ? 
S  ? 3 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 3 ? 
W  ? 4 ? 
X  ? 3 ? 
Y  ? 2 ? 
Z  ? 2 ? 
1A ? 2 ? 
1B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
1A 1 2 ? anti-parallel 
1B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 PHE A 44  ? LEU A 51  ? PHE 1 44  LEU 1 51  
A  2 ARG A 284 ? VAL A 295 ? ARG 1 284 VAL 1 295 
A  3 ILE A 107 ? VAL A 119 ? ILE 1 107 VAL 1 119 
B  1 SER A 89  ? PRO A 94  ? SER 1 89  PRO 1 94  
B  2 SER A 258 ? ILE A 266 ? SER 1 258 ILE 1 266 
B  3 ASN A 148 ? GLY A 155 ? ASN 1 148 GLY 1 155 
B  4 THR A 218 ? THR A 225 ? THR 1 218 THR 1 225 
B  5 VAL E 233 ? THR E 237 ? VAL 5 233 THR 5 237 
C  1 LYS A 194 ? LEU A 197 ? LYS 1 194 LEU 1 197 
C  2 LEU A 159 ? GLY A 163 ? LEU 1 159 GLY 1 163 
C  3 TRP A 208 ? PRO A 210 ? TRP 1 208 PRO 1 210 
D  1 PRO A 232 ? THR A 237 ? PRO 1 232 THR 1 237 
D  2 THR B 218 ? GLY B 226 ? THR 2 218 GLY 2 226 
D  3 ASN B 148 ? GLY B 155 ? ASN 2 148 GLY 2 155 
D  4 SER B 258 ? ILE B 266 ? SER 2 258 ILE 2 266 
D  5 SER B 89  ? PRO B 94  ? SER 2 89  PRO 2 94  
E  1 GLY A 268 ? THR A 271 ? GLY 1 268 THR 1 271 
E  2 GLN A 277 ? LYS A 280 ? GLN 1 277 LYS 1 280 
F  1 ILE A 347 ? ILE A 350 ? ILE 1 347 ILE 1 350 
F  2 GLN A 355 ? THR A 358 ? GLN 1 355 THR 1 358 
G  1 GLN B 22  ? PRO B 24  ? GLN 2 22  PRO 2 24  
G  2 THR F 337 ? GLU F 339 ? THR 6 337 GLU 6 339 
H  1 LEU B 26  ? GLY B 30  ? LEU 2 26  GLY 2 30  
H  2 GLU F 330 ? TYR F 334 ? GLU 6 330 TYR 6 334 
H  3 PHE B 44  ? LEU B 51  ? PHE 2 44  LEU 2 51  
H  4 ARG B 284 ? VAL B 295 ? ARG 2 284 VAL 2 295 
H  5 ILE B 107 ? VAL B 119 ? ILE 2 107 VAL 2 119 
I  1 LYS B 194 ? LEU B 197 ? LYS 2 194 LEU 2 197 
I  2 LEU B 159 ? GLY B 163 ? LEU 2 159 GLY 2 163 
I  3 TRP B 208 ? PRO B 210 ? TRP 2 208 PRO 2 210 
J  1 VAL B 233 ? THR B 237 ? VAL 2 233 THR 2 237 
J  2 THR C 218 ? THR C 225 ? THR 3 218 THR 3 225 
J  3 ASN C 148 ? GLY C 155 ? ASN 3 148 GLY 3 155 
J  4 SER C 258 ? ILE C 266 ? SER 3 258 ILE 3 266 
J  5 SER C 89  ? PRO C 94  ? SER 3 89  PRO 3 94  
K  1 ILE B 347 ? ILE B 350 ? ILE 2 347 ILE 2 350 
K  2 GLN B 355 ? THR B 358 ? GLN 2 355 THR 2 358 
L  1 PHE C 44  ? LEU C 51  ? PHE 3 44  LEU 3 51  
L  2 PRO C 283 ? LYS C 296 ? PRO 3 283 LYS 3 296 
L  3 ASN C 106 ? ILE C 120 ? ASN 3 106 ILE 3 120 
L  4 PRO C 252 ? CYS C 254 ? PRO 3 252 CYS 3 254 
M  1 LYS C 194 ? LEU C 197 ? LYS 3 194 LEU 3 197 
M  2 LEU C 159 ? GLY C 163 ? LEU 3 159 GLY 3 163 
M  3 TRP C 208 ? PRO C 210 ? TRP 3 208 PRO 3 210 
N  1 LEU C 234 ? THR C 237 ? LEU 3 234 THR 3 237 
N  2 THR D 218 ? THR D 225 ? THR 4 218 THR 4 225 
N  3 ASN D 148 ? GLY D 155 ? ASN 4 148 GLY 4 155 
N  4 SER D 258 ? ILE D 266 ? SER 4 258 ILE 4 266 
N  5 SER D 89  ? PRO D 94  ? SER 4 89  PRO 4 94  
O  1 PHE D 44  ? LEU D 51  ? PHE 4 44  LEU 4 51  
O  2 ARG D 284 ? VAL D 295 ? ARG 4 284 VAL 4 295 
O  3 ILE D 107 ? VAL D 119 ? ILE 4 107 VAL 4 119 
P  1 LYS D 194 ? LEU D 197 ? LYS 4 194 LEU 4 197 
P  2 LEU D 159 ? GLY D 163 ? LEU 4 159 GLY 4 163 
P  3 TRP D 208 ? PRO D 210 ? TRP 4 208 PRO 4 210 
Q  1 VAL D 233 ? THR D 237 ? VAL 4 233 THR 4 237 
Q  2 THR E 218 ? THR E 225 ? THR 5 218 THR 5 225 
Q  3 ASN E 148 ? GLY E 155 ? ASN 5 148 GLY 5 155 
Q  4 SER E 258 ? ILE E 266 ? SER 5 258 ILE 5 266 
Q  5 SER E 89  ? PRO E 94  ? SER 5 89  PRO 5 94  
R  1 PHE E 44  ? LEU E 51  ? PHE 5 44  LEU 5 51  
R  2 ARG E 284 ? VAL E 295 ? ARG 5 284 VAL 5 295 
R  3 ILE E 107 ? VAL E 119 ? ILE 5 107 VAL 5 119 
S  1 LYS E 194 ? LEU E 197 ? LYS 5 194 LEU 5 197 
S  2 LEU E 159 ? GLY E 163 ? LEU 5 159 GLY 5 163 
S  3 TRP E 208 ? PRO E 210 ? TRP 5 208 PRO 5 210 
T  1 GLY E 268 ? THR E 271 ? GLY 5 268 THR 5 271 
T  2 GLN E 277 ? LYS E 280 ? GLN 5 277 LYS 5 280 
U  1 ILE E 347 ? ILE E 350 ? ILE 5 347 ILE 5 350 
U  2 GLN E 355 ? THR E 358 ? GLN 5 355 THR 5 358 
V  1 PHE F 44  ? LEU F 51  ? PHE 6 44  LEU 6 51  
V  2 PRO F 283 ? LYS F 296 ? PRO 6 283 LYS 6 296 
V  3 ASN F 106 ? ILE F 120 ? ASN 6 106 ILE 6 120 
W  1 SER F 89  ? PRO F 94  ? SER 6 89  PRO 6 94  
W  2 SER F 258 ? ILE F 266 ? SER 6 258 ILE 6 266 
W  3 ASN F 148 ? GLY F 155 ? ASN 6 148 GLY 6 155 
W  4 THR F 218 ? THR F 225 ? THR 6 218 THR 6 225 
X  1 LYS F 194 ? LEU F 197 ? LYS 6 194 LEU 6 197 
X  2 LEU F 159 ? GLY F 163 ? LEU 6 159 GLY 6 163 
X  3 TRP F 208 ? PRO F 210 ? TRP 6 208 PRO 6 210 
Y  1 ILE B 266 ? THR B 271 ? ILE 2 266 THR 2 271 
Y  2 GLN B 277 ? GLY B 281 ? GLN 2 277 GLY 2 281 
Z  1 ILE C 266 ? THR C 271 ? ILE 3 266 THR 3 271 
Z  2 GLN C 277 ? GLY C 281 ? GLN 3 277 GLY 3 281 
1A 1 ILE D 266 ? THR D 271 ? ILE 4 266 THR 4 271 
1A 2 GLN D 277 ? GLY D 281 ? GLN 4 277 GLY 4 281 
1B 1 ILE F 266 ? THR F 271 ? ILE 6 266 THR 6 271 
1B 2 GLN F 277 ? GLY F 281 ? GLN 6 277 GLY 6 281 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O THR A 45  ? O THR 1 45  N LEU A 290 ? N LEU 1 290 
A  2 3 O TYR A 285 ? O TYR 1 285 N GLU A 118 ? N GLU 1 118 
B  1 2 O SER A 89  ? O SER 1 89  N ALA A 263 ? N ALA 1 263 
B  2 3 O TYR A 260 ? O TYR 1 260 N GLY A 155 ? N GLY 1 155 
B  3 4 O ASN A 148 ? O ASN 1 148 N THR A 225 ? N THR 1 225 
B  4 5 O GLY A 222 ? O GLY 1 222 N ILE E 236 ? N ILE 5 236 
C  1 2 O ALA A 195 ? O ALA 1 195 N LEU A 161 ? N LEU 1 161 
C  2 3 O GLN A 162 ? O GLN 1 162 N VAL A 209 ? N VAL 1 209 
D  1 2 O PRO A 232 ? O PRO 1 232 N GLY B 226 ? N GLY 2 226 
D  2 3 O ARG B 219 ? O ARG 2 219 N VAL B 154 ? N VAL 2 154 
D  3 4 O PHE B 149 ? O PHE 2 149 N ILE B 266 ? N ILE 2 266 
D  4 5 O LEU B 259 ? O LEU 2 259 N ILE B 93  ? N ILE 2 93  
E  1 2 O GLY A 268 ? O GLY 1 268 N LYS A 280 ? N LYS 1 280 
F  1 2 O ILE A 347 ? O ILE 1 347 N THR A 358 ? N THR 1 358 
G  1 2 O VAL B 23  ? O VAL 2 23  N GLU F 338 ? N GLU 6 338 
H  1 2 O VAL B 27  ? O VAL 2 27  N VAL F 333 ? N VAL 6 333 
H  2 3 O GLU F 330 ? O GLU 6 330 N GLU B 48  ? N GLU 2 48  
H  3 4 O THR B 45  ? O THR 2 45  N LEU B 290 ? N LEU 2 290 
H  4 5 O TYR B 285 ? O TYR 2 285 N GLU B 118 ? N GLU 2 118 
I  1 2 O ALA B 195 ? O ALA 2 195 N LEU B 161 ? N LEU 2 161 
I  2 3 O GLN B 162 ? O GLN 2 162 N VAL B 209 ? N VAL 2 209 
J  1 2 O LEU B 234 ? O LEU 2 234 N TYR C 224 ? N TYR 3 224 
J  2 3 O ARG C 219 ? O ARG 3 219 N VAL C 154 ? N VAL 3 154 
J  3 4 O PHE C 149 ? O PHE 3 149 N ILE C 266 ? N ILE 3 266 
J  4 5 O LEU C 259 ? O LEU 3 259 N ILE C 93  ? N ILE 3 93  
K  1 2 O ILE B 347 ? O ILE 2 347 N THR B 358 ? N THR 2 358 
L  1 2 O THR C 45  ? O THR 3 45  N LEU C 290 ? N LEU 3 290 
L  2 3 O PRO C 283 ? O PRO 3 283 N ILE C 120 ? N ILE 3 120 
L  3 4 O TRP C 110 ? O TRP 3 110 N CYS C 254 ? N CYS 3 254 
M  1 2 O ALA C 195 ? O ALA 3 195 N LEU C 161 ? N LEU 3 161 
M  2 3 O GLN C 162 ? O GLN 3 162 N VAL C 209 ? N VAL 3 209 
N  1 2 O LEU C 234 ? O LEU 3 234 N TYR D 224 ? N TYR 4 224 
N  2 3 O ARG D 219 ? O ARG 4 219 N VAL D 154 ? N VAL 4 154 
N  3 4 O PHE D 149 ? O PHE 4 149 N ILE D 266 ? N ILE 4 266 
N  4 5 O LEU D 259 ? O LEU 4 259 N ILE D 93  ? N ILE 4 93  
O  1 2 O THR D 45  ? O THR 4 45  N LEU D 290 ? N LEU 4 290 
O  2 3 O TYR D 285 ? O TYR 4 285 N GLU D 118 ? N GLU 4 118 
P  1 2 O ALA D 195 ? O ALA 4 195 N LEU D 161 ? N LEU 4 161 
P  2 3 O GLN D 162 ? O GLN 4 162 N VAL D 209 ? N VAL 4 209 
Q  1 2 O LEU D 234 ? O LEU 4 234 N TYR E 224 ? N TYR 5 224 
Q  2 3 O ARG E 219 ? O ARG 5 219 N VAL E 154 ? N VAL 5 154 
Q  3 4 O PHE E 149 ? O PHE 5 149 N ILE E 266 ? N ILE 5 266 
Q  4 5 O LEU E 259 ? O LEU 5 259 N ILE E 93  ? N ILE 5 93  
R  1 2 O THR E 45  ? O THR 5 45  N LEU E 290 ? N LEU 5 290 
R  2 3 O TYR E 285 ? O TYR 5 285 N GLU E 118 ? N GLU 5 118 
S  1 2 O ALA E 195 ? O ALA 5 195 N LEU E 161 ? N LEU 5 161 
S  2 3 O GLN E 162 ? O GLN 5 162 N VAL E 209 ? N VAL 5 209 
T  1 2 O GLY E 268 ? O GLY 5 268 N LYS E 280 ? N LYS 5 280 
U  1 2 O ILE E 347 ? O ILE 5 347 N THR E 358 ? N THR 5 358 
V  1 2 O THR F 45  ? O THR 6 45  N LEU F 290 ? N LEU 6 290 
V  2 3 O PRO F 283 ? O PRO 6 283 N ILE F 120 ? N ILE 6 120 
W  1 2 O SER F 89  ? O SER 6 89  N ALA F 263 ? N ALA 6 263 
W  2 3 O TYR F 260 ? O TYR 6 260 N GLY F 155 ? N GLY 6 155 
W  3 4 O ASN F 148 ? O ASN 6 148 N THR F 225 ? N THR 6 225 
X  1 2 O ALA F 195 ? O ALA 6 195 N LEU F 161 ? N LEU 6 161 
X  2 3 O GLN F 162 ? O GLN 6 162 N VAL F 209 ? N VAL 6 209 
Y  1 2 O CYS B 267 ? O CYS 2 267 N LYS B 280 ? N LYS 2 280 
Z  1 2 O CYS C 267 ? O CYS 3 267 N LYS C 280 ? N LYS 3 280 
1A 1 2 O CYS D 267 ? O CYS 4 267 N LYS D 280 ? N LYS 4 280 
1B 1 2 O CYS F 267 ? O CYS 6 267 N LYS F 280 ? N LYS 6 280 
# 
_database_PDB_matrix.entry_id          1SVA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SVA 
_atom_sites.fract_transf_matrix[1][1]   0.001792 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.001792 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001792 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . PRO A 1 14  ? 5.042   60.663  171.802 1.00 164.49 ? 14  PRO 1 N   1 
ATOM 2     C CA  . PRO A 1 14  ? 5.897   60.271  172.926 1.00 162.49 ? 14  PRO 1 CA  1 
ATOM 3     C C   . PRO A 1 14  ? 5.843   58.760  173.185 1.00 157.66 ? 14  PRO 1 C   1 
ATOM 4     O O   . PRO A 1 14  ? 5.616   57.953  172.265 1.00 159.79 ? 14  PRO 1 O   1 
ATOM 5     C CB  . PRO A 1 14  ? 5.280   61.053  174.093 1.00 162.31 ? 14  PRO 1 CB  1 
ATOM 6     C CG  . PRO A 1 14  ? 3.813   60.997  173.775 1.00 159.04 ? 14  PRO 1 CG  1 
ATOM 7     C CD  . PRO A 1 14  ? 3.809   61.319  172.284 1.00 162.31 ? 14  PRO 1 CD  1 
ATOM 8     N N   . LYS A 1 15  ? 6.110   58.379  174.430 1.00 147.14 ? 15  LYS 1 N   1 
ATOM 9     C CA  . LYS A 1 15  ? 6.045   56.987  174.804 1.00 131.44 ? 15  LYS 1 CA  1 
ATOM 10    C C   . LYS A 1 15  ? 4.847   56.775  175.695 1.00 120.71 ? 15  LYS 1 C   1 
ATOM 11    O O   . LYS A 1 15  ? 4.620   57.496  176.675 1.00 121.61 ? 15  LYS 1 O   1 
ATOM 12    C CB  . LYS A 1 15  ? 7.332   56.503  175.481 1.00 135.15 ? 15  LYS 1 CB  1 
ATOM 13    C CG  . LYS A 1 15  ? 8.430   56.120  174.491 1.00 142.19 ? 15  LYS 1 CG  1 
ATOM 14    C CD  . LYS A 1 15  ? 7.919   55.172  173.382 1.00 155.93 ? 15  LYS 1 CD  1 
ATOM 15    C CE  . LYS A 1 15  ? 8.956   55.026  172.249 1.00 165.08 ? 15  LYS 1 CE  1 
ATOM 16    N NZ  . LYS A 1 15  ? 8.460   54.349  171.003 1.00 160.69 ? 15  LYS 1 NZ  1 
ATOM 17    N N   . LYS A 1 16  ? 3.976   55.911  175.216 1.00 105.22 ? 16  LYS 1 N   1 
ATOM 18    C CA  . LYS A 1 16  ? 2.813   55.549  175.971 1.00 90.29  ? 16  LYS 1 CA  1 
ATOM 19    C C   . LYS A 1 16  ? 3.466   54.567  176.927 1.00 71.73  ? 16  LYS 1 C   1 
ATOM 20    O O   . LYS A 1 16  ? 4.531   53.985  176.632 1.00 59.01  ? 16  LYS 1 O   1 
ATOM 21    C CB  . LYS A 1 16  ? 1.826   54.810  175.058 1.00 115.23 ? 16  LYS 1 CB  1 
ATOM 22    C CG  . LYS A 1 16  ? 0.533   54.330  175.722 1.00 137.55 ? 16  LYS 1 CG  1 
ATOM 23    C CD  . LYS A 1 16  ? -0.240  53.336  174.830 1.00 157.62 ? 16  LYS 1 CD  1 
ATOM 24    C CE  . LYS A 1 16  ? -1.671  53.818  174.546 1.00 170.11 ? 16  LYS 1 CE  1 
ATOM 25    N NZ  . LYS A 1 16  ? -2.538  52.816  173.840 1.00 168.03 ? 16  LYS 1 NZ  1 
ATOM 26    N N   . PRO A 1 17  ? 2.928   54.456  178.130 1.00 55.53  ? 17  PRO 1 N   1 
ATOM 27    C CA  . PRO A 1 17  ? 3.612   53.482  178.962 1.00 51.50  ? 17  PRO 1 CA  1 
ATOM 28    C C   . PRO A 1 17  ? 3.320   52.121  178.341 1.00 55.41  ? 17  PRO 1 C   1 
ATOM 29    O O   . PRO A 1 17  ? 2.440   51.974  177.483 1.00 61.47  ? 17  PRO 1 O   1 
ATOM 30    C CB  . PRO A 1 17  ? 2.913   53.641  180.308 1.00 55.62  ? 17  PRO 1 CB  1 
ATOM 31    C CG  . PRO A 1 17  ? 1.532   54.003  179.916 1.00 60.78  ? 17  PRO 1 CG  1 
ATOM 32    C CD  . PRO A 1 17  ? 1.744   55.006  178.800 1.00 59.47  ? 17  PRO 1 CD  1 
ATOM 33    N N   . LYS A 1 18  ? 4.069   51.128  178.773 1.00 51.93  ? 18  LYS 1 N   1 
ATOM 34    C CA  . LYS A 1 18  ? 3.905   49.773  178.284 1.00 55.04  ? 18  LYS 1 CA  1 
ATOM 35    C C   . LYS A 1 18  ? 2.714   49.173  179.037 1.00 54.32  ? 18  LYS 1 C   1 
ATOM 36    O O   . LYS A 1 18  ? 2.127   49.832  179.892 1.00 53.63  ? 18  LYS 1 O   1 
ATOM 37    C CB  . LYS A 1 18  ? 5.177   48.975  178.562 1.00 77.95  ? 18  LYS 1 CB  1 
ATOM 38    C CG  . LYS A 1 18  ? 6.460   49.838  178.741 1.00 119.14 ? 18  LYS 1 CG  1 
ATOM 39    C CD  . LYS A 1 18  ? 6.636   50.388  180.189 1.00 144.23 ? 18  LYS 1 CD  1 
ATOM 40    C CE  . LYS A 1 18  ? 7.775   51.421  180.299 1.00 154.27 ? 18  LYS 1 CE  1 
ATOM 41    N NZ  . LYS A 1 18  ? 9.127   50.914  179.884 1.00 166.23 ? 18  LYS 1 NZ  1 
ATOM 42    N N   . GLU A 1 19  ? 2.368   47.928  178.733 1.00 57.27  ? 19  GLU 1 N   1 
ATOM 43    C CA  . GLU A 1 19  ? 1.244   47.266  179.387 1.00 60.58  ? 19  GLU 1 CA  1 
ATOM 44    C C   . GLU A 1 19  ? 1.657   46.531  180.647 1.00 50.84  ? 19  GLU 1 C   1 
ATOM 45    O O   . GLU A 1 19  ? 2.738   45.939  180.722 1.00 58.65  ? 19  GLU 1 O   1 
ATOM 46    C CB  . GLU A 1 19  ? 0.550   46.311  178.425 1.00 92.44  ? 19  GLU 1 CB  1 
ATOM 47    C CG  . GLU A 1 19  ? -0.181  47.024  177.293 1.00 139.35 ? 19  GLU 1 CG  1 
ATOM 48    C CD  . GLU A 1 19  ? -0.670  46.082  176.199 1.00 166.82 ? 19  GLU 1 CD  1 
ATOM 49    O OE1 . GLU A 1 19  ? -0.673  44.840  176.399 1.00 181.55 ? 19  GLU 1 OE1 1 
ATOM 50    O OE2 . GLU A 1 19  ? -1.051  46.600  175.126 1.00 183.48 ? 19  GLU 1 OE2 1 
ATOM 51    N N   . PRO A 1 20  ? 0.778   46.526  181.650 1.00 38.43  ? 20  PRO 1 N   1 
ATOM 52    C CA  . PRO A 1 20  ? 1.125   45.847  182.889 1.00 47.18  ? 20  PRO 1 CA  1 
ATOM 53    C C   . PRO A 1 20  ? 1.472   44.406  182.668 1.00 47.68  ? 20  PRO 1 C   1 
ATOM 54    O O   . PRO A 1 20  ? 0.851   43.704  181.880 1.00 46.19  ? 20  PRO 1 O   1 
ATOM 55    C CB  . PRO A 1 20  ? -0.138  46.001  183.730 1.00 51.60  ? 20  PRO 1 CB  1 
ATOM 56    C CG  . PRO A 1 20  ? -0.672  47.306  183.275 1.00 39.19  ? 20  PRO 1 CG  1 
ATOM 57    C CD  . PRO A 1 20  ? -0.536  47.171  181.769 1.00 32.41  ? 20  PRO 1 CD  1 
ATOM 58    N N   . VAL A 1 21  ? 2.517   43.983  183.348 1.00 60.71  ? 21  VAL 1 N   1 
ATOM 59    C CA  . VAL A 1 21  ? 2.962   42.612  183.257 1.00 48.85  ? 21  VAL 1 CA  1 
ATOM 60    C C   . VAL A 1 21  ? 1.837   41.767  183.801 1.00 48.27  ? 21  VAL 1 C   1 
ATOM 61    O O   . VAL A 1 21  ? 1.097   42.202  184.685 1.00 48.11  ? 21  VAL 1 O   1 
ATOM 62    C CB  . VAL A 1 21  ? 4.134   42.355  184.173 1.00 50.46  ? 21  VAL 1 CB  1 
ATOM 63    C CG1 . VAL A 1 21  ? 5.205   41.603  183.413 1.00 88.51  ? 21  VAL 1 CG1 1 
ATOM 64    C CG2 . VAL A 1 21  ? 4.650   43.652  184.789 1.00 69.60  ? 21  VAL 1 CG2 1 
ATOM 65    N N   . GLN A 1 22  ? 1.692   40.571  183.252 1.00 51.22  ? 22  GLN 1 N   1 
ATOM 66    C CA  . GLN A 1 22  ? 0.671   39.641  183.717 1.00 47.80  ? 22  GLN 1 CA  1 
ATOM 67    C C   . GLN A 1 22  ? 1.187   38.970  184.985 1.00 36.01  ? 22  GLN 1 C   1 
ATOM 68    O O   . GLN A 1 22  ? 2.383   38.801  185.166 1.00 53.95  ? 22  GLN 1 O   1 
ATOM 69    C CB  . GLN A 1 22  ? 0.385   38.589  182.643 1.00 41.78  ? 22  GLN 1 CB  1 
ATOM 70    C CG  . GLN A 1 22  ? -0.619  39.028  181.595 1.00 59.30  ? 22  GLN 1 CG  1 
ATOM 71    C CD  . GLN A 1 22  ? -2.044  38.997  182.122 1.00 75.31  ? 22  GLN 1 CD  1 
ATOM 72    O OE1 . GLN A 1 22  ? -2.404  38.120  182.918 1.00 67.74  ? 22  GLN 1 OE1 1 
ATOM 73    N NE2 . GLN A 1 22  ? -2.865  39.950  181.679 1.00 95.67  ? 22  GLN 1 NE2 1 
ATOM 74    N N   . VAL A 1 23  ? 0.310   38.672  185.917 1.00 22.70  ? 23  VAL 1 N   1 
ATOM 75    C CA  . VAL A 1 23  ? 0.765   38.018  187.115 1.00 22.42  ? 23  VAL 1 CA  1 
ATOM 76    C C   . VAL A 1 23  ? -0.399  37.204  187.597 1.00 25.66  ? 23  VAL 1 C   1 
ATOM 77    O O   . VAL A 1 23  ? -1.555  37.502  187.302 1.00 26.45  ? 23  VAL 1 O   1 
ATOM 78    C CB  . VAL A 1 23  ? 1.213   39.014  188.199 1.00 24.35  ? 23  VAL 1 CB  1 
ATOM 79    C CG1 . VAL A 1 23  ? 1.219   40.415  187.665 1.00 28.53  ? 23  VAL 1 CG1 1 
ATOM 80    C CG2 . VAL A 1 23  ? 0.312   38.905  189.452 1.00 36.33  ? 23  VAL 1 CG2 1 
ATOM 81    N N   . PRO A 1 24  ? -0.109  36.132  188.309 1.00 25.64  ? 24  PRO 1 N   1 
ATOM 82    C CA  . PRO A 1 24  ? -1.134  35.253  188.841 1.00 31.96  ? 24  PRO 1 CA  1 
ATOM 83    C C   . PRO A 1 24  ? -2.327  36.034  189.332 1.00 27.99  ? 24  PRO 1 C   1 
ATOM 84    O O   . PRO A 1 24  ? -2.214  36.979  190.134 1.00 20.91  ? 24  PRO 1 O   1 
ATOM 85    C CB  . PRO A 1 24  ? -0.407  34.565  189.978 1.00 37.36  ? 24  PRO 1 CB  1 
ATOM 86    C CG  . PRO A 1 24  ? 0.659   35.589  190.352 1.00 30.45  ? 24  PRO 1 CG  1 
ATOM 87    C CD  . PRO A 1 24  ? 1.157   35.869  188.980 1.00 27.89  ? 24  PRO 1 CD  1 
ATOM 88    N N   . LYS A 1 25  ? -3.447  35.694  188.720 1.00 27.96  ? 25  LYS 1 N   1 
ATOM 89    C CA  . LYS A 1 25  ? -4.712  36.310  189.015 1.00 36.37  ? 25  LYS 1 CA  1 
ATOM 90    C C   . LYS A 1 25  ? -5.254  35.881  190.369 1.00 28.92  ? 25  LYS 1 C   1 
ATOM 91    O O   . LYS A 1 25  ? -5.543  34.704  190.587 1.00 28.60  ? 25  LYS 1 O   1 
ATOM 92    C CB  . LYS A 1 25  ? -5.677  35.925  187.918 1.00 27.98  ? 25  LYS 1 CB  1 
ATOM 93    C CG  . LYS A 1 25  ? -7.049  36.440  188.095 1.00 49.04  ? 25  LYS 1 CG  1 
ATOM 94    C CD  . LYS A 1 25  ? -7.920  35.830  187.014 1.00 85.70  ? 25  LYS 1 CD  1 
ATOM 95    C CE  . LYS A 1 25  ? -9.286  36.485  186.966 1.00 108.59 ? 25  LYS 1 CE  1 
ATOM 96    N NZ  . LYS A 1 25  ? -9.236  37.865  186.400 1.00 116.72 ? 25  LYS 1 NZ  1 
ATOM 97    N N   . LEU A 1 26  ? -5.343  36.815  191.304 1.00 31.04  ? 26  LEU 1 N   1 
ATOM 98    C CA  . LEU A 1 26  ? -5.901  36.457  192.602 1.00 31.58  ? 26  LEU 1 CA  1 
ATOM 99    C C   . LEU A 1 26  ? -7.339  36.071  192.355 1.00 40.26  ? 26  LEU 1 C   1 
ATOM 100   O O   . LEU A 1 26  ? -8.085  36.768  191.651 1.00 44.18  ? 26  LEU 1 O   1 
ATOM 101   C CB  . LEU A 1 26  ? -5.897  37.612  193.579 1.00 22.64  ? 26  LEU 1 CB  1 
ATOM 102   C CG  . LEU A 1 26  ? -6.900  37.329  194.689 1.00 11.77  ? 26  LEU 1 CG  1 
ATOM 103   C CD1 . LEU A 1 26  ? -6.339  36.404  195.726 1.00 15.17  ? 26  LEU 1 CD1 1 
ATOM 104   C CD2 . LEU A 1 26  ? -7.287  38.622  195.324 1.00 42.21  ? 26  LEU 1 CD2 1 
ATOM 105   N N   . VAL A 1 27  ? -7.731  34.980  192.988 1.00 45.93  ? 27  VAL 1 N   1 
ATOM 106   C CA  . VAL A 1 27  ? -9.067  34.439  192.833 1.00 41.95  ? 27  VAL 1 CA  1 
ATOM 107   C C   . VAL A 1 27  ? -9.946  34.755  193.993 1.00 32.03  ? 27  VAL 1 C   1 
ATOM 108   O O   . VAL A 1 27  ? -11.127 34.977  193.854 1.00 33.37  ? 27  VAL 1 O   1 
ATOM 109   C CB  . VAL A 1 27  ? -8.975  32.962  192.680 1.00 45.66  ? 27  VAL 1 CB  1 
ATOM 110   C CG1 . VAL A 1 27  ? -10.267 32.320  193.058 1.00 33.50  ? 27  VAL 1 CG1 1 
ATOM 111   C CG2 . VAL A 1 27  ? -8.583  32.660  191.246 1.00 50.35  ? 27  VAL 1 CG2 1 
ATOM 112   N N   . ILE A 1 28  ? -9.392  34.617  195.167 1.00 21.79  ? 28  ILE 1 N   1 
ATOM 113   C CA  . ILE A 1 28  ? -10.142 34.944  196.332 1.00 19.28  ? 28  ILE 1 CA  1 
ATOM 114   C C   . ILE A 1 28  ? -9.151  34.916  197.433 1.00 24.21  ? 28  ILE 1 C   1 
ATOM 115   O O   . ILE A 1 28  ? -8.133  34.230  197.351 1.00 33.98  ? 28  ILE 1 O   1 
ATOM 116   C CB  . ILE A 1 28  ? -11.248 33.961  196.608 1.00 22.51  ? 28  ILE 1 CB  1 
ATOM 117   C CG1 . ILE A 1 28  ? -11.629 34.040  198.089 1.00 23.24  ? 28  ILE 1 CG1 1 
ATOM 118   C CG2 . ILE A 1 28  ? -10.829 32.584  196.176 1.00 21.53  ? 28  ILE 1 CG2 1 
ATOM 119   C CD1 . ILE A 1 28  ? -12.951 33.448  198.417 1.00 37.95  ? 28  ILE 1 CD1 1 
ATOM 120   N N   . LYS A 1 29  ? -9.438  35.714  198.436 1.00 12.19  ? 29  LYS 1 N   1 
ATOM 121   C CA  . LYS A 1 29  ? -8.594  35.848  199.578 1.00 21.73  ? 29  LYS 1 CA  1 
ATOM 122   C C   . LYS A 1 29  ? -9.577  35.926  200.692 1.00 25.90  ? 29  LYS 1 C   1 
ATOM 123   O O   . LYS A 1 29  ? -10.657 36.460  200.509 1.00 42.80  ? 29  LYS 1 O   1 
ATOM 124   C CB  . LYS A 1 29  ? -7.853  37.180  199.503 1.00 25.08  ? 29  LYS 1 CB  1 
ATOM 125   C CG  . LYS A 1 29  ? -7.610  37.811  200.880 1.00 37.20  ? 29  LYS 1 CG  1 
ATOM 126   C CD  . LYS A 1 29  ? -7.378  39.300  200.775 1.00 68.91  ? 29  LYS 1 CD  1 
ATOM 127   C CE  . LYS A 1 29  ? -7.012  39.924  202.122 1.00 91.01  ? 29  LYS 1 CE  1 
ATOM 128   N NZ  . LYS A 1 29  ? -6.341  41.263  201.919 1.00 117.35 ? 29  LYS 1 NZ  1 
ATOM 129   N N   . GLY A 1 30  ? -9.167  35.486  201.866 1.00 35.83  ? 30  GLY 1 N   1 
ATOM 130   C CA  . GLY A 1 30  ? -10.026 35.526  203.028 1.00 41.93  ? 30  GLY 1 CA  1 
ATOM 131   C C   . GLY A 1 30  ? -9.439  34.553  204.025 1.00 49.27  ? 30  GLY 1 C   1 
ATOM 132   O O   . GLY A 1 30  ? -8.226  34.355  204.050 1.00 56.27  ? 30  GLY 1 O   1 
ATOM 133   N N   . GLY A 1 31  ? -10.291 33.921  204.820 1.00 59.29  ? 31  GLY 1 N   1 
ATOM 134   C CA  . GLY A 1 31  ? -9.818  32.963  205.806 1.00 51.69  ? 31  GLY 1 CA  1 
ATOM 135   C C   . GLY A 1 31  ? -9.778  31.518  205.324 1.00 54.08  ? 31  GLY 1 C   1 
ATOM 136   O O   . GLY A 1 31  ? -9.961  31.233  204.115 1.00 48.15  ? 31  GLY 1 O   1 
ATOM 137   N N   . ILE A 1 32  ? -9.644  30.602  206.291 1.00 43.80  ? 32  ILE 1 N   1 
ATOM 138   C CA  . ILE A 1 32  ? -9.529  29.156  206.016 1.00 49.97  ? 32  ILE 1 CA  1 
ATOM 139   C C   . ILE A 1 32  ? -10.665 28.602  205.142 1.00 48.27  ? 32  ILE 1 C   1 
ATOM 140   O O   . ILE A 1 32  ? -10.497 27.685  204.303 1.00 29.92  ? 32  ILE 1 O   1 
ATOM 141   C CB  . ILE A 1 32  ? -9.378  28.380  207.360 1.00 51.81  ? 32  ILE 1 CB  1 
ATOM 142   C CG1 . ILE A 1 32  ? -9.234  26.879  207.120 1.00 59.58  ? 32  ILE 1 CG1 1 
ATOM 143   C CG2 . ILE A 1 32  ? -10.489 28.743  208.312 1.00 66.10  ? 32  ILE 1 CG2 1 
ATOM 144   C CD1 . ILE A 1 32  ? -7.957  26.496  206.398 1.00 52.99  ? 32  ILE 1 CD1 1 
ATOM 145   N N   . GLU A 1 33  ? -11.797 29.264  205.322 1.00 48.98  ? 33  GLU 1 N   1 
ATOM 146   C CA  . GLU A 1 33  ? -13.043 28.994  204.655 1.00 48.04  ? 33  GLU 1 CA  1 
ATOM 147   C C   . GLU A 1 33  ? -12.807 29.039  203.176 1.00 48.69  ? 33  GLU 1 C   1 
ATOM 148   O O   . GLU A 1 33  ? -13.166 28.115  202.442 1.00 55.35  ? 33  GLU 1 O   1 
ATOM 149   C CB  . GLU A 1 33  ? -14.038 30.100  204.995 1.00 56.18  ? 33  GLU 1 CB  1 
ATOM 150   C CG  . GLU A 1 33  ? -14.000 30.608  206.440 1.00 102.68 ? 33  GLU 1 CG  1 
ATOM 151   C CD  . GLU A 1 33  ? -13.019 31.759  206.658 1.00 121.00 ? 33  GLU 1 CD  1 
ATOM 152   O OE1 . GLU A 1 33  ? -13.120 32.794  205.944 1.00 120.74 ? 33  GLU 1 OE1 1 
ATOM 153   O OE2 . GLU A 1 33  ? -12.142 31.613  207.548 1.00 139.53 ? 33  GLU 1 OE2 1 
ATOM 154   N N   . VAL A 1 34  ? -12.159 30.119  202.761 1.00 38.44  ? 34  VAL 1 N   1 
ATOM 155   C CA  . VAL A 1 34  ? -11.867 30.384  201.369 1.00 41.83  ? 34  VAL 1 CA  1 
ATOM 156   C C   . VAL A 1 34  ? -11.451 29.131  200.648 1.00 40.56  ? 34  VAL 1 C   1 
ATOM 157   O O   . VAL A 1 34  ? -11.636 28.994  199.433 1.00 34.72  ? 34  VAL 1 O   1 
ATOM 158   C CB  . VAL A 1 34  ? -10.754 31.424  201.248 1.00 56.35  ? 34  VAL 1 CB  1 
ATOM 159   C CG1 . VAL A 1 34  ? -10.398 31.656  199.787 1.00 70.25  ? 34  VAL 1 CG1 1 
ATOM 160   C CG2 . VAL A 1 34  ? -11.189 32.714  201.893 1.00 55.52  ? 34  VAL 1 CG2 1 
ATOM 161   N N   . LEU A 1 35  ? -10.884 28.212  201.415 1.00 39.80  ? 35  LEU 1 N   1 
ATOM 162   C CA  . LEU A 1 35  ? -10.422 26.955  200.871 1.00 51.49  ? 35  LEU 1 CA  1 
ATOM 163   C C   . LEU A 1 35  ? -11.463 26.225  200.070 1.00 58.43  ? 35  LEU 1 C   1 
ATOM 164   O O   . LEU A 1 35  ? -11.196 25.734  198.959 1.00 56.87  ? 35  LEU 1 O   1 
ATOM 165   C CB  . LEU A 1 35  ? -9.928  26.084  202.005 1.00 50.79  ? 35  LEU 1 CB  1 
ATOM 166   C CG  . LEU A 1 35  ? -8.462  26.472  202.041 1.00 54.21  ? 35  LEU 1 CG  1 
ATOM 167   C CD1 . LEU A 1 35  ? -7.791  25.837  203.245 1.00 40.92  ? 35  LEU 1 CD1 1 
ATOM 168   C CD2 . LEU A 1 35  ? -7.810  26.112  200.637 1.00 9.76   ? 35  LEU 1 CD2 1 
ATOM 169   N N   . GLY A 1 36  ? -12.655 26.195  200.656 1.00 59.26  ? 36  GLY 1 N   1 
ATOM 170   C CA  . GLY A 1 36  ? -13.791 25.534  200.064 1.00 62.32  ? 36  GLY 1 CA  1 
ATOM 171   C C   . GLY A 1 36  ? -14.066 25.904  198.630 1.00 62.09  ? 36  GLY 1 C   1 
ATOM 172   O O   . GLY A 1 36  ? -14.764 25.183  197.913 1.00 64.19  ? 36  GLY 1 O   1 
ATOM 173   N N   . VAL A 1 37  ? -13.543 27.029  198.188 1.00 64.12  ? 37  VAL 1 N   1 
ATOM 174   C CA  . VAL A 1 37  ? -13.805 27.386  196.826 1.00 71.99  ? 37  VAL 1 CA  1 
ATOM 175   C C   . VAL A 1 37  ? -13.203 26.372  195.901 1.00 67.86  ? 37  VAL 1 C   1 
ATOM 176   O O   . VAL A 1 37  ? -12.043 25.970  196.046 1.00 80.61  ? 37  VAL 1 O   1 
ATOM 177   C CB  . VAL A 1 37  ? -13.278 28.734  196.497 1.00 83.49  ? 37  VAL 1 CB  1 
ATOM 178   C CG1 . VAL A 1 37  ? -13.506 29.007  195.026 1.00 94.71  ? 37  VAL 1 CG1 1 
ATOM 179   C CG2 . VAL A 1 37  ? -13.993 29.760  197.359 1.00 101.91 ? 37  VAL 1 CG2 1 
ATOM 180   N N   . LYS A 1 38  ? -14.033 25.890  194.996 1.00 60.41  ? 38  LYS 1 N   1 
ATOM 181   C CA  . LYS A 1 38  ? -13.552 24.931  194.053 1.00 70.77  ? 38  LYS 1 CA  1 
ATOM 182   C C   . LYS A 1 38  ? -12.822 25.672  192.964 1.00 61.19  ? 38  LYS 1 C   1 
ATOM 183   O O   . LYS A 1 38  ? -13.399 26.377  192.134 1.00 53.14  ? 38  LYS 1 O   1 
ATOM 184   C CB  . LYS A 1 38  ? -14.662 24.036  193.518 1.00 98.13  ? 38  LYS 1 CB  1 
ATOM 185   C CG  . LYS A 1 38  ? -14.704 22.656  194.201 1.00 133.00 ? 38  LYS 1 CG  1 
ATOM 186   C CD  . LYS A 1 38  ? -15.238 21.583  193.237 1.00 158.29 ? 38  LYS 1 CD  1 
ATOM 187   C CE  . LYS A 1 38  ? -15.202 20.169  193.829 1.00 170.65 ? 38  LYS 1 CE  1 
ATOM 188   N NZ  . LYS A 1 38  ? -15.654 19.111  192.855 1.00 166.69 ? 38  LYS 1 NZ  1 
ATOM 189   N N   . THR A 1 39  ? -11.512 25.568  193.090 1.00 62.48  ? 39  THR 1 N   1 
ATOM 190   C CA  . THR A 1 39  ? -10.531 26.169  192.225 1.00 51.53  ? 39  THR 1 CA  1 
ATOM 191   C C   . THR A 1 39  ? -10.216 25.213  191.082 1.00 50.61  ? 39  THR 1 C   1 
ATOM 192   O O   . THR A 1 39  ? -10.716 24.087  191.043 1.00 56.19  ? 39  THR 1 O   1 
ATOM 193   C CB  . THR A 1 39  ? -9.304  26.415  193.079 1.00 55.58  ? 39  THR 1 CB  1 
ATOM 194   O OG1 . THR A 1 39  ? -9.101  25.285  193.956 1.00 75.69  ? 39  THR 1 OG1 1 
ATOM 195   C CG2 . THR A 1 39  ? -9.548  27.604  193.956 1.00 66.65  ? 39  THR 1 CG2 1 
ATOM 196   N N   . GLY A 1 40  ? -9.351  25.625  190.173 1.00 53.34  ? 40  GLY 1 N   1 
ATOM 197   C CA  . GLY A 1 40  ? -9.020  24.749  189.065 1.00 50.09  ? 40  GLY 1 CA  1 
ATOM 198   C C   . GLY A 1 40  ? -7.896  23.772  189.346 1.00 61.10  ? 40  GLY 1 C   1 
ATOM 199   O O   . GLY A 1 40  ? -7.467  23.573  190.485 1.00 51.24  ? 40  GLY 1 O   1 
ATOM 200   N N   . VAL A 1 41  ? -7.388  23.195  188.270 1.00 67.93  ? 41  VAL 1 N   1 
ATOM 201   C CA  . VAL A 1 41  ? -6.306  22.230  188.335 1.00 68.27  ? 41  VAL 1 CA  1 
ATOM 202   C C   . VAL A 1 41  ? -5.011  22.955  188.634 1.00 70.56  ? 41  VAL 1 C   1 
ATOM 203   O O   . VAL A 1 41  ? -4.197  22.518  189.457 1.00 73.62  ? 41  VAL 1 O   1 
ATOM 204   C CB  . VAL A 1 41  ? -6.170  21.547  186.974 1.00 63.48  ? 41  VAL 1 CB  1 
ATOM 205   C CG1 . VAL A 1 41  ? -4.839  20.831  186.851 1.00 63.10  ? 41  VAL 1 CG1 1 
ATOM 206   C CG2 . VAL A 1 41  ? -7.326  20.594  186.780 1.00 75.16  ? 41  VAL 1 CG2 1 
ATOM 207   N N   . ASP A 1 42  ? -4.859  24.099  187.986 1.00 64.01  ? 42  ASP 1 N   1 
ATOM 208   C CA  . ASP A 1 42  ? -3.661  24.880  188.130 1.00 59.40  ? 42  ASP 1 CA  1 
ATOM 209   C C   . ASP A 1 42  ? -3.726  25.984  189.159 1.00 53.13  ? 42  ASP 1 C   1 
ATOM 210   O O   . ASP A 1 42  ? -2.872  26.850  189.205 1.00 56.10  ? 42  ASP 1 O   1 
ATOM 211   C CB  . ASP A 1 42  ? -3.298  25.430  186.771 1.00 63.02  ? 42  ASP 1 CB  1 
ATOM 212   C CG  . ASP A 1 42  ? -3.237  24.348  185.725 1.00 75.90  ? 42  ASP 1 CG  1 
ATOM 213   O OD1 . ASP A 1 42  ? -2.592  23.298  185.975 1.00 77.81  ? 42  ASP 1 OD1 1 
ATOM 214   O OD2 . ASP A 1 42  ? -3.870  24.540  184.668 1.00 94.09  ? 42  ASP 1 OD2 1 
ATOM 215   N N   . SER A 1 43  ? -4.750  25.985  189.987 1.00 49.20  ? 43  SER 1 N   1 
ATOM 216   C CA  . SER A 1 43  ? -4.831  27.020  190.998 1.00 36.68  ? 43  SER 1 CA  1 
ATOM 217   C C   . SER A 1 43  ? -3.721  26.669  191.934 1.00 38.55  ? 43  SER 1 C   1 
ATOM 218   O O   . SER A 1 43  ? -3.195  25.546  191.909 1.00 51.36  ? 43  SER 1 O   1 
ATOM 219   C CB  . SER A 1 43  ? -6.128  26.899  191.812 1.00 44.67  ? 43  SER 1 CB  1 
ATOM 220   O OG  . SER A 1 43  ? -5.907  26.220  193.063 1.00 51.18  ? 43  SER 1 OG  1 
ATOM 221   N N   . PHE A 1 44  ? -3.392  27.611  192.791 1.00 31.76  ? 44  PHE 1 N   1 
ATOM 222   C CA  . PHE A 1 44  ? -2.417  27.342  193.811 1.00 31.56  ? 44  PHE 1 CA  1 
ATOM 223   C C   . PHE A 1 44  ? -2.828  28.179  194.948 1.00 30.91  ? 44  PHE 1 C   1 
ATOM 224   O O   . PHE A 1 44  ? -3.515  29.198  194.782 1.00 38.44  ? 44  PHE 1 O   1 
ATOM 225   C CB  . PHE A 1 44  ? -0.989  27.594  193.377 1.00 40.82  ? 44  PHE 1 CB  1 
ATOM 226   C CG  . PHE A 1 44  ? -0.657  29.010  193.075 1.00 55.74  ? 44  PHE 1 CG  1 
ATOM 227   C CD1 . PHE A 1 44  ? -0.128  29.835  194.063 1.00 67.27  ? 44  PHE 1 CD1 1 
ATOM 228   C CD2 . PHE A 1 44  ? -0.715  29.485  191.774 1.00 75.61  ? 44  PHE 1 CD2 1 
ATOM 229   C CE1 . PHE A 1 44  ? 0.361   31.121  193.763 1.00 58.10  ? 44  PHE 1 CE1 1 
ATOM 230   C CE2 . PHE A 1 44  ? -0.231  30.770  191.458 1.00 85.37  ? 44  PHE 1 CE2 1 
ATOM 231   C CZ  . PHE A 1 44  ? 0.312   31.585  192.465 1.00 71.84  ? 44  PHE 1 CZ  1 
ATOM 232   N N   . THR A 1 45  ? -2.460  27.765  196.132 1.00 12.94  ? 45  THR 1 N   1 
ATOM 233   C CA  . THR A 1 45  ? -2.952  28.548  197.199 1.00 26.64  ? 45  THR 1 CA  1 
ATOM 234   C C   . THR A 1 45  ? -1.941  28.740  198.259 1.00 30.56  ? 45  THR 1 C   1 
ATOM 235   O O   . THR A 1 45  ? -1.121  27.863  198.511 1.00 48.24  ? 45  THR 1 O   1 
ATOM 236   C CB  . THR A 1 45  ? -4.220  27.934  197.770 1.00 32.13  ? 45  THR 1 CB  1 
ATOM 237   O OG1 . THR A 1 45  ? -3.926  27.347  199.045 1.00 43.09  ? 45  THR 1 OG1 1 
ATOM 238   C CG2 . THR A 1 45  ? -4.817  26.873  196.794 1.00 29.36  ? 45  THR 1 CG2 1 
ATOM 239   N N   . GLU A 1 46  ? -2.070  29.869  198.935 1.00 29.62  ? 46  GLU 1 N   1 
ATOM 240   C CA  . GLU A 1 46  ? -1.161  30.235  199.980 1.00 31.23  ? 46  GLU 1 CA  1 
ATOM 241   C C   . GLU A 1 46  ? -1.876  30.257  201.315 1.00 33.07  ? 46  GLU 1 C   1 
ATOM 242   O O   . GLU A 1 46  ? -2.882  30.956  201.473 1.00 44.19  ? 46  GLU 1 O   1 
ATOM 243   C CB  . GLU A 1 46  ? -0.577  31.639  199.694 1.00 42.56  ? 46  GLU 1 CB  1 
ATOM 244   C CG  . GLU A 1 46  ? -0.093  31.903  198.236 1.00 39.31  ? 46  GLU 1 CG  1 
ATOM 245   C CD  . GLU A 1 46  ? 0.719   33.207  198.046 1.00 47.06  ? 46  GLU 1 CD  1 
ATOM 246   O OE1 . GLU A 1 46  ? 0.542   34.192  198.824 1.00 51.92  ? 46  GLU 1 OE1 1 
ATOM 247   O OE2 . GLU A 1 46  ? 1.541   33.236  197.093 1.00 43.89  ? 46  GLU 1 OE2 1 
ATOM 248   N N   . VAL A 1 47  ? -1.343  29.525  202.284 1.00 15.26  ? 47  VAL 1 N   1 
ATOM 249   C CA  . VAL A 1 47  ? -1.926  29.526  203.619 1.00 16.62  ? 47  VAL 1 CA  1 
ATOM 250   C C   . VAL A 1 47  ? -0.965  30.159  204.627 1.00 13.67  ? 47  VAL 1 C   1 
ATOM 251   O O   . VAL A 1 47  ? 0.154   29.695  204.816 1.00 31.93  ? 47  VAL 1 O   1 
ATOM 252   C CB  . VAL A 1 47  ? -2.286  28.110  204.032 1.00 13.83  ? 47  VAL 1 CB  1 
ATOM 253   C CG1 . VAL A 1 47  ? -2.915  28.101  205.412 1.00 13.20  ? 47  VAL 1 CG1 1 
ATOM 254   C CG2 . VAL A 1 47  ? -3.200  27.520  202.995 1.00 8.51   ? 47  VAL 1 CG2 1 
ATOM 255   N N   . GLU A 1 48  ? -1.339  31.309  205.151 1.00 18.22  ? 48  GLU 1 N   1 
ATOM 256   C CA  . GLU A 1 48  ? -0.486  31.999  206.127 1.00 35.98  ? 48  GLU 1 CA  1 
ATOM 257   C C   . GLU A 1 48  ? -1.199  31.573  207.410 1.00 31.87  ? 48  GLU 1 C   1 
ATOM 258   O O   . GLU A 1 48  ? -2.400  31.352  207.377 1.00 30.38  ? 48  GLU 1 O   1 
ATOM 259   C CB  . GLU A 1 48  ? -0.447  33.568  205.908 1.00 19.81  ? 48  GLU 1 CB  1 
ATOM 260   C CG  . GLU A 1 48  ? -0.376  34.045  204.391 1.00 31.93  ? 48  GLU 1 CG  1 
ATOM 261   C CD  . GLU A 1 48  ? -0.104  35.576  204.137 1.00 51.63  ? 48  GLU 1 CD  1 
ATOM 262   O OE1 . GLU A 1 48  ? 0.564   36.220  204.975 1.00 27.43  ? 48  GLU 1 OE1 1 
ATOM 263   O OE2 . GLU A 1 48  ? -0.508  36.110  203.056 1.00 48.88  ? 48  GLU 1 OE2 1 
ATOM 264   N N   . CYS A 1 49  ? -0.467  31.341  208.491 1.00 33.90  ? 49  CYS 1 N   1 
ATOM 265   C CA  . CYS A 1 49  ? -1.076  30.908  209.737 1.00 26.73  ? 49  CYS 1 CA  1 
ATOM 266   C C   . CYS A 1 49  ? 0.043   30.884  210.707 1.00 22.47  ? 49  CYS 1 C   1 
ATOM 267   O O   . CYS A 1 49  ? 1.128   31.364  210.389 1.00 29.50  ? 49  CYS 1 O   1 
ATOM 268   C CB  . CYS A 1 49  ? -1.577  29.483  209.609 1.00 37.61  ? 49  CYS 1 CB  1 
ATOM 269   S SG  . CYS A 1 49  ? -0.211  28.311  209.588 1.00 42.16  ? 49  CYS 1 SG  1 
ATOM 270   N N   . PHE A 1 50  ? -0.140  30.157  211.801 1.00 12.71  ? 50  PHE 1 N   1 
ATOM 271   C CA  . PHE A 1 50  ? 0.915   30.131  212.790 1.00 28.39  ? 50  PHE 1 CA  1 
ATOM 272   C C   . PHE A 1 50  ? 0.675   29.164  213.922 1.00 30.72  ? 50  PHE 1 C   1 
ATOM 273   O O   . PHE A 1 50  ? -0.406  28.573  214.022 1.00 39.79  ? 50  PHE 1 O   1 
ATOM 274   C CB  . PHE A 1 50  ? 1.040   31.492  213.411 1.00 12.71  ? 50  PHE 1 CB  1 
ATOM 275   C CG  . PHE A 1 50  ? -0.102  31.828  214.260 1.00 34.68  ? 50  PHE 1 CG  1 
ATOM 276   C CD1 . PHE A 1 50  ? -1.276  32.310  213.688 1.00 44.16  ? 50  PHE 1 CD1 1 
ATOM 277   C CD2 . PHE A 1 50  ? -0.036  31.628  215.637 1.00 42.13  ? 50  PHE 1 CD2 1 
ATOM 278   C CE1 . PHE A 1 50  ? -2.376  32.593  214.476 1.00 43.75  ? 50  PHE 1 CE1 1 
ATOM 279   C CE2 . PHE A 1 50  ? -1.129  31.909  216.434 1.00 47.38  ? 50  PHE 1 CE2 1 
ATOM 280   C CZ  . PHE A 1 50  ? -2.308  32.395  215.850 1.00 37.41  ? 50  PHE 1 CZ  1 
ATOM 281   N N   . LEU A 1 51  ? 1.655   29.116  214.829 1.00 20.97  ? 51  LEU 1 N   1 
ATOM 282   C CA  . LEU A 1 51  ? 1.630   28.247  215.985 1.00 12.52  ? 51  LEU 1 CA  1 
ATOM 283   C C   . LEU A 1 51  ? 2.172   28.999  217.140 1.00 21.20  ? 51  LEU 1 C   1 
ATOM 284   O O   . LEU A 1 51  ? 3.023   29.869  216.970 1.00 22.78  ? 51  LEU 1 O   1 
ATOM 285   C CB  . LEU A 1 51  ? 2.506   27.018  215.798 1.00 6.26   ? 51  LEU 1 CB  1 
ATOM 286   C CG  . LEU A 1 51  ? 2.108   25.952  214.764 1.00 26.30  ? 51  LEU 1 CG  1 
ATOM 287   C CD1 . LEU A 1 51  ? 2.976   24.708  214.942 1.00 58.37  ? 51  LEU 1 CD1 1 
ATOM 288   C CD2 . LEU A 1 51  ? 0.654   25.555  214.926 1.00 43.15  ? 51  LEU 1 CD2 1 
ATOM 289   N N   . ASN A 1 52  ? 1.702   28.615  218.318 1.00 24.24  ? 52  ASN 1 N   1 
ATOM 290   C CA  . ASN A 1 52  ? 2.098   29.234  219.570 1.00 23.80  ? 52  ASN 1 CA  1 
ATOM 291   C C   . ASN A 1 52  ? 3.075   28.349  220.278 1.00 27.88  ? 52  ASN 1 C   1 
ATOM 292   O O   . ASN A 1 52  ? 3.041   27.122  220.155 1.00 28.66  ? 52  ASN 1 O   1 
ATOM 293   C CB  . ASN A 1 52  ? 0.911   29.419  220.489 1.00 40.92  ? 52  ASN 1 CB  1 
ATOM 294   C CG  . ASN A 1 52  ? 0.043   30.570  220.097 1.00 52.32  ? 52  ASN 1 CG  1 
ATOM 295   O OD1 . ASN A 1 52  ? 0.449   31.731  220.214 1.00 53.48  ? 52  ASN 1 OD1 1 
ATOM 296   N ND2 . ASN A 1 52  ? -1.191  30.269  219.686 1.00 62.56  ? 52  ASN 1 ND2 1 
ATOM 297   N N   . PRO A 1 53  ? 3.866   28.950  221.151 1.00 24.87  ? 53  PRO 1 N   1 
ATOM 298   C CA  . PRO A 1 53  ? 4.866   28.198  221.887 1.00 42.95  ? 53  PRO 1 CA  1 
ATOM 299   C C   . PRO A 1 53  ? 4.313   27.494  223.101 1.00 53.89  ? 53  PRO 1 C   1 
ATOM 300   O O   . PRO A 1 53  ? 3.590   28.100  223.895 1.00 64.51  ? 53  PRO 1 O   1 
ATOM 301   C CB  . PRO A 1 53  ? 5.880   29.286  222.266 1.00 49.71  ? 53  PRO 1 CB  1 
ATOM 302   C CG  . PRO A 1 53  ? 5.015   30.494  222.523 1.00 29.24  ? 53  PRO 1 CG  1 
ATOM 303   C CD  . PRO A 1 53  ? 3.961   30.398  221.411 1.00 33.14  ? 53  PRO 1 CD  1 
ATOM 304   N N   . GLN A 1 54  ? 4.717   26.240  223.291 1.00 60.56  ? 54  GLN 1 N   1 
ATOM 305   C CA  . GLN A 1 54  ? 4.265   25.474  224.452 1.00 57.53  ? 54  GLN 1 CA  1 
ATOM 306   C C   . GLN A 1 54  ? 5.392   25.233  225.451 1.00 52.90  ? 54  GLN 1 C   1 
ATOM 307   O O   . GLN A 1 54  ? 5.961   24.141  225.527 1.00 58.30  ? 54  GLN 1 O   1 
ATOM 308   C CB  . GLN A 1 54  ? 3.670   24.157  223.987 1.00 61.52  ? 54  GLN 1 CB  1 
ATOM 309   C CG  . GLN A 1 54  ? 2.510   24.336  223.021 1.00 68.41  ? 54  GLN 1 CG  1 
ATOM 310   C CD  . GLN A 1 54  ? 1.242   24.832  223.693 1.00 72.96  ? 54  GLN 1 CD  1 
ATOM 311   O OE1 . GLN A 1 54  ? 1.284   25.436  224.775 1.00 77.36  ? 54  GLN 1 OE1 1 
ATOM 312   N NE2 . GLN A 1 54  ? 0.102   24.582  223.056 1.00 60.12  ? 54  GLN 1 NE2 1 
ATOM 313   N N   . MET A 1 55  ? 5.686   26.245  226.253 1.00 46.18  ? 55  MET 1 N   1 
ATOM 314   C CA  . MET A 1 55  ? 6.773   26.140  227.220 1.00 57.52  ? 55  MET 1 CA  1 
ATOM 315   C C   . MET A 1 55  ? 6.356   25.541  228.536 1.00 63.73  ? 55  MET 1 C   1 
ATOM 316   O O   . MET A 1 55  ? 7.158   25.486  229.470 1.00 62.39  ? 55  MET 1 O   1 
ATOM 317   C CB  . MET A 1 55  ? 7.366   27.518  227.482 1.00 60.93  ? 55  MET 1 CB  1 
ATOM 318   C CG  . MET A 1 55  ? 7.717   28.264  226.219 1.00 71.58  ? 55  MET 1 CG  1 
ATOM 319   S SD  . MET A 1 55  ? 8.794   27.307  225.135 1.00 50.71  ? 55  MET 1 SD  1 
ATOM 320   C CE  . MET A 1 55  ? 10.287  28.053  225.664 1.00 59.55  ? 55  MET 1 CE  1 
ATOM 321   N N   . GLY A 1 56  ? 5.106   25.084  228.589 1.00 78.83  ? 56  GLY 1 N   1 
ATOM 322   C CA  . GLY A 1 56  ? 4.531   24.526  229.801 1.00 84.46  ? 56  GLY 1 CA  1 
ATOM 323   C C   . GLY A 1 56  ? 3.400   25.457  230.221 1.00 84.08  ? 56  GLY 1 C   1 
ATOM 324   O O   . GLY A 1 56  ? 2.233   25.067  230.143 1.00 93.07  ? 56  GLY 1 O   1 
ATOM 325   N N   . ASN A 1 57  ? 3.751   26.700  230.587 1.00 77.38  ? 57  ASN 1 N   1 
ATOM 326   C CA  . ASN A 1 57  ? 2.814   27.763  231.012 1.00 63.46  ? 57  ASN 1 CA  1 
ATOM 327   C C   . ASN A 1 57  ? 2.293   27.562  232.423 1.00 53.98  ? 57  ASN 1 C   1 
ATOM 328   O O   . ASN A 1 57  ? 1.162   27.105  232.611 1.00 52.09  ? 57  ASN 1 O   1 
ATOM 329   C CB  . ASN A 1 57  ? 1.599   27.876  230.080 1.00 75.65  ? 57  ASN 1 CB  1 
ATOM 330   C CG  . ASN A 1 57  ? 1.966   28.241  228.659 1.00 81.82  ? 57  ASN 1 CG  1 
ATOM 331   O OD1 . ASN A 1 57  ? 2.879   29.040  228.419 1.00 91.16  ? 57  ASN 1 OD1 1 
ATOM 332   N ND2 . ASN A 1 57  ? 1.237   27.669  227.697 1.00 74.80  ? 57  ASN 1 ND2 1 
ATOM 333   N N   . PRO A 1 58  ? 3.078   27.967  233.430 1.00 52.64  ? 58  PRO 1 N   1 
ATOM 334   C CA  . PRO A 1 58  ? 2.774   27.865  234.865 1.00 73.89  ? 58  PRO 1 CA  1 
ATOM 335   C C   . PRO A 1 58  ? 1.371   28.329  235.288 1.00 83.87  ? 58  PRO 1 C   1 
ATOM 336   O O   . PRO A 1 58  ? 0.549   27.521  235.754 1.00 88.31  ? 58  PRO 1 O   1 
ATOM 337   C CB  . PRO A 1 58  ? 3.876   28.718  235.512 1.00 72.89  ? 58  PRO 1 CB  1 
ATOM 338   C CG  . PRO A 1 58  ? 4.268   29.666  234.435 1.00 63.77  ? 58  PRO 1 CG  1 
ATOM 339   C CD  . PRO A 1 58  ? 4.287   28.769  233.226 1.00 62.55  ? 58  PRO 1 CD  1 
ATOM 340   N N   . ASP A 1 59  ? 1.137   29.635  235.213 1.00 81.32  ? 59  ASP 1 N   1 
ATOM 341   C CA  . ASP A 1 59  ? -0.158  30.198  235.550 1.00 74.37  ? 59  ASP 1 CA  1 
ATOM 342   C C   . ASP A 1 59  ? -0.754  30.701  234.244 1.00 75.26  ? 59  ASP 1 C   1 
ATOM 343   O O   . ASP A 1 59  ? -0.631  30.042  233.206 1.00 75.89  ? 59  ASP 1 O   1 
ATOM 344   C CB  . ASP A 1 59  ? 0.001   31.331  236.574 1.00 74.08  ? 59  ASP 1 CB  1 
ATOM 345   C CG  . ASP A 1 59  ? 1.092   32.303  236.211 1.00 78.34  ? 59  ASP 1 CG  1 
ATOM 346   O OD1 . ASP A 1 59  ? 1.426   32.370  235.015 1.00 87.55  ? 59  ASP 1 OD1 1 
ATOM 347   O OD2 . ASP A 1 59  ? 1.602   33.011  237.114 1.00 77.10  ? 59  ASP 1 OD2 1 
ATOM 348   N N   . GLU A 1 60  ? -1.486  31.802  234.302 1.00 81.70  ? 60  GLU 1 N   1 
ATOM 349   C CA  . GLU A 1 60  ? -2.032  32.368  233.081 1.00 94.98  ? 60  GLU 1 CA  1 
ATOM 350   C C   . GLU A 1 60  ? -1.226  33.624  232.832 1.00 87.35  ? 60  GLU 1 C   1 
ATOM 351   O O   . GLU A 1 60  ? -0.842  33.896  231.715 1.00 89.80  ? 60  GLU 1 O   1 
ATOM 352   C CB  . GLU A 1 60  ? -3.542  32.657  233.155 1.00 116.46 ? 60  GLU 1 CB  1 
ATOM 353   C CG  . GLU A 1 60  ? -3.991  33.678  234.197 1.00 150.43 ? 60  GLU 1 CG  1 
ATOM 354   C CD  . GLU A 1 60  ? -4.086  33.092  235.598 1.00 171.84 ? 60  GLU 1 CD  1 
ATOM 355   O OE1 . GLU A 1 60  ? -4.448  31.900  235.731 1.00 184.03 ? 60  GLU 1 OE1 1 
ATOM 356   O OE2 . GLU A 1 60  ? -3.791  33.826  236.566 1.00 181.73 ? 60  GLU 1 OE2 1 
ATOM 357   N N   . HIS A 1 61  ? -0.835  34.317  233.889 1.00 83.51  ? 61  HIS 1 N   1 
ATOM 358   C CA  . HIS A 1 61  ? -0.034  35.524  233.716 1.00 91.10  ? 61  HIS 1 CA  1 
ATOM 359   C C   . HIS A 1 61  ? 1.352   35.214  233.123 1.00 86.15  ? 61  HIS 1 C   1 
ATOM 360   O O   . HIS A 1 61  ? 2.228   36.103  233.050 1.00 81.40  ? 61  HIS 1 O   1 
ATOM 361   C CB  . HIS A 1 61  ? 0.143   36.231  235.052 1.00 111.94 ? 61  HIS 1 CB  1 
ATOM 362   C CG  . HIS A 1 61  ? -1.145  36.557  235.731 1.00 135.73 ? 61  HIS 1 CG  1 
ATOM 363   N ND1 . HIS A 1 61  ? -1.477  36.051  236.968 1.00 152.71 ? 61  HIS 1 ND1 1 
ATOM 364   C CD2 . HIS A 1 61  ? -2.186  37.331  235.345 1.00 147.01 ? 61  HIS 1 CD2 1 
ATOM 365   C CE1 . HIS A 1 61  ? -2.671  36.500  237.318 1.00 164.65 ? 61  HIS 1 CE1 1 
ATOM 366   N NE2 . HIS A 1 61  ? -3.122  37.277  236.350 1.00 166.69 ? 61  HIS 1 NE2 1 
ATOM 367   N N   . GLN A 1 62  ? 1.560   33.953  232.747 1.00 75.02  ? 62  GLN 1 N   1 
ATOM 368   C CA  . GLN A 1 62  ? 2.815   33.523  232.177 1.00 63.24  ? 62  GLN 1 CA  1 
ATOM 369   C C   . GLN A 1 62  ? 2.672   32.528  231.051 1.00 61.53  ? 62  GLN 1 C   1 
ATOM 370   O O   . GLN A 1 62  ? 2.983   31.338  231.195 1.00 50.85  ? 62  GLN 1 O   1 
ATOM 371   C CB  . GLN A 1 62  ? 3.739   32.976  233.255 1.00 61.10  ? 62  GLN 1 CB  1 
ATOM 372   C CG  . GLN A 1 62  ? 4.260   34.056  234.186 1.00 74.38  ? 62  GLN 1 CG  1 
ATOM 373   C CD  . GLN A 1 62  ? 5.023   33.499  235.373 1.00 85.56  ? 62  GLN 1 CD  1 
ATOM 374   O OE1 . GLN A 1 62  ? 4.896   32.315  235.723 1.00 80.20  ? 62  GLN 1 OE1 1 
ATOM 375   N NE2 . GLN A 1 62  ? 5.842   34.353  235.996 1.00 90.42  ? 62  GLN 1 NE2 1 
ATOM 376   N N   . LYS A 1 63  ? 2.107   33.001  229.949 1.00 57.17  ? 63  LYS 1 N   1 
ATOM 377   C CA  . LYS A 1 63  ? 2.013   32.147  228.792 1.00 59.23  ? 63  LYS 1 CA  1 
ATOM 378   C C   . LYS A 1 63  ? 3.355   32.303  228.054 1.00 63.94  ? 63  LYS 1 C   1 
ATOM 379   O O   . LYS A 1 63  ? 4.065   33.319  228.223 1.00 48.34  ? 63  LYS 1 O   1 
ATOM 380   C CB  . LYS A 1 63  ? 0.832   32.526  227.908 1.00 58.25  ? 63  LYS 1 CB  1 
ATOM 381   C CG  . LYS A 1 63  ? -0.418  31.667  228.132 1.00 55.26  ? 63  LYS 1 CG  1 
ATOM 382   C CD  . LYS A 1 63  ? -1.523  32.030  227.129 1.00 78.13  ? 63  LYS 1 CD  1 
ATOM 383   C CE  . LYS A 1 63  ? -2.719  31.064  227.110 1.00 84.91  ? 63  LYS 1 CE  1 
ATOM 384   N NZ  . LYS A 1 63  ? -3.697  31.407  226.006 1.00 101.95 ? 63  LYS 1 NZ  1 
ATOM 385   N N   . GLY A 1 64  ? 3.720   31.270  227.291 1.00 66.10  ? 64  GLY 1 N   1 
ATOM 386   C CA  . GLY A 1 64  ? 4.975   31.281  226.559 1.00 66.06  ? 64  GLY 1 CA  1 
ATOM 387   C C   . GLY A 1 64  ? 6.169   31.380  227.498 1.00 61.24  ? 64  GLY 1 C   1 
ATOM 388   O O   . GLY A 1 64  ? 7.127   32.125  227.253 1.00 47.93  ? 64  GLY 1 O   1 
ATOM 389   N N   . LEU A 1 65  ? 6.086   30.623  228.585 1.00 67.67  ? 65  LEU 1 N   1 
ATOM 390   C CA  . LEU A 1 65  ? 7.112   30.556  229.615 1.00 59.29  ? 65  LEU 1 CA  1 
ATOM 391   C C   . LEU A 1 65  ? 6.981   29.215  230.284 1.00 62.72  ? 65  LEU 1 C   1 
ATOM 392   O O   . LEU A 1 65  ? 5.911   28.608  230.281 1.00 68.60  ? 65  LEU 1 O   1 
ATOM 393   C CB  . LEU A 1 65  ? 6.910   31.649  230.652 1.00 46.21  ? 65  LEU 1 CB  1 
ATOM 394   C CG  . LEU A 1 65  ? 7.578   32.921  230.174 1.00 52.39  ? 65  LEU 1 CG  1 
ATOM 395   C CD1 . LEU A 1 65  ? 7.225   34.101  231.025 1.00 66.85  ? 65  LEU 1 CD1 1 
ATOM 396   C CD2 . LEU A 1 65  ? 9.051   32.671  230.191 1.00 39.41  ? 65  LEU 1 CD2 1 
ATOM 397   N N   . SER A 1 66  ? 8.077   28.710  230.805 1.00 69.19  ? 66  SER 1 N   1 
ATOM 398   C CA  . SER A 1 66  ? 8.014   27.438  231.480 1.00 70.49  ? 66  SER 1 CA  1 
ATOM 399   C C   . SER A 1 66  ? 7.942   27.792  232.944 1.00 74.96  ? 66  SER 1 C   1 
ATOM 400   O O   . SER A 1 66  ? 8.197   28.938  233.330 1.00 68.73  ? 66  SER 1 O   1 
ATOM 401   C CB  . SER A 1 66  ? 9.290   26.651  231.228 1.00 78.77  ? 66  SER 1 CB  1 
ATOM 402   O OG  . SER A 1 66  ? 10.395  27.308  231.841 1.00 95.95  ? 66  SER 1 OG  1 
ATOM 403   N N   . LYS A 1 67  ? 7.626   26.800  233.761 1.00 72.62  ? 67  LYS 1 N   1 
ATOM 404   C CA  . LYS A 1 67  ? 7.571   26.995  235.191 1.00 77.19  ? 67  LYS 1 CA  1 
ATOM 405   C C   . LYS A 1 67  ? 9.035   27.215  235.529 1.00 67.25  ? 67  LYS 1 C   1 
ATOM 406   O O   . LYS A 1 67  ? 9.901   26.847  234.737 1.00 70.98  ? 67  LYS 1 O   1 
ATOM 407   C CB  . LYS A 1 67  ? 7.067   25.714  235.860 1.00 87.13  ? 67  LYS 1 CB  1 
ATOM 408   C CG  . LYS A 1 67  ? 6.803   25.822  237.372 1.00 115.49 ? 67  LYS 1 CG  1 
ATOM 409   C CD  . LYS A 1 67  ? 6.147   24.537  237.916 1.00 131.65 ? 67  LYS 1 CD  1 
ATOM 410   C CE  . LYS A 1 67  ? 5.876   24.560  239.432 1.00 134.14 ? 67  LYS 1 CE  1 
ATOM 411   N NZ  . LYS A 1 67  ? 5.377   23.231  239.929 1.00 135.03 ? 67  LYS 1 NZ  1 
ATOM 412   N N   . SER A 1 68  ? 9.317   27.873  236.649 1.00 64.10  ? 68  SER 1 N   1 
ATOM 413   C CA  . SER A 1 68  ? 10.701  28.078  237.063 1.00 69.10  ? 68  SER 1 CA  1 
ATOM 414   C C   . SER A 1 68  ? 11.387  26.736  236.880 1.00 74.79  ? 68  SER 1 C   1 
ATOM 415   O O   . SER A 1 68  ? 10.807  25.669  237.155 1.00 62.58  ? 68  SER 1 O   1 
ATOM 416   C CB  . SER A 1 68  ? 10.790  28.510  238.528 1.00 77.99  ? 68  SER 1 CB  1 
ATOM 417   O OG  . SER A 1 68  ? 10.434  29.876  238.706 1.00 95.12  ? 68  SER 1 OG  1 
ATOM 418   N N   . LEU A 1 69  ? 12.596  26.779  236.353 1.00 80.87  ? 69  LEU 1 N   1 
ATOM 419   C CA  . LEU A 1 69  ? 13.279  25.549  236.093 1.00 81.10  ? 69  LEU 1 CA  1 
ATOM 420   C C   . LEU A 1 69  ? 14.031  24.894  237.222 1.00 86.05  ? 69  LEU 1 C   1 
ATOM 421   O O   . LEU A 1 69  ? 14.697  25.538  238.059 1.00 74.01  ? 69  LEU 1 O   1 
ATOM 422   C CB  . LEU A 1 69  ? 14.096  25.635  234.811 1.00 77.04  ? 69  LEU 1 CB  1 
ATOM 423   C CG  . LEU A 1 69  ? 13.220  25.496  233.568 1.00 69.82  ? 69  LEU 1 CG  1 
ATOM 424   C CD1 . LEU A 1 69  ? 14.089  25.714  232.364 1.00 77.22  ? 69  LEU 1 CD1 1 
ATOM 425   C CD2 . LEU A 1 69  ? 12.534  24.123  233.512 1.00 60.01  ? 69  LEU 1 CD2 1 
ATOM 426   N N   . ALA A 1 70  ? 13.824  23.581  237.229 1.00 86.74  ? 70  ALA 1 N   1 
ATOM 427   C CA  . ALA A 1 70  ? 14.382  22.650  238.176 1.00 93.31  ? 70  ALA 1 CA  1 
ATOM 428   C C   . ALA A 1 70  ? 15.857  22.479  237.919 1.00 97.87  ? 70  ALA 1 C   1 
ATOM 429   O O   . ALA A 1 70  ? 16.261  22.247  236.776 1.00 106.48 ? 70  ALA 1 O   1 
ATOM 430   C CB  . ALA A 1 70  ? 13.690  21.328  238.008 1.00 105.39 ? 70  ALA 1 CB  1 
ATOM 431   N N   . ALA A 1 71  ? 16.638  22.491  238.997 1.00 97.05  ? 71  ALA 1 N   1 
ATOM 432   C CA  . ALA A 1 71  ? 18.091  22.353  238.909 1.00 101.11 ? 71  ALA 1 CA  1 
ATOM 433   C C   . ALA A 1 71  ? 18.757  20.952  239.089 1.00 99.66  ? 71  ALA 1 C   1 
ATOM 434   O O   . ALA A 1 71  ? 18.563  20.033  238.269 1.00 93.35  ? 71  ALA 1 O   1 
ATOM 435   C CB  . ALA A 1 71  ? 18.770  23.409  239.824 1.00 95.61  ? 71  ALA 1 CB  1 
ATOM 436   N N   . GLU A 1 72  ? 19.488  20.804  240.198 1.00 83.11  ? 72  GLU 1 N   1 
ATOM 437   C CA  . GLU A 1 72  ? 20.283  19.624  240.535 1.00 65.99  ? 72  GLU 1 CA  1 
ATOM 438   C C   . GLU A 1 72  ? 19.647  18.301  240.924 1.00 64.36  ? 72  GLU 1 C   1 
ATOM 439   O O   . GLU A 1 72  ? 20.117  17.652  241.861 1.00 65.64  ? 72  GLU 1 O   1 
ATOM 440   C CB  . GLU A 1 72  ? 21.273  20.037  241.616 1.00 49.39  ? 72  GLU 1 CB  1 
ATOM 441   C CG  . GLU A 1 72  ? 22.054  21.276  241.223 1.00 73.01  ? 72  GLU 1 CG  1 
ATOM 442   C CD  . GLU A 1 72  ? 22.771  21.944  242.380 1.00 81.43  ? 72  GLU 1 CD  1 
ATOM 443   O OE1 . GLU A 1 72  ? 22.103  22.253  243.391 1.00 101.36 ? 72  GLU 1 OE1 1 
ATOM 444   O OE2 . GLU A 1 72  ? 23.992  22.211  242.260 1.00 94.87  ? 72  GLU 1 OE2 1 
ATOM 445   N N   . LYS A 1 73  ? 18.630  17.857  240.196 1.00 64.62  ? 73  LYS 1 N   1 
ATOM 446   C CA  . LYS A 1 73  ? 17.987  16.590  240.535 1.00 78.52  ? 73  LYS 1 CA  1 
ATOM 447   C C   . LYS A 1 73  ? 18.955  15.415  240.518 1.00 77.27  ? 73  LYS 1 C   1 
ATOM 448   O O   . LYS A 1 73  ? 20.058  15.527  240.005 1.00 86.95  ? 73  LYS 1 O   1 
ATOM 449   C CB  . LYS A 1 73  ? 16.834  16.279  239.582 1.00 84.63  ? 73  LYS 1 CB  1 
ATOM 450   C CG  . LYS A 1 73  ? 15.479  16.680  240.110 1.00 113.49 ? 73  LYS 1 CG  1 
ATOM 451   C CD  . LYS A 1 73  ? 14.405  15.873  239.411 1.00 131.49 ? 73  LYS 1 CD  1 
ATOM 452   C CE  . LYS A 1 73  ? 13.044  16.041  240.059 1.00 151.55 ? 73  LYS 1 CE  1 
ATOM 453   N NZ  . LYS A 1 73  ? 12.229  17.071  239.364 1.00 167.55 ? 73  LYS 1 NZ  1 
ATOM 454   N N   . GLN A 1 74  ? 18.574  14.320  241.168 1.00 80.01  ? 74  GLN 1 N   1 
ATOM 455   C CA  . GLN A 1 74  ? 19.393  13.119  241.160 1.00 76.86  ? 74  GLN 1 CA  1 
ATOM 456   C C   . GLN A 1 74  ? 18.732  12.293  240.081 1.00 58.78  ? 74  GLN 1 C   1 
ATOM 457   O O   . GLN A 1 74  ? 17.526  12.289  239.976 1.00 55.50  ? 74  GLN 1 O   1 
ATOM 458   C CB  . GLN A 1 74  ? 19.368  12.388  242.514 1.00 97.48  ? 74  GLN 1 CB  1 
ATOM 459   C CG  . GLN A 1 74  ? 20.043  10.983  242.517 1.00 124.15 ? 74  GLN 1 CG  1 
ATOM 460   C CD  . GLN A 1 74  ? 21.464  10.947  241.906 1.00 134.17 ? 74  GLN 1 CD  1 
ATOM 461   O OE1 . GLN A 1 74  ? 22.022  11.980  241.536 1.00 141.30 ? 74  GLN 1 OE1 1 
ATOM 462   N NE2 . GLN A 1 74  ? 22.036  9.745   241.789 1.00 122.81 ? 74  GLN 1 NE2 1 
ATOM 463   N N   . PHE A 1 75  ? 19.526  11.593  239.286 1.00 58.90  ? 75  PHE 1 N   1 
ATOM 464   C CA  . PHE A 1 75  ? 19.017  10.790  238.177 1.00 66.84  ? 75  PHE 1 CA  1 
ATOM 465   C C   . PHE A 1 75  ? 17.844  9.914   238.529 1.00 73.48  ? 75  PHE 1 C   1 
ATOM 466   O O   . PHE A 1 75  ? 16.911  9.747   237.746 1.00 69.03  ? 75  PHE 1 O   1 
ATOM 467   C CB  . PHE A 1 75  ? 20.132  9.930   237.600 1.00 74.12  ? 75  PHE 1 CB  1 
ATOM 468   C CG  . PHE A 1 75  ? 21.226  10.722  236.969 1.00 91.08  ? 75  PHE 1 CG  1 
ATOM 469   C CD1 . PHE A 1 75  ? 22.201  11.334  237.755 1.00 99.55  ? 75  PHE 1 CD1 1 
ATOM 470   C CD2 . PHE A 1 75  ? 21.280  10.871  235.592 1.00 91.37  ? 75  PHE 1 CD2 1 
ATOM 471   C CE1 . PHE A 1 75  ? 23.217  12.086  237.179 1.00 104.48 ? 75  PHE 1 CE1 1 
ATOM 472   C CE2 . PHE A 1 75  ? 22.283  11.614  235.007 1.00 104.13 ? 75  PHE 1 CE2 1 
ATOM 473   C CZ  . PHE A 1 75  ? 23.258  12.226  235.804 1.00 107.98 ? 75  PHE 1 CZ  1 
ATOM 474   N N   . THR A 1 76  ? 17.913  9.337   239.716 1.00 92.17  ? 76  THR 1 N   1 
ATOM 475   C CA  . THR A 1 76  ? 16.857  8.469   240.186 1.00 110.36 ? 76  THR 1 CA  1 
ATOM 476   C C   . THR A 1 76  ? 15.636  9.305   240.506 1.00 116.80 ? 76  THR 1 C   1 
ATOM 477   O O   . THR A 1 76  ? 14.536  9.020   240.029 1.00 123.50 ? 76  THR 1 O   1 
ATOM 478   C CB  . THR A 1 76  ? 17.293  7.720   241.436 1.00 117.53 ? 76  THR 1 CB  1 
ATOM 479   O OG1 . THR A 1 76  ? 18.637  8.109   241.775 1.00 116.43 ? 76  THR 1 OG1 1 
ATOM 480   C CG2 . THR A 1 76  ? 17.209  6.206   241.198 1.00 127.22 ? 76  THR 1 CG2 1 
ATOM 481   N N   . ASP A 1 77  ? 15.839  10.355  241.295 1.00 114.78 ? 77  ASP 1 N   1 
ATOM 482   C CA  . ASP A 1 77  ? 14.736  11.219  241.667 1.00 115.73 ? 77  ASP 1 CA  1 
ATOM 483   C C   . ASP A 1 77  ? 14.443  12.279  240.608 1.00 106.88 ? 77  ASP 1 C   1 
ATOM 484   O O   . ASP A 1 77  ? 14.191  13.442  240.919 1.00 98.77  ? 77  ASP 1 O   1 
ATOM 485   C CB  . ASP A 1 77  ? 14.991  11.857  243.031 1.00 127.36 ? 77  ASP 1 CB  1 
ATOM 486   C CG  . ASP A 1 77  ? 13.705  12.086  243.804 1.00 142.48 ? 77  ASP 1 CG  1 
ATOM 487   O OD1 . ASP A 1 77  ? 12.762  11.259  243.666 1.00 146.98 ? 77  ASP 1 OD1 1 
ATOM 488   O OD2 . ASP A 1 77  ? 13.638  13.086  244.547 1.00 151.10 ? 77  ASP 1 OD2 1 
ATOM 489   N N   . ASP A 1 78  ? 14.462  11.875  239.346 1.00 96.60  ? 78  ASP 1 N   1 
ATOM 490   C CA  . ASP A 1 78  ? 14.189  12.830  238.310 1.00 92.89  ? 78  ASP 1 CA  1 
ATOM 491   C C   . ASP A 1 78  ? 12.830  12.670  237.705 1.00 86.83  ? 78  ASP 1 C   1 
ATOM 492   O O   . ASP A 1 78  ? 12.538  11.703  237.019 1.00 63.87  ? 78  ASP 1 O   1 
ATOM 493   C CB  . ASP A 1 78  ? 15.259  12.839  237.211 1.00 107.07 ? 78  ASP 1 CB  1 
ATOM 494   C CG  . ASP A 1 78  ? 15.183  14.090  236.312 1.00 112.22 ? 78  ASP 1 CG  1 
ATOM 495   O OD1 . ASP A 1 78  ? 14.315  14.967  236.559 1.00 103.72 ? 78  ASP 1 OD1 1 
ATOM 496   O OD2 . ASP A 1 78  ? 16.002  14.204  235.361 1.00 105.66 ? 78  ASP 1 OD2 1 
ATOM 497   N N   . SER A 1 79  ? 11.963  13.560  238.141 1.00 83.09  ? 79  SER 1 N   1 
ATOM 498   C CA  . SER A 1 79  ? 10.630  13.686  237.614 1.00 87.69  ? 79  SER 1 CA  1 
ATOM 499   C C   . SER A 1 79  ? 10.253  15.119  237.912 1.00 95.93  ? 79  SER 1 C   1 
ATOM 500   O O   . SER A 1 79  ? 10.238  15.553  239.077 1.00 91.81  ? 79  SER 1 O   1 
ATOM 501   C CB  . SER A 1 79  ? 9.619   12.762  238.233 1.00 82.98  ? 79  SER 1 CB  1 
ATOM 502   O OG  . SER A 1 79  ? 8.417   12.898  237.478 1.00 83.84  ? 79  SER 1 OG  1 
ATOM 503   N N   . PRO A 1 80  ? 10.137  15.920  236.852 1.00 97.11  ? 80  PRO 1 N   1 
ATOM 504   C CA  . PRO A 1 80  ? 9.785   17.338  236.877 1.00 90.08  ? 80  PRO 1 CA  1 
ATOM 505   C C   . PRO A 1 80  ? 8.296   17.472  236.570 1.00 89.71  ? 80  PRO 1 C   1 
ATOM 506   O O   . PRO A 1 80  ? 7.594   16.463  236.449 1.00 90.21  ? 80  PRO 1 O   1 
ATOM 507   C CB  . PRO A 1 80  ? 10.622  17.875  235.740 1.00 88.44  ? 80  PRO 1 CB  1 
ATOM 508   C CG  . PRO A 1 80  ? 10.411  16.779  234.700 1.00 87.51  ? 80  PRO 1 CG  1 
ATOM 509   C CD  . PRO A 1 80  ? 10.521  15.495  235.491 1.00 90.10  ? 80  PRO 1 CD  1 
ATOM 510   N N   . ASP A 1 81  ? 7.830   18.704  236.408 1.00 79.41  ? 81  ASP 1 N   1 
ATOM 511   C CA  . ASP A 1 81  ? 6.431   18.954  236.116 1.00 71.48  ? 81  ASP 1 CA  1 
ATOM 512   C C   . ASP A 1 81  ? 6.276   19.313  234.673 1.00 65.15  ? 81  ASP 1 C   1 
ATOM 513   O O   . ASP A 1 81  ? 7.116   20.022  234.115 1.00 60.76  ? 81  ASP 1 O   1 
ATOM 514   C CB  . ASP A 1 81  ? 5.944   20.126  236.942 1.00 77.97  ? 81  ASP 1 CB  1 
ATOM 515   C CG  . ASP A 1 81  ? 6.235   19.946  238.397 1.00 98.60  ? 81  ASP 1 CG  1 
ATOM 516   O OD1 . ASP A 1 81  ? 5.741   18.946  238.956 1.00 117.38 ? 81  ASP 1 OD1 1 
ATOM 517   O OD2 . ASP A 1 81  ? 6.959   20.788  238.981 1.00 109.54 ? 81  ASP 1 OD2 1 
ATOM 518   N N   . LYS A 1 82  ? 5.186   18.864  234.070 1.00 49.63  ? 82  LYS 1 N   1 
ATOM 519   C CA  . LYS A 1 82  ? 4.919   19.200  232.679 1.00 51.45  ? 82  LYS 1 CA  1 
ATOM 520   C C   . LYS A 1 82  ? 4.982   20.718  232.449 1.00 51.59  ? 82  LYS 1 C   1 
ATOM 521   O O   . LYS A 1 82  ? 5.199   21.198  231.334 1.00 51.41  ? 82  LYS 1 O   1 
ATOM 522   C CB  . LYS A 1 82  ? 3.556   18.668  232.272 1.00 46.60  ? 82  LYS 1 CB  1 
ATOM 523   C CG  . LYS A 1 82  ? 3.014   19.280  231.013 1.00 50.78  ? 82  LYS 1 CG  1 
ATOM 524   C CD  . LYS A 1 82  ? 2.193   18.272  230.254 1.00 50.36  ? 82  LYS 1 CD  1 
ATOM 525   C CE  . LYS A 1 82  ? 1.440   18.957  229.119 1.00 74.48  ? 82  LYS 1 CE  1 
ATOM 526   N NZ  . LYS A 1 82  ? 0.653   18.020  228.242 1.00 80.99  ? 82  LYS 1 NZ  1 
ATOM 527   N N   . GLU A 1 83  ? 4.785   21.472  233.515 1.00 53.79  ? 83  GLU 1 N   1 
ATOM 528   C CA  . GLU A 1 83  ? 4.854   22.914  233.419 1.00 65.60  ? 83  GLU 1 CA  1 
ATOM 529   C C   . GLU A 1 83  ? 6.299   23.330  233.201 1.00 58.71  ? 83  GLU 1 C   1 
ATOM 530   O O   . GLU A 1 83  ? 6.580   24.515  233.041 1.00 64.83  ? 83  GLU 1 O   1 
ATOM 531   C CB  . GLU A 1 83  ? 4.314   23.581  234.693 1.00 80.24  ? 83  GLU 1 CB  1 
ATOM 532   C CG  . GLU A 1 83  ? 2.794   23.560  234.855 1.00 109.31 ? 83  GLU 1 CG  1 
ATOM 533   C CD  . GLU A 1 83  ? 2.237   22.174  235.131 1.00 129.49 ? 83  GLU 1 CD  1 
ATOM 534   O OE1 . GLU A 1 83  ? 2.215   21.785  236.320 1.00 143.48 ? 83  GLU 1 OE1 1 
ATOM 535   O OE2 . GLU A 1 83  ? 1.830   21.476  234.167 1.00 135.25 ? 83  GLU 1 OE2 1 
ATOM 536   N N   . GLN A 1 84  ? 7.212   22.365  233.232 1.00 43.23  ? 84  GLN 1 N   1 
ATOM 537   C CA  . GLN A 1 84  ? 8.630   22.639  233.033 1.00 45.27  ? 84  GLN 1 CA  1 
ATOM 538   C C   . GLN A 1 84  ? 9.119   21.968  231.769 1.00 37.45  ? 84  GLN 1 C   1 
ATOM 539   O O   . GLN A 1 84  ? 10.308  22.026  231.424 1.00 41.89  ? 84  GLN 1 O   1 
ATOM 540   C CB  . GLN A 1 84  ? 9.429   22.104  234.190 1.00 45.59  ? 84  GLN 1 CB  1 
ATOM 541   C CG  . GLN A 1 84  ? 9.065   22.707  235.494 1.00 61.29  ? 84  GLN 1 CG  1 
ATOM 542   C CD  . GLN A 1 84  ? 9.777   22.026  236.647 1.00 73.07  ? 84  GLN 1 CD  1 
ATOM 543   O OE1 . GLN A 1 84  ? 9.728   20.794  236.794 1.00 69.83  ? 84  GLN 1 OE1 1 
ATOM 544   N NE2 . GLN A 1 84  ? 10.448  22.822  237.477 1.00 69.65  ? 84  GLN 1 NE2 1 
ATOM 545   N N   . LEU A 1 85  ? 8.193   21.334  231.070 1.00 31.10  ? 85  LEU 1 N   1 
ATOM 546   C CA  . LEU A 1 85  ? 8.544   20.623  229.856 1.00 47.08  ? 85  LEU 1 CA  1 
ATOM 547   C C   . LEU A 1 85  ? 8.069   21.228  228.579 1.00 46.18  ? 85  LEU 1 C   1 
ATOM 548   O O   . LEU A 1 85  ? 6.958   20.951  228.109 1.00 48.57  ? 85  LEU 1 O   1 
ATOM 549   C CB  . LEU A 1 85  ? 8.058   19.188  229.897 1.00 52.44  ? 85  LEU 1 CB  1 
ATOM 550   C CG  . LEU A 1 85  ? 8.665   18.333  231.000 1.00 55.42  ? 85  LEU 1 CG  1 
ATOM 551   C CD1 . LEU A 1 85  ? 8.780   16.937  230.449 1.00 61.84  ? 85  LEU 1 CD1 1 
ATOM 552   C CD2 . LEU A 1 85  ? 10.027  18.846  231.418 1.00 29.19  ? 85  LEU 1 CD2 1 
ATOM 553   N N   . PRO A 1 86  ? 8.921   22.038  227.969 1.00 38.60  ? 86  PRO 1 N   1 
ATOM 554   C CA  . PRO A 1 86  ? 8.475   22.627  226.720 1.00 25.83  ? 86  PRO 1 CA  1 
ATOM 555   C C   . PRO A 1 86  ? 8.268   21.459  225.772 1.00 25.37  ? 86  PRO 1 C   1 
ATOM 556   O O   . PRO A 1 86  ? 8.958   20.424  225.885 1.00 38.33  ? 86  PRO 1 O   1 
ATOM 557   C CB  . PRO A 1 86  ? 9.665   23.479  226.332 1.00 21.26  ? 86  PRO 1 CB  1 
ATOM 558   C CG  . PRO A 1 86  ? 10.262  23.843  227.681 1.00 20.76  ? 86  PRO 1 CG  1 
ATOM 559   C CD  . PRO A 1 86  ? 10.261  22.512  228.339 1.00 29.97  ? 86  PRO 1 CD  1 
ATOM 560   N N   . CYS A 1 87  ? 7.277   21.589  224.902 1.00 14.90  ? 87  CYS 1 N   1 
ATOM 561   C CA  . CYS A 1 87  ? 6.958   20.541  223.938 1.00 32.84  ? 87  CYS 1 CA  1 
ATOM 562   C C   . CYS A 1 87  ? 6.696   21.005  222.509 1.00 36.84  ? 87  CYS 1 C   1 
ATOM 563   O O   . CYS A 1 87  ? 6.206   22.109  222.235 1.00 31.69  ? 87  CYS 1 O   1 
ATOM 564   C CB  . CYS A 1 87  ? 5.697   19.786  224.351 1.00 42.39  ? 87  CYS 1 CB  1 
ATOM 565   S SG  . CYS A 1 87  ? 5.601   19.305  226.044 1.00 49.67  ? 87  CYS 1 SG  1 
ATOM 566   N N   . TYR A 1 88  ? 6.900   20.068  221.605 1.00 40.29  ? 88  TYR 1 N   1 
ATOM 567   C CA  . TYR A 1 88  ? 6.666   20.316  220.208 1.00 47.86  ? 88  TYR 1 CA  1 
ATOM 568   C C   . TYR A 1 88  ? 5.212   20.735  220.056 1.00 50.22  ? 88  TYR 1 C   1 
ATOM 569   O O   . TYR A 1 88  ? 4.296   20.052  220.560 1.00 66.86  ? 88  TYR 1 O   1 
ATOM 570   C CB  . TYR A 1 88  ? 6.937   19.049  219.382 1.00 48.68  ? 88  TYR 1 CB  1 
ATOM 571   C CG  . TYR A 1 88  ? 8.401   18.656  219.281 1.00 59.44  ? 88  TYR 1 CG  1 
ATOM 572   C CD1 . TYR A 1 88  ? 9.240   18.681  220.411 1.00 58.42  ? 88  TYR 1 CD1 1 
ATOM 573   C CD2 . TYR A 1 88  ? 8.942   18.231  218.064 1.00 51.30  ? 88  TYR 1 CD2 1 
ATOM 574   C CE1 . TYR A 1 88  ? 10.569  18.292  220.331 1.00 59.23  ? 88  TYR 1 CE1 1 
ATOM 575   C CE2 . TYR A 1 88  ? 10.273  17.837  217.977 1.00 60.30  ? 88  TYR 1 CE2 1 
ATOM 576   C CZ  . TYR A 1 88  ? 11.078  17.867  219.117 1.00 67.75  ? 88  TYR 1 CZ  1 
ATOM 577   O OH  . TYR A 1 88  ? 12.384  17.439  219.050 1.00 79.32  ? 88  TYR 1 OH  1 
ATOM 578   N N   . SER A 1 89  ? 5.044   21.906  219.441 1.00 40.76  ? 89  SER 1 N   1 
ATOM 579   C CA  . SER A 1 89  ? 3.763   22.520  219.139 1.00 24.40  ? 89  SER 1 CA  1 
ATOM 580   C C   . SER A 1 89  ? 3.391   22.048  217.729 1.00 24.95  ? 89  SER 1 C   1 
ATOM 581   O O   . SER A 1 89  ? 4.221   22.083  216.816 1.00 37.94  ? 89  SER 1 O   1 
ATOM 582   C CB  . SER A 1 89  ? 3.940   24.048  219.187 1.00 32.71  ? 89  SER 1 CB  1 
ATOM 583   O OG  . SER A 1 89  ? 4.745   24.474  220.311 1.00 40.02  ? 89  SER 1 OG  1 
ATOM 584   N N   . VAL A 1 90  ? 2.161   21.611  217.522 1.00 29.01  ? 90  VAL 1 N   1 
ATOM 585   C CA  . VAL A 1 90  ? 1.777   21.110  216.199 1.00 33.49  ? 90  VAL 1 CA  1 
ATOM 586   C C   . VAL A 1 90  ? 0.340   21.487  215.822 1.00 39.97  ? 90  VAL 1 C   1 
ATOM 587   O O   . VAL A 1 90  ? -0.378  22.038  216.670 1.00 41.36  ? 90  VAL 1 O   1 
ATOM 588   C CB  . VAL A 1 90  ? 1.895   19.585  216.203 1.00 39.82  ? 90  VAL 1 CB  1 
ATOM 589   C CG1 . VAL A 1 90  ? 1.008   19.012  217.302 1.00 33.44  ? 90  VAL 1 CG1 1 
ATOM 590   C CG2 . VAL A 1 90  ? 1.558   18.992  214.837 1.00 40.64  ? 90  VAL 1 CG2 1 
ATOM 591   N N   . ALA A 1 91  ? -0.067  21.208  214.570 1.00 16.93  ? 91  ALA 1 N   1 
ATOM 592   C CA  . ALA A 1 91  ? -1.422  21.502  214.094 1.00 19.40  ? 91  ALA 1 CA  1 
ATOM 593   C C   . ALA A 1 91  ? -1.638  20.950  212.699 1.00 30.06  ? 91  ALA 1 C   1 
ATOM 594   O O   . ALA A 1 91  ? -0.663  20.729  211.978 1.00 35.86  ? 91  ALA 1 O   1 
ATOM 595   C CB  . ALA A 1 91  ? -1.653  22.985  214.075 1.00 40.65  ? 91  ALA 1 CB  1 
ATOM 596   N N   . ARG A 1 92  ? -2.899  20.774  212.288 1.00 20.09  ? 92  ARG 1 N   1 
ATOM 597   C CA  . ARG A 1 92  ? -3.159  20.235  210.950 1.00 31.57  ? 92  ARG 1 CA  1 
ATOM 598   C C   . ARG A 1 92  ? -4.145  21.056  210.156 1.00 38.74  ? 92  ARG 1 C   1 
ATOM 599   O O   . ARG A 1 92  ? -5.327  21.153  210.469 1.00 48.53  ? 92  ARG 1 O   1 
ATOM 600   C CB  . ARG A 1 92  ? -3.613  18.769  211.022 1.00 51.69  ? 92  ARG 1 CB  1 
ATOM 601   C CG  . ARG A 1 92  ? -4.485  18.230  209.850 1.00 61.95  ? 92  ARG 1 CG  1 
ATOM 602   C CD  . ARG A 1 92  ? -5.344  17.025  210.326 1.00 58.94  ? 92  ARG 1 CD  1 
ATOM 603   N NE  . ARG A 1 92  ? -5.665  17.140  211.768 1.00 90.83  ? 92  ARG 1 NE  1 
ATOM 604   C CZ  . ARG A 1 92  ? -6.893  17.313  212.273 1.00 91.39  ? 92  ARG 1 CZ  1 
ATOM 605   N NH1 . ARG A 1 92  ? -7.917  17.354  211.401 1.00 81.95  ? 92  ARG 1 NH1 1 
ATOM 606   N NH2 . ARG A 1 92  ? -7.076  17.546  213.615 1.00 42.68  ? 92  ARG 1 NH2 1 
ATOM 607   N N   . ILE A 1 93  ? -3.625  21.698  209.143 1.00 35.31  ? 93  ILE 1 N   1 
ATOM 608   C CA  . ILE A 1 93  ? -4.441  22.507  208.311 1.00 26.67  ? 93  ILE 1 CA  1 
ATOM 609   C C   . ILE A 1 93  ? -5.125  21.547  207.384 1.00 30.07  ? 93  ILE 1 C   1 
ATOM 610   O O   . ILE A 1 93  ? -4.506  20.860  206.599 1.00 39.48  ? 93  ILE 1 O   1 
ATOM 611   C CB  . ILE A 1 93  ? -3.580  23.510  207.610 1.00 22.04  ? 93  ILE 1 CB  1 
ATOM 612   C CG1 . ILE A 1 93  ? -3.208  24.566  208.633 1.00 33.16  ? 93  ILE 1 CG1 1 
ATOM 613   C CG2 . ILE A 1 93  ? -4.260  24.055  206.389 1.00 15.28  ? 93  ILE 1 CG2 1 
ATOM 614   C CD1 . ILE A 1 93  ? -2.092  25.460  208.184 1.00 68.14  ? 93  ILE 1 CD1 1 
ATOM 615   N N   . PRO A 1 94  ? -6.427  21.440  207.526 1.00 35.98  ? 94  PRO 1 N   1 
ATOM 616   C CA  . PRO A 1 94  ? -7.368  20.603  206.793 1.00 34.18  ? 94  PRO 1 CA  1 
ATOM 617   C C   . PRO A 1 94  ? -7.478  21.134  205.415 1.00 30.15  ? 94  PRO 1 C   1 
ATOM 618   O O   . PRO A 1 94  ? -7.671  22.316  205.254 1.00 46.71  ? 94  PRO 1 O   1 
ATOM 619   C CB  . PRO A 1 94  ? -8.677  20.892  207.496 1.00 31.21  ? 94  PRO 1 CB  1 
ATOM 620   C CG  . PRO A 1 94  ? -8.256  21.427  208.832 1.00 50.71  ? 94  PRO 1 CG  1 
ATOM 621   C CD  . PRO A 1 94  ? -7.147  22.310  208.454 1.00 51.26  ? 94  PRO 1 CD  1 
ATOM 622   N N   . LEU A 1 95  ? -7.362  20.292  204.412 1.00 29.06  ? 95  LEU 1 N   1 
ATOM 623   C CA  . LEU A 1 95  ? -7.506  20.801  203.065 1.00 39.40  ? 95  LEU 1 CA  1 
ATOM 624   C C   . LEU A 1 95  ? -8.668  20.125  202.367 1.00 47.64  ? 95  LEU 1 C   1 
ATOM 625   O O   . LEU A 1 95  ? -9.198  19.137  202.850 1.00 60.84  ? 95  LEU 1 O   1 
ATOM 626   C CB  . LEU A 1 95  ? -6.228  20.585  202.278 1.00 43.51  ? 95  LEU 1 CB  1 
ATOM 627   C CG  . LEU A 1 95  ? -4.908  21.011  202.913 1.00 53.27  ? 95  LEU 1 CG  1 
ATOM 628   C CD1 . LEU A 1 95  ? -3.942  21.242  201.762 1.00 41.13  ? 95  LEU 1 CD1 1 
ATOM 629   C CD2 . LEU A 1 95  ? -5.054  22.280  203.753 1.00 43.75  ? 95  LEU 1 CD2 1 
ATOM 630   N N   . PRO A 1 96  ? -9.158  20.722  201.285 1.00 56.45  ? 96  PRO 1 N   1 
ATOM 631   C CA  . PRO A 1 96  ? -10.266 20.253  200.450 1.00 61.57  ? 96  PRO 1 CA  1 
ATOM 632   C C   . PRO A 1 96  ? -9.906  19.005  199.669 1.00 63.03  ? 96  PRO 1 C   1 
ATOM 633   O O   . PRO A 1 96  ? -8.902  19.016  198.965 1.00 76.37  ? 96  PRO 1 O   1 
ATOM 634   C CB  . PRO A 1 96  ? -10.447 21.410  199.460 1.00 67.70  ? 96  PRO 1 CB  1 
ATOM 635   C CG  . PRO A 1 96  ? -10.125 22.590  200.271 1.00 80.87  ? 96  PRO 1 CG  1 
ATOM 636   C CD  . PRO A 1 96  ? -8.876  22.140  201.012 1.00 76.91  ? 96  PRO 1 CD  1 
ATOM 637   N N   . ASN A 1 97  ? -10.738 17.965  199.715 1.00 63.98  ? 97  ASN 1 N   1 
ATOM 638   C CA  . ASN A 1 97  ? -10.422 16.765  198.936 1.00 72.57  ? 97  ASN 1 CA  1 
ATOM 639   C C   . ASN A 1 97  ? -10.668 17.136  197.498 1.00 64.76  ? 97  ASN 1 C   1 
ATOM 640   O O   . ASN A 1 97  ? -11.769 17.500  197.124 1.00 67.00  ? 97  ASN 1 O   1 
ATOM 641   C CB  . ASN A 1 97  ? -11.288 15.557  199.309 1.00 85.76  ? 97  ASN 1 CB  1 
ATOM 642   C CG  . ASN A 1 97  ? -10.944 14.292  198.485 1.00 102.48 ? 97  ASN 1 CG  1 
ATOM 643   O OD1 . ASN A 1 97  ? -11.647 13.284  198.577 1.00 123.64 ? 97  ASN 1 OD1 1 
ATOM 644   N ND2 . ASN A 1 97  ? -9.843  14.327  197.725 1.00 106.15 ? 97  ASN 1 ND2 1 
ATOM 645   N N   . ILE A 1 98  ? -9.631  17.092  196.689 1.00 59.66  ? 98  ILE 1 N   1 
ATOM 646   C CA  . ILE A 1 98  ? -9.826  17.476  195.317 1.00 64.71  ? 98  ILE 1 CA  1 
ATOM 647   C C   . ILE A 1 98  ? -10.266 16.258  194.501 1.00 63.22  ? 98  ILE 1 C   1 
ATOM 648   O O   . ILE A 1 98  ? -10.557 16.332  193.294 1.00 69.86  ? 98  ILE 1 O   1 
ATOM 649   C CB  . ILE A 1 98  ? -8.591  18.343  194.759 1.00 80.03  ? 98  ILE 1 CB  1 
ATOM 650   C CG1 . ILE A 1 98  ? -8.055  17.795  193.434 1.00 98.10  ? 98  ILE 1 CG1 1 
ATOM 651   C CG2 . ILE A 1 98  ? -7.506  18.624  195.855 1.00 42.97  ? 98  ILE 1 CG2 1 
ATOM 652   C CD1 . ILE A 1 98  ? -8.859  18.269  192.179 1.00 137.45 ? 98  ILE 1 CD1 1 
ATOM 653   N N   . ASN A 1 99  ? -10.451 15.145  195.193 1.00 60.17  ? 99  ASN 1 N   1 
ATOM 654   C CA  . ASN A 1 99  ? -10.886 13.954  194.483 1.00 80.36  ? 99  ASN 1 CA  1 
ATOM 655   C C   . ASN A 1 99  ? -12.201 13.476  195.053 1.00 82.99  ? 99  ASN 1 C   1 
ATOM 656   O O   . ASN A 1 99  ? -12.215 12.807  196.085 1.00 82.15  ? 99  ASN 1 O   1 
ATOM 657   C CB  . ASN A 1 99  ? -9.850  12.832  194.578 1.00 82.48  ? 99  ASN 1 CB  1 
ATOM 658   C CG  . ASN A 1 99  ? -8.587  13.124  193.796 1.00 85.12  ? 99  ASN 1 CG  1 
ATOM 659   O OD1 . ASN A 1 99  ? -8.610  13.364  192.576 1.00 79.06  ? 99  ASN 1 OD1 1 
ATOM 660   N ND2 . ASN A 1 99  ? -7.462  13.073  194.496 1.00 89.26  ? 99  ASN 1 ND2 1 
ATOM 661   N N   . GLU A 1 100 ? -13.308 13.887  194.444 1.00 83.06  ? 100 GLU 1 N   1 
ATOM 662   C CA  . GLU A 1 100 ? -14.615 13.441  194.913 1.00 86.68  ? 100 GLU 1 CA  1 
ATOM 663   C C   . GLU A 1 100 ? -15.505 13.064  193.755 1.00 76.99  ? 100 GLU 1 C   1 
ATOM 664   O O   . GLU A 1 100 ? -16.727 13.021  193.849 1.00 75.51  ? 100 GLU 1 O   1 
ATOM 665   C CB  . GLU A 1 100 ? -15.294 14.399  195.920 1.00 107.61 ? 100 GLU 1 CB  1 
ATOM 666   C CG  . GLU A 1 100 ? -14.885 15.868  195.876 1.00 149.97 ? 100 GLU 1 CG  1 
ATOM 667   C CD  . GLU A 1 100 ? -15.582 16.660  194.783 1.00 171.84 ? 100 GLU 1 CD  1 
ATOM 668   O OE1 . GLU A 1 100 ? -15.215 16.513  193.588 1.00 188.59 ? 100 GLU 1 OE1 1 
ATOM 669   O OE2 . GLU A 1 100 ? -16.476 17.471  195.119 1.00 181.34 ? 100 GLU 1 OE2 1 
ATOM 670   N N   . ASP A 1 101 ? -14.847 12.769  192.652 1.00 66.96  ? 101 ASP 1 N   1 
ATOM 671   C CA  . ASP A 1 101 ? -15.513 12.310  191.470 1.00 66.64  ? 101 ASP 1 CA  1 
ATOM 672   C C   . ASP A 1 101 ? -14.395 11.488  190.922 1.00 72.04  ? 101 ASP 1 C   1 
ATOM 673   O O   . ASP A 1 101 ? -13.394 12.042  190.459 1.00 83.73  ? 101 ASP 1 O   1 
ATOM 674   C CB  . ASP A 1 101 ? -15.804 13.454  190.533 1.00 88.99  ? 101 ASP 1 CB  1 
ATOM 675   C CG  . ASP A 1 101 ? -16.194 12.973  189.162 1.00 112.81 ? 101 ASP 1 CG  1 
ATOM 676   O OD1 . ASP A 1 101 ? -17.370 12.593  188.985 1.00 126.33 ? 101 ASP 1 OD1 1 
ATOM 677   O OD2 . ASP A 1 101 ? -15.312 12.936  188.269 1.00 137.63 ? 101 ASP 1 OD2 1 
ATOM 678   N N   . LEU A 1 102 ? -14.479 10.176  191.116 1.00 64.99  ? 102 LEU 1 N   1 
ATOM 679   C CA  . LEU A 1 102 ? -13.417 9.289   190.641 1.00 69.33  ? 102 LEU 1 CA  1 
ATOM 680   C C   . LEU A 1 102 ? -13.744 8.856   189.242 1.00 77.02  ? 102 LEU 1 C   1 
ATOM 681   O O   . LEU A 1 102 ? -13.237 7.848   188.746 1.00 82.05  ? 102 LEU 1 O   1 
ATOM 682   C CB  . LEU A 1 102 ? -13.250 8.057   191.539 1.00 57.09  ? 102 LEU 1 CB  1 
ATOM 683   C CG  . LEU A 1 102 ? -12.854 8.328   192.989 1.00 58.37  ? 102 LEU 1 CG  1 
ATOM 684   C CD1 . LEU A 1 102 ? -12.600 7.041   193.744 1.00 71.54  ? 102 LEU 1 CD1 1 
ATOM 685   C CD2 . LEU A 1 102 ? -11.628 9.180   193.021 1.00 72.20  ? 102 LEU 1 CD2 1 
ATOM 686   N N   . THR A 1 103 ? -14.575 9.642   188.589 1.00 86.59  ? 103 THR 1 N   1 
ATOM 687   C CA  . THR A 1 103 ? -14.979 9.315   187.251 1.00 113.86 ? 103 THR 1 CA  1 
ATOM 688   C C   . THR A 1 103 ? -13.975 9.762   186.193 1.00 136.30 ? 103 THR 1 C   1 
ATOM 689   O O   . THR A 1 103 ? -13.777 9.041   185.208 1.00 140.24 ? 103 THR 1 O   1 
ATOM 690   C CB  . THR A 1 103 ? -16.360 9.893   186.960 1.00 108.06 ? 103 THR 1 CB  1 
ATOM 691   O OG1 . THR A 1 103 ? -17.137 9.870   188.167 1.00 111.80 ? 103 THR 1 OG1 1 
ATOM 692   C CG2 . THR A 1 103 ? -17.072 9.050   185.890 1.00 112.03 ? 103 THR 1 CG2 1 
ATOM 693   N N   . CYS A 1 104 ? -13.317 10.919  186.393 1.00 162.41 ? 104 CYS 1 N   1 
ATOM 694   C CA  . CYS A 1 104 ? -12.341 11.428  185.410 1.00 185.74 ? 104 CYS 1 CA  1 
ATOM 695   C C   . CYS A 1 104 ? -11.009 10.661  185.257 1.00 188.56 ? 104 CYS 1 C   1 
ATOM 696   O O   . CYS A 1 104 ? -10.280 10.887  184.283 1.00 192.00 ? 104 CYS 1 O   1 
ATOM 697   C CB  . CYS A 1 104 ? -12.117 12.951  185.551 1.00 195.53 ? 104 CYS 1 CB  1 
ATOM 698   S SG  . CYS A 1 104 ? -12.592 13.917  184.060 1.00 233.50 ? 104 CYS 1 SG  1 
ATOM 699   N N   . GLY A 1 105 ? -10.624 9.852   186.245 1.00 186.23 ? 105 GLY 1 N   1 
ATOM 700   C CA  . GLY A 1 105 ? -9.425  9.044   186.047 1.00 183.40 ? 105 GLY 1 CA  1 
ATOM 701   C C   . GLY A 1 105 ? -8.157  9.135   186.872 1.00 181.03 ? 105 GLY 1 C   1 
ATOM 702   O O   . GLY A 1 105 ? -7.689  8.104   187.385 1.00 185.03 ? 105 GLY 1 O   1 
ATOM 703   N N   . ASN A 1 106 ? -7.527  10.311  186.911 1.00 170.24 ? 106 ASN 1 N   1 
ATOM 704   C CA  . ASN A 1 106 ? -6.290  10.491  187.681 1.00 148.62 ? 106 ASN 1 CA  1 
ATOM 705   C C   . ASN A 1 106 ? -6.501  11.342  188.940 1.00 122.72 ? 106 ASN 1 C   1 
ATOM 706   O O   . ASN A 1 106 ? -7.273  12.320  188.974 1.00 107.09 ? 106 ASN 1 O   1 
ATOM 707   C CB  . ASN A 1 106 ? -5.127  11.006  186.813 1.00 160.01 ? 106 ASN 1 CB  1 
ATOM 708   C CG  . ASN A 1 106 ? -5.153  12.497  186.632 1.00 174.86 ? 106 ASN 1 CG  1 
ATOM 709   O OD1 . ASN A 1 106 ? -4.470  13.222  187.350 1.00 181.26 ? 106 ASN 1 OD1 1 
ATOM 710   N ND2 . ASN A 1 106 ? -5.930  12.970  185.659 1.00 180.32 ? 106 ASN 1 ND2 1 
ATOM 711   N N   . ILE A 1 107 ? -5.849  10.880  189.992 1.00 93.06  ? 107 ILE 1 N   1 
ATOM 712   C CA  . ILE A 1 107 ? -5.941  11.480  191.294 1.00 71.86  ? 107 ILE 1 CA  1 
ATOM 713   C C   . ILE A 1 107 ? -5.152  12.734  191.299 1.00 63.68  ? 107 ILE 1 C   1 
ATOM 714   O O   . ILE A 1 107 ? -4.327  12.969  190.406 1.00 65.77  ? 107 ILE 1 O   1 
ATOM 715   C CB  . ILE A 1 107 ? -5.355  10.515  192.357 1.00 77.27  ? 107 ILE 1 CB  1 
ATOM 716   C CG1 . ILE A 1 107 ? -6.166  9.232   192.356 1.00 77.60  ? 107 ILE 1 CG1 1 
ATOM 717   C CG2 . ILE A 1 107 ? -5.372  11.097  193.758 1.00 83.90  ? 107 ILE 1 CG2 1 
ATOM 718   C CD1 . ILE A 1 107 ? -7.588  9.467   191.989 1.00 70.76  ? 107 ILE 1 CD1 1 
ATOM 719   N N   . LEU A 1 108 ? -5.433  13.536  192.315 1.00 49.61  ? 108 LEU 1 N   1 
ATOM 720   C CA  . LEU A 1 108 ? -4.754  14.791  192.561 1.00 44.64  ? 108 LEU 1 CA  1 
ATOM 721   C C   . LEU A 1 108 ? -4.549  14.941  194.038 1.00 38.90  ? 108 LEU 1 C   1 
ATOM 722   O O   . LEU A 1 108 ? -5.472  14.687  194.809 1.00 37.38  ? 108 LEU 1 O   1 
ATOM 723   C CB  . LEU A 1 108 ? -5.606  15.950  192.088 1.00 42.01  ? 108 LEU 1 CB  1 
ATOM 724   C CG  . LEU A 1 108 ? -5.619  16.028  190.574 1.00 52.60  ? 108 LEU 1 CG  1 
ATOM 725   C CD1 . LEU A 1 108 ? -6.444  17.191  190.109 1.00 53.04  ? 108 LEU 1 CD1 1 
ATOM 726   C CD2 . LEU A 1 108 ? -4.192  16.182  190.105 1.00 64.07  ? 108 LEU 1 CD2 1 
ATOM 727   N N   . MET A 1 109 ? -3.353  15.334  194.450 1.00 38.80  ? 109 MET 1 N   1 
ATOM 728   C CA  . MET A 1 109 ? -3.127  15.550  195.862 1.00 42.60  ? 109 MET 1 CA  1 
ATOM 729   C C   . MET A 1 109 ? -2.466  16.920  196.100 1.00 46.82  ? 109 MET 1 C   1 
ATOM 730   O O   . MET A 1 109 ? -1.792  17.504  195.210 1.00 33.40  ? 109 MET 1 O   1 
ATOM 731   C CB  . MET A 1 109 ? -2.322  14.405  196.439 1.00 57.64  ? 109 MET 1 CB  1 
ATOM 732   C CG  . MET A 1 109 ? -2.416  14.204  197.968 1.00 72.64  ? 109 MET 1 CG  1 
ATOM 733   S SD  . MET A 1 109 ? -1.477  12.670  198.388 1.00 74.09  ? 109 MET 1 SD  1 
ATOM 734   C CE  . MET A 1 109 ? -1.268  12.021  196.535 1.00 2.08   ? 109 MET 1 CE  1 
ATOM 735   N N   . TRP A 1 110 ? -2.758  17.472  197.272 1.00 44.19  ? 110 TRP 1 N   1 
ATOM 736   C CA  . TRP A 1 110 ? -2.233  18.770  197.663 1.00 50.16  ? 110 TRP 1 CA  1 
ATOM 737   C C   . TRP A 1 110 ? -0.752  18.678  197.989 1.00 51.02  ? 110 TRP 1 C   1 
ATOM 738   O O   . TRP A 1 110 ? -0.363  18.006  198.975 1.00 38.40  ? 110 TRP 1 O   1 
ATOM 739   C CB  . TRP A 1 110 ? -2.966  19.278  198.910 1.00 68.72  ? 110 TRP 1 CB  1 
ATOM 740   C CG  . TRP A 1 110 ? -4.263  20.002  198.663 1.00 78.96  ? 110 TRP 1 CG  1 
ATOM 741   C CD1 . TRP A 1 110 ? -5.447  19.775  199.284 1.00 74.30  ? 110 TRP 1 CD1 1 
ATOM 742   C CD2 . TRP A 1 110 ? -4.487  21.097  197.766 1.00 84.09  ? 110 TRP 1 CD2 1 
ATOM 743   N NE1 . TRP A 1 110 ? -6.394  20.656  198.840 1.00 79.31  ? 110 TRP 1 NE1 1 
ATOM 744   C CE2 . TRP A 1 110 ? -5.830  21.483  197.908 1.00 71.02  ? 110 TRP 1 CE2 1 
ATOM 745   C CE3 . TRP A 1 110 ? -3.679  21.793  196.865 1.00 88.88  ? 110 TRP 1 CE3 1 
ATOM 746   C CZ2 . TRP A 1 110 ? -6.388  22.520  197.184 1.00 64.01  ? 110 TRP 1 CZ2 1 
ATOM 747   C CZ3 . TRP A 1 110 ? -4.240  22.829  196.144 1.00 89.10  ? 110 TRP 1 CZ3 1 
ATOM 748   C CH2 . TRP A 1 110 ? -5.580  23.185  196.311 1.00 72.70  ? 110 TRP 1 CH2 1 
ATOM 749   N N   . GLU A 1 111 ? 0.058   19.382  197.198 1.00 39.32  ? 111 GLU 1 N   1 
ATOM 750   C CA  . GLU A 1 111 ? 1.495   19.392  197.409 1.00 31.29  ? 111 GLU 1 CA  1 
ATOM 751   C C   . GLU A 1 111 ? 2.007   20.701  197.961 1.00 32.37  ? 111 GLU 1 C   1 
ATOM 752   O O   . GLU A 1 111 ? 1.647   21.778  197.472 1.00 28.43  ? 111 GLU 1 O   1 
ATOM 753   C CB  . GLU A 1 111 ? 2.213   19.127  196.121 1.00 31.55  ? 111 GLU 1 CB  1 
ATOM 754   C CG  . GLU A 1 111 ? 3.724   19.110  196.256 1.00 37.35  ? 111 GLU 1 CG  1 
ATOM 755   C CD  . GLU A 1 111 ? 4.380   18.792  194.933 1.00 56.02  ? 111 GLU 1 CD  1 
ATOM 756   O OE1 . GLU A 1 111 ? 3.650   18.703  193.916 1.00 46.15  ? 111 GLU 1 OE1 1 
ATOM 757   O OE2 . GLU A 1 111 ? 5.617   18.642  194.861 1.00 49.53  ? 111 GLU 1 OE2 1 
ATOM 758   N N   . ALA A 1 112 ? 2.812   20.597  199.011 1.00 32.12  ? 112 ALA 1 N   1 
ATOM 759   C CA  . ALA A 1 112 ? 3.427   21.761  199.644 1.00 33.85  ? 112 ALA 1 CA  1 
ATOM 760   C C   . ALA A 1 112 ? 4.716   21.959  198.902 1.00 33.88  ? 112 ALA 1 C   1 
ATOM 761   O O   . ALA A 1 112 ? 5.588   21.093  198.877 1.00 39.01  ? 112 ALA 1 O   1 
ATOM 762   C CB  . ALA A 1 112 ? 3.716   21.519  201.100 1.00 31.70  ? 112 ALA 1 CB  1 
ATOM 763   N N   . VAL A 1 113 ? 4.891   23.172  198.445 1.00 31.22  ? 113 VAL 1 N   1 
ATOM 764   C CA  . VAL A 1 113 ? 6.021   23.504  197.648 1.00 25.36  ? 113 VAL 1 CA  1 
ATOM 765   C C   . VAL A 1 113 ? 6.993   24.469  198.252 1.00 27.42  ? 113 VAL 1 C   1 
ATOM 766   O O   . VAL A 1 113 ? 8.206   24.347  198.105 1.00 30.84  ? 113 VAL 1 O   1 
ATOM 767   C CB  . VAL A 1 113 ? 5.475   24.094  196.411 1.00 17.08  ? 113 VAL 1 CB  1 
ATOM 768   C CG1 . VAL A 1 113 ? 6.529   24.798  195.646 1.00 32.71  ? 113 VAL 1 CG1 1 
ATOM 769   C CG2 . VAL A 1 113 ? 4.873   22.988  195.624 1.00 28.11  ? 113 VAL 1 CG2 1 
ATOM 770   N N   . THR A 1 114 ? 6.469   25.350  199.058 1.00 22.98  ? 114 THR 1 N   1 
ATOM 771   C CA  . THR A 1 114 ? 7.317   26.362  199.566 1.00 16.31  ? 114 THR 1 CA  1 
ATOM 772   C C   . THR A 1 114 ? 6.834   26.877  200.862 1.00 17.98  ? 114 THR 1 C   1 
ATOM 773   O O   . THR A 1 114 ? 5.635   26.921  201.141 1.00 32.71  ? 114 THR 1 O   1 
ATOM 774   C CB  . THR A 1 114 ? 7.238   27.452  198.552 1.00 14.24  ? 114 THR 1 CB  1 
ATOM 775   O OG1 . THR A 1 114 ? 8.373   27.348  197.718 1.00 17.93  ? 114 THR 1 OG1 1 
ATOM 776   C CG2 . THR A 1 114 ? 7.058   28.834  199.177 1.00 23.66  ? 114 THR 1 CG2 1 
ATOM 777   N N   . VAL A 1 115 ? 7.746   27.338  201.661 1.00 7.67   ? 115 VAL 1 N   1 
ATOM 778   C CA  . VAL A 1 115 ? 7.246   27.881  202.871 1.00 24.28  ? 115 VAL 1 CA  1 
ATOM 779   C C   . VAL A 1 115 ? 8.098   29.031  203.226 1.00 28.41  ? 115 VAL 1 C   1 
ATOM 780   O O   . VAL A 1 115 ? 9.248   29.102  202.816 1.00 24.42  ? 115 VAL 1 O   1 
ATOM 781   C CB  . VAL A 1 115 ? 7.306   26.894  203.998 1.00 23.55  ? 115 VAL 1 CB  1 
ATOM 782   C CG1 . VAL A 1 115 ? 8.716   26.441  204.187 1.00 11.71  ? 115 VAL 1 CG1 1 
ATOM 783   C CG2 . VAL A 1 115 ? 6.782   27.534  205.264 1.00 16.33  ? 115 VAL 1 CG2 1 
ATOM 784   N N   . LYS A 1 116 ? 7.464   29.997  203.859 1.00 25.23  ? 116 LYS 1 N   1 
ATOM 785   C CA  . LYS A 1 116 ? 8.151   31.150  204.375 1.00 22.99  ? 116 LYS 1 CA  1 
ATOM 786   C C   . LYS A 1 116 ? 7.696   31.033  205.822 1.00 29.74  ? 116 LYS 1 C   1 
ATOM 787   O O   . LYS A 1 116 ? 6.517   30.723  206.065 1.00 36.31  ? 116 LYS 1 O   1 
ATOM 788   C CB  . LYS A 1 116 ? 7.603   32.440  203.776 1.00 13.98  ? 116 LYS 1 CB  1 
ATOM 789   C CG  . LYS A 1 116 ? 7.997   32.812  202.314 1.00 45.14  ? 116 LYS 1 CG  1 
ATOM 790   C CD  . LYS A 1 116 ? 7.776   34.360  202.025 1.00 27.44  ? 116 LYS 1 CD  1 
ATOM 791   C CE  . LYS A 1 116 ? 7.759   34.707  200.518 1.00 58.45  ? 116 LYS 1 CE  1 
ATOM 792   N NZ  . LYS A 1 116 ? 7.687   36.181  200.191 1.00 61.35  ? 116 LYS 1 NZ  1 
ATOM 793   N N   . THR A 1 117 ? 8.608   31.180  206.780 1.00 19.31  ? 117 THR 1 N   1 
ATOM 794   C CA  . THR A 1 117 ? 8.227   31.076  208.194 1.00 25.15  ? 117 THR 1 CA  1 
ATOM 795   C C   . THR A 1 117 ? 9.100   32.027  208.966 1.00 31.51  ? 117 THR 1 C   1 
ATOM 796   O O   . THR A 1 117 ? 10.193  32.343  208.498 1.00 31.66  ? 117 THR 1 O   1 
ATOM 797   C CB  . THR A 1 117 ? 8.426   29.654  208.728 1.00 32.40  ? 117 THR 1 CB  1 
ATOM 798   O OG1 . THR A 1 117 ? 9.253   29.664  209.903 1.00 30.56  ? 117 THR 1 OG1 1 
ATOM 799   C CG2 . THR A 1 117 ? 9.090   28.800  207.669 1.00 54.26  ? 117 THR 1 CG2 1 
ATOM 800   N N   . GLU A 1 118 ? 8.680   32.411  210.172 1.00 33.19  ? 118 GLU 1 N   1 
ATOM 801   C CA  . GLU A 1 118 ? 9.466   33.377  210.938 1.00 30.70  ? 118 GLU 1 CA  1 
ATOM 802   C C   . GLU A 1 118 ? 8.991   33.492  212.363 1.00 28.25  ? 118 GLU 1 C   1 
ATOM 803   O O   . GLU A 1 118 ? 7.890   33.051  212.707 1.00 32.95  ? 118 GLU 1 O   1 
ATOM 804   C CB  . GLU A 1 118 ? 9.373   34.722  210.221 1.00 35.45  ? 118 GLU 1 CB  1 
ATOM 805   C CG  . GLU A 1 118 ? 9.738   36.006  210.946 1.00 41.96  ? 118 GLU 1 CG  1 
ATOM 806   C CD  . GLU A 1 118 ? 9.429   37.211  210.051 1.00 41.75  ? 118 GLU 1 CD  1 
ATOM 807   O OE1 . GLU A 1 118 ? 9.962   37.260  208.918 1.00 46.48  ? 118 GLU 1 OE1 1 
ATOM 808   O OE2 . GLU A 1 118 ? 8.600   38.073  210.440 1.00 42.45  ? 118 GLU 1 OE2 1 
ATOM 809   N N   . VAL A 1 119 ? 9.836   34.040  213.213 1.00 10.53  ? 119 VAL 1 N   1 
ATOM 810   C CA  . VAL A 1 119 ? 9.417   34.140  214.567 1.00 15.59  ? 119 VAL 1 CA  1 
ATOM 811   C C   . VAL A 1 119 ? 8.737   35.432  214.835 1.00 29.16  ? 119 VAL 1 C   1 
ATOM 812   O O   . VAL A 1 119 ? 9.305   36.549  214.745 1.00 42.03  ? 119 VAL 1 O   1 
ATOM 813   C CB  . VAL A 1 119 ? 10.540  33.900  215.525 1.00 18.49  ? 119 VAL 1 CB  1 
ATOM 814   C CG1 . VAL A 1 119 ? 10.193  34.424  216.913 1.00 19.21  ? 119 VAL 1 CG1 1 
ATOM 815   C CG2 . VAL A 1 119 ? 10.735  32.450  215.615 1.00 11.89  ? 119 VAL 1 CG2 1 
ATOM 816   N N   . ILE A 1 120 ? 7.503   35.280  215.244 1.00 24.48  ? 120 ILE 1 N   1 
ATOM 817   C CA  . ILE A 1 120 ? 6.752   36.461  215.529 1.00 23.53  ? 120 ILE 1 CA  1 
ATOM 818   C C   . ILE A 1 120 ? 7.095   36.997  216.878 1.00 23.08  ? 120 ILE 1 C   1 
ATOM 819   O O   . ILE A 1 120 ? 7.055   36.260  217.867 1.00 25.06  ? 120 ILE 1 O   1 
ATOM 820   C CB  . ILE A 1 120 ? 5.267   36.207  215.567 1.00 14.95  ? 120 ILE 1 CB  1 
ATOM 821   C CG1 . ILE A 1 120 ? 4.742   35.698  214.226 1.00 2.79   ? 120 ILE 1 CG1 1 
ATOM 822   C CG2 . ILE A 1 120 ? 4.588   37.476  215.905 1.00 17.36  ? 120 ILE 1 CG2 1 
ATOM 823   C CD1 . ILE A 1 120 ? 5.109   34.294  213.948 1.00 33.23  ? 120 ILE 1 CD1 1 
ATOM 824   N N   . GLY A 1 121 ? 7.498   38.253  216.917 1.00 16.33  ? 121 GLY 1 N   1 
ATOM 825   C CA  . GLY A 1 121 ? 7.717   38.848  218.218 1.00 28.05  ? 121 GLY 1 CA  1 
ATOM 826   C C   . GLY A 1 121 ? 9.090   38.888  218.805 1.00 25.40  ? 121 GLY 1 C   1 
ATOM 827   O O   . GLY A 1 121 ? 9.254   39.107  219.997 1.00 27.33  ? 121 GLY 1 O   1 
ATOM 828   N N   . VAL A 1 122 ? 10.096  38.850  217.963 1.00 32.59  ? 122 VAL 1 N   1 
ATOM 829   C CA  . VAL A 1 122 ? 11.421  38.849  218.528 1.00 33.97  ? 122 VAL 1 CA  1 
ATOM 830   C C   . VAL A 1 122 ? 11.765  40.110  219.318 1.00 22.71  ? 122 VAL 1 C   1 
ATOM 831   O O   . VAL A 1 122 ? 12.358  39.997  220.383 1.00 26.95  ? 122 VAL 1 O   1 
ATOM 832   C CB  . VAL A 1 122 ? 12.463  38.539  217.483 1.00 31.73  ? 122 VAL 1 CB  1 
ATOM 833   C CG1 . VAL A 1 122 ? 11.885  37.554  216.431 1.00 21.53  ? 122 VAL 1 CG1 1 
ATOM 834   C CG2 . VAL A 1 122 ? 12.923  39.793  216.873 1.00 19.96  ? 122 VAL 1 CG2 1 
ATOM 835   N N   . THR A 1 123 ? 11.316  41.285  218.872 1.00 21.75  ? 123 THR 1 N   1 
ATOM 836   C CA  . THR A 1 123 ? 11.631  42.552  219.592 1.00 37.51  ? 123 THR 1 CA  1 
ATOM 837   C C   . THR A 1 123 ? 11.207  42.534  221.022 1.00 34.84  ? 123 THR 1 C   1 
ATOM 838   O O   . THR A 1 123 ? 11.665  43.342  221.829 1.00 18.99  ? 123 THR 1 O   1 
ATOM 839   C CB  . THR A 1 123 ? 10.871  43.721  219.084 1.00 30.99  ? 123 THR 1 CB  1 
ATOM 840   O OG1 . THR A 1 123 ? 9.530   43.294  218.801 1.00 44.95  ? 123 THR 1 OG1 1 
ATOM 841   C CG2 . THR A 1 123 ? 11.568  44.317  217.902 1.00 35.55  ? 123 THR 1 CG2 1 
ATOM 842   N N   . ALA A 1 124 ? 10.184  41.730  221.260 1.00 35.60  ? 124 ALA 1 N   1 
ATOM 843   C CA  . ALA A 1 124 ? 9.633   41.563  222.571 1.00 32.15  ? 124 ALA 1 CA  1 
ATOM 844   C C   . ALA A 1 124 ? 10.733  41.467  223.632 1.00 31.47  ? 124 ALA 1 C   1 
ATOM 845   O O   . ALA A 1 124 ? 10.734  42.217  224.605 1.00 26.17  ? 124 ALA 1 O   1 
ATOM 846   C CB  . ALA A 1 124 ? 8.791   40.344  222.580 1.00 31.09  ? 124 ALA 1 CB  1 
ATOM 847   N N   . MET A 1 125 ? 11.736  40.631  223.390 1.00 37.58  ? 125 MET 1 N   1 
ATOM 848   C CA  . MET A 1 125 ? 12.827  40.444  224.353 1.00 31.74  ? 125 MET 1 CA  1 
ATOM 849   C C   . MET A 1 125 ? 13.631  41.719  224.621 1.00 37.57  ? 125 MET 1 C   1 
ATOM 850   O O   . MET A 1 125 ? 14.668  41.691  225.307 1.00 50.36  ? 125 MET 1 O   1 
ATOM 851   C CB  . MET A 1 125 ? 13.731  39.309  223.897 1.00 19.17  ? 125 MET 1 CB  1 
ATOM 852   C CG  . MET A 1 125 ? 12.946  38.088  223.450 1.00 24.55  ? 125 MET 1 CG  1 
ATOM 853   S SD  . MET A 1 125 ? 13.965  36.794  222.734 1.00 43.63  ? 125 MET 1 SD  1 
ATOM 854   C CE  . MET A 1 125 ? 15.664  37.330  223.484 1.00 38.11  ? 125 MET 1 CE  1 
ATOM 855   N N   . LEU A 1 126 ? 13.167  42.829  224.056 1.00 15.40  ? 126 LEU 1 N   1 
ATOM 856   C CA  . LEU A 1 126 ? 13.804  44.100  224.286 1.00 29.90  ? 126 LEU 1 CA  1 
ATOM 857   C C   . LEU A 1 126 ? 13.325  44.739  225.588 1.00 45.69  ? 126 LEU 1 C   1 
ATOM 858   O O   . LEU A 1 126 ? 13.814  45.814  225.956 1.00 59.19  ? 126 LEU 1 O   1 
ATOM 859   C CB  . LEU A 1 126 ? 13.525  45.035  223.131 1.00 29.52  ? 126 LEU 1 CB  1 
ATOM 860   C CG  . LEU A 1 126 ? 14.443  44.865  221.927 1.00 37.28  ? 126 LEU 1 CG  1 
ATOM 861   C CD1 . LEU A 1 126 ? 13.959  45.758  220.785 1.00 35.31  ? 126 LEU 1 CD1 1 
ATOM 862   C CD2 . LEU A 1 126 ? 15.841  45.247  222.347 1.00 10.47  ? 126 LEU 1 CD2 1 
ATOM 863   N N   . ASN A 1 127 ? 12.347  44.115  226.264 1.00 54.06  ? 127 ASN 1 N   1 
ATOM 864   C CA  . ASN A 1 127 ? 11.831  44.625  227.557 1.00 53.99  ? 127 ASN 1 CA  1 
ATOM 865   C C   . ASN A 1 127 ? 12.813  44.204  228.649 1.00 49.89  ? 127 ASN 1 C   1 
ATOM 866   O O   . ASN A 1 127 ? 12.717  43.094  229.188 1.00 42.65  ? 127 ASN 1 O   1 
ATOM 867   C CB  . ASN A 1 127 ? 10.428  44.056  227.901 1.00 62.60  ? 127 ASN 1 CB  1 
ATOM 868   C CG  . ASN A 1 127 ? 9.776   44.726  229.155 1.00 69.02  ? 127 ASN 1 CG  1 
ATOM 869   O OD1 . ASN A 1 127 ? 8.708   45.312  229.056 1.00 81.10  ? 127 ASN 1 OD1 1 
ATOM 870   N ND2 . ASN A 1 127 ? 10.409  44.610  230.323 1.00 53.56  ? 127 ASN 1 ND2 1 
ATOM 871   N N   . LEU A 1 128 ? 13.750  45.085  228.977 1.00 43.13  ? 128 LEU 1 N   1 
ATOM 872   C CA  . LEU A 1 128 ? 14.726  44.769  229.999 1.00 53.34  ? 128 LEU 1 CA  1 
ATOM 873   C C   . LEU A 1 128 ? 14.292  45.371  231.308 1.00 62.01  ? 128 LEU 1 C   1 
ATOM 874   O O   . LEU A 1 128 ? 15.108  45.957  232.032 1.00 67.01  ? 128 LEU 1 O   1 
ATOM 875   C CB  . LEU A 1 128 ? 16.117  45.287  229.627 1.00 57.89  ? 128 LEU 1 CB  1 
ATOM 876   C CG  . LEU A 1 128 ? 16.922  44.609  228.511 1.00 62.00  ? 128 LEU 1 CG  1 
ATOM 877   C CD1 . LEU A 1 128 ? 18.413  44.553  228.908 1.00 61.34  ? 128 LEU 1 CD1 1 
ATOM 878   C CD2 . LEU A 1 128 ? 16.384  43.208  228.219 1.00 64.36  ? 128 LEU 1 CD2 1 
ATOM 879   N N   . HIS A 1 129 ? 13.016  45.180  231.635 1.00 63.12  ? 129 HIS 1 N   1 
ATOM 880   C CA  . HIS A 1 129 ? 12.493  45.745  232.861 1.00 63.80  ? 129 HIS 1 CA  1 
ATOM 881   C C   . HIS A 1 129 ? 11.216  45.133  233.424 1.00 57.74  ? 129 HIS 1 C   1 
ATOM 882   O O   . HIS A 1 129 ? 10.572  45.777  234.220 1.00 77.58  ? 129 HIS 1 O   1 
ATOM 883   C CB  . HIS A 1 129 ? 12.274  47.240  232.665 1.00 57.95  ? 129 HIS 1 CB  1 
ATOM 884   C CG  . HIS A 1 129 ? 11.297  47.530  231.586 1.00 62.24  ? 129 HIS 1 CG  1 
ATOM 885   N ND1 . HIS A 1 129 ? 11.689  47.885  230.316 1.00 72.27  ? 129 HIS 1 ND1 1 
ATOM 886   C CD2 . HIS A 1 129 ? 9.952   47.362  231.534 1.00 53.69  ? 129 HIS 1 CD2 1 
ATOM 887   C CE1 . HIS A 1 129 ? 10.630  47.910  229.527 1.00 73.45  ? 129 HIS 1 CE1 1 
ATOM 888   N NE2 . HIS A 1 129 ? 9.564   47.596  230.241 1.00 38.15  ? 129 HIS 1 NE2 1 
ATOM 889   N N   . SER A 1 130 ? 10.756  43.976  232.976 1.00 60.19  ? 130 SER 1 N   1 
ATOM 890   C CA  . SER A 1 130 ? 9.565   43.448  233.641 1.00 69.74  ? 130 SER 1 CA  1 
ATOM 891   C C   . SER A 1 130 ? 10.139  42.578  234.779 1.00 82.99  ? 130 SER 1 C   1 
ATOM 892   O O   . SER A 1 130 ? 11.043  43.048  235.491 1.00 87.22  ? 130 SER 1 O   1 
ATOM 893   C CB  . SER A 1 130 ? 8.652   42.675  232.694 1.00 68.20  ? 130 SER 1 CB  1 
ATOM 894   O OG  . SER A 1 130 ? 9.233   41.430  232.342 1.00 93.73  ? 130 SER 1 OG  1 
ATOM 895   N N   . GLY A 1 131 ? 9.763   41.295  234.870 1.00 87.59  ? 131 GLY 1 N   1 
ATOM 896   C CA  . GLY A 1 131 ? 10.274  40.424  235.940 1.00 93.31  ? 131 GLY 1 CA  1 
ATOM 897   C C   . GLY A 1 131 ? 11.787  40.238  236.041 1.00 92.92  ? 131 GLY 1 C   1 
ATOM 898   O O   . GLY A 1 131 ? 12.291  39.352  236.744 1.00 101.20 ? 131 GLY 1 O   1 
ATOM 899   N N   . THR A 1 132 ? 12.471  41.073  235.268 1.00 90.38  ? 132 THR 1 N   1 
ATOM 900   C CA  . THR A 1 132 ? 13.908  41.205  235.092 1.00 83.19  ? 132 THR 1 CA  1 
ATOM 901   C C   . THR A 1 132 ? 14.821  41.056  236.283 1.00 73.86  ? 132 THR 1 C   1 
ATOM 902   O O   . THR A 1 132 ? 14.474  41.475  237.382 1.00 72.80  ? 132 THR 1 O   1 
ATOM 903   C CB  . THR A 1 132 ? 14.169  42.637  234.502 1.00 85.57  ? 132 THR 1 CB  1 
ATOM 904   O OG1 . THR A 1 132 ? 14.328  42.568  233.084 1.00 88.34  ? 132 THR 1 OG1 1 
ATOM 905   C CG2 . THR A 1 132 ? 15.365  43.329  235.131 1.00 76.48  ? 132 THR 1 CG2 1 
ATOM 906   N N   . GLN A 1 133 ? 15.978  40.438  236.063 1.00 65.31  ? 133 GLN 1 N   1 
ATOM 907   C CA  . GLN A 1 133 ? 16.983  40.409  237.114 1.00 72.03  ? 133 GLN 1 CA  1 
ATOM 908   C C   . GLN A 1 133 ? 17.996  41.454  236.636 1.00 65.85  ? 133 GLN 1 C   1 
ATOM 909   O O   . GLN A 1 133 ? 18.252  41.570  235.442 1.00 76.16  ? 133 GLN 1 O   1 
ATOM 910   C CB  . GLN A 1 133 ? 17.693  39.074  237.289 1.00 81.33  ? 133 GLN 1 CB  1 
ATOM 911   C CG  . GLN A 1 133 ? 18.962  39.301  238.130 1.00 91.53  ? 133 GLN 1 CG  1 
ATOM 912   C CD  . GLN A 1 133 ? 19.498  38.076  238.797 1.00 97.47  ? 133 GLN 1 CD  1 
ATOM 913   O OE1 . GLN A 1 133 ? 20.702  37.815  238.753 1.00 111.44 ? 133 GLN 1 OE1 1 
ATOM 914   N NE2 . GLN A 1 133 ? 18.627  37.334  239.463 1.00 90.62  ? 133 GLN 1 NE2 1 
ATOM 915   N N   . LYS A 1 134 ? 18.580  42.194  237.560 1.00 60.82  ? 134 LYS 1 N   1 
ATOM 916   C CA  . LYS A 1 134 ? 19.526  43.246  237.237 1.00 65.44  ? 134 LYS 1 CA  1 
ATOM 917   C C   . LYS A 1 134 ? 20.786  42.779  236.557 1.00 76.49  ? 134 LYS 1 C   1 
ATOM 918   O O   . LYS A 1 134 ? 21.369  41.768  236.952 1.00 84.33  ? 134 LYS 1 O   1 
ATOM 919   C CB  . LYS A 1 134 ? 19.936  43.927  238.515 1.00 79.76  ? 134 LYS 1 CB  1 
ATOM 920   C CG  . LYS A 1 134 ? 20.198  45.397  238.403 1.00 105.45 ? 134 LYS 1 CG  1 
ATOM 921   C CD  . LYS A 1 134 ? 20.574  45.926  239.790 1.00 132.74 ? 134 LYS 1 CD  1 
ATOM 922   C CE  . LYS A 1 134 ? 19.675  45.339  240.890 1.00 137.48 ? 134 LYS 1 CE  1 
ATOM 923   N NZ  . LYS A 1 134 ? 20.177  45.573  242.273 1.00 145.97 ? 134 LYS 1 NZ  1 
ATOM 924   N N   . THR A 1 135 ? 21.235  43.564  235.579 1.00 88.25  ? 135 THR 1 N   1 
ATOM 925   C CA  . THR A 1 135 ? 22.469  43.292  234.843 1.00 91.03  ? 135 THR 1 CA  1 
ATOM 926   C C   . THR A 1 135 ? 23.544  43.462  235.915 1.00 90.75  ? 135 THR 1 C   1 
ATOM 927   O O   . THR A 1 135 ? 24.418  42.619  236.099 1.00 83.98  ? 135 THR 1 O   1 
ATOM 928   C CB  . THR A 1 135 ? 22.763  44.391  233.755 1.00 88.32  ? 135 THR 1 CB  1 
ATOM 929   O OG1 . THR A 1 135 ? 21.631  44.590  232.903 1.00 95.92  ? 135 THR 1 OG1 1 
ATOM 930   C CG2 . THR A 1 135 ? 23.965  44.014  232.904 1.00 82.70  ? 135 THR 1 CG2 1 
ATOM 931   N N   . HIS A 1 136 ? 23.416  44.553  236.664 1.00 88.58  ? 136 HIS 1 N   1 
ATOM 932   C CA  . HIS A 1 136 ? 24.370  44.898  237.702 1.00 92.99  ? 136 HIS 1 CA  1 
ATOM 933   C C   . HIS A 1 136 ? 23.922  46.228  238.309 1.00 93.58  ? 136 HIS 1 C   1 
ATOM 934   O O   . HIS A 1 136 ? 22.838  46.708  237.995 1.00 98.03  ? 136 HIS 1 O   1 
ATOM 935   C CB  . HIS A 1 136 ? 25.752  45.077  237.063 1.00 96.51  ? 136 HIS 1 CB  1 
ATOM 936   C CG  . HIS A 1 136 ? 25.837  46.243  236.121 1.00 107.55 ? 136 HIS 1 CG  1 
ATOM 937   N ND1 . HIS A 1 136 ? 25.944  46.092  234.756 1.00 115.70 ? 136 HIS 1 ND1 1 
ATOM 938   C CD2 . HIS A 1 136 ? 25.833  47.580  236.351 1.00 112.48 ? 136 HIS 1 CD2 1 
ATOM 939   C CE1 . HIS A 1 136 ? 26.005  47.284  234.187 1.00 121.92 ? 136 HIS 1 CE1 1 
ATOM 940   N NE2 . HIS A 1 136 ? 25.936  48.202  235.133 1.00 115.13 ? 136 HIS 1 NE2 1 
ATOM 941   N N   . GLU A 1 137 ? 24.812  46.841  239.090 1.00 90.65  ? 137 GLU 1 N   1 
ATOM 942   C CA  . GLU A 1 137 ? 24.630  48.136  239.756 1.00 92.39  ? 137 GLU 1 CA  1 
ATOM 943   C C   . GLU A 1 137 ? 23.334  48.856  239.486 1.00 83.70  ? 137 GLU 1 C   1 
ATOM 944   O O   . GLU A 1 137 ? 22.403  48.813  240.281 1.00 94.22  ? 137 GLU 1 O   1 
ATOM 945   C CB  . GLU A 1 137 ? 25.782  49.092  239.394 1.00 106.04 ? 137 GLU 1 CB  1 
ATOM 946   C CG  . GLU A 1 137 ? 27.163  48.471  239.452 1.00 151.46 ? 137 GLU 1 CG  1 
ATOM 947   C CD  . GLU A 1 137 ? 27.305  47.489  240.613 1.00 178.37 ? 137 GLU 1 CD  1 
ATOM 948   O OE1 . GLU A 1 137 ? 27.121  47.911  241.777 1.00 198.72 ? 137 GLU 1 OE1 1 
ATOM 949   O OE2 . GLU A 1 137 ? 27.558  46.285  240.354 1.00 190.32 ? 137 GLU 1 OE2 1 
ATOM 950   N N   . ASN A 1 138 ? 23.288  49.529  238.351 1.00 75.65  ? 138 ASN 1 N   1 
ATOM 951   C CA  . ASN A 1 138 ? 22.127  50.305  237.954 1.00 73.52  ? 138 ASN 1 CA  1 
ATOM 952   C C   . ASN A 1 138 ? 21.966  49.930  236.498 1.00 63.13  ? 138 ASN 1 C   1 
ATOM 953   O O   . ASN A 1 138 ? 21.651  50.732  235.603 1.00 52.75  ? 138 ASN 1 O   1 
ATOM 954   C CB  . ASN A 1 138 ? 22.477  51.773  238.149 1.00 90.57  ? 138 ASN 1 CB  1 
ATOM 955   C CG  . ASN A 1 138 ? 23.592  51.962  239.178 1.00 94.68  ? 138 ASN 1 CG  1 
ATOM 956   O OD1 . ASN A 1 138 ? 24.758  51.674  238.894 1.00 102.31 ? 138 ASN 1 OD1 1 
ATOM 957   N ND2 . ASN A 1 138 ? 23.229  52.345  240.396 1.00 93.48  ? 138 ASN 1 ND2 1 
ATOM 958   N N   . GLY A 1 139 ? 22.315  48.676  236.285 1.00 61.44  ? 139 GLY 1 N   1 
ATOM 959   C CA  . GLY A 1 139 ? 22.246  48.077  234.988 1.00 60.85  ? 139 GLY 1 CA  1 
ATOM 960   C C   . GLY A 1 139 ? 20.815  47.766  234.679 1.00 54.84  ? 139 GLY 1 C   1 
ATOM 961   O O   . GLY A 1 139 ? 19.940  47.813  235.560 1.00 57.38  ? 139 GLY 1 O   1 
ATOM 962   N N   . ALA A 1 140 ? 20.593  47.412  233.423 1.00 41.24  ? 140 ALA 1 N   1 
ATOM 963   C CA  . ALA A 1 140 ? 19.265  47.099  232.960 1.00 47.59  ? 140 ALA 1 CA  1 
ATOM 964   C C   . ALA A 1 140 ? 18.984  45.691  233.394 1.00 42.41  ? 140 ALA 1 C   1 
ATOM 965   O O   . ALA A 1 140 ? 19.574  45.211  234.348 1.00 53.30  ? 140 ALA 1 O   1 
ATOM 966   C CB  . ALA A 1 140 ? 19.216  47.205  231.464 1.00 53.19  ? 140 ALA 1 CB  1 
ATOM 967   N N   . GLY A 1 141 ? 18.038  45.044  232.741 1.00 37.17  ? 141 GLY 1 N   1 
ATOM 968   C CA  . GLY A 1 141 ? 17.773  43.673  233.090 1.00 52.95  ? 141 GLY 1 CA  1 
ATOM 969   C C   . GLY A 1 141 ? 18.760  42.733  232.424 1.00 51.96  ? 141 GLY 1 C   1 
ATOM 970   O O   . GLY A 1 141 ? 19.601  43.148  231.617 1.00 63.60  ? 141 GLY 1 O   1 
ATOM 971   N N   . LYS A 1 142 ? 18.736  41.478  232.839 1.00 53.40  ? 142 LYS 1 N   1 
ATOM 972   C CA  . LYS A 1 142 ? 19.586  40.497  232.214 1.00 61.60  ? 142 LYS 1 CA  1 
ATOM 973   C C   . LYS A 1 142 ? 18.601  39.933  231.200 1.00 58.26  ? 142 LYS 1 C   1 
ATOM 974   O O   . LYS A 1 142 ? 17.565  39.365  231.568 1.00 59.55  ? 142 LYS 1 O   1 
ATOM 975   C CB  . LYS A 1 142 ? 20.062  39.415  233.192 1.00 74.51  ? 142 LYS 1 CB  1 
ATOM 976   C CG  . LYS A 1 142 ? 20.946  38.346  232.514 1.00 97.63  ? 142 LYS 1 CG  1 
ATOM 977   C CD  . LYS A 1 142 ? 21.555  37.274  233.455 1.00 116.43 ? 142 LYS 1 CD  1 
ATOM 978   C CE  . LYS A 1 142 ? 22.478  36.303  232.665 1.00 131.50 ? 142 LYS 1 CE  1 
ATOM 979   N NZ  . LYS A 1 142 ? 23.209  35.248  233.446 1.00 136.83 ? 142 LYS 1 NZ  1 
ATOM 980   N N   . PRO A 1 143 ? 18.860  40.196  229.911 1.00 57.68  ? 143 PRO 1 N   1 
ATOM 981   C CA  . PRO A 1 143 ? 18.050  39.758  228.767 1.00 49.28  ? 143 PRO 1 CA  1 
ATOM 982   C C   . PRO A 1 143 ? 18.034  38.253  228.580 1.00 45.74  ? 143 PRO 1 C   1 
ATOM 983   O O   . PRO A 1 143 ? 18.968  37.559  228.975 1.00 41.48  ? 143 PRO 1 O   1 
ATOM 984   C CB  . PRO A 1 143 ? 18.732  40.451  227.586 1.00 51.13  ? 143 PRO 1 CB  1 
ATOM 985   C CG  . PRO A 1 143 ? 20.162  40.576  228.034 1.00 46.28  ? 143 PRO 1 CG  1 
ATOM 986   C CD  . PRO A 1 143 ? 20.041  40.969  229.468 1.00 52.24  ? 143 PRO 1 CD  1 
ATOM 987   N N   . ILE A 1 144 ? 16.975  37.743  227.972 1.00 45.33  ? 144 ILE 1 N   1 
ATOM 988   C CA  . ILE A 1 144 ? 16.892  36.308  227.733 1.00 52.38  ? 144 ILE 1 CA  1 
ATOM 989   C C   . ILE A 1 144 ? 18.116  35.850  226.981 1.00 51.36  ? 144 ILE 1 C   1 
ATOM 990   O O   . ILE A 1 144 ? 18.455  36.442  225.970 1.00 64.06  ? 144 ILE 1 O   1 
ATOM 991   C CB  . ILE A 1 144 ? 15.756  35.953  226.802 1.00 52.65  ? 144 ILE 1 CB  1 
ATOM 992   C CG1 . ILE A 1 144 ? 14.425  36.357  227.411 1.00 64.86  ? 144 ILE 1 CG1 1 
ATOM 993   C CG2 . ILE A 1 144 ? 15.827  34.463  226.432 1.00 59.92  ? 144 ILE 1 CG2 1 
ATOM 994   C CD1 . ILE A 1 144 ? 13.251  35.910  226.584 1.00 69.26  ? 144 ILE 1 CD1 1 
ATOM 995   N N   . GLN A 1 145 ? 18.733  34.771  227.439 1.00 48.96  ? 145 GLN 1 N   1 
ATOM 996   C CA  . GLN A 1 145 ? 19.897  34.221  226.773 1.00 40.79  ? 145 GLN 1 CA  1 
ATOM 997   C C   . GLN A 1 145 ? 20.054  32.784  227.190 1.00 45.24  ? 145 GLN 1 C   1 
ATOM 998   O O   . GLN A 1 145 ? 19.174  32.243  227.848 1.00 48.80  ? 145 GLN 1 O   1 
ATOM 999   C CB  . GLN A 1 145 ? 21.157  35.023  227.084 1.00 24.51  ? 145 GLN 1 CB  1 
ATOM 1000  C CG  . GLN A 1 145 ? 21.500  35.158  228.517 1.00 35.56  ? 145 GLN 1 CG  1 
ATOM 1001  C CD  . GLN A 1 145 ? 22.567  36.216  228.728 1.00 66.28  ? 145 GLN 1 CD  1 
ATOM 1002  O OE1 . GLN A 1 145 ? 23.721  35.911  229.039 1.00 93.26  ? 145 GLN 1 OE1 1 
ATOM 1003  N NE2 . GLN A 1 145 ? 22.186  37.475  228.557 1.00 74.45  ? 145 GLN 1 NE2 1 
ATOM 1004  N N   . GLY A 1 146 ? 21.183  32.179  226.839 1.00 49.51  ? 146 GLY 1 N   1 
ATOM 1005  C CA  . GLY A 1 146 ? 21.412  30.783  227.168 1.00 48.74  ? 146 GLY 1 CA  1 
ATOM 1006  C C   . GLY A 1 146 ? 20.780  29.868  226.132 1.00 43.17  ? 146 GLY 1 C   1 
ATOM 1007  O O   . GLY A 1 146 ? 20.145  30.340  225.184 1.00 43.79  ? 146 GLY 1 O   1 
ATOM 1008  N N   . SER A 1 147 ? 20.934  28.564  226.334 1.00 35.54  ? 147 SER 1 N   1 
ATOM 1009  C CA  . SER A 1 147 ? 20.419  27.556  225.415 1.00 37.67  ? 147 SER 1 CA  1 
ATOM 1010  C C   . SER A 1 147 ? 19.170  27.928  224.645 1.00 40.10  ? 147 SER 1 C   1 
ATOM 1011  O O   . SER A 1 147 ? 18.306  28.655  225.131 1.00 51.65  ? 147 SER 1 O   1 
ATOM 1012  C CB  . SER A 1 147 ? 20.183  26.237  226.141 1.00 35.21  ? 147 SER 1 CB  1 
ATOM 1013  O OG  . SER A 1 147 ? 21.404  25.681  226.593 1.00 51.73  ? 147 SER 1 OG  1 
ATOM 1014  N N   . ASN A 1 148 ? 19.084  27.441  223.422 1.00 34.01  ? 148 ASN 1 N   1 
ATOM 1015  C CA  . ASN A 1 148 ? 17.930  27.740  222.623 1.00 34.05  ? 148 ASN 1 CA  1 
ATOM 1016  C C   . ASN A 1 148 ? 17.872  26.746  221.513 1.00 29.84  ? 148 ASN 1 C   1 
ATOM 1017  O O   . ASN A 1 148 ? 18.889  26.125  221.148 1.00 32.78  ? 148 ASN 1 O   1 
ATOM 1018  C CB  . ASN A 1 148 ? 17.949  29.184  222.097 1.00 44.39  ? 148 ASN 1 CB  1 
ATOM 1019  C CG  . ASN A 1 148 ? 19.034  29.434  221.079 1.00 62.14  ? 148 ASN 1 CG  1 
ATOM 1020  O OD1 . ASN A 1 148 ? 19.299  28.599  220.212 1.00 78.97  ? 148 ASN 1 OD1 1 
ATOM 1021  N ND2 . ASN A 1 148 ? 19.629  30.625  221.133 1.00 79.87  ? 148 ASN 1 ND2 1 
ATOM 1022  N N   . PHE A 1 149 ? 16.673  26.574  220.991 1.00 8.49   ? 149 PHE 1 N   1 
ATOM 1023  C CA  . PHE A 1 149 ? 16.476  25.620  219.943 1.00 20.61  ? 149 PHE 1 CA  1 
ATOM 1024  C C   . PHE A 1 149 ? 15.243  26.081  219.256 1.00 32.74  ? 149 PHE 1 C   1 
ATOM 1025  O O   . PHE A 1 149 ? 14.229  26.429  219.896 1.00 27.20  ? 149 PHE 1 O   1 
ATOM 1026  C CB  . PHE A 1 149 ? 16.258  24.250  220.528 1.00 3.11   ? 149 PHE 1 CB  1 
ATOM 1027  C CG  . PHE A 1 149 ? 15.817  23.230  219.541 1.00 14.28  ? 149 PHE 1 CG  1 
ATOM 1028  C CD1 . PHE A 1 149 ? 16.701  22.714  218.612 1.00 38.15  ? 149 PHE 1 CD1 1 
ATOM 1029  C CD2 . PHE A 1 149 ? 14.529  22.715  219.586 1.00 17.11  ? 149 PHE 1 CD2 1 
ATOM 1030  C CE1 . PHE A 1 149 ? 16.293  21.668  217.731 1.00 43.72  ? 149 PHE 1 CE1 1 
ATOM 1031  C CE2 . PHE A 1 149 ? 14.116  21.683  218.721 1.00 23.41  ? 149 PHE 1 CE2 1 
ATOM 1032  C CZ  . PHE A 1 149 ? 14.996  21.157  217.795 1.00 11.12  ? 149 PHE 1 CZ  1 
ATOM 1033  N N   . HIS A 1 150 ? 15.358  26.120  217.940 1.00 34.88  ? 150 HIS 1 N   1 
ATOM 1034  C CA  . HIS A 1 150 ? 14.282  26.579  217.094 1.00 32.82  ? 150 HIS 1 CA  1 
ATOM 1035  C C   . HIS A 1 150 ? 14.192  25.526  216.021 1.00 32.30  ? 150 HIS 1 C   1 
ATOM 1036  O O   . HIS A 1 150 ? 15.210  25.161  215.431 1.00 40.01  ? 150 HIS 1 O   1 
ATOM 1037  C CB  . HIS A 1 150 ? 14.644  27.955  216.513 1.00 28.81  ? 150 HIS 1 CB  1 
ATOM 1038  C CG  . HIS A 1 150 ? 14.877  29.011  217.552 1.00 29.15  ? 150 HIS 1 CG  1 
ATOM 1039  N ND1 . HIS A 1 150 ? 13.846  29.694  218.161 1.00 26.37  ? 150 HIS 1 ND1 1 
ATOM 1040  C CD2 . HIS A 1 150 ? 16.020  29.482  218.113 1.00 48.57  ? 150 HIS 1 CD2 1 
ATOM 1041  C CE1 . HIS A 1 150 ? 14.345  30.536  219.052 1.00 52.33  ? 150 HIS 1 CE1 1 
ATOM 1042  N NE2 . HIS A 1 150 ? 15.666  30.430  219.043 1.00 34.69  ? 150 HIS 1 NE2 1 
ATOM 1043  N N   . PHE A 1 151 ? 12.985  25.069  215.728 1.00 24.33  ? 151 PHE 1 N   1 
ATOM 1044  C CA  . PHE A 1 151 ? 12.829  23.995  214.773 1.00 22.10  ? 151 PHE 1 CA  1 
ATOM 1045  C C   . PHE A 1 151 ? 11.479  24.156  214.158 1.00 22.31  ? 151 PHE 1 C   1 
ATOM 1046  O O   . PHE A 1 151 ? 10.646  24.866  214.696 1.00 33.84  ? 151 PHE 1 O   1 
ATOM 1047  C CB  . PHE A 1 151 ? 12.879  22.648  215.565 1.00 22.59  ? 151 PHE 1 CB  1 
ATOM 1048  C CG  . PHE A 1 151 ? 12.085  21.551  214.939 1.00 22.39  ? 151 PHE 1 CG  1 
ATOM 1049  C CD1 . PHE A 1 151 ? 10.735  21.426  215.199 1.00 37.35  ? 151 PHE 1 CD1 1 
ATOM 1050  C CD2 . PHE A 1 151 ? 12.637  20.755  213.962 1.00 32.78  ? 151 PHE 1 CD2 1 
ATOM 1051  C CE1 . PHE A 1 151 ? 9.947   20.531  214.470 1.00 47.66  ? 151 PHE 1 CE1 1 
ATOM 1052  C CE2 . PHE A 1 151 ? 11.856  19.862  213.233 1.00 30.00  ? 151 PHE 1 CE2 1 
ATOM 1053  C CZ  . PHE A 1 151 ? 10.512  19.753  213.485 1.00 23.05  ? 151 PHE 1 CZ  1 
ATOM 1054  N N   . PHE A 1 152 ? 11.250  23.479  213.048 1.00 14.08  ? 152 PHE 1 N   1 
ATOM 1055  C CA  . PHE A 1 152 ? 9.940   23.490  212.451 1.00 19.34  ? 152 PHE 1 CA  1 
ATOM 1056  C C   . PHE A 1 152 ? 9.965   22.509  211.319 1.00 22.37  ? 152 PHE 1 C   1 
ATOM 1057  O O   . PHE A 1 152 ? 11.024  22.177  210.771 1.00 23.02  ? 152 PHE 1 O   1 
ATOM 1058  C CB  . PHE A 1 152 ? 9.560   24.855  211.931 1.00 25.38  ? 152 PHE 1 CB  1 
ATOM 1059  C CG  . PHE A 1 152 ? 10.111  25.143  210.589 1.00 35.34  ? 152 PHE 1 CG  1 
ATOM 1060  C CD1 . PHE A 1 152 ? 9.434   24.744  209.441 1.00 34.93  ? 152 PHE 1 CD1 1 
ATOM 1061  C CD2 . PHE A 1 152 ? 11.322  25.797  210.462 1.00 30.21  ? 152 PHE 1 CD2 1 
ATOM 1062  C CE1 . PHE A 1 152 ? 9.975   25.006  208.182 1.00 30.38  ? 152 PHE 1 CE1 1 
ATOM 1063  C CE2 . PHE A 1 152 ? 11.871  26.062  209.210 1.00 24.45  ? 152 PHE 1 CE2 1 
ATOM 1064  C CZ  . PHE A 1 152 ? 11.205  25.669  208.068 1.00 2.04   ? 152 PHE 1 CZ  1 
ATOM 1065  N N   . ALA A 1 153 ? 8.790   22.151  210.866 1.00 12.37  ? 153 ALA 1 N   1 
ATOM 1066  C CA  . ALA A 1 153 ? 8.745   21.203  209.818 1.00 18.71  ? 153 ALA 1 CA  1 
ATOM 1067  C C   . ALA A 1 153 ? 7.439   21.399  209.146 1.00 24.34  ? 153 ALA 1 C   1 
ATOM 1068  O O   . ALA A 1 153 ? 6.518   21.973  209.726 1.00 23.35  ? 153 ALA 1 O   1 
ATOM 1069  C CB  . ALA A 1 153 ? 8.826   19.842  210.406 1.00 17.30  ? 153 ALA 1 CB  1 
ATOM 1070  N N   . VAL A 1 154 ? 7.328   20.856  207.953 1.00 6.10   ? 154 VAL 1 N   1 
ATOM 1071  C CA  . VAL A 1 154 ? 6.119   21.006  207.201 1.00 4.31   ? 154 VAL 1 CA  1 
ATOM 1072  C C   . VAL A 1 154 ? 5.998   19.732  206.420 1.00 30.84  ? 154 VAL 1 C   1 
ATOM 1073  O O   . VAL A 1 154 ? 6.940   19.393  205.692 1.00 39.98  ? 154 VAL 1 O   1 
ATOM 1074  C CB  . VAL A 1 154 ? 6.335   22.135  206.205 1.00 8.33   ? 154 VAL 1 CB  1 
ATOM 1075  C CG1 . VAL A 1 154 ? 5.216   22.209  205.154 1.00 2.00   ? 154 VAL 1 CG1 1 
ATOM 1076  C CG2 . VAL A 1 154 ? 6.522   23.443  206.948 1.00 19.28  ? 154 VAL 1 CG2 1 
ATOM 1077  N N   . GLY A 1 155 ? 4.864   19.034  206.523 1.00 38.29  ? 155 GLY 1 N   1 
ATOM 1078  C CA  . GLY A 1 155 ? 4.718   17.794  205.769 1.00 38.31  ? 155 GLY 1 CA  1 
ATOM 1079  C C   . GLY A 1 155 ? 3.306   17.312  205.507 1.00 39.87  ? 155 GLY 1 C   1 
ATOM 1080  O O   . GLY A 1 155 ? 2.364   17.892  206.061 1.00 35.94  ? 155 GLY 1 O   1 
ATOM 1081  N N   . GLY A 1 156 ? 3.182   16.253  204.685 1.00 44.15  ? 156 GLY 1 N   1 
ATOM 1082  C CA  . GLY A 1 156 ? 1.900   15.646  204.307 1.00 42.52  ? 156 GLY 1 CA  1 
ATOM 1083  C C   . GLY A 1 156 ? 1.310   14.541  205.190 1.00 43.93  ? 156 GLY 1 C   1 
ATOM 1084  O O   . GLY A 1 156 ? 0.201   14.029  204.935 1.00 53.73  ? 156 GLY 1 O   1 
ATOM 1085  N N   . GLU A 1 157 ? 2.068   14.170  206.218 1.00 34.27  ? 157 GLU 1 N   1 
ATOM 1086  C CA  . GLU A 1 157 ? 1.708   13.156  207.215 1.00 28.98  ? 157 GLU 1 CA  1 
ATOM 1087  C C   . GLU A 1 157 ? 2.223   13.821  208.434 1.00 29.96  ? 157 GLU 1 C   1 
ATOM 1088  O O   . GLU A 1 157 ? 2.917   14.839  208.341 1.00 41.68  ? 157 GLU 1 O   1 
ATOM 1089  C CB  . GLU A 1 157 ? 2.561   11.905  207.087 1.00 38.62  ? 157 GLU 1 CB  1 
ATOM 1090  C CG  . GLU A 1 157 ? 2.755   11.432  205.678 1.00 51.97  ? 157 GLU 1 CG  1 
ATOM 1091  C CD  . GLU A 1 157 ? 3.448   10.105  205.628 1.00 65.79  ? 157 GLU 1 CD  1 
ATOM 1092  O OE1 . GLU A 1 157 ? 3.301   9.314   206.591 1.00 91.77  ? 157 GLU 1 OE1 1 
ATOM 1093  O OE2 . GLU A 1 157 ? 4.090   9.830   204.601 1.00 70.23  ? 157 GLU 1 OE2 1 
ATOM 1094  N N   . PRO A 1 158 ? 1.984   13.229  209.598 1.00 37.36  ? 158 PRO 1 N   1 
ATOM 1095  C CA  . PRO A 1 158 ? 2.507   13.904  210.795 1.00 39.72  ? 158 PRO 1 CA  1 
ATOM 1096  C C   . PRO A 1 158 ? 3.993   13.662  210.885 1.00 43.96  ? 158 PRO 1 C   1 
ATOM 1097  O O   . PRO A 1 158 ? 4.572   12.857  210.131 1.00 40.73  ? 158 PRO 1 O   1 
ATOM 1098  C CB  . PRO A 1 158 ? 1.777   13.227  211.950 1.00 38.39  ? 158 PRO 1 CB  1 
ATOM 1099  C CG  . PRO A 1 158 ? 0.574   12.560  211.274 1.00 31.43  ? 158 PRO 1 CG  1 
ATOM 1100  C CD  . PRO A 1 158 ? 1.104   12.109  209.944 1.00 30.02  ? 158 PRO 1 CD  1 
ATOM 1101  N N   . LEU A 1 159 ? 4.589   14.320  211.861 1.00 46.61  ? 159 LEU 1 N   1 
ATOM 1102  C CA  . LEU A 1 159 ? 6.022   14.231  212.068 1.00 46.81  ? 159 LEU 1 CA  1 
ATOM 1103  C C   . LEU A 1 159 ? 6.395   12.958  212.796 1.00 50.18  ? 159 LEU 1 C   1 
ATOM 1104  O O   . LEU A 1 159 ? 6.027   12.792  213.960 1.00 63.61  ? 159 LEU 1 O   1 
ATOM 1105  C CB  . LEU A 1 159 ? 6.500   15.418  212.913 1.00 43.41  ? 159 LEU 1 CB  1 
ATOM 1106  C CG  . LEU A 1 159 ? 8.013   15.452  213.133 1.00 36.12  ? 159 LEU 1 CG  1 
ATOM 1107  C CD1 . LEU A 1 159 ? 8.643   15.521  211.771 1.00 31.25  ? 159 LEU 1 CD1 1 
ATOM 1108  C CD2 . LEU A 1 159 ? 8.480   16.621  214.014 1.00 15.77  ? 159 LEU 1 CD2 1 
ATOM 1109  N N   . GLU A 1 160 ? 7.154   12.089  212.136 1.00 44.95  ? 160 GLU 1 N   1 
ATOM 1110  C CA  . GLU A 1 160 ? 7.615   10.828  212.734 1.00 34.51  ? 160 GLU 1 CA  1 
ATOM 1111  C C   . GLU A 1 160 ? 8.821   11.095  213.673 1.00 33.64  ? 160 GLU 1 C   1 
ATOM 1112  O O   . GLU A 1 160 ? 9.763   11.818  213.322 1.00 37.89  ? 160 GLU 1 O   1 
ATOM 1113  C CB  . GLU A 1 160 ? 7.910   9.819   211.612 1.00 9.12   ? 160 GLU 1 CB  1 
ATOM 1114  C CG  . GLU A 1 160 ? 6.685   9.613   210.708 1.00 34.40  ? 160 GLU 1 CG  1 
ATOM 1115  C CD  . GLU A 1 160 ? 6.907   8.742   209.467 1.00 41.22  ? 160 GLU 1 CD  1 
ATOM 1116  O OE1 . GLU A 1 160 ? 6.791   7.499   209.591 1.00 78.45  ? 160 GLU 1 OE1 1 
ATOM 1117  O OE2 . GLU A 1 160 ? 7.124   9.296   208.358 1.00 71.88  ? 160 GLU 1 OE2 1 
ATOM 1118  N N   . LEU A 1 161 ? 8.751   10.601  214.904 1.00 31.89  ? 161 LEU 1 N   1 
ATOM 1119  C CA  . LEU A 1 161 ? 9.828   10.850  215.851 1.00 33.77  ? 161 LEU 1 CA  1 
ATOM 1120  C C   . LEU A 1 161 ? 10.694  9.693   216.209 1.00 35.81  ? 161 LEU 1 C   1 
ATOM 1121  O O   . LEU A 1 161 ? 10.599  8.591   215.642 1.00 36.19  ? 161 LEU 1 O   1 
ATOM 1122  C CB  . LEU A 1 161 ? 9.296   11.448  217.129 1.00 38.79  ? 161 LEU 1 CB  1 
ATOM 1123  C CG  . LEU A 1 161 ? 8.413   12.648  216.848 1.00 44.32  ? 161 LEU 1 CG  1 
ATOM 1124  C CD1 . LEU A 1 161 ? 8.267   13.435  218.140 1.00 31.64  ? 161 LEU 1 CD1 1 
ATOM 1125  C CD2 . LEU A 1 161 ? 9.068   13.500  215.771 1.00 38.24  ? 161 LEU 1 CD2 1 
ATOM 1126  N N   . GLN A 1 162 ? 11.592  10.000  217.126 1.00 30.60  ? 162 GLN 1 N   1 
ATOM 1127  C CA  . GLN A 1 162 ? 12.549  9.056   217.626 1.00 29.14  ? 162 GLN 1 CA  1 
ATOM 1128  C C   . GLN A 1 162 ? 12.917  9.635   218.950 1.00 25.87  ? 162 GLN 1 C   1 
ATOM 1129  O O   . GLN A 1 162 ? 13.275  10.811  219.058 1.00 27.57  ? 162 GLN 1 O   1 
ATOM 1130  C CB  . GLN A 1 162 ? 13.775  8.993   216.741 1.00 26.80  ? 162 GLN 1 CB  1 
ATOM 1131  C CG  . GLN A 1 162 ? 14.957  8.368   217.457 1.00 36.82  ? 162 GLN 1 CG  1 
ATOM 1132  C CD  . GLN A 1 162 ? 14.706  6.940   217.874 1.00 44.01  ? 162 GLN 1 CD  1 
ATOM 1133  O OE1 . GLN A 1 162 ? 14.864  6.599   219.041 1.00 54.08  ? 162 GLN 1 OE1 1 
ATOM 1134  N NE2 . GLN A 1 162 ? 14.281  6.097   216.924 1.00 16.73  ? 162 GLN 1 NE2 1 
ATOM 1135  N N   . GLY A 1 163 ? 12.739  8.822   219.971 1.00 26.21  ? 163 GLY 1 N   1 
ATOM 1136  C CA  . GLY A 1 163 ? 13.007  9.296   221.300 1.00 29.52  ? 163 GLY 1 CA  1 
ATOM 1137  C C   . GLY A 1 163 ? 14.456  9.091   221.559 1.00 27.93  ? 163 GLY 1 C   1 
ATOM 1138  O O   . GLY A 1 163 ? 15.090  8.335   220.833 1.00 30.64  ? 163 GLY 1 O   1 
ATOM 1139  N N   . VAL A 1 164 ? 14.948  9.773   222.586 1.00 11.90  ? 164 VAL 1 N   1 
ATOM 1140  C CA  . VAL A 1 164 ? 16.321  9.700   223.039 1.00 26.54  ? 164 VAL 1 CA  1 
ATOM 1141  C C   . VAL A 1 164 ? 16.376  10.648  224.216 1.00 35.97  ? 164 VAL 1 C   1 
ATOM 1142  O O   . VAL A 1 164 ? 15.700  11.681  224.180 1.00 48.01  ? 164 VAL 1 O   1 
ATOM 1143  C CB  . VAL A 1 164 ? 17.299  10.259  221.991 1.00 23.07  ? 164 VAL 1 CB  1 
ATOM 1144  C CG1 . VAL A 1 164 ? 18.621  10.697  222.668 1.00 36.23  ? 164 VAL 1 CG1 1 
ATOM 1145  C CG2 . VAL A 1 164 ? 17.612  9.215   220.965 1.00 42.68  ? 164 VAL 1 CG2 1 
ATOM 1146  N N   . LEU A 1 165 ? 17.171  10.335  225.241 1.00 35.48  ? 165 LEU 1 N   1 
ATOM 1147  C CA  . LEU A 1 165 ? 17.286  11.248  226.369 1.00 40.70  ? 165 LEU 1 CA  1 
ATOM 1148  C C   . LEU A 1 165 ? 18.426  10.991  227.305 1.00 47.10  ? 165 LEU 1 C   1 
ATOM 1149  O O   . LEU A 1 165 ? 18.968  9.889   227.359 1.00 50.09  ? 165 LEU 1 O   1 
ATOM 1150  C CB  . LEU A 1 165 ? 16.011  11.265  227.184 1.00 54.84  ? 165 LEU 1 CB  1 
ATOM 1151  C CG  . LEU A 1 165 ? 15.584  9.962   227.851 1.00 60.32  ? 165 LEU 1 CG  1 
ATOM 1152  C CD1 . LEU A 1 165 ? 15.247  10.339  229.282 1.00 71.53  ? 165 LEU 1 CD1 1 
ATOM 1153  C CD2 . LEU A 1 165 ? 14.378  9.271   227.130 1.00 35.01  ? 165 LEU 1 CD2 1 
ATOM 1154  N N   . ALA A 1 166 ? 18.818  12.034  228.023 1.00 45.20  ? 166 ALA 1 N   1 
ATOM 1155  C CA  . ALA A 1 166 ? 19.875  11.862  228.997 1.00 67.33  ? 166 ALA 1 CA  1 
ATOM 1156  C C   . ALA A 1 166 ? 19.050  11.422  230.166 1.00 80.04  ? 166 ALA 1 C   1 
ATOM 1157  O O   . ALA A 1 166 ? 17.898  11.846  230.290 1.00 97.75  ? 166 ALA 1 O   1 
ATOM 1158  C CB  . ALA A 1 166 ? 20.561  13.173  229.324 1.00 71.65  ? 166 ALA 1 CB  1 
ATOM 1159  N N   . ASN A 1 167 ? 19.593  10.506  230.961 1.00 87.60  ? 167 ASN 1 N   1 
ATOM 1160  C CA  . ASN A 1 167 ? 18.914  10.010  232.160 1.00 76.47  ? 167 ASN 1 CA  1 
ATOM 1161  C C   . ASN A 1 167 ? 17.598  9.299   231.889 1.00 59.39  ? 167 ASN 1 C   1 
ATOM 1162  O O   . ASN A 1 167 ? 16.550  9.804   232.240 1.00 46.02  ? 167 ASN 1 O   1 
ATOM 1163  C CB  . ASN A 1 167 ? 18.676  11.179  233.125 1.00 75.62  ? 167 ASN 1 CB  1 
ATOM 1164  C CG  . ASN A 1 167 ? 18.003  10.752  234.376 1.00 78.40  ? 167 ASN 1 CG  1 
ATOM 1165  O OD1 . ASN A 1 167 ? 18.078  9.579   234.756 1.00 80.97  ? 167 ASN 1 OD1 1 
ATOM 1166  N ND2 . ASN A 1 167 ? 17.322  11.682  235.028 1.00 86.95  ? 167 ASN 1 ND2 1 
ATOM 1167  N N   . TYR A 1 168 ? 17.643  8.111   231.302 1.00 58.46  ? 168 TYR 1 N   1 
ATOM 1168  C CA  . TYR A 1 168 ? 16.400  7.390   231.017 1.00 71.48  ? 168 TYR 1 CA  1 
ATOM 1169  C C   . TYR A 1 168 ? 15.661  7.124   232.336 1.00 78.03  ? 168 TYR 1 C   1 
ATOM 1170  O O   . TYR A 1 168 ? 14.459  6.848   232.367 1.00 78.74  ? 168 TYR 1 O   1 
ATOM 1171  C CB  . TYR A 1 168 ? 16.692  6.086   230.282 1.00 66.65  ? 168 TYR 1 CB  1 
ATOM 1172  C CG  . TYR A 1 168 ? 17.446  5.120   231.137 1.00 81.90  ? 168 TYR 1 CG  1 
ATOM 1173  C CD1 . TYR A 1 168 ? 18.742  5.394   231.555 1.00 88.39  ? 168 TYR 1 CD1 1 
ATOM 1174  C CD2 . TYR A 1 168 ? 16.843  3.964   231.589 1.00 81.76  ? 168 TYR 1 CD2 1 
ATOM 1175  C CE1 . TYR A 1 168 ? 19.404  4.538   232.411 1.00 95.38  ? 168 TYR 1 CE1 1 
ATOM 1176  C CE2 . TYR A 1 168 ? 17.493  3.098   232.437 1.00 93.45  ? 168 TYR 1 CE2 1 
ATOM 1177  C CZ  . TYR A 1 168 ? 18.769  3.388   232.853 1.00 97.47  ? 168 TYR 1 CZ  1 
ATOM 1178  O OH  . TYR A 1 168 ? 19.382  2.546   233.752 1.00 110.45 ? 168 TYR 1 OH  1 
ATOM 1179  N N   . ARG A 1 169 ? 16.388  7.289   233.432 1.00 84.21  ? 169 ARG 1 N   1 
ATOM 1180  C CA  . ARG A 1 169 ? 15.841  7.096   234.762 1.00 89.04  ? 169 ARG 1 CA  1 
ATOM 1181  C C   . ARG A 1 169 ? 15.026  8.330   235.206 1.00 85.21  ? 169 ARG 1 C   1 
ATOM 1182  O O   . ARG A 1 169 ? 14.905  8.657   236.394 1.00 76.49  ? 169 ARG 1 O   1 
ATOM 1183  C CB  . ARG A 1 169 ? 16.989  6.760   235.728 1.00 102.01 ? 169 ARG 1 CB  1 
ATOM 1184  C CG  . ARG A 1 169 ? 17.644  5.392   235.449 1.00 101.72 ? 169 ARG 1 CG  1 
ATOM 1185  C CD  . ARG A 1 169 ? 19.153  5.423   235.608 1.00 110.48 ? 169 ARG 1 CD  1 
ATOM 1186  N NE  . ARG A 1 169 ? 19.597  5.623   236.986 1.00 135.29 ? 169 ARG 1 NE  1 
ATOM 1187  C CZ  . ARG A 1 169 ? 20.713  6.272   237.330 1.00 152.12 ? 169 ARG 1 CZ  1 
ATOM 1188  N NH1 . ARG A 1 169 ? 21.501  6.801   236.396 1.00 161.46 ? 169 ARG 1 NH1 1 
ATOM 1189  N NH2 . ARG A 1 169 ? 21.063  6.369   238.609 1.00 165.42 ? 169 ARG 1 NH2 1 
ATOM 1190  N N   . THR A 1 170 ? 14.483  9.038   234.231 1.00 83.20  ? 170 THR 1 N   1 
ATOM 1191  C CA  . THR A 1 170 ? 13.675  10.183  234.546 1.00 76.88  ? 170 THR 1 CA  1 
ATOM 1192  C C   . THR A 1 170 ? 12.260  9.672   234.506 1.00 79.52  ? 170 THR 1 C   1 
ATOM 1193  O O   . THR A 1 170 ? 11.878  8.889   233.615 1.00 70.84  ? 170 THR 1 O   1 
ATOM 1194  C CB  . THR A 1 170 ? 13.830  11.323  233.532 1.00 73.25  ? 170 THR 1 CB  1 
ATOM 1195  O OG1 . THR A 1 170 ? 15.174  11.814  233.558 1.00 85.24  ? 170 THR 1 OG1 1 
ATOM 1196  C CG2 . THR A 1 170 ? 12.916  12.462  233.894 1.00 78.52  ? 170 THR 1 CG2 1 
ATOM 1197  N N   . LYS A 1 171 ? 11.579  9.960   235.605 1.00 86.80  ? 171 LYS 1 N   1 
ATOM 1198  C CA  . LYS A 1 171 ? 10.177  9.646   235.839 1.00 91.05  ? 171 LYS 1 CA  1 
ATOM 1199  C C   . LYS A 1 171 ? 9.436   10.781  235.132 1.00 82.56  ? 171 LYS 1 C   1 
ATOM 1200  O O   . LYS A 1 171 ? 9.536   11.950  235.537 1.00 64.26  ? 171 LYS 1 O   1 
ATOM 1201  C CB  . LYS A 1 171 ? 9.914   9.698   237.345 1.00 111.17 ? 171 LYS 1 CB  1 
ATOM 1202  C CG  . LYS A 1 171 ? 11.014  9.058   238.216 1.00 129.25 ? 171 LYS 1 CG  1 
ATOM 1203  C CD  . LYS A 1 171 ? 10.801  9.373   239.704 1.00 146.88 ? 171 LYS 1 CD  1 
ATOM 1204  C CE  . LYS A 1 171 ? 11.648  8.489   240.633 1.00 154.57 ? 171 LYS 1 CE  1 
ATOM 1205  N NZ  . LYS A 1 171 ? 11.407  8.769   242.095 1.00 159.33 ? 171 LYS 1 NZ  1 
ATOM 1206  N N   . TYR A 1 172 ? 8.703   10.450  234.074 1.00 79.32  ? 172 TYR 1 N   1 
ATOM 1207  C CA  . TYR A 1 172 ? 8.042   11.498  233.296 1.00 88.62  ? 172 TYR 1 CA  1 
ATOM 1208  C C   . TYR A 1 172 ? 6.609   11.918  233.560 1.00 85.78  ? 172 TYR 1 C   1 
ATOM 1209  O O   . TYR A 1 172 ? 5.665   11.189  233.237 1.00 90.79  ? 172 TYR 1 O   1 
ATOM 1210  C CB  . TYR A 1 172 ? 8.266   11.287  231.779 1.00 86.95  ? 172 TYR 1 CB  1 
ATOM 1211  C CG  . TYR A 1 172 ? 9.532   11.963  231.243 1.00 76.07  ? 172 TYR 1 CG  1 
ATOM 1212  C CD1 . TYR A 1 172 ? 9.839   13.278  231.589 1.00 78.01  ? 172 TYR 1 CD1 1 
ATOM 1213  C CD2 . TYR A 1 172 ? 10.447  11.271  230.453 1.00 73.91  ? 172 TYR 1 CD2 1 
ATOM 1214  C CE1 . TYR A 1 172 ? 11.028  13.890  231.177 1.00 83.05  ? 172 TYR 1 CE1 1 
ATOM 1215  C CE2 . TYR A 1 172 ? 11.647  11.883  230.034 1.00 87.83  ? 172 TYR 1 CE2 1 
ATOM 1216  C CZ  . TYR A 1 172 ? 11.930  13.195  230.404 1.00 82.14  ? 172 TYR 1 CZ  1 
ATOM 1217  O OH  . TYR A 1 172 ? 13.108  13.818  230.032 1.00 84.55  ? 172 TYR 1 OH  1 
ATOM 1218  N N   . PRO A 1 173 ? 6.435   13.138  234.106 1.00 87.31  ? 173 PRO 1 N   1 
ATOM 1219  C CA  . PRO A 1 173 ? 5.149   13.743  234.432 1.00 85.71  ? 173 PRO 1 CA  1 
ATOM 1220  C C   . PRO A 1 173 ? 3.964   13.377  233.546 1.00 79.18  ? 173 PRO 1 C   1 
ATOM 1221  O O   . PRO A 1 173 ? 4.050   13.245  232.336 1.00 68.20  ? 173 PRO 1 O   1 
ATOM 1222  C CB  . PRO A 1 173 ? 5.453   15.261  234.422 1.00 85.87  ? 173 PRO 1 CB  1 
ATOM 1223  C CG  . PRO A 1 173 ? 6.949   15.359  234.119 1.00 89.29  ? 173 PRO 1 CG  1 
ATOM 1224  C CD  . PRO A 1 173 ? 7.505   14.034  234.563 1.00 85.89  ? 173 PRO 1 CD  1 
ATOM 1225  N N   . ALA A 1 174 ? 2.859   13.205  234.243 1.00 86.48  ? 174 ALA 1 N   1 
ATOM 1226  C CA  . ALA A 1 174 ? 1.551   12.852  233.748 1.00 89.83  ? 174 ALA 1 CA  1 
ATOM 1227  C C   . ALA A 1 174 ? 1.148   12.814  232.278 1.00 90.09  ? 174 ALA 1 C   1 
ATOM 1228  O O   . ALA A 1 174 ? 1.123   11.760  231.636 1.00 88.49  ? 174 ALA 1 O   1 
ATOM 1229  C CB  . ALA A 1 174 ? 0.541   13.681  234.515 1.00 107.69 ? 174 ALA 1 CB  1 
ATOM 1230  N N   . GLN A 1 175 ? 0.688   13.969  231.822 1.00 90.15  ? 175 GLN 1 N   1 
ATOM 1231  C CA  . GLN A 1 175 ? 0.147   14.164  230.480 1.00 101.78 ? 175 GLN 1 CA  1 
ATOM 1232  C C   . GLN A 1 175 ? 1.099   13.974  229.301 1.00 93.85  ? 175 GLN 1 C   1 
ATOM 1233  O O   . GLN A 1 175 ? 0.684   13.627  228.186 1.00 97.08  ? 175 GLN 1 O   1 
ATOM 1234  C CB  . GLN A 1 175 ? -0.474  15.562  230.412 1.00 127.30 ? 175 GLN 1 CB  1 
ATOM 1235  C CG  . GLN A 1 175 ? -0.899  16.159  231.785 1.00 163.31 ? 175 GLN 1 CG  1 
ATOM 1236  C CD  . GLN A 1 175 ? -2.354  15.873  232.183 1.00 182.51 ? 175 GLN 1 CD  1 
ATOM 1237  O OE1 . GLN A 1 175 ? -2.993  16.686  232.863 1.00 193.22 ? 175 GLN 1 OE1 1 
ATOM 1238  N NE2 . GLN A 1 175 ? -2.873  14.717  231.772 1.00 194.80 ? 175 GLN 1 NE2 1 
ATOM 1239  N N   . THR A 1 176 ? 2.367   14.244  229.561 1.00 78.85  ? 176 THR 1 N   1 
ATOM 1240  C CA  . THR A 1 176 ? 3.413   14.154  228.570 1.00 52.40  ? 176 THR 1 CA  1 
ATOM 1241  C C   . THR A 1 176 ? 3.535   12.787  227.956 1.00 44.95  ? 176 THR 1 C   1 
ATOM 1242  O O   . THR A 1 176 ? 3.529   11.752  228.630 1.00 48.29  ? 176 THR 1 O   1 
ATOM 1243  C CB  . THR A 1 176 ? 4.763   14.444  229.204 1.00 57.59  ? 176 THR 1 CB  1 
ATOM 1244  O OG1 . THR A 1 176 ? 5.139   13.348  230.051 1.00 77.64  ? 176 THR 1 OG1 1 
ATOM 1245  C CG2 . THR A 1 176 ? 4.682   15.678  230.066 1.00 62.33  ? 176 THR 1 CG2 1 
ATOM 1246  N N   . VAL A 1 177 ? 3.732   12.786  226.661 1.00 46.15  ? 177 VAL 1 N   1 
ATOM 1247  C CA  . VAL A 1 177 ? 3.938   11.540  225.978 1.00 52.74  ? 177 VAL 1 CA  1 
ATOM 1248  C C   . VAL A 1 177 ? 5.448   11.404  225.913 1.00 55.77  ? 177 VAL 1 C   1 
ATOM 1249  O O   . VAL A 1 177 ? 6.119   12.179  225.224 1.00 57.44  ? 177 VAL 1 O   1 
ATOM 1250  C CB  . VAL A 1 177 ? 3.405   11.594  224.565 1.00 52.38  ? 177 VAL 1 CB  1 
ATOM 1251  C CG1 . VAL A 1 177 ? 3.703   10.289  223.856 1.00 42.33  ? 177 VAL 1 CG1 1 
ATOM 1252  C CG2 . VAL A 1 177 ? 1.931   11.857  224.605 1.00 65.93  ? 177 VAL 1 CG2 1 
ATOM 1253  N N   . THR A 1 178 ? 5.999   10.511  226.720 1.00 56.10  ? 178 THR 1 N   1 
ATOM 1254  C CA  . THR A 1 178 ? 7.436   10.314  226.683 1.00 54.07  ? 178 THR 1 CA  1 
ATOM 1255  C C   . THR A 1 178 ? 7.676   8.946   226.104 1.00 64.44  ? 178 THR 1 C   1 
ATOM 1256  O O   . THR A 1 178 ? 6.718   8.219   225.805 1.00 58.18  ? 178 THR 1 O   1 
ATOM 1257  C CB  . THR A 1 178 ? 8.082   10.405  228.055 1.00 47.16  ? 178 THR 1 CB  1 
ATOM 1258  O OG1 . THR A 1 178 ? 7.692   9.282   228.855 1.00 65.10  ? 178 THR 1 OG1 1 
ATOM 1259  C CG2 . THR A 1 178 ? 7.699   11.712  228.706 1.00 10.93  ? 178 THR 1 CG2 1 
ATOM 1260  N N   . PRO A 1 179 ? 8.952   8.607   225.847 1.00 76.97  ? 179 PRO 1 N   1 
ATOM 1261  C CA  . PRO A 1 179 ? 9.216   7.286   225.285 1.00 78.83  ? 179 PRO 1 CA  1 
ATOM 1262  C C   . PRO A 1 179 ? 9.042   6.224   226.369 1.00 84.68  ? 179 PRO 1 C   1 
ATOM 1263  O O   . PRO A 1 179 ? 9.205   6.486   227.591 1.00 59.87  ? 179 PRO 1 O   1 
ATOM 1264  C CB  . PRO A 1 179 ? 10.656  7.412   224.793 1.00 75.80  ? 179 PRO 1 CB  1 
ATOM 1265  C CG  . PRO A 1 179 ? 11.266  8.348   225.810 1.00 75.27  ? 179 PRO 1 CG  1 
ATOM 1266  C CD  . PRO A 1 179 ? 10.197  9.394   225.965 1.00 76.73  ? 179 PRO 1 CD  1 
ATOM 1267  N N   . LYS A 1 180 ? 8.721   5.024   225.896 1.00 94.09  ? 180 LYS 1 N   1 
ATOM 1268  C CA  . LYS A 1 180 ? 8.478   3.878   226.765 1.00 111.17 ? 180 LYS 1 CA  1 
ATOM 1269  C C   . LYS A 1 180 ? 9.639   2.947   227.037 1.00 110.09 ? 180 LYS 1 C   1 
ATOM 1270  O O   . LYS A 1 180 ? 10.556  2.852   226.237 1.00 127.49 ? 180 LYS 1 O   1 
ATOM 1271  C CB  . LYS A 1 180 ? 7.339   3.056   226.191 1.00 126.90 ? 180 LYS 1 CB  1 
ATOM 1272  C CG  . LYS A 1 180 ? 5.980   3.577   226.602 1.00 158.37 ? 180 LYS 1 CG  1 
ATOM 1273  C CD  . LYS A 1 180 ? 5.824   3.575   228.133 1.00 177.28 ? 180 LYS 1 CD  1 
ATOM 1274  C CE  . LYS A 1 180 ? 4.436   4.073   228.552 1.00 189.40 ? 180 LYS 1 CE  1 
ATOM 1275  N NZ  . LYS A 1 180 ? 4.192   3.989   230.023 1.00 196.49 ? 180 LYS 1 NZ  1 
ATOM 1276  N N   . ASN A 1 181 ? 9.563   2.217   228.147 1.00 102.31 ? 181 ASN 1 N   1 
ATOM 1277  C CA  . ASN A 1 181 ? 10.602  1.255   228.506 1.00 99.71  ? 181 ASN 1 CA  1 
ATOM 1278  C C   . ASN A 1 181 ? 11.977  1.899   228.565 1.00 85.57  ? 181 ASN 1 C   1 
ATOM 1279  O O   . ASN A 1 181 ? 12.894  1.492   227.857 1.00 62.18  ? 181 ASN 1 O   1 
ATOM 1280  C CB  . ASN A 1 181 ? 10.663  0.104   227.486 1.00 119.10 ? 181 ASN 1 CB  1 
ATOM 1281  C CG  . ASN A 1 181 ? 9.325   -0.566  227.262 1.00 134.54 ? 181 ASN 1 CG  1 
ATOM 1282  O OD1 . ASN A 1 181 ? 9.037   -1.042  226.158 1.00 142.64 ? 181 ASN 1 OD1 1 
ATOM 1283  N ND2 . ASN A 1 181 ? 8.501   -0.622  228.307 1.00 142.79 ? 181 ASN 1 ND2 1 
ATOM 1284  N N   . ALA A 1 182 ? 12.129  2.904   229.408 1.00 84.82  ? 182 ALA 1 N   1 
ATOM 1285  C CA  . ALA A 1 182 ? 13.416  3.576   229.531 1.00 90.49  ? 182 ALA 1 CA  1 
ATOM 1286  C C   . ALA A 1 182 ? 14.572  2.633   229.885 1.00 90.41  ? 182 ALA 1 C   1 
ATOM 1287  O O   . ALA A 1 182 ? 14.719  2.257   231.044 1.00 104.84 ? 182 ALA 1 O   1 
ATOM 1288  C CB  . ALA A 1 182 ? 13.322  4.691   230.571 1.00 87.63  ? 182 ALA 1 CB  1 
ATOM 1289  N N   . THR A 1 183 ? 15.355  2.207   228.895 1.00 83.08  ? 183 THR 1 N   1 
ATOM 1290  C CA  . THR A 1 183 ? 16.513  1.354   229.162 1.00 68.25  ? 183 THR 1 CA  1 
ATOM 1291  C C   . THR A 1 183 ? 17.693  2.313   229.107 1.00 61.62  ? 183 THR 1 C   1 
ATOM 1292  O O   . THR A 1 183 ? 17.505  3.500   228.837 1.00 61.96  ? 183 THR 1 O   1 
ATOM 1293  C CB  . THR A 1 183 ? 16.710  0.272   228.088 1.00 62.00  ? 183 THR 1 CB  1 
ATOM 1294  O OG1 . THR A 1 183 ? 17.543  0.781   227.047 1.00 65.07  ? 183 THR 1 OG1 1 
ATOM 1295  C CG2 . THR A 1 183 ? 15.380  -0.157  227.492 1.00 53.34  ? 183 THR 1 CG2 1 
ATOM 1296  N N   . VAL A 1 184 ? 18.907  1.828   229.326 1.00 63.71  ? 184 VAL 1 N   1 
ATOM 1297  C CA  . VAL A 1 184 ? 20.053  2.738   229.260 1.00 63.02  ? 184 VAL 1 CA  1 
ATOM 1298  C C   . VAL A 1 184 ? 20.258  3.228   227.844 1.00 56.45  ? 184 VAL 1 C   1 
ATOM 1299  O O   . VAL A 1 184 ? 20.669  4.370   227.627 1.00 55.58  ? 184 VAL 1 O   1 
ATOM 1300  C CB  . VAL A 1 184 ? 21.342  2.090   229.667 1.00 63.29  ? 184 VAL 1 CB  1 
ATOM 1301  C CG1 . VAL A 1 184 ? 22.339  3.182   230.029 1.00 35.32  ? 184 VAL 1 CG1 1 
ATOM 1302  C CG2 . VAL A 1 184 ? 21.088  1.096   230.795 1.00 83.15  ? 184 VAL 1 CG2 1 
ATOM 1303  N N   . ASP A 1 185 ? 19.972  2.343   226.894 1.00 39.46  ? 185 ASP 1 N   1 
ATOM 1304  C CA  . ASP A 1 185 ? 20.088  2.633   225.470 1.00 52.13  ? 185 ASP 1 CA  1 
ATOM 1305  C C   . ASP A 1 185 ? 19.301  3.849   225.021 1.00 48.12  ? 185 ASP 1 C   1 
ATOM 1306  O O   . ASP A 1 185 ? 19.586  4.448   224.001 1.00 45.24  ? 185 ASP 1 O   1 
ATOM 1307  C CB  . ASP A 1 185 ? 19.651  1.423   224.661 1.00 64.12  ? 185 ASP 1 CB  1 
ATOM 1308  C CG  . ASP A 1 185 ? 20.516  0.220   224.927 1.00 77.89  ? 185 ASP 1 CG  1 
ATOM 1309  O OD1 . ASP A 1 185 ? 20.902  0.027   226.108 1.00 80.84  ? 185 ASP 1 OD1 1 
ATOM 1310  O OD2 . ASP A 1 185 ? 20.855  -0.508  223.964 1.00 92.10  ? 185 ASP 1 OD2 1 
ATOM 1311  N N   . SER A 1 186 ? 18.281  4.194   225.780 1.00 62.15  ? 186 SER 1 N   1 
ATOM 1312  C CA  . SER A 1 186 ? 17.490  5.359   225.465 1.00 66.89  ? 186 SER 1 CA  1 
ATOM 1313  C C   . SER A 1 186 ? 18.391  6.579   225.626 1.00 59.00  ? 186 SER 1 C   1 
ATOM 1314  O O   . SER A 1 186 ? 18.137  7.626   225.031 1.00 57.37  ? 186 SER 1 O   1 
ATOM 1315  C CB  . SER A 1 186 ? 16.297  5.422   226.404 1.00 76.51  ? 186 SER 1 CB  1 
ATOM 1316  O OG  . SER A 1 186 ? 15.499  4.256   226.261 1.00 67.10  ? 186 SER 1 OG  1 
ATOM 1317  N N   . GLN A 1 187 ? 19.416  6.451   226.465 1.00 46.12  ? 187 GLN 1 N   1 
ATOM 1318  C CA  . GLN A 1 187 ? 20.373  7.528   226.649 1.00 48.77  ? 187 GLN 1 CA  1 
ATOM 1319  C C   . GLN A 1 187 ? 21.112  7.768   225.308 1.00 49.40  ? 187 GLN 1 C   1 
ATOM 1320  O O   . GLN A 1 187 ? 21.680  8.864   225.083 1.00 47.41  ? 187 GLN 1 O   1 
ATOM 1321  C CB  . GLN A 1 187 ? 21.345  7.194   227.776 1.00 44.97  ? 187 GLN 1 CB  1 
ATOM 1322  C CG  . GLN A 1 187 ? 20.720  7.207   229.134 1.00 49.69  ? 187 GLN 1 CG  1 
ATOM 1323  C CD  . GLN A 1 187 ? 21.516  8.047   230.133 1.00 72.78  ? 187 GLN 1 CD  1 
ATOM 1324  O OE1 . GLN A 1 187 ? 22.005  9.135   229.806 1.00 96.46  ? 187 GLN 1 OE1 1 
ATOM 1325  N NE2 . GLN A 1 187 ? 21.612  7.568   231.368 1.00 80.55  ? 187 GLN 1 NE2 1 
ATOM 1326  N N   . GLN A 1 188 ? 21.083  6.740   224.442 1.00 25.46  ? 188 GLN 1 N   1 
ATOM 1327  C CA  . GLN A 1 188 ? 21.663  6.786   223.105 1.00 19.65  ? 188 GLN 1 CA  1 
ATOM 1328  C C   . GLN A 1 188 ? 20.621  6.249   222.110 1.00 26.76  ? 188 GLN 1 C   1 
ATOM 1329  O O   . GLN A 1 188 ? 19.410  6.371   222.359 1.00 44.78  ? 188 GLN 1 O   1 
ATOM 1330  C CB  . GLN A 1 188 ? 22.939  5.980   223.021 1.00 37.97  ? 188 GLN 1 CB  1 
ATOM 1331  C CG  . GLN A 1 188 ? 22.727  4.484   222.995 1.00 66.99  ? 188 GLN 1 CG  1 
ATOM 1332  C CD  . GLN A 1 188 ? 24.022  3.690   222.853 1.00 79.91  ? 188 GLN 1 CD  1 
ATOM 1333  O OE1 . GLN A 1 188 ? 24.034  2.618   222.236 1.00 83.03  ? 188 GLN 1 OE1 1 
ATOM 1334  N NE2 . GLN A 1 188 ? 25.110  4.186   223.456 1.00 78.14  ? 188 GLN 1 NE2 1 
ATOM 1335  N N   . MET A 1 189 ? 21.039  5.632   221.007 1.00 10.30  ? 189 MET 1 N   1 
ATOM 1336  C CA  . MET A 1 189 ? 20.030  5.182   220.061 1.00 28.79  ? 189 MET 1 CA  1 
ATOM 1337  C C   . MET A 1 189 ? 19.258  3.999   220.581 1.00 46.30  ? 189 MET 1 C   1 
ATOM 1338  O O   . MET A 1 189 ? 19.821  2.932   220.814 1.00 51.72  ? 189 MET 1 O   1 
ATOM 1339  C CB  . MET A 1 189 ? 20.615  4.818   218.714 1.00 33.18  ? 189 MET 1 CB  1 
ATOM 1340  C CG  . MET A 1 189 ? 19.536  4.410   217.732 1.00 34.36  ? 189 MET 1 CG  1 
ATOM 1341  S SD  . MET A 1 189 ? 18.461  5.824   217.432 1.00 49.55  ? 189 MET 1 SD  1 
ATOM 1342  C CE  . MET A 1 189 ? 17.730  5.357   215.814 1.00 41.88  ? 189 MET 1 CE  1 
ATOM 1343  N N   . ASN A 1 190 ? 17.946  4.148   220.641 1.00 55.38  ? 190 ASN 1 N   1 
ATOM 1344  C CA  . ASN A 1 190 ? 17.129  3.078   221.158 1.00 51.73  ? 190 ASN 1 CA  1 
ATOM 1345  C C   . ASN A 1 190 ? 15.881  2.861   220.322 1.00 42.34  ? 190 ASN 1 C   1 
ATOM 1346  O O   . ASN A 1 190 ? 14.786  3.207   220.728 1.00 47.38  ? 190 ASN 1 O   1 
ATOM 1347  C CB  . ASN A 1 190 ? 16.763  3.444   222.577 1.00 54.14  ? 190 ASN 1 CB  1 
ATOM 1348  C CG  . ASN A 1 190 ? 16.090  2.331   223.301 1.00 63.65  ? 190 ASN 1 CG  1 
ATOM 1349  O OD1 . ASN A 1 190 ? 16.005  2.381   224.520 1.00 68.34  ? 190 ASN 1 OD1 1 
ATOM 1350  N ND2 . ASN A 1 190 ? 15.587  1.316   222.572 1.00 52.54  ? 190 ASN 1 ND2 1 
ATOM 1351  N N   . THR A 1 191 ? 16.046  2.155   219.224 1.00 26.53  ? 191 THR 1 N   1 
ATOM 1352  C CA  . THR A 1 191 ? 14.978  1.874   218.269 1.00 41.38  ? 191 THR 1 CA  1 
ATOM 1353  C C   . THR A 1 191 ? 13.523  1.655   218.703 1.00 56.02  ? 191 THR 1 C   1 
ATOM 1354  O O   . THR A 1 191 ? 12.626  1.570   217.857 1.00 53.47  ? 191 THR 1 O   1 
ATOM 1355  C CB  . THR A 1 191 ? 15.349  0.672   217.469 1.00 57.40  ? 191 THR 1 CB  1 
ATOM 1356  O OG1 . THR A 1 191 ? 16.732  0.372   217.708 1.00 84.38  ? 191 THR 1 OG1 1 
ATOM 1357  C CG2 . THR A 1 191 ? 15.098  0.926   215.990 1.00 52.62  ? 191 THR 1 CG2 1 
ATOM 1358  N N   . ASP A 1 192 ? 13.280  1.505   219.995 1.00 70.95  ? 192 ASP 1 N   1 
ATOM 1359  C CA  . ASP A 1 192 ? 11.920  1.295   220.487 1.00 79.28  ? 192 ASP 1 CA  1 
ATOM 1360  C C   . ASP A 1 192 ? 11.173  2.607   220.640 1.00 65.83  ? 192 ASP 1 C   1 
ATOM 1361  O O   . ASP A 1 192 ? 10.013  2.666   221.069 1.00 77.15  ? 192 ASP 1 O   1 
ATOM 1362  C CB  . ASP A 1 192 ? 11.974  0.610   221.850 1.00 102.75 ? 192 ASP 1 CB  1 
ATOM 1363  C CG  . ASP A 1 192 ? 12.630  -0.747  221.794 1.00 111.70 ? 192 ASP 1 CG  1 
ATOM 1364  O OD1 . ASP A 1 192 ? 12.276  -1.538  220.886 1.00 96.51  ? 192 ASP 1 OD1 1 
ATOM 1365  O OD2 . ASP A 1 192 ? 13.503  -1.005  222.657 1.00 126.23 ? 192 ASP 1 OD2 1 
ATOM 1366  N N   . HIS A 1 193 ? 11.880  3.688   220.401 1.00 46.07  ? 193 HIS 1 N   1 
ATOM 1367  C CA  . HIS A 1 193 ? 11.257  4.970   220.547 1.00 42.60  ? 193 HIS 1 CA  1 
ATOM 1368  C C   . HIS A 1 193 ? 10.845  5.634   219.288 1.00 45.12  ? 193 HIS 1 C   1 
ATOM 1369  O O   . HIS A 1 193 ? 10.978  6.847   219.145 1.00 47.31  ? 193 HIS 1 O   1 
ATOM 1370  C CB  . HIS A 1 193 ? 12.140  5.835   221.371 1.00 43.04  ? 193 HIS 1 CB  1 
ATOM 1371  C CG  . HIS A 1 193 ? 12.555  5.149   222.620 1.00 55.77  ? 193 HIS 1 CG  1 
ATOM 1372  N ND1 . HIS A 1 193 ? 11.938  3.997   223.042 1.00 33.22  ? 193 HIS 1 ND1 1 
ATOM 1373  C CD2 . HIS A 1 193 ? 13.518  5.429   223.524 1.00 66.35  ? 193 HIS 1 CD2 1 
ATOM 1374  C CE1 . HIS A 1 193 ? 12.508  3.595   224.165 1.00 62.68  ? 193 HIS 1 CE1 1 
ATOM 1375  N NE2 . HIS A 1 193 ? 13.468  4.449   224.480 1.00 43.51  ? 193 HIS 1 NE2 1 
ATOM 1376  N N   . LYS A 1 194 ? 10.422  4.827   218.332 1.00 44.56  ? 194 LYS 1 N   1 
ATOM 1377  C CA  . LYS A 1 194 ? 9.912   5.393   217.116 1.00 67.05  ? 194 LYS 1 CA  1 
ATOM 1378  C C   . LYS A 1 194 ? 8.526   5.889   217.585 1.00 81.29  ? 194 LYS 1 C   1 
ATOM 1379  O O   . LYS A 1 194 ? 7.917   5.277   218.468 1.00 85.17  ? 194 LYS 1 O   1 
ATOM 1380  C CB  . LYS A 1 194 ? 9.841   4.331   216.026 1.00 68.20  ? 194 LYS 1 CB  1 
ATOM 1381  C CG  . LYS A 1 194 ? 11.221  3.851   215.588 1.00 72.69  ? 194 LYS 1 CG  1 
ATOM 1382  C CD  . LYS A 1 194 ? 12.127  5.025   215.236 1.00 70.50  ? 194 LYS 1 CD  1 
ATOM 1383  C CE  . LYS A 1 194 ? 13.434  4.567   214.622 1.00 58.41  ? 194 LYS 1 CE  1 
ATOM 1384  N NZ  . LYS A 1 194 ? 14.275  5.717   214.219 1.00 79.99  ? 194 LYS 1 NZ  1 
ATOM 1385  N N   . ALA A 1 195 ? 8.099   7.054   217.101 1.00 89.63  ? 195 ALA 1 N   1 
ATOM 1386  C CA  . ALA A 1 195 ? 6.821   7.642   217.515 1.00 78.62  ? 195 ALA 1 CA  1 
ATOM 1387  C C   . ALA A 1 195 ? 6.249   8.588   216.461 1.00 80.06  ? 195 ALA 1 C   1 
ATOM 1388  O O   . ALA A 1 195 ? 6.689   8.568   215.303 1.00 95.64  ? 195 ALA 1 O   1 
ATOM 1389  C CB  . ALA A 1 195 ? 6.999   8.377   218.842 1.00 55.72  ? 195 ALA 1 CB  1 
ATOM 1390  N N   . VAL A 1 196 ? 5.269   9.404   216.859 1.00 72.64  ? 196 VAL 1 N   1 
ATOM 1391  C CA  . VAL A 1 196 ? 4.633   10.357  215.952 1.00 62.85  ? 196 VAL 1 CA  1 
ATOM 1392  C C   . VAL A 1 196 ? 4.058   11.535  216.736 1.00 60.13  ? 196 VAL 1 C   1 
ATOM 1393  O O   . VAL A 1 196 ? 3.589   11.376  217.855 1.00 69.46  ? 196 VAL 1 O   1 
ATOM 1394  C CB  . VAL A 1 196 ? 3.540   9.673   215.112 1.00 47.03  ? 196 VAL 1 CB  1 
ATOM 1395  C CG1 . VAL A 1 196 ? 2.374   9.300   215.988 1.00 86.70  ? 196 VAL 1 CG1 1 
ATOM 1396  C CG2 . VAL A 1 196 ? 3.108   10.554  213.970 1.00 59.71  ? 196 VAL 1 CG2 1 
ATOM 1397  N N   . LEU A 1 197 ? 4.204   12.730  216.184 1.00 60.39  ? 197 LEU 1 N   1 
ATOM 1398  C CA  . LEU A 1 197 ? 3.714   13.937  216.824 1.00 57.72  ? 197 LEU 1 CA  1 
ATOM 1399  C C   . LEU A 1 197 ? 2.296   14.109  216.393 1.00 60.81  ? 197 LEU 1 C   1 
ATOM 1400  O O   . LEU A 1 197 ? 2.041   14.507  215.249 1.00 58.03  ? 197 LEU 1 O   1 
ATOM 1401  C CB  . LEU A 1 197 ? 4.495   15.153  216.359 1.00 55.06  ? 197 LEU 1 CB  1 
ATOM 1402  C CG  . LEU A 1 197 ? 4.183   16.388  217.185 1.00 51.41  ? 197 LEU 1 CG  1 
ATOM 1403  C CD1 . LEU A 1 197 ? 3.752   15.996  218.592 1.00 57.40  ? 197 LEU 1 CD1 1 
ATOM 1404  C CD2 . LEU A 1 197 ? 5.415   17.244  217.247 1.00 36.51  ? 197 LEU 1 CD2 1 
ATOM 1405  N N   . ASP A 1 198 ? 1.382   13.844  217.316 1.00 58.04  ? 198 ASP 1 N   1 
ATOM 1406  C CA  . ASP A 1 198 ? -0.034  13.939  217.011 1.00 57.67  ? 198 ASP 1 CA  1 
ATOM 1407  C C   . ASP A 1 198 ? -0.758  14.737  218.079 1.00 49.14  ? 198 ASP 1 C   1 
ATOM 1408  O O   . ASP A 1 198 ? -1.958  15.005  217.988 1.00 54.91  ? 198 ASP 1 O   1 
ATOM 1409  C CB  . ASP A 1 198 ? -0.613  12.539  216.897 1.00 60.55  ? 198 ASP 1 CB  1 
ATOM 1410  C CG  . ASP A 1 198 ? -0.375  11.732  218.137 1.00 70.44  ? 198 ASP 1 CG  1 
ATOM 1411  O OD1 . ASP A 1 198 ? -0.520  12.310  219.249 1.00 67.95  ? 198 ASP 1 OD1 1 
ATOM 1412  O OD2 . ASP A 1 198 ? -0.042  10.536  218.002 1.00 66.74  ? 198 ASP 1 OD2 1 
ATOM 1413  N N   . LYS A 1 199 ? -0.050  15.071  219.134 1.00 24.40  ? 199 LYS 1 N   1 
ATOM 1414  C CA  . LYS A 1 199 ? -0.699  15.866  220.121 1.00 30.44  ? 199 LYS 1 CA  1 
ATOM 1415  C C   . LYS A 1 199 ? 0.141   17.078  220.515 1.00 38.68  ? 199 LYS 1 C   1 
ATOM 1416  O O   . LYS A 1 199 ? 1.354   16.990  220.766 1.00 42.28  ? 199 LYS 1 O   1 
ATOM 1417  C CB  . LYS A 1 199 ? -1.051  15.019  221.309 1.00 42.76  ? 199 LYS 1 CB  1 
ATOM 1418  C CG  . LYS A 1 199 ? -1.866  15.804  222.320 1.00 101.68 ? 199 LYS 1 CG  1 
ATOM 1419  C CD  . LYS A 1 199 ? -2.332  14.936  223.485 1.00 138.04 ? 199 LYS 1 CD  1 
ATOM 1420  C CE  . LYS A 1 199 ? -3.300  13.830  223.039 1.00 164.43 ? 199 LYS 1 CE  1 
ATOM 1421  N NZ  . LYS A 1 199 ? -4.574  14.367  222.467 1.00 180.68 ? 199 LYS 1 NZ  1 
ATOM 1422  N N   . ASP A 1 200 ? -0.530  18.213  220.634 1.00 23.79  ? 200 ASP 1 N   1 
ATOM 1423  C CA  . ASP A 1 200 ? 0.153   19.440  220.978 1.00 25.38  ? 200 ASP 1 CA  1 
ATOM 1424  C C   . ASP A 1 200 ? 0.401   19.503  222.492 1.00 27.13  ? 200 ASP 1 C   1 
ATOM 1425  O O   . ASP A 1 200 ? -0.295  18.865  223.261 1.00 44.30  ? 200 ASP 1 O   1 
ATOM 1426  C CB  . ASP A 1 200 ? -0.708  20.600  220.479 1.00 33.17  ? 200 ASP 1 CB  1 
ATOM 1427  C CG  . ASP A 1 200 ? -0.043  21.952  220.619 1.00 51.59  ? 200 ASP 1 CG  1 
ATOM 1428  O OD1 . ASP A 1 200 ? 0.351   22.305  221.755 1.00 40.47  ? 200 ASP 1 OD1 1 
ATOM 1429  O OD2 . ASP A 1 200 ? 0.064   22.661  219.589 1.00 59.69  ? 200 ASP 1 OD2 1 
ATOM 1430  N N   . ASN A 1 201 ? 1.425   20.245  222.903 1.00 38.77  ? 201 ASN 1 N   1 
ATOM 1431  C CA  . ASN A 1 201 ? 1.821   20.389  224.308 1.00 48.52  ? 201 ASN 1 CA  1 
ATOM 1432  C C   . ASN A 1 201 ? 1.912   18.985  224.862 1.00 60.31  ? 201 ASN 1 C   1 
ATOM 1433  O O   . ASN A 1 201 ? 1.827   18.762  226.063 1.00 70.50  ? 201 ASN 1 O   1 
ATOM 1434  C CB  . ASN A 1 201 ? 0.826   21.208  225.128 1.00 15.20  ? 201 ASN 1 CB  1 
ATOM 1435  C CG  . ASN A 1 201 ? 1.495   21.892  226.361 1.00 65.06  ? 201 ASN 1 CG  1 
ATOM 1436  O OD1 . ASN A 1 201 ? 1.108   22.992  226.752 1.00 75.78  ? 201 ASN 1 OD1 1 
ATOM 1437  N ND2 . ASN A 1 201 ? 2.517   21.252  226.951 1.00 77.01  ? 201 ASN 1 ND2 1 
ATOM 1438  N N   . ALA A 1 202 ? 2.134   18.037  223.969 1.00 67.66  ? 202 ALA 1 N   1 
ATOM 1439  C CA  . ALA A 1 202 ? 2.182   16.666  224.385 1.00 63.11  ? 202 ALA 1 CA  1 
ATOM 1440  C C   . ALA A 1 202 ? 3.594   16.208  224.615 1.00 64.99  ? 202 ALA 1 C   1 
ATOM 1441  O O   . ALA A 1 202 ? 4.116   16.319  225.720 1.00 55.78  ? 202 ALA 1 O   1 
ATOM 1442  C CB  . ALA A 1 202 ? 1.509   15.797  223.361 1.00 61.33  ? 202 ALA 1 CB  1 
ATOM 1443  N N   . TYR A 1 203 ? 4.223   15.771  223.536 1.00 59.33  ? 203 TYR 1 N   1 
ATOM 1444  C CA  . TYR A 1 203 ? 5.558   15.235  223.573 1.00 44.77  ? 203 TYR 1 CA  1 
ATOM 1445  C C   . TYR A 1 203 ? 6.541   16.345  223.840 1.00 42.52  ? 203 TYR 1 C   1 
ATOM 1446  O O   . TYR A 1 203 ? 6.649   17.273  223.053 1.00 51.75  ? 203 TYR 1 O   1 
ATOM 1447  C CB  . TYR A 1 203 ? 5.841   14.613  222.242 1.00 34.19  ? 203 TYR 1 CB  1 
ATOM 1448  C CG  . TYR A 1 203 ? 4.718   13.784  221.685 1.00 42.05  ? 203 TYR 1 CG  1 
ATOM 1449  C CD1 . TYR A 1 203 ? 3.515   14.357  221.283 1.00 55.98  ? 203 TYR 1 CD1 1 
ATOM 1450  C CD2 . TYR A 1 203 ? 4.897   12.436  221.464 1.00 51.24  ? 203 TYR 1 CD2 1 
ATOM 1451  C CE1 . TYR A 1 203 ? 2.524   13.595  220.665 1.00 55.75  ? 203 TYR 1 CE1 1 
ATOM 1452  C CE2 . TYR A 1 203 ? 3.927   11.677  220.858 1.00 50.31  ? 203 TYR 1 CE2 1 
ATOM 1453  C CZ  . TYR A 1 203 ? 2.753   12.257  220.466 1.00 53.64  ? 203 TYR 1 CZ  1 
ATOM 1454  O OH  . TYR A 1 203 ? 1.825   11.459  219.892 1.00 47.22  ? 203 TYR 1 OH  1 
ATOM 1455  N N   . PRO A 1 204 ? 7.235   16.292  224.984 1.00 42.33  ? 204 PRO 1 N   1 
ATOM 1456  C CA  . PRO A 1 204 ? 8.216   17.326  225.349 1.00 46.50  ? 204 PRO 1 CA  1 
ATOM 1457  C C   . PRO A 1 204 ? 9.425   17.269  224.476 1.00 49.39  ? 204 PRO 1 C   1 
ATOM 1458  O O   . PRO A 1 204 ? 9.836   16.203  224.032 1.00 56.85  ? 204 PRO 1 O   1 
ATOM 1459  C CB  . PRO A 1 204 ? 8.546   17.021  226.809 1.00 42.56  ? 204 PRO 1 CB  1 
ATOM 1460  C CG  . PRO A 1 204 ? 8.249   15.557  226.937 1.00 45.55  ? 204 PRO 1 CG  1 
ATOM 1461  C CD  . PRO A 1 204 ? 7.039   15.318  226.072 1.00 37.86  ? 204 PRO 1 CD  1 
ATOM 1462  N N   . VAL A 1 205 ? 10.012  18.430  224.256 1.00 62.22  ? 205 VAL 1 N   1 
ATOM 1463  C CA  . VAL A 1 205 ? 11.169  18.555  223.379 1.00 66.52  ? 205 VAL 1 CA  1 
ATOM 1464  C C   . VAL A 1 205 ? 12.327  17.651  223.682 1.00 66.47  ? 205 VAL 1 C   1 
ATOM 1465  O O   . VAL A 1 205 ? 12.852  16.987  222.784 1.00 60.70  ? 205 VAL 1 O   1 
ATOM 1466  C CB  . VAL A 1 205 ? 11.702  19.962  223.390 1.00 65.83  ? 205 VAL 1 CB  1 
ATOM 1467  C CG1 . VAL A 1 205 ? 10.860  20.835  222.491 1.00 47.98  ? 205 VAL 1 CG1 1 
ATOM 1468  C CG2 . VAL A 1 205 ? 11.680  20.470  224.834 1.00 84.73  ? 205 VAL 1 CG2 1 
ATOM 1469  N N   . GLU A 1 206 ? 12.700  17.603  224.956 1.00 63.42  ? 206 GLU 1 N   1 
ATOM 1470  C CA  . GLU A 1 206 ? 13.844  16.810  225.375 1.00 61.87  ? 206 GLU 1 CA  1 
ATOM 1471  C C   . GLU A 1 206 ? 13.726  15.307  225.284 1.00 53.45  ? 206 GLU 1 C   1 
ATOM 1472  O O   . GLU A 1 206 ? 14.608  14.595  225.733 1.00 63.98  ? 206 GLU 1 O   1 
ATOM 1473  C CB  . GLU A 1 206 ? 14.282  17.201  226.773 1.00 60.89  ? 206 GLU 1 CB  1 
ATOM 1474  C CG  . GLU A 1 206 ? 13.196  17.127  227.790 1.00 74.34  ? 206 GLU 1 CG  1 
ATOM 1475  C CD  . GLU A 1 206 ? 13.693  17.550  229.150 1.00 84.81  ? 206 GLU 1 CD  1 
ATOM 1476  O OE1 . GLU A 1 206 ? 13.797  18.788  229.395 1.00 93.03  ? 206 GLU 1 OE1 1 
ATOM 1477  O OE2 . GLU A 1 206 ? 13.993  16.641  229.962 1.00 64.48  ? 206 GLU 1 OE2 1 
ATOM 1478  N N   . CYS A 1 207 ? 12.673  14.808  224.668 1.00 45.79  ? 207 CYS 1 N   1 
ATOM 1479  C CA  . CYS A 1 207 ? 12.549  13.373  224.566 1.00 49.06  ? 207 CYS 1 CA  1 
ATOM 1480  C C   . CYS A 1 207 ? 12.601  12.973  223.125 1.00 50.02  ? 207 CYS 1 C   1 
ATOM 1481  O O   . CYS A 1 207 ? 12.868  11.805  222.774 1.00 39.51  ? 207 CYS 1 O   1 
ATOM 1482  C CB  . CYS A 1 207 ? 11.234  12.904  225.184 1.00 56.26  ? 207 CYS 1 CB  1 
ATOM 1483  S SG  . CYS A 1 207 ? 11.213  13.066  226.967 1.00 81.45  ? 207 CYS 1 SG  1 
ATOM 1484  N N   . TRP A 1 208 ? 12.373  13.954  222.268 1.00 46.60  ? 208 TRP 1 N   1 
ATOM 1485  C CA  . TRP A 1 208 ? 12.345  13.635  220.871 1.00 51.07  ? 208 TRP 1 CA  1 
ATOM 1486  C C   . TRP A 1 208 ? 13.087  14.580  219.987 1.00 42.28  ? 208 TRP 1 C   1 
ATOM 1487  O O   . TRP A 1 208 ? 13.580  15.632  220.385 1.00 39.28  ? 208 TRP 1 O   1 
ATOM 1488  C CB  . TRP A 1 208 ? 10.896  13.551  220.404 1.00 58.34  ? 208 TRP 1 CB  1 
ATOM 1489  C CG  . TRP A 1 208 ? 10.044  12.817  221.378 1.00 66.06  ? 208 TRP 1 CG  1 
ATOM 1490  C CD1 . TRP A 1 208 ? 9.523   13.290  222.571 1.00 51.27  ? 208 TRP 1 CD1 1 
ATOM 1491  C CD2 . TRP A 1 208 ? 9.697   11.444  221.310 1.00 66.25  ? 208 TRP 1 CD2 1 
ATOM 1492  N NE1 . TRP A 1 208 ? 8.892   12.274  223.242 1.00 45.67  ? 208 TRP 1 NE1 1 
ATOM 1493  C CE2 . TRP A 1 208 ? 8.983   11.125  222.487 1.00 55.92  ? 208 TRP 1 CE2 1 
ATOM 1494  C CE3 . TRP A 1 208 ? 9.922   10.433  220.360 1.00 68.08  ? 208 TRP 1 CE3 1 
ATOM 1495  C CZ2 . TRP A 1 208 ? 8.499   9.857   222.740 1.00 53.68  ? 208 TRP 1 CZ2 1 
ATOM 1496  C CZ3 . TRP A 1 208 ? 9.439   9.172   220.612 1.00 58.67  ? 208 TRP 1 CZ3 1 
ATOM 1497  C CH2 . TRP A 1 208 ? 8.736   8.891   221.790 1.00 63.93  ? 208 TRP 1 CH2 1 
ATOM 1498  N N   . VAL A 1 209 ? 13.227  14.096  218.779 1.00 32.14  ? 209 VAL 1 N   1 
ATOM 1499  C CA  . VAL A 1 209 ? 13.836  14.796  217.705 1.00 26.94  ? 209 VAL 1 CA  1 
ATOM 1500  C C   . VAL A 1 209 ? 13.178  14.000  216.611 1.00 34.96  ? 209 VAL 1 C   1 
ATOM 1501  O O   . VAL A 1 209 ? 12.751  12.837  216.797 1.00 34.06  ? 209 VAL 1 O   1 
ATOM 1502  C CB  . VAL A 1 209 ? 15.320  14.549  217.616 1.00 34.04  ? 209 VAL 1 CB  1 
ATOM 1503  C CG1 . VAL A 1 209 ? 16.035  14.995  218.888 1.00 34.45  ? 209 VAL 1 CG1 1 
ATOM 1504  C CG2 . VAL A 1 209 ? 15.557  13.113  217.341 1.00 33.35  ? 209 VAL 1 CG2 1 
ATOM 1505  N N   . PRO A 1 210 ? 13.000  14.635  215.472 1.00 37.05  ? 210 PRO 1 N   1 
ATOM 1506  C CA  . PRO A 1 210 ? 12.370  13.899  214.386 1.00 36.70  ? 210 PRO 1 CA  1 
ATOM 1507  C C   . PRO A 1 210 ? 13.259  12.750  214.069 1.00 30.55  ? 210 PRO 1 C   1 
ATOM 1508  O O   . PRO A 1 210 ? 14.459  12.793  214.346 1.00 27.39  ? 210 PRO 1 O   1 
ATOM 1509  C CB  . PRO A 1 210 ? 12.390  14.903  213.243 1.00 39.93  ? 210 PRO 1 CB  1 
ATOM 1510  C CG  . PRO A 1 210 ? 13.559  15.780  213.579 1.00 36.13  ? 210 PRO 1 CG  1 
ATOM 1511  C CD  . PRO A 1 210 ? 13.416  15.979  215.053 1.00 13.41  ? 210 PRO 1 CD  1 
ATOM 1512  N N   . ASP A 1 211 ? 12.677  11.711  213.517 1.00 23.24  ? 211 ASP 1 N   1 
ATOM 1513  C CA  . ASP A 1 211 ? 13.499  10.598  213.160 1.00 37.54  ? 211 ASP 1 CA  1 
ATOM 1514  C C   . ASP A 1 211 ? 13.764  10.555  211.647 1.00 36.11  ? 211 ASP 1 C   1 
ATOM 1515  O O   . ASP A 1 211 ? 12.904  10.244  210.807 1.00 31.55  ? 211 ASP 1 O   1 
ATOM 1516  C CB  . ASP A 1 211 ? 12.970  9.300   213.750 1.00 43.43  ? 211 ASP 1 CB  1 
ATOM 1517  C CG  . ASP A 1 211 ? 13.176  8.116   212.848 1.00 58.02  ? 211 ASP 1 CG  1 
ATOM 1518  O OD1 . ASP A 1 211 ? 14.212  8.008   212.138 1.00 40.39  ? 211 ASP 1 OD1 1 
ATOM 1519  O OD2 . ASP A 1 211 ? 12.291  7.246   212.908 1.00 69.98  ? 211 ASP 1 OD2 1 
ATOM 1520  N N   . PRO A 1 212 ? 15.024  10.782  211.311 1.00 30.33  ? 212 PRO 1 N   1 
ATOM 1521  C CA  . PRO A 1 212 ? 15.697  10.835  210.020 1.00 28.51  ? 212 PRO 1 CA  1 
ATOM 1522  C C   . PRO A 1 212 ? 15.464  9.638   209.199 1.00 22.00  ? 212 PRO 1 C   1 
ATOM 1523  O O   . PRO A 1 212 ? 15.335  9.719   207.972 1.00 45.43  ? 212 PRO 1 O   1 
ATOM 1524  C CB  . PRO A 1 212 ? 17.147  10.842  210.419 1.00 24.94  ? 212 PRO 1 CB  1 
ATOM 1525  C CG  . PRO A 1 212 ? 17.094  10.132  211.736 1.00 20.54  ? 212 PRO 1 CG  1 
ATOM 1526  C CD  . PRO A 1 212 ? 16.018  10.831  212.384 1.00 2.00   ? 212 PRO 1 CD  1 
ATOM 1527  N N   . SER A 1 213 ? 15.401  8.515   209.884 1.00 18.40  ? 213 SER 1 N   1 
ATOM 1528  C CA  . SER A 1 213 ? 15.249  7.272   209.180 1.00 39.79  ? 213 SER 1 CA  1 
ATOM 1529  C C   . SER A 1 213 ? 13.936  7.173   208.477 1.00 48.34  ? 213 SER 1 C   1 
ATOM 1530  O O   . SER A 1 213 ? 13.756  6.318   207.605 1.00 45.47  ? 213 SER 1 O   1 
ATOM 1531  C CB  . SER A 1 213 ? 15.439  6.097   210.135 1.00 45.74  ? 213 SER 1 CB  1 
ATOM 1532  O OG  . SER A 1 213 ? 14.265  5.780   210.852 1.00 38.98  ? 213 SER 1 OG  1 
ATOM 1533  N N   . LYS A 1 214 ? 13.017  8.067   208.810 1.00 56.68  ? 214 LYS 1 N   1 
ATOM 1534  C CA  . LYS A 1 214 ? 11.744  7.914   208.170 1.00 68.62  ? 214 LYS 1 CA  1 
ATOM 1535  C C   . LYS A 1 214 ? 10.849  9.058   207.748 1.00 74.40  ? 214 LYS 1 C   1 
ATOM 1536  O O   . LYS A 1 214 ? 9.788   8.808   207.180 1.00 95.06  ? 214 LYS 1 O   1 
ATOM 1537  C CB  . LYS A 1 214 ? 10.925  6.892   208.962 1.00 74.44  ? 214 LYS 1 CB  1 
ATOM 1538  C CG  . LYS A 1 214 ? 10.854  7.140   210.463 1.00 78.11  ? 214 LYS 1 CG  1 
ATOM 1539  C CD  . LYS A 1 214 ? 10.118  5.989   211.176 1.00 91.64  ? 214 LYS 1 CD  1 
ATOM 1540  C CE  . LYS A 1 214 ? 10.685  4.628   210.748 1.00 108.02 ? 214 LYS 1 CE  1 
ATOM 1541  N NZ  . LYS A 1 214 ? 9.613   3.639   210.427 1.00 120.02 ? 214 LYS 1 NZ  1 
ATOM 1542  N N   . ASN A 1 215 ? 11.236  10.306  207.925 1.00 59.54  ? 215 ASN 1 N   1 
ATOM 1543  C CA  . ASN A 1 215 ? 10.283  11.333  207.527 1.00 42.26  ? 215 ASN 1 CA  1 
ATOM 1544  C C   . ASN A 1 215 ? 10.226  11.597  206.045 1.00 43.40  ? 215 ASN 1 C   1 
ATOM 1545  O O   . ASN A 1 215 ? 10.276  12.727  205.591 1.00 46.93  ? 215 ASN 1 O   1 
ATOM 1546  C CB  . ASN A 1 215 ? 10.515  12.585  208.323 1.00 35.48  ? 215 ASN 1 CB  1 
ATOM 1547  C CG  . ASN A 1 215 ? 9.869   12.511  209.685 1.00 46.00  ? 215 ASN 1 CG  1 
ATOM 1548  O OD1 . ASN A 1 215 ? 8.638   12.549  209.789 1.00 51.51  ? 215 ASN 1 OD1 1 
ATOM 1549  N ND2 . ASN A 1 215 ? 10.688  12.387  210.744 1.00 37.69  ? 215 ASN 1 ND2 1 
ATOM 1550  N N   . GLU A 1 216 ? 10.024  10.540  205.289 1.00 41.71  ? 216 GLU 1 N   1 
ATOM 1551  C CA  . GLU A 1 216 ? 10.003  10.633  203.851 1.00 49.69  ? 216 GLU 1 CA  1 
ATOM 1552  C C   . GLU A 1 216 ? 9.118   11.714  203.271 1.00 48.99  ? 216 GLU 1 C   1 
ATOM 1553  O O   . GLU A 1 216 ? 9.440   12.269  202.214 1.00 52.54  ? 216 GLU 1 O   1 
ATOM 1554  C CB  . GLU A 1 216 ? 9.622   9.273   203.242 1.00 67.37  ? 216 GLU 1 CB  1 
ATOM 1555  C CG  . GLU A 1 216 ? 10.748  8.233   203.237 1.00 81.58  ? 216 GLU 1 CG  1 
ATOM 1556  C CD  . GLU A 1 216 ? 11.072  7.674   204.619 1.00 93.83  ? 216 GLU 1 CD  1 
ATOM 1557  O OE1 . GLU A 1 216 ? 10.166  7.018   205.189 1.00 91.03  ? 216 GLU 1 OE1 1 
ATOM 1558  O OE2 . GLU A 1 216 ? 12.222  7.873   205.107 1.00 92.17  ? 216 GLU 1 OE2 1 
ATOM 1559  N N   . ASN A 1 217 ? 8.033   12.045  203.973 1.00 55.05  ? 217 ASN 1 N   1 
ATOM 1560  C CA  . ASN A 1 217 ? 7.068   13.023  203.457 1.00 46.99  ? 217 ASN 1 CA  1 
ATOM 1561  C C   . ASN A 1 217 ? 6.895   14.339  204.203 1.00 42.00  ? 217 ASN 1 C   1 
ATOM 1562  O O   . ASN A 1 217 ? 5.845   14.972  204.118 1.00 43.48  ? 217 ASN 1 O   1 
ATOM 1563  C CB  . ASN A 1 217 ? 5.711   12.350  203.294 1.00 55.36  ? 217 ASN 1 CB  1 
ATOM 1564  C CG  . ASN A 1 217 ? 4.829   13.043  202.289 1.00 51.25  ? 217 ASN 1 CG  1 
ATOM 1565  O OD1 . ASN A 1 217 ? 5.278   13.442  201.207 1.00 52.02  ? 217 ASN 1 OD1 1 
ATOM 1566  N ND2 . ASN A 1 217 ? 3.552   13.169  202.628 1.00 59.05  ? 217 ASN 1 ND2 1 
ATOM 1567  N N   . THR A 1 218 ? 7.889   14.724  204.988 1.00 33.16  ? 218 THR 1 N   1 
ATOM 1568  C CA  . THR A 1 218 ? 7.836   15.998  205.672 1.00 36.08  ? 218 THR 1 CA  1 
ATOM 1569  C C   . THR A 1 218 ? 9.257   16.598  205.631 1.00 40.42  ? 218 THR 1 C   1 
ATOM 1570  O O   . THR A 1 218 ? 10.145  16.000  205.021 1.00 55.29  ? 218 THR 1 O   1 
ATOM 1571  C CB  . THR A 1 218 ? 7.166   15.899  207.072 1.00 32.61  ? 218 THR 1 CB  1 
ATOM 1572  O OG1 . THR A 1 218 ? 7.944   16.618  208.044 1.00 53.29  ? 218 THR 1 OG1 1 
ATOM 1573  C CG2 . THR A 1 218 ? 6.922   14.438  207.475 1.00 53.06  ? 218 THR 1 CG2 1 
ATOM 1574  N N   . ARG A 1 219 ? 9.456   17.821  206.110 1.00 35.98  ? 219 ARG 1 N   1 
ATOM 1575  C CA  . ARG A 1 219 ? 10.783  18.413  206.054 1.00 22.30  ? 219 ARG 1 CA  1 
ATOM 1576  C C   . ARG A 1 219 ? 10.933  19.151  207.313 1.00 25.90  ? 219 ARG 1 C   1 
ATOM 1577  O O   . ARG A 1 219 ? 10.027  19.899  207.729 1.00 24.39  ? 219 ARG 1 O   1 
ATOM 1578  C CB  . ARG A 1 219 ? 10.915  19.408  204.927 1.00 2.13   ? 219 ARG 1 CB  1 
ATOM 1579  C CG  . ARG A 1 219 ? 10.364  18.930  203.614 1.00 28.56  ? 219 ARG 1 CG  1 
ATOM 1580  C CD  . ARG A 1 219 ? 11.322  18.092  202.839 1.00 18.96  ? 219 ARG 1 CD  1 
ATOM 1581  N NE  . ARG A 1 219 ? 10.826  17.934  201.478 1.00 38.09  ? 219 ARG 1 NE  1 
ATOM 1582  C CZ  . ARG A 1 219 ? 10.314  16.796  201.011 1.00 47.78  ? 219 ARG 1 CZ  1 
ATOM 1583  N NH1 . ARG A 1 219 ? 10.257  15.743  201.817 1.00 58.86  ? 219 ARG 1 NH1 1 
ATOM 1584  N NH2 . ARG A 1 219 ? 9.827   16.709  199.766 1.00 34.28  ? 219 ARG 1 NH2 1 
ATOM 1585  N N   . TYR A 1 220 ? 12.097  18.981  207.900 1.00 5.27   ? 220 TYR 1 N   1 
ATOM 1586  C CA  . TYR A 1 220 ? 12.328  19.622  209.142 1.00 13.51  ? 220 TYR 1 CA  1 
ATOM 1587  C C   . TYR A 1 220 ? 13.627  20.329  209.084 1.00 24.81  ? 220 TYR 1 C   1 
ATOM 1588  O O   . TYR A 1 220 ? 14.535  20.029  208.269 1.00 25.29  ? 220 TYR 1 O   1 
ATOM 1589  C CB  . TYR A 1 220 ? 12.324  18.625  210.295 1.00 20.51  ? 220 TYR 1 CB  1 
ATOM 1590  C CG  . TYR A 1 220 ? 13.367  17.537  210.180 1.00 40.13  ? 220 TYR 1 CG  1 
ATOM 1591  C CD1 . TYR A 1 220 ? 13.110  16.391  209.434 1.00 29.99  ? 220 TYR 1 CD1 1 
ATOM 1592  C CD2 . TYR A 1 220 ? 14.612  17.644  210.834 1.00 44.76  ? 220 TYR 1 CD2 1 
ATOM 1593  C CE1 . TYR A 1 220 ? 14.050  15.379  209.338 1.00 36.14  ? 220 TYR 1 CE1 1 
ATOM 1594  C CE2 . TYR A 1 220 ? 15.563  16.630  210.739 1.00 36.04  ? 220 TYR 1 CE2 1 
ATOM 1595  C CZ  . TYR A 1 220 ? 15.270  15.496  209.983 1.00 45.28  ? 220 TYR 1 CZ  1 
ATOM 1596  O OH  . TYR A 1 220 ? 16.179  14.470  209.816 1.00 66.48  ? 220 TYR 1 OH  1 
ATOM 1597  N N   . PHE A 1 221 ? 13.706  21.273  209.997 1.00 17.34  ? 221 PHE 1 N   1 
ATOM 1598  C CA  . PHE A 1 221 ? 14.840  22.116  210.090 1.00 8.63   ? 221 PHE 1 CA  1 
ATOM 1599  C C   . PHE A 1 221 ? 14.882  22.566  211.515 1.00 18.68  ? 221 PHE 1 C   1 
ATOM 1600  O O   . PHE A 1 221 ? 13.846  22.959  212.094 1.00 25.97  ? 221 PHE 1 O   1 
ATOM 1601  C CB  . PHE A 1 221 ? 14.595  23.340  209.225 1.00 8.09   ? 221 PHE 1 CB  1 
ATOM 1602  C CG  . PHE A 1 221 ? 14.043  23.028  207.872 1.00 22.30  ? 221 PHE 1 CG  1 
ATOM 1603  C CD1 . PHE A 1 221 ? 12.699  22.748  207.710 1.00 31.53  ? 221 PHE 1 CD1 1 
ATOM 1604  C CD2 . PHE A 1 221 ? 14.873  23.001  206.755 1.00 22.49  ? 221 PHE 1 CD2 1 
ATOM 1605  C CE1 . PHE A 1 221 ? 12.195  22.447  206.456 1.00 47.28  ? 221 PHE 1 CE1 1 
ATOM 1606  C CE2 . PHE A 1 221 ? 14.372  22.706  205.491 1.00 20.11  ? 221 PHE 1 CE2 1 
ATOM 1607  C CZ  . PHE A 1 221 ? 13.036  22.428  205.341 1.00 39.38  ? 221 PHE 1 CZ  1 
ATOM 1608  N N   . GLY A 1 222 ? 16.077  22.536  212.081 1.00 12.94  ? 222 GLY 1 N   1 
ATOM 1609  C CA  . GLY A 1 222 ? 16.223  22.970  213.443 1.00 20.77  ? 222 GLY 1 CA  1 
ATOM 1610  C C   . GLY A 1 222 ? 17.679  23.020  213.814 1.00 23.28  ? 222 GLY 1 C   1 
ATOM 1611  O O   . GLY A 1 222 ? 18.516  22.384  213.166 1.00 27.15  ? 222 GLY 1 O   1 
ATOM 1612  N N   . THR A 1 223 ? 17.981  23.838  214.816 1.00 11.08  ? 223 THR 1 N   1 
ATOM 1613  C CA  . THR A 1 223 ? 19.328  23.991  215.287 1.00 22.95  ? 223 THR 1 CA  1 
ATOM 1614  C C   . THR A 1 223 ? 19.409  24.285  216.787 1.00 31.34  ? 223 THR 1 C   1 
ATOM 1615  O O   . THR A 1 223 ? 18.853  25.271  217.316 1.00 34.99  ? 223 THR 1 O   1 
ATOM 1616  C CB  . THR A 1 223 ? 20.041  25.065  214.513 1.00 21.58  ? 223 THR 1 CB  1 
ATOM 1617  O OG1 . THR A 1 223 ? 20.108  26.254  215.305 1.00 44.49  ? 223 THR 1 OG1 1 
ATOM 1618  C CG2 . THR A 1 223 ? 19.310  25.359  213.204 1.00 18.57  ? 223 THR 1 CG2 1 
ATOM 1619  N N   . TYR A 1 224 ? 20.058  23.361  217.467 1.00 32.37  ? 224 TYR 1 N   1 
ATOM 1620  C CA  . TYR A 1 224 ? 20.238  23.455  218.878 1.00 29.14  ? 224 TYR 1 CA  1 
ATOM 1621  C C   . TYR A 1 224 ? 21.496  24.254  219.053 1.00 30.21  ? 224 TYR 1 C   1 
ATOM 1622  O O   . TYR A 1 224 ? 22.450  24.124  218.274 1.00 26.36  ? 224 TYR 1 O   1 
ATOM 1623  C CB  . TYR A 1 224 ? 20.407  22.070  219.467 1.00 21.49  ? 224 TYR 1 CB  1 
ATOM 1624  C CG  . TYR A 1 224 ? 20.773  22.101  220.920 1.00 40.76  ? 224 TYR 1 CG  1 
ATOM 1625  C CD1 . TYR A 1 224 ? 19.842  22.465  221.870 1.00 44.75  ? 224 TYR 1 CD1 1 
ATOM 1626  C CD2 . TYR A 1 224 ? 22.070  21.837  221.338 1.00 35.64  ? 224 TYR 1 CD2 1 
ATOM 1627  C CE1 . TYR A 1 224 ? 20.184  22.578  223.203 1.00 51.76  ? 224 TYR 1 CE1 1 
ATOM 1628  C CE2 . TYR A 1 224 ? 22.422  21.940  222.668 1.00 47.10  ? 224 TYR 1 CE2 1 
ATOM 1629  C CZ  . TYR A 1 224 ? 21.470  22.318  223.600 1.00 51.08  ? 224 TYR 1 CZ  1 
ATOM 1630  O OH  . TYR A 1 224 ? 21.797  22.460  224.932 1.00 68.86  ? 224 TYR 1 OH  1 
ATOM 1631  N N   . THR A 1 225 ? 21.501  25.053  220.099 1.00 20.06  ? 225 THR 1 N   1 
ATOM 1632  C CA  . THR A 1 225 ? 22.630  25.887  220.364 1.00 28.94  ? 225 THR 1 CA  1 
ATOM 1633  C C   . THR A 1 225 ? 22.794  25.808  221.845 1.00 35.35  ? 225 THR 1 C   1 
ATOM 1634  O O   . THR A 1 225 ? 22.196  26.581  222.582 1.00 46.12  ? 225 THR 1 O   1 
ATOM 1635  C CB  . THR A 1 225 ? 22.311  27.341  219.995 1.00 42.77  ? 225 THR 1 CB  1 
ATOM 1636  O OG1 . THR A 1 225 ? 21.571  27.383  218.763 1.00 52.77  ? 225 THR 1 OG1 1 
ATOM 1637  C CG2 . THR A 1 225 ? 23.584  28.155  219.885 1.00 29.38  ? 225 THR 1 CG2 1 
ATOM 1638  N N   . GLY A 1 226 ? 23.525  24.806  222.295 1.00 48.65  ? 226 GLY 1 N   1 
ATOM 1639  C CA  . GLY A 1 226 ? 23.741  24.665  223.722 1.00 44.63  ? 226 GLY 1 CA  1 
ATOM 1640  C C   . GLY A 1 226 ? 24.687  25.731  224.222 1.00 41.12  ? 226 GLY 1 C   1 
ATOM 1641  O O   . GLY A 1 226 ? 25.637  26.082  223.530 1.00 55.71  ? 226 GLY 1 O   1 
ATOM 1642  N N   . GLY A 1 227 ? 24.422  26.261  225.406 1.00 31.26  ? 227 GLY 1 N   1 
ATOM 1643  C CA  . GLY A 1 227 ? 25.295  27.271  225.962 1.00 30.73  ? 227 GLY 1 CA  1 
ATOM 1644  C C   . GLY A 1 227 ? 24.665  27.896  227.179 1.00 40.89  ? 227 GLY 1 C   1 
ATOM 1645  O O   . GLY A 1 227 ? 23.468  28.182  227.231 1.00 43.82  ? 227 GLY 1 O   1 
ATOM 1646  N N   . GLU A 1 228 ? 25.485  28.130  228.180 1.00 51.91  ? 228 GLU 1 N   1 
ATOM 1647  C CA  . GLU A 1 228 ? 24.978  28.701  229.399 1.00 56.42  ? 228 GLU 1 CA  1 
ATOM 1648  C C   . GLU A 1 228 ? 24.478  30.105  229.122 1.00 47.33  ? 228 GLU 1 C   1 
ATOM 1649  O O   . GLU A 1 228 ? 23.445  30.510  229.617 1.00 50.48  ? 228 GLU 1 O   1 
ATOM 1650  C CB  . GLU A 1 228 ? 26.070  28.705  230.438 1.00 67.08  ? 228 GLU 1 CB  1 
ATOM 1651  C CG  . GLU A 1 228 ? 25.556  28.842  231.810 1.00 97.25  ? 228 GLU 1 CG  1 
ATOM 1652  C CD  . GLU A 1 228 ? 26.631  29.306  232.738 1.00 120.15 ? 228 GLU 1 CD  1 
ATOM 1653  O OE1 . GLU A 1 228 ? 27.715  28.673  232.741 1.00 131.34 ? 228 GLU 1 OE1 1 
ATOM 1654  O OE2 . GLU A 1 228 ? 26.402  30.318  233.440 1.00 143.36 ? 228 GLU 1 OE2 1 
ATOM 1655  N N   . ASN A 1 229 ? 25.191  30.835  228.286 1.00 46.95  ? 229 ASN 1 N   1 
ATOM 1656  C CA  . ASN A 1 229 ? 24.740  32.172  227.965 1.00 63.85  ? 229 ASN 1 CA  1 
ATOM 1657  C C   . ASN A 1 229 ? 24.962  32.584  226.509 1.00 62.83  ? 229 ASN 1 C   1 
ATOM 1658  O O   . ASN A 1 229 ? 25.494  33.672  226.167 1.00 47.59  ? 229 ASN 1 O   1 
ATOM 1659  C CB  . ASN A 1 229 ? 25.262  33.195  228.970 1.00 74.37  ? 229 ASN 1 CB  1 
ATOM 1660  C CG  . ASN A 1 229 ? 26.706  33.007  229.295 1.00 87.65  ? 229 ASN 1 CG  1 
ATOM 1661  O OD1 . ASN A 1 229 ? 27.209  33.615  230.236 1.00 98.45  ? 229 ASN 1 OD1 1 
ATOM 1662  N ND2 . ASN A 1 229 ? 27.403  32.175  228.514 1.00 104.30 ? 229 ASN 1 ND2 1 
ATOM 1663  N N   . VAL A 1 230 ? 24.505  31.685  225.648 1.00 52.08  ? 230 VAL 1 N   1 
ATOM 1664  C CA  . VAL A 1 230 ? 24.580  31.920  224.235 1.00 45.95  ? 230 VAL 1 CA  1 
ATOM 1665  C C   . VAL A 1 230 ? 23.565  33.005  223.999 1.00 42.78  ? 230 VAL 1 C   1 
ATOM 1666  O O   . VAL A 1 230 ? 22.569  33.101  224.713 1.00 55.23  ? 230 VAL 1 O   1 
ATOM 1667  C CB  . VAL A 1 230 ? 24.115  30.701  223.427 1.00 52.86  ? 230 VAL 1 CB  1 
ATOM 1668  C CG1 . VAL A 1 230 ? 24.779  29.478  223.915 1.00 63.84  ? 230 VAL 1 CG1 1 
ATOM 1669  C CG2 . VAL A 1 230 ? 22.608  30.529  223.492 1.00 69.69  ? 230 VAL 1 CG2 1 
ATOM 1670  N N   . PRO A 1 231 ? 23.873  33.925  223.108 1.00 36.31  ? 231 PRO 1 N   1 
ATOM 1671  C CA  . PRO A 1 231 ? 22.952  35.007  222.789 1.00 31.72  ? 231 PRO 1 CA  1 
ATOM 1672  C C   . PRO A 1 231 ? 22.121  34.522  221.631 1.00 29.95  ? 231 PRO 1 C   1 
ATOM 1673  O O   . PRO A 1 231 ? 22.604  33.848  220.721 1.00 37.90  ? 231 PRO 1 O   1 
ATOM 1674  C CB  . PRO A 1 231 ? 23.878  36.132  222.376 1.00 28.01  ? 231 PRO 1 CB  1 
ATOM 1675  C CG  . PRO A 1 231 ? 24.993  35.419  221.751 1.00 42.92  ? 231 PRO 1 CG  1 
ATOM 1676  C CD  . PRO A 1 231 ? 25.234  34.251  222.678 1.00 46.55  ? 231 PRO 1 CD  1 
ATOM 1677  N N   . PRO A 1 232 ? 20.825  34.696  221.736 1.00 32.45  ? 232 PRO 1 N   1 
ATOM 1678  C CA  . PRO A 1 232 ? 19.952  34.255  220.654 1.00 41.96  ? 232 PRO 1 CA  1 
ATOM 1679  C C   . PRO A 1 232 ? 20.066  35.247  219.506 1.00 38.58  ? 232 PRO 1 C   1 
ATOM 1680  O O   . PRO A 1 232 ? 20.357  36.434  219.705 1.00 30.12  ? 232 PRO 1 O   1 
ATOM 1681  C CB  . PRO A 1 232 ? 18.584  34.309  221.305 1.00 35.20  ? 232 PRO 1 CB  1 
ATOM 1682  C CG  . PRO A 1 232 ? 18.759  35.515  222.225 1.00 34.64  ? 232 PRO 1 CG  1 
ATOM 1683  C CD  . PRO A 1 232 ? 20.057  35.186  222.879 1.00 15.96  ? 232 PRO 1 CD  1 
ATOM 1684  N N   . VAL A 1 233 ? 19.876  34.767  218.292 1.00 38.34  ? 233 VAL 1 N   1 
ATOM 1685  C CA  . VAL A 1 233 ? 19.962  35.683  217.183 1.00 28.96  ? 233 VAL 1 CA  1 
ATOM 1686  C C   . VAL A 1 233 ? 18.858  35.374  216.239 1.00 24.93  ? 233 VAL 1 C   1 
ATOM 1687  O O   . VAL A 1 233 ? 18.777  34.279  215.667 1.00 21.58  ? 233 VAL 1 O   1 
ATOM 1688  C CB  . VAL A 1 233 ? 21.261  35.567  216.446 1.00 24.77  ? 233 VAL 1 CB  1 
ATOM 1689  C CG1 . VAL A 1 233 ? 21.551  36.857  215.789 1.00 41.59  ? 233 VAL 1 CG1 1 
ATOM 1690  C CG2 . VAL A 1 233 ? 22.353  35.236  217.386 1.00 39.17  ? 233 VAL 1 CG2 1 
ATOM 1691  N N   . LEU A 1 234 ? 18.035  36.372  216.008 1.00 22.93  ? 234 LEU 1 N   1 
ATOM 1692  C CA  . LEU A 1 234 ? 16.914  36.148  215.157 1.00 28.72  ? 234 LEU 1 CA  1 
ATOM 1693  C C   . LEU A 1 234 ? 16.739  37.111  214.055 1.00 31.85  ? 234 LEU 1 C   1 
ATOM 1694  O O   . LEU A 1 234 ? 17.012  38.302  214.223 1.00 25.94  ? 234 LEU 1 O   1 
ATOM 1695  C CB  . LEU A 1 234 ? 15.700  36.197  216.020 1.00 43.04  ? 234 LEU 1 CB  1 
ATOM 1696  C CG  . LEU A 1 234 ? 15.802  34.967  216.879 1.00 31.95  ? 234 LEU 1 CG  1 
ATOM 1697  C CD1 . LEU A 1 234 ? 14.807  35.058  217.986 1.00 31.45  ? 234 LEU 1 CD1 1 
ATOM 1698  C CD2 . LEU A 1 234 ? 15.581  33.776  215.960 1.00 35.24  ? 234 LEU 1 CD2 1 
ATOM 1699  N N   . HIS A 1 235 ? 16.271  36.592  212.924 1.00 25.49  ? 235 HIS 1 N   1 
ATOM 1700  C CA  . HIS A 1 235 ? 16.016  37.451  211.782 1.00 39.12  ? 235 HIS 1 CA  1 
ATOM 1701  C C   . HIS A 1 235 ? 14.581  37.444  211.425 1.00 43.56  ? 235 HIS 1 C   1 
ATOM 1702  O O   . HIS A 1 235 ? 13.962  36.384  211.289 1.00 52.81  ? 235 HIS 1 O   1 
ATOM 1703  C CB  . HIS A 1 235 ? 16.788  37.012  210.579 1.00 59.74  ? 235 HIS 1 CB  1 
ATOM 1704  C CG  . HIS A 1 235 ? 18.245  37.049  210.801 1.00 84.37  ? 235 HIS 1 CG  1 
ATOM 1705  N ND1 . HIS A 1 235 ? 18.963  35.946  211.211 1.00 102.32 ? 235 HIS 1 ND1 1 
ATOM 1706  C CD2 . HIS A 1 235 ? 19.124  38.075  210.760 1.00 98.36  ? 235 HIS 1 CD2 1 
ATOM 1707  C CE1 . HIS A 1 235 ? 20.218  36.292  211.413 1.00 105.49 ? 235 HIS 1 CE1 1 
ATOM 1708  N NE2 . HIS A 1 235 ? 20.344  37.580  211.148 1.00 105.12 ? 235 HIS 1 NE2 1 
ATOM 1709  N N   . ILE A 1 236 ? 14.060  38.631  211.218 1.00 31.68  ? 236 ILE 1 N   1 
ATOM 1710  C CA  . ILE A 1 236 ? 12.684  38.749  210.863 1.00 23.04  ? 236 ILE 1 CA  1 
ATOM 1711  C C   . ILE A 1 236 ? 12.837  39.375  209.475 1.00 26.05  ? 236 ILE 1 C   1 
ATOM 1712  O O   . ILE A 1 236 ? 13.682  40.268  209.299 1.00 18.60  ? 236 ILE 1 O   1 
ATOM 1713  C CB  . ILE A 1 236 ? 11.961  39.619  211.947 1.00 30.44  ? 236 ILE 1 CB  1 
ATOM 1714  C CG1 . ILE A 1 236 ? 10.468  39.804  211.626 1.00 68.43  ? 236 ILE 1 CG1 1 
ATOM 1715  C CG2 . ILE A 1 236 ? 12.654  40.966  212.107 1.00 8.90   ? 236 ILE 1 CG2 1 
ATOM 1716  C CD1 . ILE A 1 236 ? 9.450   39.808  212.861 1.00 77.93  ? 236 ILE 1 CD1 1 
ATOM 1717  N N   . THR A 1 237 ? 12.224  38.728  208.480 1.00 18.97  ? 237 THR 1 N   1 
ATOM 1718  C CA  . THR A 1 237 ? 12.225  39.179  207.086 1.00 22.94  ? 237 THR 1 CA  1 
ATOM 1719  C C   . THR A 1 237 ? 11.203  38.546  206.178 1.00 29.30  ? 237 THR 1 C   1 
ATOM 1720  O O   . THR A 1 237 ? 11.156  37.325  206.000 1.00 42.49  ? 237 THR 1 O   1 
ATOM 1721  C CB  . THR A 1 237 ? 13.456  38.881  206.420 1.00 21.03  ? 237 THR 1 CB  1 
ATOM 1722  O OG1 . THR A 1 237 ? 14.515  39.474  207.164 1.00 71.71  ? 237 THR 1 OG1 1 
ATOM 1723  C CG2 . THR A 1 237 ? 13.392  39.454  205.052 1.00 2.00   ? 237 THR 1 CG2 1 
ATOM 1724  N N   . ASN A 1 238 ? 10.581  39.390  205.390 1.00 14.30  ? 238 ASN 1 N   1 
ATOM 1725  C CA  . ASN A 1 238 ? 9.549   38.879  204.541 1.00 25.85  ? 238 ASN 1 CA  1 
ATOM 1726  C C   . ASN A 1 238 ? 10.043  38.579  203.161 1.00 22.05  ? 238 ASN 1 C   1 
ATOM 1727  O O   . ASN A 1 238 ? 9.260   38.391  202.236 1.00 27.38  ? 238 ASN 1 O   1 
ATOM 1728  C CB  . ASN A 1 238 ? 8.385   39.861  204.498 1.00 38.97  ? 238 ASN 1 CB  1 
ATOM 1729  C CG  . ASN A 1 238 ? 8.759   41.163  203.847 1.00 39.71  ? 238 ASN 1 CG  1 
ATOM 1730  O OD1 . ASN A 1 238 ? 9.876   41.682  204.016 1.00 44.37  ? 238 ASN 1 OD1 1 
ATOM 1731  N ND2 . ASN A 1 238 ? 7.838   41.696  203.082 1.00 49.13  ? 238 ASN 1 ND2 1 
ATOM 1732  N N   . THR A 1 239 ? 11.341  38.461  203.004 1.00 29.92  ? 239 THR 1 N   1 
ATOM 1733  C CA  . THR A 1 239 ? 11.840  38.191  201.664 1.00 38.22  ? 239 THR 1 CA  1 
ATOM 1734  C C   . THR A 1 239 ? 12.406  36.816  201.453 1.00 39.51  ? 239 THR 1 C   1 
ATOM 1735  O O   . THR A 1 239 ? 12.692  36.422  200.324 1.00 43.67  ? 239 THR 1 O   1 
ATOM 1736  C CB  . THR A 1 239 ? 12.914  39.167  201.300 1.00 33.70  ? 239 THR 1 CB  1 
ATOM 1737  O OG1 . THR A 1 239 ? 13.391  39.785  202.492 1.00 25.06  ? 239 THR 1 OG1 1 
ATOM 1738  C CG2 . THR A 1 239 ? 12.363  40.221  200.363 1.00 66.93  ? 239 THR 1 CG2 1 
ATOM 1739  N N   . ALA A 1 240 ? 12.485  36.058  202.537 1.00 45.09  ? 240 ALA 1 N   1 
ATOM 1740  C CA  . ALA A 1 240 ? 13.077  34.735  202.500 1.00 27.23  ? 240 ALA 1 CA  1 
ATOM 1741  C C   . ALA A 1 240 ? 12.152  33.584  202.264 1.00 31.81  ? 240 ALA 1 C   1 
ATOM 1742  O O   . ALA A 1 240 ? 11.241  33.357  203.054 1.00 51.69  ? 240 ALA 1 O   1 
ATOM 1743  C CB  . ALA A 1 240 ? 13.811  34.506  203.775 1.00 54.94  ? 240 ALA 1 CB  1 
ATOM 1744  N N   . THR A 1 241 ? 12.468  32.774  201.262 1.00 28.20  ? 241 THR 1 N   1 
ATOM 1745  C CA  . THR A 1 241 ? 11.651  31.609  200.984 1.00 29.85  ? 241 THR 1 CA  1 
ATOM 1746  C C   . THR A 1 241 ? 12.425  30.321  201.080 1.00 29.88  ? 241 THR 1 C   1 
ATOM 1747  O O   . THR A 1 241 ? 13.600  30.262  200.733 1.00 60.74  ? 241 THR 1 O   1 
ATOM 1748  C CB  . THR A 1 241 ? 11.067  31.661  199.612 1.00 25.88  ? 241 THR 1 CB  1 
ATOM 1749  O OG1 . THR A 1 241 ? 10.311  32.863  199.469 1.00 60.46  ? 241 THR 1 OG1 1 
ATOM 1750  C CG2 . THR A 1 241 ? 10.166  30.493  199.403 1.00 16.26  ? 241 THR 1 CG2 1 
ATOM 1751  N N   . THR A 1 242 ? 11.721  29.271  201.461 1.00 31.16  ? 242 THR 1 N   1 
ATOM 1752  C CA  . THR A 1 242 ? 12.296  27.959  201.608 1.00 19.41  ? 242 THR 1 CA  1 
ATOM 1753  C C   . THR A 1 242 ? 11.547  26.991  200.749 1.00 21.46  ? 242 THR 1 C   1 
ATOM 1754  O O   . THR A 1 242 ? 10.292  26.964  200.715 1.00 26.86  ? 242 THR 1 O   1 
ATOM 1755  C CB  . THR A 1 242 ? 12.145  27.479  203.032 1.00 18.01  ? 242 THR 1 CB  1 
ATOM 1756  O OG1 . THR A 1 242 ? 12.943  28.286  203.906 1.00 31.67  ? 242 THR 1 OG1 1 
ATOM 1757  C CG2 . THR A 1 242 ? 12.537  26.057  203.142 1.00 15.77  ? 242 THR 1 CG2 1 
ATOM 1758  N N   . VAL A 1 243 ? 12.309  26.132  200.107 1.00 17.94  ? 243 VAL 1 N   1 
ATOM 1759  C CA  . VAL A 1 243 ? 11.671  25.150  199.275 1.00 26.74  ? 243 VAL 1 CA  1 
ATOM 1760  C C   . VAL A 1 243 ? 11.468  23.824  199.955 1.00 29.00  ? 243 VAL 1 C   1 
ATOM 1761  O O   . VAL A 1 243 ? 12.367  23.308  200.607 1.00 55.50  ? 243 VAL 1 O   1 
ATOM 1762  C CB  . VAL A 1 243 ? 12.425  24.920  198.031 1.00 14.14  ? 243 VAL 1 CB  1 
ATOM 1763  C CG1 . VAL A 1 243 ? 11.747  23.818  197.262 1.00 23.17  ? 243 VAL 1 CG1 1 
ATOM 1764  C CG2 . VAL A 1 243 ? 12.450  26.175  197.236 1.00 2.00   ? 243 VAL 1 CG2 1 
ATOM 1765  N N   . LEU A 1 244 ? 10.299  23.246  199.743 1.00 23.54  ? 244 LEU 1 N   1 
ATOM 1766  C CA  . LEU A 1 244 ? 9.978   21.970  200.343 1.00 23.28  ? 244 LEU 1 CA  1 
ATOM 1767  C C   . LEU A 1 244 ? 10.163  20.878  199.324 1.00 34.41  ? 244 LEU 1 C   1 
ATOM 1768  O O   . LEU A 1 244 ? 9.969   19.697  199.643 1.00 33.07  ? 244 LEU 1 O   1 
ATOM 1769  C CB  . LEU A 1 244 ? 8.545   21.994  200.790 1.00 26.10  ? 244 LEU 1 CB  1 
ATOM 1770  C CG  . LEU A 1 244 ? 8.419   23.224  201.644 1.00 30.73  ? 244 LEU 1 CG  1 
ATOM 1771  C CD1 . LEU A 1 244 ? 6.997   23.615  201.762 1.00 52.87  ? 244 LEU 1 CD1 1 
ATOM 1772  C CD2 . LEU A 1 244 ? 9.039   22.910  202.969 1.00 14.92  ? 244 LEU 1 CD2 1 
ATOM 1773  N N   . LEU A 1 245 ? 10.457  21.264  198.081 1.00 17.95  ? 245 LEU 1 N   1 
ATOM 1774  C CA  . LEU A 1 245 ? 10.659  20.270  197.034 1.00 28.54  ? 245 LEU 1 CA  1 
ATOM 1775  C C   . LEU A 1 245 ? 11.705  19.232  197.334 1.00 35.00  ? 245 LEU 1 C   1 
ATOM 1776  O O   . LEU A 1 245 ? 12.653  19.479  198.086 1.00 44.38  ? 245 LEU 1 O   1 
ATOM 1777  C CB  . LEU A 1 245 ? 10.997  20.914  195.718 1.00 25.68  ? 245 LEU 1 CB  1 
ATOM 1778  C CG  . LEU A 1 245 ? 9.787   21.549  195.061 1.00 29.16  ? 245 LEU 1 CG  1 
ATOM 1779  C CD1 . LEU A 1 245 ? 9.868   21.256  193.588 1.00 25.75  ? 245 LEU 1 CD1 1 
ATOM 1780  C CD2 . LEU A 1 245 ? 8.518   20.951  195.602 1.00 47.22  ? 245 LEU 1 CD2 1 
ATOM 1781  N N   . ASP A 1 246 ? 11.467  18.029  196.832 1.00 48.04  ? 246 ASP 1 N   1 
ATOM 1782  C CA  . ASP A 1 246 ? 12.419  16.954  197.046 1.00 46.78  ? 246 ASP 1 CA  1 
ATOM 1783  C C   . ASP A 1 246 ? 13.269  16.853  195.821 1.00 44.65  ? 246 ASP 1 C   1 
ATOM 1784  O O   . ASP A 1 246 ? 13.111  17.620  194.873 1.00 46.98  ? 246 ASP 1 O   1 
ATOM 1785  C CB  . ASP A 1 246 ? 11.746  15.596  197.394 1.00 44.32  ? 246 ASP 1 CB  1 
ATOM 1786  C CG  . ASP A 1 246 ? 11.173  14.829  196.173 1.00 57.23  ? 246 ASP 1 CG  1 
ATOM 1787  O OD1 . ASP A 1 246 ? 11.100  15.358  195.038 1.00 40.52  ? 246 ASP 1 OD1 1 
ATOM 1788  O OD2 . ASP A 1 246 ? 10.769  13.655  196.384 1.00 64.95  ? 246 ASP 1 OD2 1 
ATOM 1789  N N   . GLU A 1 247 ? 14.140  15.866  195.845 1.00 55.07  ? 247 GLU 1 N   1 
ATOM 1790  C CA  . GLU A 1 247 ? 15.066  15.586  194.772 1.00 58.10  ? 247 GLU 1 CA  1 
ATOM 1791  C C   . GLU A 1 247 ? 14.315  15.393  193.454 1.00 53.96  ? 247 GLU 1 C   1 
ATOM 1792  O O   . GLU A 1 247 ? 14.673  15.998  192.457 1.00 54.10  ? 247 GLU 1 O   1 
ATOM 1793  C CB  . GLU A 1 247 ? 15.914  14.337  195.129 1.00 71.73  ? 247 GLU 1 CB  1 
ATOM 1794  C CG  . GLU A 1 247 ? 16.907  14.477  196.339 1.00 89.34  ? 247 GLU 1 CG  1 
ATOM 1795  C CD  . GLU A 1 247 ? 16.347  14.076  197.727 1.00 107.98 ? 247 GLU 1 CD  1 
ATOM 1796  O OE1 . GLU A 1 247 ? 15.843  12.932  197.879 1.00 106.46 ? 247 GLU 1 OE1 1 
ATOM 1797  O OE2 . GLU A 1 247 ? 16.465  14.893  198.687 1.00 118.76 ? 247 GLU 1 OE2 1 
ATOM 1798  N N   . GLN A 1 248 ? 13.234  14.619  193.461 1.00 52.57  ? 248 GLN 1 N   1 
ATOM 1799  C CA  . GLN A 1 248 ? 12.491  14.376  192.229 1.00 60.18  ? 248 GLN 1 CA  1 
ATOM 1800  C C   . GLN A 1 248 ? 11.742  15.643  191.803 1.00 52.06  ? 248 GLN 1 C   1 
ATOM 1801  O O   . GLN A 1 248 ? 11.276  15.761  190.665 1.00 59.73  ? 248 GLN 1 O   1 
ATOM 1802  C CB  . GLN A 1 248 ? 11.516  13.207  192.402 1.00 87.24  ? 248 GLN 1 CB  1 
ATOM 1803  C CG  . GLN A 1 248 ? 11.840  12.214  193.533 1.00 103.92 ? 248 GLN 1 CG  1 
ATOM 1804  C CD  . GLN A 1 248 ? 13.078  11.382  193.273 1.00 111.04 ? 248 GLN 1 CD  1 
ATOM 1805  O OE1 . GLN A 1 248 ? 13.658  11.431  192.183 1.00 109.33 ? 248 GLN 1 OE1 1 
ATOM 1806  N NE2 . GLN A 1 248 ? 13.480  10.589  194.270 1.00 119.73 ? 248 GLN 1 NE2 1 
ATOM 1807  N N   . GLY A 1 249 ? 11.624  16.581  192.730 1.00 31.55  ? 249 GLY 1 N   1 
ATOM 1808  C CA  . GLY A 1 249 ? 10.962  17.825  192.434 1.00 25.70  ? 249 GLY 1 CA  1 
ATOM 1809  C C   . GLY A 1 249 ? 9.576   17.750  192.977 1.00 29.04  ? 249 GLY 1 C   1 
ATOM 1810  O O   . GLY A 1 249 ? 8.615   18.128  192.299 1.00 42.63  ? 249 GLY 1 O   1 
ATOM 1811  N N   . VAL A 1 250 ? 9.457   17.265  194.204 1.00 19.44  ? 250 VAL 1 N   1 
ATOM 1812  C CA  . VAL A 1 250 ? 8.150   17.128  194.792 1.00 24.49  ? 250 VAL 1 CA  1 
ATOM 1813  C C   . VAL A 1 250 ? 8.165   17.377  196.269 1.00 22.58  ? 250 VAL 1 C   1 
ATOM 1814  O O   . VAL A 1 250 ? 8.891   16.747  197.012 1.00 30.43  ? 250 VAL 1 O   1 
ATOM 1815  C CB  . VAL A 1 250 ? 7.499   15.736  194.491 1.00 30.34  ? 250 VAL 1 CB  1 
ATOM 1816  C CG1 . VAL A 1 250 ? 8.299   14.948  193.459 1.00 16.33  ? 250 VAL 1 CG1 1 
ATOM 1817  C CG2 . VAL A 1 250 ? 7.305   14.932  195.761 1.00 32.93  ? 250 VAL 1 CG2 1 
ATOM 1818  N N   . GLY A 1 251 ? 7.396   18.356  196.696 1.00 35.40  ? 251 GLY 1 N   1 
ATOM 1819  C CA  . GLY A 1 251 ? 7.323   18.651  198.108 1.00 25.75  ? 251 GLY 1 CA  1 
ATOM 1820  C C   . GLY A 1 251 ? 6.366   17.643  198.681 1.00 22.93  ? 251 GLY 1 C   1 
ATOM 1821  O O   . GLY A 1 251 ? 5.855   16.748  197.983 1.00 27.12  ? 251 GLY 1 O   1 
ATOM 1822  N N   . PRO A 1 252 ? 6.101   17.777  199.971 1.00 8.75   ? 252 PRO 1 N   1 
ATOM 1823  C CA  . PRO A 1 252 ? 5.202   16.901  200.721 1.00 24.99  ? 252 PRO 1 CA  1 
ATOM 1824  C C   . PRO A 1 252 ? 3.872   16.790  200.038 1.00 31.98  ? 252 PRO 1 C   1 
ATOM 1825  O O   . PRO A 1 252 ? 3.403   17.759  199.415 1.00 35.30  ? 252 PRO 1 O   1 
ATOM 1826  C CB  . PRO A 1 252 ? 5.043   17.617  202.064 1.00 19.65  ? 252 PRO 1 CB  1 
ATOM 1827  C CG  . PRO A 1 252 ? 6.383   18.288  202.233 1.00 21.92  ? 252 PRO 1 CG  1 
ATOM 1828  C CD  . PRO A 1 252 ? 6.632   18.847  200.814 1.00 10.24  ? 252 PRO 1 CD  1 
ATOM 1829  N N   . LEU A 1 253 ? 3.331   15.575  200.074 1.00 34.34  ? 253 LEU 1 N   1 
ATOM 1830  C CA  . LEU A 1 253 ? 2.019   15.284  199.529 1.00 32.51  ? 253 LEU 1 CA  1 
ATOM 1831  C C   . LEU A 1 253 ? 1.109   15.139  200.729 1.00 48.79  ? 253 LEU 1 C   1 
ATOM 1832  O O   . LEU A 1 253 ? 1.453   14.467  201.697 1.00 51.38  ? 253 LEU 1 O   1 
ATOM 1833  C CB  . LEU A 1 253 ? 2.081   14.034  198.694 1.00 17.11  ? 253 LEU 1 CB  1 
ATOM 1834  C CG  . LEU A 1 253 ? 2.917   14.507  197.513 1.00 21.19  ? 253 LEU 1 CG  1 
ATOM 1835  C CD1 . LEU A 1 253 ? 3.056   13.467  196.394 1.00 30.01  ? 253 LEU 1 CD1 1 
ATOM 1836  C CD2 . LEU A 1 253 ? 2.220   15.733  196.989 1.00 18.73  ? 253 LEU 1 CD2 1 
ATOM 1837  N N   . CYS A 1 254 ? 0.017   15.884  200.742 1.00 54.49  ? 254 CYS 1 N   1 
ATOM 1838  C CA  . CYS A 1 254 ? -0.870  15.815  201.888 1.00 55.70  ? 254 CYS 1 CA  1 
ATOM 1839  C C   . CYS A 1 254 ? -1.695  14.574  201.784 1.00 57.08  ? 254 CYS 1 C   1 
ATOM 1840  O O   . CYS A 1 254 ? -2.625  14.510  200.987 1.00 58.30  ? 254 CYS 1 O   1 
ATOM 1841  C CB  . CYS A 1 254 ? -1.724  17.054  201.948 1.00 60.26  ? 254 CYS 1 CB  1 
ATOM 1842  S SG  . CYS A 1 254 ? -0.712  18.477  202.336 1.00 44.97  ? 254 CYS 1 SG  1 
ATOM 1843  N N   . LYS A 1 255 ? -1.335  13.589  202.594 1.00 57.44  ? 255 LYS 1 N   1 
ATOM 1844  C CA  . LYS A 1 255 ? -1.994  12.304  202.563 1.00 67.98  ? 255 LYS 1 CA  1 
ATOM 1845  C C   . LYS A 1 255 ? -3.445  12.350  203.000 1.00 73.33  ? 255 LYS 1 C   1 
ATOM 1846  O O   . LYS A 1 255 ? -4.378  12.271  202.161 1.00 60.05  ? 255 LYS 1 O   1 
ATOM 1847  C CB  . LYS A 1 255 ? -1.150  11.276  203.324 1.00 73.83  ? 255 LYS 1 CB  1 
ATOM 1848  C CG  . LYS A 1 255 ? -0.230  10.498  202.340 1.00 86.04  ? 255 LYS 1 CG  1 
ATOM 1849  C CD  . LYS A 1 255 ? 1.185   10.187  202.842 1.00 91.38  ? 255 LYS 1 CD  1 
ATOM 1850  C CE  . LYS A 1 255 ? 1.352   8.733   203.281 1.00 100.99 ? 255 LYS 1 CE  1 
ATOM 1851  N NZ  . LYS A 1 255 ? 0.970   8.495   204.706 1.00 107.91 ? 255 LYS 1 NZ  1 
ATOM 1852  N N   . ALA A 1 256 ? -3.656  12.360  204.311 1.00 77.25  ? 256 ALA 1 N   1 
ATOM 1853  C CA  . ALA A 1 256 ? -5.022  12.502  204.811 1.00 78.07  ? 256 ALA 1 CA  1 
ATOM 1854  C C   . ALA A 1 256 ? -5.040  13.918  204.355 1.00 72.23  ? 256 ALA 1 C   1 
ATOM 1855  O O   . ALA A 1 256 ? -4.070  14.618  204.666 1.00 85.66  ? 256 ALA 1 O   1 
ATOM 1856  C CB  . ALA A 1 256 ? -5.031  12.453  206.320 1.00 96.38  ? 256 ALA 1 CB  1 
ATOM 1857  N N   . ASP A 1 257 ? -5.980  14.300  203.495 1.00 46.96  ? 257 ASP 1 N   1 
ATOM 1858  C CA  . ASP A 1 257 ? -5.953  15.666  202.985 1.00 38.07  ? 257 ASP 1 CA  1 
ATOM 1859  C C   . ASP A 1 257 ? -5.753  16.639  204.115 1.00 46.52  ? 257 ASP 1 C   1 
ATOM 1860  O O   . ASP A 1 257 ? -6.675  17.270  204.602 1.00 64.57  ? 257 ASP 1 O   1 
ATOM 1861  C CB  . ASP A 1 257 ? -7.173  15.963  202.148 1.00 38.90  ? 257 ASP 1 CB  1 
ATOM 1862  C CG  . ASP A 1 257 ? -7.079  15.340  200.759 1.00 66.16  ? 257 ASP 1 CG  1 
ATOM 1863  O OD1 . ASP A 1 257 ? -5.956  15.256  200.191 1.00 70.50  ? 257 ASP 1 OD1 1 
ATOM 1864  O OD2 . ASP A 1 257 ? -8.134  14.934  200.226 1.00 77.03  ? 257 ASP 1 OD2 1 
ATOM 1865  N N   . SER A 1 258 ? -4.494  16.776  204.495 1.00 54.09  ? 258 SER 1 N   1 
ATOM 1866  C CA  . SER A 1 258 ? -4.080  17.581  205.618 1.00 59.49  ? 258 SER 1 CA  1 
ATOM 1867  C C   . SER A 1 258 ? -2.661  18.053  205.394 1.00 56.36  ? 258 SER 1 C   1 
ATOM 1868  O O   . SER A 1 258 ? -1.852  17.395  204.741 1.00 56.51  ? 258 SER 1 O   1 
ATOM 1869  C CB  . SER A 1 258 ? -4.125  16.756  206.921 1.00 59.35  ? 258 SER 1 CB  1 
ATOM 1870  O OG  . SER A 1 258 ? -5.426  16.242  207.205 1.00 56.80  ? 258 SER 1 OG  1 
ATOM 1871  N N   . LEU A 1 259 ? -2.380  19.197  205.985 1.00 50.82  ? 259 LEU 1 N   1 
ATOM 1872  C CA  . LEU A 1 259 ? -1.105  19.839  205.905 1.00 36.60  ? 259 LEU 1 CA  1 
ATOM 1873  C C   . LEU A 1 259 ? -0.700  19.846  207.351 1.00 38.76  ? 259 LEU 1 C   1 
ATOM 1874  O O   . LEU A 1 259 ? -1.493  20.206  208.220 1.00 43.14  ? 259 LEU 1 O   1 
ATOM 1875  C CB  . LEU A 1 259 ? -1.325  21.257  205.448 1.00 48.86  ? 259 LEU 1 CB  1 
ATOM 1876  C CG  . LEU A 1 259 ? -0.004  21.939  205.243 1.00 62.49  ? 259 LEU 1 CG  1 
ATOM 1877  C CD1 . LEU A 1 259 ? 0.662   21.194  204.115 1.00 47.26  ? 259 LEU 1 CD1 1 
ATOM 1878  C CD2 . LEU A 1 259 ? -0.222  23.389  204.887 1.00 71.17  ? 259 LEU 1 CD2 1 
ATOM 1879  N N   . TYR A 1 260 ? 0.524   19.454  207.629 1.00 34.96  ? 260 TYR 1 N   1 
ATOM 1880  C CA  . TYR A 1 260 ? 0.941   19.403  209.004 1.00 32.25  ? 260 TYR 1 CA  1 
ATOM 1881  C C   . TYR A 1 260 ? 2.073   20.357  209.280 1.00 36.37  ? 260 TYR 1 C   1 
ATOM 1882  O O   . TYR A 1 260 ? 3.055   20.433  208.536 1.00 50.22  ? 260 TYR 1 O   1 
ATOM 1883  C CB  . TYR A 1 260 ? 1.340   17.969  209.389 1.00 50.96  ? 260 TYR 1 CB  1 
ATOM 1884  C CG  . TYR A 1 260 ? 0.268   16.889  209.191 1.00 51.38  ? 260 TYR 1 CG  1 
ATOM 1885  C CD1 . TYR A 1 260 ? -0.002  16.372  207.913 1.00 51.83  ? 260 TYR 1 CD1 1 
ATOM 1886  C CD2 . TYR A 1 260 ? -0.472  16.387  210.284 1.00 38.77  ? 260 TYR 1 CD2 1 
ATOM 1887  C CE1 . TYR A 1 260 ? -0.978  15.391  207.716 1.00 65.41  ? 260 TYR 1 CE1 1 
ATOM 1888  C CE2 . TYR A 1 260 ? -1.458  15.405  210.106 1.00 47.27  ? 260 TYR 1 CE2 1 
ATOM 1889  C CZ  . TYR A 1 260 ? -1.711  14.911  208.807 1.00 69.52  ? 260 TYR 1 CZ  1 
ATOM 1890  O OH  . TYR A 1 260 ? -2.706  13.972  208.566 1.00 57.73  ? 260 TYR 1 OH  1 
ATOM 1891  N N   . VAL A 1 261 ? 1.953   21.036  210.404 1.00 32.45  ? 261 VAL 1 N   1 
ATOM 1892  C CA  . VAL A 1 261 ? 2.938   22.001  210.830 1.00 34.27  ? 261 VAL 1 CA  1 
ATOM 1893  C C   . VAL A 1 261 ? 3.370   21.738  212.264 1.00 39.41  ? 261 VAL 1 C   1 
ATOM 1894  O O   . VAL A 1 261 ? 2.555   21.555  213.180 1.00 44.48  ? 261 VAL 1 O   1 
ATOM 1895  C CB  . VAL A 1 261 ? 2.391   23.408  210.658 1.00 31.50  ? 261 VAL 1 CB  1 
ATOM 1896  C CG1 . VAL A 1 261 ? 3.212   24.410  211.450 1.00 44.47  ? 261 VAL 1 CG1 1 
ATOM 1897  C CG2 . VAL A 1 261 ? 2.379   23.752  209.175 1.00 31.29  ? 261 VAL 1 CG2 1 
ATOM 1898  N N   . SER A 1 262 ? 4.662   21.866  212.475 1.00 39.67  ? 262 SER 1 N   1 
ATOM 1899  C CA  . SER A 1 262 ? 5.233   21.549  213.757 1.00 34.30  ? 262 SER 1 CA  1 
ATOM 1900  C C   . SER A 1 262 ? 6.380   22.489  213.931 1.00 33.29  ? 262 SER 1 C   1 
ATOM 1901  O O   . SER A 1 262 ? 7.111   22.782  212.966 1.00 37.60  ? 262 SER 1 O   1 
ATOM 1902  C CB  . SER A 1 262 ? 5.743   20.131  213.625 1.00 45.22  ? 262 SER 1 CB  1 
ATOM 1903  O OG  . SER A 1 262 ? 5.502   19.684  212.272 1.00 60.73  ? 262 SER 1 OG  1 
ATOM 1904  N N   . ALA A 1 263 ? 6.584   22.925  215.161 1.00 19.21  ? 263 ALA 1 N   1 
ATOM 1905  C CA  . ALA A 1 263 ? 7.647   23.869  215.418 1.00 14.48  ? 263 ALA 1 CA  1 
ATOM 1906  C C   . ALA A 1 263 ? 8.005   23.902  216.882 1.00 22.32  ? 263 ALA 1 C   1 
ATOM 1907  O O   . ALA A 1 263 ? 7.283   23.371  217.709 1.00 32.45  ? 263 ALA 1 O   1 
ATOM 1908  C CB  . ALA A 1 263 ? 7.203   25.210  214.999 1.00 16.98  ? 263 ALA 1 CB  1 
ATOM 1909  N N   . VAL A 1 264 ? 9.101   24.570  217.203 1.00 18.49  ? 264 VAL 1 N   1 
ATOM 1910  C CA  . VAL A 1 264 ? 9.560   24.684  218.568 1.00 23.34  ? 264 VAL 1 CA  1 
ATOM 1911  C C   . VAL A 1 264 ? 10.442  25.892  218.567 1.00 33.78  ? 264 VAL 1 C   1 
ATOM 1912  O O   . VAL A 1 264 ? 11.275  26.018  217.660 1.00 27.98  ? 264 VAL 1 O   1 
ATOM 1913  C CB  . VAL A 1 264 ? 10.523  23.589  218.918 1.00 29.64  ? 264 VAL 1 CB  1 
ATOM 1914  C CG1 . VAL A 1 264 ? 11.053  23.849  220.331 1.00 11.88  ? 264 VAL 1 CG1 1 
ATOM 1915  C CG2 . VAL A 1 264 ? 9.889   22.226  218.747 1.00 18.33  ? 264 VAL 1 CG2 1 
ATOM 1916  N N   . ASP A 1 265 ? 10.405  26.672  219.644 1.00 28.57  ? 265 ASP 1 N   1 
ATOM 1917  C CA  . ASP A 1 265 ? 11.223  27.863  219.669 1.00 23.71  ? 265 ASP 1 CA  1 
ATOM 1918  C C   . ASP A 1 265 ? 11.691  28.330  221.004 1.00 29.13  ? 265 ASP 1 C   1 
ATOM 1919  O O   . ASP A 1 265 ? 11.282  29.400  221.485 1.00 27.86  ? 265 ASP 1 O   1 
ATOM 1920  C CB  . ASP A 1 265 ? 10.499  29.004  218.977 1.00 16.23  ? 265 ASP 1 CB  1 
ATOM 1921  C CG  . ASP A 1 265 ? 10.420  28.812  217.471 1.00 43.81  ? 265 ASP 1 CG  1 
ATOM 1922  O OD1 . ASP A 1 265 ? 11.431  29.174  216.798 1.00 26.51  ? 265 ASP 1 OD1 1 
ATOM 1923  O OD2 . ASP A 1 265 ? 9.369   28.293  216.973 1.00 37.90  ? 265 ASP 1 OD2 1 
ATOM 1924  N N   . ILE A 1 266 ? 12.556  27.551  221.625 1.00 27.47  ? 266 ILE 1 N   1 
ATOM 1925  C CA  . ILE A 1 266 ? 13.057  28.003  222.900 1.00 27.97  ? 266 ILE 1 CA  1 
ATOM 1926  C C   . ILE A 1 266 ? 14.010  29.080  222.488 1.00 21.19  ? 266 ILE 1 C   1 
ATOM 1927  O O   . ILE A 1 266 ? 15.002  28.794  221.825 1.00 25.76  ? 266 ILE 1 O   1 
ATOM 1928  C CB  . ILE A 1 266 ? 13.871  26.958  223.645 1.00 40.36  ? 266 ILE 1 CB  1 
ATOM 1929  C CG1 . ILE A 1 266 ? 12.980  25.816  224.137 1.00 27.69  ? 266 ILE 1 CG1 1 
ATOM 1930  C CG2 . ILE A 1 266 ? 14.607  27.632  224.802 1.00 43.45  ? 266 ILE 1 CG2 1 
ATOM 1931  C CD1 . ILE A 1 266 ? 12.403  24.951  223.037 1.00 20.43  ? 266 ILE 1 CD1 1 
ATOM 1932  N N   . CYS A 1 267 ? 13.671  30.321  222.786 1.00 20.35  ? 267 CYS 1 N   1 
ATOM 1933  C CA  . CYS A 1 267 ? 14.553  31.409  222.422 1.00 33.36  ? 267 CYS 1 CA  1 
ATOM 1934  C C   . CYS A 1 267 ? 15.639  31.502  223.458 1.00 32.95  ? 267 CYS 1 C   1 
ATOM 1935  O O   . CYS A 1 267 ? 16.673  32.144  223.231 1.00 47.81  ? 267 CYS 1 O   1 
ATOM 1936  C CB  . CYS A 1 267 ? 13.815  32.740  222.395 1.00 22.23  ? 267 CYS 1 CB  1 
ATOM 1937  S SG  . CYS A 1 267 ? 12.277  32.694  221.487 1.00 69.92  ? 267 CYS 1 SG  1 
ATOM 1938  N N   . GLY A 1 268 ? 15.406  30.893  224.609 1.00 15.14  ? 268 GLY 1 N   1 
ATOM 1939  C CA  . GLY A 1 268 ? 16.416  30.994  225.653 1.00 40.40  ? 268 GLY 1 CA  1 
ATOM 1940  C C   . GLY A 1 268 ? 15.939  31.043  227.105 1.00 37.90  ? 268 GLY 1 C   1 
ATOM 1941  O O   . GLY A 1 268 ? 14.850  30.571  227.443 1.00 42.07  ? 268 GLY 1 O   1 
ATOM 1942  N N   . LEU A 1 269 ? 16.692  31.712  227.960 1.00 31.12  ? 269 LEU 1 N   1 
ATOM 1943  C CA  . LEU A 1 269 ? 16.318  31.727  229.361 1.00 44.80  ? 269 LEU 1 CA  1 
ATOM 1944  C C   . LEU A 1 269 ? 15.991  33.018  230.080 1.00 50.48  ? 269 LEU 1 C   1 
ATOM 1945  O O   . LEU A 1 269 ? 16.852  33.913  230.236 1.00 49.16  ? 269 LEU 1 O   1 
ATOM 1946  C CB  . LEU A 1 269 ? 17.341  30.945  230.166 1.00 49.45  ? 269 LEU 1 CB  1 
ATOM 1947  C CG  . LEU A 1 269 ? 17.122  29.441  230.034 1.00 54.72  ? 269 LEU 1 CG  1 
ATOM 1948  C CD1 . LEU A 1 269 ? 18.167  28.743  230.845 1.00 67.89  ? 269 LEU 1 CD1 1 
ATOM 1949  C CD2 . LEU A 1 269 ? 15.739  29.057  230.525 1.00 61.24  ? 269 LEU 1 CD2 1 
ATOM 1950  N N   . PHE A 1 270 ? 14.751  33.071  230.574 1.00 50.32  ? 270 PHE 1 N   1 
ATOM 1951  C CA  . PHE A 1 270 ? 14.260  34.230  231.312 1.00 48.21  ? 270 PHE 1 CA  1 
ATOM 1952  C C   . PHE A 1 270 ? 14.813  34.162  232.697 1.00 45.96  ? 270 PHE 1 C   1 
ATOM 1953  O O   . PHE A 1 270 ? 14.543  33.224  233.439 1.00 43.12  ? 270 PHE 1 O   1 
ATOM 1954  C CB  . PHE A 1 270 ? 12.740  34.245  231.411 1.00 49.70  ? 270 PHE 1 CB  1 
ATOM 1955  C CG  . PHE A 1 270 ? 12.173  35.568  231.874 1.00 59.05  ? 270 PHE 1 CG  1 
ATOM 1956  C CD1 . PHE A 1 270 ? 12.909  36.422  232.681 1.00 46.21  ? 270 PHE 1 CD1 1 
ATOM 1957  C CD2 . PHE A 1 270 ? 10.901  35.976  231.454 1.00 81.43  ? 270 PHE 1 CD2 1 
ATOM 1958  C CE1 . PHE A 1 270 ? 12.400  37.649  233.062 1.00 60.82  ? 270 PHE 1 CE1 1 
ATOM 1959  C CE2 . PHE A 1 270 ? 10.372  37.220  231.831 1.00 85.28  ? 270 PHE 1 CE2 1 
ATOM 1960  C CZ  . PHE A 1 270 ? 11.129  38.056  232.636 1.00 69.78  ? 270 PHE 1 CZ  1 
ATOM 1961  N N   . THR A 1 271 ? 15.540  35.193  233.069 1.00 51.61  ? 271 THR 1 N   1 
ATOM 1962  C CA  . THR A 1 271 ? 16.121  35.207  234.379 1.00 62.40  ? 271 THR 1 CA  1 
ATOM 1963  C C   . THR A 1 271 ? 15.400  36.197  235.287 1.00 69.28  ? 271 THR 1 C   1 
ATOM 1964  O O   . THR A 1 271 ? 15.566  37.429  235.177 1.00 72.46  ? 271 THR 1 O   1 
ATOM 1965  C CB  . THR A 1 271 ? 17.629  35.459  234.298 1.00 70.49  ? 271 THR 1 CB  1 
ATOM 1966  O OG1 . THR A 1 271 ? 18.251  34.396  233.557 1.00 75.61  ? 271 THR 1 OG1 1 
ATOM 1967  C CG2 . THR A 1 271 ? 18.235  35.505  235.686 1.00 70.86  ? 271 THR 1 CG2 1 
ATOM 1968  N N   . ASN A 1 272 ? 14.577  35.612  236.161 1.00 65.31  ? 272 ASN 1 N   1 
ATOM 1969  C CA  . ASN A 1 272 ? 13.759  36.315  237.143 1.00 58.54  ? 272 ASN 1 CA  1 
ATOM 1970  C C   . ASN A 1 272 ? 14.576  37.120  238.093 1.00 58.47  ? 272 ASN 1 C   1 
ATOM 1971  O O   . ASN A 1 272 ? 15.693  36.743  238.425 1.00 68.46  ? 272 ASN 1 O   1 
ATOM 1972  C CB  . ASN A 1 272 ? 12.967  35.333  237.954 1.00 52.54  ? 272 ASN 1 CB  1 
ATOM 1973  C CG  . ASN A 1 272 ? 11.878  34.697  237.163 1.00 68.04  ? 272 ASN 1 CG  1 
ATOM 1974  O OD1 . ASN A 1 272 ? 10.911  35.344  236.774 1.00 72.35  ? 272 ASN 1 OD1 1 
ATOM 1975  N ND2 . ASN A 1 272 ? 12.009  33.414  236.931 1.00 90.41  ? 272 ASN 1 ND2 1 
ATOM 1976  N N   . THR A 1 273 ? 13.954  38.158  238.628 1.00 57.35  ? 273 THR 1 N   1 
ATOM 1977  C CA  . THR A 1 273 ? 14.586  39.075  239.569 1.00 63.47  ? 273 THR 1 CA  1 
ATOM 1978  C C   . THR A 1 273 ? 15.300  38.326  240.694 1.00 68.38  ? 273 THR 1 C   1 
ATOM 1979  O O   . THR A 1 273 ? 16.388  38.732  241.174 1.00 55.17  ? 273 THR 1 O   1 
ATOM 1980  C CB  . THR A 1 273 ? 13.522  39.953  240.190 1.00 68.41  ? 273 THR 1 CB  1 
ATOM 1981  O OG1 . THR A 1 273 ? 12.647  40.453  239.167 1.00 91.54  ? 273 THR 1 OG1 1 
ATOM 1982  C CG2 . THR A 1 273 ? 14.162  41.096  240.906 1.00 64.49  ? 273 THR 1 CG2 1 
ATOM 1983  N N   . SER A 1 274 ? 14.657  37.216  241.070 1.00 68.51  ? 274 SER 1 N   1 
ATOM 1984  C CA  . SER A 1 274 ? 15.103  36.304  242.116 1.00 67.44  ? 274 SER 1 CA  1 
ATOM 1985  C C   . SER A 1 274 ? 16.389  35.621  241.731 1.00 67.02  ? 274 SER 1 C   1 
ATOM 1986  O O   . SER A 1 274 ? 17.349  35.586  242.505 1.00 71.85  ? 274 SER 1 O   1 
ATOM 1987  C CB  . SER A 1 274 ? 14.040  35.223  242.329 1.00 76.14  ? 274 SER 1 CB  1 
ATOM 1988  O OG  . SER A 1 274 ? 13.723  34.575  241.108 1.00 75.74  ? 274 SER 1 OG  1 
ATOM 1989  N N   . GLY A 1 275 ? 16.378  35.060  240.526 1.00 63.81  ? 275 GLY 1 N   1 
ATOM 1990  C CA  . GLY A 1 275 ? 17.528  34.348  240.020 1.00 62.95  ? 275 GLY 1 CA  1 
ATOM 1991  C C   . GLY A 1 275 ? 17.049  33.058  239.406 1.00 62.69  ? 275 GLY 1 C   1 
ATOM 1992  O O   . GLY A 1 275 ? 17.840  32.275  238.864 1.00 68.00  ? 275 GLY 1 O   1 
ATOM 1993  N N   . THR A 1 276 ? 15.754  32.803  239.515 1.00 55.18  ? 276 THR 1 N   1 
ATOM 1994  C CA  . THR A 1 276 ? 15.235  31.596  238.927 1.00 66.68  ? 276 THR 1 CA  1 
ATOM 1995  C C   . THR A 1 276 ? 15.273  31.878  237.463 1.00 66.71  ? 276 THR 1 C   1 
ATOM 1996  O O   . THR A 1 276 ? 15.421  33.036  237.064 1.00 69.52  ? 276 THR 1 O   1 
ATOM 1997  C CB  . THR A 1 276 ? 13.787  31.384  239.245 1.00 82.77  ? 276 THR 1 CB  1 
ATOM 1998  O OG1 . THR A 1 276 ? 13.393  32.241  240.325 1.00 98.20  ? 276 THR 1 OG1 1 
ATOM 1999  C CG2 . THR A 1 276 ? 13.571  29.933  239.594 1.00 108.83 ? 276 THR 1 CG2 1 
ATOM 2000  N N   . GLN A 1 277 ? 15.061  30.849  236.661 1.00 60.53  ? 277 GLN 1 N   1 
ATOM 2001  C CA  . GLN A 1 277 ? 15.071  31.027  235.227 1.00 54.70  ? 277 GLN 1 CA  1 
ATOM 2002  C C   . GLN A 1 277 ? 14.018  30.108  234.655 1.00 52.09  ? 277 GLN 1 C   1 
ATOM 2003  O O   . GLN A 1 277 ? 13.770  29.044  235.218 1.00 55.08  ? 277 GLN 1 O   1 
ATOM 2004  C CB  . GLN A 1 277 ? 16.438  30.637  234.646 1.00 60.20  ? 277 GLN 1 CB  1 
ATOM 2005  C CG  . GLN A 1 277 ? 17.606  31.556  234.960 1.00 63.62  ? 277 GLN 1 CG  1 
ATOM 2006  C CD  . GLN A 1 277 ? 18.931  30.942  234.527 1.00 87.39  ? 277 GLN 1 CD  1 
ATOM 2007  O OE1 . GLN A 1 277 ? 19.340  31.054  233.374 1.00 108.12 ? 277 GLN 1 OE1 1 
ATOM 2008  N NE2 . GLN A 1 277 ? 19.608  30.288  235.457 1.00 90.97  ? 277 GLN 1 NE2 1 
ATOM 2009  N N   . GLN A 1 278 ? 13.378  30.533  233.570 1.00 48.81  ? 278 GLN 1 N   1 
ATOM 2010  C CA  . GLN A 1 278 ? 12.390  29.701  232.878 1.00 50.17  ? 278 GLN 1 CA  1 
ATOM 2011  C C   . GLN A 1 278 ? 12.484  29.927  231.353 1.00 46.82  ? 278 GLN 1 C   1 
ATOM 2012  O O   . GLN A 1 278 ? 13.037  30.926  230.869 1.00 44.02  ? 278 GLN 1 O   1 
ATOM 2013  C CB  . GLN A 1 278 ? 10.968  29.904  233.435 1.00 46.09  ? 278 GLN 1 CB  1 
ATOM 2014  C CG  . GLN A 1 278 ? 10.456  31.320  233.324 1.00 68.67  ? 278 GLN 1 CG  1 
ATOM 2015  C CD  . GLN A 1 278 ? 9.382   31.693  234.350 1.00 70.31  ? 278 GLN 1 CD  1 
ATOM 2016  O OE1 . GLN A 1 278 ? 9.652   32.428  235.314 1.00 52.10  ? 278 GLN 1 OE1 1 
ATOM 2017  N NE2 . GLN A 1 278 ? 8.151   31.259  234.106 1.00 66.10  ? 278 GLN 1 NE2 1 
ATOM 2018  N N   . TRP A 1 279 ? 12.048  28.927  230.616 1.00 34.20  ? 279 TRP 1 N   1 
ATOM 2019  C CA  . TRP A 1 279 ? 12.080  28.915  229.173 1.00 43.07  ? 279 TRP 1 CA  1 
ATOM 2020  C C   . TRP A 1 279 ? 11.202  29.915  228.417 1.00 54.43  ? 279 TRP 1 C   1 
ATOM 2021  O O   . TRP A 1 279 ? 9.981   29.762  228.461 1.00 67.20  ? 279 TRP 1 O   1 
ATOM 2022  C CB  . TRP A 1 279 ? 11.616  27.535  228.716 1.00 48.24  ? 279 TRP 1 CB  1 
ATOM 2023  C CG  . TRP A 1 279 ? 12.499  26.399  229.074 1.00 56.31  ? 279 TRP 1 CG  1 
ATOM 2024  C CD1 . TRP A 1 279 ? 12.124  25.185  229.583 1.00 65.29  ? 279 TRP 1 CD1 1 
ATOM 2025  C CD2 . TRP A 1 279 ? 13.896  26.317  228.842 1.00 57.76  ? 279 TRP 1 CD2 1 
ATOM 2026  N NE1 . TRP A 1 279 ? 13.206  24.346  229.663 1.00 66.52  ? 279 TRP 1 NE1 1 
ATOM 2027  C CE2 . TRP A 1 279 ? 14.307  25.025  229.209 1.00 64.35  ? 279 TRP 1 CE2 1 
ATOM 2028  C CE3 . TRP A 1 279 ? 14.841  27.209  228.342 1.00 55.43  ? 279 TRP 1 CE3 1 
ATOM 2029  C CZ2 . TRP A 1 279 ? 15.621  24.614  229.090 1.00 69.57  ? 279 TRP 1 CZ2 1 
ATOM 2030  C CZ3 . TRP A 1 279 ? 16.130  26.801  228.225 1.00 56.95  ? 279 TRP 1 CZ3 1 
ATOM 2031  C CH2 . TRP A 1 279 ? 16.515  25.517  228.593 1.00 60.60  ? 279 TRP 1 CH2 1 
ATOM 2032  N N   . LYS A 1 280 ? 11.764  30.901  227.698 1.00 52.04  ? 280 LYS 1 N   1 
ATOM 2033  C CA  . LYS A 1 280 ? 10.872  31.767  226.904 1.00 43.18  ? 280 LYS 1 CA  1 
ATOM 2034  C C   . LYS A 1 280 ? 10.697  31.247  225.491 1.00 36.29  ? 280 LYS 1 C   1 
ATOM 2035  O O   . LYS A 1 280 ? 11.653  30.795  224.838 1.00 35.64  ? 280 LYS 1 O   1 
ATOM 2036  C CB  . LYS A 1 280 ? 11.261  33.240  226.822 1.00 23.85  ? 280 LYS 1 CB  1 
ATOM 2037  C CG  . LYS A 1 280 ? 10.137  34.064  226.091 1.00 20.96  ? 280 LYS 1 CG  1 
ATOM 2038  C CD  . LYS A 1 280 ? 9.889   35.499  226.703 1.00 46.11  ? 280 LYS 1 CD  1 
ATOM 2039  C CE  . LYS A 1 280 ? 8.386   35.852  226.974 1.00 59.95  ? 280 LYS 1 CE  1 
ATOM 2040  N NZ  . LYS A 1 280 ? 7.454   35.835  225.770 1.00 64.66  ? 280 LYS 1 NZ  1 
ATOM 2041  N N   . GLY A 1 281 ? 9.458   31.296  225.032 1.00 32.58  ? 281 GLY 1 N   1 
ATOM 2042  C CA  . GLY A 1 281 ? 9.162   30.844  223.693 1.00 34.42  ? 281 GLY 1 CA  1 
ATOM 2043  C C   . GLY A 1 281 ? 8.522   31.972  222.918 1.00 37.81  ? 281 GLY 1 C   1 
ATOM 2044  O O   . GLY A 1 281 ? 8.263   33.067  223.459 1.00 45.64  ? 281 GLY 1 O   1 
ATOM 2045  N N   . LEU A 1 282 ? 8.193   31.673  221.674 1.00 18.18  ? 282 LEU 1 N   1 
ATOM 2046  C CA  . LEU A 1 282 ? 7.593   32.637  220.781 1.00 19.49  ? 282 LEU 1 CA  1 
ATOM 2047  C C   . LEU A 1 282 ? 6.954   31.869  219.680 1.00 33.76  ? 282 LEU 1 C   1 
ATOM 2048  O O   . LEU A 1 282 ? 7.356   30.751  219.331 1.00 46.08  ? 282 LEU 1 O   1 
ATOM 2049  C CB  . LEU A 1 282 ? 8.649   33.538  220.166 1.00 13.51  ? 282 LEU 1 CB  1 
ATOM 2050  C CG  . LEU A 1 282 ? 8.887   34.764  221.020 1.00 27.73  ? 282 LEU 1 CG  1 
ATOM 2051  C CD1 . LEU A 1 282 ? 10.076  35.569  220.582 1.00 37.33  ? 282 LEU 1 CD1 1 
ATOM 2052  C CD2 . LEU A 1 282 ? 7.647   35.564  220.914 1.00 38.29  ? 282 LEU 1 CD2 1 
ATOM 2053  N N   . PRO A 1 283 ? 5.898   32.427  219.147 1.00 36.13  ? 283 PRO 1 N   1 
ATOM 2054  C CA  . PRO A 1 283 ? 5.153   31.807  218.061 1.00 34.30  ? 283 PRO 1 CA  1 
ATOM 2055  C C   . PRO A 1 283 ? 5.862   31.915  216.722 1.00 32.62  ? 283 PRO 1 C   1 
ATOM 2056  O O   . PRO A 1 283 ? 6.748   32.765  216.517 1.00 38.76  ? 283 PRO 1 O   1 
ATOM 2057  C CB  . PRO A 1 283 ? 3.853   32.573  218.085 1.00 36.53  ? 283 PRO 1 CB  1 
ATOM 2058  C CG  . PRO A 1 283 ? 4.301   33.926  218.540 1.00 45.98  ? 283 PRO 1 CG  1 
ATOM 2059  C CD  . PRO A 1 283 ? 5.221   33.614  219.666 1.00 29.17  ? 283 PRO 1 CD  1 
ATOM 2060  N N   . ARG A 1 284 ? 5.404   31.100  215.787 1.00 15.86  ? 284 ARG 1 N   1 
ATOM 2061  C CA  . ARG A 1 284 ? 6.003   31.061  214.490 1.00 21.60  ? 284 ARG 1 CA  1 
ATOM 2062  C C   . ARG A 1 284 ? 4.927   31.110  213.456 1.00 28.16  ? 284 ARG 1 C   1 
ATOM 2063  O O   . ARG A 1 284 ? 3.876   30.501  213.606 1.00 30.48  ? 284 ARG 1 O   1 
ATOM 2064  C CB  . ARG A 1 284 ? 6.812   29.786  214.340 1.00 33.35  ? 284 ARG 1 CB  1 
ATOM 2065  C CG  . ARG A 1 284 ? 7.179   29.487  212.928 1.00 33.38  ? 284 ARG 1 CG  1 
ATOM 2066  C CD  . ARG A 1 284 ? 8.012   28.253  212.872 1.00 32.12  ? 284 ARG 1 CD  1 
ATOM 2067  N NE  . ARG A 1 284 ? 9.341   28.619  212.426 1.00 48.08  ? 284 ARG 1 NE  1 
ATOM 2068  C CZ  . ARG A 1 284 ? 10.342  28.906  213.246 1.00 38.42  ? 284 ARG 1 CZ  1 
ATOM 2069  N NH1 . ARG A 1 284 ? 10.160  28.841  214.555 1.00 23.15  ? 284 ARG 1 NH1 1 
ATOM 2070  N NH2 . ARG A 1 284 ? 11.492  29.348  212.749 1.00 45.07  ? 284 ARG 1 NH2 1 
ATOM 2071  N N   . TYR A 1 285 ? 5.245   31.817  212.385 1.00 31.37  ? 285 TYR 1 N   1 
ATOM 2072  C CA  . TYR A 1 285 ? 4.366   32.049  211.263 1.00 19.42  ? 285 TYR 1 CA  1 
ATOM 2073  C C   . TYR A 1 285 ? 4.757   31.077  210.202 1.00 20.76  ? 285 TYR 1 C   1 
ATOM 2074  O O   . TYR A 1 285 ? 5.928   30.667  210.124 1.00 20.64  ? 285 TYR 1 O   1 
ATOM 2075  C CB  . TYR A 1 285 ? 4.648   33.476  210.756 1.00 20.51  ? 285 TYR 1 CB  1 
ATOM 2076  C CG  . TYR A 1 285 ? 4.171   33.847  209.368 1.00 16.25  ? 285 TYR 1 CG  1 
ATOM 2077  C CD1 . TYR A 1 285 ? 4.622   33.189  208.236 1.00 26.44  ? 285 TYR 1 CD1 1 
ATOM 2078  C CD2 . TYR A 1 285 ? 3.338   34.930  209.181 1.00 49.24  ? 285 TYR 1 CD2 1 
ATOM 2079  C CE1 . TYR A 1 285 ? 4.259   33.616  206.957 1.00 43.87  ? 285 TYR 1 CE1 1 
ATOM 2080  C CE2 . TYR A 1 285 ? 2.976   35.369  207.901 1.00 53.17  ? 285 TYR 1 CE2 1 
ATOM 2081  C CZ  . TYR A 1 285 ? 3.436   34.716  206.799 1.00 44.78  ? 285 TYR 1 CZ  1 
ATOM 2082  O OH  . TYR A 1 285 ? 3.101   35.180  205.549 1.00 42.85  ? 285 TYR 1 OH  1 
ATOM 2083  N N   . PHE A 1 286 ? 3.813   30.808  209.314 1.00 2.76   ? 286 PHE 1 N   1 
ATOM 2084  C CA  . PHE A 1 286 ? 4.082   29.927  208.198 1.00 20.50  ? 286 PHE 1 CA  1 
ATOM 2085  C C   . PHE A 1 286 ? 3.299   30.384  206.999 1.00 22.20  ? 286 PHE 1 C   1 
ATOM 2086  O O   . PHE A 1 286 ? 2.142   30.758  207.143 1.00 33.15  ? 286 PHE 1 O   1 
ATOM 2087  C CB  . PHE A 1 286 ? 3.604   28.515  208.501 1.00 28.62  ? 286 PHE 1 CB  1 
ATOM 2088  C CG  . PHE A 1 286 ? 4.388   27.827  209.531 1.00 32.14  ? 286 PHE 1 CG  1 
ATOM 2089  C CD1 . PHE A 1 286 ? 4.283   28.191  210.866 1.00 41.43  ? 286 PHE 1 CD1 1 
ATOM 2090  C CD2 . PHE A 1 286 ? 5.250   26.811  209.176 1.00 34.39  ? 286 PHE 1 CD2 1 
ATOM 2091  C CE1 . PHE A 1 286 ? 5.038   27.545  211.832 1.00 35.33  ? 286 PHE 1 CE1 1 
ATOM 2092  C CE2 . PHE A 1 286 ? 6.017   26.155  210.142 1.00 37.94  ? 286 PHE 1 CE2 1 
ATOM 2093  C CZ  . PHE A 1 286 ? 5.912   26.523  211.466 1.00 20.02  ? 286 PHE 1 CZ  1 
ATOM 2094  N N   . LYS A 1 287 ? 3.896   30.320  205.818 1.00 16.19  ? 287 LYS 1 N   1 
ATOM 2095  C CA  . LYS A 1 287 ? 3.168   30.670  204.613 1.00 18.17  ? 287 LYS 1 CA  1 
ATOM 2096  C C   . LYS A 1 287 ? 3.514   29.567  203.649 1.00 21.52  ? 287 LYS 1 C   1 
ATOM 2097  O O   . LYS A 1 287 ? 4.608   29.501  203.065 1.00 35.13  ? 287 LYS 1 O   1 
ATOM 2098  C CB  . LYS A 1 287 ? 3.547   32.053  204.089 1.00 17.91  ? 287 LYS 1 CB  1 
ATOM 2099  C CG  . LYS A 1 287 ? 3.100   32.363  202.634 1.00 33.98  ? 287 LYS 1 CG  1 
ATOM 2100  C CD  . LYS A 1 287 ? 3.185   33.882  202.291 1.00 36.08  ? 287 LYS 1 CD  1 
ATOM 2101  C CE  . LYS A 1 287 ? 2.920   34.206  200.808 1.00 52.38  ? 287 LYS 1 CE  1 
ATOM 2102  N NZ  . LYS A 1 287 ? 2.512   35.645  200.555 1.00 89.14  ? 287 LYS 1 NZ  1 
ATOM 2103  N N   . ILE A 1 288 ? 2.630   28.596  203.623 1.00 11.52  ? 288 ILE 1 N   1 
ATOM 2104  C CA  . ILE A 1 288 ? 2.858   27.472  202.757 1.00 18.78  ? 288 ILE 1 CA  1 
ATOM 2105  C C   . ILE A 1 288 ? 2.102   27.722  201.502 1.00 23.88  ? 288 ILE 1 C   1 
ATOM 2106  O O   . ILE A 1 288 ? 0.938   28.131  201.509 1.00 32.45  ? 288 ILE 1 O   1 
ATOM 2107  C CB  . ILE A 1 288 ? 2.364   26.154  203.294 1.00 14.86  ? 288 ILE 1 CB  1 
ATOM 2108  C CG1 . ILE A 1 288 ? 3.008   25.824  204.644 1.00 16.36  ? 288 ILE 1 CG1 1 
ATOM 2109  C CG2 . ILE A 1 288 ? 2.687   25.095  202.255 1.00 8.41   ? 288 ILE 1 CG2 1 
ATOM 2110  C CD1 . ILE A 1 288 ? 2.684   26.787  205.774 1.00 11.66  ? 288 ILE 1 CD1 1 
ATOM 2111  N N   . THR A 1 289 ? 2.733   27.310  200.436 1.00 16.10  ? 289 THR 1 N   1 
ATOM 2112  C CA  . THR A 1 289 ? 2.215   27.501  199.130 1.00 17.57  ? 289 THR 1 CA  1 
ATOM 2113  C C   . THR A 1 289 ? 1.963   26.093  198.660 1.00 25.08  ? 289 THR 1 C   1 
ATOM 2114  O O   . THR A 1 289 ? 2.881   25.280  198.643 1.00 46.11  ? 289 THR 1 O   1 
ATOM 2115  C CB  . THR A 1 289 ? 3.322   28.156  198.345 1.00 36.42  ? 289 THR 1 CB  1 
ATOM 2116  O OG1 . THR A 1 289 ? 4.084   29.017  199.227 1.00 45.32  ? 289 THR 1 OG1 1 
ATOM 2117  C CG2 . THR A 1 289 ? 2.768   28.943  197.213 1.00 30.40  ? 289 THR 1 CG2 1 
ATOM 2118  N N   . LEU A 1 290 ? 0.719   25.790  198.322 1.00 23.75  ? 290 LEU 1 N   1 
ATOM 2119  C CA  . LEU A 1 290 ? 0.335   24.449  197.891 1.00 19.82  ? 290 LEU 1 CA  1 
ATOM 2120  C C   . LEU A 1 290 ? -0.094  24.458  196.489 1.00 21.30  ? 290 LEU 1 C   1 
ATOM 2121  O O   . LEU A 1 290 ? -0.547  25.484  195.992 1.00 37.44  ? 290 LEU 1 O   1 
ATOM 2122  C CB  . LEU A 1 290 ? -0.852  23.965  198.698 1.00 2.00   ? 290 LEU 1 CB  1 
ATOM 2123  C CG  . LEU A 1 290 ? -0.347  24.168  200.114 1.00 27.11  ? 290 LEU 1 CG  1 
ATOM 2124  C CD1 . LEU A 1 290 ? -1.440  24.405  201.094 1.00 26.27  ? 290 LEU 1 CD1 1 
ATOM 2125  C CD2 . LEU A 1 290 ? 0.491   22.981  200.482 1.00 37.27  ? 290 LEU 1 CD2 1 
ATOM 2126  N N   . ARG A 1 291 ? -0.040  23.291  195.872 1.00 20.74  ? 291 ARG 1 N   1 
ATOM 2127  C CA  . ARG A 1 291 ? -0.493  23.160  194.498 1.00 32.60  ? 291 ARG 1 CA  1 
ATOM 2128  C C   . ARG A 1 291 ? -1.088  21.763  194.297 1.00 40.18  ? 291 ARG 1 C   1 
ATOM 2129  O O   . ARG A 1 291 ? -1.024  20.881  195.187 1.00 38.71  ? 291 ARG 1 O   1 
ATOM 2130  C CB  . ARG A 1 291 ? 0.629   23.411  193.508 1.00 16.48  ? 291 ARG 1 CB  1 
ATOM 2131  C CG  . ARG A 1 291 ? 1.716   22.389  193.660 1.00 62.28  ? 291 ARG 1 CG  1 
ATOM 2132  C CD  . ARG A 1 291 ? 2.708   22.334  192.504 1.00 72.80  ? 291 ARG 1 CD  1 
ATOM 2133  N NE  . ARG A 1 291 ? 3.671   21.252  192.739 1.00 89.54  ? 291 ARG 1 NE  1 
ATOM 2134  C CZ  . ARG A 1 291 ? 4.924   21.221  192.287 1.00 90.61  ? 291 ARG 1 CZ  1 
ATOM 2135  N NH1 . ARG A 1 291 ? 5.394   22.220  191.555 1.00 89.92  ? 291 ARG 1 NH1 1 
ATOM 2136  N NH2 . ARG A 1 291 ? 5.724   20.204  192.603 1.00 96.36  ? 291 ARG 1 NH2 1 
ATOM 2137  N N   . LYS A 1 292 ? -1.685  21.582  193.128 1.00 39.68  ? 292 LYS 1 N   1 
ATOM 2138  C CA  . LYS A 1 292 ? -2.330  20.331  192.788 1.00 51.02  ? 292 LYS 1 CA  1 
ATOM 2139  C C   . LYS A 1 292 ? -1.442  19.352  192.013 1.00 55.24  ? 292 LYS 1 C   1 
ATOM 2140  O O   . LYS A 1 292 ? -1.090  19.571  190.831 1.00 55.53  ? 292 LYS 1 O   1 
ATOM 2141  C CB  . LYS A 1 292 ? -3.652  20.619  192.045 1.00 62.20  ? 292 LYS 1 CB  1 
ATOM 2142  C CG  . LYS A 1 292 ? -4.742  21.250  192.944 1.00 70.40  ? 292 LYS 1 CG  1 
ATOM 2143  C CD  . LYS A 1 292 ? -6.047  21.641  192.204 1.00 67.95  ? 292 LYS 1 CD  1 
ATOM 2144  C CE  . LYS A 1 292 ? -6.977  22.438  193.151 1.00 63.03  ? 292 LYS 1 CE  1 
ATOM 2145  N NZ  . LYS A 1 292 ? -8.388  22.635  192.685 1.00 71.32  ? 292 LYS 1 NZ  1 
ATOM 2146  N N   . ARG A 1 293 ? -1.113  18.245  192.674 1.00 46.21  ? 293 ARG 1 N   1 
ATOM 2147  C CA  . ARG A 1 293 ? -0.272  17.248  192.042 1.00 47.81  ? 293 ARG 1 CA  1 
ATOM 2148  C C   . ARG A 1 293 ? -1.037  16.028  191.575 1.00 47.42  ? 293 ARG 1 C   1 
ATOM 2149  O O   . ARG A 1 293 ? -1.783  15.423  192.341 1.00 40.06  ? 293 ARG 1 O   1 
ATOM 2150  C CB  . ARG A 1 293 ? 0.873   16.827  192.978 1.00 48.62  ? 293 ARG 1 CB  1 
ATOM 2151  C CG  . ARG A 1 293 ? 2.045   16.103  192.274 1.00 60.83  ? 293 ARG 1 CG  1 
ATOM 2152  C CD  . ARG A 1 293 ? 2.427   16.811  190.954 1.00 77.63  ? 293 ARG 1 CD  1 
ATOM 2153  N NE  . ARG A 1 293 ? 3.763   16.491  190.421 1.00 75.40  ? 293 ARG 1 NE  1 
ATOM 2154  C CZ  . ARG A 1 293 ? 4.925   16.754  191.039 1.00 63.08  ? 293 ARG 1 CZ  1 
ATOM 2155  N NH1 . ARG A 1 293 ? 4.946   17.320  192.235 1.00 31.41  ? 293 ARG 1 NH1 1 
ATOM 2156  N NH2 . ARG A 1 293 ? 6.085   16.550  190.416 1.00 69.92  ? 293 ARG 1 NH2 1 
ATOM 2157  N N   . SER A 1 294 ? -0.900  15.716  190.292 1.00 49.41  ? 294 SER 1 N   1 
ATOM 2158  C CA  . SER A 1 294 ? -1.526  14.527  189.719 1.00 53.83  ? 294 SER 1 CA  1 
ATOM 2159  C C   . SER A 1 294 ? -0.689  13.327  190.157 1.00 55.59  ? 294 SER 1 C   1 
ATOM 2160  O O   . SER A 1 294 ? 0.551   13.353  190.142 1.00 60.59  ? 294 SER 1 O   1 
ATOM 2161  C CB  . SER A 1 294 ? -1.543  14.635  188.199 1.00 60.28  ? 294 SER 1 CB  1 
ATOM 2162  O OG  . SER A 1 294 ? -0.562  15.586  187.779 1.00 100.91 ? 294 SER 1 OG  1 
ATOM 2163  N N   . VAL A 1 295 ? -1.368  12.273  190.554 1.00 62.02  ? 295 VAL 1 N   1 
ATOM 2164  C CA  . VAL A 1 295 ? -0.701  11.072  191.014 1.00 68.83  ? 295 VAL 1 CA  1 
ATOM 2165  C C   . VAL A 1 295 ? -1.419  9.881   190.405 1.00 81.89  ? 295 VAL 1 C   1 
ATOM 2166  O O   . VAL A 1 295 ? -2.374  10.076  189.627 1.00 86.76  ? 295 VAL 1 O   1 
ATOM 2167  C CB  . VAL A 1 295 ? -0.682  10.990  192.558 1.00 62.85  ? 295 VAL 1 CB  1 
ATOM 2168  C CG1 . VAL A 1 295 ? 0.687   11.360  193.058 1.00 77.85  ? 295 VAL 1 CG1 1 
ATOM 2169  C CG2 . VAL A 1 295 ? -1.694  11.942  193.178 1.00 65.29  ? 295 VAL 1 CG2 1 
ATOM 2170  N N   . LYS A 1 296 ? -0.938  8.662   190.670 1.00 92.56  ? 296 LYS 1 N   1 
ATOM 2171  C CA  . LYS A 1 296 ? -1.596  7.509   190.073 1.00 114.48 ? 296 LYS 1 CA  1 
ATOM 2172  C C   . LYS A 1 296 ? -2.719  6.735   190.801 1.00 126.59 ? 296 LYS 1 C   1 
ATOM 2173  O O   . LYS A 1 296 ? -3.871  7.169   190.750 1.00 132.71 ? 296 LYS 1 O   1 
ATOM 2174  C CB  . LYS A 1 296 ? -0.607  6.583   189.365 1.00 108.84 ? 296 LYS 1 CB  1 
ATOM 2175  C CG  . LYS A 1 296 ? -1.249  5.942   188.117 1.00 129.45 ? 296 LYS 1 CG  1 
ATOM 2176  C CD  . LYS A 1 296 ? -2.335  6.864   187.415 1.00 147.92 ? 296 LYS 1 CD  1 
ATOM 2177  C CE  . LYS A 1 296 ? -3.785  6.303   187.584 1.00 155.52 ? 296 LYS 1 CE  1 
ATOM 2178  N NZ  . LYS A 1 296 ? -4.964  7.050   186.999 1.00 153.31 ? 296 LYS 1 NZ  1 
ATOM 2179  N N   . ASN A 1 297 ? -2.436  5.594   191.430 1.00 136.71 ? 297 ASN 1 N   1 
ATOM 2180  C CA  . ASN A 1 297 ? -3.517  4.820   192.080 1.00 145.64 ? 297 ASN 1 CA  1 
ATOM 2181  C C   . ASN A 1 297 ? -3.294  4.443   193.546 1.00 145.90 ? 297 ASN 1 C   1 
ATOM 2182  O O   . ASN A 1 297 ? -2.568  3.490   193.834 1.00 144.67 ? 297 ASN 1 O   1 
ATOM 2183  C CB  . ASN A 1 297 ? -3.782  3.522   191.306 1.00 164.06 ? 297 ASN 1 CB  1 
ATOM 2184  C CG  . ASN A 1 297 ? -4.734  3.700   190.127 1.00 181.10 ? 297 ASN 1 CG  1 
ATOM 2185  O OD1 . ASN A 1 297 ? -5.627  4.557   190.145 1.00 187.74 ? 297 ASN 1 OD1 1 
ATOM 2186  N ND2 . ASN A 1 297 ? -4.572  2.849   189.109 1.00 186.10 ? 297 ASN 1 ND2 1 
ATOM 2187  N N   . PRO A 1 298 ? -3.998  5.115   194.476 1.00 147.65 ? 298 PRO 1 N   1 
ATOM 2188  C CA  . PRO A 1 298 ? -3.844  4.817   195.910 1.00 150.26 ? 298 PRO 1 CA  1 
ATOM 2189  C C   . PRO A 1 298 ? -4.341  3.420   196.381 1.00 152.10 ? 298 PRO 1 C   1 
ATOM 2190  O O   . PRO A 1 298 ? -3.580  2.653   196.980 1.00 156.68 ? 298 PRO 1 O   1 
ATOM 2191  C CB  . PRO A 1 298 ? -4.576  5.994   196.590 1.00 144.10 ? 298 PRO 1 CB  1 
ATOM 2192  C CG  . PRO A 1 298 ? -5.601  6.419   195.566 1.00 147.56 ? 298 PRO 1 CG  1 
ATOM 2193  C CD  . PRO A 1 298 ? -4.883  6.274   194.247 1.00 146.26 ? 298 PRO 1 CD  1 
ATOM 2194  N N   . TYR A 1 299 ? -5.599  3.091   196.066 1.00 143.87 ? 299 TYR 1 N   1 
ATOM 2195  C CA  . TYR A 1 299 ? -6.238  1.815   196.432 1.00 139.42 ? 299 TYR 1 CA  1 
ATOM 2196  C C   . TYR A 1 299 ? -6.987  1.238   195.212 1.00 151.31 ? 299 TYR 1 C   1 
ATOM 2197  O O   . TYR A 1 299 ? -8.151  0.842   195.339 1.00 156.01 ? 299 TYR 1 O   1 
ATOM 2198  C CB  . TYR A 1 299 ? -7.252  2.044   197.579 1.00 126.22 ? 299 TYR 1 CB  1 
ATOM 2199  C CG  . TYR A 1 299 ? -7.780  3.471   197.709 1.00 126.12 ? 299 TYR 1 CG  1 
ATOM 2200  C CD1 . TYR A 1 299 ? -7.708  4.383   196.643 1.00 131.76 ? 299 TYR 1 CD1 1 
ATOM 2201  C CD2 . TYR A 1 299 ? -8.241  3.949   198.936 1.00 125.23 ? 299 TYR 1 CD2 1 
ATOM 2202  C CE1 . TYR A 1 299 ? -8.060  5.751   196.804 1.00 139.88 ? 299 TYR 1 CE1 1 
ATOM 2203  C CE2 . TYR A 1 299 ? -8.596  5.315   199.114 1.00 136.20 ? 299 TYR 1 CE2 1 
ATOM 2204  C CZ  . TYR A 1 299 ? -8.491  6.216   198.045 1.00 142.71 ? 299 TYR 1 CZ  1 
ATOM 2205  O OH  . TYR A 1 299 ? -8.735  7.577   198.231 1.00 136.68 ? 299 TYR 1 OH  1 
ATOM 2206  N N   . PRO A 1 300 ? -6.291  1.097   194.047 1.00 160.02 ? 300 PRO 1 N   1 
ATOM 2207  C CA  . PRO A 1 300 ? -6.881  0.574   192.791 1.00 161.81 ? 300 PRO 1 CA  1 
ATOM 2208  C C   . PRO A 1 300 ? -7.322  -0.894  192.786 1.00 163.65 ? 300 PRO 1 C   1 
ATOM 2209  O O   . PRO A 1 300 ? -8.216  -1.280  193.548 1.00 172.47 ? 300 PRO 1 O   1 
ATOM 2210  C CB  . PRO A 1 300 ? -5.752  0.809   191.791 1.00 157.59 ? 300 PRO 1 CB  1 
ATOM 2211  C CG  . PRO A 1 300 ? -4.530  0.510   192.624 1.00 157.57 ? 300 PRO 1 CG  1 
ATOM 2212  C CD  . PRO A 1 300 ? -4.830  1.218   193.930 1.00 156.93 ? 300 PRO 1 CD  1 
ATOM 2213  N N   . ILE A 1 301 ? -6.775  -1.692  191.881 1.00 155.11 ? 301 ILE 1 N   1 
ATOM 2214  C CA  . ILE A 1 301 ? -7.119  -3.103  191.863 1.00 146.27 ? 301 ILE 1 CA  1 
ATOM 2215  C C   . ILE A 1 301 ? -6.710  -3.621  193.245 1.00 160.72 ? 301 ILE 1 C   1 
ATOM 2216  O O   . ILE A 1 301 ? -5.640  -3.244  193.769 1.00 162.73 ? 301 ILE 1 O   1 
ATOM 2217  C CB  . ILE A 1 301 ? -6.363  -3.881  190.745 1.00 121.20 ? 301 ILE 1 CB  1 
ATOM 2218  C CG1 . ILE A 1 301 ? -6.828  -5.332  190.689 1.00 110.39 ? 301 ILE 1 CG1 1 
ATOM 2219  C CG2 . ILE A 1 301 ? -4.862  -3.769  190.882 1.00 116.62 ? 301 ILE 1 CG2 1 
ATOM 2220  C CD1 . ILE A 1 301 ? -8.270  -5.458  190.277 1.00 105.82 ? 301 ILE 1 CD1 1 
ATOM 2221  N N   . SER A 1 302 ? -7.591  -4.400  193.877 1.00 172.07 ? 302 SER 1 N   1 
ATOM 2222  C CA  . SER A 1 302 ? -7.274  -4.942  195.195 1.00 187.80 ? 302 SER 1 CA  1 
ATOM 2223  C C   . SER A 1 302 ? -7.909  -6.281  195.584 1.00 187.26 ? 302 SER 1 C   1 
ATOM 2224  O O   . SER A 1 302 ? -8.931  -6.739  195.031 1.00 180.71 ? 302 SER 1 O   1 
ATOM 2225  C CB  . SER A 1 302 ? -7.492  -3.895  196.305 1.00 195.46 ? 302 SER 1 CB  1 
ATOM 2226  O OG  . SER A 1 302 ? -6.644  -4.151  197.422 1.00 201.25 ? 302 SER 1 OG  1 
ATOM 2227  N N   . PHE A 1 303 ? -7.231  -6.893  196.548 1.00 183.09 ? 303 PHE 1 N   1 
ATOM 2228  C CA  . PHE A 1 303 ? -7.579  -8.178  197.115 1.00 182.26 ? 303 PHE 1 CA  1 
ATOM 2229  C C   . PHE A 1 303 ? -7.780  -7.976  198.632 1.00 177.85 ? 303 PHE 1 C   1 
ATOM 2230  O O   . PHE A 1 303 ? -8.924  -7.935  199.116 1.00 174.76 ? 303 PHE 1 O   1 
ATOM 2231  C CB  . PHE A 1 303 ? -6.435  -9.166  196.802 1.00 177.64 ? 303 PHE 1 CB  1 
ATOM 2232  C CG  . PHE A 1 303 ? -6.532  -10.487 197.518 1.00 181.68 ? 303 PHE 1 CG  1 
ATOM 2233  C CD1 . PHE A 1 303 ? -7.641  -11.325 197.344 1.00 179.97 ? 303 PHE 1 CD1 1 
ATOM 2234  C CD2 . PHE A 1 303 ? -5.492  -10.906 198.356 1.00 181.19 ? 303 PHE 1 CD2 1 
ATOM 2235  C CE1 . PHE A 1 303 ? -7.713  -12.570 198.001 1.00 180.12 ? 303 PHE 1 CE1 1 
ATOM 2236  C CE2 . PHE A 1 303 ? -5.549  -12.145 199.018 1.00 181.69 ? 303 PHE 1 CE2 1 
ATOM 2237  C CZ  . PHE A 1 303 ? -6.663  -12.982 198.839 1.00 178.51 ? 303 PHE 1 CZ  1 
ATOM 2238  N N   . LEU A 1 304 ? -6.677  -7.757  199.353 1.00 166.92 ? 304 LEU 1 N   1 
ATOM 2239  C CA  . LEU A 1 304 ? -6.710  -7.570  200.806 1.00 159.30 ? 304 LEU 1 CA  1 
ATOM 2240  C C   . LEU A 1 304 ? -6.592  -6.094  201.209 1.00 166.46 ? 304 LEU 1 C   1 
ATOM 2241  O O   . LEU A 1 304 ? -6.904  -5.195  200.419 1.00 162.72 ? 304 LEU 1 O   1 
ATOM 2242  C CB  . LEU A 1 304 ? -5.589  -8.406  201.465 1.00 135.20 ? 304 LEU 1 CB  1 
ATOM 2243  C CG  . LEU A 1 304 ? -4.116  -7.958  201.479 1.00 116.55 ? 304 LEU 1 CG  1 
ATOM 2244  C CD1 . LEU A 1 304 ? -3.219  -9.130  201.844 1.00 105.18 ? 304 LEU 1 CD1 1 
ATOM 2245  C CD2 . LEU A 1 304 ? -3.703  -7.395  200.142 1.00 105.51 ? 304 LEU 1 CD2 1 
ATOM 2246  N N   . LEU A 1 305 ? -6.205  -5.865  202.466 1.00 171.77 ? 305 LEU 1 N   1 
ATOM 2247  C CA  . LEU A 1 305 ? -5.998  -4.514  202.994 1.00 176.90 ? 305 LEU 1 CA  1 
ATOM 2248  C C   . LEU A 1 305 ? -4.875  -3.912  202.122 1.00 183.26 ? 305 LEU 1 C   1 
ATOM 2249  O O   . LEU A 1 305 ? -5.109  -2.956  201.371 1.00 182.12 ? 305 LEU 1 O   1 
ATOM 2250  C CB  . LEU A 1 305 ? -5.568  -4.563  204.484 1.00 168.77 ? 305 LEU 1 CB  1 
ATOM 2251  C CG  . LEU A 1 305 ? -6.375  -5.270  205.601 1.00 161.63 ? 305 LEU 1 CG  1 
ATOM 2252  C CD1 . LEU A 1 305 ? -7.833  -4.797  205.607 1.00 150.19 ? 305 LEU 1 CD1 1 
ATOM 2253  C CD2 . LEU A 1 305 ? -6.302  -6.802  205.481 1.00 145.03 ? 305 LEU 1 CD2 1 
ATOM 2254  N N   . SER A 1 306 ? -3.687  -4.527  202.209 1.00 184.66 ? 306 SER 1 N   1 
ATOM 2255  C CA  . SER A 1 306 ? -2.466  -4.175  201.453 1.00 186.25 ? 306 SER 1 CA  1 
ATOM 2256  C C   . SER A 1 306 ? -1.167  -4.682  202.119 1.00 187.24 ? 306 SER 1 C   1 
ATOM 2257  O O   . SER A 1 306 ? -1.106  -4.864  203.349 1.00 185.39 ? 306 SER 1 O   1 
ATOM 2258  C CB  . SER A 1 306 ? -2.347  -2.659  201.191 1.00 178.81 ? 306 SER 1 CB  1 
ATOM 2259  O OG  . SER A 1 306 ? -2.815  -2.310  199.887 1.00 167.42 ? 306 SER 1 OG  1 
ATOM 2260  N N   . ASP A 1 307 ? -0.159  -4.948  201.282 1.00 182.98 ? 307 ASP 1 N   1 
ATOM 2261  C CA  . ASP A 1 307 ? 1.173   -5.401  201.718 1.00 179.79 ? 307 ASP 1 CA  1 
ATOM 2262  C C   . ASP A 1 307 ? 2.209   -4.945  200.684 1.00 179.98 ? 307 ASP 1 C   1 
ATOM 2263  O O   . ASP A 1 307 ? 1.853   -4.587  199.545 1.00 170.51 ? 307 ASP 1 O   1 
ATOM 2264  C CB  . ASP A 1 307 ? 1.255   -6.931  201.916 1.00 173.08 ? 307 ASP 1 CB  1 
ATOM 2265  C CG  . ASP A 1 307 ? 2.616   -7.387  202.494 1.00 168.69 ? 307 ASP 1 CG  1 
ATOM 2266  O OD1 . ASP A 1 307 ? 2.906   -7.080  203.674 1.00 161.94 ? 307 ASP 1 OD1 1 
ATOM 2267  O OD2 . ASP A 1 307 ? 3.404   -8.037  201.766 1.00 159.66 ? 307 ASP 1 OD2 1 
ATOM 2268  N N   . LEU A 1 308 ? 3.479   -4.956  201.100 1.00 180.23 ? 308 LEU 1 N   1 
ATOM 2269  C CA  . LEU A 1 308 ? 4.609   -4.522  200.270 1.00 181.81 ? 308 LEU 1 CA  1 
ATOM 2270  C C   . LEU A 1 308 ? 5.963   -5.230  200.550 1.00 185.78 ? 308 LEU 1 C   1 
ATOM 2271  O O   . LEU A 1 308 ? 6.443   -6.050  199.749 1.00 187.35 ? 308 LEU 1 O   1 
ATOM 2272  C CB  . LEU A 1 308 ? 4.793   -2.983  200.399 1.00 176.01 ? 308 LEU 1 CB  1 
ATOM 2273  C CG  . LEU A 1 308 ? 4.436   -2.242  201.713 1.00 167.41 ? 308 LEU 1 CG  1 
ATOM 2274  C CD1 . LEU A 1 308 ? 5.453   -1.139  202.043 1.00 159.57 ? 308 LEU 1 CD1 1 
ATOM 2275  C CD2 . LEU A 1 308 ? 3.022   -1.657  201.619 1.00 160.27 ? 308 LEU 1 CD2 1 
ATOM 2276  N N   . ILE A 1 309 ? 6.550   -4.885  201.698 1.00 183.48 ? 309 ILE 1 N   1 
ATOM 2277  C CA  . ILE A 1 309 ? 7.855   -5.354  202.177 1.00 173.28 ? 309 ILE 1 CA  1 
ATOM 2278  C C   . ILE A 1 309 ? 8.263   -6.842  201.974 1.00 172.15 ? 309 ILE 1 C   1 
ATOM 2279  O O   . ILE A 1 309 ? 7.423   -7.739  201.800 1.00 169.53 ? 309 ILE 1 O   1 
ATOM 2280  C CB  . ILE A 1 309 ? 8.054   -4.850  203.669 1.00 169.44 ? 309 ILE 1 CB  1 
ATOM 2281  C CG1 . ILE A 1 309 ? 9.535   -4.676  204.026 1.00 161.55 ? 309 ILE 1 CG1 1 
ATOM 2282  C CG2 . ILE A 1 309 ? 7.333   -5.751  204.651 1.00 168.47 ? 309 ILE 1 CG2 1 
ATOM 2283  C CD1 . ILE A 1 309 ? 9.768   -3.847  205.293 1.00 153.94 ? 309 ILE 1 CD1 1 
ATOM 2284  N N   . ASN A 1 310 ? 9.584   -7.053  201.973 1.00 170.26 ? 310 ASN 1 N   1 
ATOM 2285  C CA  . ASN A 1 310 ? 10.247  -8.357  201.795 1.00 163.51 ? 310 ASN 1 CA  1 
ATOM 2286  C C   . ASN A 1 310 ? 9.677   -9.456  202.682 1.00 165.80 ? 310 ASN 1 C   1 
ATOM 2287  O O   . ASN A 1 310 ? 9.391   -10.567 202.226 1.00 164.55 ? 310 ASN 1 O   1 
ATOM 2288  C CB  . ASN A 1 310 ? 11.754  -8.214  202.119 1.00 161.93 ? 310 ASN 1 CB  1 
ATOM 2289  C CG  . ASN A 1 310 ? 12.060  -8.264  203.642 1.00 159.90 ? 310 ASN 1 CG  1 
ATOM 2290  O OD1 . ASN A 1 310 ? 12.473  -9.303  204.153 1.00 161.81 ? 310 ASN 1 OD1 1 
ATOM 2291  N ND2 . ASN A 1 310 ? 11.787  -7.170  204.367 1.00 148.29 ? 310 ASN 1 ND2 1 
ATOM 2292  N N   . ARG A 1 311 ? 9.580   -9.115  203.966 1.00 165.08 ? 311 ARG 1 N   1 
ATOM 2293  C CA  . ARG A 1 311 ? 9.110   -9.971  205.038 1.00 160.12 ? 311 ARG 1 CA  1 
ATOM 2294  C C   . ARG A 1 311 ? 8.417   -9.074  206.060 1.00 155.43 ? 311 ARG 1 C   1 
ATOM 2295  O O   . ARG A 1 311 ? 9.076   -8.483  206.931 1.00 149.07 ? 311 ARG 1 O   1 
ATOM 2296  C CB  . ARG A 1 311 ? 10.305  -10.654 205.728 1.00 162.64 ? 311 ARG 1 CB  1 
ATOM 2297  C CG  . ARG A 1 311 ? 10.543  -12.122 205.377 1.00 170.04 ? 311 ARG 1 CG  1 
ATOM 2298  C CD  . ARG A 1 311 ? 11.994  -12.394 204.939 1.00 182.32 ? 311 ARG 1 CD  1 
ATOM 2299  N NE  . ARG A 1 311 ? 13.012  -11.678 205.723 1.00 193.25 ? 311 ARG 1 NE  1 
ATOM 2300  C CZ  . ARG A 1 311 ? 13.568  -12.115 206.856 1.00 194.19 ? 311 ARG 1 CZ  1 
ATOM 2301  N NH1 . ARG A 1 311 ? 13.213  -13.286 207.376 1.00 196.38 ? 311 ARG 1 NH1 1 
ATOM 2302  N NH2 . ARG A 1 311 ? 14.520  -11.395 207.444 1.00 195.50 ? 311 ARG 1 NH2 1 
ATOM 2303  N N   . ARG A 1 312 ? 7.111   -8.882  205.884 1.00 157.37 ? 312 ARG 1 N   1 
ATOM 2304  C CA  . ARG A 1 312 ? 6.308   -8.113  206.841 1.00 165.38 ? 312 ARG 1 CA  1 
ATOM 2305  C C   . ARG A 1 312 ? 5.982   -9.240  207.829 1.00 167.31 ? 312 ARG 1 C   1 
ATOM 2306  O O   . ARG A 1 312 ? 4.808   -9.515  208.129 1.00 166.18 ? 312 ARG 1 O   1 
ATOM 2307  C CB  . ARG A 1 312 ? 5.014   -7.583  206.186 1.00 164.38 ? 312 ARG 1 CB  1 
ATOM 2308  C CG  . ARG A 1 312 ? 4.187   -6.627  207.064 1.00 165.73 ? 312 ARG 1 CG  1 
ATOM 2309  C CD  . ARG A 1 312 ? 2.714   -6.613  206.647 1.00 167.41 ? 312 ARG 1 CD  1 
ATOM 2310  N NE  . ARG A 1 312 ? 1.806   -6.961  207.746 1.00 173.68 ? 312 ARG 1 NE  1 
ATOM 2311  C CZ  . ARG A 1 312 ? 1.049   -8.061  207.796 1.00 171.66 ? 312 ARG 1 CZ  1 
ATOM 2312  N NH1 . ARG A 1 312 ? 1.082   -8.953  206.808 1.00 167.77 ? 312 ARG 1 NH1 1 
ATOM 2313  N NH2 . ARG A 1 312 ? 0.224   -8.253  208.825 1.00 168.90 ? 312 ARG 1 NH2 1 
ATOM 2314  N N   . THR A 1 313 ? 7.045   -9.922  208.270 1.00 168.55 ? 313 THR 1 N   1 
ATOM 2315  C CA  . THR A 1 313 ? 6.964   -11.065 209.169 1.00 167.88 ? 313 THR 1 CA  1 
ATOM 2316  C C   . THR A 1 313 ? 6.117   -10.779 210.391 1.00 162.36 ? 313 THR 1 C   1 
ATOM 2317  O O   . THR A 1 313 ? 6.622   -10.353 211.443 1.00 169.33 ? 313 THR 1 O   1 
ATOM 2318  C CB  . THR A 1 313 ? 8.384   -11.570 209.609 1.00 174.28 ? 313 THR 1 CB  1 
ATOM 2319  O OG1 . THR A 1 313 ? 9.192   -11.823 208.449 1.00 175.90 ? 313 THR 1 OG1 1 
ATOM 2320  C CG2 . THR A 1 313 ? 8.277   -12.869 210.428 1.00 171.56 ? 313 THR 1 CG2 1 
ATOM 2321  N N   . GLN A 1 314 ? 4.808   -10.891 210.207 1.00 148.99 ? 314 GLN 1 N   1 
ATOM 2322  C CA  . GLN A 1 314 ? 3.922   -10.717 211.323 1.00 139.15 ? 314 GLN 1 CA  1 
ATOM 2323  C C   . GLN A 1 314 ? 4.087   -12.099 211.943 1.00 131.64 ? 314 GLN 1 C   1 
ATOM 2324  O O   . GLN A 1 314 ? 3.483   -13.092 211.528 1.00 135.56 ? 314 GLN 1 O   1 
ATOM 2325  C CB  . GLN A 1 314 ? 2.492   -10.397 210.884 1.00 136.15 ? 314 GLN 1 CB  1 
ATOM 2326  C CG  . GLN A 1 314 ? 2.102   -8.938  211.146 1.00 137.97 ? 314 GLN 1 CG  1 
ATOM 2327  C CD  . GLN A 1 314 ? 2.533   -8.434  212.533 1.00 147.01 ? 314 GLN 1 CD  1 
ATOM 2328  O OE1 . GLN A 1 314 ? 1.943   -8.793  213.567 1.00 140.17 ? 314 GLN 1 OE1 1 
ATOM 2329  N NE2 . GLN A 1 314 ? 3.564   -7.589  212.554 1.00 153.71 ? 314 GLN 1 NE2 1 
ATOM 2330  N N   . ARG A 1 315 ? 5.132   -12.170 212.749 1.00 121.04 ? 315 ARG 1 N   1 
ATOM 2331  C CA  . ARG A 1 315 ? 5.506   -13.373 213.444 1.00 108.37 ? 315 ARG 1 CA  1 
ATOM 2332  C C   . ARG A 1 315 ? 4.448   -13.690 214.467 1.00 88.74  ? 315 ARG 1 C   1 
ATOM 2333  O O   . ARG A 1 315 ? 3.551   -12.900 214.762 1.00 81.30  ? 315 ARG 1 O   1 
ATOM 2334  C CB  . ARG A 1 315 ? 6.826   -13.139 214.197 1.00 136.99 ? 315 ARG 1 CB  1 
ATOM 2335  C CG  . ARG A 1 315 ? 6.669   -12.505 215.623 1.00 172.61 ? 315 ARG 1 CG  1 
ATOM 2336  C CD  . ARG A 1 315 ? 6.187   -11.022 215.646 1.00 194.75 ? 315 ARG 1 CD  1 
ATOM 2337  N NE  . ARG A 1 315 ? 4.902   -10.778 216.337 1.00 212.73 ? 315 ARG 1 NE  1 
ATOM 2338  C CZ  . ARG A 1 315 ? 4.627   -11.053 217.619 1.00 217.99 ? 315 ARG 1 CZ  1 
ATOM 2339  N NH1 . ARG A 1 315 ? 5.541   -11.613 218.413 1.00 220.36 ? 315 ARG 1 NH1 1 
ATOM 2340  N NH2 . ARG A 1 315 ? 3.444   -10.706 218.129 1.00 221.40 ? 315 ARG 1 NH2 1 
ATOM 2341  N N   . VAL A 1 316 ? 4.589   -14.854 215.048 1.00 72.64  ? 316 VAL 1 N   1 
ATOM 2342  C CA  . VAL A 1 316 ? 3.710   -15.248 216.098 1.00 65.62  ? 316 VAL 1 CA  1 
ATOM 2343  C C   . VAL A 1 316 ? 4.530   -16.284 216.813 1.00 76.01  ? 316 VAL 1 C   1 
ATOM 2344  O O   . VAL A 1 316 ? 5.517   -16.850 216.258 1.00 74.71  ? 316 VAL 1 O   1 
ATOM 2345  C CB  . VAL A 1 316 ? 2.422   -15.910 215.611 1.00 62.30  ? 316 VAL 1 CB  1 
ATOM 2346  C CG1 . VAL A 1 316 ? 1.569   -14.857 214.901 1.00 73.34  ? 316 VAL 1 CG1 1 
ATOM 2347  C CG2 . VAL A 1 316 ? 2.708   -17.128 214.714 1.00 51.37  ? 316 VAL 1 CG2 1 
ATOM 2348  N N   . ASP A 1 317 ? 4.186   -16.457 218.077 1.00 76.41  ? 317 ASP 1 N   1 
ATOM 2349  C CA  . ASP A 1 317 ? 4.857   -17.441 218.850 1.00 88.52  ? 317 ASP 1 CA  1 
ATOM 2350  C C   . ASP A 1 317 ? 4.282   -18.673 218.253 1.00 94.59  ? 317 ASP 1 C   1 
ATOM 2351  O O   . ASP A 1 317 ? 4.671   -19.065 217.138 1.00 99.88  ? 317 ASP 1 O   1 
ATOM 2352  C CB  . ASP A 1 317 ? 4.491   -17.305 220.305 1.00 99.57  ? 317 ASP 1 CB  1 
ATOM 2353  C CG  . ASP A 1 317 ? 5.539   -16.563 221.065 1.00 124.58 ? 317 ASP 1 CG  1 
ATOM 2354  O OD1 . ASP A 1 317 ? 6.054   -15.551 220.524 1.00 130.56 ? 317 ASP 1 OD1 1 
ATOM 2355  O OD2 . ASP A 1 317 ? 5.872   -17.013 222.181 1.00 145.14 ? 317 ASP 1 OD2 1 
ATOM 2356  N N   . GLY A 1 318 ? 3.269   -19.203 218.929 1.00 97.46  ? 318 GLY 1 N   1 
ATOM 2357  C CA  . GLY A 1 318 ? 2.605   -20.399 218.450 1.00 101.44 ? 318 GLY 1 CA  1 
ATOM 2358  C C   . GLY A 1 318 ? 3.438   -21.566 217.932 1.00 86.67  ? 318 GLY 1 C   1 
ATOM 2359  O O   . GLY A 1 318 ? 4.544   -21.420 217.392 1.00 80.14  ? 318 GLY 1 O   1 
ATOM 2360  N N   . GLN A 1 319 ? 2.843   -22.742 218.089 1.00 79.76  ? 319 GLN 1 N   1 
ATOM 2361  C CA  . GLN A 1 319 ? 3.422   -23.993 217.668 1.00 63.81  ? 319 GLN 1 CA  1 
ATOM 2362  C C   . GLN A 1 319 ? 4.447   -23.880 216.521 1.00 61.10  ? 319 GLN 1 C   1 
ATOM 2363  O O   . GLN A 1 319 ? 4.305   -23.090 215.564 1.00 61.31  ? 319 GLN 1 O   1 
ATOM 2364  C CB  . GLN A 1 319 ? 2.297   -24.990 217.376 1.00 63.12  ? 319 GLN 1 CB  1 
ATOM 2365  C CG  . GLN A 1 319 ? 1.636   -25.487 218.657 1.00 62.46  ? 319 GLN 1 CG  1 
ATOM 2366  C CD  . GLN A 1 319 ? 0.254   -26.102 218.467 1.00 63.47  ? 319 GLN 1 CD  1 
ATOM 2367  O OE1 . GLN A 1 319 ? 0.106   -27.222 217.966 1.00 80.43  ? 319 GLN 1 OE1 1 
ATOM 2368  N NE2 . GLN A 1 319 ? -0.760  -25.397 218.933 1.00 47.09  ? 319 GLN 1 NE2 1 
ATOM 2369  N N   . PRO A 1 320 ? 5.553   -24.610 216.680 1.00 55.23  ? 320 PRO 1 N   1 
ATOM 2370  C CA  . PRO A 1 320 ? 6.728   -24.745 215.816 1.00 41.38  ? 320 PRO 1 CA  1 
ATOM 2371  C C   . PRO A 1 320 ? 6.513   -25.570 214.569 1.00 40.48  ? 320 PRO 1 C   1 
ATOM 2372  O O   . PRO A 1 320 ? 6.243   -26.764 214.639 1.00 48.17  ? 320 PRO 1 O   1 
ATOM 2373  C CB  . PRO A 1 320 ? 7.697   -25.466 216.724 1.00 53.01  ? 320 PRO 1 CB  1 
ATOM 2374  C CG  . PRO A 1 320 ? 6.759   -26.394 217.516 1.00 43.83  ? 320 PRO 1 CG  1 
ATOM 2375  C CD  . PRO A 1 320 ? 5.689   -25.439 217.898 1.00 46.67  ? 320 PRO 1 CD  1 
ATOM 2376  N N   . MET A 1 321 ? 6.647   -24.956 213.415 1.00 41.70  ? 321 MET 1 N   1 
ATOM 2377  C CA  . MET A 1 321 ? 6.482   -25.724 212.194 1.00 52.42  ? 321 MET 1 CA  1 
ATOM 2378  C C   . MET A 1 321 ? 7.896   -25.892 211.674 1.00 53.48  ? 321 MET 1 C   1 
ATOM 2379  O O   . MET A 1 321 ? 8.111   -26.223 210.501 1.00 60.27  ? 321 MET 1 O   1 
ATOM 2380  C CB  . MET A 1 321 ? 5.587   -24.994 211.148 1.00 55.03  ? 321 MET 1 CB  1 
ATOM 2381  C CG  . MET A 1 321 ? 4.074   -25.155 211.342 1.00 35.91  ? 321 MET 1 CG  1 
ATOM 2382  S SD  . MET A 1 321 ? 3.636   -26.591 212.378 1.00 50.09  ? 321 MET 1 SD  1 
ATOM 2383  C CE  . MET A 1 321 ? 2.474   -27.463 211.319 1.00 69.97  ? 321 MET 1 CE  1 
ATOM 2384  N N   . ILE A 1 322 ? 8.880   -25.746 212.549 1.00 49.64  ? 322 ILE 1 N   1 
ATOM 2385  C CA  . ILE A 1 322 ? 10.227  -25.847 212.023 1.00 59.80  ? 322 ILE 1 CA  1 
ATOM 2386  C C   . ILE A 1 322 ? 11.387  -26.344 212.846 1.00 67.11  ? 322 ILE 1 C   1 
ATOM 2387  O O   . ILE A 1 322 ? 11.392  -26.299 214.092 1.00 61.40  ? 322 ILE 1 O   1 
ATOM 2388  C CB  . ILE A 1 322 ? 10.650  -24.546 211.390 1.00 49.97  ? 322 ILE 1 CB  1 
ATOM 2389  C CG1 . ILE A 1 322 ? 11.475  -24.830 210.150 1.00 50.52  ? 322 ILE 1 CG1 1 
ATOM 2390  C CG2 . ILE A 1 322 ? 11.443  -23.734 212.378 1.00 34.88  ? 322 ILE 1 CG2 1 
ATOM 2391  C CD1 . ILE A 1 322 ? 11.399  -23.717 209.157 1.00 77.60  ? 322 ILE 1 CD1 1 
ATOM 2392  N N   . GLY A 1 323 ? 12.406  -26.751 212.093 1.00 66.58  ? 323 GLY 1 N   1 
ATOM 2393  C CA  . GLY A 1 323 ? 13.599  -27.269 212.690 1.00 83.12  ? 323 GLY 1 CA  1 
ATOM 2394  C C   . GLY A 1 323 ? 13.268  -28.500 213.499 1.00 90.76  ? 323 GLY 1 C   1 
ATOM 2395  O O   . GLY A 1 323 ? 12.333  -29.236 213.193 1.00 82.72  ? 323 GLY 1 O   1 
ATOM 2396  N N   . MET A 1 324 ? 13.930  -28.615 214.636 1.00 106.52 ? 324 MET 1 N   1 
ATOM 2397  C CA  . MET A 1 324 ? 13.781  -29.779 215.473 1.00 116.24 ? 324 MET 1 CA  1 
ATOM 2398  C C   . MET A 1 324 ? 12.401  -30.223 215.913 1.00 101.66 ? 324 MET 1 C   1 
ATOM 2399  O O   . MET A 1 324 ? 12.195  -31.405 216.173 1.00 97.12  ? 324 MET 1 O   1 
ATOM 2400  C CB  . MET A 1 324 ? 14.756  -29.697 216.650 1.00 147.79 ? 324 MET 1 CB  1 
ATOM 2401  C CG  . MET A 1 324 ? 16.122  -30.338 216.336 1.00 184.01 ? 324 MET 1 CG  1 
ATOM 2402  S SD  . MET A 1 324 ? 16.051  -32.178 216.197 1.00 220.44 ? 324 MET 1 SD  1 
ATOM 2403  C CE  . MET A 1 324 ? 16.834  -32.523 214.578 1.00 219.14 ? 324 MET 1 CE  1 
ATOM 2404  N N   . SER A 1 325 ? 11.426  -29.333 215.950 1.00 90.16  ? 325 SER 1 N   1 
ATOM 2405  C CA  . SER A 1 325 ? 10.134  -29.814 216.399 1.00 87.44  ? 325 SER 1 CA  1 
ATOM 2406  C C   . SER A 1 325 ? 8.961   -29.573 215.477 1.00 74.46  ? 325 SER 1 C   1 
ATOM 2407  O O   . SER A 1 325 ? 7.801   -29.743 215.885 1.00 65.85  ? 325 SER 1 O   1 
ATOM 2408  C CB  . SER A 1 325 ? 9.860   -29.323 217.808 1.00 100.20 ? 325 SER 1 CB  1 
ATOM 2409  O OG  . SER A 1 325 ? 10.889  -29.780 218.667 1.00 114.53 ? 325 SER 1 OG  1 
ATOM 2410  N N   . SER A 1 326 ? 9.294   -29.265 214.220 1.00 59.13  ? 326 SER 1 N   1 
ATOM 2411  C CA  . SER A 1 326 ? 8.330   -29.006 213.162 1.00 46.90  ? 326 SER 1 CA  1 
ATOM 2412  C C   . SER A 1 326 ? 7.116   -29.901 213.320 1.00 51.80  ? 326 SER 1 C   1 
ATOM 2413  O O   . SER A 1 326 ? 7.241   -31.119 213.462 1.00 56.31  ? 326 SER 1 O   1 
ATOM 2414  C CB  . SER A 1 326 ? 8.967   -29.282 211.814 1.00 35.70  ? 326 SER 1 CB  1 
ATOM 2415  O OG  . SER A 1 326 ? 8.056   -29.057 210.764 1.00 35.90  ? 326 SER 1 OG  1 
ATOM 2416  N N   . GLN A 1 327 ? 5.945   -29.284 213.377 1.00 44.51  ? 327 GLN 1 N   1 
ATOM 2417  C CA  . GLN A 1 327 ? 4.739   -30.051 213.537 1.00 34.65  ? 327 GLN 1 CA  1 
ATOM 2418  C C   . GLN A 1 327 ? 4.188   -30.377 212.149 1.00 36.22  ? 327 GLN 1 C   1 
ATOM 2419  O O   . GLN A 1 327 ? 3.054   -30.862 212.012 1.00 47.16  ? 327 GLN 1 O   1 
ATOM 2420  C CB  . GLN A 1 327 ? 3.753   -29.307 214.439 1.00 34.02  ? 327 GLN 1 CB  1 
ATOM 2421  C CG  . GLN A 1 327 ? 4.332   -28.963 215.817 1.00 26.39  ? 327 GLN 1 CG  1 
ATOM 2422  C CD  . GLN A 1 327 ? 3.258   -28.703 216.880 1.00 56.79  ? 327 GLN 1 CD  1 
ATOM 2423  O OE1 . GLN A 1 327 ? 3.555   -28.531 218.079 1.00 55.72  ? 327 GLN 1 OE1 1 
ATOM 2424  N NE2 . GLN A 1 327 ? 1.996   -28.689 216.449 1.00 69.19  ? 327 GLN 1 NE2 1 
ATOM 2425  N N   . VAL A 1 328 ? 4.956   -30.035 211.110 1.00 7.76   ? 328 VAL 1 N   1 
ATOM 2426  C CA  . VAL A 1 328 ? 4.534   -30.402 209.773 1.00 20.30  ? 328 VAL 1 CA  1 
ATOM 2427  C C   . VAL A 1 328 ? 5.093   -31.812 209.664 1.00 34.70  ? 328 VAL 1 C   1 
ATOM 2428  O O   . VAL A 1 328 ? 6.303   -32.010 209.800 1.00 37.20  ? 328 VAL 1 O   1 
ATOM 2429  C CB  . VAL A 1 328 ? 5.097   -29.492 208.598 1.00 20.88  ? 328 VAL 1 CB  1 
ATOM 2430  C CG1 . VAL A 1 328 ? 5.709   -28.241 209.096 1.00 14.71  ? 328 VAL 1 CG1 1 
ATOM 2431  C CG2 . VAL A 1 328 ? 6.016   -30.256 207.639 1.00 5.51   ? 328 VAL 1 CG2 1 
ATOM 2432  N N   . GLU A 1 329 ? 4.216   -32.801 209.525 1.00 40.02  ? 329 GLU 1 N   1 
ATOM 2433  C CA  . GLU A 1 329 ? 4.710   -34.152 209.428 1.00 30.42  ? 329 GLU 1 CA  1 
ATOM 2434  C C   . GLU A 1 329 ? 5.046   -34.672 208.041 1.00 28.22  ? 329 GLU 1 C   1 
ATOM 2435  O O   . GLU A 1 329 ? 5.581   -35.782 207.932 1.00 41.16  ? 329 GLU 1 O   1 
ATOM 2436  C CB  . GLU A 1 329 ? 3.846   -35.169 210.181 1.00 15.95  ? 329 GLU 1 CB  1 
ATOM 2437  C CG  . GLU A 1 329 ? 2.479   -34.748 210.691 1.00 36.43  ? 329 GLU 1 CG  1 
ATOM 2438  C CD  . GLU A 1 329 ? 1.806   -35.927 211.439 1.00 54.93  ? 329 GLU 1 CD  1 
ATOM 2439  O OE1 . GLU A 1 329 ? 2.557   -36.839 211.890 1.00 34.58  ? 329 GLU 1 OE1 1 
ATOM 2440  O OE2 . GLU A 1 329 ? 0.547   -35.972 211.542 1.00 55.62  ? 329 GLU 1 OE2 1 
ATOM 2441  N N   . GLU A 1 330 ? 4.826   -33.886 206.989 1.00 16.38  ? 330 GLU 1 N   1 
ATOM 2442  C CA  . GLU A 1 330 ? 5.137   -34.401 205.647 1.00 32.88  ? 330 GLU 1 CA  1 
ATOM 2443  C C   . GLU A 1 330 ? 4.903   -33.356 204.580 1.00 34.60  ? 330 GLU 1 C   1 
ATOM 2444  O O   . GLU A 1 330 ? 4.017   -32.516 204.695 1.00 52.28  ? 330 GLU 1 O   1 
ATOM 2445  C CB  . GLU A 1 330 ? 4.289   -35.646 205.372 1.00 47.97  ? 330 GLU 1 CB  1 
ATOM 2446  C CG  . GLU A 1 330 ? 4.522   -36.446 204.089 1.00 73.27  ? 330 GLU 1 CG  1 
ATOM 2447  C CD  . GLU A 1 330 ? 3.823   -37.830 204.146 1.00 84.32  ? 330 GLU 1 CD  1 
ATOM 2448  O OE1 . GLU A 1 330 ? 2.568   -37.938 203.979 1.00 67.87  ? 330 GLU 1 OE1 1 
ATOM 2449  O OE2 . GLU A 1 330 ? 4.547   -38.824 204.374 1.00 99.97  ? 330 GLU 1 OE2 1 
ATOM 2450  N N   . VAL A 1 331 ? 5.712   -33.393 203.540 1.00 18.42  ? 331 VAL 1 N   1 
ATOM 2451  C CA  . VAL A 1 331 ? 5.567   -32.413 202.504 1.00 20.51  ? 331 VAL 1 CA  1 
ATOM 2452  C C   . VAL A 1 331 ? 5.843   -33.071 201.194 1.00 26.67  ? 331 VAL 1 C   1 
ATOM 2453  O O   . VAL A 1 331 ? 6.835   -33.774 201.037 1.00 38.19  ? 331 VAL 1 O   1 
ATOM 2454  C CB  . VAL A 1 331 ? 6.554   -31.257 202.709 1.00 24.67  ? 331 VAL 1 CB  1 
ATOM 2455  C CG1 . VAL A 1 331 ? 6.551   -30.344 201.479 1.00 25.94  ? 331 VAL 1 CG1 1 
ATOM 2456  C CG2 . VAL A 1 331 ? 6.189   -30.469 203.992 1.00 10.45  ? 331 VAL 1 CG2 1 
ATOM 2457  N N   . ARG A 1 332 ? 4.942   -32.884 200.255 1.00 22.47  ? 332 ARG 1 N   1 
ATOM 2458  C CA  . ARG A 1 332 ? 5.136   -33.483 198.960 1.00 24.62  ? 332 ARG 1 CA  1 
ATOM 2459  C C   . ARG A 1 332 ? 5.116   -32.348 197.983 1.00 25.51  ? 332 ARG 1 C   1 
ATOM 2460  O O   . ARG A 1 332 ? 4.514   -31.308 198.229 1.00 33.08  ? 332 ARG 1 O   1 
ATOM 2461  C CB  . ARG A 1 332 ? 4.016   -34.462 198.635 1.00 37.18  ? 332 ARG 1 CB  1 
ATOM 2462  C CG  . ARG A 1 332 ? 3.790   -35.577 199.646 1.00 45.06  ? 332 ARG 1 CG  1 
ATOM 2463  C CD  . ARG A 1 332 ? 2.938   -36.656 198.984 1.00 59.31  ? 332 ARG 1 CD  1 
ATOM 2464  N NE  . ARG A 1 332 ? 3.315   -38.020 199.362 1.00 48.01  ? 332 ARG 1 NE  1 
ATOM 2465  C CZ  . ARG A 1 332 ? 3.008   -38.574 200.529 1.00 76.53  ? 332 ARG 1 CZ  1 
ATOM 2466  N NH1 . ARG A 1 332 ? 2.312   -37.875 201.432 1.00 95.84  ? 332 ARG 1 NH1 1 
ATOM 2467  N NH2 . ARG A 1 332 ? 3.367   -39.834 200.779 1.00 88.23  ? 332 ARG 1 NH2 1 
ATOM 2468  N N   . VAL A 1 333 ? 5.764   -32.550 196.859 1.00 22.41  ? 333 VAL 1 N   1 
ATOM 2469  C CA  . VAL A 1 333 ? 5.817   -31.513 195.883 1.00 26.00  ? 333 VAL 1 CA  1 
ATOM 2470  C C   . VAL A 1 333 ? 5.737   -32.167 194.558 1.00 32.58  ? 333 VAL 1 C   1 
ATOM 2471  O O   . VAL A 1 333 ? 6.575   -33.008 194.222 1.00 40.09  ? 333 VAL 1 O   1 
ATOM 2472  C CB  . VAL A 1 333 ? 7.149   -30.823 195.900 1.00 31.43  ? 333 VAL 1 CB  1 
ATOM 2473  C CG1 . VAL A 1 333 ? 7.163   -29.789 194.802 1.00 18.53  ? 333 VAL 1 CG1 1 
ATOM 2474  C CG2 . VAL A 1 333 ? 7.429   -30.217 197.287 1.00 30.68  ? 333 VAL 1 CG2 1 
ATOM 2475  N N   . TYR A 1 334 ? 4.740   -31.786 193.791 1.00 23.56  ? 334 TYR 1 N   1 
ATOM 2476  C CA  . TYR A 1 334 ? 4.621   -32.381 192.491 1.00 24.44  ? 334 TYR 1 CA  1 
ATOM 2477  C C   . TYR A 1 334 ? 4.903   -31.301 191.527 1.00 17.26  ? 334 TYR 1 C   1 
ATOM 2478  O O   . TYR A 1 334 ? 4.916   -30.122 191.904 1.00 22.09  ? 334 TYR 1 O   1 
ATOM 2479  C CB  . TYR A 1 334 ? 3.208   -32.877 192.253 1.00 31.68  ? 334 TYR 1 CB  1 
ATOM 2480  C CG  . TYR A 1 334 ? 2.752   -33.876 193.274 1.00 31.92  ? 334 TYR 1 CG  1 
ATOM 2481  C CD1 . TYR A 1 334 ? 2.722   -33.557 194.634 1.00 18.66  ? 334 TYR 1 CD1 1 
ATOM 2482  C CD2 . TYR A 1 334 ? 2.382   -35.149 192.887 1.00 44.83  ? 334 TYR 1 CD2 1 
ATOM 2483  C CE1 . TYR A 1 334 ? 2.341   -34.487 195.573 1.00 24.22  ? 334 TYR 1 CE1 1 
ATOM 2484  C CE2 . TYR A 1 334 ? 1.986   -36.087 193.820 1.00 59.42  ? 334 TYR 1 CE2 1 
ATOM 2485  C CZ  . TYR A 1 334 ? 1.976   -35.754 195.162 1.00 45.40  ? 334 TYR 1 CZ  1 
ATOM 2486  O OH  . TYR A 1 334 ? 1.620   -36.714 196.077 1.00 65.69  ? 334 TYR 1 OH  1 
ATOM 2487  N N   . GLU A 1 335 ? 5.063   -31.706 190.280 1.00 22.53  ? 335 GLU 1 N   1 
ATOM 2488  C CA  . GLU A 1 335 ? 5.312   -30.817 189.165 1.00 26.87  ? 335 GLU 1 CA  1 
ATOM 2489  C C   . GLU A 1 335 ? 5.323   -31.661 187.939 1.00 29.48  ? 335 GLU 1 C   1 
ATOM 2490  O O   . GLU A 1 335 ? 6.081   -32.623 187.820 1.00 32.01  ? 335 GLU 1 O   1 
ATOM 2491  C CB  . GLU A 1 335 ? 6.645   -30.109 189.276 1.00 46.03  ? 335 GLU 1 CB  1 
ATOM 2492  C CG  . GLU A 1 335 ? 6.984   -29.258 188.028 1.00 71.06  ? 335 GLU 1 CG  1 
ATOM 2493  C CD  . GLU A 1 335 ? 8.188   -28.357 188.158 1.00 89.60  ? 335 GLU 1 CD  1 
ATOM 2494  O OE1 . GLU A 1 335 ? 8.774   -28.237 189.281 1.00 89.52  ? 335 GLU 1 OE1 1 
ATOM 2495  O OE2 . GLU A 1 335 ? 8.552   -27.739 187.103 1.00 90.14  ? 335 GLU 1 OE2 1 
ATOM 2496  N N   . ASP A 1 336 ? 4.475   -31.283 187.014 1.00 44.02  ? 336 ASP 1 N   1 
ATOM 2497  C CA  . ASP A 1 336 ? 4.339   -32.053 185.791 1.00 47.37  ? 336 ASP 1 CA  1 
ATOM 2498  C C   . ASP A 1 336 ? 3.799   -33.425 186.219 1.00 37.11  ? 336 ASP 1 C   1 
ATOM 2499  O O   . ASP A 1 336 ? 3.321   -33.590 187.337 1.00 39.53  ? 336 ASP 1 O   1 
ATOM 2500  C CB  . ASP A 1 336 ? 5.676   -32.151 185.042 1.00 57.57  ? 336 ASP 1 CB  1 
ATOM 2501  C CG  . ASP A 1 336 ? 5.523   -32.734 183.640 1.00 85.54  ? 336 ASP 1 CG  1 
ATOM 2502  O OD1 . ASP A 1 336 ? 4.368   -32.940 183.161 1.00 94.34  ? 336 ASP 1 OD1 1 
ATOM 2503  O OD2 . ASP A 1 336 ? 6.576   -32.994 183.009 1.00 121.23 ? 336 ASP 1 OD2 1 
ATOM 2504  N N   . THR A 1 337 ? 3.903   -34.422 185.375 1.00 40.36  ? 337 THR 1 N   1 
ATOM 2505  C CA  . THR A 1 337 ? 3.323   -35.699 185.717 1.00 35.10  ? 337 THR 1 CA  1 
ATOM 2506  C C   . THR A 1 337 ? 4.036   -36.861 185.122 1.00 40.00  ? 337 THR 1 C   1 
ATOM 2507  O O   . THR A 1 337 ? 4.789   -36.716 184.159 1.00 46.33  ? 337 THR 1 O   1 
ATOM 2508  C CB  . THR A 1 337 ? 1.937   -35.783 185.150 1.00 28.81  ? 337 THR 1 CB  1 
ATOM 2509  O OG1 . THR A 1 337 ? 1.983   -35.502 183.734 1.00 11.53  ? 337 THR 1 OG1 1 
ATOM 2510  C CG2 . THR A 1 337 ? 1.057   -34.797 185.847 1.00 38.08  ? 337 THR 1 CG2 1 
ATOM 2511  N N   . GLU A 1 338 ? 3.662   -38.038 185.610 1.00 35.09  ? 338 GLU 1 N   1 
ATOM 2512  C CA  . GLU A 1 338 ? 4.233   -39.300 185.155 1.00 43.96  ? 338 GLU 1 CA  1 
ATOM 2513  C C   . GLU A 1 338 ? 3.097   -40.310 184.990 1.00 36.91  ? 338 GLU 1 C   1 
ATOM 2514  O O   . GLU A 1 338 ? 1.923   -39.951 185.137 1.00 41.50  ? 338 GLU 1 O   1 
ATOM 2515  C CB  . GLU A 1 338 ? 5.253   -39.781 186.189 1.00 28.65  ? 338 GLU 1 CB  1 
ATOM 2516  C CG  . GLU A 1 338 ? 4.710   -39.722 187.573 1.00 20.28  ? 338 GLU 1 CG  1 
ATOM 2517  C CD  . GLU A 1 338 ? 5.728   -40.028 188.642 1.00 48.59  ? 338 GLU 1 CD  1 
ATOM 2518  O OE1 . GLU A 1 338 ? 6.728   -40.718 188.331 1.00 50.50  ? 338 GLU 1 OE1 1 
ATOM 2519  O OE2 . GLU A 1 338 ? 5.520   -39.577 189.804 1.00 56.29  ? 338 GLU 1 OE2 1 
ATOM 2520  N N   . GLU A 1 339 ? 3.430   -41.546 184.625 1.00 41.08  ? 339 GLU 1 N   1 
ATOM 2521  C CA  . GLU A 1 339 ? 2.413   -42.587 184.486 1.00 32.78  ? 339 GLU 1 CA  1 
ATOM 2522  C C   . GLU A 1 339 ? 2.096   -43.088 185.899 1.00 34.15  ? 339 GLU 1 C   1 
ATOM 2523  O O   . GLU A 1 339 ? 2.946   -43.077 186.798 1.00 20.06  ? 339 GLU 1 O   1 
ATOM 2524  C CB  . GLU A 1 339 ? 2.919   -43.756 183.639 1.00 27.68  ? 339 GLU 1 CB  1 
ATOM 2525  C CG  . GLU A 1 339 ? 3.634   -43.342 182.353 1.00 73.09  ? 339 GLU 1 CG  1 
ATOM 2526  C CD  . GLU A 1 339 ? 3.853   -44.503 181.370 1.00 84.13  ? 339 GLU 1 CD  1 
ATOM 2527  O OE1 . GLU A 1 339 ? 4.327   -45.593 181.789 1.00 94.64  ? 339 GLU 1 OE1 1 
ATOM 2528  O OE2 . GLU A 1 339 ? 3.557   -44.310 180.165 1.00 84.43  ? 339 GLU 1 OE2 1 
ATOM 2529  N N   . LEU A 1 340 ? 0.863   -43.520 186.092 1.00 24.56  ? 340 LEU 1 N   1 
ATOM 2530  C CA  . LEU A 1 340 ? 0.448   -44.015 187.377 1.00 21.88  ? 340 LEU 1 CA  1 
ATOM 2531  C C   . LEU A 1 340 ? 1.424   -45.066 187.954 1.00 26.22  ? 340 LEU 1 C   1 
ATOM 2532  O O   . LEU A 1 340 ? 1.634   -46.150 187.402 1.00 40.58  ? 340 LEU 1 O   1 
ATOM 2533  C CB  . LEU A 1 340 ? -0.959  -44.570 187.240 1.00 22.68  ? 340 LEU 1 CB  1 
ATOM 2534  C CG  . LEU A 1 340 ? -1.532  -45.250 188.469 1.00 30.62  ? 340 LEU 1 CG  1 
ATOM 2535  C CD1 . LEU A 1 340 ? -1.170  -44.504 189.733 1.00 34.48  ? 340 LEU 1 CD1 1 
ATOM 2536  C CD2 . LEU A 1 340 ? -3.019  -45.351 188.288 1.00 39.34  ? 340 LEU 1 CD2 1 
ATOM 2537  N N   . PRO A 1 341 ? 2.096   -44.719 189.035 1.00 15.45  ? 341 PRO 1 N   1 
ATOM 2538  C CA  . PRO A 1 341 ? 3.028   -45.654 189.640 1.00 33.74  ? 341 PRO 1 CA  1 
ATOM 2539  C C   . PRO A 1 341 ? 2.436   -46.704 190.555 1.00 36.21  ? 341 PRO 1 C   1 
ATOM 2540  O O   . PRO A 1 341 ? 1.721   -46.398 191.523 1.00 31.70  ? 341 PRO 1 O   1 
ATOM 2541  C CB  . PRO A 1 341 ? 3.964   -44.735 190.431 1.00 27.51  ? 341 PRO 1 CB  1 
ATOM 2542  C CG  . PRO A 1 341 ? 3.113   -43.639 190.815 1.00 27.20  ? 341 PRO 1 CG  1 
ATOM 2543  C CD  . PRO A 1 341 ? 2.399   -43.364 189.490 1.00 16.29  ? 341 PRO 1 CD  1 
ATOM 2544  N N   . GLY A 1 342 ? 2.835   -47.937 190.287 1.00 27.88  ? 342 GLY 1 N   1 
ATOM 2545  C CA  . GLY A 1 342 ? 2.405   -49.016 191.125 1.00 25.27  ? 342 GLY 1 CA  1 
ATOM 2546  C C   . GLY A 1 342 ? 2.694   -48.821 192.616 1.00 18.34  ? 342 GLY 1 C   1 
ATOM 2547  O O   . GLY A 1 342 ? 1.976   -49.334 193.450 1.00 17.74  ? 342 GLY 1 O   1 
ATOM 2548  N N   . ASP A 1 343 ? 3.792   -48.214 193.013 1.00 23.84  ? 343 ASP 1 N   1 
ATOM 2549  C CA  . ASP A 1 343 ? 3.918   -48.100 194.450 1.00 26.82  ? 343 ASP 1 CA  1 
ATOM 2550  C C   . ASP A 1 343 ? 3.715   -46.706 194.881 1.00 36.39  ? 343 ASP 1 C   1 
ATOM 2551  O O   . ASP A 1 343 ? 4.657   -45.953 195.057 1.00 45.20  ? 343 ASP 1 O   1 
ATOM 2552  C CB  . ASP A 1 343 ? 5.212   -48.610 195.047 1.00 23.46  ? 343 ASP 1 CB  1 
ATOM 2553  C CG  . ASP A 1 343 ? 5.173   -48.522 196.547 1.00 36.24  ? 343 ASP 1 CG  1 
ATOM 2554  O OD1 . ASP A 1 343 ? 4.028   -48.471 197.065 1.00 30.51  ? 343 ASP 1 OD1 1 
ATOM 2555  O OD2 . ASP A 1 343 ? 6.235   -48.450 197.205 1.00 42.05  ? 343 ASP 1 OD2 1 
ATOM 2556  N N   . PRO A 1 344 ? 2.485   -46.386 195.219 1.00 40.31  ? 344 PRO 1 N   1 
ATOM 2557  C CA  . PRO A 1 344 ? 2.073   -45.071 195.664 1.00 48.89  ? 344 PRO 1 CA  1 
ATOM 2558  C C   . PRO A 1 344 ? 2.720   -44.734 197.019 1.00 55.35  ? 344 PRO 1 C   1 
ATOM 2559  O O   . PRO A 1 344 ? 2.418   -43.708 197.625 1.00 57.78  ? 344 PRO 1 O   1 
ATOM 2560  C CB  . PRO A 1 344 ? 0.572   -45.245 195.774 1.00 40.31  ? 344 PRO 1 CB  1 
ATOM 2561  C CG  . PRO A 1 344 ? 0.505   -46.552 196.415 1.00 26.53  ? 344 PRO 1 CG  1 
ATOM 2562  C CD  . PRO A 1 344 ? 1.472   -47.375 195.584 1.00 37.31  ? 344 PRO 1 CD  1 
ATOM 2563  N N   . ASP A 1 345 ? 3.584   -45.608 197.510 1.00 52.11  ? 345 ASP 1 N   1 
ATOM 2564  C CA  . ASP A 1 345 ? 4.266   -45.322 198.750 1.00 51.33  ? 345 ASP 1 CA  1 
ATOM 2565  C C   . ASP A 1 345 ? 5.696   -44.900 198.482 1.00 50.65  ? 345 ASP 1 C   1 
ATOM 2566  O O   . ASP A 1 345 ? 6.457   -44.559 199.408 1.00 50.92  ? 345 ASP 1 O   1 
ATOM 2567  C CB  . ASP A 1 345 ? 4.259   -46.537 199.621 1.00 66.67  ? 345 ASP 1 CB  1 
ATOM 2568  C CG  . ASP A 1 345 ? 3.163   -46.496 200.599 1.00 78.64  ? 345 ASP 1 CG  1 
ATOM 2569  O OD1 . ASP A 1 345 ? 1.992   -46.312 200.168 1.00 75.66  ? 345 ASP 1 OD1 1 
ATOM 2570  O OD2 . ASP A 1 345 ? 3.477   -46.625 201.797 1.00 103.69 ? 345 ASP 1 OD2 1 
ATOM 2571  N N   . MET A 1 346 ? 6.047   -44.923 197.201 1.00 38.70  ? 346 MET 1 N   1 
ATOM 2572  C CA  . MET A 1 346 ? 7.374   -44.563 196.745 1.00 37.00  ? 346 MET 1 CA  1 
ATOM 2573  C C   . MET A 1 346 ? 7.879   -43.272 197.332 1.00 33.41  ? 346 MET 1 C   1 
ATOM 2574  O O   . MET A 1 346 ? 7.118   -42.436 197.805 1.00 40.26  ? 346 MET 1 O   1 
ATOM 2575  C CB  . MET A 1 346 ? 7.401   -44.402 195.239 1.00 9.45   ? 346 MET 1 CB  1 
ATOM 2576  C CG  . MET A 1 346 ? 6.756   -43.156 194.809 1.00 2.00   ? 346 MET 1 CG  1 
ATOM 2577  S SD  . MET A 1 346 ? 7.021   -42.840 193.083 1.00 58.43  ? 346 MET 1 SD  1 
ATOM 2578  C CE  . MET A 1 346 ? 7.824   -44.421 192.599 1.00 35.06  ? 346 MET 1 CE  1 
ATOM 2579  N N   . ILE A 1 347 ? 9.168   -43.059 197.157 1.00 38.18  ? 347 ILE 1 N   1 
ATOM 2580  C CA  . ILE A 1 347 ? 9.786   -41.877 197.666 1.00 35.42  ? 347 ILE 1 CA  1 
ATOM 2581  C C   . ILE A 1 347 ? 10.664  -41.214 196.667 1.00 40.81  ? 347 ILE 1 C   1 
ATOM 2582  O O   . ILE A 1 347 ? 11.427  -41.855 195.966 1.00 57.65  ? 347 ILE 1 O   1 
ATOM 2583  C CB  . ILE A 1 347 ? 10.630  -42.200 198.840 1.00 25.10  ? 347 ILE 1 CB  1 
ATOM 2584  C CG1 . ILE A 1 347 ? 9.726   -42.764 199.933 1.00 29.17  ? 347 ILE 1 CG1 1 
ATOM 2585  C CG2 . ILE A 1 347 ? 11.408  -40.958 199.248 1.00 40.27  ? 347 ILE 1 CG2 1 
ATOM 2586  C CD1 . ILE A 1 347 ? 10.380  -42.916 201.262 1.00 31.10  ? 347 ILE 1 CD1 1 
ATOM 2587  N N   . ARG A 1 348 ? 10.562  -39.909 196.603 1.00 37.36  ? 348 ARG 1 N   1 
ATOM 2588  C CA  . ARG A 1 348 ? 11.407  -39.194 195.701 1.00 40.31  ? 348 ARG 1 CA  1 
ATOM 2589  C C   . ARG A 1 348 ? 12.020  -38.168 196.563 1.00 46.73  ? 348 ARG 1 C   1 
ATOM 2590  O O   . ARG A 1 348 ? 11.365  -37.632 197.461 1.00 45.86  ? 348 ARG 1 O   1 
ATOM 2591  C CB  . ARG A 1 348 ? 10.642  -38.607 194.545 1.00 17.01  ? 348 ARG 1 CB  1 
ATOM 2592  C CG  . ARG A 1 348 ? 10.186  -39.700 193.649 1.00 13.75  ? 348 ARG 1 CG  1 
ATOM 2593  C CD  . ARG A 1 348 ? 9.792   -39.096 192.372 1.00 41.73  ? 348 ARG 1 CD  1 
ATOM 2594  N NE  . ARG A 1 348 ? 10.068  -40.018 191.293 1.00 48.64  ? 348 ARG 1 NE  1 
ATOM 2595  C CZ  . ARG A 1 348 ? 9.128   -40.600 190.566 1.00 50.16  ? 348 ARG 1 CZ  1 
ATOM 2596  N NH1 . ARG A 1 348 ? 7.854   -40.359 190.814 1.00 42.26  ? 348 ARG 1 NH1 1 
ATOM 2597  N NH2 . ARG A 1 348 ? 9.467   -41.398 189.565 1.00 82.64  ? 348 ARG 1 NH2 1 
ATOM 2598  N N   . TYR A 1 349 ? 13.332  -38.078 196.410 1.00 55.61  ? 349 TYR 1 N   1 
ATOM 2599  C CA  . TYR A 1 349 ? 14.154  -37.162 197.152 1.00 50.13  ? 349 TYR 1 CA  1 
ATOM 2600  C C   . TYR A 1 349 ? 15.165  -36.544 196.210 1.00 51.24  ? 349 TYR 1 C   1 
ATOM 2601  O O   . TYR A 1 349 ? 15.102  -36.757 194.997 1.00 55.29  ? 349 TYR 1 O   1 
ATOM 2602  C CB  . TYR A 1 349 ? 14.884  -37.924 198.243 1.00 54.49  ? 349 TYR 1 CB  1 
ATOM 2603  C CG  . TYR A 1 349 ? 14.963  -37.099 199.480 1.00 89.80  ? 349 TYR 1 CG  1 
ATOM 2604  C CD1 . TYR A 1 349 ? 15.981  -36.157 199.656 1.00 98.91  ? 349 TYR 1 CD1 1 
ATOM 2605  C CD2 . TYR A 1 349 ? 13.964  -37.182 200.442 1.00 104.46 ? 349 TYR 1 CD2 1 
ATOM 2606  C CE1 . TYR A 1 349 ? 15.994  -35.306 200.758 1.00 119.06 ? 349 TYR 1 CE1 1 
ATOM 2607  C CE2 . TYR A 1 349 ? 13.961  -36.341 201.551 1.00 125.79 ? 349 TYR 1 CE2 1 
ATOM 2608  C CZ  . TYR A 1 349 ? 14.979  -35.401 201.707 1.00 128.32 ? 349 TYR 1 CZ  1 
ATOM 2609  O OH  . TYR A 1 349 ? 14.970  -34.555 202.802 1.00 138.91 ? 349 TYR 1 OH  1 
ATOM 2610  N N   . ILE A 1 350 ? 16.041  -35.707 196.748 1.00 48.68  ? 350 ILE 1 N   1 
ATOM 2611  C CA  . ILE A 1 350 ? 17.107  -35.116 195.958 1.00 49.06  ? 350 ILE 1 CA  1 
ATOM 2612  C C   . ILE A 1 350 ? 18.323  -35.208 196.830 1.00 58.07  ? 350 ILE 1 C   1 
ATOM 2613  O O   . ILE A 1 350 ? 18.344  -34.576 197.892 1.00 65.45  ? 350 ILE 1 O   1 
ATOM 2614  C CB  . ILE A 1 350 ? 16.916  -33.671 195.729 1.00 48.03  ? 350 ILE 1 CB  1 
ATOM 2615  C CG1 . ILE A 1 350 ? 15.530  -33.412 195.131 1.00 38.50  ? 350 ILE 1 CG1 1 
ATOM 2616  C CG2 . ILE A 1 350 ? 18.122  -33.161 194.910 1.00 64.82  ? 350 ILE 1 CG2 1 
ATOM 2617  C CD1 . ILE A 1 350 ? 15.362  -33.870 193.714 1.00 20.70  ? 350 ILE 1 CD1 1 
ATOM 2618  N N   . ASP A 1 351 ? 19.316  -35.977 196.374 1.00 64.81  ? 351 ASP 1 N   1 
ATOM 2619  C CA  . ASP A 1 351 ? 20.581  -36.235 197.093 1.00 60.49  ? 351 ASP 1 CA  1 
ATOM 2620  C C   . ASP A 1 351 ? 21.160  -34.908 197.542 1.00 63.10  ? 351 ASP 1 C   1 
ATOM 2621  O O   . ASP A 1 351 ? 20.769  -34.361 198.576 1.00 80.54  ? 351 ASP 1 O   1 
ATOM 2622  C CB  . ASP A 1 351 ? 21.570  -37.010 196.180 1.00 45.35  ? 351 ASP 1 CB  1 
ATOM 2623  C CG  . ASP A 1 351 ? 21.583  -36.473 194.743 1.00 54.72  ? 351 ASP 1 CG  1 
ATOM 2624  O OD1 . ASP A 1 351 ? 20.962  -35.397 194.588 1.00 53.62  ? 351 ASP 1 OD1 1 
ATOM 2625  O OD2 . ASP A 1 351 ? 22.185  -37.083 193.789 1.00 43.07  ? 351 ASP 1 OD2 1 
ATOM 2626  N N   . GLU A 1 352 ? 22.117  -34.406 196.791 1.00 51.47  ? 352 GLU 1 N   1 
ATOM 2627  C CA  . GLU A 1 352 ? 22.700  -33.126 197.083 1.00 42.92  ? 352 GLU 1 CA  1 
ATOM 2628  C C   . GLU A 1 352 ? 22.909  -32.564 195.725 1.00 41.18  ? 352 GLU 1 C   1 
ATOM 2629  O O   . GLU A 1 352 ? 23.810  -31.765 195.542 1.00 46.27  ? 352 GLU 1 O   1 
ATOM 2630  C CB  . GLU A 1 352 ? 24.046  -33.249 197.772 1.00 43.00  ? 352 GLU 1 CB  1 
ATOM 2631  C CG  . GLU A 1 352 ? 23.982  -33.773 199.193 1.00 92.89  ? 352 GLU 1 CG  1 
ATOM 2632  C CD  . GLU A 1 352 ? 24.848  -35.014 199.409 1.00 116.59 ? 352 GLU 1 CD  1 
ATOM 2633  O OE1 . GLU A 1 352 ? 26.076  -34.866 199.638 1.00 129.48 ? 352 GLU 1 OE1 1 
ATOM 2634  O OE2 . GLU A 1 352 ? 24.290  -36.135 199.355 1.00 134.61 ? 352 GLU 1 OE2 1 
ATOM 2635  N N   . PHE A 1 353 ? 22.114  -33.042 194.762 1.00 30.48  ? 353 PHE 1 N   1 
ATOM 2636  C CA  . PHE A 1 353 ? 22.201  -32.635 193.351 1.00 35.94  ? 353 PHE 1 CA  1 
ATOM 2637  C C   . PHE A 1 353 ? 21.089  -33.359 192.463 1.00 54.06  ? 353 PHE 1 C   1 
ATOM 2638  O O   . PHE A 1 353 ? 20.114  -32.732 191.996 1.00 32.99  ? 353 PHE 1 O   1 
ATOM 2639  C CB  . PHE A 1 353 ? 23.673  -32.835 192.777 1.00 20.44  ? 353 PHE 1 CB  1 
ATOM 2640  C CG  . PHE A 1 353 ? 24.711  -33.593 193.735 1.00 41.34  ? 353 PHE 1 CG  1 
ATOM 2641  C CD1 . PHE A 1 353 ? 24.427  -34.819 194.353 1.00 58.32  ? 353 PHE 1 CD1 1 
ATOM 2642  C CD2 . PHE A 1 353 ? 25.987  -33.052 194.002 1.00 71.25  ? 353 PHE 1 CD2 1 
ATOM 2643  C CE1 . PHE A 1 353 ? 25.402  -35.499 195.228 1.00 57.57  ? 353 PHE 1 CE1 1 
ATOM 2644  C CE2 . PHE A 1 353 ? 26.964  -33.728 194.876 1.00 61.14  ? 353 PHE 1 CE2 1 
ATOM 2645  C CZ  . PHE A 1 353 ? 26.664  -34.951 195.486 1.00 12.19  ? 353 PHE 1 CZ  1 
ATOM 2646  N N   . GLY A 1 354 ? 21.230  -34.684 192.273 1.00 76.85  ? 354 GLY 1 N   1 
ATOM 2647  C CA  . GLY A 1 354 ? 20.308  -35.498 191.474 1.00 61.42  ? 354 GLY 1 CA  1 
ATOM 2648  C C   . GLY A 1 354 ? 19.024  -36.009 192.124 1.00 60.56  ? 354 GLY 1 C   1 
ATOM 2649  O O   . GLY A 1 354 ? 18.872  -36.029 193.356 1.00 38.51  ? 354 GLY 1 O   1 
ATOM 2650  N N   . GLN A 1 355 ? 18.104  -36.491 191.289 1.00 70.91  ? 355 GLN 1 N   1 
ATOM 2651  C CA  . GLN A 1 355 ? 16.802  -36.991 191.770 1.00 76.14  ? 355 GLN 1 CA  1 
ATOM 2652  C C   . GLN A 1 355 ? 16.748  -38.477 192.098 1.00 61.02  ? 355 GLN 1 C   1 
ATOM 2653  O O   . GLN A 1 355 ? 17.054  -39.306 191.261 1.00 69.59  ? 355 GLN 1 O   1 
ATOM 2654  C CB  . GLN A 1 355 ? 15.716  -36.654 190.755 1.00 84.16  ? 355 GLN 1 CB  1 
ATOM 2655  C CG  . GLN A 1 355 ? 14.337  -36.521 191.359 1.00 134.63 ? 355 GLN 1 CG  1 
ATOM 2656  C CD  . GLN A 1 355 ? 13.395  -35.699 190.483 1.00 169.63 ? 355 GLN 1 CD  1 
ATOM 2657  O OE1 . GLN A 1 355 ? 13.796  -34.691 189.889 1.00 189.09 ? 355 GLN 1 OE1 1 
ATOM 2658  N NE2 . GLN A 1 355 ? 12.134  -36.125 190.403 1.00 189.82 ? 355 GLN 1 NE2 1 
ATOM 2659  N N   . THR A 1 356 ? 16.327  -38.821 193.304 1.00 62.33  ? 356 THR 1 N   1 
ATOM 2660  C CA  . THR A 1 356 ? 16.260  -40.225 193.692 1.00 68.36  ? 356 THR 1 CA  1 
ATOM 2661  C C   . THR A 1 356 ? 14.851  -40.816 194.006 1.00 74.12  ? 356 THR 1 C   1 
ATOM 2662  O O   . THR A 1 356 ? 14.078  -40.243 194.777 1.00 83.49  ? 356 THR 1 O   1 
ATOM 2663  C CB  . THR A 1 356 ? 17.253  -40.499 194.858 1.00 68.03  ? 356 THR 1 CB  1 
ATOM 2664  O OG1 . THR A 1 356 ? 17.316  -41.904 195.084 1.00 110.76 ? 356 THR 1 OG1 1 
ATOM 2665  C CG2 . THR A 1 356 ? 16.843  -39.800 196.168 1.00 56.89  ? 356 THR 1 CG2 1 
ATOM 2666  N N   . THR A 1 357 ? 14.529  -41.969 193.407 1.00 70.55  ? 357 THR 1 N   1 
ATOM 2667  C CA  . THR A 1 357 ? 13.235  -42.665 193.611 1.00 62.19  ? 357 THR 1 CA  1 
ATOM 2668  C C   . THR A 1 357 ? 13.472  -43.851 194.555 1.00 58.95  ? 357 THR 1 C   1 
ATOM 2669  O O   . THR A 1 357 ? 14.422  -44.568 194.353 1.00 62.52  ? 357 THR 1 O   1 
ATOM 2670  C CB  . THR A 1 357 ? 12.695  -43.227 192.279 1.00 64.79  ? 357 THR 1 CB  1 
ATOM 2671  O OG1 . THR A 1 357 ? 13.055  -42.362 191.185 1.00 85.52  ? 357 THR 1 OG1 1 
ATOM 2672  C CG2 . THR A 1 357 ? 11.197  -43.326 192.331 1.00 68.71  ? 357 THR 1 CG2 1 
ATOM 2673  N N   . THR A 1 358 ? 12.596  -44.121 195.530 1.00 64.03  ? 358 THR 1 N   1 
ATOM 2674  C CA  . THR A 1 358 ? 12.878  -45.208 196.468 1.00 66.26  ? 358 THR 1 CA  1 
ATOM 2675  C C   . THR A 1 358 ? 11.696  -45.921 197.153 1.00 71.39  ? 358 THR 1 C   1 
ATOM 2676  O O   . THR A 1 358 ? 10.561  -45.641 196.837 1.00 76.64  ? 358 THR 1 O   1 
ATOM 2677  C CB  . THR A 1 358 ? 13.972  -44.743 197.458 1.00 83.92  ? 358 THR 1 CB  1 
ATOM 2678  O OG1 . THR A 1 358 ? 14.142  -45.703 198.505 1.00 118.52 ? 358 THR 1 OG1 1 
ATOM 2679  C CG2 . THR A 1 358 ? 13.639  -43.380 198.050 1.00 110.33 ? 358 THR 1 CG2 1 
ATOM 2680  N N   . ARG A 1 359 ? 11.948  -46.766 198.164 1.00 77.47  ? 359 ARG 1 N   1 
ATOM 2681  C CA  . ARG A 1 359 ? 10.891  -47.583 198.754 1.00 72.16  ? 359 ARG 1 CA  1 
ATOM 2682  C C   . ARG A 1 359 ? 10.481  -47.712 200.222 1.00 75.19  ? 359 ARG 1 C   1 
ATOM 2683  O O   . ARG A 1 359 ? 9.291   -47.905 200.441 1.00 90.70  ? 359 ARG 1 O   1 
ATOM 2684  C CB  . ARG A 1 359 ? 11.029  -49.018 198.197 1.00 75.12  ? 359 ARG 1 CB  1 
ATOM 2685  C CG  . ARG A 1 359 ? 9.768   -49.625 197.644 1.00 95.13  ? 359 ARG 1 CG  1 
ATOM 2686  C CD  . ARG A 1 359 ? 9.603   -51.064 198.092 1.00 91.52  ? 359 ARG 1 CD  1 
ATOM 2687  N NE  . ARG A 1 359 ? 8.188   -51.436 198.329 1.00 131.73 ? 359 ARG 1 NE  1 
ATOM 2688  C CZ  . ARG A 1 359 ? 7.289   -50.780 199.096 1.00 134.85 ? 359 ARG 1 CZ  1 
ATOM 2689  N NH1 . ARG A 1 359 ? 7.580   -49.652 199.739 1.00 129.76 ? 359 ARG 1 NH1 1 
ATOM 2690  N NH2 . ARG A 1 359 ? 6.085   -51.312 199.326 1.00 132.83 ? 359 ARG 1 NH2 1 
ATOM 2691  N N   . MET A 1 360 ? 11.366  -47.641 201.229 1.00 92.42  ? 360 MET 1 N   1 
ATOM 2692  C CA  . MET A 1 360 ? 10.907  -47.845 202.644 1.00 110.34 ? 360 MET 1 CA  1 
ATOM 2693  C C   . MET A 1 360 ? 9.672   -47.016 203.064 1.00 128.29 ? 360 MET 1 C   1 
ATOM 2694  O O   . MET A 1 360 ? 9.810   -45.836 203.435 1.00 140.22 ? 360 MET 1 O   1 
ATOM 2695  C CB  . MET A 1 360 ? 12.041  -47.628 203.672 1.00 118.90 ? 360 MET 1 CB  1 
ATOM 2696  C CG  . MET A 1 360 ? 11.669  -47.992 205.161 1.00 137.72 ? 360 MET 1 CG  1 
ATOM 2697  S SD  . MET A 1 360 ? 12.985  -47.667 206.501 1.00 191.47 ? 360 MET 1 SD  1 
ATOM 2698  C CE  . MET A 1 360 ? 12.125  -48.253 208.083 1.00 141.41 ? 360 MET 1 CE  1 
ATOM 2699  N N   . GLN A 1 361 ? 8.496   -47.662 203.061 1.00 140.64 ? 361 GLN 1 N   1 
ATOM 2700  C CA  . GLN A 1 361 ? 7.170   -47.068 203.386 1.00 150.66 ? 361 GLN 1 CA  1 
ATOM 2701  C C   . GLN A 1 361 ? 7.149   -45.631 203.990 1.00 146.44 ? 361 GLN 1 C   1 
ATOM 2702  O O   . GLN A 1 361 ? 6.518   -45.342 205.024 1.00 148.31 ? 361 GLN 1 O   1 
ATOM 2703  C CB  . GLN A 1 361 ? 6.317   -48.065 204.224 1.00 165.66 ? 361 GLN 1 CB  1 
ATOM 2704  C CG  . GLN A 1 361 ? 4.968   -48.565 203.554 1.00 182.17 ? 361 GLN 1 CG  1 
ATOM 2705  C CD  . GLN A 1 361 ? 4.333   -49.823 204.214 1.00 192.27 ? 361 GLN 1 CD  1 
ATOM 2706  O OE1 . GLN A 1 361 ? 5.034   -50.720 204.688 1.00 197.07 ? 361 GLN 1 OE1 1 
ATOM 2707  N NE2 . GLN A 1 361 ? 3.001   -49.900 204.202 1.00 193.53 ? 361 GLN 1 NE2 1 
ATOM 2708  N N   . PRO B 1 14  ? 47.572  54.888  165.582 1.00 187.11 ? 14  PRO 2 N   1 
ATOM 2709  C CA  . PRO B 1 14  ? 48.318  54.429  166.767 1.00 187.88 ? 14  PRO 2 CA  1 
ATOM 2710  C C   . PRO B 1 14  ? 47.397  53.632  167.722 1.00 190.53 ? 14  PRO 2 C   1 
ATOM 2711  O O   . PRO B 1 14  ? 47.384  52.391  167.727 1.00 196.18 ? 14  PRO 2 O   1 
ATOM 2712  C CB  . PRO B 1 14  ? 48.805  55.751  167.391 1.00 185.49 ? 14  PRO 2 CB  1 
ATOM 2713  C CG  . PRO B 1 14  ? 48.904  56.691  166.200 1.00 182.19 ? 14  PRO 2 CG  1 
ATOM 2714  C CD  . PRO B 1 14  ? 47.636  56.355  165.446 1.00 183.39 ? 14  PRO 2 CD  1 
ATOM 2715  N N   . LYS B 1 15  ? 46.681  54.364  168.569 1.00 185.35 ? 15  LYS 2 N   1 
ATOM 2716  C CA  . LYS B 1 15  ? 45.711  53.805  169.496 1.00 172.84 ? 15  LYS 2 CA  1 
ATOM 2717  C C   . LYS B 1 15  ? 44.579  54.855  169.448 1.00 173.32 ? 15  LYS 2 C   1 
ATOM 2718  O O   . LYS B 1 15  ? 44.835  56.067  169.514 1.00 171.22 ? 15  LYS 2 O   1 
ATOM 2719  C CB  . LYS B 1 15  ? 46.315  53.535  170.910 1.00 160.62 ? 15  LYS 2 CB  1 
ATOM 2720  C CG  . LYS B 1 15  ? 47.348  54.542  171.490 1.00 153.68 ? 15  LYS 2 CG  1 
ATOM 2721  C CD  . LYS B 1 15  ? 46.693  55.655  172.349 1.00 153.40 ? 15  LYS 2 CD  1 
ATOM 2722  C CE  . LYS B 1 15  ? 47.657  56.314  173.367 1.00 153.21 ? 15  LYS 2 CE  1 
ATOM 2723  N NZ  . LYS B 1 15  ? 47.009  57.285  174.334 1.00 133.94 ? 15  LYS 2 NZ  1 
ATOM 2724  N N   . LYS B 1 16  ? 43.365  54.392  169.152 1.00 171.70 ? 16  LYS 2 N   1 
ATOM 2725  C CA  . LYS B 1 16  ? 42.181  55.261  169.020 1.00 169.10 ? 16  LYS 2 CA  1 
ATOM 2726  C C   . LYS B 1 16  ? 41.387  55.485  170.336 1.00 166.13 ? 16  LYS 2 C   1 
ATOM 2727  O O   . LYS B 1 16  ? 40.874  54.516  170.918 1.00 162.36 ? 16  LYS 2 O   1 
ATOM 2728  C CB  . LYS B 1 16  ? 41.234  54.648  167.973 1.00 169.87 ? 16  LYS 2 CB  1 
ATOM 2729  C CG  . LYS B 1 16  ? 41.908  54.099  166.709 1.00 174.35 ? 16  LYS 2 CG  1 
ATOM 2730  C CD  . LYS B 1 16  ? 42.200  55.196  165.693 1.00 181.50 ? 16  LYS 2 CD  1 
ATOM 2731  C CE  . LYS B 1 16  ? 42.257  54.625  164.275 1.00 187.23 ? 16  LYS 2 CE  1 
ATOM 2732  N NZ  . LYS B 1 16  ? 41.813  55.620  163.246 1.00 191.55 ? 16  LYS 2 NZ  1 
ATOM 2733  N N   . PRO B 1 17  ? 41.238  56.759  170.799 1.00 162.78 ? 17  PRO 2 N   1 
ATOM 2734  C CA  . PRO B 1 17  ? 40.482  56.982  172.045 1.00 150.10 ? 17  PRO 2 CA  1 
ATOM 2735  C C   . PRO B 1 17  ? 39.032  56.511  171.890 1.00 145.54 ? 17  PRO 2 C   1 
ATOM 2736  O O   . PRO B 1 17  ? 38.225  57.131  171.182 1.00 153.10 ? 17  PRO 2 O   1 
ATOM 2737  C CB  . PRO B 1 17  ? 40.574  58.502  172.250 1.00 150.94 ? 17  PRO 2 CB  1 
ATOM 2738  C CG  . PRO B 1 17  ? 40.661  59.036  170.843 1.00 159.73 ? 17  PRO 2 CG  1 
ATOM 2739  C CD  . PRO B 1 17  ? 41.640  58.047  170.195 1.00 162.78 ? 17  PRO 2 CD  1 
ATOM 2740  N N   . LYS B 1 18  ? 38.763  55.349  172.480 1.00 132.22 ? 18  LYS 2 N   1 
ATOM 2741  C CA  . LYS B 1 18  ? 37.456  54.686  172.485 1.00 118.75 ? 18  LYS 2 CA  1 
ATOM 2742  C C   . LYS B 1 18  ? 36.321  55.712  172.558 1.00 111.07 ? 18  LYS 2 C   1 
ATOM 2743  O O   . LYS B 1 18  ? 36.522  56.836  173.018 1.00 114.92 ? 18  LYS 2 O   1 
ATOM 2744  C CB  . LYS B 1 18  ? 37.378  53.777  173.732 1.00 132.75 ? 18  LYS 2 CB  1 
ATOM 2745  C CG  . LYS B 1 18  ? 38.723  53.102  174.116 1.00 149.62 ? 18  LYS 2 CG  1 
ATOM 2746  C CD  . LYS B 1 18  ? 38.938  52.823  175.637 1.00 156.11 ? 18  LYS 2 CD  1 
ATOM 2747  C CE  . LYS B 1 18  ? 40.397  52.333  175.886 1.00 151.56 ? 18  LYS 2 CE  1 
ATOM 2748  N NZ  . LYS B 1 18  ? 40.770  51.854  177.259 1.00 155.56 ? 18  LYS 2 NZ  1 
ATOM 2749  N N   . GLU B 1 19  ? 35.140  55.356  172.071 1.00 95.98  ? 19  GLU 2 N   1 
ATOM 2750  C CA  . GLU B 1 19  ? 34.000  56.268  172.176 1.00 80.79  ? 19  GLU 2 CA  1 
ATOM 2751  C C   . GLU B 1 19  ? 33.458  55.948  173.570 1.00 62.54  ? 19  GLU 2 C   1 
ATOM 2752  O O   . GLU B 1 19  ? 33.440  54.785  173.972 1.00 72.45  ? 19  GLU 2 O   1 
ATOM 2753  C CB  . GLU B 1 19  ? 32.969  55.927  171.126 1.00 91.62  ? 19  GLU 2 CB  1 
ATOM 2754  C CG  . GLU B 1 19  ? 32.292  57.129  170.538 1.00 131.97 ? 19  GLU 2 CG  1 
ATOM 2755  C CD  . GLU B 1 19  ? 31.230  56.736  169.535 1.00 160.12 ? 19  GLU 2 CD  1 
ATOM 2756  O OE1 . GLU B 1 19  ? 31.387  55.673  168.888 1.00 177.09 ? 19  GLU 2 OE1 1 
ATOM 2757  O OE2 . GLU B 1 19  ? 30.233  57.479  169.396 1.00 177.90 ? 19  GLU 2 OE2 1 
ATOM 2758  N N   . PRO B 1 20  ? 33.043  56.956  174.344 1.00 46.25  ? 20  PRO 2 N   1 
ATOM 2759  C CA  . PRO B 1 20  ? 32.552  56.591  175.673 1.00 38.73  ? 20  PRO 2 CA  1 
ATOM 2760  C C   . PRO B 1 20  ? 31.279  55.800  175.741 1.00 39.96  ? 20  PRO 2 C   1 
ATOM 2761  O O   . PRO B 1 20  ? 30.413  55.828  174.852 1.00 44.17  ? 20  PRO 2 O   1 
ATOM 2762  C CB  . PRO B 1 20  ? 32.411  57.929  176.378 1.00 44.61  ? 20  PRO 2 CB  1 
ATOM 2763  C CG  . PRO B 1 20  ? 33.459  58.749  175.746 1.00 47.32  ? 20  PRO 2 CG  1 
ATOM 2764  C CD  . PRO B 1 20  ? 33.254  58.404  174.269 1.00 50.88  ? 20  PRO 2 CD  1 
ATOM 2765  N N   . VAL B 1 21  ? 31.185  55.102  176.853 1.00 37.63  ? 21  VAL 2 N   1 
ATOM 2766  C CA  . VAL B 1 21  ? 30.063  54.250  177.155 1.00 27.24  ? 21  VAL 2 CA  1 
ATOM 2767  C C   . VAL B 1 21  ? 28.882  55.127  177.324 1.00 30.48  ? 21  VAL 2 C   1 
ATOM 2768  O O   . VAL B 1 21  ? 28.993  56.239  177.833 1.00 30.61  ? 21  VAL 2 O   1 
ATOM 2769  C CB  . VAL B 1 21  ? 30.206  53.670  178.507 1.00 32.11  ? 21  VAL 2 CB  1 
ATOM 2770  C CG1 . VAL B 1 21  ? 29.383  52.402  178.602 1.00 63.73  ? 21  VAL 2 CG1 1 
ATOM 2771  C CG2 . VAL B 1 21  ? 31.688  53.521  178.862 1.00 58.07  ? 21  VAL 2 CG2 1 
ATOM 2772  N N   . GLN B 1 22  ? 27.721  54.592  177.030 1.00 34.61  ? 22  GLN 2 N   1 
ATOM 2773  C CA  . GLN B 1 22  ? 26.557  55.416  177.198 1.00 33.79  ? 22  GLN 2 CA  1 
ATOM 2774  C C   . GLN B 1 22  ? 25.971  55.072  178.542 1.00 23.79  ? 22  GLN 2 C   1 
ATOM 2775  O O   . GLN B 1 22  ? 25.693  53.910  178.819 1.00 37.58  ? 22  GLN 2 O   1 
ATOM 2776  C CB  . GLN B 1 22  ? 25.569  55.140  176.069 1.00 38.24  ? 22  GLN 2 CB  1 
ATOM 2777  C CG  . GLN B 1 22  ? 24.706  56.323  175.679 1.00 35.74  ? 22  GLN 2 CG  1 
ATOM 2778  C CD  . GLN B 1 22  ? 25.478  57.466  175.068 1.00 61.35  ? 22  GLN 2 CD  1 
ATOM 2779  O OE1 . GLN B 1 22  ? 24.993  58.606  175.041 1.00 87.91  ? 22  GLN 2 OE1 1 
ATOM 2780  N NE2 . GLN B 1 22  ? 26.679  57.178  174.553 1.00 72.54  ? 22  GLN 2 NE2 1 
ATOM 2781  N N   . VAL B 1 23  ? 25.844  56.055  179.413 1.00 19.05  ? 23  VAL 2 N   1 
ATOM 2782  C CA  . VAL B 1 23  ? 25.249  55.786  180.723 1.00 30.94  ? 23  VAL 2 CA  1 
ATOM 2783  C C   . VAL B 1 23  ? 24.039  56.687  180.926 1.00 28.66  ? 23  VAL 2 C   1 
ATOM 2784  O O   . VAL B 1 23  ? 23.814  57.601  180.156 1.00 35.05  ? 23  VAL 2 O   1 
ATOM 2785  C CB  . VAL B 1 23  ? 26.251  56.002  181.852 1.00 18.02  ? 23  VAL 2 CB  1 
ATOM 2786  C CG1 . VAL B 1 23  ? 27.625  55.714  181.346 1.00 23.19  ? 23  VAL 2 CG1 1 
ATOM 2787  C CG2 . VAL B 1 23  ? 26.119  57.395  182.404 1.00 12.44  ? 23  VAL 2 CG2 1 
ATOM 2788  N N   . PRO B 1 24  ? 23.223  56.415  181.943 1.00 28.75  ? 24  PRO 2 N   1 
ATOM 2789  C CA  . PRO B 1 24  ? 22.044  57.228  182.201 1.00 31.34  ? 24  PRO 2 CA  1 
ATOM 2790  C C   . PRO B 1 24  ? 22.330  58.701  182.389 1.00 30.22  ? 24  PRO 2 C   1 
ATOM 2791  O O   . PRO B 1 24  ? 23.246  59.101  183.130 1.00 28.20  ? 24  PRO 2 O   1 
ATOM 2792  C CB  . PRO B 1 24  ? 21.459  56.580  183.447 1.00 24.90  ? 24  PRO 2 CB  1 
ATOM 2793  C CG  . PRO B 1 24  ? 22.632  55.979  184.086 1.00 40.51  ? 24  PRO 2 CG  1 
ATOM 2794  C CD  . PRO B 1 24  ? 23.273  55.322  182.911 1.00 38.20  ? 24  PRO 2 CD  1 
ATOM 2795  N N   . LYS B 1 25  ? 21.540  59.473  181.649 1.00 23.02  ? 25  LYS 2 N   1 
ATOM 2796  C CA  . LYS B 1 25  ? 21.587  60.913  181.603 1.00 30.64  ? 25  LYS 2 CA  1 
ATOM 2797  C C   . LYS B 1 25  ? 20.860  61.536  182.749 1.00 27.74  ? 25  LYS 2 C   1 
ATOM 2798  O O   . LYS B 1 25  ? 19.632  61.427  182.885 1.00 31.54  ? 25  LYS 2 O   1 
ATOM 2799  C CB  . LYS B 1 25  ? 20.946  61.391  180.328 1.00 42.12  ? 25  LYS 2 CB  1 
ATOM 2800  C CG  . LYS B 1 25  ? 20.661  62.859  180.291 1.00 55.81  ? 25  LYS 2 CG  1 
ATOM 2801  C CD  . LYS B 1 25  ? 19.508  63.084  179.329 1.00 100.07 ? 25  LYS 2 CD  1 
ATOM 2802  C CE  . LYS B 1 25  ? 19.685  64.352  178.504 1.00 122.05 ? 25  LYS 2 CE  1 
ATOM 2803  N NZ  . LYS B 1 25  ? 20.921  64.335  177.662 1.00 143.62 ? 25  LYS 2 NZ  1 
ATOM 2804  N N   . LEU B 1 26  ? 21.622  62.238  183.553 1.00 22.51  ? 26  LEU 2 N   1 
ATOM 2805  C CA  . LEU B 1 26  ? 21.029  62.881  184.676 1.00 16.32  ? 26  LEU 2 CA  1 
ATOM 2806  C C   . LEU B 1 26  ? 20.438  64.115  184.138 1.00 25.31  ? 26  LEU 2 C   1 
ATOM 2807  O O   . LEU B 1 26  ? 21.145  64.942  183.567 1.00 34.64  ? 26  LEU 2 O   1 
ATOM 2808  C CB  . LEU B 1 26  ? 22.066  63.297  185.683 1.00 13.22  ? 26  LEU 2 CB  1 
ATOM 2809  C CG  . LEU B 1 26  ? 21.424  64.325  186.603 1.00 8.19   ? 26  LEU 2 CG  1 
ATOM 2810  C CD1 . LEU B 1 26  ? 20.445  63.671  187.567 1.00 24.82  ? 26  LEU 2 CD1 1 
ATOM 2811  C CD2 . LEU B 1 26  ? 22.499  65.023  187.345 1.00 13.61  ? 26  LEU 2 CD2 1 
ATOM 2812  N N   . VAL B 1 27  ? 19.160  64.260  184.435 1.00 32.94  ? 27  VAL 2 N   1 
ATOM 2813  C CA  . VAL B 1 27  ? 18.337  65.388  184.050 1.00 21.54  ? 27  VAL 2 CA  1 
ATOM 2814  C C   . VAL B 1 27  ? 18.371  66.449  185.109 1.00 18.31  ? 27  VAL 2 C   1 
ATOM 2815  O O   . VAL B 1 27  ? 18.209  67.632  184.829 1.00 34.59  ? 27  VAL 2 O   1 
ATOM 2816  C CB  . VAL B 1 27  ? 16.936  64.940  183.994 1.00 27.55  ? 27  VAL 2 CB  1 
ATOM 2817  C CG1 . VAL B 1 27  ? 16.002  66.113  184.094 1.00 33.85  ? 27  VAL 2 CG1 1 
ATOM 2818  C CG2 . VAL B 1 27  ? 16.735  64.155  182.747 1.00 41.07  ? 27  VAL 2 CG2 1 
ATOM 2819  N N   . ILE B 1 28  ? 18.411  66.025  186.351 1.00 9.86   ? 28  ILE 2 N   1 
ATOM 2820  C CA  . ILE B 1 28  ? 18.453  67.027  187.382 1.00 27.08  ? 28  ILE 2 CA  1 
ATOM 2821  C C   . ILE B 1 28  ? 18.652  66.413  188.735 1.00 28.94  ? 28  ILE 2 C   1 
ATOM 2822  O O   . ILE B 1 28  ? 18.110  65.337  189.034 1.00 27.85  ? 28  ILE 2 O   1 
ATOM 2823  C CB  . ILE B 1 28  ? 17.177  67.837  187.423 1.00 17.54  ? 28  ILE 2 CB  1 
ATOM 2824  C CG1 . ILE B 1 28  ? 17.210  68.741  188.640 1.00 9.39   ? 28  ILE 2 CG1 1 
ATOM 2825  C CG2 . ILE B 1 28  ? 16.041  66.912  187.535 1.00 9.87   ? 28  ILE 2 CG2 1 
ATOM 2826  C CD1 . ILE B 1 28  ? 16.128  69.699  188.700 1.00 29.42  ? 28  ILE 2 CD1 1 
ATOM 2827  N N   . LYS B 1 29  ? 19.470  67.092  189.531 1.00 23.33  ? 29  LYS 2 N   1 
ATOM 2828  C CA  . LYS B 1 29  ? 19.773  66.649  190.873 1.00 20.49  ? 29  LYS 2 CA  1 
ATOM 2829  C C   . LYS B 1 29  ? 19.322  67.771  191.775 1.00 23.72  ? 29  LYS 2 C   1 
ATOM 2830  O O   . LYS B 1 29  ? 19.250  68.924  191.339 1.00 29.63  ? 29  LYS 2 O   1 
ATOM 2831  C CB  . LYS B 1 29  ? 21.275  66.395  191.015 1.00 28.75  ? 29  LYS 2 CB  1 
ATOM 2832  C CG  . LYS B 1 29  ? 22.135  67.609  191.347 1.00 51.94  ? 29  LYS 2 CG  1 
ATOM 2833  C CD  . LYS B 1 29  ? 23.635  67.350  191.091 1.00 57.10  ? 29  LYS 2 CD  1 
ATOM 2834  C CE  . LYS B 1 29  ? 24.519  67.573  192.324 1.00 66.68  ? 29  LYS 2 CE  1 
ATOM 2835  N NZ  . LYS B 1 29  ? 25.982  67.642  191.974 1.00 79.12  ? 29  LYS 2 NZ  1 
ATOM 2836  N N   . GLY B 1 30  ? 18.985  67.435  193.012 1.00 22.68  ? 30  GLY 2 N   1 
ATOM 2837  C CA  . GLY B 1 30  ? 18.531  68.438  193.955 1.00 27.01  ? 30  GLY 2 CA  1 
ATOM 2838  C C   . GLY B 1 30  ? 17.732  67.824  195.080 1.00 32.99  ? 30  GLY 2 C   1 
ATOM 2839  O O   . GLY B 1 30  ? 17.811  66.618  195.301 1.00 43.55  ? 30  GLY 2 O   1 
ATOM 2840  N N   . GLY B 1 31  ? 16.981  68.655  195.799 1.00 35.09  ? 31  GLY 2 N   1 
ATOM 2841  C CA  . GLY B 1 31  ? 16.148  68.208  196.913 1.00 27.70  ? 31  GLY 2 CA  1 
ATOM 2842  C C   . GLY B 1 31  ? 14.876  67.506  196.459 1.00 31.69  ? 31  GLY 2 C   1 
ATOM 2843  O O   . GLY B 1 31  ? 14.599  67.386  195.244 1.00 29.98  ? 31  GLY 2 O   1 
ATOM 2844  N N   . ILE B 1 32  ? 14.040  67.126  197.420 1.00 29.12  ? 32  ILE 2 N   1 
ATOM 2845  C CA  . ILE B 1 32  ? 12.849  66.366  197.059 1.00 28.09  ? 32  ILE 2 CA  1 
ATOM 2846  C C   . ILE B 1 32  ? 11.975  67.010  195.982 1.00 24.41  ? 32  ILE 2 C   1 
ATOM 2847  O O   . ILE B 1 32  ? 11.464  66.319  195.096 1.00 23.21  ? 32  ILE 2 O   1 
ATOM 2848  C CB  . ILE B 1 32  ? 12.049  65.891  198.322 1.00 15.06  ? 32  ILE 2 CB  1 
ATOM 2849  C CG1 . ILE B 1 32  ? 10.879  64.997  197.934 1.00 24.23  ? 32  ILE 2 CG1 1 
ATOM 2850  C CG2 . ILE B 1 32  ? 11.512  67.032  199.052 1.00 23.18  ? 32  ILE 2 CG2 1 
ATOM 2851  C CD1 . ILE B 1 32  ? 11.198  63.991  196.820 1.00 24.61  ? 32  ILE 2 CD1 1 
ATOM 2852  N N   . GLU B 1 33  ? 11.902  68.333  195.991 1.00 25.84  ? 33  GLU 2 N   1 
ATOM 2853  C CA  . GLU B 1 33  ? 11.079  69.084  195.031 1.00 40.92  ? 33  GLU 2 CA  1 
ATOM 2854  C C   . GLU B 1 33  ? 11.406  68.697  193.605 1.00 23.77  ? 33  GLU 2 C   1 
ATOM 2855  O O   . GLU B 1 33  ? 10.502  68.535  192.748 1.00 25.70  ? 33  GLU 2 O   1 
ATOM 2856  C CB  . GLU B 1 33  ? 11.213  70.622  195.191 1.00 66.03  ? 33  GLU 2 CB  1 
ATOM 2857  C CG  . GLU B 1 33  ? 11.806  71.104  196.514 1.00 126.46 ? 33  GLU 2 CG  1 
ATOM 2858  C CD  . GLU B 1 33  ? 13.199  70.533  196.762 1.00 156.76 ? 33  GLU 2 CD  1 
ATOM 2859  O OE1 . GLU B 1 33  ? 13.834  70.126  195.766 1.00 177.20 ? 33  GLU 2 OE1 1 
ATOM 2860  O OE2 . GLU B 1 33  ? 13.595  70.346  197.937 1.00 170.47 ? 33  GLU 2 OE2 1 
ATOM 2861  N N   . VAL B 1 34  ? 12.687  68.456  193.375 1.00 7.80   ? 34  VAL 2 N   1 
ATOM 2862  C CA  . VAL B 1 34  ? 13.136  68.122  192.045 1.00 13.80  ? 34  VAL 2 CA  1 
ATOM 2863  C C   . VAL B 1 34  ? 12.363  66.965  191.487 1.00 24.66  ? 34  VAL 2 C   1 
ATOM 2864  O O   . VAL B 1 34  ? 12.094  66.919  190.291 1.00 22.32  ? 34  VAL 2 O   1 
ATOM 2865  C CB  . VAL B 1 34  ? 14.586  67.780  192.028 1.00 18.85  ? 34  VAL 2 CB  1 
ATOM 2866  C CG1 . VAL B 1 34  ? 14.989  67.325  190.653 1.00 36.41  ? 34  VAL 2 CG1 1 
ATOM 2867  C CG2 . VAL B 1 34  ? 15.381  68.976  192.407 1.00 15.93  ? 34  VAL 2 CG2 1 
ATOM 2868  N N   . LEU B 1 35  ? 11.969  66.055  192.367 1.00 27.36  ? 35  LEU 2 N   1 
ATOM 2869  C CA  . LEU B 1 35  ? 11.212  64.879  191.975 1.00 24.46  ? 35  LEU 2 CA  1 
ATOM 2870  C C   . LEU B 1 35  ? 10.124  65.250  191.004 1.00 25.03  ? 35  LEU 2 C   1 
ATOM 2871  O O   . LEU B 1 35  ? 9.790   64.476  190.097 1.00 31.78  ? 35  LEU 2 O   1 
ATOM 2872  C CB  . LEU B 1 35  ? 10.591  64.224  193.195 1.00 15.72  ? 35  LEU 2 CB  1 
ATOM 2873  C CG  . LEU B 1 35  ? 11.042  62.781  193.239 1.00 25.50  ? 35  LEU 2 CG  1 
ATOM 2874  C CD1 . LEU B 1 35  ? 10.163  62.065  194.248 1.00 33.92  ? 35  LEU 2 CD1 1 
ATOM 2875  C CD2 . LEU B 1 35  ? 10.958  62.148  191.818 1.00 2.00   ? 35  LEU 2 CD2 1 
ATOM 2876  N N   . GLY B 1 36  ? 9.638   66.477  191.165 1.00 19.63  ? 36  GLY 2 N   1 
ATOM 2877  C CA  . GLY B 1 36  ? 8.588   66.988  190.320 1.00 22.11  ? 36  GLY 2 CA  1 
ATOM 2878  C C   . GLY B 1 36  ? 8.894   67.316  188.868 1.00 22.70  ? 36  GLY 2 C   1 
ATOM 2879  O O   . GLY B 1 36  ? 8.047   67.866  188.178 1.00 37.28  ? 36  GLY 2 O   1 
ATOM 2880  N N   . VAL B 1 37  ? 10.079  67.026  188.372 1.00 23.32  ? 37  VAL 2 N   1 
ATOM 2881  C CA  . VAL B 1 37  ? 10.342  67.344  186.974 1.00 30.53  ? 37  VAL 2 CA  1 
ATOM 2882  C C   . VAL B 1 37  ? 9.437   66.513  186.091 1.00 31.03  ? 37  VAL 2 C   1 
ATOM 2883  O O   . VAL B 1 37  ? 9.234   65.321  186.378 1.00 46.94  ? 37  VAL 2 O   1 
ATOM 2884  C CB  . VAL B 1 37  ? 11.728  66.960  186.587 1.00 32.87  ? 37  VAL 2 CB  1 
ATOM 2885  C CG1 . VAL B 1 37  ? 12.016  67.440  185.199 1.00 17.16  ? 37  VAL 2 CG1 1 
ATOM 2886  C CG2 . VAL B 1 37  ? 12.681  67.527  187.569 1.00 52.19  ? 37  VAL 2 CG2 1 
ATOM 2887  N N   . LYS B 1 38  ? 8.888   67.115  185.036 1.00 14.98  ? 38  LYS 2 N   1 
ATOM 2888  C CA  . LYS B 1 38  ? 8.026   66.365  184.139 1.00 28.78  ? 38  LYS 2 CA  1 
ATOM 2889  C C   . LYS B 1 38  ? 8.926   65.567  183.217 1.00 38.54  ? 38  LYS 2 C   1 
ATOM 2890  O O   . LYS B 1 38  ? 9.389   66.066  182.188 1.00 48.65  ? 38  LYS 2 O   1 
ATOM 2891  C CB  . LYS B 1 38  ? 7.062   67.247  183.324 1.00 43.75  ? 38  LYS 2 CB  1 
ATOM 2892  C CG  . LYS B 1 38  ? 5.813   67.830  184.067 1.00 69.43  ? 38  LYS 2 CG  1 
ATOM 2893  C CD  . LYS B 1 38  ? 4.697   68.255  183.048 1.00 91.29  ? 38  LYS 2 CD  1 
ATOM 2894  C CE  . LYS B 1 38  ? 3.816   69.454  183.483 1.00 88.90  ? 38  LYS 2 CE  1 
ATOM 2895  N NZ  . LYS B 1 38  ? 2.889   69.161  184.603 1.00 84.99  ? 38  LYS 2 NZ  1 
ATOM 2896  N N   . THR B 1 39  ? 9.160   64.322  183.623 1.00 42.96  ? 39  THR 2 N   1 
ATOM 2897  C CA  . THR B 1 39  ? 9.994   63.349  182.923 1.00 41.80  ? 39  THR 2 CA  1 
ATOM 2898  C C   . THR B 1 39  ? 9.150   62.372  182.128 1.00 42.40  ? 39  THR 2 C   1 
ATOM 2899  O O   . THR B 1 39  ? 7.931   62.323  182.292 1.00 48.18  ? 39  THR 2 O   1 
ATOM 2900  C CB  . THR B 1 39  ? 10.808  62.554  183.934 1.00 42.62  ? 39  THR 2 CB  1 
ATOM 2901  O OG1 . THR B 1 39  ? 9.984   62.207  185.071 1.00 58.80  ? 39  THR 2 OG1 1 
ATOM 2902  C CG2 . THR B 1 39  ? 11.931  63.405  184.417 1.00 72.16  ? 39  THR 2 CG2 1 
ATOM 2903  N N   . GLY B 1 40  ? 9.808   61.536  181.339 1.00 54.33  ? 40  GLY 2 N   1 
ATOM 2904  C CA  . GLY B 1 40  ? 9.091   60.567  180.530 1.00 54.23  ? 40  GLY 2 CA  1 
ATOM 2905  C C   . GLY B 1 40  ? 8.755   59.263  181.216 1.00 52.07  ? 40  GLY 2 C   1 
ATOM 2906  O O   . GLY B 1 40  ? 9.015   59.089  182.406 1.00 55.87  ? 40  GLY 2 O   1 
ATOM 2907  N N   . VAL B 1 41  ? 8.217   58.328  180.447 1.00 48.42  ? 41  VAL 2 N   1 
ATOM 2908  C CA  . VAL B 1 41  ? 7.816   57.030  180.962 1.00 36.76  ? 41  VAL 2 CA  1 
ATOM 2909  C C   . VAL B 1 41  ? 8.985   56.160  181.410 1.00 38.43  ? 41  VAL 2 C   1 
ATOM 2910  O O   . VAL B 1 41  ? 8.868   55.335  182.339 1.00 39.89  ? 41  VAL 2 O   1 
ATOM 2911  C CB  . VAL B 1 41  ? 7.037   56.312  179.894 1.00 32.86  ? 41  VAL 2 CB  1 
ATOM 2912  C CG1 . VAL B 1 41  ? 6.932   54.854  180.199 1.00 58.37  ? 41  VAL 2 CG1 1 
ATOM 2913  C CG2 . VAL B 1 41  ? 5.671   56.899  179.830 1.00 53.55  ? 41  VAL 2 CG2 1 
ATOM 2914  N N   . ASP B 1 42  ? 10.131  56.387  180.787 1.00 35.03  ? 42  ASP 2 N   1 
ATOM 2915  C CA  . ASP B 1 42  ? 11.291  55.596  181.108 1.00 39.52  ? 42  ASP 2 CA  1 
ATOM 2916  C C   . ASP B 1 42  ? 12.315  56.239  182.012 1.00 38.29  ? 42  ASP 2 C   1 
ATOM 2917  O O   . ASP B 1 42  ? 13.485  55.812  182.052 1.00 34.34  ? 42  ASP 2 O   1 
ATOM 2918  C CB  . ASP B 1 42  ? 11.963  55.139  179.825 1.00 61.60  ? 42  ASP 2 CB  1 
ATOM 2919  C CG  . ASP B 1 42  ? 11.126  54.157  179.063 1.00 77.15  ? 42  ASP 2 CG  1 
ATOM 2920  O OD1 . ASP B 1 42  ? 10.709  53.142  179.657 1.00 90.20  ? 42  ASP 2 OD1 1 
ATOM 2921  O OD2 . ASP B 1 42  ? 10.866  54.407  177.871 1.00 105.61 ? 42  ASP 2 OD2 1 
ATOM 2922  N N   . SER B 1 43  ? 11.929  57.269  182.743 1.00 19.85  ? 43  SER 2 N   1 
ATOM 2923  C CA  . SER B 1 43  ? 12.950  57.853  183.583 1.00 23.58  ? 43  SER 2 CA  1 
ATOM 2924  C C   . SER B 1 43  ? 12.822  57.144  184.884 1.00 24.29  ? 43  SER 2 C   1 
ATOM 2925  O O   . SER B 1 43  ? 11.971  56.235  185.021 1.00 37.39  ? 43  SER 2 O   1 
ATOM 2926  C CB  . SER B 1 43  ? 12.726  59.339  183.780 1.00 16.78  ? 43  SER 2 CB  1 
ATOM 2927  O OG  . SER B 1 43  ? 11.639  59.561  184.652 1.00 33.95  ? 43  SER 2 OG  1 
ATOM 2928  N N   . PHE B 1 44  ? 13.626  57.608  185.834 1.00 18.33  ? 44  PHE 2 N   1 
ATOM 2929  C CA  . PHE B 1 44  ? 13.647  57.106  187.194 1.00 18.84  ? 44  PHE 2 CA  1 
ATOM 2930  C C   . PHE B 1 44  ? 14.512  58.012  188.035 1.00 25.43  ? 44  PHE 2 C   1 
ATOM 2931  O O   . PHE B 1 44  ? 15.343  58.793  187.516 1.00 25.50  ? 44  PHE 2 O   1 
ATOM 2932  C CB  . PHE B 1 44  ? 14.254  55.750  187.261 1.00 13.72  ? 44  PHE 2 CB  1 
ATOM 2933  C CG  . PHE B 1 44  ? 15.655  55.732  186.840 1.00 23.48  ? 44  PHE 2 CG  1 
ATOM 2934  C CD1 . PHE B 1 44  ? 15.978  55.821  185.500 1.00 35.29  ? 44  PHE 2 CD1 1 
ATOM 2935  C CD2 . PHE B 1 44  ? 16.666  55.573  187.766 1.00 19.57  ? 44  PHE 2 CD2 1 
ATOM 2936  C CE1 . PHE B 1 44  ? 17.318  55.738  185.076 1.00 50.99  ? 44  PHE 2 CE1 1 
ATOM 2937  C CE2 . PHE B 1 44  ? 18.010  55.489  187.353 1.00 20.34  ? 44  PHE 2 CE2 1 
ATOM 2938  C CZ  . PHE B 1 44  ? 18.335  55.568  186.010 1.00 16.78  ? 44  PHE 2 CZ  1 
ATOM 2939  N N   . THR B 1 45  ? 14.452  57.776  189.333 1.00 3.21   ? 45  THR 2 N   1 
ATOM 2940  C CA  . THR B 1 45  ? 15.176  58.635  190.210 1.00 19.70  ? 45  THR 2 CA  1 
ATOM 2941  C C   . THR B 1 45  ? 15.764  57.829  191.278 1.00 27.43  ? 45  THR 2 C   1 
ATOM 2942  O O   . THR B 1 45  ? 15.316  56.699  191.564 1.00 31.99  ? 45  THR 2 O   1 
ATOM 2943  C CB  . THR B 1 45  ? 14.253  59.587  190.969 1.00 24.84  ? 45  THR 2 CB  1 
ATOM 2944  O OG1 . THR B 1 45  ? 13.301  58.813  191.699 1.00 20.93  ? 45  THR 2 OG1 1 
ATOM 2945  C CG2 . THR B 1 45  ? 13.515  60.476  190.047 1.00 42.94  ? 45  THR 2 CG2 1 
ATOM 2946  N N   . GLU B 1 46  ? 16.610  58.538  192.002 1.00 14.46  ? 46  GLU 2 N   1 
ATOM 2947  C CA  . GLU B 1 46  ? 17.295  58.005  193.122 1.00 9.69   ? 46  GLU 2 CA  1 
ATOM 2948  C C   . GLU B 1 46  ? 16.996  59.029  194.197 1.00 21.84  ? 46  GLU 2 C   1 
ATOM 2949  O O   . GLU B 1 46  ? 17.232  60.224  194.008 1.00 42.08  ? 46  GLU 2 O   1 
ATOM 2950  C CB  . GLU B 1 46  ? 18.795  57.967  192.817 1.00 34.19  ? 46  GLU 2 CB  1 
ATOM 2951  C CG  . GLU B 1 46  ? 19.245  56.907  191.784 1.00 15.33  ? 46  GLU 2 CG  1 
ATOM 2952  C CD  . GLU B 1 46  ? 20.771  56.842  191.565 1.00 39.19  ? 46  GLU 2 CD  1 
ATOM 2953  O OE1 . GLU B 1 46  ? 21.520  57.737  192.051 1.00 61.44  ? 46  GLU 2 OE1 1 
ATOM 2954  O OE2 . GLU B 1 46  ? 21.225  55.870  190.916 1.00 53.15  ? 46  GLU 2 OE2 1 
ATOM 2955  N N   . VAL B 1 47  ? 16.412  58.565  195.290 1.00 7.74   ? 47  VAL 2 N   1 
ATOM 2956  C CA  . VAL B 1 47  ? 16.076  59.420  196.413 1.00 8.82   ? 47  VAL 2 CA  1 
ATOM 2957  C C   . VAL B 1 47  ? 16.979  59.019  197.560 1.00 19.18  ? 47  VAL 2 C   1 
ATOM 2958  O O   . VAL B 1 47  ? 17.018  57.835  197.929 1.00 20.20  ? 47  VAL 2 O   1 
ATOM 2959  C CB  . VAL B 1 47  ? 14.631  59.135  196.861 1.00 17.69  ? 47  VAL 2 CB  1 
ATOM 2960  C CG1 . VAL B 1 47  ? 14.284  59.872  198.167 1.00 4.50   ? 47  VAL 2 CG1 1 
ATOM 2961  C CG2 . VAL B 1 47  ? 13.681  59.492  195.765 1.00 14.87  ? 47  VAL 2 CG2 1 
ATOM 2962  N N   . GLU B 1 48  ? 17.698  59.985  198.120 1.00 17.96  ? 48  GLU 2 N   1 
ATOM 2963  C CA  . GLU B 1 48  ? 18.582  59.726  199.251 1.00 14.73  ? 48  GLU 2 CA  1 
ATOM 2964  C C   . GLU B 1 48  ? 18.036  60.468  200.453 1.00 21.07  ? 48  GLU 2 C   1 
ATOM 2965  O O   . GLU B 1 48  ? 18.144  61.686  200.548 1.00 31.79  ? 48  GLU 2 O   1 
ATOM 2966  C CB  . GLU B 1 48  ? 19.990  60.198  198.925 1.00 14.37  ? 48  GLU 2 CB  1 
ATOM 2967  C CG  . GLU B 1 48  ? 20.816  59.184  198.154 1.00 22.07  ? 48  GLU 2 CG  1 
ATOM 2968  C CD  . GLU B 1 48  ? 22.147  59.737  197.639 1.00 37.02  ? 48  GLU 2 CD  1 
ATOM 2969  O OE1 . GLU B 1 48  ? 22.161  60.341  196.533 1.00 47.50  ? 48  GLU 2 OE1 1 
ATOM 2970  O OE2 . GLU B 1 48  ? 23.185  59.502  198.305 1.00 39.71  ? 48  GLU 2 OE2 1 
ATOM 2971  N N   . CYS B 1 49  ? 17.356  59.740  201.320 1.00 28.27  ? 49  CYS 2 N   1 
ATOM 2972  C CA  . CYS B 1 49  ? 16.758  60.321  202.513 1.00 20.60  ? 49  CYS 2 CA  1 
ATOM 2973  C C   . CYS B 1 49  ? 17.599  59.815  203.651 1.00 13.49  ? 49  CYS 2 C   1 
ATOM 2974  O O   . CYS B 1 49  ? 18.743  59.453  203.440 1.00 22.21  ? 49  CYS 2 O   1 
ATOM 2975  C CB  . CYS B 1 49  ? 15.352  59.756  202.672 1.00 2.00   ? 49  CYS 2 CB  1 
ATOM 2976  S SG  . CYS B 1 49  ? 15.390  58.100  203.015 1.00 83.04  ? 49  CYS 2 SG  1 
ATOM 2977  N N   . PHE B 1 50  ? 17.019  59.804  204.846 1.00 17.01  ? 50  PHE 2 N   1 
ATOM 2978  C CA  . PHE B 1 50  ? 17.643  59.259  206.057 1.00 14.79  ? 50  PHE 2 CA  1 
ATOM 2979  C C   . PHE B 1 50  ? 16.717  59.507  207.230 1.00 18.99  ? 50  PHE 2 C   1 
ATOM 2980  O O   . PHE B 1 50  ? 15.905  60.447  207.223 1.00 28.59  ? 50  PHE 2 O   1 
ATOM 2981  C CB  . PHE B 1 50  ? 18.998  59.850  206.357 1.00 8.91   ? 50  PHE 2 CB  1 
ATOM 2982  C CG  . PHE B 1 50  ? 18.931  61.135  207.053 1.00 13.92  ? 50  PHE 2 CG  1 
ATOM 2983  C CD1 . PHE B 1 50  ? 18.598  61.198  208.394 1.00 21.42  ? 50  PHE 2 CD1 1 
ATOM 2984  C CD2 . PHE B 1 50  ? 19.101  62.303  206.348 1.00 27.17  ? 50  PHE 2 CD2 1 
ATOM 2985  C CE1 . PHE B 1 50  ? 18.424  62.415  209.006 1.00 41.09  ? 50  PHE 2 CE1 1 
ATOM 2986  C CE2 . PHE B 1 50  ? 18.932  63.535  206.961 1.00 20.16  ? 50  PHE 2 CE2 1 
ATOM 2987  C CZ  . PHE B 1 50  ? 18.591  63.596  208.278 1.00 18.18  ? 50  PHE 2 CZ  1 
ATOM 2988  N N   . LEU B 1 51  ? 16.959  58.767  208.295 1.00 6.78   ? 51  LEU 2 N   1 
ATOM 2989  C CA  . LEU B 1 51  ? 16.119  58.865  209.465 1.00 18.05  ? 51  LEU 2 CA  1 
ATOM 2990  C C   . LEU B 1 51  ? 16.940  58.907  210.695 1.00 25.54  ? 51  LEU 2 C   1 
ATOM 2991  O O   . LEU B 1 51  ? 17.872  58.125  210.834 1.00 38.03  ? 51  LEU 2 O   1 
ATOM 2992  C CB  . LEU B 1 51  ? 15.266  57.611  209.634 1.00 16.16  ? 51  LEU 2 CB  1 
ATOM 2993  C CG  . LEU B 1 51  ? 14.208  57.175  208.639 1.00 13.73  ? 51  LEU 2 CG  1 
ATOM 2994  C CD1 . LEU B 1 51  ? 13.457  55.962  209.189 1.00 43.15  ? 51  LEU 2 CD1 1 
ATOM 2995  C CD2 . LEU B 1 51  ? 13.256  58.311  208.429 1.00 52.31  ? 51  LEU 2 CD2 1 
ATOM 2996  N N   . ASN B 1 52  ? 16.538  59.750  211.634 1.00 27.55  ? 52  ASN 2 N   1 
ATOM 2997  C CA  . ASN B 1 52  ? 17.229  59.809  212.908 1.00 22.78  ? 52  ASN 2 CA  1 
ATOM 2998  C C   . ASN B 1 52  ? 16.576  58.747  213.776 1.00 25.45  ? 52  ASN 2 C   1 
ATOM 2999  O O   . ASN B 1 52  ? 15.467  58.272  213.494 1.00 30.37  ? 52  ASN 2 O   1 
ATOM 3000  C CB  . ASN B 1 52  ? 17.047  61.149  213.579 1.00 20.57  ? 52  ASN 2 CB  1 
ATOM 3001  C CG  . ASN B 1 52  ? 17.774  62.252  212.882 1.00 42.12  ? 52  ASN 2 CG  1 
ATOM 3002  O OD1 . ASN B 1 52  ? 19.005  62.275  212.837 1.00 46.39  ? 52  ASN 2 OD1 1 
ATOM 3003  N ND2 . ASN B 1 52  ? 17.017  63.215  212.369 1.00 78.83  ? 52  ASN 2 ND2 1 
ATOM 3004  N N   . PRO B 1 53  ? 17.255  58.345  214.839 1.00 24.08  ? 53  PRO 2 N   1 
ATOM 3005  C CA  . PRO B 1 53  ? 16.654  57.321  215.692 1.00 33.83  ? 53  PRO 2 CA  1 
ATOM 3006  C C   . PRO B 1 53  ? 15.934  57.906  216.882 1.00 45.23  ? 53  PRO 2 C   1 
ATOM 3007  O O   . PRO B 1 53  ? 16.234  59.030  217.323 1.00 56.97  ? 53  PRO 2 O   1 
ATOM 3008  C CB  . PRO B 1 53  ? 17.865  56.524  216.135 1.00 49.02  ? 53  PRO 2 CB  1 
ATOM 3009  C CG  . PRO B 1 53  ? 18.933  57.616  216.284 1.00 28.03  ? 53  PRO 2 CG  1 
ATOM 3010  C CD  . PRO B 1 53  ? 18.704  58.485  215.076 1.00 29.22  ? 53  PRO 2 CD  1 
ATOM 3011  N N   . GLN B 1 54  ? 15.024  57.117  217.441 1.00 44.58  ? 54  GLN 2 N   1 
ATOM 3012  C CA  . GLN B 1 54  ? 14.264  57.549  218.608 1.00 44.83  ? 54  GLN 2 CA  1 
ATOM 3013  C C   . GLN B 1 54  ? 14.426  56.575  219.770 1.00 48.13  ? 54  GLN 2 C   1 
ATOM 3014  O O   . GLN B 1 54  ? 13.634  55.634  219.929 1.00 48.15  ? 54  GLN 2 O   1 
ATOM 3015  C CB  . GLN B 1 54  ? 12.793  57.668  218.244 1.00 51.04  ? 54  GLN 2 CB  1 
ATOM 3016  C CG  . GLN B 1 54  ? 12.517  58.592  217.082 1.00 60.11  ? 54  GLN 2 CG  1 
ATOM 3017  C CD  . GLN B 1 54  ? 12.712  60.038  217.431 1.00 67.10  ? 54  GLN 2 CD  1 
ATOM 3018  O OE1 . GLN B 1 54  ? 13.291  60.373  218.468 1.00 89.72  ? 54  GLN 2 OE1 1 
ATOM 3019  N NE2 . GLN B 1 54  ? 12.215  60.916  216.573 1.00 82.28  ? 54  GLN 2 NE2 1 
ATOM 3020  N N   . MET B 1 55  ? 15.447  56.787  220.590 1.00 43.20  ? 55  MET 2 N   1 
ATOM 3021  C CA  . MET B 1 55  ? 15.662  55.873  221.703 1.00 51.02  ? 55  MET 2 CA  1 
ATOM 3022  C C   . MET B 1 55  ? 14.864  56.303  222.905 1.00 54.22  ? 55  MET 2 C   1 
ATOM 3023  O O   . MET B 1 55  ? 14.609  55.508  223.813 1.00 55.90  ? 55  MET 2 O   1 
ATOM 3024  C CB  . MET B 1 55  ? 17.152  55.779  222.044 1.00 55.47  ? 55  MET 2 CB  1 
ATOM 3025  C CG  . MET B 1 55  ? 18.017  55.296  220.876 1.00 65.57  ? 55  MET 2 CG  1 
ATOM 3026  S SD  . MET B 1 55  ? 17.379  53.773  220.068 1.00 42.83  ? 55  MET 2 SD  1 
ATOM 3027  C CE  . MET B 1 55  ? 18.590  52.668  220.584 1.00 85.42  ? 55  MET 2 CE  1 
ATOM 3028  N N   . GLY B 1 56  ? 14.444  57.566  222.868 1.00 63.00  ? 56  GLY 2 N   1 
ATOM 3029  C CA  . GLY B 1 56  ? 13.676  58.166  223.945 1.00 73.22  ? 56  GLY 2 CA  1 
ATOM 3030  C C   . GLY B 1 56  ? 14.058  59.631  224.078 1.00 71.82  ? 56  GLY 2 C   1 
ATOM 3031  O O   . GLY B 1 56  ? 13.205  60.494  224.296 1.00 79.92  ? 56  GLY 2 O   1 
ATOM 3032  N N   . ASN B 1 57  ? 15.354  59.901  223.936 1.00 62.59  ? 57  ASN 2 N   1 
ATOM 3033  C CA  . ASN B 1 57  ? 15.911  61.250  224.005 1.00 68.18  ? 57  ASN 2 CA  1 
ATOM 3034  C C   . ASN B 1 57  ? 15.551  62.011  225.271 1.00 70.90  ? 57  ASN 2 C   1 
ATOM 3035  O O   . ASN B 1 57  ? 14.934  63.076  225.210 1.00 74.96  ? 57  ASN 2 O   1 
ATOM 3036  C CB  . ASN B 1 57  ? 15.500  62.048  222.769 1.00 76.68  ? 57  ASN 2 CB  1 
ATOM 3037  C CG  . ASN B 1 57  ? 16.218  61.587  221.526 1.00 87.73  ? 57  ASN 2 CG  1 
ATOM 3038  O OD1 . ASN B 1 57  ? 17.399  61.229  221.570 1.00 96.70  ? 57  ASN 2 OD1 1 
ATOM 3039  N ND2 . ASN B 1 57  ? 15.505  61.559  220.406 1.00 108.72 ? 57  ASN 2 ND2 1 
ATOM 3040  N N   . PRO B 1 58  ? 16.014  61.514  226.429 1.00 68.93  ? 58  PRO 2 N   1 
ATOM 3041  C CA  . PRO B 1 58  ? 15.795  62.059  227.764 1.00 72.29  ? 58  PRO 2 CA  1 
ATOM 3042  C C   . PRO B 1 58  ? 15.983  63.560  227.918 1.00 73.11  ? 58  PRO 2 C   1 
ATOM 3043  O O   . PRO B 1 58  ? 15.007  64.260  228.176 1.00 91.52  ? 58  PRO 2 O   1 
ATOM 3044  C CB  . PRO B 1 58  ? 16.742  61.237  228.630 1.00 78.45  ? 58  PRO 2 CB  1 
ATOM 3045  C CG  . PRO B 1 58  ? 17.781  60.802  227.691 1.00 86.62  ? 58  PRO 2 CG  1 
ATOM 3046  C CD  . PRO B 1 58  ? 16.977  60.412  226.502 1.00 83.19  ? 58  PRO 2 CD  1 
ATOM 3047  N N   . ASP B 1 59  ? 17.207  64.067  227.863 1.00 66.04  ? 59  ASP 2 N   1 
ATOM 3048  C CA  . ASP B 1 59  ? 17.356  65.514  227.976 1.00 62.67  ? 59  ASP 2 CA  1 
ATOM 3049  C C   . ASP B 1 59  ? 17.673  66.035  226.587 1.00 61.46  ? 59  ASP 2 C   1 
ATOM 3050  O O   . ASP B 1 59  ? 17.749  65.263  225.632 1.00 66.02  ? 59  ASP 2 O   1 
ATOM 3051  C CB  . ASP B 1 59  ? 18.412  65.919  229.020 1.00 66.82  ? 59  ASP 2 CB  1 
ATOM 3052  C CG  . ASP B 1 59  ? 19.826  65.809  228.508 1.00 85.09  ? 59  ASP 2 CG  1 
ATOM 3053  O OD1 . ASP B 1 59  ? 20.075  65.006  227.606 1.00 100.50 ? 59  ASP 2 OD1 1 
ATOM 3054  O OD2 . ASP B 1 59  ? 20.712  66.535  228.996 1.00 99.96  ? 59  ASP 2 OD2 1 
ATOM 3055  N N   . GLU B 1 60  ? 17.855  67.333  226.447 1.00 66.66  ? 60  GLU 2 N   1 
ATOM 3056  C CA  . GLU B 1 60  ? 18.143  67.855  225.131 1.00 76.72  ? 60  GLU 2 CA  1 
ATOM 3057  C C   . GLU B 1 60  ? 19.606  67.730  224.813 1.00 70.28  ? 60  GLU 2 C   1 
ATOM 3058  O O   . GLU B 1 60  ? 20.076  68.392  223.918 1.00 83.65  ? 60  GLU 2 O   1 
ATOM 3059  C CB  . GLU B 1 60  ? 17.680  69.313  224.960 1.00 101.22 ? 60  GLU 2 CB  1 
ATOM 3060  C CG  . GLU B 1 60  ? 18.448  70.369  225.776 1.00 137.51 ? 60  GLU 2 CG  1 
ATOM 3061  C CD  . GLU B 1 60  ? 18.114  70.362  227.276 1.00 157.42 ? 60  GLU 2 CD  1 
ATOM 3062  O OE1 . GLU B 1 60  ? 17.085  69.770  227.676 1.00 171.03 ? 60  GLU 2 OE1 1 
ATOM 3063  O OE2 . GLU B 1 60  ? 18.887  70.960  228.061 1.00 164.61 ? 60  GLU 2 OE2 1 
ATOM 3064  N N   . HIS B 1 61  ? 20.356  66.958  225.583 1.00 59.61  ? 61  HIS 2 N   1 
ATOM 3065  C CA  . HIS B 1 61  ? 21.770  66.779  225.274 1.00 58.81  ? 61  HIS 2 CA  1 
ATOM 3066  C C   . HIS B 1 61  ? 22.028  65.308  225.042 1.00 56.05  ? 61  HIS 2 C   1 
ATOM 3067  O O   . HIS B 1 61  ? 23.114  64.901  224.632 1.00 63.97  ? 61  HIS 2 O   1 
ATOM 3068  C CB  . HIS B 1 61  ? 22.650  67.206  226.429 1.00 70.33  ? 61  HIS 2 CB  1 
ATOM 3069  C CG  . HIS B 1 61  ? 22.481  68.626  226.834 1.00 85.77  ? 61  HIS 2 CG  1 
ATOM 3070  N ND1 . HIS B 1 61  ? 21.807  68.987  227.975 1.00 108.23 ? 61  HIS 2 ND1 1 
ATOM 3071  C CD2 . HIS B 1 61  ? 22.933  69.774  226.282 1.00 95.59  ? 61  HIS 2 CD2 1 
ATOM 3072  C CE1 . HIS B 1 61  ? 21.851  70.299  228.114 1.00 124.58 ? 61  HIS 2 CE1 1 
ATOM 3073  N NE2 . HIS B 1 61  ? 22.529  70.801  227.098 1.00 119.97 ? 61  HIS 2 NE2 1 
ATOM 3074  N N   . GLN B 1 62  ? 21.038  64.499  225.360 1.00 47.88  ? 62  GLN 2 N   1 
ATOM 3075  C CA  . GLN B 1 62  ? 21.189  63.083  225.224 1.00 48.15  ? 62  GLN 2 CA  1 
ATOM 3076  C C   . GLN B 1 62  ? 20.433  62.534  224.050 1.00 51.11  ? 62  GLN 2 C   1 
ATOM 3077  O O   . GLN B 1 62  ? 19.641  61.579  224.169 1.00 40.23  ? 62  GLN 2 O   1 
ATOM 3078  C CB  . GLN B 1 62  ? 20.805  62.387  226.509 1.00 43.46  ? 62  GLN 2 CB  1 
ATOM 3079  C CG  . GLN B 1 62  ? 21.827  62.613  227.582 1.00 74.85  ? 62  GLN 2 CG  1 
ATOM 3080  C CD  . GLN B 1 62  ? 21.630  61.690  228.756 1.00 93.28  ? 62  GLN 2 CD  1 
ATOM 3081  O OE1 . GLN B 1 62  ? 20.529  61.584  229.305 1.00 91.41  ? 62  GLN 2 OE1 1 
ATOM 3082  N NE2 . GLN B 1 62  ? 22.705  61.002  229.152 1.00 108.97 ? 62  GLN 2 NE2 1 
ATOM 3083  N N   . LYS B 1 63  ? 20.661  63.162  222.903 1.00 46.72  ? 63  LYS 2 N   1 
ATOM 3084  C CA  . LYS B 1 63  ? 20.025  62.680  221.714 1.00 42.83  ? 63  LYS 2 CA  1 
ATOM 3085  C C   . LYS B 1 63  ? 20.762  61.420  221.303 1.00 41.79  ? 63  LYS 2 C   1 
ATOM 3086  O O   . LYS B 1 63  ? 21.996  61.320  221.395 1.00 42.77  ? 63  LYS 2 O   1 
ATOM 3087  C CB  . LYS B 1 63  ? 20.008  63.748  220.633 1.00 56.59  ? 63  LYS 2 CB  1 
ATOM 3088  C CG  . LYS B 1 63  ? 18.805  64.696  220.789 1.00 74.67  ? 63  LYS 2 CG  1 
ATOM 3089  C CD  . LYS B 1 63  ? 18.591  65.626  219.586 1.00 91.58  ? 63  LYS 2 CD  1 
ATOM 3090  C CE  . LYS B 1 63  ? 17.183  66.274  219.569 1.00 97.87  ? 63  LYS 2 CE  1 
ATOM 3091  N NZ  . LYS B 1 63  ? 16.879  66.986  218.273 1.00 116.33 ? 63  LYS 2 NZ  1 
ATOM 3092  N N   . GLY B 1 64  ? 19.981  60.414  220.954 1.00 37.03  ? 64  GLY 2 N   1 
ATOM 3093  C CA  . GLY B 1 64  ? 20.559  59.153  220.558 1.00 50.51  ? 64  GLY 2 CA  1 
ATOM 3094  C C   . GLY B 1 64  ? 20.641  58.234  221.749 1.00 47.87  ? 64  GLY 2 C   1 
ATOM 3095  O O   . GLY B 1 64  ? 21.270  57.160  221.709 1.00 55.69  ? 64  GLY 2 O   1 
ATOM 3096  N N   . LEU B 1 65  ? 19.950  58.631  222.801 1.00 39.92  ? 65  LEU 2 N   1 
ATOM 3097  C CA  . LEU B 1 65  ? 19.957  57.849  224.009 1.00 45.72  ? 65  LEU 2 CA  1 
ATOM 3098  C C   . LEU B 1 65  ? 18.573  57.609  224.566 1.00 43.70  ? 65  LEU 2 C   1 
ATOM 3099  O O   . LEU B 1 65  ? 17.623  58.268  224.169 1.00 54.70  ? 65  LEU 2 O   1 
ATOM 3100  C CB  . LEU B 1 65  ? 20.853  58.559  225.019 1.00 47.12  ? 65  LEU 2 CB  1 
ATOM 3101  C CG  . LEU B 1 65  ? 22.300  58.385  224.548 1.00 44.01  ? 65  LEU 2 CG  1 
ATOM 3102  C CD1 . LEU B 1 65  ? 23.308  59.326  225.208 1.00 46.95  ? 65  LEU 2 CD1 1 
ATOM 3103  C CD2 . LEU B 1 65  ? 22.630  56.930  224.817 1.00 32.10  ? 65  LEU 2 CD2 1 
ATOM 3104  N N   . SER B 1 66  ? 18.421  56.568  225.365 1.00 43.47  ? 66  SER 2 N   1 
ATOM 3105  C CA  . SER B 1 66  ? 17.137  56.328  225.995 1.00 51.60  ? 66  SER 2 CA  1 
ATOM 3106  C C   . SER B 1 66  ? 17.367  56.898  227.383 1.00 61.93  ? 66  SER 2 C   1 
ATOM 3107  O O   . SER B 1 66  ? 18.495  57.260  227.732 1.00 65.57  ? 66  SER 2 O   1 
ATOM 3108  C CB  . SER B 1 66  ? 16.855  54.840  226.098 1.00 53.26  ? 66  SER 2 CB  1 
ATOM 3109  O OG  . SER B 1 66  ? 17.959  54.172  226.693 1.00 64.91  ? 66  SER 2 OG  1 
ATOM 3110  N N   . LYS B 1 67  ? 16.315  57.022  228.172 1.00 71.57  ? 67  LYS 2 N   1 
ATOM 3111  C CA  . LYS B 1 67  ? 16.485  57.531  229.519 1.00 74.34  ? 67  LYS 2 CA  1 
ATOM 3112  C C   . LYS B 1 67  ? 17.201  56.393  230.219 1.00 70.88  ? 67  LYS 2 C   1 
ATOM 3113  O O   . LYS B 1 67  ? 17.114  55.248  229.770 1.00 77.10  ? 67  LYS 2 O   1 
ATOM 3114  C CB  . LYS B 1 67  ? 15.130  57.756  230.174 1.00 83.62  ? 67  LYS 2 CB  1 
ATOM 3115  C CG  . LYS B 1 67  ? 15.202  58.414  231.545 1.00 111.12 ? 67  LYS 2 CG  1 
ATOM 3116  C CD  . LYS B 1 67  ? 13.796  58.590  232.134 1.00 136.78 ? 67  LYS 2 CD  1 
ATOM 3117  C CE  . LYS B 1 67  ? 13.783  59.265  233.514 1.00 147.15 ? 67  LYS 2 CE  1 
ATOM 3118  N NZ  . LYS B 1 67  ? 12.392  59.358  234.077 1.00 153.36 ? 67  LYS 2 NZ  1 
ATOM 3119  N N   . SER B 1 68  ? 17.942  56.706  231.274 1.00 64.67  ? 68  SER 2 N   1 
ATOM 3120  C CA  . SER B 1 68  ? 18.664  55.696  232.045 1.00 63.20  ? 68  SER 2 CA  1 
ATOM 3121  C C   . SER B 1 68  ? 17.698  54.531  232.307 1.00 56.46  ? 68  SER 2 C   1 
ATOM 3122  O O   . SER B 1 68  ? 16.605  54.720  232.833 1.00 57.27  ? 68  SER 2 O   1 
ATOM 3123  C CB  . SER B 1 68  ? 19.146  56.336  233.345 1.00 80.84  ? 68  SER 2 CB  1 
ATOM 3124  O OG  . SER B 1 68  ? 19.656  57.656  233.111 1.00 101.10 ? 68  SER 2 OG  1 
ATOM 3125  N N   . LEU B 1 69  ? 18.082  53.335  231.898 1.00 61.91  ? 69  LEU 2 N   1 
ATOM 3126  C CA  . LEU B 1 69  ? 17.199  52.185  232.017 1.00 66.68  ? 69  LEU 2 CA  1 
ATOM 3127  C C   . LEU B 1 69  ? 16.884  51.609  233.375 1.00 68.18  ? 69  LEU 2 C   1 
ATOM 3128  O O   . LEU B 1 69  ? 17.708  51.582  234.294 1.00 70.46  ? 69  LEU 2 O   1 
ATOM 3129  C CB  . LEU B 1 69  ? 17.610  51.082  231.043 1.00 75.30  ? 69  LEU 2 CB  1 
ATOM 3130  C CG  . LEU B 1 69  ? 17.602  51.553  229.587 1.00 79.71  ? 69  LEU 2 CG  1 
ATOM 3131  C CD1 . LEU B 1 69  ? 17.862  50.392  228.671 1.00 89.84  ? 69  LEU 2 CD1 1 
ATOM 3132  C CD2 . LEU B 1 69  ? 16.270  52.180  229.252 1.00 84.97  ? 69  LEU 2 CD2 1 
ATOM 3133  N N   . ALA B 1 70  ? 15.668  51.091  233.442 1.00 69.85  ? 70  ALA 2 N   1 
ATOM 3134  C CA  . ALA B 1 70  ? 15.104  50.505  234.641 1.00 74.94  ? 70  ALA 2 CA  1 
ATOM 3135  C C   . ALA B 1 70  ? 15.286  49.023  234.670 1.00 72.67  ? 70  ALA 2 C   1 
ATOM 3136  O O   . ALA B 1 70  ? 14.951  48.336  233.709 1.00 78.92  ? 70  ALA 2 O   1 
ATOM 3137  C CB  . ALA B 1 70  ? 13.636  50.810  234.697 1.00 96.75  ? 70  ALA 2 CB  1 
ATOM 3138  N N   . ALA B 1 71  ? 15.648  48.523  235.836 1.00 72.73  ? 71  ALA 2 N   1 
ATOM 3139  C CA  . ALA B 1 71  ? 15.881  47.109  235.970 1.00 83.71  ? 71  ALA 2 CA  1 
ATOM 3140  C C   . ALA B 1 71  ? 14.675  46.292  236.457 1.00 84.08  ? 71  ALA 2 C   1 
ATOM 3141  O O   . ALA B 1 71  ? 13.655  46.250  235.781 1.00 89.58  ? 71  ALA 2 O   1 
ATOM 3142  C CB  . ALA B 1 71  ? 17.116  46.877  236.822 1.00 93.52  ? 71  ALA 2 CB  1 
ATOM 3143  N N   . GLU B 1 72  ? 14.800  45.642  237.612 1.00 82.62  ? 72  GLU 2 N   1 
ATOM 3144  C CA  . GLU B 1 72  ? 13.757  44.789  238.186 1.00 78.99  ? 72  GLU 2 CA  1 
ATOM 3145  C C   . GLU B 1 72  ? 12.519  45.587  238.565 1.00 84.24  ? 72  GLU 2 C   1 
ATOM 3146  O O   . GLU B 1 72  ? 12.614  46.648  239.190 1.00 95.90  ? 72  GLU 2 O   1 
ATOM 3147  C CB  . GLU B 1 72  ? 14.325  44.076  239.412 1.00 69.36  ? 72  GLU 2 CB  1 
ATOM 3148  C CG  . GLU B 1 72  ? 15.676  43.419  239.127 1.00 81.74  ? 72  GLU 2 CG  1 
ATOM 3149  C CD  . GLU B 1 72  ? 16.574  43.266  240.346 1.00 93.63  ? 72  GLU 2 CD  1 
ATOM 3150  O OE1 . GLU B 1 72  ? 16.768  44.270  241.070 1.00 94.08  ? 72  GLU 2 OE1 1 
ATOM 3151  O OE2 . GLU B 1 72  ? 17.127  42.153  240.551 1.00 106.58 ? 72  GLU 2 OE2 1 
ATOM 3152  N N   . LYS B 1 73  ? 11.364  45.118  238.121 1.00 77.49  ? 73  LYS 2 N   1 
ATOM 3153  C CA  . LYS B 1 73  ? 10.103  45.781  238.422 1.00 78.99  ? 73  LYS 2 CA  1 
ATOM 3154  C C   . LYS B 1 73  ? 9.073   44.686  238.444 1.00 71.38  ? 73  LYS 2 C   1 
ATOM 3155  O O   . LYS B 1 73  ? 9.066   43.832  237.584 1.00 70.43  ? 73  LYS 2 O   1 
ATOM 3156  C CB  . LYS B 1 73  ? 9.738   46.803  237.346 1.00 80.41  ? 73  LYS 2 CB  1 
ATOM 3157  C CG  . LYS B 1 73  ? 10.029  48.251  237.702 1.00 105.05 ? 73  LYS 2 CG  1 
ATOM 3158  C CD  . LYS B 1 73  ? 9.363   49.162  236.666 1.00 142.33 ? 73  LYS 2 CD  1 
ATOM 3159  C CE  . LYS B 1 73  ? 9.515   50.650  236.992 1.00 166.78 ? 73  LYS 2 CE  1 
ATOM 3160  N NZ  . LYS B 1 73  ? 9.007   51.530  235.878 1.00 185.40 ? 73  LYS 2 NZ  1 
ATOM 3161  N N   . GLN B 1 74  ? 8.208   44.675  239.438 1.00 77.03  ? 74  GLN 2 N   1 
ATOM 3162  C CA  . GLN B 1 74  ? 7.229   43.607  239.482 1.00 78.25  ? 74  GLN 2 CA  1 
ATOM 3163  C C   . GLN B 1 74  ? 6.306   43.714  238.274 1.00 57.30  ? 74  GLN 2 C   1 
ATOM 3164  O O   . GLN B 1 74  ? 5.830   44.792  237.953 1.00 39.30  ? 74  GLN 2 O   1 
ATOM 3165  C CB  . GLN B 1 74  ? 6.478   43.591  240.840 1.00 99.05  ? 74  GLN 2 CB  1 
ATOM 3166  C CG  . GLN B 1 74  ? 5.291   42.578  240.995 1.00 120.71 ? 74  GLN 2 CG  1 
ATOM 3167  C CD  . GLN B 1 74  ? 5.521   41.164  240.399 1.00 132.53 ? 74  GLN 2 CD  1 
ATOM 3168  O OE1 . GLN B 1 74  ? 6.609   40.837  239.919 1.00 143.15 ? 74  GLN 2 OE1 1 
ATOM 3169  N NE2 . GLN B 1 74  ? 4.467   40.342  240.401 1.00 118.95 ? 74  GLN 2 NE2 1 
ATOM 3170  N N   . PHE B 1 75  ? 6.103   42.583  237.600 1.00 50.75  ? 75  PHE 2 N   1 
ATOM 3171  C CA  . PHE B 1 75  ? 5.245   42.483  236.421 1.00 60.83  ? 75  PHE 2 CA  1 
ATOM 3172  C C   . PHE B 1 75  ? 4.066   43.434  236.493 1.00 68.72  ? 75  PHE 2 C   1 
ATOM 3173  O O   . PHE B 1 75  ? 3.751   44.154  235.543 1.00 71.54  ? 75  PHE 2 O   1 
ATOM 3174  C CB  . PHE B 1 75  ? 4.705   41.063  236.288 1.00 57.51  ? 75  PHE 2 CB  1 
ATOM 3175  C CG  . PHE B 1 75  ? 5.644   40.106  235.618 1.00 78.48  ? 75  PHE 2 CG  1 
ATOM 3176  C CD1 . PHE B 1 75  ? 6.818   39.704  236.245 1.00 78.61  ? 75  PHE 2 CD1 1 
ATOM 3177  C CD2 . PHE B 1 75  ? 5.312   39.540  234.385 1.00 92.21  ? 75  PHE 2 CD2 1 
ATOM 3178  C CE1 . PHE B 1 75  ? 7.648   38.747  235.665 1.00 78.64  ? 75  PHE 2 CE1 1 
ATOM 3179  C CE2 . PHE B 1 75  ? 6.137   38.580  233.793 1.00 96.76  ? 75  PHE 2 CE2 1 
ATOM 3180  C CZ  . PHE B 1 75  ? 7.308   38.184  234.440 1.00 90.69  ? 75  PHE 2 CZ  1 
ATOM 3181  N N   . THR B 1 76  ? 3.426   43.414  237.651 1.00 82.11  ? 76  THR 2 N   1 
ATOM 3182  C CA  . THR B 1 76  ? 2.271   44.240  237.937 1.00 93.05  ? 76  THR 2 CA  1 
ATOM 3183  C C   . THR B 1 76  ? 2.645   45.698  237.913 1.00 93.27  ? 76  THR 2 C   1 
ATOM 3184  O O   . THR B 1 76  ? 2.035   46.504  237.220 1.00 97.90  ? 76  THR 2 O   1 
ATOM 3185  C CB  . THR B 1 76  ? 1.763   43.952  239.319 1.00 98.48  ? 76  THR 2 CB  1 
ATOM 3186  O OG1 . THR B 1 76  ? 2.170   42.631  239.697 1.00 114.28 ? 76  THR 2 OG1 1 
ATOM 3187  C CG2 . THR B 1 76  ? 0.258   44.060  239.343 1.00 121.04 ? 76  THR 2 CG2 1 
ATOM 3188  N N   . ASP B 1 77  ? 3.634   46.052  238.708 1.00 86.94  ? 77  ASP 2 N   1 
ATOM 3189  C CA  . ASP B 1 77  ? 4.036   47.424  238.727 1.00 89.18  ? 77  ASP 2 CA  1 
ATOM 3190  C C   . ASP B 1 77  ? 5.075   47.746  237.649 1.00 89.53  ? 77  ASP 2 C   1 
ATOM 3191  O O   . ASP B 1 77  ? 6.138   48.288  237.945 1.00 95.84  ? 77  ASP 2 O   1 
ATOM 3192  C CB  . ASP B 1 77  ? 4.538   47.796  240.109 1.00 102.37 ? 77  ASP 2 CB  1 
ATOM 3193  C CG  . ASP B 1 77  ? 4.577   49.285  240.310 1.00 123.83 ? 77  ASP 2 CG  1 
ATOM 3194  O OD1 . ASP B 1 77  ? 3.634   49.966  239.825 1.00 134.76 ? 77  ASP 2 OD1 1 
ATOM 3195  O OD2 . ASP B 1 77  ? 5.547   49.772  240.933 1.00 133.70 ? 77  ASP 2 OD2 1 
ATOM 3196  N N   . ASP B 1 78  ? 4.792   47.395  236.397 1.00 83.59  ? 78  ASP 2 N   1 
ATOM 3197  C CA  . ASP B 1 78  ? 5.742   47.712  235.340 1.00 83.54  ? 78  ASP 2 CA  1 
ATOM 3198  C C   . ASP B 1 78  ? 5.230   48.882  234.521 1.00 80.75  ? 78  ASP 2 C   1 
ATOM 3199  O O   . ASP B 1 78  ? 4.503   48.713  233.543 1.00 78.82  ? 78  ASP 2 O   1 
ATOM 3200  C CB  . ASP B 1 78  ? 6.038   46.507  234.433 1.00 87.72  ? 78  ASP 2 CB  1 
ATOM 3201  C CG  . ASP B 1 78  ? 7.285   46.722  233.545 1.00 93.59  ? 78  ASP 2 CG  1 
ATOM 3202  O OD1 . ASP B 1 78  ? 7.925   47.812  233.649 1.00 80.30  ? 78  ASP 2 OD1 1 
ATOM 3203  O OD2 . ASP B 1 78  ? 7.624   45.796  232.749 1.00 83.29  ? 78  ASP 2 OD2 1 
ATOM 3204  N N   . SER B 1 79  ? 5.528   50.082  234.986 1.00 63.24  ? 79  SER 2 N   1 
ATOM 3205  C CA  . SER B 1 79  ? 5.111   51.256  234.262 1.00 66.95  ? 79  SER 2 CA  1 
ATOM 3206  C C   . SER B 1 79  ? 6.365   51.982  233.856 1.00 68.94  ? 79  SER 2 C   1 
ATOM 3207  O O   . SER B 1 79  ? 6.972   52.688  234.664 1.00 76.90  ? 79  SER 2 O   1 
ATOM 3208  C CB  . SER B 1 79  ? 4.279   52.151  235.147 1.00 81.93  ? 79  SER 2 CB  1 
ATOM 3209  O OG  . SER B 1 79  ? 3.876   53.292  234.413 1.00 114.35 ? 79  SER 2 OG  1 
ATOM 3210  N N   . PRO B 1 80  ? 6.832   51.748  232.633 1.00 64.47  ? 80  PRO 2 N   1 
ATOM 3211  C CA  . PRO B 1 80  ? 8.047   52.399  232.144 1.00 54.52  ? 80  PRO 2 CA  1 
ATOM 3212  C C   . PRO B 1 80  ? 7.670   53.763  231.629 1.00 51.43  ? 80  PRO 2 C   1 
ATOM 3213  O O   . PRO B 1 80  ? 6.481   54.056  231.507 1.00 58.78  ? 80  PRO 2 O   1 
ATOM 3214  C CB  . PRO B 1 80  ? 8.463   51.477  231.016 1.00 58.03  ? 80  PRO 2 CB  1 
ATOM 3215  C CG  . PRO B 1 80  ? 7.115   51.083  230.420 1.00 48.18  ? 80  PRO 2 CG  1 
ATOM 3216  C CD  . PRO B 1 80  ? 6.262   50.829  231.629 1.00 57.15  ? 80  PRO 2 CD  1 
ATOM 3217  N N   . ASP B 1 81  ? 8.661   54.592  231.320 1.00 52.60  ? 81  ASP 2 N   1 
ATOM 3218  C CA  . ASP B 1 81  ? 8.390   55.940  230.799 1.00 64.50  ? 81  ASP 2 CA  1 
ATOM 3219  C C   . ASP B 1 81  ? 8.688   55.958  229.325 1.00 61.10  ? 81  ASP 2 C   1 
ATOM 3220  O O   . ASP B 1 81  ? 9.587   55.261  228.856 1.00 63.07  ? 81  ASP 2 O   1 
ATOM 3221  C CB  . ASP B 1 81  ? 9.292   57.008  231.425 1.00 75.33  ? 81  ASP 2 CB  1 
ATOM 3222  C CG  . ASP B 1 81  ? 9.527   56.806  232.910 1.00 90.73  ? 81  ASP 2 CG  1 
ATOM 3223  O OD1 . ASP B 1 81  ? 8.991   55.841  233.509 1.00 100.68 ? 81  ASP 2 OD1 1 
ATOM 3224  O OD2 . ASP B 1 81  ? 10.291  57.625  233.477 1.00 89.16  ? 81  ASP 2 OD2 1 
ATOM 3225  N N   . LYS B 1 82  ? 8.004   56.817  228.592 1.00 56.92  ? 82  LYS 2 N   1 
ATOM 3226  C CA  . LYS B 1 82  ? 8.267   56.875  227.176 1.00 49.30  ? 82  LYS 2 CA  1 
ATOM 3227  C C   . LYS B 1 82  ? 9.737   57.124  226.932 1.00 45.95  ? 82  LYS 2 C   1 
ATOM 3228  O O   . LYS B 1 82  ? 10.329  56.491  226.077 1.00 49.35  ? 82  LYS 2 O   1 
ATOM 3229  C CB  . LYS B 1 82  ? 7.455   57.962  226.502 1.00 49.39  ? 82  LYS 2 CB  1 
ATOM 3230  C CG  . LYS B 1 82  ? 7.988   58.320  225.123 1.00 63.33  ? 82  LYS 2 CG  1 
ATOM 3231  C CD  . LYS B 1 82  ? 6.855   58.518  224.141 1.00 66.74  ? 82  LYS 2 CD  1 
ATOM 3232  C CE  . LYS B 1 82  ? 7.337   59.182  222.857 1.00 83.34  ? 82  LYS 2 CE  1 
ATOM 3233  N NZ  . LYS B 1 82  ? 6.203   59.511  221.927 1.00 84.56  ? 82  LYS 2 NZ  1 
ATOM 3234  N N   . GLU B 1 83  ? 10.351  57.989  227.724 1.00 43.25  ? 83  GLU 2 N   1 
ATOM 3235  C CA  . GLU B 1 83  ? 11.768  58.292  227.515 1.00 49.91  ? 83  GLU 2 CA  1 
ATOM 3236  C C   . GLU B 1 83  ? 12.668  57.071  227.624 1.00 42.08  ? 83  GLU 2 C   1 
ATOM 3237  O O   . GLU B 1 83  ? 13.831  57.122  227.259 1.00 43.83  ? 83  GLU 2 O   1 
ATOM 3238  C CB  . GLU B 1 83  ? 12.267  59.380  228.470 1.00 59.85  ? 83  GLU 2 CB  1 
ATOM 3239  C CG  . GLU B 1 83  ? 11.747  60.789  228.213 1.00 73.60  ? 83  GLU 2 CG  1 
ATOM 3240  C CD  . GLU B 1 83  ? 10.259  60.945  228.476 1.00 90.25  ? 83  GLU 2 CD  1 
ATOM 3241  O OE1 . GLU B 1 83  ? 9.679   60.167  229.276 1.00 101.98 ? 83  GLU 2 OE1 1 
ATOM 3242  O OE2 . GLU B 1 83  ? 9.665   61.857  227.871 1.00 97.28  ? 83  GLU 2 OE2 1 
ATOM 3243  N N   . GLN B 1 84  ? 12.150  55.979  228.158 1.00 42.50  ? 84  GLN 2 N   1 
ATOM 3244  C CA  . GLN B 1 84  ? 12.953  54.774  228.274 1.00 48.39  ? 84  GLN 2 CA  1 
ATOM 3245  C C   . GLN B 1 84  ? 12.630  53.817  227.146 1.00 40.98  ? 84  GLN 2 C   1 
ATOM 3246  O O   . GLN B 1 84  ? 13.337  52.840  226.915 1.00 43.74  ? 84  GLN 2 O   1 
ATOM 3247  C CB  . GLN B 1 84  ? 12.641  54.047  229.564 1.00 63.76  ? 84  GLN 2 CB  1 
ATOM 3248  C CG  . GLN B 1 84  ? 12.483  54.906  230.769 1.00 77.64  ? 84  GLN 2 CG  1 
ATOM 3249  C CD  . GLN B 1 84  ? 12.368  54.069  232.019 1.00 85.74  ? 84  GLN 2 CD  1 
ATOM 3250  O OE1 . GLN B 1 84  ? 11.445  53.241  232.172 1.00 88.28  ? 84  GLN 2 OE1 1 
ATOM 3251  N NE2 . GLN B 1 84  ? 13.336  54.237  232.908 1.00 91.80  ? 84  GLN 2 NE2 1 
ATOM 3252  N N   . LEU B 1 85  ? 11.499  54.038  226.508 1.00 35.60  ? 85  LEU 2 N   1 
ATOM 3253  C CA  . LEU B 1 85  ? 11.099  53.165  225.431 1.00 37.04  ? 85  LEU 2 CA  1 
ATOM 3254  C C   . LEU B 1 85  ? 11.496  53.608  224.040 1.00 45.89  ? 85  LEU 2 C   1 
ATOM 3255  O O   . LEU B 1 85  ? 10.998  54.610  223.489 1.00 47.06  ? 85  LEU 2 O   1 
ATOM 3256  C CB  . LEU B 1 85  ? 9.610   52.922  225.487 1.00 32.84  ? 85  LEU 2 CB  1 
ATOM 3257  C CG  . LEU B 1 85  ? 9.219   52.502  226.879 1.00 28.38  ? 85  LEU 2 CG  1 
ATOM 3258  C CD1 . LEU B 1 85  ? 7.889   51.806  226.770 1.00 37.81  ? 85  LEU 2 CD1 1 
ATOM 3259  C CD2 . LEU B 1 85  ? 10.282  51.561  227.438 1.00 43.23  ? 85  LEU 2 CD2 1 
ATOM 3260  N N   . PRO B 1 86  ? 12.392  52.845  223.429 1.00 44.53  ? 86  PRO 2 N   1 
ATOM 3261  C CA  . PRO B 1 86  ? 12.801  53.221  222.093 1.00 40.54  ? 86  PRO 2 CA  1 
ATOM 3262  C C   . PRO B 1 86  ? 11.645  52.796  221.181 1.00 44.94  ? 86  PRO 2 C   1 
ATOM 3263  O O   . PRO B 1 86  ? 10.979  51.739  221.406 1.00 38.27  ? 86  PRO 2 O   1 
ATOM 3264  C CB  . PRO B 1 86  ? 14.047  52.372  221.885 1.00 33.59  ? 86  PRO 2 CB  1 
ATOM 3265  C CG  . PRO B 1 86  ? 14.482  52.048  223.260 1.00 26.71  ? 86  PRO 2 CG  1 
ATOM 3266  C CD  . PRO B 1 86  ? 13.189  51.715  223.902 1.00 41.39  ? 86  PRO 2 CD  1 
ATOM 3267  N N   . CYS B 1 87  ? 11.404  53.639  220.182 1.00 26.47  ? 87  CYS 2 N   1 
ATOM 3268  C CA  . CYS B 1 87  ? 10.344  53.429  219.221 1.00 37.93  ? 87  CYS 2 CA  1 
ATOM 3269  C C   . CYS B 1 87  ? 10.836  53.350  217.803 1.00 38.98  ? 87  CYS 2 C   1 
ATOM 3270  O O   . CYS B 1 87  ? 11.862  53.934  217.447 1.00 44.60  ? 87  CYS 2 O   1 
ATOM 3271  C CB  . CYS B 1 87  ? 9.398   54.620  219.245 1.00 41.77  ? 87  CYS 2 CB  1 
ATOM 3272  S SG  . CYS B 1 87  ? 8.381   54.726  220.640 1.00 55.88  ? 87  CYS 2 SG  1 
ATOM 3273  N N   . TYR B 1 88  ? 10.016  52.743  216.962 1.00 31.18  ? 88  TYR 2 N   1 
ATOM 3274  C CA  . TYR B 1 88  ? 10.321  52.686  215.545 1.00 35.47  ? 88  TYR 2 CA  1 
ATOM 3275  C C   . TYR B 1 88  ? 10.296  54.110  214.990 1.00 30.54  ? 88  TYR 2 C   1 
ATOM 3276  O O   . TYR B 1 88  ? 9.437   54.913  215.376 1.00 47.58  ? 88  TYR 2 O   1 
ATOM 3277  C CB  . TYR B 1 88  ? 9.254   51.898  214.806 1.00 15.30  ? 88  TYR 2 CB  1 
ATOM 3278  C CG  . TYR B 1 88  ? 9.324   50.428  215.040 1.00 25.47  ? 88  TYR 2 CG  1 
ATOM 3279  C CD1 . TYR B 1 88  ? 8.798   49.856  216.186 1.00 41.24  ? 88  TYR 2 CD1 1 
ATOM 3280  C CD2 . TYR B 1 88  ? 9.823   49.592  214.071 1.00 23.15  ? 88  TYR 2 CD2 1 
ATOM 3281  C CE1 . TYR B 1 88  ? 8.756   48.475  216.339 1.00 44.32  ? 88  TYR 2 CE1 1 
ATOM 3282  C CE2 . TYR B 1 88  ? 9.789   48.226  214.218 1.00 31.49  ? 88  TYR 2 CE2 1 
ATOM 3283  C CZ  . TYR B 1 88  ? 9.241   47.678  215.337 1.00 31.57  ? 88  TYR 2 CZ  1 
ATOM 3284  O OH  . TYR B 1 88  ? 9.065   46.329  215.375 1.00 46.69  ? 88  TYR 2 OH  1 
ATOM 3285  N N   . SER B 1 89  ? 11.215  54.392  214.073 1.00 29.45  ? 89  SER 2 N   1 
ATOM 3286  C CA  . SER B 1 89  ? 11.327  55.681  213.406 1.00 28.72  ? 89  SER 2 CA  1 
ATOM 3287  C C   . SER B 1 89  ? 10.685  55.471  212.029 1.00 23.99  ? 89  SER 2 C   1 
ATOM 3288  O O   . SER B 1 89  ? 10.905  54.449  211.378 1.00 35.91  ? 89  SER 2 O   1 
ATOM 3289  C CB  . SER B 1 89  ? 12.811  56.063  213.274 1.00 33.50  ? 89  SER 2 CB  1 
ATOM 3290  O OG  . SER B 1 89  ? 13.549  55.736  214.469 1.00 45.93  ? 89  SER 2 OG  1 
ATOM 3291  N N   . VAL B 1 90  ? 9.853   56.402  211.595 1.00 22.44  ? 90  VAL 2 N   1 
ATOM 3292  C CA  . VAL B 1 90  ? 9.186   56.259  210.302 1.00 22.95  ? 90  VAL 2 CA  1 
ATOM 3293  C C   . VAL B 1 90  ? 9.058   57.606  209.594 1.00 21.96  ? 90  VAL 2 C   1 
ATOM 3294  O O   . VAL B 1 90  ? 9.235   58.646  210.226 1.00 27.23  ? 90  VAL 2 O   1 
ATOM 3295  C CB  . VAL B 1 90  ? 7.805   55.707  210.490 1.00 26.07  ? 90  VAL 2 CB  1 
ATOM 3296  C CG1 . VAL B 1 90  ? 6.967   56.724  211.204 1.00 23.70  ? 90  VAL 2 CG1 1 
ATOM 3297  C CG2 . VAL B 1 90  ? 7.193   55.301  209.141 1.00 48.36  ? 90  VAL 2 CG2 1 
ATOM 3298  N N   . ALA B 1 91  ? 8.737   57.589  208.298 1.00 10.10  ? 91  ALA 2 N   1 
ATOM 3299  C CA  . ALA B 1 91  ? 8.613   58.816  207.511 1.00 15.98  ? 91  ALA 2 CA  1 
ATOM 3300  C C   . ALA B 1 91  ? 8.023   58.511  206.156 1.00 17.36  ? 91  ALA 2 C   1 
ATOM 3301  O O   . ALA B 1 91  ? 8.120   57.375  205.665 1.00 15.07  ? 91  ALA 2 O   1 
ATOM 3302  C CB  . ALA B 1 91  ? 9.960   59.455  207.333 1.00 27.91  ? 91  ALA 2 CB  1 
ATOM 3303  N N   . ARG B 1 92  ? 7.435   59.524  205.531 1.00 21.15  ? 92  ARG 2 N   1 
ATOM 3304  C CA  . ARG B 1 92  ? 6.829   59.297  204.233 1.00 21.05  ? 92  ARG 2 CA  1 
ATOM 3305  C C   . ARG B 1 92  ? 7.316   60.307  203.232 1.00 23.54  ? 92  ARG 2 C   1 
ATOM 3306  O O   . ARG B 1 92  ? 7.233   61.510  203.457 1.00 41.15  ? 92  ARG 2 O   1 
ATOM 3307  C CB  . ARG B 1 92  ? 5.309   59.358  204.341 1.00 8.68   ? 92  ARG 2 CB  1 
ATOM 3308  C CG  . ARG B 1 92  ? 4.559   59.323  202.986 1.00 51.90  ? 92  ARG 2 CG  1 
ATOM 3309  C CD  . ARG B 1 92  ? 3.036   59.525  203.165 1.00 57.83  ? 92  ARG 2 CD  1 
ATOM 3310  N NE  . ARG B 1 92  ? 2.826   60.621  204.098 1.00 78.19  ? 92  ARG 2 NE  1 
ATOM 3311  C CZ  . ARG B 1 92  ? 2.745   61.888  203.733 1.00 78.09  ? 92  ARG 2 CZ  1 
ATOM 3312  N NH1 . ARG B 1 92  ? 2.798   62.183  202.429 1.00 48.58  ? 92  ARG 2 NH1 1 
ATOM 3313  N NH2 . ARG B 1 92  ? 2.828   62.847  204.667 1.00 94.49  ? 92  ARG 2 NH2 1 
ATOM 3314  N N   . ILE B 1 93  ? 7.857   59.812  202.139 1.00 9.38   ? 93  ILE 2 N   1 
ATOM 3315  C CA  . ILE B 1 93  ? 8.352   60.681  201.111 1.00 18.56  ? 93  ILE 2 CA  1 
ATOM 3316  C C   . ILE B 1 93  ? 7.294   60.724  200.071 1.00 23.99  ? 93  ILE 2 C   1 
ATOM 3317  O O   . ILE B 1 93  ? 6.929   59.717  199.490 1.00 33.57  ? 93  ILE 2 O   1 
ATOM 3318  C CB  . ILE B 1 93  ? 9.551   60.107  200.456 1.00 22.03  ? 93  ILE 2 CB  1 
ATOM 3319  C CG1 . ILE B 1 93  ? 10.620  59.902  201.497 1.00 2.00   ? 93  ILE 2 CG1 1 
ATOM 3320  C CG2 . ILE B 1 93  ? 9.984   60.990  199.294 1.00 19.43  ? 93  ILE 2 CG2 1 
ATOM 3321  C CD1 . ILE B 1 93  ? 11.569  58.930  201.055 1.00 16.34  ? 93  ILE 2 CD1 1 
ATOM 3322  N N   . PRO B 1 94  ? 6.840   61.912  199.759 1.00 25.72  ? 94  PRO 2 N   1 
ATOM 3323  C CA  . PRO B 1 94  ? 5.806   62.157  198.773 1.00 25.48  ? 94  PRO 2 CA  1 
ATOM 3324  C C   . PRO B 1 94  ? 6.413   62.045  197.418 1.00 20.86  ? 94  PRO 2 C   1 
ATOM 3325  O O   . PRO B 1 94  ? 7.559   62.442  197.203 1.00 25.52  ? 94  PRO 2 O   1 
ATOM 3326  C CB  . PRO B 1 94  ? 5.446   63.607  199.034 1.00 26.66  ? 94  PRO 2 CB  1 
ATOM 3327  C CG  . PRO B 1 94  ? 6.133   63.939  200.311 1.00 28.49  ? 94  PRO 2 CG  1 
ATOM 3328  C CD  . PRO B 1 94  ? 7.370   63.176  200.238 1.00 21.15  ? 94  PRO 2 CD  1 
ATOM 3329  N N   . LEU B 1 95  ? 5.634   61.528  196.494 1.00 13.10  ? 95  LEU 2 N   1 
ATOM 3330  C CA  . LEU B 1 95  ? 6.122   61.416  195.141 1.00 27.27  ? 95  LEU 2 CA  1 
ATOM 3331  C C   . LEU B 1 95  ? 5.143   62.121  194.257 1.00 23.92  ? 95  LEU 2 C   1 
ATOM 3332  O O   . LEU B 1 95  ? 3.951   62.198  194.530 1.00 32.62  ? 95  LEU 2 O   1 
ATOM 3333  C CB  . LEU B 1 95  ? 6.253   59.971  194.725 1.00 26.43  ? 95  LEU 2 CB  1 
ATOM 3334  C CG  . LEU B 1 95  ? 7.019   59.219  195.786 1.00 25.69  ? 95  LEU 2 CG  1 
ATOM 3335  C CD1 . LEU B 1 95  ? 7.154   57.794  195.344 1.00 22.26  ? 95  LEU 2 CD1 1 
ATOM 3336  C CD2 . LEU B 1 95  ? 8.368   59.875  195.980 1.00 5.47   ? 95  LEU 2 CD2 1 
ATOM 3337  N N   . PRO B 1 96  ? 5.640   62.697  193.197 1.00 26.29  ? 96  PRO 2 N   1 
ATOM 3338  C CA  . PRO B 1 96  ? 4.772   63.416  192.271 1.00 29.69  ? 96  PRO 2 CA  1 
ATOM 3339  C C   . PRO B 1 96  ? 3.852   62.473  191.522 1.00 22.77  ? 96  PRO 2 C   1 
ATOM 3340  O O   . PRO B 1 96  ? 4.337   61.488  190.996 1.00 17.82  ? 96  PRO 2 O   1 
ATOM 3341  C CB  . PRO B 1 96  ? 5.777   64.084  191.344 1.00 18.29  ? 96  PRO 2 CB  1 
ATOM 3342  C CG  . PRO B 1 96  ? 6.946   63.149  191.362 1.00 28.91  ? 96  PRO 2 CG  1 
ATOM 3343  C CD  . PRO B 1 96  ? 7.050   62.742  192.791 1.00 34.34  ? 96  PRO 2 CD  1 
ATOM 3344  N N   . ASN B 1 97  ? 2.546   62.745  191.487 1.00 21.11  ? 97  ASN 2 N   1 
ATOM 3345  C CA  . ASN B 1 97  ? 1.660   61.856  190.736 1.00 30.21  ? 97  ASN 2 CA  1 
ATOM 3346  C C   . ASN B 1 97  ? 2.073   61.776  189.270 1.00 26.53  ? 97  ASN 2 C   1 
ATOM 3347  O O   . ASN B 1 97  ? 2.130   62.780  188.558 1.00 22.32  ? 97  ASN 2 O   1 
ATOM 3348  C CB  . ASN B 1 97  ? 0.203   62.259  190.792 1.00 33.72  ? 97  ASN 2 CB  1 
ATOM 3349  C CG  . ASN B 1 97  ? -0.638  61.380  189.907 1.00 41.58  ? 97  ASN 2 CG  1 
ATOM 3350  O OD1 . ASN B 1 97  ? -0.662  61.553  188.684 1.00 48.16  ? 97  ASN 2 OD1 1 
ATOM 3351  N ND2 . ASN B 1 97  ? -1.228  60.353  190.493 1.00 50.13  ? 97  ASN 2 ND2 1 
ATOM 3352  N N   . ILE B 1 98  ? 2.216   60.567  188.767 1.00 23.37  ? 98  ILE 2 N   1 
ATOM 3353  C CA  . ILE B 1 98  ? 2.693   60.466  187.412 1.00 29.98  ? 98  ILE 2 CA  1 
ATOM 3354  C C   . ILE B 1 98  ? 1.636   60.452  186.336 1.00 32.57  ? 98  ILE 2 C   1 
ATOM 3355  O O   . ILE B 1 98  ? 1.920   60.728  185.164 1.00 41.23  ? 98  ILE 2 O   1 
ATOM 3356  C CB  . ILE B 1 98  ? 3.636   59.267  187.260 1.00 45.51  ? 98  ILE 2 CB  1 
ATOM 3357  C CG1 . ILE B 1 98  ? 2.877   57.983  187.510 1.00 68.24  ? 98  ILE 2 CG1 1 
ATOM 3358  C CG2 . ILE B 1 98  ? 4.784   59.306  188.308 1.00 16.26  ? 98  ILE 2 CG2 1 
ATOM 3359  C CD1 . ILE B 1 98  ? 3.830   56.855  187.798 1.00 100.80 ? 98  ILE 2 CD1 1 
ATOM 3360  N N   . ASN B 1 99  ? 0.405   60.156  186.722 1.00 38.55  ? 99  ASN 2 N   1 
ATOM 3361  C CA  . ASN B 1 99  ? -0.670  60.107  185.744 1.00 51.85  ? 99  ASN 2 CA  1 
ATOM 3362  C C   . ASN B 1 99  ? -1.097  61.471  185.240 1.00 65.56  ? 99  ASN 2 C   1 
ATOM 3363  O O   . ASN B 1 99  ? -1.935  61.543  184.356 1.00 65.85  ? 99  ASN 2 O   1 
ATOM 3364  C CB  . ASN B 1 99  ? -1.898  59.423  186.306 1.00 54.79  ? 99  ASN 2 CB  1 
ATOM 3365  C CG  . ASN B 1 99  ? -1.570  58.196  187.088 1.00 66.21  ? 99  ASN 2 CG  1 
ATOM 3366  O OD1 . ASN B 1 99  ? -2.004  58.049  188.230 1.00 76.48  ? 99  ASN 2 OD1 1 
ATOM 3367  N ND2 . ASN B 1 99  ? -0.797  57.299  186.491 1.00 66.47  ? 99  ASN 2 ND2 1 
ATOM 3368  N N   . GLU B 1 100 ? -0.532  62.541  185.800 1.00 87.35  ? 100 GLU 2 N   1 
ATOM 3369  C CA  . GLU B 1 100 ? -0.869  63.928  185.417 1.00 94.21  ? 100 GLU 2 CA  1 
ATOM 3370  C C   . GLU B 1 100 ? -1.268  64.095  183.934 1.00 90.32  ? 100 GLU 2 C   1 
ATOM 3371  O O   . GLU B 1 100 ? -2.332  64.621  183.619 1.00 87.55  ? 100 GLU 2 O   1 
ATOM 3372  C CB  . GLU B 1 100 ? 0.283   64.895  185.793 1.00 104.31 ? 100 GLU 2 CB  1 
ATOM 3373  C CG  . GLU B 1 100 ? -0.157  66.242  186.443 1.00 114.26 ? 100 GLU 2 CG  1 
ATOM 3374  C CD  . GLU B 1 100 ? -0.119  67.461  185.493 1.00 121.14 ? 100 GLU 2 CD  1 
ATOM 3375  O OE1 . GLU B 1 100 ? 0.775   67.527  184.609 1.00 111.02 ? 100 GLU 2 OE1 1 
ATOM 3376  O OE2 . GLU B 1 100 ? -0.958  68.383  185.665 1.00 121.27 ? 100 GLU 2 OE2 1 
ATOM 3377  N N   . ASP B 1 101 ? -0.433  63.638  183.019 1.00 95.87  ? 101 ASP 2 N   1 
ATOM 3378  C CA  . ASP B 1 101 ? -0.780  63.760  181.616 1.00 109.01 ? 101 ASP 2 CA  1 
ATOM 3379  C C   . ASP B 1 101 ? -0.784  62.386  180.971 1.00 112.89 ? 101 ASP 2 C   1 
ATOM 3380  O O   . ASP B 1 101 ? -0.502  62.224  179.776 1.00 113.46 ? 101 ASP 2 O   1 
ATOM 3381  C CB  . ASP B 1 101 ? 0.173   64.731  180.901 1.00 129.84 ? 101 ASP 2 CB  1 
ATOM 3382  C CG  . ASP B 1 101 ? 1.634   64.562  181.321 1.00 151.74 ? 101 ASP 2 CG  1 
ATOM 3383  O OD1 . ASP B 1 101 ? 2.022   63.452  181.765 1.00 165.79 ? 101 ASP 2 OD1 1 
ATOM 3384  O OD2 . ASP B 1 101 ? 2.392   65.559  181.199 1.00 161.62 ? 101 ASP 2 OD2 1 
ATOM 3385  N N   . LEU B 1 102 ? -1.143  61.396  181.778 1.00 120.50 ? 102 LEU 2 N   1 
ATOM 3386  C CA  . LEU B 1 102 ? -1.184  60.018  181.320 1.00 126.48 ? 102 LEU 2 CA  1 
ATOM 3387  C C   . LEU B 1 102 ? -2.303  59.749  180.332 1.00 130.34 ? 102 LEU 2 C   1 
ATOM 3388  O O   . LEU B 1 102 ? -3.495  59.929  180.625 1.00 123.85 ? 102 LEU 2 O   1 
ATOM 3389  C CB  . LEU B 1 102 ? -1.218  59.044  182.493 1.00 116.62 ? 102 LEU 2 CB  1 
ATOM 3390  C CG  . LEU B 1 102 ? -0.273  57.859  182.271 1.00 109.70 ? 102 LEU 2 CG  1 
ATOM 3391  C CD1 . LEU B 1 102 ? 0.774   58.140  181.170 1.00 91.83  ? 102 LEU 2 CD1 1 
ATOM 3392  C CD2 . LEU B 1 102 ? 0.388   57.539  183.590 1.00 105.67 ? 102 LEU 2 CD2 1 
ATOM 3393  N N   . THR B 1 103 ? -1.872  59.194  179.203 1.00 137.84 ? 103 THR 2 N   1 
ATOM 3394  C CA  . THR B 1 103 ? -2.676  58.886  178.021 1.00 152.08 ? 103 THR 2 CA  1 
ATOM 3395  C C   . THR B 1 103 ? -4.158  58.424  178.001 1.00 153.61 ? 103 THR 2 C   1 
ATOM 3396  O O   . THR B 1 103 ? -5.030  59.232  177.695 1.00 157.61 ? 103 THR 2 O   1 
ATOM 3397  C CB  . THR B 1 103 ? -1.826  58.092  176.972 1.00 155.17 ? 103 THR 2 CB  1 
ATOM 3398  O OG1 . THR B 1 103 ? -0.958  57.171  177.645 1.00 161.03 ? 103 THR 2 OG1 1 
ATOM 3399  C CG2 . THR B 1 103 ? -0.958  59.063  176.142 1.00 153.37 ? 103 THR 2 CG2 1 
ATOM 3400  N N   . CYS B 1 104 ? -4.467  57.169  178.291 1.00 154.44 ? 104 CYS 2 N   1 
ATOM 3401  C CA  . CYS B 1 104 ? -5.867  56.731  178.189 1.00 157.26 ? 104 CYS 2 CA  1 
ATOM 3402  C C   . CYS B 1 104 ? -6.368  56.260  179.563 1.00 149.60 ? 104 CYS 2 C   1 
ATOM 3403  O O   . CYS B 1 104 ? -7.010  57.010  180.324 1.00 141.37 ? 104 CYS 2 O   1 
ATOM 3404  C CB  . CYS B 1 104 ? -5.925  55.596  177.129 1.00 174.07 ? 104 CYS 2 CB  1 
ATOM 3405  S SG  . CYS B 1 104 ? -7.532  55.119  176.375 1.00 211.92 ? 104 CYS 2 SG  1 
ATOM 3406  N N   . GLY B 1 105 ? -6.137  54.975  179.814 1.00 145.28 ? 105 GLY 2 N   1 
ATOM 3407  C CA  . GLY B 1 105 ? -6.484  54.331  181.066 1.00 137.13 ? 105 GLY 2 CA  1 
ATOM 3408  C C   . GLY B 1 105 ? -5.197  53.654  181.507 1.00 130.74 ? 105 GLY 2 C   1 
ATOM 3409  O O   . GLY B 1 105 ? -5.193  52.695  182.295 1.00 140.42 ? 105 GLY 2 O   1 
ATOM 3410  N N   . ASN B 1 106 ? -4.110  54.083  180.868 1.00 113.49 ? 106 ASN 2 N   1 
ATOM 3411  C CA  . ASN B 1 106 ? -2.787  53.597  181.185 1.00 92.07  ? 106 ASN 2 CA  1 
ATOM 3412  C C   . ASN B 1 106 ? -2.542  54.343  182.459 1.00 74.51  ? 106 ASN 2 C   1 
ATOM 3413  O O   . ASN B 1 106 ? -2.611  55.566  182.477 1.00 74.86  ? 106 ASN 2 O   1 
ATOM 3414  C CB  . ASN B 1 106 ? -1.778  54.058  180.145 1.00 85.71  ? 106 ASN 2 CB  1 
ATOM 3415  C CG  . ASN B 1 106 ? -1.759  53.171  178.944 1.00 98.12  ? 106 ASN 2 CG  1 
ATOM 3416  O OD1 . ASN B 1 106 ? -1.126  52.111  178.942 1.00 106.35 ? 106 ASN 2 OD1 1 
ATOM 3417  N ND2 . ASN B 1 106 ? -2.491  53.571  177.916 1.00 102.32 ? 106 ASN 2 ND2 1 
ATOM 3418  N N   . ILE B 1 107 ? -2.368  53.619  183.543 1.00 54.27  ? 107 ILE 2 N   1 
ATOM 3419  C CA  . ILE B 1 107 ? -2.130  54.280  184.794 1.00 41.21  ? 107 ILE 2 CA  1 
ATOM 3420  C C   . ILE B 1 107 ? -0.779  53.801  185.276 1.00 42.54  ? 107 ILE 2 C   1 
ATOM 3421  O O   . ILE B 1 107 ? -0.436  52.629  185.109 1.00 57.28  ? 107 ILE 2 O   1 
ATOM 3422  C CB  . ILE B 1 107 ? -3.268  54.019  185.783 1.00 30.30  ? 107 ILE 2 CB  1 
ATOM 3423  C CG1 . ILE B 1 107 ? -2.753  54.124  187.205 1.00 36.29  ? 107 ILE 2 CG1 1 
ATOM 3424  C CG2 . ILE B 1 107 ? -3.901  52.677  185.547 1.00 52.43  ? 107 ILE 2 CG2 1 
ATOM 3425  C CD1 . ILE B 1 107 ? -3.856  54.022  188.198 1.00 56.57  ? 107 ILE 2 CD1 1 
ATOM 3426  N N   . LEU B 1 108 ? 0.025   54.740  185.757 1.00 27.38  ? 108 LEU 2 N   1 
ATOM 3427  C CA  . LEU B 1 108 ? 1.367   54.436  186.226 1.00 23.43  ? 108 LEU 2 CA  1 
ATOM 3428  C C   . LEU B 1 108 ? 1.515   54.704  187.704 1.00 22.29  ? 108 LEU 2 C   1 
ATOM 3429  O O   . LEU B 1 108 ? 0.834   55.571  188.242 1.00 42.91  ? 108 LEU 2 O   1 
ATOM 3430  C CB  . LEU B 1 108 ? 2.370   55.309  185.490 1.00 11.25  ? 108 LEU 2 CB  1 
ATOM 3431  C CG  . LEU B 1 108 ? 2.750   54.988  184.059 1.00 23.49  ? 108 LEU 2 CG  1 
ATOM 3432  C CD1 . LEU B 1 108 ? 3.457   56.171  183.511 1.00 23.68  ? 108 LEU 2 CD1 1 
ATOM 3433  C CD2 . LEU B 1 108 ? 3.661   53.790  183.995 1.00 33.41  ? 108 LEU 2 CD2 1 
ATOM 3434  N N   . MET B 1 109 ? 2.431   53.992  188.353 1.00 18.76  ? 109 MET 2 N   1 
ATOM 3435  C CA  . MET B 1 109 ? 2.712   54.181  189.782 1.00 18.64  ? 109 MET 2 CA  1 
ATOM 3436  C C   . MET B 1 109 ? 4.225   54.050  190.027 1.00 25.00  ? 109 MET 2 C   1 
ATOM 3437  O O   . MET B 1 109 ? 4.967   53.433  189.240 1.00 20.76  ? 109 MET 2 O   1 
ATOM 3438  C CB  . MET B 1 109 ? 1.984   53.161  190.657 1.00 27.27  ? 109 MET 2 CB  1 
ATOM 3439  C CG  . MET B 1 109 ? 0.456   53.163  190.606 1.00 20.57  ? 109 MET 2 CG  1 
ATOM 3440  S SD  . MET B 1 109 ? -0.283  52.366  192.083 1.00 49.03  ? 109 MET 2 SD  1 
ATOM 3441  C CE  . MET B 1 109 ? -0.933  51.030  191.272 1.00 14.71  ? 109 MET 2 CE  1 
ATOM 3442  N N   . TRP B 1 110 ? 4.690   54.673  191.100 1.00 29.84  ? 110 TRP 2 N   1 
ATOM 3443  C CA  . TRP B 1 110 ? 6.101   54.624  191.438 1.00 17.53  ? 110 TRP 2 CA  1 
ATOM 3444  C C   . TRP B 1 110 ? 6.417   53.283  192.059 1.00 26.29  ? 110 TRP 2 C   1 
ATOM 3445  O O   . TRP B 1 110 ? 5.761   52.852  193.035 1.00 30.22  ? 110 TRP 2 O   1 
ATOM 3446  C CB  . TRP B 1 110 ? 6.426   55.719  192.442 1.00 30.50  ? 110 TRP 2 CB  1 
ATOM 3447  C CG  . TRP B 1 110 ? 6.506   57.087  191.857 1.00 34.44  ? 110 TRP 2 CG  1 
ATOM 3448  C CD1 . TRP B 1 110 ? 5.679   58.136  192.104 1.00 49.77  ? 110 TRP 2 CD1 1 
ATOM 3449  C CD2 . TRP B 1 110 ? 7.539   57.588  191.020 1.00 28.76  ? 110 TRP 2 CD2 1 
ATOM 3450  N NE1 . TRP B 1 110 ? 6.141   59.267  191.485 1.00 36.06  ? 110 TRP 2 NE1 1 
ATOM 3451  C CE2 . TRP B 1 110 ? 7.272   58.948  190.813 1.00 23.23  ? 110 TRP 2 CE2 1 
ATOM 3452  C CE3 . TRP B 1 110 ? 8.653   57.009  190.433 1.00 36.21  ? 110 TRP 2 CE3 1 
ATOM 3453  C CZ2 . TRP B 1 110 ? 8.100   59.734  190.054 1.00 19.20  ? 110 TRP 2 CZ2 1 
ATOM 3454  C CZ3 . TRP B 1 110 ? 9.469   57.801  189.681 1.00 35.29  ? 110 TRP 2 CZ3 1 
ATOM 3455  C CH2 . TRP B 1 110 ? 9.188   59.147  189.491 1.00 27.29  ? 110 TRP 2 CH2 1 
ATOM 3456  N N   . GLU B 1 111 ? 7.411   52.617  191.490 1.00 18.38  ? 111 GLU 2 N   1 
ATOM 3457  C CA  . GLU B 1 111 ? 7.812   51.332  192.011 1.00 18.29  ? 111 GLU 2 CA  1 
ATOM 3458  C C   . GLU B 1 111 ? 9.193   51.395  192.611 1.00 22.80  ? 111 GLU 2 C   1 
ATOM 3459  O O   . GLU B 1 111 ? 10.133  51.931  191.997 1.00 26.08  ? 111 GLU 2 O   1 
ATOM 3460  C CB  . GLU B 1 111 ? 7.823   50.305  190.918 1.00 19.32  ? 111 GLU 2 CB  1 
ATOM 3461  C CG  . GLU B 1 111 ? 8.369   48.951  191.368 1.00 31.60  ? 111 GLU 2 CG  1 
ATOM 3462  C CD  . GLU B 1 111 ? 8.529   48.041  190.186 1.00 34.20  ? 111 GLU 2 CD  1 
ATOM 3463  O OE1 . GLU B 1 111 ? 8.431   48.547  189.052 1.00 22.52  ? 111 GLU 2 OE1 1 
ATOM 3464  O OE2 . GLU B 1 111 ? 8.724   46.826  190.347 1.00 27.48  ? 111 GLU 2 OE2 1 
ATOM 3465  N N   . ALA B 1 112 ? 9.316   50.862  193.818 1.00 13.38  ? 112 ALA 2 N   1 
ATOM 3466  C CA  . ALA B 1 112 ? 10.600  50.853  194.480 1.00 16.78  ? 112 ALA 2 CA  1 
ATOM 3467  C C   . ALA B 1 112 ? 11.284  49.594  194.092 1.00 18.03  ? 112 ALA 2 C   1 
ATOM 3468  O O   . ALA B 1 112 ? 10.832  48.497  194.401 1.00 37.51  ? 112 ALA 2 O   1 
ATOM 3469  C CB  . ALA B 1 112 ? 10.438  50.902  195.929 1.00 13.66  ? 112 ALA 2 CB  1 
ATOM 3470  N N   . VAL B 1 113 ? 12.433  49.764  193.495 1.00 14.79  ? 113 VAL 2 N   1 
ATOM 3471  C CA  . VAL B 1 113 ? 13.202  48.645  193.028 1.00 16.28  ? 113 VAL 2 CA  1 
ATOM 3472  C C   . VAL B 1 113 ? 14.380  48.238  193.891 1.00 24.44  ? 113 VAL 2 C   1 
ATOM 3473  O O   . VAL B 1 113 ? 14.617  47.043  194.204 1.00 5.24   ? 113 VAL 2 O   1 
ATOM 3474  C CB  . VAL B 1 113 ? 13.749  49.026  191.696 1.00 2.00   ? 113 VAL 2 CB  1 
ATOM 3475  C CG1 . VAL B 1 113 ? 14.938  48.213  191.346 1.00 20.40  ? 113 VAL 2 CG1 1 
ATOM 3476  C CG2 . VAL B 1 113 ? 12.715  48.834  190.712 1.00 10.62  ? 113 VAL 2 CG2 1 
ATOM 3477  N N   . THR B 1 114 ? 15.115  49.255  194.288 1.00 18.87  ? 114 THR 2 N   1 
ATOM 3478  C CA  . THR B 1 114 ? 16.320  48.997  194.983 1.00 12.22  ? 114 THR 2 CA  1 
ATOM 3479  C C   . THR B 1 114 ? 16.614  49.852  196.129 1.00 8.75   ? 114 THR 2 C   1 
ATOM 3480  O O   . THR B 1 114 ? 16.326  51.034  196.121 1.00 37.06  ? 114 THR 2 O   1 
ATOM 3481  C CB  . THR B 1 114 ? 17.354  49.157  193.977 1.00 3.50   ? 114 THR 2 CB  1 
ATOM 3482  O OG1 . THR B 1 114 ? 17.604  47.864  193.462 1.00 18.91  ? 114 THR 2 OG1 1 
ATOM 3483  C CG2 . THR B 1 114 ? 18.578  49.862  194.503 1.00 24.96  ? 114 THR 2 CG2 1 
ATOM 3484  N N   . VAL B 1 115 ? 17.245  49.285  197.116 1.00 2.30   ? 115 VAL 2 N   1 
ATOM 3485  C CA  . VAL B 1 115 ? 17.560  50.143  198.212 1.00 16.58  ? 115 VAL 2 CA  1 
ATOM 3486  C C   . VAL B 1 115 ? 18.957  49.898  198.673 1.00 13.56  ? 115 VAL 2 C   1 
ATOM 3487  O O   . VAL B 1 115 ? 19.475  48.804  198.517 1.00 24.22  ? 115 VAL 2 O   1 
ATOM 3488  C CB  . VAL B 1 115 ? 16.629  49.925  199.358 1.00 17.72  ? 115 VAL 2 CB  1 
ATOM 3489  C CG1 . VAL B 1 115 ? 16.627  48.449  199.737 1.00 2.00   ? 115 VAL 2 CG1 1 
ATOM 3490  C CG2 . VAL B 1 115 ? 17.056  50.816  200.494 1.00 2.28   ? 115 VAL 2 CG2 1 
ATOM 3491  N N   . LYS B 1 116 ? 19.591  50.947  199.161 1.00 7.26   ? 116 LYS 2 N   1 
ATOM 3492  C CA  . LYS B 1 116 ? 20.934  50.843  199.711 1.00 19.01  ? 116 LYS 2 CA  1 
ATOM 3493  C C   . LYS B 1 116 ? 20.790  51.530  201.022 1.00 20.73  ? 116 LYS 2 C   1 
ATOM 3494  O O   . LYS B 1 116 ? 20.289  52.665  201.081 1.00 29.52  ? 116 LYS 2 O   1 
ATOM 3495  C CB  . LYS B 1 116 ? 21.959  51.651  198.930 1.00 9.66   ? 116 LYS 2 CB  1 
ATOM 3496  C CG  . LYS B 1 116 ? 22.458  51.019  197.662 1.00 33.89  ? 116 LYS 2 CG  1 
ATOM 3497  C CD  . LYS B 1 116 ? 23.825  51.586  197.269 1.00 33.71  ? 116 LYS 2 CD  1 
ATOM 3498  C CE  . LYS B 1 116 ? 24.133  51.324  195.807 1.00 48.63  ? 116 LYS 2 CE  1 
ATOM 3499  N NZ  . LYS B 1 116 ? 25.486  51.801  195.418 1.00 59.42  ? 116 LYS 2 NZ  1 
ATOM 3500  N N   . THR B 1 117 ? 21.190  50.865  202.082 1.00 7.32   ? 117 THR 2 N   1 
ATOM 3501  C CA  . THR B 1 117 ? 21.092  51.525  203.353 1.00 20.92  ? 117 THR 2 CA  1 
ATOM 3502  C C   . THR B 1 117 ? 22.356  51.308  204.155 1.00 26.11  ? 117 THR 2 C   1 
ATOM 3503  O O   . THR B 1 117 ? 23.163  50.434  203.819 1.00 41.91  ? 117 THR 2 O   1 
ATOM 3504  C CB  . THR B 1 117 ? 19.863  51.114  204.124 1.00 21.42  ? 117 THR 2 CB  1 
ATOM 3505  O OG1 . THR B 1 117 ? 19.941  51.651  205.444 1.00 47.21  ? 117 THR 2 OG1 1 
ATOM 3506  C CG2 . THR B 1 117 ? 19.781  49.651  204.222 1.00 14.86  ? 117 THR 2 CG2 1 
ATOM 3507  N N   . GLU B 1 118 ? 22.538  52.103  205.208 1.00 22.11  ? 118 GLU 2 N   1 
ATOM 3508  C CA  . GLU B 1 118 ? 23.752  51.997  206.008 1.00 28.49  ? 118 GLU 2 CA  1 
ATOM 3509  C C   . GLU B 1 118 ? 23.577  52.704  207.320 1.00 35.07  ? 118 GLU 2 C   1 
ATOM 3510  O O   . GLU B 1 118 ? 22.775  53.656  207.421 1.00 36.32  ? 118 GLU 2 O   1 
ATOM 3511  C CB  . GLU B 1 118 ? 24.867  52.663  205.253 1.00 21.48  ? 118 GLU 2 CB  1 
ATOM 3512  C CG  . GLU B 1 118 ? 26.218  52.450  205.762 1.00 30.36  ? 118 GLU 2 CG  1 
ATOM 3513  C CD  . GLU B 1 118 ? 27.171  52.863  204.701 1.00 36.76  ? 118 GLU 2 CD  1 
ATOM 3514  O OE1 . GLU B 1 118 ? 27.358  52.069  203.760 1.00 52.39  ? 118 GLU 2 OE1 1 
ATOM 3515  O OE2 . GLU B 1 118 ? 27.654  54.012  204.758 1.00 51.41  ? 118 GLU 2 OE2 1 
ATOM 3516  N N   . VAL B 1 119 ? 24.275  52.236  208.345 1.00 25.12  ? 119 VAL 2 N   1 
ATOM 3517  C CA  . VAL B 1 119 ? 24.086  52.932  209.589 1.00 27.95  ? 119 VAL 2 CA  1 
ATOM 3518  C C   . VAL B 1 119 ? 25.034  54.066  209.663 1.00 29.39  ? 119 VAL 2 C   1 
ATOM 3519  O O   . VAL B 1 119 ? 26.255  53.916  209.478 1.00 39.04  ? 119 VAL 2 O   1 
ATOM 3520  C CB  . VAL B 1 119 ? 24.191  52.064  210.795 1.00 31.35  ? 119 VAL 2 CB  1 
ATOM 3521  C CG1 . VAL B 1 119 ? 24.419  52.931  212.016 1.00 17.85  ? 119 VAL 2 CG1 1 
ATOM 3522  C CG2 . VAL B 1 119 ? 22.887  51.308  210.957 1.00 26.71  ? 119 VAL 2 CG2 1 
ATOM 3523  N N   . ILE B 1 120 ? 24.484  55.207  210.012 1.00 17.73  ? 120 ILE 2 N   1 
ATOM 3524  C CA  . ILE B 1 120 ? 25.324  56.356  210.042 1.00 22.28  ? 120 ILE 2 CA  1 
ATOM 3525  C C   . ILE B 1 120 ? 26.076  56.642  211.294 1.00 29.29  ? 120 ILE 2 C   1 
ATOM 3526  O O   . ILE B 1 120 ? 25.489  56.730  212.370 1.00 35.97  ? 120 ILE 2 O   1 
ATOM 3527  C CB  . ILE B 1 120 ? 24.590  57.558  209.660 1.00 24.95  ? 120 ILE 2 CB  1 
ATOM 3528  C CG1 . ILE B 1 120 ? 23.704  57.244  208.459 1.00 31.60  ? 120 ILE 2 CG1 1 
ATOM 3529  C CG2 . ILE B 1 120 ? 25.580  58.585  209.297 1.00 12.85  ? 120 ILE 2 CG2 1 
ATOM 3530  C CD1 . ILE B 1 120 ? 22.985  58.426  207.929 1.00 42.96  ? 120 ILE 2 CD1 1 
ATOM 3531  N N   . GLY B 1 121 ? 27.389  56.769  211.132 1.00 27.46  ? 121 GLY 2 N   1 
ATOM 3532  C CA  . GLY B 1 121 ? 28.242  57.101  212.252 1.00 29.75  ? 121 GLY 2 CA  1 
ATOM 3533  C C   . GLY B 1 121 ? 28.728  55.985  213.129 1.00 26.15  ? 121 GLY 2 C   1 
ATOM 3534  O O   . GLY B 1 121 ? 29.039  56.221  214.267 1.00 21.95  ? 121 GLY 2 O   1 
ATOM 3535  N N   . VAL B 1 122 ? 28.930  54.793  212.607 1.00 32.36  ? 122 VAL 2 N   1 
ATOM 3536  C CA  . VAL B 1 122 ? 29.359  53.752  213.529 1.00 28.60  ? 122 VAL 2 CA  1 
ATOM 3537  C C   . VAL B 1 122 ? 30.634  54.096  214.274 1.00 21.03  ? 122 VAL 2 C   1 
ATOM 3538  O O   . VAL B 1 122 ? 30.730  53.797  215.453 1.00 27.19  ? 122 VAL 2 O   1 
ATOM 3539  C CB  . VAL B 1 122 ? 29.533  52.400  212.849 1.00 28.30  ? 122 VAL 2 CB  1 
ATOM 3540  C CG1 . VAL B 1 122 ? 28.430  52.175  211.856 1.00 48.69  ? 122 VAL 2 CG1 1 
ATOM 3541  C CG2 . VAL B 1 122 ? 30.856  52.329  212.166 1.00 51.19  ? 122 VAL 2 CG2 1 
ATOM 3542  N N   . THR B 1 123 ? 31.572  54.772  213.606 1.00 18.03  ? 123 THR 2 N   1 
ATOM 3543  C CA  . THR B 1 123 ? 32.871  55.129  214.196 1.00 22.77  ? 123 THR 2 CA  1 
ATOM 3544  C C   . THR B 1 123 ? 32.761  55.878  215.470 1.00 28.75  ? 123 THR 2 C   1 
ATOM 3545  O O   . THR B 1 123 ? 33.731  56.036  216.207 1.00 35.73  ? 123 THR 2 O   1 
ATOM 3546  C CB  . THR B 1 123 ? 33.635  56.086  213.352 1.00 19.42  ? 123 THR 2 CB  1 
ATOM 3547  O OG1 . THR B 1 123 ? 32.708  56.967  212.708 1.00 32.33  ? 123 THR 2 OG1 1 
ATOM 3548  C CG2 . THR B 1 123 ? 34.507  55.356  212.400 1.00 22.97  ? 123 THR 2 CG2 1 
ATOM 3549  N N   . ALA B 1 124 ? 31.611  56.477  215.663 1.00 28.67  ? 124 ALA 2 N   1 
ATOM 3550  C CA  . ALA B 1 124 ? 31.424  57.238  216.861 1.00 32.08  ? 124 ALA 2 CA  1 
ATOM 3551  C C   . ALA B 1 124 ? 31.497  56.427  218.129 1.00 33.43  ? 124 ALA 2 C   1 
ATOM 3552  O O   . ALA B 1 124 ? 31.771  56.975  219.172 1.00 55.19  ? 124 ALA 2 O   1 
ATOM 3553  C CB  . ALA B 1 124 ? 30.150  57.956  216.800 1.00 43.49  ? 124 ALA 2 CB  1 
ATOM 3554  N N   . MET B 1 125 ? 31.297  55.123  218.068 1.00 32.76  ? 125 MET 2 N   1 
ATOM 3555  C CA  . MET B 1 125 ? 31.351  54.338  219.291 1.00 28.65  ? 125 MET 2 CA  1 
ATOM 3556  C C   . MET B 1 125 ? 32.780  54.059  219.738 1.00 36.21  ? 125 MET 2 C   1 
ATOM 3557  O O   . MET B 1 125 ? 33.059  53.113  220.504 1.00 44.68  ? 125 MET 2 O   1 
ATOM 3558  C CB  . MET B 1 125 ? 30.554  53.076  219.112 1.00 24.91  ? 125 MET 2 CB  1 
ATOM 3559  C CG  . MET B 1 125 ? 29.139  53.391  218.743 1.00 33.63  ? 125 MET 2 CG  1 
ATOM 3560  S SD  . MET B 1 125 ? 28.163  51.941  218.414 1.00 40.30  ? 125 MET 2 SD  1 
ATOM 3561  C CE  . MET B 1 125 ? 29.041  50.718  219.511 1.00 63.74  ? 125 MET 2 CE  1 
ATOM 3562  N N   . LEU B 1 126 ? 33.677  54.921  219.267 1.00 24.63  ? 126 LEU 2 N   1 
ATOM 3563  C CA  . LEU B 1 126 ? 35.086  54.838  219.583 1.00 39.14  ? 126 LEU 2 CA  1 
ATOM 3564  C C   . LEU B 1 126 ? 35.547  55.927  220.541 1.00 50.72  ? 126 LEU 2 C   1 
ATOM 3565  O O   . LEU B 1 126 ? 36.746  56.252  220.619 1.00 64.82  ? 126 LEU 2 O   1 
ATOM 3566  C CB  . LEU B 1 126 ? 35.903  54.872  218.299 1.00 44.88  ? 126 LEU 2 CB  1 
ATOM 3567  C CG  . LEU B 1 126 ? 35.777  53.594  217.464 1.00 41.68  ? 126 LEU 2 CG  1 
ATOM 3568  C CD1 . LEU B 1 126 ? 36.885  53.593  216.454 1.00 21.74  ? 126 LEU 2 CD1 1 
ATOM 3569  C CD2 . LEU B 1 126 ? 35.886  52.348  218.367 1.00 45.50  ? 126 LEU 2 CD2 1 
ATOM 3570  N N   . ASN B 1 127 ? 34.572  56.561  221.189 1.00 56.63  ? 127 ASN 2 N   1 
ATOM 3571  C CA  . ASN B 1 127 ? 34.842  57.574  222.200 1.00 55.23  ? 127 ASN 2 CA  1 
ATOM 3572  C C   . ASN B 1 127 ? 34.606  56.760  223.454 1.00 58.42  ? 127 ASN 2 C   1 
ATOM 3573  O O   . ASN B 1 127 ? 33.479  56.669  223.960 1.00 49.00  ? 127 ASN 2 O   1 
ATOM 3574  C CB  . ASN B 1 127 ? 33.862  58.760  222.149 1.00 47.33  ? 127 ASN 2 CB  1 
ATOM 3575  C CG  . ASN B 1 127 ? 34.196  59.866  223.169 1.00 55.29  ? 127 ASN 2 CG  1 
ATOM 3576  O OD1 . ASN B 1 127 ? 34.096  61.045  222.862 1.00 75.56  ? 127 ASN 2 OD1 1 
ATOM 3577  N ND2 . ASN B 1 127 ? 34.577  59.486  224.384 1.00 52.95  ? 127 ASN 2 ND2 1 
ATOM 3578  N N   . LEU B 1 128 ? 35.661  56.093  223.900 1.00 53.67  ? 128 LEU 2 N   1 
ATOM 3579  C CA  . LEU B 1 128 ? 35.565  55.303  225.097 1.00 47.64  ? 128 LEU 2 CA  1 
ATOM 3580  C C   . LEU B 1 128 ? 35.824  56.193  226.293 1.00 49.55  ? 128 LEU 2 C   1 
ATOM 3581  O O   . LEU B 1 128 ? 35.904  55.711  227.418 1.00 44.57  ? 128 LEU 2 O   1 
ATOM 3582  C CB  . LEU B 1 128 ? 36.585  54.184  225.036 1.00 50.51  ? 128 LEU 2 CB  1 
ATOM 3583  C CG  . LEU B 1 128 ? 36.117  53.095  224.085 1.00 58.58  ? 128 LEU 2 CG  1 
ATOM 3584  C CD1 . LEU B 1 128 ? 36.881  51.814  224.352 1.00 68.09  ? 128 LEU 2 CD1 1 
ATOM 3585  C CD2 . LEU B 1 128 ? 34.631  52.844  224.312 1.00 76.93  ? 128 LEU 2 CD2 1 
ATOM 3586  N N   . HIS B 1 129 ? 35.817  57.501  226.046 1.00 44.16  ? 129 HIS 2 N   1 
ATOM 3587  C CA  . HIS B 1 129 ? 36.123  58.483  227.062 1.00 42.92  ? 129 HIS 2 CA  1 
ATOM 3588  C C   . HIS B 1 129 ? 35.097  59.588  227.295 1.00 41.73  ? 129 HIS 2 C   1 
ATOM 3589  O O   . HIS B 1 129 ? 35.392  60.726  227.008 1.00 40.66  ? 129 HIS 2 O   1 
ATOM 3590  C CB  . HIS B 1 129 ? 37.438  59.139  226.641 1.00 58.86  ? 129 HIS 2 CB  1 
ATOM 3591  C CG  . HIS B 1 129 ? 37.332  59.944  225.380 1.00 60.89  ? 129 HIS 2 CG  1 
ATOM 3592  N ND1 . HIS B 1 129 ? 37.492  59.393  224.130 1.00 76.99  ? 129 HIS 2 ND1 1 
ATOM 3593  C CD2 . HIS B 1 129 ? 37.016  61.248  225.173 1.00 61.63  ? 129 HIS 2 CD2 1 
ATOM 3594  C CE1 . HIS B 1 129 ? 37.269  60.318  223.211 1.00 71.80  ? 129 HIS 2 CE1 1 
ATOM 3595  N NE2 . HIS B 1 129 ? 36.973  61.450  223.819 1.00 45.21  ? 129 HIS 2 NE2 1 
ATOM 3596  N N   . SER B 1 130 ? 33.907  59.339  227.803 1.00 41.53  ? 130 SER 2 N   1 
ATOM 3597  C CA  . SER B 1 130 ? 33.062  60.521  227.936 1.00 52.54  ? 130 SER 2 CA  1 
ATOM 3598  C C   . SER B 1 130 ? 31.953  60.416  228.917 1.00 60.03  ? 130 SER 2 C   1 
ATOM 3599  O O   . SER B 1 130 ? 31.239  61.380  229.128 1.00 96.06  ? 130 SER 2 O   1 
ATOM 3600  C CB  . SER B 1 130 ? 32.496  61.012  226.597 1.00 22.05  ? 130 SER 2 CB  1 
ATOM 3601  O OG  . SER B 1 130 ? 31.562  60.056  226.158 1.00 66.53  ? 130 SER 2 OG  1 
ATOM 3602  N N   . GLY B 1 131 ? 31.692  59.235  229.419 1.00 37.64  ? 131 GLY 2 N   1 
ATOM 3603  C CA  . GLY B 1 131 ? 30.663  59.138  230.439 1.00 41.37  ? 131 GLY 2 CA  1 
ATOM 3604  C C   . GLY B 1 131 ? 30.698  57.702  230.816 1.00 57.16  ? 131 GLY 2 C   1 
ATOM 3605  O O   . GLY B 1 131 ? 29.894  57.158  231.593 1.00 61.10  ? 131 GLY 2 O   1 
ATOM 3606  N N   . THR B 1 132 ? 31.751  57.134  230.265 1.00 59.84  ? 132 THR 2 N   1 
ATOM 3607  C CA  . THR B 1 132 ? 32.082  55.754  230.308 1.00 60.50  ? 132 THR 2 CA  1 
ATOM 3608  C C   . THR B 1 132 ? 32.422  55.284  231.667 1.00 54.43  ? 132 THR 2 C   1 
ATOM 3609  O O   . THR B 1 132 ? 32.866  56.066  232.483 1.00 51.84  ? 132 THR 2 O   1 
ATOM 3610  C CB  . THR B 1 132 ? 33.279  55.561  229.413 1.00 63.60  ? 132 THR 2 CB  1 
ATOM 3611  O OG1 . THR B 1 132 ? 33.668  56.845  228.872 1.00 55.53  ? 132 THR 2 OG1 1 
ATOM 3612  C CG2 . THR B 1 132 ? 32.910  54.625  228.290 1.00 67.27  ? 132 THR 2 CG2 1 
ATOM 3613  N N   . GLN B 1 133 ? 32.048  54.046  231.942 1.00 52.11  ? 133 GLN 2 N   1 
ATOM 3614  C CA  . GLN B 1 133 ? 32.409  53.411  233.194 1.00 53.54  ? 133 GLN 2 CA  1 
ATOM 3615  C C   . GLN B 1 133 ? 33.715  52.781  232.779 1.00 56.12  ? 133 GLN 2 C   1 
ATOM 3616  O O   . GLN B 1 133 ? 33.865  52.379  231.635 1.00 71.69  ? 133 GLN 2 O   1 
ATOM 3617  C CB  . GLN B 1 133 ? 31.414  52.327  233.572 1.00 48.66  ? 133 GLN 2 CB  1 
ATOM 3618  C CG  . GLN B 1 133 ? 31.957  51.256  234.478 1.00 36.87  ? 133 GLN 2 CG  1 
ATOM 3619  C CD  . GLN B 1 133 ? 30.836  50.578  235.249 1.00 79.81  ? 133 GLN 2 CD  1 
ATOM 3620  O OE1 . GLN B 1 133 ? 30.624  49.357  235.145 1.00 87.89  ? 133 GLN 2 OE1 1 
ATOM 3621  N NE2 . GLN B 1 133 ? 30.084  51.378  236.013 1.00 90.92  ? 133 GLN 2 NE2 1 
ATOM 3622  N N   . LYS B 1 134 ? 34.665  52.706  233.685 1.00 63.69  ? 134 LYS 2 N   1 
ATOM 3623  C CA  . LYS B 1 134 ? 35.955  52.143  233.358 1.00 67.26  ? 134 LYS 2 CA  1 
ATOM 3624  C C   . LYS B 1 134 ? 35.920  50.645  233.116 1.00 72.10  ? 134 LYS 2 C   1 
ATOM 3625  O O   . LYS B 1 134 ? 35.200  49.903  233.795 1.00 66.30  ? 134 LYS 2 O   1 
ATOM 3626  C CB  . LYS B 1 134 ? 36.929  52.452  234.467 1.00 78.59  ? 134 LYS 2 CB  1 
ATOM 3627  C CG  . LYS B 1 134 ? 38.358  52.529  234.029 1.00 108.20 ? 134 LYS 2 CG  1 
ATOM 3628  C CD  . LYS B 1 134 ? 39.231  52.736  235.254 1.00 134.31 ? 134 LYS 2 CD  1 
ATOM 3629  C CE  . LYS B 1 134 ? 38.812  53.967  236.063 1.00 142.62 ? 134 LYS 2 CE  1 
ATOM 3630  N NZ  . LYS B 1 134 ? 39.004  53.780  237.533 1.00 148.32 ? 134 LYS 2 NZ  1 
ATOM 3631  N N   . THR B 1 135 ? 36.718  50.229  232.132 1.00 79.64  ? 135 THR 2 N   1 
ATOM 3632  C CA  . THR B 1 135 ? 36.869  48.837  231.728 1.00 80.55  ? 135 THR 2 CA  1 
ATOM 3633  C C   . THR B 1 135 ? 37.365  48.118  232.981 1.00 85.81  ? 135 THR 2 C   1 
ATOM 3634  O O   . THR B 1 135 ? 36.903  47.042  233.353 1.00 85.74  ? 135 THR 2 O   1 
ATOM 3635  C CB  . THR B 1 135 ? 38.014  48.684  230.669 1.00 81.77  ? 135 THR 2 CB  1 
ATOM 3636  O OG1 . THR B 1 135 ? 38.016  49.775  229.745 1.00 69.09  ? 135 THR 2 OG1 1 
ATOM 3637  C CG2 . THR B 1 135 ? 37.875  47.390  229.896 1.00 87.54  ? 135 THR 2 CG2 1 
ATOM 3638  N N   . HIS B 1 136 ? 38.331  48.757  233.625 1.00 88.89  ? 136 HIS 2 N   1 
ATOM 3639  C CA  . HIS B 1 136 ? 38.974  48.225  234.813 1.00 89.60  ? 136 HIS 2 CA  1 
ATOM 3640  C C   . HIS B 1 136 ? 40.087  49.223  235.124 1.00 89.37  ? 136 HIS 2 C   1 
ATOM 3641  O O   . HIS B 1 136 ? 40.447  50.031  234.277 1.00 81.64  ? 136 HIS 2 O   1 
ATOM 3642  C CB  . HIS B 1 136 ? 39.640  46.890  234.465 1.00 99.11  ? 136 HIS 2 CB  1 
ATOM 3643  C CG  . HIS B 1 136 ? 40.728  47.030  233.442 1.00 111.81 ? 136 HIS 2 CG  1 
ATOM 3644  N ND1 . HIS B 1 136 ? 40.508  46.837  232.095 1.00 119.56 ? 136 HIS 2 ND1 1 
ATOM 3645  C CD2 . HIS B 1 136 ? 42.007  47.471  233.551 1.00 111.38 ? 136 HIS 2 CD2 1 
ATOM 3646  C CE1 . HIS B 1 136 ? 41.595  47.164  231.420 1.00 120.97 ? 136 HIS 2 CE1 1 
ATOM 3647  N NE2 . HIS B 1 136 ? 42.518  47.554  232.281 1.00 108.09 ? 136 HIS 2 NE2 1 
ATOM 3648  N N   . GLU B 1 137 ? 40.689  49.051  236.291 1.00 91.54  ? 137 GLU 2 N   1 
ATOM 3649  C CA  . GLU B 1 137 ? 41.809  49.833  236.828 1.00 105.24 ? 137 GLU 2 CA  1 
ATOM 3650  C C   . GLU B 1 137 ? 42.244  51.110  236.122 1.00 98.14  ? 137 GLU 2 C   1 
ATOM 3651  O O   . GLU B 1 137 ? 41.979  52.199  236.621 1.00 109.50 ? 137 GLU 2 O   1 
ATOM 3652  C CB  . GLU B 1 137 ? 43.007  48.911  237.056 1.00 125.85 ? 137 GLU 2 CB  1 
ATOM 3653  C CG  . GLU B 1 137 ? 42.628  47.473  237.515 1.00 162.42 ? 137 GLU 2 CG  1 
ATOM 3654  C CD  . GLU B 1 137 ? 41.408  47.398  238.464 1.00 178.84 ? 137 GLU 2 CD  1 
ATOM 3655  O OE1 . GLU B 1 137 ? 41.334  48.168  239.453 1.00 194.34 ? 137 GLU 2 OE1 1 
ATOM 3656  O OE2 . GLU B 1 137 ? 40.502  46.572  238.192 1.00 180.86 ? 137 GLU 2 OE2 1 
ATOM 3657  N N   . ASN B 1 138 ? 42.967  51.000  235.017 1.00 92.03  ? 138 ASN 2 N   1 
ATOM 3658  C CA  . ASN B 1 138 ? 43.378  52.200  234.283 1.00 93.60  ? 138 ASN 2 CA  1 
ATOM 3659  C C   . ASN B 1 138 ? 42.980  52.026  232.840 1.00 93.93  ? 138 ASN 2 C   1 
ATOM 3660  O O   . ASN B 1 138 ? 43.541  52.653  231.919 1.00 81.18  ? 138 ASN 2 O   1 
ATOM 3661  C CB  . ASN B 1 138 ? 44.875  52.420  234.382 1.00 100.48 ? 138 ASN 2 CB  1 
ATOM 3662  C CG  . ASN B 1 138 ? 45.338  52.519  235.798 1.00 103.97 ? 138 ASN 2 CG  1 
ATOM 3663  O OD1 . ASN B 1 138 ? 45.437  51.507  236.494 1.00 105.76 ? 138 ASN 2 OD1 1 
ATOM 3664  N ND2 . ASN B 1 138 ? 45.594  53.739  236.257 1.00 108.66 ? 138 ASN 2 ND2 1 
ATOM 3665  N N   . GLY B 1 139 ? 42.041  51.098  232.674 1.00 91.92  ? 139 GLY 2 N   1 
ATOM 3666  C CA  . GLY B 1 139 ? 41.490  50.765  231.385 1.00 90.37  ? 139 GLY 2 CA  1 
ATOM 3667  C C   . GLY B 1 139 ? 40.808  51.971  230.797 1.00 86.91  ? 139 GLY 2 C   1 
ATOM 3668  O O   . GLY B 1 139 ? 40.850  53.076  231.357 1.00 82.17  ? 139 GLY 2 O   1 
ATOM 3669  N N   . ALA B 1 140 ? 40.198  51.760  229.644 1.00 75.68  ? 140 ALA 2 N   1 
ATOM 3670  C CA  . ALA B 1 140 ? 39.502  52.835  228.984 1.00 68.73  ? 140 ALA 2 CA  1 
ATOM 3671  C C   . ALA B 1 140 ? 38.049  52.669  229.365 1.00 66.16  ? 140 ALA 2 C   1 
ATOM 3672  O O   . ALA B 1 140 ? 37.744  52.055  230.385 1.00 73.83  ? 140 ALA 2 O   1 
ATOM 3673  C CB  . ALA B 1 140 ? 39.687  52.744  227.508 1.00 74.50  ? 140 ALA 2 CB  1 
ATOM 3674  N N   . GLY B 1 141 ? 37.151  53.251  228.593 1.00 53.11  ? 141 GLY 2 N   1 
ATOM 3675  C CA  . GLY B 1 141 ? 35.760  53.117  228.929 1.00 46.53  ? 141 GLY 2 CA  1 
ATOM 3676  C C   . GLY B 1 141 ? 35.216  51.811  228.412 1.00 44.09  ? 141 GLY 2 C   1 
ATOM 3677  O O   . GLY B 1 141 ? 35.764  51.236  227.481 1.00 50.04  ? 141 GLY 2 O   1 
ATOM 3678  N N   . LYS B 1 142 ? 34.177  51.309  229.061 1.00 45.27  ? 142 LYS 2 N   1 
ATOM 3679  C CA  . LYS B 1 142 ? 33.538  50.097  228.623 1.00 47.53  ? 142 LYS 2 CA  1 
ATOM 3680  C C   . LYS B 1 142 ? 32.654  50.559  227.460 1.00 57.91  ? 142 LYS 2 C   1 
ATOM 3681  O O   . LYS B 1 142 ? 31.712  51.361  227.639 1.00 64.09  ? 142 LYS 2 O   1 
ATOM 3682  C CB  . LYS B 1 142 ? 32.703  49.489  229.742 1.00 55.41  ? 142 LYS 2 CB  1 
ATOM 3683  C CG  . LYS B 1 142 ? 32.086  48.144  229.367 1.00 80.05  ? 142 LYS 2 CG  1 
ATOM 3684  C CD  . LYS B 1 142 ? 31.304  47.487  230.516 1.00 106.71 ? 142 LYS 2 CD  1 
ATOM 3685  C CE  . LYS B 1 142 ? 30.702  46.141  230.067 1.00 126.94 ? 142 LYS 2 CE  1 
ATOM 3686  N NZ  . LYS B 1 142 ? 29.826  45.451  231.073 1.00 142.62 ? 142 LYS 2 NZ  1 
ATOM 3687  N N   . PRO B 1 143 ? 32.989  50.105  226.239 1.00 58.38  ? 143 PRO 2 N   1 
ATOM 3688  C CA  . PRO B 1 143 ? 32.287  50.426  224.998 1.00 54.66  ? 143 PRO 2 CA  1 
ATOM 3689  C C   . PRO B 1 143 ? 30.848  49.972  224.985 1.00 49.13  ? 143 PRO 2 C   1 
ATOM 3690  O O   . PRO B 1 143 ? 30.458  49.054  225.709 1.00 46.08  ? 143 PRO 2 O   1 
ATOM 3691  C CB  . PRO B 1 143 ? 33.101  49.666  223.957 1.00 58.82  ? 143 PRO 2 CB  1 
ATOM 3692  C CG  . PRO B 1 143 ? 33.563  48.464  224.717 1.00 48.40  ? 143 PRO 2 CG  1 
ATOM 3693  C CD  . PRO B 1 143 ? 34.034  49.095  225.987 1.00 58.94  ? 143 PRO 2 CD  1 
ATOM 3694  N N   . ILE B 1 144 ? 30.066  50.603  224.124 1.00 49.82  ? 144 ILE 2 N   1 
ATOM 3695  C CA  . ILE B 1 144 ? 28.658  50.251  223.993 1.00 44.65  ? 144 ILE 2 CA  1 
ATOM 3696  C C   . ILE B 1 144 ? 28.540  48.817  223.511 1.00 39.71  ? 144 ILE 2 C   1 
ATOM 3697  O O   . ILE B 1 144 ? 29.153  48.463  222.507 1.00 51.29  ? 144 ILE 2 O   1 
ATOM 3698  C CB  . ILE B 1 144 ? 27.989  51.095  222.928 1.00 34.18  ? 144 ILE 2 CB  1 
ATOM 3699  C CG1 . ILE B 1 144 ? 28.151  52.572  223.230 1.00 48.57  ? 144 ILE 2 CG1 1 
ATOM 3700  C CG2 . ILE B 1 144 ? 26.547  50.723  222.817 1.00 49.83  ? 144 ILE 2 CG2 1 
ATOM 3701  C CD1 . ILE B 1 144 ? 27.374  53.426  222.267 1.00 53.84  ? 144 ILE 2 CD1 1 
ATOM 3702  N N   . GLN B 1 145 ? 27.754  48.003  224.202 1.00 27.36  ? 145 GLN 2 N   1 
ATOM 3703  C CA  . GLN B 1 145 ? 27.547  46.615  223.798 1.00 31.79  ? 145 GLN 2 CA  1 
ATOM 3704  C C   . GLN B 1 145 ? 26.221  46.121  224.355 1.00 41.71  ? 145 GLN 2 C   1 
ATOM 3705  O O   . GLN B 1 145 ? 25.448  46.911  224.883 1.00 55.83  ? 145 GLN 2 O   1 
ATOM 3706  C CB  . GLN B 1 145 ? 28.682  45.746  224.297 1.00 43.94  ? 145 GLN 2 CB  1 
ATOM 3707  C CG  . GLN B 1 145 ? 28.943  45.836  225.784 1.00 64.74  ? 145 GLN 2 CG  1 
ATOM 3708  C CD  . GLN B 1 145 ? 30.346  45.377  226.138 1.00 74.70  ? 145 GLN 2 CD  1 
ATOM 3709  O OE1 . GLN B 1 145 ? 30.569  44.212  226.480 1.00 82.62  ? 145 GLN 2 OE1 1 
ATOM 3710  N NE2 . GLN B 1 145 ? 31.306  46.296  226.055 1.00 83.16  ? 145 GLN 2 NE2 1 
ATOM 3711  N N   . GLY B 1 146 ? 25.969  44.822  224.281 1.00 33.50  ? 146 GLY 2 N   1 
ATOM 3712  C CA  . GLY B 1 146 ? 24.711  44.297  224.776 1.00 33.79  ? 146 GLY 2 CA  1 
ATOM 3713  C C   . GLY B 1 146 ? 23.692  44.174  223.657 1.00 34.07  ? 146 GLY 2 C   1 
ATOM 3714  O O   . GLY B 1 146 ? 23.973  44.566  222.509 1.00 36.87  ? 146 GLY 2 O   1 
ATOM 3715  N N   . SER B 1 147 ? 22.516  43.644  223.999 1.00 35.40  ? 147 SER 2 N   1 
ATOM 3716  C CA  . SER B 1 147 ? 21.418  43.422  223.051 1.00 39.31  ? 147 SER 2 CA  1 
ATOM 3717  C C   . SER B 1 147 ? 21.301  44.525  222.027 1.00 42.81  ? 147 SER 2 C   1 
ATOM 3718  O O   . SER B 1 147 ? 21.374  45.714  222.373 1.00 43.34  ? 147 SER 2 O   1 
ATOM 3719  C CB  . SER B 1 147 ? 20.074  43.332  223.775 1.00 31.88  ? 147 SER 2 CB  1 
ATOM 3720  O OG  . SER B 1 147 ? 20.093  42.376  224.815 1.00 60.39  ? 147 SER 2 OG  1 
ATOM 3721  N N   . ASN B 1 148 ? 21.140  44.144  220.766 1.00 33.50  ? 148 ASN 2 N   1 
ATOM 3722  C CA  . ASN B 1 148 ? 20.985  45.153  219.741 1.00 36.36  ? 148 ASN 2 CA  1 
ATOM 3723  C C   . ASN B 1 148 ? 19.984  44.713  218.692 1.00 31.61  ? 148 ASN 2 C   1 
ATOM 3724  O O   . ASN B 1 148 ? 19.677  43.516  218.554 1.00 37.54  ? 148 ASN 2 O   1 
ATOM 3725  C CB  . ASN B 1 148 ? 22.338  45.596  219.158 1.00 42.65  ? 148 ASN 2 CB  1 
ATOM 3726  C CG  . ASN B 1 148 ? 23.007  44.544  218.313 1.00 53.51  ? 148 ASN 2 CG  1 
ATOM 3727  O OD1 . ASN B 1 148 ? 22.403  43.543  217.940 1.00 52.44  ? 148 ASN 2 OD1 1 
ATOM 3728  N ND2 . ASN B 1 148 ? 24.268  44.796  217.955 1.00 77.80  ? 148 ASN 2 ND2 1 
ATOM 3729  N N   . PHE B 1 149 ? 19.359  45.681  218.048 1.00 15.44  ? 149 PHE 2 N   1 
ATOM 3730  C CA  . PHE B 1 149 ? 18.375  45.317  217.052 1.00 28.20  ? 149 PHE 2 CA  1 
ATOM 3731  C C   . PHE B 1 149 ? 18.381  46.363  215.997 1.00 32.94  ? 149 PHE 2 C   1 
ATOM 3732  O O   . PHE B 1 149 ? 18.312  47.580  216.295 1.00 32.74  ? 149 PHE 2 O   1 
ATOM 3733  C CB  . PHE B 1 149 ? 16.990  45.200  217.662 1.00 23.48  ? 149 PHE 2 CB  1 
ATOM 3734  C CG  . PHE B 1 149 ? 15.893  45.040  216.652 1.00 21.88  ? 149 PHE 2 CG  1 
ATOM 3735  C CD1 . PHE B 1 149 ? 15.554  43.780  216.176 1.00 19.92  ? 149 PHE 2 CD1 1 
ATOM 3736  C CD2 . PHE B 1 149 ? 15.152  46.143  216.222 1.00 17.18  ? 149 PHE 2 CD2 1 
ATOM 3737  C CE1 . PHE B 1 149 ? 14.476  43.615  215.282 1.00 16.38  ? 149 PHE 2 CE1 1 
ATOM 3738  C CE2 . PHE B 1 149 ? 14.073  45.990  215.328 1.00 28.24  ? 149 PHE 2 CE2 1 
ATOM 3739  C CZ  . PHE B 1 149 ? 13.734  44.715  214.857 1.00 5.23   ? 149 PHE 2 CZ  1 
ATOM 3740  N N   . HIS B 1 150 ? 18.505  45.883  214.762 1.00 16.21  ? 150 HIS 2 N   1 
ATOM 3741  C CA  . HIS B 1 150 ? 18.564  46.780  213.626 1.00 25.85  ? 150 HIS 2 CA  1 
ATOM 3742  C C   . HIS B 1 150 ? 17.590  46.256  212.604 1.00 29.88  ? 150 HIS 2 C   1 
ATOM 3743  O O   . HIS B 1 150 ? 17.586  45.061  212.263 1.00 29.63  ? 150 HIS 2 O   1 
ATOM 3744  C CB  . HIS B 1 150 ? 19.979  46.883  213.055 1.00 14.49  ? 150 HIS 2 CB  1 
ATOM 3745  C CG  . HIS B 1 150 ? 21.040  47.205  214.076 1.00 19.02  ? 150 HIS 2 CG  1 
ATOM 3746  N ND1 . HIS B 1 150 ? 21.424  48.491  214.368 1.00 34.85  ? 150 HIS 2 ND1 1 
ATOM 3747  C CD2 . HIS B 1 150 ? 21.832  46.399  214.826 1.00 52.03  ? 150 HIS 2 CD2 1 
ATOM 3748  C CE1 . HIS B 1 150 ? 22.412  48.470  215.252 1.00 49.73  ? 150 HIS 2 CE1 1 
ATOM 3749  N NE2 . HIS B 1 150 ? 22.680  47.209  215.545 1.00 49.16  ? 150 HIS 2 NE2 1 
ATOM 3750  N N   . PHE B 1 151 ? 16.808  47.168  212.056 1.00 21.70  ? 151 PHE 2 N   1 
ATOM 3751  C CA  . PHE B 1 151 ? 15.769  46.747  211.181 1.00 16.53  ? 151 PHE 2 CA  1 
ATOM 3752  C C   . PHE B 1 151 ? 15.396  47.905  210.376 1.00 20.48  ? 151 PHE 2 C   1 
ATOM 3753  O O   . PHE B 1 151 ? 15.523  49.026  210.849 1.00 26.21  ? 151 PHE 2 O   1 
ATOM 3754  C CB  . PHE B 1 151 ? 14.572  46.421  212.073 1.00 17.11  ? 151 PHE 2 CB  1 
ATOM 3755  C CG  . PHE B 1 151 ? 13.270  46.565  211.403 1.00 12.17  ? 151 PHE 2 CG  1 
ATOM 3756  C CD1 . PHE B 1 151 ? 12.660  47.788  211.337 1.00 8.19   ? 151 PHE 2 CD1 1 
ATOM 3757  C CD2 . PHE B 1 151 ? 12.672  45.475  210.780 1.00 31.10  ? 151 PHE 2 CD2 1 
ATOM 3758  C CE1 . PHE B 1 151 ? 11.471  47.929  210.636 1.00 35.05  ? 151 PHE 2 CE1 1 
ATOM 3759  C CE2 . PHE B 1 151 ? 11.490  45.602  210.083 1.00 27.05  ? 151 PHE 2 CE2 1 
ATOM 3760  C CZ  . PHE B 1 151 ? 10.884  46.832  210.010 1.00 32.85  ? 151 PHE 2 CZ  1 
ATOM 3761  N N   . PHE B 1 152 ? 14.825  47.630  209.213 1.00 11.62  ? 152 PHE 2 N   1 
ATOM 3762  C CA  . PHE B 1 152 ? 14.326  48.690  208.379 1.00 19.03  ? 152 PHE 2 CA  1 
ATOM 3763  C C   . PHE B 1 152 ? 13.409  48.074  207.356 1.00 26.25  ? 152 PHE 2 C   1 
ATOM 3764  O O   . PHE B 1 152 ? 13.439  46.851  207.102 1.00 30.11  ? 152 PHE 2 O   1 
ATOM 3765  C CB  . PHE B 1 152 ? 15.439  49.430  207.689 1.00 20.09  ? 152 PHE 2 CB  1 
ATOM 3766  C CG  . PHE B 1 152 ? 15.937  48.728  206.499 1.00 33.64  ? 152 PHE 2 CG  1 
ATOM 3767  C CD1 . PHE B 1 152 ? 16.913  47.765  206.610 1.00 25.77  ? 152 PHE 2 CD1 1 
ATOM 3768  C CD2 . PHE B 1 152 ? 15.399  48.985  205.255 1.00 41.59  ? 152 PHE 2 CD2 1 
ATOM 3769  C CE1 . PHE B 1 152 ? 17.356  47.048  205.479 1.00 25.69  ? 152 PHE 2 CE1 1 
ATOM 3770  C CE2 . PHE B 1 152 ? 15.842  48.270  204.127 1.00 45.49  ? 152 PHE 2 CE2 1 
ATOM 3771  C CZ  . PHE B 1 152 ? 16.821  47.303  204.245 1.00 2.00   ? 152 PHE 2 CZ  1 
ATOM 3772  N N   . ALA B 1 153 ? 12.683  48.948  206.683 1.00 17.12  ? 153 ALA 2 N   1 
ATOM 3773  C CA  . ALA B 1 153 ? 11.758  48.495  205.703 1.00 17.83  ? 153 ALA 2 CA  1 
ATOM 3774  C C   . ALA B 1 153 ? 11.444  49.605  204.742 1.00 18.35  ? 153 ALA 2 C   1 
ATOM 3775  O O   . ALA B 1 153 ? 11.400  50.786  205.094 1.00 25.46  ? 153 ALA 2 O   1 
ATOM 3776  C CB  . ALA B 1 153 ? 10.540  48.033  206.375 1.00 15.38  ? 153 ALA 2 CB  1 
ATOM 3777  N N   . VAL B 1 154 ? 11.143  49.205  203.528 1.00 5.48   ? 154 VAL 2 N   1 
ATOM 3778  C CA  . VAL B 1 154 ? 10.856  50.158  202.493 1.00 4.49   ? 154 VAL 2 CA  1 
ATOM 3779  C C   . VAL B 1 154 ? 9.594   49.682  201.816 1.00 14.57  ? 154 VAL 2 C   1 
ATOM 3780  O O   . VAL B 1 154 ? 9.541   48.559  201.336 1.00 12.82  ? 154 VAL 2 O   1 
ATOM 3781  C CB  . VAL B 1 154 ? 12.036  50.155  201.533 1.00 9.69   ? 154 VAL 2 CB  1 
ATOM 3782  C CG1 . VAL B 1 154 ? 11.689  50.787  200.187 1.00 20.00  ? 154 VAL 2 CG1 1 
ATOM 3783  C CG2 . VAL B 1 154 ? 13.174  50.877  202.174 1.00 11.13  ? 154 VAL 2 CG2 1 
ATOM 3784  N N   . GLY B 1 155 ? 8.562   50.510  201.788 1.00 28.32  ? 155 GLY 2 N   1 
ATOM 3785  C CA  . GLY B 1 155 ? 7.329   50.063  201.170 1.00 27.28  ? 155 GLY 2 CA  1 
ATOM 3786  C C   . GLY B 1 155 ? 6.431   51.105  200.548 1.00 31.53  ? 155 GLY 2 C   1 
ATOM 3787  O O   . GLY B 1 155 ? 6.597   52.315  200.769 1.00 28.08  ? 155 GLY 2 O   1 
ATOM 3788  N N   . GLY B 1 156 ? 5.444   50.598  199.806 1.00 35.69  ? 156 GLY 2 N   1 
ATOM 3789  C CA  . GLY B 1 156 ? 4.472   51.418  199.089 1.00 35.20  ? 156 GLY 2 CA  1 
ATOM 3790  C C   . GLY B 1 156 ? 3.227   51.796  199.860 1.00 31.72  ? 156 GLY 2 C   1 
ATOM 3791  O O   . GLY B 1 156 ? 2.295   52.419  199.309 1.00 35.25  ? 156 GLY 2 O   1 
ATOM 3792  N N   . GLU B 1 157 ? 3.248   51.434  201.141 1.00 24.78  ? 157 GLU 2 N   1 
ATOM 3793  C CA  . GLU B 1 157 ? 2.184   51.689  202.098 1.00 14.99  ? 157 GLU 2 CA  1 
ATOM 3794  C C   . GLU B 1 157 ? 2.862   51.701  203.427 1.00 21.74  ? 157 GLU 2 C   1 
ATOM 3795  O O   . GLU B 1 157 ? 4.003   51.212  203.578 1.00 35.23  ? 157 GLU 2 O   1 
ATOM 3796  C CB  . GLU B 1 157 ? 1.231   50.515  202.213 1.00 25.50  ? 157 GLU 2 CB  1 
ATOM 3797  C CG  . GLU B 1 157 ? 0.859   49.819  200.966 1.00 39.56  ? 157 GLU 2 CG  1 
ATOM 3798  C CD  . GLU B 1 157 ? -0.069  48.726  201.303 1.00 44.71  ? 157 GLU 2 CD  1 
ATOM 3799  O OE1 . GLU B 1 157 ? 0.368   47.831  202.059 1.00 71.71  ? 157 GLU 2 OE1 1 
ATOM 3800  O OE2 . GLU B 1 157 ? -1.241  48.799  200.868 1.00 69.47  ? 157 GLU 2 OE2 1 
ATOM 3801  N N   . PRO B 1 158 ? 2.119   52.117  204.451 1.00 26.57  ? 158 PRO 2 N   1 
ATOM 3802  C CA  . PRO B 1 158 ? 2.644   52.179  205.811 1.00 24.80  ? 158 PRO 2 CA  1 
ATOM 3803  C C   . PRO B 1 158 ? 2.922   50.794  206.290 1.00 21.02  ? 158 PRO 2 C   1 
ATOM 3804  O O   . PRO B 1 158 ? 2.278   49.840  205.883 1.00 32.64  ? 158 PRO 2 O   1 
ATOM 3805  C CB  . PRO B 1 158 ? 1.501   52.790  206.586 1.00 21.84  ? 158 PRO 2 CB  1 
ATOM 3806  C CG  . PRO B 1 158 ? 0.795   53.583  205.568 1.00 33.65  ? 158 PRO 2 CG  1 
ATOM 3807  C CD  . PRO B 1 158 ? 0.763   52.667  204.403 1.00 29.21  ? 158 PRO 2 CD  1 
ATOM 3808  N N   . LEU B 1 159 ? 3.923   50.700  207.131 1.00 29.35  ? 159 LEU 2 N   1 
ATOM 3809  C CA  . LEU B 1 159 ? 4.311   49.432  207.678 1.00 29.77  ? 159 LEU 2 CA  1 
ATOM 3810  C C   . LEU B 1 159 ? 3.228   48.877  208.591 1.00 22.85  ? 159 LEU 2 C   1 
ATOM 3811  O O   . LEU B 1 159 ? 2.902   49.473  209.613 1.00 32.46  ? 159 LEU 2 O   1 
ATOM 3812  C CB  . LEU B 1 159 ? 5.564   49.634  208.503 1.00 43.78  ? 159 LEU 2 CB  1 
ATOM 3813  C CG  . LEU B 1 159 ? 6.042   48.404  209.260 1.00 31.73  ? 159 LEU 2 CG  1 
ATOM 3814  C CD1 . LEU B 1 159 ? 6.367   47.330  208.279 1.00 15.84  ? 159 LEU 2 CD1 1 
ATOM 3815  C CD2 . LEU B 1 159 ? 7.256   48.745  210.050 1.00 35.99  ? 159 LEU 2 CD2 1 
ATOM 3816  N N   . GLU B 1 160 ? 2.749   47.691  208.270 1.00 14.77  ? 160 GLU 2 N   1 
ATOM 3817  C CA  . GLU B 1 160 ? 1.727   47.018  209.060 1.00 22.03  ? 160 GLU 2 CA  1 
ATOM 3818  C C   . GLU B 1 160 ? 2.335   46.247  210.222 1.00 27.01  ? 160 GLU 2 C   1 
ATOM 3819  O O   . GLU B 1 160 ? 3.198   45.406  210.034 1.00 24.96  ? 160 GLU 2 O   1 
ATOM 3820  C CB  . GLU B 1 160 ? 0.927   46.074  208.163 1.00 18.20  ? 160 GLU 2 CB  1 
ATOM 3821  C CG  . GLU B 1 160 ? 0.074   46.833  207.161 1.00 21.18  ? 160 GLU 2 CG  1 
ATOM 3822  C CD  . GLU B 1 160 ? -0.594  45.952  206.156 1.00 34.17  ? 160 GLU 2 CD  1 
ATOM 3823  O OE1 . GLU B 1 160 ? 0.139   45.327  205.353 1.00 49.00  ? 160 GLU 2 OE1 1 
ATOM 3824  O OE2 . GLU B 1 160 ? -1.854  45.891  206.174 1.00 68.65  ? 160 GLU 2 OE2 1 
ATOM 3825  N N   . LEU B 1 161 ? 1.869   46.514  211.431 1.00 35.11  ? 161 LEU 2 N   1 
ATOM 3826  C CA  . LEU B 1 161 ? 2.417   45.827  212.583 1.00 36.51  ? 161 LEU 2 CA  1 
ATOM 3827  C C   . LEU B 1 161 ? 1.578   44.703  213.100 1.00 42.84  ? 161 LEU 2 C   1 
ATOM 3828  O O   . LEU B 1 161 ? 0.533   44.352  212.517 1.00 43.93  ? 161 LEU 2 O   1 
ATOM 3829  C CB  . LEU B 1 161 ? 2.660   46.796  213.714 1.00 29.08  ? 161 LEU 2 CB  1 
ATOM 3830  C CG  . LEU B 1 161 ? 3.592   47.852  213.172 1.00 38.75  ? 161 LEU 2 CG  1 
ATOM 3831  C CD1 . LEU B 1 161 ? 3.941   48.865  214.252 1.00 31.10  ? 161 LEU 2 CD1 1 
ATOM 3832  C CD2 . LEU B 1 161 ? 4.814   47.132  212.638 1.00 49.62  ? 161 LEU 2 CD2 1 
ATOM 3833  N N   . GLN B 1 162 ? 2.100   44.144  214.189 1.00 32.93  ? 162 GLN 2 N   1 
ATOM 3834  C CA  . GLN B 1 162 ? 1.525   43.054  214.954 1.00 27.73  ? 162 GLN 2 CA  1 
ATOM 3835  C C   . GLN B 1 162 ? 2.298   43.169  216.252 1.00 28.99  ? 162 GLN 2 C   1 
ATOM 3836  O O   . GLN B 1 162 ? 3.528   43.216  216.255 1.00 30.24  ? 162 GLN 2 O   1 
ATOM 3837  C CB  . GLN B 1 162 ? 1.771   41.718  214.277 1.00 16.84  ? 162 GLN 2 CB  1 
ATOM 3838  C CG  . GLN B 1 162 ? 1.630   40.498  215.166 1.00 31.26  ? 162 GLN 2 CG  1 
ATOM 3839  C CD  . GLN B 1 162 ? 0.396   40.470  216.014 1.00 32.01  ? 162 GLN 2 CD  1 
ATOM 3840  O OE1 . GLN B 1 162 ? 0.433   40.899  217.152 1.00 24.06  ? 162 GLN 2 OE1 1 
ATOM 3841  N NE2 . GLN B 1 162 ? -0.682  39.889  215.496 1.00 7.37   ? 162 GLN 2 NE2 1 
ATOM 3842  N N   . GLY B 1 163 ? 1.557   43.346  217.333 1.00 29.33  ? 163 GLY 2 N   1 
ATOM 3843  C CA  . GLY B 1 163 ? 2.162   43.522  218.623 1.00 20.40  ? 163 GLY 2 CA  1 
ATOM 3844  C C   . GLY B 1 163 ? 2.224   42.235  219.393 1.00 32.88  ? 163 GLY 2 C   1 
ATOM 3845  O O   . GLY B 1 163 ? 1.353   41.337  219.325 1.00 37.37  ? 163 GLY 2 O   1 
ATOM 3846  N N   . VAL B 1 164 ? 3.249   42.176  220.211 1.00 19.77  ? 164 VAL 2 N   1 
ATOM 3847  C CA  . VAL B 1 164 ? 3.466   41.016  221.021 1.00 29.92  ? 164 VAL 2 CA  1 
ATOM 3848  C C   . VAL B 1 164 ? 4.398   41.506  222.082 1.00 38.53  ? 164 VAL 2 C   1 
ATOM 3849  O O   . VAL B 1 164 ? 5.286   42.323  221.799 1.00 34.61  ? 164 VAL 2 O   1 
ATOM 3850  C CB  . VAL B 1 164 ? 4.134   39.923  220.191 1.00 31.33  ? 164 VAL 2 CB  1 
ATOM 3851  C CG1 . VAL B 1 164 ? 4.877   38.956  221.074 1.00 28.56  ? 164 VAL 2 CG1 1 
ATOM 3852  C CG2 . VAL B 1 164 ? 3.074   39.183  219.396 1.00 58.77  ? 164 VAL 2 CG2 1 
ATOM 3853  N N   . LEU B 1 165 ? 4.186   41.030  223.303 1.00 43.98  ? 165 LEU 2 N   1 
ATOM 3854  C CA  . LEU B 1 165 ? 5.035   41.439  224.402 1.00 53.20  ? 165 LEU 2 CA  1 
ATOM 3855  C C   . LEU B 1 165 ? 5.247   40.377  225.463 1.00 55.61  ? 165 LEU 2 C   1 
ATOM 3856  O O   . LEU B 1 165 ? 4.814   39.222  225.330 1.00 49.12  ? 165 LEU 2 O   1 
ATOM 3857  C CB  . LEU B 1 165 ? 4.432   42.684  225.025 1.00 64.96  ? 165 LEU 2 CB  1 
ATOM 3858  C CG  . LEU B 1 165 ? 2.900   42.679  224.973 1.00 63.51  ? 165 LEU 2 CG  1 
ATOM 3859  C CD1 . LEU B 1 165 ? 2.377   41.760  226.062 1.00 88.38  ? 165 LEU 2 CD1 1 
ATOM 3860  C CD2 . LEU B 1 165 ? 2.334   44.097  225.124 1.00 36.85  ? 165 LEU 2 CD2 1 
ATOM 3861  N N   . ALA B 1 166 ? 6.063   40.733  226.442 1.00 57.93  ? 166 ALA 2 N   1 
ATOM 3862  C CA  . ALA B 1 166 ? 6.279   39.857  227.582 1.00 76.23  ? 166 ALA 2 CA  1 
ATOM 3863  C C   . ALA B 1 166 ? 5.694   40.755  228.648 1.00 85.94  ? 166 ALA 2 C   1 
ATOM 3864  O O   . ALA B 1 166 ? 5.884   41.986  228.590 1.00 93.64  ? 166 ALA 2 O   1 
ATOM 3865  C CB  . ALA B 1 166 ? 7.768   39.601  227.854 1.00 84.94  ? 166 ALA 2 CB  1 
ATOM 3866  N N   . ASN B 1 167 ? 4.895   40.166  229.539 1.00 85.11  ? 167 ASN 2 N   1 
ATOM 3867  C CA  . ASN B 1 167 ? 4.261   40.903  230.636 1.00 69.53  ? 167 ASN 2 CA  1 
ATOM 3868  C C   . ASN B 1 167 ? 3.178   41.820  230.104 1.00 54.36  ? 167 ASN 2 C   1 
ATOM 3869  O O   . ASN B 1 167 ? 3.355   43.040  230.075 1.00 23.61  ? 167 ASN 2 O   1 
ATOM 3870  C CB  . ASN B 1 167 ? 5.316   41.727  231.389 1.00 72.22  ? 167 ASN 2 CB  1 
ATOM 3871  C CG  . ASN B 1 167 ? 4.730   42.529  232.476 1.00 59.60  ? 167 ASN 2 CG  1 
ATOM 3872  O OD1 . ASN B 1 167 ? 3.683   42.156  233.020 1.00 61.63  ? 167 ASN 2 OD1 1 
ATOM 3873  N ND2 . ASN B 1 167 ? 5.349   43.662  232.782 1.00 61.40  ? 167 ASN 2 ND2 1 
ATOM 3874  N N   . TYR B 1 168 ? 2.060   41.235  229.682 1.00 47.72  ? 168 TYR 2 N   1 
ATOM 3875  C CA  . TYR B 1 168 ? 0.968   42.033  229.137 1.00 49.10  ? 168 TYR 2 CA  1 
ATOM 3876  C C   . TYR B 1 168 ? 0.464   43.028  230.164 1.00 54.85  ? 168 TYR 2 C   1 
ATOM 3877  O O   . TYR B 1 168 ? -0.080  44.094  229.856 1.00 57.73  ? 168 TYR 2 O   1 
ATOM 3878  C CB  . TYR B 1 168 ? -0.162  41.148  228.652 1.00 42.00  ? 168 TYR 2 CB  1 
ATOM 3879  C CG  . TYR B 1 168 ? -0.877  40.411  229.729 1.00 61.87  ? 168 TYR 2 CG  1 
ATOM 3880  C CD1 . TYR B 1 168 ? -0.442  39.167  230.143 1.00 79.45  ? 168 TYR 2 CD1 1 
ATOM 3881  C CD2 . TYR B 1 168 ? -2.024  40.927  230.296 1.00 76.61  ? 168 TYR 2 CD2 1 
ATOM 3882  C CE1 . TYR B 1 168 ? -1.134  38.446  231.094 1.00 96.97  ? 168 TYR 2 CE1 1 
ATOM 3883  C CE2 . TYR B 1 168 ? -2.729  40.217  231.251 1.00 96.19  ? 168 TYR 2 CE2 1 
ATOM 3884  C CZ  . TYR B 1 168 ? -2.278  38.978  231.646 1.00 98.92  ? 168 TYR 2 CZ  1 
ATOM 3885  O OH  . TYR B 1 168 ? -2.963  38.270  232.602 1.00 113.89 ? 168 TYR 2 OH  1 
ATOM 3886  N N   . ARG B 1 169 ? 0.733   42.707  231.405 1.00 55.11  ? 169 ARG 2 N   1 
ATOM 3887  C CA  . ARG B 1 169 ? 0.318   43.568  232.468 1.00 61.82  ? 169 ARG 2 CA  1 
ATOM 3888  C C   . ARG B 1 169 ? 1.249   44.793  232.607 1.00 56.21  ? 169 ARG 2 C   1 
ATOM 3889  O O   . ARG B 1 169 ? 1.391   45.358  233.687 1.00 59.14  ? 169 ARG 2 O   1 
ATOM 3890  C CB  . ARG B 1 169 ? 0.224   42.709  233.735 1.00 83.06  ? 169 ARG 2 CB  1 
ATOM 3891  C CG  . ARG B 1 169 ? -0.833  41.565  233.608 1.00 81.93  ? 169 ARG 2 CG  1 
ATOM 3892  C CD  . ARG B 1 169 ? -0.298  40.174  233.943 1.00 84.32  ? 169 ARG 2 CD  1 
ATOM 3893  N NE  . ARG B 1 169 ? 0.198   40.083  235.315 1.00 110.48 ? 169 ARG 2 NE  1 
ATOM 3894  C CZ  . ARG B 1 169 ? 1.340   39.492  235.667 1.00 127.67 ? 169 ARG 2 CZ  1 
ATOM 3895  N NH1 . ARG B 1 169 ? 2.119   38.926  234.745 1.00 139.11 ? 169 ARG 2 NH1 1 
ATOM 3896  N NH2 . ARG B 1 169 ? 1.712   39.478  236.945 1.00 136.80 ? 169 ARG 2 NH2 1 
ATOM 3897  N N   . THR B 1 170 ? 1.869   45.228  231.514 1.00 54.34  ? 170 THR 2 N   1 
ATOM 3898  C CA  . THR B 1 170 ? 2.746   46.389  231.620 1.00 57.43  ? 170 THR 2 CA  1 
ATOM 3899  C C   . THR B 1 170 ? 1.980   47.674  231.380 1.00 61.05  ? 170 THR 2 C   1 
ATOM 3900  O O   . THR B 1 170 ? 1.129   47.762  230.483 1.00 65.68  ? 170 THR 2 O   1 
ATOM 3901  C CB  . THR B 1 170 ? 3.955   46.323  230.681 1.00 57.22  ? 170 THR 2 CB  1 
ATOM 3902  O OG1 . THR B 1 170 ? 4.687   45.120  230.932 1.00 61.91  ? 170 THR 2 OG1 1 
ATOM 3903  C CG2 . THR B 1 170 ? 4.889   47.518  230.930 1.00 33.87  ? 170 THR 2 CG2 1 
ATOM 3904  N N   . LYS B 1 171 ? 2.279   48.656  232.217 1.00 58.56  ? 171 LYS 2 N   1 
ATOM 3905  C CA  . LYS B 1 171 ? 1.642   49.954  232.179 1.00 75.75  ? 171 LYS 2 CA  1 
ATOM 3906  C C   . LYS B 1 171 ? 2.401   50.878  231.262 1.00 70.62  ? 171 LYS 2 C   1 
ATOM 3907  O O   . LYS B 1 171 ? 3.375   51.530  231.663 1.00 71.58  ? 171 LYS 2 O   1 
ATOM 3908  C CB  . LYS B 1 171 ? 1.602   50.531  233.587 1.00 110.85 ? 171 LYS 2 CB  1 
ATOM 3909  C CG  . LYS B 1 171 ? 1.009   49.580  234.640 1.00 154.35 ? 171 LYS 2 CG  1 
ATOM 3910  C CD  . LYS B 1 171 ? 1.023   50.199  236.059 1.00 182.63 ? 171 LYS 2 CD  1 
ATOM 3911  C CE  . LYS B 1 171 ? 0.408   49.268  237.128 1.00 194.14 ? 171 LYS 2 CE  1 
ATOM 3912  N NZ  . LYS B 1 171 ? 0.334   49.880  238.504 1.00 197.72 ? 171 LYS 2 NZ  1 
ATOM 3913  N N   . TYR B 1 172 ? 1.906   50.982  230.038 1.00 70.69  ? 172 TYR 2 N   1 
ATOM 3914  C CA  . TYR B 1 172 ? 2.566   51.795  229.037 1.00 67.39  ? 172 TYR 2 CA  1 
ATOM 3915  C C   . TYR B 1 172 ? 2.298   53.270  229.035 1.00 62.90  ? 172 TYR 2 C   1 
ATOM 3916  O O   . TYR B 1 172 ? 1.172   53.706  228.809 1.00 67.47  ? 172 TYR 2 O   1 
ATOM 3917  C CB  . TYR B 1 172 ? 2.356   51.203  227.652 1.00 71.83  ? 172 TYR 2 CB  1 
ATOM 3918  C CG  . TYR B 1 172 ? 3.292   50.046  227.400 1.00 68.55  ? 172 TYR 2 CG  1 
ATOM 3919  C CD1 . TYR B 1 172 ? 4.670   50.222  227.485 1.00 55.28  ? 172 TYR 2 CD1 1 
ATOM 3920  C CD2 . TYR B 1 172 ? 2.805   48.771  227.113 1.00 74.76  ? 172 TYR 2 CD2 1 
ATOM 3921  C CE1 . TYR B 1 172 ? 5.548   49.171  227.295 1.00 59.04  ? 172 TYR 2 CE1 1 
ATOM 3922  C CE2 . TYR B 1 172 ? 3.687   47.698  226.921 1.00 78.67  ? 172 TYR 2 CE2 1 
ATOM 3923  C CZ  . TYR B 1 172 ? 5.061   47.909  227.012 1.00 66.25  ? 172 TYR 2 CZ  1 
ATOM 3924  O OH  . TYR B 1 172 ? 5.952   46.871  226.818 1.00 67.10  ? 172 TYR 2 OH  1 
ATOM 3925  N N   . PRO B 1 173 ? 3.369   54.059  229.186 1.00 60.75  ? 173 PRO 2 N   1 
ATOM 3926  C CA  . PRO B 1 173 ? 3.380   55.512  229.222 1.00 63.05  ? 173 PRO 2 CA  1 
ATOM 3927  C C   . PRO B 1 173 ? 2.437   56.198  228.274 1.00 64.41  ? 173 PRO 2 C   1 
ATOM 3928  O O   . PRO B 1 173 ? 2.023   55.688  227.234 1.00 58.23  ? 173 PRO 2 O   1 
ATOM 3929  C CB  . PRO B 1 173 ? 4.846   55.875  228.942 1.00 64.68  ? 173 PRO 2 CB  1 
ATOM 3930  C CG  . PRO B 1 173 ? 5.390   54.669  228.287 1.00 71.73  ? 173 PRO 2 CG  1 
ATOM 3931  C CD  . PRO B 1 173 ? 4.743   53.565  229.082 1.00 69.97  ? 173 PRO 2 CD  1 
ATOM 3932  N N   . ALA B 1 174 ? 2.136   57.408  228.691 1.00 79.07  ? 174 ALA 2 N   1 
ATOM 3933  C CA  . ALA B 1 174 ? 1.223   58.294  228.033 1.00 82.14  ? 174 ALA 2 CA  1 
ATOM 3934  C C   . ALA B 1 174 ? 1.306   58.371  226.539 1.00 73.47  ? 174 ALA 2 C   1 
ATOM 3935  O O   . ALA B 1 174 ? 0.391   57.954  225.826 1.00 72.45  ? 174 ALA 2 O   1 
ATOM 3936  C CB  . ALA B 1 174 ? 1.383   59.693  228.628 1.00 103.73 ? 174 ALA 2 CB  1 
ATOM 3937  N N   . GLN B 1 175 ? 2.418   58.913  226.076 1.00 68.39  ? 175 GLN 2 N   1 
ATOM 3938  C CA  . GLN B 1 175 ? 2.612   59.158  224.660 1.00 80.69  ? 175 GLN 2 CA  1 
ATOM 3939  C C   . GLN B 1 175 ? 3.096   58.032  223.758 1.00 71.78  ? 175 GLN 2 C   1 
ATOM 3940  O O   . GLN B 1 175 ? 3.929   58.249  222.879 1.00 71.50  ? 175 GLN 2 O   1 
ATOM 3941  C CB  . GLN B 1 175 ? 3.518   60.379  224.515 1.00 107.09 ? 175 GLN 2 CB  1 
ATOM 3942  C CG  . GLN B 1 175 ? 2.903   61.671  225.038 1.00 140.08 ? 175 GLN 2 CG  1 
ATOM 3943  C CD  . GLN B 1 175 ? 1.751   62.168  224.163 1.00 160.84 ? 175 GLN 2 CD  1 
ATOM 3944  O OE1 . GLN B 1 175 ? 1.912   63.109  223.378 1.00 177.98 ? 175 GLN 2 OE1 1 
ATOM 3945  N NE2 . GLN B 1 175 ? 0.588   61.531  224.290 1.00 164.91 ? 175 GLN 2 NE2 1 
ATOM 3946  N N   . THR B 1 176 ? 2.531   56.851  223.905 1.00 57.79  ? 176 THR 2 N   1 
ATOM 3947  C CA  . THR B 1 176 ? 2.984   55.752  223.094 1.00 44.79  ? 176 THR 2 CA  1 
ATOM 3948  C C   . THR B 1 176 ? 1.810   54.980  222.610 1.00 42.01  ? 176 THR 2 C   1 
ATOM 3949  O O   . THR B 1 176 ? 0.783   54.917  223.277 1.00 63.93  ? 176 THR 2 O   1 
ATOM 3950  C CB  . THR B 1 176 ? 3.803   54.780  223.926 1.00 43.03  ? 176 THR 2 CB  1 
ATOM 3951  O OG1 . THR B 1 176 ? 2.934   54.110  224.851 1.00 50.35  ? 176 THR 2 OG1 1 
ATOM 3952  C CG2 . THR B 1 176 ? 4.879   55.530  224.713 1.00 40.87  ? 176 THR 2 CG2 1 
ATOM 3953  N N   . VAL B 1 177 ? 1.974   54.322  221.484 1.00 33.14  ? 177 VAL 2 N   1 
ATOM 3954  C CA  . VAL B 1 177 ? 0.902   53.503  220.976 1.00 37.49  ? 177 VAL 2 CA  1 
ATOM 3955  C C   . VAL B 1 177 ? 1.329   52.097  221.347 1.00 45.91  ? 177 VAL 2 C   1 
ATOM 3956  O O   . VAL B 1 177 ? 2.472   51.708  221.082 1.00 55.67  ? 177 VAL 2 O   1 
ATOM 3957  C CB  . VAL B 1 177 ? 0.790   53.613  219.472 1.00 32.03  ? 177 VAL 2 CB  1 
ATOM 3958  C CG1 . VAL B 1 177 ? -0.377  52.837  219.006 1.00 38.99  ? 177 VAL 2 CG1 1 
ATOM 3959  C CG2 . VAL B 1 177 ? 0.648   55.046  219.068 1.00 44.22  ? 177 VAL 2 CG2 1 
ATOM 3960  N N   . THR B 1 178 ? 0.466   51.373  222.045 1.00 42.53  ? 178 THR 2 N   1 
ATOM 3961  C CA  . THR B 1 178 ? 0.799   50.020  222.449 1.00 41.45  ? 178 THR 2 CA  1 
ATOM 3962  C C   . THR B 1 178 ? -0.356  49.140  222.058 1.00 47.09  ? 178 THR 2 C   1 
ATOM 3963  O O   . THR B 1 178 ? -1.387  49.638  221.593 1.00 47.79  ? 178 THR 2 O   1 
ATOM 3964  C CB  . THR B 1 178 ? 1.116   49.932  223.936 1.00 48.39  ? 178 THR 2 CB  1 
ATOM 3965  O OG1 . THR B 1 178 ? -0.076  50.147  224.699 1.00 77.10  ? 178 THR 2 OG1 1 
ATOM 3966  C CG2 . THR B 1 178 ? 2.155   50.989  224.293 1.00 41.39  ? 178 THR 2 CG2 1 
ATOM 3967  N N   . PRO B 1 179 ? -0.214  47.816  222.231 1.00 53.16  ? 179 PRO 2 N   1 
ATOM 3968  C CA  . PRO B 1 179 ? -1.309  46.931  221.840 1.00 56.77  ? 179 PRO 2 CA  1 
ATOM 3969  C C   . PRO B 1 179 ? -2.521  47.246  222.630 1.00 61.78  ? 179 PRO 2 C   1 
ATOM 3970  O O   . PRO B 1 179 ? -2.437  47.617  223.812 1.00 44.66  ? 179 PRO 2 O   1 
ATOM 3971  C CB  . PRO B 1 179 ? -0.774  45.540  222.158 1.00 42.73  ? 179 PRO 2 CB  1 
ATOM 3972  C CG  . PRO B 1 179 ? 0.692   45.716  222.041 1.00 53.32  ? 179 PRO 2 CG  1 
ATOM 3973  C CD  . PRO B 1 179 ? 0.896   47.029  222.774 1.00 54.27  ? 179 PRO 2 CD  1 
ATOM 3974  N N   . LYS B 1 180 ? -3.653  47.114  221.964 1.00 72.29  ? 180 LYS 2 N   1 
ATOM 3975  C CA  . LYS B 1 180 ? -4.877  47.404  222.635 1.00 87.00  ? 180 LYS 2 CA  1 
ATOM 3976  C C   . LYS B 1 180 ? -5.559  46.236  223.319 1.00 86.63  ? 180 LYS 2 C   1 
ATOM 3977  O O   . LYS B 1 180 ? -6.002  45.290  222.655 1.00 91.12  ? 180 LYS 2 O   1 
ATOM 3978  C CB  . LYS B 1 180 ? -5.804  48.143  221.691 1.00 112.66 ? 180 LYS 2 CB  1 
ATOM 3979  C CG  . LYS B 1 180 ? -5.488  49.637  221.669 1.00 150.15 ? 180 LYS 2 CG  1 
ATOM 3980  C CD  . LYS B 1 180 ? -5.468  50.217  223.112 1.00 174.62 ? 180 LYS 2 CD  1 
ATOM 3981  C CE  . LYS B 1 180 ? -5.197  51.738  223.164 1.00 188.95 ? 180 LYS 2 CE  1 
ATOM 3982  N NZ  . LYS B 1 180 ? -5.313  52.320  224.550 1.00 190.85 ? 180 LYS 2 NZ  1 
ATOM 3983  N N   . ASN B 1 181 ? -5.608  46.309  224.653 1.00 76.65  ? 181 ASN 2 N   1 
ATOM 3984  C CA  . ASN B 1 181 ? -6.249  45.299  225.493 1.00 83.01  ? 181 ASN 2 CA  1 
ATOM 3985  C C   . ASN B 1 181 ? -5.438  44.065  225.696 1.00 72.19  ? 181 ASN 2 C   1 
ATOM 3986  O O   . ASN B 1 181 ? -5.827  42.956  225.318 1.00 63.11  ? 181 ASN 2 O   1 
ATOM 3987  C CB  . ASN B 1 181 ? -7.619  44.902  224.962 1.00 110.33 ? 181 ASN 2 CB  1 
ATOM 3988  C CG  . ASN B 1 181 ? -8.685  45.911  225.304 1.00 141.17 ? 181 ASN 2 CG  1 
ATOM 3989  O OD1 . ASN B 1 181 ? -9.800  45.837  224.790 1.00 165.91 ? 181 ASN 2 OD1 1 
ATOM 3990  N ND2 . ASN B 1 181 ? -8.357  46.868  226.178 1.00 152.22 ? 181 ASN 2 ND2 1 
ATOM 3991  N N   . ALA B 1 182 ? -4.324  44.264  226.368 1.00 69.44  ? 182 ALA 2 N   1 
ATOM 3992  C CA  . ALA B 1 182 ? -3.412  43.185  226.647 1.00 74.15  ? 182 ALA 2 CA  1 
ATOM 3993  C C   . ALA B 1 182 ? -4.105  42.063  227.383 1.00 67.90  ? 182 ALA 2 C   1 
ATOM 3994  O O   . ALA B 1 182 ? -4.838  42.304  228.338 1.00 80.25  ? 182 ALA 2 O   1 
ATOM 3995  C CB  . ALA B 1 182 ? -2.255  43.703  227.474 1.00 88.01  ? 182 ALA 2 CB  1 
ATOM 3996  N N   . THR B 1 183 ? -3.924  40.851  226.879 1.00 57.49  ? 183 THR 2 N   1 
ATOM 3997  C CA  . THR B 1 183 ? -4.466  39.657  227.493 1.00 46.96  ? 183 THR 2 CA  1 
ATOM 3998  C C   . THR B 1 183 ? -3.195  38.834  227.733 1.00 49.27  ? 183 THR 2 C   1 
ATOM 3999  O O   . THR B 1 183 ? -2.079  39.329  227.550 1.00 42.01  ? 183 THR 2 O   1 
ATOM 4000  C CB  . THR B 1 183 ? -5.470  38.904  226.527 1.00 44.74  ? 183 THR 2 CB  1 
ATOM 4001  O OG1 . THR B 1 183 ? -4.853  37.747  225.952 1.00 55.06  ? 183 THR 2 OG1 1 
ATOM 4002  C CG2 . THR B 1 183 ? -5.959  39.813  225.396 1.00 46.31  ? 183 THR 2 CG2 1 
ATOM 4003  N N   . VAL B 1 184 ? -3.338  37.587  228.136 1.00 60.01  ? 184 VAL 2 N   1 
ATOM 4004  C CA  . VAL B 1 184 ? -2.163  36.765  228.313 1.00 61.80  ? 184 VAL 2 CA  1 
ATOM 4005  C C   . VAL B 1 184 ? -1.641  36.423  226.927 1.00 54.83  ? 184 VAL 2 C   1 
ATOM 4006  O O   . VAL B 1 184 ? -0.450  36.498  226.659 1.00 65.60  ? 184 VAL 2 O   1 
ATOM 4007  C CB  . VAL B 1 184 ? -2.480  35.471  228.978 1.00 65.48  ? 184 VAL 2 CB  1 
ATOM 4008  C CG1 . VAL B 1 184 ? -1.195  34.795  229.293 1.00 88.21  ? 184 VAL 2 CG1 1 
ATOM 4009  C CG2 . VAL B 1 184 ? -3.301  35.707  230.219 1.00 86.48  ? 184 VAL 2 CG2 1 
ATOM 4010  N N   . ASP B 1 185 ? -2.548  36.075  226.033 1.00 39.47  ? 185 ASP 2 N   1 
ATOM 4011  C CA  . ASP B 1 185 ? -2.178  35.744  224.674 1.00 50.03  ? 185 ASP 2 CA  1 
ATOM 4012  C C   . ASP B 1 185 ? -1.394  36.868  223.971 1.00 53.47  ? 185 ASP 2 C   1 
ATOM 4013  O O   . ASP B 1 185 ? -0.982  36.735  222.829 1.00 67.09  ? 185 ASP 2 O   1 
ATOM 4014  C CB  . ASP B 1 185 ? -3.439  35.390  223.879 1.00 69.87  ? 185 ASP 2 CB  1 
ATOM 4015  C CG  . ASP B 1 185 ? -4.256  34.283  224.536 1.00 83.15  ? 185 ASP 2 CG  1 
ATOM 4016  O OD1 . ASP B 1 185 ? -4.499  34.378  225.757 1.00 83.77  ? 185 ASP 2 OD1 1 
ATOM 4017  O OD2 . ASP B 1 185 ? -4.635  33.301  223.850 1.00 96.81  ? 185 ASP 2 OD2 1 
ATOM 4018  N N   . SER B 1 186 ? -1.205  37.991  224.637 1.00 44.26  ? 186 SER 2 N   1 
ATOM 4019  C CA  . SER B 1 186 ? -0.457  39.069  224.042 1.00 35.87  ? 186 SER 2 CA  1 
ATOM 4020  C C   . SER B 1 186 ? 1.028   38.824  224.267 1.00 42.73  ? 186 SER 2 C   1 
ATOM 4021  O O   . SER B 1 186 ? 1.888   39.479  223.670 1.00 50.69  ? 186 SER 2 O   1 
ATOM 4022  C CB  . SER B 1 186 ? -0.908  40.360  224.675 1.00 39.30  ? 186 SER 2 CB  1 
ATOM 4023  O OG  . SER B 1 186 ? -2.300  40.499  224.466 1.00 43.52  ? 186 SER 2 OG  1 
ATOM 4024  N N   . GLN B 1 187 ? 1.313   37.907  225.184 1.00 45.53  ? 187 GLN 2 N   1 
ATOM 4025  C CA  . GLN B 1 187 ? 2.673   37.505  225.519 1.00 36.40  ? 187 GLN 2 CA  1 
ATOM 4026  C C   . GLN B 1 187 ? 3.104   36.502  224.466 1.00 38.30  ? 187 GLN 2 C   1 
ATOM 4027  O O   . GLN B 1 187 ? 4.290   36.170  224.345 1.00 43.82  ? 187 GLN 2 O   1 
ATOM 4028  C CB  . GLN B 1 187 ? 2.721   36.880  226.906 1.00 32.06  ? 187 GLN 2 CB  1 
ATOM 4029  C CG  . GLN B 1 187 ? 2.244   37.812  228.005 1.00 59.74  ? 187 GLN 2 CG  1 
ATOM 4030  C CD  . GLN B 1 187 ? 2.991   37.612  229.310 1.00 78.93  ? 187 GLN 2 CD  1 
ATOM 4031  O OE1 . GLN B 1 187 ? 4.003   36.909  229.353 1.00 102.00 ? 187 GLN 2 OE1 1 
ATOM 4032  N NE2 . GLN B 1 187 ? 2.529   38.272  230.376 1.00 85.41  ? 187 GLN 2 NE2 1 
ATOM 4033  N N   . GLN B 1 188 ? 2.103   35.987  223.753 1.00 29.32  ? 188 GLN 2 N   1 
ATOM 4034  C CA  . GLN B 1 188 ? 2.290   35.056  222.658 1.00 36.46  ? 188 GLN 2 CA  1 
ATOM 4035  C C   . GLN B 1 188 ? 1.458   35.656  221.479 1.00 45.58  ? 188 GLN 2 C   1 
ATOM 4036  O O   . GLN B 1 188 ? 1.241   36.882  221.467 1.00 57.11  ? 188 GLN 2 O   1 
ATOM 4037  C CB  . GLN B 1 188 ? 1.906   33.630  223.088 1.00 34.42  ? 188 GLN 2 CB  1 
ATOM 4038  C CG  . GLN B 1 188 ? 0.481   33.170  222.806 1.00 51.01  ? 188 GLN 2 CG  1 
ATOM 4039  C CD  . GLN B 1 188 ? 0.162   31.737  223.303 1.00 62.83  ? 188 GLN 2 CD  1 
ATOM 4040  O OE1 . GLN B 1 188 ? -0.805  31.108  222.847 1.00 73.83  ? 188 GLN 2 OE1 1 
ATOM 4041  N NE2 . GLN B 1 188 ? 0.938   31.245  224.270 1.00 54.72  ? 188 GLN 2 NE2 1 
ATOM 4042  N N   . MET B 1 189 ? 0.992   34.860  220.508 1.00 36.61  ? 189 MET 2 N   1 
ATOM 4043  C CA  . MET B 1 189 ? 0.235   35.416  219.365 1.00 41.51  ? 189 MET 2 CA  1 
ATOM 4044  C C   . MET B 1 189 ? -1.160  36.022  219.637 1.00 52.69  ? 189 MET 2 C   1 
ATOM 4045  O O   . MET B 1 189 ? -2.192  35.325  219.616 1.00 51.02  ? 189 MET 2 O   1 
ATOM 4046  C CB  . MET B 1 189 ? 0.128   34.392  218.212 1.00 35.48  ? 189 MET 2 CB  1 
ATOM 4047  C CG  . MET B 1 189 ? -0.373  34.971  216.868 1.00 29.26  ? 189 MET 2 CG  1 
ATOM 4048  S SD  . MET B 1 189 ? 0.440   36.573  216.462 1.00 53.61  ? 189 MET 2 SD  1 
ATOM 4049  C CE  . MET B 1 189 ? 0.012   36.776  214.708 1.00 49.35  ? 189 MET 2 CE  1 
ATOM 4050  N N   . ASN B 1 190 ? -1.227  37.330  219.833 1.00 55.07  ? 190 ASN 2 N   1 
ATOM 4051  C CA  . ASN B 1 190 ? -2.540  37.882  220.053 1.00 51.63  ? 190 ASN 2 CA  1 
ATOM 4052  C C   . ASN B 1 190 ? -3.056  38.671  218.862 1.00 48.82  ? 190 ASN 2 C   1 
ATOM 4053  O O   . ASN B 1 190 ? -2.759  39.850  218.675 1.00 55.17  ? 190 ASN 2 O   1 
ATOM 4054  C CB  . ASN B 1 190 ? -2.577  38.710  221.305 1.00 56.63  ? 190 ASN 2 CB  1 
ATOM 4055  C CG  . ASN B 1 190 ? -3.932  39.257  221.553 1.00 54.96  ? 190 ASN 2 CG  1 
ATOM 4056  O OD1 . ASN B 1 190 ? -4.074  40.259  222.231 1.00 64.82  ? 190 ASN 2 OD1 1 
ATOM 4057  N ND2 . ASN B 1 190 ? -4.955  38.618  220.978 1.00 39.70  ? 190 ASN 2 ND2 1 
ATOM 4058  N N   . THR B 1 191 ? -3.930  38.043  218.112 1.00 28.82  ? 191 THR 2 N   1 
ATOM 4059  C CA  . THR B 1 191 ? -4.459  38.669  216.912 1.00 37.22  ? 191 THR 2 CA  1 
ATOM 4060  C C   . THR B 1 191 ? -5.067  40.052  217.037 1.00 43.50  ? 191 THR 2 C   1 
ATOM 4061  O O   . THR B 1 191 ? -5.194  40.772  216.062 1.00 46.61  ? 191 THR 2 O   1 
ATOM 4062  C CB  . THR B 1 191 ? -5.514  37.793  216.320 1.00 33.40  ? 191 THR 2 CB  1 
ATOM 4063  O OG1 . THR B 1 191 ? -5.253  36.449  216.727 1.00 61.12  ? 191 THR 2 OG1 1 
ATOM 4064  C CG2 . THR B 1 191 ? -5.498  37.878  214.819 1.00 37.08  ? 191 THR 2 CG2 1 
ATOM 4065  N N   . ASP B 1 192 ? -5.457  40.445  218.227 1.00 58.56  ? 192 ASP 2 N   1 
ATOM 4066  C CA  . ASP B 1 192 ? -6.084  41.747  218.347 1.00 71.64  ? 192 ASP 2 CA  1 
ATOM 4067  C C   . ASP B 1 192 ? -5.034  42.823  218.260 1.00 63.23  ? 192 ASP 2 C   1 
ATOM 4068  O O   . ASP B 1 192 ? -5.316  44.027  218.310 1.00 74.12  ? 192 ASP 2 O   1 
ATOM 4069  C CB  . ASP B 1 192 ? -6.850  41.844  219.671 1.00 97.57  ? 192 ASP 2 CB  1 
ATOM 4070  C CG  . ASP B 1 192 ? -7.832  40.682  219.877 1.00 109.28 ? 192 ASP 2 CG  1 
ATOM 4071  O OD1 . ASP B 1 192 ? -8.490  40.239  218.898 1.00 95.51  ? 192 ASP 2 OD1 1 
ATOM 4072  O OD2 . ASP B 1 192 ? -7.928  40.201  221.031 1.00 124.33 ? 192 ASP 2 OD2 1 
ATOM 4073  N N   . HIS B 1 193 ? -3.798  42.395  218.136 1.00 43.90  ? 193 HIS 2 N   1 
ATOM 4074  C CA  . HIS B 1 193 ? -2.753  43.372  218.093 1.00 46.94  ? 193 HIS 2 CA  1 
ATOM 4075  C C   . HIS B 1 193 ? -2.196  43.700  216.768 1.00 44.47  ? 193 HIS 2 C   1 
ATOM 4076  O O   . HIS B 1 193 ? -0.979  43.781  216.586 1.00 52.41  ? 193 HIS 2 O   1 
ATOM 4077  C CB  . HIS B 1 193 ? -1.679  42.994  219.055 1.00 56.18  ? 193 HIS 2 CB  1 
ATOM 4078  C CG  . HIS B 1 193 ? -2.196  42.888  220.435 1.00 52.14  ? 193 HIS 2 CG  1 
ATOM 4079  N ND1 . HIS B 1 193 ? -3.292  43.603  220.850 1.00 50.58  ? 193 HIS 2 ND1 1 
ATOM 4080  C CD2 . HIS B 1 193 ? -1.793  42.148  221.489 1.00 64.27  ? 193 HIS 2 CD2 1 
ATOM 4081  C CE1 . HIS B 1 193 ? -3.541  43.311  222.111 1.00 69.51  ? 193 HIS 2 CE1 1 
ATOM 4082  N NE2 . HIS B 1 193 ? -2.647  42.432  222.522 1.00 58.94  ? 193 HIS 2 NE2 1 
ATOM 4083  N N   . LYS B 1 194 ? -3.089  43.873  215.819 1.00 24.37  ? 194 LYS 2 N   1 
ATOM 4084  C CA  . LYS B 1 194 ? -2.641  44.257  214.511 1.00 34.75  ? 194 LYS 2 CA  1 
ATOM 4085  C C   . LYS B 1 194 ? -2.695  45.810  214.453 1.00 43.77  ? 194 LYS 2 C   1 
ATOM 4086  O O   . LYS B 1 194 ? -3.631  46.439  214.945 1.00 57.12  ? 194 LYS 2 O   1 
ATOM 4087  C CB  . LYS B 1 194 ? -3.496  43.562  213.449 1.00 24.56  ? 194 LYS 2 CB  1 
ATOM 4088  C CG  . LYS B 1 194 ? -3.495  42.002  213.510 1.00 34.02  ? 194 LYS 2 CG  1 
ATOM 4089  C CD  . LYS B 1 194 ? -2.106  41.350  213.320 1.00 44.37  ? 194 LYS 2 CD  1 
ATOM 4090  C CE  . LYS B 1 194 ? -2.214  39.867  212.916 1.00 41.45  ? 194 LYS 2 CE  1 
ATOM 4091  N NZ  . LYS B 1 194 ? -0.881  39.216  212.647 1.00 64.99  ? 194 LYS 2 NZ  1 
ATOM 4092  N N   . ALA B 1 195 ? -1.654  46.439  213.934 1.00 47.68  ? 195 ALA 2 N   1 
ATOM 4093  C CA  . ALA B 1 195 ? -1.637  47.890  213.892 1.00 37.80  ? 195 ALA 2 CA  1 
ATOM 4094  C C   . ALA B 1 195 ? -0.899  48.380  212.672 1.00 42.05  ? 195 ALA 2 C   1 
ATOM 4095  O O   . ALA B 1 195 ? -0.758  47.638  211.681 1.00 50.49  ? 195 ALA 2 O   1 
ATOM 4096  C CB  . ALA B 1 195 ? -0.989  48.440  215.139 1.00 23.40  ? 195 ALA 2 CB  1 
ATOM 4097  N N   . VAL B 1 196 ? -0.408  49.616  212.760 1.00 29.86  ? 196 VAL 2 N   1 
ATOM 4098  C CA  . VAL B 1 196 ? 0.313   50.221  211.654 1.00 37.65  ? 196 VAL 2 CA  1 
ATOM 4099  C C   . VAL B 1 196 ? 1.188   51.367  212.135 1.00 34.76  ? 196 VAL 2 C   1 
ATOM 4100  O O   . VAL B 1 196 ? 0.757   52.202  212.916 1.00 42.51  ? 196 VAL 2 O   1 
ATOM 4101  C CB  . VAL B 1 196 ? -0.646  50.755  210.641 1.00 19.41  ? 196 VAL 2 CB  1 
ATOM 4102  C CG1 . VAL B 1 196 ? -1.582  51.695  211.349 1.00 64.51  ? 196 VAL 2 CG1 1 
ATOM 4103  C CG2 . VAL B 1 196 ? 0.090   51.491  209.592 1.00 26.80  ? 196 VAL 2 CG2 1 
ATOM 4104  N N   . LEU B 1 197 ? 2.422   51.382  211.655 1.00 29.64  ? 197 LEU 2 N   1 
ATOM 4105  C CA  . LEU B 1 197 ? 3.372   52.381  212.044 1.00 30.12  ? 197 LEU 2 CA  1 
ATOM 4106  C C   . LEU B 1 197 ? 2.994   53.590  211.265 1.00 34.08  ? 197 LEU 2 C   1 
ATOM 4107  O O   . LEU B 1 197 ? 3.307   53.671  210.073 1.00 42.19  ? 197 LEU 2 O   1 
ATOM 4108  C CB  . LEU B 1 197 ? 4.773   51.935  211.665 1.00 31.14  ? 197 LEU 2 CB  1 
ATOM 4109  C CG  . LEU B 1 197 ? 5.756   52.932  212.242 1.00 31.24  ? 197 LEU 2 CG  1 
ATOM 4110  C CD1 . LEU B 1 197 ? 5.416   53.217  213.700 1.00 58.39  ? 197 LEU 2 CD1 1 
ATOM 4111  C CD2 . LEU B 1 197 ? 7.134   52.382  212.142 1.00 28.85  ? 197 LEU 2 CD2 1 
ATOM 4112  N N   . ASP B 1 198 ? 2.312   54.512  211.938 1.00 34.03  ? 198 ASP 2 N   1 
ATOM 4113  C CA  . ASP B 1 198 ? 1.814   55.745  211.312 1.00 37.99  ? 198 ASP 2 CA  1 
ATOM 4114  C C   . ASP B 1 198 ? 2.286   56.987  212.033 1.00 33.46  ? 198 ASP 2 C   1 
ATOM 4115  O O   . ASP B 1 198 ? 1.963   58.132  211.662 1.00 37.37  ? 198 ASP 2 O   1 
ATOM 4116  C CB  . ASP B 1 198 ? 0.282   55.742  211.332 1.00 27.57  ? 198 ASP 2 CB  1 
ATOM 4117  C CG  . ASP B 1 198 ? -0.276  55.634  212.736 1.00 46.97  ? 198 ASP 2 CG  1 
ATOM 4118  O OD1 . ASP B 1 198 ? 0.520   55.683  213.711 1.00 43.66  ? 198 ASP 2 OD1 1 
ATOM 4119  O OD2 . ASP B 1 198 ? -1.508  55.486  212.863 1.00 59.01  ? 198 ASP 2 OD2 1 
ATOM 4120  N N   . LYS B 1 199 ? 3.012   56.752  213.101 1.00 15.75  ? 199 LYS 2 N   1 
ATOM 4121  C CA  . LYS B 1 199 ? 3.476   57.845  213.866 1.00 12.59  ? 199 LYS 2 CA  1 
ATOM 4122  C C   . LYS B 1 199 ? 4.897   57.582  214.347 1.00 25.65  ? 199 LYS 2 C   1 
ATOM 4123  O O   . LYS B 1 199 ? 5.252   56.516  214.925 1.00 28.01  ? 199 LYS 2 O   1 
ATOM 4124  C CB  . LYS B 1 199 ? 2.453   58.093  214.984 1.00 41.17  ? 199 LYS 2 CB  1 
ATOM 4125  C CG  . LYS B 1 199 ? 2.838   59.085  216.052 1.00 64.49  ? 199 LYS 2 CG  1 
ATOM 4126  C CD  . LYS B 1 199 ? 3.452   60.327  215.466 1.00 110.97 ? 199 LYS 2 CD  1 
ATOM 4127  C CE  . LYS B 1 199 ? 3.927   61.273  216.558 1.00 131.82 ? 199 LYS 2 CE  1 
ATOM 4128  N NZ  . LYS B 1 199 ? 2.772   61.826  217.320 1.00 146.37 ? 199 LYS 2 NZ  1 
ATOM 4129  N N   . ASP B 1 200 ? 5.742   58.542  214.025 1.00 23.91  ? 200 ASP 2 N   1 
ATOM 4130  C CA  . ASP B 1 200 ? 7.131   58.448  214.406 1.00 32.70  ? 200 ASP 2 CA  1 
ATOM 4131  C C   . ASP B 1 200 ? 7.258   58.619  215.901 1.00 29.35  ? 200 ASP 2 C   1 
ATOM 4132  O O   . ASP B 1 200 ? 6.510   59.360  216.524 1.00 40.16  ? 200 ASP 2 O   1 
ATOM 4133  C CB  . ASP B 1 200 ? 7.951   59.516  213.694 1.00 42.58  ? 200 ASP 2 CB  1 
ATOM 4134  C CG  . ASP B 1 200 ? 9.424   59.410  213.996 1.00 45.38  ? 200 ASP 2 CG  1 
ATOM 4135  O OD1 . ASP B 1 200 ? 10.094  58.548  213.394 1.00 53.14  ? 200 ASP 2 OD1 1 
ATOM 4136  O OD2 . ASP B 1 200 ? 9.912   60.186  214.838 1.00 48.74  ? 200 ASP 2 OD2 1 
ATOM 4137  N N   . ASN B 1 201 ? 8.201   57.901  216.470 1.00 33.31  ? 201 ASN 2 N   1 
ATOM 4138  C CA  . ASN B 1 201 ? 8.472   57.948  217.893 1.00 37.50  ? 201 ASN 2 CA  1 
ATOM 4139  C C   . ASN B 1 201 ? 7.237   57.648  218.671 1.00 33.44  ? 201 ASN 2 C   1 
ATOM 4140  O O   . ASN B 1 201 ? 6.959   58.309  219.654 1.00 34.70  ? 201 ASN 2 O   1 
ATOM 4141  C CB  . ASN B 1 201 ? 9.005   59.309  218.327 1.00 17.00  ? 201 ASN 2 CB  1 
ATOM 4142  C CG  . ASN B 1 201 ? 9.602   59.282  219.739 1.00 41.70  ? 201 ASN 2 CG  1 
ATOM 4143  O OD1 . ASN B 1 201 ? 10.032  60.309  220.248 1.00 65.92  ? 201 ASN 2 OD1 1 
ATOM 4144  N ND2 . ASN B 1 201 ? 9.637   58.103  220.371 1.00 45.31  ? 201 ASN 2 ND2 1 
ATOM 4145  N N   . ALA B 1 202 ? 6.506   56.628  218.269 1.00 42.06  ? 202 ALA 2 N   1 
ATOM 4146  C CA  . ALA B 1 202 ? 5.291   56.341  218.993 1.00 40.24  ? 202 ALA 2 CA  1 
ATOM 4147  C C   . ALA B 1 202 ? 5.241   54.913  219.356 1.00 42.15  ? 202 ALA 2 C   1 
ATOM 4148  O O   . ALA B 1 202 ? 5.126   54.561  220.517 1.00 44.33  ? 202 ALA 2 O   1 
ATOM 4149  C CB  . ALA B 1 202 ? 4.111   56.675  218.158 1.00 56.52  ? 202 ALA 2 CB  1 
ATOM 4150  N N   . TYR B 1 203 ? 5.301   54.079  218.341 1.00 41.48  ? 203 TYR 2 N   1 
ATOM 4151  C CA  . TYR B 1 203 ? 5.248   52.674  218.584 1.00 32.59  ? 203 TYR 2 CA  1 
ATOM 4152  C C   . TYR B 1 203 ? 6.616   52.280  219.089 1.00 33.74  ? 203 TYR 2 C   1 
ATOM 4153  O O   . TYR B 1 203 ? 7.611   52.418  218.381 1.00 44.47  ? 203 TYR 2 O   1 
ATOM 4154  C CB  . TYR B 1 203 ? 4.940   52.023  217.292 1.00 25.26  ? 203 TYR 2 CB  1 
ATOM 4155  C CG  . TYR B 1 203 ? 3.630   52.453  216.748 1.00 30.25  ? 203 TYR 2 CG  1 
ATOM 4156  C CD1 . TYR B 1 203 ? 3.408   53.752  216.287 1.00 31.12  ? 203 TYR 2 CD1 1 
ATOM 4157  C CD2 . TYR B 1 203 ? 2.616   51.532  216.623 1.00 46.49  ? 203 TYR 2 CD2 1 
ATOM 4158  C CE1 . TYR B 1 203 ? 2.181   54.094  215.694 1.00 34.45  ? 203 TYR 2 CE1 1 
ATOM 4159  C CE2 . TYR B 1 203 ? 1.411   51.855  216.049 1.00 48.17  ? 203 TYR 2 CE2 1 
ATOM 4160  C CZ  . TYR B 1 203 ? 1.186   53.117  215.585 1.00 40.98  ? 203 TYR 2 CZ  1 
ATOM 4161  O OH  . TYR B 1 203 ? -0.053  53.302  215.009 1.00 52.86  ? 203 TYR 2 OH  1 
ATOM 4162  N N   . PRO B 1 204 ? 6.696   51.862  220.347 1.00 25.03  ? 204 PRO 2 N   1 
ATOM 4163  C CA  . PRO B 1 204 ? 7.940   51.454  220.989 1.00 35.08  ? 204 PRO 2 CA  1 
ATOM 4164  C C   . PRO B 1 204 ? 8.300   50.091  220.448 1.00 44.38  ? 204 PRO 2 C   1 
ATOM 4165  O O   . PRO B 1 204 ? 7.420   49.229  220.265 1.00 37.18  ? 204 PRO 2 O   1 
ATOM 4166  C CB  . PRO B 1 204 ? 7.560   51.427  222.453 1.00 32.93  ? 204 PRO 2 CB  1 
ATOM 4167  C CG  . PRO B 1 204 ? 6.168   50.897  222.388 1.00 36.56  ? 204 PRO 2 CG  1 
ATOM 4168  C CD  . PRO B 1 204 ? 5.539   51.592  221.210 1.00 31.48  ? 204 PRO 2 CD  1 
ATOM 4169  N N   . VAL B 1 205 ? 9.581   49.907  220.151 1.00 46.32  ? 205 VAL 2 N   1 
ATOM 4170  C CA  . VAL B 1 205 ? 10.023  48.659  219.552 1.00 46.37  ? 205 VAL 2 CA  1 
ATOM 4171  C C   . VAL B 1 205 ? 9.711   47.443  220.315 1.00 47.10  ? 205 VAL 2 C   1 
ATOM 4172  O O   . VAL B 1 205 ? 9.377   46.427  219.719 1.00 50.11  ? 205 VAL 2 O   1 
ATOM 4173  C CB  . VAL B 1 205 ? 11.493  48.610  219.309 1.00 35.61  ? 205 VAL 2 CB  1 
ATOM 4174  C CG1 . VAL B 1 205 ? 11.807  49.268  218.004 1.00 51.37  ? 205 VAL 2 CG1 1 
ATOM 4175  C CG2 . VAL B 1 205 ? 12.192  49.294  220.445 1.00 60.50  ? 205 VAL 2 CG2 1 
ATOM 4176  N N   . GLU B 1 206 ? 9.772   47.541  221.635 1.00 41.83  ? 206 GLU 2 N   1 
ATOM 4177  C CA  . GLU B 1 206 ? 9.536   46.345  222.418 1.00 47.04  ? 206 GLU 2 CA  1 
ATOM 4178  C C   . GLU B 1 206 ? 8.150   45.773  222.391 1.00 44.53  ? 206 GLU 2 C   1 
ATOM 4179  O O   . GLU B 1 206 ? 7.936   44.739  223.020 1.00 50.65  ? 206 GLU 2 O   1 
ATOM 4180  C CB  . GLU B 1 206 ? 9.976   46.517  223.860 1.00 54.70  ? 206 GLU 2 CB  1 
ATOM 4181  C CG  . GLU B 1 206 ? 9.363   47.681  224.567 1.00 64.35  ? 206 GLU 2 CG  1 
ATOM 4182  C CD  . GLU B 1 206 ? 9.900   47.833  225.979 1.00 68.72  ? 206 GLU 2 CD  1 
ATOM 4183  O OE1 . GLU B 1 206 ? 11.084  48.285  226.131 1.00 63.62  ? 206 GLU 2 OE1 1 
ATOM 4184  O OE2 . GLU B 1 206 ? 9.129   47.500  226.920 1.00 35.60  ? 206 GLU 2 OE2 1 
ATOM 4185  N N   . CYS B 1 207 ? 7.237   46.385  221.629 1.00 38.61  ? 207 CYS 2 N   1 
ATOM 4186  C CA  . CYS B 1 207 ? 5.844   45.916  221.574 1.00 38.48  ? 207 CYS 2 CA  1 
ATOM 4187  C C   . CYS B 1 207 ? 5.415   45.444  220.223 1.00 46.13  ? 207 CYS 2 C   1 
ATOM 4188  O O   . CYS B 1 207 ? 4.370   44.779  220.071 1.00 45.68  ? 207 CYS 2 O   1 
ATOM 4189  C CB  . CYS B 1 207 ? 4.858   47.040  221.898 1.00 45.59  ? 207 CYS 2 CB  1 
ATOM 4190  S SG  . CYS B 1 207 ? 5.081   47.940  223.404 1.00 61.97  ? 207 CYS 2 SG  1 
ATOM 4191  N N   . TRP B 1 208 ? 6.156   45.855  219.212 1.00 41.63  ? 208 TRP 2 N   1 
ATOM 4192  C CA  . TRP B 1 208 ? 5.714   45.490  217.892 1.00 43.46  ? 208 TRP 2 CA  1 
ATOM 4193  C C   . TRP B 1 208 ? 6.754   44.911  217.018 1.00 36.53  ? 208 TRP 2 C   1 
ATOM 4194  O O   . TRP B 1 208 ? 7.946   45.054  217.266 1.00 38.30  ? 208 TRP 2 O   1 
ATOM 4195  C CB  . TRP B 1 208 ? 5.208   46.719  217.187 1.00 55.50  ? 208 TRP 2 CB  1 
ATOM 4196  C CG  . TRP B 1 208 ? 4.301   47.503  217.988 1.00 47.85  ? 208 TRP 2 CG  1 
ATOM 4197  C CD1 . TRP B 1 208 ? 4.607   48.552  218.819 1.00 45.23  ? 208 TRP 2 CD1 1 
ATOM 4198  C CD2 . TRP B 1 208 ? 2.898   47.382  217.979 1.00 46.04  ? 208 TRP 2 CD2 1 
ATOM 4199  N NE1 . TRP B 1 208 ? 3.455   49.102  219.311 1.00 45.35  ? 208 TRP 2 NE1 1 
ATOM 4200  C CE2 . TRP B 1 208 ? 2.390   48.404  218.804 1.00 41.69  ? 208 TRP 2 CE2 1 
ATOM 4201  C CE3 . TRP B 1 208 ? 2.010   46.515  217.327 1.00 44.25  ? 208 TRP 2 CE3 1 
ATOM 4202  C CZ2 . TRP B 1 208 ? 1.036   48.576  219.001 1.00 28.42  ? 208 TRP 2 CZ2 1 
ATOM 4203  C CZ3 . TRP B 1 208 ? 0.668   46.684  217.523 1.00 29.87  ? 208 TRP 2 CZ3 1 
ATOM 4204  C CH2 . TRP B 1 208 ? 0.188   47.709  218.349 1.00 35.69  ? 208 TRP 2 CH2 1 
ATOM 4205  N N   . VAL B 1 209 ? 6.265   44.291  215.960 1.00 18.33  ? 209 VAL 2 N   1 
ATOM 4206  C CA  . VAL B 1 209 ? 7.107   43.714  214.959 1.00 20.63  ? 209 VAL 2 CA  1 
ATOM 4207  C C   . VAL B 1 209 ? 6.278   43.714  213.707 1.00 24.51  ? 209 VAL 2 C   1 
ATOM 4208  O O   . VAL B 1 209 ? 5.023   43.716  213.728 1.00 25.57  ? 209 VAL 2 O   1 
ATOM 4209  C CB  . VAL B 1 209 ? 7.526   42.252  215.244 1.00 18.24  ? 209 VAL 2 CB  1 
ATOM 4210  C CG1 . VAL B 1 209 ? 8.105   42.101  216.624 1.00 36.64  ? 209 VAL 2 CG1 1 
ATOM 4211  C CG2 . VAL B 1 209 ? 6.392   41.337  215.033 1.00 25.19  ? 209 VAL 2 CG2 1 
ATOM 4212  N N   . PRO B 1 210 ? 6.966   43.797  212.585 1.00 16.31  ? 210 PRO 2 N   1 
ATOM 4213  C CA  . PRO B 1 210 ? 6.264   43.790  211.323 1.00 20.79  ? 210 PRO 2 CA  1 
ATOM 4214  C C   . PRO B 1 210 ? 5.435   42.526  211.291 1.00 16.19  ? 210 PRO 2 C   1 
ATOM 4215  O O   . PRO B 1 210 ? 5.910   41.440  211.650 1.00 22.74  ? 210 PRO 2 O   1 
ATOM 4216  C CB  . PRO B 1 210 ? 7.408   43.758  210.307 1.00 17.67  ? 210 PRO 2 CB  1 
ATOM 4217  C CG  . PRO B 1 210 ? 8.560   43.223  211.101 1.00 28.21  ? 210 PRO 2 CG  1 
ATOM 4218  C CD  . PRO B 1 210 ? 8.408   43.932  212.383 1.00 14.15  ? 210 PRO 2 CD  1 
ATOM 4219  N N   . ASP B 1 211 ? 4.161   42.711  211.004 1.00 13.34  ? 211 ASP 2 N   1 
ATOM 4220  C CA  . ASP B 1 211 ? 3.258   41.600  210.903 1.00 27.08  ? 211 ASP 2 CA  1 
ATOM 4221  C C   . ASP B 1 211 ? 3.477   40.912  209.577 1.00 21.27  ? 211 ASP 2 C   1 
ATOM 4222  O O   . ASP B 1 211 ? 3.000   41.358  208.538 1.00 20.72  ? 211 ASP 2 O   1 
ATOM 4223  C CB  . ASP B 1 211 ? 1.827   42.051  210.944 1.00 33.84  ? 211 ASP 2 CB  1 
ATOM 4224  C CG  . ASP B 1 211 ? 0.873   40.916  210.686 1.00 48.89  ? 211 ASP 2 CG  1 
ATOM 4225  O OD1 . ASP B 1 211 ? 1.279   39.727  210.434 1.00 28.73  ? 211 ASP 2 OD1 1 
ATOM 4226  O OD2 . ASP B 1 211 ? -0.321  41.223  210.778 1.00 54.84  ? 211 ASP 2 OD2 1 
ATOM 4227  N N   . PRO B 1 212 ? 4.015   39.709  209.638 1.00 18.66  ? 212 PRO 2 N   1 
ATOM 4228  C CA  . PRO B 1 212 ? 4.305   38.913  208.457 1.00 17.26  ? 212 PRO 2 CA  1 
ATOM 4229  C C   . PRO B 1 212 ? 3.123   38.525  207.656 1.00 20.14  ? 212 PRO 2 C   1 
ATOM 4230  O O   . PRO B 1 212 ? 3.162   38.559  206.421 1.00 47.36  ? 212 PRO 2 O   1 
ATOM 4231  C CB  . PRO B 1 212 ? 4.996   37.694  209.033 1.00 14.79  ? 212 PRO 2 CB  1 
ATOM 4232  C CG  . PRO B 1 212 ? 4.473   37.626  210.414 1.00 25.40  ? 212 PRO 2 CG  1 
ATOM 4233  C CD  . PRO B 1 212 ? 4.469   39.031  210.858 1.00 21.17  ? 212 PRO 2 CD  1 
ATOM 4234  N N   . SER B 1 213 ? 2.035   38.239  208.340 1.00 28.51  ? 213 SER 2 N   1 
ATOM 4235  C CA  . SER B 1 213 ? 0.865   37.782  207.619 1.00 41.10  ? 213 SER 2 CA  1 
ATOM 4236  C C   . SER B 1 213 ? 0.436   38.787  206.600 1.00 41.21  ? 213 SER 2 C   1 
ATOM 4237  O O   . SER B 1 213 ? -0.127  38.456  205.541 1.00 20.43  ? 213 SER 2 O   1 
ATOM 4238  C CB  . SER B 1 213 ? -0.278  37.555  208.576 1.00 39.38  ? 213 SER 2 CB  1 
ATOM 4239  O OG  . SER B 1 213 ? -0.730  38.788  209.053 1.00 41.55  ? 213 SER 2 OG  1 
ATOM 4240  N N   . LYS B 1 214 ? 0.801   40.025  206.885 1.00 40.94  ? 214 LYS 2 N   1 
ATOM 4241  C CA  . LYS B 1 214 ? 0.332   41.033  206.015 1.00 52.68  ? 214 LYS 2 CA  1 
ATOM 4242  C C   . LYS B 1 214 ? 1.150   42.012  205.246 1.00 52.99  ? 214 LYS 2 C   1 
ATOM 4243  O O   . LYS B 1 214 ? 0.643   42.516  204.263 1.00 90.25  ? 214 LYS 2 O   1 
ATOM 4244  C CB  . LYS B 1 214 ? -0.802  41.785  206.705 1.00 56.46  ? 214 LYS 2 CB  1 
ATOM 4245  C CG  . LYS B 1 214 ? -0.452  42.351  208.064 1.00 71.32  ? 214 LYS 2 CG  1 
ATOM 4246  C CD  . LYS B 1 214 ? -1.643  43.112  208.678 1.00 85.10  ? 214 LYS 2 CD  1 
ATOM 4247  C CE  . LYS B 1 214 ? -2.967  42.374  208.443 1.00 74.57  ? 214 LYS 2 CE  1 
ATOM 4248  N NZ  . LYS B 1 214 ? -3.930  43.201  207.661 1.00 86.45  ? 214 LYS 2 NZ  1 
ATOM 4249  N N   . ASN B 1 215 ? 2.355   42.367  205.631 1.00 32.14  ? 215 ASN 2 N   1 
ATOM 4250  C CA  . ASN B 1 215 ? 2.977   43.385  204.802 1.00 25.78  ? 215 ASN 2 CA  1 
ATOM 4251  C C   . ASN B 1 215 ? 3.200   42.915  203.390 1.00 32.44  ? 215 ASN 2 C   1 
ATOM 4252  O O   . ASN B 1 215 ? 4.287   42.523  203.000 1.00 43.09  ? 215 ASN 2 O   1 
ATOM 4253  C CB  . ASN B 1 215 ? 4.228   43.899  205.431 1.00 27.10  ? 215 ASN 2 CB  1 
ATOM 4254  C CG  . ASN B 1 215 ? 3.933   44.836  206.536 1.00 42.90  ? 215 ASN 2 CG  1 
ATOM 4255  O OD1 . ASN B 1 215 ? 3.704   46.037  206.311 1.00 54.40  ? 215 ASN 2 OD1 1 
ATOM 4256  N ND2 . ASN B 1 215 ? 3.889   44.305  207.749 1.00 39.32  ? 215 ASN 2 ND2 1 
ATOM 4257  N N   . GLU B 1 216 ? 2.180   43.067  202.576 1.00 32.61  ? 216 GLU 2 N   1 
ATOM 4258  C CA  . GLU B 1 216 ? 2.274   42.556  201.237 1.00 36.07  ? 216 GLU 2 CA  1 
ATOM 4259  C C   . GLU B 1 216 ? 2.908   43.554  200.230 1.00 32.39  ? 216 GLU 2 C   1 
ATOM 4260  O O   . GLU B 1 216 ? 3.320   43.151  199.139 1.00 29.25  ? 216 GLU 2 O   1 
ATOM 4261  C CB  . GLU B 1 216 ? 0.886   41.917  200.809 1.00 21.12  ? 216 GLU 2 CB  1 
ATOM 4262  C CG  . GLU B 1 216 ? 0.678   40.320  201.072 1.00 47.54  ? 216 GLU 2 CG  1 
ATOM 4263  C CD  . GLU B 1 216 ? 0.059   39.875  202.474 1.00 74.73  ? 216 GLU 2 CD  1 
ATOM 4264  O OE1 . GLU B 1 216 ? -0.949  40.500  202.909 1.00 86.68  ? 216 GLU 2 OE1 1 
ATOM 4265  O OE2 . GLU B 1 216 ? 0.519   38.858  203.097 1.00 45.68  ? 216 GLU 2 OE2 1 
ATOM 4266  N N   . ASN B 1 217 ? 3.090   44.825  200.619 1.00 37.33  ? 217 ASN 2 N   1 
ATOM 4267  C CA  . ASN B 1 217 ? 3.662   45.824  199.679 1.00 26.82  ? 217 ASN 2 CA  1 
ATOM 4268  C C   . ASN B 1 217 ? 4.843   46.597  200.231 1.00 30.48  ? 217 ASN 2 C   1 
ATOM 4269  O O   . ASN B 1 217 ? 5.139   47.714  199.816 1.00 30.04  ? 217 ASN 2 O   1 
ATOM 4270  C CB  . ASN B 1 217 ? 2.594   46.803  199.173 1.00 21.45  ? 217 ASN 2 CB  1 
ATOM 4271  C CG  . ASN B 1 217 ? 3.046   47.638  197.966 1.00 38.87  ? 217 ASN 2 CG  1 
ATOM 4272  O OD1 . ASN B 1 217 ? 3.800   47.189  197.062 1.00 42.20  ? 217 ASN 2 OD1 1 
ATOM 4273  N ND2 . ASN B 1 217 ? 2.537   48.856  197.921 1.00 39.25  ? 217 ASN 2 ND2 1 
ATOM 4274  N N   . THR B 1 218 ? 5.526   46.001  201.189 1.00 34.58  ? 218 THR 2 N   1 
ATOM 4275  C CA  . THR B 1 218 ? 6.699   46.632  201.738 1.00 27.39  ? 218 THR 2 CA  1 
ATOM 4276  C C   . THR B 1 218 ? 7.672   45.493  202.066 1.00 19.27  ? 218 THR 2 C   1 
ATOM 4277  O O   . THR B 1 218 ? 7.241   44.376  202.224 1.00 31.66  ? 218 THR 2 O   1 
ATOM 4278  C CB  . THR B 1 218 ? 6.340   47.492  202.956 1.00 15.53  ? 218 THR 2 CB  1 
ATOM 4279  O OG1 . THR B 1 218 ? 7.146   47.079  204.054 1.00 34.89  ? 218 THR 2 OG1 1 
ATOM 4280  C CG2 . THR B 1 218 ? 4.840   47.400  203.320 1.00 33.25  ? 218 THR 2 CG2 1 
ATOM 4281  N N   . ARG B 1 219 ? 8.976   45.720  202.005 1.00 14.57  ? 219 ARG 2 N   1 
ATOM 4282  C CA  . ARG B 1 219 ? 9.904   44.652  202.346 1.00 13.61  ? 219 ARG 2 CA  1 
ATOM 4283  C C   . ARG B 1 219 ? 10.555  45.111  203.603 1.00 19.49  ? 219 ARG 2 C   1 
ATOM 4284  O O   . ARG B 1 219 ? 10.743  46.329  203.809 1.00 17.99  ? 219 ARG 2 O   1 
ATOM 4285  C CB  . ARG B 1 219 ? 10.994  44.497  201.314 1.00 10.61  ? 219 ARG 2 CB  1 
ATOM 4286  C CG  . ARG B 1 219 ? 10.510  44.534  199.877 1.00 20.31  ? 219 ARG 2 CG  1 
ATOM 4287  C CD  . ARG B 1 219 ? 9.462   43.493  199.538 1.00 3.83   ? 219 ARG 2 CD  1 
ATOM 4288  N NE  . ARG B 1 219 ? 9.234   43.505  198.095 1.00 34.50  ? 219 ARG 2 NE  1 
ATOM 4289  C CZ  . ARG B 1 219 ? 8.031   43.432  197.525 1.00 51.37  ? 219 ARG 2 CZ  1 
ATOM 4290  N NH1 . ARG B 1 219 ? 6.956   43.294  198.302 1.00 57.29  ? 219 ARG 2 NH1 1 
ATOM 4291  N NH2 . ARG B 1 219 ? 7.884   43.682  196.212 1.00 40.65  ? 219 ARG 2 NH2 1 
ATOM 4292  N N   . TYR B 1 220 ? 10.901  44.150  204.444 1.00 4.27   ? 220 TYR 2 N   1 
ATOM 4293  C CA  . TYR B 1 220 ? 11.561  44.492  205.679 1.00 9.05   ? 220 TYR 2 CA  1 
ATOM 4294  C C   . TYR B 1 220 ? 12.568  43.474  206.087 1.00 16.52  ? 220 TYR 2 C   1 
ATOM 4295  O O   . TYR B 1 220 ? 12.517  42.250  205.789 1.00 12.11  ? 220 TYR 2 O   1 
ATOM 4296  C CB  . TYR B 1 220 ? 10.592  44.649  206.821 1.00 9.64   ? 220 TYR 2 CB  1 
ATOM 4297  C CG  . TYR B 1 220 ? 9.967   43.348  207.233 1.00 21.25  ? 220 TYR 2 CG  1 
ATOM 4298  C CD1 . TYR B 1 220 ? 10.552  42.539  208.199 1.00 39.81  ? 220 TYR 2 CD1 1 
ATOM 4299  C CD2 . TYR B 1 220 ? 8.767   42.937  206.683 1.00 20.62  ? 220 TYR 2 CD2 1 
ATOM 4300  C CE1 . TYR B 1 220 ? 9.936   41.346  208.604 1.00 40.67  ? 220 TYR 2 CE1 1 
ATOM 4301  C CE2 . TYR B 1 220 ? 8.142   41.765  207.085 1.00 19.60  ? 220 TYR 2 CE2 1 
ATOM 4302  C CZ  . TYR B 1 220 ? 8.725   40.976  208.041 1.00 30.59  ? 220 TYR 2 CZ  1 
ATOM 4303  O OH  . TYR B 1 220 ? 8.072   39.839  208.433 1.00 34.82  ? 220 TYR 2 OH  1 
ATOM 4304  N N   . PHE B 1 221 ? 13.444  43.981  206.912 1.00 13.11  ? 221 PHE 2 N   1 
ATOM 4305  C CA  . PHE B 1 221 ? 14.495  43.149  207.365 1.00 10.20  ? 221 PHE 2 CA  1 
ATOM 4306  C C   . PHE B 1 221 ? 14.928  43.644  208.699 1.00 20.59  ? 221 PHE 2 C   1 
ATOM 4307  O O   . PHE B 1 221 ? 14.954  44.868  208.966 1.00 29.00  ? 221 PHE 2 O   1 
ATOM 4308  C CB  . PHE B 1 221 ? 15.653  43.310  206.424 1.00 13.17  ? 221 PHE 2 CB  1 
ATOM 4309  C CG  . PHE B 1 221 ? 15.259  43.476  205.008 1.00 13.39  ? 221 PHE 2 CG  1 
ATOM 4310  C CD1 . PHE B 1 221 ? 14.769  44.675  204.561 1.00 12.52  ? 221 PHE 2 CD1 1 
ATOM 4311  C CD2 . PHE B 1 221 ? 15.406  42.433  204.115 1.00 11.69  ? 221 PHE 2 CD2 1 
ATOM 4312  C CE1 . PHE B 1 221 ? 14.436  44.823  203.234 1.00 40.42  ? 221 PHE 2 CE1 1 
ATOM 4313  C CE2 . PHE B 1 221 ? 15.078  42.581  202.783 1.00 10.62  ? 221 PHE 2 CE2 1 
ATOM 4314  C CZ  . PHE B 1 221 ? 14.595  43.770  202.339 1.00 16.27  ? 221 PHE 2 CZ  1 
ATOM 4315  N N   . GLY B 1 222 ? 15.329  42.694  209.520 1.00 9.86   ? 222 GLY 2 N   1 
ATOM 4316  C CA  . GLY B 1 222 ? 15.788  43.059  210.829 1.00 17.33  ? 222 GLY 2 CA  1 
ATOM 4317  C C   . GLY B 1 222 ? 16.352  41.838  211.500 1.00 27.93  ? 222 GLY 2 C   1 
ATOM 4318  O O   . GLY B 1 222 ? 16.080  40.676  211.071 1.00 22.79  ? 222 GLY 2 O   1 
ATOM 4319  N N   . THR B 1 223 ? 17.213  42.116  212.485 1.00 10.45  ? 223 THR 2 N   1 
ATOM 4320  C CA  . THR B 1 223 ? 17.805  41.073  213.277 1.00 20.00  ? 223 THR 2 CA  1 
ATOM 4321  C C   . THR B 1 223 ? 18.066  41.436  214.730 1.00 27.40  ? 223 THR 2 C   1 
ATOM 4322  O O   . THR B 1 223 ? 18.645  42.480  215.083 1.00 30.42  ? 223 THR 2 O   1 
ATOM 4323  C CB  . THR B 1 223 ? 19.048  40.458  212.643 1.00 8.09   ? 223 THR 2 CB  1 
ATOM 4324  O OG1 . THR B 1 223 ? 20.109  40.463  213.596 1.00 42.78  ? 223 THR 2 OG1 1 
ATOM 4325  C CG2 . THR B 1 223 ? 19.453  41.194  211.414 1.00 36.80  ? 223 THR 2 CG2 1 
ATOM 4326  N N   . TYR B 1 224 ? 17.549  40.556  215.563 1.00 28.22  ? 224 TYR 2 N   1 
ATOM 4327  C CA  . TYR B 1 224 ? 17.682  40.688  216.963 1.00 30.54  ? 224 TYR 2 CA  1 
ATOM 4328  C C   . TYR B 1 224 ? 18.861  39.839  217.268 1.00 29.54  ? 224 TYR 2 C   1 
ATOM 4329  O O   . TYR B 1 224 ? 18.964  38.700  216.820 1.00 28.23  ? 224 TYR 2 O   1 
ATOM 4330  C CB  . TYR B 1 224 ? 16.469  40.122  217.676 1.00 26.22  ? 224 TYR 2 CB  1 
ATOM 4331  C CG  . TYR B 1 224 ? 16.590  40.289  219.156 1.00 35.79  ? 224 TYR 2 CG  1 
ATOM 4332  C CD1 . TYR B 1 224 ? 16.578  41.548  219.726 1.00 47.22  ? 224 TYR 2 CD1 1 
ATOM 4333  C CD2 . TYR B 1 224 ? 16.736  39.194  219.989 1.00 36.64  ? 224 TYR 2 CD2 1 
ATOM 4334  C CE1 . TYR B 1 224 ? 16.713  41.715  221.101 1.00 60.42  ? 224 TYR 2 CE1 1 
ATOM 4335  C CE2 . TYR B 1 224 ? 16.876  39.345  221.364 1.00 46.61  ? 224 TYR 2 CE2 1 
ATOM 4336  C CZ  . TYR B 1 224 ? 16.861  40.606  221.922 1.00 59.69  ? 224 TYR 2 CZ  1 
ATOM 4337  O OH  . TYR B 1 224 ? 16.997  40.764  223.297 1.00 69.30  ? 224 TYR 2 OH  1 
ATOM 4338  N N   . THR B 1 225 ? 19.702  40.384  218.112 1.00 34.55  ? 225 THR 2 N   1 
ATOM 4339  C CA  . THR B 1 225 ? 20.906  39.729  218.556 1.00 39.71  ? 225 THR 2 CA  1 
ATOM 4340  C C   . THR B 1 225 ? 20.886  40.078  220.027 1.00 46.41  ? 225 THR 2 C   1 
ATOM 4341  O O   . THR B 1 225 ? 21.272  41.180  220.428 1.00 51.50  ? 225 THR 2 O   1 
ATOM 4342  C CB  . THR B 1 225 ? 22.079  40.402  217.916 1.00 43.40  ? 225 THR 2 CB  1 
ATOM 4343  O OG1 . THR B 1 225 ? 21.644  41.047  216.699 1.00 52.89  ? 225 THR 2 OG1 1 
ATOM 4344  C CG2 . THR B 1 225 ? 23.137  39.396  217.635 1.00 35.67  ? 225 THR 2 CG2 1 
ATOM 4345  N N   . GLY B 1 226 ? 20.324  39.177  220.818 1.00 56.15  ? 226 GLY 2 N   1 
ATOM 4346  C CA  . GLY B 1 226 ? 20.198  39.415  222.247 1.00 57.34  ? 226 GLY 2 CA  1 
ATOM 4347  C C   . GLY B 1 226 ? 21.285  38.880  223.157 1.00 51.91  ? 226 GLY 2 C   1 
ATOM 4348  O O   . GLY B 1 226 ? 21.712  37.735  223.021 1.00 53.24  ? 226 GLY 2 O   1 
ATOM 4349  N N   . GLY B 1 227 ? 21.705  39.707  224.110 1.00 42.25  ? 227 GLY 2 N   1 
ATOM 4350  C CA  . GLY B 1 227 ? 22.738  39.306  225.037 1.00 48.42  ? 227 GLY 2 CA  1 
ATOM 4351  C C   . GLY B 1 227 ? 23.170  40.446  225.928 1.00 51.43  ? 227 GLY 2 C   1 
ATOM 4352  O O   . GLY B 1 227 ? 23.204  41.609  225.533 1.00 52.70  ? 227 GLY 2 O   1 
ATOM 4353  N N   . GLU B 1 228 ? 23.561  40.073  227.132 1.00 58.39  ? 228 GLU 2 N   1 
ATOM 4354  C CA  . GLU B 1 228 ? 23.984  40.999  228.167 1.00 67.62  ? 228 GLU 2 CA  1 
ATOM 4355  C C   . GLU B 1 228 ? 25.147  41.856  227.682 1.00 64.31  ? 228 GLU 2 C   1 
ATOM 4356  O O   . GLU B 1 228 ? 25.311  43.018  228.078 1.00 64.22  ? 228 GLU 2 O   1 
ATOM 4357  C CB  . GLU B 1 228 ? 24.380  40.164  229.377 1.00 79.30  ? 228 GLU 2 CB  1 
ATOM 4358  C CG  . GLU B 1 228 ? 24.593  40.904  230.665 1.00 111.14 ? 228 GLU 2 CG  1 
ATOM 4359  C CD  . GLU B 1 228 ? 24.978  39.959  231.800 1.00 130.86 ? 228 GLU 2 CD  1 
ATOM 4360  O OE1 . GLU B 1 228 ? 24.877  38.716  231.620 1.00 134.90 ? 228 GLU 2 OE1 1 
ATOM 4361  O OE2 . GLU B 1 228 ? 25.379  40.458  232.877 1.00 148.23 ? 228 GLU 2 OE2 1 
ATOM 4362  N N   . ASN B 1 229 ? 25.949  41.275  226.802 1.00 61.95  ? 229 ASN 2 N   1 
ATOM 4363  C CA  . ASN B 1 229 ? 27.087  41.996  226.266 1.00 69.99  ? 229 ASN 2 CA  1 
ATOM 4364  C C   . ASN B 1 229 ? 27.541  41.498  224.903 1.00 68.63  ? 229 ASN 2 C   1 
ATOM 4365  O O   . ASN B 1 229 ? 28.703  41.145  224.668 1.00 61.70  ? 229 ASN 2 O   1 
ATOM 4366  C CB  . ASN B 1 229 ? 28.239  42.047  227.264 1.00 69.05  ? 229 ASN 2 CB  1 
ATOM 4367  C CG  . ASN B 1 229 ? 28.313  40.817  228.131 1.00 82.94  ? 229 ASN 2 CG  1 
ATOM 4368  O OD1 . ASN B 1 229 ? 28.827  40.887  229.249 1.00 93.72  ? 229 ASN 2 OD1 1 
ATOM 4369  N ND2 . ASN B 1 229 ? 27.806  39.676  227.629 1.00 82.90  ? 229 ASN 2 ND2 1 
ATOM 4370  N N   . VAL B 1 230 ? 26.587  41.457  223.994 1.00 58.75  ? 230 VAL 2 N   1 
ATOM 4371  C CA  . VAL B 1 230 ? 26.916  41.071  222.665 1.00 46.52  ? 230 VAL 2 CA  1 
ATOM 4372  C C   . VAL B 1 230 ? 27.530  42.316  222.044 1.00 52.27  ? 230 VAL 2 C   1 
ATOM 4373  O O   . VAL B 1 230 ? 27.060  43.452  222.222 1.00 61.38  ? 230 VAL 2 O   1 
ATOM 4374  C CB  . VAL B 1 230 ? 25.686  40.626  221.888 1.00 47.56  ? 230 VAL 2 CB  1 
ATOM 4375  C CG1 . VAL B 1 230 ? 25.012  39.533  222.632 1.00 54.65  ? 230 VAL 2 CG1 1 
ATOM 4376  C CG2 . VAL B 1 230 ? 24.722  41.772  221.675 1.00 68.71  ? 230 VAL 2 CG2 1 
ATOM 4377  N N   . PRO B 1 231 ? 28.646  42.129  221.375 1.00 44.85  ? 231 PRO 2 N   1 
ATOM 4378  C CA  . PRO B 1 231 ? 29.382  43.182  220.706 1.00 34.20  ? 231 PRO 2 CA  1 
ATOM 4379  C C   . PRO B 1 231 ? 28.663  43.495  219.415 1.00 37.37  ? 231 PRO 2 C   1 
ATOM 4380  O O   . PRO B 1 231 ? 28.147  42.623  218.689 1.00 33.53  ? 231 PRO 2 O   1 
ATOM 4381  C CB  . PRO B 1 231 ? 30.655  42.491  220.376 1.00 33.92  ? 231 PRO 2 CB  1 
ATOM 4382  C CG  . PRO B 1 231 ? 30.115  41.180  219.900 1.00 16.42  ? 231 PRO 2 CG  1 
ATOM 4383  C CD  . PRO B 1 231 ? 29.196  40.820  221.022 1.00 33.84  ? 231 PRO 2 CD  1 
ATOM 4384  N N   . PRO B 1 232 ? 28.517  44.758  219.157 1.00 35.76  ? 232 PRO 2 N   1 
ATOM 4385  C CA  . PRO B 1 232 ? 27.841  45.098  217.918 1.00 39.89  ? 232 PRO 2 CA  1 
ATOM 4386  C C   . PRO B 1 232 ? 28.865  44.983  216.805 1.00 36.40  ? 232 PRO 2 C   1 
ATOM 4387  O O   . PRO B 1 232 ? 30.078  45.130  217.011 1.00 33.57  ? 232 PRO 2 O   1 
ATOM 4388  C CB  . PRO B 1 232 ? 27.429  46.530  218.166 1.00 36.83  ? 232 PRO 2 CB  1 
ATOM 4389  C CG  . PRO B 1 232 ? 28.529  47.007  219.109 1.00 34.16  ? 232 PRO 2 CG  1 
ATOM 4390  C CD  . PRO B 1 232 ? 28.606  45.896  220.069 1.00 26.43  ? 232 PRO 2 CD  1 
ATOM 4391  N N   . VAL B 1 233 ? 28.380  44.674  215.624 1.00 30.74  ? 233 VAL 2 N   1 
ATOM 4392  C CA  . VAL B 1 233 ? 29.278  44.553  214.492 1.00 29.27  ? 233 VAL 2 CA  1 
ATOM 4393  C C   . VAL B 1 233 ? 28.524  45.166  213.380 1.00 26.79  ? 233 VAL 2 C   1 
ATOM 4394  O O   . VAL B 1 233 ? 27.429  44.709  213.050 1.00 32.50  ? 233 VAL 2 O   1 
ATOM 4395  C CB  . VAL B 1 233 ? 29.472  43.134  214.099 1.00 17.28  ? 233 VAL 2 CB  1 
ATOM 4396  C CG1 . VAL B 1 233 ? 30.892  42.892  213.901 1.00 37.93  ? 233 VAL 2 CG1 1 
ATOM 4397  C CG2 . VAL B 1 233 ? 28.899  42.222  215.168 1.00 50.90  ? 233 VAL 2 CG2 1 
ATOM 4398  N N   . LEU B 1 234 ? 29.085  46.188  212.772 1.00 21.87  ? 234 LEU 2 N   1 
ATOM 4399  C CA  . LEU B 1 234 ? 28.346  46.834  211.719 1.00 15.64  ? 234 LEU 2 CA  1 
ATOM 4400  C C   . LEU B 1 234 ? 29.329  47.168  210.664 1.00 26.79  ? 234 LEU 2 C   1 
ATOM 4401  O O   . LEU B 1 234 ? 30.509  47.416  210.986 1.00 14.55  ? 234 LEU 2 O   1 
ATOM 4402  C CB  . LEU B 1 234 ? 27.787  48.147  212.231 1.00 21.50  ? 234 LEU 2 CB  1 
ATOM 4403  C CG  . LEU B 1 234 ? 27.205  48.187  213.637 1.00 12.39  ? 234 LEU 2 CG  1 
ATOM 4404  C CD1 . LEU B 1 234 ? 27.002  49.604  214.007 1.00 34.26  ? 234 LEU 2 CD1 1 
ATOM 4405  C CD2 . LEU B 1 234 ? 25.902  47.437  213.734 1.00 39.28  ? 234 LEU 2 CD2 1 
ATOM 4406  N N   . HIS B 1 235 ? 28.852  47.156  209.415 1.00 20.10  ? 235 HIS 2 N   1 
ATOM 4407  C CA  . HIS B 1 235 ? 29.694  47.528  208.295 1.00 23.41  ? 235 HIS 2 CA  1 
ATOM 4408  C C   . HIS B 1 235 ? 29.095  48.713  207.654 1.00 30.20  ? 235 HIS 2 C   1 
ATOM 4409  O O   . HIS B 1 235 ? 27.881  48.881  207.609 1.00 52.13  ? 235 HIS 2 O   1 
ATOM 4410  C CB  . HIS B 1 235 ? 29.774  46.467  207.260 1.00 39.28  ? 235 HIS 2 CB  1 
ATOM 4411  C CG  . HIS B 1 235 ? 29.889  45.113  207.834 1.00 72.83  ? 235 HIS 2 CG  1 
ATOM 4412  N ND1 . HIS B 1 235 ? 28.798  44.418  208.319 1.00 95.46  ? 235 HIS 2 ND1 1 
ATOM 4413  C CD2 . HIS B 1 235 ? 30.959  44.301  208.017 1.00 85.03  ? 235 HIS 2 CD2 1 
ATOM 4414  C CE1 . HIS B 1 235 ? 29.193  43.243  208.764 1.00 101.58 ? 235 HIS 2 CE1 1 
ATOM 4415  N NE2 . HIS B 1 235 ? 30.499  43.145  208.595 1.00 79.72  ? 235 HIS 2 NE2 1 
ATOM 4416  N N   . ILE B 1 236 ? 29.961  49.427  206.991 1.00 30.69  ? 236 ILE 2 N   1 
ATOM 4417  C CA  . ILE B 1 236 ? 29.582  50.627  206.352 1.00 25.84  ? 236 ILE 2 CA  1 
ATOM 4418  C C   . ILE B 1 236 ? 30.274  50.396  205.003 1.00 28.02  ? 236 ILE 2 C   1 
ATOM 4419  O O   . ILE B 1 236 ? 31.434  49.920  204.976 1.00 28.18  ? 236 ILE 2 O   1 
ATOM 4420  C CB  . ILE B 1 236 ? 30.153  51.794  207.257 1.00 41.05  ? 236 ILE 2 CB  1 
ATOM 4421  C CG1 . ILE B 1 236 ? 29.487  53.141  206.940 1.00 77.72  ? 236 ILE 2 CG1 1 
ATOM 4422  C CG2 . ILE B 1 236 ? 31.695  51.866  207.194 1.00 8.44   ? 236 ILE 2 CG2 1 
ATOM 4423  C CD1 . ILE B 1 236 ? 29.271  54.109  208.167 1.00 93.22  ? 236 ILE 2 CD1 1 
ATOM 4424  N N   . THR B 1 237 ? 29.482  50.476  203.927 1.00 15.10  ? 237 THR 2 N   1 
ATOM 4425  C CA  . THR B 1 237 ? 29.949  50.331  202.528 1.00 13.61  ? 237 THR 2 CA  1 
ATOM 4426  C C   . THR B 1 237 ? 28.996  50.835  201.511 1.00 20.19  ? 237 THR 2 C   1 
ATOM 4427  O O   . THR B 1 237 ? 27.840  50.432  201.445 1.00 40.84  ? 237 THR 2 O   1 
ATOM 4428  C CB  . THR B 1 237 ? 30.103  48.948  202.080 1.00 4.08   ? 237 THR 2 CB  1 
ATOM 4429  O OG1 . THR B 1 237 ? 31.027  48.298  202.962 1.00 71.12  ? 237 THR 2 OG1 1 
ATOM 4430  C CG2 . THR B 1 237 ? 30.636  48.934  200.669 1.00 2.00   ? 237 THR 2 CG2 1 
ATOM 4431  N N   . ASN B 1 238 ? 29.528  51.551  200.561 1.00 21.25  ? 238 ASN 2 N   1 
ATOM 4432  C CA  . ASN B 1 238 ? 28.643  52.068  199.560 1.00 28.99  ? 238 ASN 2 CA  1 
ATOM 4433  C C   . ASN B 1 238 ? 28.641  51.150  198.340 1.00 24.05  ? 238 ASN 2 C   1 
ATOM 4434  O O   . ASN B 1 238 ? 28.331  51.580  197.242 1.00 21.15  ? 238 ASN 2 O   1 
ATOM 4435  C CB  . ASN B 1 238 ? 29.118  53.452  199.174 1.00 37.20  ? 238 ASN 2 CB  1 
ATOM 4436  C CG  . ASN B 1 238 ? 30.491  53.424  198.569 1.00 39.31  ? 238 ASN 2 CG  1 
ATOM 4437  O OD1 . ASN B 1 238 ? 31.380  52.655  198.995 1.00 48.39  ? 238 ASN 2 OD1 1 
ATOM 4438  N ND2 . ASN B 1 238 ? 30.682  54.244  197.570 1.00 29.10  ? 238 ASN 2 ND2 1 
ATOM 4439  N N   . THR B 1 239 ? 28.922  49.871  198.507 1.00 22.98  ? 239 THR 2 N   1 
ATOM 4440  C CA  . THR B 1 239 ? 28.958  49.012  197.332 1.00 15.90  ? 239 THR 2 CA  1 
ATOM 4441  C C   . THR B 1 239 ? 27.808  48.044  197.278 1.00 23.90  ? 239 THR 2 C   1 
ATOM 4442  O O   . THR B 1 239 ? 27.591  47.356  196.277 1.00 48.59  ? 239 THR 2 O   1 
ATOM 4443  C CB  . THR B 1 239 ? 30.195  48.168  197.322 1.00 16.41  ? 239 THR 2 CB  1 
ATOM 4444  O OG1 . THR B 1 239 ? 30.177  47.316  198.467 1.00 44.26  ? 239 THR 2 OG1 1 
ATOM 4445  C CG2 . THR B 1 239 ? 31.399  49.016  197.385 1.00 28.54  ? 239 THR 2 CG2 1 
ATOM 4446  N N   . ALA B 1 240 ? 27.019  48.017  198.332 1.00 27.61  ? 240 ALA 2 N   1 
ATOM 4447  C CA  . ALA B 1 240 ? 25.946  47.054  198.378 1.00 15.49  ? 240 ALA 2 CA  1 
ATOM 4448  C C   . ALA B 1 240 ? 24.550  47.547  198.141 1.00 28.72  ? 240 ALA 2 C   1 
ATOM 4449  O O   . ALA B 1 240 ? 24.092  48.522  198.765 1.00 42.29  ? 240 ALA 2 O   1 
ATOM 4450  C CB  . ALA B 1 240 ? 25.999  46.362  199.642 1.00 35.14  ? 240 ALA 2 CB  1 
ATOM 4451  N N   . THR B 1 241 ? 23.841  46.759  197.339 1.00 22.54  ? 241 THR 2 N   1 
ATOM 4452  C CA  . THR B 1 241 ? 22.469  47.046  196.964 1.00 29.04  ? 241 THR 2 CA  1 
ATOM 4453  C C   . THR B 1 241 ? 21.501  45.929  197.360 1.00 19.99  ? 241 THR 2 C   1 
ATOM 4454  O O   . THR B 1 241 ? 21.876  44.771  197.449 1.00 50.32  ? 241 THR 2 O   1 
ATOM 4455  C CB  . THR B 1 241 ? 22.371  47.242  195.462 1.00 8.30   ? 241 THR 2 CB  1 
ATOM 4456  O OG1 . THR B 1 241 ? 23.335  48.211  195.033 1.00 51.02  ? 241 THR 2 OG1 1 
ATOM 4457  C CG2 . THR B 1 241 ? 21.016  47.717  195.102 1.00 28.07  ? 241 THR 2 CG2 1 
ATOM 4458  N N   . THR B 1 242 ? 20.254  46.289  197.601 1.00 25.13  ? 242 THR 2 N   1 
ATOM 4459  C CA  . THR B 1 242 ? 19.255  45.327  197.966 1.00 17.72  ? 242 THR 2 CA  1 
ATOM 4460  C C   . THR B 1 242 ? 18.107  45.447  197.004 1.00 28.63  ? 242 THR 2 C   1 
ATOM 4461  O O   . THR B 1 242 ? 17.608  46.559  196.680 1.00 35.13  ? 242 THR 2 O   1 
ATOM 4462  C CB  . THR B 1 242 ? 18.710  45.603  199.337 1.00 11.22  ? 242 THR 2 CB  1 
ATOM 4463  O OG1 . THR B 1 242 ? 19.657  45.189  200.327 1.00 38.20  ? 242 THR 2 OG1 1 
ATOM 4464  C CG2 . THR B 1 242 ? 17.415  44.859  199.520 1.00 24.72  ? 242 THR 2 CG2 1 
ATOM 4465  N N   . VAL B 1 243 ? 17.624  44.289  196.610 1.00 7.42   ? 243 VAL 2 N   1 
ATOM 4466  C CA  . VAL B 1 243 ? 16.519  44.310  195.707 1.00 23.49  ? 243 VAL 2 CA  1 
ATOM 4467  C C   . VAL B 1 243 ? 15.182  44.168  196.393 1.00 24.84  ? 243 VAL 2 C   1 
ATOM 4468  O O   . VAL B 1 243 ? 14.989  43.286  197.240 1.00 32.54  ? 243 VAL 2 O   1 
ATOM 4469  C CB  . VAL B 1 243 ? 16.656  43.274  194.695 1.00 18.01  ? 243 VAL 2 CB  1 
ATOM 4470  C CG1 . VAL B 1 243 ? 15.494  43.404  193.742 1.00 19.10  ? 243 VAL 2 CG1 1 
ATOM 4471  C CG2 . VAL B 1 243 ? 17.979  43.439  194.020 1.00 2.00   ? 243 VAL 2 CG2 1 
ATOM 4472  N N   . LEU B 1 244 ? 14.225  44.956  195.936 1.00 8.94   ? 244 LEU 2 N   1 
ATOM 4473  C CA  . LEU B 1 244 ? 12.937  44.952  196.578 1.00 18.91  ? 244 LEU 2 CA  1 
ATOM 4474  C C   . LEU B 1 244 ? 11.971  44.273  195.701 1.00 26.48  ? 244 LEU 2 C   1 
ATOM 4475  O O   . LEU B 1 244 ? 10.772  44.230  195.988 1.00 39.07  ? 244 LEU 2 O   1 
ATOM 4476  C CB  . LEU B 1 244 ? 12.508  46.397  196.813 1.00 14.91  ? 244 LEU 2 CB  1 
ATOM 4477  C CG  . LEU B 1 244 ? 13.667  47.057  197.551 1.00 6.63   ? 244 LEU 2 CG  1 
ATOM 4478  C CD1 . LEU B 1 244 ? 13.530  48.534  197.673 1.00 18.08  ? 244 LEU 2 CD1 1 
ATOM 4479  C CD2 . LEU B 1 244 ? 13.691  46.405  198.879 1.00 2.10   ? 244 LEU 2 CD2 1 
ATOM 4480  N N   . LEU B 1 245 ? 12.466  43.764  194.593 1.00 15.20  ? 245 LEU 2 N   1 
ATOM 4481  C CA  . LEU B 1 245 ? 11.536  43.131  193.694 1.00 23.66  ? 245 LEU 2 CA  1 
ATOM 4482  C C   . LEU B 1 245 ? 10.925  41.928  194.321 1.00 27.58  ? 245 LEU 2 C   1 
ATOM 4483  O O   . LEU B 1 245 ? 11.576  41.253  195.115 1.00 25.95  ? 245 LEU 2 O   1 
ATOM 4484  C CB  . LEU B 1 245 ? 12.195  42.787  192.388 1.00 15.08  ? 245 LEU 2 CB  1 
ATOM 4485  C CG  . LEU B 1 245 ? 12.492  44.059  191.618 1.00 17.26  ? 245 LEU 2 CG  1 
ATOM 4486  C CD1 . LEU B 1 245 ? 12.782  43.721  190.184 1.00 42.20  ? 245 LEU 2 CD1 1 
ATOM 4487  C CD2 . LEU B 1 245 ? 11.266  44.938  191.671 1.00 51.18  ? 245 LEU 2 CD2 1 
ATOM 4488  N N   . ASP B 1 246 ? 9.620   41.775  194.103 1.00 48.96  ? 246 ASP 2 N   1 
ATOM 4489  C CA  . ASP B 1 246 ? 8.896   40.628  194.644 1.00 33.27  ? 246 ASP 2 CA  1 
ATOM 4490  C C   . ASP B 1 246 ? 9.142   39.524  193.688 1.00 22.15  ? 246 ASP 2 C   1 
ATOM 4491  O O   . ASP B 1 246 ? 9.842   39.679  192.696 1.00 20.81  ? 246 ASP 2 O   1 
ATOM 4492  C CB  . ASP B 1 246 ? 7.367   40.849  194.824 1.00 27.67  ? 246 ASP 2 CB  1 
ATOM 4493  C CG  . ASP B 1 246 ? 6.607   41.059  193.518 1.00 44.16  ? 246 ASP 2 CG  1 
ATOM 4494  O OD1 . ASP B 1 246 ? 7.198   41.164  192.412 1.00 37.12  ? 246 ASP 2 OD1 1 
ATOM 4495  O OD2 . ASP B 1 246 ? 5.370   41.155  193.631 1.00 69.00  ? 246 ASP 2 OD2 1 
ATOM 4496  N N   . GLU B 1 247 ? 8.471   38.431  193.949 1.00 39.34  ? 247 GLU 2 N   1 
ATOM 4497  C CA  . GLU B 1 247 ? 8.595   37.236  193.151 1.00 43.05  ? 247 GLU 2 CA  1 
ATOM 4498  C C   . GLU B 1 247 ? 8.259   37.507  191.665 1.00 35.97  ? 247 GLU 2 C   1 
ATOM 4499  O O   . GLU B 1 247 ? 8.748   36.805  190.816 1.00 27.54  ? 247 GLU 2 O   1 
ATOM 4500  C CB  . GLU B 1 247 ? 7.716   36.120  193.791 1.00 54.19  ? 247 GLU 2 CB  1 
ATOM 4501  C CG  . GLU B 1 247 ? 8.090   35.641  195.296 1.00 77.21  ? 247 GLU 2 CG  1 
ATOM 4502  C CD  . GLU B 1 247 ? 7.519   36.470  196.517 1.00 88.65  ? 247 GLU 2 CD  1 
ATOM 4503  O OE1 . GLU B 1 247 ? 6.278   36.645  196.644 1.00 86.55  ? 247 GLU 2 OE1 1 
ATOM 4504  O OE2 . GLU B 1 247 ? 8.321   36.875  197.413 1.00 97.30  ? 247 GLU 2 OE2 1 
ATOM 4505  N N   . GLN B 1 248 ? 7.522   38.577  191.350 1.00 35.47  ? 248 GLN 2 N   1 
ATOM 4506  C CA  . GLN B 1 248 ? 7.131   38.884  189.967 1.00 27.98  ? 248 GLN 2 CA  1 
ATOM 4507  C C   . GLN B 1 248 ? 7.967   39.970  189.337 1.00 35.67  ? 248 GLN 2 C   1 
ATOM 4508  O O   . GLN B 1 248 ? 7.697   40.440  188.213 1.00 46.58  ? 248 GLN 2 O   1 
ATOM 4509  C CB  . GLN B 1 248 ? 5.703   39.378  189.947 1.00 52.70  ? 248 GLN 2 CB  1 
ATOM 4510  C CG  . GLN B 1 248 ? 4.773   38.645  190.862 1.00 64.78  ? 248 GLN 2 CG  1 
ATOM 4511  C CD  . GLN B 1 248 ? 4.635   37.199  190.484 1.00 66.46  ? 248 GLN 2 CD  1 
ATOM 4512  O OE1 . GLN B 1 248 ? 4.791   36.814  189.297 1.00 54.67  ? 248 GLN 2 OE1 1 
ATOM 4513  N NE2 . GLN B 1 248 ? 4.326   36.369  191.490 1.00 47.17  ? 248 GLN 2 NE2 1 
ATOM 4514  N N   . GLY B 1 249 ? 8.904   40.473  190.114 1.00 29.39  ? 249 GLY 2 N   1 
ATOM 4515  C CA  . GLY B 1 249 ? 9.757   41.505  189.599 1.00 23.17  ? 249 GLY 2 CA  1 
ATOM 4516  C C   . GLY B 1 249 ? 9.047   42.811  189.713 1.00 29.44  ? 249 GLY 2 C   1 
ATOM 4517  O O   . GLY B 1 249 ? 9.034   43.596  188.743 1.00 36.91  ? 249 GLY 2 O   1 
ATOM 4518  N N   . VAL B 1 250 ? 8.384   43.004  190.852 1.00 5.73   ? 250 VAL 2 N   1 
ATOM 4519  C CA  . VAL B 1 250 ? 7.692   44.250  191.074 1.00 17.74  ? 250 VAL 2 CA  1 
ATOM 4520  C C   . VAL B 1 250 ? 8.011   44.567  192.500 1.00 23.10  ? 250 VAL 2 C   1 
ATOM 4521  O O   . VAL B 1 250 ? 7.943   43.714  193.352 1.00 12.53  ? 250 VAL 2 O   1 
ATOM 4522  C CB  . VAL B 1 250 ? 6.181   44.179  190.787 1.00 7.66   ? 250 VAL 2 CB  1 
ATOM 4523  C CG1 . VAL B 1 250 ? 5.897   42.949  190.022 1.00 2.01   ? 250 VAL 2 CG1 1 
ATOM 4524  C CG2 . VAL B 1 250 ? 5.349   44.268  192.069 1.00 23.95  ? 250 VAL 2 CG2 1 
ATOM 4525  N N   . GLY B 1 251 ? 8.528   45.756  192.737 1.00 25.38  ? 251 GLY 2 N   1 
ATOM 4526  C CA  . GLY B 1 251 ? 8.872   46.097  194.083 1.00 8.14   ? 251 GLY 2 CA  1 
ATOM 4527  C C   . GLY B 1 251 ? 7.654   46.776  194.573 1.00 12.59  ? 251 GLY 2 C   1 
ATOM 4528  O O   . GLY B 1 251 ? 6.584   46.789  193.937 1.00 19.85  ? 251 GLY 2 O   1 
ATOM 4529  N N   . PRO B 1 252 ? 7.787   47.350  195.743 1.00 2.25   ? 252 PRO 2 N   1 
ATOM 4530  C CA  . PRO B 1 252 ? 6.667   48.053  196.333 1.00 10.56  ? 252 PRO 2 CA  1 
ATOM 4531  C C   . PRO B 1 252 ? 6.126   49.092  195.360 1.00 23.86  ? 252 PRO 2 C   1 
ATOM 4532  O O   . PRO B 1 252 ? 6.906   49.835  194.723 1.00 20.85  ? 252 PRO 2 O   1 
ATOM 4533  C CB  . PRO B 1 252 ? 7.312   48.722  197.522 1.00 5.55   ? 252 PRO 2 CB  1 
ATOM 4534  C CG  . PRO B 1 252 ? 8.360   47.773  197.885 1.00 4.00   ? 252 PRO 2 CG  1 
ATOM 4535  C CD  . PRO B 1 252 ? 8.975   47.429  196.589 1.00 2.00   ? 252 PRO 2 CD  1 
ATOM 4536  N N   . LEU B 1 253 ? 4.811   49.064  195.162 1.00 22.40  ? 253 LEU 2 N   1 
ATOM 4537  C CA  . LEU B 1 253 ? 4.155   50.066  194.321 1.00 24.02  ? 253 LEU 2 CA  1 
ATOM 4538  C C   . LEU B 1 253 ? 3.729   51.131  195.280 1.00 26.63  ? 253 LEU 2 C   1 
ATOM 4539  O O   . LEU B 1 253 ? 3.261   50.801  196.355 1.00 22.49  ? 253 LEU 2 O   1 
ATOM 4540  C CB  . LEU B 1 253 ? 2.901   49.502  193.716 1.00 19.18  ? 253 LEU 2 CB  1 
ATOM 4541  C CG  . LEU B 1 253 ? 3.280   48.306  192.878 1.00 23.62  ? 253 LEU 2 CG  1 
ATOM 4542  C CD1 . LEU B 1 253 ? 2.081   47.744  192.222 1.00 30.36  ? 253 LEU 2 CD1 1 
ATOM 4543  C CD2 . LEU B 1 253 ? 4.252   48.762  191.849 1.00 30.15  ? 253 LEU 2 CD2 1 
ATOM 4544  N N   . CYS B 1 254 ? 3.894   52.400  194.950 1.00 33.40  ? 254 CYS 2 N   1 
ATOM 4545  C CA  . CYS B 1 254 ? 3.455   53.423  195.897 1.00 37.51  ? 254 CYS 2 CA  1 
ATOM 4546  C C   . CYS B 1 254 ? 2.041   53.864  195.592 1.00 43.61  ? 254 CYS 2 C   1 
ATOM 4547  O O   . CYS B 1 254 ? 1.834   54.820  194.847 1.00 43.33  ? 254 CYS 2 O   1 
ATOM 4548  C CB  . CYS B 1 254 ? 4.377   54.601  195.826 1.00 33.22  ? 254 CYS 2 CB  1 
ATOM 4549  S SG  . CYS B 1 254 ? 6.071   54.095  195.869 1.00 33.04  ? 254 CYS 2 SG  1 
ATOM 4550  N N   . LYS B 1 255 ? 1.095   53.076  196.094 1.00 50.30  ? 255 LYS 2 N   1 
ATOM 4551  C CA  . LYS B 1 255 ? -0.346  53.283  195.945 1.00 46.91  ? 255 LYS 2 CA  1 
ATOM 4552  C C   . LYS B 1 255 ? -0.698  54.761  195.994 1.00 51.46  ? 255 LYS 2 C   1 
ATOM 4553  O O   . LYS B 1 255 ? -1.240  55.292  195.027 1.00 49.72  ? 255 LYS 2 O   1 
ATOM 4554  C CB  . LYS B 1 255 ? -1.072  52.601  197.100 1.00 49.32  ? 255 LYS 2 CB  1 
ATOM 4555  C CG  . LYS B 1 255 ? -1.656  51.243  196.825 1.00 31.15  ? 255 LYS 2 CG  1 
ATOM 4556  C CD  . LYS B 1 255 ? -1.932  50.527  198.179 1.00 34.24  ? 255 LYS 2 CD  1 
ATOM 4557  C CE  . LYS B 1 255 ? -3.362  50.668  198.700 1.00 47.84  ? 255 LYS 2 CE  1 
ATOM 4558  N NZ  . LYS B 1 255 ? -3.512  50.302  200.151 1.00 62.38  ? 255 LYS 2 NZ  1 
ATOM 4559  N N   . ALA B 1 256 ? -0.569  55.360  197.185 1.00 47.91  ? 256 ALA 2 N   1 
ATOM 4560  C CA  . ALA B 1 256 ? -0.818  56.797  197.347 1.00 44.58  ? 256 ALA 2 CA  1 
ATOM 4561  C C   . ALA B 1 256 ? 0.547   57.206  196.988 1.00 51.44  ? 256 ALA 2 C   1 
ATOM 4562  O O   . ALA B 1 256 ? 1.496   56.567  197.453 1.00 64.56  ? 256 ALA 2 O   1 
ATOM 4563  C CB  . ALA B 1 256 ? -1.065  57.169  198.767 1.00 46.60  ? 256 ALA 2 CB  1 
ATOM 4564  N N   . ASP B 1 257 ? 0.665   58.220  196.155 1.00 35.20  ? 257 ASP 2 N   1 
ATOM 4565  C CA  . ASP B 1 257 ? 1.962   58.646  195.703 1.00 41.09  ? 257 ASP 2 CA  1 
ATOM 4566  C C   . ASP B 1 257 ? 2.880   59.057  196.863 1.00 44.86  ? 257 ASP 2 C   1 
ATOM 4567  O O   . ASP B 1 257 ? 3.312   60.209  197.001 1.00 57.28  ? 257 ASP 2 O   1 
ATOM 4568  C CB  . ASP B 1 257 ? 1.748   59.716  194.650 1.00 56.34  ? 257 ASP 2 CB  1 
ATOM 4569  C CG  . ASP B 1 257 ? 0.977   59.186  193.445 1.00 61.43  ? 257 ASP 2 CG  1 
ATOM 4570  O OD1 . ASP B 1 257 ? 0.951   57.953  193.234 1.00 78.63  ? 257 ASP 2 OD1 1 
ATOM 4571  O OD2 . ASP B 1 257 ? 0.412   60.002  192.691 1.00 71.36  ? 257 ASP 2 OD2 1 
ATOM 4572  N N   . SER B 1 258 ? 3.282   58.043  197.613 1.00 34.87  ? 258 SER 2 N   1 
ATOM 4573  C CA  . SER B 1 258 ? 4.077   58.195  198.804 1.00 44.36  ? 258 SER 2 CA  1 
ATOM 4574  C C   . SER B 1 258 ? 4.989   56.981  199.010 1.00 38.16  ? 258 SER 2 C   1 
ATOM 4575  O O   . SER B 1 258 ? 4.646   55.856  198.656 1.00 45.73  ? 258 SER 2 O   1 
ATOM 4576  C CB  . SER B 1 258 ? 3.131   58.393  199.991 1.00 48.53  ? 258 SER 2 CB  1 
ATOM 4577  O OG  . SER B 1 258 ? 2.310   59.555  199.810 1.00 70.61  ? 258 SER 2 OG  1 
ATOM 4578  N N   . LEU B 1 259 ? 6.161   57.235  199.575 1.00 34.47  ? 259 LEU 2 N   1 
ATOM 4579  C CA  . LEU B 1 259 ? 7.163   56.219  199.806 1.00 21.88  ? 259 LEU 2 CA  1 
ATOM 4580  C C   . LEU B 1 259 ? 7.402   56.093  201.280 1.00 26.44  ? 259 LEU 2 C   1 
ATOM 4581  O O   . LEU B 1 259 ? 7.824   57.062  201.917 1.00 35.52  ? 259 LEU 2 O   1 
ATOM 4582  C CB  . LEU B 1 259 ? 8.465   56.653  199.176 1.00 30.20  ? 259 LEU 2 CB  1 
ATOM 4583  C CG  . LEU B 1 259 ? 9.386   55.459  199.204 1.00 24.60  ? 259 LEU 2 CG  1 
ATOM 4584  C CD1 . LEU B 1 259 ? 8.647   54.388  198.437 1.00 16.28  ? 259 LEU 2 CD1 1 
ATOM 4585  C CD2 . LEU B 1 259 ? 10.734  55.796  198.590 1.00 16.47  ? 259 LEU 2 CD2 1 
ATOM 4586  N N   . TYR B 1 260 ? 7.236   54.888  201.805 1.00 13.64  ? 260 TYR 2 N   1 
ATOM 4587  C CA  . TYR B 1 260 ? 7.393   54.681  203.224 1.00 10.65  ? 260 TYR 2 CA  1 
ATOM 4588  C C   . TYR B 1 260 ? 8.692   53.996  203.642 1.00 29.27  ? 260 TYR 2 C   1 
ATOM 4589  O O   . TYR B 1 260 ? 9.027   52.878  203.236 1.00 43.35  ? 260 TYR 2 O   1 
ATOM 4590  C CB  . TYR B 1 260 ? 6.184   53.942  203.733 1.00 30.97  ? 260 TYR 2 CB  1 
ATOM 4591  C CG  . TYR B 1 260 ? 4.866   54.657  203.453 1.00 34.06  ? 260 TYR 2 CG  1 
ATOM 4592  C CD1 . TYR B 1 260 ? 4.177   54.487  202.247 1.00 35.89  ? 260 TYR 2 CD1 1 
ATOM 4593  C CD2 . TYR B 1 260 ? 4.285   55.464  204.420 1.00 35.27  ? 260 TYR 2 CD2 1 
ATOM 4594  C CE1 . TYR B 1 260 ? 2.946   55.110  202.030 1.00 41.42  ? 260 TYR 2 CE1 1 
ATOM 4595  C CE2 . TYR B 1 260 ? 3.065   56.081  204.217 1.00 35.20  ? 260 TYR 2 CE2 1 
ATOM 4596  C CZ  . TYR B 1 260 ? 2.402   55.910  203.030 1.00 42.88  ? 260 TYR 2 CZ  1 
ATOM 4597  O OH  . TYR B 1 260 ? 1.218   56.592  202.861 1.00 49.33  ? 260 TYR 2 OH  1 
ATOM 4598  N N   . VAL B 1 261 ? 9.406   54.682  204.503 1.00 22.89  ? 261 VAL 2 N   1 
ATOM 4599  C CA  . VAL B 1 261 ? 10.671  54.224  204.970 1.00 19.06  ? 261 VAL 2 CA  1 
ATOM 4600  C C   . VAL B 1 261 ? 10.538  54.139  206.462 1.00 32.31  ? 261 VAL 2 C   1 
ATOM 4601  O O   . VAL B 1 261 ? 10.031  55.057  207.107 1.00 40.83  ? 261 VAL 2 O   1 
ATOM 4602  C CB  . VAL B 1 261 ? 11.727  55.237  204.560 1.00 11.45  ? 261 VAL 2 CB  1 
ATOM 4603  C CG1 . VAL B 1 261 ? 12.713  55.477  205.666 1.00 38.39  ? 261 VAL 2 CG1 1 
ATOM 4604  C CG2 . VAL B 1 261 ? 12.436  54.731  203.360 1.00 27.69  ? 261 VAL 2 CG2 1 
ATOM 4605  N N   . SER B 1 262 ? 11.069  53.069  207.017 1.00 30.23  ? 262 SER 2 N   1 
ATOM 4606  C CA  . SER B 1 262 ? 10.941  52.827  208.436 1.00 25.00  ? 262 SER 2 CA  1 
ATOM 4607  C C   . SER B 1 262 ? 12.195  52.106  208.843 1.00 29.66  ? 262 SER 2 C   1 
ATOM 4608  O O   . SER B 1 262 ? 12.735  51.300  208.079 1.00 41.46  ? 262 SER 2 O   1 
ATOM 4609  C CB  . SER B 1 262 ? 9.731   51.932  208.613 1.00 24.14  ? 262 SER 2 CB  1 
ATOM 4610  O OG  . SER B 1 262 ? 9.066   51.788  207.337 1.00 48.73  ? 262 SER 2 OG  1 
ATOM 4611  N N   . ALA B 1 263 ? 12.638  52.339  210.065 1.00 26.32  ? 263 ALA 2 N   1 
ATOM 4612  C CA  . ALA B 1 263 ? 13.870  51.734  210.500 1.00 22.65  ? 263 ALA 2 CA  1 
ATOM 4613  C C   . ALA B 1 263 ? 14.028  51.788  211.996 1.00 24.55  ? 263 ALA 2 C   1 
ATOM 4614  O O   . ALA B 1 263 ? 13.320  52.537  212.643 1.00 27.51  ? 263 ALA 2 O   1 
ATOM 4615  C CB  . ALA B 1 263 ? 14.992  52.472  209.863 1.00 35.73  ? 263 ALA 2 CB  1 
ATOM 4616  N N   . VAL B 1 264 ? 14.984  51.024  212.528 1.00 22.42  ? 264 VAL 2 N   1 
ATOM 4617  C CA  . VAL B 1 264 ? 15.274  50.966  213.950 1.00 15.39  ? 264 VAL 2 CA  1 
ATOM 4618  C C   . VAL B 1 264 ? 16.698  50.466  214.125 1.00 20.38  ? 264 VAL 2 C   1 
ATOM 4619  O O   . VAL B 1 264 ? 17.057  49.433  213.566 1.00 14.15  ? 264 VAL 2 O   1 
ATOM 4620  C CB  . VAL B 1 264 ? 14.438  49.925  214.633 1.00 19.02  ? 264 VAL 2 CB  1 
ATOM 4621  C CG1 . VAL B 1 264 ? 14.613  50.051  216.119 1.00 2.00   ? 264 VAL 2 CG1 1 
ATOM 4622  C CG2 . VAL B 1 264 ? 13.006  50.034  214.232 1.00 20.96  ? 264 VAL 2 CG2 1 
ATOM 4623  N N   . ASP B 1 265 ? 17.463  51.105  214.999 1.00 21.68  ? 265 ASP 2 N   1 
ATOM 4624  C CA  . ASP B 1 265 ? 18.842  50.694  215.206 1.00 8.60   ? 265 ASP 2 CA  1 
ATOM 4625  C C   . ASP B 1 265 ? 19.361  50.839  216.606 1.00 26.12  ? 265 ASP 2 C   1 
ATOM 4626  O O   . ASP B 1 265 ? 20.137  51.768  216.899 1.00 30.44  ? 265 ASP 2 O   1 
ATOM 4627  C CB  . ASP B 1 265 ? 19.736  51.524  214.329 1.00 11.96  ? 265 ASP 2 CB  1 
ATOM 4628  C CG  . ASP B 1 265 ? 19.411  51.346  212.901 1.00 34.85  ? 265 ASP 2 CG  1 
ATOM 4629  O OD1 . ASP B 1 265 ? 19.824  50.278  212.376 1.00 13.96  ? 265 ASP 2 OD1 1 
ATOM 4630  O OD2 . ASP B 1 265 ? 18.685  52.223  212.345 1.00 46.02  ? 265 ASP 2 OD2 1 
ATOM 4631  N N   . ILE B 1 266 ? 18.955  49.934  217.481 1.00 21.26  ? 266 ILE 2 N   1 
ATOM 4632  C CA  . ILE B 1 266 ? 19.455  50.010  218.828 1.00 22.03  ? 266 ILE 2 CA  1 
ATOM 4633  C C   . ILE B 1 266 ? 20.765  49.333  218.658 1.00 25.28  ? 266 ILE 2 C   1 
ATOM 4634  O O   . ILE B 1 266 ? 20.791  48.116  218.389 1.00 22.58  ? 266 ILE 2 O   1 
ATOM 4635  C CB  . ILE B 1 266 ? 18.704  49.116  219.813 1.00 39.89  ? 266 ILE 2 CB  1 
ATOM 4636  C CG1 . ILE B 1 266 ? 17.241  49.531  219.968 1.00 27.27  ? 266 ILE 2 CG1 1 
ATOM 4637  C CG2 . ILE B 1 266 ? 19.432  49.139  221.149 1.00 45.70  ? 266 ILE 2 CG2 1 
ATOM 4638  C CD1 . ILE B 1 266 ? 16.374  49.104  218.844 1.00 45.97  ? 266 ILE 2 CD1 1 
ATOM 4639  N N   . CYS B 1 267 ? 21.842  50.097  218.738 1.00 19.33  ? 267 CYS 2 N   1 
ATOM 4640  C CA  . CYS B 1 267 ? 23.161  49.512  218.589 1.00 25.12  ? 267 CYS 2 CA  1 
ATOM 4641  C C   . CYS B 1 267 ? 23.549  48.696  219.800 1.00 37.96  ? 267 CYS 2 C   1 
ATOM 4642  O O   . CYS B 1 267 ? 24.333  47.740  219.699 1.00 44.90  ? 267 CYS 2 O   1 
ATOM 4643  C CB  . CYS B 1 267 ? 24.166  50.602  218.396 1.00 14.14  ? 267 CYS 2 CB  1 
ATOM 4644  S SG  . CYS B 1 267 ? 23.759  51.608  216.988 1.00 40.59  ? 267 CYS 2 SG  1 
ATOM 4645  N N   . GLY B 1 268 ? 22.980  49.080  220.936 1.00 46.55  ? 268 GLY 2 N   1 
ATOM 4646  C CA  . GLY B 1 268 ? 23.262  48.405  222.189 1.00 54.86  ? 268 GLY 2 CA  1 
ATOM 4647  C C   . GLY B 1 268 ? 23.084  49.328  223.393 1.00 57.73  ? 268 GLY 2 C   1 
ATOM 4648  O O   . GLY B 1 268 ? 22.316  50.306  223.344 1.00 61.92  ? 268 GLY 2 O   1 
ATOM 4649  N N   . LEU B 1 269 ? 23.856  49.074  224.448 1.00 45.09  ? 269 LEU 2 N   1 
ATOM 4650  C CA  . LEU B 1 269 ? 23.760  49.846  225.680 1.00 44.84  ? 269 LEU 2 CA  1 
ATOM 4651  C C   . LEU B 1 269 ? 24.993  50.615  226.064 1.00 50.49  ? 269 LEU 2 C   1 
ATOM 4652  O O   . LEU B 1 269 ? 26.104  50.070  226.105 1.00 65.25  ? 269 LEU 2 O   1 
ATOM 4653  C CB  . LEU B 1 269 ? 23.381  48.936  226.841 1.00 35.03  ? 269 LEU 2 CB  1 
ATOM 4654  C CG  . LEU B 1 269 ? 21.936  48.456  226.743 1.00 45.98  ? 269 LEU 2 CG  1 
ATOM 4655  C CD1 . LEU B 1 269 ? 21.680  47.246  227.645 1.00 29.84  ? 269 LEU 2 CD1 1 
ATOM 4656  C CD2 . LEU B 1 269 ? 21.008  49.639  227.029 1.00 47.60  ? 269 LEU 2 CD2 1 
ATOM 4657  N N   . PHE B 1 270 ? 24.792  51.897  226.344 1.00 51.06  ? 270 PHE 2 N   1 
ATOM 4658  C CA  . PHE B 1 270 ? 25.879  52.757  226.758 1.00 51.54  ? 270 PHE 2 CA  1 
ATOM 4659  C C   . PHE B 1 270 ? 25.889  52.548  228.232 1.00 61.92  ? 270 PHE 2 C   1 
ATOM 4660  O O   . PHE B 1 270 ? 24.829  52.632  228.867 1.00 67.94  ? 270 PHE 2 O   1 
ATOM 4661  C CB  . PHE B 1 270 ? 25.532  54.213  226.523 1.00 45.23  ? 270 PHE 2 CB  1 
ATOM 4662  C CG  . PHE B 1 270 ? 26.631  55.160  226.898 1.00 61.41  ? 270 PHE 2 CG  1 
ATOM 4663  C CD1 . PHE B 1 270 ? 27.160  55.170  228.173 1.00 50.34  ? 270 PHE 2 CD1 1 
ATOM 4664  C CD2 . PHE B 1 270 ? 27.165  56.025  225.944 1.00 90.79  ? 270 PHE 2 CD2 1 
ATOM 4665  C CE1 . PHE B 1 270 ? 28.200  56.012  228.497 1.00 80.83  ? 270 PHE 2 CE1 1 
ATOM 4666  C CE2 . PHE B 1 270 ? 28.218  56.886  226.252 1.00 97.63  ? 270 PHE 2 CE2 1 
ATOM 4667  C CZ  . PHE B 1 270 ? 28.740  56.880  227.532 1.00 90.10  ? 270 PHE 2 CZ  1 
ATOM 4668  N N   . THR B 1 271 ? 27.051  52.241  228.789 1.00 67.40  ? 271 THR 2 N   1 
ATOM 4669  C CA  . THR B 1 271 ? 27.098  52.084  230.230 1.00 58.51  ? 271 THR 2 CA  1 
ATOM 4670  C C   . THR B 1 271 ? 27.830  53.262  230.861 1.00 56.76  ? 271 THR 2 C   1 
ATOM 4671  O O   . THR B 1 271 ? 28.985  53.578  230.536 1.00 53.02  ? 271 THR 2 O   1 
ATOM 4672  C CB  . THR B 1 271 ? 27.673  50.736  230.689 1.00 58.16  ? 271 THR 2 CB  1 
ATOM 4673  O OG1 . THR B 1 271 ? 26.771  49.669  230.348 1.00 62.18  ? 271 THR 2 OG1 1 
ATOM 4674  C CG2 . THR B 1 271 ? 27.848  50.739  232.182 1.00 53.52  ? 271 THR 2 CG2 1 
ATOM 4675  N N   . ASN B 1 272 ? 27.082  53.952  231.711 1.00 60.25  ? 272 ASN 2 N   1 
ATOM 4676  C CA  . ASN B 1 272 ? 27.531  55.130  232.434 1.00 58.33  ? 272 ASN 2 CA  1 
ATOM 4677  C C   . ASN B 1 272 ? 28.551  54.837  233.490 1.00 59.90  ? 272 ASN 2 C   1 
ATOM 4678  O O   . ASN B 1 272 ? 28.603  53.741  234.055 1.00 55.12  ? 272 ASN 2 O   1 
ATOM 4679  C CB  . ASN B 1 272 ? 26.364  55.774  233.130 1.00 52.38  ? 272 ASN 2 CB  1 
ATOM 4680  C CG  . ASN B 1 272 ? 25.444  56.484  232.186 1.00 73.05  ? 272 ASN 2 CG  1 
ATOM 4681  O OD1 . ASN B 1 272 ? 25.792  57.511  231.599 1.00 72.04  ? 272 ASN 2 OD1 1 
ATOM 4682  N ND2 . ASN B 1 272 ? 24.240  55.966  232.060 1.00 88.48  ? 272 ASN 2 ND2 1 
ATOM 4683  N N   . THR B 1 273 ? 29.294  55.876  233.829 1.00 54.84  ? 273 THR 2 N   1 
ATOM 4684  C CA  . THR B 1 273 ? 30.311  55.792  234.851 1.00 47.17  ? 273 THR 2 CA  1 
ATOM 4685  C C   . THR B 1 273 ? 29.586  55.276  236.066 1.00 50.48  ? 273 THR 2 C   1 
ATOM 4686  O O   . THR B 1 273 ? 30.033  54.353  236.754 1.00 46.56  ? 273 THR 2 O   1 
ATOM 4687  C CB  . THR B 1 273 ? 30.780  57.154  235.197 1.00 41.18  ? 273 THR 2 CB  1 
ATOM 4688  O OG1 . THR B 1 273 ? 30.722  57.998  234.037 1.00 69.96  ? 273 THR 2 OG1 1 
ATOM 4689  C CG2 . THR B 1 273 ? 32.167  57.066  235.689 1.00 37.01  ? 273 THR 2 CG2 1 
ATOM 4690  N N   . SER B 1 274 ? 28.411  55.861  236.267 1.00 51.68  ? 274 SER 2 N   1 
ATOM 4691  C CA  . SER B 1 274 ? 27.550  55.487  237.367 1.00 60.98  ? 274 SER 2 CA  1 
ATOM 4692  C C   . SER B 1 274 ? 27.126  54.030  237.307 1.00 55.77  ? 274 SER 2 C   1 
ATOM 4693  O O   . SER B 1 274 ? 26.704  53.473  238.303 1.00 67.15  ? 274 SER 2 O   1 
ATOM 4694  C CB  . SER B 1 274 ? 26.317  56.390  237.406 1.00 77.33  ? 274 SER 2 CB  1 
ATOM 4695  O OG  . SER B 1 274 ? 25.632  56.420  236.168 1.00 92.51  ? 274 SER 2 OG  1 
ATOM 4696  N N   . GLY B 1 275 ? 27.226  53.418  236.136 1.00 55.82  ? 275 GLY 2 N   1 
ATOM 4697  C CA  . GLY B 1 275 ? 26.852  52.023  236.008 1.00 58.30  ? 275 GLY 2 CA  1 
ATOM 4698  C C   . GLY B 1 275 ? 25.451  51.886  235.461 1.00 57.25  ? 275 GLY 2 C   1 
ATOM 4699  O O   . GLY B 1 275 ? 24.940  50.769  235.283 1.00 55.47  ? 275 GLY 2 O   1 
ATOM 4700  N N   . THR B 1 276 ? 24.807  53.024  235.231 1.00 57.40  ? 276 THR 2 N   1 
ATOM 4701  C CA  . THR B 1 276 ? 23.469  53.022  234.682 1.00 64.81  ? 276 THR 2 CA  1 
ATOM 4702  C C   . THR B 1 276 ? 23.624  52.714  233.218 1.00 67.49  ? 276 THR 2 C   1 
ATOM 4703  O O   . THR B 1 276 ? 24.579  53.160  232.589 1.00 67.75  ? 276 THR 2 O   1 
ATOM 4704  C CB  . THR B 1 276 ? 22.821  54.391  234.708 1.00 69.13  ? 276 THR 2 CB  1 
ATOM 4705  O OG1 . THR B 1 276 ? 23.360  55.183  235.775 1.00 75.43  ? 276 THR 2 OG1 1 
ATOM 4706  C CG2 . THR B 1 276 ? 21.323  54.232  234.853 1.00 80.05  ? 276 THR 2 CG2 1 
ATOM 4707  N N   . GLN B 1 277 ? 22.659  52.010  232.657 1.00 66.23  ? 277 GLN 2 N   1 
ATOM 4708  C CA  . GLN B 1 277 ? 22.722  51.679  231.253 1.00 61.87  ? 277 GLN 2 CA  1 
ATOM 4709  C C   . GLN B 1 277 ? 21.584  52.391  230.520 1.00 59.44  ? 277 GLN 2 C   1 
ATOM 4710  O O   . GLN B 1 277 ? 20.566  52.694  231.123 1.00 62.82  ? 277 GLN 2 O   1 
ATOM 4711  C CB  . GLN B 1 277 ? 22.614  50.156  231.090 1.00 57.49  ? 277 GLN 2 CB  1 
ATOM 4712  C CG  . GLN B 1 277 ? 23.881  49.373  231.446 1.00 43.53  ? 277 GLN 2 CG  1 
ATOM 4713  C CD  . GLN B 1 277 ? 23.654  47.861  231.498 1.00 64.12  ? 277 GLN 2 CD  1 
ATOM 4714  O OE1 . GLN B 1 277 ? 23.493  47.191  230.486 1.00 72.58  ? 277 GLN 2 OE1 1 
ATOM 4715  N NE2 . GLN B 1 277 ? 23.646  47.325  232.693 1.00 79.08  ? 277 GLN 2 NE2 1 
ATOM 4716  N N   . GLN B 1 278 ? 21.794  52.739  229.258 1.00 51.88  ? 278 GLN 2 N   1 
ATOM 4717  C CA  . GLN B 1 278 ? 20.748  53.357  228.444 1.00 48.70  ? 278 GLN 2 CA  1 
ATOM 4718  C C   . GLN B 1 278 ? 21.054  53.065  226.956 1.00 41.26  ? 278 GLN 2 C   1 
ATOM 4719  O O   . GLN B 1 278 ? 22.215  52.981  226.561 1.00 41.74  ? 278 GLN 2 O   1 
ATOM 4720  C CB  . GLN B 1 278 ? 20.589  54.856  228.772 1.00 43.48  ? 278 GLN 2 CB  1 
ATOM 4721  C CG  . GLN B 1 278 ? 21.837  55.684  228.584 1.00 58.34  ? 278 GLN 2 CG  1 
ATOM 4722  C CD  . GLN B 1 278 ? 21.751  57.126  229.120 1.00 51.33  ? 278 GLN 2 CD  1 
ATOM 4723  O OE1 . GLN B 1 278 ? 22.431  57.468  230.085 1.00 60.44  ? 278 GLN 2 OE1 1 
ATOM 4724  N NE2 . GLN B 1 278 ? 21.013  57.992  228.435 1.00 42.67  ? 278 GLN 2 NE2 1 
ATOM 4725  N N   . TRP B 1 279 ? 20.021  52.725  226.197 1.00 21.76  ? 279 TRP 2 N   1 
ATOM 4726  C CA  . TRP B 1 279 ? 20.143  52.392  224.781 1.00 26.35  ? 279 TRP 2 CA  1 
ATOM 4727  C C   . TRP B 1 279 ? 20.769  53.456  223.897 1.00 38.12  ? 279 TRP 2 C   1 
ATOM 4728  O O   . TRP B 1 279 ? 20.515  54.644  224.109 1.00 52.34  ? 279 TRP 2 O   1 
ATOM 4729  C CB  . TRP B 1 279 ? 18.765  52.186  224.195 1.00 18.27  ? 279 TRP 2 CB  1 
ATOM 4730  C CG  . TRP B 1 279 ? 17.959  51.181  224.847 1.00 26.67  ? 279 TRP 2 CG  1 
ATOM 4731  C CD1 . TRP B 1 279 ? 16.744  51.369  225.419 1.00 34.57  ? 279 TRP 2 CD1 1 
ATOM 4732  C CD2 . TRP B 1 279 ? 18.205  49.779  224.874 1.00 26.11  ? 279 TRP 2 CD2 1 
ATOM 4733  N NE1 . TRP B 1 279 ? 16.192  50.162  225.772 1.00 44.96  ? 279 TRP 2 NE1 1 
ATOM 4734  C CE2 . TRP B 1 279 ? 17.070  49.165  225.434 1.00 35.78  ? 279 TRP 2 CE2 1 
ATOM 4735  C CE3 . TRP B 1 279 ? 19.256  48.978  224.450 1.00 23.25  ? 279 TRP 2 CE3 1 
ATOM 4736  C CZ2 . TRP B 1 279 ? 16.969  47.783  225.604 1.00 42.78  ? 279 TRP 2 CZ2 1 
ATOM 4737  C CZ3 . TRP B 1 279 ? 19.159  47.609  224.620 1.00 41.71  ? 279 TRP 2 CZ3 1 
ATOM 4738  C CH2 . TRP B 1 279 ? 18.018  47.023  225.178 1.00 32.23  ? 279 TRP 2 CH2 1 
ATOM 4739  N N   . LYS B 1 280 ? 21.558  53.038  222.900 1.00 36.60  ? 280 LYS 2 N   1 
ATOM 4740  C CA  . LYS B 1 280 ? 22.138  53.979  221.938 1.00 35.16  ? 280 LYS 2 CA  1 
ATOM 4741  C C   . LYS B 1 280 ? 21.661  53.610  220.555 1.00 36.51  ? 280 LYS 2 C   1 
ATOM 4742  O O   . LYS B 1 280 ? 21.588  52.421  220.186 1.00 39.19  ? 280 LYS 2 O   1 
ATOM 4743  C CB  . LYS B 1 280 ? 23.680  54.040  221.898 1.00 3.73   ? 280 LYS 2 CB  1 
ATOM 4744  C CG  . LYS B 1 280 ? 24.137  55.033  220.755 1.00 16.90  ? 280 LYS 2 CG  1 
ATOM 4745  C CD  . LYS B 1 280 ? 25.293  55.961  221.128 1.00 26.73  ? 280 LYS 2 CD  1 
ATOM 4746  C CE  . LYS B 1 280 ? 24.966  57.479  221.005 1.00 56.03  ? 280 LYS 2 CE  1 
ATOM 4747  N NZ  . LYS B 1 280 ? 25.391  58.231  219.755 1.00 51.09  ? 280 LYS 2 NZ  1 
ATOM 4748  N N   . GLY B 1 281 ? 21.343  54.640  219.787 1.00 28.17  ? 281 GLY 2 N   1 
ATOM 4749  C CA  . GLY B 1 281 ? 20.911  54.423  218.426 1.00 28.78  ? 281 GLY 2 CA  1 
ATOM 4750  C C   . GLY B 1 281 ? 21.654  55.327  217.452 1.00 35.22  ? 281 GLY 2 C   1 
ATOM 4751  O O   . GLY B 1 281 ? 22.312  56.326  217.842 1.00 31.57  ? 281 GLY 2 O   1 
ATOM 4752  N N   . LEU B 1 282 ? 21.537  54.986  216.174 1.00 21.61  ? 282 LEU 2 N   1 
ATOM 4753  C CA  . LEU B 1 282 ? 22.171  55.776  215.144 1.00 20.11  ? 282 LEU 2 CA  1 
ATOM 4754  C C   . LEU B 1 282 ? 21.266  55.994  213.952 1.00 25.59  ? 282 LEU 2 C   1 
ATOM 4755  O O   . LEU B 1 282 ? 20.397  55.164  213.583 1.00 22.62  ? 282 LEU 2 O   1 
ATOM 4756  C CB  . LEU B 1 282 ? 23.471  55.138  214.672 1.00 23.49  ? 282 LEU 2 CB  1 
ATOM 4757  C CG  . LEU B 1 282 ? 24.645  55.203  215.631 1.00 22.77  ? 282 LEU 2 CG  1 
ATOM 4758  C CD1 . LEU B 1 282 ? 25.958  54.838  214.948 1.00 31.62  ? 282 LEU 2 CD1 1 
ATOM 4759  C CD2 . LEU B 1 282 ? 24.713  56.619  216.095 1.00 49.04  ? 282 LEU 2 CD2 1 
ATOM 4760  N N   . PRO B 1 283 ? 21.429  57.145  213.338 1.00 19.09  ? 283 PRO 2 N   1 
ATOM 4761  C CA  . PRO B 1 283 ? 20.598  57.422  212.185 1.00 23.75  ? 283 PRO 2 CA  1 
ATOM 4762  C C   . PRO B 1 283 ? 20.977  56.413  211.115 1.00 24.12  ? 283 PRO 2 C   1 
ATOM 4763  O O   . PRO B 1 283 ? 22.081  55.860  211.147 1.00 33.15  ? 283 PRO 2 O   1 
ATOM 4764  C CB  . PRO B 1 283 ? 21.018  58.837  211.822 1.00 17.13  ? 283 PRO 2 CB  1 
ATOM 4765  C CG  . PRO B 1 283 ? 22.463  58.821  212.159 1.00 27.71  ? 283 PRO 2 CG  1 
ATOM 4766  C CD  . PRO B 1 283 ? 22.467  58.162  213.508 1.00 23.19  ? 283 PRO 2 CD  1 
ATOM 4767  N N   . ARG B 1 284 ? 20.056  56.179  210.188 1.00 15.56  ? 284 ARG 2 N   1 
ATOM 4768  C CA  . ARG B 1 284 ? 20.257  55.260  209.092 1.00 17.49  ? 284 ARG 2 CA  1 
ATOM 4769  C C   . ARG B 1 284 ? 19.975  55.939  207.747 1.00 21.03  ? 284 ARG 2 C   1 
ATOM 4770  O O   . ARG B 1 284 ? 19.033  56.725  207.623 1.00 28.63  ? 284 ARG 2 O   1 
ATOM 4771  C CB  . ARG B 1 284 ? 19.363  54.052  209.273 1.00 12.86  ? 284 ARG 2 CB  1 
ATOM 4772  C CG  . ARG B 1 284 ? 18.813  53.550  207.963 1.00 18.83  ? 284 ARG 2 CG  1 
ATOM 4773  C CD  . ARG B 1 284 ? 18.132  52.198  208.101 1.00 37.97  ? 284 ARG 2 CD  1 
ATOM 4774  N NE  . ARG B 1 284 ? 19.048  51.089  207.881 1.00 36.62  ? 284 ARG 2 NE  1 
ATOM 4775  C CZ  . ARG B 1 284 ? 19.423  50.262  208.834 1.00 35.25  ? 284 ARG 2 CZ  1 
ATOM 4776  N NH1 . ARG B 1 284 ? 18.942  50.434  210.056 1.00 39.66  ? 284 ARG 2 NH1 1 
ATOM 4777  N NH2 . ARG B 1 284 ? 20.297  49.298  208.565 1.00 34.81  ? 284 ARG 2 NH2 1 
ATOM 4778  N N   . TYR B 1 285 ? 20.752  55.576  206.730 1.00 17.39  ? 285 TYR 2 N   1 
ATOM 4779  C CA  . TYR B 1 285 ? 20.645  56.170  205.396 1.00 15.26  ? 285 TYR 2 CA  1 
ATOM 4780  C C   . TYR B 1 285 ? 19.847  55.326  204.455 1.00 23.95  ? 285 TYR 2 C   1 
ATOM 4781  O O   . TYR B 1 285 ? 19.848  54.107  204.571 1.00 26.24  ? 285 TYR 2 O   1 
ATOM 4782  C CB  . TYR B 1 285 ? 22.050  56.261  204.824 1.00 12.19  ? 285 TYR 2 CB  1 
ATOM 4783  C CG  . TYR B 1 285 ? 22.222  56.455  203.321 1.00 14.12  ? 285 TYR 2 CG  1 
ATOM 4784  C CD1 . TYR B 1 285 ? 22.040  55.424  202.427 1.00 20.74  ? 285 TYR 2 CD1 1 
ATOM 4785  C CD2 . TYR B 1 285 ? 22.695  57.660  202.811 1.00 35.69  ? 285 TYR 2 CD2 1 
ATOM 4786  C CE1 . TYR B 1 285 ? 22.340  55.598  201.066 1.00 36.63  ? 285 TYR 2 CE1 1 
ATOM 4787  C CE2 . TYR B 1 285 ? 22.997  57.835  201.459 1.00 23.59  ? 285 TYR 2 CE2 1 
ATOM 4788  C CZ  . TYR B 1 285 ? 22.824  56.808  200.602 1.00 27.01  ? 285 TYR 2 CZ  1 
ATOM 4789  O OH  . TYR B 1 285 ? 23.185  56.988  199.298 1.00 25.47  ? 285 TYR 2 OH  1 
ATOM 4790  N N   . PHE B 1 286 ? 19.197  55.947  203.487 1.00 9.26   ? 286 PHE 2 N   1 
ATOM 4791  C CA  . PHE B 1 286 ? 18.522  55.120  202.518 1.00 17.02  ? 286 PHE 2 CA  1 
ATOM 4792  C C   . PHE B 1 286 ? 18.757  55.692  201.162 1.00 27.86  ? 286 PHE 2 C   1 
ATOM 4793  O O   . PHE B 1 286 ? 18.915  56.918  201.004 1.00 25.18  ? 286 PHE 2 O   1 
ATOM 4794  C CB  . PHE B 1 286 ? 17.022  55.073  202.702 1.00 12.58  ? 286 PHE 2 CB  1 
ATOM 4795  C CG  . PHE B 1 286 ? 16.585  54.412  203.934 1.00 15.69  ? 286 PHE 2 CG  1 
ATOM 4796  C CD1 . PHE B 1 286 ? 16.673  55.071  205.137 1.00 5.43   ? 286 PHE 2 CD1 1 
ATOM 4797  C CD2 . PHE B 1 286 ? 16.003  53.159  203.892 1.00 19.75  ? 286 PHE 2 CD2 1 
ATOM 4798  C CE1 . PHE B 1 286 ? 16.180  54.497  206.276 1.00 14.47  ? 286 PHE 2 CE1 1 
ATOM 4799  C CE2 . PHE B 1 286 ? 15.502  52.565  205.054 1.00 18.31  ? 286 PHE 2 CE2 1 
ATOM 4800  C CZ  . PHE B 1 286 ? 15.587  53.234  206.237 1.00 12.83  ? 286 PHE 2 CZ  1 
ATOM 4801  N N   . LYS B 1 287 ? 18.777  54.797  200.185 1.00 23.19  ? 287 LYS 2 N   1 
ATOM 4802  C CA  . LYS B 1 287 ? 18.896  55.211  198.818 1.00 18.99  ? 287 LYS 2 CA  1 
ATOM 4803  C C   . LYS B 1 287 ? 18.004  54.294  198.027 1.00 21.01  ? 287 LYS 2 C   1 
ATOM 4804  O O   . LYS B 1 287 ? 18.340  53.138  197.725 1.00 31.83  ? 287 LYS 2 O   1 
ATOM 4805  C CB  . LYS B 1 287 ? 20.324  55.195  198.309 1.00 11.12  ? 287 LYS 2 CB  1 
ATOM 4806  C CG  . LYS B 1 287 ? 20.439  55.632  196.818 1.00 4.20   ? 287 LYS 2 CG  1 
ATOM 4807  C CD  . LYS B 1 287 ? 21.906  55.799  196.388 1.00 38.19  ? 287 LYS 2 CD  1 
ATOM 4808  C CE  . LYS B 1 287 ? 22.173  55.737  194.871 1.00 24.44  ? 287 LYS 2 CE  1 
ATOM 4809  N NZ  . LYS B 1 287 ? 23.595  56.203  194.526 1.00 73.34  ? 287 LYS 2 NZ  1 
ATOM 4810  N N   . ILE B 1 288 ? 16.828  54.822  197.741 1.00 16.01  ? 288 ILE 2 N   1 
ATOM 4811  C CA  . ILE B 1 288 ? 15.852  54.090  196.988 1.00 12.35  ? 288 ILE 2 CA  1 
ATOM 4812  C C   . ILE B 1 288 ? 15.794  54.544  195.566 1.00 16.82  ? 288 ILE 2 C   1 
ATOM 4813  O O   . ILE B 1 288 ? 15.783  55.739  195.262 1.00 30.46  ? 288 ILE 2 O   1 
ATOM 4814  C CB  . ILE B 1 288 ? 14.534  54.237  197.565 1.00 14.18  ? 288 ILE 2 CB  1 
ATOM 4815  C CG1 . ILE B 1 288 ? 14.608  53.795  199.017 1.00 16.04  ? 288 ILE 2 CG1 1 
ATOM 4816  C CG2 . ILE B 1 288 ? 13.531  53.483  196.699 1.00 27.62  ? 288 ILE 2 CG2 1 
ATOM 4817  C CD1 . ILE B 1 288 ? 14.286  54.877  199.936 1.00 10.99  ? 288 ILE 2 CD1 1 
ATOM 4818  N N   . THR B 1 289 ? 15.677  53.562  194.699 1.00 22.73  ? 289 THR 2 N   1 
ATOM 4819  C CA  . THR B 1 289 ? 15.678  53.778  193.276 1.00 21.17  ? 289 THR 2 CA  1 
ATOM 4820  C C   . THR B 1 289 ? 14.287  53.480  192.802 1.00 24.16  ? 289 THR 2 C   1 
ATOM 4821  O O   . THR B 1 289 ? 13.788  52.363  192.954 1.00 37.75  ? 289 THR 2 O   1 
ATOM 4822  C CB  . THR B 1 289 ? 16.660  52.824  192.658 1.00 22.00  ? 289 THR 2 CB  1 
ATOM 4823  O OG1 . THR B 1 289 ? 17.752  52.577  193.570 1.00 45.40  ? 289 THR 2 OG1 1 
ATOM 4824  C CG2 . THR B 1 289 ? 17.218  53.428  191.493 1.00 25.10  ? 289 THR 2 CG2 1 
ATOM 4825  N N   . LEU B 1 290 ? 13.658  54.492  192.240 1.00 21.97  ? 290 LEU 2 N   1 
ATOM 4826  C CA  . LEU B 1 290 ? 12.286  54.368  191.799 1.00 16.76  ? 290 LEU 2 CA  1 
ATOM 4827  C C   . LEU B 1 290 ? 12.125  54.477  190.318 1.00 20.68  ? 290 LEU 2 C   1 
ATOM 4828  O O   . LEU B 1 290 ? 12.809  55.288  189.659 1.00 17.69  ? 290 LEU 2 O   1 
ATOM 4829  C CB  . LEU B 1 290 ? 11.460  55.457  192.444 1.00 13.58  ? 290 LEU 2 CB  1 
ATOM 4830  C CG  . LEU B 1 290 ? 11.604  55.297  193.936 1.00 15.62  ? 290 LEU 2 CG  1 
ATOM 4831  C CD1 . LEU B 1 290 ? 10.968  56.418  194.706 1.00 4.56   ? 290 LEU 2 CD1 1 
ATOM 4832  C CD2 . LEU B 1 290 ? 10.963  54.001  194.275 1.00 34.75  ? 290 LEU 2 CD2 1 
ATOM 4833  N N   . ARG B 1 291 ? 11.154  53.719  189.821 1.00 5.18   ? 291 ARG 2 N   1 
ATOM 4834  C CA  . ARG B 1 291 ? 10.851  53.717  188.410 1.00 17.42  ? 291 ARG 2 CA  1 
ATOM 4835  C C   . ARG B 1 291 ? 9.358   53.846  188.147 1.00 24.82  ? 291 ARG 2 C   1 
ATOM 4836  O O   . ARG B 1 291 ? 8.539   53.790  189.079 1.00 22.73  ? 291 ARG 2 O   1 
ATOM 4837  C CB  . ARG B 1 291 ? 11.394  52.466  187.745 1.00 2.08   ? 291 ARG 2 CB  1 
ATOM 4838  C CG  . ARG B 1 291 ? 10.684  51.175  188.097 1.00 18.29  ? 291 ARG 2 CG  1 
ATOM 4839  C CD  . ARG B 1 291 ? 11.374  49.925  187.420 1.00 44.45  ? 291 ARG 2 CD  1 
ATOM 4840  N NE  . ARG B 1 291 ? 10.874  48.634  187.924 1.00 58.47  ? 291 ARG 2 NE  1 
ATOM 4841  C CZ  . ARG B 1 291 ? 11.315  47.426  187.562 1.00 67.04  ? 291 ARG 2 CZ  1 
ATOM 4842  N NH1 . ARG B 1 291 ? 12.302  47.302  186.677 1.00 83.74  ? 291 ARG 2 NH1 1 
ATOM 4843  N NH2 . ARG B 1 291 ? 10.740  46.332  188.070 1.00 85.17  ? 291 ARG 2 NH2 1 
ATOM 4844  N N   . LYS B 1 292 ? 9.014   54.029  186.876 1.00 24.56  ? 292 LYS 2 N   1 
ATOM 4845  C CA  . LYS B 1 292 ? 7.628   54.185  186.501 1.00 21.13  ? 292 LYS 2 CA  1 
ATOM 4846  C C   . LYS B 1 292 ? 7.006   52.867  186.068 1.00 23.83  ? 292 LYS 2 C   1 
ATOM 4847  O O   . LYS B 1 292 ? 7.329   52.324  184.989 1.00 32.99  ? 292 LYS 2 O   1 
ATOM 4848  C CB  . LYS B 1 292 ? 7.538   55.248  185.428 1.00 31.74  ? 292 LYS 2 CB  1 
ATOM 4849  C CG  . LYS B 1 292 ? 7.825   56.637  185.989 1.00 20.18  ? 292 LYS 2 CG  1 
ATOM 4850  C CD  . LYS B 1 292 ? 7.778   57.688  184.892 1.00 42.46  ? 292 LYS 2 CD  1 
ATOM 4851  C CE  . LYS B 1 292 ? 7.912   59.100  185.442 1.00 36.54  ? 292 LYS 2 CE  1 
ATOM 4852  N NZ  . LYS B 1 292 ? 7.795   60.181  184.404 1.00 47.93  ? 292 LYS 2 NZ  1 
ATOM 4853  N N   . ARG B 1 293 ? 6.118   52.346  186.920 1.00 15.56  ? 293 ARG 2 N   1 
ATOM 4854  C CA  . ARG B 1 293 ? 5.475   51.044  186.662 1.00 30.81  ? 293 ARG 2 CA  1 
ATOM 4855  C C   . ARG B 1 293 ? 4.065   51.164  186.173 1.00 29.51  ? 293 ARG 2 C   1 
ATOM 4856  O O   . ARG B 1 293 ? 3.267   51.938  186.705 1.00 22.15  ? 293 ARG 2 O   1 
ATOM 4857  C CB  . ARG B 1 293 ? 5.512   50.112  187.904 1.00 27.84  ? 293 ARG 2 CB  1 
ATOM 4858  C CG  . ARG B 1 293 ? 5.010   48.629  187.725 1.00 12.88  ? 293 ARG 2 CG  1 
ATOM 4859  C CD  . ARG B 1 293 ? 5.492   47.960  186.412 1.00 55.10  ? 293 ARG 2 CD  1 
ATOM 4860  N NE  . ARG B 1 293 ? 5.707   46.502  186.450 1.00 47.01  ? 293 ARG 2 NE  1 
ATOM 4861  C CZ  . ARG B 1 293 ? 6.628   45.898  187.210 1.00 34.46  ? 293 ARG 2 CZ  1 
ATOM 4862  N NH1 . ARG B 1 293 ? 7.375   46.625  187.999 1.00 13.65  ? 293 ARG 2 NH1 1 
ATOM 4863  N NH2 . ARG B 1 293 ? 6.898   44.594  187.092 1.00 38.41  ? 293 ARG 2 NH2 1 
ATOM 4864  N N   . SER B 1 294 ? 3.792   50.433  185.102 1.00 30.76  ? 294 SER 2 N   1 
ATOM 4865  C CA  . SER B 1 294 ? 2.475   50.423  184.528 1.00 28.39  ? 294 SER 2 CA  1 
ATOM 4866  C C   . SER B 1 294 ? 1.640   49.375  185.250 1.00 28.69  ? 294 SER 2 C   1 
ATOM 4867  O O   . SER B 1 294 ? 2.088   48.235  185.459 1.00 49.64  ? 294 SER 2 O   1 
ATOM 4868  C CB  . SER B 1 294 ? 2.574   50.101  183.053 1.00 33.85  ? 294 SER 2 CB  1 
ATOM 4869  O OG  . SER B 1 294 ? 1.320   50.309  182.450 1.00 58.05  ? 294 SER 2 OG  1 
ATOM 4870  N N   . VAL B 1 295 ? 0.455   49.781  185.679 1.00 26.54  ? 295 VAL 2 N   1 
ATOM 4871  C CA  . VAL B 1 295 ? -0.460  48.896  186.389 1.00 35.25  ? 295 VAL 2 CA  1 
ATOM 4872  C C   . VAL B 1 295 ? -1.869  49.111  185.890 1.00 37.05  ? 295 VAL 2 C   1 
ATOM 4873  O O   . VAL B 1 295 ? -2.128  50.018  185.074 1.00 33.29  ? 295 VAL 2 O   1 
ATOM 4874  C CB  . VAL B 1 295 ? -0.489  49.170  187.905 1.00 26.57  ? 295 VAL 2 CB  1 
ATOM 4875  C CG1 . VAL B 1 295 ? 0.907   49.248  188.433 1.00 35.13  ? 295 VAL 2 CG1 1 
ATOM 4876  C CG2 . VAL B 1 295 ? -1.215  50.438  188.181 1.00 9.94   ? 295 VAL 2 CG2 1 
ATOM 4877  N N   . LYS B 1 296 ? -2.790  48.308  186.412 1.00 28.15  ? 296 LYS 2 N   1 
ATOM 4878  C CA  . LYS B 1 296 ? -4.156  48.459  185.997 1.00 36.49  ? 296 LYS 2 CA  1 
ATOM 4879  C C   . LYS B 1 296 ? -4.975  48.807  187.190 1.00 41.03  ? 296 LYS 2 C   1 
ATOM 4880  O O   . LYS B 1 296 ? -4.611  48.490  188.338 1.00 23.69  ? 296 LYS 2 O   1 
ATOM 4881  C CB  . LYS B 1 296 ? -4.702  47.196  185.335 1.00 44.50  ? 296 LYS 2 CB  1 
ATOM 4882  C CG  . LYS B 1 296 ? -5.446  46.229  186.247 1.00 63.06  ? 296 LYS 2 CG  1 
ATOM 4883  C CD  . LYS B 1 296 ? -5.830  44.983  185.449 1.00 88.77  ? 296 LYS 2 CD  1 
ATOM 4884  C CE  . LYS B 1 296 ? -6.607  43.923  186.248 1.00 97.55  ? 296 LYS 2 CE  1 
ATOM 4885  N NZ  . LYS B 1 296 ? -6.894  42.692  185.407 1.00 116.35 ? 296 LYS 2 NZ  1 
ATOM 4886  N N   . ASN B 1 297 ? -6.020  49.576  186.909 1.00 44.65  ? 297 ASN 2 N   1 
ATOM 4887  C CA  . ASN B 1 297 ? -6.931  49.948  187.947 1.00 42.46  ? 297 ASN 2 CA  1 
ATOM 4888  C C   . ASN B 1 297 ? -7.739  48.704  188.056 1.00 42.44  ? 297 ASN 2 C   1 
ATOM 4889  O O   . ASN B 1 297 ? -8.453  48.352  187.135 1.00 51.92  ? 297 ASN 2 O   1 
ATOM 4890  C CB  . ASN B 1 297 ? -7.874  51.030  187.517 1.00 50.71  ? 297 ASN 2 CB  1 
ATOM 4891  C CG  . ASN B 1 297 ? -9.027  51.150  188.480 1.00 58.25  ? 297 ASN 2 CG  1 
ATOM 4892  O OD1 . ASN B 1 297 ? -8.983  50.586  189.597 1.00 38.55  ? 297 ASN 2 OD1 1 
ATOM 4893  N ND2 . ASN B 1 297 ? -10.084 51.841  188.061 1.00 74.76  ? 297 ASN 2 ND2 1 
ATOM 4894  N N   . PRO B 1 298 ? -7.661  48.033  189.190 1.00 44.89  ? 298 PRO 2 N   1 
ATOM 4895  C CA  . PRO B 1 298 ? -8.379  46.787  189.459 1.00 52.81  ? 298 PRO 2 CA  1 
ATOM 4896  C C   . PRO B 1 298 ? -9.851  46.962  189.747 1.00 56.36  ? 298 PRO 2 C   1 
ATOM 4897  O O   . PRO B 1 298 ? -10.610 45.992  189.718 1.00 62.62  ? 298 PRO 2 O   1 
ATOM 4898  C CB  . PRO B 1 298 ? -7.688  46.290  190.711 1.00 52.78  ? 298 PRO 2 CB  1 
ATOM 4899  C CG  . PRO B 1 298 ? -7.429  47.574  191.463 1.00 49.78  ? 298 PRO 2 CG  1 
ATOM 4900  C CD  . PRO B 1 298 ? -6.863  48.449  190.355 1.00 52.18  ? 298 PRO 2 CD  1 
ATOM 4901  N N   . TYR B 1 299 ? -10.229 48.190  190.077 1.00 57.86  ? 299 TYR 2 N   1 
ATOM 4902  C CA  . TYR B 1 299 ? -11.591 48.526  190.457 1.00 60.47  ? 299 TYR 2 CA  1 
ATOM 4903  C C   . TYR B 1 299 ? -12.424 49.188  189.338 1.00 69.28  ? 299 TYR 2 C   1 
ATOM 4904  O O   . TYR B 1 299 ? -11.912 49.477  188.253 1.00 78.84  ? 299 TYR 2 O   1 
ATOM 4905  C CB  . TYR B 1 299 ? -11.524 49.445  191.673 1.00 44.03  ? 299 TYR 2 CB  1 
ATOM 4906  C CG  . TYR B 1 299 ? -10.593 48.996  192.762 1.00 39.60  ? 299 TYR 2 CG  1 
ATOM 4907  C CD1 . TYR B 1 299 ? -10.375 47.668  193.006 1.00 60.86  ? 299 TYR 2 CD1 1 
ATOM 4908  C CD2 . TYR B 1 299 ? -9.955  49.915  193.575 1.00 53.74  ? 299 TYR 2 CD2 1 
ATOM 4909  C CE1 . TYR B 1 299 ? -9.543  47.263  194.037 1.00 71.61  ? 299 TYR 2 CE1 1 
ATOM 4910  C CE2 . TYR B 1 299 ? -9.130  49.522  194.606 1.00 54.00  ? 299 TYR 2 CE2 1 
ATOM 4911  C CZ  . TYR B 1 299 ? -8.925  48.193  194.830 1.00 54.75  ? 299 TYR 2 CZ  1 
ATOM 4912  O OH  . TYR B 1 299 ? -8.088  47.773  195.835 1.00 45.44  ? 299 TYR 2 OH  1 
ATOM 4913  N N   . PRO B 1 300 ? -13.740 49.364  189.563 1.00 70.20  ? 300 PRO 2 N   1 
ATOM 4914  C CA  . PRO B 1 300 ? -14.616 49.990  188.566 1.00 67.48  ? 300 PRO 2 CA  1 
ATOM 4915  C C   . PRO B 1 300 ? -15.040 51.438  188.860 1.00 59.18  ? 300 PRO 2 C   1 
ATOM 4916  O O   . PRO B 1 300 ? -15.303 51.793  190.023 1.00 48.37  ? 300 PRO 2 O   1 
ATOM 4917  C CB  . PRO B 1 300 ? -15.811 49.054  188.558 1.00 77.66  ? 300 PRO 2 CB  1 
ATOM 4918  C CG  . PRO B 1 300 ? -15.947 48.724  190.010 1.00 73.73  ? 300 PRO 2 CG  1 
ATOM 4919  C CD  . PRO B 1 300 ? -14.529 48.530  190.492 1.00 71.99  ? 300 PRO 2 CD  1 
ATOM 4920  N N   . ILE B 1 301 ? -15.152 52.245  187.800 1.00 46.25  ? 301 ILE 2 N   1 
ATOM 4921  C CA  . ILE B 1 301 ? -15.536 53.650  187.893 1.00 47.55  ? 301 ILE 2 CA  1 
ATOM 4922  C C   . ILE B 1 301 ? -16.691 53.771  188.831 1.00 50.27  ? 301 ILE 2 C   1 
ATOM 4923  O O   . ILE B 1 301 ? -16.652 54.556  189.775 1.00 43.21  ? 301 ILE 2 O   1 
ATOM 4924  C CB  . ILE B 1 301 ? -15.960 54.217  186.524 1.00 60.81  ? 301 ILE 2 CB  1 
ATOM 4925  C CG1 . ILE B 1 301 ? -14.820 54.029  185.546 1.00 63.86  ? 301 ILE 2 CG1 1 
ATOM 4926  C CG2 . ILE B 1 301 ? -16.225 55.718  186.604 1.00 55.27  ? 301 ILE 2 CG2 1 
ATOM 4927  C CD1 . ILE B 1 301 ? -13.493 54.372  186.165 1.00 32.12  ? 301 ILE 2 CD1 1 
ATOM 4928  N N   . SER B 1 302 ? -17.696 52.943  188.581 1.00 51.91  ? 302 SER 2 N   1 
ATOM 4929  C CA  . SER B 1 302 ? -18.907 52.895  189.391 1.00 66.32  ? 302 SER 2 CA  1 
ATOM 4930  C C   . SER B 1 302 ? -18.582 52.964  190.873 1.00 68.20  ? 302 SER 2 C   1 
ATOM 4931  O O   . SER B 1 302 ? -19.057 53.837  191.598 1.00 68.78  ? 302 SER 2 O   1 
ATOM 4932  C CB  . SER B 1 302 ? -19.619 51.582  189.105 1.00 76.49  ? 302 SER 2 CB  1 
ATOM 4933  O OG  . SER B 1 302 ? -18.679 50.646  188.601 1.00 98.30  ? 302 SER 2 OG  1 
ATOM 4934  N N   . PHE B 1 303 ? -17.729 52.042  191.288 1.00 74.31  ? 303 PHE 2 N   1 
ATOM 4935  C CA  . PHE B 1 303 ? -17.266 51.908  192.658 1.00 82.36  ? 303 PHE 2 CA  1 
ATOM 4936  C C   . PHE B 1 303 ? -16.477 53.147  193.108 1.00 71.57  ? 303 PHE 2 C   1 
ATOM 4937  O O   . PHE B 1 303 ? -16.398 53.496  194.292 1.00 61.70  ? 303 PHE 2 O   1 
ATOM 4938  C CB  . PHE B 1 303 ? -16.384 50.665  192.705 1.00 97.07  ? 303 PHE 2 CB  1 
ATOM 4939  C CG  . PHE B 1 303 ? -15.868 50.341  194.054 1.00 111.40 ? 303 PHE 2 CG  1 
ATOM 4940  C CD1 . PHE B 1 303 ? -16.744 50.084  195.106 1.00 124.41 ? 303 PHE 2 CD1 1 
ATOM 4941  C CD2 . PHE B 1 303 ? -14.502 50.285  194.282 1.00 121.05 ? 303 PHE 2 CD2 1 
ATOM 4942  C CE1 . PHE B 1 303 ? -16.263 49.776  196.384 1.00 132.98 ? 303 PHE 2 CE1 1 
ATOM 4943  C CE2 . PHE B 1 303 ? -14.003 49.979  195.551 1.00 137.71 ? 303 PHE 2 CE2 1 
ATOM 4944  C CZ  . PHE B 1 303 ? -14.889 49.722  196.609 1.00 134.76 ? 303 PHE 2 CZ  1 
ATOM 4945  N N   . LEU B 1 304 ? -15.899 53.822  192.142 1.00 70.64  ? 304 LEU 2 N   1 
ATOM 4946  C CA  . LEU B 1 304 ? -15.126 55.003  192.442 1.00 84.58  ? 304 LEU 2 CA  1 
ATOM 4947  C C   . LEU B 1 304 ? -16.056 56.165  192.709 1.00 78.48  ? 304 LEU 2 C   1 
ATOM 4948  O O   . LEU B 1 304 ? -15.979 56.811  193.744 1.00 76.02  ? 304 LEU 2 O   1 
ATOM 4949  C CB  . LEU B 1 304 ? -14.180 55.285  191.280 1.00 105.42 ? 304 LEU 2 CB  1 
ATOM 4950  C CG  . LEU B 1 304 ? -13.580 53.972  190.727 1.00 123.38 ? 304 LEU 2 CG  1 
ATOM 4951  C CD1 . LEU B 1 304 ? -12.458 54.252  189.736 1.00 126.34 ? 304 LEU 2 CD1 1 
ATOM 4952  C CD2 . LEU B 1 304 ? -13.085 53.045  191.856 1.00 121.77 ? 304 LEU 2 CD2 1 
ATOM 4953  N N   . LEU B 1 305 ? -17.004 56.358  191.809 1.00 79.08  ? 305 LEU 2 N   1 
ATOM 4954  C CA  . LEU B 1 305 ? -17.984 57.424  191.930 1.00 80.04  ? 305 LEU 2 CA  1 
ATOM 4955  C C   . LEU B 1 305 ? -18.807 57.239  193.191 1.00 84.08  ? 305 LEU 2 C   1 
ATOM 4956  O O   . LEU B 1 305 ? -19.122 58.215  193.866 1.00 85.13  ? 305 LEU 2 O   1 
ATOM 4957  C CB  . LEU B 1 305 ? -18.907 57.419  190.723 1.00 79.27  ? 305 LEU 2 CB  1 
ATOM 4958  C CG  . LEU B 1 305 ? -18.156 57.245  189.404 1.00 101.68 ? 305 LEU 2 CG  1 
ATOM 4959  C CD1 . LEU B 1 305 ? -19.008 57.794  188.248 1.00 101.66 ? 305 LEU 2 CD1 1 
ATOM 4960  C CD2 . LEU B 1 305 ? -16.776 57.947  189.476 1.00 107.08 ? 305 LEU 2 CD2 1 
ATOM 4961  N N   . SER B 1 306 ? -19.137 55.988  193.514 1.00 86.38  ? 306 SER 2 N   1 
ATOM 4962  C CA  . SER B 1 306 ? -19.907 55.656  194.710 1.00 89.96  ? 306 SER 2 CA  1 
ATOM 4963  C C   . SER B 1 306 ? -19.445 56.520  195.862 1.00 93.12  ? 306 SER 2 C   1 
ATOM 4964  O O   . SER B 1 306 ? -20.232 56.863  196.740 1.00 93.76  ? 306 SER 2 O   1 
ATOM 4965  C CB  . SER B 1 306 ? -19.711 54.191  195.087 1.00 100.80 ? 306 SER 2 CB  1 
ATOM 4966  O OG  . SER B 1 306 ? -20.120 53.331  194.040 1.00 118.14 ? 306 SER 2 OG  1 
ATOM 4967  N N   . ASP B 1 307 ? -18.150 56.824  195.875 1.00 100.52 ? 307 ASP 2 N   1 
ATOM 4968  C CA  . ASP B 1 307 ? -17.579 57.690  196.890 1.00 111.75 ? 307 ASP 2 CA  1 
ATOM 4969  C C   . ASP B 1 307 ? -18.368 58.992  196.851 1.00 105.53 ? 307 ASP 2 C   1 
ATOM 4970  O O   . ASP B 1 307 ? -19.336 59.133  197.590 1.00 103.06 ? 307 ASP 2 O   1 
ATOM 4971  C CB  . ASP B 1 307 ? -16.097 57.968  196.595 1.00 131.30 ? 307 ASP 2 CB  1 
ATOM 4972  C CG  . ASP B 1 307 ? -15.604 59.291  197.198 1.00 147.82 ? 307 ASP 2 CG  1 
ATOM 4973  O OD1 . ASP B 1 307 ? -15.259 59.314  198.402 1.00 153.77 ? 307 ASP 2 OD1 1 
ATOM 4974  O OD2 . ASP B 1 307 ? -15.541 60.310  196.455 1.00 154.46 ? 307 ASP 2 OD2 1 
ATOM 4975  N N   . LEU B 1 308 ? -18.014 59.874  195.910 1.00 102.05 ? 308 LEU 2 N   1 
ATOM 4976  C CA  . LEU B 1 308 ? -18.645 61.183  195.746 1.00 100.01 ? 308 LEU 2 CA  1 
ATOM 4977  C C   . LEU B 1 308 ? -20.129 61.113  196.068 1.00 100.43 ? 308 LEU 2 C   1 
ATOM 4978  O O   . LEU B 1 308 ? -20.609 61.794  196.964 1.00 96.00  ? 308 LEU 2 O   1 
ATOM 4979  C CB  . LEU B 1 308 ? -18.417 61.710  194.318 1.00 103.86 ? 308 LEU 2 CB  1 
ATOM 4980  C CG  . LEU B 1 308 ? -19.052 63.049  193.889 1.00 109.71 ? 308 LEU 2 CG  1 
ATOM 4981  C CD1 . LEU B 1 308 ? -18.732 64.141  194.901 1.00 111.06 ? 308 LEU 2 CD1 1 
ATOM 4982  C CD2 . LEU B 1 308 ? -18.588 63.469  192.483 1.00 102.91 ? 308 LEU 2 CD2 1 
ATOM 4983  N N   . ILE B 1 309 ? -20.809 60.182  195.415 1.00 101.35 ? 309 ILE 2 N   1 
ATOM 4984  C CA  . ILE B 1 309 ? -22.238 59.967  195.593 1.00 101.86 ? 309 ILE 2 CA  1 
ATOM 4985  C C   . ILE B 1 309 ? -22.697 59.773  197.038 1.00 101.02 ? 309 ILE 2 C   1 
ATOM 4986  O O   . ILE B 1 309 ? -23.355 60.638  197.604 1.00 86.63  ? 309 ILE 2 O   1 
ATOM 4987  C CB  . ILE B 1 309 ? -22.696 58.749  194.783 1.00 105.15 ? 309 ILE 2 CB  1 
ATOM 4988  C CG1 . ILE B 1 309 ? -22.486 59.006  193.288 1.00 112.78 ? 309 ILE 2 CG1 1 
ATOM 4989  C CG2 . ILE B 1 309 ? -24.141 58.422  195.098 1.00 106.05 ? 309 ILE 2 CG2 1 
ATOM 4990  C CD1 . ILE B 1 309 ? -22.615 57.754  192.422 1.00 132.64 ? 309 ILE 2 CD1 1 
ATOM 4991  N N   . ASN B 1 310 ? -22.377 58.626  197.629 1.00 115.36 ? 310 ASN 2 N   1 
ATOM 4992  C CA  . ASN B 1 310 ? -22.827 58.373  198.992 1.00 135.36 ? 310 ASN 2 CA  1 
ATOM 4993  C C   . ASN B 1 310 ? -22.061 59.171  200.028 1.00 131.81 ? 310 ASN 2 C   1 
ATOM 4994  O O   . ASN B 1 310 ? -22.552 59.422  201.132 1.00 134.16 ? 310 ASN 2 O   1 
ATOM 4995  C CB  . ASN B 1 310 ? -22.892 56.873  199.315 1.00 153.55 ? 310 ASN 2 CB  1 
ATOM 4996  C CG  . ASN B 1 310 ? -24.341 56.336  199.318 1.00 176.18 ? 310 ASN 2 CG  1 
ATOM 4997  O OD1 . ASN B 1 310 ? -25.311 57.106  199.303 1.00 185.80 ? 310 ASN 2 OD1 1 
ATOM 4998  N ND2 . ASN B 1 310 ? -24.485 55.016  199.354 1.00 187.00 ? 310 ASN 2 ND2 1 
ATOM 4999  N N   . ARG B 1 311 ? -20.878 59.617  199.642 1.00 130.06 ? 311 ARG 2 N   1 
ATOM 5000  C CA  . ARG B 1 311 ? -20.065 60.453  200.508 1.00 141.52 ? 311 ARG 2 CA  1 
ATOM 5001  C C   . ARG B 1 311 ? -20.679 61.870  200.460 1.00 144.26 ? 311 ARG 2 C   1 
ATOM 5002  O O   . ARG B 1 311 ? -20.429 62.692  201.345 1.00 146.83 ? 311 ARG 2 O   1 
ATOM 5003  C CB  . ARG B 1 311 ? -18.612 60.495  199.992 1.00 146.57 ? 311 ARG 2 CB  1 
ATOM 5004  C CG  . ARG B 1 311 ? -17.804 61.745  200.390 1.00 151.45 ? 311 ARG 2 CG  1 
ATOM 5005  C CD  . ARG B 1 311 ? -16.613 61.965  199.468 1.00 153.16 ? 311 ARG 2 CD  1 
ATOM 5006  N NE  . ARG B 1 311 ? -16.108 63.332  199.555 1.00 157.09 ? 311 ARG 2 NE  1 
ATOM 5007  C CZ  . ARG B 1 311 ? -15.766 64.076  198.505 1.00 158.07 ? 311 ARG 2 CZ  1 
ATOM 5008  N NH1 . ARG B 1 311 ? -15.863 63.591  197.264 1.00 143.64 ? 311 ARG 2 NH1 1 
ATOM 5009  N NH2 . ARG B 1 311 ? -15.337 65.320  198.704 1.00 160.99 ? 311 ARG 2 NH2 1 
ATOM 5010  N N   . ARG B 1 312 ? -21.536 62.125  199.468 1.00 144.87 ? 312 ARG 2 N   1 
ATOM 5011  C CA  . ARG B 1 312 ? -22.106 63.466  199.304 1.00 147.35 ? 312 ARG 2 CA  1 
ATOM 5012  C C   . ARG B 1 312 ? -23.557 63.701  198.870 1.00 147.86 ? 312 ARG 2 C   1 
ATOM 5013  O O   . ARG B 1 312 ? -23.914 64.847  198.539 1.00 146.01 ? 312 ARG 2 O   1 
ATOM 5014  C CB  . ARG B 1 312 ? -21.265 64.231  198.299 1.00 140.83 ? 312 ARG 2 CB  1 
ATOM 5015  C CG  . ARG B 1 312 ? -20.341 65.260  198.848 1.00 133.64 ? 312 ARG 2 CG  1 
ATOM 5016  C CD  . ARG B 1 312 ? -20.206 66.333  197.810 1.00 137.47 ? 312 ARG 2 CD  1 
ATOM 5017  N NE  . ARG B 1 312 ? -18.822 66.750  197.586 1.00 151.37 ? 312 ARG 2 NE  1 
ATOM 5018  C CZ  . ARG B 1 312 ? -18.450 67.591  196.620 1.00 154.65 ? 312 ARG 2 CZ  1 
ATOM 5019  N NH1 . ARG B 1 312 ? -19.363 68.079  195.785 1.00 153.27 ? 312 ARG 2 NH1 1 
ATOM 5020  N NH2 . ARG B 1 312 ? -17.184 67.998  196.528 1.00 154.48 ? 312 ARG 2 NH2 1 
ATOM 5021  N N   . THR B 1 313 ? -24.391 62.672  198.853 1.00 147.02 ? 313 THR 2 N   1 
ATOM 5022  C CA  . THR B 1 313 ? -25.749 62.921  198.417 1.00 153.37 ? 313 THR 2 CA  1 
ATOM 5023  C C   . THR B 1 313 ? -26.675 62.589  199.573 1.00 154.27 ? 313 THR 2 C   1 
ATOM 5024  O O   . THR B 1 313 ? -26.385 62.930  200.741 1.00 147.17 ? 313 THR 2 O   1 
ATOM 5025  C CB  . THR B 1 313 ? -26.106 62.169  197.076 1.00 156.13 ? 313 THR 2 CB  1 
ATOM 5026  O OG1 . THR B 1 313 ? -25.054 62.369  196.122 1.00 165.28 ? 313 THR 2 OG1 1 
ATOM 5027  C CG2 . THR B 1 313 ? -27.410 62.735  196.439 1.00 152.46 ? 313 THR 2 CG2 1 
ATOM 5028  N N   . GLN B 1 314 ? -27.748 61.869  199.278 1.00 157.21 ? 314 GLN 2 N   1 
ATOM 5029  C CA  . GLN B 1 314 ? -28.689 61.575  200.321 1.00 149.66 ? 314 GLN 2 CA  1 
ATOM 5030  C C   . GLN B 1 314 ? -28.500 60.354  201.171 1.00 145.55 ? 314 GLN 2 C   1 
ATOM 5031  O O   . GLN B 1 314 ? -28.445 59.211  200.698 1.00 148.11 ? 314 GLN 2 O   1 
ATOM 5032  C CB  . GLN B 1 314 ? -30.126 61.729  199.839 1.00 150.10 ? 314 GLN 2 CB  1 
ATOM 5033  C CG  . GLN B 1 314 ? -30.577 63.189  199.889 1.00 151.21 ? 314 GLN 2 CG  1 
ATOM 5034  C CD  . GLN B 1 314 ? -30.072 63.942  201.141 1.00 152.28 ? 314 GLN 2 CD  1 
ATOM 5035  O OE1 . GLN B 1 314 ? -29.789 63.352  202.193 1.00 149.52 ? 314 GLN 2 OE1 1 
ATOM 5036  N NE2 . GLN B 1 314 ? -29.926 65.248  201.005 1.00 151.31 ? 314 GLN 2 NE2 1 
ATOM 5037  N N   . ARG B 1 315 ? -28.379 60.641  202.457 1.00 136.17 ? 315 ARG 2 N   1 
ATOM 5038  C CA  . ARG B 1 315 ? -28.204 59.627  203.464 1.00 130.56 ? 315 ARG 2 CA  1 
ATOM 5039  C C   . ARG B 1 315 ? -29.517 59.624  204.237 1.00 108.21 ? 315 ARG 2 C   1 
ATOM 5040  O O   . ARG B 1 315 ? -30.007 60.686  204.628 1.00 98.43  ? 315 ARG 2 O   1 
ATOM 5041  C CB  . ARG B 1 315 ? -27.039 60.027  204.357 1.00 148.25 ? 315 ARG 2 CB  1 
ATOM 5042  C CG  . ARG B 1 315 ? -26.525 58.903  205.226 1.00 176.89 ? 315 ARG 2 CG  1 
ATOM 5043  C CD  . ARG B 1 315 ? -25.318 59.376  206.023 1.00 202.49 ? 315 ARG 2 CD  1 
ATOM 5044  N NE  . ARG B 1 315 ? -24.876 58.397  207.020 1.00 220.05 ? 315 ARG 2 NE  1 
ATOM 5045  C CZ  . ARG B 1 315 ? -23.787 58.534  207.779 1.00 225.74 ? 315 ARG 2 CZ  1 
ATOM 5046  N NH1 . ARG B 1 315 ? -23.015 59.614  207.659 1.00 230.47 ? 315 ARG 2 NH1 1 
ATOM 5047  N NH2 . ARG B 1 315 ? -23.466 57.588  208.659 1.00 225.05 ? 315 ARG 2 NH2 1 
ATOM 5048  N N   . VAL B 1 316 ? -30.115 58.449  204.418 1.00 85.04  ? 316 VAL 2 N   1 
ATOM 5049  C CA  . VAL B 1 316 ? -31.390 58.389  205.122 1.00 74.42  ? 316 VAL 2 CA  1 
ATOM 5050  C C   . VAL B 1 316 ? -31.613 57.292  206.178 1.00 80.09  ? 316 VAL 2 C   1 
ATOM 5051  O O   . VAL B 1 316 ? -31.379 56.063  205.957 1.00 68.10  ? 316 VAL 2 O   1 
ATOM 5052  C CB  . VAL B 1 316 ? -32.551 58.372  204.133 1.00 66.76  ? 316 VAL 2 CB  1 
ATOM 5053  C CG1 . VAL B 1 316 ? -33.849 58.537  204.847 1.00 49.36  ? 316 VAL 2 CG1 1 
ATOM 5054  C CG2 . VAL B 1 316 ? -32.383 59.461  203.123 1.00 76.98  ? 316 VAL 2 CG2 1 
ATOM 5055  N N   . ASP B 1 317 ? -32.128 57.764  207.312 1.00 78.85  ? 317 ASP 2 N   1 
ATOM 5056  C CA  . ASP B 1 317 ? -32.416 56.910  208.447 1.00 88.18  ? 317 ASP 2 CA  1 
ATOM 5057  C C   . ASP B 1 317 ? -33.877 56.645  208.579 1.00 80.12  ? 317 ASP 2 C   1 
ATOM 5058  O O   . ASP B 1 317 ? -34.665 57.499  209.009 1.00 73.09  ? 317 ASP 2 O   1 
ATOM 5059  C CB  . ASP B 1 317 ? -31.885 57.493  209.755 1.00 113.68 ? 317 ASP 2 CB  1 
ATOM 5060  C CG  . ASP B 1 317 ? -30.397 57.232  209.953 1.00 152.32 ? 317 ASP 2 CG  1 
ATOM 5061  O OD1 . ASP B 1 317 ? -29.824 56.351  209.257 1.00 174.96 ? 317 ASP 2 OD1 1 
ATOM 5062  O OD2 . ASP B 1 317 ? -29.801 57.912  210.818 1.00 175.26 ? 317 ASP 2 OD2 1 
ATOM 5063  N N   . GLY B 1 318 ? -34.236 55.442  208.176 1.00 72.84  ? 318 GLY 2 N   1 
ATOM 5064  C CA  . GLY B 1 318 ? -35.615 55.037  208.251 1.00 72.99  ? 318 GLY 2 CA  1 
ATOM 5065  C C   . GLY B 1 318 ? -35.629 53.539  208.236 1.00 58.44  ? 318 GLY 2 C   1 
ATOM 5066  O O   . GLY B 1 318 ? -34.637 52.934  207.821 1.00 69.74  ? 318 GLY 2 O   1 
ATOM 5067  N N   . GLN B 1 319 ? -36.763 52.979  208.656 1.00 43.53  ? 319 GLN 2 N   1 
ATOM 5068  C CA  . GLN B 1 319 ? -36.999 51.549  208.731 1.00 32.52  ? 319 GLN 2 CA  1 
ATOM 5069  C C   . GLN B 1 319 ? -36.052 50.697  207.850 1.00 39.50  ? 319 GLN 2 C   1 
ATOM 5070  O O   . GLN B 1 319 ? -35.734 51.012  206.674 1.00 47.30  ? 319 GLN 2 O   1 
ATOM 5071  C CB  . GLN B 1 319 ? -38.487 51.237  208.506 1.00 12.42  ? 319 GLN 2 CB  1 
ATOM 5072  C CG  . GLN B 1 319 ? -39.410 51.940  209.529 1.00 24.21  ? 319 GLN 2 CG  1 
ATOM 5073  C CD  . GLN B 1 319 ? -40.931 51.717  209.328 1.00 40.13  ? 319 GLN 2 CD  1 
ATOM 5074  O OE1 . GLN B 1 319 ? -41.402 50.605  209.027 1.00 43.69  ? 319 GLN 2 OE1 1 
ATOM 5075  N NE2 . GLN B 1 319 ? -41.701 52.780  209.532 1.00 49.20  ? 319 GLN 2 NE2 1 
ATOM 5076  N N   . PRO B 1 320 ? -35.508 49.656  208.468 1.00 26.28  ? 320 PRO 2 N   1 
ATOM 5077  C CA  . PRO B 1 320 ? -34.571 48.679  207.942 1.00 19.11  ? 320 PRO 2 CA  1 
ATOM 5078  C C   . PRO B 1 320 ? -35.003 47.848  206.774 1.00 27.95  ? 320 PRO 2 C   1 
ATOM 5079  O O   . PRO B 1 320 ? -35.942 47.050  206.865 1.00 34.03  ? 320 PRO 2 O   1 
ATOM 5080  C CB  . PRO B 1 320 ? -34.333 47.791  209.147 1.00 33.91  ? 320 PRO 2 CB  1 
ATOM 5081  C CG  . PRO B 1 320 ? -35.641 47.849  209.857 1.00 32.45  ? 320 PRO 2 CG  1 
ATOM 5082  C CD  . PRO B 1 320 ? -35.896 49.302  209.845 1.00 13.98  ? 320 PRO 2 CD  1 
ATOM 5083  N N   . MET B 1 321 ? -34.278 47.983  205.680 1.00 26.70  ? 321 MET 2 N   1 
ATOM 5084  C CA  . MET B 1 321 ? -34.602 47.172  204.534 1.00 31.50  ? 321 MET 2 CA  1 
ATOM 5085  C C   . MET B 1 321 ? -33.501 46.125  204.410 1.00 40.41  ? 321 MET 2 C   1 
ATOM 5086  O O   . MET B 1 321 ? -33.500 45.294  203.490 1.00 35.84  ? 321 MET 2 O   1 
ATOM 5087  C CB  . MET B 1 321 ? -34.786 48.010  203.259 1.00 42.75  ? 321 MET 2 CB  1 
ATOM 5088  C CG  . MET B 1 321 ? -36.018 48.939  203.247 1.00 33.63  ? 321 MET 2 CG  1 
ATOM 5089  S SD  . MET B 1 321 ? -37.544 48.292  204.045 1.00 49.85  ? 321 MET 2 SD  1 
ATOM 5090  C CE  . MET B 1 321 ? -37.654 46.799  203.309 1.00 35.99  ? 321 MET 2 CE  1 
ATOM 5091  N N   . ILE B 1 322 ? -32.544 46.173  205.338 1.00 52.37  ? 322 ILE 2 N   1 
ATOM 5092  C CA  . ILE B 1 322 ? -31.464 45.182  205.358 1.00 68.04  ? 322 ILE 2 CA  1 
ATOM 5093  C C   . ILE B 1 322 ? -31.077 44.766  206.758 1.00 78.49  ? 322 ILE 2 C   1 
ATOM 5094  O O   . ILE B 1 322 ? -31.420 45.429  207.747 1.00 90.88  ? 322 ILE 2 O   1 
ATOM 5095  C CB  . ILE B 1 322 ? -30.158 45.630  204.728 1.00 57.66  ? 322 ILE 2 CB  1 
ATOM 5096  C CG1 . ILE B 1 322 ? -30.392 46.379  203.436 1.00 84.14  ? 322 ILE 2 CG1 1 
ATOM 5097  C CG2 . ILE B 1 322 ? -29.348 44.380  204.366 1.00 74.19  ? 322 ILE 2 CG2 1 
ATOM 5098  C CD1 . ILE B 1 322 ? -29.104 46.593  202.644 1.00 107.02 ? 322 ILE 2 CD1 1 
ATOM 5099  N N   . GLY B 1 323 ? -30.335 43.670  206.837 1.00 71.41  ? 323 GLY 2 N   1 
ATOM 5100  C CA  . GLY B 1 323 ? -29.895 43.204  208.121 1.00 84.65  ? 323 GLY 2 CA  1 
ATOM 5101  C C   . GLY B 1 323 ? -30.839 42.109  208.485 1.00 87.03  ? 323 GLY 2 C   1 
ATOM 5102  O O   . GLY B 1 323 ? -31.589 41.607  207.645 1.00 79.99  ? 323 GLY 2 O   1 
ATOM 5103  N N   . MET B 1 324 ? -30.805 41.722  209.742 1.00 96.60  ? 324 MET 2 N   1 
ATOM 5104  C CA  . MET B 1 324 ? -31.685 40.666  210.142 1.00 107.44 ? 324 MET 2 CA  1 
ATOM 5105  C C   . MET B 1 324 ? -33.053 41.254  210.378 1.00 95.86  ? 324 MET 2 C   1 
ATOM 5106  O O   . MET B 1 324 ? -33.993 40.533  210.682 1.00 109.30 ? 324 MET 2 O   1 
ATOM 5107  C CB  . MET B 1 324 ? -31.147 39.910  211.366 1.00 142.41 ? 324 MET 2 CB  1 
ATOM 5108  C CG  . MET B 1 324 ? -30.918 40.736  212.630 1.00 176.46 ? 324 MET 2 CG  1 
ATOM 5109  S SD  . MET B 1 324 ? -30.412 39.679  214.035 1.00 205.94 ? 324 MET 2 SD  1 
ATOM 5110  C CE  . MET B 1 324 ? -32.033 39.286  214.807 1.00 184.65 ? 324 MET 2 CE  1 
ATOM 5111  N N   . SER B 1 325 ? -33.189 42.561  210.208 1.00 73.76  ? 325 SER 2 N   1 
ATOM 5112  C CA  . SER B 1 325 ? -34.499 43.146  210.420 1.00 75.78  ? 325 SER 2 CA  1 
ATOM 5113  C C   . SER B 1 325 ? -35.169 43.679  209.169 1.00 64.38  ? 325 SER 2 C   1 
ATOM 5114  O O   . SER B 1 325 ? -36.210 44.361  209.249 1.00 61.34  ? 325 SER 2 O   1 
ATOM 5115  C CB  . SER B 1 325 ? -34.435 44.208  211.503 1.00 88.70  ? 325 SER 2 CB  1 
ATOM 5116  O OG  . SER B 1 325 ? -34.225 43.598  212.765 1.00 113.78 ? 325 SER 2 OG  1 
ATOM 5117  N N   . SER B 1 326 ? -34.621 43.281  208.023 1.00 42.63  ? 326 SER 2 N   1 
ATOM 5118  C CA  . SER B 1 326 ? -35.122 43.720  206.743 1.00 33.55  ? 326 SER 2 CA  1 
ATOM 5119  C C   . SER B 1 326 ? -36.600 43.554  206.710 1.00 40.47  ? 326 SER 2 C   1 
ATOM 5120  O O   . SER B 1 326 ? -37.110 42.487  207.050 1.00 54.16  ? 326 SER 2 O   1 
ATOM 5121  C CB  . SER B 1 326 ? -34.529 42.899  205.617 1.00 33.52  ? 326 SER 2 CB  1 
ATOM 5122  O OG  . SER B 1 326 ? -35.188 43.192  204.395 1.00 47.06  ? 326 SER 2 OG  1 
ATOM 5123  N N   . GLN B 1 327 ? -37.289 44.623  206.337 1.00 36.52  ? 327 GLN 2 N   1 
ATOM 5124  C CA  . GLN B 1 327 ? -38.734 44.586  206.243 1.00 29.97  ? 327 GLN 2 CA  1 
ATOM 5125  C C   . GLN B 1 327 ? -39.101 44.266  204.785 1.00 29.01  ? 327 GLN 2 C   1 
ATOM 5126  O O   . GLN B 1 327 ? -40.213 44.567  204.313 1.00 30.85  ? 327 GLN 2 O   1 
ATOM 5127  C CB  . GLN B 1 327 ? -39.338 45.884  206.778 1.00 23.79  ? 327 GLN 2 CB  1 
ATOM 5128  C CG  . GLN B 1 327 ? -38.783 46.247  208.169 1.00 32.58  ? 327 GLN 2 CG  1 
ATOM 5129  C CD  . GLN B 1 327 ? -39.462 47.446  208.813 1.00 40.66  ? 327 GLN 2 CD  1 
ATOM 5130  O OE1 . GLN B 1 327 ? -39.268 47.724  209.995 1.00 52.08  ? 327 GLN 2 OE1 1 
ATOM 5131  N NE2 . GLN B 1 327 ? -40.280 48.148  208.050 1.00 49.77  ? 327 GLN 2 NE2 1 
ATOM 5132  N N   . VAL B 1 328 ? -38.094 43.779  204.052 1.00 6.96   ? 328 VAL 2 N   1 
ATOM 5133  C CA  . VAL B 1 328 ? -38.270 43.327  202.691 1.00 12.58  ? 328 VAL 2 CA  1 
ATOM 5134  C C   . VAL B 1 328 ? -38.602 41.865  202.985 1.00 23.28  ? 328 VAL 2 C   1 
ATOM 5135  O O   . VAL B 1 328 ? -37.805 41.152  203.594 1.00 34.34  ? 328 VAL 2 O   1 
ATOM 5136  C CB  . VAL B 1 328 ? -36.971 43.340  201.882 1.00 14.92  ? 328 VAL 2 CB  1 
ATOM 5137  C CG1 . VAL B 1 328 ? -37.076 42.365  200.718 1.00 4.29   ? 328 VAL 2 CG1 1 
ATOM 5138  C CG2 . VAL B 1 328 ? -36.693 44.708  201.347 1.00 19.62  ? 328 VAL 2 CG2 1 
ATOM 5139  N N   . GLU B 1 329 ? -39.805 41.448  202.636 1.00 25.13  ? 329 GLU 2 N   1 
ATOM 5140  C CA  . GLU B 1 329 ? -40.222 40.080  202.870 1.00 26.23  ? 329 GLU 2 CA  1 
ATOM 5141  C C   . GLU B 1 329 ? -39.903 39.135  201.693 1.00 29.93  ? 329 GLU 2 C   1 
ATOM 5142  O O   . GLU B 1 329 ? -39.725 37.921  201.892 1.00 42.86  ? 329 GLU 2 O   1 
ATOM 5143  C CB  . GLU B 1 329 ? -41.732 40.002  203.114 1.00 17.88  ? 329 GLU 2 CB  1 
ATOM 5144  C CG  . GLU B 1 329 ? -42.333 40.892  204.157 1.00 28.58  ? 329 GLU 2 CG  1 
ATOM 5145  C CD  . GLU B 1 329 ? -43.640 40.313  204.654 1.00 45.38  ? 329 GLU 2 CD  1 
ATOM 5146  O OE1 . GLU B 1 329 ? -43.570 39.267  205.337 1.00 57.16  ? 329 GLU 2 OE1 1 
ATOM 5147  O OE2 . GLU B 1 329 ? -44.731 40.849  204.339 1.00 38.01  ? 329 GLU 2 OE2 1 
ATOM 5148  N N   . GLU B 1 330 ? -39.851 39.658  200.471 1.00 18.16  ? 330 GLU 2 N   1 
ATOM 5149  C CA  . GLU B 1 330 ? -39.622 38.782  199.329 1.00 21.42  ? 330 GLU 2 CA  1 
ATOM 5150  C C   . GLU B 1 330 ? -39.172 39.569  198.100 1.00 28.44  ? 330 GLU 2 C   1 
ATOM 5151  O O   . GLU B 1 330 ? -39.570 40.734  197.873 1.00 31.31  ? 330 GLU 2 O   1 
ATOM 5152  C CB  . GLU B 1 330 ? -40.936 38.049  199.028 1.00 40.07  ? 330 GLU 2 CB  1 
ATOM 5153  C CG  . GLU B 1 330 ? -40.902 36.637  198.415 1.00 68.20  ? 330 GLU 2 CG  1 
ATOM 5154  C CD  . GLU B 1 330 ? -42.274 35.915  198.522 1.00 88.77  ? 330 GLU 2 CD  1 
ATOM 5155  O OE1 . GLU B 1 330 ? -43.244 36.287  197.801 1.00 68.58  ? 330 GLU 2 OE1 1 
ATOM 5156  O OE2 . GLU B 1 330 ? -42.366 34.959  199.341 1.00 108.75 ? 330 GLU 2 OE2 1 
ATOM 5157  N N   . VAL B 1 331 ? -38.294 38.936  197.338 1.00 4.84   ? 331 VAL 2 N   1 
ATOM 5158  C CA  . VAL B 1 331 ? -37.788 39.518  196.120 1.00 12.92  ? 331 VAL 2 CA  1 
ATOM 5159  C C   . VAL B 1 331 ? -37.782 38.436  195.072 1.00 18.30  ? 331 VAL 2 C   1 
ATOM 5160  O O   . VAL B 1 331 ? -37.325 37.326  195.326 1.00 28.55  ? 331 VAL 2 O   1 
ATOM 5161  C CB  . VAL B 1 331 ? -36.358 39.978  196.280 1.00 16.96  ? 331 VAL 2 CB  1 
ATOM 5162  C CG1 . VAL B 1 331 ? -35.785 40.394  194.903 1.00 19.42  ? 331 VAL 2 CG1 1 
ATOM 5163  C CG2 . VAL B 1 331 ? -36.290 41.096  197.316 1.00 6.21   ? 331 VAL 2 CG2 1 
ATOM 5164  N N   . ARG B 1 332 ? -38.316 38.720  193.902 1.00 19.65  ? 332 ARG 2 N   1 
ATOM 5165  C CA  . ARG B 1 332 ? -38.280 37.706  192.870 1.00 25.14  ? 332 ARG 2 CA  1 
ATOM 5166  C C   . ARG B 1 332 ? -37.632 38.408  191.709 1.00 17.09  ? 332 ARG 2 C   1 
ATOM 5167  O O   . ARG B 1 332 ? -37.748 39.625  191.563 1.00 23.05  ? 332 ARG 2 O   1 
ATOM 5168  C CB  . ARG B 1 332 ? -39.684 37.218  192.495 1.00 34.21  ? 332 ARG 2 CB  1 
ATOM 5169  C CG  . ARG B 1 332 ? -40.712 37.412  193.588 1.00 48.64  ? 332 ARG 2 CG  1 
ATOM 5170  C CD  . ARG B 1 332 ? -42.070 36.898  193.174 1.00 60.31  ? 332 ARG 2 CD  1 
ATOM 5171  N NE  . ARG B 1 332 ? -42.130 35.440  193.229 1.00 50.85  ? 332 ARG 2 NE  1 
ATOM 5172  C CZ  . ARG B 1 332 ? -42.617 34.766  194.267 1.00 58.03  ? 332 ARG 2 CZ  1 
ATOM 5173  N NH1 . ARG B 1 332 ? -43.084 35.433  195.338 1.00 59.96  ? 332 ARG 2 NH1 1 
ATOM 5174  N NH2 . ARG B 1 332 ? -42.637 33.428  194.228 1.00 43.71  ? 332 ARG 2 NH2 1 
ATOM 5175  N N   . VAL B 1 333 ? -36.903 37.655  190.913 1.00 14.67  ? 333 VAL 2 N   1 
ATOM 5176  C CA  . VAL B 1 333 ? -36.239 38.237  189.782 1.00 19.21  ? 333 VAL 2 CA  1 
ATOM 5177  C C   . VAL B 1 333 ? -36.521 37.480  188.516 1.00 17.17  ? 333 VAL 2 C   1 
ATOM 5178  O O   . VAL B 1 333 ? -36.569 36.251  188.518 1.00 27.48  ? 333 VAL 2 O   1 
ATOM 5179  C CB  . VAL B 1 333 ? -34.777 38.228  189.992 1.00 16.81  ? 333 VAL 2 CB  1 
ATOM 5180  C CG1 . VAL B 1 333 ? -34.134 38.787  188.774 1.00 24.25  ? 333 VAL 2 CG1 1 
ATOM 5181  C CG2 . VAL B 1 333 ? -34.435 39.049  191.233 1.00 25.64  ? 333 VAL 2 CG2 1 
ATOM 5182  N N   . TYR B 1 334 ? -36.637 38.192  187.416 1.00 3.34   ? 334 TYR 2 N   1 
ATOM 5183  C CA  . TYR B 1 334 ? -36.938 37.481  186.210 1.00 13.95  ? 334 TYR 2 CA  1 
ATOM 5184  C C   . TYR B 1 334 ? -36.155 37.996  185.093 1.00 15.70  ? 334 TYR 2 C   1 
ATOM 5185  O O   . TYR B 1 334 ? -35.867 39.190  185.034 1.00 31.89  ? 334 TYR 2 O   1 
ATOM 5186  C CB  . TYR B 1 334 ? -38.394 37.676  185.795 1.00 13.80  ? 334 TYR 2 CB  1 
ATOM 5187  C CG  . TYR B 1 334 ? -39.408 37.257  186.813 1.00 21.37  ? 334 TYR 2 CG  1 
ATOM 5188  C CD1 . TYR B 1 334 ? -39.632 38.025  187.966 1.00 23.37  ? 334 TYR 2 CD1 1 
ATOM 5189  C CD2 . TYR B 1 334 ? -40.153 36.091  186.632 1.00 34.00  ? 334 TYR 2 CD2 1 
ATOM 5190  C CE1 . TYR B 1 334 ? -40.565 37.637  188.925 1.00 28.29  ? 334 TYR 2 CE1 1 
ATOM 5191  C CE2 . TYR B 1 334 ? -41.090 35.691  187.577 1.00 46.31  ? 334 TYR 2 CE2 1 
ATOM 5192  C CZ  . TYR B 1 334 ? -41.298 36.466  188.723 1.00 43.10  ? 334 TYR 2 CZ  1 
ATOM 5193  O OH  . TYR B 1 334 ? -42.212 36.031  189.663 1.00 45.20  ? 334 TYR 2 OH  1 
ATOM 5194  N N   . GLU B 1 335 ? -35.848 37.098  184.196 1.00 16.16  ? 335 GLU 2 N   1 
ATOM 5195  C CA  . GLU B 1 335 ? -35.192 37.435  182.960 1.00 24.38  ? 335 GLU 2 CA  1 
ATOM 5196  C C   . GLU B 1 335 ? -35.788 36.398  182.067 1.00 26.80  ? 335 GLU 2 C   1 
ATOM 5197  O O   . GLU B 1 335 ? -36.178 35.337  182.552 1.00 38.94  ? 335 GLU 2 O   1 
ATOM 5198  C CB  . GLU B 1 335 ? -33.673 37.245  183.051 1.00 36.04  ? 335 GLU 2 CB  1 
ATOM 5199  C CG  . GLU B 1 335 ? -32.893 38.168  182.067 1.00 48.60  ? 335 GLU 2 CG  1 
ATOM 5200  C CD  . GLU B 1 335 ? -31.399 37.986  182.039 1.00 62.46  ? 335 GLU 2 CD  1 
ATOM 5201  O OE1 . GLU B 1 335 ? -30.800 37.553  183.067 1.00 70.74  ? 335 GLU 2 OE1 1 
ATOM 5202  O OE2 . GLU B 1 335 ? -30.797 38.289  180.956 1.00 74.99  ? 335 GLU 2 OE2 1 
ATOM 5203  N N   . ASP B 1 336 ? -35.921 36.722  180.799 1.00 48.24  ? 336 ASP 2 N   1 
ATOM 5204  C CA  . ASP B 1 336 ? -36.489 35.821  179.782 1.00 61.76  ? 336 ASP 2 CA  1 
ATOM 5205  C C   . ASP B 1 336 ? -37.834 35.235  180.198 1.00 54.07  ? 336 ASP 2 C   1 
ATOM 5206  O O   . ASP B 1 336 ? -38.524 35.746  181.098 1.00 60.42  ? 336 ASP 2 O   1 
ATOM 5207  C CB  . ASP B 1 336 ? -35.516 34.685  179.434 1.00 78.50  ? 336 ASP 2 CB  1 
ATOM 5208  C CG  . ASP B 1 336 ? -34.153 35.157  178.974 1.00 98.06  ? 336 ASP 2 CG  1 
ATOM 5209  O OD1 . ASP B 1 336 ? -34.103 36.173  178.207 1.00 104.44 ? 336 ASP 2 OD1 1 
ATOM 5210  O OD2 . ASP B 1 336 ? -33.142 34.496  179.360 1.00 112.18 ? 336 ASP 2 OD2 1 
ATOM 5211  N N   . THR B 1 337 ? -38.163 34.122  179.588 1.00 46.58  ? 337 THR 2 N   1 
ATOM 5212  C CA  . THR B 1 337 ? -39.420 33.463  179.853 1.00 48.67  ? 337 THR 2 CA  1 
ATOM 5213  C C   . THR B 1 337 ? -39.300 31.971  179.818 1.00 43.19  ? 337 THR 2 C   1 
ATOM 5214  O O   . THR B 1 337 ? -38.350 31.444  179.256 1.00 51.35  ? 337 THR 2 O   1 
ATOM 5215  C CB  . THR B 1 337 ? -40.361 33.800  178.766 1.00 34.56  ? 337 THR 2 CB  1 
ATOM 5216  O OG1 . THR B 1 337 ? -39.642 33.810  177.528 1.00 34.99  ? 337 THR 2 OG1 1 
ATOM 5217  C CG2 . THR B 1 337 ? -40.968 35.112  179.018 1.00 43.59  ? 337 THR 2 CG2 1 
ATOM 5218  N N   . GLU B 1 338 ? -40.360 31.307  180.253 1.00 35.33  ? 338 GLU 2 N   1 
ATOM 5219  C CA  . GLU B 1 338 ? -40.432 29.862  180.280 1.00 35.55  ? 338 GLU 2 CA  1 
ATOM 5220  C C   . GLU B 1 338 ? -41.880 29.431  180.152 1.00 37.35  ? 338 GLU 2 C   1 
ATOM 5221  O O   . GLU B 1 338 ? -42.797 30.247  180.298 1.00 44.75  ? 338 GLU 2 O   1 
ATOM 5222  C CB  . GLU B 1 338 ? -39.870 29.334  181.588 1.00 15.34  ? 338 GLU 2 CB  1 
ATOM 5223  C CG  . GLU B 1 338 ? -40.679 29.713  182.798 1.00 37.98  ? 338 GLU 2 CG  1 
ATOM 5224  C CD  . GLU B 1 338 ? -39.917 29.436  184.074 1.00 55.23  ? 338 GLU 2 CD  1 
ATOM 5225  O OE1 . GLU B 1 338 ? -39.125 28.457  184.044 1.00 34.61  ? 338 GLU 2 OE1 1 
ATOM 5226  O OE2 . GLU B 1 338 ? -40.073 30.190  185.083 1.00 61.13  ? 338 GLU 2 OE2 1 
ATOM 5227  N N   . GLU B 1 339 ? -42.097 28.154  179.852 1.00 39.17  ? 339 GLU 2 N   1 
ATOM 5228  C CA  . GLU B 1 339 ? -43.468 27.660  179.752 1.00 34.72  ? 339 GLU 2 CA  1 
ATOM 5229  C C   . GLU B 1 339 ? -44.088 27.774  181.143 1.00 29.57  ? 339 GLU 2 C   1 
ATOM 5230  O O   . GLU B 1 339 ? -43.432 27.580  182.172 1.00 23.15  ? 339 GLU 2 O   1 
ATOM 5231  C CB  . GLU B 1 339 ? -43.521 26.207  179.277 1.00 43.75  ? 339 GLU 2 CB  1 
ATOM 5232  C CG  . GLU B 1 339 ? -42.421 25.803  178.275 1.00 79.56  ? 339 GLU 2 CG  1 
ATOM 5233  C CD  . GLU B 1 339 ? -42.678 24.430  177.645 1.00 84.08  ? 339 GLU 2 CD  1 
ATOM 5234  O OE1 . GLU B 1 339 ? -42.689 23.406  178.382 1.00 90.11  ? 339 GLU 2 OE1 1 
ATOM 5235  O OE2 . GLU B 1 339 ? -42.873 24.381  176.408 1.00 78.10  ? 339 GLU 2 OE2 1 
ATOM 5236  N N   . LEU B 1 340 ? -45.352 28.118  181.176 1.00 25.78  ? 340 LEU 2 N   1 
ATOM 5237  C CA  . LEU B 1 340 ? -46.019 28.274  182.435 1.00 24.35  ? 340 LEU 2 CA  1 
ATOM 5238  C C   . LEU B 1 340 ? -45.828 27.121  183.448 1.00 22.26  ? 340 LEU 2 C   1 
ATOM 5239  O O   . LEU B 1 340 ? -46.305 25.991  183.297 1.00 28.56  ? 340 LEU 2 O   1 
ATOM 5240  C CB  . LEU B 1 340 ? -47.481 28.560  182.168 1.00 21.64  ? 340 LEU 2 CB  1 
ATOM 5241  C CG  . LEU B 1 340 ? -48.312 28.465  183.417 1.00 31.46  ? 340 LEU 2 CG  1 
ATOM 5242  C CD1 . LEU B 1 340 ? -47.691 29.311  184.509 1.00 37.97  ? 340 LEU 2 CD1 1 
ATOM 5243  C CD2 . LEU B 1 340 ? -49.709 28.886  183.079 1.00 49.19  ? 340 LEU 2 CD2 1 
ATOM 5244  N N   . PRO B 1 341 ? -45.084 27.393  184.488 1.00 7.65   ? 341 PRO 2 N   1 
ATOM 5245  C CA  . PRO B 1 341 ? -44.839 26.396  185.518 1.00 24.85  ? 341 PRO 2 CA  1 
ATOM 5246  C C   . PRO B 1 341 ? -46.035 26.049  186.400 1.00 24.37  ? 341 PRO 2 C   1 
ATOM 5247  O O   . PRO B 1 341 ? -46.778 26.903  186.870 1.00 30.40  ? 341 PRO 2 O   1 
ATOM 5248  C CB  . PRO B 1 341 ? -43.724 27.029  186.339 1.00 24.33  ? 341 PRO 2 CB  1 
ATOM 5249  C CG  . PRO B 1 341 ? -43.931 28.478  186.129 1.00 37.63  ? 341 PRO 2 CG  1 
ATOM 5250  C CD  . PRO B 1 341 ? -44.189 28.527  184.646 1.00 14.02  ? 341 PRO 2 CD  1 
ATOM 5251  N N   . GLY B 1 342 ? -46.137 24.775  186.692 1.00 21.71  ? 342 GLY 2 N   1 
ATOM 5252  C CA  . GLY B 1 342 ? -47.196 24.307  187.531 1.00 16.07  ? 342 GLY 2 CA  1 
ATOM 5253  C C   . GLY B 1 342 ? -47.157 24.692  188.998 1.00 18.64  ? 342 GLY 2 C   1 
ATOM 5254  O O   . GLY B 1 342 ? -48.195 24.904  189.590 1.00 29.01  ? 342 GLY 2 O   1 
ATOM 5255  N N   . ASP B 1 343 ? -46.021 24.648  189.667 1.00 31.19  ? 343 ASP 2 N   1 
ATOM 5256  C CA  . ASP B 1 343 ? -46.071 25.042  191.074 1.00 29.42  ? 343 ASP 2 CA  1 
ATOM 5257  C C   . ASP B 1 343 ? -45.652 26.492  191.084 1.00 35.29  ? 343 ASP 2 C   1 
ATOM 5258  O O   . ASP B 1 343 ? -44.505 26.832  190.841 1.00 39.90  ? 343 ASP 2 O   1 
ATOM 5259  C CB  . ASP B 1 343 ? -45.153 24.222  192.006 1.00 11.68  ? 343 ASP 2 CB  1 
ATOM 5260  C CG  . ASP B 1 343 ? -45.315 24.647  193.456 1.00 25.35  ? 343 ASP 2 CG  1 
ATOM 5261  O OD1 . ASP B 1 343 ? -46.132 25.561  193.643 1.00 21.39  ? 343 ASP 2 OD1 1 
ATOM 5262  O OD2 . ASP B 1 343 ? -44.709 24.091  194.417 1.00 27.78  ? 343 ASP 2 OD2 1 
ATOM 5263  N N   . PRO B 1 344 ? -46.597 27.381  191.294 1.00 40.72  ? 344 PRO 2 N   1 
ATOM 5264  C CA  . PRO B 1 344 ? -46.249 28.792  191.314 1.00 42.25  ? 344 PRO 2 CA  1 
ATOM 5265  C C   . PRO B 1 344 ? -45.456 29.182  192.557 1.00 39.34  ? 344 PRO 2 C   1 
ATOM 5266  O O   . PRO B 1 344 ? -44.849 30.244  192.599 1.00 43.80  ? 344 PRO 2 O   1 
ATOM 5267  C CB  . PRO B 1 344 ? -47.606 29.455  191.270 1.00 37.52  ? 344 PRO 2 CB  1 
ATOM 5268  C CG  . PRO B 1 344 ? -48.396 28.494  190.506 1.00 37.91  ? 344 PRO 2 CG  1 
ATOM 5269  C CD  . PRO B 1 344 ? -48.044 27.230  191.202 1.00 44.46  ? 344 PRO 2 CD  1 
ATOM 5270  N N   . ASP B 1 345 ? -45.476 28.361  193.590 1.00 40.08  ? 345 ASP 2 N   1 
ATOM 5271  C CA  . ASP B 1 345 ? -44.682 28.697  194.756 1.00 44.78  ? 345 ASP 2 CA  1 
ATOM 5272  C C   . ASP B 1 345 ? -43.302 28.088  194.607 1.00 41.93  ? 345 ASP 2 C   1 
ATOM 5273  O O   . ASP B 1 345 ? -42.489 28.121  195.544 1.00 40.50  ? 345 ASP 2 O   1 
ATOM 5274  C CB  . ASP B 1 345 ? -45.330 28.182  196.016 1.00 61.29  ? 345 ASP 2 CB  1 
ATOM 5275  C CG  . ASP B 1 345 ? -46.714 28.687  196.174 1.00 63.69  ? 345 ASP 2 CG  1 
ATOM 5276  O OD1 . ASP B 1 345 ? -46.871 29.842  196.630 1.00 68.58  ? 345 ASP 2 OD1 1 
ATOM 5277  O OD2 . ASP B 1 345 ? -47.631 27.921  195.816 1.00 80.66  ? 345 ASP 2 OD2 1 
ATOM 5278  N N   . MET B 1 346 ? -43.028 27.554  193.422 1.00 21.77  ? 346 MET 2 N   1 
ATOM 5279  C CA  . MET B 1 346 ? -41.745 26.952  193.179 1.00 23.74  ? 346 MET 2 CA  1 
ATOM 5280  C C   . MET B 1 346 ? -40.673 27.931  193.585 1.00 29.97  ? 346 MET 2 C   1 
ATOM 5281  O O   . MET B 1 346 ? -40.901 29.146  193.622 1.00 35.34  ? 346 MET 2 O   1 
ATOM 5282  C CB  . MET B 1 346 ? -41.565 26.662  191.712 1.00 18.49  ? 346 MET 2 CB  1 
ATOM 5283  C CG  . MET B 1 346 ? -41.010 27.833  190.930 1.00 2.00   ? 346 MET 2 CG  1 
ATOM 5284  S SD  . MET B 1 346 ? -41.144 27.350  189.211 1.00 36.49  ? 346 MET 2 SD  1 
ATOM 5285  C CE  . MET B 1 346 ? -40.251 28.637  188.321 1.00 34.98  ? 346 MET 2 CE  1 
ATOM 5286  N N   . ILE B 1 347 ? -39.487 27.396  193.828 1.00 38.81  ? 347 ILE 2 N   1 
ATOM 5287  C CA  . ILE B 1 347 ? -38.361 28.214  194.206 1.00 28.57  ? 347 ILE 2 CA  1 
ATOM 5288  C C   . ILE B 1 347 ? -37.115 28.022  193.416 1.00 29.87  ? 347 ILE 2 C   1 
ATOM 5289  O O   . ILE B 1 347 ? -36.445 26.994  193.462 1.00 47.77  ? 347 ILE 2 O   1 
ATOM 5290  C CB  . ILE B 1 347 ? -37.940 27.983  195.584 1.00 9.97   ? 347 ILE 2 CB  1 
ATOM 5291  C CG1 . ILE B 1 347 ? -39.063 28.345  196.498 1.00 11.22  ? 347 ILE 2 CG1 1 
ATOM 5292  C CG2 . ILE B 1 347 ? -36.707 28.812  195.867 1.00 8.88   ? 347 ILE 2 CG2 1 
ATOM 5293  C CD1 . ILE B 1 347 ? -38.699 28.073  197.876 1.00 34.51  ? 347 ILE 2 CD1 1 
ATOM 5294  N N   . ARG B 1 348 ? -36.712 29.102  192.820 1.00 29.14  ? 348 ARG 2 N   1 
ATOM 5295  C CA  . ARG B 1 348 ? -35.516 29.066  192.084 1.00 32.00  ? 348 ARG 2 CA  1 
ATOM 5296  C C   . ARG B 1 348 ? -34.534 29.788  192.953 1.00 41.53  ? 348 ARG 2 C   1 
ATOM 5297  O O   . ARG B 1 348 ? -34.888 30.752  193.657 1.00 29.58  ? 348 ARG 2 O   1 
ATOM 5298  C CB  . ARG B 1 348 ? -35.749 29.737  190.772 1.00 22.25  ? 348 ARG 2 CB  1 
ATOM 5299  C CG  . ARG B 1 348 ? -36.665 28.889  189.964 1.00 13.66  ? 348 ARG 2 CG  1 
ATOM 5300  C CD  . ARG B 1 348 ? -36.185 28.943  188.576 1.00 18.34  ? 348 ARG 2 CD  1 
ATOM 5301  N NE  . ARG B 1 348 ? -36.640 27.820  187.795 1.00 26.10  ? 348 ARG 2 NE  1 
ATOM 5302  C CZ  . ARG B 1 348 ? -37.457 27.931  186.760 1.00 41.63  ? 348 ARG 2 CZ  1 
ATOM 5303  N NH1 . ARG B 1 348 ? -37.924 29.117  186.397 1.00 55.35  ? 348 ARG 2 NH1 1 
ATOM 5304  N NH2 . ARG B 1 348 ? -37.713 26.865  186.025 1.00 77.71  ? 348 ARG 2 NH2 1 
ATOM 5305  N N   . TYR B 1 349 ? -33.353 29.198  193.048 1.00 48.80  ? 349 TYR 2 N   1 
ATOM 5306  C CA  . TYR B 1 349 ? -32.300 29.784  193.828 1.00 38.58  ? 349 TYR 2 CA  1 
ATOM 5307  C C   . TYR B 1 349 ? -31.003 29.474  193.202 1.00 40.69  ? 349 TYR 2 C   1 
ATOM 5308  O O   . TYR B 1 349 ? -30.927 28.834  192.149 1.00 38.38  ? 349 TYR 2 O   1 
ATOM 5309  C CB  . TYR B 1 349 ? -32.263 29.226  195.221 1.00 26.67  ? 349 TYR 2 CB  1 
ATOM 5310  C CG  . TYR B 1 349 ? -31.890 30.287  196.220 1.00 42.23  ? 349 TYR 2 CG  1 
ATOM 5311  C CD1 . TYR B 1 349 ? -32.871 31.092  196.788 1.00 67.40  ? 349 TYR 2 CD1 1 
ATOM 5312  C CD2 . TYR B 1 349 ? -30.578 30.501  196.591 1.00 20.59  ? 349 TYR 2 CD2 1 
ATOM 5313  C CE1 . TYR B 1 349 ? -32.554 32.085  197.711 1.00 72.50  ? 349 TYR 2 CE1 1 
ATOM 5314  C CE2 . TYR B 1 349 ? -30.243 31.495  197.516 1.00 51.55  ? 349 TYR 2 CE2 1 
ATOM 5315  C CZ  . TYR B 1 349 ? -31.239 32.286  198.075 1.00 56.30  ? 349 TYR 2 CZ  1 
ATOM 5316  O OH  . TYR B 1 349 ? -30.943 33.263  199.015 1.00 64.99  ? 349 TYR 2 OH  1 
ATOM 5317  N N   . ILE B 1 350 ? -29.972 30.016  193.817 1.00 42.81  ? 350 ILE 2 N   1 
ATOM 5318  C CA  . ILE B 1 350 ? -28.642 29.756  193.361 1.00 48.61  ? 350 ILE 2 CA  1 
ATOM 5319  C C   . ILE B 1 350 ? -27.725 29.580  194.553 1.00 60.97  ? 350 ILE 2 C   1 
ATOM 5320  O O   . ILE B 1 350 ? -27.693 30.413  195.468 1.00 58.22  ? 350 ILE 2 O   1 
ATOM 5321  C CB  . ILE B 1 350 ? -28.156 30.813  192.436 1.00 19.42  ? 350 ILE 2 CB  1 
ATOM 5322  C CG1 . ILE B 1 350 ? -29.175 31.000  191.316 1.00 12.32  ? 350 ILE 2 CG1 1 
ATOM 5323  C CG2 . ILE B 1 350 ? -26.854 30.349  191.840 1.00 40.01  ? 350 ILE 2 CG2 1 
ATOM 5324  C CD1 . ILE B 1 350 ? -28.832 32.078  190.343 1.00 21.88  ? 350 ILE 2 CD1 1 
ATOM 5325  N N   . ASP B 1 351 ? -27.164 28.373  194.595 1.00 81.59  ? 351 ASP 2 N   1 
ATOM 5326  C CA  . ASP B 1 351 ? -26.224 27.844  195.604 1.00 88.17  ? 351 ASP 2 CA  1 
ATOM 5327  C C   . ASP B 1 351 ? -24.988 28.737  195.710 1.00 89.05  ? 351 ASP 2 C   1 
ATOM 5328  O O   . ASP B 1 351 ? -24.969 29.705  196.488 1.00 101.11 ? 351 ASP 2 O   1 
ATOM 5329  C CB  . ASP B 1 351 ? -25.809 26.436  195.146 1.00 84.60  ? 351 ASP 2 CB  1 
ATOM 5330  C CG  . ASP B 1 351 ? -25.536 26.375  193.627 1.00 83.64  ? 351 ASP 2 CG  1 
ATOM 5331  O OD1 . ASP B 1 351 ? -25.585 27.439  192.970 1.00 65.45  ? 351 ASP 2 OD1 1 
ATOM 5332  O OD2 . ASP B 1 351 ? -25.272 25.280  193.083 1.00 78.44  ? 351 ASP 2 OD2 1 
ATOM 5333  N N   . GLU B 1 352 ? -23.928 28.328  195.017 1.00 73.03  ? 352 GLU 2 N   1 
ATOM 5334  C CA  . GLU B 1 352 ? -22.703 29.089  194.930 1.00 68.72  ? 352 GLU 2 CA  1 
ATOM 5335  C C   . GLU B 1 352 ? -22.317 29.021  193.479 1.00 69.29  ? 352 GLU 2 C   1 
ATOM 5336  O O   . GLU B 1 352 ? -21.170 29.257  193.156 1.00 81.35  ? 352 GLU 2 O   1 
ATOM 5337  C CB  . GLU B 1 352 ? -21.565 28.506  195.751 1.00 55.86  ? 352 GLU 2 CB  1 
ATOM 5338  C CG  . GLU B 1 352 ? -21.757 28.561  197.237 1.00 101.92 ? 352 GLU 2 CG  1 
ATOM 5339  C CD  . GLU B 1 352 ? -22.058 27.190  197.812 1.00 130.63 ? 352 GLU 2 CD  1 
ATOM 5340  O OE1 . GLU B 1 352 ? -21.289 26.238  197.525 1.00 142.72 ? 352 GLU 2 OE1 1 
ATOM 5341  O OE2 . GLU B 1 352 ? -23.063 27.064  198.548 1.00 149.62 ? 352 GLU 2 OE2 1 
ATOM 5342  N N   . PHE B 1 353 ? -23.242 28.580  192.623 1.00 70.15  ? 353 PHE 2 N   1 
ATOM 5343  C CA  . PHE B 1 353 ? -23.005 28.450  191.171 1.00 79.31  ? 353 PHE 2 CA  1 
ATOM 5344  C C   . PHE B 1 353 ? -24.241 28.110  190.263 1.00 82.82  ? 353 PHE 2 C   1 
ATOM 5345  O O   . PHE B 1 353 ? -24.537 28.854  189.318 1.00 75.46  ? 353 PHE 2 O   1 
ATOM 5346  C CB  . PHE B 1 353 ? -21.840 27.463  190.894 1.00 81.02  ? 353 PHE 2 CB  1 
ATOM 5347  C CG  . PHE B 1 353 ? -21.377 26.676  192.130 1.00 116.88 ? 353 PHE 2 CG  1 
ATOM 5348  C CD1 . PHE B 1 353 ? -22.285 25.961  192.913 1.00 134.35 ? 353 PHE 2 CD1 1 
ATOM 5349  C CD2 . PHE B 1 353 ? -20.042 26.703  192.540 1.00 136.05 ? 353 PHE 2 CD2 1 
ATOM 5350  C CE1 . PHE B 1 353 ? -21.871 25.291  194.089 1.00 145.98 ? 353 PHE 2 CE1 1 
ATOM 5351  C CE2 . PHE B 1 353 ? -19.621 26.032  193.720 1.00 144.09 ? 353 PHE 2 CE2 1 
ATOM 5352  C CZ  . PHE B 1 353 ? -20.539 25.329  194.489 1.00 137.96 ? 353 PHE 2 CZ  1 
ATOM 5353  N N   . GLY B 1 354 ? -24.949 27.006  190.525 1.00 75.86  ? 354 GLY 2 N   1 
ATOM 5354  C CA  . GLY B 1 354 ? -26.091 26.642  189.691 1.00 68.17  ? 354 GLY 2 CA  1 
ATOM 5355  C C   . GLY B 1 354 ? -27.481 27.068  190.179 1.00 70.96  ? 354 GLY 2 C   1 
ATOM 5356  O O   . GLY B 1 354 ? -27.653 27.544  191.311 1.00 63.98  ? 354 GLY 2 O   1 
ATOM 5357  N N   . GLN B 1 355 ? -28.491 26.878  189.325 1.00 65.41  ? 355 GLN 2 N   1 
ATOM 5358  C CA  . GLN B 1 355 ? -29.872 27.223  189.671 1.00 62.37  ? 355 GLN 2 CA  1 
ATOM 5359  C C   . GLN B 1 355 ? -30.682 26.021  190.184 1.00 61.02  ? 355 GLN 2 C   1 
ATOM 5360  O O   . GLN B 1 355 ? -30.888 25.040  189.485 1.00 59.38  ? 355 GLN 2 O   1 
ATOM 5361  C CB  . GLN B 1 355 ? -30.572 27.861  188.482 1.00 51.89  ? 355 GLN 2 CB  1 
ATOM 5362  C CG  . GLN B 1 355 ? -31.585 28.933  188.879 1.00 105.52 ? 355 GLN 2 CG  1 
ATOM 5363  C CD  . GLN B 1 355 ? -31.625 30.136  187.905 1.00 131.23 ? 355 GLN 2 CD  1 
ATOM 5364  O OE1 . GLN B 1 355 ? -30.578 30.671  187.526 1.00 150.95 ? 355 GLN 2 OE1 1 
ATOM 5365  N NE2 . GLN B 1 355 ? -32.835 30.567  187.515 1.00 129.16 ? 355 GLN 2 NE2 1 
ATOM 5366  N N   . THR B 1 356 ? -31.113 26.108  191.431 1.00 62.62  ? 356 THR 2 N   1 
ATOM 5367  C CA  . THR B 1 356 ? -31.899 25.075  192.086 1.00 60.70  ? 356 THR 2 CA  1 
ATOM 5368  C C   . THR B 1 356 ? -33.362 25.449  191.928 1.00 63.31  ? 356 THR 2 C   1 
ATOM 5369  O O   . THR B 1 356 ? -33.716 26.625  192.014 1.00 69.29  ? 356 THR 2 O   1 
ATOM 5370  C CB  . THR B 1 356 ? -31.692 25.141  193.579 1.00 74.88  ? 356 THR 2 CB  1 
ATOM 5371  O OG1 . THR B 1 356 ? -30.360 25.591  193.865 1.00 91.64  ? 356 THR 2 OG1 1 
ATOM 5372  C CG2 . THR B 1 356 ? -31.950 23.803  194.208 1.00 82.87  ? 356 THR 2 CG2 1 
ATOM 5373  N N   . THR B 1 357 ? -34.220 24.452  191.795 1.00 54.26  ? 357 THR 2 N   1 
ATOM 5374  C CA  . THR B 1 357 ? -35.647 24.697  191.654 1.00 41.22  ? 357 THR 2 CA  1 
ATOM 5375  C C   . THR B 1 357 ? -36.332 23.703  192.546 1.00 30.06  ? 357 THR 2 C   1 
ATOM 5376  O O   . THR B 1 357 ? -36.333 22.535  192.246 1.00 52.08  ? 357 THR 2 O   1 
ATOM 5377  C CB  . THR B 1 357 ? -36.114 24.395  190.243 1.00 41.87  ? 357 THR 2 CB  1 
ATOM 5378  O OG1 . THR B 1 357 ? -35.161 24.896  189.295 1.00 59.16  ? 357 THR 2 OG1 1 
ATOM 5379  C CG2 . THR B 1 357 ? -37.463 25.002  190.012 1.00 35.90  ? 357 THR 2 CG2 1 
ATOM 5380  N N   . THR B 1 358 ? -36.870 24.118  193.671 1.00 33.74  ? 358 THR 2 N   1 
ATOM 5381  C CA  . THR B 1 358 ? -37.527 23.149  194.537 1.00 43.14  ? 358 THR 2 CA  1 
ATOM 5382  C C   . THR B 1 358 ? -38.777 23.724  195.141 1.00 43.09  ? 358 THR 2 C   1 
ATOM 5383  O O   . THR B 1 358 ? -38.946 24.947  195.184 1.00 36.36  ? 358 THR 2 O   1 
ATOM 5384  C CB  . THR B 1 358 ? -36.614 22.693  195.694 1.00 59.64  ? 358 THR 2 CB  1 
ATOM 5385  O OG1 . THR B 1 358 ? -36.044 23.845  196.332 1.00 80.71  ? 358 THR 2 OG1 1 
ATOM 5386  C CG2 . THR B 1 358 ? -35.499 21.736  195.192 1.00 65.35  ? 358 THR 2 CG2 1 
ATOM 5387  N N   . ARG B 1 359 ? -39.677 22.843  195.556 1.00 35.23  ? 359 ARG 2 N   1 
ATOM 5388  C CA  . ARG B 1 359 ? -40.899 23.291  196.176 1.00 41.35  ? 359 ARG 2 CA  1 
ATOM 5389  C C   . ARG B 1 359 ? -40.518 23.722  197.569 1.00 51.76  ? 359 ARG 2 C   1 
ATOM 5390  O O   . ARG B 1 359 ? -39.452 23.369  198.072 1.00 50.18  ? 359 ARG 2 O   1 
ATOM 5391  C CB  . ARG B 1 359 ? -41.877 22.160  196.287 1.00 33.95  ? 359 ARG 2 CB  1 
ATOM 5392  C CG  . ARG B 1 359 ? -41.262 20.970  197.005 1.00 46.83  ? 359 ARG 2 CG  1 
ATOM 5393  C CD  . ARG B 1 359 ? -42.225 19.818  197.253 1.00 38.67  ? 359 ARG 2 CD  1 
ATOM 5394  N NE  . ARG B 1 359 ? -43.463 20.005  196.537 1.00 24.40  ? 359 ARG 2 NE  1 
ATOM 5395  C CZ  . ARG B 1 359 ? -43.541 20.094  195.220 1.00 43.07  ? 359 ARG 2 CZ  1 
ATOM 5396  N NH1 . ARG B 1 359 ? -42.444 19.998  194.477 1.00 19.37  ? 359 ARG 2 NH1 1 
ATOM 5397  N NH2 . ARG B 1 359 ? -44.695 20.404  194.663 1.00 82.81  ? 359 ARG 2 NH2 1 
ATOM 5398  N N   . MET B 1 360 ? -41.414 24.464  198.197 1.00 79.73  ? 360 MET 2 N   1 
ATOM 5399  C CA  . MET B 1 360 ? -41.196 24.945  199.553 1.00 115.05 ? 360 MET 2 CA  1 
ATOM 5400  C C   . MET B 1 360 ? -41.437 23.791  200.503 1.00 127.96 ? 360 MET 2 C   1 
ATOM 5401  O O   . MET B 1 360 ? -40.597 23.458  201.341 1.00 133.06 ? 360 MET 2 O   1 
ATOM 5402  C CB  . MET B 1 360 ? -42.174 26.085  199.875 1.00 138.50 ? 360 MET 2 CB  1 
ATOM 5403  C CG  . MET B 1 360 ? -43.600 25.902  199.314 1.00 174.05 ? 360 MET 2 CG  1 
ATOM 5404  S SD  . MET B 1 360 ? -44.934 26.385  200.466 1.00 212.33 ? 360 MET 2 SD  1 
ATOM 5405  C CE  . MET B 1 360 ? -44.551 28.168  200.729 1.00 210.05 ? 360 MET 2 CE  1 
ATOM 5406  N N   . GLN B 1 361 ? -42.615 23.197  200.335 1.00 146.43 ? 361 GLN 2 N   1 
ATOM 5407  C CA  . GLN B 1 361 ? -43.113 22.061  201.101 1.00 163.10 ? 361 GLN 2 CA  1 
ATOM 5408  C C   . GLN B 1 361 ? -44.498 21.765  200.502 1.00 169.57 ? 361 GLN 2 C   1 
ATOM 5409  O O   . GLN B 1 361 ? -44.769 22.087  199.325 1.00 173.07 ? 361 GLN 2 O   1 
ATOM 5410  C CB  . GLN B 1 361 ? -43.226 22.403  202.601 1.00 174.79 ? 361 GLN 2 CB  1 
ATOM 5411  C CG  . GLN B 1 361 ? -43.339 21.170  203.524 1.00 192.21 ? 361 GLN 2 CG  1 
ATOM 5412  C CD  . GLN B 1 361 ? -43.257 21.503  205.015 1.00 203.38 ? 361 GLN 2 CD  1 
ATOM 5413  O OE1 . GLN B 1 361 ? -42.978 22.641  205.398 1.00 216.00 ? 361 GLN 2 OE1 1 
ATOM 5414  N NE2 . GLN B 1 361 ? -43.509 20.504  205.863 1.00 203.09 ? 361 GLN 2 NE2 1 
ATOM 5415  N N   . PRO C 1 14  ? 56.678  10.788  170.582 1.00 184.72 ? 14  PRO 3 N   1 
ATOM 5416  C CA  . PRO C 1 14  ? 57.055  12.127  171.056 1.00 184.20 ? 14  PRO 3 CA  1 
ATOM 5417  C C   . PRO C 1 14  ? 55.896  13.133  170.984 1.00 184.39 ? 14  PRO 3 C   1 
ATOM 5418  O O   . PRO C 1 14  ? 55.271  13.310  169.929 1.00 190.87 ? 14  PRO 3 O   1 
ATOM 5419  C CB  . PRO C 1 14  ? 58.198  12.514  170.111 1.00 182.78 ? 14  PRO 3 CB  1 
ATOM 5420  C CG  . PRO C 1 14  ? 58.839  11.193  169.807 1.00 185.89 ? 14  PRO 3 CG  1 
ATOM 5421  C CD  . PRO C 1 14  ? 57.632  10.300  169.570 1.00 185.40 ? 14  PRO 3 CD  1 
ATOM 5422  N N   . LYS C 1 15  ? 55.613  13.777  172.117 1.00 179.64 ? 15  LYS 3 N   1 
ATOM 5423  C CA  . LYS C 1 15  ? 54.537  14.768  172.221 1.00 164.46 ? 15  LYS 3 CA  1 
ATOM 5424  C C   . LYS C 1 15  ? 55.152  16.167  172.080 1.00 164.51 ? 15  LYS 3 C   1 
ATOM 5425  O O   . LYS C 1 15  ? 56.276  16.403  172.545 1.00 164.72 ? 15  LYS 3 O   1 
ATOM 5426  C CB  . LYS C 1 15  ? 53.838  14.622  173.579 1.00 158.67 ? 15  LYS 3 CB  1 
ATOM 5427  C CG  . LYS C 1 15  ? 53.357  13.202  173.868 1.00 160.38 ? 15  LYS 3 CG  1 
ATOM 5428  C CD  . LYS C 1 15  ? 53.215  12.919  175.363 1.00 166.88 ? 15  LYS 3 CD  1 
ATOM 5429  C CE  . LYS C 1 15  ? 52.833  11.459  175.605 1.00 171.27 ? 15  LYS 3 CE  1 
ATOM 5430  N NZ  . LYS C 1 15  ? 52.712  11.095  177.049 1.00 171.65 ? 15  LYS 3 NZ  1 
ATOM 5431  N N   . LYS C 1 16  ? 54.440  17.078  171.416 1.00 161.62 ? 16  LYS 3 N   1 
ATOM 5432  C CA  . LYS C 1 16  ? 54.943  18.442  171.217 1.00 154.77 ? 16  LYS 3 CA  1 
ATOM 5433  C C   . LYS C 1 16  ? 54.466  19.441  172.299 1.00 140.45 ? 16  LYS 3 C   1 
ATOM 5434  O O   . LYS C 1 16  ? 53.265  19.529  172.586 1.00 137.34 ? 16  LYS 3 O   1 
ATOM 5435  C CB  . LYS C 1 16  ? 54.584  18.935  169.797 1.00 166.61 ? 16  LYS 3 CB  1 
ATOM 5436  C CG  . LYS C 1 16  ? 55.361  20.187  169.355 1.00 180.37 ? 16  LYS 3 CG  1 
ATOM 5437  C CD  . LYS C 1 16  ? 55.621  20.246  167.842 1.00 186.04 ? 16  LYS 3 CD  1 
ATOM 5438  C CE  . LYS C 1 16  ? 56.569  21.411  167.495 1.00 188.85 ? 16  LYS 3 CE  1 
ATOM 5439  N NZ  . LYS C 1 16  ? 57.073  21.404  166.081 1.00 184.88 ? 16  LYS 3 NZ  1 
ATOM 5440  N N   . PRO C 1 17  ? 55.413  20.174  172.936 1.00 126.47 ? 17  PRO 3 N   1 
ATOM 5441  C CA  . PRO C 1 17  ? 55.099  21.161  173.979 1.00 119.58 ? 17  PRO 3 CA  1 
ATOM 5442  C C   . PRO C 1 17  ? 54.508  22.417  173.344 1.00 124.21 ? 17  PRO 3 C   1 
ATOM 5443  O O   . PRO C 1 17  ? 55.198  23.142  172.614 1.00 131.87 ? 17  PRO 3 O   1 
ATOM 5444  C CB  . PRO C 1 17  ? 56.469  21.463  174.578 1.00 110.70 ? 17  PRO 3 CB  1 
ATOM 5445  C CG  . PRO C 1 17  ? 57.363  21.424  173.366 1.00 122.61 ? 17  PRO 3 CG  1 
ATOM 5446  C CD  . PRO C 1 17  ? 56.868  20.147  172.675 1.00 126.80 ? 17  PRO 3 CD  1 
ATOM 5447  N N   . LYS C 1 18  ? 53.235  22.667  173.636 1.00 120.92 ? 18  LYS 3 N   1 
ATOM 5448  C CA  . LYS C 1 18  ? 52.498  23.817  173.101 1.00 121.88 ? 18  LYS 3 CA  1 
ATOM 5449  C C   . LYS C 1 18  ? 53.158  25.171  173.293 1.00 110.69 ? 18  LYS 3 C   1 
ATOM 5450  O O   . LYS C 1 18  ? 54.074  25.331  174.095 1.00 111.66 ? 18  LYS 3 O   1 
ATOM 5451  C CB  . LYS C 1 18  ? 51.126  23.919  173.754 1.00 136.51 ? 18  LYS 3 CB  1 
ATOM 5452  C CG  . LYS C 1 18  ? 50.298  22.679  173.695 1.00 159.38 ? 18  LYS 3 CG  1 
ATOM 5453  C CD  . LYS C 1 18  ? 49.200  22.786  174.731 1.00 187.15 ? 18  LYS 3 CD  1 
ATOM 5454  C CE  . LYS C 1 18  ? 48.541  21.437  174.988 1.00 210.42 ? 18  LYS 3 CE  1 
ATOM 5455  N NZ  . LYS C 1 18  ? 47.626  21.482  176.175 1.00 231.55 ? 18  LYS 3 NZ  1 
ATOM 5456  N N   . GLU C 1 19  ? 52.613  26.158  172.595 1.00 98.16  ? 19  GLU 3 N   1 
ATOM 5457  C CA  . GLU C 1 19  ? 53.092  27.515  172.702 1.00 82.91  ? 19  GLU 3 CA  1 
ATOM 5458  C C   . GLU C 1 19  ? 52.620  27.920  174.087 1.00 62.81  ? 19  GLU 3 C   1 
ATOM 5459  O O   . GLU C 1 19  ? 51.524  27.531  174.541 1.00 72.01  ? 19  GLU 3 O   1 
ATOM 5460  C CB  . GLU C 1 19  ? 52.414  28.402  171.656 1.00 113.92 ? 19  GLU 3 CB  1 
ATOM 5461  C CG  . GLU C 1 19  ? 52.095  27.713  170.320 1.00 155.28 ? 19  GLU 3 CG  1 
ATOM 5462  C CD  . GLU C 1 19  ? 53.330  27.320  169.502 1.00 179.21 ? 19  GLU 3 CD  1 
ATOM 5463  O OE1 . GLU C 1 19  ? 54.426  27.897  169.705 1.00 189.11 ? 19  GLU 3 OE1 1 
ATOM 5464  O OE2 . GLU C 1 19  ? 53.189  26.433  168.629 1.00 194.71 ? 19  GLU 3 OE2 1 
ATOM 5465  N N   . PRO C 1 20  ? 53.446  28.664  174.809 1.00 36.93  ? 20  PRO 3 N   1 
ATOM 5466  C CA  . PRO C 1 20  ? 53.005  29.060  176.144 1.00 47.79  ? 20  PRO 3 CA  1 
ATOM 5467  C C   . PRO C 1 20  ? 51.852  30.008  175.911 1.00 42.47  ? 20  PRO 3 C   1 
ATOM 5468  O O   . PRO C 1 20  ? 51.827  30.700  174.900 1.00 32.44  ? 20  PRO 3 O   1 
ATOM 5469  C CB  . PRO C 1 20  ? 54.220  29.827  176.685 1.00 57.14  ? 20  PRO 3 CB  1 
ATOM 5470  C CG  . PRO C 1 20  ? 55.375  29.333  175.868 1.00 21.96  ? 20  PRO 3 CG  1 
ATOM 5471  C CD  . PRO C 1 20  ? 54.755  29.236  174.500 1.00 16.60  ? 20  PRO 3 CD  1 
ATOM 5472  N N   . VAL C 1 21  ? 50.877  30.032  176.801 1.00 46.86  ? 21  VAL 3 N   1 
ATOM 5473  C CA  . VAL C 1 21  ? 49.776  30.964  176.580 1.00 44.79  ? 21  VAL 3 CA  1 
ATOM 5474  C C   . VAL C 1 21  ? 50.204  32.406  176.584 1.00 41.83  ? 21  VAL 3 C   1 
ATOM 5475  O O   . VAL C 1 21  ? 51.306  32.773  177.047 1.00 26.37  ? 21  VAL 3 O   1 
ATOM 5476  C CB  . VAL C 1 21  ? 48.721  30.865  177.621 1.00 44.14  ? 21  VAL 3 CB  1 
ATOM 5477  C CG1 . VAL C 1 21  ? 47.682  29.873  177.185 1.00 92.94  ? 21  VAL 3 CG1 1 
ATOM 5478  C CG2 . VAL C 1 21  ? 49.359  30.502  178.953 1.00 60.09  ? 21  VAL 3 CG2 1 
ATOM 5479  N N   . GLN C 1 22  ? 49.289  33.239  176.120 1.00 37.54  ? 22  GLN 3 N   1 
ATOM 5480  C CA  . GLN C 1 22  ? 49.580  34.643  176.074 1.00 34.83  ? 22  GLN 3 CA  1 
ATOM 5481  C C   . GLN C 1 22  ? 49.239  35.284  177.404 1.00 22.81  ? 22  GLN 3 C   1 
ATOM 5482  O O   . GLN C 1 22  ? 48.280  34.933  178.061 1.00 47.14  ? 22  GLN 3 O   1 
ATOM 5483  C CB  . GLN C 1 22  ? 48.843  35.280  174.911 1.00 56.41  ? 22  GLN 3 CB  1 
ATOM 5484  C CG  . GLN C 1 22  ? 49.582  36.472  174.287 1.00 77.53  ? 22  GLN 3 CG  1 
ATOM 5485  C CD  . GLN C 1 22  ? 50.867  36.096  173.583 1.00 73.51  ? 22  GLN 3 CD  1 
ATOM 5486  O OE1 . GLN C 1 22  ? 51.748  36.925  173.404 1.00 80.80  ? 22  GLN 3 OE1 1 
ATOM 5487  N NE2 . GLN C 1 22  ? 50.973  34.846  173.163 1.00 77.79  ? 22  GLN 3 NE2 1 
ATOM 5488  N N   . VAL C 1 23  ? 50.008  36.276  177.767 1.00 21.62  ? 23  VAL 3 N   1 
ATOM 5489  C CA  . VAL C 1 23  ? 49.844  36.949  179.023 1.00 13.90  ? 23  VAL 3 CA  1 
ATOM 5490  C C   . VAL C 1 23  ? 50.152  38.395  178.765 1.00 22.66  ? 23  VAL 3 C   1 
ATOM 5491  O O   . VAL C 1 23  ? 50.895  38.727  177.860 1.00 38.26  ? 23  VAL 3 O   1 
ATOM 5492  C CB  . VAL C 1 23  ? 50.891  36.408  179.929 1.00 18.21  ? 23  VAL 3 CB  1 
ATOM 5493  C CG1 . VAL C 1 23  ? 51.135  37.335  181.135 1.00 38.30  ? 23  VAL 3 CG1 1 
ATOM 5494  C CG2 . VAL C 1 23  ? 50.494  35.022  180.301 1.00 8.69   ? 23  VAL 3 CG2 1 
ATOM 5495  N N   . PRO C 1 24  ? 49.562  39.290  179.530 1.00 20.53  ? 24  PRO 3 N   1 
ATOM 5496  C CA  . PRO C 1 24  ? 49.885  40.672  179.254 1.00 30.14  ? 24  PRO 3 CA  1 
ATOM 5497  C C   . PRO C 1 24  ? 51.366  40.917  179.399 1.00 26.40  ? 24  PRO 3 C   1 
ATOM 5498  O O   . PRO C 1 24  ? 52.028  40.418  180.338 1.00 19.30  ? 24  PRO 3 O   1 
ATOM 5499  C CB  . PRO C 1 24  ? 49.048  41.417  180.283 1.00 39.68  ? 24  PRO 3 CB  1 
ATOM 5500  C CG  . PRO C 1 24  ? 48.955  40.438  181.386 1.00 27.61  ? 24  PRO 3 CG  1 
ATOM 5501  C CD  . PRO C 1 24  ? 48.604  39.213  180.626 1.00 33.07  ? 24  PRO 3 CD  1 
ATOM 5502  N N   . LYS C 1 25  ? 51.869  41.645  178.411 1.00 23.61  ? 25  LYS 3 N   1 
ATOM 5503  C CA  . LYS C 1 25  ? 53.266  41.973  178.338 1.00 34.25  ? 25  LYS 3 CA  1 
ATOM 5504  C C   . LYS C 1 25  ? 53.701  43.059  179.283 1.00 24.30  ? 25  LYS 3 C   1 
ATOM 5505  O O   . LYS C 1 25  ? 53.193  44.190  179.240 1.00 19.94  ? 25  LYS 3 O   1 
ATOM 5506  C CB  . LYS C 1 25  ? 53.641  42.352  176.921 1.00 37.19  ? 25  LYS 3 CB  1 
ATOM 5507  C CG  . LYS C 1 25  ? 55.004  43.006  176.849 1.00 67.29  ? 25  LYS 3 CG  1 
ATOM 5508  C CD  . LYS C 1 25  ? 55.394  43.319  175.419 1.00 106.28 ? 25  LYS 3 CD  1 
ATOM 5509  C CE  . LYS C 1 25  ? 54.465  44.352  174.795 1.00 130.06 ? 25  LYS 3 CE  1 
ATOM 5510  N NZ  . LYS C 1 25  ? 54.693  44.513  173.322 1.00 152.58 ? 25  LYS 3 NZ  1 
ATOM 5511  N N   . LEU C 1 26  ? 54.651  42.710  180.137 1.00 18.65  ? 26  LEU 3 N   1 
ATOM 5512  C CA  . LEU C 1 26  ? 55.173  43.675  181.078 1.00 22.31  ? 26  LEU 3 CA  1 
ATOM 5513  C C   . LEU C 1 26  ? 55.994  44.672  180.312 1.00 26.98  ? 26  LEU 3 C   1 
ATOM 5514  O O   . LEU C 1 26  ? 56.919  44.306  179.599 1.00 32.42  ? 26  LEU 3 O   1 
ATOM 5515  C CB  . LEU C 1 26  ? 56.064  43.018  182.103 1.00 24.09  ? 26  LEU 3 CB  1 
ATOM 5516  C CG  . LEU C 1 26  ? 56.774  44.055  182.958 1.00 29.49  ? 26  LEU 3 CG  1 
ATOM 5517  C CD1 . LEU C 1 26  ? 55.772  45.038  183.488 1.00 36.75  ? 26  LEU 3 CD1 1 
ATOM 5518  C CD2 . LEU C 1 26  ? 57.479  43.369  184.092 1.00 42.57  ? 26  LEU 3 CD2 1 
ATOM 5519  N N   . VAL C 1 27  ? 55.687  45.939  180.510 1.00 32.10  ? 27  VAL 3 N   1 
ATOM 5520  C CA  . VAL C 1 27  ? 56.385  47.011  179.826 1.00 28.47  ? 27  VAL 3 CA  1 
ATOM 5521  C C   . VAL C 1 27  ? 57.531  47.532  180.664 1.00 28.92  ? 27  VAL 3 C   1 
ATOM 5522  O O   . VAL C 1 27  ? 58.615  47.803  180.172 1.00 35.30  ? 27  VAL 3 O   1 
ATOM 5523  C CB  . VAL C 1 27  ? 55.431  48.155  179.545 1.00 30.28  ? 27  VAL 3 CB  1 
ATOM 5524  C CG1 . VAL C 1 27  ? 56.212  49.379  179.180 1.00 18.32  ? 27  VAL 3 CG1 1 
ATOM 5525  C CG2 . VAL C 1 27  ? 54.435  47.758  178.432 1.00 28.29  ? 27  VAL 3 CG2 1 
ATOM 5526  N N   . ILE C 1 28  ? 57.281  47.730  181.936 1.00 11.25  ? 28  ILE 3 N   1 
ATOM 5527  C CA  . ILE C 1 28  ? 58.341  48.210  182.772 1.00 21.17  ? 28  ILE 3 CA  1 
ATOM 5528  C C   . ILE C 1 28  ? 57.847  48.084  184.179 1.00 23.33  ? 28  ILE 3 C   1 
ATOM 5529  O O   . ILE C 1 28  ? 56.635  48.132  184.424 1.00 22.05  ? 28  ILE 3 O   1 
ATOM 5530  C CB  . ILE C 1 28  ? 58.659  49.661  182.465 1.00 29.27  ? 28  ILE 3 CB  1 
ATOM 5531  C CG1 . ILE C 1 28  ? 59.570  50.246  183.559 1.00 31.11  ? 28  ILE 3 CG1 1 
ATOM 5532  C CG2 . ILE C 1 28  ? 57.366  50.398  182.285 1.00 13.08  ? 28  ILE 3 CG2 1 
ATOM 5533  C CD1 . ILE C 1 28  ? 60.256  51.512  183.184 1.00 21.45  ? 28  ILE 3 CD1 1 
ATOM 5534  N N   . LYS C 1 29  ? 58.791  47.908  185.090 1.00 3.42   ? 29  LYS 3 N   1 
ATOM 5535  C CA  . LYS C 1 29  ? 58.480  47.734  186.484 1.00 13.87  ? 29  LYS 3 CA  1 
ATOM 5536  C C   . LYS C 1 29  ? 59.480  48.598  187.230 1.00 23.59  ? 29  LYS 3 C   1 
ATOM 5537  O O   . LYS C 1 29  ? 60.656  48.668  186.855 1.00 38.70  ? 29  LYS 3 O   1 
ATOM 5538  C CB  . LYS C 1 29  ? 58.637  46.236  186.879 1.00 17.26  ? 29  LYS 3 CB  1 
ATOM 5539  C CG  . LYS C 1 29  ? 59.091  45.991  188.349 1.00 20.95  ? 29  LYS 3 CG  1 
ATOM 5540  C CD  . LYS C 1 29  ? 59.585  44.569  188.586 1.00 52.51  ? 29  LYS 3 CD  1 
ATOM 5541  C CE  . LYS C 1 29  ? 60.113  44.363  190.031 1.00 79.51  ? 29  LYS 3 CE  1 
ATOM 5542  N NZ  . LYS C 1 29  ? 60.466  42.913  190.351 1.00 96.59  ? 29  LYS 3 NZ  1 
ATOM 5543  N N   . GLY C 1 30  ? 59.009  49.240  188.291 1.00 10.66  ? 30  GLY 3 N   1 
ATOM 5544  C CA  . GLY C 1 30  ? 59.862  50.081  189.097 1.00 34.52  ? 30  GLY 3 CA  1 
ATOM 5545  C C   . GLY C 1 30  ? 58.972  50.835  190.052 1.00 38.98  ? 30  GLY 3 C   1 
ATOM 5546  O O   . GLY C 1 30  ? 57.917  50.339  190.439 1.00 54.18  ? 30  GLY 3 O   1 
ATOM 5547  N N   . GLY C 1 31  ? 59.385  52.039  190.423 1.00 49.72  ? 31  GLY 3 N   1 
ATOM 5548  C CA  . GLY C 1 31  ? 58.600  52.860  191.333 1.00 43.51  ? 31  GLY 3 CA  1 
ATOM 5549  C C   . GLY C 1 31  ? 57.629  53.794  190.621 1.00 46.17  ? 31  GLY 3 C   1 
ATOM 5550  O O   . GLY C 1 31  ? 57.466  53.763  189.374 1.00 41.73  ? 31  GLY 3 O   1 
ATOM 5551  N N   . ILE C 1 32  ? 57.053  54.706  191.397 1.00 35.05  ? 32  ILE 3 N   1 
ATOM 5552  C CA  . ILE C 1 32  ? 56.064  55.616  190.835 1.00 40.21  ? 32  ILE 3 CA  1 
ATOM 5553  C C   . ILE C 1 32  ? 56.536  56.330  189.543 1.00 28.73  ? 32  ILE 3 C   1 
ATOM 5554  O O   . ILE C 1 32  ? 55.777  56.568  188.589 1.00 21.39  ? 32  ILE 3 O   1 
ATOM 5555  C CB  . ILE C 1 32  ? 55.548  56.547  191.935 1.00 30.26  ? 32  ILE 3 CB  1 
ATOM 5556  C CG1 . ILE C 1 32  ? 54.618  57.584  191.350 1.00 33.87  ? 32  ILE 3 CG1 1 
ATOM 5557  C CG2 . ILE C 1 32  ? 56.683  57.086  192.707 1.00 36.93  ? 32  ILE 3 CG2 1 
ATOM 5558  C CD1 . ILE C 1 32  ? 53.453  56.963  190.651 1.00 32.16  ? 32  ILE 3 CD1 1 
ATOM 5559  N N   . GLU C 1 33  ? 57.835  56.506  189.467 1.00 28.76  ? 33  GLU 3 N   1 
ATOM 5560  C CA  . GLU C 1 33  ? 58.457  57.140  188.323 1.00 44.17  ? 33  GLU 3 CA  1 
ATOM 5561  C C   . GLU C 1 33  ? 58.040  56.466  187.052 1.00 35.90  ? 33  GLU 3 C   1 
ATOM 5562  O O   . GLU C 1 33  ? 57.758  57.110  186.044 1.00 40.51  ? 33  GLU 3 O   1 
ATOM 5563  C CB  . GLU C 1 33  ? 59.971  57.008  188.400 1.00 55.18  ? 33  GLU 3 CB  1 
ATOM 5564  C CG  . GLU C 1 33  ? 60.545  57.100  189.788 1.00 83.96  ? 33  GLU 3 CG  1 
ATOM 5565  C CD  . GLU C 1 33  ? 60.472  55.783  190.499 1.00 106.46 ? 33  GLU 3 CD  1 
ATOM 5566  O OE1 . GLU C 1 33  ? 60.893  54.764  189.893 1.00 118.62 ? 33  GLU 3 OE1 1 
ATOM 5567  O OE2 . GLU C 1 33  ? 59.955  55.766  191.641 1.00 123.88 ? 33  GLU 3 OE2 1 
ATOM 5568  N N   . VAL C 1 34  ? 58.024  55.151  187.111 1.00 29.00  ? 34  VAL 3 N   1 
ATOM 5569  C CA  . VAL C 1 34  ? 57.700  54.360  185.951 1.00 34.62  ? 34  VAL 3 CA  1 
ATOM 5570  C C   . VAL C 1 34  ? 56.408  54.799  185.320 1.00 32.21  ? 34  VAL 3 C   1 
ATOM 5571  O O   . VAL C 1 34  ? 56.198  54.620  184.103 1.00 18.96  ? 34  VAL 3 O   1 
ATOM 5572  C CB  . VAL C 1 34  ? 57.591  52.890  186.316 1.00 43.51  ? 34  VAL 3 CB  1 
ATOM 5573  C CG1 . VAL C 1 34  ? 57.404  52.079  185.080 1.00 37.73  ? 34  VAL 3 CG1 1 
ATOM 5574  C CG2 . VAL C 1 34  ? 58.838  52.446  187.024 1.00 55.79  ? 34  VAL 3 CG2 1 
ATOM 5575  N N   . LEU C 1 35  ? 55.552  55.405  186.137 1.00 26.71  ? 35  LEU 3 N   1 
ATOM 5576  C CA  . LEU C 1 35  ? 54.260  55.828  185.641 1.00 37.82  ? 35  LEU 3 CA  1 
ATOM 5577  C C   . LEU C 1 35  ? 54.441  56.661  184.396 1.00 47.80  ? 35  LEU 3 C   1 
ATOM 5578  O O   . LEU C 1 35  ? 53.748  56.464  183.391 1.00 48.30  ? 35  LEU 3 O   1 
ATOM 5579  C CB  . LEU C 1 35  ? 53.495  56.589  186.720 1.00 40.32  ? 35  LEU 3 CB  1 
ATOM 5580  C CG  . LEU C 1 35  ? 52.463  55.718  187.449 1.00 32.79  ? 35  LEU 3 CG  1 
ATOM 5581  C CD1 . LEU C 1 35  ? 51.475  56.607  188.168 1.00 37.58  ? 35  LEU 3 CD1 1 
ATOM 5582  C CD2 . LEU C 1 35  ? 51.711  54.859  186.425 1.00 15.61  ? 35  LEU 3 CD2 1 
ATOM 5583  N N   . GLY C 1 36  ? 55.502  57.464  184.446 1.00 56.36  ? 36  GLY 3 N   1 
ATOM 5584  C CA  . GLY C 1 36  ? 55.870  58.374  183.378 1.00 53.71  ? 36  GLY 3 CA  1 
ATOM 5585  C C   . GLY C 1 36  ? 56.038  57.850  181.969 1.00 50.76  ? 36  GLY 3 C   1 
ATOM 5586  O O   . GLY C 1 36  ? 56.109  58.616  181.006 1.00 69.22  ? 36  GLY 3 O   1 
ATOM 5587  N N   . VAL C 1 37  ? 56.129  56.556  181.801 1.00 39.03  ? 37  VAL 3 N   1 
ATOM 5588  C CA  . VAL C 1 37  ? 56.287  56.100  180.454 1.00 33.04  ? 37  VAL 3 CA  1 
ATOM 5589  C C   . VAL C 1 37  ? 55.005  56.282  179.706 1.00 37.92  ? 37  VAL 3 C   1 
ATOM 5590  O O   . VAL C 1 37  ? 53.915  55.990  180.223 1.00 57.47  ? 37  VAL 3 O   1 
ATOM 5591  C CB  . VAL C 1 37  ? 56.626  54.645  180.420 1.00 36.28  ? 37  VAL 3 CB  1 
ATOM 5592  C CG1 . VAL C 1 37  ? 56.606  54.125  178.949 1.00 10.54  ? 37  VAL 3 CG1 1 
ATOM 5593  C CG2 . VAL C 1 37  ? 57.952  54.431  181.119 1.00 24.63  ? 37  VAL 3 CG2 1 
ATOM 5594  N N   . LYS C 1 38  ? 55.108  56.792  178.495 1.00 39.92  ? 38  LYS 3 N   1 
ATOM 5595  C CA  . LYS C 1 38  ? 53.892  56.910  177.731 1.00 58.08  ? 38  LYS 3 CA  1 
ATOM 5596  C C   . LYS C 1 38  ? 53.576  55.523  177.199 1.00 52.18  ? 38  LYS 3 C   1 
ATOM 5597  O O   . LYS C 1 38  ? 54.419  54.822  176.652 1.00 55.10  ? 38  LYS 3 O   1 
ATOM 5598  C CB  . LYS C 1 38  ? 53.966  58.002  176.659 1.00 83.31  ? 38  LYS 3 CB  1 
ATOM 5599  C CG  . LYS C 1 38  ? 53.885  59.444  177.266 1.00 125.56 ? 38  LYS 3 CG  1 
ATOM 5600  C CD  . LYS C 1 38  ? 53.732  60.596  176.220 1.00 150.56 ? 38  LYS 3 CD  1 
ATOM 5601  C CE  . LYS C 1 38  ? 53.777  62.018  176.866 1.00 165.95 ? 38  LYS 3 CE  1 
ATOM 5602  N NZ  . LYS C 1 38  ? 53.544  63.181  175.921 1.00 175.20 ? 38  LYS 3 NZ  1 
ATOM 5603  N N   . THR C 1 39  ? 52.381  55.084  177.537 1.00 57.78  ? 39  THR 3 N   1 
ATOM 5604  C CA  . THR C 1 39  ? 51.872  53.773  177.183 1.00 46.94  ? 39  THR 3 CA  1 
ATOM 5605  C C   . THR C 1 39  ? 50.742  53.929  176.197 1.00 38.10  ? 39  THR 3 C   1 
ATOM 5606  O O   . THR C 1 39  ? 50.218  55.029  176.013 1.00 39.61  ? 39  THR 3 O   1 
ATOM 5607  C CB  . THR C 1 39  ? 51.367  53.135  178.438 1.00 43.49  ? 39  THR 3 CB  1 
ATOM 5608  O OG1 . THR C 1 39  ? 50.573  54.087  179.163 1.00 69.69  ? 39  THR 3 OG1 1 
ATOM 5609  C CG2 . THR C 1 39  ? 52.535  52.851  179.318 1.00 68.26  ? 39  THR 3 CG2 1 
ATOM 5610  N N   . GLY C 1 40  ? 50.323  52.832  175.604 1.00 50.28  ? 40  GLY 3 N   1 
ATOM 5611  C CA  . GLY C 1 40  ? 49.251  52.903  174.626 1.00 51.47  ? 40  GLY 3 CA  1 
ATOM 5612  C C   . GLY C 1 40  ? 47.923  53.226  175.268 1.00 47.12  ? 40  GLY 3 C   1 
ATOM 5613  O O   . GLY C 1 40  ? 47.856  53.597  176.452 1.00 46.86  ? 40  GLY 3 O   1 
ATOM 5614  N N   . VAL C 1 41  ? 46.841  53.047  174.528 1.00 39.33  ? 41  VAL 3 N   1 
ATOM 5615  C CA  . VAL C 1 41  ? 45.552  53.384  175.116 1.00 41.60  ? 41  VAL 3 CA  1 
ATOM 5616  C C   . VAL C 1 41  ? 44.947  52.236  175.889 1.00 37.69  ? 41  VAL 3 C   1 
ATOM 5617  O O   . VAL C 1 41  ? 44.127  52.424  176.800 1.00 39.87  ? 41  VAL 3 O   1 
ATOM 5618  C CB  . VAL C 1 41  ? 44.586  53.871  174.061 1.00 35.69  ? 41  VAL 3 CB  1 
ATOM 5619  C CG1 . VAL C 1 41  ? 43.734  52.784  173.590 1.00 4.47   ? 41  VAL 3 CG1 1 
ATOM 5620  C CG2 . VAL C 1 41  ? 43.755  54.984  174.611 1.00 58.64  ? 41  VAL 3 CG2 1 
ATOM 5621  N N   . ASP C 1 42  ? 45.355  51.043  175.488 1.00 32.38  ? 42  ASP 3 N   1 
ATOM 5622  C CA  . ASP C 1 42  ? 44.903  49.823  176.109 1.00 29.75  ? 42  ASP 3 CA  1 
ATOM 5623  C C   . ASP C 1 42  ? 45.889  49.370  177.189 1.00 29.33  ? 42  ASP 3 C   1 
ATOM 5624  O O   . ASP C 1 42  ? 45.881  48.219  177.642 1.00 25.68  ? 42  ASP 3 O   1 
ATOM 5625  C CB  . ASP C 1 42  ? 44.786  48.761  175.047 1.00 42.94  ? 42  ASP 3 CB  1 
ATOM 5626  C CG  . ASP C 1 42  ? 43.771  49.110  174.008 1.00 65.95  ? 42  ASP 3 CG  1 
ATOM 5627  O OD1 . ASP C 1 42  ? 42.589  49.296  174.389 1.00 73.07  ? 42  ASP 3 OD1 1 
ATOM 5628  O OD2 . ASP C 1 42  ? 44.165  49.217  172.822 1.00 101.13 ? 42  ASP 3 OD2 1 
ATOM 5629  N N   . SER C 1 43  ? 46.799  50.248  177.564 1.00 16.16  ? 43  SER 3 N   1 
ATOM 5630  C CA  . SER C 1 43  ? 47.732  49.876  178.591 1.00 18.45  ? 43  SER 3 CA  1 
ATOM 5631  C C   . SER C 1 43  ? 46.901  49.824  179.865 1.00 29.44  ? 43  SER 3 C   1 
ATOM 5632  O O   . SER C 1 43  ? 45.669  50.108  179.849 1.00 38.54  ? 43  SER 3 O   1 
ATOM 5633  C CB  . SER C 1 43  ? 48.827  50.952  178.718 1.00 30.83  ? 43  SER 3 CB  1 
ATOM 5634  O OG  . SER C 1 43  ? 48.648  51.786  179.867 1.00 55.41  ? 43  SER 3 OG  1 
ATOM 5635  N N   . PHE C 1 44  ? 47.568  49.433  180.944 1.00 15.86  ? 44  PHE 3 N   1 
ATOM 5636  C CA  . PHE C 1 44  ? 46.974  49.399  182.249 1.00 26.24  ? 44  PHE 3 CA  1 
ATOM 5637  C C   . PHE C 1 44  ? 48.068  49.205  183.245 1.00 26.30  ? 44  PHE 3 C   1 
ATOM 5638  O O   . PHE C 1 44  ? 49.076  48.556  182.943 1.00 24.81  ? 44  PHE 3 O   1 
ATOM 5639  C CB  . PHE C 1 44  ? 45.918  48.316  182.366 1.00 32.16  ? 44  PHE 3 CB  1 
ATOM 5640  C CG  . PHE C 1 44  ? 46.450  46.945  182.564 1.00 32.47  ? 44  PHE 3 CG  1 
ATOM 5641  C CD1 . PHE C 1 44  ? 46.955  46.538  183.794 1.00 47.74  ? 44  PHE 3 CD1 1 
ATOM 5642  C CD2 . PHE C 1 44  ? 46.350  46.012  181.554 1.00 47.30  ? 44  PHE 3 CD2 1 
ATOM 5643  C CE1 . PHE C 1 44  ? 47.349  45.201  184.009 1.00 37.35  ? 44  PHE 3 CE1 1 
ATOM 5644  C CE2 . PHE C 1 44  ? 46.741  44.672  181.758 1.00 28.47  ? 44  PHE 3 CE2 1 
ATOM 5645  C CZ  . PHE C 1 44  ? 47.237  44.277  182.986 1.00 16.27  ? 44  PHE 3 CZ  1 
ATOM 5646  N N   . THR C 1 45  ? 47.878  49.741  184.440 1.00 17.29  ? 45  THR 3 N   1 
ATOM 5647  C CA  . THR C 1 45  ? 48.917  49.613  185.420 1.00 21.03  ? 45  THR 3 CA  1 
ATOM 5648  C C   . THR C 1 45  ? 48.483  49.151  186.808 1.00 27.22  ? 45  THR 3 C   1 
ATOM 5649  O O   . THR C 1 45  ? 47.298  49.222  187.190 1.00 36.78  ? 45  THR 3 O   1 
ATOM 5650  C CB  . THR C 1 45  ? 49.739  50.902  185.489 1.00 23.46  ? 45  THR 3 CB  1 
ATOM 5651  O OG1 . THR C 1 45  ? 49.414  51.625  186.681 1.00 30.61  ? 45  THR 3 OG1 1 
ATOM 5652  C CG2 . THR C 1 45  ? 49.473  51.774  184.244 1.00 27.03  ? 45  THR 3 CG2 1 
ATOM 5653  N N   . GLU C 1 46  ? 49.470  48.703  187.571 1.00 4.82   ? 46  GLU 3 N   1 
ATOM 5654  C CA  . GLU C 1 46  ? 49.225  48.201  188.891 1.00 8.48   ? 46  GLU 3 CA  1 
ATOM 5655  C C   . GLU C 1 46  ? 50.075  48.971  189.864 1.00 17.27  ? 46  GLU 3 C   1 
ATOM 5656  O O   . GLU C 1 46  ? 51.303  49.035  189.700 1.00 31.08  ? 46  GLU 3 O   1 
ATOM 5657  C CB  . GLU C 1 46  ? 49.589  46.712  188.948 1.00 23.82  ? 46  GLU 3 CB  1 
ATOM 5658  C CG  . GLU C 1 46  ? 48.793  45.801  187.978 1.00 36.78  ? 46  GLU 3 CG  1 
ATOM 5659  C CD  . GLU C 1 46  ? 49.050  44.285  188.167 1.00 48.33  ? 46  GLU 3 CD  1 
ATOM 5660  O OE1 . GLU C 1 46  ? 50.172  43.900  188.577 1.00 54.05  ? 46  GLU 3 OE1 1 
ATOM 5661  O OE2 . GLU C 1 46  ? 48.115  43.477  187.917 1.00 67.13  ? 46  GLU 3 OE2 1 
ATOM 5662  N N   . VAL C 1 47  ? 49.425  49.561  190.868 1.00 7.57   ? 47  VAL 3 N   1 
ATOM 5663  C CA  . VAL C 1 47  ? 50.137  50.328  191.879 1.00 8.32   ? 47  VAL 3 CA  1 
ATOM 5664  C C   . VAL C 1 47  ? 50.090  49.736  193.266 1.00 13.17  ? 47  VAL 3 C   1 
ATOM 5665  O O   . VAL C 1 47  ? 49.027  49.539  193.853 1.00 17.55  ? 47  VAL 3 O   1 
ATOM 5666  C CB  . VAL C 1 47  ? 49.652  51.732  191.916 1.00 11.51  ? 47  VAL 3 CB  1 
ATOM 5667  C CG1 . VAL C 1 47  ? 50.330  52.481  193.065 1.00 12.61  ? 47  VAL 3 CG1 1 
ATOM 5668  C CG2 . VAL C 1 47  ? 49.941  52.374  190.569 1.00 2.00   ? 47  VAL 3 CG2 1 
ATOM 5669  N N   . GLU C 1 48  ? 51.266  49.455  193.787 1.00 17.82  ? 48  GLU 3 N   1 
ATOM 5670  C CA  . GLU C 1 48  ? 51.372  48.843  195.091 1.00 25.74  ? 48  GLU 3 CA  1 
ATOM 5671  C C   . GLU C 1 48  ? 51.886  49.943  195.993 1.00 20.77  ? 48  GLU 3 C   1 
ATOM 5672  O O   . GLU C 1 48  ? 52.921  50.542  195.740 1.00 26.73  ? 48  GLU 3 O   1 
ATOM 5673  C CB  . GLU C 1 48  ? 52.334  47.606  195.020 1.00 38.11  ? 48  GLU 3 CB  1 
ATOM 5674  C CG  . GLU C 1 48  ? 51.685  46.221  194.601 1.00 4.72   ? 48  GLU 3 CG  1 
ATOM 5675  C CD  . GLU C 1 48  ? 52.610  45.178  193.849 1.00 46.30  ? 48  GLU 3 CD  1 
ATOM 5676  O OE1 . GLU C 1 48  ? 52.831  45.314  192.610 1.00 46.22  ? 48  GLU 3 OE1 1 
ATOM 5677  O OE2 . GLU C 1 48  ? 52.982  44.140  194.449 1.00 28.92  ? 48  GLU 3 OE2 1 
ATOM 5678  N N   . CYS C 1 49  ? 51.073  50.318  196.953 1.00 22.89  ? 49  CYS 3 N   1 
ATOM 5679  C CA  . CYS C 1 49  ? 51.464  51.362  197.868 1.00 23.08  ? 49  CYS 3 CA  1 
ATOM 5680  C C   . CYS C 1 49  ? 51.028  50.872  199.203 1.00 21.14  ? 49  CYS 3 C   1 
ATOM 5681  O O   . CYS C 1 49  ? 50.497  49.775  199.302 1.00 35.05  ? 49  CYS 3 O   1 
ATOM 5682  C CB  . CYS C 1 49  ? 50.707  52.642  197.547 1.00 5.63   ? 49  CYS 3 CB  1 
ATOM 5683  S SG  . CYS C 1 49  ? 48.988  52.489  197.724 1.00 68.57  ? 49  CYS 3 SG  1 
ATOM 5684  N N   . PHE C 1 50  ? 51.138  51.716  200.216 1.00 20.10  ? 50  PHE 3 N   1 
ATOM 5685  C CA  . PHE C 1 50  ? 50.734  51.314  201.553 1.00 12.59  ? 50  PHE 3 CA  1 
ATOM 5686  C C   . PHE C 1 50  ? 50.529  52.526  202.437 1.00 15.82  ? 50  PHE 3 C   1 
ATOM 5687  O O   . PHE C 1 50  ? 51.004  53.608  202.104 1.00 29.22  ? 50  PHE 3 O   1 
ATOM 5688  C CB  . PHE C 1 50  ? 51.805  50.451  202.157 1.00 20.97  ? 50  PHE 3 CB  1 
ATOM 5689  C CG  . PHE C 1 50  ? 53.016  51.207  202.593 1.00 30.26  ? 50  PHE 3 CG  1 
ATOM 5690  C CD1 . PHE C 1 50  ? 53.010  51.904  203.790 1.00 40.92  ? 50  PHE 3 CD1 1 
ATOM 5691  C CD2 . PHE C 1 50  ? 54.159  51.211  201.828 1.00 37.55  ? 50  PHE 3 CD2 1 
ATOM 5692  C CE1 . PHE C 1 50  ? 54.116  52.581  204.215 1.00 41.05  ? 50  PHE 3 CE1 1 
ATOM 5693  C CE2 . PHE C 1 50  ? 55.275  51.889  202.254 1.00 47.40  ? 50  PHE 3 CE2 1 
ATOM 5694  C CZ  . PHE C 1 50  ? 55.248  52.579  203.449 1.00 46.28  ? 50  PHE 3 CZ  1 
ATOM 5695  N N   . LEU C 1 51  ? 49.881  52.346  203.584 1.00 10.31  ? 51  LEU 3 N   1 
ATOM 5696  C CA  . LEU C 1 51  ? 49.641  53.463  204.486 1.00 15.01  ? 51  LEU 3 CA  1 
ATOM 5697  C C   . LEU C 1 51  ? 49.900  53.066  205.883 1.00 25.61  ? 51  LEU 3 C   1 
ATOM 5698  O O   . LEU C 1 51  ? 49.514  51.973  206.313 1.00 30.49  ? 51  LEU 3 O   1 
ATOM 5699  C CB  . LEU C 1 51  ? 48.208  53.913  204.452 1.00 15.83  ? 51  LEU 3 CB  1 
ATOM 5700  C CG  . LEU C 1 51  ? 47.825  54.639  203.189 1.00 16.66  ? 51  LEU 3 CG  1 
ATOM 5701  C CD1 . LEU C 1 51  ? 46.412  55.206  203.315 1.00 45.89  ? 51  LEU 3 CD1 1 
ATOM 5702  C CD2 . LEU C 1 51  ? 48.816  55.731  203.006 1.00 51.78  ? 51  LEU 3 CD2 1 
ATOM 5703  N N   . ASN C 1 52  ? 50.562  53.956  206.596 1.00 28.22  ? 52  ASN 3 N   1 
ATOM 5704  C CA  . ASN C 1 52  ? 50.853  53.693  207.982 1.00 29.92  ? 52  ASN 3 CA  1 
ATOM 5705  C C   . ASN C 1 52  ? 49.681  54.207  208.752 1.00 23.81  ? 52  ASN 3 C   1 
ATOM 5706  O O   . ASN C 1 52  ? 48.974  55.117  208.316 1.00 16.94  ? 52  ASN 3 O   1 
ATOM 5707  C CB  . ASN C 1 52  ? 52.124  54.378  208.429 1.00 21.57  ? 52  ASN 3 CB  1 
ATOM 5708  C CG  . ASN C 1 52  ? 53.349  53.674  207.948 1.00 45.23  ? 52  ASN 3 CG  1 
ATOM 5709  O OD1 . ASN C 1 52  ? 53.744  52.639  208.502 1.00 61.39  ? 52  ASN 3 OD1 1 
ATOM 5710  N ND2 . ASN C 1 52  ? 53.969  54.216  206.906 1.00 53.37  ? 52  ASN 3 ND2 1 
ATOM 5711  N N   . PRO C 1 53  ? 49.457  53.630  209.916 1.00 20.60  ? 53  PRO 3 N   1 
ATOM 5712  C CA  . PRO C 1 53  ? 48.328  54.052  210.738 1.00 38.25  ? 53  PRO 3 CA  1 
ATOM 5713  C C   . PRO C 1 53  ? 48.636  55.226  211.646 1.00 45.00  ? 53  PRO 3 C   1 
ATOM 5714  O O   . PRO C 1 53  ? 49.751  55.369  212.145 1.00 61.90  ? 53  PRO 3 O   1 
ATOM 5715  C CB  . PRO C 1 53  ? 48.000  52.774  211.523 1.00 45.88  ? 53  PRO 3 CB  1 
ATOM 5716  C CG  . PRO C 1 53  ? 49.374  52.130  211.747 1.00 28.58  ? 53  PRO 3 CG  1 
ATOM 5717  C CD  . PRO C 1 53  ? 50.164  52.458  210.472 1.00 23.38  ? 53  PRO 3 CD  1 
ATOM 5718  N N   . GLN C 1 54  ? 47.643  56.060  211.896 1.00 46.95  ? 54  GLN 3 N   1 
ATOM 5719  C CA  . GLN C 1 54  ? 47.867  57.186  212.787 1.00 50.16  ? 54  GLN 3 CA  1 
ATOM 5720  C C   . GLN C 1 54  ? 47.062  56.969  214.044 1.00 50.17  ? 54  GLN 3 C   1 
ATOM 5721  O O   . GLN C 1 54  ? 46.002  57.571  214.218 1.00 54.53  ? 54  GLN 3 O   1 
ATOM 5722  C CB  . GLN C 1 54  ? 47.427  58.461  212.103 1.00 58.29  ? 54  GLN 3 CB  1 
ATOM 5723  C CG  . GLN C 1 54  ? 48.119  58.674  210.785 1.00 60.91  ? 54  GLN 3 CG  1 
ATOM 5724  C CD  . GLN C 1 54  ? 49.550  59.037  210.981 1.00 56.88  ? 54  GLN 3 CD  1 
ATOM 5725  O OE1 . GLN C 1 54  ? 50.106  58.858  212.069 1.00 71.69  ? 54  GLN 3 OE1 1 
ATOM 5726  N NE2 . GLN C 1 54  ? 50.157  59.590  209.951 1.00 62.15  ? 54  GLN 3 NE2 1 
ATOM 5727  N N   . MET C 1 55  ? 47.543  56.091  214.913 1.00 42.81  ? 55  MET 3 N   1 
ATOM 5728  C CA  . MET C 1 55  ? 46.806  55.812  216.135 1.00 59.09  ? 55  MET 3 CA  1 
ATOM 5729  C C   . MET C 1 55  ? 46.947  56.895  217.193 1.00 64.75  ? 55  MET 3 C   1 
ATOM 5730  O O   . MET C 1 55  ? 46.188  56.922  218.150 1.00 69.50  ? 55  MET 3 O   1 
ATOM 5731  C CB  . MET C 1 55  ? 47.217  54.463  216.733 1.00 67.73  ? 55  MET 3 CB  1 
ATOM 5732  C CG  . MET C 1 55  ? 47.015  53.286  215.805 1.00 53.68  ? 55  MET 3 CG  1 
ATOM 5733  S SD  . MET C 1 55  ? 45.480  53.437  214.936 1.00 56.17  ? 55  MET 3 SD  1 
ATOM 5734  C CE  . MET C 1 55  ? 44.582  52.526  216.039 1.00 26.49  ? 55  MET 3 CE  1 
ATOM 5735  N N   . GLY C 1 56  ? 47.932  57.770  217.041 1.00 72.68  ? 56  GLY 3 N   1 
ATOM 5736  C CA  . GLY C 1 56  ? 48.143  58.817  218.028 1.00 80.79  ? 56  GLY 3 CA  1 
ATOM 5737  C C   . GLY C 1 56  ? 49.615  59.146  218.120 1.00 79.82  ? 56  GLY 3 C   1 
ATOM 5738  O O   . GLY C 1 56  ? 49.996  60.321  218.127 1.00 85.28  ? 56  GLY 3 O   1 
ATOM 5739  N N   . ASN C 1 57  ? 50.435  58.097  218.192 1.00 71.97  ? 57  ASN 3 N   1 
ATOM 5740  C CA  . ASN C 1 57  ? 51.889  58.218  218.247 1.00 63.17  ? 57  ASN 3 CA  1 
ATOM 5741  C C   . ASN C 1 57  ? 52.365  59.219  219.284 1.00 62.96  ? 57  ASN 3 C   1 
ATOM 5742  O O   . ASN C 1 57  ? 52.947  60.268  218.953 1.00 60.37  ? 57  ASN 3 O   1 
ATOM 5743  C CB  . ASN C 1 57  ? 52.442  58.575  216.868 1.00 63.53  ? 57  ASN 3 CB  1 
ATOM 5744  C CG  . ASN C 1 57  ? 52.245  57.466  215.868 1.00 69.74  ? 57  ASN 3 CG  1 
ATOM 5745  O OD1 . ASN C 1 57  ? 51.994  56.311  216.239 1.00 89.22  ? 57  ASN 3 OD1 1 
ATOM 5746  N ND2 . ASN C 1 57  ? 52.333  57.803  214.585 1.00 81.40  ? 57  ASN 3 ND2 1 
ATOM 5747  N N   . PRO C 1 58  ? 52.166  58.875  220.562 1.00 56.12  ? 58  PRO 3 N   1 
ATOM 5748  C CA  . PRO C 1 58  ? 52.544  59.696  221.710 1.00 59.60  ? 58  PRO 3 CA  1 
ATOM 5749  C C   . PRO C 1 58  ? 53.990  60.149  221.645 1.00 63.64  ? 58  PRO 3 C   1 
ATOM 5750  O O   . PRO C 1 58  ? 54.258  61.337  221.471 1.00 70.86  ? 58  PRO 3 O   1 
ATOM 5751  C CB  . PRO C 1 58  ? 52.270  58.772  222.892 1.00 59.57  ? 58  PRO 3 CB  1 
ATOM 5752  C CG  . PRO C 1 58  ? 52.413  57.399  222.292 1.00 55.85  ? 58  PRO 3 CG  1 
ATOM 5753  C CD  . PRO C 1 58  ? 51.706  57.550  220.997 1.00 47.71  ? 58  PRO 3 CD  1 
ATOM 5754  N N   . ASP C 1 59  ? 54.921  59.220  221.808 1.00 65.46  ? 59  ASP 3 N   1 
ATOM 5755  C CA  . ASP C 1 59  ? 56.325  59.574  221.742 1.00 73.56  ? 59  ASP 3 CA  1 
ATOM 5756  C C   . ASP C 1 59  ? 56.889  59.052  220.433 1.00 78.58  ? 59  ASP 3 C   1 
ATOM 5757  O O   . ASP C 1 59  ? 56.155  58.847  219.465 1.00 86.43  ? 59  ASP 3 O   1 
ATOM 5758  C CB  . ASP C 1 59  ? 57.081  59.000  222.942 1.00 72.36  ? 59  ASP 3 CB  1 
ATOM 5759  C CG  . ASP C 1 59  ? 56.996  57.502  223.026 1.00 75.91  ? 59  ASP 3 CG  1 
ATOM 5760  O OD1 . ASP C 1 59  ? 56.481  56.872  222.089 1.00 83.66  ? 59  ASP 3 OD1 1 
ATOM 5761  O OD2 . ASP C 1 59  ? 57.464  56.941  224.031 1.00 86.43  ? 59  ASP 3 OD2 1 
ATOM 5762  N N   . GLU C 1 60  ? 58.191  58.846  220.383 1.00 81.83  ? 60  GLU 3 N   1 
ATOM 5763  C CA  . GLU C 1 60  ? 58.779  58.330  219.165 1.00 88.82  ? 60  GLU 3 CA  1 
ATOM 5764  C C   . GLU C 1 60  ? 59.254  56.917  219.422 1.00 77.97  ? 60  GLU 3 C   1 
ATOM 5765  O O   . GLU C 1 60  ? 60.289  56.484  218.934 1.00 84.55  ? 60  GLU 3 O   1 
ATOM 5766  C CB  . GLU C 1 60  ? 59.913  59.236  218.655 1.00 103.85 ? 60  GLU 3 CB  1 
ATOM 5767  C CG  . GLU C 1 60  ? 61.213  59.241  219.478 1.00 131.06 ? 60  GLU 3 CG  1 
ATOM 5768  C CD  . GLU C 1 60  ? 61.050  59.774  220.894 1.00 147.78 ? 60  GLU 3 CD  1 
ATOM 5769  O OE1 . GLU C 1 60  ? 60.206  60.674  221.123 1.00 155.77 ? 60  GLU 3 OE1 1 
ATOM 5770  O OE2 . GLU C 1 60  ? 61.779  59.283  221.785 1.00 161.18 ? 60  GLU 3 OE2 1 
ATOM 5771  N N   . HIS C 1 61  ? 58.531  56.201  220.253 1.00 55.77  ? 61  HIS 3 N   1 
ATOM 5772  C CA  . HIS C 1 61  ? 58.929  54.844  220.505 1.00 66.76  ? 61  HIS 3 CA  1 
ATOM 5773  C C   . HIS C 1 61  ? 57.711  54.019  220.283 1.00 72.28  ? 61  HIS 3 C   1 
ATOM 5774  O O   . HIS C 1 61  ? 57.758  52.892  219.787 1.00 79.16  ? 61  HIS 3 O   1 
ATOM 5775  C CB  . HIS C 1 61  ? 59.412  54.689  221.933 1.00 77.05  ? 61  HIS 3 CB  1 
ATOM 5776  C CG  . HIS C 1 61  ? 60.798  55.192  222.150 1.00 93.60  ? 61  HIS 3 CG  1 
ATOM 5777  N ND1 . HIS C 1 61  ? 61.080  56.268  222.961 1.00 109.88 ? 61  HIS 3 ND1 1 
ATOM 5778  C CD2 . HIS C 1 61  ? 61.984  54.774  221.653 1.00 106.26 ? 61  HIS 3 CD2 1 
ATOM 5779  C CE1 . HIS C 1 61  ? 62.382  56.492  222.955 1.00 118.44 ? 61  HIS 3 CE1 1 
ATOM 5780  N NE2 . HIS C 1 61  ? 62.953  55.599  222.168 1.00 121.07 ? 61  HIS 3 NE2 1 
ATOM 5781  N N   . GLN C 1 62  ? 56.594  54.626  220.605 1.00 67.93  ? 62  GLN 3 N   1 
ATOM 5782  C CA  . GLN C 1 62  ? 55.352  53.954  220.478 1.00 69.37  ? 62  GLN 3 CA  1 
ATOM 5783  C C   . GLN C 1 62  ? 54.657  54.436  219.237 1.00 63.67  ? 62  GLN 3 C   1 
ATOM 5784  O O   . GLN C 1 62  ? 53.968  55.443  219.256 1.00 69.14  ? 62  GLN 3 O   1 
ATOM 5785  C CB  . GLN C 1 62  ? 54.486  54.210  221.707 1.00 76.13  ? 62  GLN 3 CB  1 
ATOM 5786  C CG  . GLN C 1 62  ? 55.084  53.734  223.017 1.00 90.20  ? 62  GLN 3 CG  1 
ATOM 5787  C CD  . GLN C 1 62  ? 54.159  53.990  224.210 1.00 101.43 ? 62  GLN 3 CD  1 
ATOM 5788  O OE1 . GLN C 1 62  ? 53.857  55.142  224.550 1.00 92.81  ? 62  GLN 3 OE1 1 
ATOM 5789  N NE2 . GLN C 1 62  ? 53.704  52.907  224.849 1.00 109.23 ? 62  GLN 3 NE2 1 
ATOM 5790  N N   . LYS C 1 63  ? 54.945  53.801  218.120 1.00 59.76  ? 63  LYS 3 N   1 
ATOM 5791  C CA  . LYS C 1 63  ? 54.227  54.162  216.930 1.00 52.80  ? 63  LYS 3 CA  1 
ATOM 5792  C C   . LYS C 1 63  ? 53.134  53.108  216.777 1.00 54.94  ? 63  LYS 3 C   1 
ATOM 5793  O O   . LYS C 1 63  ? 53.240  51.989  217.322 1.00 49.40  ? 63  LYS 3 O   1 
ATOM 5794  C CB  . LYS C 1 63  ? 55.144  54.225  215.723 1.00 51.82  ? 63  LYS 3 CB  1 
ATOM 5795  C CG  . LYS C 1 63  ? 55.840  55.565  215.587 1.00 54.61  ? 63  LYS 3 CG  1 
ATOM 5796  C CD  . LYS C 1 63  ? 56.519  55.707  214.231 1.00 72.71  ? 63  LYS 3 CD  1 
ATOM 5797  C CE  . LYS C 1 63  ? 56.898  57.158  213.898 1.00 86.56  ? 63  LYS 3 CE  1 
ATOM 5798  N NZ  . LYS C 1 63  ? 57.603  57.273  212.569 1.00 112.06 ? 63  LYS 3 NZ  1 
ATOM 5799  N N   . GLY C 1 64  ? 52.053  53.485  216.102 1.00 51.60  ? 64  GLY 3 N   1 
ATOM 5800  C CA  . GLY C 1 64  ? 50.960  52.553  215.912 1.00 53.42  ? 64  GLY 3 CA  1 
ATOM 5801  C C   . GLY C 1 64  ? 50.331  52.259  217.254 1.00 52.23  ? 64  GLY 3 C   1 
ATOM 5802  O O   . GLY C 1 64  ? 49.737  51.198  217.484 1.00 49.15  ? 64  GLY 3 O   1 
ATOM 5803  N N   . LEU C 1 65  ? 50.476  53.233  218.137 1.00 43.71  ? 65  LEU 3 N   1 
ATOM 5804  C CA  . LEU C 1 65  ? 49.926  53.173  219.465 1.00 38.16  ? 65  LEU 3 CA  1 
ATOM 5805  C C   . LEU C 1 65  ? 49.326  54.546  219.749 1.00 47.56  ? 65  LEU 3 C   1 
ATOM 5806  O O   . LEU C 1 65  ? 49.836  55.576  219.280 1.00 43.96  ? 65  LEU 3 O   1 
ATOM 5807  C CB  . LEU C 1 65  ? 51.032  52.820  220.439 1.00 20.95  ? 65  LEU 3 CB  1 
ATOM 5808  C CG  . LEU C 1 65  ? 51.084  51.302  220.514 1.00 42.64  ? 65  LEU 3 CG  1 
ATOM 5809  C CD1 . LEU C 1 65  ? 52.366  50.713  221.129 1.00 53.53  ? 65  LEU 3 CD1 1 
ATOM 5810  C CD2 . LEU C 1 65  ? 49.862  50.919  221.296 1.00 44.50  ? 65  LEU 3 CD2 1 
ATOM 5811  N N   . SER C 1 66  ? 48.173  54.565  220.395 1.00 50.81  ? 66  SER 3 N   1 
ATOM 5812  C CA  . SER C 1 66  ? 47.548  55.839  220.717 1.00 54.18  ? 66  SER 3 CA  1 
ATOM 5813  C C   . SER C 1 66  ? 48.198  56.246  222.001 1.00 59.77  ? 66  SER 3 C   1 
ATOM 5814  O O   . SER C 1 66  ? 48.920  55.455  222.591 1.00 65.66  ? 66  SER 3 O   1 
ATOM 5815  C CB  . SER C 1 66  ? 46.065  55.631  221.005 1.00 56.52  ? 66  SER 3 CB  1 
ATOM 5816  O OG  . SER C 1 66  ? 45.888  54.752  222.106 1.00 55.58  ? 66  SER 3 OG  1 
ATOM 5817  N N   . LYS C 1 67  ? 47.924  57.449  222.476 1.00 63.16  ? 67  LYS 3 N   1 
ATOM 5818  C CA  . LYS C 1 67  ? 48.471  57.822  223.760 1.00 69.95  ? 67  LYS 3 CA  1 
ATOM 5819  C C   . LYS C 1 67  ? 47.625  56.992  224.709 1.00 71.00  ? 67  LYS 3 C   1 
ATOM 5820  O O   . LYS C 1 67  ? 46.593  56.430  224.313 1.00 74.83  ? 67  LYS 3 O   1 
ATOM 5821  C CB  . LYS C 1 67  ? 48.258  59.298  224.062 1.00 82.00  ? 67  LYS 3 CB  1 
ATOM 5822  C CG  . LYS C 1 67  ? 48.732  59.694  225.456 1.00 117.75 ? 67  LYS 3 CG  1 
ATOM 5823  C CD  . LYS C 1 67  ? 48.527  61.181  225.747 1.00 147.23 ? 67  LYS 3 CD  1 
ATOM 5824  C CE  . LYS C 1 67  ? 48.910  61.544  227.195 1.00 164.16 ? 67  LYS 3 CE  1 
ATOM 5825  N NZ  . LYS C 1 67  ? 48.744  63.007  227.502 1.00 175.41 ? 67  LYS 3 NZ  1 
ATOM 5826  N N   . SER C 1 68  ? 48.098  56.855  225.934 1.00 70.89  ? 68  SER 3 N   1 
ATOM 5827  C CA  . SER C 1 68  ? 47.390  56.112  226.957 1.00 72.05  ? 68  SER 3 CA  1 
ATOM 5828  C C   . SER C 1 68  ? 45.955  56.572  226.869 1.00 64.55  ? 68  SER 3 C   1 
ATOM 5829  O O   . SER C 1 68  ? 45.672  57.766  226.697 1.00 51.88  ? 68  SER 3 O   1 
ATOM 5830  C CB  . SER C 1 68  ? 47.995  56.448  228.319 1.00 93.93  ? 68  SER 3 CB  1 
ATOM 5831  O OG  . SER C 1 68  ? 49.421  56.564  228.221 1.00 129.59 ? 68  SER 3 OG  1 
ATOM 5832  N N   . LEU C 1 69  ? 45.039  55.629  226.909 1.00 63.69  ? 69  LEU 3 N   1 
ATOM 5833  C CA  . LEU C 1 69  ? 43.670  56.032  226.764 1.00 71.83  ? 69  LEU 3 CA  1 
ATOM 5834  C C   . LEU C 1 69  ? 42.932  56.544  227.970 1.00 74.27  ? 69  LEU 3 C   1 
ATOM 5835  O O   . LEU C 1 69  ? 43.119  56.074  229.100 1.00 65.07  ? 69  LEU 3 O   1 
ATOM 5836  C CB  . LEU C 1 69  ? 42.860  54.987  226.000 1.00 67.56  ? 69  LEU 3 CB  1 
ATOM 5837  C CG  . LEU C 1 69  ? 43.022  55.200  224.491 1.00 71.03  ? 69  LEU 3 CG  1 
ATOM 5838  C CD1 . LEU C 1 69  ? 42.570  53.951  223.782 1.00 68.96  ? 69  LEU 3 CD1 1 
ATOM 5839  C CD2 . LEU C 1 69  ? 42.257  56.458  223.998 1.00 75.84  ? 69  LEU 3 CD2 1 
ATOM 5840  N N   . ALA C 1 70  ? 42.110  57.549  227.661 1.00 88.01  ? 70  ALA 3 N   1 
ATOM 5841  C CA  . ALA C 1 70  ? 41.230  58.278  228.573 1.00 92.07  ? 70  ALA 3 CA  1 
ATOM 5842  C C   . ALA C 1 70  ? 40.086  57.386  229.055 1.00 92.74  ? 70  ALA 3 C   1 
ATOM 5843  O O   . ALA C 1 70  ? 39.584  56.557  228.289 1.00 100.91 ? 70  ALA 3 O   1 
ATOM 5844  C CB  . ALA C 1 70  ? 40.665  59.499  227.842 1.00 97.02  ? 70  ALA 3 CB  1 
ATOM 5845  N N   . ALA C 1 71  ? 39.597  57.637  230.268 1.00 88.60  ? 71  ALA 3 N   1 
ATOM 5846  C CA  . ALA C 1 71  ? 38.546  56.803  230.836 1.00 92.54  ? 71  ALA 3 CA  1 
ATOM 5847  C C   . ALA C 1 71  ? 37.133  57.344  231.058 1.00 98.43  ? 71  ALA 3 C   1 
ATOM 5848  O O   . ALA C 1 71  ? 36.283  57.248  230.169 1.00 113.97 ? 71  ALA 3 O   1 
ATOM 5849  C CB  . ALA C 1 71  ? 39.056  56.143  232.108 1.00 100.58 ? 71  ALA 3 CB  1 
ATOM 5850  N N   . GLU C 1 72  ? 36.881  57.937  232.222 1.00 91.85  ? 72  GLU 3 N   1 
ATOM 5851  C CA  . GLU C 1 72  ? 35.531  58.396  232.545 1.00 85.85  ? 72  GLU 3 CA  1 
ATOM 5852  C C   . GLU C 1 72  ? 35.185  59.880  232.492 1.00 80.18  ? 72  GLU 3 C   1 
ATOM 5853  O O   . GLU C 1 72  ? 34.269  60.304  233.190 1.00 79.54  ? 72  GLU 3 O   1 
ATOM 5854  C CB  . GLU C 1 72  ? 35.141  57.820  233.905 1.00 83.42  ? 72  GLU 3 CB  1 
ATOM 5855  C CG  . GLU C 1 72  ? 35.280  56.295  233.985 1.00 104.52 ? 72  GLU 3 CG  1 
ATOM 5856  C CD  . GLU C 1 72  ? 35.273  55.763  235.410 1.00 107.77 ? 72  GLU 3 CD  1 
ATOM 5857  O OE1 . GLU C 1 72  ? 36.126  56.212  236.204 1.00 126.31 ? 72  GLU 3 OE1 1 
ATOM 5858  O OE2 . GLU C 1 72  ? 34.447  54.877  235.737 1.00 112.31 ? 72  GLU 3 OE2 1 
ATOM 5859  N N   . LYS C 1 73  ? 35.853  60.641  231.621 1.00 78.87  ? 73  LYS 3 N   1 
ATOM 5860  C CA  . LYS C 1 73  ? 35.626  62.090  231.461 1.00 78.20  ? 73  LYS 3 CA  1 
ATOM 5861  C C   . LYS C 1 73  ? 34.177  62.539  231.527 1.00 76.91  ? 73  LYS 3 C   1 
ATOM 5862  O O   . LYS C 1 73  ? 33.296  61.853  231.048 1.00 82.39  ? 73  LYS 3 O   1 
ATOM 5863  C CB  . LYS C 1 73  ? 36.185  62.573  230.135 1.00 88.58  ? 73  LYS 3 CB  1 
ATOM 5864  C CG  . LYS C 1 73  ? 37.660  62.860  230.163 1.00 122.42 ? 73  LYS 3 CG  1 
ATOM 5865  C CD  . LYS C 1 73  ? 37.920  64.361  230.147 1.00 159.31 ? 73  LYS 3 CD  1 
ATOM 5866  C CE  . LYS C 1 73  ? 39.403  64.685  229.957 1.00 179.77 ? 73  LYS 3 CE  1 
ATOM 5867  N NZ  . LYS C 1 73  ? 39.945  64.232  228.631 1.00 201.02 ? 73  LYS 3 NZ  1 
ATOM 5868  N N   . GLN C 1 74  ? 33.929  63.704  232.105 1.00 78.63  ? 74  GLN 3 N   1 
ATOM 5869  C CA  . GLN C 1 74  ? 32.569  64.185  232.189 1.00 73.73  ? 74  GLN 3 CA  1 
ATOM 5870  C C   . GLN C 1 74  ? 32.275  64.920  230.908 1.00 60.34  ? 74  GLN 3 C   1 
ATOM 5871  O O   . GLN C 1 74  ? 33.071  65.721  230.451 1.00 52.14  ? 74  GLN 3 O   1 
ATOM 5872  C CB  . GLN C 1 74  ? 32.372  65.098  233.408 1.00 98.31  ? 74  GLN 3 CB  1 
ATOM 5873  C CG  . GLN C 1 74  ? 31.074  65.955  233.394 1.00 125.60 ? 74  GLN 3 CG  1 
ATOM 5874  C CD  . GLN C 1 74  ? 29.795  65.204  232.945 1.00 134.45 ? 74  GLN 3 CD  1 
ATOM 5875  O OE1 . GLN C 1 74  ? 29.768  63.975  232.865 1.00 137.95 ? 74  GLN 3 OE1 1 
ATOM 5876  N NE2 . GLN C 1 74  ? 28.743  65.961  232.636 1.00 122.88 ? 74  GLN 3 NE2 1 
ATOM 5877  N N   . PHE C 1 75  ? 31.101  64.662  230.360 1.00 49.82  ? 75  PHE 3 N   1 
ATOM 5878  C CA  . PHE C 1 75  ? 30.657  65.270  229.119 1.00 54.14  ? 75  PHE 3 CA  1 
ATOM 5879  C C   . PHE C 1 75  ? 31.066  66.700  228.980 1.00 61.74  ? 75  PHE 3 C   1 
ATOM 5880  O O   . PHE C 1 75  ? 31.683  67.102  227.989 1.00 61.71  ? 75  PHE 3 O   1 
ATOM 5881  C CB  . PHE C 1 75  ? 29.145  65.235  229.048 1.00 63.10  ? 75  PHE 3 CB  1 
ATOM 5882  C CG  . PHE C 1 75  ? 28.587  63.883  228.797 1.00 78.10  ? 75  PHE 3 CG  1 
ATOM 5883  C CD1 . PHE C 1 75  ? 28.679  62.891  229.762 1.00 76.39  ? 75  PHE 3 CD1 1 
ATOM 5884  C CD2 . PHE C 1 75  ? 27.958  63.599  227.593 1.00 91.00  ? 75  PHE 3 CD2 1 
ATOM 5885  C CE1 . PHE C 1 75  ? 28.152  61.631  229.532 1.00 85.54  ? 75  PHE 3 CE1 1 
ATOM 5886  C CE2 . PHE C 1 75  ? 27.426  62.345  227.354 1.00 103.08 ? 75  PHE 3 CE2 1 
ATOM 5887  C CZ  . PHE C 1 75  ? 27.525  61.356  228.330 1.00 95.06  ? 75  PHE 3 CZ  1 
ATOM 5888  N N   . THR C 1 76  ? 30.677  67.467  229.987 1.00 75.71  ? 76  THR 3 N   1 
ATOM 5889  C CA  . THR C 1 76  ? 30.939  68.890  230.025 1.00 87.61  ? 76  THR 3 CA  1 
ATOM 5890  C C   . THR C 1 76  ? 32.411  69.170  229.981 1.00 85.73  ? 76  THR 3 C   1 
ATOM 5891  O O   . THR C 1 76  ? 32.836  70.173  229.414 1.00 86.93  ? 76  THR 3 O   1 
ATOM 5892  C CB  . THR C 1 76  ? 30.337  69.525  231.267 1.00 100.58 ? 76  THR 3 CB  1 
ATOM 5893  O OG1 . THR C 1 76  ? 29.790  68.498  232.113 1.00 111.91 ? 76  THR 3 OG1 1 
ATOM 5894  C CG2 . THR C 1 76  ? 29.235  70.506  230.863 1.00 112.94 ? 76  THR 3 CG2 1 
ATOM 5895  N N   . ASP C 1 77  ? 33.192  68.306  230.607 1.00 85.61  ? 77  ASP 3 N   1 
ATOM 5896  C CA  . ASP C 1 77  ? 34.617  68.502  230.570 1.00 103.09 ? 77  ASP 3 CA  1 
ATOM 5897  C C   . ASP C 1 77  ? 35.264  67.286  229.945 1.00 100.01 ? 77  ASP 3 C   1 
ATOM 5898  O O   . ASP C 1 77  ? 35.891  66.473  230.628 1.00 105.99 ? 77  ASP 3 O   1 
ATOM 5899  C CB  . ASP C 1 77  ? 35.178  68.780  231.965 1.00 125.28 ? 77  ASP 3 CB  1 
ATOM 5900  C CG  . ASP C 1 77  ? 36.394  69.702  231.927 1.00 141.77 ? 77  ASP 3 CG  1 
ATOM 5901  O OD1 . ASP C 1 77  ? 36.795  70.135  230.813 1.00 152.45 ? 77  ASP 3 OD1 1 
ATOM 5902  O OD2 . ASP C 1 77  ? 36.931  70.020  233.010 1.00 152.42 ? 77  ASP 3 OD2 1 
ATOM 5903  N N   . ASP C 1 78  ? 34.997  67.094  228.663 1.00 86.72  ? 78  ASP 3 N   1 
ATOM 5904  C CA  . ASP C 1 78  ? 35.582  65.978  227.962 1.00 72.41  ? 78  ASP 3 CA  1 
ATOM 5905  C C   . ASP C 1 78  ? 36.444  66.593  226.898 1.00 66.78  ? 78  ASP 3 C   1 
ATOM 5906  O O   . ASP C 1 78  ? 35.952  67.100  225.900 1.00 57.25  ? 78  ASP 3 O   1 
ATOM 5907  C CB  . ASP C 1 78  ? 34.512  65.066  227.353 1.00 69.96  ? 78  ASP 3 CB  1 
ATOM 5908  C CG  . ASP C 1 78  ? 35.106  63.860  226.641 1.00 70.08  ? 78  ASP 3 CG  1 
ATOM 5909  O OD1 . ASP C 1 78  ? 36.361  63.712  226.694 1.00 60.16  ? 78  ASP 3 OD1 1 
ATOM 5910  O OD2 . ASP C 1 78  ? 34.318  63.080  226.026 1.00 48.30  ? 78  ASP 3 OD2 1 
ATOM 5911  N N   . SER C 1 79  ? 37.714  66.735  227.221 1.00 61.97  ? 79  SER 3 N   1 
ATOM 5912  C CA  . SER C 1 79  ? 38.643  67.275  226.262 1.00 73.27  ? 79  SER 3 CA  1 
ATOM 5913  C C   . SER C 1 79  ? 39.808  66.342  226.182 1.00 77.31  ? 79  SER 3 C   1 
ATOM 5914  O O   . SER C 1 79  ? 40.648  66.319  227.079 1.00 80.95  ? 79  SER 3 O   1 
ATOM 5915  C CB  . SER C 1 79  ? 39.174  68.630  226.669 1.00 79.84  ? 79  SER 3 CB  1 
ATOM 5916  O OG  . SER C 1 79  ? 40.228  68.985  225.776 1.00 100.91 ? 79  SER 3 OG  1 
ATOM 5917  N N   . PRO C 1 80  ? 39.814  65.471  225.181 1.00 75.31  ? 80  PRO 3 N   1 
ATOM 5918  C CA  . PRO C 1 80  ? 40.912  64.526  225.017 1.00 65.57  ? 80  PRO 3 CA  1 
ATOM 5919  C C   . PRO C 1 80  ? 42.024  65.254  224.258 1.00 60.02  ? 80  PRO 3 C   1 
ATOM 5920  O O   . PRO C 1 80  ? 41.842  66.432  223.897 1.00 45.75  ? 80  PRO 3 O   1 
ATOM 5921  C CB  . PRO C 1 80  ? 40.258  63.431  224.213 1.00 65.09  ? 80  PRO 3 CB  1 
ATOM 5922  C CG  . PRO C 1 80  ? 39.399  64.229  223.294 1.00 64.23  ? 80  PRO 3 CG  1 
ATOM 5923  C CD  . PRO C 1 80  ? 38.741  65.204  224.217 1.00 70.48  ? 80  PRO 3 CD  1 
ATOM 5924  N N   . ASP C 1 81  ? 43.176  64.584  224.117 1.00 54.69  ? 81  ASP 3 N   1 
ATOM 5925  C CA  . ASP C 1 81  ? 44.365  65.115  223.440 1.00 53.46  ? 81  ASP 3 CA  1 
ATOM 5926  C C   . ASP C 1 81  ? 44.514  64.416  222.141 1.00 45.53  ? 81  ASP 3 C   1 
ATOM 5927  O O   . ASP C 1 81  ? 44.314  63.204  222.059 1.00 36.50  ? 81  ASP 3 O   1 
ATOM 5928  C CB  . ASP C 1 81  ? 45.643  64.814  224.207 1.00 76.68  ? 81  ASP 3 CB  1 
ATOM 5929  C CG  . ASP C 1 81  ? 45.658  65.417  225.583 1.00 100.39 ? 81  ASP 3 CG  1 
ATOM 5930  O OD1 . ASP C 1 81  ? 45.434  66.646  225.696 1.00 118.80 ? 81  ASP 3 OD1 1 
ATOM 5931  O OD2 . ASP C 1 81  ? 45.921  64.656  226.549 1.00 105.13 ? 81  ASP 3 OD2 1 
ATOM 5932  N N   . LYS C 1 82  ? 45.032  65.142  221.166 1.00 40.67  ? 82  LYS 3 N   1 
ATOM 5933  C CA  . LYS C 1 82  ? 45.191  64.585  219.838 1.00 32.70  ? 82  LYS 3 CA  1 
ATOM 5934  C C   . LYS C 1 82  ? 45.828  63.220  219.864 1.00 34.78  ? 82  LYS 3 C   1 
ATOM 5935  O O   . LYS C 1 82  ? 45.362  62.285  219.236 1.00 45.66  ? 82  LYS 3 O   1 
ATOM 5936  C CB  . LYS C 1 82  ? 46.037  65.510  218.987 1.00 22.79  ? 82  LYS 3 CB  1 
ATOM 5937  C CG  . LYS C 1 82  ? 46.528  64.840  217.728 1.00 47.06  ? 82  LYS 3 CG  1 
ATOM 5938  C CD  . LYS C 1 82  ? 46.341  65.741  216.541 1.00 60.65  ? 82  LYS 3 CD  1 
ATOM 5939  C CE  . LYS C 1 82  ? 47.046  65.166  215.337 1.00 88.10  ? 82  LYS 3 CE  1 
ATOM 5940  N NZ  . LYS C 1 82  ? 46.835  65.992  214.100 1.00 106.01 ? 82  LYS 3 NZ  1 
ATOM 5941  N N   . GLU C 1 83  ? 46.842  63.104  220.692 1.00 37.44  ? 83  GLU 3 N   1 
ATOM 5942  C CA  . GLU C 1 83  ? 47.621  61.899  220.806 1.00 38.37  ? 83  GLU 3 CA  1 
ATOM 5943  C C   . GLU C 1 83  ? 46.829  60.679  221.217 1.00 30.21  ? 83  GLU 3 C   1 
ATOM 5944  O O   . GLU C 1 83  ? 47.340  59.571  221.132 1.00 45.38  ? 83  GLU 3 O   1 
ATOM 5945  C CB  . GLU C 1 83  ? 48.805  62.133  221.760 1.00 65.83  ? 83  GLU 3 CB  1 
ATOM 5946  C CG  . GLU C 1 83  ? 49.873  63.136  221.267 1.00 83.10  ? 83  GLU 3 CG  1 
ATOM 5947  C CD  . GLU C 1 83  ? 49.301  64.489  220.857 1.00 105.01 ? 83  GLU 3 CD  1 
ATOM 5948  O OE1 . GLU C 1 83  ? 48.538  65.102  221.650 1.00 114.72 ? 83  GLU 3 OE1 1 
ATOM 5949  O OE2 . GLU C 1 83  ? 49.592  64.927  219.721 1.00 114.10 ? 83  GLU 3 OE2 1 
ATOM 5950  N N   . GLN C 1 84  ? 45.607  60.850  221.694 1.00 19.81  ? 84  GLN 3 N   1 
ATOM 5951  C CA  . GLN C 1 84  ? 44.812  59.674  222.072 1.00 41.16  ? 84  GLN 3 CA  1 
ATOM 5952  C C   . GLN C 1 84  ? 43.592  59.520  221.140 1.00 42.04  ? 84  GLN 3 C   1 
ATOM 5953  O O   . GLN C 1 84  ? 42.636  58.743  221.383 1.00 31.34  ? 84  GLN 3 O   1 
ATOM 5954  C CB  . GLN C 1 84  ? 44.412  59.750  223.536 1.00 46.70  ? 84  GLN 3 CB  1 
ATOM 5955  C CG  . GLN C 1 84  ? 44.321  61.167  224.085 1.00 47.45  ? 84  GLN 3 CG  1 
ATOM 5956  C CD  . GLN C 1 84  ? 43.683  61.203  225.456 1.00 65.52  ? 84  GLN 3 CD  1 
ATOM 5957  O OE1 . GLN C 1 84  ? 42.809  62.038  225.731 1.00 71.40  ? 84  GLN 3 OE1 1 
ATOM 5958  N NE2 . GLN C 1 84  ? 44.077  60.261  226.316 1.00 65.44  ? 84  GLN 3 NE2 1 
ATOM 5959  N N   . LEU C 1 85  ? 43.716  60.204  220.008 1.00 37.04  ? 85  LEU 3 N   1 
ATOM 5960  C CA  . LEU C 1 85  ? 42.706  60.237  218.984 1.00 38.87  ? 85  LEU 3 CA  1 
ATOM 5961  C C   . LEU C 1 85  ? 43.159  59.718  217.639 1.00 43.54  ? 85  LEU 3 C   1 
ATOM 5962  O O   . LEU C 1 85  ? 43.748  60.439  216.807 1.00 39.54  ? 85  LEU 3 O   1 
ATOM 5963  C CB  . LEU C 1 85  ? 42.197  61.653  218.805 1.00 47.61  ? 85  LEU 3 CB  1 
ATOM 5964  C CG  . LEU C 1 85  ? 41.411  62.138  220.002 1.00 50.84  ? 85  LEU 3 CG  1 
ATOM 5965  C CD1 . LEU C 1 85  ? 40.739  63.427  219.589 1.00 56.26  ? 85  LEU 3 CD1 1 
ATOM 5966  C CD2 . LEU C 1 85  ? 40.383  61.074  220.425 1.00 45.12  ? 85  LEU 3 CD2 1 
ATOM 5967  N N   . PRO C 1 86  ? 42.851  58.454  217.384 1.00 37.90  ? 86  PRO 3 N   1 
ATOM 5968  C CA  . PRO C 1 86  ? 43.239  57.868  216.111 1.00 24.43  ? 86  PRO 3 CA  1 
ATOM 5969  C C   . PRO C 1 86  ? 42.487  58.590  215.001 1.00 26.28  ? 86  PRO 3 C   1 
ATOM 5970  O O   . PRO C 1 86  ? 41.280  58.928  215.145 1.00 30.62  ? 86  PRO 3 O   1 
ATOM 5971  C CB  . PRO C 1 86  ? 42.763  56.433  216.258 1.00 23.34  ? 86  PRO 3 CB  1 
ATOM 5972  C CG  . PRO C 1 86  ? 42.856  56.196  217.741 1.00 17.49  ? 86  PRO 3 CG  1 
ATOM 5973  C CD  . PRO C 1 86  ? 42.266  57.450  218.289 1.00 27.94  ? 86  PRO 3 CD  1 
ATOM 5974  N N   . CYS C 1 87  ? 43.221  58.853  213.924 1.00 16.14  ? 87  CYS 3 N   1 
ATOM 5975  C CA  . CYS C 1 87  ? 42.677  59.519  212.739 1.00 34.61  ? 87  CYS 3 CA  1 
ATOM 5976  C C   . CYS C 1 87  ? 42.786  58.739  211.436 1.00 30.36  ? 87  CYS 3 C   1 
ATOM 5977  O O   . CYS C 1 87  ? 43.663  57.900  211.217 1.00 32.26  ? 87  CYS 3 O   1 
ATOM 5978  C CB  . CYS C 1 87  ? 43.356  60.865  212.494 1.00 37.36  ? 87  CYS 3 CB  1 
ATOM 5979  S SG  . CYS C 1 87  ? 43.286  61.947  213.867 1.00 55.22  ? 87  CYS 3 SG  1 
ATOM 5980  N N   . TYR C 1 88  ? 41.934  59.123  210.514 1.00 33.99  ? 88  TYR 3 N   1 
ATOM 5981  C CA  . TYR C 1 88  ? 41.925  58.505  209.221 1.00 27.99  ? 88  TYR 3 CA  1 
ATOM 5982  C C   . TYR C 1 88  ? 43.247  58.855  208.601 1.00 26.10  ? 88  TYR 3 C   1 
ATOM 5983  O O   . TYR C 1 88  ? 43.734  59.994  208.734 1.00 37.17  ? 88  TYR 3 O   1 
ATOM 5984  C CB  . TYR C 1 88  ? 40.807  59.098  208.362 1.00 28.27  ? 88  TYR 3 CB  1 
ATOM 5985  C CG  . TYR C 1 88  ? 39.439  58.632  208.750 1.00 22.60  ? 88  TYR 3 CG  1 
ATOM 5986  C CD1 . TYR C 1 88  ? 38.826  59.093  209.902 1.00 42.87  ? 88  TYR 3 CD1 1 
ATOM 5987  C CD2 . TYR C 1 88  ? 38.749  57.739  207.959 1.00 22.75  ? 88  TYR 3 CD2 1 
ATOM 5988  C CE1 . TYR C 1 88  ? 37.551  58.672  210.249 1.00 52.66  ? 88  TYR 3 CE1 1 
ATOM 5989  C CE2 . TYR C 1 88  ? 37.485  57.310  208.295 1.00 33.90  ? 88  TYR 3 CE2 1 
ATOM 5990  C CZ  . TYR C 1 88  ? 36.887  57.781  209.434 1.00 45.93  ? 88  TYR 3 CZ  1 
ATOM 5991  O OH  . TYR C 1 88  ? 35.613  57.383  209.723 1.00 46.34  ? 88  TYR 3 OH  1 
ATOM 5992  N N   . SER C 1 89  ? 43.816  57.861  207.939 1.00 22.80  ? 89  SER 3 N   1 
ATOM 5993  C CA  . SER C 1 89  ? 45.069  58.002  207.232 1.00 30.79  ? 89  SER 3 CA  1 
ATOM 5994  C C   . SER C 1 89  ? 44.631  58.130  205.782 1.00 22.28  ? 89  SER 3 C   1 
ATOM 5995  O O   . SER C 1 89  ? 43.854  57.312  205.298 1.00 28.16  ? 89  SER 3 O   1 
ATOM 5996  C CB  . SER C 1 89  ? 45.928  56.745  207.437 1.00 19.58  ? 89  SER 3 CB  1 
ATOM 5997  O OG  . SER C 1 89  ? 45.979  56.385  208.821 1.00 41.58  ? 89  SER 3 OG  1 
ATOM 5998  N N   . VAL C 1 90  ? 45.064  59.179  205.102 1.00 16.18  ? 90  VAL 3 N   1 
ATOM 5999  C CA  . VAL C 1 90  ? 44.684  59.364  203.706 1.00 19.98  ? 90  VAL 3 CA  1 
ATOM 6000  C C   . VAL C 1 90  ? 45.983  59.572  202.949 1.00 18.84  ? 90  VAL 3 C   1 
ATOM 6001  O O   . VAL C 1 90  ? 47.026  59.682  203.587 1.00 21.12  ? 90  VAL 3 O   1 
ATOM 6002  C CB  . VAL C 1 90  ? 43.769  60.602  203.579 1.00 40.04  ? 90  VAL 3 CB  1 
ATOM 6003  C CG1 . VAL C 1 90  ? 44.596  61.870  203.452 1.00 38.96  ? 90  VAL 3 CG1 1 
ATOM 6004  C CG2 . VAL C 1 90  ? 42.731  60.432  202.440 1.00 58.60  ? 90  VAL 3 CG2 1 
ATOM 6005  N N   . ALA C 1 91  ? 45.941  59.616  201.616 1.00 15.43  ? 91  ALA 3 N   1 
ATOM 6006  C CA  . ALA C 1 91  ? 47.151  59.829  200.804 1.00 14.48  ? 91  ALA 3 CA  1 
ATOM 6007  C C   . ALA C 1 91  ? 46.783  59.960  199.342 1.00 19.24  ? 91  ALA 3 C   1 
ATOM 6008  O O   . ALA C 1 91  ? 45.776  59.386  198.909 1.00 30.79  ? 91  ALA 3 O   1 
ATOM 6009  C CB  . ALA C 1 91  ? 48.076  58.662  200.956 1.00 11.46  ? 91  ALA 3 CB  1 
ATOM 6010  N N   . ARG C 1 92  ? 47.600  60.646  198.548 1.00 14.77  ? 92  ARG 3 N   1 
ATOM 6011  C CA  . ARG C 1 92  ? 47.251  60.756  197.124 1.00 23.34  ? 92  ARG 3 CA  1 
ATOM 6012  C C   . ARG C 1 92  ? 48.357  60.374  196.151 1.00 30.52  ? 92  ARG 3 C   1 
ATOM 6013  O O   . ARG C 1 92  ? 49.500  60.850  196.239 1.00 41.18  ? 92  ARG 3 O   1 
ATOM 6014  C CB  . ARG C 1 92  ? 46.716  62.145  196.772 1.00 25.38  ? 92  ARG 3 CB  1 
ATOM 6015  C CG  . ARG C 1 92  ? 46.839  62.533  195.268 1.00 71.65  ? 92  ARG 3 CG  1 
ATOM 6016  C CD  . ARG C 1 92  ? 46.672  64.051  195.019 1.00 77.12  ? 92  ARG 3 CD  1 
ATOM 6017  N NE  . ARG C 1 92  ? 47.596  64.817  195.853 1.00 112.68 ? 92  ARG 3 NE  1 
ATOM 6018  C CZ  . ARG C 1 92  ? 48.658  65.474  195.399 1.00 127.96 ? 92  ARG 3 CZ  1 
ATOM 6019  N NH1 . ARG C 1 92  ? 48.923  65.473  194.089 1.00 133.72 ? 92  ARG 3 NH1 1 
ATOM 6020  N NH2 . ARG C 1 92  ? 49.484  66.071  196.265 1.00 135.39 ? 92  ARG 3 NH2 1 
ATOM 6021  N N   . ILE C 1 93  ? 47.982  59.535  195.200 1.00 20.72  ? 93  ILE 3 N   1 
ATOM 6022  C CA  . ILE C 1 93  ? 48.886  59.064  194.200 1.00 16.84  ? 93  ILE 3 CA  1 
ATOM 6023  C C   . ILE C 1 93  ? 48.581  59.803  192.947 1.00 20.57  ? 93  ILE 3 C   1 
ATOM 6024  O O   . ILE C 1 93  ? 47.490  59.750  192.427 1.00 40.33  ? 93  ILE 3 O   1 
ATOM 6025  C CB  . ILE C 1 93  ? 48.719  57.602  193.969 1.00 19.25  ? 93  ILE 3 CB  1 
ATOM 6026  C CG1 . ILE C 1 93  ? 49.072  56.878  195.263 1.00 8.47   ? 93  ILE 3 CG1 1 
ATOM 6027  C CG2 . ILE C 1 93  ? 49.613  57.169  192.825 1.00 20.98  ? 93  ILE 3 CG2 1 
ATOM 6028  C CD1 . ILE C 1 93  ? 48.609  55.485  195.309 1.00 23.84  ? 93  ILE 3 CD1 1 
ATOM 6029  N N   . PRO C 1 94  ? 49.542  60.574  192.493 1.00 27.46  ? 94  PRO 3 N   1 
ATOM 6030  C CA  . PRO C 1 94  ? 49.590  61.429  191.317 1.00 21.31  ? 94  PRO 3 CA  1 
ATOM 6031  C C   . PRO C 1 94  ? 49.771  60.579  190.132 1.00 17.64  ? 94  PRO 3 C   1 
ATOM 6032  O O   . PRO C 1 94  ? 50.707  59.808  190.072 1.00 32.30  ? 94  PRO 3 O   1 
ATOM 6033  C CB  . PRO C 1 94  ? 50.867  62.210  191.538 1.00 20.54  ? 94  PRO 3 CB  1 
ATOM 6034  C CG  . PRO C 1 94  ? 51.002  62.211  193.030 1.00 25.95  ? 94  PRO 3 CG  1 
ATOM 6035  C CD  . PRO C 1 94  ? 50.718  60.801  193.333 1.00 29.11  ? 94  PRO 3 CD  1 
ATOM 6036  N N   . LEU C 1 95  ? 48.896  60.729  189.169 1.00 14.91  ? 95  LEU 3 N   1 
ATOM 6037  C CA  . LEU C 1 95  ? 49.008  59.938  187.966 1.00 28.23  ? 95  LEU 3 CA  1 
ATOM 6038  C C   . LEU C 1 95  ? 49.245  60.862  186.800 1.00 29.39  ? 95  LEU 3 C   1 
ATOM 6039  O O   . LEU C 1 95  ? 48.840  61.996  186.805 1.00 36.32  ? 95  LEU 3 O   1 
ATOM 6040  C CB  . LEU C 1 95  ? 47.744  59.127  187.744 1.00 29.33  ? 95  LEU 3 CB  1 
ATOM 6041  C CG  . LEU C 1 95  ? 47.273  58.436  188.999 1.00 27.49  ? 95  LEU 3 CG  1 
ATOM 6042  C CD1 . LEU C 1 95  ? 46.253  57.456  188.578 1.00 35.26  ? 95  LEU 3 CD1 1 
ATOM 6043  C CD2 . LEU C 1 95  ? 48.427  57.723  189.673 1.00 34.25  ? 95  LEU 3 CD2 1 
ATOM 6044  N N   . PRO C 1 96  ? 49.883  60.368  185.758 1.00 41.29  ? 96  PRO 3 N   1 
ATOM 6045  C CA  . PRO C 1 96  ? 50.216  61.111  184.536 1.00 37.70  ? 96  PRO 3 CA  1 
ATOM 6046  C C   . PRO C 1 96  ? 49.014  61.607  183.779 1.00 31.89  ? 96  PRO 3 C   1 
ATOM 6047  O O   . PRO C 1 96  ? 48.139  60.802  183.507 1.00 45.39  ? 96  PRO 3 O   1 
ATOM 6048  C CB  . PRO C 1 96  ? 50.910  60.046  183.686 1.00 57.29  ? 96  PRO 3 CB  1 
ATOM 6049  C CG  . PRO C 1 96  ? 51.447  59.055  184.704 1.00 72.98  ? 96  PRO 3 CG  1 
ATOM 6050  C CD  . PRO C 1 96  ? 50.314  58.964  185.672 1.00 56.51  ? 96  PRO 3 CD  1 
ATOM 6051  N N   . ASN C 1 97  ? 48.971  62.873  183.350 1.00 38.13  ? 97  ASN 3 N   1 
ATOM 6052  C CA  . ASN C 1 97  ? 47.795  63.288  182.561 1.00 53.69  ? 97  ASN 3 CA  1 
ATOM 6053  C C   . ASN C 1 97  ? 47.809  62.484  181.288 1.00 50.77  ? 97  ASN 3 C   1 
ATOM 6054  O O   . ASN C 1 97  ? 48.790  62.447  180.544 1.00 50.04  ? 97  ASN 3 O   1 
ATOM 6055  C CB  . ASN C 1 97  ? 47.727  64.760  182.170 1.00 71.52  ? 97  ASN 3 CB  1 
ATOM 6056  C CG  . ASN C 1 97  ? 46.575  65.034  181.176 1.00 85.60  ? 97  ASN 3 CG  1 
ATOM 6057  O OD1 . ASN C 1 97  ? 46.580  64.541  180.043 1.00 78.41  ? 97  ASN 3 OD1 1 
ATOM 6058  N ND2 . ASN C 1 97  ? 45.564  65.765  181.626 1.00 108.00 ? 97  ASN 3 ND2 1 
ATOM 6059  N N   . ILE C 1 98  ? 46.666  61.935  180.973 1.00 50.71  ? 98  ILE 3 N   1 
ATOM 6060  C CA  . ILE C 1 98  ? 46.614  61.092  179.832 1.00 56.85  ? 98  ILE 3 CA  1 
ATOM 6061  C C   . ILE C 1 98  ? 46.423  61.697  178.445 1.00 55.27  ? 98  ILE 3 C   1 
ATOM 6062  O O   . ILE C 1 98  ? 47.138  61.349  177.511 1.00 72.99  ? 98  ILE 3 O   1 
ATOM 6063  C CB  . ILE C 1 98  ? 45.669  59.946  180.151 1.00 54.75  ? 98  ILE 3 CB  1 
ATOM 6064  C CG1 . ILE C 1 98  ? 46.373  59.012  181.140 1.00 30.36  ? 98  ILE 3 CG1 1 
ATOM 6065  C CG2 . ILE C 1 98  ? 45.223  59.233  178.895 1.00 80.05  ? 98  ILE 3 CG2 1 
ATOM 6066  C CD1 . ILE C 1 98  ? 45.526  57.870  181.563 1.00 54.97  ? 98  ILE 3 CD1 1 
ATOM 6067  N N   . ASN C 1 99  ? 45.514  62.633  178.303 1.00 59.80  ? 99  ASN 3 N   1 
ATOM 6068  C CA  . ASN C 1 99  ? 45.258  63.207  176.992 1.00 74.71  ? 99  ASN 3 CA  1 
ATOM 6069  C C   . ASN C 1 99  ? 46.080  64.469  176.794 1.00 90.00  ? 99  ASN 3 C   1 
ATOM 6070  O O   . ASN C 1 99  ? 46.112  65.333  177.672 1.00 84.55  ? 99  ASN 3 O   1 
ATOM 6071  C CB  . ASN C 1 99  ? 43.767  63.476  176.855 1.00 70.11  ? 99  ASN 3 CB  1 
ATOM 6072  C CG  . ASN C 1 99  ? 43.093  63.608  178.205 1.00 73.58  ? 99  ASN 3 CG  1 
ATOM 6073  O OD1 . ASN C 1 99  ? 43.195  64.636  178.857 1.00 82.23  ? 99  ASN 3 OD1 1 
ATOM 6074  N ND2 . ASN C 1 99  ? 42.521  62.521  178.691 1.00 68.26  ? 99  ASN 3 ND2 1 
ATOM 6075  N N   . GLU C 1 100 ? 46.797  64.531  175.667 1.00 105.39 ? 100 GLU 3 N   1 
ATOM 6076  C CA  . GLU C 1 100 ? 47.646  65.679  175.353 1.00 113.74 ? 100 GLU 3 CA  1 
ATOM 6077  C C   . GLU C 1 100 ? 46.752  66.819  174.954 1.00 120.39 ? 100 GLU 3 C   1 
ATOM 6078  O O   . GLU C 1 100 ? 46.171  67.477  175.814 1.00 124.61 ? 100 GLU 3 O   1 
ATOM 6079  C CB  . GLU C 1 100 ? 48.658  65.324  174.266 1.00 119.91 ? 100 GLU 3 CB  1 
ATOM 6080  C CG  . GLU C 1 100 ? 49.686  64.309  174.767 1.00 154.81 ? 100 GLU 3 CG  1 
ATOM 6081  C CD  . GLU C 1 100 ? 51.104  64.877  174.921 1.00 170.83 ? 100 GLU 3 CD  1 
ATOM 6082  O OE1 . GLU C 1 100 ? 51.833  64.882  173.905 1.00 189.47 ? 100 GLU 3 OE1 1 
ATOM 6083  O OE2 . GLU C 1 100 ? 51.518  65.262  176.049 1.00 167.95 ? 100 GLU 3 OE2 1 
ATOM 6084  N N   . ASP C 1 101 ? 46.630  67.093  173.671 1.00 130.05 ? 101 ASP 3 N   1 
ATOM 6085  C CA  . ASP C 1 101 ? 45.721  68.155  173.339 1.00 140.91 ? 101 ASP 3 CA  1 
ATOM 6086  C C   . ASP C 1 101 ? 44.315  67.631  173.228 1.00 136.80 ? 101 ASP 3 C   1 
ATOM 6087  O O   . ASP C 1 101 ? 43.945  66.925  172.279 1.00 138.67 ? 101 ASP 3 O   1 
ATOM 6088  C CB  . ASP C 1 101 ? 46.143  68.935  172.107 1.00 157.15 ? 101 ASP 3 CB  1 
ATOM 6089  C CG  . ASP C 1 101 ? 46.691  70.302  172.467 1.00 170.38 ? 101 ASP 3 CG  1 
ATOM 6090  O OD1 . ASP C 1 101 ? 47.351  70.388  173.516 1.00 171.66 ? 101 ASP 3 OD1 1 
ATOM 6091  O OD2 . ASP C 1 101 ? 46.440  71.286  171.745 1.00 185.97 ? 101 ASP 3 OD2 1 
ATOM 6092  N N   . LEU C 1 102 ? 43.556  67.933  174.267 1.00 128.84 ? 102 LEU 3 N   1 
ATOM 6093  C CA  . LEU C 1 102 ? 42.164  67.559  174.349 1.00 129.79 ? 102 LEU 3 CA  1 
ATOM 6094  C C   . LEU C 1 102 ? 41.442  68.699  173.724 1.00 133.48 ? 102 LEU 3 C   1 
ATOM 6095  O O   . LEU C 1 102 ? 40.429  69.165  174.235 1.00 122.16 ? 102 LEU 3 O   1 
ATOM 6096  C CB  . LEU C 1 102 ? 41.722  67.462  175.788 1.00 135.95 ? 102 LEU 3 CB  1 
ATOM 6097  C CG  . LEU C 1 102 ? 42.525  68.306  176.773 1.00 134.64 ? 102 LEU 3 CG  1 
ATOM 6098  C CD1 . LEU C 1 102 ? 41.626  68.931  177.814 1.00 128.93 ? 102 LEU 3 CD1 1 
ATOM 6099  C CD2 . LEU C 1 102 ? 43.570  67.401  177.410 1.00 147.69 ? 102 LEU 3 CD2 1 
ATOM 6100  N N   . THR C 1 103 ? 42.042  69.211  172.663 1.00 148.47 ? 103 THR 3 N   1 
ATOM 6101  C CA  . THR C 1 103 ? 41.450  70.293  171.916 1.00 164.32 ? 103 THR 3 CA  1 
ATOM 6102  C C   . THR C 1 103 ? 40.067  69.744  171.569 1.00 173.27 ? 103 THR 3 C   1 
ATOM 6103  O O   . THR C 1 103 ? 39.105  70.506  171.440 1.00 174.91 ? 103 THR 3 O   1 
ATOM 6104  C CB  . THR C 1 103 ? 42.261  70.544  170.619 1.00 170.72 ? 103 THR 3 CB  1 
ATOM 6105  O OG1 . THR C 1 103 ? 43.659  70.593  170.934 1.00 169.51 ? 103 THR 3 OG1 1 
ATOM 6106  C CG2 . THR C 1 103 ? 41.843  71.867  169.939 1.00 167.86 ? 103 THR 3 CG2 1 
ATOM 6107  N N   . CYS C 1 104 ? 39.969  68.412  171.456 1.00 179.12 ? 104 CYS 3 N   1 
ATOM 6108  C CA  . CYS C 1 104 ? 38.676  67.833  171.146 1.00 181.47 ? 104 CYS 3 CA  1 
ATOM 6109  C C   . CYS C 1 104 ? 38.131  66.568  171.839 1.00 174.35 ? 104 CYS 3 C   1 
ATOM 6110  O O   . CYS C 1 104 ? 38.762  65.498  171.855 1.00 171.69 ? 104 CYS 3 O   1 
ATOM 6111  C CB  . CYS C 1 104 ? 38.471  67.750  169.611 1.00 193.65 ? 104 CYS 3 CB  1 
ATOM 6112  S SG  . CYS C 1 104 ? 37.716  69.283  168.849 1.00 207.57 ? 104 CYS 3 SG  1 
ATOM 6113  N N   . GLY C 1 105 ? 36.964  66.826  172.445 1.00 162.67 ? 105 GLY 3 N   1 
ATOM 6114  C CA  . GLY C 1 105 ? 36.039  65.903  173.113 1.00 147.33 ? 105 GLY 3 CA  1 
ATOM 6115  C C   . GLY C 1 105 ? 36.173  64.660  173.998 1.00 144.35 ? 105 GLY 3 C   1 
ATOM 6116  O O   . GLY C 1 105 ? 35.825  64.734  175.177 1.00 140.43 ? 105 GLY 3 O   1 
ATOM 6117  N N   . ASN C 1 106 ? 36.433  63.498  173.377 1.00 138.71 ? 106 ASN 3 N   1 
ATOM 6118  C CA  . ASN C 1 106 ? 36.574  62.194  174.071 1.00 125.30 ? 106 ASN 3 CA  1 
ATOM 6119  C C   . ASN C 1 106 ? 37.985  61.992  174.650 1.00 105.11 ? 106 ASN 3 C   1 
ATOM 6120  O O   . ASN C 1 106 ? 38.904  61.463  173.995 1.00 102.82 ? 106 ASN 3 O   1 
ATOM 6121  C CB  . ASN C 1 106 ? 36.256  61.014  173.119 1.00 139.79 ? 106 ASN 3 CB  1 
ATOM 6122  C CG  . ASN C 1 106 ? 34.913  61.155  172.396 1.00 149.22 ? 106 ASN 3 CG  1 
ATOM 6123  O OD1 . ASN C 1 106 ? 34.817  60.865  171.198 1.00 161.23 ? 106 ASN 3 OD1 1 
ATOM 6124  N ND2 . ASN C 1 106 ? 33.871  61.576  173.116 1.00 140.67 ? 106 ASN 3 ND2 1 
ATOM 6125  N N   . ILE C 1 107 ? 38.136  62.393  175.898 1.00 71.95  ? 107 ILE 3 N   1 
ATOM 6126  C CA  . ILE C 1 107 ? 39.403  62.283  176.564 1.00 62.21  ? 107 ILE 3 CA  1 
ATOM 6127  C C   . ILE C 1 107 ? 39.501  61.059  177.460 1.00 55.54  ? 107 ILE 3 C   1 
ATOM 6128  O O   . ILE C 1 107 ? 38.553  60.282  177.601 1.00 54.95  ? 107 ILE 3 O   1 
ATOM 6129  C CB  . ILE C 1 107 ? 39.648  63.526  177.365 1.00 63.73  ? 107 ILE 3 CB  1 
ATOM 6130  C CG1 . ILE C 1 107 ? 38.879  63.464  178.691 1.00 71.01  ? 107 ILE 3 CG1 1 
ATOM 6131  C CG2 . ILE C 1 107 ? 39.188  64.709  176.542 1.00 54.70  ? 107 ILE 3 CG2 1 
ATOM 6132  C CD1 . ILE C 1 107 ? 39.276  64.528  179.731 1.00 72.62  ? 107 ILE 3 CD1 1 
ATOM 6133  N N   . LEU C 1 108 ? 40.640  60.928  178.115 1.00 29.53  ? 108 LEU 3 N   1 
ATOM 6134  C CA  . LEU C 1 108 ? 40.864  59.790  178.957 1.00 25.20  ? 108 LEU 3 CA  1 
ATOM 6135  C C   . LEU C 1 108 ? 41.227  60.110  180.359 1.00 30.38  ? 108 LEU 3 C   1 
ATOM 6136  O O   . LEU C 1 108 ? 42.113  60.941  180.613 1.00 38.12  ? 108 LEU 3 O   1 
ATOM 6137  C CB  . LEU C 1 108 ? 41.975  58.938  178.389 1.00 26.50  ? 108 LEU 3 CB  1 
ATOM 6138  C CG  . LEU C 1 108 ? 41.788  58.502  176.953 1.00 34.04  ? 108 LEU 3 CG  1 
ATOM 6139  C CD1 . LEU C 1 108 ? 42.770  57.416  176.742 1.00 21.52  ? 108 LEU 3 CD1 1 
ATOM 6140  C CD2 . LEU C 1 108 ? 40.382  57.984  176.707 1.00 41.01  ? 108 LEU 3 CD2 1 
ATOM 6141  N N   . MET C 1 109 ? 40.569  59.406  181.272 1.00 29.44  ? 109 MET 3 N   1 
ATOM 6142  C CA  . MET C 1 109 ? 40.850  59.570  182.677 1.00 27.51  ? 109 MET 3 CA  1 
ATOM 6143  C C   . MET C 1 109 ? 41.329  58.217  183.143 1.00 27.48  ? 109 MET 3 C   1 
ATOM 6144  O O   . MET C 1 109 ? 41.145  57.186  182.455 1.00 17.91  ? 109 MET 3 O   1 
ATOM 6145  C CB  . MET C 1 109 ? 39.597  59.934  183.455 1.00 42.16  ? 109 MET 3 CB  1 
ATOM 6146  C CG  . MET C 1 109 ? 38.799  61.137  182.991 1.00 17.46  ? 109 MET 3 CG  1 
ATOM 6147  S SD  . MET C 1 109 ? 38.213  61.914  184.515 1.00 49.13  ? 109 MET 3 SD  1 
ATOM 6148  C CE  . MET C 1 109 ? 37.014  62.887  183.820 1.00 54.52  ? 109 MET 3 CE  1 
ATOM 6149  N N   . TRP C 1 110 ? 41.967  58.212  184.299 1.00 24.05  ? 110 TRP 3 N   1 
ATOM 6150  C CA  . TRP C 1 110 ? 42.430  56.954  184.833 1.00 29.54  ? 110 TRP 3 CA  1 
ATOM 6151  C C   . TRP C 1 110 ? 41.273  56.387  185.623 1.00 35.22  ? 110 TRP 3 C   1 
ATOM 6152  O O   . TRP C 1 110 ? 40.647  57.129  186.407 1.00 38.14  ? 110 TRP 3 O   1 
ATOM 6153  C CB  . TRP C 1 110 ? 43.587  57.179  185.793 1.00 43.82  ? 110 TRP 3 CB  1 
ATOM 6154  C CG  . TRP C 1 110 ? 44.915  57.481  185.158 1.00 45.69  ? 110 TRP 3 CG  1 
ATOM 6155  C CD1 . TRP C 1 110 ? 45.565  58.660  185.183 1.00 47.10  ? 110 TRP 3 CD1 1 
ATOM 6156  C CD2 . TRP C 1 110 ? 45.792  56.559  184.497 1.00 41.13  ? 110 TRP 3 CD2 1 
ATOM 6157  N NE1 . TRP C 1 110 ? 46.790  58.545  184.591 1.00 43.54  ? 110 TRP 3 NE1 1 
ATOM 6158  C CE2 . TRP C 1 110 ? 46.954  57.262  184.161 1.00 33.81  ? 110 TRP 3 CE2 1 
ATOM 6159  C CE3 . TRP C 1 110 ? 45.703  55.208  184.164 1.00 44.84  ? 110 TRP 3 CE3 1 
ATOM 6160  C CZ2 . TRP C 1 110 ? 48.020  56.669  183.513 1.00 43.73  ? 110 TRP 3 CZ2 1 
ATOM 6161  C CZ3 . TRP C 1 110 ? 46.762  54.621  183.522 1.00 43.76  ? 110 TRP 3 CZ3 1 
ATOM 6162  C CH2 . TRP C 1 110 ? 47.907  55.349  183.201 1.00 49.44  ? 110 TRP 3 CH2 1 
ATOM 6163  N N   . GLU C 1 111 ? 40.993  55.096  185.427 1.00 22.44  ? 111 GLU 3 N   1 
ATOM 6164  C CA  . GLU C 1 111 ? 39.922  54.414  186.163 1.00 19.43  ? 111 GLU 3 CA  1 
ATOM 6165  C C   . GLU C 1 111 ? 40.415  53.334  187.122 1.00 19.68  ? 111 GLU 3 C   1 
ATOM 6166  O O   . GLU C 1 111 ? 41.142  52.419  186.734 1.00 28.27  ? 111 GLU 3 O   1 
ATOM 6167  C CB  . GLU C 1 111 ? 38.945  53.791  185.208 1.00 2.00   ? 111 GLU 3 CB  1 
ATOM 6168  C CG  . GLU C 1 111 ? 37.874  52.930  185.849 1.00 18.22  ? 111 GLU 3 CG  1 
ATOM 6169  C CD  . GLU C 1 111 ? 36.963  52.364  184.765 1.00 37.22  ? 111 GLU 3 CD  1 
ATOM 6170  O OE1 . GLU C 1 111 ? 37.338  52.580  183.577 1.00 2.00   ? 111 GLU 3 OE1 1 
ATOM 6171  O OE2 . GLU C 1 111 ? 35.908  51.719  185.062 1.00 17.01  ? 111 GLU 3 OE2 1 
ATOM 6172  N N   . ALA C 1 112 ? 40.029  53.439  188.383 1.00 16.43  ? 112 ALA 3 N   1 
ATOM 6173  C CA  . ALA C 1 112 ? 40.452  52.451  189.358 1.00 13.27  ? 112 ALA 3 CA  1 
ATOM 6174  C C   . ALA C 1 112 ? 39.491  51.337  189.207 1.00 18.88  ? 112 ALA 3 C   1 
ATOM 6175  O O   . ALA C 1 112 ? 38.295  51.482  189.441 1.00 26.21  ? 112 ALA 3 O   1 
ATOM 6176  C CB  . ALA C 1 112 ? 40.357  52.988  190.705 1.00 8.48   ? 112 ALA 3 CB  1 
ATOM 6177  N N   . VAL C 1 113 ? 40.031  50.184  188.927 1.00 24.73  ? 113 VAL 3 N   1 
ATOM 6178  C CA  . VAL C 1 113 ? 39.185  49.054  188.686 1.00 18.59  ? 113 VAL 3 CA  1 
ATOM 6179  C C   . VAL C 1 113 ? 39.126  48.017  189.759 1.00 18.84  ? 113 VAL 3 C   1 
ATOM 6180  O O   . VAL C 1 113 ? 38.063  47.497  190.116 1.00 12.60  ? 113 VAL 3 O   1 
ATOM 6181  C CB  . VAL C 1 113 ? 39.713  48.369  187.503 1.00 2.00   ? 113 VAL 3 CB  1 
ATOM 6182  C CG1 . VAL C 1 113 ? 38.931  47.196  187.232 1.00 11.74  ? 113 VAL 3 CG1 1 
ATOM 6183  C CG2 . VAL C 1 113 ? 39.641  49.288  186.366 1.00 34.12  ? 113 VAL 3 CG2 1 
ATOM 6184  N N   . THR C 1 114 ? 40.299  47.762  190.290 1.00 18.93  ? 114 THR 3 N   1 
ATOM 6185  C CA  . THR C 1 114 ? 40.467  46.716  191.227 1.00 14.20  ? 114 THR 3 CA  1 
ATOM 6186  C C   . THR C 1 114 ? 41.386  47.038  192.314 1.00 14.93  ? 114 THR 3 C   1 
ATOM 6187  O O   . THR C 1 114 ? 42.358  47.768  192.129 1.00 34.37  ? 114 THR 3 O   1 
ATOM 6188  C CB  . THR C 1 114 ? 41.092  45.609  190.460 1.00 10.51  ? 114 THR 3 CB  1 
ATOM 6189  O OG1 . THR C 1 114 ? 40.083  44.671  190.201 1.00 17.18  ? 114 THR 3 OG1 1 
ATOM 6190  C CG2 . THR C 1 114 ? 42.322  44.987  191.165 1.00 22.82  ? 114 THR 3 CG2 1 
ATOM 6191  N N   . VAL C 1 115 ? 41.228  46.306  193.387 1.00 11.23  ? 115 VAL 3 N   1 
ATOM 6192  C CA  . VAL C 1 115 ? 42.140  46.545  194.462 1.00 20.59  ? 115 VAL 3 CA  1 
ATOM 6193  C C   . VAL C 1 115 ? 42.294  45.318  195.278 1.00 19.88  ? 115 VAL 3 C   1 
ATOM 6194  O O   . VAL C 1 115 ? 41.343  44.564  195.469 1.00 16.77  ? 115 VAL 3 O   1 
ATOM 6195  C CB  . VAL C 1 115 ? 41.611  47.610  195.375 1.00 14.03  ? 115 VAL 3 CB  1 
ATOM 6196  C CG1 . VAL C 1 115 ? 40.237  47.249  195.774 1.00 14.05  ? 115 VAL 3 CG1 1 
ATOM 6197  C CG2 . VAL C 1 115 ? 42.451  47.712  196.596 1.00 11.06  ? 115 VAL 3 CG2 1 
ATOM 6198  N N   . LYS C 1 116 ? 43.519  45.073  195.700 1.00 11.13  ? 116 LYS 3 N   1 
ATOM 6199  C CA  . LYS C 1 116 ? 43.766  43.965  196.602 1.00 14.36  ? 116 LYS 3 CA  1 
ATOM 6200  C C   . LYS C 1 116 ? 44.304  44.750  197.769 1.00 11.74  ? 116 LYS 3 C   1 
ATOM 6201  O O   . LYS C 1 116 ? 44.982  45.767  197.564 1.00 23.52  ? 116 LYS 3 O   1 
ATOM 6202  C CB  . LYS C 1 116 ? 44.859  43.024  196.096 1.00 2.00   ? 116 LYS 3 CB  1 
ATOM 6203  C CG  . LYS C 1 116 ? 44.501  42.100  194.924 1.00 27.86  ? 116 LYS 3 CG  1 
ATOM 6204  C CD  . LYS C 1 116 ? 45.509  40.894  194.770 1.00 23.36  ? 116 LYS 3 CD  1 
ATOM 6205  C CE  . LYS C 1 116 ? 45.318  40.136  193.438 1.00 59.95  ? 116 LYS 3 CE  1 
ATOM 6206  N NZ  . LYS C 1 116 ? 46.028  38.820  193.335 1.00 62.02  ? 116 LYS 3 NZ  1 
ATOM 6207  N N   . THR C 1 117 ? 43.968  44.355  198.983 1.00 6.05   ? 117 THR 3 N   1 
ATOM 6208  C CA  . THR C 1 117 ? 44.490  45.081  200.132 1.00 17.07  ? 117 THR 3 CA  1 
ATOM 6209  C C   . THR C 1 117 ? 44.632  44.110  201.270 1.00 22.58  ? 117 THR 3 C   1 
ATOM 6210  O O   . THR C 1 117 ? 44.001  43.046  201.268 1.00 35.21  ? 117 THR 3 O   1 
ATOM 6211  C CB  . THR C 1 117 ? 43.580  46.229  200.572 1.00 18.34  ? 117 THR 3 CB  1 
ATOM 6212  O OG1 . THR C 1 117 ? 44.016  46.730  201.840 1.00 45.04  ? 117 THR 3 OG1 1 
ATOM 6213  C CG2 . THR C 1 117 ? 42.196  45.751  200.754 1.00 25.92  ? 117 THR 3 CG2 1 
ATOM 6214  N N   . GLU C 1 118 ? 45.426  44.482  202.263 1.00 23.66  ? 118 GLU 3 N   1 
ATOM 6215  C CA  . GLU C 1 118 ? 45.646  43.584  203.379 1.00 24.75  ? 118 GLU 3 CA  1 
ATOM 6216  C C   . GLU C 1 118 ? 46.361  44.343  204.462 1.00 24.90  ? 118 GLU 3 C   1 
ATOM 6217  O O   . GLU C 1 118 ? 46.914  45.427  204.225 1.00 30.37  ? 118 GLU 3 O   1 
ATOM 6218  C CB  . GLU C 1 118 ? 46.527  42.460  202.871 1.00 34.08  ? 118 GLU 3 CB  1 
ATOM 6219  C CG  . GLU C 1 118 ? 46.845  41.320  203.766 1.00 32.23  ? 118 GLU 3 CG  1 
ATOM 6220  C CD  . GLU C 1 118 ? 47.796  40.382  203.041 1.00 24.53  ? 118 GLU 3 CD  1 
ATOM 6221  O OE1 . GLU C 1 118 ? 47.344  39.509  202.296 1.00 29.59  ? 118 GLU 3 OE1 1 
ATOM 6222  O OE2 . GLU C 1 118 ? 49.017  40.549  203.164 1.00 57.51  ? 118 GLU 3 OE2 1 
ATOM 6223  N N   . VAL C 1 119 ? 46.314  43.803  205.664 1.00 14.64  ? 119 VAL 3 N   1 
ATOM 6224  C CA  . VAL C 1 119 ? 46.987  44.463  206.757 1.00 23.32  ? 119 VAL 3 CA  1 
ATOM 6225  C C   . VAL C 1 119 ? 48.388  43.948  207.003 1.00 27.17  ? 119 VAL 3 C   1 
ATOM 6226  O O   . VAL C 1 119 ? 48.624  42.776  207.400 1.00 26.39  ? 119 VAL 3 O   1 
ATOM 6227  C CB  . VAL C 1 119 ? 46.207  44.362  208.023 1.00 24.00  ? 119 VAL 3 CB  1 
ATOM 6228  C CG1 . VAL C 1 119 ? 47.014  44.980  209.169 1.00 16.35  ? 119 VAL 3 CG1 1 
ATOM 6229  C CG2 . VAL C 1 119 ? 44.887  45.070  207.827 1.00 15.12  ? 119 VAL 3 CG2 1 
ATOM 6230  N N   . ILE C 1 120 ? 49.327  44.861  206.883 1.00 18.55  ? 120 ILE 3 N   1 
ATOM 6231  C CA  . ILE C 1 120 ? 50.684  44.451  207.080 1.00 20.07  ? 120 ILE 3 CA  1 
ATOM 6232  C C   . ILE C 1 120 ? 51.066  44.193  208.541 1.00 29.62  ? 120 ILE 3 C   1 
ATOM 6233  O O   . ILE C 1 120 ? 50.884  45.069  209.406 1.00 16.02  ? 120 ILE 3 O   1 
ATOM 6234  C CB  . ILE C 1 120 ? 51.650  45.444  206.486 1.00 3.15   ? 120 ILE 3 CB  1 
ATOM 6235  C CG1 . ILE C 1 120 ? 51.438  45.593  204.984 1.00 14.47  ? 120 ILE 3 CG1 1 
ATOM 6236  C CG2 . ILE C 1 120 ? 53.025  44.946  206.667 1.00 31.75  ? 120 ILE 3 CG2 1 
ATOM 6237  C CD1 . ILE C 1 120 ? 50.400  46.613  204.635 1.00 48.26  ? 120 ILE 3 CD1 1 
ATOM 6238  N N   . GLY C 1 121 ? 51.519  42.964  208.808 1.00 29.65  ? 121 GLY 3 N   1 
ATOM 6239  C CA  . GLY C 1 121 ? 52.008  42.616  210.127 1.00 20.64  ? 121 GLY 3 CA  1 
ATOM 6240  C C   . GLY C 1 121 ? 51.034  42.087  211.135 1.00 23.97  ? 121 GLY 3 C   1 
ATOM 6241  O O   . GLY C 1 121 ? 51.210  42.276  212.322 1.00 18.05  ? 121 GLY 3 O   1 
ATOM 6242  N N   . VAL C 1 122 ? 50.076  41.298  210.716 1.00 25.31  ? 122 VAL 3 N   1 
ATOM 6243  C CA  . VAL C 1 122 ? 49.123  40.854  211.721 1.00 24.41  ? 122 VAL 3 CA  1 
ATOM 6244  C C   . VAL C 1 122 ? 49.774  40.019  212.801 1.00 24.90  ? 122 VAL 3 C   1 
ATOM 6245  O O   . VAL C 1 122 ? 49.415  40.124  213.976 1.00 22.47  ? 122 VAL 3 O   1 
ATOM 6246  C CB  . VAL C 1 122 ? 47.982  40.074  211.091 1.00 20.65  ? 122 VAL 3 CB  1 
ATOM 6247  C CG1 . VAL C 1 122 ? 47.866  40.461  209.641 1.00 45.23  ? 122 VAL 3 CG1 1 
ATOM 6248  C CG2 . VAL C 1 122 ? 48.211  38.596  211.210 1.00 29.64  ? 122 VAL 3 CG2 1 
ATOM 6249  N N   . THR C 1 123 ? 50.734  39.194  212.384 1.00 30.69  ? 123 THR 3 N   1 
ATOM 6250  C CA  . THR C 1 123 ? 51.431  38.274  213.288 1.00 34.21  ? 123 THR 3 CA  1 
ATOM 6251  C C   . THR C 1 123 ? 52.044  39.007  214.408 1.00 30.97  ? 123 THR 3 C   1 
ATOM 6252  O O   . THR C 1 123 ? 52.222  38.471  215.513 1.00 30.54  ? 123 THR 3 O   1 
ATOM 6253  C CB  . THR C 1 123 ? 52.602  37.642  212.642 1.00 26.88  ? 123 THR 3 CB  1 
ATOM 6254  O OG1 . THR C 1 123 ? 53.331  38.666  211.948 1.00 25.13  ? 123 THR 3 OG1 1 
ATOM 6255  C CG2 . THR C 1 123 ? 52.152  36.528  211.732 1.00 38.28  ? 123 THR 3 CG2 1 
ATOM 6256  N N   . ALA C 1 124 ? 52.428  40.229  214.095 1.00 24.80  ? 124 ALA 3 N   1 
ATOM 6257  C CA  . ALA C 1 124 ? 53.070  41.051  215.084 1.00 36.15  ? 124 ALA 3 CA  1 
ATOM 6258  C C   . ALA C 1 124 ? 52.407  41.028  216.457 1.00 29.29  ? 124 ALA 3 C   1 
ATOM 6259  O O   . ALA C 1 124 ? 53.061  41.309  217.437 1.00 45.48  ? 124 ALA 3 O   1 
ATOM 6260  C CB  . ALA C 1 124 ? 53.180  42.439  214.584 1.00 42.43  ? 124 ALA 3 CB  1 
ATOM 6261  N N   . MET C 1 125 ? 51.137  40.646  216.544 1.00 33.72  ? 125 MET 3 N   1 
ATOM 6262  C CA  . MET C 1 125 ? 50.445  40.630  217.825 1.00 27.86  ? 125 MET 3 CA  1 
ATOM 6263  C C   . MET C 1 125 ? 50.630  39.368  218.638 1.00 34.95  ? 125 MET 3 C   1 
ATOM 6264  O O   . MET C 1 125 ? 49.800  39.048  219.506 1.00 43.63  ? 125 MET 3 O   1 
ATOM 6265  C CB  . MET C 1 125 ? 48.977  40.918  217.620 1.00 37.97  ? 125 MET 3 CB  1 
ATOM 6266  C CG  . MET C 1 125 ? 48.714  42.311  217.107 1.00 32.93  ? 125 MET 3 CG  1 
ATOM 6267  S SD  . MET C 1 125 ? 47.088  42.409  216.420 1.00 42.69  ? 125 MET 3 SD  1 
ATOM 6268  C CE  . MET C 1 125 ? 46.129  41.544  217.839 1.00 33.99  ? 125 MET 3 CE  1 
ATOM 6269  N N   . LEU C 1 126 ? 51.700  38.637  218.343 1.00 28.18  ? 126 LEU 3 N   1 
ATOM 6270  C CA  . LEU C 1 126 ? 52.016  37.430  219.092 1.00 31.89  ? 126 LEU 3 CA  1 
ATOM 6271  C C   . LEU C 1 126 ? 53.147  37.637  220.109 1.00 48.24  ? 126 LEU 3 C   1 
ATOM 6272  O O   . LEU C 1 126 ? 53.665  36.667  220.696 1.00 69.86  ? 126 LEU 3 O   1 
ATOM 6273  C CB  . LEU C 1 126 ? 52.344  36.293  218.148 1.00 26.87  ? 126 LEU 3 CB  1 
ATOM 6274  C CG  . LEU C 1 126 ? 51.135  35.964  217.287 1.00 31.31  ? 126 LEU 3 CG  1 
ATOM 6275  C CD1 . LEU C 1 126 ? 51.418  34.832  216.307 1.00 2.00   ? 126 LEU 3 CD1 1 
ATOM 6276  C CD2 . LEU C 1 126 ? 50.025  35.605  218.238 1.00 45.39  ? 126 LEU 3 CD2 1 
ATOM 6277  N N   . ASN C 1 127 ? 53.557  38.894  220.299 1.00 44.86  ? 127 ASN 3 N   1 
ATOM 6278  C CA  . ASN C 1 127 ? 54.592  39.222  221.281 1.00 48.80  ? 127 ASN 3 CA  1 
ATOM 6279  C C   . ASN C 1 127 ? 53.822  39.411  222.593 1.00 47.97  ? 127 ASN 3 C   1 
ATOM 6280  O O   . ASN C 1 127 ? 53.447  40.519  222.949 1.00 60.47  ? 127 ASN 3 O   1 
ATOM 6281  C CB  . ASN C 1 127 ? 55.345  40.515  220.879 1.00 46.36  ? 127 ASN 3 CB  1 
ATOM 6282  C CG  . ASN C 1 127 ? 56.505  40.897  221.850 1.00 65.66  ? 127 ASN 3 CG  1 
ATOM 6283  O OD1 . ASN C 1 127 ? 57.595  41.249  221.404 1.00 86.54  ? 127 ASN 3 OD1 1 
ATOM 6284  N ND2 . ASN C 1 127 ? 56.250  40.884  223.158 1.00 58.83  ? 127 ASN 3 ND2 1 
ATOM 6285  N N   . LEU C 1 128 ? 53.549  38.333  223.306 1.00 44.09  ? 128 LEU 3 N   1 
ATOM 6286  C CA  . LEU C 1 128 ? 52.826  38.479  224.559 1.00 45.18  ? 128 LEU 3 CA  1 
ATOM 6287  C C   . LEU C 1 128 ? 53.799  38.724  225.659 1.00 48.16  ? 128 LEU 3 C   1 
ATOM 6288  O O   . LEU C 1 128 ? 53.471  38.613  226.834 1.00 43.18  ? 128 LEU 3 O   1 
ATOM 6289  C CB  . LEU C 1 128 ? 52.102  37.203  224.872 1.00 52.55  ? 128 LEU 3 CB  1 
ATOM 6290  C CG  . LEU C 1 128 ? 51.133  36.953  223.752 1.00 29.76  ? 128 LEU 3 CG  1 
ATOM 6291  C CD1 . LEU C 1 128 ? 50.240  35.829  224.160 1.00 41.63  ? 128 LEU 3 CD1 1 
ATOM 6292  C CD2 . LEU C 1 128 ? 50.352  38.230  223.536 1.00 47.50  ? 128 LEU 3 CD2 1 
ATOM 6293  N N   . HIS C 1 129 ? 54.978  39.157  225.265 1.00 36.48  ? 129 HIS 3 N   1 
ATOM 6294  C CA  . HIS C 1 129 ? 56.023  39.343  226.204 1.00 27.41  ? 129 HIS 3 CA  1 
ATOM 6295  C C   . HIS C 1 129 ? 56.654  40.735  226.262 1.00 33.69  ? 129 HIS 3 C   1 
ATOM 6296  O O   . HIS C 1 129 ? 57.761  40.845  226.732 1.00 67.49  ? 129 HIS 3 O   1 
ATOM 6297  C CB  . HIS C 1 129 ? 57.075  38.313  225.859 1.00 30.18  ? 129 HIS 3 CB  1 
ATOM 6298  C CG  . HIS C 1 129 ? 57.688  38.551  224.519 1.00 44.78  ? 129 HIS 3 CG  1 
ATOM 6299  N ND1 . HIS C 1 129 ? 57.374  37.801  223.407 1.00 67.31  ? 129 HIS 3 ND1 1 
ATOM 6300  C CD2 . HIS C 1 129 ? 58.557  39.496  224.095 1.00 36.45  ? 129 HIS 3 CD2 1 
ATOM 6301  C CE1 . HIS C 1 129 ? 58.027  38.274  222.359 1.00 55.20  ? 129 HIS 3 CE1 1 
ATOM 6302  N NE2 . HIS C 1 129 ? 58.751  39.306  222.751 1.00 46.38  ? 129 HIS 3 NE2 1 
ATOM 6303  N N   . SER C 1 130 ? 56.068  41.784  225.713 1.00 28.66  ? 130 SER 3 N   1 
ATOM 6304  C CA  . SER C 1 130 ? 56.740  43.065  225.895 1.00 37.29  ? 130 SER 3 CA  1 
ATOM 6305  C C   . SER C 1 130 ? 55.944  43.857  226.959 1.00 47.86  ? 130 SER 3 C   1 
ATOM 6306  O O   . SER C 1 130 ? 55.618  43.279  227.998 1.00 60.26  ? 130 SER 3 O   1 
ATOM 6307  C CB  . SER C 1 130 ? 56.958  43.815  224.594 1.00 28.99  ? 130 SER 3 CB  1 
ATOM 6308  O OG  . SER C 1 130 ? 55.698  44.178  224.085 1.00 74.88  ? 130 SER 3 OG  1 
ATOM 6309  N N   . GLY C 1 131 ? 55.529  45.101  226.715 1.00 38.58  ? 131 GLY 3 N   1 
ATOM 6310  C CA  . GLY C 1 131 ? 54.824  45.833  227.776 1.00 44.74  ? 131 GLY 3 CA  1 
ATOM 6311  C C   . GLY C 1 131 ? 53.652  45.122  228.425 1.00 39.91  ? 131 GLY 3 C   1 
ATOM 6312  O O   . GLY C 1 131 ? 53.014  45.632  229.343 1.00 43.39  ? 131 GLY 3 O   1 
ATOM 6313  N N   . THR C 1 132 ? 53.308  44.003  227.807 1.00 38.11  ? 132 THR 3 N   1 
ATOM 6314  C CA  . THR C 1 132 ? 52.234  43.112  228.179 1.00 48.08  ? 132 THR 3 CA  1 
ATOM 6315  C C   . THR C 1 132 ? 51.809  43.139  229.609 1.00 48.96  ? 132 THR 3 C   1 
ATOM 6316  O O   . THR C 1 132 ? 52.650  43.293  230.477 1.00 53.78  ? 132 THR 3 O   1 
ATOM 6317  C CB  . THR C 1 132 ? 52.680  41.649  227.976 1.00 43.72  ? 132 THR 3 CB  1 
ATOM 6318  O OG1 . THR C 1 132 ? 53.817  41.591  227.109 1.00 65.42  ? 132 THR 3 OG1 1 
ATOM 6319  C CG2 . THR C 1 132 ? 51.596  40.868  227.353 1.00 53.31  ? 132 THR 3 CG2 1 
ATOM 6320  N N   . GLN C 1 133 ? 50.506  43.061  229.863 1.00 48.08  ? 133 GLN 3 N   1 
ATOM 6321  C CA  . GLN C 1 133 ? 50.081  42.906  231.249 1.00 53.94  ? 133 GLN 3 CA  1 
ATOM 6322  C C   . GLN C 1 133 ? 49.991  41.386  231.363 1.00 54.37  ? 133 GLN 3 C   1 
ATOM 6323  O O   . GLN C 1 133 ? 49.972  40.698  230.348 1.00 70.49  ? 133 GLN 3 O   1 
ATOM 6324  C CB  . GLN C 1 133 ? 48.719  43.501  231.529 1.00 60.22  ? 133 GLN 3 CB  1 
ATOM 6325  C CG  . GLN C 1 133 ? 48.126  42.953  232.804 1.00 50.20  ? 133 GLN 3 CG  1 
ATOM 6326  C CD  . GLN C 1 133 ? 46.996  43.781  233.315 1.00 77.23  ? 133 GLN 3 CD  1 
ATOM 6327  O OE1 . GLN C 1 133 ? 45.842  43.353  233.283 1.00 89.56  ? 133 GLN 3 OE1 1 
ATOM 6328  N NE2 . GLN C 1 133 ? 47.310  44.984  233.796 1.00 85.07  ? 133 GLN 3 NE2 1 
ATOM 6329  N N   . LYS C 1 134 ? 49.918  40.853  232.570 1.00 53.32  ? 134 LYS 3 N   1 
ATOM 6330  C CA  . LYS C 1 134 ? 49.849  39.408  232.766 1.00 68.32  ? 134 LYS 3 CA  1 
ATOM 6331  C C   . LYS C 1 134 ? 48.449  38.852  232.545 1.00 64.71  ? 134 LYS 3 C   1 
ATOM 6332  O O   . LYS C 1 134 ? 47.467  39.475  232.947 1.00 69.31  ? 134 LYS 3 O   1 
ATOM 6333  C CB  . LYS C 1 134 ? 50.303  39.088  234.190 1.00 91.82  ? 134 LYS 3 CB  1 
ATOM 6334  C CG  . LYS C 1 134 ? 50.734  37.657  234.442 1.00 111.37 ? 134 LYS 3 CG  1 
ATOM 6335  C CD  . LYS C 1 134 ? 51.143  37.470  235.913 1.00 135.48 ? 134 LYS 3 CD  1 
ATOM 6336  C CE  . LYS C 1 134 ? 52.310  38.377  236.332 1.00 144.40 ? 134 LYS 3 CE  1 
ATOM 6337  N NZ  . LYS C 1 134 ? 52.649  38.299  237.791 1.00 149.34 ? 134 LYS 3 NZ  1 
ATOM 6338  N N   . THR C 1 135 ? 48.356  37.687  231.903 1.00 71.20  ? 135 THR 3 N   1 
ATOM 6339  C CA  . THR C 1 135 ? 47.057  37.052  231.663 1.00 80.94  ? 135 THR 3 CA  1 
ATOM 6340  C C   . THR C 1 135 ? 46.553  36.607  233.027 1.00 84.42  ? 135 THR 3 C   1 
ATOM 6341  O O   . THR C 1 135 ? 45.360  36.648  233.295 1.00 94.66  ? 135 THR 3 O   1 
ATOM 6342  C CB  . THR C 1 135 ? 47.145  35.775  230.732 1.00 87.40  ? 135 THR 3 CB  1 
ATOM 6343  O OG1 . THR C 1 135 ? 47.580  36.134  229.412 1.00 105.22 ? 135 THR 3 OG1 1 
ATOM 6344  C CG2 . THR C 1 135 ? 45.788  35.092  230.603 1.00 80.02  ? 135 THR 3 CG2 1 
ATOM 6345  N N   . HIS C 1 136 ? 47.477  36.178  233.883 1.00 84.60  ? 136 HIS 3 N   1 
ATOM 6346  C CA  . HIS C 1 136 ? 47.161  35.689  235.228 1.00 94.75  ? 136 HIS 3 CA  1 
ATOM 6347  C C   . HIS C 1 136 ? 48.399  34.984  235.767 1.00 100.64 ? 136 HIS 3 C   1 
ATOM 6348  O O   . HIS C 1 136 ? 49.243  34.564  234.989 1.00 108.46 ? 136 HIS 3 O   1 
ATOM 6349  C CB  . HIS C 1 136 ? 46.019  34.661  235.180 1.00 92.75  ? 136 HIS 3 CB  1 
ATOM 6350  C CG  . HIS C 1 136 ? 46.338  33.446  234.364 1.00 102.78 ? 136 HIS 3 CG  1 
ATOM 6351  N ND1 . HIS C 1 136 ? 45.804  33.231  233.111 1.00 109.70 ? 136 HIS 3 ND1 1 
ATOM 6352  C CD2 . HIS C 1 136 ? 47.180  32.408  234.596 1.00 101.88 ? 136 HIS 3 CD2 1 
ATOM 6353  C CE1 . HIS C 1 136 ? 46.309  32.120  232.603 1.00 105.63 ? 136 HIS 3 CE1 1 
ATOM 6354  N NE2 . HIS C 1 136 ? 47.146  31.603  233.484 1.00 95.96  ? 136 HIS 3 NE2 1 
ATOM 6355  N N   . GLU C 1 137 ? 48.454  34.783  237.077 1.00 102.70 ? 137 GLU 3 N   1 
ATOM 6356  C CA  . GLU C 1 137 ? 49.567  34.111  237.749 1.00 109.28 ? 137 GLU 3 CA  1 
ATOM 6357  C C   . GLU C 1 137 ? 50.930  33.951  237.069 1.00 103.29 ? 137 GLU 3 C   1 
ATOM 6358  O O   . GLU C 1 137 ? 51.896  34.652  237.418 1.00 97.58  ? 137 GLU 3 O   1 
ATOM 6359  C CB  . GLU C 1 137 ? 49.109  32.766  238.310 1.00 125.51 ? 137 GLU 3 CB  1 
ATOM 6360  C CG  . GLU C 1 137 ? 48.702  32.858  239.782 1.00 160.00 ? 137 GLU 3 CG  1 
ATOM 6361  C CD  . GLU C 1 137 ? 49.688  33.690  240.636 1.00 176.93 ? 137 GLU 3 CD  1 
ATOM 6362  O OE1 . GLU C 1 137 ? 50.871  33.297  240.801 1.00 181.59 ? 137 GLU 3 OE1 1 
ATOM 6363  O OE2 . GLU C 1 137 ? 49.269  34.754  241.145 1.00 191.42 ? 137 GLU 3 OE2 1 
ATOM 6364  N N   . ASN C 1 138 ? 51.023  33.003  236.140 1.00 98.19  ? 138 ASN 3 N   1 
ATOM 6365  C CA  . ASN C 1 138 ? 52.279  32.748  235.430 1.00 102.51 ? 138 ASN 3 CA  1 
ATOM 6366  C C   . ASN C 1 138 ? 51.994  32.532  233.954 1.00 98.04  ? 138 ASN 3 C   1 
ATOM 6367  O O   . ASN C 1 138 ? 52.807  31.973  233.198 1.00 89.50  ? 138 ASN 3 O   1 
ATOM 6368  C CB  . ASN C 1 138 ? 52.962  31.513  236.006 1.00 115.46 ? 138 ASN 3 CB  1 
ATOM 6369  C CG  . ASN C 1 138 ? 52.449  31.159  237.382 1.00 124.04 ? 138 ASN 3 CG  1 
ATOM 6370  O OD1 . ASN C 1 138 ? 51.322  30.675  237.519 1.00 120.28 ? 138 ASN 3 OD1 1 
ATOM 6371  N ND2 . ASN C 1 138 ? 53.253  31.430  238.415 1.00 132.53 ? 138 ASN 3 ND2 1 
ATOM 6372  N N   . GLY C 1 139 ? 50.784  32.928  233.583 1.00 97.96  ? 139 GLY 3 N   1 
ATOM 6373  C CA  . GLY C 1 139 ? 50.330  32.822  232.220 1.00 93.05  ? 139 GLY 3 CA  1 
ATOM 6374  C C   . GLY C 1 139 ? 51.070  33.822  231.365 1.00 87.70  ? 139 GLY 3 C   1 
ATOM 6375  O O   . GLY C 1 139 ? 51.854  34.645  231.867 1.00 76.94  ? 139 GLY 3 O   1 
ATOM 6376  N N   . ALA C 1 140 ? 50.815  33.736  230.066 1.00 76.79  ? 140 ALA 3 N   1 
ATOM 6377  C CA  . ALA C 1 140 ? 51.433  34.607  229.098 1.00 67.75  ? 140 ALA 3 CA  1 
ATOM 6378  C C   . ALA C 1 140 ? 50.852  35.996  229.250 1.00 60.52  ? 140 ALA 3 C   1 
ATOM 6379  O O   . ALA C 1 140 ? 50.133  36.272  230.201 1.00 63.25  ? 140 ALA 3 O   1 
ATOM 6380  C CB  . ALA C 1 140 ? 51.172  34.073  227.721 1.00 76.18  ? 140 ALA 3 CB  1 
ATOM 6381  N N   . GLY C 1 141 ? 51.186  36.885  228.332 1.00 55.25  ? 141 GLY 3 N   1 
ATOM 6382  C CA  . GLY C 1 141 ? 50.645  38.216  228.419 1.00 54.09  ? 141 GLY 3 CA  1 
ATOM 6383  C C   . GLY C 1 141 ? 49.266  38.350  227.796 1.00 57.74  ? 141 GLY 3 C   1 
ATOM 6384  O O   . GLY C 1 141 ? 48.813  37.480  227.035 1.00 58.84  ? 141 GLY 3 O   1 
ATOM 6385  N N   . LYS C 1 142 ? 48.588  39.450  228.112 1.00 58.28  ? 142 LYS 3 N   1 
ATOM 6386  C CA  . LYS C 1 142 ? 47.268  39.679  227.564 1.00 63.61  ? 142 LYS 3 CA  1 
ATOM 6387  C C   . LYS C 1 142 ? 47.386  40.233  226.160 1.00 68.56  ? 142 LYS 3 C   1 
ATOM 6388  O O   . LYS C 1 142 ? 47.906  41.345  225.940 1.00 69.05  ? 142 LYS 3 O   1 
ATOM 6389  C CB  . LYS C 1 142 ? 46.431  40.622  228.423 1.00 80.61  ? 142 LYS 3 CB  1 
ATOM 6390  C CG  . LYS C 1 142 ? 44.986  40.716  227.920 1.00 107.49 ? 142 LYS 3 CG  1 
ATOM 6391  C CD  . LYS C 1 142 ? 44.017  41.389  228.898 1.00 128.84 ? 142 LYS 3 CD  1 
ATOM 6392  C CE  . LYS C 1 142 ? 42.576  41.280  228.381 1.00 141.45 ? 142 LYS 3 CE  1 
ATOM 6393  N NZ  . LYS C 1 142 ? 41.532  41.830  229.293 1.00 152.27 ? 142 LYS 3 NZ  1 
ATOM 6394  N N   . PRO C 1 143 ? 46.910  39.448  225.183 1.00 61.11  ? 143 PRO 3 N   1 
ATOM 6395  C CA  . PRO C 1 143 ? 46.933  39.806  223.769 1.00 49.78  ? 143 PRO 3 CA  1 
ATOM 6396  C C   . PRO C 1 143 ? 46.131  41.056  223.511 1.00 50.62  ? 143 PRO 3 C   1 
ATOM 6397  O O   . PRO C 1 143 ? 45.297  41.460  224.330 1.00 50.62  ? 143 PRO 3 O   1 
ATOM 6398  C CB  . PRO C 1 143 ? 46.263  38.600  223.115 1.00 45.96  ? 143 PRO 3 CB  1 
ATOM 6399  C CG  . PRO C 1 143 ? 45.354  38.079  224.188 1.00 46.06  ? 143 PRO 3 CG  1 
ATOM 6400  C CD  . PRO C 1 143 ? 46.238  38.147  225.383 1.00 56.92  ? 143 PRO 3 CD  1 
ATOM 6401  N N   . ILE C 1 144 ? 46.387  41.687  222.378 1.00 49.38  ? 144 ILE 3 N   1 
ATOM 6402  C CA  . ILE C 1 144 ? 45.612  42.863  222.038 1.00 45.96  ? 144 ILE 3 CA  1 
ATOM 6403  C C   . ILE C 1 144 ? 44.198  42.427  221.751 1.00 43.58  ? 144 ILE 3 C   1 
ATOM 6404  O O   . ILE C 1 144 ? 44.017  41.445  221.038 1.00 38.65  ? 144 ILE 3 O   1 
ATOM 6405  C CB  . ILE C 1 144 ? 46.071  43.449  220.752 1.00 42.67  ? 144 ILE 3 CB  1 
ATOM 6406  C CG1 . ILE C 1 144 ? 47.388  44.163  220.960 1.00 41.81  ? 144 ILE 3 CG1 1 
ATOM 6407  C CG2 . ILE C 1 144 ? 44.972  44.339  220.149 1.00 43.18  ? 144 ILE 3 CG2 1 
ATOM 6408  C CD1 . ILE C 1 144 ? 47.737  45.055  219.793 1.00 64.13  ? 144 ILE 3 CD1 1 
ATOM 6409  N N   . GLN C 1 145 ? 43.211  43.176  222.238 1.00 47.54  ? 145 GLN 3 N   1 
ATOM 6410  C CA  . GLN C 1 145 ? 41.817  42.852  221.951 1.00 53.03  ? 145 GLN 3 CA  1 
ATOM 6411  C C   . GLN C 1 145 ? 40.861  44.006  222.175 1.00 57.99  ? 145 GLN 3 C   1 
ATOM 6412  O O   . GLN C 1 145 ? 41.299  45.115  222.479 1.00 65.32  ? 145 GLN 3 O   1 
ATOM 6413  C CB  . GLN C 1 145 ? 41.364  41.617  222.720 1.00 55.78  ? 145 GLN 3 CB  1 
ATOM 6414  C CG  . GLN C 1 145 ? 41.488  41.682  224.210 1.00 62.65  ? 145 GLN 3 CG  1 
ATOM 6415  C CD  . GLN C 1 145 ? 41.571  40.292  224.793 1.00 71.17  ? 145 GLN 3 CD  1 
ATOM 6416  O OE1 . GLN C 1 145 ? 40.556  39.652  225.090 1.00 76.12  ? 145 GLN 3 OE1 1 
ATOM 6417  N NE2 . GLN C 1 145 ? 42.794  39.790  224.917 1.00 93.91  ? 145 GLN 3 NE2 1 
ATOM 6418  N N   . GLY C 1 146 ? 39.564  43.741  221.985 1.00 59.11  ? 146 GLY 3 N   1 
ATOM 6419  C CA  . GLY C 1 146 ? 38.525  44.751  222.170 1.00 63.42  ? 146 GLY 3 CA  1 
ATOM 6420  C C   . GLY C 1 146 ? 38.100  45.504  220.920 1.00 56.84  ? 146 GLY 3 C   1 
ATOM 6421  O O   . GLY C 1 146 ? 38.588  45.196  219.834 1.00 62.44  ? 146 GLY 3 O   1 
ATOM 6422  N N   . SER C 1 147 ? 37.181  46.463  221.077 1.00 53.52  ? 147 SER 3 N   1 
ATOM 6423  C CA  . SER C 1 147 ? 36.669  47.285  219.977 1.00 44.17  ? 147 SER 3 CA  1 
ATOM 6424  C C   . SER C 1 147 ? 37.708  47.476  218.884 1.00 39.99  ? 147 SER 3 C   1 
ATOM 6425  O O   . SER C 1 147 ? 38.868  47.737  219.176 1.00 47.39  ? 147 SER 3 O   1 
ATOM 6426  C CB  . SER C 1 147 ? 36.250  48.670  220.496 1.00 49.46  ? 147 SER 3 CB  1 
ATOM 6427  O OG  . SER C 1 147 ? 34.948  48.671  221.054 1.00 49.92  ? 147 SER 3 OG  1 
ATOM 6428  N N   . ASN C 1 148 ? 37.314  47.294  217.629 1.00 43.61  ? 148 ASN 3 N   1 
ATOM 6429  C CA  . ASN C 1 148 ? 38.246  47.501  216.521 1.00 43.61  ? 148 ASN 3 CA  1 
ATOM 6430  C C   . ASN C 1 148 ? 37.529  47.953  215.269 1.00 38.42  ? 148 ASN 3 C   1 
ATOM 6431  O O   . ASN C 1 148 ? 36.293  47.808  215.118 1.00 42.52  ? 148 ASN 3 O   1 
ATOM 6432  C CB  . ASN C 1 148 ? 39.128  46.284  216.237 1.00 52.29  ? 148 ASN 3 CB  1 
ATOM 6433  C CG  . ASN C 1 148 ? 38.354  45.107  215.700 1.00 65.35  ? 148 ASN 3 CG  1 
ATOM 6434  O OD1 . ASN C 1 148 ? 37.206  45.232  215.267 1.00 63.16  ? 148 ASN 3 OD1 1 
ATOM 6435  N ND2 . ASN C 1 148 ? 38.993  43.940  215.707 1.00 92.61  ? 148 ASN 3 ND2 1 
ATOM 6436  N N   . PHE C 1 149 ? 38.303  48.564  214.389 1.00 25.74  ? 149 PHE 3 N   1 
ATOM 6437  C CA  . PHE C 1 149 ? 37.732  49.083  213.171 1.00 29.19  ? 149 PHE 3 CA  1 
ATOM 6438  C C   . PHE C 1 149 ? 38.767  49.123  212.112 1.00 30.23  ? 149 PHE 3 C   1 
ATOM 6439  O O   . PHE C 1 149 ? 39.898  49.630  212.284 1.00 27.74  ? 149 PHE 3 O   1 
ATOM 6440  C CB  . PHE C 1 149 ? 37.189  50.466  213.403 1.00 13.22  ? 149 PHE 3 CB  1 
ATOM 6441  C CG  . PHE C 1 149 ? 36.667  51.135  212.188 1.00 4.82   ? 149 PHE 3 CG  1 
ATOM 6442  C CD1 . PHE C 1 149 ? 35.403  50.846  211.703 1.00 13.31  ? 149 PHE 3 CD1 1 
ATOM 6443  C CD2 . PHE C 1 149 ? 37.371  52.203  211.624 1.00 29.39  ? 149 PHE 3 CD2 1 
ATOM 6444  C CE1 . PHE C 1 149 ? 34.841  51.631  210.679 1.00 2.71   ? 149 PHE 3 CE1 1 
ATOM 6445  C CE2 . PHE C 1 149 ? 36.817  52.993  210.599 1.00 21.69  ? 149 PHE 3 CE2 1 
ATOM 6446  C CZ  . PHE C 1 149 ? 35.555  52.707  210.134 1.00 2.00   ? 149 PHE 3 CZ  1 
ATOM 6447  N N   . HIS C 1 150 ? 38.376  48.514  211.017 1.00 22.78  ? 150 HIS 3 N   1 
ATOM 6448  C CA  . HIS C 1 150 ? 39.233  48.422  209.882 1.00 24.09  ? 150 HIS 3 CA  1 
ATOM 6449  C C   . HIS C 1 150 ? 38.352  48.948  208.798 1.00 25.07  ? 150 HIS 3 C   1 
ATOM 6450  O O   . HIS C 1 150 ? 37.153  48.642  208.748 1.00 25.55  ? 150 HIS 3 O   1 
ATOM 6451  C CB  . HIS C 1 150 ? 39.638  46.973  209.662 1.00 11.92  ? 150 HIS 3 CB  1 
ATOM 6452  C CG  . HIS C 1 150 ? 40.402  46.390  210.808 1.00 21.65  ? 150 HIS 3 CG  1 
ATOM 6453  N ND1 . HIS C 1 150 ? 41.668  46.813  211.148 1.00 34.53  ? 150 HIS 3 ND1 1 
ATOM 6454  C CD2 . HIS C 1 150 ? 40.052  45.462  211.732 1.00 41.40  ? 150 HIS 3 CD2 1 
ATOM 6455  C CE1 . HIS C 1 150 ? 42.065  46.173  212.239 1.00 57.25  ? 150 HIS 3 CE1 1 
ATOM 6456  N NE2 . HIS C 1 150 ? 41.101  45.345  212.613 1.00 45.92  ? 150 HIS 3 NE2 1 
ATOM 6457  N N   . PHE C 1 151 ? 38.934  49.801  207.976 1.00 26.52  ? 151 PHE 3 N   1 
ATOM 6458  C CA  . PHE C 1 151 ? 38.189  50.416  206.921 1.00 21.59  ? 151 PHE 3 CA  1 
ATOM 6459  C C   . PHE C 1 151 ? 39.141  50.942  205.904 1.00 17.41  ? 151 PHE 3 C   1 
ATOM 6460  O O   . PHE C 1 151 ? 40.267  51.298  206.228 1.00 22.90  ? 151 PHE 3 O   1 
ATOM 6461  C CB  . PHE C 1 151 ? 37.445  51.605  207.512 1.00 21.00  ? 151 PHE 3 CB  1 
ATOM 6462  C CG  . PHE C 1 151 ? 37.196  52.684  206.540 1.00 9.90   ? 151 PHE 3 CG  1 
ATOM 6463  C CD1 . PHE C 1 151 ? 38.159  53.640  206.296 1.00 2.32   ? 151 PHE 3 CD1 1 
ATOM 6464  C CD2 . PHE C 1 151 ? 36.029  52.698  205.798 1.00 23.90  ? 151 PHE 3 CD2 1 
ATOM 6465  C CE1 . PHE C 1 151 ? 37.956  54.582  205.324 1.00 17.14  ? 151 PHE 3 CE1 1 
ATOM 6466  C CE2 . PHE C 1 151 ? 35.821  53.646  204.821 1.00 26.39  ? 151 PHE 3 CE2 1 
ATOM 6467  C CZ  . PHE C 1 151 ? 36.790  54.589  204.583 1.00 19.87  ? 151 PHE 3 CZ  1 
ATOM 6468  N N   . PHE C 1 152 ? 38.672  51.047  204.678 1.00 5.33   ? 152 PHE 3 N   1 
ATOM 6469  C CA  . PHE C 1 152 ? 39.486  51.644  203.668 1.00 11.29  ? 152 PHE 3 CA  1 
ATOM 6470  C C   . PHE C 1 152 ? 38.593  52.044  202.528 1.00 18.78  ? 152 PHE 3 C   1 
ATOM 6471  O O   . PHE C 1 152 ? 37.418  51.615  202.415 1.00 14.54  ? 152 PHE 3 O   1 
ATOM 6472  C CB  . PHE C 1 152 ? 40.537  50.690  203.199 1.00 2.00   ? 152 PHE 3 CB  1 
ATOM 6473  C CG  . PHE C 1 152 ? 40.033  49.727  202.217 1.00 16.85  ? 152 PHE 3 CG  1 
ATOM 6474  C CD1 . PHE C 1 152 ? 40.011  50.043  200.867 1.00 27.67  ? 152 PHE 3 CD1 1 
ATOM 6475  C CD2 . PHE C 1 152 ? 39.572  48.488  202.618 1.00 19.64  ? 152 PHE 3 CD2 1 
ATOM 6476  C CE1 . PHE C 1 152 ? 39.531  49.109  199.921 1.00 26.16  ? 152 PHE 3 CE1 1 
ATOM 6477  C CE2 . PHE C 1 152 ? 39.090  47.544  201.681 1.00 11.41  ? 152 PHE 3 CE2 1 
ATOM 6478  C CZ  . PHE C 1 152 ? 39.072  47.853  200.335 1.00 2.00   ? 152 PHE 3 CZ  1 
ATOM 6479  N N   . ALA C 1 153 ? 39.214  52.743  201.600 1.00 5.22   ? 153 ALA 3 N   1 
ATOM 6480  C CA  . ALA C 1 153 ? 38.464  53.216  200.493 1.00 8.70   ? 153 ALA 3 CA  1 
ATOM 6481  C C   . ALA C 1 153 ? 39.394  53.672  199.439 1.00 10.16  ? 153 ALA 3 C   1 
ATOM 6482  O O   . ALA C 1 153 ? 40.424  54.277  199.730 1.00 20.85  ? 153 ALA 3 O   1 
ATOM 6483  C CB  . ALA C 1 153 ? 37.617  54.362  200.951 1.00 2.58   ? 153 ALA 3 CB  1 
ATOM 6484  N N   . VAL C 1 154 ? 38.972  53.476  198.203 1.00 2.02   ? 154 VAL 3 N   1 
ATOM 6485  C CA  . VAL C 1 154 ? 39.754  53.899  197.040 1.00 7.92   ? 154 VAL 3 CA  1 
ATOM 6486  C C   . VAL C 1 154 ? 38.830  54.731  196.164 1.00 24.05  ? 154 VAL 3 C   1 
ATOM 6487  O O   . VAL C 1 154 ? 37.675  54.345  196.003 1.00 34.66  ? 154 VAL 3 O   1 
ATOM 6488  C CB  . VAL C 1 154 ? 40.149  52.696  196.297 1.00 4.87   ? 154 VAL 3 CB  1 
ATOM 6489  C CG1 . VAL C 1 154 ? 40.618  53.060  194.948 1.00 2.00   ? 154 VAL 3 CG1 1 
ATOM 6490  C CG2 . VAL C 1 154 ? 41.175  51.971  197.090 1.00 11.82  ? 154 VAL 3 CG2 1 
ATOM 6491  N N   . GLY C 1 155 ? 39.302  55.864  195.631 1.00 26.24  ? 155 GLY 3 N   1 
ATOM 6492  C CA  . GLY C 1 155 ? 38.451  56.739  194.813 1.00 18.99  ? 155 GLY 3 CA  1 
ATOM 6493  C C   . GLY C 1 155 ? 39.168  57.819  193.991 1.00 26.35  ? 155 GLY 3 C   1 
ATOM 6494  O O   . GLY C 1 155 ? 40.331  58.160  194.264 1.00 23.74  ? 155 GLY 3 O   1 
ATOM 6495  N N   . GLY C 1 156 ? 38.473  58.371  192.992 1.00 23.15  ? 156 GLY 3 N   1 
ATOM 6496  C CA  . GLY C 1 156 ? 39.052  59.374  192.092 1.00 17.30  ? 156 GLY 3 CA  1 
ATOM 6497  C C   . GLY C 1 156 ? 39.065  60.838  192.514 1.00 17.25  ? 156 GLY 3 C   1 
ATOM 6498  O O   . GLY C 1 156 ? 39.415  61.728  191.700 1.00 32.59  ? 156 GLY 3 O   1 
ATOM 6499  N N   . GLU C 1 157 ? 38.714  61.060  193.786 1.00 10.18  ? 157 GLU 3 N   1 
ATOM 6500  C CA  . GLU C 1 157 ? 38.623  62.365  194.473 1.00 6.50   ? 157 GLU 3 CA  1 
ATOM 6501  C C   . GLU C 1 157 ? 38.763  62.008  195.936 1.00 18.41  ? 157 GLU 3 C   1 
ATOM 6502  O O   . GLU C 1 157 ? 38.606  60.840  196.316 1.00 43.48  ? 157 GLU 3 O   1 
ATOM 6503  C CB  . GLU C 1 157 ? 37.216  62.961  194.406 1.00 18.66  ? 157 GLU 3 CB  1 
ATOM 6504  C CG  . GLU C 1 157 ? 36.378  62.668  193.196 1.00 34.27  ? 157 GLU 3 CG  1 
ATOM 6505  C CD  . GLU C 1 157 ? 34.966  63.191  193.364 1.00 55.03  ? 157 GLU 3 CD  1 
ATOM 6506  O OE1 . GLU C 1 157 ? 34.649  63.729  194.451 1.00 70.49  ? 157 GLU 3 OE1 1 
ATOM 6507  O OE2 . GLU C 1 157 ? 34.188  63.085  192.393 1.00 56.85  ? 157 GLU 3 OE2 1 
ATOM 6508  N N   . PRO C 1 158 ? 38.873  63.017  196.801 1.00 22.28  ? 158 PRO 3 N   1 
ATOM 6509  C CA  . PRO C 1 158 ? 39.016  62.764  198.238 1.00 26.42  ? 158 PRO 3 CA  1 
ATOM 6510  C C   . PRO C 1 158 ? 37.792  62.187  198.856 1.00 27.76  ? 158 PRO 3 C   1 
ATOM 6511  O O   . PRO C 1 158 ? 36.672  62.343  198.359 1.00 33.37  ? 158 PRO 3 O   1 
ATOM 6512  C CB  . PRO C 1 158 ? 39.273  64.134  198.812 1.00 21.00  ? 158 PRO 3 CB  1 
ATOM 6513  C CG  . PRO C 1 158 ? 39.903  64.850  197.667 1.00 25.74  ? 158 PRO 3 CG  1 
ATOM 6514  C CD  . PRO C 1 158 ? 39.057  64.436  196.511 1.00 24.99  ? 158 PRO 3 CD  1 
ATOM 6515  N N   . LEU C 1 159 ? 38.014  61.602  200.010 1.00 23.74  ? 159 LEU 3 N   1 
ATOM 6516  C CA  . LEU C 1 159 ? 36.938  60.981  200.714 1.00 25.65  ? 159 LEU 3 CA  1 
ATOM 6517  C C   . LEU C 1 159 ? 36.006  61.991  201.374 1.00 26.14  ? 159 LEU 3 C   1 
ATOM 6518  O O   . LEU C 1 159 ? 36.439  62.762  202.226 1.00 34.04  ? 159 LEU 3 O   1 
ATOM 6519  C CB  . LEU C 1 159 ? 37.523  60.054  201.762 1.00 26.14  ? 159 LEU 3 CB  1 
ATOM 6520  C CG  . LEU C 1 159 ? 36.420  59.325  202.511 1.00 15.50  ? 159 LEU 3 CG  1 
ATOM 6521  C CD1 . LEU C 1 159 ? 35.503  58.732  201.495 1.00 12.91  ? 159 LEU 3 CD1 1 
ATOM 6522  C CD2 . LEU C 1 159 ? 36.976  58.230  203.411 1.00 12.08  ? 159 LEU 3 CD2 1 
ATOM 6523  N N   . GLU C 1 160 ? 34.735  61.985  200.983 1.00 16.81  ? 160 GLU 3 N   1 
ATOM 6524  C CA  . GLU C 1 160 ? 33.727  62.885  201.569 1.00 21.45  ? 160 GLU 3 CA  1 
ATOM 6525  C C   . GLU C 1 160 ? 33.182  62.306  202.872 1.00 22.47  ? 160 GLU 3 C   1 
ATOM 6526  O O   . GLU C 1 160 ? 32.776  61.142  202.926 1.00 17.60  ? 160 GLU 3 O   1 
ATOM 6527  C CB  . GLU C 1 160 ? 32.587  63.121  200.575 1.00 18.96  ? 160 GLU 3 CB  1 
ATOM 6528  C CG  . GLU C 1 160 ? 33.053  63.858  199.339 1.00 30.48  ? 160 GLU 3 CG  1 
ATOM 6529  C CD  . GLU C 1 160 ? 32.119  63.767  198.153 1.00 4.28   ? 160 GLU 3 CD  1 
ATOM 6530  O OE1 . GLU C 1 160 ? 32.001  62.664  197.567 1.00 59.30  ? 160 GLU 3 OE1 1 
ATOM 6531  O OE2 . GLU C 1 160 ? 31.564  64.817  197.758 1.00 64.89  ? 160 GLU 3 OE2 1 
ATOM 6532  N N   . LEU C 1 161 ? 33.190  63.099  203.935 1.00 27.52  ? 161 LEU 3 N   1 
ATOM 6533  C CA  . LEU C 1 161 ? 32.722  62.596  205.221 1.00 23.63  ? 161 LEU 3 CA  1 
ATOM 6534  C C   . LEU C 1 161 ? 31.525  63.297  205.732 1.00 25.31  ? 161 LEU 3 C   1 
ATOM 6535  O O   . LEU C 1 161 ? 31.045  64.267  205.141 1.00 39.13  ? 161 LEU 3 O   1 
ATOM 6536  C CB  . LEU C 1 161 ? 33.776  62.738  206.276 1.00 12.84  ? 161 LEU 3 CB  1 
ATOM 6537  C CG  . LEU C 1 161 ? 35.168  62.615  205.725 1.00 22.24  ? 161 LEU 3 CG  1 
ATOM 6538  C CD1 . LEU C 1 161 ? 36.183  62.930  206.805 1.00 14.29  ? 161 LEU 3 CD1 1 
ATOM 6539  C CD2 . LEU C 1 161 ? 35.307  61.210  205.214 1.00 48.24  ? 161 LEU 3 CD2 1 
ATOM 6540  N N   . GLN C 1 162 ? 31.080  62.798  206.874 1.00 11.23  ? 162 GLN 3 N   1 
ATOM 6541  C CA  . GLN C 1 162 ? 29.915  63.307  207.566 1.00 21.39  ? 162 GLN 3 CA  1 
ATOM 6542  C C   . GLN C 1 162 ? 30.223  63.043  208.992 1.00 20.04  ? 162 GLN 3 C   1 
ATOM 6543  O O   . GLN C 1 162 ? 30.524  61.906  209.370 1.00 25.99  ? 162 GLN 3 O   1 
ATOM 6544  C CB  . GLN C 1 162 ? 28.663  62.515  207.228 1.00 23.72  ? 162 GLN 3 CB  1 
ATOM 6545  C CG  . GLN C 1 162 ? 27.592  62.650  208.289 1.00 11.69  ? 162 GLN 3 CG  1 
ATOM 6546  C CD  . GLN C 1 162 ? 26.924  63.990  208.228 1.00 30.29  ? 162 GLN 3 CD  1 
ATOM 6547  O OE1 . GLN C 1 162 ? 26.980  64.780  209.173 1.00 41.63  ? 162 GLN 3 OE1 1 
ATOM 6548  N NE2 . GLN C 1 162 ? 26.291  64.267  207.098 1.00 13.95  ? 162 GLN 3 NE2 1 
ATOM 6549  N N   . GLY C 1 163 ? 30.082  64.084  209.785 1.00 22.85  ? 163 GLY 3 N   1 
ATOM 6550  C CA  . GLY C 1 163 ? 30.385  63.977  211.177 1.00 15.88  ? 163 GLY 3 CA  1 
ATOM 6551  C C   . GLY C 1 163 ? 29.181  63.541  211.956 1.00 22.98  ? 163 GLY 3 C   1 
ATOM 6552  O O   . GLY C 1 163 ? 28.011  63.837  211.650 1.00 32.55  ? 163 GLY 3 O   1 
ATOM 6553  N N   . VAL C 1 164 ? 29.504  62.787  212.982 1.00 19.40  ? 164 VAL 3 N   1 
ATOM 6554  C CA  . VAL C 1 164 ? 28.540  62.289  213.918 1.00 33.74  ? 164 VAL 3 CA  1 
ATOM 6555  C C   . VAL C 1 164 ? 29.405  61.985  215.094 1.00 40.16  ? 164 VAL 3 C   1 
ATOM 6556  O O   . VAL C 1 164 ? 30.566  61.560  214.910 1.00 41.92  ? 164 VAL 3 O   1 
ATOM 6557  C CB  . VAL C 1 164 ? 27.964  60.960  213.519 1.00 31.24  ? 164 VAL 3 CB  1 
ATOM 6558  C CG1 . VAL C 1 164 ? 26.922  60.562  214.525 1.00 36.25  ? 164 VAL 3 CG1 1 
ATOM 6559  C CG2 . VAL C 1 164 ? 27.369  61.037  212.163 1.00 59.98  ? 164 VAL 3 CG2 1 
ATOM 6560  N N   . LEU C 1 165 ? 28.855  62.204  216.287 1.00 37.62  ? 165 LEU 3 N   1 
ATOM 6561  C CA  . LEU C 1 165 ? 29.574  61.904  217.509 1.00 44.34  ? 165 LEU 3 CA  1 
ATOM 6562  C C   . LEU C 1 165 ? 28.664  61.656  218.688 1.00 45.32  ? 165 LEU 3 C   1 
ATOM 6563  O O   . LEU C 1 165 ? 27.432  61.616  218.541 1.00 44.11  ? 165 LEU 3 O   1 
ATOM 6564  C CB  . LEU C 1 165 ? 30.589  62.992  217.806 1.00 39.90  ? 165 LEU 3 CB  1 
ATOM 6565  C CG  . LEU C 1 165 ? 30.101  64.345  217.333 1.00 44.61  ? 165 LEU 3 CG  1 
ATOM 6566  C CD1 . LEU C 1 165 ? 29.031  64.756  218.303 1.00 64.58  ? 165 LEU 3 CD1 1 
ATOM 6567  C CD2 . LEU C 1 165 ? 31.223  65.371  217.268 1.00 27.00  ? 165 LEU 3 CD2 1 
ATOM 6568  N N   . ALA C 1 166 ? 29.279  61.231  219.784 1.00 42.42  ? 166 ALA 3 N   1 
ATOM 6569  C CA  . ALA C 1 166 ? 28.534  61.023  221.009 1.00 56.21  ? 166 ALA 3 CA  1 
ATOM 6570  C C   . ALA C 1 166 ? 29.130  62.179  221.782 1.00 69.66  ? 166 ALA 3 C   1 
ATOM 6571  O O   . ALA C 1 166 ? 30.284  62.552  221.512 1.00 82.97  ? 166 ALA 3 O   1 
ATOM 6572  C CB  . ALA C 1 166 ? 28.890  59.704  221.647 1.00 57.24  ? 166 ALA 3 CB  1 
ATOM 6573  N N   . ASN C 1 167 ? 28.338  62.814  222.648 1.00 67.03  ? 167 ASN 3 N   1 
ATOM 6574  C CA  . ASN C 1 167 ? 28.828  63.952  223.440 1.00 59.46  ? 167 ASN 3 CA  1 
ATOM 6575  C C   . ASN C 1 167 ? 29.367  65.032  222.515 1.00 49.74  ? 167 ASN 3 C   1 
ATOM 6576  O O   . ASN C 1 167 ? 30.564  65.093  222.269 1.00 36.38  ? 167 ASN 3 O   1 
ATOM 6577  C CB  . ASN C 1 167 ? 29.939  63.501  224.404 1.00 59.83  ? 167 ASN 3 CB  1 
ATOM 6578  C CG  . ASN C 1 167 ? 30.532  64.638  225.171 1.00 62.79  ? 167 ASN 3 CG  1 
ATOM 6579  O OD1 . ASN C 1 167 ? 29.965  65.735  225.197 1.00 67.01  ? 167 ASN 3 OD1 1 
ATOM 6580  N ND2 . ASN C 1 167 ? 31.690  64.406  225.781 1.00 74.67  ? 167 ASN 3 ND2 1 
ATOM 6581  N N   . TYR C 1 168 ? 28.487  65.867  221.979 1.00 41.84  ? 168 TYR 3 N   1 
ATOM 6582  C CA  . TYR C 1 168 ? 28.949  66.923  221.085 1.00 47.38  ? 168 TYR 3 CA  1 
ATOM 6583  C C   . TYR C 1 168 ? 29.733  67.947  221.875 1.00 52.63  ? 168 TYR 3 C   1 
ATOM 6584  O O   . TYR C 1 168 ? 30.544  68.704  221.340 1.00 53.24  ? 168 TYR 3 O   1 
ATOM 6585  C CB  . TYR C 1 168 ? 27.770  67.587  220.394 1.00 50.36  ? 168 TYR 3 CB  1 
ATOM 6586  C CG  . TYR C 1 168 ? 26.801  68.192  221.338 1.00 51.88  ? 168 TYR 3 CG  1 
ATOM 6587  C CD1 . TYR C 1 168 ? 26.012  67.398  222.160 1.00 54.74  ? 168 TYR 3 CD1 1 
ATOM 6588  C CD2 . TYR C 1 168 ? 26.699  69.563  221.444 1.00 47.60  ? 168 TYR 3 CD2 1 
ATOM 6589  C CE1 . TYR C 1 168 ? 25.139  67.967  223.073 1.00 66.86  ? 168 TYR 3 CE1 1 
ATOM 6590  C CE2 . TYR C 1 168 ? 25.833  70.145  222.347 1.00 62.36  ? 168 TYR 3 CE2 1 
ATOM 6591  C CZ  . TYR C 1 168 ? 25.061  69.350  223.165 1.00 63.96  ? 168 TYR 3 CZ  1 
ATOM 6592  O OH  . TYR C 1 168 ? 24.248  69.972  224.080 1.00 68.17  ? 168 TYR 3 OH  1 
ATOM 6593  N N   . ARG C 1 169 ? 29.515  67.911  223.179 1.00 59.62  ? 169 ARG 3 N   1 
ATOM 6594  C CA  . ARG C 1 169 ? 30.174  68.807  224.106 1.00 67.00  ? 169 ARG 3 CA  1 
ATOM 6595  C C   . ARG C 1 169 ? 31.652  68.432  224.296 1.00 67.04  ? 169 ARG 3 C   1 
ATOM 6596  O O   . ARG C 1 169 ? 32.354  69.009  225.123 1.00 73.20  ? 169 ARG 3 O   1 
ATOM 6597  C CB  . ARG C 1 169 ? 29.412  68.786  225.433 1.00 75.39  ? 169 ARG 3 CB  1 
ATOM 6598  C CG  . ARG C 1 169 ? 27.911  69.050  225.280 1.00 81.80  ? 169 ARG 3 CG  1 
ATOM 6599  C CD  . ARG C 1 169 ? 27.073  67.840  225.690 1.00 100.18 ? 169 ARG 3 CD  1 
ATOM 6600  N NE  . ARG C 1 169 ? 26.615  67.928  227.075 1.00 110.28 ? 169 ARG 3 NE  1 
ATOM 6601  C CZ  . ARG C 1 169 ? 25.864  67.009  227.681 1.00 124.05 ? 169 ARG 3 CZ  1 
ATOM 6602  N NH1 . ARG C 1 169 ? 25.479  65.916  227.023 1.00 131.46 ? 169 ARG 3 NH1 1 
ATOM 6603  N NH2 . ARG C 1 169 ? 25.492  67.186  228.947 1.00 129.91 ? 169 ARG 3 NH2 1 
ATOM 6604  N N   . THR C 1 170 ? 32.125  67.450  223.544 1.00 63.21  ? 170 THR 3 N   1 
ATOM 6605  C CA  . THR C 1 170 ? 33.515  67.067  223.649 1.00 55.27  ? 170 THR 3 CA  1 
ATOM 6606  C C   . THR C 1 170 ? 34.368  68.152  223.011 1.00 54.99  ? 170 THR 3 C   1 
ATOM 6607  O O   . THR C 1 170 ? 34.120  68.603  221.892 1.00 53.18  ? 170 THR 3 O   1 
ATOM 6608  C CB  . THR C 1 170 ? 33.784  65.729  222.976 1.00 46.30  ? 170 THR 3 CB  1 
ATOM 6609  O OG1 . THR C 1 170 ? 32.971  64.729  223.590 1.00 65.47  ? 170 THR 3 OG1 1 
ATOM 6610  C CG2 . THR C 1 170 ? 35.230  65.338  223.143 1.00 40.40  ? 170 THR 3 CG2 1 
ATOM 6611  N N   . LYS C 1 171 ? 35.356  68.593  223.765 1.00 60.04  ? 171 LYS 3 N   1 
ATOM 6612  C CA  . LYS C 1 171 ? 36.263  69.628  223.326 1.00 72.07  ? 171 LYS 3 CA  1 
ATOM 6613  C C   . LYS C 1 171 ? 37.408  68.959  222.581 1.00 69.93  ? 171 LYS 3 C   1 
ATOM 6614  O O   . LYS C 1 171 ? 38.145  68.117  223.132 1.00 55.83  ? 171 LYS 3 O   1 
ATOM 6615  C CB  . LYS C 1 171 ? 36.749  70.385  224.551 1.00 102.29 ? 171 LYS 3 CB  1 
ATOM 6616  C CG  . LYS C 1 171 ? 35.608  70.690  225.539 1.00 140.17 ? 171 LYS 3 CG  1 
ATOM 6617  C CD  . LYS C 1 171 ? 36.099  71.290  226.860 1.00 166.43 ? 171 LYS 3 CD  1 
ATOM 6618  C CE  . LYS C 1 171 ? 34.928  71.660  227.782 1.00 178.87 ? 171 LYS 3 CE  1 
ATOM 6619  N NZ  . LYS C 1 171 ? 35.359  72.267  229.082 1.00 188.64 ? 171 LYS 3 NZ  1 
ATOM 6620  N N   . TYR C 1 172 ? 37.572  69.357  221.327 1.00 66.03  ? 172 TYR 3 N   1 
ATOM 6621  C CA  . TYR C 1 172 ? 38.585  68.735  220.499 1.00 63.94  ? 172 TYR 3 CA  1 
ATOM 6622  C C   . TYR C 1 172 ? 39.944  69.363  220.307 1.00 61.76  ? 172 TYR 3 C   1 
ATOM 6623  O O   . TYR C 1 172 ? 40.063  70.518  219.910 1.00 67.49  ? 172 TYR 3 O   1 
ATOM 6624  C CB  . TYR C 1 172 ? 37.993  68.359  219.132 1.00 64.87  ? 172 TYR 3 CB  1 
ATOM 6625  C CG  . TYR C 1 172 ? 37.119  67.123  219.196 1.00 58.05  ? 172 TYR 3 CG  1 
ATOM 6626  C CD1 . TYR C 1 172 ? 37.630  65.933  219.688 1.00 48.10  ? 172 TYR 3 CD1 1 
ATOM 6627  C CD2 . TYR C 1 172 ? 35.766  67.163  218.852 1.00 60.46  ? 172 TYR 3 CD2 1 
ATOM 6628  C CE1 . TYR C 1 172 ? 36.829  64.810  219.861 1.00 50.13  ? 172 TYR 3 CE1 1 
ATOM 6629  C CE2 . TYR C 1 172 ? 34.953  66.036  219.022 1.00 62.15  ? 172 TYR 3 CE2 1 
ATOM 6630  C CZ  . TYR C 1 172 ? 35.497  64.857  219.535 1.00 52.81  ? 172 TYR 3 CZ  1 
ATOM 6631  O OH  . TYR C 1 172 ? 34.727  63.736  219.782 1.00 32.67  ? 172 TYR 3 OH  1 
ATOM 6632  N N   . PRO C 1 173 ? 40.996  68.583  220.589 1.00 61.19  ? 173 PRO 3 N   1 
ATOM 6633  C CA  . PRO C 1 173 ? 42.403  68.931  220.471 1.00 62.16  ? 173 PRO 3 CA  1 
ATOM 6634  C C   . PRO C 1 173 ? 42.669  69.808  219.292 1.00 63.96  ? 173 PRO 3 C   1 
ATOM 6635  O O   . PRO C 1 173 ? 42.166  69.619  218.192 1.00 66.33  ? 173 PRO 3 O   1 
ATOM 6636  C CB  . PRO C 1 173 ? 43.056  67.582  220.309 1.00 61.40  ? 173 PRO 3 CB  1 
ATOM 6637  C CG  . PRO C 1 173 ? 42.313  66.781  221.314 1.00 68.45  ? 173 PRO 3 CG  1 
ATOM 6638  C CD  . PRO C 1 173 ? 40.873  67.335  221.356 1.00 69.95  ? 173 PRO 3 CD  1 
ATOM 6639  N N   . ALA C 1 174 ? 43.556  70.734  219.547 1.00 79.69  ? 174 ALA 3 N   1 
ATOM 6640  C CA  . ALA C 1 174 ? 43.937  71.745  218.605 1.00 90.48  ? 174 ALA 3 CA  1 
ATOM 6641  C C   . ALA C 1 174 ? 44.291  71.331  217.204 1.00 86.61  ? 174 ALA 3 C   1 
ATOM 6642  O O   . ALA C 1 174 ? 43.897  71.978  216.226 1.00 90.52  ? 174 ALA 3 O   1 
ATOM 6643  C CB  . ALA C 1 174 ? 45.084  72.529  219.193 1.00 116.87 ? 174 ALA 3 CB  1 
ATOM 6644  N N   . GLN C 1 175 ? 45.059  70.268  217.097 1.00 75.96  ? 175 GLN 3 N   1 
ATOM 6645  C CA  . GLN C 1 175 ? 45.508  69.903  215.783 1.00 82.21  ? 175 GLN 3 CA  1 
ATOM 6646  C C   . GLN C 1 175 ? 44.566  69.197  214.841 1.00 72.47  ? 175 GLN 3 C   1 
ATOM 6647  O O   . GLN C 1 175 ? 44.787  69.178  213.629 1.00 78.10  ? 175 GLN 3 O   1 
ATOM 6648  C CB  . GLN C 1 175 ? 46.842  69.190  215.898 1.00 112.02 ? 175 GLN 3 CB  1 
ATOM 6649  C CG  . GLN C 1 175 ? 47.963  70.125  216.356 1.00 138.04 ? 175 GLN 3 CG  1 
ATOM 6650  C CD  . GLN C 1 175 ? 48.397  71.143  215.281 1.00 152.04 ? 175 GLN 3 CD  1 
ATOM 6651  O OE1 . GLN C 1 175 ? 49.588  71.429  215.146 1.00 165.61 ? 175 GLN 3 OE1 1 
ATOM 6652  N NE2 . GLN C 1 175 ? 47.441  71.697  214.529 1.00 151.23 ? 175 GLN 3 NE2 1 
ATOM 6653  N N   . THR C 1 176 ? 43.474  68.708  215.396 1.00 56.45  ? 176 THR 3 N   1 
ATOM 6654  C CA  . THR C 1 176 ? 42.468  67.968  214.661 1.00 36.93  ? 176 THR 3 CA  1 
ATOM 6655  C C   . THR C 1 176 ? 41.536  68.824  213.827 1.00 45.11  ? 176 THR 3 C   1 
ATOM 6656  O O   . THR C 1 176 ? 41.527  70.052  213.907 1.00 61.15  ? 176 THR 3 O   1 
ATOM 6657  C CB  . THR C 1 176 ? 41.575  67.287  215.645 1.00 37.12  ? 176 THR 3 CB  1 
ATOM 6658  O OG1 . THR C 1 176 ? 40.631  68.254  216.168 1.00 52.29  ? 176 THR 3 OG1 1 
ATOM 6659  C CG2 . THR C 1 176 ? 42.427  66.716  216.792 1.00 16.49  ? 176 THR 3 CG2 1 
ATOM 6660  N N   . VAL C 1 177 ? 40.677  68.141  213.091 1.00 42.73  ? 177 VAL 3 N   1 
ATOM 6661  C CA  . VAL C 1 177 ? 39.663  68.800  212.292 1.00 38.32  ? 177 VAL 3 CA  1 
ATOM 6662  C C   . VAL C 1 177 ? 38.441  68.072  212.763 1.00 31.88  ? 177 VAL 3 C   1 
ATOM 6663  O O   . VAL C 1 177 ? 38.355  66.860  212.605 1.00 41.09  ? 177 VAL 3 O   1 
ATOM 6664  C CB  . VAL C 1 177 ? 39.858  68.542  210.814 1.00 41.27  ? 177 VAL 3 CB  1 
ATOM 6665  C CG1 . VAL C 1 177 ? 38.677  69.038  210.059 1.00 19.86  ? 177 VAL 3 CG1 1 
ATOM 6666  C CG2 . VAL C 1 177 ? 41.108  69.241  210.334 1.00 42.47  ? 177 VAL 3 CG2 1 
ATOM 6667  N N   . THR C 1 178 ? 37.558  68.779  213.449 1.00 38.18  ? 178 THR 3 N   1 
ATOM 6668  C CA  . THR C 1 178 ? 36.349  68.157  213.982 1.00 42.82  ? 178 THR 3 CA  1 
ATOM 6669  C C   . THR C 1 178 ? 35.082  68.822  213.468 1.00 46.14  ? 178 THR 3 C   1 
ATOM 6670  O O   . THR C 1 178 ? 35.165  69.863  212.807 1.00 53.05  ? 178 THR 3 O   1 
ATOM 6671  C CB  . THR C 1 178 ? 36.380  68.178  215.499 1.00 34.60  ? 178 THR 3 CB  1 
ATOM 6672  O OG1 . THR C 1 178 ? 36.764  69.482  215.947 1.00 66.54  ? 178 THR 3 OG1 1 
ATOM 6673  C CG2 . THR C 1 178 ? 37.385  67.172  215.987 1.00 20.30  ? 178 THR 3 CG2 1 
ATOM 6674  N N   . PRO C 1 179 ? 33.903  68.192  213.667 1.00 46.03  ? 179 PRO 3 N   1 
ATOM 6675  C CA  . PRO C 1 179 ? 32.678  68.829  213.175 1.00 48.93  ? 179 PRO 3 CA  1 
ATOM 6676  C C   . PRO C 1 179 ? 32.492  70.128  213.916 1.00 55.91  ? 179 PRO 3 C   1 
ATOM 6677  O O   . PRO C 1 179 ? 32.671  70.207  215.157 1.00 50.48  ? 179 PRO 3 O   1 
ATOM 6678  C CB  . PRO C 1 179 ? 31.594  67.814  213.511 1.00 33.47  ? 179 PRO 3 CB  1 
ATOM 6679  C CG  . PRO C 1 179 ? 32.139  67.143  214.721 1.00 43.44  ? 179 PRO 3 CG  1 
ATOM 6680  C CD  . PRO C 1 179 ? 33.583  66.928  214.344 1.00 47.66  ? 179 PRO 3 CD  1 
ATOM 6681  N N   . LYS C 1 180 ? 32.205  71.163  213.141 1.00 59.08  ? 180 LYS 3 N   1 
ATOM 6682  C CA  . LYS C 1 180 ? 32.041  72.461  213.732 1.00 71.30  ? 180 LYS 3 CA  1 
ATOM 6683  C C   . LYS C 1 180 ? 30.634  72.831  214.077 1.00 69.03  ? 180 LYS 3 C   1 
ATOM 6684  O O   . LYS C 1 180 ? 29.706  72.552  213.324 1.00 74.60  ? 180 LYS 3 O   1 
ATOM 6685  C CB  . LYS C 1 180 ? 32.677  73.530  212.858 1.00 94.25  ? 180 LYS 3 CB  1 
ATOM 6686  C CG  . LYS C 1 180 ? 34.175  73.718  213.147 1.00 148.52 ? 180 LYS 3 CG  1 
ATOM 6687  C CD  . LYS C 1 180 ? 34.474  74.229  214.598 1.00 179.25 ? 180 LYS 3 CD  1 
ATOM 6688  C CE  . LYS C 1 180 ? 36.003  74.303  214.879 1.00 198.49 ? 180 LYS 3 CE  1 
ATOM 6689  N NZ  . LYS C 1 180 ? 36.426  75.031  216.127 1.00 199.36 ? 180 LYS 3 NZ  1 
ATOM 6690  N N   . ASN C 1 181 ? 30.493  73.460  215.236 1.00 66.76  ? 181 ASN 3 N   1 
ATOM 6691  C CA  . ASN C 1 181 ? 29.205  73.910  215.710 1.00 72.78  ? 181 ASN 3 CA  1 
ATOM 6692  C C   . ASN C 1 181 ? 28.392  72.726  216.117 1.00 61.71  ? 181 ASN 3 C   1 
ATOM 6693  O O   . ASN C 1 181 ? 27.192  72.655  215.866 1.00 49.90  ? 181 ASN 3 O   1 
ATOM 6694  C CB  . ASN C 1 181 ? 28.471  74.709  214.630 1.00 101.04 ? 181 ASN 3 CB  1 
ATOM 6695  C CG  . ASN C 1 181 ? 29.147  76.037  214.317 1.00 128.58 ? 181 ASN 3 CG  1 
ATOM 6696  O OD1 . ASN C 1 181 ? 28.599  76.861  213.588 1.00 152.26 ? 181 ASN 3 OD1 1 
ATOM 6697  N ND2 . ASN C 1 181 ? 30.345  76.249  214.859 1.00 141.51 ? 181 ASN 3 ND2 1 
ATOM 6698  N N   . ALA C 1 182 ? 29.064  71.774  216.738 1.00 61.17  ? 182 ALA 3 N   1 
ATOM 6699  C CA  . ALA C 1 182 ? 28.383  70.586  217.199 1.00 64.03  ? 182 ALA 3 CA  1 
ATOM 6700  C C   . ALA C 1 182 ? 27.192  71.073  217.996 1.00 56.31  ? 182 ALA 3 C   1 
ATOM 6701  O O   . ALA C 1 182 ? 27.270  72.096  218.663 1.00 66.07  ? 182 ALA 3 O   1 
ATOM 6702  C CB  . ALA C 1 182 ? 29.297  69.781  218.079 1.00 78.49  ? 182 ALA 3 CB  1 
ATOM 6703  N N   . THR C 1 183 ? 26.067  70.410  217.810 1.00 42.11  ? 183 THR 3 N   1 
ATOM 6704  C CA  . THR C 1 183 ? 24.845  70.736  218.507 1.00 32.28  ? 183 THR 3 CA  1 
ATOM 6705  C C   . THR C 1 183 ? 24.411  69.393  219.050 1.00 36.35  ? 183 THR 3 C   1 
ATOM 6706  O O   . THR C 1 183 ? 25.070  68.380  218.818 1.00 38.95  ? 183 THR 3 O   1 
ATOM 6707  C CB  . THR C 1 183 ? 23.784  71.195  217.534 1.00 31.65  ? 183 THR 3 CB  1 
ATOM 6708  O OG1 . THR C 1 183 ? 23.089  70.052  217.023 1.00 48.10  ? 183 THR 3 OG1 1 
ATOM 6709  C CG2 . THR C 1 183 ? 24.424  71.918  216.359 1.00 41.56  ? 183 THR 3 CG2 1 
ATOM 6710  N N   . VAL C 1 184 ? 23.258  69.334  219.682 1.00 38.18  ? 184 VAL 3 N   1 
ATOM 6711  C CA  . VAL C 1 184 ? 22.844  68.041  220.194 1.00 51.00  ? 184 VAL 3 CA  1 
ATOM 6712  C C   . VAL C 1 184 ? 22.518  67.145  219.044 1.00 46.29  ? 184 VAL 3 C   1 
ATOM 6713  O O   . VAL C 1 184 ? 22.614  65.934  219.151 1.00 55.03  ? 184 VAL 3 O   1 
ATOM 6714  C CB  . VAL C 1 184 ? 21.625  68.113  221.049 1.00 61.28  ? 184 VAL 3 CB  1 
ATOM 6715  C CG1 . VAL C 1 184 ? 21.503  66.800  221.858 1.00 57.91  ? 184 VAL 3 CG1 1 
ATOM 6716  C CG2 . VAL C 1 184 ? 21.694  69.369  221.920 1.00 83.01  ? 184 VAL 3 CG2 1 
ATOM 6717  N N   . ASP C 1 185 ? 22.105  67.753  217.948 1.00 46.08  ? 185 ASP 3 N   1 
ATOM 6718  C CA  . ASP C 1 185 ? 21.784  67.011  216.752 1.00 44.16  ? 185 ASP 3 CA  1 
ATOM 6719  C C   . ASP C 1 185 ? 23.017  66.305  216.219 1.00 44.88  ? 185 ASP 3 C   1 
ATOM 6720  O O   . ASP C 1 185 ? 22.912  65.305  215.503 1.00 48.55  ? 185 ASP 3 O   1 
ATOM 6721  C CB  . ASP C 1 185 ? 21.238  67.953  215.701 1.00 51.81  ? 185 ASP 3 CB  1 
ATOM 6722  C CG  . ASP C 1 185 ? 19.787  68.263  215.915 1.00 58.59  ? 185 ASP 3 CG  1 
ATOM 6723  O OD1 . ASP C 1 185 ? 19.105  67.455  216.587 1.00 56.32  ? 185 ASP 3 OD1 1 
ATOM 6724  O OD2 . ASP C 1 185 ? 19.326  69.313  215.418 1.00 73.43  ? 185 ASP 3 OD2 1 
ATOM 6725  N N   . SER C 1 186 ? 24.189  66.817  216.582 1.00 30.55  ? 186 SER 3 N   1 
ATOM 6726  C CA  . SER C 1 186 ? 25.424  66.209  216.144 1.00 29.16  ? 186 SER 3 CA  1 
ATOM 6727  C C   . SER C 1 186 ? 25.598  64.805  216.732 1.00 30.61  ? 186 SER 3 C   1 
ATOM 6728  O O   . SER C 1 186 ? 26.383  64.009  216.212 1.00 48.05  ? 186 SER 3 O   1 
ATOM 6729  C CB  . SER C 1 186 ? 26.584  67.114  216.500 1.00 30.34  ? 186 SER 3 CB  1 
ATOM 6730  O OG  . SER C 1 186 ? 26.390  68.380  215.900 1.00 35.64  ? 186 SER 3 OG  1 
ATOM 6731  N N   . GLN C 1 187 ? 24.845  64.490  217.783 1.00 18.47  ? 187 GLN 3 N   1 
ATOM 6732  C CA  . GLN C 1 187 ? 24.907  63.160  218.392 1.00 30.73  ? 187 GLN 3 CA  1 
ATOM 6733  C C   . GLN C 1 187 ? 24.153  62.141  217.510 1.00 31.66  ? 187 GLN 3 C   1 
ATOM 6734  O O   . GLN C 1 187 ? 24.198  60.916  217.745 1.00 37.81  ? 187 GLN 3 O   1 
ATOM 6735  C CB  . GLN C 1 187 ? 24.390  63.183  219.845 1.00 31.37  ? 187 GLN 3 CB  1 
ATOM 6736  C CG  . GLN C 1 187 ? 25.182  64.141  220.742 1.00 34.82  ? 187 GLN 3 CG  1 
ATOM 6737  C CD  . GLN C 1 187 ? 25.300  63.669  222.170 1.00 61.70  ? 187 GLN 3 CD  1 
ATOM 6738  O OE1 . GLN C 1 187 ? 24.891  62.553  222.507 1.00 87.34  ? 187 GLN 3 OE1 1 
ATOM 6739  N NE2 . GLN C 1 187 ? 25.910  64.498  223.020 1.00 64.52  ? 187 GLN 3 NE2 1 
ATOM 6740  N N   . GLN C 1 188 ? 23.458  62.679  216.504 1.00 27.94  ? 188 GLN 3 N   1 
ATOM 6741  C CA  . GLN C 1 188 ? 22.719  61.912  215.501 1.00 31.98  ? 188 GLN 3 CA  1 
ATOM 6742  C C   . GLN C 1 188 ? 23.013  62.614  214.166 1.00 32.27  ? 188 GLN 3 C   1 
ATOM 6743  O O   . GLN C 1 188 ? 24.017  63.351  214.057 1.00 45.14  ? 188 GLN 3 O   1 
ATOM 6744  C CB  . GLN C 1 188 ? 21.214  61.858  215.786 1.00 32.01  ? 188 GLN 3 CB  1 
ATOM 6745  C CG  . GLN C 1 188 ? 20.489  63.187  215.649 1.00 54.13  ? 188 GLN 3 CG  1 
ATOM 6746  C CD  . GLN C 1 188 ? 18.978  63.133  215.968 1.00 65.50  ? 188 GLN 3 CD  1 
ATOM 6747  O OE1 . GLN C 1 188 ? 18.241  64.070  215.630 1.00 80.58  ? 188 GLN 3 OE1 1 
ATOM 6748  N NE2 . GLN C 1 188 ? 18.519  62.062  216.632 1.00 49.77  ? 188 GLN 3 NE2 1 
ATOM 6749  N N   . MET C 1 189 ? 22.161  62.419  213.163 1.00 16.26  ? 189 MET 3 N   1 
ATOM 6750  C CA  . MET C 1 189 ? 22.414  63.011  211.841 1.00 33.01  ? 189 MET 3 CA  1 
ATOM 6751  C C   . MET C 1 189 ? 22.414  64.548  211.768 1.00 37.94  ? 189 MET 3 C   1 
ATOM 6752  O O   . MET C 1 189 ? 21.366  65.198  211.751 1.00 38.39  ? 189 MET 3 O   1 
ATOM 6753  C CB  . MET C 1 189 ? 21.485  62.387  210.789 1.00 30.40  ? 189 MET 3 CB  1 
ATOM 6754  C CG  . MET C 1 189 ? 21.803  62.731  209.354 1.00 29.44  ? 189 MET 3 CG  1 
ATOM 6755  S SD  . MET C 1 189 ? 23.509  62.387  208.980 1.00 49.29  ? 189 MET 3 SD  1 
ATOM 6756  C CE  . MET C 1 189 ? 23.573  62.814  207.276 1.00 55.28  ? 189 MET 3 CE  1 
ATOM 6757  N N   . ASN C 1 190 ? 23.601  65.135  211.728 1.00 41.13  ? 190 ASN 3 N   1 
ATOM 6758  C CA  . ASN C 1 190 ? 23.663  66.574  211.659 1.00 40.55  ? 190 ASN 3 CA  1 
ATOM 6759  C C   . ASN C 1 190 ? 24.217  67.039  210.331 1.00 33.85  ? 190 ASN 3 C   1 
ATOM 6760  O O   . ASN C 1 190 ? 25.396  67.334  210.189 1.00 40.29  ? 190 ASN 3 O   1 
ATOM 6761  C CB  . ASN C 1 190 ? 24.494  67.119  212.799 1.00 55.68  ? 190 ASN 3 CB  1 
ATOM 6762  C CG  . ASN C 1 190 ? 24.427  68.626  212.879 1.00 61.56  ? 190 ASN 3 CG  1 
ATOM 6763  O OD1 . ASN C 1 190 ? 25.011  69.228  213.783 1.00 59.94  ? 190 ASN 3 OD1 1 
ATOM 6764  N ND2 . ASN C 1 190 ? 23.694  69.250  211.947 1.00 42.24  ? 190 ASN 3 ND2 1 
ATOM 6765  N N   . THR C 1 191 ? 23.320  67.211  209.391 1.00 19.02  ? 191 THR 3 N   1 
ATOM 6766  C CA  . THR C 1 191 ? 23.651  67.614  208.039 1.00 30.53  ? 191 THR 3 CA  1 
ATOM 6767  C C   . THR C 1 191 ? 24.705  68.674  207.854 1.00 34.56  ? 191 THR 3 C   1 
ATOM 6768  O O   . THR C 1 191 ? 25.153  68.908  206.746 1.00 43.33  ? 191 THR 3 O   1 
ATOM 6769  C CB  . THR C 1 191 ? 22.431  68.149  207.358 1.00 36.71  ? 191 THR 3 CB  1 
ATOM 6770  O OG1 . THR C 1 191 ? 21.282  67.741  208.104 1.00 86.26  ? 191 THR 3 OG1 1 
ATOM 6771  C CG2 . THR C 1 191 ? 22.334  67.620  205.962 1.00 39.21  ? 191 THR 3 CG2 1 
ATOM 6772  N N   . ASP C 1 192 ? 25.054  69.389  208.897 1.00 47.18  ? 192 ASP 3 N   1 
ATOM 6773  C CA  . ASP C 1 192 ? 26.053  70.427  208.706 1.00 60.24  ? 192 ASP 3 CA  1 
ATOM 6774  C C   . ASP C 1 192 ? 27.434  69.837  208.628 1.00 48.62  ? 192 ASP 3 C   1 
ATOM 6775  O O   . ASP C 1 192 ? 28.296  70.326  207.905 1.00 52.64  ? 192 ASP 3 O   1 
ATOM 6776  C CB  . ASP C 1 192 ? 26.026  71.425  209.862 1.00 88.50  ? 192 ASP 3 CB  1 
ATOM 6777  C CG  . ASP C 1 192 ? 24.668  72.049  210.062 1.00 99.44  ? 192 ASP 3 CG  1 
ATOM 6778  O OD1 . ASP C 1 192 ? 24.096  72.582  209.077 1.00 90.88  ? 192 ASP 3 OD1 1 
ATOM 6779  O OD2 . ASP C 1 192 ? 24.181  71.988  211.216 1.00 120.09 ? 192 ASP 3 OD2 1 
ATOM 6780  N N   . HIS C 1 193 ? 27.639  68.804  209.424 1.00 34.67  ? 193 HIS 3 N   1 
ATOM 6781  C CA  . HIS C 1 193 ? 28.909  68.135  209.511 1.00 30.93  ? 193 HIS 3 CA  1 
ATOM 6782  C C   . HIS C 1 193 ? 29.389  67.388  208.301 1.00 32.40  ? 193 HIS 3 C   1 
ATOM 6783  O O   . HIS C 1 193 ? 29.791  66.234  208.402 1.00 34.71  ? 193 HIS 3 O   1 
ATOM 6784  C CB  . HIS C 1 193 ? 28.874  67.259  210.721 1.00 24.10  ? 193 HIS 3 CB  1 
ATOM 6785  C CG  . HIS C 1 193 ? 28.540  68.031  211.939 1.00 33.76  ? 193 HIS 3 CG  1 
ATOM 6786  N ND1 . HIS C 1 193 ? 28.807  69.379  212.028 1.00 27.80  ? 193 HIS 3 ND1 1 
ATOM 6787  C CD2 . HIS C 1 193 ? 27.980  67.672  213.117 1.00 43.54  ? 193 HIS 3 CD2 1 
ATOM 6788  C CE1 . HIS C 1 193 ? 28.436  69.814  213.218 1.00 44.22  ? 193 HIS 3 CE1 1 
ATOM 6789  N NE2 . HIS C 1 193 ? 27.933  68.799  213.899 1.00 37.81  ? 193 HIS 3 NE2 1 
ATOM 6790  N N   . LYS C 1 194 ? 29.362  68.054  207.153 1.00 24.33  ? 194 LYS 3 N   1 
ATOM 6791  C CA  . LYS C 1 194 ? 29.841  67.457  205.930 1.00 33.56  ? 194 LYS 3 CA  1 
ATOM 6792  C C   . LYS C 1 194 ? 31.253  67.987  205.753 1.00 42.31  ? 194 LYS 3 C   1 
ATOM 6793  O O   . LYS C 1 194 ? 31.495  69.204  205.876 1.00 38.53  ? 194 LYS 3 O   1 
ATOM 6794  C CB  . LYS C 1 194 ? 28.955  67.829  204.745 1.00 22.03  ? 194 LYS 3 CB  1 
ATOM 6795  C CG  . LYS C 1 194 ? 27.497  67.345  204.862 1.00 39.31  ? 194 LYS 3 CG  1 
ATOM 6796  C CD  . LYS C 1 194 ? 27.304  65.820  204.844 1.00 39.04  ? 194 LYS 3 CD  1 
ATOM 6797  C CE  . LYS C 1 194 ? 25.842  65.484  204.536 1.00 30.72  ? 194 LYS 3 CE  1 
ATOM 6798  N NZ  . LYS C 1 194 ? 25.555  64.048  204.196 1.00 70.47  ? 194 LYS 3 NZ  1 
ATOM 6799  N N   . ALA C 1 195 ? 32.181  67.054  205.533 1.00 47.01  ? 195 ALA 3 N   1 
ATOM 6800  C CA  . ALA C 1 195 ? 33.586  67.377  205.369 1.00 43.28  ? 195 ALA 3 CA  1 
ATOM 6801  C C   . ALA C 1 195 ? 34.247  66.490  204.335 1.00 44.00  ? 195 ALA 3 C   1 
ATOM 6802  O O   . ALA C 1 195 ? 33.573  65.721  203.645 1.00 59.38  ? 195 ALA 3 O   1 
ATOM 6803  C CB  . ALA C 1 195 ? 34.280  67.224  206.680 1.00 46.35  ? 195 ALA 3 CB  1 
ATOM 6804  N N   . VAL C 1 196 ? 35.572  66.587  204.248 1.00 35.87  ? 196 VAL 3 N   1 
ATOM 6805  C CA  . VAL C 1 196 ? 36.347  65.796  203.293 1.00 33.26  ? 196 VAL 3 CA  1 
ATOM 6806  C C   . VAL C 1 196 ? 37.751  65.468  203.812 1.00 28.47  ? 196 VAL 3 C   1 
ATOM 6807  O O   . VAL C 1 196 ? 38.476  66.344  204.262 1.00 35.02  ? 196 VAL 3 O   1 
ATOM 6808  C CB  . VAL C 1 196 ? 36.474  66.528  201.969 1.00 7.36   ? 196 VAL 3 CB  1 
ATOM 6809  C CG1 . VAL C 1 196 ? 36.904  67.923  202.232 1.00 60.17  ? 196 VAL 3 CG1 1 
ATOM 6810  C CG2 . VAL C 1 196 ? 37.509  65.868  201.129 1.00 30.62  ? 196 VAL 3 CG2 1 
ATOM 6811  N N   . LEU C 1 197 ? 38.109  64.193  203.757 1.00 25.08  ? 197 LEU 3 N   1 
ATOM 6812  C CA  . LEU C 1 197 ? 39.392  63.727  204.228 1.00 26.71  ? 197 LEU 3 CA  1 
ATOM 6813  C C   . LEU C 1 197 ? 40.439  64.251  203.312 1.00 34.83  ? 197 LEU 3 C   1 
ATOM 6814  O O   . LEU C 1 197 ? 40.632  63.685  202.229 1.00 42.04  ? 197 LEU 3 O   1 
ATOM 6815  C CB  . LEU C 1 197 ? 39.453  62.220  204.155 1.00 26.89  ? 197 LEU 3 CB  1 
ATOM 6816  C CG  . LEU C 1 197 ? 40.606  61.748  205.007 1.00 30.21  ? 197 LEU 3 CG  1 
ATOM 6817  C CD1 . LEU C 1 197 ? 40.642  62.532  206.304 1.00 52.97  ? 197 LEU 3 CD1 1 
ATOM 6818  C CD2 . LEU C 1 197 ? 40.412  60.306  205.296 1.00 36.31  ? 197 LEU 3 CD2 1 
ATOM 6819  N N   . ASP C 1 198 ? 41.140  65.287  203.764 1.00 34.63  ? 198 ASP 3 N   1 
ATOM 6820  C CA  . ASP C 1 198 ? 42.181  65.932  202.962 1.00 40.24  ? 198 ASP 3 CA  1 
ATOM 6821  C C   . ASP C 1 198 ? 43.469  66.144  203.739 1.00 42.13  ? 198 ASP 3 C   1 
ATOM 6822  O O   . ASP C 1 198 ? 44.421  66.773  203.233 1.00 34.25  ? 198 ASP 3 O   1 
ATOM 6823  C CB  . ASP C 1 198 ? 41.706  67.290  202.460 1.00 40.37  ? 198 ASP 3 CB  1 
ATOM 6824  C CG  . ASP C 1 198 ? 41.225  68.183  203.589 1.00 53.22  ? 198 ASP 3 CG  1 
ATOM 6825  O OD1 . ASP C 1 198 ? 41.548  67.884  204.771 1.00 38.77  ? 198 ASP 3 OD1 1 
ATOM 6826  O OD2 . ASP C 1 198 ? 40.525  69.175  203.289 1.00 53.89  ? 198 ASP 3 OD2 1 
ATOM 6827  N N   . LYS C 1 199 ? 43.492  65.649  204.969 1.00 27.29  ? 199 LYS 3 N   1 
ATOM 6828  C CA  . LYS C 1 199 ? 44.674  65.800  205.767 1.00 19.84  ? 199 LYS 3 CA  1 
ATOM 6829  C C   . LYS C 1 199 ? 44.937  64.558  206.571 1.00 29.68  ? 199 LYS 3 C   1 
ATOM 6830  O O   . LYS C 1 199 ? 44.094  64.091  207.390 1.00 26.40  ? 199 LYS 3 O   1 
ATOM 6831  C CB  . LYS C 1 199 ? 44.542  67.014  206.669 1.00 34.92  ? 199 LYS 3 CB  1 
ATOM 6832  C CG  . LYS C 1 199 ? 45.790  67.315  207.456 1.00 76.55  ? 199 LYS 3 CG  1 
ATOM 6833  C CD  . LYS C 1 199 ? 47.019  67.275  206.549 1.00 124.87 ? 199 LYS 3 CD  1 
ATOM 6834  C CE  . LYS C 1 199 ? 48.311  67.533  207.310 1.00 148.63 ? 199 LYS 3 CE  1 
ATOM 6835  N NZ  . LYS C 1 199 ? 48.292  68.882  207.946 1.00 170.84 ? 199 LYS 3 NZ  1 
ATOM 6836  N N   . ASP C 1 200 ? 46.115  64.005  206.322 1.00 26.75  ? 200 ASP 3 N   1 
ATOM 6837  C CA  . ASP C 1 200 ? 46.522  62.797  207.020 1.00 34.92  ? 200 ASP 3 CA  1 
ATOM 6838  C C   . ASP C 1 200 ? 46.638  63.058  208.512 1.00 20.27  ? 200 ASP 3 C   1 
ATOM 6839  O O   . ASP C 1 200 ? 46.993  64.144  208.936 1.00 27.69  ? 200 ASP 3 O   1 
ATOM 6840  C CB  . ASP C 1 200 ? 47.845  62.270  206.473 1.00 37.76  ? 200 ASP 3 CB  1 
ATOM 6841  C CG  . ASP C 1 200 ? 48.171  60.882  206.994 1.00 49.18  ? 200 ASP 3 CG  1 
ATOM 6842  O OD1 . ASP C 1 200 ? 47.415  59.934  206.702 1.00 43.52  ? 200 ASP 3 OD1 1 
ATOM 6843  O OD2 . ASP C 1 200 ? 49.182  60.735  207.700 1.00 54.09  ? 200 ASP 3 OD2 1 
ATOM 6844  N N   . ASN C 1 201 ? 46.372  62.044  209.311 1.00 25.42  ? 201 ASN 3 N   1 
ATOM 6845  C CA  . ASN C 1 201 ? 46.419  62.183  210.769 1.00 42.21  ? 201 ASN 3 CA  1 
ATOM 6846  C C   . ASN C 1 201 ? 45.659  63.417  211.202 1.00 41.85  ? 201 ASN 3 C   1 
ATOM 6847  O O   . ASN C 1 201 ? 46.061  64.086  212.128 1.00 33.75  ? 201 ASN 3 O   1 
ATOM 6848  C CB  . ASN C 1 201 ? 47.869  62.278  211.270 1.00 50.83  ? 201 ASN 3 CB  1 
ATOM 6849  C CG  . ASN C 1 201 ? 47.981  62.287  212.810 1.00 64.36  ? 201 ASN 3 CG  1 
ATOM 6850  O OD1 . ASN C 1 201 ? 48.839  62.972  213.356 1.00 99.74  ? 201 ASN 3 OD1 1 
ATOM 6851  N ND2 . ASN C 1 201 ? 47.118  61.545  213.501 1.00 60.89  ? 201 ASN 3 ND2 1 
ATOM 6852  N N   . ALA C 1 202 ? 44.540  63.719  210.570 1.00 52.60  ? 202 ALA 3 N   1 
ATOM 6853  C CA  . ALA C 1 202 ? 43.866  64.930  210.981 1.00 44.02  ? 202 ALA 3 CA  1 
ATOM 6854  C C   . ALA C 1 202 ? 42.472  64.726  211.479 1.00 45.65  ? 202 ALA 3 C   1 
ATOM 6855  O O   . ALA C 1 202 ? 42.076  65.313  212.489 1.00 37.43  ? 202 ALA 3 O   1 
ATOM 6856  C CB  . ALA C 1 202 ? 43.869  65.929  209.858 1.00 43.16  ? 202 ALA 3 CB  1 
ATOM 6857  N N   . TYR C 1 203 ? 41.718  63.900  210.776 1.00 39.90  ? 203 TYR 3 N   1 
ATOM 6858  C CA  . TYR C 1 203 ? 40.350  63.706  211.174 1.00 28.58  ? 203 TYR 3 CA  1 
ATOM 6859  C C   . TYR C 1 203 ? 40.186  62.469  212.012 1.00 28.51  ? 203 TYR 3 C   1 
ATOM 6860  O O   . TYR C 1 203 ? 40.343  61.371  211.517 1.00 48.00  ? 203 TYR 3 O   1 
ATOM 6861  C CB  . TYR C 1 203 ? 39.514  63.619  209.945 1.00 19.83  ? 203 TYR 3 CB  1 
ATOM 6862  C CG  . TYR C 1 203 ? 39.622  64.826  209.045 1.00 26.43  ? 203 TYR 3 CG  1 
ATOM 6863  C CD1 . TYR C 1 203 ? 40.818  65.171  208.392 1.00 26.57  ? 203 TYR 3 CD1 1 
ATOM 6864  C CD2 . TYR C 1 203 ? 38.492  65.555  208.754 1.00 31.88  ? 203 TYR 3 CD2 1 
ATOM 6865  C CE1 . TYR C 1 203 ? 40.847  66.223  207.460 1.00 33.52  ? 203 TYR 3 CE1 1 
ATOM 6866  C CE2 . TYR C 1 203 ? 38.508  66.584  207.844 1.00 36.13  ? 203 TYR 3 CE2 1 
ATOM 6867  C CZ  . TYR C 1 203 ? 39.662  66.929  207.201 1.00 43.28  ? 203 TYR 3 CZ  1 
ATOM 6868  O OH  . TYR C 1 203 ? 39.536  68.017  206.359 1.00 39.62  ? 203 TYR 3 OH  1 
ATOM 6869  N N   . PRO C 1 204 ? 39.932  62.636  213.312 1.00 16.90  ? 204 PRO 3 N   1 
ATOM 6870  C CA  . PRO C 1 204 ? 39.746  61.557  214.291 1.00 20.18  ? 204 PRO 3 CA  1 
ATOM 6871  C C   . PRO C 1 204 ? 38.649  60.632  213.877 1.00 30.29  ? 204 PRO 3 C   1 
ATOM 6872  O O   . PRO C 1 204 ? 37.506  61.038  213.670 1.00 35.65  ? 204 PRO 3 O   1 
ATOM 6873  C CB  . PRO C 1 204 ? 39.367  62.300  215.560 1.00 32.60  ? 204 PRO 3 CB  1 
ATOM 6874  C CG  . PRO C 1 204 ? 38.820  63.630  215.037 1.00 26.16  ? 204 PRO 3 CG  1 
ATOM 6875  C CD  . PRO C 1 204 ? 39.751  63.956  213.931 1.00 11.10  ? 204 PRO 3 CD  1 
ATOM 6876  N N   . VAL C 1 205 ? 38.978  59.364  213.812 1.00 37.94  ? 205 VAL 3 N   1 
ATOM 6877  C CA  . VAL C 1 205 ? 37.998  58.404  213.371 1.00 45.85  ? 205 VAL 3 CA  1 
ATOM 6878  C C   . VAL C 1 205 ? 36.800  58.423  214.258 1.00 45.71  ? 205 VAL 3 C   1 
ATOM 6879  O O   . VAL C 1 205 ? 35.712  58.012  213.858 1.00 44.65  ? 205 VAL 3 O   1 
ATOM 6880  C CB  . VAL C 1 205 ? 38.566  57.008  213.358 1.00 48.58  ? 205 VAL 3 CB  1 
ATOM 6881  C CG1 . VAL C 1 205 ? 39.777  56.979  212.476 1.00 55.37  ? 205 VAL 3 CG1 1 
ATOM 6882  C CG2 . VAL C 1 205 ? 38.954  56.622  214.738 1.00 70.16  ? 205 VAL 3 CG2 1 
ATOM 6883  N N   . GLU C 1 206 ? 36.968  58.933  215.462 1.00 42.23  ? 206 GLU 3 N   1 
ATOM 6884  C CA  . GLU C 1 206 ? 35.813  58.907  216.315 1.00 53.13  ? 206 GLU 3 CA  1 
ATOM 6885  C C   . GLU C 1 206 ? 34.799  60.012  216.077 1.00 47.01  ? 206 GLU 3 C   1 
ATOM 6886  O O   . GLU C 1 206 ? 33.796  60.082  216.782 1.00 48.70  ? 206 GLU 3 O   1 
ATOM 6887  C CB  . GLU C 1 206 ? 36.221  58.824  217.767 1.00 57.02  ? 206 GLU 3 CB  1 
ATOM 6888  C CG  . GLU C 1 206 ? 36.910  60.027  218.267 1.00 69.26  ? 206 GLU 3 CG  1 
ATOM 6889  C CD  . GLU C 1 206 ? 36.663  60.184  219.736 1.00 63.28  ? 206 GLU 3 CD  1 
ATOM 6890  O OE1 . GLU C 1 206 ? 36.886  59.190  220.458 1.00 71.79  ? 206 GLU 3 OE1 1 
ATOM 6891  O OE2 . GLU C 1 206 ? 36.236  61.278  220.165 1.00 29.82  ? 206 GLU 3 OE2 1 
ATOM 6892  N N   . CYS C 1 207 ? 35.016  60.816  215.040 1.00 39.57  ? 207 CYS 3 N   1 
ATOM 6893  C CA  . CYS C 1 207 ? 34.104  61.914  214.720 1.00 41.07  ? 207 CYS 3 CA  1 
ATOM 6894  C C   . CYS C 1 207 ? 33.583  61.811  213.306 1.00 40.92  ? 207 CYS 3 C   1 
ATOM 6895  O O   . CYS C 1 207 ? 32.678  62.537  212.882 1.00 41.72  ? 207 CYS 3 O   1 
ATOM 6896  C CB  . CYS C 1 207 ? 34.844  63.243  214.804 1.00 38.61  ? 207 CYS 3 CB  1 
ATOM 6897  S SG  . CYS C 1 207 ? 35.623  63.559  216.360 1.00 58.07  ? 207 CYS 3 SG  1 
ATOM 6898  N N   . TRP C 1 208 ? 34.162  60.917  212.540 1.00 44.12  ? 208 TRP 3 N   1 
ATOM 6899  C CA  . TRP C 1 208 ? 33.744  60.868  211.171 1.00 39.67  ? 208 TRP 3 CA  1 
ATOM 6900  C C   . TRP C 1 208 ? 33.483  59.529  210.596 1.00 37.97  ? 208 TRP 3 C   1 
ATOM 6901  O O   . TRP C 1 208 ? 33.984  58.519  211.075 1.00 40.03  ? 208 TRP 3 O   1 
ATOM 6902  C CB  . TRP C 1 208 ? 34.816  61.502  210.344 1.00 47.98  ? 208 TRP 3 CB  1 
ATOM 6903  C CG  . TRP C 1 208 ? 35.122  62.866  210.762 1.00 55.81  ? 208 TRP 3 CG  1 
ATOM 6904  C CD1 . TRP C 1 208 ? 36.210  63.301  211.489 1.00 51.24  ? 208 TRP 3 CD1 1 
ATOM 6905  C CD2 . TRP C 1 208 ? 34.425  64.021  210.347 1.00 52.19  ? 208 TRP 3 CD2 1 
ATOM 6906  N NE1 . TRP C 1 208 ? 36.234  64.669  211.507 1.00 49.01  ? 208 TRP 3 NE1 1 
ATOM 6907  C CE2 . TRP C 1 208 ? 35.144  65.135  210.814 1.00 50.22  ? 208 TRP 3 CE2 1 
ATOM 6908  C CE3 . TRP C 1 208 ? 33.256  64.228  209.608 1.00 55.43  ? 208 TRP 3 CE3 1 
ATOM 6909  C CZ2 . TRP C 1 208 ? 34.733  66.430  210.557 1.00 34.93  ? 208 TRP 3 CZ2 1 
ATOM 6910  C CZ3 . TRP C 1 208 ? 32.850  65.517  209.352 1.00 44.72  ? 208 TRP 3 CZ3 1 
ATOM 6911  C CH2 . TRP C 1 208 ? 33.582  66.598  209.824 1.00 33.65  ? 208 TRP 3 CH2 1 
ATOM 6912  N N   . VAL C 1 209 ? 32.634  59.533  209.586 1.00 31.19  ? 209 VAL 3 N   1 
ATOM 6913  C CA  . VAL C 1 209 ? 32.332  58.334  208.871 1.00 23.22  ? 209 VAL 3 CA  1 
ATOM 6914  C C   . VAL C 1 209 ? 32.071  58.806  207.473 1.00 24.17  ? 209 VAL 3 C   1 
ATOM 6915  O O   . VAL C 1 209 ? 31.638  59.943  207.243 1.00 28.92  ? 209 VAL 3 O   1 
ATOM 6916  C CB  . VAL C 1 209 ? 31.129  57.558  209.449 1.00 18.80  ? 209 VAL 3 CB  1 
ATOM 6917  C CG1 . VAL C 1 209 ? 30.847  57.985  210.853 1.00 19.96  ? 209 VAL 3 CG1 1 
ATOM 6918  C CG2 . VAL C 1 209 ? 29.931  57.645  208.556 1.00 16.34  ? 209 VAL 3 CG2 1 
ATOM 6919  N N   . PRO C 1 210 ? 32.483  58.000  206.509 1.00 21.55  ? 210 PRO 3 N   1 
ATOM 6920  C CA  . PRO C 1 210 ? 32.290  58.318  205.097 1.00 24.68  ? 210 PRO 3 CA  1 
ATOM 6921  C C   . PRO C 1 210 ? 30.825  58.655  204.889 1.00 24.41  ? 210 PRO 3 C   1 
ATOM 6922  O O   . PRO C 1 210 ? 29.931  57.898  205.331 1.00 23.09  ? 210 PRO 3 O   1 
ATOM 6923  C CB  . PRO C 1 210 ? 32.658  56.995  204.383 1.00 26.13  ? 210 PRO 3 CB  1 
ATOM 6924  C CG  . PRO C 1 210 ? 32.519  55.936  205.441 1.00 34.21  ? 210 PRO 3 CG  1 
ATOM 6925  C CD  . PRO C 1 210 ? 33.046  56.657  206.678 1.00 20.81  ? 210 PRO 3 CD  1 
ATOM 6926  N N   . ASP C 1 211 ? 30.591  59.818  204.293 1.00 6.85   ? 211 ASP 3 N   1 
ATOM 6927  C CA  . ASP C 1 211 ? 29.245  60.265  204.010 1.00 13.47  ? 211 ASP 3 CA  1 
ATOM 6928  C C   . ASP C 1 211 ? 28.692  59.510  202.816 1.00 9.53   ? 211 ASP 3 C   1 
ATOM 6929  O O   . ASP C 1 211 ? 29.080  59.745  201.674 1.00 11.95  ? 211 ASP 3 O   1 
ATOM 6930  C CB  . ASP C 1 211 ? 29.229  61.744  203.692 1.00 23.11  ? 211 ASP 3 CB  1 
ATOM 6931  C CG  . ASP C 1 211 ? 27.861  62.235  203.277 1.00 37.76  ? 211 ASP 3 CG  1 
ATOM 6932  O OD1 . ASP C 1 211 ? 26.841  61.486  203.265 1.00 22.26  ? 211 ASP 3 OD1 1 
ATOM 6933  O OD2 . ASP C 1 211 ? 27.806  63.433  202.980 1.00 53.97  ? 211 ASP 3 OD2 1 
ATOM 6934  N N   . PRO C 1 212 ? 27.708  58.650  203.060 1.00 7.26   ? 212 PRO 3 N   1 
ATOM 6935  C CA  . PRO C 1 212 ? 27.010  57.806  202.095 1.00 3.76   ? 212 PRO 3 CA  1 
ATOM 6936  C C   . PRO C 1 212 ? 26.237  58.606  201.070 1.00 17.05  ? 212 PRO 3 C   1 
ATOM 6937  O O   . PRO C 1 212 ? 26.201  58.270  199.877 1.00 38.66  ? 212 PRO 3 O   1 
ATOM 6938  C CB  . PRO C 1 212 ? 26.074  57.005  202.983 1.00 10.44  ? 212 PRO 3 CB  1 
ATOM 6939  C CG  . PRO C 1 212 ? 25.812  57.896  204.071 1.00 3.78   ? 212 PRO 3 CG  1 
ATOM 6940  C CD  . PRO C 1 212 ? 27.154  58.445  204.399 1.00 2.00   ? 212 PRO 3 CD  1 
ATOM 6941  N N   . SER C 1 213 ? 25.685  59.707  201.542 1.00 22.87  ? 213 SER 3 N   1 
ATOM 6942  C CA  . SER C 1 213 ? 24.906  60.583  200.709 1.00 23.06  ? 213 SER 3 CA  1 
ATOM 6943  C C   . SER C 1 213 ? 25.736  61.026  199.550 1.00 32.84  ? 213 SER 3 C   1 
ATOM 6944  O O   . SER C 1 213 ? 25.201  61.430  198.511 1.00 40.68  ? 213 SER 3 O   1 
ATOM 6945  C CB  . SER C 1 213 ? 24.516  61.816  201.509 1.00 21.39  ? 213 SER 3 CB  1 
ATOM 6946  O OG  . SER C 1 213 ? 25.138  62.990  201.005 1.00 42.48  ? 213 SER 3 OG  1 
ATOM 6947  N N   . LYS C 1 214 ? 27.053  61.017  199.739 1.00 28.36  ? 214 LYS 3 N   1 
ATOM 6948  C CA  . LYS C 1 214 ? 27.845  61.525  198.671 1.00 39.92  ? 214 LYS 3 CA  1 
ATOM 6949  C C   . LYS C 1 214 ? 29.107  60.932  198.124 1.00 46.04  ? 214 LYS 3 C   1 
ATOM 6950  O O   . LYS C 1 214 ? 29.722  61.578  197.283 1.00 84.26  ? 214 LYS 3 O   1 
ATOM 6951  C CB  . LYS C 1 214 ? 28.049  63.041  198.867 1.00 54.49  ? 214 LYS 3 CB  1 
ATOM 6952  C CG  . LYS C 1 214 ? 28.607  63.485  200.217 1.00 59.64  ? 214 LYS 3 CG  1 
ATOM 6953  C CD  . LYS C 1 214 ? 28.702  65.033  200.367 1.00 61.57  ? 214 LYS 3 CD  1 
ATOM 6954  C CE  . LYS C 1 214 ? 27.408  65.767  199.958 1.00 63.01  ? 214 LYS 3 CE  1 
ATOM 6955  N NZ  . LYS C 1 214 ? 27.593  66.523  198.669 1.00 81.34  ? 214 LYS 3 NZ  1 
ATOM 6956  N N   . ASN C 1 215 ? 29.526  59.731  198.459 1.00 24.56  ? 215 ASN 3 N   1 
ATOM 6957  C CA  . ASN C 1 215 ? 30.785  59.353  197.815 1.00 24.76  ? 215 ASN 3 CA  1 
ATOM 6958  C C   . ASN C 1 215 ? 30.596  58.721  196.453 1.00 29.15  ? 215 ASN 3 C   1 
ATOM 6959  O O   . ASN C 1 215 ? 30.843  57.534  196.225 1.00 38.80  ? 215 ASN 3 O   1 
ATOM 6960  C CB  . ASN C 1 215 ? 31.646  58.541  198.742 1.00 33.90  ? 215 ASN 3 CB  1 
ATOM 6961  C CG  . ASN C 1 215 ? 32.366  59.412  199.739 1.00 36.07  ? 215 ASN 3 CG  1 
ATOM 6962  O OD1 . ASN C 1 215 ? 33.295  60.159  199.380 1.00 42.43  ? 215 ASN 3 OD1 1 
ATOM 6963  N ND2 . ASN C 1 215 ? 31.933  59.351  200.998 1.00 32.89  ? 215 ASN 3 ND2 1 
ATOM 6964  N N   . GLU C 1 216 ? 30.234  59.554  195.498 1.00 35.06  ? 216 GLU 3 N   1 
ATOM 6965  C CA  . GLU C 1 216 ? 29.914  59.031  194.182 1.00 41.05  ? 216 GLU 3 CA  1 
ATOM 6966  C C   . GLU C 1 216 ? 31.103  58.543  193.362 1.00 36.42  ? 216 GLU 3 C   1 
ATOM 6967  O O   . GLU C 1 216 ? 30.937  57.691  192.493 1.00 44.05  ? 216 GLU 3 O   1 
ATOM 6968  C CB  . GLU C 1 216 ? 28.987  60.016  193.407 1.00 33.79  ? 216 GLU 3 CB  1 
ATOM 6969  C CG  . GLU C 1 216 ? 27.441  59.875  193.655 1.00 59.55  ? 216 GLU 3 CG  1 
ATOM 6970  C CD  . GLU C 1 216 ? 26.877  60.625  194.903 1.00 86.82  ? 216 GLU 3 CD  1 
ATOM 6971  O OE1 . GLU C 1 216 ? 27.194  61.832  195.070 1.00 99.86  ? 216 GLU 3 OE1 1 
ATOM 6972  O OE2 . GLU C 1 216 ? 26.076  60.016  195.674 1.00 90.26  ? 216 GLU 3 OE2 1 
ATOM 6973  N N   . ASN C 1 217 ? 32.308  59.019  193.675 1.00 32.71  ? 217 ASN 3 N   1 
ATOM 6974  C CA  . ASN C 1 217 ? 33.480  58.598  192.905 1.00 21.47  ? 217 ASN 3 CA  1 
ATOM 6975  C C   . ASN C 1 217 ? 34.480  57.809  193.715 1.00 26.69  ? 217 ASN 3 C   1 
ATOM 6976  O O   . ASN C 1 217 ? 35.650  57.675  193.340 1.00 35.52  ? 217 ASN 3 O   1 
ATOM 6977  C CB  . ASN C 1 217 ? 34.186  59.791  192.279 1.00 17.81  ? 217 ASN 3 CB  1 
ATOM 6978  C CG  . ASN C 1 217 ? 35.042  59.408  191.081 1.00 25.94  ? 217 ASN 3 CG  1 
ATOM 6979  O OD1 . ASN C 1 217 ? 34.734  58.474  190.312 1.00 36.86  ? 217 ASN 3 OD1 1 
ATOM 6980  N ND2 . ASN C 1 217 ? 36.117  60.146  190.899 1.00 34.57  ? 217 ASN 3 ND2 1 
ATOM 6981  N N   . THR C 1 218 ? 34.039  57.292  194.847 1.00 24.54  ? 218 THR 3 N   1 
ATOM 6982  C CA  . THR C 1 218 ? 34.941  56.520  195.649 1.00 20.82  ? 218 THR 3 CA  1 
ATOM 6983  C C   . THR C 1 218 ? 34.178  55.361  196.236 1.00 22.20  ? 218 THR 3 C   1 
ATOM 6984  O O   . THR C 1 218 ? 32.955  55.321  196.133 1.00 37.62  ? 218 THR 3 O   1 
ATOM 6985  C CB  . THR C 1 218 ? 35.699  57.396  196.671 1.00 22.40  ? 218 THR 3 CB  1 
ATOM 6986  O OG1 . THR C 1 218 ? 35.910  56.653  197.872 1.00 51.51  ? 218 THR 3 OG1 1 
ATOM 6987  C CG2 . THR C 1 218 ? 34.983  58.741  196.935 1.00 47.03  ? 218 THR 3 CG2 1 
ATOM 6988  N N   . ARG C 1 219 ? 34.903  54.325  196.642 1.00 21.86  ? 219 ARG 3 N   1 
ATOM 6989  C CA  . ARG C 1 219 ? 34.279  53.150  197.207 1.00 17.26  ? 219 ARG 3 CA  1 
ATOM 6990  C C   . ARG C 1 219 ? 34.977  52.896  198.507 1.00 25.28  ? 219 ARG 3 C   1 
ATOM 6991  O O   . ARG C 1 219 ? 36.230  53.020  198.608 1.00 21.67  ? 219 ARG 3 O   1 
ATOM 6992  C CB  . ARG C 1 219 ? 34.489  51.950  196.317 1.00 2.86   ? 219 ARG 3 CB  1 
ATOM 6993  C CG  . ARG C 1 219 ? 34.419  52.248  194.839 1.00 27.35  ? 219 ARG 3 CG  1 
ATOM 6994  C CD  . ARG C 1 219 ? 33.061  52.021  194.234 1.00 22.57  ? 219 ARG 3 CD  1 
ATOM 6995  N NE  . ARG C 1 219 ? 33.118  52.158  192.779 1.00 36.63  ? 219 ARG 3 NE  1 
ATOM 6996  C CZ  . ARG C 1 219 ? 32.627  53.204  192.117 1.00 43.96  ? 219 ARG 3 CZ  1 
ATOM 6997  N NH1 . ARG C 1 219 ? 32.036  54.185  192.814 1.00 47.99  ? 219 ARG 3 NH1 1 
ATOM 6998  N NH2 . ARG C 1 219 ? 32.723  53.272  190.781 1.00 30.25  ? 219 ARG 3 NH2 1 
ATOM 6999  N N   . TYR C 1 220 ? 34.172  52.557  199.501 1.00 2.00   ? 220 TYR 3 N   1 
ATOM 7000  C CA  . TYR C 1 220 ? 34.725  52.296  200.782 1.00 4.66   ? 220 TYR 3 CA  1 
ATOM 7001  C C   . TYR C 1 220 ? 34.019  51.166  201.384 1.00 20.50  ? 220 TYR 3 C   1 
ATOM 7002  O O   . TYR C 1 220 ? 32.883  50.788  201.021 1.00 16.45  ? 220 TYR 3 O   1 
ATOM 7003  C CB  . TYR C 1 220 ? 34.518  53.442  201.713 1.00 12.67  ? 220 TYR 3 CB  1 
ATOM 7004  C CG  . TYR C 1 220 ? 33.055  53.726  201.978 1.00 25.81  ? 220 TYR 3 CG  1 
ATOM 7005  C CD1 . TYR C 1 220 ? 32.346  53.054  202.967 1.00 33.98  ? 220 TYR 3 CD1 1 
ATOM 7006  C CD2 . TYR C 1 220 ? 32.397  54.703  201.263 1.00 4.91   ? 220 TYR 3 CD2 1 
ATOM 7007  C CE1 . TYR C 1 220 ? 31.012  53.354  203.208 1.00 27.18  ? 220 TYR 3 CE1 1 
ATOM 7008  C CE2 . TYR C 1 220 ? 31.090  55.008  201.507 1.00 11.52  ? 220 TYR 3 CE2 1 
ATOM 7009  C CZ  . TYR C 1 220 ? 30.395  54.348  202.476 1.00 17.98  ? 220 TYR 3 CZ  1 
ATOM 7010  O OH  . TYR C 1 220 ? 29.074  54.710  202.672 1.00 25.08  ? 220 TYR 3 OH  1 
ATOM 7011  N N   . PHE C 1 221 ? 34.656  50.744  202.449 1.00 17.67  ? 221 PHE 3 N   1 
ATOM 7012  C CA  . PHE C 1 221 ? 34.196  49.623  203.166 1.00 8.65   ? 221 PHE 3 CA  1 
ATOM 7013  C C   . PHE C 1 221 ? 34.906  49.666  204.451 1.00 22.04  ? 221 PHE 3 C   1 
ATOM 7014  O O   . PHE C 1 221 ? 36.101  50.000  204.514 1.00 19.34  ? 221 PHE 3 O   1 
ATOM 7015  C CB  . PHE C 1 221 ? 34.721  48.374  202.524 1.00 15.24  ? 221 PHE 3 CB  1 
ATOM 7016  C CG  . PHE C 1 221 ? 34.936  48.484  201.082 1.00 19.40  ? 221 PHE 3 CG  1 
ATOM 7017  C CD1 . PHE C 1 221 ? 35.975  49.247  200.588 1.00 26.75  ? 221 PHE 3 CD1 1 
ATOM 7018  C CD2 . PHE C 1 221 ? 34.095  47.809  200.200 1.00 12.10  ? 221 PHE 3 CD2 1 
ATOM 7019  C CE1 . PHE C 1 221 ? 36.164  49.331  199.218 1.00 49.44  ? 221 PHE 3 CE1 1 
ATOM 7020  C CE2 . PHE C 1 221 ? 34.282  47.881  198.831 1.00 10.95  ? 221 PHE 3 CE2 1 
ATOM 7021  C CZ  . PHE C 1 221 ? 35.315  48.641  198.332 1.00 17.61  ? 221 PHE 3 CZ  1 
ATOM 7022  N N   . GLY C 1 222 ? 34.225  49.125  205.438 1.00 24.21  ? 222 GLY 3 N   1 
ATOM 7023  C CA  . GLY C 1 222 ? 34.798  49.055  206.747 1.00 26.63  ? 222 GLY 3 CA  1 
ATOM 7024  C C   . GLY C 1 222 ? 33.772  48.455  207.666 1.00 29.99  ? 222 GLY 3 C   1 
ATOM 7025  O O   . GLY C 1 222 ? 32.582  48.316  207.310 1.00 24.40  ? 222 GLY 3 O   1 
ATOM 7026  N N   . THR C 1 223 ? 34.268  48.008  208.812 1.00 15.98  ? 223 THR 3 N   1 
ATOM 7027  C CA  . THR C 1 223 ? 33.418  47.456  209.818 1.00 20.50  ? 223 THR 3 CA  1 
ATOM 7028  C C   . THR C 1 223 ? 33.928  47.760  211.200 1.00 30.64  ? 223 THR 3 C   1 
ATOM 7029  O O   . THR C 1 223 ? 35.140  47.796  211.479 1.00 36.57  ? 223 THR 3 O   1 
ATOM 7030  C CB  . THR C 1 223 ? 33.247  45.971  209.713 1.00 13.16  ? 223 THR 3 CB  1 
ATOM 7031  O OG1 . THR C 1 223 ? 33.766  45.359  210.899 1.00 38.96  ? 223 THR 3 OG1 1 
ATOM 7032  C CG2 . THR C 1 223 ? 33.919  45.454  208.503 1.00 2.00   ? 223 THR 3 CG2 1 
ATOM 7033  N N   . TYR C 1 224 ? 32.958  47.950  212.063 1.00 26.41  ? 224 TYR 3 N   1 
ATOM 7034  C CA  . TYR C 1 224 ? 33.233  48.240  213.407 1.00 28.39  ? 224 TYR 3 CA  1 
ATOM 7035  C C   . TYR C 1 224 ? 32.703  47.043  214.137 1.00 29.62  ? 224 TYR 3 C   1 
ATOM 7036  O O   . TYR C 1 224 ? 31.649  46.471  213.813 1.00 15.02  ? 224 TYR 3 O   1 
ATOM 7037  C CB  . TYR C 1 224 ? 32.495  49.492  213.825 1.00 20.18  ? 224 TYR 3 CB  1 
ATOM 7038  C CG  . TYR C 1 224 ? 32.449  49.654  215.313 1.00 30.66  ? 224 TYR 3 CG  1 
ATOM 7039  C CD1 . TYR C 1 224 ? 31.439  49.074  216.071 1.00 29.26  ? 224 TYR 3 CD1 1 
ATOM 7040  C CD2 . TYR C 1 224 ? 33.413  50.383  215.966 1.00 40.85  ? 224 TYR 3 CD2 1 
ATOM 7041  C CE1 . TYR C 1 224 ? 31.399  49.238  217.445 1.00 45.18  ? 224 TYR 3 CE1 1 
ATOM 7042  C CE2 . TYR C 1 224 ? 33.378  50.550  217.338 1.00 51.35  ? 224 TYR 3 CE2 1 
ATOM 7043  C CZ  . TYR C 1 224 ? 32.382  49.975  218.073 1.00 48.57  ? 224 TYR 3 CZ  1 
ATOM 7044  O OH  . TYR C 1 224 ? 32.393  50.131  219.438 1.00 63.68  ? 224 TYR 3 OH  1 
ATOM 7045  N N   . THR C 1 225 ? 33.403  46.748  215.200 1.00 26.23  ? 225 THR 3 N   1 
ATOM 7046  C CA  . THR C 1 225 ? 33.057  45.651  216.018 1.00 23.31  ? 225 THR 3 CA  1 
ATOM 7047  C C   . THR C 1 225 ? 33.367  46.172  217.368 1.00 33.77  ? 225 THR 3 C   1 
ATOM 7048  O O   . THR C 1 225 ? 34.526  46.389  217.710 1.00 28.29  ? 225 THR 3 O   1 
ATOM 7049  C CB  . THR C 1 225 ? 33.995  44.555  215.765 1.00 27.35  ? 225 THR 3 CB  1 
ATOM 7050  O OG1 . THR C 1 225 ? 34.184  44.414  214.349 1.00 34.15  ? 225 THR 3 OG1 1 
ATOM 7051  C CG2 . THR C 1 225 ? 33.461  43.331  216.357 1.00 9.13   ? 225 THR 3 CG2 1 
ATOM 7052  N N   . GLY C 1 226 ? 32.321  46.536  218.077 1.00 49.36  ? 226 GLY 3 N   1 
ATOM 7053  C CA  . GLY C 1 226 ? 32.505  47.038  219.419 1.00 49.83  ? 226 GLY 3 CA  1 
ATOM 7054  C C   . GLY C 1 226 ? 32.575  45.827  220.306 1.00 47.77  ? 226 GLY 3 C   1 
ATOM 7055  O O   . GLY C 1 226 ? 32.141  44.746  219.908 1.00 44.65  ? 226 GLY 3 O   1 
ATOM 7056  N N   . GLY C 1 227 ? 33.104  46.013  221.504 1.00 43.96  ? 227 GLY 3 N   1 
ATOM 7057  C CA  . GLY C 1 227 ? 33.236  44.914  222.435 1.00 53.13  ? 227 GLY 3 CA  1 
ATOM 7058  C C   . GLY C 1 227 ? 34.373  45.256  223.364 1.00 66.53  ? 227 GLY 3 C   1 
ATOM 7059  O O   . GLY C 1 227 ? 35.412  45.795  222.964 1.00 59.88  ? 227 GLY 3 O   1 
ATOM 7060  N N   . GLU C 1 228 ? 34.160  44.961  224.633 1.00 75.03  ? 228 GLU 3 N   1 
ATOM 7061  C CA  . GLU C 1 228 ? 35.145  45.258  225.660 1.00 77.64  ? 228 GLU 3 CA  1 
ATOM 7062  C C   . GLU C 1 228 ? 36.354  44.398  225.390 1.00 63.44  ? 228 GLU 3 C   1 
ATOM 7063  O O   . GLU C 1 228 ? 37.490  44.766  225.678 1.00 67.34  ? 228 GLU 3 O   1 
ATOM 7064  C CB  . GLU C 1 228 ? 34.547  44.912  227.007 1.00 84.93  ? 228 GLU 3 CB  1 
ATOM 7065  C CG  . GLU C 1 228 ? 35.245  45.498  228.173 1.00 97.55  ? 228 GLU 3 CG  1 
ATOM 7066  C CD  . GLU C 1 228 ? 34.744  44.895  229.462 1.00 124.24 ? 228 GLU 3 CD  1 
ATOM 7067  O OE1 . GLU C 1 228 ? 33.705  44.184  229.433 1.00 127.14 ? 228 GLU 3 OE1 1 
ATOM 7068  O OE2 . GLU C 1 228 ? 35.389  45.127  230.506 1.00 148.73 ? 228 GLU 3 OE2 1 
ATOM 7069  N N   . ASN C 1 229 ? 36.085  43.228  224.842 1.00 53.86  ? 229 ASN 3 N   1 
ATOM 7070  C CA  . ASN C 1 229 ? 37.146  42.316  224.506 1.00 64.67  ? 229 ASN 3 CA  1 
ATOM 7071  C C   . ASN C 1 229 ? 36.715  41.319  223.446 1.00 62.26  ? 229 ASN 3 C   1 
ATOM 7072  O O   . ASN C 1 229 ? 36.404  40.147  223.686 1.00 56.47  ? 229 ASN 3 O   1 
ATOM 7073  C CB  . ASN C 1 229 ? 37.733  41.651  225.743 1.00 76.09  ? 229 ASN 3 CB  1 
ATOM 7074  C CG  . ASN C 1 229 ? 36.688  41.100  226.660 1.00 85.21  ? 229 ASN 3 CG  1 
ATOM 7075  O OD1 . ASN C 1 229 ? 36.969  40.860  227.828 1.00 96.45  ? 229 ASN 3 OD1 1 
ATOM 7076  N ND2 . ASN C 1 229 ? 35.477  40.871  226.144 1.00 105.70 ? 229 ASN 3 ND2 1 
ATOM 7077  N N   . VAL C 1 230 ? 36.552  41.886  222.271 1.00 56.39  ? 230 VAL 3 N   1 
ATOM 7078  C CA  . VAL C 1 230 ? 36.206  41.119  221.121 1.00 40.85  ? 230 VAL 3 CA  1 
ATOM 7079  C C   . VAL C 1 230 ? 37.567  40.813  220.585 1.00 36.89  ? 230 VAL 3 C   1 
ATOM 7080  O O   . VAL C 1 230 ? 38.479  41.629  220.670 1.00 50.90  ? 230 VAL 3 O   1 
ATOM 7081  C CB  . VAL C 1 230 ? 35.425  41.945  220.119 1.00 43.65  ? 230 VAL 3 CB  1 
ATOM 7082  C CG1 . VAL C 1 230 ? 34.068  42.180  220.649 1.00 59.70  ? 230 VAL 3 CG1 1 
ATOM 7083  C CG2 . VAL C 1 230 ? 36.086  43.279  219.878 1.00 44.88  ? 230 VAL 3 CG2 1 
ATOM 7084  N N   . PRO C 1 231 ? 37.760  39.599  220.125 1.00 30.60  ? 231 PRO 3 N   1 
ATOM 7085  C CA  . PRO C 1 231 ? 39.024  39.142  219.573 1.00 32.72  ? 231 PRO 3 CA  1 
ATOM 7086  C C   . PRO C 1 231 ? 39.256  39.542  218.135 1.00 30.33  ? 231 PRO 3 C   1 
ATOM 7087  O O   . PRO C 1 231 ? 38.469  39.251  217.234 1.00 30.97  ? 231 PRO 3 O   1 
ATOM 7088  C CB  . PRO C 1 231 ? 38.881  37.648  219.668 1.00 38.46  ? 231 PRO 3 CB  1 
ATOM 7089  C CG  . PRO C 1 231 ? 37.448  37.460  219.336 1.00 29.34  ? 231 PRO 3 CG  1 
ATOM 7090  C CD  . PRO C 1 231 ? 36.815  38.485  220.233 1.00 34.01  ? 231 PRO 3 CD  1 
ATOM 7091  N N   . PRO C 1 232 ? 40.349  40.230  217.895 1.00 30.49  ? 232 PRO 3 N   1 
ATOM 7092  C CA  . PRO C 1 232 ? 40.597  40.610  216.514 1.00 38.30  ? 232 PRO 3 CA  1 
ATOM 7093  C C   . PRO C 1 232 ? 40.771  39.364  215.672 1.00 34.37  ? 232 PRO 3 C   1 
ATOM 7094  O O   . PRO C 1 232 ? 41.247  38.322  216.130 1.00 39.72  ? 232 PRO 3 O   1 
ATOM 7095  C CB  . PRO C 1 232 ? 41.911  41.371  216.611 1.00 34.51  ? 232 PRO 3 CB  1 
ATOM 7096  C CG  . PRO C 1 232 ? 42.576  40.718  217.811 1.00 43.72  ? 232 PRO 3 CG  1 
ATOM 7097  C CD  . PRO C 1 232 ? 41.429  40.675  218.777 1.00 33.97  ? 232 PRO 3 CD  1 
ATOM 7098  N N   . VAL C 1 233 ? 40.369  39.485  214.429 1.00 31.65  ? 233 VAL 3 N   1 
ATOM 7099  C CA  . VAL C 1 233 ? 40.516  38.401  213.509 1.00 23.40  ? 233 VAL 3 CA  1 
ATOM 7100  C C   . VAL C 1 233 ? 40.943  39.056  212.234 1.00 17.50  ? 233 VAL 3 C   1 
ATOM 7101  O O   . VAL C 1 233 ? 40.315  40.004  211.789 1.00 33.05  ? 233 VAL 3 O   1 
ATOM 7102  C CB  . VAL C 1 233 ? 39.215  37.745  213.280 1.00 7.38   ? 233 VAL 3 CB  1 
ATOM 7103  C CG1 . VAL C 1 233 ? 39.237  37.083  211.988 1.00 16.36  ? 233 VAL 3 CG1 1 
ATOM 7104  C CG2 . VAL C 1 233 ? 38.981  36.757  214.332 1.00 32.27  ? 233 VAL 3 CG2 1 
ATOM 7105  N N   . LEU C 1 234 ? 41.958  38.520  211.601 1.00 8.84   ? 234 LEU 3 N   1 
ATOM 7106  C CA  . LEU C 1 234 ? 42.441  39.128  210.386 1.00 15.52  ? 234 LEU 3 CA  1 
ATOM 7107  C C   . LEU C 1 234 ? 42.997  38.073  209.472 1.00 27.33  ? 234 LEU 3 C   1 
ATOM 7108  O O   . LEU C 1 234 ? 43.645  37.131  209.955 1.00 14.64  ? 234 LEU 3 O   1 
ATOM 7109  C CB  . LEU C 1 234 ? 43.583  40.039  210.737 1.00 22.01  ? 234 LEU 3 CB  1 
ATOM 7110  C CG  . LEU C 1 234 ? 43.252  41.204  211.633 1.00 6.04   ? 234 LEU 3 CG  1 
ATOM 7111  C CD1 . LEU C 1 234 ? 44.517  41.696  212.270 1.00 45.00  ? 234 LEU 3 CD1 1 
ATOM 7112  C CD2 . LEU C 1 234 ? 42.657  42.259  210.808 1.00 31.16  ? 234 LEU 3 CD2 1 
ATOM 7113  N N   . HIS C 1 235 ? 42.797  38.262  208.162 1.00 27.37  ? 235 HIS 3 N   1 
ATOM 7114  C CA  . HIS C 1 235 ? 43.292  37.320  207.166 1.00 26.12  ? 235 HIS 3 CA  1 
ATOM 7115  C C   . HIS C 1 235 ? 44.266  38.002  206.270 1.00 23.76  ? 235 HIS 3 C   1 
ATOM 7116  O O   . HIS C 1 235 ? 44.046  39.124  205.820 1.00 36.50  ? 235 HIS 3 O   1 
ATOM 7117  C CB  . HIS C 1 235 ? 42.189  36.731  206.319 1.00 39.54  ? 235 HIS 3 CB  1 
ATOM 7118  C CG  . HIS C 1 235 ? 40.977  36.341  207.097 1.00 80.66  ? 235 HIS 3 CG  1 
ATOM 7119  N ND1 . HIS C 1 235 ? 39.951  37.222  207.367 1.00 114.24 ? 235 HIS 3 ND1 1 
ATOM 7120  C CD2 . HIS C 1 235 ? 40.598  35.150  207.623 1.00 95.60  ? 235 HIS 3 CD2 1 
ATOM 7121  C CE1 . HIS C 1 235 ? 38.986  36.590  208.018 1.00 115.70 ? 235 HIS 3 CE1 1 
ATOM 7122  N NE2 . HIS C 1 235 ? 39.355  35.336  208.185 1.00 103.26 ? 235 HIS 3 NE2 1 
ATOM 7123  N N   . ILE C 1 236 ? 45.303  37.262  205.945 1.00 18.72  ? 236 ILE 3 N   1 
ATOM 7124  C CA  . ILE C 1 236 ? 46.365  37.771  205.144 1.00 17.87  ? 236 ILE 3 CA  1 
ATOM 7125  C C   . ILE C 1 236 ? 46.383  36.771  203.987 1.00 18.81  ? 236 ILE 3 C   1 
ATOM 7126  O O   . ILE C 1 236 ? 46.268  35.567  204.235 1.00 23.69  ? 236 ILE 3 O   1 
ATOM 7127  C CB  . ILE C 1 236 ? 47.651  37.804  206.060 1.00 20.29  ? 236 ILE 3 CB  1 
ATOM 7128  C CG1 . ILE C 1 236 ? 48.742  38.650  205.415 1.00 60.98  ? 236 ILE 3 CG1 1 
ATOM 7129  C CG2 . ILE C 1 236 ? 48.190  36.367  206.392 1.00 2.00   ? 236 ILE 3 CG2 1 
ATOM 7130  C CD1 . ILE C 1 236 ? 49.521  39.619  206.372 1.00 84.41  ? 236 ILE 3 CD1 1 
ATOM 7131  N N   . THR C 1 237 ? 46.281  37.274  202.752 1.00 8.19   ? 237 THR 3 N   1 
ATOM 7132  C CA  . THR C 1 237 ? 46.308  36.476  201.511 1.00 5.89   ? 237 THR 3 CA  1 
ATOM 7133  C C   . THR C 1 237 ? 46.459  37.313  200.304 1.00 24.86  ? 237 THR 3 C   1 
ATOM 7134  O O   . THR C 1 237 ? 45.677  38.247  200.044 1.00 45.06  ? 237 THR 3 O   1 
ATOM 7135  C CB  . THR C 1 237 ? 45.028  35.877  201.128 1.00 2.00   ? 237 THR 3 CB  1 
ATOM 7136  O OG1 . THR C 1 237 ? 44.440  35.284  202.275 1.00 62.89  ? 237 THR 3 OG1 1 
ATOM 7137  C CG2 . THR C 1 237 ? 45.284  34.847  200.088 1.00 2.00   ? 237 THR 3 CG2 1 
ATOM 7138  N N   . ASN C 1 238 ? 47.227  36.767  199.400 1.00 15.59  ? 238 ASN 3 N   1 
ATOM 7139  C CA  . ASN C 1 238 ? 47.432  37.500  198.199 1.00 21.54  ? 238 ASN 3 CA  1 
ATOM 7140  C C   . ASN C 1 238 ? 46.531  36.952  197.117 1.00 10.18  ? 238 ASN 3 C   1 
ATOM 7141  O O   . ASN C 1 238 ? 46.687  37.278  195.956 1.00 19.21  ? 238 ASN 3 O   1 
ATOM 7142  C CB  . ASN C 1 238 ? 48.893  37.414  197.797 1.00 35.87  ? 238 ASN 3 CB  1 
ATOM 7143  C CG  . ASN C 1 238 ? 49.336  36.003  197.575 1.00 32.08  ? 238 ASN 3 CG  1 
ATOM 7144  O OD1 . ASN C 1 238 ? 48.699  35.050  198.048 1.00 37.15  ? 238 ASN 3 OD1 1 
ATOM 7145  N ND2 . ASN C 1 238 ? 50.435  35.848  196.872 1.00 36.75  ? 238 ASN 3 ND2 1 
ATOM 7146  N N   . THR C 1 239 ? 45.542  36.162  197.472 1.00 16.49  ? 239 THR 3 N   1 
ATOM 7147  C CA  . THR C 1 239 ? 44.676  35.617  196.431 1.00 23.59  ? 239 THR 3 CA  1 
ATOM 7148  C C   . THR C 1 239 ? 43.347  36.333  196.281 1.00 31.20  ? 239 THR 3 C   1 
ATOM 7149  O O   . THR C 1 239 ? 42.553  36.007  195.400 1.00 46.60  ? 239 THR 3 O   1 
ATOM 7150  C CB  . THR C 1 239 ? 44.373  34.171  196.682 1.00 22.34  ? 239 THR 3 CB  1 
ATOM 7151  O OG1 . THR C 1 239 ? 43.922  34.018  198.022 1.00 39.82  ? 239 THR 3 OG1 1 
ATOM 7152  C CG2 . THR C 1 239 ? 45.588  33.339  196.468 1.00 42.14  ? 239 THR 3 CG2 1 
ATOM 7153  N N   . ALA C 1 240 ? 43.154  37.402  197.039 1.00 44.49  ? 240 ALA 3 N   1 
ATOM 7154  C CA  . ALA C 1 240 ? 41.876  38.085  196.989 1.00 24.83  ? 240 ALA 3 CA  1 
ATOM 7155  C C   . ALA C 1 240 ? 41.851  39.454  196.428 1.00 28.93  ? 240 ALA 3 C   1 
ATOM 7156  O O   . ALA C 1 240 ? 42.526  40.355  196.948 1.00 32.13  ? 240 ALA 3 O   1 
ATOM 7157  C CB  . ALA C 1 240 ? 41.308  38.132  198.333 1.00 56.32  ? 240 ALA 3 CB  1 
ATOM 7158  N N   . THR C 1 241 ? 40.891  39.640  195.527 1.00 28.17  ? 241 THR 3 N   1 
ATOM 7159  C CA  . THR C 1 241 ? 40.693  40.915  194.864 1.00 29.80  ? 241 THR 3 CA  1 
ATOM 7160  C C   . THR C 1 241 ? 39.303  41.492  195.040 1.00 21.65  ? 241 THR 3 C   1 
ATOM 7161  O O   . THR C 1 241 ? 38.337  40.764  195.193 1.00 51.34  ? 241 THR 3 O   1 
ATOM 7162  C CB  . THR C 1 241 ? 40.930  40.764  193.425 1.00 23.36  ? 241 THR 3 CB  1 
ATOM 7163  O OG1 . THR C 1 241 ? 42.082  39.930  193.242 1.00 42.77  ? 241 THR 3 OG1 1 
ATOM 7164  C CG2 . THR C 1 241 ? 41.155  42.103  192.814 1.00 49.24  ? 241 THR 3 CG2 1 
ATOM 7165  N N   . THR C 1 242 ? 39.215  42.806  194.919 1.00 26.28  ? 242 THR 3 N   1 
ATOM 7166  C CA  . THR C 1 242 ? 37.978  43.551  195.090 1.00 18.37  ? 242 THR 3 CA  1 
ATOM 7167  C C   . THR C 1 242 ? 37.700  44.476  193.918 1.00 25.61  ? 242 THR 3 C   1 
ATOM 7168  O O   . THR C 1 242 ? 38.566  45.293  193.493 1.00 34.04  ? 242 THR 3 O   1 
ATOM 7169  C CB  . THR C 1 242 ? 38.105  44.445  196.284 1.00 2.00   ? 242 THR 3 CB  1 
ATOM 7170  O OG1 . THR C 1 242 ? 38.339  43.656  197.452 1.00 25.67  ? 242 THR 3 OG1 1 
ATOM 7171  C CG2 . THR C 1 242 ? 36.886  45.263  196.438 1.00 14.55  ? 242 THR 3 CG2 1 
ATOM 7172  N N   . VAL C 1 243 ? 36.460  44.441  193.461 1.00 5.62   ? 243 VAL 3 N   1 
ATOM 7173  C CA  . VAL C 1 243 ? 36.147  45.289  192.348 1.00 14.37  ? 243 VAL 3 CA  1 
ATOM 7174  C C   . VAL C 1 243 ? 35.623  46.627  192.741 1.00 17.21  ? 243 VAL 3 C   1 
ATOM 7175  O O   . VAL C 1 243 ? 34.829  46.737  193.658 1.00 30.79  ? 243 VAL 3 O   1 
ATOM 7176  C CB  . VAL C 1 243 ? 35.184  44.662  191.474 1.00 15.79  ? 243 VAL 3 CB  1 
ATOM 7177  C CG1 . VAL C 1 243 ? 34.940  45.564  190.268 1.00 20.44  ? 243 VAL 3 CG1 1 
ATOM 7178  C CG2 . VAL C 1 243 ? 35.718  43.347  191.080 1.00 2.00   ? 243 VAL 3 CG2 1 
ATOM 7179  N N   . LEU C 1 244 ? 35.951  47.614  191.932 1.00 2.68   ? 244 LEU 3 N   1 
ATOM 7180  C CA  . LEU C 1 244 ? 35.556  48.945  192.230 1.00 5.71   ? 244 LEU 3 CA  1 
ATOM 7181  C C   . LEU C 1 244 ? 34.629  49.369  191.164 1.00 19.49  ? 244 LEU 3 C   1 
ATOM 7182  O O   . LEU C 1 244 ? 34.339  50.565  191.023 1.00 29.27  ? 244 LEU 3 O   1 
ATOM 7183  C CB  . LEU C 1 244 ? 36.788  49.826  192.195 1.00 16.97  ? 244 LEU 3 CB  1 
ATOM 7184  C CG  . LEU C 1 244 ? 37.829  49.204  193.097 1.00 11.88  ? 244 LEU 3 CG  1 
ATOM 7185  C CD1 . LEU C 1 244 ? 39.172  49.728  192.813 1.00 18.72  ? 244 LEU 3 CD1 1 
ATOM 7186  C CD2 . LEU C 1 244 ? 37.432  49.513  194.465 1.00 2.00   ? 244 LEU 3 CD2 1 
ATOM 7187  N N   . LEU C 1 245 ? 34.194  48.431  190.343 1.00 14.56  ? 245 LEU 3 N   1 
ATOM 7188  C CA  . LEU C 1 245 ? 33.294  48.866  189.297 1.00 19.52  ? 245 LEU 3 CA  1 
ATOM 7189  C C   . LEU C 1 245 ? 31.978  49.161  189.892 1.00 24.27  ? 245 LEU 3 C   1 
ATOM 7190  O O   . LEU C 1 245 ? 31.695  48.738  191.015 1.00 27.53  ? 245 LEU 3 O   1 
ATOM 7191  C CB  . LEU C 1 245 ? 33.149  47.870  188.195 1.00 4.35   ? 245 LEU 3 CB  1 
ATOM 7192  C CG  . LEU C 1 245 ? 34.479  47.697  187.493 1.00 8.04   ? 245 LEU 3 CG  1 
ATOM 7193  C CD1 . LEU C 1 245 ? 34.168  47.434  186.079 1.00 18.56  ? 245 LEU 3 CD1 1 
ATOM 7194  C CD2 . LEU C 1 245 ? 35.333  48.951  187.588 1.00 39.56  ? 245 LEU 3 CD2 1 
ATOM 7195  N N   . ASP C 1 246 ? 31.264  50.047  189.214 1.00 35.47  ? 246 ASP 3 N   1 
ATOM 7196  C CA  . ASP C 1 246 ? 29.947  50.478  189.650 1.00 26.93  ? 246 ASP 3 CA  1 
ATOM 7197  C C   . ASP C 1 246 ? 28.968  49.789  188.775 1.00 12.92  ? 246 ASP 3 C   1 
ATOM 7198  O O   . ASP C 1 246 ? 29.350  49.066  187.878 1.00 24.64  ? 246 ASP 3 O   1 
ATOM 7199  C CB  . ASP C 1 246 ? 29.765  52.015  189.555 1.00 23.78  ? 246 ASP 3 CB  1 
ATOM 7200  C CG  . ASP C 1 246 ? 29.669  52.538  188.132 1.00 28.26  ? 246 ASP 3 CG  1 
ATOM 7201  O OD1 . ASP C 1 246 ? 29.969  51.811  187.152 1.00 25.10  ? 246 ASP 3 OD1 1 
ATOM 7202  O OD2 . ASP C 1 246 ? 29.306  53.727  188.000 1.00 56.57  ? 246 ASP 3 OD2 1 
ATOM 7203  N N   . GLU C 1 247 ? 27.702  50.079  188.995 1.00 23.67  ? 247 GLU 3 N   1 
ATOM 7204  C CA  . GLU C 1 247 ? 26.609  49.493  188.236 1.00 15.78  ? 247 GLU 3 CA  1 
ATOM 7205  C C   . GLU C 1 247 ? 26.787  49.679  186.726 1.00 15.41  ? 247 GLU 3 C   1 
ATOM 7206  O O   . GLU C 1 247 ? 26.324  48.862  185.971 1.00 36.57  ? 247 GLU 3 O   1 
ATOM 7207  C CB  . GLU C 1 247 ? 25.271  50.108  188.694 1.00 24.49  ? 247 GLU 3 CB  1 
ATOM 7208  C CG  . GLU C 1 247 ? 24.962  50.011  190.226 1.00 72.62  ? 247 GLU 3 CG  1 
ATOM 7209  C CD  . GLU C 1 247 ? 25.384  51.226  191.069 1.00 84.19  ? 247 GLU 3 CD  1 
ATOM 7210  O OE1 . GLU C 1 247 ? 25.294  52.378  190.567 1.00 99.24  ? 247 GLU 3 OE1 1 
ATOM 7211  O OE2 . GLU C 1 247 ? 25.777  51.016  192.251 1.00 92.25  ? 247 GLU 3 OE2 1 
ATOM 7212  N N   . GLN C 1 248 ? 27.471  50.727  186.277 1.00 20.23  ? 248 GLN 3 N   1 
ATOM 7213  C CA  . GLN C 1 248 ? 27.631  50.962  184.845 1.00 20.53  ? 248 GLN 3 CA  1 
ATOM 7214  C C   . GLN C 1 248 ? 28.936  50.355  184.369 1.00 29.49  ? 248 GLN 3 C   1 
ATOM 7215  O O   . GLN C 1 248 ? 29.342  50.505  183.214 1.00 40.08  ? 248 GLN 3 O   1 
ATOM 7216  C CB  . GLN C 1 248 ? 27.643  52.458  184.570 1.00 50.87  ? 248 GLN 3 CB  1 
ATOM 7217  C CG  . GLN C 1 248 ? 26.756  53.293  185.484 1.00 56.11  ? 248 GLN 3 CG  1 
ATOM 7218  C CD  . GLN C 1 248 ? 25.307  52.880  185.407 1.00 58.02  ? 248 GLN 3 CD  1 
ATOM 7219  O OE1 . GLN C 1 248 ? 24.841  52.383  184.363 1.00 34.22  ? 248 GLN 3 OE1 1 
ATOM 7220  N NE2 . GLN C 1 248 ? 24.571  53.082  186.515 1.00 67.96  ? 248 GLN 3 NE2 1 
ATOM 7221  N N   . GLY C 1 249 ? 29.655  49.768  185.305 1.00 26.66  ? 249 GLY 3 N   1 
ATOM 7222  C CA  . GLY C 1 249 ? 30.890  49.126  184.960 1.00 20.15  ? 249 GLY 3 CA  1 
ATOM 7223  C C   . GLY C 1 249 ? 32.023  50.087  184.876 1.00 24.64  ? 249 GLY 3 C   1 
ATOM 7224  O O   . GLY C 1 249 ? 32.870  49.992  183.974 1.00 36.54  ? 249 GLY 3 O   1 
ATOM 7225  N N   . VAL C 1 250 ? 32.054  51.025  185.806 1.00 12.88  ? 250 VAL 3 N   1 
ATOM 7226  C CA  . VAL C 1 250 ? 33.145  51.976  185.806 1.00 20.08  ? 250 VAL 3 CA  1 
ATOM 7227  C C   . VAL C 1 250 ? 33.609  52.073  187.224 1.00 18.41  ? 250 VAL 3 C   1 
ATOM 7228  O O   . VAL C 1 250 ? 32.860  51.824  188.147 1.00 14.94  ? 250 VAL 3 O   1 
ATOM 7229  C CB  . VAL C 1 250 ? 32.746  53.332  185.278 1.00 13.24  ? 250 VAL 3 CB  1 
ATOM 7230  C CG1 . VAL C 1 250 ? 31.537  53.202  184.311 1.00 5.59   ? 250 VAL 3 CG1 1 
ATOM 7231  C CG2 . VAL C 1 250 ? 32.454  54.263  186.434 1.00 48.61  ? 250 VAL 3 CG2 1 
ATOM 7232  N N   . GLY C 1 251 ? 34.875  52.350  187.413 1.00 23.48  ? 251 GLY 3 N   1 
ATOM 7233  C CA  . GLY C 1 251 ? 35.354  52.432  188.767 1.00 13.74  ? 251 GLY 3 CA  1 
ATOM 7234  C C   . GLY C 1 251 ? 35.622  53.881  189.003 1.00 13.49  ? 251 GLY 3 C   1 
ATOM 7235  O O   . GLY C 1 251 ? 35.191  54.755  188.234 1.00 22.91  ? 251 GLY 3 O   1 
ATOM 7236  N N   . PRO C 1 252 ? 36.286  54.178  190.105 1.00 3.68   ? 252 PRO 3 N   1 
ATOM 7237  C CA  . PRO C 1 252 ? 36.601  55.568  190.417 1.00 16.12  ? 252 PRO 3 CA  1 
ATOM 7238  C C   . PRO C 1 252 ? 37.340  56.147  189.250 1.00 19.05  ? 252 PRO 3 C   1 
ATOM 7239  O O   . PRO C 1 252 ? 38.002  55.405  188.514 1.00 15.55  ? 252 PRO 3 O   1 
ATOM 7240  C CB  . PRO C 1 252 ? 37.500  55.436  191.626 1.00 9.42   ? 252 PRO 3 CB  1 
ATOM 7241  C CG  . PRO C 1 252 ? 36.832  54.318  192.344 1.00 20.94  ? 252 PRO 3 CG  1 
ATOM 7242  C CD  . PRO C 1 252 ? 36.601  53.300  191.233 1.00 7.05   ? 252 PRO 3 CD  1 
ATOM 7243  N N   . LEU C 1 253 ? 37.133  57.441  189.028 1.00 23.62  ? 253 LEU 3 N   1 
ATOM 7244  C CA  . LEU C 1 253 ? 37.787  58.164  187.945 1.00 26.36  ? 253 LEU 3 CA  1 
ATOM 7245  C C   . LEU C 1 253 ? 38.673  59.220  188.488 1.00 29.80  ? 253 LEU 3 C   1 
ATOM 7246  O O   . LEU C 1 253 ? 38.258  60.042  189.279 1.00 32.00  ? 253 LEU 3 O   1 
ATOM 7247  C CB  . LEU C 1 253 ? 36.769  58.803  187.041 1.00 12.48  ? 253 LEU 3 CB  1 
ATOM 7248  C CG  . LEU C 1 253 ? 36.090  57.655  186.317 1.00 26.86  ? 253 LEU 3 CG  1 
ATOM 7249  C CD1 . LEU C 1 253 ? 35.176  58.154  185.245 1.00 14.28  ? 253 LEU 3 CD1 1 
ATOM 7250  C CD2 . LEU C 1 253 ? 37.171  56.802  185.690 1.00 40.73  ? 253 LEU 3 CD2 1 
ATOM 7251  N N   . CYS C 1 254 ? 39.930  59.166  188.133 1.00 39.07  ? 254 CYS 3 N   1 
ATOM 7252  C CA  . CYS C 1 254 ? 40.823  60.172  188.638 1.00 43.20  ? 254 CYS 3 CA  1 
ATOM 7253  C C   . CYS C 1 254 ? 40.564  61.390  187.815 1.00 47.70  ? 254 CYS 3 C   1 
ATOM 7254  O O   . CYS C 1 254 ? 41.017  61.496  186.667 1.00 54.26  ? 254 CYS 3 O   1 
ATOM 7255  C CB  . CYS C 1 254 ? 42.208  59.646  188.501 1.00 44.91  ? 254 CYS 3 CB  1 
ATOM 7256  S SG  . CYS C 1 254 ? 42.207  58.077  189.353 1.00 42.18  ? 254 CYS 3 SG  1 
ATOM 7257  N N   . LYS C 1 255 ? 39.659  62.190  188.366 1.00 47.59  ? 255 LYS 3 N   1 
ATOM 7258  C CA  . LYS C 1 255 ? 39.189  63.441  187.781 1.00 53.86  ? 255 LYS 3 CA  1 
ATOM 7259  C C   . LYS C 1 255 ? 40.413  64.303  187.585 1.00 62.91  ? 255 LYS 3 C   1 
ATOM 7260  O O   . LYS C 1 255 ? 40.765  64.669  186.460 1.00 57.88  ? 255 LYS 3 O   1 
ATOM 7261  C CB  . LYS C 1 255 ? 38.321  64.162  188.800 1.00 67.60  ? 255 LYS 3 CB  1 
ATOM 7262  C CG  . LYS C 1 255 ? 36.836  63.860  188.877 1.00 69.67  ? 255 LYS 3 CG  1 
ATOM 7263  C CD  . LYS C 1 255 ? 36.320  64.568  190.164 1.00 74.13  ? 255 LYS 3 CD  1 
ATOM 7264  C CE  . LYS C 1 255 ? 34.885  65.065  190.068 1.00 77.12  ? 255 LYS 3 CE  1 
ATOM 7265  N NZ  . LYS C 1 255 ? 34.470  65.943  191.213 1.00 83.31  ? 255 LYS 3 NZ  1 
ATOM 7266  N N   . ALA C 1 256 ? 40.922  64.782  188.725 1.00 66.83  ? 256 ALA 3 N   1 
ATOM 7267  C CA  . ALA C 1 256 ? 42.150  65.567  188.781 1.00 61.65  ? 256 ALA 3 CA  1 
ATOM 7268  C C   . ALA C 1 256 ? 42.954  64.331  188.708 1.00 64.66  ? 256 ALA 3 C   1 
ATOM 7269  O O   . ALA C 1 256 ? 42.659  63.398  189.473 1.00 76.93  ? 256 ALA 3 O   1 
ATOM 7270  C CB  . ALA C 1 256 ? 42.328  66.173  190.140 1.00 77.79  ? 256 ALA 3 CB  1 
ATOM 7271  N N   . ASP C 1 257 ? 43.880  64.257  187.768 1.00 46.75  ? 257 ASP 3 N   1 
ATOM 7272  C CA  . ASP C 1 257 ? 44.648  63.037  187.609 1.00 47.39  ? 257 ASP 3 CA  1 
ATOM 7273  C C   . ASP C 1 257 ? 45.342  62.636  188.910 1.00 40.71  ? 257 ASP 3 C   1 
ATOM 7274  O O   . ASP C 1 257 ? 46.544  62.705  189.070 1.00 53.61  ? 257 ASP 3 O   1 
ATOM 7275  C CB  . ASP C 1 257 ? 45.581  63.160  186.421 1.00 46.84  ? 257 ASP 3 CB  1 
ATOM 7276  C CG  . ASP C 1 257 ? 44.844  63.547  185.138 1.00 73.19  ? 257 ASP 3 CG  1 
ATOM 7277  O OD1 . ASP C 1 257 ? 44.005  62.751  184.626 1.00 79.65  ? 257 ASP 3 OD1 1 
ATOM 7278  O OD2 . ASP C 1 257 ? 45.122  64.664  184.641 1.00 86.06  ? 257 ASP 3 OD2 1 
ATOM 7279  N N   . SER C 1 258 ? 44.544  62.104  189.813 1.00 43.03  ? 258 SER 3 N   1 
ATOM 7280  C CA  . SER C 1 258 ? 44.995  61.738  191.127 1.00 40.25  ? 258 SER 3 CA  1 
ATOM 7281  C C   . SER C 1 258 ? 44.152  60.557  191.601 1.00 39.66  ? 258 SER 3 C   1 
ATOM 7282  O O   . SER C 1 258 ? 42.967  60.414  191.264 1.00 44.56  ? 258 SER 3 O   1 
ATOM 7283  C CB  . SER C 1 258 ? 44.807  62.938  192.059 1.00 40.16  ? 258 SER 3 CB  1 
ATOM 7284  O OG  . SER C 1 258 ? 45.019  64.166  191.360 1.00 54.17  ? 258 SER 3 OG  1 
ATOM 7285  N N   . LEU C 1 259 ? 44.783  59.735  192.412 1.00 26.72  ? 259 LEU 3 N   1 
ATOM 7286  C CA  . LEU C 1 259 ? 44.197  58.541  192.934 1.00 22.39  ? 259 LEU 3 CA  1 
ATOM 7287  C C   . LEU C 1 259 ? 44.253  58.730  194.425 1.00 28.02  ? 259 LEU 3 C   1 
ATOM 7288  O O   . LEU C 1 259 ? 45.304  59.096  194.954 1.00 29.75  ? 259 LEU 3 O   1 
ATOM 7289  C CB  . LEU C 1 259 ? 45.091  57.395  192.531 1.00 36.68  ? 259 LEU 3 CB  1 
ATOM 7290  C CG  . LEU C 1 259 ? 44.657  56.120  193.191 1.00 40.45  ? 259 LEU 3 CG  1 
ATOM 7291  C CD1 . LEU C 1 259 ? 43.257  55.876  192.706 1.00 23.23  ? 259 LEU 3 CD1 1 
ATOM 7292  C CD2 . LEU C 1 259 ? 45.604  54.999  192.817 1.00 39.09  ? 259 LEU 3 CD2 1 
ATOM 7293  N N   . TYR C 1 260 ? 43.148  58.462  195.107 1.00 23.76  ? 260 TYR 3 N   1 
ATOM 7294  C CA  . TYR C 1 260 ? 43.105  58.687  196.538 1.00 18.72  ? 260 TYR 3 CA  1 
ATOM 7295  C C   . TYR C 1 260 ? 42.853  57.444  197.330 1.00 29.39  ? 260 TYR 3 C   1 
ATOM 7296  O O   . TYR C 1 260 ? 41.889  56.697  197.116 1.00 48.67  ? 260 TYR 3 O   1 
ATOM 7297  C CB  . TYR C 1 260 ? 42.042  59.727  196.895 1.00 26.20  ? 260 TYR 3 CB  1 
ATOM 7298  C CG  . TYR C 1 260 ? 42.208  61.090  196.244 1.00 21.30  ? 260 TYR 3 CG  1 
ATOM 7299  C CD1 . TYR C 1 260 ? 41.906  61.294  194.892 1.00 31.78  ? 260 TYR 3 CD1 1 
ATOM 7300  C CD2 . TYR C 1 260 ? 42.675  62.178  196.980 1.00 17.03  ? 260 TYR 3 CD2 1 
ATOM 7301  C CE1 . TYR C 1 260 ? 42.078  62.556  194.294 1.00 49.47  ? 260 TYR 3 CE1 1 
ATOM 7302  C CE2 . TYR C 1 260 ? 42.852  63.440  196.395 1.00 29.64  ? 260 TYR 3 CE2 1 
ATOM 7303  C CZ  . TYR C 1 260 ? 42.555  63.624  195.061 1.00 47.80  ? 260 TYR 3 CZ  1 
ATOM 7304  O OH  . TYR C 1 260 ? 42.753  64.872  194.511 1.00 67.23  ? 260 TYR 3 OH  1 
ATOM 7305  N N   . VAL C 1 261 ? 43.664  57.295  198.346 1.00 24.67  ? 261 VAL 3 N   1 
ATOM 7306  C CA  . VAL C 1 261 ? 43.568  56.140  199.167 1.00 18.86  ? 261 VAL 3 CA  1 
ATOM 7307  C C   . VAL C 1 261 ? 43.456  56.632  200.549 1.00 24.48  ? 261 VAL 3 C   1 
ATOM 7308  O O   . VAL C 1 261 ? 44.203  57.511  200.985 1.00 37.77  ? 261 VAL 3 O   1 
ATOM 7309  C CB  . VAL C 1 261 ? 44.808  55.292  199.002 1.00 20.02  ? 261 VAL 3 CB  1 
ATOM 7310  C CG1 . VAL C 1 261 ? 44.866  54.223  200.050 1.00 45.61  ? 261 VAL 3 CG1 1 
ATOM 7311  C CG2 . VAL C 1 261 ? 44.785  54.652  197.648 1.00 25.81  ? 261 VAL 3 CG2 1 
ATOM 7312  N N   . SER C 1 262 ? 42.599  55.959  201.279 1.00 22.65  ? 262 SER 3 N   1 
ATOM 7313  C CA  . SER C 1 262 ? 42.306  56.327  202.635 1.00 17.18  ? 262 SER 3 CA  1 
ATOM 7314  C C   . SER C 1 262 ? 42.037  55.016  203.324 1.00 22.85  ? 262 SER 3 C   1 
ATOM 7315  O O   . SER C 1 262 ? 41.471  54.084  202.718 1.00 31.65  ? 262 SER 3 O   1 
ATOM 7316  C CB  . SER C 1 262 ? 41.034  57.178  202.589 1.00 23.65  ? 262 SER 3 CB  1 
ATOM 7317  O OG  . SER C 1 262 ? 40.578  57.324  201.221 1.00 50.48  ? 262 SER 3 OG  1 
ATOM 7318  N N   . ALA C 1 263 ? 42.432  54.930  204.584 1.00 27.11  ? 263 ALA 3 N   1 
ATOM 7319  C CA  . ALA C 1 263 ? 42.210  53.720  205.358 1.00 10.25  ? 263 ALA 3 CA  1 
ATOM 7320  C C   . ALA C 1 263 ? 42.356  53.950  206.852 1.00 16.16  ? 263 ALA 3 C   1 
ATOM 7321  O O   . ALA C 1 263 ? 42.897  54.976  207.272 1.00 28.44  ? 263 ALA 3 O   1 
ATOM 7322  C CB  . ALA C 1 263 ? 43.154  52.680  204.917 1.00 12.49  ? 263 ALA 3 CB  1 
ATOM 7323  N N   . VAL C 1 264 ? 41.887  52.989  207.650 1.00 18.25  ? 264 VAL 3 N   1 
ATOM 7324  C CA  . VAL C 1 264 ? 41.958  53.057  209.107 1.00 16.28  ? 264 VAL 3 CA  1 
ATOM 7325  C C   . VAL C 1 264 ? 41.993  51.652  209.672 1.00 23.84  ? 264 VAL 3 C   1 
ATOM 7326  O O   . VAL C 1 264 ? 41.116  50.841  209.339 1.00 23.26  ? 264 VAL 3 O   1 
ATOM 7327  C CB  . VAL C 1 264 ? 40.688  53.626  209.682 1.00 19.47  ? 264 VAL 3 CB  1 
ATOM 7328  C CG1 . VAL C 1 264 ? 40.809  53.686  211.161 1.00 6.26   ? 264 VAL 3 CG1 1 
ATOM 7329  C CG2 . VAL C 1 264 ? 40.391  54.973  209.114 1.00 37.53  ? 264 VAL 3 CG2 1 
ATOM 7330  N N   . ASP C 1 265 ? 42.887  51.398  210.621 1.00 21.02  ? 265 ASP 3 N   1 
ATOM 7331  C CA  . ASP C 1 265 ? 42.937  50.063  211.183 1.00 19.88  ? 265 ASP 3 CA  1 
ATOM 7332  C C   . ASP C 1 265 ? 43.166  49.894  212.655 1.00 23.55  ? 265 ASP 3 C   1 
ATOM 7333  O O   . ASP C 1 265 ? 44.222  49.416  213.075 1.00 16.78  ? 265 ASP 3 O   1 
ATOM 7334  C CB  . ASP C 1 265 ? 43.969  49.254  210.451 1.00 18.94  ? 265 ASP 3 CB  1 
ATOM 7335  C CG  . ASP C 1 265 ? 43.535  48.919  209.067 1.00 37.87  ? 265 ASP 3 CG  1 
ATOM 7336  O OD1 . ASP C 1 265 ? 42.740  47.942  208.934 1.00 9.28   ? 265 ASP 3 OD1 1 
ATOM 7337  O OD2 . ASP C 1 265 ? 43.980  49.640  208.127 1.00 37.63  ? 265 ASP 3 OD2 1 
ATOM 7338  N N   . ILE C 1 266 ? 42.196  50.265  213.467 1.00 23.71  ? 266 ILE 3 N   1 
ATOM 7339  C CA  . ILE C 1 266 ? 42.398  50.067  214.884 1.00 9.62   ? 266 ILE 3 CA  1 
ATOM 7340  C C   . ILE C 1 266 ? 42.257  48.576  215.004 1.00 18.60  ? 266 ILE 3 C   1 
ATOM 7341  O O   . ILE C 1 266 ? 41.146  48.046  214.876 1.00 24.81  ? 266 ILE 3 O   1 
ATOM 7342  C CB  . ILE C 1 266 ? 41.280  50.637  215.740 1.00 20.92  ? 266 ILE 3 CB  1 
ATOM 7343  C CG1 . ILE C 1 266 ? 41.290  52.157  215.755 1.00 14.86  ? 266 ILE 3 CG1 1 
ATOM 7344  C CG2 . ILE C 1 266 ? 41.420  50.105  217.153 1.00 36.77  ? 266 ILE 3 CG2 1 
ATOM 7345  C CD1 . ILE C 1 266 ? 40.891  52.771  214.477 1.00 13.47  ? 266 ILE 3 CD1 1 
ATOM 7346  N N   . CYS C 1 267 ? 43.360  47.870  215.173 1.00 21.08  ? 267 CYS 3 N   1 
ATOM 7347  C CA  . CYS C 1 267 ? 43.241  46.423  215.322 1.00 23.86  ? 267 CYS 3 CA  1 
ATOM 7348  C C   . CYS C 1 267 ? 42.628  46.131  216.678 1.00 18.56  ? 267 CYS 3 C   1 
ATOM 7349  O O   . CYS C 1 267 ? 41.990  45.101  216.864 1.00 31.88  ? 267 CYS 3 O   1 
ATOM 7350  C CB  . CYS C 1 267 ? 44.594  45.751  215.213 1.00 2.00   ? 267 CYS 3 CB  1 
ATOM 7351  S SG  . CYS C 1 267 ? 45.521  46.420  213.855 1.00 61.19  ? 267 CYS 3 SG  1 
ATOM 7352  N N   . GLY C 1 268 ? 42.805  47.066  217.605 1.00 18.59  ? 268 GLY 3 N   1 
ATOM 7353  C CA  . GLY C 1 268 ? 42.271  46.897  218.948 1.00 30.67  ? 268 GLY 3 CA  1 
ATOM 7354  C C   . GLY C 1 268 ? 42.974  47.651  220.088 1.00 40.26  ? 268 GLY 3 C   1 
ATOM 7355  O O   . GLY C 1 268 ? 43.634  48.705  219.896 1.00 38.76  ? 268 GLY 3 O   1 
ATOM 7356  N N   . LEU C 1 269 ? 42.862  47.080  221.287 1.00 33.30  ? 269 LEU 3 N   1 
ATOM 7357  C CA  . LEU C 1 269 ? 43.452  47.675  222.482 1.00 39.93  ? 269 LEU 3 CA  1 
ATOM 7358  C C   . LEU C 1 269 ? 44.570  46.929  223.173 1.00 43.37  ? 269 LEU 3 C   1 
ATOM 7359  O O   . LEU C 1 269 ? 44.418  45.775  223.640 1.00 41.57  ? 269 LEU 3 O   1 
ATOM 7360  C CB  . LEU C 1 269 ? 42.393  47.936  223.542 1.00 42.80  ? 269 LEU 3 CB  1 
ATOM 7361  C CG  . LEU C 1 269 ? 41.495  49.143  223.360 1.00 41.49  ? 269 LEU 3 CG  1 
ATOM 7362  C CD1 . LEU C 1 269 ? 40.514  49.177  224.525 1.00 36.21  ? 269 LEU 3 CD1 1 
ATOM 7363  C CD2 . LEU C 1 269 ? 42.339  50.406  223.271 1.00 36.01  ? 269 LEU 3 CD2 1 
ATOM 7364  N N   . PHE C 1 270 ? 45.667  47.652  223.330 1.00 42.73  ? 270 PHE 3 N   1 
ATOM 7365  C CA  . PHE C 1 270 ? 46.825  47.130  224.012 1.00 47.44  ? 270 PHE 3 CA  1 
ATOM 7366  C C   . PHE C 1 270 ? 46.669  47.396  225.487 1.00 52.21  ? 270 PHE 3 C   1 
ATOM 7367  O O   . PHE C 1 270 ? 46.526  48.541  225.909 1.00 59.60  ? 270 PHE 3 O   1 
ATOM 7368  C CB  . PHE C 1 270 ? 48.094  47.820  223.553 1.00 41.04  ? 270 PHE 3 CB  1 
ATOM 7369  C CG  . PHE C 1 270 ? 49.316  47.324  224.246 1.00 47.52  ? 270 PHE 3 CG  1 
ATOM 7370  C CD1 . PHE C 1 270 ? 49.303  46.101  224.898 1.00 59.15  ? 270 PHE 3 CD1 1 
ATOM 7371  C CD2 . PHE C 1 270 ? 50.465  48.084  224.277 1.00 68.24  ? 270 PHE 3 CD2 1 
ATOM 7372  C CE1 . PHE C 1 270 ? 50.405  45.641  225.575 1.00 78.89  ? 270 PHE 3 CE1 1 
ATOM 7373  C CE2 . PHE C 1 270 ? 51.584  47.632  224.953 1.00 87.52  ? 270 PHE 3 CE2 1 
ATOM 7374  C CZ  . PHE C 1 270 ? 51.552  46.404  225.608 1.00 89.79  ? 270 PHE 3 CZ  1 
ATOM 7375  N N   . THR C 1 271 ? 46.717  46.337  226.272 1.00 52.79  ? 271 THR 3 N   1 
ATOM 7376  C CA  . THR C 1 271 ? 46.603  46.484  227.698 1.00 53.22  ? 271 THR 3 CA  1 
ATOM 7377  C C   . THR C 1 271 ? 48.004  46.373  228.301 1.00 58.24  ? 271 THR 3 C   1 
ATOM 7378  O O   . THR C 1 271 ? 48.604  45.284  228.379 1.00 63.58  ? 271 THR 3 O   1 
ATOM 7379  C CB  . THR C 1 271 ? 45.701  45.414  228.287 1.00 62.02  ? 271 THR 3 CB  1 
ATOM 7380  O OG1 . THR C 1 271 ? 44.543  45.224  227.447 1.00 81.60  ? 271 THR 3 OG1 1 
ATOM 7381  C CG2 . THR C 1 271 ? 45.272  45.826  229.670 1.00 52.32  ? 271 THR 3 CG2 1 
ATOM 7382  N N   . ASN C 1 272 ? 48.555  47.529  228.638 1.00 55.98  ? 272 ASN 3 N   1 
ATOM 7383  C CA  . ASN C 1 272 ? 49.869  47.607  229.241 1.00 54.67  ? 272 ASN 3 CA  1 
ATOM 7384  C C   . ASN C 1 272 ? 49.879  46.877  230.542 1.00 58.90  ? 272 ASN 3 C   1 
ATOM 7385  O O   . ASN C 1 272 ? 48.842  46.631  231.157 1.00 60.36  ? 272 ASN 3 O   1 
ATOM 7386  C CB  . ASN C 1 272 ? 50.223  49.033  229.573 1.00 44.00  ? 272 ASN 3 CB  1 
ATOM 7387  C CG  . ASN C 1 272 ? 50.742  49.774  228.402 1.00 60.81  ? 272 ASN 3 CG  1 
ATOM 7388  O OD1 . ASN C 1 272 ? 51.845  49.527  227.941 1.00 69.53  ? 272 ASN 3 OD1 1 
ATOM 7389  N ND2 . ASN C 1 272 ? 49.970  50.723  227.924 1.00 71.38  ? 272 ASN 3 ND2 1 
ATOM 7390  N N   . THR C 1 273 ? 51.082  46.677  231.027 1.00 60.26  ? 273 THR 3 N   1 
ATOM 7391  C CA  . THR C 1 273 ? 51.315  46.031  232.299 1.00 58.03  ? 273 THR 3 CA  1 
ATOM 7392  C C   . THR C 1 273 ? 50.501  46.729  233.392 1.00 60.31  ? 273 THR 3 C   1 
ATOM 7393  O O   . THR C 1 273 ? 49.837  46.081  234.199 1.00 52.18  ? 273 THR 3 O   1 
ATOM 7394  C CB  . THR C 1 273 ? 52.784  46.180  232.636 1.00 62.61  ? 273 THR 3 CB  1 
ATOM 7395  O OG1 . THR C 1 273 ? 53.431  46.998  231.634 1.00 81.55  ? 273 THR 3 OG1 1 
ATOM 7396  C CG2 . THR C 1 273 ? 53.428  44.838  232.711 1.00 52.12  ? 273 THR 3 CG2 1 
ATOM 7397  N N   . SER C 1 274 ? 50.539  48.065  233.360 1.00 65.36  ? 274 SER 3 N   1 
ATOM 7398  C CA  . SER C 1 274 ? 49.855  48.938  234.319 1.00 64.06  ? 274 SER 3 CA  1 
ATOM 7399  C C   . SER C 1 274 ? 48.372  48.666  234.423 1.00 64.40  ? 274 SER 3 C   1 
ATOM 7400  O O   . SER C 1 274 ? 47.806  48.630  235.507 1.00 71.64  ? 274 SER 3 O   1 
ATOM 7401  C CB  . SER C 1 274 ? 50.027  50.416  233.923 1.00 62.94  ? 274 SER 3 CB  1 
ATOM 7402  O OG  . SER C 1 274 ? 51.103  50.622  233.006 1.00 86.96  ? 274 SER 3 OG  1 
ATOM 7403  N N   . GLY C 1 275 ? 47.748  48.441  233.284 1.00 70.32  ? 275 GLY 3 N   1 
ATOM 7404  C CA  . GLY C 1 275 ? 46.319  48.224  233.271 1.00 68.60  ? 275 GLY 3 CA  1 
ATOM 7405  C C   . GLY C 1 275 ? 45.778  49.293  232.345 1.00 68.05  ? 275 GLY 3 C   1 
ATOM 7406  O O   . GLY C 1 275 ? 44.585  49.312  232.009 1.00 61.87  ? 275 GLY 3 O   1 
ATOM 7407  N N   . THR C 1 276 ? 46.663  50.209  231.961 1.00 52.63  ? 276 THR 3 N   1 
ATOM 7408  C CA  . THR C 1 276 ? 46.309  51.269  231.048 1.00 61.87  ? 276 THR 3 CA  1 
ATOM 7409  C C   . THR C 1 276 ? 46.200  50.590  229.686 1.00 63.47  ? 276 THR 3 C   1 
ATOM 7410  O O   . THR C 1 276 ? 46.873  49.581  229.443 1.00 64.19  ? 276 THR 3 O   1 
ATOM 7411  C CB  . THR C 1 276 ? 47.420  52.291  231.000 1.00 63.61  ? 276 THR 3 CB  1 
ATOM 7412  O OG1 . THR C 1 276 ? 48.632  51.641  230.607 1.00 80.41  ? 276 THR 3 OG1 1 
ATOM 7413  C CG2 . THR C 1 276 ? 47.623  52.885  232.368 1.00 82.09  ? 276 THR 3 CG2 1 
ATOM 7414  N N   . GLN C 1 277 ? 45.351  51.122  228.814 1.00 58.36  ? 277 GLN 3 N   1 
ATOM 7415  C CA  . GLN C 1 277 ? 45.169  50.550  227.493 1.00 48.66  ? 277 GLN 3 CA  1 
ATOM 7416  C C   . GLN C 1 277 ? 45.391  51.619  226.440 1.00 50.73  ? 277 GLN 3 C   1 
ATOM 7417  O O   . GLN C 1 277 ? 45.273  52.812  226.738 1.00 62.46  ? 277 GLN 3 O   1 
ATOM 7418  C CB  . GLN C 1 277 ? 43.756  49.978  227.366 1.00 50.88  ? 277 GLN 3 CB  1 
ATOM 7419  C CG  . GLN C 1 277 ? 43.487  48.781  228.271 1.00 47.07  ? 277 GLN 3 CG  1 
ATOM 7420  C CD  . GLN C 1 277 ? 42.025  48.347  228.276 1.00 58.79  ? 277 GLN 3 CD  1 
ATOM 7421  O OE1 . GLN C 1 277 ? 41.715  47.160  228.149 1.00 77.40  ? 277 GLN 3 OE1 1 
ATOM 7422  N NE2 . GLN C 1 277 ? 41.122  49.302  228.469 1.00 61.62  ? 277 GLN 3 NE2 1 
ATOM 7423  N N   . GLN C 1 278 ? 45.802  51.207  225.241 1.00 43.53  ? 278 GLN 3 N   1 
ATOM 7424  C CA  . GLN C 1 278 ? 45.998  52.138  224.117 1.00 51.69  ? 278 GLN 3 CA  1 
ATOM 7425  C C   . GLN C 1 278 ? 45.699  51.420  222.794 1.00 46.11  ? 278 GLN 3 C   1 
ATOM 7426  O O   . GLN C 1 278 ? 45.751  50.196  222.727 1.00 42.57  ? 278 GLN 3 O   1 
ATOM 7427  C CB  . GLN C 1 278 ? 47.368  52.843  224.144 1.00 48.81  ? 278 GLN 3 CB  1 
ATOM 7428  C CG  . GLN C 1 278 ? 48.518  51.974  224.634 1.00 73.24  ? 278 GLN 3 CG  1 
ATOM 7429  C CD  . GLN C 1 278 ? 49.847  52.727  224.819 1.00 72.88  ? 278 GLN 3 CD  1 
ATOM 7430  O OE1 . GLN C 1 278 ? 50.679  52.360  225.661 1.00 62.26  ? 278 GLN 3 OE1 1 
ATOM 7431  N NE2 . GLN C 1 278 ? 50.071  53.736  224.001 1.00 76.77  ? 278 GLN 3 NE2 1 
ATOM 7432  N N   . TRP C 1 279 ? 45.241  52.177  221.805 1.00 36.98  ? 279 TRP 3 N   1 
ATOM 7433  C CA  . TRP C 1 279 ? 44.855  51.649  220.507 1.00 34.80  ? 279 TRP 3 CA  1 
ATOM 7434  C C   . TRP C 1 279 ? 46.015  51.177  219.658 1.00 44.25  ? 279 TRP 3 C   1 
ATOM 7435  O O   . TRP C 1 279 ? 47.030  51.889  219.561 1.00 49.24  ? 279 TRP 3 O   1 
ATOM 7436  C CB  . TRP C 1 279 ? 44.211  52.767  219.698 1.00 40.95  ? 279 TRP 3 CB  1 
ATOM 7437  C CG  . TRP C 1 279 ? 42.946  53.338  220.214 1.00 35.41  ? 279 TRP 3 CG  1 
ATOM 7438  C CD1 . TRP C 1 279 ? 42.670  54.651  220.433 1.00 32.74  ? 279 TRP 3 CD1 1 
ATOM 7439  C CD2 . TRP C 1 279 ? 41.727  52.635  220.415 1.00 38.84  ? 279 TRP 3 CD2 1 
ATOM 7440  N NE1 . TRP C 1 279 ? 41.344  54.817  220.736 1.00 38.30  ? 279 TRP 3 NE1 1 
ATOM 7441  C CE2 . TRP C 1 279 ? 40.745  53.590  220.735 1.00 32.17  ? 279 TRP 3 CE2 1 
ATOM 7442  C CE3 . TRP C 1 279 ? 41.366  51.283  220.341 1.00 42.65  ? 279 TRP 3 CE3 1 
ATOM 7443  C CZ2 . TRP C 1 279 ? 39.420  53.232  220.976 1.00 33.65  ? 279 TRP 3 CZ2 1 
ATOM 7444  C CZ3 . TRP C 1 279 ? 40.043  50.930  220.578 1.00 32.09  ? 279 TRP 3 CZ3 1 
ATOM 7445  C CH2 . TRP C 1 279 ? 39.090  51.896  220.893 1.00 37.52  ? 279 TRP 3 CH2 1 
ATOM 7446  N N   . LYS C 1 280 ? 45.904  49.999  219.044 1.00 33.83  ? 280 LYS 3 N   1 
ATOM 7447  C CA  . LYS C 1 280 ? 46.979  49.620  218.138 1.00 31.32  ? 280 LYS 3 CA  1 
ATOM 7448  C C   . LYS C 1 280 ? 46.456  49.602  216.746 1.00 29.18  ? 280 LYS 3 C   1 
ATOM 7449  O O   . LYS C 1 280 ? 45.306  49.209  216.495 1.00 35.32  ? 280 LYS 3 O   1 
ATOM 7450  C CB  . LYS C 1 280 ? 47.671  48.267  218.382 1.00 20.90  ? 280 LYS 3 CB  1 
ATOM 7451  C CG  . LYS C 1 280 ? 48.824  48.082  217.274 1.00 35.39  ? 280 LYS 3 CG  1 
ATOM 7452  C CD  . LYS C 1 280 ? 50.039  47.172  217.603 1.00 20.17  ? 280 LYS 3 CD  1 
ATOM 7453  C CE  . LYS C 1 280 ? 51.433  47.897  217.598 1.00 55.33  ? 280 LYS 3 CE  1 
ATOM 7454  N NZ  . LYS C 1 280 ? 52.340  47.744  216.382 1.00 57.67  ? 280 LYS 3 NZ  1 
ATOM 7455  N N   . GLY C 1 281 ? 47.323  50.016  215.840 1.00 17.92  ? 281 GLY 3 N   1 
ATOM 7456  C CA  . GLY C 1 281 ? 46.989  50.008  214.443 1.00 20.35  ? 281 GLY 3 CA  1 
ATOM 7457  C C   . GLY C 1 281 ? 48.159  49.397  213.708 1.00 28.38  ? 281 GLY 3 C   1 
ATOM 7458  O O   . GLY C 1 281 ? 49.288  49.308  214.242 1.00 35.78  ? 281 GLY 3 O   1 
ATOM 7459  N N   . LEU C 1 282 ? 47.884  48.955  212.489 1.00 18.68  ? 282 LEU 3 N   1 
ATOM 7460  C CA  . LEU C 1 282 ? 48.893  48.363  211.623 1.00 20.28  ? 282 LEU 3 CA  1 
ATOM 7461  C C   . LEU C 1 282 ? 48.728  49.013  210.305 1.00 16.23  ? 282 LEU 3 C   1 
ATOM 7462  O O   . LEU C 1 282 ? 47.725  49.646  210.027 1.00 29.57  ? 282 LEU 3 O   1 
ATOM 7463  C CB  . LEU C 1 282 ? 48.667  46.879  211.433 1.00 21.53  ? 282 LEU 3 CB  1 
ATOM 7464  C CG  . LEU C 1 282 ? 48.981  46.096  212.684 1.00 20.35  ? 282 LEU 3 CG  1 
ATOM 7465  C CD1 . LEU C 1 282 ? 49.260  44.642  212.334 1.00 24.49  ? 282 LEU 3 CD1 1 
ATOM 7466  C CD2 . LEU C 1 282 ? 50.200  46.739  213.307 1.00 34.68  ? 282 LEU 3 CD2 1 
ATOM 7467  N N   . PRO C 1 283 ? 49.744  48.939  209.488 1.00 21.72  ? 283 PRO 3 N   1 
ATOM 7468  C CA  . PRO C 1 283 ? 49.562  49.586  208.195 1.00 21.75  ? 283 PRO 3 CA  1 
ATOM 7469  C C   . PRO C 1 283 ? 48.803  48.683  207.246 1.00 25.40  ? 283 PRO 3 C   1 
ATOM 7470  O O   . PRO C 1 283 ? 48.688  47.463  207.450 1.00 28.49  ? 283 PRO 3 O   1 
ATOM 7471  C CB  . PRO C 1 283 ? 50.990  49.821  207.736 1.00 27.99  ? 283 PRO 3 CB  1 
ATOM 7472  C CG  . PRO C 1 283 ? 51.721  48.665  208.360 1.00 30.35  ? 283 PRO 3 CG  1 
ATOM 7473  C CD  . PRO C 1 283 ? 51.148  48.612  209.748 1.00 20.98  ? 283 PRO 3 CD  1 
ATOM 7474  N N   . ARG C 1 284 ? 48.313  49.295  206.188 1.00 18.67  ? 284 ARG 3 N   1 
ATOM 7475  C CA  . ARG C 1 284 ? 47.558  48.586  205.198 1.00 22.53  ? 284 ARG 3 CA  1 
ATOM 7476  C C   . ARG C 1 284 ? 48.200  48.759  203.835 1.00 22.63  ? 284 ARG 3 C   1 
ATOM 7477  O O   . ARG C 1 284 ? 48.769  49.801  203.511 1.00 21.39  ? 284 ARG 3 O   1 
ATOM 7478  C CB  . ARG C 1 284 ? 46.103  49.060  205.181 1.00 21.98  ? 284 ARG 3 CB  1 
ATOM 7479  C CG  . ARG C 1 284 ? 45.453  48.880  203.821 1.00 18.46  ? 284 ARG 3 CG  1 
ATOM 7480  C CD  . ARG C 1 284 ? 43.984  49.173  203.844 1.00 24.25  ? 284 ARG 3 CD  1 
ATOM 7481  N NE  . ARG C 1 284 ? 43.192  47.965  204.020 1.00 34.84  ? 284 ARG 3 NE  1 
ATOM 7482  C CZ  . ARG C 1 284 ? 42.809  47.508  205.203 1.00 34.84  ? 284 ARG 3 CZ  1 
ATOM 7483  N NH1 . ARG C 1 284 ? 43.151  48.176  206.294 1.00 26.47  ? 284 ARG 3 NH1 1 
ATOM 7484  N NH2 . ARG C 1 284 ? 42.113  46.377  205.290 1.00 25.71  ? 284 ARG 3 NH2 1 
ATOM 7485  N N   . TYR C 1 285 ? 48.019  47.726  203.035 1.00 11.60  ? 285 TYR 3 N   1 
ATOM 7486  C CA  . TYR C 1 285 ? 48.566  47.604  201.716 1.00 14.44  ? 285 TYR 3 CA  1 
ATOM 7487  C C   . TYR C 1 285 ? 47.513  47.801  200.649 1.00 28.32  ? 285 TYR 3 C   1 
ATOM 7488  O O   . TYR C 1 285 ? 46.380  47.349  200.832 1.00 27.97  ? 285 TYR 3 O   1 
ATOM 7489  C CB  . TYR C 1 285 ? 49.005  46.152  201.597 1.00 14.86  ? 285 TYR 3 CB  1 
ATOM 7490  C CG  . TYR C 1 285 ? 49.344  45.657  200.199 1.00 29.17  ? 285 TYR 3 CG  1 
ATOM 7491  C CD1 . TYR C 1 285 ? 48.397  45.574  199.182 1.00 33.92  ? 285 TYR 3 CD1 1 
ATOM 7492  C CD2 . TYR C 1 285 ? 50.617  45.258  199.906 1.00 31.46  ? 285 TYR 3 CD2 1 
ATOM 7493  C CE1 . TYR C 1 285 ? 48.741  45.107  197.922 1.00 37.41  ? 285 TYR 3 CE1 1 
ATOM 7494  C CE2 . TYR C 1 285 ? 50.964  44.783  198.658 1.00 45.03  ? 285 TYR 3 CE2 1 
ATOM 7495  C CZ  . TYR C 1 285 ? 50.042  44.705  197.669 1.00 39.01  ? 285 TYR 3 CZ  1 
ATOM 7496  O OH  . TYR C 1 285 ? 50.466  44.196  196.457 1.00 26.94  ? 285 TYR 3 OH  1 
ATOM 7497  N N   . PHE C 1 286 ? 47.916  48.292  199.477 1.00 3.33   ? 286 PHE 3 N   1 
ATOM 7498  C CA  . PHE C 1 286 ? 46.955  48.380  198.382 1.00 11.08  ? 286 PHE 3 CA  1 
ATOM 7499  C C   . PHE C 1 286 ? 47.619  48.079  197.059 1.00 21.80  ? 286 PHE 3 C   1 
ATOM 7500  O O   . PHE C 1 286 ? 48.743  48.547  196.804 1.00 25.37  ? 286 PHE 3 O   1 
ATOM 7501  C CB  . PHE C 1 286 ? 46.329  49.770  198.211 1.00 18.82  ? 286 PHE 3 CB  1 
ATOM 7502  C CG  . PHE C 1 286 ? 45.651  50.292  199.416 1.00 9.95   ? 286 PHE 3 CG  1 
ATOM 7503  C CD1 . PHE C 1 286 ? 46.390  50.738  200.489 1.00 22.11  ? 286 PHE 3 CD1 1 
ATOM 7504  C CD2 . PHE C 1 286 ? 44.278  50.364  199.477 1.00 24.43  ? 286 PHE 3 CD2 1 
ATOM 7505  C CE1 . PHE C 1 286 ? 45.782  51.246  201.593 1.00 14.49  ? 286 PHE 3 CE1 1 
ATOM 7506  C CE2 . PHE C 1 286 ? 43.650  50.882  200.604 1.00 17.43  ? 286 PHE 3 CE2 1 
ATOM 7507  C CZ  . PHE C 1 286 ? 44.407  51.319  201.649 1.00 26.63  ? 286 PHE 3 CZ  1 
ATOM 7508  N N   . LYS C 1 287 ? 46.906  47.342  196.207 1.00 20.13  ? 287 LYS 3 N   1 
ATOM 7509  C CA  . LYS C 1 287 ? 47.363  47.046  194.856 1.00 15.57  ? 287 LYS 3 CA  1 
ATOM 7510  C C   . LYS C 1 287 ? 46.197  47.471  193.997 1.00 28.17  ? 287 LYS 3 C   1 
ATOM 7511  O O   . LYS C 1 287 ? 45.098  46.874  194.007 1.00 35.58  ? 287 LYS 3 O   1 
ATOM 7512  C CB  . LYS C 1 287 ? 47.698  45.581  194.647 1.00 16.91  ? 287 LYS 3 CB  1 
ATOM 7513  C CG  . LYS C 1 287 ? 48.034  45.171  193.174 1.00 17.84  ? 287 LYS 3 CG  1 
ATOM 7514  C CD  . LYS C 1 287 ? 48.913  43.883  193.123 1.00 45.48  ? 287 LYS 3 CD  1 
ATOM 7515  C CE  . LYS C 1 287 ? 48.886  43.089  191.795 1.00 63.73  ? 287 LYS 3 CE  1 
ATOM 7516  N NZ  . LYS C 1 287 ? 50.082  42.156  191.670 1.00 99.35  ? 287 LYS 3 NZ  1 
ATOM 7517  N N   . ILE C 1 288 ? 46.437  48.547  193.278 1.00 23.17  ? 288 ILE 3 N   1 
ATOM 7518  C CA  . ILE C 1 288 ? 45.396  49.110  192.495 1.00 21.43  ? 288 ILE 3 CA  1 
ATOM 7519  C C   . ILE C 1 288 ? 45.649  49.041  191.061 1.00 17.29  ? 288 ILE 3 C   1 
ATOM 7520  O O   . ILE C 1 288 ? 46.653  49.533  190.547 1.00 27.94  ? 288 ILE 3 O   1 
ATOM 7521  C CB  . ILE C 1 288 ? 45.189  50.523  192.881 1.00 25.04  ? 288 ILE 3 CB  1 
ATOM 7522  C CG1 . ILE C 1 288 ? 45.204  50.598  194.399 1.00 12.12  ? 288 ILE 3 CG1 1 
ATOM 7523  C CG2 . ILE C 1 288 ? 43.879  51.002  192.323 1.00 17.42  ? 288 ILE 3 CG2 1 
ATOM 7524  C CD1 . ILE C 1 288 ? 44.941  51.914  194.895 1.00 31.47  ? 288 ILE 3 CD1 1 
ATOM 7525  N N   . THR C 1 289 ? 44.679  48.480  190.398 1.00 15.25  ? 289 THR 3 N   1 
ATOM 7526  C CA  . THR C 1 289 ? 44.779  48.320  188.990 1.00 20.76  ? 289 THR 3 CA  1 
ATOM 7527  C C   . THR C 1 289 ? 44.028  49.450  188.335 1.00 25.66  ? 289 THR 3 C   1 
ATOM 7528  O O   . THR C 1 289 ? 42.877  49.743  188.686 1.00 32.40  ? 289 THR 3 O   1 
ATOM 7529  C CB  . THR C 1 289 ? 44.199  47.020  188.644 1.00 23.57  ? 289 THR 3 CB  1 
ATOM 7530  O OG1 . THR C 1 289 ? 44.724  46.018  189.537 1.00 34.72  ? 289 THR 3 OG1 1 
ATOM 7531  C CG2 . THR C 1 289 ? 44.549  46.710  187.264 1.00 31.04  ? 289 THR 3 CG2 1 
ATOM 7532  N N   . LEU C 1 290 ? 44.694  50.107  187.402 1.00 18.43  ? 290 LEU 3 N   1 
ATOM 7533  C CA  . LEU C 1 290 ? 44.107  51.247  186.712 1.00 18.22  ? 290 LEU 3 CA  1 
ATOM 7534  C C   . LEU C 1 290 ? 44.141  51.048  185.226 1.00 19.83  ? 290 LEU 3 C   1 
ATOM 7535  O O   . LEU C 1 290 ? 45.050  50.380  184.723 1.00 17.10  ? 290 LEU 3 O   1 
ATOM 7536  C CB  . LEU C 1 290 ? 44.918  52.490  187.014 1.00 19.43  ? 290 LEU 3 CB  1 
ATOM 7537  C CG  . LEU C 1 290 ? 45.084  52.645  188.512 1.00 25.94  ? 290 LEU 3 CG  1 
ATOM 7538  C CD1 . LEU C 1 290 ? 46.083  53.700  188.825 1.00 32.79  ? 290 LEU 3 CD1 1 
ATOM 7539  C CD2 . LEU C 1 290 ? 43.746  52.985  189.092 1.00 32.48  ? 290 LEU 3 CD2 1 
ATOM 7540  N N   . ARG C 1 291 ? 43.172  51.641  184.527 1.00 14.84  ? 291 ARG 3 N   1 
ATOM 7541  C CA  . ARG C 1 291 ? 43.103  51.560  183.070 1.00 19.47  ? 291 ARG 3 CA  1 
ATOM 7542  C C   . ARG C 1 291 ? 42.770  52.925  182.510 1.00 30.08  ? 291 ARG 3 C   1 
ATOM 7543  O O   . ARG C 1 291 ? 42.282  53.810  183.231 1.00 36.88  ? 291 ARG 3 O   1 
ATOM 7544  C CB  . ARG C 1 291 ? 42.065  50.558  182.593 1.00 20.55  ? 291 ARG 3 CB  1 
ATOM 7545  C CG  . ARG C 1 291 ? 40.619  50.912  182.926 1.00 48.29  ? 291 ARG 3 CG  1 
ATOM 7546  C CD  . ARG C 1 291 ? 39.603  49.866  182.400 1.00 47.43  ? 291 ARG 3 CD  1 
ATOM 7547  N NE  . ARG C 1 291 ? 38.278  50.066  182.991 1.00 56.21  ? 291 ARG 3 NE  1 
ATOM 7548  C CZ  . ARG C 1 291 ? 37.257  49.212  182.904 1.00 73.18  ? 291 ARG 3 CZ  1 
ATOM 7549  N NH1 . ARG C 1 291 ? 37.400  48.065  182.246 1.00 86.81  ? 291 ARG 3 NH1 1 
ATOM 7550  N NH2 . ARG C 1 291 ? 36.078  49.514  183.451 1.00 76.79  ? 291 ARG 3 NH2 1 
ATOM 7551  N N   . LYS C 1 292 ? 43.055  53.105  181.228 1.00 28.58  ? 292 LYS 3 N   1 
ATOM 7552  C CA  . LYS C 1 292 ? 42.803  54.385  180.605 1.00 23.35  ? 292 LYS 3 CA  1 
ATOM 7553  C C   . LYS C 1 292 ? 41.382  54.294  180.149 1.00 26.02  ? 292 LYS 3 C   1 
ATOM 7554  O O   . LYS C 1 292 ? 41.068  53.432  179.311 1.00 26.66  ? 292 LYS 3 O   1 
ATOM 7555  C CB  . LYS C 1 292 ? 43.763  54.584  179.435 1.00 35.90  ? 292 LYS 3 CB  1 
ATOM 7556  C CG  . LYS C 1 292 ? 45.236  54.776  179.877 1.00 33.08  ? 292 LYS 3 CG  1 
ATOM 7557  C CD  . LYS C 1 292 ? 46.216  54.820  178.693 1.00 46.23  ? 292 LYS 3 CD  1 
ATOM 7558  C CE  . LYS C 1 292 ? 47.536  55.439  179.131 1.00 57.22  ? 292 LYS 3 CE  1 
ATOM 7559  N NZ  . LYS C 1 292 ? 48.495  55.677  178.014 1.00 78.07  ? 292 LYS 3 NZ  1 
ATOM 7560  N N   . ARG C 1 293 ? 40.517  55.123  180.749 1.00 21.64  ? 293 ARG 3 N   1 
ATOM 7561  C CA  . ARG C 1 293 ? 39.076  55.125  180.430 1.00 27.48  ? 293 ARG 3 CA  1 
ATOM 7562  C C   . ARG C 1 293 ? 38.671  56.339  179.684 1.00 27.27  ? 293 ARG 3 C   1 
ATOM 7563  O O   . ARG C 1 293 ? 39.031  57.458  180.052 1.00 30.48  ? 293 ARG 3 O   1 
ATOM 7564  C CB  . ARG C 1 293 ? 38.192  55.035  181.696 1.00 36.28  ? 293 ARG 3 CB  1 
ATOM 7565  C CG  . ARG C 1 293 ? 36.644  55.036  181.470 1.00 23.11  ? 293 ARG 3 CG  1 
ATOM 7566  C CD  . ARG C 1 293 ? 36.230  54.074  180.335 1.00 63.20  ? 293 ARG 3 CD  1 
ATOM 7567  N NE  . ARG C 1 293 ? 34.868  53.512  180.411 1.00 57.74  ? 293 ARG 3 NE  1 
ATOM 7568  C CZ  . ARG C 1 293 ? 34.414  52.759  181.421 1.00 33.19  ? 293 ARG 3 CZ  1 
ATOM 7569  N NH1 . ARG C 1 293 ? 35.199  52.512  182.441 1.00 14.96  ? 293 ARG 3 NH1 1 
ATOM 7570  N NH2 . ARG C 1 293 ? 33.228  52.143  181.371 1.00 38.82  ? 293 ARG 3 NH2 1 
ATOM 7571  N N   . SER C 1 294 ? 37.828  56.109  178.694 1.00 29.48  ? 294 SER 3 N   1 
ATOM 7572  C CA  . SER C 1 294 ? 37.311  57.171  177.860 1.00 31.62  ? 294 SER 3 CA  1 
ATOM 7573  C C   . SER C 1 294 ? 36.026  57.833  178.414 1.00 30.64  ? 294 SER 3 C   1 
ATOM 7574  O O   . SER C 1 294 ? 34.997  57.159  178.582 1.00 49.28  ? 294 SER 3 O   1 
ATOM 7575  C CB  . SER C 1 294 ? 37.045  56.579  176.496 1.00 22.37  ? 294 SER 3 CB  1 
ATOM 7576  O OG  . SER C 1 294 ? 36.676  57.612  175.621 1.00 37.55  ? 294 SER 3 OG  1 
ATOM 7577  N N   . VAL C 1 295 ? 36.096  59.138  178.677 1.00 23.64  ? 295 VAL 3 N   1 
ATOM 7578  C CA  . VAL C 1 295 ? 34.977  59.925  179.204 1.00 32.26  ? 295 VAL 3 CA  1 
ATOM 7579  C C   . VAL C 1 295 ? 34.601  61.068  178.270 1.00 44.78  ? 295 VAL 3 C   1 
ATOM 7580  O O   . VAL C 1 295 ? 35.156  61.195  177.191 1.00 57.58  ? 295 VAL 3 O   1 
ATOM 7581  C CB  . VAL C 1 295 ? 35.318  60.568  180.555 1.00 33.08  ? 295 VAL 3 CB  1 
ATOM 7582  C CG1 . VAL C 1 295 ? 35.709  59.532  181.527 1.00 58.30  ? 295 VAL 3 CG1 1 
ATOM 7583  C CG2 . VAL C 1 295 ? 36.434  61.559  180.404 1.00 22.86  ? 295 VAL 3 CG2 1 
ATOM 7584  N N   . LYS C 1 296 ? 33.722  61.958  178.720 1.00 54.45  ? 296 LYS 3 N   1 
ATOM 7585  C CA  . LYS C 1 296 ? 33.289  63.083  177.896 1.00 64.66  ? 296 LYS 3 CA  1 
ATOM 7586  C C   . LYS C 1 296 ? 33.824  64.316  178.599 1.00 73.13  ? 296 LYS 3 C   1 
ATOM 7587  O O   . LYS C 1 296 ? 33.223  64.762  179.576 1.00 77.99  ? 296 LYS 3 O   1 
ATOM 7588  C CB  . LYS C 1 296 ? 31.769  63.125  177.890 1.00 71.63  ? 296 LYS 3 CB  1 
ATOM 7589  C CG  . LYS C 1 296 ? 31.154  63.768  176.663 1.00 96.58  ? 296 LYS 3 CG  1 
ATOM 7590  C CD  . LYS C 1 296 ? 29.612  63.678  176.727 1.00 120.84 ? 296 LYS 3 CD  1 
ATOM 7591  C CE  . LYS C 1 296 ? 28.974  64.812  177.563 1.00 131.37 ? 296 LYS 3 CE  1 
ATOM 7592  N NZ  . LYS C 1 296 ? 27.964  64.403  178.606 1.00 125.36 ? 296 LYS 3 NZ  1 
ATOM 7593  N N   . ASN C 1 297 ? 35.004  64.784  178.182 1.00 80.84  ? 297 ASN 3 N   1 
ATOM 7594  C CA  . ASN C 1 297 ? 35.668  65.946  178.788 1.00 87.89  ? 297 ASN 3 CA  1 
ATOM 7595  C C   . ASN C 1 297 ? 34.706  66.910  179.372 1.00 92.51  ? 297 ASN 3 C   1 
ATOM 7596  O O   . ASN C 1 297 ? 34.016  67.628  178.638 1.00 109.30 ? 297 ASN 3 O   1 
ATOM 7597  C CB  . ASN C 1 297 ? 36.554  66.709  177.818 1.00 97.92  ? 297 ASN 3 CB  1 
ATOM 7598  C CG  . ASN C 1 297 ? 37.526  67.602  178.536 1.00 106.61 ? 297 ASN 3 CG  1 
ATOM 7599  O OD1 . ASN C 1 297 ? 37.501  67.696  179.777 1.00 101.96 ? 297 ASN 3 OD1 1 
ATOM 7600  N ND2 . ASN C 1 297 ? 38.412  68.252  177.787 1.00 128.30 ? 297 ASN 3 ND2 1 
ATOM 7601  N N   . PRO C 1 298 ? 34.577  66.869  180.698 1.00 98.21  ? 298 PRO 3 N   1 
ATOM 7602  C CA  . PRO C 1 298 ? 33.699  67.723  181.497 1.00 115.58 ? 298 PRO 3 CA  1 
ATOM 7603  C C   . PRO C 1 298 ? 34.169  69.178  181.683 1.00 129.11 ? 298 PRO 3 C   1 
ATOM 7604  O O   . PRO C 1 298 ? 33.409  70.140  181.463 1.00 134.48 ? 298 PRO 3 O   1 
ATOM 7605  C CB  . PRO C 1 298 ? 33.628  66.971  182.824 1.00 108.50 ? 298 PRO 3 CB  1 
ATOM 7606  C CG  . PRO C 1 298 ? 34.984  66.292  182.922 1.00 95.47  ? 298 PRO 3 CG  1 
ATOM 7607  C CD  . PRO C 1 298 ? 35.166  65.785  181.523 1.00 94.93  ? 298 PRO 3 CD  1 
ATOM 7608  N N   . TYR C 1 299 ? 35.435  69.317  182.058 1.00 136.99 ? 299 TYR 3 N   1 
ATOM 7609  C CA  . TYR C 1 299 ? 36.108  70.585  182.339 1.00 137.76 ? 299 TYR 3 CA  1 
ATOM 7610  C C   . TYR C 1 299 ? 36.200  71.775  181.376 1.00 133.99 ? 299 TYR 3 C   1 
ATOM 7611  O O   . TYR C 1 299 ? 35.989  72.919  181.770 1.00 138.11 ? 299 TYR 3 O   1 
ATOM 7612  C CB  . TYR C 1 299 ? 37.544  70.240  182.778 1.00 139.06 ? 299 TYR 3 CB  1 
ATOM 7613  C CG  . TYR C 1 299 ? 37.575  69.367  183.996 1.00 141.46 ? 299 TYR 3 CG  1 
ATOM 7614  C CD1 . TYR C 1 299 ? 36.991  69.812  185.180 1.00 144.88 ? 299 TYR 3 CD1 1 
ATOM 7615  C CD2 . TYR C 1 299 ? 38.109  68.071  183.964 1.00 131.30 ? 299 TYR 3 CD2 1 
ATOM 7616  C CE1 . TYR C 1 299 ? 36.918  69.014  186.304 1.00 142.83 ? 299 TYR 3 CE1 1 
ATOM 7617  C CE2 . TYR C 1 299 ? 38.043  67.247  185.103 1.00 135.41 ? 299 TYR 3 CE2 1 
ATOM 7618  C CZ  . TYR C 1 299 ? 37.439  67.742  186.266 1.00 137.44 ? 299 TYR 3 CZ  1 
ATOM 7619  O OH  . TYR C 1 299 ? 37.348  67.033  187.431 1.00 137.06 ? 299 TYR 3 OH  1 
ATOM 7620  N N   . PRO C 1 300 ? 36.370  71.490  180.075 1.00 132.20 ? 300 PRO 3 N   1 
ATOM 7621  C CA  . PRO C 1 300 ? 36.521  72.552  179.091 1.00 129.19 ? 300 PRO 3 CA  1 
ATOM 7622  C C   . PRO C 1 300 ? 35.772  73.841  179.006 1.00 128.95 ? 300 PRO 3 C   1 
ATOM 7623  O O   . PRO C 1 300 ? 34.794  74.131  179.729 1.00 117.34 ? 300 PRO 3 O   1 
ATOM 7624  C CB  . PRO C 1 300 ? 36.567  71.791  177.773 1.00 120.28 ? 300 PRO 3 CB  1 
ATOM 7625  C CG  . PRO C 1 300 ? 35.879  70.525  178.049 1.00 130.56 ? 300 PRO 3 CG  1 
ATOM 7626  C CD  . PRO C 1 300 ? 36.249  70.195  179.435 1.00 132.00 ? 300 PRO 3 CD  1 
ATOM 7627  N N   . ILE C 1 301 ? 36.362  74.596  178.079 1.00 129.32 ? 301 ILE 3 N   1 
ATOM 7628  C CA  . ILE C 1 301 ? 36.085  75.946  177.621 1.00 125.65 ? 301 ILE 3 CA  1 
ATOM 7629  C C   . ILE C 1 301 ? 35.136  76.855  178.379 1.00 127.88 ? 301 ILE 3 C   1 
ATOM 7630  O O   . ILE C 1 301 ? 35.608  77.770  179.056 1.00 127.29 ? 301 ILE 3 O   1 
ATOM 7631  C CB  . ILE C 1 301 ? 35.839  75.998  176.100 1.00 113.84 ? 301 ILE 3 CB  1 
ATOM 7632  C CG1 . ILE C 1 301 ? 36.852  75.095  175.349 1.00 103.18 ? 301 ILE 3 CG1 1 
ATOM 7633  C CG2 . ILE C 1 301 ? 36.029  77.413  175.615 1.00 109.04 ? 301 ILE 3 CG2 1 
ATOM 7634  C CD1 . ILE C 1 301 ? 38.310  75.162  175.852 1.00 87.80  ? 301 ILE 3 CD1 1 
ATOM 7635  N N   . SER C 1 302 ? 33.831  76.607  178.329 1.00 128.17 ? 302 SER 3 N   1 
ATOM 7636  C CA  . SER C 1 302 ? 32.944  77.512  179.041 1.00 133.19 ? 302 SER 3 CA  1 
ATOM 7637  C C   . SER C 1 302 ? 33.344  77.536  180.512 1.00 124.22 ? 302 SER 3 C   1 
ATOM 7638  O O   . SER C 1 302 ? 33.370  78.601  181.129 1.00 121.84 ? 302 SER 3 O   1 
ATOM 7639  C CB  . SER C 1 302 ? 31.450  77.170  178.860 1.00 144.21 ? 302 SER 3 CB  1 
ATOM 7640  O OG  . SER C 1 302 ? 30.610  78.311  179.086 1.00 145.84 ? 302 SER 3 OG  1 
ATOM 7641  N N   . PHE C 1 303 ? 33.774  76.409  181.064 1.00 105.98 ? 303 PHE 3 N   1 
ATOM 7642  C CA  . PHE C 1 303 ? 34.134  76.473  182.455 1.00 101.79 ? 303 PHE 3 CA  1 
ATOM 7643  C C   . PHE C 1 303 ? 35.357  77.353  182.732 1.00 89.18  ? 303 PHE 3 C   1 
ATOM 7644  O O   . PHE C 1 303 ? 35.432  78.043  183.752 1.00 64.58  ? 303 PHE 3 O   1 
ATOM 7645  C CB  . PHE C 1 303 ? 34.229  75.091  183.062 1.00 117.79 ? 303 PHE 3 CB  1 
ATOM 7646  C CG  . PHE C 1 303 ? 33.490  74.988  184.363 1.00 140.37 ? 303 PHE 3 CG  1 
ATOM 7647  C CD1 . PHE C 1 303 ? 32.133  74.673  184.387 1.00 142.46 ? 303 PHE 3 CD1 1 
ATOM 7648  C CD2 . PHE C 1 303 ? 34.132  75.274  185.566 1.00 152.18 ? 303 PHE 3 CD2 1 
ATOM 7649  C CE1 . PHE C 1 303 ? 31.423  74.650  185.591 1.00 140.97 ? 303 PHE 3 CE1 1 
ATOM 7650  C CE2 . PHE C 1 303 ? 33.431  75.252  186.778 1.00 157.54 ? 303 PHE 3 CE2 1 
ATOM 7651  C CZ  . PHE C 1 303 ? 32.074  74.939  186.789 1.00 150.50 ? 303 PHE 3 CZ  1 
ATOM 7652  N N   . LEU C 1 304 ? 36.272  77.393  181.775 1.00 83.32  ? 304 LEU 3 N   1 
ATOM 7653  C CA  . LEU C 1 304 ? 37.466  78.223  181.893 1.00 82.25  ? 304 LEU 3 CA  1 
ATOM 7654  C C   . LEU C 1 304 ? 36.992  79.622  181.631 1.00 74.65  ? 304 LEU 3 C   1 
ATOM 7655  O O   . LEU C 1 304 ? 37.561  80.591  182.130 1.00 69.42  ? 304 LEU 3 O   1 
ATOM 7656  C CB  . LEU C 1 304 ? 38.461  77.898  180.794 1.00 90.73  ? 304 LEU 3 CB  1 
ATOM 7657  C CG  . LEU C 1 304 ? 38.383  76.480  180.264 1.00 98.28  ? 304 LEU 3 CG  1 
ATOM 7658  C CD1 . LEU C 1 304 ? 39.313  76.327  179.073 1.00 90.02  ? 304 LEU 3 CD1 1 
ATOM 7659  C CD2 . LEU C 1 304 ? 38.712  75.507  181.394 1.00 105.73 ? 304 LEU 3 CD2 1 
ATOM 7660  N N   . LEU C 1 305 ? 35.993  79.706  180.757 1.00 68.14  ? 305 LEU 3 N   1 
ATOM 7661  C CA  . LEU C 1 305 ? 35.391  80.968  180.356 1.00 77.58  ? 305 LEU 3 CA  1 
ATOM 7662  C C   . LEU C 1 305 ? 34.892  81.605  181.634 1.00 80.43  ? 305 LEU 3 C   1 
ATOM 7663  O O   . LEU C 1 305 ? 35.388  82.643  182.072 1.00 80.27  ? 305 LEU 3 O   1 
ATOM 7664  C CB  . LEU C 1 305 ? 34.208  80.725  179.409 1.00 70.80  ? 305 LEU 3 CB  1 
ATOM 7665  C CG  . LEU C 1 305 ? 33.893  81.631  178.204 1.00 73.71  ? 305 LEU 3 CG  1 
ATOM 7666  C CD1 . LEU C 1 305 ? 34.049  83.103  178.571 1.00 78.44  ? 305 LEU 3 CD1 1 
ATOM 7667  C CD2 . LEU C 1 305 ? 34.788  81.277  177.014 1.00 70.85  ? 305 LEU 3 CD2 1 
ATOM 7668  N N   . SER C 1 306 ? 33.926  80.951  182.254 1.00 82.58  ? 306 SER 3 N   1 
ATOM 7669  C CA  . SER C 1 306 ? 33.381  81.447  183.488 1.00 90.07  ? 306 SER 3 CA  1 
ATOM 7670  C C   . SER C 1 306 ? 34.548  81.628  184.460 1.00 87.79  ? 306 SER 3 C   1 
ATOM 7671  O O   . SER C 1 306 ? 34.713  82.731  185.009 1.00 81.38  ? 306 SER 3 O   1 
ATOM 7672  C CB  . SER C 1 306 ? 32.346  80.458  184.031 1.00 103.21 ? 306 SER 3 CB  1 
ATOM 7673  O OG  . SER C 1 306 ? 31.341  80.192  183.064 1.00 122.87 ? 306 SER 3 OG  1 
ATOM 7674  N N   . ASP C 1 307 ? 35.394  80.589  184.577 1.00 82.33  ? 307 ASP 3 N   1 
ATOM 7675  C CA  . ASP C 1 307 ? 36.560  80.595  185.472 1.00 83.96  ? 307 ASP 3 CA  1 
ATOM 7676  C C   . ASP C 1 307 ? 37.174  81.975  185.415 1.00 83.55  ? 307 ASP 3 C   1 
ATOM 7677  O O   . ASP C 1 307 ? 37.385  82.633  186.443 1.00 80.75  ? 307 ASP 3 O   1 
ATOM 7678  C CB  . ASP C 1 307 ? 37.607  79.537  185.047 1.00 85.65  ? 307 ASP 3 CB  1 
ATOM 7679  C CG  . ASP C 1 307 ? 39.069  80.069  185.097 1.00 101.64 ? 307 ASP 3 CG  1 
ATOM 7680  O OD1 . ASP C 1 307 ? 39.582  80.365  186.208 1.00 98.55  ? 307 ASP 3 OD1 1 
ATOM 7681  O OD2 . ASP C 1 307 ? 39.717  80.200  184.024 1.00 103.80 ? 307 ASP 3 OD2 1 
ATOM 7682  N N   . LEU C 1 308 ? 37.350  82.426  184.184 1.00 82.16  ? 308 LEU 3 N   1 
ATOM 7683  C CA  . LEU C 1 308 ? 37.931  83.714  183.882 1.00 91.44  ? 308 LEU 3 CA  1 
ATOM 7684  C C   . LEU C 1 308 ? 37.040  84.907  184.173 1.00 88.74  ? 308 LEU 3 C   1 
ATOM 7685  O O   . LEU C 1 308 ? 37.408  85.813  184.944 1.00 80.02  ? 308 LEU 3 O   1 
ATOM 7686  C CB  . LEU C 1 308 ? 38.349  83.742  182.404 1.00 107.88 ? 308 LEU 3 CB  1 
ATOM 7687  C CG  . LEU C 1 308 ? 38.053  84.974  181.521 1.00 123.81 ? 308 LEU 3 CG  1 
ATOM 7688  C CD1 . LEU C 1 308 ? 38.862  86.225  181.931 1.00 124.30 ? 308 LEU 3 CD1 1 
ATOM 7689  C CD2 . LEU C 1 308 ? 38.337  84.604  180.072 1.00 135.30 ? 308 LEU 3 CD2 1 
ATOM 7690  N N   . ILE C 1 309 ? 35.874  84.914  183.544 1.00 80.30  ? 309 ILE 3 N   1 
ATOM 7691  C CA  . ILE C 1 309 ? 34.986  86.040  183.685 1.00 87.91  ? 309 ILE 3 CA  1 
ATOM 7692  C C   . ILE C 1 309 ? 34.721  86.443  185.136 1.00 97.39  ? 309 ILE 3 C   1 
ATOM 7693  O O   . ILE C 1 309 ? 34.594  87.633  185.419 1.00 96.70  ? 309 ILE 3 O   1 
ATOM 7694  C CB  . ILE C 1 309 ? 33.693  85.901  182.807 1.00 79.55  ? 309 ILE 3 CB  1 
ATOM 7695  C CG1 . ILE C 1 309 ? 34.075  85.436  181.378 1.00 71.81  ? 309 ILE 3 CG1 1 
ATOM 7696  C CG2 . ILE C 1 309 ? 32.955  87.260  182.750 1.00 68.32  ? 309 ILE 3 CG2 1 
ATOM 7697  C CD1 . ILE C 1 309 ? 33.170  85.932  180.224 1.00 51.11  ? 309 ILE 3 CD1 1 
ATOM 7698  N N   . ASN C 1 310 ? 34.768  85.495  186.070 1.00 102.52 ? 310 ASN 3 N   1 
ATOM 7699  C CA  . ASN C 1 310 ? 34.534  85.847  187.475 1.00 119.32 ? 310 ASN 3 CA  1 
ATOM 7700  C C   . ASN C 1 310 ? 35.683  86.648  188.066 1.00 120.19 ? 310 ASN 3 C   1 
ATOM 7701  O O   . ASN C 1 310 ? 35.544  87.330  189.093 1.00 119.72 ? 310 ASN 3 O   1 
ATOM 7702  C CB  . ASN C 1 310 ? 34.259  84.612  188.333 1.00 132.90 ? 310 ASN 3 CB  1 
ATOM 7703  C CG  . ASN C 1 310 ? 32.774  84.422  188.608 1.00 141.99 ? 310 ASN 3 CG  1 
ATOM 7704  O OD1 . ASN C 1 310 ? 32.232  84.900  189.619 1.00 144.67 ? 310 ASN 3 OD1 1 
ATOM 7705  N ND2 . ASN C 1 310 ? 32.100  83.744  187.688 1.00 138.69 ? 310 ASN 3 ND2 1 
ATOM 7706  N N   . ARG C 1 311 ? 36.828  86.524  187.416 1.00 117.43 ? 311 ARG 3 N   1 
ATOM 7707  C CA  . ARG C 1 311 ? 38.028  87.225  187.818 1.00 127.74 ? 311 ARG 3 CA  1 
ATOM 7708  C C   . ARG C 1 311 ? 37.970  88.631  187.239 1.00 129.39 ? 311 ARG 3 C   1 
ATOM 7709  O O   . ARG C 1 311 ? 38.517  89.585  187.813 1.00 126.18 ? 311 ARG 3 O   1 
ATOM 7710  C CB  . ARG C 1 311 ? 39.238  86.463  187.295 1.00 131.70 ? 311 ARG 3 CB  1 
ATOM 7711  C CG  . ARG C 1 311 ? 39.388  85.086  187.943 1.00 143.93 ? 311 ARG 3 CG  1 
ATOM 7712  C CD  . ARG C 1 311 ? 39.949  84.051  186.981 1.00 141.71 ? 311 ARG 3 CD  1 
ATOM 7713  N NE  . ARG C 1 311 ? 41.085  84.565  186.223 1.00 140.15 ? 311 ARG 3 NE  1 
ATOM 7714  C CZ  . ARG C 1 311 ? 41.626  83.952  185.174 1.00 135.31 ? 311 ARG 3 CZ  1 
ATOM 7715  N NH1 . ARG C 1 311 ? 41.139  82.775  184.753 1.00 120.34 ? 311 ARG 3 NH1 1 
ATOM 7716  N NH2 . ARG C 1 311 ? 42.623  84.550  184.522 1.00 129.21 ? 311 ARG 3 NH2 1 
ATOM 7717  N N   . ARG C 1 312 ? 37.288  88.735  186.099 1.00 130.46 ? 312 ARG 3 N   1 
ATOM 7718  C CA  . ARG C 1 312 ? 37.096  90.001  185.391 1.00 138.13 ? 312 ARG 3 CA  1 
ATOM 7719  C C   . ARG C 1 312 ? 35.960  90.836  186.042 1.00 133.97 ? 312 ARG 3 C   1 
ATOM 7720  O O   . ARG C 1 312 ? 36.049  92.076  186.117 1.00 141.32 ? 312 ARG 3 O   1 
ATOM 7721  C CB  . ARG C 1 312 ? 36.851  89.727  183.886 1.00 135.51 ? 312 ARG 3 CB  1 
ATOM 7722  C CG  . ARG C 1 312 ? 36.430  90.933  183.043 1.00 136.83 ? 312 ARG 3 CG  1 
ATOM 7723  C CD  . ARG C 1 312 ? 34.934  90.875  182.742 1.00 141.60 ? 312 ARG 3 CD  1 
ATOM 7724  N NE  . ARG C 1 312 ? 34.281  92.184  182.824 1.00 149.61 ? 312 ARG 3 NE  1 
ATOM 7725  C CZ  . ARG C 1 312 ? 33.763  92.820  181.778 1.00 148.90 ? 312 ARG 3 CZ  1 
ATOM 7726  N NH1 . ARG C 1 312 ? 33.838  92.263  180.571 1.00 144.28 ? 312 ARG 3 NH1 1 
ATOM 7727  N NH2 . ARG C 1 312 ? 33.118  93.972  181.953 1.00 149.53 ? 312 ARG 3 NH2 1 
ATOM 7728  N N   . THR C 1 313 ? 34.884  90.176  186.476 1.00 122.34 ? 313 THR 3 N   1 
ATOM 7729  C CA  . THR C 1 313 ? 33.797  90.891  187.136 1.00 106.18 ? 313 THR 3 CA  1 
ATOM 7730  C C   . THR C 1 313 ? 33.885  90.667  188.628 1.00 94.60  ? 313 THR 3 C   1 
ATOM 7731  O O   . THR C 1 313 ? 34.715  89.903  189.139 1.00 81.59  ? 313 THR 3 O   1 
ATOM 7732  C CB  . THR C 1 313 ? 32.356  90.510  186.649 1.00 104.52 ? 313 THR 3 CB  1 
ATOM 7733  O OG1 . THR C 1 313 ? 32.106  89.114  186.856 1.00 87.53  ? 313 THR 3 OG1 1 
ATOM 7734  C CG2 . THR C 1 313 ? 32.136  90.901  185.186 1.00 95.65  ? 313 THR 3 CG2 1 
ATOM 7735  N N   . GLN C 1 314 ? 32.966  91.297  189.325 1.00 86.42  ? 314 GLN 3 N   1 
ATOM 7736  C CA  . GLN C 1 314 ? 32.982  91.199  190.744 1.00 86.06  ? 314 GLN 3 CA  1 
ATOM 7737  C C   . GLN C 1 314 ? 32.111  90.150  191.353 1.00 86.58  ? 314 GLN 3 C   1 
ATOM 7738  O O   . GLN C 1 314 ? 31.229  89.524  190.731 1.00 76.62  ? 314 GLN 3 O   1 
ATOM 7739  C CB  . GLN C 1 314 ? 32.641  92.546  191.365 1.00 95.67  ? 314 GLN 3 CB  1 
ATOM 7740  C CG  . GLN C 1 314 ? 33.435  93.698  190.804 1.00 118.66 ? 314 GLN 3 CG  1 
ATOM 7741  C CD  . GLN C 1 314 ? 34.912  93.554  191.055 1.00 142.41 ? 314 GLN 3 CD  1 
ATOM 7742  O OE1 . GLN C 1 314 ? 35.337  92.798  191.939 1.00 161.74 ? 314 GLN 3 OE1 1 
ATOM 7743  N NE2 . GLN C 1 314 ? 35.714  94.272  190.273 1.00 150.44 ? 314 GLN 3 NE2 1 
ATOM 7744  N N   . ARG C 1 315 ? 32.429  89.969  192.618 1.00 87.13  ? 315 ARG 3 N   1 
ATOM 7745  C CA  . ARG C 1 315 ? 31.741  89.066  193.477 1.00 90.41  ? 315 ARG 3 CA  1 
ATOM 7746  C C   . ARG C 1 315 ? 30.977  90.088  194.267 1.00 67.59  ? 315 ARG 3 C   1 
ATOM 7747  O O   . ARG C 1 315 ? 31.527  91.073  194.768 1.00 66.55  ? 315 ARG 3 O   1 
ATOM 7748  C CB  . ARG C 1 315 ? 32.721  88.338  194.394 1.00 118.74 ? 315 ARG 3 CB  1 
ATOM 7749  C CG  . ARG C 1 315 ? 34.001  87.875  193.711 1.00 155.45 ? 315 ARG 3 CG  1 
ATOM 7750  C CD  . ARG C 1 315 ? 35.171  88.857  193.915 1.00 177.80 ? 315 ARG 3 CD  1 
ATOM 7751  N NE  . ARG C 1 315 ? 36.462  88.214  193.649 1.00 198.10 ? 315 ARG 3 NE  1 
ATOM 7752  C CZ  . ARG C 1 315 ? 36.920  87.140  194.300 1.00 207.32 ? 315 ARG 3 CZ  1 
ATOM 7753  N NH1 . ARG C 1 315 ? 36.203  86.575  195.274 1.00 212.16 ? 315 ARG 3 NH1 1 
ATOM 7754  N NH2 . ARG C 1 315 ? 38.085  86.598  193.957 1.00 212.85 ? 315 ARG 3 NH2 1 
ATOM 7755  N N   . VAL C 1 316 ? 29.685  89.903  194.293 1.00 47.13  ? 316 VAL 3 N   1 
ATOM 7756  C CA  . VAL C 1 316 ? 28.864  90.807  195.026 1.00 39.66  ? 316 VAL 3 CA  1 
ATOM 7757  C C   . VAL C 1 316 ? 28.268  90.152  196.272 1.00 43.39  ? 316 VAL 3 C   1 
ATOM 7758  O O   . VAL C 1 316 ? 27.680  89.039  196.234 1.00 41.78  ? 316 VAL 3 O   1 
ATOM 7759  C CB  . VAL C 1 316 ? 27.778  91.312  194.124 1.00 40.04  ? 316 VAL 3 CB  1 
ATOM 7760  C CG1 . VAL C 1 316 ? 26.929  92.331  194.836 1.00 30.07  ? 316 VAL 3 CG1 1 
ATOM 7761  C CG2 . VAL C 1 316 ? 28.404  91.855  192.870 1.00 40.02  ? 316 VAL 3 CG2 1 
ATOM 7762  N N   . ASP C 1 317 ? 28.526  90.789  197.402 1.00 42.64  ? 317 ASP 3 N   1 
ATOM 7763  C CA  . ASP C 1 317 ? 27.960  90.311  198.644 1.00 46.88  ? 317 ASP 3 CA  1 
ATOM 7764  C C   . ASP C 1 317 ? 26.586  90.962  198.572 1.00 43.09  ? 317 ASP 3 C   1 
ATOM 7765  O O   . ASP C 1 317 ? 26.451  92.182  198.790 1.00 28.54  ? 317 ASP 3 O   1 
ATOM 7766  C CB  . ASP C 1 317 ? 28.726  90.825  199.863 1.00 61.18  ? 317 ASP 3 CB  1 
ATOM 7767  C CG  . ASP C 1 317 ? 27.959  90.601  201.156 1.00 92.21  ? 317 ASP 3 CG  1 
ATOM 7768  O OD1 . ASP C 1 317 ? 28.113  89.505  201.724 1.00 117.79 ? 317 ASP 3 OD1 1 
ATOM 7769  O OD2 . ASP C 1 317 ? 27.189  91.497  201.599 1.00 104.07 ? 317 ASP 3 OD2 1 
ATOM 7770  N N   . GLY C 1 318 ? 25.595  90.180  198.146 1.00 41.86  ? 318 GLY 3 N   1 
ATOM 7771  C CA  . GLY C 1 318 ? 24.262  90.728  198.008 1.00 44.00  ? 318 GLY 3 CA  1 
ATOM 7772  C C   . GLY C 1 318 ? 23.239  89.962  198.774 1.00 36.34  ? 318 GLY 3 C   1 
ATOM 7773  O O   . GLY C 1 318 ? 23.574  89.094  199.562 1.00 57.77  ? 318 GLY 3 O   1 
ATOM 7774  N N   . GLN C 1 319 ? 21.990  90.360  198.653 1.00 30.06  ? 319 GLN 3 N   1 
ATOM 7775  C CA  . GLN C 1 319 ? 20.964  89.615  199.332 1.00 20.50  ? 319 GLN 3 CA  1 
ATOM 7776  C C   . GLN C 1 319 ? 20.957  88.204  198.715 1.00 26.01  ? 319 GLN 3 C   1 
ATOM 7777  O O   . GLN C 1 319 ? 21.352  87.971  197.538 1.00 29.97  ? 319 GLN 3 O   1 
ATOM 7778  C CB  . GLN C 1 319 ? 19.620  90.315  199.235 1.00 3.66   ? 319 GLN 3 CB  1 
ATOM 7779  C CG  . GLN C 1 319 ? 19.685  91.691  199.814 1.00 18.08  ? 319 GLN 3 CG  1 
ATOM 7780  C CD  . GLN C 1 319 ? 18.339  92.357  199.889 1.00 32.11  ? 319 GLN 3 CD  1 
ATOM 7781  O OE1 . GLN C 1 319 ? 18.227  93.569  199.740 1.00 26.45  ? 319 GLN 3 OE1 1 
ATOM 7782  N NE2 . GLN C 1 319 ? 17.297  91.565  200.135 1.00 40.25  ? 319 GLN 3 NE2 1 
ATOM 7783  N N   . PRO C 1 320 ? 20.616  87.233  199.550 1.00 20.76  ? 320 PRO 3 N   1 
ATOM 7784  C CA  . PRO C 1 320 ? 20.502  85.788  199.384 1.00 20.72  ? 320 PRO 3 CA  1 
ATOM 7785  C C   . PRO C 1 320 ? 19.637  85.298  198.280 1.00 17.53  ? 320 PRO 3 C   1 
ATOM 7786  O O   . PRO C 1 320 ? 18.427  85.316  198.399 1.00 16.46  ? 320 PRO 3 O   1 
ATOM 7787  C CB  . PRO C 1 320 ? 19.882  85.364  200.697 1.00 13.28  ? 320 PRO 3 CB  1 
ATOM 7788  C CG  . PRO C 1 320 ? 20.353  86.386  201.649 1.00 23.67  ? 320 PRO 3 CG  1 
ATOM 7789  C CD  . PRO C 1 320 ? 20.143  87.622  200.883 1.00 27.25  ? 320 PRO 3 CD  1 
ATOM 7790  N N   . MET C 1 321 ? 20.233  84.852  197.198 1.00 12.30  ? 321 MET 3 N   1 
ATOM 7791  C CA  . MET C 1 321 ? 19.382  84.296  196.180 1.00 22.95  ? 321 MET 3 CA  1 
ATOM 7792  C C   . MET C 1 321 ? 19.597  82.791  196.356 1.00 29.15  ? 321 MET 3 C   1 
ATOM 7793  O O   . MET C 1 321 ? 19.281  81.952  195.500 1.00 16.58  ? 321 MET 3 O   1 
ATOM 7794  C CB  . MET C 1 321 ? 19.792  84.824  194.805 1.00 29.07  ? 321 MET 3 CB  1 
ATOM 7795  C CG  . MET C 1 321 ? 19.254  86.221  194.574 1.00 12.41  ? 321 MET 3 CG  1 
ATOM 7796  S SD  . MET C 1 321 ? 17.542  86.247  195.108 1.00 46.25  ? 321 MET 3 SD  1 
ATOM 7797  C CE  . MET C 1 321 ? 17.406  87.859  195.761 1.00 7.30   ? 321 MET 3 CE  1 
ATOM 7798  N N   . ILE C 1 322 ? 19.991  82.411  197.559 1.00 39.56  ? 322 ILE 3 N   1 
ATOM 7799  C CA  . ILE C 1 322 ? 20.301  81.017  197.710 1.00 40.52  ? 322 ILE 3 CA  1 
ATOM 7800  C C   . ILE C 1 322 ? 20.243  80.306  199.055 1.00 46.96  ? 322 ILE 3 C   1 
ATOM 7801  O O   . ILE C 1 322 ? 20.439  80.892  200.144 1.00 49.92  ? 322 ILE 3 O   1 
ATOM 7802  C CB  . ILE C 1 322 ? 21.652  80.791  197.061 1.00 38.26  ? 322 ILE 3 CB  1 
ATOM 7803  C CG1 . ILE C 1 322 ? 21.522  79.721  196.011 1.00 17.40  ? 322 ILE 3 CG1 1 
ATOM 7804  C CG2 . ILE C 1 322 ? 22.742  80.556  198.103 1.00 47.08  ? 322 ILE 3 CG2 1 
ATOM 7805  C CD1 . ILE C 1 322 ? 22.758  79.597  195.190 1.00 73.03  ? 322 ILE 3 CD1 1 
ATOM 7806  N N   . GLY C 1 323 ? 19.990  79.008  198.956 1.00 33.45  ? 323 GLY 3 N   1 
ATOM 7807  C CA  . GLY C 1 323 ? 19.910  78.207  200.146 1.00 50.16  ? 323 GLY 3 CA  1 
ATOM 7808  C C   . GLY C 1 323 ? 18.688  78.416  201.000 1.00 49.16  ? 323 GLY 3 C   1 
ATOM 7809  O O   . GLY C 1 323 ? 17.594  78.705  200.523 1.00 62.30  ? 323 GLY 3 O   1 
ATOM 7810  N N   . MET C 1 324 ? 18.899  78.308  202.294 1.00 57.85  ? 324 MET 3 N   1 
ATOM 7811  C CA  . MET C 1 324 ? 17.802  78.412  203.211 1.00 71.59  ? 324 MET 3 CA  1 
ATOM 7812  C C   . MET C 1 324 ? 17.098  79.731  203.131 1.00 64.40  ? 324 MET 3 C   1 
ATOM 7813  O O   . MET C 1 324 ? 15.875  79.808  203.278 1.00 73.39  ? 324 MET 3 O   1 
ATOM 7814  C CB  . MET C 1 324 ? 18.296  78.172  204.639 1.00 107.10 ? 324 MET 3 CB  1 
ATOM 7815  C CG  . MET C 1 324 ? 17.450  77.156  205.385 1.00 128.52 ? 324 MET 3 CG  1 
ATOM 7816  S SD  . MET C 1 324 ? 17.173  75.692  204.335 1.00 158.38 ? 324 MET 3 SD  1 
ATOM 7817  C CE  . MET C 1 324 ? 17.943  74.422  205.360 1.00 153.74 ? 324 MET 3 CE  1 
ATOM 7818  N N   . SER C 1 325 ? 17.842  80.765  202.798 1.00 49.76  ? 325 SER 3 N   1 
ATOM 7819  C CA  . SER C 1 325 ? 17.220  82.060  202.805 1.00 53.02  ? 325 SER 3 CA  1 
ATOM 7820  C C   . SER C 1 325 ? 16.986  82.730  201.470 1.00 49.04  ? 325 SER 3 C   1 
ATOM 7821  O O   . SER C 1 325 ? 16.732  83.939  201.420 1.00 52.45  ? 325 SER 3 O   1 
ATOM 7822  C CB  . SER C 1 325 ? 18.029  82.959  203.720 1.00 64.94  ? 325 SER 3 CB  1 
ATOM 7823  O OG  . SER C 1 325 ? 18.576  82.195  204.777 1.00 80.99  ? 325 SER 3 OG  1 
ATOM 7824  N N   . SER C 1 326 ? 16.993  81.945  200.401 1.00 38.10  ? 326 SER 3 N   1 
ATOM 7825  C CA  . SER C 1 326 ? 16.806  82.491  199.074 1.00 24.73  ? 326 SER 3 CA  1 
ATOM 7826  C C   . SER C 1 326 ? 15.607  83.413  198.983 1.00 28.09  ? 326 SER 3 C   1 
ATOM 7827  O O   . SER C 1 326 ? 14.503  83.034  199.360 1.00 47.63  ? 326 SER 3 O   1 
ATOM 7828  C CB  . SER C 1 326 ? 16.628  81.369  198.089 1.00 14.32  ? 326 SER 3 CB  1 
ATOM 7829  O OG  . SER C 1 326 ? 16.635  81.901  196.786 1.00 49.09  ? 326 SER 3 OG  1 
ATOM 7830  N N   . GLN C 1 327 ? 15.814  84.614  198.454 1.00 21.80  ? 327 GLN 3 N   1 
ATOM 7831  C CA  . GLN C 1 327 ? 14.726  85.586  198.306 1.00 26.98  ? 327 GLN 3 CA  1 
ATOM 7832  C C   . GLN C 1 327 ? 14.139  85.444  196.892 1.00 25.91  ? 327 GLN 3 C   1 
ATOM 7833  O O   . GLN C 1 327 ? 13.640  86.404  196.286 1.00 37.54  ? 327 GLN 3 O   1 
ATOM 7834  C CB  . GLN C 1 327 ? 15.218  87.017  198.610 1.00 9.98   ? 327 GLN 3 CB  1 
ATOM 7835  C CG  . GLN C 1 327 ? 16.068  87.087  199.866 1.00 12.15  ? 327 GLN 3 CG  1 
ATOM 7836  C CD  . GLN C 1 327 ? 16.433  88.482  200.282 1.00 33.09  ? 327 GLN 3 CD  1 
ATOM 7837  O OE1 . GLN C 1 327 ? 16.078  89.450  199.616 1.00 61.31  ? 327 GLN 3 OE1 1 
ATOM 7838  N NE2 . GLN C 1 327 ? 17.138  88.604  201.405 1.00 48.10  ? 327 GLN 3 NE2 1 
ATOM 7839  N N   . VAL C 1 328 ? 14.319  84.241  196.357 1.00 3.30   ? 328 VAL 3 N   1 
ATOM 7840  C CA  . VAL C 1 328 ? 13.804  83.840  195.070 1.00 3.99   ? 328 VAL 3 CA  1 
ATOM 7841  C C   . VAL C 1 328 ? 12.665  82.951  195.503 1.00 10.82  ? 328 VAL 3 C   1 
ATOM 7842  O O   . VAL C 1 328 ? 12.894  81.881  196.062 1.00 25.53  ? 328 VAL 3 O   1 
ATOM 7843  C CB  . VAL C 1 328 ? 14.737  82.918  194.336 1.00 13.63  ? 328 VAL 3 CB  1 
ATOM 7844  C CG1 . VAL C 1 328 ? 13.995  82.267  193.180 1.00 2.82   ? 328 VAL 3 CG1 1 
ATOM 7845  C CG2 . VAL C 1 328 ? 15.953  83.658  193.890 1.00 21.94  ? 328 VAL 3 CG2 1 
ATOM 7846  N N   . GLU C 1 329 ? 11.449  83.385  195.216 1.00 23.27  ? 329 GLU 3 N   1 
ATOM 7847  C CA  . GLU C 1 329 ? 10.256  82.661  195.591 1.00 10.21  ? 329 GLU 3 CA  1 
ATOM 7848  C C   . GLU C 1 329 ? 9.870   81.590  194.617 1.00 17.00  ? 329 GLU 3 C   1 
ATOM 7849  O O   . GLU C 1 329 ? 9.266   80.608  195.045 1.00 40.17  ? 329 GLU 3 O   1 
ATOM 7850  C CB  . GLU C 1 329 ? 9.059   83.580  195.773 1.00 16.50  ? 329 GLU 3 CB  1 
ATOM 7851  C CG  . GLU C 1 329 ? 9.294   84.858  196.550 1.00 36.45  ? 329 GLU 3 CG  1 
ATOM 7852  C CD  . GLU C 1 329 ? 8.012   85.353  197.135 1.00 44.65  ? 329 GLU 3 CD  1 
ATOM 7853  O OE1 . GLU C 1 329 ? 7.323   84.519  197.786 1.00 49.03  ? 329 GLU 3 OE1 1 
ATOM 7854  O OE2 . GLU C 1 329 ? 7.667   86.539  196.911 1.00 44.37  ? 329 GLU 3 OE2 1 
ATOM 7855  N N   . GLU C 1 330 ? 10.144  81.747  193.320 1.00 15.54  ? 330 GLU 3 N   1 
ATOM 7856  C CA  . GLU C 1 330 ? 9.756   80.668  192.405 1.00 16.87  ? 330 GLU 3 CA  1 
ATOM 7857  C C   . GLU C 1 330 ? 10.367  80.773  191.046 1.00 19.99  ? 330 GLU 3 C   1 
ATOM 7858  O O   . GLU C 1 330 ? 10.602  81.869  190.521 1.00 33.79  ? 330 GLU 3 O   1 
ATOM 7859  C CB  . GLU C 1 330 ? 8.224   80.540  192.299 1.00 16.84  ? 330 GLU 3 CB  1 
ATOM 7860  C CG  . GLU C 1 330 ? 7.656   79.296  191.577 1.00 41.06  ? 330 GLU 3 CG  1 
ATOM 7861  C CD  . GLU C 1 330 ? 6.105   79.201  191.625 1.00 54.30  ? 330 GLU 3 CD  1 
ATOM 7862  O OE1 . GLU C 1 330 ? 5.393   80.233  191.642 1.00 68.83  ? 330 GLU 3 OE1 1 
ATOM 7863  O OE2 . GLU C 1 330 ? 5.573   78.071  191.599 1.00 56.75  ? 330 GLU 3 OE2 1 
ATOM 7864  N N   . VAL C 1 331 ? 10.613  79.604  190.482 1.00 7.60   ? 331 VAL 3 N   1 
ATOM 7865  C CA  . VAL C 1 331 ? 11.204  79.491  189.181 1.00 9.37   ? 331 VAL 3 CA  1 
ATOM 7866  C C   . VAL C 1 331 ? 10.418  78.522  188.394 1.00 16.05  ? 331 VAL 3 C   1 
ATOM 7867  O O   . VAL C 1 331 ? 10.138  77.427  188.856 1.00 27.01  ? 331 VAL 3 O   1 
ATOM 7868  C CB  . VAL C 1 331 ? 12.569  78.913  189.258 1.00 5.97   ? 331 VAL 3 CB  1 
ATOM 7869  C CG1 . VAL C 1 331 ? 13.126  78.787  187.840 1.00 21.64  ? 331 VAL 3 CG1 1 
ATOM 7870  C CG2 . VAL C 1 331 ? 13.441  79.802  190.154 1.00 2.13   ? 331 VAL 3 CG2 1 
ATOM 7871  N N   . ARG C 1 332 ? 10.062  78.914  187.195 1.00 14.26  ? 332 ARG 3 N   1 
ATOM 7872  C CA  . ARG C 1 332 ? 9.314   78.024  186.359 1.00 13.34  ? 332 ARG 3 CA  1 
ATOM 7873  C C   . ARG C 1 332 ? 10.158  77.919  185.132 1.00 15.44  ? 332 ARG 3 C   1 
ATOM 7874  O O   . ARG C 1 332 ? 10.871  78.853  184.769 1.00 20.57  ? 332 ARG 3 O   1 
ATOM 7875  C CB  . ARG C 1 332 ? 7.963   78.621  186.035 1.00 18.32  ? 332 ARG 3 CB  1 
ATOM 7876  C CG  . ARG C 1 332 ? 6.957   78.534  187.163 1.00 40.34  ? 332 ARG 3 CG  1 
ATOM 7877  C CD  . ARG C 1 332 ? 5.743   79.446  186.890 1.00 61.86  ? 332 ARG 3 CD  1 
ATOM 7878  N NE  . ARG C 1 332 ? 4.405   78.849  187.120 1.00 47.85  ? 332 ARG 3 NE  1 
ATOM 7879  C CZ  . ARG C 1 332 ? 3.779   78.802  188.302 1.00 56.62  ? 332 ARG 3 CZ  1 
ATOM 7880  N NH1 . ARG C 1 332 ? 4.365   79.284  189.403 1.00 46.65  ? 332 ARG 3 NH1 1 
ATOM 7881  N NH2 . ARG C 1 332 ? 2.514   78.374  188.368 1.00 61.62  ? 332 ARG 3 NH2 1 
ATOM 7882  N N   . VAL C 1 333 ? 10.134  76.749  184.529 1.00 11.91  ? 333 VAL 3 N   1 
ATOM 7883  C CA  . VAL C 1 333 ? 10.916  76.527  183.344 1.00 4.45   ? 333 VAL 3 CA  1 
ATOM 7884  C C   . VAL C 1 333 ? 10.092  75.864  182.302 1.00 15.48  ? 333 VAL 3 C   1 
ATOM 7885  O O   . VAL C 1 333 ? 9.564   74.764  182.514 1.00 16.52  ? 333 VAL 3 O   1 
ATOM 7886  C CB  . VAL C 1 333 ? 11.980  75.583  183.606 1.00 3.71   ? 333 VAL 3 CB  1 
ATOM 7887  C CG1 . VAL C 1 333 ? 12.808  75.447  182.349 1.00 13.48  ? 333 VAL 3 CG1 1 
ATOM 7888  C CG2 . VAL C 1 333 ? 12.771  76.028  184.806 1.00 9.99   ? 333 VAL 3 CG2 1 
ATOM 7889  N N   . TYR C 1 334 ? 10.160  76.418  181.113 1.00 2.32   ? 334 TYR 3 N   1 
ATOM 7890  C CA  . TYR C 1 334 ? 9.345   75.884  180.072 1.00 9.20   ? 334 TYR 3 CA  1 
ATOM 7891  C C   . TYR C 1 334 ? 10.120  75.373  178.930 1.00 18.52  ? 334 TYR 3 C   1 
ATOM 7892  O O   . TYR C 1 334 ? 11.226  75.891  178.669 1.00 30.15  ? 334 TYR 3 O   1 
ATOM 7893  C CB  . TYR C 1 334 ? 8.482   76.988  179.545 1.00 17.69  ? 334 TYR 3 CB  1 
ATOM 7894  C CG  . TYR C 1 334 ? 7.630   77.591  180.595 1.00 18.03  ? 334 TYR 3 CG  1 
ATOM 7895  C CD1 . TYR C 1 334 ? 8.082   78.644  181.355 1.00 20.02  ? 334 TYR 3 CD1 1 
ATOM 7896  C CD2 . TYR C 1 334 ? 6.367   77.117  180.818 1.00 29.23  ? 334 TYR 3 CD2 1 
ATOM 7897  C CE1 . TYR C 1 334 ? 7.295   79.210  182.329 1.00 31.74  ? 334 TYR 3 CE1 1 
ATOM 7898  C CE2 . TYR C 1 334 ? 5.575   77.672  181.786 1.00 46.73  ? 334 TYR 3 CE2 1 
ATOM 7899  C CZ  . TYR C 1 334 ? 6.037   78.724  182.530 1.00 28.62  ? 334 TYR 3 CZ  1 
ATOM 7900  O OH  . TYR C 1 334 ? 5.196   79.267  183.455 1.00 39.79  ? 334 TYR 3 OH  1 
ATOM 7901  N N   . GLU C 1 335 ? 9.571   74.343  178.278 1.00 6.50   ? 335 GLU 3 N   1 
ATOM 7902  C CA  . GLU C 1 335 ? 10.201  73.847  177.079 1.00 18.31  ? 335 GLU 3 CA  1 
ATOM 7903  C C   . GLU C 1 335 ? 9.326   73.848  175.862 1.00 34.71  ? 335 GLU 3 C   1 
ATOM 7904  O O   . GLU C 1 335 ? 9.471   74.740  175.013 1.00 65.06  ? 335 GLU 3 O   1 
ATOM 7905  C CB  . GLU C 1 335 ? 10.924  72.527  177.226 1.00 42.35  ? 335 GLU 3 CB  1 
ATOM 7906  C CG  . GLU C 1 335 ? 12.340  72.634  176.579 1.00 45.96  ? 335 GLU 3 CG  1 
ATOM 7907  C CD  . GLU C 1 335 ? 13.101  71.353  176.447 1.00 63.62  ? 335 GLU 3 CD  1 
ATOM 7908  O OE1 . GLU C 1 335 ? 13.046  70.473  177.352 1.00 94.36  ? 335 GLU 3 OE1 1 
ATOM 7909  O OE2 . GLU C 1 335 ? 13.777  71.224  175.393 1.00 72.80  ? 335 GLU 3 OE2 1 
ATOM 7910  N N   . ASP C 1 336 ? 8.394   72.925  175.719 1.00 13.75  ? 336 ASP 3 N   1 
ATOM 7911  C CA  . ASP C 1 336 ? 7.647   73.097  174.471 1.00 40.57  ? 336 ASP 3 CA  1 
ATOM 7912  C C   . ASP C 1 336 ? 6.359   73.855  174.709 1.00 34.27  ? 336 ASP 3 C   1 
ATOM 7913  O O   . ASP C 1 336 ? 6.329   74.914  175.348 1.00 39.21  ? 336 ASP 3 O   1 
ATOM 7914  C CB  . ASP C 1 336 ? 7.371   71.776  173.772 1.00 72.52  ? 336 ASP 3 CB  1 
ATOM 7915  C CG  . ASP C 1 336 ? 8.605   71.107  173.331 1.00 99.36  ? 336 ASP 3 CG  1 
ATOM 7916  O OD1 . ASP C 1 336 ? 9.361   71.759  172.551 1.00 89.98  ? 336 ASP 3 OD1 1 
ATOM 7917  O OD2 . ASP C 1 336 ? 8.800   69.936  173.771 1.00 136.52 ? 336 ASP 3 OD2 1 
ATOM 7918  N N   . THR C 1 337 ? 5.291   73.302  174.166 1.00 28.78  ? 337 THR 3 N   1 
ATOM 7919  C CA  . THR C 1 337 ? 3.965   73.832  174.304 1.00 31.32  ? 337 THR 3 CA  1 
ATOM 7920  C C   . THR C 1 337 ? 3.121   72.642  174.690 1.00 28.55  ? 337 THR 3 C   1 
ATOM 7921  O O   . THR C 1 337 ? 3.443   71.516  174.373 1.00 39.01  ? 337 THR 3 O   1 
ATOM 7922  C CB  . THR C 1 337 ? 3.508   74.368  173.029 1.00 24.06  ? 337 THR 3 CB  1 
ATOM 7923  O OG1 . THR C 1 337 ? 3.816   73.423  171.994 1.00 47.87  ? 337 THR 3 OG1 1 
ATOM 7924  C CG2 . THR C 1 337 ? 4.207   75.648  172.784 1.00 48.17  ? 337 THR 3 CG2 1 
ATOM 7925  N N   . GLU C 1 338 ? 1.985   72.927  175.282 1.00 31.84  ? 338 GLU 3 N   1 
ATOM 7926  C CA  . GLU C 1 338 ? 1.086   71.938  175.836 1.00 15.07  ? 338 GLU 3 CA  1 
ATOM 7927  C C   . GLU C 1 338 ? -0.314  72.494  175.528 1.00 23.42  ? 338 GLU 3 C   1 
ATOM 7928  O O   . GLU C 1 338 ? -0.480  73.684  175.201 1.00 24.40  ? 338 GLU 3 O   1 
ATOM 7929  C CB  . GLU C 1 338 ? 1.406   71.947  177.355 1.00 16.31  ? 338 GLU 3 CB  1 
ATOM 7930  C CG  . GLU C 1 338 ? 0.756   71.000  178.362 1.00 18.80  ? 338 GLU 3 CG  1 
ATOM 7931  C CD  . GLU C 1 338 ? 1.458   71.067  179.753 1.00 60.72  ? 338 GLU 3 CD  1 
ATOM 7932  O OE1 . GLU C 1 338 ? 2.116   72.093  180.093 1.00 65.46  ? 338 GLU 3 OE1 1 
ATOM 7933  O OE2 . GLU C 1 338 ? 1.380   70.066  180.506 1.00 87.11  ? 338 GLU 3 OE2 1 
ATOM 7934  N N   . GLU C 1 339 ? -1.309  71.628  175.486 1.00 32.29  ? 339 GLU 3 N   1 
ATOM 7935  C CA  . GLU C 1 339 ? -2.638  72.134  175.240 1.00 28.30  ? 339 GLU 3 CA  1 
ATOM 7936  C C   . GLU C 1 339 ? -2.972  72.972  176.484 1.00 23.28  ? 339 GLU 3 C   1 
ATOM 7937  O O   . GLU C 1 339 ? -2.600  72.616  177.604 1.00 9.38   ? 339 GLU 3 O   1 
ATOM 7938  C CB  . GLU C 1 339 ? -3.619  70.986  175.073 1.00 41.88  ? 339 GLU 3 CB  1 
ATOM 7939  C CG  . GLU C 1 339 ? -3.121  69.835  174.227 1.00 66.19  ? 339 GLU 3 CG  1 
ATOM 7940  C CD  . GLU C 1 339 ? -4.278  68.980  173.747 1.00 82.87  ? 339 GLU 3 CD  1 
ATOM 7941  O OE1 . GLU C 1 339 ? -5.075  68.478  174.592 1.00 84.99  ? 339 GLU 3 OE1 1 
ATOM 7942  O OE2 . GLU C 1 339 ? -4.403  68.840  172.513 1.00 96.37  ? 339 GLU 3 OE2 1 
ATOM 7943  N N   . LEU C 1 340 ? -3.631  74.102  176.294 1.00 18.61  ? 340 LEU 3 N   1 
ATOM 7944  C CA  . LEU C 1 340 ? -3.943  74.929  177.432 1.00 19.47  ? 340 LEU 3 CA  1 
ATOM 7945  C C   . LEU C 1 340 ? -4.662  74.163  178.535 1.00 22.24  ? 340 LEU 3 C   1 
ATOM 7946  O O   . LEU C 1 340 ? -5.794  73.722  178.400 1.00 40.35  ? 340 LEU 3 O   1 
ATOM 7947  C CB  . LEU C 1 340 ? -4.716  76.186  177.037 1.00 21.51  ? 340 LEU 3 CB  1 
ATOM 7948  C CG  . LEU C 1 340 ? -5.395  76.875  178.218 1.00 15.75  ? 340 LEU 3 CG  1 
ATOM 7949  C CD1 . LEU C 1 340 ? -4.395  77.243  179.286 1.00 24.09  ? 340 LEU 3 CD1 1 
ATOM 7950  C CD2 . LEU C 1 340 ? -6.107  78.094  177.733 1.00 32.62  ? 340 LEU 3 CD2 1 
ATOM 7951  N N   . PRO C 1 341 ? -3.978  74.001  179.650 1.00 13.35  ? 341 PRO 3 N   1 
ATOM 7952  C CA  . PRO C 1 341 ? -4.307  73.349  180.905 1.00 22.17  ? 341 PRO 3 CA  1 
ATOM 7953  C C   . PRO C 1 341 ? -5.434  74.024  181.578 1.00 24.39  ? 341 PRO 3 C   1 
ATOM 7954  O O   . PRO C 1 341 ? -5.417  75.235  181.761 1.00 27.31  ? 341 PRO 3 O   1 
ATOM 7955  C CB  . PRO C 1 341 ? -3.080  73.612  181.743 1.00 17.52  ? 341 PRO 3 CB  1 
ATOM 7956  C CG  . PRO C 1 341 ? -2.030  73.606  180.733 1.00 22.64  ? 341 PRO 3 CG  1 
ATOM 7957  C CD  . PRO C 1 341 ? -2.594  74.461  179.678 1.00 8.48   ? 341 PRO 3 CD  1 
ATOM 7958  N N   . GLY C 1 342 ? -6.358  73.208  182.041 1.00 24.90  ? 342 GLY 3 N   1 
ATOM 7959  C CA  . GLY C 1 342 ? -7.480  73.739  182.759 1.00 25.08  ? 342 GLY 3 CA  1 
ATOM 7960  C C   . GLY C 1 342 ? -7.040  74.217  184.129 1.00 31.00  ? 342 GLY 3 C   1 
ATOM 7961  O O   . GLY C 1 342 ? -7.451  75.280  184.548 1.00 30.80  ? 342 GLY 3 O   1 
ATOM 7962  N N   . ASP C 1 343 ? -6.226  73.459  184.852 1.00 37.85  ? 343 ASP 3 N   1 
ATOM 7963  C CA  . ASP C 1 343 ? -5.825  73.951  186.155 1.00 40.24  ? 343 ASP 3 CA  1 
ATOM 7964  C C   . ASP C 1 343 ? -4.370  74.359  186.166 1.00 53.54  ? 343 ASP 3 C   1 
ATOM 7965  O O   . ASP C 1 343 ? -3.471  73.507  186.259 1.00 39.19  ? 343 ASP 3 O   1 
ATOM 7966  C CB  . ASP C 1 343 ? -6.128  72.961  187.262 1.00 41.12  ? 343 ASP 3 CB  1 
ATOM 7967  C CG  . ASP C 1 343 ? -6.130  73.621  188.615 1.00 48.17  ? 343 ASP 3 CG  1 
ATOM 7968  O OD1 . ASP C 1 343 ? -5.183  74.383  188.901 1.00 32.85  ? 343 ASP 3 OD1 1 
ATOM 7969  O OD2 . ASP C 1 343 ? -7.104  73.448  189.382 1.00 59.19  ? 343 ASP 3 OD2 1 
ATOM 7970  N N   . PRO C 1 344 ? -4.131  75.690  186.074 1.00 75.65  ? 344 PRO 3 N   1 
ATOM 7971  C CA  . PRO C 1 344 ? -2.884  76.469  186.043 1.00 94.29  ? 344 PRO 3 CA  1 
ATOM 7972  C C   . PRO C 1 344 ? -1.902  76.138  187.159 1.00 107.95 ? 344 PRO 3 C   1 
ATOM 7973  O O   . PRO C 1 344 ? -0.688  76.350  187.033 1.00 112.81 ? 344 PRO 3 O   1 
ATOM 7974  C CB  . PRO C 1 344 ? -3.387  77.910  186.134 1.00 91.86  ? 344 PRO 3 CB  1 
ATOM 7975  C CG  . PRO C 1 344 ? -4.690  77.840  185.417 1.00 78.21  ? 344 PRO 3 CG  1 
ATOM 7976  C CD  . PRO C 1 344 ? -5.278  76.617  186.061 1.00 77.43  ? 344 PRO 3 CD  1 
ATOM 7977  N N   . ASP C 1 345 ? -2.441  75.713  188.288 1.00 125.64 ? 345 ASP 3 N   1 
ATOM 7978  C CA  . ASP C 1 345 ? -1.608  75.307  189.397 1.00 129.79 ? 345 ASP 3 CA  1 
ATOM 7979  C C   . ASP C 1 345 ? -1.636  73.779  189.279 1.00 134.51 ? 345 ASP 3 C   1 
ATOM 7980  O O   . ASP C 1 345 ? -2.436  73.076  189.918 1.00 137.09 ? 345 ASP 3 O   1 
ATOM 7981  C CB  . ASP C 1 345 ? -2.165  75.831  190.731 1.00 129.08 ? 345 ASP 3 CB  1 
ATOM 7982  C CG  . ASP C 1 345 ? -2.020  77.345  190.872 1.00 127.79 ? 345 ASP 3 CG  1 
ATOM 7983  O OD1 . ASP C 1 345 ? -0.920  77.870  190.572 1.00 130.89 ? 345 ASP 3 OD1 1 
ATOM 7984  O OD2 . ASP C 1 345 ? -3.003  77.994  191.287 1.00 127.13 ? 345 ASP 3 OD2 1 
ATOM 7985  N N   . MET C 1 346 ? -0.847  73.310  188.320 1.00 129.02 ? 346 MET 3 N   1 
ATOM 7986  C CA  . MET C 1 346 ? -0.704  71.898  188.016 1.00 132.50 ? 346 MET 3 CA  1 
ATOM 7987  C C   . MET C 1 346 ? -0.678  71.110  189.308 1.00 134.86 ? 346 MET 3 C   1 
ATOM 7988  O O   . MET C 1 346 ? 0.335   71.173  190.018 1.00 140.00 ? 346 MET 3 O   1 
ATOM 7989  C CB  . MET C 1 346 ? 0.645   71.656  187.329 1.00 134.18 ? 346 MET 3 CB  1 
ATOM 7990  C CG  . MET C 1 346 ? 1.182   72.826  186.529 1.00 134.14 ? 346 MET 3 CG  1 
ATOM 7991  S SD  . MET C 1 346 ? 0.150   73.188  185.091 1.00 138.02 ? 346 MET 3 SD  1 
ATOM 7992  C CE  . MET C 1 346 ? 0.808   71.984  183.889 1.00 136.74 ? 346 MET 3 CE  1 
ATOM 7993  N N   . ILE C 1 347 ? -1.783  70.459  189.680 1.00 131.65 ? 347 ILE 3 N   1 
ATOM 7994  C CA  . ILE C 1 347 ? -1.745  69.638  190.894 1.00 129.32 ? 347 ILE 3 CA  1 
ATOM 7995  C C   . ILE C 1 347 ? -0.676  68.582  190.512 1.00 130.57 ? 347 ILE 3 C   1 
ATOM 7996  O O   . ILE C 1 347 ? -0.870  67.765  189.590 1.00 122.42 ? 347 ILE 3 O   1 
ATOM 7997  C CB  . ILE C 1 347 ? -3.146  69.006  191.282 1.00 128.66 ? 347 ILE 3 CB  1 
ATOM 7998  C CG1 . ILE C 1 347 ? -3.520  69.333  192.738 1.00 128.91 ? 347 ILE 3 CG1 1 
ATOM 7999  C CG2 . ILE C 1 347 ? -3.126  67.510  191.178 1.00 121.94 ? 347 ILE 3 CG2 1 
ATOM 8000  C CD1 . ILE C 1 347 ? -4.740  68.526  193.304 1.00 118.69 ? 347 ILE 3 CD1 1 
ATOM 8001  N N   . ARG C 1 348 ? 0.511   68.768  191.105 1.00 129.64 ? 348 ARG 3 N   1 
ATOM 8002  C CA  . ARG C 1 348 ? 1.706   67.938  190.887 1.00 117.19 ? 348 ARG 3 CA  1 
ATOM 8003  C C   . ARG C 1 348 ? 1.799   66.760  191.878 1.00 109.08 ? 348 ARG 3 C   1 
ATOM 8004  O O   . ARG C 1 348 ? 1.861   65.595  191.465 1.00 102.80 ? 348 ARG 3 O   1 
ATOM 8005  C CB  . ARG C 1 348 ? 2.953   68.838  190.970 1.00 115.44 ? 348 ARG 3 CB  1 
ATOM 8006  C CG  . ARG C 1 348 ? 3.863   68.863  189.725 1.00 127.12 ? 348 ARG 3 CG  1 
ATOM 8007  C CD  . ARG C 1 348 ? 3.169   68.467  188.407 1.00 139.32 ? 348 ARG 3 CD  1 
ATOM 8008  N NE  . ARG C 1 348 ? 3.271   67.030  188.086 1.00 152.67 ? 348 ARG 3 NE  1 
ATOM 8009  C CZ  . ARG C 1 348 ? 4.392   66.404  187.703 1.00 157.82 ? 348 ARG 3 CZ  1 
ATOM 8010  N NH1 . ARG C 1 348 ? 5.535   67.083  187.593 1.00 163.57 ? 348 ARG 3 NH1 1 
ATOM 8011  N NH2 . ARG C 1 348 ? 4.372   65.100  187.406 1.00 160.82 ? 348 ARG 3 NH2 1 
ATOM 8012  N N   . TYR C 1 349 ? 1.851   67.072  193.175 1.00 109.65 ? 349 TYR 3 N   1 
ATOM 8013  C CA  . TYR C 1 349 ? 1.899   66.061  194.251 1.00 113.14 ? 349 TYR 3 CA  1 
ATOM 8014  C C   . TYR C 1 349 ? 0.412   65.865  194.631 1.00 114.96 ? 349 TYR 3 C   1 
ATOM 8015  O O   . TYR C 1 349 ? -0.395  66.731  194.284 1.00 119.59 ? 349 TYR 3 O   1 
ATOM 8016  C CB  . TYR C 1 349 ? 2.755   66.584  195.447 1.00 105.10 ? 349 TYR 3 CB  1 
ATOM 8017  C CG  . TYR C 1 349 ? 4.281   66.405  195.273 1.00 107.55 ? 349 TYR 3 CG  1 
ATOM 8018  C CD1 . TYR C 1 349 ? 4.926   65.235  195.695 1.00 122.49 ? 349 TYR 3 CD1 1 
ATOM 8019  C CD2 . TYR C 1 349 ? 5.070   67.382  194.663 1.00 105.56 ? 349 TYR 3 CD2 1 
ATOM 8020  C CE1 . TYR C 1 349 ? 6.315   65.043  195.512 1.00 113.15 ? 349 TYR 3 CE1 1 
ATOM 8021  C CE2 . TYR C 1 349 ? 6.465   67.192  194.473 1.00 95.62  ? 349 TYR 3 CE2 1 
ATOM 8022  C CZ  . TYR C 1 349 ? 7.070   66.024  194.902 1.00 103.08 ? 349 TYR 3 CZ  1 
ATOM 8023  O OH  . TYR C 1 349 ? 8.422   65.821  194.729 1.00 109.59 ? 349 TYR 3 OH  1 
ATOM 8024  N N   . ILE C 1 350 ? 0.001   64.749  195.247 1.00 110.43 ? 350 ILE 3 N   1 
ATOM 8025  C CA  . ILE C 1 350 ? -1.435  64.649  195.575 1.00 106.78 ? 350 ILE 3 CA  1 
ATOM 8026  C C   . ILE C 1 350 ? -1.901  65.150  196.938 1.00 112.96 ? 350 ILE 3 C   1 
ATOM 8027  O O   . ILE C 1 350 ? -3.040  64.884  197.313 1.00 118.53 ? 350 ILE 3 O   1 
ATOM 8028  C CB  . ILE C 1 350 ? -2.099  63.272  195.319 1.00 94.29  ? 350 ILE 3 CB  1 
ATOM 8029  C CG1 . ILE C 1 350 ? -1.190  62.353  194.526 1.00 102.98 ? 350 ILE 3 CG1 1 
ATOM 8030  C CG2 . ILE C 1 350 ? -3.437  63.467  194.573 1.00 64.83  ? 350 ILE 3 CG2 1 
ATOM 8031  C CD1 . ILE C 1 350 ? -1.677  60.930  194.591 1.00 124.50 ? 350 ILE 3 CD1 1 
ATOM 8032  N N   . ASP C 1 351 ? -1.016  65.796  197.698 1.00 121.60 ? 351 ASP 3 N   1 
ATOM 8033  C CA  . ASP C 1 351 ? -1.397  66.402  198.978 1.00 139.56 ? 351 ASP 3 CA  1 
ATOM 8034  C C   . ASP C 1 351 ? -1.561  65.552  200.228 1.00 151.46 ? 351 ASP 3 C   1 
ATOM 8035  O O   . ASP C 1 351 ? -2.559  65.730  200.941 1.00 144.18 ? 351 ASP 3 O   1 
ATOM 8036  C CB  . ASP C 1 351 ? -2.725  67.198  198.859 1.00 161.01 ? 351 ASP 3 CB  1 
ATOM 8037  C CG  . ASP C 1 351 ? -2.759  68.170  197.693 1.00 183.53 ? 351 ASP 3 CG  1 
ATOM 8038  O OD1 . ASP C 1 351 ? -1.749  68.881  197.488 1.00 202.90 ? 351 ASP 3 OD1 1 
ATOM 8039  O OD2 . ASP C 1 351 ? -3.817  68.240  197.007 1.00 189.14 ? 351 ASP 3 OD2 1 
ATOM 8040  N N   . GLU C 1 352 ? -0.665  64.619  200.534 1.00 166.87 ? 352 GLU 3 N   1 
ATOM 8041  C CA  . GLU C 1 352 ? -0.898  63.916  201.805 1.00 188.47 ? 352 GLU 3 CA  1 
ATOM 8042  C C   . GLU C 1 352 ? -0.019  64.460  202.948 1.00 197.30 ? 352 GLU 3 C   1 
ATOM 8043  O O   . GLU C 1 352 ? 1.220   64.336  202.915 1.00 205.31 ? 352 GLU 3 O   1 
ATOM 8044  C CB  . GLU C 1 352 ? -0.807  62.375  201.725 1.00 186.72 ? 352 GLU 3 CB  1 
ATOM 8045  C CG  . GLU C 1 352 ? -1.663  61.703  202.852 1.00 181.26 ? 352 GLU 3 CG  1 
ATOM 8046  C CD  . GLU C 1 352 ? -1.164  60.335  203.326 1.00 177.75 ? 352 GLU 3 CD  1 
ATOM 8047  O OE1 . GLU C 1 352 ? -0.202  60.287  204.135 1.00 167.20 ? 352 GLU 3 OE1 1 
ATOM 8048  O OE2 . GLU C 1 352 ? -1.774  59.318  202.928 1.00 172.79 ? 352 GLU 3 OE2 1 
ATOM 8049  N N   . PHE C 1 353 ? -0.666  65.147  203.897 1.00 201.72 ? 353 PHE 3 N   1 
ATOM 8050  C CA  . PHE C 1 353 ? -0.012  65.721  205.087 1.00 204.14 ? 353 PHE 3 CA  1 
ATOM 8051  C C   . PHE C 1 353 ? -0.722  65.106  206.293 1.00 205.45 ? 353 PHE 3 C   1 
ATOM 8052  O O   . PHE C 1 353 ? -0.123  64.324  207.043 1.00 195.52 ? 353 PHE 3 O   1 
ATOM 8053  C CB  . PHE C 1 353 ? -0.156  67.259  205.141 1.00 206.02 ? 353 PHE 3 CB  1 
ATOM 8054  C CG  . PHE C 1 353 ? 0.505   67.989  203.989 1.00 211.97 ? 353 PHE 3 CG  1 
ATOM 8055  C CD1 . PHE C 1 353 ? 1.747   67.572  203.487 1.00 211.03 ? 353 PHE 3 CD1 1 
ATOM 8056  C CD2 . PHE C 1 353 ? -0.130  69.081  203.388 1.00 212.06 ? 353 PHE 3 CD2 1 
ATOM 8057  C CE1 . PHE C 1 353 ? 2.347   68.232  202.397 1.00 208.90 ? 353 PHE 3 CE1 1 
ATOM 8058  C CE2 . PHE C 1 353 ? 0.461   69.751  202.297 1.00 212.10 ? 353 PHE 3 CE2 1 
ATOM 8059  C CZ  . PHE C 1 353 ? 1.702   69.321  201.801 1.00 210.58 ? 353 PHE 3 CZ  1 
ATOM 8060  N N   . GLY C 1 354 ? -1.997  65.479  206.455 1.00 205.02 ? 354 GLY 3 N   1 
ATOM 8061  C CA  . GLY C 1 354 ? -2.844  64.972  207.529 1.00 209.11 ? 354 GLY 3 CA  1 
ATOM 8062  C C   . GLY C 1 354 ? -4.218  64.545  207.010 1.00 211.74 ? 354 GLY 3 C   1 
ATOM 8063  O O   . GLY C 1 354 ? -5.254  64.856  207.616 1.00 213.50 ? 354 GLY 3 O   1 
ATOM 8064  N N   . GLN C 1 355 ? -4.211  63.814  205.892 1.00 209.39 ? 355 GLN 3 N   1 
ATOM 8065  C CA  . GLN C 1 355 ? -5.425  63.326  205.229 1.00 203.05 ? 355 GLN 3 CA  1 
ATOM 8066  C C   . GLN C 1 355 ? -5.444  61.786  205.107 1.00 196.74 ? 355 GLN 3 C   1 
ATOM 8067  O O   . GLN C 1 355 ? -5.739  61.066  206.075 1.00 188.01 ? 355 GLN 3 O   1 
ATOM 8068  C CB  . GLN C 1 355 ? -5.551  63.986  203.834 1.00 204.19 ? 355 GLN 3 CB  1 
ATOM 8069  C CG  . GLN C 1 355 ? -6.758  64.943  203.669 1.00 207.39 ? 355 GLN 3 CG  1 
ATOM 8070  C CD  . GLN C 1 355 ? -6.397  66.344  203.148 1.00 207.17 ? 355 GLN 3 CD  1 
ATOM 8071  O OE1 . GLN C 1 355 ? -5.236  66.645  202.857 1.00 203.17 ? 355 GLN 3 OE1 1 
ATOM 8072  N NE2 . GLN C 1 355 ? -7.406  67.210  203.052 1.00 210.44 ? 355 GLN 3 NE2 1 
ATOM 8073  N N   . ALA D 1 13  ? 19.666  -11.135 182.537 1.00 194.16 ? 13  ALA 4 N   1 
ATOM 8074  C CA  . ALA D 1 13  ? 19.315  -10.175 181.499 1.00 198.12 ? 13  ALA 4 CA  1 
ATOM 8075  C C   . ALA D 1 13  ? 20.111  -8.884  181.712 1.00 196.94 ? 13  ALA 4 C   1 
ATOM 8076  O O   . ALA D 1 13  ? 20.789  -8.772  182.741 1.00 199.68 ? 13  ALA 4 O   1 
ATOM 8077  C CB  . ALA D 1 13  ? 17.812  -9.945  181.514 1.00 193.28 ? 13  ALA 4 CB  1 
ATOM 8078  N N   . PRO D 1 14  ? 20.014  -7.887  180.758 1.00 194.40 ? 14  PRO 4 N   1 
ATOM 8079  C CA  . PRO D 1 14  ? 20.713  -6.599  180.823 1.00 179.69 ? 14  PRO 4 CA  1 
ATOM 8080  C C   . PRO D 1 14  ? 21.344  -6.207  182.084 1.00 168.86 ? 14  PRO 4 C   1 
ATOM 8081  O O   . PRO D 1 14  ? 20.844  -5.414  182.867 1.00 160.75 ? 14  PRO 4 O   1 
ATOM 8082  C CB  . PRO D 1 14  ? 19.662  -5.626  180.338 1.00 180.62 ? 14  PRO 4 CB  1 
ATOM 8083  C CG  . PRO D 1 14  ? 19.230  -6.403  179.053 1.00 193.17 ? 14  PRO 4 CG  1 
ATOM 8084  C CD  . PRO D 1 14  ? 19.216  -7.914  179.532 1.00 195.61 ? 14  PRO 4 CD  1 
ATOM 8085  N N   . LYS D 1 15  ? 22.521  -6.833  182.216 1.00 169.62 ? 15  LYS 4 N   1 
ATOM 8086  C CA  . LYS D 1 15  ? 23.454  -6.647  183.277 1.00 173.15 ? 15  LYS 4 CA  1 
ATOM 8087  C C   . LYS D 1 15  ? 24.626  -6.478  182.319 1.00 173.55 ? 15  LYS 4 C   1 
ATOM 8088  O O   . LYS D 1 15  ? 25.413  -7.410  182.084 1.00 176.59 ? 15  LYS 4 O   1 
ATOM 8089  C CB  . LYS D 1 15  ? 23.623  -7.909  184.155 1.00 173.22 ? 15  LYS 4 CB  1 
ATOM 8090  C CG  . LYS D 1 15  ? 22.516  -8.143  185.206 1.00 169.97 ? 15  LYS 4 CG  1 
ATOM 8091  C CD  . LYS D 1 15  ? 23.039  -8.899  186.439 1.00 162.82 ? 15  LYS 4 CD  1 
ATOM 8092  C CE  . LYS D 1 15  ? 23.741  -7.957  187.429 1.00 152.33 ? 15  LYS 4 CE  1 
ATOM 8093  N NZ  . LYS D 1 15  ? 24.489  -8.689  188.489 1.00 139.17 ? 15  LYS 4 NZ  1 
ATOM 8094  N N   . LYS D 1 16  ? 24.551  -5.370  181.580 1.00 167.77 ? 16  LYS 4 N   1 
ATOM 8095  C CA  . LYS D 1 16  ? 25.573  -4.994  180.612 1.00 155.41 ? 16  LYS 4 CA  1 
ATOM 8096  C C   . LYS D 1 16  ? 26.390  -3.945  181.350 1.00 144.95 ? 16  LYS 4 C   1 
ATOM 8097  O O   . LYS D 1 16  ? 26.098  -2.745  181.269 1.00 139.02 ? 16  LYS 4 O   1 
ATOM 8098  C CB  . LYS D 1 16  ? 24.948  -4.367  179.358 1.00 158.34 ? 16  LYS 4 CB  1 
ATOM 8099  C CG  . LYS D 1 16  ? 24.059  -5.293  178.530 1.00 157.31 ? 16  LYS 4 CG  1 
ATOM 8100  C CD  . LYS D 1 16  ? 23.444  -4.547  177.343 1.00 157.16 ? 16  LYS 4 CD  1 
ATOM 8101  C CE  . LYS D 1 16  ? 22.586  -3.364  177.798 1.00 157.65 ? 16  LYS 4 CE  1 
ATOM 8102  N NZ  . LYS D 1 16  ? 21.886  -2.681  176.668 1.00 162.28 ? 16  LYS 4 NZ  1 
ATOM 8103  N N   . PRO D 1 17  ? 27.344  -4.390  182.176 1.00 137.81 ? 17  PRO 4 N   1 
ATOM 8104  C CA  . PRO D 1 17  ? 28.150  -3.414  182.901 1.00 130.61 ? 17  PRO 4 CA  1 
ATOM 8105  C C   . PRO D 1 17  ? 28.803  -2.525  181.845 1.00 127.79 ? 17  PRO 4 C   1 
ATOM 8106  O O   . PRO D 1 17  ? 29.564  -2.991  180.985 1.00 132.60 ? 17  PRO 4 O   1 
ATOM 8107  C CB  . PRO D 1 17  ? 29.166  -4.293  183.633 1.00 139.23 ? 17  PRO 4 CB  1 
ATOM 8108  C CG  . PRO D 1 17  ? 29.315  -5.478  182.730 1.00 142.98 ? 17  PRO 4 CG  1 
ATOM 8109  C CD  . PRO D 1 17  ? 27.887  -5.750  182.338 1.00 139.63 ? 17  PRO 4 CD  1 
ATOM 8110  N N   . LYS D 1 18  ? 28.399  -1.266  181.845 1.00 116.09 ? 18  LYS 4 N   1 
ATOM 8111  C CA  . LYS D 1 18  ? 28.921  -0.312  180.886 1.00 107.15 ? 18  LYS 4 CA  1 
ATOM 8112  C C   . LYS D 1 18  ? 30.424  -0.219  181.015 1.00 94.35  ? 18  LYS 4 C   1 
ATOM 8113  O O   . LYS D 1 18  ? 30.970  -0.330  182.105 1.00 86.63  ? 18  LYS 4 O   1 
ATOM 8114  C CB  . LYS D 1 18  ? 28.272  1.044   181.119 1.00 122.30 ? 18  LYS 4 CB  1 
ATOM 8115  C CG  . LYS D 1 18  ? 26.757  0.960   181.110 1.00 148.74 ? 18  LYS 4 CG  1 
ATOM 8116  C CD  . LYS D 1 18  ? 26.092  2.255   181.549 1.00 174.35 ? 18  LYS 4 CD  1 
ATOM 8117  C CE  . LYS D 1 18  ? 24.562  2.130   181.503 1.00 192.65 ? 18  LYS 4 CE  1 
ATOM 8118  N NZ  . LYS D 1 18  ? 23.860  3.326   182.068 1.00 206.69 ? 18  LYS 4 NZ  1 
ATOM 8119  N N   . GLU D 1 19  ? 31.097  -0.029  179.896 1.00 88.57  ? 19  GLU 4 N   1 
ATOM 8120  C CA  . GLU D 1 19  ? 32.541  0.072   179.915 1.00 87.29  ? 19  GLU 4 CA  1 
ATOM 8121  C C   . GLU D 1 19  ? 32.959  1.160   180.900 1.00 72.38  ? 19  GLU 4 C   1 
ATOM 8122  O O   . GLU D 1 19  ? 32.482  2.302   180.829 1.00 73.43  ? 19  GLU 4 O   1 
ATOM 8123  C CB  . GLU D 1 19  ? 33.040  0.393   178.516 1.00 115.87 ? 19  GLU 4 CB  1 
ATOM 8124  C CG  . GLU D 1 19  ? 32.485  -0.550  177.461 1.00 166.05 ? 19  GLU 4 CG  1 
ATOM 8125  C CD  . GLU D 1 19  ? 32.820  -0.115  176.043 1.00 196.40 ? 19  GLU 4 CD  1 
ATOM 8126  O OE1 . GLU D 1 19  ? 34.011  0.154   175.767 1.00 213.71 ? 19  GLU 4 OE1 1 
ATOM 8127  O OE2 . GLU D 1 19  ? 31.890  -0.045  175.206 1.00 214.75 ? 19  GLU 4 OE2 1 
ATOM 8128  N N   . PRO D 1 20  ? 33.789  0.793   181.887 1.00 58.55  ? 20  PRO 4 N   1 
ATOM 8129  C CA  . PRO D 1 20  ? 34.285  1.708   182.911 1.00 60.25  ? 20  PRO 4 CA  1 
ATOM 8130  C C   . PRO D 1 20  ? 34.837  2.987   182.315 1.00 58.75  ? 20  PRO 4 C   1 
ATOM 8131  O O   . PRO D 1 20  ? 35.416  3.008   181.220 1.00 58.62  ? 20  PRO 4 O   1 
ATOM 8132  C CB  . PRO D 1 20  ? 35.392  0.895   183.579 1.00 49.47  ? 20  PRO 4 CB  1 
ATOM 8133  C CG  . PRO D 1 20  ? 34.845  -0.456  183.555 1.00 41.13  ? 20  PRO 4 CG  1 
ATOM 8134  C CD  . PRO D 1 20  ? 34.293  -0.563  182.137 1.00 53.46  ? 20  PRO 4 CD  1 
ATOM 8135  N N   . VAL D 1 21  ? 34.676  4.049   183.081 1.00 54.67  ? 21  VAL 4 N   1 
ATOM 8136  C CA  . VAL D 1 21  ? 35.126  5.370   182.687 1.00 50.73  ? 21  VAL 4 CA  1 
ATOM 8137  C C   . VAL D 1 21  ? 36.630  5.466   182.564 1.00 43.24  ? 21  VAL 4 C   1 
ATOM 8138  O O   . VAL D 1 21  ? 37.374  4.864   183.338 1.00 37.78  ? 21  VAL 4 O   1 
ATOM 8139  C CB  . VAL D 1 21  ? 34.785  6.371   183.755 1.00 62.75  ? 21  VAL 4 CB  1 
ATOM 8140  C CG1 . VAL D 1 21  ? 34.579  7.746   183.126 1.00 99.19  ? 21  VAL 4 CG1 1 
ATOM 8141  C CG2 . VAL D 1 21  ? 33.610  5.884   184.601 1.00 49.24  ? 21  VAL 4 CG2 1 
ATOM 8142  N N   . GLN D 1 22  ? 37.098  6.277   181.639 1.00 37.32  ? 22  GLN 4 N   1 
ATOM 8143  C CA  . GLN D 1 22  ? 38.531  6.409   181.562 1.00 41.51  ? 22  GLN 4 CA  1 
ATOM 8144  C C   . GLN D 1 22  ? 38.946  7.383   182.642 1.00 33.63  ? 22  GLN 4 C   1 
ATOM 8145  O O   . GLN D 1 22  ? 38.181  8.288   182.990 1.00 45.34  ? 22  GLN 4 O   1 
ATOM 8146  C CB  . GLN D 1 22  ? 38.976  6.866   180.179 1.00 33.58  ? 22  GLN 4 CB  1 
ATOM 8147  C CG  . GLN D 1 22  ? 39.172  5.705   179.222 1.00 52.95  ? 22  GLN 4 CG  1 
ATOM 8148  C CD  . GLN D 1 22  ? 40.268  4.750   179.671 1.00 66.96  ? 22  GLN 4 CD  1 
ATOM 8149  O OE1 . GLN D 1 22  ? 40.667  4.736   180.835 1.00 82.61  ? 22  GLN 4 OE1 1 
ATOM 8150  N NE2 . GLN D 1 22  ? 40.762  3.943   178.742 1.00 103.05 ? 22  GLN 4 NE2 1 
ATOM 8151  N N   . VAL D 1 23  ? 40.066  7.110   183.295 1.00 18.60  ? 23  VAL 4 N   1 
ATOM 8152  C CA  . VAL D 1 23  ? 40.547  8.031   184.307 1.00 17.56  ? 23  VAL 4 CA  1 
ATOM 8153  C C   . VAL D 1 23  ? 42.059  8.077   184.226 1.00 21.53  ? 23  VAL 4 C   1 
ATOM 8154  O O   . VAL D 1 23  ? 42.665  7.391   183.421 1.00 27.25  ? 23  VAL 4 O   1 
ATOM 8155  C CB  . VAL D 1 23  ? 40.093  7.645   185.688 1.00 13.19  ? 23  VAL 4 CB  1 
ATOM 8156  C CG1 . VAL D 1 23  ? 38.695  7.126   185.625 1.00 18.70  ? 23  VAL 4 CG1 1 
ATOM 8157  C CG2 . VAL D 1 23  ? 41.028  6.658   186.293 1.00 16.80  ? 23  VAL 4 CG2 1 
ATOM 8158  N N   . PRO D 1 24  ? 42.688  8.942   185.004 1.00 23.51  ? 24  PRO 4 N   1 
ATOM 8159  C CA  . PRO D 1 24  ? 44.135  9.043   184.967 1.00 32.35  ? 24  PRO 4 CA  1 
ATOM 8160  C C   . PRO D 1 24  ? 44.860  7.761   185.268 1.00 36.21  ? 24  PRO 4 C   1 
ATOM 8161  O O   . PRO D 1 24  ? 44.633  7.103   186.291 1.00 38.76  ? 24  PRO 4 O   1 
ATOM 8162  C CB  . PRO D 1 24  ? 44.407  10.110  185.998 1.00 39.96  ? 24  PRO 4 CB  1 
ATOM 8163  C CG  . PRO D 1 24  ? 43.304  11.002  185.764 1.00 37.89  ? 24  PRO 4 CG  1 
ATOM 8164  C CD  . PRO D 1 24  ? 42.139  10.062  185.763 1.00 34.65  ? 24  PRO 4 CD  1 
ATOM 8165  N N   . LYS D 1 25  ? 45.764  7.447   184.354 1.00 40.32  ? 25  LYS 4 N   1 
ATOM 8166  C CA  . LYS D 1 25  ? 46.587  6.256   184.394 1.00 41.46  ? 25  LYS 4 CA  1 
ATOM 8167  C C   . LYS D 1 25  ? 47.770  6.422   185.335 1.00 31.13  ? 25  LYS 4 C   1 
ATOM 8168  O O   . LYS D 1 25  ? 48.736  7.111   185.000 1.00 38.40  ? 25  LYS 4 O   1 
ATOM 8169  C CB  . LYS D 1 25  ? 47.074  6.007   182.973 1.00 56.66  ? 25  LYS 4 CB  1 
ATOM 8170  C CG  . LYS D 1 25  ? 48.073  4.901   182.753 1.00 90.80  ? 25  LYS 4 CG  1 
ATOM 8171  C CD  . LYS D 1 25  ? 48.781  5.170   181.408 1.00 122.64 ? 25  LYS 4 CD  1 
ATOM 8172  C CE  . LYS D 1 25  ? 49.690  4.032   180.945 1.00 140.59 ? 25  LYS 4 CE  1 
ATOM 8173  N NZ  . LYS D 1 25  ? 48.930  2.797   180.584 1.00 152.33 ? 25  LYS 4 NZ  1 
ATOM 8174  N N   . LEU D 1 26  ? 47.677  5.843   186.529 1.00 22.30  ? 26  LEU 4 N   1 
ATOM 8175  C CA  . LEU D 1 26  ? 48.792  5.906   187.472 1.00 21.17  ? 26  LEU 4 CA  1 
ATOM 8176  C C   . LEU D 1 26  ? 50.000  5.313   186.782 1.00 32.38  ? 26  LEU 4 C   1 
ATOM 8177  O O   . LEU D 1 26  ? 50.011  4.163   186.337 1.00 34.17  ? 26  LEU 4 O   1 
ATOM 8178  C CB  . LEU D 1 26  ? 48.549  5.076   188.712 1.00 7.42   ? 26  LEU 4 CB  1 
ATOM 8179  C CG  . LEU D 1 26  ? 49.845  4.884   189.499 1.00 25.87  ? 26  LEU 4 CG  1 
ATOM 8180  C CD1 . LEU D 1 26  ? 50.343  6.217   190.005 1.00 8.43   ? 26  LEU 4 CD1 1 
ATOM 8181  C CD2 . LEU D 1 26  ? 49.630  3.915   190.634 1.00 30.16  ? 26  LEU 4 CD2 1 
ATOM 8182  N N   . VAL D 1 27  ? 51.060  6.074   186.757 1.00 32.91  ? 27  VAL 4 N   1 
ATOM 8183  C CA  . VAL D 1 27  ? 52.202  5.576   186.081 1.00 29.45  ? 27  VAL 4 CA  1 
ATOM 8184  C C   . VAL D 1 27  ? 53.140  4.937   187.035 1.00 24.36  ? 27  VAL 4 C   1 
ATOM 8185  O O   . VAL D 1 27  ? 53.875  4.013   186.710 1.00 32.39  ? 27  VAL 4 O   1 
ATOM 8186  C CB  . VAL D 1 27  ? 52.842  6.699   185.372 1.00 30.78  ? 27  VAL 4 CB  1 
ATOM 8187  C CG1 . VAL D 1 27  ? 54.318  6.546   185.394 1.00 23.22  ? 27  VAL 4 CG1 1 
ATOM 8188  C CG2 . VAL D 1 27  ? 52.314  6.718   183.974 1.00 39.59  ? 27  VAL 4 CG2 1 
ATOM 8189  N N   . ILE D 1 28  ? 53.138  5.451   188.231 1.00 11.95  ? 28  ILE 4 N   1 
ATOM 8190  C CA  . ILE D 1 28  ? 54.043  4.901   189.171 1.00 16.26  ? 28  ILE 4 CA  1 
ATOM 8191  C C   . ILE D 1 28  ? 53.787  5.685   190.389 1.00 20.39  ? 28  ILE 4 C   1 
ATOM 8192  O O   . ILE D 1 28  ? 53.497  6.892   190.326 1.00 17.92  ? 28  ILE 4 O   1 
ATOM 8193  C CB  . ILE D 1 28  ? 55.457  5.105   188.723 1.00 16.95  ? 28  ILE 4 CB  1 
ATOM 8194  C CG1 . ILE D 1 28  ? 56.387  4.767   189.866 1.00 24.10  ? 28  ILE 4 CG1 1 
ATOM 8195  C CG2 . ILE D 1 28  ? 55.655  6.525   188.277 1.00 6.87   ? 28  ILE 4 CG2 1 
ATOM 8196  C CD1 . ILE D 1 28  ? 57.771  4.620   189.394 1.00 46.63  ? 28  ILE 4 CD1 1 
ATOM 8197  N N   . LYS D 1 29  ? 53.921  4.980   191.492 1.00 15.07  ? 29  LYS 4 N   1 
ATOM 8198  C CA  . LYS D 1 29  ? 53.640  5.526   192.782 1.00 31.29  ? 29  LYS 4 CA  1 
ATOM 8199  C C   . LYS D 1 29  ? 54.773  5.165   193.690 1.00 32.55  ? 29  LYS 4 C   1 
ATOM 8200  O O   . LYS D 1 29  ? 55.390  4.121   193.540 1.00 48.68  ? 29  LYS 4 O   1 
ATOM 8201  C CB  . LYS D 1 29  ? 52.338  4.897   193.276 1.00 35.90  ? 29  LYS 4 CB  1 
ATOM 8202  C CG  . LYS D 1 29  ? 51.913  5.243   194.688 1.00 52.09  ? 29  LYS 4 CG  1 
ATOM 8203  C CD  . LYS D 1 29  ? 52.516  4.325   195.736 1.00 57.59  ? 29  LYS 4 CD  1 
ATOM 8204  C CE  . LYS D 1 29  ? 51.846  4.515   197.093 1.00 60.58  ? 29  LYS 4 CE  1 
ATOM 8205  N NZ  . LYS D 1 29  ? 50.391  4.148   197.030 1.00 87.56  ? 29  LYS 4 NZ  1 
ATOM 8206  N N   . GLY D 1 30  ? 55.012  6.019   194.664 1.00 30.45  ? 30  GLY 4 N   1 
ATOM 8207  C CA  . GLY D 1 30  ? 56.081  5.780   195.595 1.00 42.31  ? 30  GLY 4 CA  1 
ATOM 8208  C C   . GLY D 1 30  ? 56.519  7.080   196.234 1.00 47.74  ? 30  GLY 4 C   1 
ATOM 8209  O O   . GLY D 1 30  ? 55.731  8.020   196.339 1.00 60.28  ? 30  GLY 4 O   1 
ATOM 8210  N N   . GLY D 1 31  ? 57.796  7.139   196.602 1.00 48.58  ? 31  GLY 4 N   1 
ATOM 8211  C CA  . GLY D 1 31  ? 58.353  8.299   197.273 1.00 39.57  ? 31  GLY 4 CA  1 
ATOM 8212  C C   . GLY D 1 31  ? 58.908  9.383   196.383 1.00 44.82  ? 31  GLY 4 C   1 
ATOM 8213  O O   . GLY D 1 31  ? 58.871  9.280   195.137 1.00 40.43  ? 31  GLY 4 O   1 
ATOM 8214  N N   . ILE D 1 32  ? 59.527  10.372  197.029 1.00 38.29  ? 32  ILE 4 N   1 
ATOM 8215  C CA  . ILE D 1 32  ? 60.063  11.529  196.321 1.00 37.00  ? 32  ILE 4 CA  1 
ATOM 8216  C C   . ILE D 1 32  ? 60.940  11.126  195.153 1.00 35.61  ? 32  ILE 4 C   1 
ATOM 8217  O O   . ILE D 1 32  ? 61.058  11.828  194.134 1.00 30.88  ? 32  ILE 4 O   1 
ATOM 8218  C CB  . ILE D 1 32  ? 60.805  12.447  197.296 1.00 32.17  ? 32  ILE 4 CB  1 
ATOM 8219  C CG1 . ILE D 1 32  ? 61.415  13.613  196.538 1.00 30.47  ? 32  ILE 4 CG1 1 
ATOM 8220  C CG2 . ILE D 1 32  ? 61.754  11.661  198.147 1.00 39.37  ? 32  ILE 4 CG2 1 
ATOM 8221  C CD1 . ILE D 1 32  ? 60.367  14.438  195.794 1.00 10.36  ? 32  ILE 4 CD1 1 
ATOM 8222  N N   . GLU D 1 33  ? 61.454  9.918   195.299 1.00 39.30  ? 33  GLU 4 N   1 
ATOM 8223  C CA  . GLU D 1 33  ? 62.330  9.272   194.344 1.00 49.97  ? 33  GLU 4 CA  1 
ATOM 8224  C C   . GLU D 1 33  ? 61.655  9.121   193.002 1.00 43.60  ? 33  GLU 4 C   1 
ATOM 8225  O O   . GLU D 1 33  ? 62.133  9.636   191.987 1.00 42.98  ? 33  GLU 4 O   1 
ATOM 8226  C CB  . GLU D 1 33  ? 62.722  7.895   194.877 1.00 40.87  ? 33  GLU 4 CB  1 
ATOM 8227  C CG  . GLU D 1 33  ? 63.183  7.910   196.334 1.00 90.06  ? 33  GLU 4 CG  1 
ATOM 8228  C CD  . GLU D 1 33  ? 62.027  7.798   197.309 1.00 117.37 ? 33  GLU 4 CD  1 
ATOM 8229  O OE1 . GLU D 1 33  ? 61.146  6.944   197.053 1.00 131.46 ? 33  GLU 4 OE1 1 
ATOM 8230  O OE2 . GLU D 1 33  ? 61.976  8.580   198.294 1.00 133.90 ? 33  GLU 4 OE2 1 
ATOM 8231  N N   . VAL D 1 34  ? 60.491  8.493   193.035 1.00 36.15  ? 34  VAL 4 N   1 
ATOM 8232  C CA  . VAL D 1 34  ? 59.706  8.230   191.846 1.00 30.88  ? 34  VAL 4 CA  1 
ATOM 8233  C C   . VAL D 1 34  ? 59.681  9.420   190.904 1.00 37.10  ? 34  VAL 4 C   1 
ATOM 8234  O O   . VAL D 1 34  ? 59.462  9.271   189.696 1.00 31.40  ? 34  VAL 4 O   1 
ATOM 8235  C CB  . VAL D 1 34  ? 58.256  7.926   192.226 1.00 37.10  ? 34  VAL 4 CB  1 
ATOM 8236  C CG1 . VAL D 1 34  ? 57.497  7.416   191.031 1.00 42.99  ? 34  VAL 4 CG1 1 
ATOM 8237  C CG2 . VAL D 1 34  ? 58.198  6.925   193.343 1.00 46.41  ? 34  VAL 4 CG2 1 
ATOM 8238  N N   . LEU D 1 35  ? 59.877  10.607  191.471 1.00 46.31  ? 35  LEU 4 N   1 
ATOM 8239  C CA  . LEU D 1 35  ? 59.835  11.838  190.704 1.00 49.67  ? 35  LEU 4 CA  1 
ATOM 8240  C C   . LEU D 1 35  ? 60.607  11.805  189.425 1.00 51.83  ? 35  LEU 4 C   1 
ATOM 8241  O O   . LEU D 1 35  ? 60.132  12.264  188.381 1.00 59.24  ? 35  LEU 4 O   1 
ATOM 8242  C CB  . LEU D 1 35  ? 60.284  13.012  191.555 1.00 48.37  ? 35  LEU 4 CB  1 
ATOM 8243  C CG  . LEU D 1 35  ? 59.040  13.795  191.960 1.00 52.45  ? 35  LEU 4 CG  1 
ATOM 8244  C CD1 . LEU D 1 35  ? 59.472  15.159  192.524 1.00 54.02  ? 35  LEU 4 CD1 1 
ATOM 8245  C CD2 . LEU D 1 35  ? 58.069  13.929  190.717 1.00 20.88  ? 35  LEU 4 CD2 1 
ATOM 8246  N N   . GLY D 1 36  ? 61.779  11.199  189.520 1.00 57.19  ? 36  GLY 4 N   1 
ATOM 8247  C CA  . GLY D 1 36  ? 62.669  11.094  188.389 1.00 62.23  ? 36  GLY 4 CA  1 
ATOM 8248  C C   . GLY D 1 36  ? 62.235  10.346  187.142 1.00 64.00  ? 36  GLY 4 C   1 
ATOM 8249  O O   . GLY D 1 36  ? 62.796  10.593  186.078 1.00 82.25  ? 36  GLY 4 O   1 
ATOM 8250  N N   . VAL D 1 37  ? 61.280  9.431   187.234 1.00 61.59  ? 37  VAL 4 N   1 
ATOM 8251  C CA  . VAL D 1 37  ? 60.872  8.691   186.044 1.00 60.48  ? 37  VAL 4 CA  1 
ATOM 8252  C C   . VAL D 1 37  ? 60.429  9.651   184.962 1.00 60.77  ? 37  VAL 4 C   1 
ATOM 8253  O O   . VAL D 1 37  ? 59.617  10.538  185.235 1.00 79.31  ? 37  VAL 4 O   1 
ATOM 8254  C CB  . VAL D 1 37  ? 59.722  7.753   186.335 1.00 60.30  ? 37  VAL 4 CB  1 
ATOM 8255  C CG1 . VAL D 1 37  ? 59.336  7.021   185.077 1.00 66.39  ? 37  VAL 4 CG1 1 
ATOM 8256  C CG2 . VAL D 1 37  ? 60.132  6.764   187.395 1.00 87.34  ? 37  VAL 4 CG2 1 
ATOM 8257  N N   . LYS D 1 38  ? 60.944  9.473   183.743 1.00 56.05  ? 38  LYS 4 N   1 
ATOM 8258  C CA  . LYS D 1 38  ? 60.586  10.370  182.651 1.00 60.63  ? 38  LYS 4 CA  1 
ATOM 8259  C C   . LYS D 1 38  ? 59.184  10.149  182.163 1.00 57.05  ? 38  LYS 4 C   1 
ATOM 8260  O O   . LYS D 1 38  ? 58.812  9.049   181.794 1.00 69.29  ? 38  LYS 4 O   1 
ATOM 8261  C CB  . LYS D 1 38  ? 61.604  10.344  181.506 1.00 86.76  ? 38  LYS 4 CB  1 
ATOM 8262  C CG  . LYS D 1 38  ? 62.867  11.166  181.820 1.00 129.83 ? 38  LYS 4 CG  1 
ATOM 8263  C CD  . LYS D 1 38  ? 63.544  11.715  180.556 1.00 162.55 ? 38  LYS 4 CD  1 
ATOM 8264  C CE  . LYS D 1 38  ? 64.673  12.710  180.894 1.00 181.95 ? 38  LYS 4 CE  1 
ATOM 8265  N NZ  . LYS D 1 38  ? 65.369  13.264  179.679 1.00 193.65 ? 38  LYS 4 NZ  1 
ATOM 8266  N N   . THR D 1 39  ? 58.408  11.225  182.174 1.00 56.72  ? 39  THR 4 N   1 
ATOM 8267  C CA  . THR D 1 39  ? 57.007  11.191  181.801 1.00 49.16  ? 39  THR 4 CA  1 
ATOM 8268  C C   . THR D 1 39  ? 56.655  11.946  180.559 1.00 51.35  ? 39  THR 4 C   1 
ATOM 8269  O O   . THR D 1 39  ? 57.468  12.717  180.032 1.00 49.35  ? 39  THR 4 O   1 
ATOM 8270  C CB  . THR D 1 39  ? 56.192  11.808  182.910 1.00 49.56  ? 39  THR 4 CB  1 
ATOM 8271  O OG1 . THR D 1 39  ? 56.909  12.928  183.463 1.00 66.42  ? 39  THR 4 OG1 1 
ATOM 8272  C CG2 . THR D 1 39  ? 55.937  10.800  183.975 1.00 57.87  ? 39  THR 4 CG2 1 
ATOM 8273  N N   . GLY D 1 40  ? 55.405  11.761  180.129 1.00 58.64  ? 40  GLY 4 N   1 
ATOM 8274  C CA  . GLY D 1 40  ? 54.924  12.481  178.970 1.00 59.06  ? 40  GLY 4 CA  1 
ATOM 8275  C C   . GLY D 1 40  ? 54.971  13.987  179.207 1.00 52.60  ? 40  GLY 4 C   1 
ATOM 8276  O O   . GLY D 1 40  ? 55.503  14.486  180.200 1.00 48.46  ? 40  GLY 4 O   1 
ATOM 8277  N N   . VAL D 1 41  ? 54.438  14.738  178.270 1.00 53.06  ? 41  VAL 4 N   1 
ATOM 8278  C CA  . VAL D 1 41  ? 54.410  16.172  178.434 1.00 51.00  ? 41  VAL 4 CA  1 
ATOM 8279  C C   . VAL D 1 41  ? 53.190  16.489  179.263 1.00 44.87  ? 41  VAL 4 C   1 
ATOM 8280  O O   . VAL D 1 41  ? 53.172  17.433  180.063 1.00 47.26  ? 41  VAL 4 O   1 
ATOM 8281  C CB  . VAL D 1 41  ? 54.261  16.836  177.096 1.00 47.17  ? 41  VAL 4 CB  1 
ATOM 8282  C CG1 . VAL D 1 41  ? 54.027  18.309  177.282 1.00 70.56  ? 41  VAL 4 CG1 1 
ATOM 8283  C CG2 . VAL D 1 41  ? 55.500  16.580  176.291 1.00 74.20  ? 41  VAL 4 CG2 1 
ATOM 8284  N N   . ASP D 1 42  ? 52.180  15.651  179.083 1.00 37.08  ? 42  ASP 4 N   1 
ATOM 8285  C CA  . ASP D 1 42  ? 50.924  15.818  179.773 1.00 42.90  ? 42  ASP 4 CA  1 
ATOM 8286  C C   . ASP D 1 42  ? 50.829  15.032  181.060 1.00 36.45  ? 42  ASP 4 C   1 
ATOM 8287  O O   . ASP D 1 42  ? 49.753  14.868  181.613 1.00 38.52  ? 42  ASP 4 O   1 
ATOM 8288  C CB  . ASP D 1 42  ? 49.773  15.423  178.855 1.00 60.68  ? 42  ASP 4 CB  1 
ATOM 8289  C CG  . ASP D 1 42  ? 50.022  15.808  177.426 1.00 83.08  ? 42  ASP 4 CG  1 
ATOM 8290  O OD1 . ASP D 1 42  ? 49.935  17.016  177.082 1.00 87.08  ? 42  ASP 4 OD1 1 
ATOM 8291  O OD2 . ASP D 1 42  ? 50.342  14.878  176.654 1.00 114.01 ? 42  ASP 4 OD2 1 
ATOM 8292  N N   . SER D 1 43  ? 51.935  14.509  181.548 1.00 37.03  ? 43  SER 4 N   1 
ATOM 8293  C CA  . SER D 1 43  ? 51.837  13.767  182.785 1.00 41.26  ? 43  SER 4 CA  1 
ATOM 8294  C C   . SER D 1 43  ? 51.611  14.808  183.858 1.00 37.01  ? 43  SER 4 C   1 
ATOM 8295  O O   . SER D 1 43  ? 51.541  16.003  183.565 1.00 47.37  ? 43  SER 4 O   1 
ATOM 8296  C CB  . SER D 1 43  ? 53.139  13.038  183.081 1.00 42.65  ? 43  SER 4 CB  1 
ATOM 8297  O OG  . SER D 1 43  ? 54.144  13.940  183.525 1.00 44.07  ? 43  SER 4 OG  1 
ATOM 8298  N N   . PHE D 1 44  ? 51.470  14.344  185.090 1.00 24.17  ? 44  PHE 4 N   1 
ATOM 8299  C CA  . PHE D 1 44  ? 51.332  15.224  186.217 1.00 23.56  ? 44  PHE 4 CA  1 
ATOM 8300  C C   . PHE D 1 44  ? 51.515  14.430  187.447 1.00 25.00  ? 44  PHE 4 C   1 
ATOM 8301  O O   . PHE D 1 44  ? 51.297  13.209  187.464 1.00 33.59  ? 44  PHE 4 O   1 
ATOM 8302  C CB  . PHE D 1 44  ? 50.033  15.968  186.239 1.00 12.65  ? 44  PHE 4 CB  1 
ATOM 8303  C CG  . PHE D 1 44  ? 48.855  15.126  186.472 1.00 29.02  ? 44  PHE 4 CG  1 
ATOM 8304  C CD1 . PHE D 1 44  ? 48.432  14.852  187.761 1.00 29.58  ? 44  PHE 4 CD1 1 
ATOM 8305  C CD2 . PHE D 1 44  ? 48.084  14.687  185.407 1.00 44.69  ? 44  PHE 4 CD2 1 
ATOM 8306  C CE1 . PHE D 1 44  ? 47.232  14.145  187.994 1.00 27.39  ? 44  PHE 4 CE1 1 
ATOM 8307  C CE2 . PHE D 1 44  ? 46.883  13.981  185.629 1.00 50.27  ? 44  PHE 4 CE2 1 
ATOM 8308  C CZ  . PHE D 1 44  ? 46.460  13.714  186.931 1.00 17.95  ? 44  PHE 4 CZ  1 
ATOM 8309  N N   . THR D 1 45  ? 51.872  15.114  188.508 1.00 6.65   ? 45  THR 4 N   1 
ATOM 8310  C CA  . THR D 1 45  ? 52.169  14.361  189.664 1.00 19.01  ? 45  THR 4 CA  1 
ATOM 8311  C C   . THR D 1 45  ? 51.618  15.063  190.843 1.00 26.05  ? 45  THR 4 C   1 
ATOM 8312  O O   . THR D 1 45  ? 51.449  16.285  190.828 1.00 44.25  ? 45  THR 4 O   1 
ATOM 8313  C CB  . THR D 1 45  ? 53.706  14.197  189.786 1.00 29.27  ? 45  THR 4 CB  1 
ATOM 8314  O OG1 . THR D 1 45  ? 54.230  15.162  190.701 1.00 33.55  ? 45  THR 4 OG1 1 
ATOM 8315  C CG2 . THR D 1 45  ? 54.378  14.457  188.428 1.00 32.99  ? 45  THR 4 CG2 1 
ATOM 8316  N N   . GLU D 1 46  ? 51.316  14.268  191.853 1.00 17.40  ? 46  GLU 4 N   1 
ATOM 8317  C CA  . GLU D 1 46  ? 50.792  14.760  193.100 1.00 19.23  ? 46  GLU 4 CA  1 
ATOM 8318  C C   . GLU D 1 46  ? 51.901  14.466  194.111 1.00 22.83  ? 46  GLU 4 C   1 
ATOM 8319  O O   . GLU D 1 46  ? 52.543  13.413  194.076 1.00 37.26  ? 46  GLU 4 O   1 
ATOM 8320  C CB  . GLU D 1 46  ? 49.496  14.009  193.470 1.00 34.59  ? 46  GLU 4 CB  1 
ATOM 8321  C CG  . GLU D 1 46  ? 48.374  13.987  192.379 1.00 31.34  ? 46  GLU 4 CG  1 
ATOM 8322  C CD  . GLU D 1 46  ? 47.024  13.362  192.840 1.00 49.70  ? 46  GLU 4 CD  1 
ATOM 8323  O OE1 . GLU D 1 46  ? 47.031  12.438  193.695 1.00 59.21  ? 46  GLU 4 OE1 1 
ATOM 8324  O OE2 . GLU D 1 46  ? 45.949  13.801  192.344 1.00 64.56  ? 46  GLU 4 OE2 1 
ATOM 8325  N N   . VAL D 1 47  ? 52.133  15.401  195.010 1.00 14.35  ? 47  VAL 4 N   1 
ATOM 8326  C CA  . VAL D 1 47  ? 53.180  15.253  195.993 1.00 10.12  ? 47  VAL 4 CA  1 
ATOM 8327  C C   . VAL D 1 47  ? 52.593  15.512  197.353 1.00 14.12  ? 47  VAL 4 C   1 
ATOM 8328  O O   . VAL D 1 47  ? 51.976  16.558  197.574 1.00 19.33  ? 47  VAL 4 O   1 
ATOM 8329  C CB  . VAL D 1 47  ? 54.259  16.272  195.702 1.00 9.42   ? 47  VAL 4 CB  1 
ATOM 8330  C CG1 . VAL D 1 47  ? 55.431  16.102  196.644 1.00 2.00   ? 47  VAL 4 CG1 1 
ATOM 8331  C CG2 . VAL D 1 47  ? 54.698  16.135  194.250 1.00 17.89  ? 47  VAL 4 CG2 1 
ATOM 8332  N N   . GLU D 1 48  ? 52.774  14.559  198.257 1.00 15.01  ? 48  GLU 4 N   1 
ATOM 8333  C CA  . GLU D 1 48  ? 52.219  14.670  199.595 1.00 15.37  ? 48  GLU 4 CA  1 
ATOM 8334  C C   . GLU D 1 48  ? 53.364  14.837  200.605 1.00 20.14  ? 48  GLU 4 C   1 
ATOM 8335  O O   . GLU D 1 48  ? 54.100  13.916  200.887 1.00 28.73  ? 48  GLU 4 O   1 
ATOM 8336  C CB  . GLU D 1 48  ? 51.312  13.421  199.895 1.00 20.06  ? 48  GLU 4 CB  1 
ATOM 8337  C CG  . GLU D 1 48  ? 50.102  13.199  198.883 1.00 14.62  ? 48  GLU 4 CG  1 
ATOM 8338  C CD  . GLU D 1 48  ? 49.114  11.964  199.109 1.00 31.83  ? 48  GLU 4 CD  1 
ATOM 8339  O OE1 . GLU D 1 48  ? 48.314  11.928  200.076 1.00 4.11   ? 48  GLU 4 OE1 1 
ATOM 8340  O OE2 . GLU D 1 48  ? 49.007  11.087  198.208 1.00 41.43  ? 48  GLU 4 OE2 1 
ATOM 8341  N N   . CYS D 1 49  ? 53.605  16.039  201.076 1.00 25.48  ? 49  CYS 4 N   1 
ATOM 8342  C CA  . CYS D 1 49  ? 54.678  16.192  202.049 1.00 26.68  ? 49  CYS 4 CA  1 
ATOM 8343  C C   . CYS D 1 49  ? 53.943  16.495  203.331 1.00 21.24  ? 49  CYS 4 C   1 
ATOM 8344  O O   . CYS D 1 49  ? 52.781  16.144  203.468 1.00 26.21  ? 49  CYS 4 O   1 
ATOM 8345  C CB  . CYS D 1 49  ? 55.518  17.394  201.684 1.00 2.00   ? 49  CYS 4 CB  1 
ATOM 8346  S SG  . CYS D 1 49  ? 54.441  18.674  201.715 1.00 82.20  ? 49  CYS 4 SG  1 
ATOM 8347  N N   . PHE D 1 50  ? 54.614  17.191  204.238 1.00 21.71  ? 50  PHE 4 N   1 
ATOM 8348  C CA  . PHE D 1 50  ? 54.039  17.615  205.509 1.00 21.14  ? 50  PHE 4 CA  1 
ATOM 8349  C C   . PHE D 1 50  ? 55.155  18.327  206.244 1.00 22.17  ? 50  PHE 4 C   1 
ATOM 8350  O O   . PHE D 1 50  ? 56.329  18.050  205.997 1.00 15.50  ? 50  PHE 4 O   1 
ATOM 8351  C CB  . PHE D 1 50  ? 53.595  16.433  206.331 1.00 21.46  ? 50  PHE 4 CB  1 
ATOM 8352  C CG  . PHE D 1 50  ? 54.688  15.788  207.090 1.00 23.30  ? 50  PHE 4 CG  1 
ATOM 8353  C CD1 . PHE D 1 50  ? 55.059  16.274  208.331 1.00 28.44  ? 50  PHE 4 CD1 1 
ATOM 8354  C CD2 . PHE D 1 50  ? 55.351  14.685  206.570 1.00 36.47  ? 50  PHE 4 CD2 1 
ATOM 8355  C CE1 . PHE D 1 50  ? 56.075  15.667  209.047 1.00 30.63  ? 50  PHE 4 CE1 1 
ATOM 8356  C CE2 . PHE D 1 50  ? 56.371  14.066  207.278 1.00 26.88  ? 50  PHE 4 CE2 1 
ATOM 8357  C CZ  . PHE D 1 50  ? 56.731  14.559  208.520 1.00 29.55  ? 50  PHE 4 CZ  1 
ATOM 8358  N N   . LEU D 1 51  ? 54.804  19.192  207.179 1.00 14.03  ? 51  LEU 4 N   1 
ATOM 8359  C CA  . LEU D 1 51  ? 55.823  19.923  207.901 1.00 11.40  ? 51  LEU 4 CA  1 
ATOM 8360  C C   . LEU D 1 51  ? 55.506  19.878  209.325 1.00 18.09  ? 51  LEU 4 C   1 
ATOM 8361  O O   . LEU D 1 51  ? 54.343  19.998  209.708 1.00 31.88  ? 51  LEU 4 O   1 
ATOM 8362  C CB  . LEU D 1 51  ? 55.834  21.394  207.529 1.00 9.45   ? 51  LEU 4 CB  1 
ATOM 8363  C CG  . LEU D 1 51  ? 56.266  21.793  206.127 1.00 17.11  ? 51  LEU 4 CG  1 
ATOM 8364  C CD1 . LEU D 1 51  ? 56.654  23.267  206.102 1.00 34.40  ? 51  LEU 4 CD1 1 
ATOM 8365  C CD2 . LEU D 1 51  ? 57.469  20.962  205.755 1.00 47.66  ? 51  LEU 4 CD2 1 
ATOM 8366  N N   . ASN D 1 52  ? 56.540  19.759  210.131 1.00 19.37  ? 52  ASN 4 N   1 
ATOM 8367  C CA  . ASN D 1 52  ? 56.314  19.728  211.558 1.00 18.50  ? 52  ASN 4 CA  1 
ATOM 8368  C C   . ASN D 1 52  ? 56.383  21.157  212.024 1.00 20.26  ? 52  ASN 4 C   1 
ATOM 8369  O O   . ASN D 1 52  ? 56.983  22.017  211.359 1.00 20.20  ? 52  ASN 4 O   1 
ATOM 8370  C CB  . ASN D 1 52  ? 57.367  18.902  212.266 1.00 10.78  ? 52  ASN 4 CB  1 
ATOM 8371  C CG  . ASN D 1 52  ? 57.140  17.422  212.121 1.00 40.77  ? 52  ASN 4 CG  1 
ATOM 8372  O OD1 . ASN D 1 52  ? 56.178  16.862  212.668 1.00 47.94  ? 52  ASN 4 OD1 1 
ATOM 8373  N ND2 . ASN D 1 52  ? 58.042  16.763  211.405 1.00 58.60  ? 52  ASN 4 ND2 1 
ATOM 8374  N N   . PRO D 1 53  ? 55.750  21.446  213.159 1.00 13.87  ? 53  PRO 4 N   1 
ATOM 8375  C CA  . PRO D 1 53  ? 55.779  22.822  213.662 1.00 39.97  ? 53  PRO 4 CA  1 
ATOM 8376  C C   . PRO D 1 53  ? 57.012  23.130  214.480 1.00 41.05  ? 53  PRO 4 C   1 
ATOM 8377  O O   . PRO D 1 53  ? 57.645  22.224  215.004 1.00 48.17  ? 53  PRO 4 O   1 
ATOM 8378  C CB  . PRO D 1 53  ? 54.511  22.895  214.529 1.00 40.08  ? 53  PRO 4 CB  1 
ATOM 8379  C CG  . PRO D 1 53  ? 54.398  21.507  215.082 1.00 11.71  ? 53  PRO 4 CG  1 
ATOM 8380  C CD  . PRO D 1 53  ? 54.777  20.618  213.894 1.00 14.68  ? 53  PRO 4 CD  1 
ATOM 8381  N N   . GLN D 1 54  ? 57.326  24.415  214.616 1.00 49.65  ? 54  GLN 4 N   1 
ATOM 8382  C CA  . GLN D 1 54  ? 58.464  24.840  215.431 1.00 44.45  ? 54  GLN 4 CA  1 
ATOM 8383  C C   . GLN D 1 54  ? 58.011  25.871  216.476 1.00 48.16  ? 54  GLN 4 C   1 
ATOM 8384  O O   . GLN D 1 54  ? 58.118  27.083  216.260 1.00 41.58  ? 54  GLN 4 O   1 
ATOM 8385  C CB  . GLN D 1 54  ? 59.556  25.431  214.555 1.00 35.63  ? 54  GLN 4 CB  1 
ATOM 8386  C CG  . GLN D 1 54  ? 60.000  24.533  213.425 1.00 44.62  ? 54  GLN 4 CG  1 
ATOM 8387  C CD  . GLN D 1 54  ? 60.826  23.381  213.907 1.00 61.86  ? 54  GLN 4 CD  1 
ATOM 8388  O OE1 . GLN D 1 54  ? 60.837  23.065  215.097 1.00 93.58  ? 54  GLN 4 OE1 1 
ATOM 8389  N NE2 . GLN D 1 54  ? 61.546  22.751  212.997 1.00 69.66  ? 54  GLN 4 NE2 1 
ATOM 8390  N N   . MET D 1 55  ? 57.479  25.394  217.598 1.00 47.46  ? 55  MET 4 N   1 
ATOM 8391  C CA  . MET D 1 55  ? 57.022  26.303  218.634 1.00 51.21  ? 55  MET 4 CA  1 
ATOM 8392  C C   . MET D 1 55  ? 58.157  26.765  219.551 1.00 56.77  ? 55  MET 4 C   1 
ATOM 8393  O O   . MET D 1 55  ? 57.992  27.693  220.343 1.00 58.26  ? 55  MET 4 O   1 
ATOM 8394  C CB  . MET D 1 55  ? 55.885  25.664  219.420 1.00 51.03  ? 55  MET 4 CB  1 
ATOM 8395  C CG  . MET D 1 55  ? 54.746  25.199  218.523 1.00 57.28  ? 55  MET 4 CG  1 
ATOM 8396  S SD  . MET D 1 55  ? 54.174  26.458  217.361 1.00 43.22  ? 55  MET 4 SD  1 
ATOM 8397  C CE  . MET D 1 55  ? 52.727  26.904  218.120 1.00 50.48  ? 55  MET 4 CE  1 
ATOM 8398  N N   . GLY D 1 56  ? 59.327  26.155  219.375 1.00 70.01  ? 56  GLY 4 N   1 
ATOM 8399  C CA  . GLY D 1 56  ? 60.499  26.487  220.170 1.00 74.64  ? 56  GLY 4 CA  1 
ATOM 8400  C C   . GLY D 1 56  ? 61.148  25.207  220.661 1.00 76.80  ? 56  GLY 4 C   1 
ATOM 8401  O O   . GLY D 1 56  ? 62.376  25.087  220.682 1.00 82.21  ? 56  GLY 4 O   1 
ATOM 8402  N N   . ASN D 1 57  ? 60.298  24.239  221.010 1.00 69.87  ? 57  ASN 4 N   1 
ATOM 8403  C CA  . ASN D 1 57  ? 60.706  22.924  221.505 1.00 62.35  ? 57  ASN 4 CA  1 
ATOM 8404  C C   . ASN D 1 57  ? 61.753  23.070  222.581 1.00 61.67  ? 57  ASN 4 C   1 
ATOM 8405  O O   . ASN D 1 57  ? 62.942  22.883  222.335 1.00 59.06  ? 57  ASN 4 O   1 
ATOM 8406  C CB  . ASN D 1 57  ? 61.227  22.047  220.375 1.00 65.49  ? 57  ASN 4 CB  1 
ATOM 8407  C CG  . ASN D 1 57  ? 60.147  21.657  219.406 1.00 76.10  ? 57  ASN 4 CG  1 
ATOM 8408  O OD1 . ASN D 1 57  ? 59.000  21.445  219.787 1.00 93.80  ? 57  ASN 4 OD1 1 
ATOM 8409  N ND2 . ASN D 1 57  ? 60.501  21.570  218.135 1.00 88.44  ? 57  ASN 4 ND2 1 
ATOM 8410  N N   . PRO D 1 58  ? 61.311  23.399  223.800 1.00 66.41  ? 58  PRO 4 N   1 
ATOM 8411  C CA  . PRO D 1 58  ? 62.132  23.603  224.994 1.00 72.15  ? 58  PRO 4 CA  1 
ATOM 8412  C C   . PRO D 1 58  ? 63.083  22.452  225.344 1.00 78.08  ? 58  PRO 4 C   1 
ATOM 8413  O O   . PRO D 1 58  ? 64.269  22.678  225.615 1.00 86.75  ? 58  PRO 4 O   1 
ATOM 8414  C CB  . PRO D 1 58  ? 61.085  23.853  226.076 1.00 70.65  ? 58  PRO 4 CB  1 
ATOM 8415  C CG  . PRO D 1 58  ? 59.898  23.097  225.584 1.00 67.78  ? 58  PRO 4 CG  1 
ATOM 8416  C CD  . PRO D 1 58  ? 59.883  23.472  224.145 1.00 68.68  ? 58  PRO 4 CD  1 
ATOM 8417  N N   . ASP D 1 59  ? 62.571  21.230  225.357 1.00 74.59  ? 59  ASP 4 N   1 
ATOM 8418  C CA  . ASP D 1 59  ? 63.408  20.090  225.660 1.00 74.32  ? 59  ASP 4 CA  1 
ATOM 8419  C C   . ASP D 1 59  ? 63.045  18.972  224.712 1.00 81.29  ? 59  ASP 4 C   1 
ATOM 8420  O O   . ASP D 1 59  ? 62.277  19.183  223.779 1.00 91.03  ? 59  ASP 4 O   1 
ATOM 8421  C CB  . ASP D 1 59  ? 63.249  19.663  227.119 1.00 76.34  ? 59  ASP 4 CB  1 
ATOM 8422  C CG  . ASP D 1 59  ? 61.824  19.321  227.491 1.00 86.99  ? 59  ASP 4 CG  1 
ATOM 8423  O OD1 . ASP D 1 59  ? 61.109  18.727  226.665 1.00 95.54  ? 59  ASP 4 OD1 1 
ATOM 8424  O OD2 . ASP D 1 59  ? 61.419  19.622  228.633 1.00 95.55  ? 59  ASP 4 OD2 1 
ATOM 8425  N N   . GLU D 1 60  ? 63.535  17.771  224.977 1.00 84.06  ? 60  GLU 4 N   1 
ATOM 8426  C CA  . GLU D 1 60  ? 63.260  16.642  224.099 1.00 90.37  ? 60  GLU 4 CA  1 
ATOM 8427  C C   . GLU D 1 60  ? 62.029  15.864  224.514 1.00 80.97  ? 60  GLU 4 C   1 
ATOM 8428  O O   . GLU D 1 60  ? 61.901  14.677  224.232 1.00 84.09  ? 60  GLU 4 O   1 
ATOM 8429  C CB  . GLU D 1 60  ? 64.484  15.711  223.996 1.00 114.03 ? 60  GLU 4 CB  1 
ATOM 8430  C CG  . GLU D 1 60  ? 64.766  14.785  225.213 1.00 141.58 ? 60  GLU 4 CG  1 
ATOM 8431  C CD  . GLU D 1 60  ? 65.299  15.498  226.465 1.00 155.54 ? 60  GLU 4 CD  1 
ATOM 8432  O OE1 . GLU D 1 60  ? 65.740  16.670  226.381 1.00 166.18 ? 60  GLU 4 OE1 1 
ATOM 8433  O OE2 . GLU D 1 60  ? 65.276  14.869  227.549 1.00 157.68 ? 60  GLU 4 OE2 1 
ATOM 8434  N N   . HIS D 1 61  ? 61.116  16.531  225.192 1.00 69.16  ? 61  HIS 4 N   1 
ATOM 8435  C CA  . HIS D 1 61  ? 59.891  15.885  225.630 1.00 74.47  ? 61  HIS 4 CA  1 
ATOM 8436  C C   . HIS D 1 61  ? 58.743  16.771  225.217 1.00 74.16  ? 61  HIS 4 C   1 
ATOM 8437  O O   . HIS D 1 61  ? 57.607  16.328  225.033 1.00 82.34  ? 61  HIS 4 O   1 
ATOM 8438  C CB  . HIS D 1 61  ? 59.865  15.766  227.155 1.00 80.63  ? 61  HIS 4 CB  1 
ATOM 8439  C CG  . HIS D 1 61  ? 60.690  14.646  227.700 1.00 97.09  ? 61  HIS 4 CG  1 
ATOM 8440  N ND1 . HIS D 1 61  ? 61.988  14.820  228.125 1.00 107.54 ? 61  HIS 4 ND1 1 
ATOM 8441  C CD2 . HIS D 1 61  ? 60.398  13.340  227.915 1.00 99.84  ? 61  HIS 4 CD2 1 
ATOM 8442  C CE1 . HIS D 1 61  ? 62.463  13.671  228.573 1.00 115.12 ? 61  HIS 4 CE1 1 
ATOM 8443  N NE2 . HIS D 1 61  ? 61.516  12.757  228.456 1.00 110.87 ? 61  HIS 4 NE2 1 
ATOM 8444  N N   . GLN D 1 62  ? 59.061  18.040  225.064 1.00 63.92  ? 62  GLN 4 N   1 
ATOM 8445  C CA  . GLN D 1 62  ? 58.065  19.002  224.747 1.00 50.14  ? 62  GLN 4 CA  1 
ATOM 8446  C C   . GLN D 1 62  ? 58.123  19.454  223.320 1.00 47.50  ? 62  GLN 4 C   1 
ATOM 8447  O O   . GLN D 1 62  ? 58.276  20.639  223.029 1.00 44.31  ? 62  GLN 4 O   1 
ATOM 8448  C CB  . GLN D 1 62  ? 58.186  20.164  225.708 1.00 49.57  ? 62  GLN 4 CB  1 
ATOM 8449  C CG  . GLN D 1 62  ? 58.026  19.732  227.136 1.00 56.99  ? 62  GLN 4 CG  1 
ATOM 8450  C CD  . GLN D 1 62  ? 57.651  20.875  228.037 1.00 79.25  ? 62  GLN 4 CD  1 
ATOM 8451  O OE1 . GLN D 1 62  ? 58.420  21.829  228.216 1.00 77.71  ? 62  GLN 4 OE1 1 
ATOM 8452  N NE2 . GLN D 1 62  ? 56.438  20.807  228.599 1.00 98.60  ? 62  GLN 4 NE2 1 
ATOM 8453  N N   . LYS D 1 63  ? 58.069  18.493  222.417 1.00 43.13  ? 63  LYS 4 N   1 
ATOM 8454  C CA  . LYS D 1 63  ? 58.047  18.859  221.031 1.00 44.48  ? 63  LYS 4 CA  1 
ATOM 8455  C C   . LYS D 1 63  ? 56.607  19.294  220.774 1.00 53.69  ? 63  LYS 4 C   1 
ATOM 8456  O O   . LYS D 1 63  ? 55.644  18.641  221.205 1.00 47.98  ? 63  LYS 4 O   1 
ATOM 8457  C CB  . LYS D 1 63  ? 58.433  17.692  220.157 1.00 46.22  ? 63  LYS 4 CB  1 
ATOM 8458  C CG  . LYS D 1 63  ? 59.898  17.690  219.773 1.00 60.62  ? 63  LYS 4 CG  1 
ATOM 8459  C CD  . LYS D 1 63  ? 60.197  16.516  218.831 1.00 91.55  ? 63  LYS 4 CD  1 
ATOM 8460  C CE  . LYS D 1 63  ? 61.613  16.539  218.249 1.00 100.09 ? 63  LYS 4 CE  1 
ATOM 8461  N NZ  . LYS D 1 63  ? 61.798  15.452  217.228 1.00 122.86 ? 63  LYS 4 NZ  1 
ATOM 8462  N N   . GLY D 1 64  ? 56.473  20.433  220.110 1.00 55.56  ? 64  GLY 4 N   1 
ATOM 8463  C CA  . GLY D 1 64  ? 55.167  20.971  219.823 1.00 50.47  ? 64  GLY 4 CA  1 
ATOM 8464  C C   . GLY D 1 64  ? 54.786  22.094  220.764 1.00 49.02  ? 64  GLY 4 C   1 
ATOM 8465  O O   . GLY D 1 64  ? 53.697  22.674  220.622 1.00 58.10  ? 64  GLY 4 O   1 
ATOM 8466  N N   . LEU D 1 65  ? 55.665  22.425  221.708 1.00 30.11  ? 65  LEU 4 N   1 
ATOM 8467  C CA  . LEU D 1 65  ? 55.375  23.500  222.649 1.00 34.54  ? 65  LEU 4 CA  1 
ATOM 8468  C C   . LEU D 1 65  ? 56.468  24.535  222.654 1.00 33.68  ? 65  LEU 4 C   1 
ATOM 8469  O O   . LEU D 1 65  ? 57.586  24.270  222.241 1.00 43.63  ? 65  LEU 4 O   1 
ATOM 8470  C CB  . LEU D 1 65  ? 55.230  22.944  224.053 1.00 42.59  ? 65  LEU 4 CB  1 
ATOM 8471  C CG  . LEU D 1 65  ? 54.298  21.742  224.122 1.00 58.84  ? 65  LEU 4 CG  1 
ATOM 8472  C CD1 . LEU D 1 65  ? 54.347  21.117  225.483 1.00 78.23  ? 65  LEU 4 CD1 1 
ATOM 8473  C CD2 . LEU D 1 65  ? 52.905  22.181  223.798 1.00 63.45  ? 65  LEU 4 CD2 1 
ATOM 8474  N N   . SER D 1 66  ? 56.140  25.737  223.077 1.00 28.97  ? 66  SER 4 N   1 
ATOM 8475  C CA  . SER D 1 66  ? 57.153  26.765  223.139 1.00 37.16  ? 66  SER 4 CA  1 
ATOM 8476  C C   . SER D 1 66  ? 57.684  26.721  224.555 1.00 45.99  ? 66  SER 4 C   1 
ATOM 8477  O O   . SER D 1 66  ? 57.062  26.121  225.426 1.00 42.59  ? 66  SER 4 O   1 
ATOM 8478  C CB  . SER D 1 66  ? 56.524  28.115  222.873 1.00 31.40  ? 66  SER 4 CB  1 
ATOM 8479  O OG  . SER D 1 66  ? 55.363  28.261  223.677 1.00 47.31  ? 66  SER 4 OG  1 
ATOM 8480  N N   . LYS D 1 67  ? 58.818  27.352  224.809 1.00 55.62  ? 67  LYS 4 N   1 
ATOM 8481  C CA  . LYS D 1 67  ? 59.323  27.360  226.163 1.00 72.73  ? 67  LYS 4 CA  1 
ATOM 8482  C C   . LYS D 1 67  ? 58.291  28.198  226.879 1.00 75.09  ? 67  LYS 4 C   1 
ATOM 8483  O O   . LYS D 1 67  ? 57.768  29.144  226.290 1.00 82.69  ? 67  LYS 4 O   1 
ATOM 8484  C CB  . LYS D 1 67  ? 60.676  28.069  226.261 1.00 88.80  ? 67  LYS 4 CB  1 
ATOM 8485  C CG  . LYS D 1 67  ? 61.256  28.121  227.711 1.00 111.48 ? 67  LYS 4 CG  1 
ATOM 8486  C CD  . LYS D 1 67  ? 62.662  28.763  227.781 1.00 122.71 ? 67  LYS 4 CD  1 
ATOM 8487  C CE  . LYS D 1 67  ? 63.285  28.722  229.186 1.00 126.90 ? 67  LYS 4 CE  1 
ATOM 8488  N NZ  . LYS D 1 67  ? 64.676  29.295  229.220 1.00 141.83 ? 67  LYS 4 NZ  1 
ATOM 8489  N N   . SER D 1 68  ? 57.985  27.819  228.119 1.00 78.03  ? 68  SER 4 N   1 
ATOM 8490  C CA  . SER D 1 68  ? 57.034  28.523  228.979 1.00 78.12  ? 68  SER 4 CA  1 
ATOM 8491  C C   . SER D 1 68  ? 57.057  30.015  228.645 1.00 70.37  ? 68  SER 4 C   1 
ATOM 8492  O O   . SER D 1 68  ? 58.119  30.649  228.624 1.00 58.46  ? 68  SER 4 O   1 
ATOM 8493  C CB  . SER D 1 68  ? 57.417  28.303  230.447 1.00 90.29  ? 68  SER 4 CB  1 
ATOM 8494  O OG  . SER D 1 68  ? 57.837  26.958  230.676 1.00 119.56 ? 68  SER 4 OG  1 
ATOM 8495  N N   . LEU D 1 69  ? 55.887  30.561  228.348 1.00 67.43  ? 69  LEU 4 N   1 
ATOM 8496  C CA  . LEU D 1 69  ? 55.801  31.945  227.948 1.00 61.54  ? 69  LEU 4 CA  1 
ATOM 8497  C C   . LEU D 1 69  ? 56.023  32.971  228.998 1.00 60.22  ? 69  LEU 4 C   1 
ATOM 8498  O O   . LEU D 1 69  ? 55.568  32.848  230.134 1.00 55.10  ? 69  LEU 4 O   1 
ATOM 8499  C CB  . LEU D 1 69  ? 54.524  32.217  227.172 1.00 62.57  ? 69  LEU 4 CB  1 
ATOM 8500  C CG  . LEU D 1 69  ? 54.731  31.808  225.713 1.00 66.25  ? 69  LEU 4 CG  1 
ATOM 8501  C CD1 . LEU D 1 69  ? 53.409  31.425  225.079 1.00 63.97  ? 69  LEU 4 CD1 1 
ATOM 8502  C CD2 . LEU D 1 69  ? 55.445  32.935  224.950 1.00 70.41  ? 69  LEU 4 CD2 1 
ATOM 8503  N N   . ALA D 1 70  ? 56.762  33.984  228.569 1.00 68.44  ? 70  ALA 4 N   1 
ATOM 8504  C CA  . ALA D 1 70  ? 57.144  35.127  229.372 1.00 78.58  ? 70  ALA 4 CA  1 
ATOM 8505  C C   . ALA D 1 70  ? 56.071  36.192  229.248 1.00 86.99  ? 70  ALA 4 C   1 
ATOM 8506  O O   . ALA D 1 70  ? 55.434  36.313  228.184 1.00 96.09  ? 70  ALA 4 O   1 
ATOM 8507  C CB  . ALA D 1 70  ? 58.454  35.667  228.861 1.00 92.51  ? 70  ALA 4 CB  1 
ATOM 8508  N N   . ALA D 1 71  ? 55.963  37.033  230.280 1.00 85.24  ? 71  ALA 4 N   1 
ATOM 8509  C CA  . ALA D 1 71  ? 54.943  38.079  230.301 1.00 86.50  ? 71  ALA 4 CA  1 
ATOM 8510  C C   . ALA D 1 71  ? 55.321  39.567  230.348 1.00 82.72  ? 71  ALA 4 C   1 
ATOM 8511  O O   . ALA D 1 71  ? 55.673  40.162  229.328 1.00 89.15  ? 71  ALA 4 O   1 
ATOM 8512  C CB  . ALA D 1 71  ? 53.896  37.769  231.388 1.00 84.14  ? 71  ALA 4 CB  1 
ATOM 8513  N N   . GLU D 1 72  ? 55.274  40.143  231.542 1.00 66.55  ? 72  GLU 4 N   1 
ATOM 8514  C CA  . GLU D 1 72  ? 55.493  41.571  231.756 1.00 67.35  ? 72  GLU 4 CA  1 
ATOM 8515  C C   . GLU D 1 72  ? 56.844  42.283  231.513 1.00 61.26  ? 72  GLU 4 C   1 
ATOM 8516  O O   . GLU D 1 72  ? 57.123  43.291  232.163 1.00 61.95  ? 72  GLU 4 O   1 
ATOM 8517  C CB  . GLU D 1 72  ? 54.919  41.918  233.142 1.00 78.80  ? 72  GLU 4 CB  1 
ATOM 8518  C CG  . GLU D 1 72  ? 53.450  41.438  233.307 1.00 95.15  ? 72  GLU 4 CG  1 
ATOM 8519  C CD  . GLU D 1 72  ? 52.858  41.646  234.698 1.00 100.26 ? 72  GLU 4 CD  1 
ATOM 8520  O OE1 . GLU D 1 72  ? 53.475  41.201  235.691 1.00 111.25 ? 72  GLU 4 OE1 1 
ATOM 8521  O OE2 . GLU D 1 72  ? 51.740  42.204  234.794 1.00 108.70 ? 72  GLU 4 OE2 1 
ATOM 8522  N N   . LYS D 1 73  ? 57.627  41.854  230.521 1.00 53.37  ? 73  LYS 4 N   1 
ATOM 8523  C CA  . LYS D 1 73  ? 58.931  42.483  230.256 1.00 61.83  ? 73  LYS 4 CA  1 
ATOM 8524  C C   . LYS D 1 73  ? 58.945  43.984  229.976 1.00 54.35  ? 73  LYS 4 C   1 
ATOM 8525  O O   . LYS D 1 73  ? 58.009  44.533  229.437 1.00 44.83  ? 73  LYS 4 O   1 
ATOM 8526  C CB  . LYS D 1 73  ? 59.660  41.774  229.123 1.00 82.60  ? 73  LYS 4 CB  1 
ATOM 8527  C CG  . LYS D 1 73  ? 60.361  40.495  229.544 1.00 119.94 ? 73  LYS 4 CG  1 
ATOM 8528  C CD  . LYS D 1 73  ? 61.038  39.836  228.339 1.00 151.89 ? 73  LYS 4 CD  1 
ATOM 8529  C CE  . LYS D 1 73  ? 61.612  38.461  228.682 1.00 174.98 ? 73  LYS 4 CE  1 
ATOM 8530  N NZ  . LYS D 1 73  ? 62.017  37.659  227.484 1.00 178.61 ? 73  LYS 4 NZ  1 
ATOM 8531  N N   . GLN D 1 74  ? 59.997  44.669  230.394 1.00 63.97  ? 74  GLN 4 N   1 
ATOM 8532  C CA  . GLN D 1 74  ? 60.059  46.094  230.123 1.00 78.67  ? 74  GLN 4 CA  1 
ATOM 8533  C C   . GLN D 1 74  ? 60.458  46.162  228.660 1.00 69.53  ? 74  GLN 4 C   1 
ATOM 8534  O O   . GLN D 1 74  ? 61.168  45.286  228.187 1.00 72.78  ? 74  GLN 4 O   1 
ATOM 8535  C CB  . GLN D 1 74  ? 61.078  46.807  231.043 1.00 102.14 ? 74  GLN 4 CB  1 
ATOM 8536  C CG  . GLN D 1 74  ? 61.286  48.333  230.777 1.00 125.56 ? 74  GLN 4 CG  1 
ATOM 8537  C CD  . GLN D 1 74  ? 59.981  49.151  230.599 1.00 135.88 ? 74  GLN 4 CD  1 
ATOM 8538  O OE1 . GLN D 1 74  ? 58.908  48.754  231.065 1.00 144.59 ? 74  GLN 4 OE1 1 
ATOM 8539  N NE2 . GLN D 1 74  ? 60.083  50.296  229.910 1.00 122.09 ? 74  GLN 4 NE2 1 
ATOM 8540  N N   . PHE D 1 75  ? 59.961  47.166  227.941 1.00 64.59  ? 75  PHE 4 N   1 
ATOM 8541  C CA  . PHE D 1 75  ? 60.261  47.336  226.516 1.00 70.14  ? 75  PHE 4 CA  1 
ATOM 8542  C C   . PHE D 1 75  ? 61.753  47.370  226.280 1.00 70.01  ? 75  PHE 4 C   1 
ATOM 8543  O O   . PHE D 1 75  ? 62.282  46.766  225.350 1.00 68.66  ? 75  PHE 4 O   1 
ATOM 8544  C CB  . PHE D 1 75  ? 59.685  48.650  225.982 1.00 85.04  ? 75  PHE 4 CB  1 
ATOM 8545  C CG  . PHE D 1 75  ? 58.206  48.606  225.639 1.00 101.93 ? 75  PHE 4 CG  1 
ATOM 8546  C CD1 . PHE D 1 75  ? 57.252  48.209  226.580 1.00 99.50  ? 75  PHE 4 CD1 1 
ATOM 8547  C CD2 . PHE D 1 75  ? 57.763  49.077  224.396 1.00 114.67 ? 75  PHE 4 CD2 1 
ATOM 8548  C CE1 . PHE D 1 75  ? 55.892  48.294  226.296 1.00 89.14  ? 75  PHE 4 CE1 1 
ATOM 8549  C CE2 . PHE D 1 75  ? 56.402  49.165  224.102 1.00 112.77 ? 75  PHE 4 CE2 1 
ATOM 8550  C CZ  . PHE D 1 75  ? 55.466  48.773  225.060 1.00 108.27 ? 75  PHE 4 CZ  1 
ATOM 8551  N N   . THR D 1 76  ? 62.437  48.092  227.145 1.00 78.56  ? 76  THR 4 N   1 
ATOM 8552  C CA  . THR D 1 76  ? 63.867  48.226  227.018 1.00 89.45  ? 76  THR 4 CA  1 
ATOM 8553  C C   . THR D 1 76  ? 64.608  47.011  227.518 1.00 87.99  ? 76  THR 4 C   1 
ATOM 8554  O O   . THR D 1 76  ? 65.818  46.893  227.338 1.00 91.34  ? 76  THR 4 O   1 
ATOM 8555  C CB  . THR D 1 76  ? 64.329  49.447  227.758 1.00 94.15  ? 76  THR 4 CB  1 
ATOM 8556  O OG1 . THR D 1 76  ? 63.177  50.140  228.273 1.00 90.05  ? 76  THR 4 OG1 1 
ATOM 8557  C CG2 . THR D 1 76  ? 65.106  50.356  226.792 1.00 106.10 ? 76  THR 4 CG2 1 
ATOM 8558  N N   . ASP D 1 77  ? 63.872  46.097  228.125 1.00 88.97  ? 77  ASP 4 N   1 
ATOM 8559  C CA  . ASP D 1 77  ? 64.478  44.897  228.635 1.00 96.21  ? 77  ASP 4 CA  1 
ATOM 8560  C C   . ASP D 1 77  ? 63.750  43.645  228.140 1.00 92.60  ? 77  ASP 4 C   1 
ATOM 8561  O O   . ASP D 1 77  ? 63.695  42.621  228.827 1.00 88.38  ? 77  ASP 4 O   1 
ATOM 8562  C CB  . ASP D 1 77  ? 64.505  44.957  230.155 1.00 113.45 ? 77  ASP 4 CB  1 
ATOM 8563  C CG  . ASP D 1 77  ? 65.648  44.171  230.731 1.00 133.42 ? 77  ASP 4 CG  1 
ATOM 8564  O OD1 . ASP D 1 77  ? 66.770  44.263  230.169 1.00 145.05 ? 77  ASP 4 OD1 1 
ATOM 8565  O OD2 . ASP D 1 77  ? 65.423  43.455  231.731 1.00 146.78 ? 77  ASP 4 OD2 1 
ATOM 8566  N N   . ASP D 1 78  ? 63.214  43.713  226.926 1.00 85.41  ? 78  ASP 4 N   1 
ATOM 8567  C CA  . ASP D 1 78  ? 62.498  42.573  226.381 1.00 77.91  ? 78  ASP 4 CA  1 
ATOM 8568  C C   . ASP D 1 78  ? 63.403  41.755  225.494 1.00 73.96  ? 78  ASP 4 C   1 
ATOM 8569  O O   . ASP D 1 78  ? 63.683  42.127  224.355 1.00 66.75  ? 78  ASP 4 O   1 
ATOM 8570  C CB  . ASP D 1 78  ? 61.248  43.015  225.606 1.00 79.31  ? 78  ASP 4 CB  1 
ATOM 8571  C CG  . ASP D 1 78  ? 60.376  41.839  225.148 1.00 76.59  ? 78  ASP 4 CG  1 
ATOM 8572  O OD1 . ASP D 1 78  ? 60.738  40.655  225.453 1.00 52.30  ? 78  ASP 4 OD1 1 
ATOM 8573  O OD2 . ASP D 1 78  ? 59.328  42.117  224.480 1.00 51.64  ? 78  ASP 4 OD2 1 
ATOM 8574  N N   . SER D 1 79  ? 63.943  40.692  226.072 1.00 65.90  ? 79  SER 4 N   1 
ATOM 8575  C CA  . SER D 1 79  ? 64.791  39.777  225.336 1.00 65.72  ? 79  SER 4 CA  1 
ATOM 8576  C C   . SER D 1 79  ? 64.312  38.373  225.625 1.00 63.41  ? 79  SER 4 C   1 
ATOM 8577  O O   . SER D 1 79  ? 64.586  37.805  226.689 1.00 54.10  ? 79  SER 4 O   1 
ATOM 8578  C CB  . SER D 1 79  ? 66.237  39.890  225.742 1.00 68.83  ? 79  SER 4 CB  1 
ATOM 8579  O OG  . SER D 1 79  ? 66.996  39.111  224.833 1.00 103.88 ? 79  SER 4 OG  1 
ATOM 8580  N N   . PRO D 1 80  ? 63.454  37.855  224.751 1.00 60.29  ? 80  PRO 4 N   1 
ATOM 8581  C CA  . PRO D 1 80  ? 62.883  36.514  224.872 1.00 51.58  ? 80  PRO 4 CA  1 
ATOM 8582  C C   . PRO D 1 80  ? 63.884  35.482  224.413 1.00 44.73  ? 80  PRO 4 C   1 
ATOM 8583  O O   . PRO D 1 80  ? 64.937  35.854  223.913 1.00 45.80  ? 80  PRO 4 O   1 
ATOM 8584  C CB  . PRO D 1 80  ? 61.682  36.600  223.961 1.00 53.02  ? 80  PRO 4 CB  1 
ATOM 8585  C CG  . PRO D 1 80  ? 62.194  37.504  222.869 1.00 56.94  ? 80  PRO 4 CG  1 
ATOM 8586  C CD  . PRO D 1 80  ? 62.878  38.586  223.612 1.00 48.15  ? 80  PRO 4 CD  1 
ATOM 8587  N N   . ASP D 1 81  ? 63.567  34.204  224.601 1.00 45.15  ? 81  ASP 4 N   1 
ATOM 8588  C CA  . ASP D 1 81  ? 64.464  33.105  224.216 1.00 56.72  ? 81  ASP 4 CA  1 
ATOM 8589  C C   . ASP D 1 81  ? 63.920  32.412  222.991 1.00 56.23  ? 81  ASP 4 C   1 
ATOM 8590  O O   . ASP D 1 81  ? 62.719  32.158  222.894 1.00 51.03  ? 81  ASP 4 O   1 
ATOM 8591  C CB  . ASP D 1 81  ? 64.566  32.028  225.309 1.00 81.64  ? 81  ASP 4 CB  1 
ATOM 8592  C CG  . ASP D 1 81  ? 64.884  32.584  226.697 1.00 99.13  ? 81  ASP 4 CG  1 
ATOM 8593  O OD1 . ASP D 1 81  ? 64.752  33.813  226.934 1.00 113.27 ? 81  ASP 4 OD1 1 
ATOM 8594  O OD2 . ASP D 1 81  ? 65.228  31.750  227.575 1.00 98.09  ? 81  ASP 4 OD2 1 
ATOM 8595  N N   . LYS D 1 82  ? 64.815  31.986  222.113 1.00 50.06  ? 82  LYS 4 N   1 
ATOM 8596  C CA  . LYS D 1 82  ? 64.379  31.332  220.900 1.00 45.16  ? 82  LYS 4 CA  1 
ATOM 8597  C C   . LYS D 1 82  ? 63.437  30.174  221.153 1.00 47.17  ? 82  LYS 4 C   1 
ATOM 8598  O O   . LYS D 1 82  ? 62.614  29.840  220.304 1.00 58.65  ? 82  LYS 4 O   1 
ATOM 8599  C CB  . LYS D 1 82  ? 65.565  30.869  220.081 1.00 36.10  ? 82  LYS 4 CB  1 
ATOM 8600  C CG  . LYS D 1 82  ? 65.164  29.916  218.980 1.00 46.35  ? 82  LYS 4 CG  1 
ATOM 8601  C CD  . LYS D 1 82  ? 66.125  29.976  217.833 1.00 56.11  ? 82  LYS 4 CD  1 
ATOM 8602  C CE  . LYS D 1 82  ? 65.830  28.887  216.815 1.00 85.68  ? 82  LYS 4 CE  1 
ATOM 8603  N NZ  . LYS D 1 82  ? 66.720  28.995  215.609 1.00 102.51 ? 82  LYS 4 NZ  1 
ATOM 8604  N N   . GLU D 1 83  ? 63.555  29.546  222.309 1.00 48.43  ? 83  GLU 4 N   1 
ATOM 8605  C CA  . GLU D 1 83  ? 62.676  28.426  222.604 1.00 55.24  ? 83  GLU 4 CA  1 
ATOM 8606  C C   . GLU D 1 83  ? 61.281  28.960  222.896 1.00 45.80  ? 83  GLU 4 C   1 
ATOM 8607  O O   . GLU D 1 83  ? 60.308  28.213  222.872 1.00 52.92  ? 83  GLU 4 O   1 
ATOM 8608  C CB  . GLU D 1 83  ? 63.201  27.579  223.768 1.00 68.31  ? 83  GLU 4 CB  1 
ATOM 8609  C CG  . GLU D 1 83  ? 64.483  26.800  223.493 1.00 84.95  ? 83  GLU 4 CG  1 
ATOM 8610  C CD  . GLU D 1 83  ? 65.677  27.697  223.236 1.00 104.52 ? 83  GLU 4 CD  1 
ATOM 8611  O OE1 . GLU D 1 83  ? 65.861  28.684  223.987 1.00 113.84 ? 83  GLU 4 OE1 1 
ATOM 8612  O OE2 . GLU D 1 83  ? 66.426  27.428  222.272 1.00 116.52 ? 83  GLU 4 OE2 1 
ATOM 8613  N N   . GLN D 1 84  ? 61.200  30.236  223.242 1.00 28.42  ? 84  GLN 4 N   1 
ATOM 8614  C CA  . GLN D 1 84  ? 59.914  30.871  223.485 1.00 44.35  ? 84  GLN 4 CA  1 
ATOM 8615  C C   . GLN D 1 84  ? 59.361  31.412  222.165 1.00 48.25  ? 84  GLN 4 C   1 
ATOM 8616  O O   . GLN D 1 84  ? 58.196  31.829  222.080 1.00 53.18  ? 84  GLN 4 O   1 
ATOM 8617  C CB  . GLN D 1 84  ? 60.078  32.097  224.364 1.00 49.95  ? 84  GLN 4 CB  1 
ATOM 8618  C CG  . GLN D 1 84  ? 60.815  31.924  225.642 1.00 52.43  ? 84  GLN 4 CG  1 
ATOM 8619  C CD  . GLN D 1 84  ? 60.621  33.130  226.538 1.00 56.23  ? 84  GLN 4 CD  1 
ATOM 8620  O OE1 . GLN D 1 84  ? 61.059  34.251  226.227 1.00 58.16  ? 84  GLN 4 OE1 1 
ATOM 8621  N NE2 . GLN D 1 84  ? 59.899  32.925  227.624 1.00 52.46  ? 84  GLN 4 NE2 1 
ATOM 8622  N N   . LEU D 1 85  ? 60.218  31.482  221.157 1.00 30.58  ? 85  LEU 4 N   1 
ATOM 8623  C CA  . LEU D 1 85  ? 59.804  32.050  219.898 1.00 25.83  ? 85  LEU 4 CA  1 
ATOM 8624  C C   . LEU D 1 85  ? 59.471  31.156  218.756 1.00 37.49  ? 85  LEU 4 C   1 
ATOM 8625  O O   . LEU D 1 85  ? 60.359  30.646  218.050 1.00 49.97  ? 85  LEU 4 O   1 
ATOM 8626  C CB  . LEU D 1 85  ? 60.815  33.069  219.442 1.00 24.45  ? 85  LEU 4 CB  1 
ATOM 8627  C CG  . LEU D 1 85  ? 60.909  34.149  220.502 1.00 30.71  ? 85  LEU 4 CG  1 
ATOM 8628  C CD1 . LEU D 1 85  ? 61.515  35.347  219.870 1.00 23.35  ? 85  LEU 4 CD1 1 
ATOM 8629  C CD2 . LEU D 1 85  ? 59.537  34.491  221.059 1.00 35.14  ? 85  LEU 4 CD2 1 
ATOM 8630  N N   . PRO D 1 86  ? 58.174  31.019  218.485 1.00 36.12  ? 86  PRO 4 N   1 
ATOM 8631  C CA  . PRO D 1 86  ? 57.783  30.162  217.374 1.00 28.19  ? 86  PRO 4 CA  1 
ATOM 8632  C C   . PRO D 1 86  ? 58.180  30.840  216.065 1.00 27.46  ? 86  PRO 4 C   1 
ATOM 8633  O O   . PRO D 1 86  ? 58.111  32.083  215.935 1.00 40.47  ? 86  PRO 4 O   1 
ATOM 8634  C CB  . PRO D 1 86  ? 56.276  30.039  217.564 1.00 24.91  ? 86  PRO 4 CB  1 
ATOM 8635  C CG  . PRO D 1 86  ? 56.085  30.259  219.040 1.00 25.35  ? 86  PRO 4 CG  1 
ATOM 8636  C CD  . PRO D 1 86  ? 57.005  31.433  219.267 1.00 37.10  ? 86  PRO 4 CD  1 
ATOM 8637  N N   . CYS D 1 87  ? 58.632  30.019  215.125 1.00 20.06  ? 87  CYS 4 N   1 
ATOM 8638  C CA  . CYS D 1 87  ? 59.086  30.477  213.820 1.00 34.03  ? 87  CYS 4 CA  1 
ATOM 8639  C C   . CYS D 1 87  ? 58.399  29.807  212.654 1.00 34.13  ? 87  CYS 4 C   1 
ATOM 8640  O O   . CYS D 1 87  ? 57.869  28.689  212.760 1.00 31.59  ? 87  CYS 4 O   1 
ATOM 8641  C CB  . CYS D 1 87  ? 60.567  30.174  213.647 1.00 42.06  ? 87  CYS 4 CB  1 
ATOM 8642  S SG  . CYS D 1 87  ? 61.612  31.075  214.705 1.00 52.69  ? 87  CYS 4 SG  1 
ATOM 8643  N N   . TYR D 1 88  ? 58.516  30.437  211.497 1.00 31.21  ? 88  TYR 4 N   1 
ATOM 8644  C CA  . TYR D 1 88  ? 57.922  29.864  210.310 1.00 25.53  ? 88  TYR 4 CA  1 
ATOM 8645  C C   . TYR D 1 88  ? 58.712  28.637  209.959 1.00 25.60  ? 88  TYR 4 C   1 
ATOM 8646  O O   . TYR D 1 88  ? 59.974  28.644  210.036 1.00 37.12  ? 88  TYR 4 O   1 
ATOM 8647  C CB  . TYR D 1 88  ? 57.975  30.826  209.138 1.00 4.55   ? 88  TYR 4 CB  1 
ATOM 8648  C CG  . TYR D 1 88  ? 57.094  32.029  209.282 1.00 16.17  ? 88  TYR 4 CG  1 
ATOM 8649  C CD1 . TYR D 1 88  ? 57.472  33.096  210.090 1.00 19.43  ? 88  TYR 4 CD1 1 
ATOM 8650  C CD2 . TYR D 1 88  ? 55.942  32.159  208.509 1.00 9.50   ? 88  TYR 4 CD2 1 
ATOM 8651  C CE1 . TYR D 1 88  ? 56.737  34.280  210.106 1.00 33.67  ? 88  TYR 4 CE1 1 
ATOM 8652  C CE2 . TYR D 1 88  ? 55.206  33.324  208.518 1.00 27.66  ? 88  TYR 4 CE2 1 
ATOM 8653  C CZ  . TYR D 1 88  ? 55.611  34.392  209.311 1.00 33.97  ? 88  TYR 4 CZ  1 
ATOM 8654  O OH  . TYR D 1 88  ? 54.948  35.598  209.233 1.00 30.17  ? 88  TYR 4 OH  1 
ATOM 8655  N N   . SER D 1 89  ? 57.948  27.594  209.628 1.00 22.09  ? 89  SER 4 N   1 
ATOM 8656  C CA  . SER D 1 89  ? 58.457  26.282  209.216 1.00 28.27  ? 89  SER 4 CA  1 
ATOM 8657  C C   . SER D 1 89  ? 58.494  26.317  207.699 1.00 21.86  ? 89  SER 4 C   1 
ATOM 8658  O O   . SER D 1 89  ? 57.540  26.755  207.057 1.00 34.12  ? 89  SER 4 O   1 
ATOM 8659  C CB  . SER D 1 89  ? 57.519  25.146  209.689 1.00 25.49  ? 89  SER 4 CB  1 
ATOM 8660  O OG  . SER D 1 89  ? 57.112  25.310  211.065 1.00 49.56  ? 89  SER 4 OG  1 
ATOM 8661  N N   . VAL D 1 90  ? 59.575  25.857  207.107 1.00 18.66  ? 90  VAL 4 N   1 
ATOM 8662  C CA  . VAL D 1 90  ? 59.658  25.896  205.666 1.00 17.16  ? 90  VAL 4 CA  1 
ATOM 8663  C C   . VAL D 1 90  ? 60.359  24.657  205.151 1.00 20.16  ? 90  VAL 4 C   1 
ATOM 8664  O O   . VAL D 1 90  ? 60.947  23.909  205.936 1.00 21.57  ? 90  VAL 4 O   1 
ATOM 8665  C CB  . VAL D 1 90  ? 60.440  27.105  205.256 1.00 27.24  ? 90  VAL 4 CB  1 
ATOM 8666  C CG1 . VAL D 1 90  ? 61.847  26.980  205.770 1.00 29.17  ? 90  VAL 4 CG1 1 
ATOM 8667  C CG2 . VAL D 1 90  ? 60.396  27.281  203.754 1.00 39.31  ? 90  VAL 4 CG2 1 
ATOM 8668  N N   . ALA D 1 91  ? 60.347  24.456  203.838 1.00 9.62   ? 91  ALA 4 N   1 
ATOM 8669  C CA  . ALA D 1 91  ? 60.989  23.280  203.287 1.00 18.43  ? 91  ALA 4 CA  1 
ATOM 8670  C C   . ALA D 1 91  ? 60.944  23.362  201.784 1.00 29.68  ? 91  ALA 4 C   1 
ATOM 8671  O O   . ALA D 1 91  ? 60.067  24.058  201.221 1.00 17.66  ? 91  ALA 4 O   1 
ATOM 8672  C CB  . ALA D 1 91  ? 60.258  22.035  203.756 1.00 24.37  ? 91  ALA 4 CB  1 
ATOM 8673  N N   . ARG D 1 92  ? 61.836  22.614  201.129 1.00 22.54  ? 92  ARG 4 N   1 
ATOM 8674  C CA  . ARG D 1 92  ? 61.855  22.656  199.677 1.00 20.80  ? 92  ARG 4 CA  1 
ATOM 8675  C C   . ARG D 1 92  ? 61.847  21.317  198.967 1.00 21.98  ? 92  ARG 4 C   1 
ATOM 8676  O O   . ARG D 1 92  ? 62.695  20.462  199.218 1.00 35.28  ? 92  ARG 4 O   1 
ATOM 8677  C CB  . ARG D 1 92  ? 63.045  23.469  199.181 1.00 2.00   ? 92  ARG 4 CB  1 
ATOM 8678  C CG  . ARG D 1 92  ? 63.340  23.227  197.694 1.00 59.17  ? 92  ARG 4 CG  1 
ATOM 8679  C CD  . ARG D 1 92  ? 64.627  23.913  197.214 1.00 89.33  ? 92  ARG 4 CD  1 
ATOM 8680  N NE  . ARG D 1 92  ? 65.837  23.449  197.890 1.00 107.90 ? 92  ARG 4 NE  1 
ATOM 8681  C CZ  . ARG D 1 92  ? 66.848  22.831  197.284 1.00 115.09 ? 92  ARG 4 CZ  1 
ATOM 8682  N NH1 . ARG D 1 92  ? 66.808  22.594  195.975 1.00 110.20 ? 92  ARG 4 NH1 1 
ATOM 8683  N NH2 . ARG D 1 92  ? 67.909  22.461  197.991 1.00 139.23 ? 92  ARG 4 NH2 1 
ATOM 8684  N N   . ILE D 1 93  ? 60.903  21.136  198.066 1.00 2.53   ? 93  ILE 4 N   1 
ATOM 8685  C CA  . ILE D 1 93  ? 60.884  19.912  197.332 1.00 7.70   ? 93  ILE 4 CA  1 
ATOM 8686  C C   . ILE D 1 93  ? 61.556  20.212  196.040 1.00 16.10  ? 93  ILE 4 C   1 
ATOM 8687  O O   . ILE D 1 93  ? 61.170  21.095  195.305 1.00 29.78  ? 93  ILE 4 O   1 
ATOM 8688  C CB  . ILE D 1 93  ? 59.486  19.410  196.987 1.00 22.04  ? 93  ILE 4 CB  1 
ATOM 8689  C CG1 . ILE D 1 93  ? 58.747  19.028  198.248 1.00 11.20  ? 93  ILE 4 CG1 1 
ATOM 8690  C CG2 . ILE D 1 93  ? 59.600  18.161  196.140 1.00 18.87  ? 93  ILE 4 CG2 1 
ATOM 8691  C CD1 . ILE D 1 93  ? 58.506  20.173  199.113 1.00 15.07  ? 93  ILE 4 CD1 1 
ATOM 8692  N N   . PRO D 1 94  ? 62.588  19.472  195.741 1.00 24.45  ? 94  PRO 4 N   1 
ATOM 8693  C CA  . PRO D 1 94  ? 63.356  19.622  194.513 1.00 20.27  ? 94  PRO 4 CA  1 
ATOM 8694  C C   . PRO D 1 94  ? 62.627  18.803  193.523 1.00 16.44  ? 94  PRO 4 C   1 
ATOM 8695  O O   . PRO D 1 94  ? 62.187  17.714  193.832 1.00 25.83  ? 94  PRO 4 O   1 
ATOM 8696  C CB  . PRO D 1 94  ? 64.642  18.903  194.830 1.00 21.91  ? 94  PRO 4 CB  1 
ATOM 8697  C CG  . PRO D 1 94  ? 64.607  18.742  196.349 1.00 26.99  ? 94  PRO 4 CG  1 
ATOM 8698  C CD  . PRO D 1 94  ? 63.202  18.495  196.634 1.00 17.58  ? 94  PRO 4 CD  1 
ATOM 8699  N N   . LEU D 1 95  ? 62.450  19.333  192.340 1.00 26.65  ? 95  LEU 4 N   1 
ATOM 8700  C CA  . LEU D 1 95  ? 61.775  18.585  191.310 1.00 26.71  ? 95  LEU 4 CA  1 
ATOM 8701  C C   . LEU D 1 95  ? 62.792  18.399  190.222 1.00 26.63  ? 95  LEU 4 C   1 
ATOM 8702  O O   . LEU D 1 95  ? 63.794  19.068  190.189 1.00 34.69  ? 95  LEU 4 O   1 
ATOM 8703  C CB  . LEU D 1 95  ? 60.595  19.381  190.787 1.00 18.23  ? 95  LEU 4 CB  1 
ATOM 8704  C CG  . LEU D 1 95  ? 59.902  20.028  191.968 1.00 24.15  ? 95  LEU 4 CG  1 
ATOM 8705  C CD1 . LEU D 1 95  ? 58.644  20.616  191.491 1.00 25.15  ? 95  LEU 4 CD1 1 
ATOM 8706  C CD2 . LEU D 1 95  ? 59.620  18.995  193.034 1.00 14.83  ? 95  LEU 4 CD2 1 
ATOM 8707  N N   . PRO D 1 96  ? 62.626  17.374  189.412 1.00 32.66  ? 96  PRO 4 N   1 
ATOM 8708  C CA  . PRO D 1 96  ? 63.490  17.023  188.282 1.00 31.34  ? 96  PRO 4 CA  1 
ATOM 8709  C C   . PRO D 1 96  ? 63.433  18.058  187.139 1.00 34.03  ? 96  PRO 4 C   1 
ATOM 8710  O O   . PRO D 1 96  ? 62.346  18.523  186.826 1.00 44.66  ? 96  PRO 4 O   1 
ATOM 8711  C CB  . PRO D 1 96  ? 62.879  15.704  187.804 1.00 30.62  ? 96  PRO 4 CB  1 
ATOM 8712  C CG  . PRO D 1 96  ? 61.466  15.740  188.306 1.00 45.28  ? 96  PRO 4 CG  1 
ATOM 8713  C CD  . PRO D 1 96  ? 61.677  16.295  189.691 1.00 43.75  ? 96  PRO 4 CD  1 
ATOM 8714  N N   . ASN D 1 97  ? 64.555  18.362  186.470 1.00 39.68  ? 97  ASN 4 N   1 
ATOM 8715  C CA  . ASN D 1 97  ? 64.530  19.323  185.350 1.00 50.33  ? 97  ASN 4 CA  1 
ATOM 8716  C C   . ASN D 1 97  ? 63.764  18.726  184.203 1.00 48.40  ? 97  ASN 4 C   1 
ATOM 8717  O O   . ASN D 1 97  ? 64.294  17.961  183.409 1.00 43.64  ? 97  ASN 4 O   1 
ATOM 8718  C CB  . ASN D 1 97  ? 65.921  19.729  184.839 1.00 74.90  ? 97  ASN 4 CB  1 
ATOM 8719  C CG  . ASN D 1 97  ? 65.849  20.687  183.621 1.00 93.65  ? 97  ASN 4 CG  1 
ATOM 8720  O OD1 . ASN D 1 97  ? 64.787  21.255  183.309 1.00 104.37 ? 97  ASN 4 OD1 1 
ATOM 8721  N ND2 . ASN D 1 97  ? 66.979  20.855  182.932 1.00 101.74 ? 97  ASN 4 ND2 1 
ATOM 8722  N N   . ILE D 1 98  ? 62.495  19.081  184.149 1.00 55.64  ? 98  ILE 4 N   1 
ATOM 8723  C CA  . ILE D 1 98  ? 61.589  18.610  183.131 1.00 62.27  ? 98  ILE 4 CA  1 
ATOM 8724  C C   . ILE D 1 98  ? 62.182  18.850  181.760 1.00 67.65  ? 98  ILE 4 C   1 
ATOM 8725  O O   . ILE D 1 98  ? 62.038  18.040  180.815 1.00 64.00  ? 98  ILE 4 O   1 
ATOM 8726  C CB  . ILE D 1 98  ? 60.283  19.373  183.244 1.00 61.42  ? 98  ILE 4 CB  1 
ATOM 8727  C CG1 . ILE D 1 98  ? 59.406  18.736  184.304 1.00 60.45  ? 98  ILE 4 CG1 1 
ATOM 8728  C CG2 . ILE D 1 98  ? 59.570  19.418  181.920 1.00 74.06  ? 98  ILE 4 CG2 1 
ATOM 8729  C CD1 . ILE D 1 98  ? 58.101  19.458  184.428 1.00 83.53  ? 98  ILE 4 CD1 1 
ATOM 8730  N N   . ASN D 1 99  ? 62.825  19.994  181.636 1.00 73.11  ? 99  ASN 4 N   1 
ATOM 8731  C CA  . ASN D 1 99  ? 63.375  20.266  180.365 1.00 81.27  ? 99  ASN 4 CA  1 
ATOM 8732  C C   . ASN D 1 99  ? 64.694  19.684  180.138 1.00 94.31  ? 99  ASN 4 C   1 
ATOM 8733  O O   . ASN D 1 99  ? 65.721  20.190  180.586 1.00 100.55 ? 99  ASN 4 O   1 
ATOM 8734  C CB  . ASN D 1 99  ? 63.326  21.703  179.998 1.00 72.48  ? 99  ASN 4 CB  1 
ATOM 8735  C CG  . ASN D 1 99  ? 62.572  21.870  178.751 1.00 83.04  ? 99  ASN 4 CG  1 
ATOM 8736  O OD1 . ASN D 1 99  ? 62.597  20.995  177.868 1.00 86.62  ? 99  ASN 4 OD1 1 
ATOM 8737  N ND2 . ASN D 1 99  ? 61.791  22.908  178.695 1.00 90.72  ? 99  ASN 4 ND2 1 
ATOM 8738  N N   . GLU D 1 100 ? 64.634  18.547  179.478 1.00 110.16 ? 100 GLU 4 N   1 
ATOM 8739  C CA  . GLU D 1 100 ? 65.821  17.810  179.146 1.00 137.94 ? 100 GLU 4 CA  1 
ATOM 8740  C C   . GLU D 1 100 ? 66.721  18.712  178.331 1.00 135.64 ? 100 GLU 4 C   1 
ATOM 8741  O O   . GLU D 1 100 ? 66.359  19.845  177.996 1.00 126.20 ? 100 GLU 4 O   1 
ATOM 8742  C CB  . GLU D 1 100 ? 65.450  16.548  178.363 1.00 159.32 ? 100 GLU 4 CB  1 
ATOM 8743  C CG  . GLU D 1 100 ? 64.354  16.748  177.303 1.00 187.48 ? 100 GLU 4 CG  1 
ATOM 8744  C CD  . GLU D 1 100 ? 63.849  15.434  176.711 1.00 201.70 ? 100 GLU 4 CD  1 
ATOM 8745  O OE1 . GLU D 1 100 ? 64.276  14.348  177.187 1.00 205.69 ? 100 GLU 4 OE1 1 
ATOM 8746  O OE2 . GLU D 1 100 ? 63.018  15.489  175.777 1.00 211.65 ? 100 GLU 4 OE2 1 
ATOM 8747  N N   . ASP D 1 101 ? 67.888  18.187  177.998 1.00 138.41 ? 101 ASP 4 N   1 
ATOM 8748  C CA  . ASP D 1 101 ? 68.871  18.923  177.229 1.00 146.42 ? 101 ASP 4 CA  1 
ATOM 8749  C C   . ASP D 1 101 ? 68.420  19.234  175.759 1.00 146.90 ? 101 ASP 4 C   1 
ATOM 8750  O O   . ASP D 1 101 ? 68.597  18.420  174.838 1.00 146.21 ? 101 ASP 4 O   1 
ATOM 8751  C CB  . ASP D 1 101 ? 70.228  18.185  177.330 1.00 153.56 ? 101 ASP 4 CB  1 
ATOM 8752  C CG  . ASP D 1 101 ? 70.736  18.036  178.801 1.00 153.72 ? 101 ASP 4 CG  1 
ATOM 8753  O OD1 . ASP D 1 101 ? 69.939  18.144  179.778 1.00 139.74 ? 101 ASP 4 OD1 1 
ATOM 8754  O OD2 . ASP D 1 101 ? 71.953  17.798  178.972 1.00 153.85 ? 101 ASP 4 OD2 1 
ATOM 8755  N N   . LEU D 1 102 ? 67.787  20.408  175.591 1.00 147.40 ? 102 LEU 4 N   1 
ATOM 8756  C CA  . LEU D 1 102 ? 67.273  20.942  174.310 1.00 145.25 ? 102 LEU 4 CA  1 
ATOM 8757  C C   . LEU D 1 102 ? 67.933  22.335  174.073 1.00 149.93 ? 102 LEU 4 C   1 
ATOM 8758  O O   . LEU D 1 102 ? 68.794  22.762  174.849 1.00 147.14 ? 102 LEU 4 O   1 
ATOM 8759  C CB  . LEU D 1 102 ? 65.729  21.065  174.396 1.00 139.87 ? 102 LEU 4 CB  1 
ATOM 8760  C CG  . LEU D 1 102 ? 64.797  21.232  173.181 1.00 133.53 ? 102 LEU 4 CG  1 
ATOM 8761  C CD1 . LEU D 1 102 ? 64.861  20.003  172.281 1.00 136.26 ? 102 LEU 4 CD1 1 
ATOM 8762  C CD2 . LEU D 1 102 ? 63.355  21.458  173.651 1.00 128.35 ? 102 LEU 4 CD2 1 
ATOM 8763  N N   . THR D 1 103 ? 67.551  23.044  173.009 1.00 159.69 ? 103 THR 4 N   1 
ATOM 8764  C CA  . THR D 1 103 ? 68.151  24.361  172.741 1.00 163.89 ? 103 THR 4 CA  1 
ATOM 8765  C C   . THR D 1 103 ? 67.223  25.586  172.714 1.00 171.11 ? 103 THR 4 C   1 
ATOM 8766  O O   . THR D 1 103 ? 67.030  26.236  173.744 1.00 172.94 ? 103 THR 4 O   1 
ATOM 8767  C CB  . THR D 1 103 ? 68.980  24.353  171.449 1.00 165.76 ? 103 THR 4 CB  1 
ATOM 8768  O OG1 . THR D 1 103 ? 68.422  23.400  170.529 1.00 171.47 ? 103 THR 4 OG1 1 
ATOM 8769  C CG2 . THR D 1 103 ? 70.446  24.039  171.748 1.00 160.63 ? 103 THR 4 CG2 1 
ATOM 8770  N N   . CYS D 1 104 ? 66.683  25.916  171.536 1.00 181.81 ? 104 CYS 4 N   1 
ATOM 8771  C CA  . CYS D 1 104 ? 65.803  27.075  171.374 1.00 186.14 ? 104 CYS 4 CA  1 
ATOM 8772  C C   . CYS D 1 104 ? 64.337  26.713  171.341 1.00 184.25 ? 104 CYS 4 C   1 
ATOM 8773  O O   . CYS D 1 104 ? 63.944  25.605  170.932 1.00 190.81 ? 104 CYS 4 O   1 
ATOM 8774  C CB  . CYS D 1 104 ? 66.123  27.841  170.084 1.00 194.62 ? 104 CYS 4 CB  1 
ATOM 8775  S SG  . CYS D 1 104 ? 67.803  28.450  169.950 1.00 219.63 ? 104 CYS 4 SG  1 
ATOM 8776  N N   . GLY D 1 105 ? 63.528  27.694  171.704 1.00 171.37 ? 105 GLY 4 N   1 
ATOM 8777  C CA  . GLY D 1 105 ? 62.110  27.490  171.705 1.00 154.77 ? 105 GLY 4 CA  1 
ATOM 8778  C C   . GLY D 1 105 ? 61.562  27.814  173.067 1.00 142.12 ? 105 GLY 4 C   1 
ATOM 8779  O O   . GLY D 1 105 ? 61.745  28.923  173.623 1.00 132.67 ? 105 GLY 4 O   1 
ATOM 8780  N N   . ASN D 1 106 ? 61.036  26.771  173.681 1.00 121.32 ? 106 ASN 4 N   1 
ATOM 8781  C CA  . ASN D 1 106 ? 60.390  26.953  174.939 1.00 94.12  ? 106 ASN 4 CA  1 
ATOM 8782  C C   . ASN D 1 106 ? 60.786  25.933  175.949 1.00 76.13  ? 106 ASN 4 C   1 
ATOM 8783  O O   . ASN D 1 106 ? 61.087  24.775  175.642 1.00 73.99  ? 106 ASN 4 O   1 
ATOM 8784  C CB  . ASN D 1 106 ? 58.875  26.901  174.743 1.00 100.23 ? 106 ASN 4 CB  1 
ATOM 8785  C CG  . ASN D 1 106 ? 58.388  27.837  173.647 1.00 98.54  ? 106 ASN 4 CG  1 
ATOM 8786  O OD1 . ASN D 1 106 ? 57.801  27.394  172.651 1.00 104.36 ? 106 ASN 4 OD1 1 
ATOM 8787  N ND2 . ASN D 1 106 ? 58.652  29.137  173.810 1.00 97.92  ? 106 ASN 4 ND2 1 
ATOM 8788  N N   . ILE D 1 107 ? 60.710  26.390  177.179 1.00 54.52  ? 107 ILE 4 N   1 
ATOM 8789  C CA  . ILE D 1 107 ? 61.017  25.605  178.324 1.00 37.85  ? 107 ILE 4 CA  1 
ATOM 8790  C C   . ILE D 1 107 ? 59.751  24.985  178.870 1.00 35.39  ? 107 ILE 4 C   1 
ATOM 8791  O O   . ILE D 1 107 ? 58.643  25.259  178.401 1.00 35.48  ? 107 ILE 4 O   1 
ATOM 8792  C CB  . ILE D 1 107 ? 61.660  26.486  179.382 1.00 42.71  ? 107 ILE 4 CB  1 
ATOM 8793  C CG1 . ILE D 1 107 ? 62.780  27.242  178.715 1.00 29.12  ? 107 ILE 4 CG1 1 
ATOM 8794  C CG2 . ILE D 1 107 ? 62.272  25.645  180.534 1.00 59.01  ? 107 ILE 4 CG2 1 
ATOM 8795  C CD1 . ILE D 1 107 ? 63.642  26.325  177.854 1.00 42.88  ? 107 ILE 4 CD1 1 
ATOM 8796  N N   . LEU D 1 108 ? 59.949  24.120  179.851 1.00 20.77  ? 108 LEU 4 N   1 
ATOM 8797  C CA  . LEU D 1 108 ? 58.899  23.435  180.524 1.00 17.80  ? 108 LEU 4 CA  1 
ATOM 8798  C C   . LEU D 1 108 ? 59.270  23.598  181.939 1.00 20.80  ? 108 LEU 4 C   1 
ATOM 8799  O O   . LEU D 1 108 ? 60.420  23.336  182.306 1.00 33.57  ? 108 LEU 4 O   1 
ATOM 8800  C CB  . LEU D 1 108 ? 58.943  21.966  180.208 1.00 13.40  ? 108 LEU 4 CB  1 
ATOM 8801  C CG  . LEU D 1 108 ? 58.238  21.606  178.917 1.00 21.37  ? 108 LEU 4 CG  1 
ATOM 8802  C CD1 . LEU D 1 108 ? 57.667  20.228  179.053 1.00 34.07  ? 108 LEU 4 CD1 1 
ATOM 8803  C CD2 . LEU D 1 108 ? 57.114  22.576  178.631 1.00 49.03  ? 108 LEU 4 CD2 1 
ATOM 8804  N N   . MET D 1 109 ? 58.330  24.089  182.727 1.00 16.91  ? 109 MET 4 N   1 
ATOM 8805  C CA  . MET D 1 109 ? 58.595  24.275  184.135 1.00 27.32  ? 109 MET 4 CA  1 
ATOM 8806  C C   . MET D 1 109 ? 57.525  23.599  184.949 1.00 32.77  ? 109 MET 4 C   1 
ATOM 8807  O O   . MET D 1 109 ? 56.360  23.412  184.506 1.00 11.71  ? 109 MET 4 O   1 
ATOM 8808  C CB  . MET D 1 109 ? 58.627  25.753  184.525 1.00 25.38  ? 109 MET 4 CB  1 
ATOM 8809  C CG  . MET D 1 109 ? 59.780  26.535  184.035 1.00 19.56  ? 109 MET 4 CG  1 
ATOM 8810  S SD  . MET D 1 109 ? 60.123  27.934  185.138 1.00 45.69  ? 109 MET 4 SD  1 
ATOM 8811  C CE  . MET D 1 109 ? 60.021  29.148  183.940 1.00 12.88  ? 109 MET 4 CE  1 
ATOM 8812  N N   . TRP D 1 110 ? 57.908  23.275  186.169 1.00 21.92  ? 110 TRP 4 N   1 
ATOM 8813  C CA  . TRP D 1 110 ? 56.956  22.649  187.030 1.00 23.76  ? 110 TRP 4 CA  1 
ATOM 8814  C C   . TRP D 1 110 ? 55.956  23.679  187.547 1.00 21.65  ? 110 TRP 4 C   1 
ATOM 8815  O O   . TRP D 1 110 ? 56.353  24.685  188.166 1.00 20.21  ? 110 TRP 4 O   1 
ATOM 8816  C CB  . TRP D 1 110 ? 57.687  21.996  188.187 1.00 42.05  ? 110 TRP 4 CB  1 
ATOM 8817  C CG  . TRP D 1 110 ? 58.200  20.642  187.870 1.00 42.78  ? 110 TRP 4 CG  1 
ATOM 8818  C CD1 . TRP D 1 110 ? 59.491  20.242  187.882 1.00 40.58  ? 110 TRP 4 CD1 1 
ATOM 8819  C CD2 . TRP D 1 110 ? 57.420  19.492  187.521 1.00 49.20  ? 110 TRP 4 CD2 1 
ATOM 8820  N NE1 . TRP D 1 110 ? 59.579  18.910  187.566 1.00 32.18  ? 110 TRP 4 NE1 1 
ATOM 8821  C CE2 . TRP D 1 110 ? 58.326  18.421  187.342 1.00 42.94  ? 110 TRP 4 CE2 1 
ATOM 8822  C CE3 . TRP D 1 110 ? 56.050  19.258  187.346 1.00 55.86  ? 110 TRP 4 CE3 1 
ATOM 8823  C CZ2 . TRP D 1 110 ? 57.905  17.132  186.986 1.00 44.41  ? 110 TRP 4 CZ2 1 
ATOM 8824  C CZ3 . TRP D 1 110 ? 55.631  17.970  186.993 1.00 58.03  ? 110 TRP 4 CZ3 1 
ATOM 8825  C CH2 . TRP D 1 110 ? 56.560  16.926  186.820 1.00 49.28  ? 110 TRP 4 CH2 1 
ATOM 8826  N N   . GLU D 1 111 ? 54.673  23.440  187.275 1.00 16.60  ? 111 GLU 4 N   1 
ATOM 8827  C CA  . GLU D 1 111 ? 53.614  24.320  187.754 1.00 9.46   ? 111 GLU 4 CA  1 
ATOM 8828  C C   . GLU D 1 111 ? 52.784  23.705  188.846 1.00 15.36  ? 111 GLU 4 C   1 
ATOM 8829  O O   . GLU D 1 111 ? 52.273  22.581  188.718 1.00 26.37  ? 111 GLU 4 O   1 
ATOM 8830  C CB  . GLU D 1 111 ? 52.646  24.678  186.654 1.00 7.03   ? 111 GLU 4 CB  1 
ATOM 8831  C CG  . GLU D 1 111 ? 51.603  25.728  187.047 1.00 17.57  ? 111 GLU 4 CG  1 
ATOM 8832  C CD  . GLU D 1 111 ? 50.729  26.092  185.856 1.00 39.94  ? 111 GLU 4 CD  1 
ATOM 8833  O OE1 . GLU D 1 111 ? 50.885  25.442  184.795 1.00 23.97  ? 111 GLU 4 OE1 1 
ATOM 8834  O OE2 . GLU D 1 111 ? 49.876  27.010  185.938 1.00 41.25  ? 111 GLU 4 OE2 1 
ATOM 8835  N N   . ALA D 1 112 ? 52.619  24.467  189.915 1.00 18.20  ? 112 ALA 4 N   1 
ATOM 8836  C CA  . ALA D 1 112 ? 51.794  24.028  191.028 1.00 19.86  ? 112 ALA 4 CA  1 
ATOM 8837  C C   . ALA D 1 112 ? 50.445  24.530  190.636 1.00 20.66  ? 112 ALA 4 C   1 
ATOM 8838  O O   . ALA D 1 112 ? 50.262  25.686  190.281 1.00 36.42  ? 112 ALA 4 O   1 
ATOM 8839  C CB  . ALA D 1 112 ? 52.223  24.676  192.324 1.00 9.80   ? 112 ALA 4 CB  1 
ATOM 8840  N N   . VAL D 1 113 ? 49.472  23.688  190.816 1.00 17.65  ? 113 VAL 4 N   1 
ATOM 8841  C CA  . VAL D 1 113 ? 48.140  24.057  190.440 1.00 22.89  ? 113 VAL 4 CA  1 
ATOM 8842  C C   . VAL D 1 113 ? 47.152  23.981  191.588 1.00 29.20  ? 113 VAL 4 C   1 
ATOM 8843  O O   . VAL D 1 113 ? 46.265  24.816  191.759 1.00 14.94  ? 113 VAL 4 O   1 
ATOM 8844  C CB  . VAL D 1 113 ? 47.698  23.042  189.437 1.00 11.67  ? 113 VAL 4 CB  1 
ATOM 8845  C CG1 . VAL D 1 113 ? 46.269  23.210  189.153 1.00 2.04   ? 113 VAL 4 CG1 1 
ATOM 8846  C CG2 . VAL D 1 113 ? 48.554  23.149  188.218 1.00 17.28  ? 113 VAL 4 CG2 1 
ATOM 8847  N N   . THR D 1 114 ? 47.396  23.011  192.435 1.00 29.32  ? 114 THR 4 N   1 
ATOM 8848  C CA  . THR D 1 114 ? 46.479  22.732  193.464 1.00 4.47   ? 114 THR 4 CA  1 
ATOM 8849  C C   . THR D 1 114 ? 47.076  22.229  194.697 1.00 9.80   ? 114 THR 4 C   1 
ATOM 8850  O O   . THR D 1 114 ? 47.923  21.327  194.705 1.00 17.36  ? 114 THR 4 O   1 
ATOM 8851  C CB  . THR D 1 114 ? 45.622  21.649  192.911 1.00 11.89  ? 114 THR 4 CB  1 
ATOM 8852  O OG1 . THR D 1 114 ? 44.513  22.274  192.305 1.00 20.76  ? 114 THR 4 OG1 1 
ATOM 8853  C CG2 . THR D 1 114 ? 45.211  20.606  193.949 1.00 28.30  ? 114 THR 4 CG2 1 
ATOM 8854  N N   . VAL D 1 115 ? 46.526  22.696  195.779 1.00 7.55   ? 115 VAL 4 N   1 
ATOM 8855  C CA  . VAL D 1 115 ? 47.036  22.156  196.993 1.00 18.81  ? 115 VAL 4 CA  1 
ATOM 8856  C C   . VAL D 1 115 ? 45.870  21.784  197.848 1.00 17.66  ? 115 VAL 4 C   1 
ATOM 8857  O O   . VAL D 1 115 ? 44.786  22.308  197.673 1.00 12.89  ? 115 VAL 4 O   1 
ATOM 8858  C CB  . VAL D 1 115 ? 47.904  23.143  197.705 1.00 10.60  ? 115 VAL 4 CB  1 
ATOM 8859  C CG1 . VAL D 1 115 ? 47.106  24.341  198.082 1.00 19.04  ? 115 VAL 4 CG1 1 
ATOM 8860  C CG2 . VAL D 1 115 ? 48.501  22.508  198.885 1.00 7.18   ? 115 VAL 4 CG2 1 
ATOM 8861  N N   . LYS D 1 116 ? 46.058  20.729  198.614 1.00 18.28  ? 116 LYS 4 N   1 
ATOM 8862  C CA  . LYS D 1 116 ? 45.074  20.286  199.572 1.00 11.43  ? 116 LYS 4 CA  1 
ATOM 8863  C C   . LYS D 1 116 ? 45.917  20.352  200.811 1.00 15.80  ? 116 LYS 4 C   1 
ATOM 8864  O O   . LYS D 1 116 ? 47.111  20.066  200.750 1.00 32.94  ? 116 LYS 4 O   1 
ATOM 8865  C CB  . LYS D 1 116 ? 44.683  18.839  199.336 1.00 2.00   ? 116 LYS 4 CB  1 
ATOM 8866  C CG  . LYS D 1 116 ? 43.704  18.572  198.170 1.00 27.03  ? 116 LYS 4 CG  1 
ATOM 8867  C CD  . LYS D 1 116 ? 42.817  17.267  198.365 1.00 22.19  ? 116 LYS 4 CD  1 
ATOM 8868  C CE  . LYS D 1 116 ? 42.127  16.796  197.052 1.00 54.73  ? 116 LYS 4 CE  1 
ATOM 8869  N NZ  . LYS D 1 116 ? 41.360  15.493  197.107 1.00 63.65  ? 116 LYS 4 NZ  1 
ATOM 8870  N N   . THR D 1 117 ? 45.368  20.812  201.919 1.00 16.72  ? 117 THR 4 N   1 
ATOM 8871  C CA  . THR D 1 117 ? 46.168  20.837  203.140 1.00 21.66  ? 117 THR 4 CA  1 
ATOM 8872  C C   . THR D 1 117 ? 45.280  20.584  204.353 1.00 25.47  ? 117 THR 4 C   1 
ATOM 8873  O O   . THR D 1 117 ? 44.056  20.621  204.233 1.00 37.51  ? 117 THR 4 O   1 
ATOM 8874  C CB  . THR D 1 117 ? 46.965  22.130  203.295 1.00 13.24  ? 117 THR 4 CB  1 
ATOM 8875  O OG1 . THR D 1 117 ? 47.593  22.149  204.574 1.00 46.72  ? 117 THR 4 OG1 1 
ATOM 8876  C CG2 . THR D 1 117 ? 46.090  23.290  203.265 1.00 31.72  ? 117 THR 4 CG2 1 
ATOM 8877  N N   . GLU D 1 118 ? 45.887  20.295  205.503 1.00 28.23  ? 118 GLU 4 N   1 
ATOM 8878  C CA  . GLU D 1 118 ? 45.124  20.004  206.720 1.00 22.33  ? 118 GLU 4 CA  1 
ATOM 8879  C C   . GLU D 1 118 ? 46.019  19.967  207.920 1.00 26.21  ? 118 GLU 4 C   1 
ATOM 8880  O O   . GLU D 1 118 ? 47.221  19.625  207.803 1.00 32.67  ? 118 GLU 4 O   1 
ATOM 8881  C CB  . GLU D 1 118 ? 44.564  18.622  206.621 1.00 9.72   ? 118 GLU 4 CB  1 
ATOM 8882  C CG  . GLU D 1 118 ? 43.326  18.347  207.360 1.00 21.79  ? 118 GLU 4 CG  1 
ATOM 8883  C CD  . GLU D 1 118 ? 42.732  17.114  206.765 1.00 44.01  ? 118 GLU 4 CD  1 
ATOM 8884  O OE1 . GLU D 1 118 ? 41.993  17.224  205.756 1.00 50.29  ? 118 GLU 4 OE1 1 
ATOM 8885  O OE2 . GLU D 1 118 ? 43.116  16.021  207.229 1.00 43.03  ? 118 GLU 4 OE2 1 
ATOM 8886  N N   . VAL D 1 119 ? 45.457  20.306  209.077 1.00 13.38  ? 119 VAL 4 N   1 
ATOM 8887  C CA  . VAL D 1 119 ? 46.280  20.229  210.254 1.00 22.59  ? 119 VAL 4 CA  1 
ATOM 8888  C C   . VAL D 1 119 ? 46.280  18.827  210.803 1.00 31.37  ? 119 VAL 4 C   1 
ATOM 8889  O O   . VAL D 1 119 ? 45.239  18.173  211.026 1.00 36.84  ? 119 VAL 4 O   1 
ATOM 8890  C CB  . VAL D 1 119 ? 45.946  21.201  211.325 1.00 6.09   ? 119 VAL 4 CB  1 
ATOM 8891  C CG1 . VAL D 1 119 ? 46.695  20.806  212.573 1.00 15.57  ? 119 VAL 4 CG1 1 
ATOM 8892  C CG2 . VAL D 1 119 ? 46.458  22.534  210.940 1.00 14.75  ? 119 VAL 4 CG2 1 
ATOM 8893  N N   . ILE D 1 120 ? 47.476  18.380  211.093 1.00 29.90  ? 120 ILE 4 N   1 
ATOM 8894  C CA  . ILE D 1 120 ? 47.573  17.054  211.555 1.00 25.91  ? 120 ILE 4 CA  1 
ATOM 8895  C C   . ILE D 1 120 ? 47.392  16.852  213.031 1.00 31.87  ? 120 ILE 4 C   1 
ATOM 8896  O O   . ILE D 1 120 ? 48.013  17.537  213.872 1.00 17.69  ? 120 ILE 4 O   1 
ATOM 8897  C CB  . ILE D 1 120 ? 48.815  16.424  211.044 1.00 24.05  ? 120 ILE 4 CB  1 
ATOM 8898  C CG1 . ILE D 1 120 ? 48.927  16.684  209.529 1.00 39.96  ? 120 ILE 4 CG1 1 
ATOM 8899  C CG2 . ILE D 1 120 ? 48.710  14.971  211.244 1.00 31.73  ? 120 ILE 4 CG2 1 
ATOM 8900  C CD1 . ILE D 1 120 ? 49.893  15.773  208.801 1.00 32.48  ? 120 ILE 4 CD1 1 
ATOM 8901  N N   . GLY D 1 121 ? 46.407  15.999  213.307 1.00 30.89  ? 121 GLY 4 N   1 
ATOM 8902  C CA  . GLY D 1 121 ? 46.106  15.594  214.661 1.00 35.59  ? 121 GLY 4 CA  1 
ATOM 8903  C C   . GLY D 1 121 ? 45.423  16.604  215.516 1.00 31.66  ? 121 GLY 4 C   1 
ATOM 8904  O O   . GLY D 1 121 ? 45.821  16.884  216.645 1.00 12.06  ? 121 GLY 4 O   1 
ATOM 8905  N N   . VAL D 1 122 ? 44.326  17.116  215.018 1.00 34.77  ? 122 VAL 4 N   1 
ATOM 8906  C CA  . VAL D 1 122 ? 43.677  18.103  215.832 1.00 34.62  ? 122 VAL 4 CA  1 
ATOM 8907  C C   . VAL D 1 122 ? 43.151  17.471  217.099 1.00 27.03  ? 122 VAL 4 C   1 
ATOM 8908  O O   . VAL D 1 122 ? 43.329  18.037  218.172 1.00 24.05  ? 122 VAL 4 O   1 
ATOM 8909  C CB  . VAL D 1 122 ? 42.588  18.779  215.072 1.00 31.39  ? 122 VAL 4 CB  1 
ATOM 8910  C CG1 . VAL D 1 122 ? 43.184  19.355  213.816 1.00 42.84  ? 122 VAL 4 CG1 1 
ATOM 8911  C CG2 . VAL D 1 122 ? 41.515  17.785  214.729 1.00 39.00  ? 122 VAL 4 CG2 1 
ATOM 8912  N N   . THR D 1 123 ? 42.647  16.239  216.973 1.00 21.50  ? 123 THR 4 N   1 
ATOM 8913  C CA  . THR D 1 123 ? 42.032  15.498  218.091 1.00 26.56  ? 123 THR 4 CA  1 
ATOM 8914  C C   . THR D 1 123 ? 42.881  15.483  219.312 1.00 26.62  ? 123 THR 4 C   1 
ATOM 8915  O O   . THR D 1 123 ? 42.398  15.489  220.453 1.00 20.15  ? 123 THR 4 O   1 
ATOM 8916  C CB  . THR D 1 123 ? 41.840  14.058  217.762 1.00 18.65  ? 123 THR 4 CB  1 
ATOM 8917  O OG1 . THR D 1 123 ? 43.102  13.527  217.314 1.00 33.55  ? 123 THR 4 OG1 1 
ATOM 8918  C CG2 . THR D 1 123 ? 40.737  13.908  216.707 1.00 7.51   ? 123 THR 4 CG2 1 
ATOM 8919  N N   . ALA D 1 124 ? 44.169  15.453  219.053 1.00 23.37  ? 124 ALA 4 N   1 
ATOM 8920  C CA  . ALA D 1 124 ? 45.129  15.420  220.109 1.00 26.46  ? 124 ALA 4 CA  1 
ATOM 8921  C C   . ALA D 1 124 ? 44.882  16.436  221.207 1.00 24.81  ? 124 ALA 4 C   1 
ATOM 8922  O O   . ALA D 1 124 ? 45.395  16.283  222.302 1.00 47.78  ? 124 ALA 4 O   1 
ATOM 8923  C CB  . ALA D 1 124 ? 46.464  15.624  219.527 1.00 50.65  ? 124 ALA 4 CB  1 
ATOM 8924  N N   . MET D 1 125 ? 44.107  17.477  220.942 1.00 21.97  ? 125 MET 4 N   1 
ATOM 8925  C CA  . MET D 1 125 ? 43.876  18.463  221.987 1.00 31.63  ? 125 MET 4 CA  1 
ATOM 8926  C C   . MET D 1 125 ? 42.739  18.053  222.927 1.00 32.25  ? 125 MET 4 C   1 
ATOM 8927  O O   . MET D 1 125 ? 42.242  18.871  223.739 1.00 33.02  ? 125 MET 4 O   1 
ATOM 8928  C CB  . MET D 1 125 ? 43.632  19.838  221.379 1.00 32.83  ? 125 MET 4 CB  1 
ATOM 8929  C CG  . MET D 1 125 ? 44.581  20.159  220.240 1.00 33.71  ? 125 MET 4 CG  1 
ATOM 8930  S SD  . MET D 1 125 ? 44.501  21.850  219.626 1.00 43.53  ? 125 MET 4 SD  1 
ATOM 8931  C CE  . MET D 1 125 ? 43.099  22.537  220.797 1.00 43.77  ? 125 MET 4 CE  1 
ATOM 8932  N N   . LEU D 1 126 ? 42.340  16.786  222.813 1.00 11.47  ? 126 LEU 4 N   1 
ATOM 8933  C CA  . LEU D 1 126 ? 41.292  16.228  223.652 1.00 32.99  ? 126 LEU 4 CA  1 
ATOM 8934  C C   . LEU D 1 126 ? 41.827  15.606  224.945 1.00 45.20  ? 126 LEU 4 C   1 
ATOM 8935  O O   . LEU D 1 126 ? 41.079  15.113  225.805 1.00 62.77  ? 126 LEU 4 O   1 
ATOM 8936  C CB  . LEU D 1 126 ? 40.479  15.220  222.858 1.00 27.26  ? 126 LEU 4 CB  1 
ATOM 8937  C CG  . LEU D 1 126 ? 39.548  15.961  221.907 1.00 28.36  ? 126 LEU 4 CG  1 
ATOM 8938  C CD1 . LEU D 1 126 ? 38.518  15.041  221.319 1.00 22.44  ? 126 LEU 4 CD1 1 
ATOM 8939  C CD2 . LEU D 1 126 ? 38.862  17.061  222.691 1.00 44.45  ? 126 LEU 4 CD2 1 
ATOM 8940  N N   . ASN D 1 127 ? 43.140  15.628  225.076 1.00 51.43  ? 127 ASN 4 N   1 
ATOM 8941  C CA  . ASN D 1 127 ? 43.791  15.108  226.253 1.00 50.05  ? 127 ASN 4 CA  1 
ATOM 8942  C C   . ASN D 1 127 ? 43.671  16.263  227.227 1.00 53.67  ? 127 ASN 4 C   1 
ATOM 8943  O O   . ASN D 1 127 ? 44.499  17.182  227.221 1.00 51.24  ? 127 ASN 4 O   1 
ATOM 8944  C CB  . ASN D 1 127 ? 45.263  14.804  225.938 1.00 61.70  ? 127 ASN 4 CB  1 
ATOM 8945  C CG  . ASN D 1 127 ? 45.997  14.152  227.090 1.00 69.09  ? 127 ASN 4 CG  1 
ATOM 8946  O OD1 . ASN D 1 127 ? 46.572  13.083  226.943 1.00 90.01  ? 127 ASN 4 OD1 1 
ATOM 8947  N ND2 . ASN D 1 127 ? 46.023  14.812  228.227 1.00 61.55  ? 127 ASN 4 ND2 1 
ATOM 8948  N N   . LEU D 1 128 ? 42.579  16.258  227.989 1.00 56.40  ? 128 LEU 4 N   1 
ATOM 8949  C CA  . LEU D 1 128 ? 42.333  17.281  229.008 1.00 64.84  ? 128 LEU 4 CA  1 
ATOM 8950  C C   . LEU D 1 128 ? 42.828  16.809  230.367 1.00 60.26  ? 128 LEU 4 C   1 
ATOM 8951  O O   . LEU D 1 128 ? 42.577  17.432  231.404 1.00 43.11  ? 128 LEU 4 O   1 
ATOM 8952  C CB  . LEU D 1 128 ? 40.847  17.588  229.102 1.00 70.10  ? 128 LEU 4 CB  1 
ATOM 8953  C CG  . LEU D 1 128 ? 40.292  18.398  227.942 1.00 64.59  ? 128 LEU 4 CG  1 
ATOM 8954  C CD1 . LEU D 1 128 ? 39.086  19.191  228.430 1.00 62.42  ? 128 LEU 4 CD1 1 
ATOM 8955  C CD2 . LEU D 1 128 ? 41.371  19.351  227.432 1.00 85.90  ? 128 LEU 4 CD2 1 
ATOM 8956  N N   . HIS D 1 129 ? 43.691  15.807  230.303 1.00 62.70  ? 129 HIS 4 N   1 
ATOM 8957  C CA  . HIS D 1 129 ? 44.221  15.167  231.474 1.00 53.93  ? 129 HIS 4 CA  1 
ATOM 8958  C C   . HIS D 1 129 ? 45.733  15.130  231.667 1.00 49.03  ? 129 HIS 4 C   1 
ATOM 8959  O O   . HIS D 1 129 ? 46.162  14.943  232.781 1.00 60.29  ? 129 HIS 4 O   1 
ATOM 8960  C CB  . HIS D 1 129 ? 43.709  13.748  231.474 1.00 54.42  ? 129 HIS 4 CB  1 
ATOM 8961  C CG  . HIS D 1 129 ? 44.186  12.966  230.300 1.00 49.11  ? 129 HIS 4 CG  1 
ATOM 8962  N ND1 . HIS D 1 129 ? 43.396  12.696  229.204 1.00 67.59  ? 129 HIS 4 ND1 1 
ATOM 8963  C CD2 . HIS D 1 129 ? 45.390  12.425  230.037 1.00 46.94  ? 129 HIS 4 CD2 1 
ATOM 8964  C CE1 . HIS D 1 129 ? 44.096  12.015  228.314 1.00 42.75  ? 129 HIS 4 CE1 1 
ATOM 8965  N NE2 . HIS D 1 129 ? 45.311  11.842  228.797 1.00 61.57  ? 129 HIS 4 NE2 1 
ATOM 8966  N N   . SER D 1 130 ? 46.559  15.251  230.632 1.00 44.91  ? 130 SER 4 N   1 
ATOM 8967  C CA  . SER D 1 130 ? 47.996  15.193  230.903 1.00 41.50  ? 130 SER 4 CA  1 
ATOM 8968  C C   . SER D 1 130 ? 48.414  16.492  231.639 1.00 40.55  ? 130 SER 4 C   1 
ATOM 8969  O O   . SER D 1 130 ? 47.644  16.984  232.448 1.00 43.43  ? 130 SER 4 O   1 
ATOM 8970  C CB  . SER D 1 130 ? 48.801  14.945  229.643 1.00 32.24  ? 130 SER 4 CB  1 
ATOM 8971  O OG  . SER D 1 130 ? 48.831  16.154  228.909 1.00 74.12  ? 130 SER 4 OG  1 
ATOM 8972  N N   . GLY D 1 131 ? 49.548  17.107  231.305 1.00 45.28  ? 131 GLY 4 N   1 
ATOM 8973  C CA  . GLY D 1 131 ? 50.030  18.296  232.038 1.00 53.42  ? 131 GLY 4 CA  1 
ATOM 8974  C C   . GLY D 1 131 ? 49.092  19.399  232.533 1.00 52.04  ? 131 GLY 4 C   1 
ATOM 8975  O O   . GLY D 1 131 ? 49.513  20.390  233.166 1.00 44.73  ? 131 GLY 4 O   1 
ATOM 8976  N N   . THR D 1 132 ? 47.860  19.261  232.063 1.00 57.37  ? 132 THR 4 N   1 
ATOM 8977  C CA  . THR D 1 132 ? 46.675  20.074  232.280 1.00 55.27  ? 132 THR 4 CA  1 
ATOM 8978  C C   . THR D 1 132 ? 46.480  20.829  233.569 1.00 49.26  ? 132 THR 4 C   1 
ATOM 8979  O O   . THR D 1 132 ? 46.987  20.431  234.593 1.00 43.81  ? 132 THR 4 O   1 
ATOM 8980  C CB  . THR D 1 132 ? 45.447  19.135  232.210 1.00 55.89  ? 132 THR 4 CB  1 
ATOM 8981  O OG1 . THR D 1 132 ? 45.632  18.130  231.199 1.00 60.56  ? 132 THR 4 OG1 1 
ATOM 8982  C CG2 . THR D 1 132 ? 44.257  19.891  231.871 1.00 51.60  ? 132 THR 4 CG2 1 
ATOM 8983  N N   . GLN D 1 133 ? 45.751  21.941  233.490 1.00 57.02  ? 133 GLN 4 N   1 
ATOM 8984  C CA  . GLN D 1 133 ? 45.341  22.675  234.686 1.00 54.18  ? 133 GLN 4 CA  1 
ATOM 8985  C C   . GLN D 1 133 ? 43.822  22.464  234.776 1.00 63.98  ? 133 GLN 4 C   1 
ATOM 8986  O O   . GLN D 1 133 ? 43.125  22.407  233.771 1.00 63.97  ? 133 GLN 4 O   1 
ATOM 8987  C CB  . GLN D 1 133 ? 45.593  24.165  234.626 1.00 41.79  ? 133 GLN 4 CB  1 
ATOM 8988  C CG  . GLN D 1 133 ? 44.865  24.880  235.768 1.00 43.96  ? 133 GLN 4 CG  1 
ATOM 8989  C CD  . GLN D 1 133 ? 45.183  26.366  235.872 1.00 70.78  ? 133 GLN 4 CD  1 
ATOM 8990  O OE1 . GLN D 1 133 ? 44.395  27.208  235.431 1.00 94.39  ? 133 GLN 4 OE1 1 
ATOM 8991  N NE2 . GLN D 1 133 ? 46.331  26.700  236.477 1.00 72.59  ? 133 GLN 4 NE2 1 
ATOM 8992  N N   . LYS D 1 134 ? 43.311  22.368  235.988 1.00 78.99  ? 134 LYS 4 N   1 
ATOM 8993  C CA  . LYS D 1 134 ? 41.895  22.146  236.217 1.00 82.42  ? 134 LYS 4 CA  1 
ATOM 8994  C C   . LYS D 1 134 ? 41.070  23.358  235.832 1.00 82.72  ? 134 LYS 4 C   1 
ATOM 8995  O O   . LYS D 1 134 ? 41.506  24.509  235.998 1.00 70.96  ? 134 LYS 4 O   1 
ATOM 8996  C CB  . LYS D 1 134 ? 41.678  21.866  237.696 1.00 98.20  ? 134 LYS 4 CB  1 
ATOM 8997  C CG  . LYS D 1 134 ? 40.367  21.219  238.067 1.00 119.13 ? 134 LYS 4 CG  1 
ATOM 8998  C CD  . LYS D 1 134 ? 40.119  21.380  239.574 1.00 145.11 ? 134 LYS 4 CD  1 
ATOM 8999  C CE  . LYS D 1 134 ? 41.266  20.856  240.451 1.00 158.08 ? 134 LYS 4 CE  1 
ATOM 9000  N NZ  . LYS D 1 134 ? 41.105  21.217  241.899 1.00 153.35 ? 134 LYS 4 NZ  1 
ATOM 9001  N N   . THR D 1 135 ? 39.859  23.067  235.355 1.00 83.51  ? 135 THR 4 N   1 
ATOM 9002  C CA  . THR D 1 135 ? 38.864  24.070  234.955 1.00 74.55  ? 135 THR 4 CA  1 
ATOM 9003  C C   . THR D 1 135 ? 38.377  24.709  236.253 1.00 72.69  ? 135 THR 4 C   1 
ATOM 9004  O O   . THR D 1 135 ? 38.322  25.929  236.412 1.00 67.16  ? 135 THR 4 O   1 
ATOM 9005  C CB  . THR D 1 135 ? 37.585  23.392  234.371 1.00 62.13  ? 135 THR 4 CB  1 
ATOM 9006  O OG1 . THR D 1 135 ? 37.884  22.102  233.829 1.00 70.85  ? 135 THR 4 OG1 1 
ATOM 9007  C CG2 . THR D 1 135 ? 36.976  24.234  233.304 1.00 76.76  ? 135 THR 4 CG2 1 
ATOM 9008  N N   . HIS D 1 136 ? 38.010  23.816  237.168 1.00 84.42  ? 136 HIS 4 N   1 
ATOM 9009  C CA  . HIS D 1 136 ? 37.460  24.143  238.474 1.00 85.51  ? 136 HIS 4 CA  1 
ATOM 9010  C C   . HIS D 1 136 ? 37.141  22.795  239.168 1.00 90.71  ? 136 HIS 4 C   1 
ATOM 9011  O O   . HIS D 1 136 ? 36.737  21.819  238.527 1.00 89.97  ? 136 HIS 4 O   1 
ATOM 9012  C CB  . HIS D 1 136 ? 36.120  24.833  238.282 1.00 93.61  ? 136 HIS 4 CB  1 
ATOM 9013  C CG  . HIS D 1 136 ? 35.157  23.915  237.548 1.00 104.68 ? 136 HIS 4 CG  1 
ATOM 9014  N ND1 . HIS D 1 136 ? 34.913  24.047  236.188 1.00 117.68 ? 136 HIS 4 ND1 1 
ATOM 9015  C CD2 . HIS D 1 136 ? 34.414  22.866  237.979 1.00 99.37  ? 136 HIS 4 CD2 1 
ATOM 9016  C CE1 . HIS D 1 136 ? 34.065  23.099  235.835 1.00 116.31 ? 136 HIS 4 CE1 1 
ATOM 9017  N NE2 . HIS D 1 136 ? 33.759  22.385  236.891 1.00 97.81  ? 136 HIS 4 NE2 1 
ATOM 9018  N N   . GLU D 1 137 ? 37.346  22.810  240.434 1.00 91.54  ? 137 GLU 4 N   1 
ATOM 9019  C CA  . GLU D 1 137 ? 37.073  21.730  241.399 1.00 94.41  ? 137 GLU 4 CA  1 
ATOM 9020  C C   . GLU D 1 137 ? 37.132  20.281  240.934 1.00 91.62  ? 137 GLU 4 C   1 
ATOM 9021  O O   . GLU D 1 137 ? 38.060  19.561  241.331 1.00 101.67 ? 137 GLU 4 O   1 
ATOM 9022  C CB  . GLU D 1 137 ? 35.797  22.082  242.134 1.00 104.85 ? 137 GLU 4 CB  1 
ATOM 9023  C CG  . GLU D 1 137 ? 36.017  23.329  243.028 1.00 148.10 ? 137 GLU 4 CG  1 
ATOM 9024  C CD  . GLU D 1 137 ? 37.167  24.249  242.539 1.00 169.03 ? 137 GLU 4 CD  1 
ATOM 9025  O OE1 . GLU D 1 137 ? 38.401  23.981  242.828 1.00 190.39 ? 137 GLU 4 OE1 1 
ATOM 9026  O OE2 . GLU D 1 137 ? 36.902  25.299  241.832 1.00 176.31 ? 137 GLU 4 OE2 1 
ATOM 9027  N N   . ASN D 1 138 ? 36.186  19.801  240.139 1.00 82.29  ? 138 ASN 4 N   1 
ATOM 9028  C CA  . ASN D 1 138 ? 36.623  18.352  239.677 1.00 88.54  ? 138 ASN 4 CA  1 
ATOM 9029  C C   . ASN D 1 138 ? 36.442  18.291  238.182 1.00 84.28  ? 138 ASN 4 C   1 
ATOM 9030  O O   . ASN D 1 138 ? 36.391  17.224  237.544 1.00 77.68  ? 138 ASN 4 O   1 
ATOM 9031  C CB  . ASN D 1 138 ? 35.662  17.403  240.358 1.00 102.46 ? 138 ASN 4 CB  1 
ATOM 9032  C CG  . ASN D 1 138 ? 35.235  17.912  241.697 1.00 118.08 ? 138 ASN 4 CG  1 
ATOM 9033  O OD1 . ASN D 1 138 ? 34.344  18.757  241.779 1.00 130.76 ? 138 ASN 4 OD1 1 
ATOM 9034  N ND2 . ASN D 1 138 ? 35.912  17.475  242.756 1.00 128.53 ? 138 ASN 4 ND2 1 
ATOM 9035  N N   . GLY D 1 139 ? 36.316  19.481  237.631 1.00 85.16  ? 139 GLY 4 N   1 
ATOM 9036  C CA  . GLY D 1 139 ? 36.117  19.615  236.215 1.00 87.33  ? 139 GLY 4 CA  1 
ATOM 9037  C C   . GLY D 1 139 ? 37.397  19.258  235.540 1.00 74.04  ? 139 GLY 4 C   1 
ATOM 9038  O O   . GLY D 1 139 ? 38.469  19.458  236.123 1.00 74.24  ? 139 GLY 4 O   1 
ATOM 9039  N N   . ALA D 1 140 ? 37.277  18.826  234.293 1.00 55.45  ? 140 ALA 4 N   1 
ATOM 9040  C CA  . ALA D 1 140 ? 38.421  18.417  233.518 1.00 46.41  ? 140 ALA 4 CA  1 
ATOM 9041  C C   . ALA D 1 140 ? 39.523  19.474  233.399 1.00 49.52  ? 140 ALA 4 C   1 
ATOM 9042  O O   . ALA D 1 140 ? 39.696  20.339  234.273 1.00 54.87  ? 140 ALA 4 O   1 
ATOM 9043  C CB  . ALA D 1 140 ? 37.965  17.964  232.176 1.00 46.07  ? 140 ALA 4 CB  1 
ATOM 9044  N N   . GLY D 1 141 ? 40.338  19.358  232.365 1.00 42.13  ? 141 GLY 4 N   1 
ATOM 9045  C CA  . GLY D 1 141 ? 41.377  20.337  232.209 1.00 40.50  ? 141 GLY 4 CA  1 
ATOM 9046  C C   . GLY D 1 141 ? 41.030  21.449  231.243 1.00 46.26  ? 141 GLY 4 C   1 
ATOM 9047  O O   . GLY D 1 141 ? 40.214  21.272  230.336 1.00 49.04  ? 141 GLY 4 O   1 
ATOM 9048  N N   . LYS D 1 142 ? 41.631  22.613  231.464 1.00 47.44  ? 142 LYS 4 N   1 
ATOM 9049  C CA  . LYS D 1 142 ? 41.439  23.765  230.606 1.00 46.79  ? 142 LYS 4 CA  1 
ATOM 9050  C C   . LYS D 1 142 ? 42.204  23.369  229.344 1.00 55.60  ? 142 LYS 4 C   1 
ATOM 9051  O O   . LYS D 1 142 ? 43.432  23.123  229.395 1.00 63.45  ? 142 LYS 4 O   1 
ATOM 9052  C CB  . LYS D 1 142 ? 42.026  25.021  231.278 1.00 50.82  ? 142 LYS 4 CB  1 
ATOM 9053  C CG  . LYS D 1 142 ? 42.094  26.271  230.399 1.00 76.97  ? 142 LYS 4 CG  1 
ATOM 9054  C CD  . LYS D 1 142 ? 42.231  27.594  231.198 1.00 95.96  ? 142 LYS 4 CD  1 
ATOM 9055  C CE  . LYS D 1 142 ? 42.610  28.778  230.258 1.00 119.16 ? 142 LYS 4 CE  1 
ATOM 9056  N NZ  . LYS D 1 142 ? 42.352  30.177  230.768 1.00 128.68 ? 142 LYS 4 NZ  1 
ATOM 9057  N N   . PRO D 1 143 ? 41.472  23.209  228.214 1.00 58.62  ? 143 PRO 4 N   1 
ATOM 9058  C CA  . PRO D 1 143 ? 42.024  22.826  226.909 1.00 57.58  ? 143 PRO 4 CA  1 
ATOM 9059  C C   . PRO D 1 143 ? 42.869  23.913  226.304 1.00 55.63  ? 143 PRO 4 C   1 
ATOM 9060  O O   . PRO D 1 143 ? 42.917  25.040  226.802 1.00 51.58  ? 143 PRO 4 O   1 
ATOM 9061  C CB  . PRO D 1 143 ? 40.773  22.584  226.066 1.00 55.27  ? 143 PRO 4 CB  1 
ATOM 9062  C CG  . PRO D 1 143 ? 39.827  23.566  226.609 1.00 47.57  ? 143 PRO 4 CG  1 
ATOM 9063  C CD  . PRO D 1 143 ? 40.022  23.449  228.102 1.00 54.29  ? 143 PRO 4 CD  1 
ATOM 9064  N N   . ILE D 1 144 ? 43.535  23.575  225.217 1.00 57.84  ? 144 ILE 4 N   1 
ATOM 9065  C CA  . ILE D 1 144 ? 44.366  24.557  224.552 1.00 53.92  ? 144 ILE 4 CA  1 
ATOM 9066  C C   . ILE D 1 144 ? 43.444  25.594  223.936 1.00 51.83  ? 144 ILE 4 C   1 
ATOM 9067  O O   . ILE D 1 144 ? 42.466  25.233  223.266 1.00 46.37  ? 144 ILE 4 O   1 
ATOM 9068  C CB  . ILE D 1 144 ? 45.131  23.917  223.455 1.00 51.27  ? 144 ILE 4 CB  1 
ATOM 9069  C CG1 . ILE D 1 144 ? 45.767  22.645  223.986 1.00 64.45  ? 144 ILE 4 CG1 1 
ATOM 9070  C CG2 . ILE D 1 144 ? 46.128  24.888  222.908 1.00 60.90  ? 144 ILE 4 CG2 1 
ATOM 9071  C CD1 . ILE D 1 144 ? 46.070  21.638  222.936 1.00 86.91  ? 144 ILE 4 CD1 1 
ATOM 9072  N N   . GLN D 1 145 ? 43.754  26.867  224.167 1.00 44.21  ? 145 GLN 4 N   1 
ATOM 9073  C CA  . GLN D 1 145 ? 42.951  27.964  223.646 1.00 30.15  ? 145 GLN 4 CA  1 
ATOM 9074  C C   . GLN D 1 145 ? 43.723  29.267  223.669 1.00 40.66  ? 145 GLN 4 C   1 
ATOM 9075  O O   . GLN D 1 145 ? 44.793  29.343  224.272 1.00 63.62  ? 145 GLN 4 O   1 
ATOM 9076  C CB  . GLN D 1 145 ? 41.687  28.121  224.474 1.00 37.45  ? 145 GLN 4 CB  1 
ATOM 9077  C CG  . GLN D 1 145 ? 41.871  28.597  225.920 1.00 61.57  ? 145 GLN 4 CG  1 
ATOM 9078  C CD  . GLN D 1 145 ? 40.556  28.559  226.719 1.00 71.44  ? 145 GLN 4 CD  1 
ATOM 9079  O OE1 . GLN D 1 145 ? 39.890  29.579  226.897 1.00 92.45  ? 145 GLN 4 OE1 1 
ATOM 9080  N NE2 . GLN D 1 145 ? 40.185  27.374  227.199 1.00 81.62  ? 145 GLN 4 NE2 1 
ATOM 9081  N N   . GLY D 1 146 ? 43.160  30.300  223.050 1.00 39.11  ? 146 GLY 4 N   1 
ATOM 9082  C CA  . GLY D 1 146 ? 43.810  31.603  223.006 1.00 38.93  ? 146 GLY 4 CA  1 
ATOM 9083  C C   . GLY D 1 146 ? 44.358  31.931  221.623 1.00 33.64  ? 146 GLY 4 C   1 
ATOM 9084  O O   . GLY D 1 146 ? 44.217  31.113  220.699 1.00 35.77  ? 146 GLY 4 O   1 
ATOM 9085  N N   . SER D 1 147 ? 44.941  33.128  221.478 1.00 25.15  ? 147 SER 4 N   1 
ATOM 9086  C CA  . SER D 1 147 ? 45.512  33.608  220.214 1.00 20.08  ? 147 SER 4 CA  1 
ATOM 9087  C C   . SER D 1 147 ? 45.983  32.477  219.354 1.00 23.72  ? 147 SER 4 C   1 
ATOM 9088  O O   . SER D 1 147 ? 46.672  31.580  219.812 1.00 37.72  ? 147 SER 4 O   1 
ATOM 9089  C CB  . SER D 1 147 ? 46.712  34.523  220.464 1.00 25.81  ? 147 SER 4 CB  1 
ATOM 9090  O OG  . SER D 1 147 ? 46.337  35.825  220.884 1.00 49.27  ? 147 SER 4 OG  1 
ATOM 9091  N N   . ASN D 1 148 ? 45.532  32.441  218.123 1.00 39.65  ? 148 ASN 4 N   1 
ATOM 9092  C CA  . ASN D 1 148 ? 46.008  31.388  217.262 1.00 44.55  ? 148 ASN 4 CA  1 
ATOM 9093  C C   . ASN D 1 148 ? 46.241  31.973  215.898 1.00 48.15  ? 148 ASN 4 C   1 
ATOM 9094  O O   . ASN D 1 148 ? 45.753  33.092  215.579 1.00 44.94  ? 148 ASN 4 O   1 
ATOM 9095  C CB  . ASN D 1 148 ? 45.098  30.141  217.251 1.00 52.51  ? 148 ASN 4 CB  1 
ATOM 9096  C CG  . ASN D 1 148 ? 43.703  30.409  216.711 1.00 68.44  ? 148 ASN 4 CG  1 
ATOM 9097  O OD1 . ASN D 1 148 ? 43.523  31.108  215.712 1.00 78.44  ? 148 ASN 4 OD1 1 
ATOM 9098  N ND2 . ASN D 1 148 ? 42.707  29.786  217.333 1.00 89.86  ? 148 ASN 4 ND2 1 
ATOM 9099  N N   . PHE D 1 149 ? 47.145  31.308  215.184 1.00 41.00  ? 149 PHE 4 N   1 
ATOM 9100  C CA  . PHE D 1 149 ? 47.512  31.702  213.838 1.00 37.02  ? 149 PHE 4 CA  1 
ATOM 9101  C C   . PHE D 1 149 ? 47.876  30.472  213.088 1.00 34.09  ? 149 PHE 4 C   1 
ATOM 9102  O O   . PHE D 1 149 ? 48.711  29.672  213.546 1.00 34.16  ? 149 PHE 4 O   1 
ATOM 9103  C CB  . PHE D 1 149 ? 48.698  32.643  213.827 1.00 24.84  ? 149 PHE 4 CB  1 
ATOM 9104  C CG  . PHE D 1 149 ? 49.121  33.082  212.448 1.00 32.15  ? 149 PHE 4 CG  1 
ATOM 9105  C CD1 . PHE D 1 149 ? 48.325  33.944  211.703 1.00 43.91  ? 149 PHE 4 CD1 1 
ATOM 9106  C CD2 . PHE D 1 149 ? 50.361  32.720  211.937 1.00 23.47  ? 149 PHE 4 CD2 1 
ATOM 9107  C CE1 . PHE D 1 149 ? 48.774  34.442  210.478 1.00 33.60  ? 149 PHE 4 CE1 1 
ATOM 9108  C CE2 . PHE D 1 149 ? 50.808  33.213  210.722 1.00 20.56  ? 149 PHE 4 CE2 1 
ATOM 9109  C CZ  . PHE D 1 149 ? 50.020  34.071  209.997 1.00 18.37  ? 149 PHE 4 CZ  1 
ATOM 9110  N N   . HIS D 1 150 ? 47.187  30.310  211.963 1.00 32.80  ? 150 HIS 4 N   1 
ATOM 9111  C CA  . HIS D 1 150 ? 47.387  29.185  211.058 1.00 36.27  ? 150 HIS 4 CA  1 
ATOM 9112  C C   . HIS D 1 150 ? 47.588  29.824  209.678 1.00 30.91  ? 150 HIS 4 C   1 
ATOM 9113  O O   . HIS D 1 150 ? 46.840  30.733  209.273 1.00 22.94  ? 150 HIS 4 O   1 
ATOM 9114  C CB  . HIS D 1 150 ? 46.208  28.217  211.130 1.00 9.26   ? 150 HIS 4 CB  1 
ATOM 9115  C CG  . HIS D 1 150 ? 45.989  27.641  212.492 1.00 16.84  ? 150 HIS 4 CG  1 
ATOM 9116  N ND1 . HIS D 1 150 ? 46.910  26.822  213.112 1.00 54.54  ? 150 HIS 4 ND1 1 
ATOM 9117  C CD2 . HIS D 1 150 ? 44.985  27.819  213.387 1.00 44.43  ? 150 HIS 4 CD2 1 
ATOM 9118  C CE1 . HIS D 1 150 ? 46.485  26.529  214.332 1.00 74.02  ? 150 HIS 4 CE1 1 
ATOM 9119  N NE2 . HIS D 1 150 ? 45.320  27.122  214.523 1.00 65.27  ? 150 HIS 4 NE2 1 
ATOM 9120  N N   . PHE D 1 151 ? 48.610  29.363  208.971 1.00 17.61  ? 151 PHE 4 N   1 
ATOM 9121  C CA  . PHE D 1 151 ? 48.953  29.984  207.727 1.00 13.89  ? 151 PHE 4 CA  1 
ATOM 9122  C C   . PHE D 1 151 ? 49.798  29.038  206.958 1.00 13.90  ? 151 PHE 4 C   1 
ATOM 9123  O O   . PHE D 1 151 ? 50.451  28.196  207.534 1.00 20.75  ? 151 PHE 4 O   1 
ATOM 9124  C CB  . PHE D 1 151 ? 49.801  31.220  208.086 1.00 19.44  ? 151 PHE 4 CB  1 
ATOM 9125  C CG  . PHE D 1 151 ? 50.824  31.569  207.076 1.00 11.71  ? 151 PHE 4 CG  1 
ATOM 9126  C CD1 . PHE D 1 151 ? 51.980  30.812  206.950 1.00 16.15  ? 151 PHE 4 CD1 1 
ATOM 9127  C CD2 . PHE D 1 151 ? 50.582  32.581  206.168 1.00 22.40  ? 151 PHE 4 CD2 1 
ATOM 9128  C CE1 . PHE D 1 151 ? 52.868  31.066  205.922 1.00 26.43  ? 151 PHE 4 CE1 1 
ATOM 9129  C CE2 . PHE D 1 151 ? 51.463  32.842  205.145 1.00 15.86  ? 151 PHE 4 CE2 1 
ATOM 9130  C CZ  . PHE D 1 151 ? 52.603  32.083  205.014 1.00 11.88  ? 151 PHE 4 CZ  1 
ATOM 9131  N N   . PHE D 1 152 ? 49.909  29.284  205.669 1.00 15.15  ? 152 PHE 4 N   1 
ATOM 9132  C CA  . PHE D 1 152 ? 50.764  28.474  204.850 1.00 15.40  ? 152 PHE 4 CA  1 
ATOM 9133  C C   . PHE D 1 152 ? 50.859  29.123  203.507 1.00 20.52  ? 152 PHE 4 C   1 
ATOM 9134  O O   . PHE D 1 152 ? 50.031  29.975  203.151 1.00 12.45  ? 152 PHE 4 O   1 
ATOM 9135  C CB  . PHE D 1 152 ? 50.177  27.116  204.657 1.00 6.18   ? 152 PHE 4 CB  1 
ATOM 9136  C CG  . PHE D 1 152 ? 49.114  27.089  203.635 1.00 20.86  ? 152 PHE 4 CG  1 
ATOM 9137  C CD1 . PHE D 1 152 ? 49.429  26.883  202.296 1.00 23.25  ? 152 PHE 4 CD1 1 
ATOM 9138  C CD2 . PHE D 1 152 ? 47.783  27.170  204.009 1.00 15.55  ? 152 PHE 4 CD2 1 
ATOM 9139  C CE1 . PHE D 1 152 ? 48.413  26.734  201.344 1.00 36.81  ? 152 PHE 4 CE1 1 
ATOM 9140  C CE2 . PHE D 1 152 ? 46.759  27.021  203.066 1.00 2.44   ? 152 PHE 4 CE2 1 
ATOM 9141  C CZ  . PHE D 1 152 ? 47.069  26.797  201.732 1.00 12.95  ? 152 PHE 4 CZ  1 
ATOM 9142  N N   . ALA D 1 153 ? 51.716  28.527  202.695 1.00 17.30  ? 153 ALA 4 N   1 
ATOM 9143  C CA  . ALA D 1 153 ? 51.961  29.019  201.375 1.00 16.20  ? 153 ALA 4 CA  1 
ATOM 9144  C C   . ALA D 1 153 ? 52.648  27.977  200.550 1.00 19.22  ? 153 ALA 4 C   1 
ATOM 9145  O O   . ALA D 1 153 ? 53.410  27.148  201.052 1.00 34.55  ? 153 ALA 4 O   1 
ATOM 9146  C CB  . ALA D 1 153 ? 52.809  30.217  201.458 1.00 11.92  ? 153 ALA 4 CB  1 
ATOM 9147  N N   . VAL D 1 154 ? 52.472  28.122  199.254 1.00 6.51   ? 154 VAL 4 N   1 
ATOM 9148  C CA  . VAL D 1 154 ? 53.016  27.204  198.285 1.00 8.08   ? 154 VAL 4 CA  1 
ATOM 9149  C C   . VAL D 1 154 ? 53.538  28.085  197.180 1.00 18.75  ? 154 VAL 4 C   1 
ATOM 9150  O O   . VAL D 1 154 ? 52.819  28.966  196.726 1.00 26.10  ? 154 VAL 4 O   1 
ATOM 9151  C CB  . VAL D 1 154 ? 51.870  26.378  197.740 1.00 8.88   ? 154 VAL 4 CB  1 
ATOM 9152  C CG1 . VAL D 1 154 ? 52.270  25.656  196.514 1.00 11.56  ? 154 VAL 4 CG1 1 
ATOM 9153  C CG2 . VAL D 1 154 ? 51.404  25.429  198.780 1.00 23.55  ? 154 VAL 4 CG2 1 
ATOM 9154  N N   . GLY D 1 155 ? 54.768  27.869  196.736 1.00 26.15  ? 155 GLY 4 N   1 
ATOM 9155  C CA  . GLY D 1 155 ? 55.301  28.721  195.688 1.00 21.01  ? 155 GLY 4 CA  1 
ATOM 9156  C C   . GLY D 1 155 ? 56.528  28.211  194.970 1.00 26.15  ? 155 GLY 4 C   1 
ATOM 9157  O O   . GLY D 1 155 ? 57.237  27.311  195.457 1.00 27.22  ? 155 GLY 4 O   1 
ATOM 9158  N N   . GLY D 1 156 ? 56.783  28.824  193.814 1.00 29.55  ? 156 GLY 4 N   1 
ATOM 9159  C CA  . GLY D 1 156 ? 57.903  28.464  192.938 1.00 30.60  ? 156 GLY 4 CA  1 
ATOM 9160  C C   . GLY D 1 156 ? 59.285  29.020  193.252 1.00 22.55  ? 156 GLY 4 C   1 
ATOM 9161  O O   . GLY D 1 156 ? 60.255  28.778  192.494 1.00 38.07  ? 156 GLY 4 O   1 
ATOM 9162  N N   . GLU D 1 157 ? 59.358  29.746  194.366 1.00 3.49   ? 157 GLU 4 N   1 
ATOM 9163  C CA  . GLU D 1 157 ? 60.575  30.364  194.885 1.00 9.24   ? 157 GLU 4 CA  1 
ATOM 9164  C C   . GLU D 1 157 ? 60.321  30.609  196.357 1.00 11.71  ? 157 GLU 4 C   1 
ATOM 9165  O O   . GLU D 1 157 ? 59.174  30.527  196.814 1.00 37.95  ? 157 GLU 4 O   1 
ATOM 9166  C CB  . GLU D 1 157 ? 60.863  31.676  194.195 1.00 28.28  ? 157 GLU 4 CB  1 
ATOM 9167  C CG  . GLU D 1 157 ? 59.877  32.759  194.519 1.00 49.70  ? 157 GLU 4 CG  1 
ATOM 9168  C CD  . GLU D 1 157 ? 59.842  33.776  193.432 1.00 54.80  ? 157 GLU 4 CD  1 
ATOM 9169  O OE1 . GLU D 1 157 ? 59.425  33.411  192.317 1.00 33.65  ? 157 GLU 4 OE1 1 
ATOM 9170  O OE2 . GLU D 1 157 ? 60.307  34.902  193.665 1.00 78.27  ? 157 GLU 4 OE2 1 
ATOM 9171  N N   . PRO D 1 158 ? 61.337  31.027  197.106 1.00 11.36  ? 158 PRO 4 N   1 
ATOM 9172  C CA  . PRO D 1 158 ? 61.077  31.230  198.532 1.00 21.76  ? 158 PRO 4 CA  1 
ATOM 9173  C C   . PRO D 1 158 ? 60.086  32.294  198.894 1.00 30.87  ? 158 PRO 4 C   1 
ATOM 9174  O O   . PRO D 1 158 ? 59.781  33.204  198.124 1.00 35.70  ? 158 PRO 4 O   1 
ATOM 9175  C CB  . PRO D 1 158 ? 62.452  31.551  199.099 1.00 23.43  ? 158 PRO 4 CB  1 
ATOM 9176  C CG  . PRO D 1 158 ? 63.388  31.014  198.098 1.00 14.64  ? 158 PRO 4 CG  1 
ATOM 9177  C CD  . PRO D 1 158 ? 62.728  31.348  196.791 1.00 13.40  ? 158 PRO 4 CD  1 
ATOM 9178  N N   . LEU D 1 159 ? 59.573  32.159  200.099 1.00 35.20  ? 159 LEU 4 N   1 
ATOM 9179  C CA  . LEU D 1 159 ? 58.619  33.122  200.573 1.00 35.76  ? 159 LEU 4 CA  1 
ATOM 9180  C C   . LEU D 1 159 ? 59.325  34.410  200.915 1.00 31.14  ? 159 LEU 4 C   1 
ATOM 9181  O O   . LEU D 1 159 ? 60.345  34.421  201.617 1.00 39.56  ? 159 LEU 4 O   1 
ATOM 9182  C CB  . LEU D 1 159 ? 57.922  32.609  201.809 1.00 38.95  ? 159 LEU 4 CB  1 
ATOM 9183  C CG  . LEU D 1 159 ? 56.878  33.563  202.359 1.00 8.88   ? 159 LEU 4 CG  1 
ATOM 9184  C CD1 . LEU D 1 159 ? 55.775  33.718  201.354 1.00 18.51  ? 159 LEU 4 CD1 1 
ATOM 9185  C CD2 . LEU D 1 159 ? 56.315  32.965  203.612 1.00 40.96  ? 159 LEU 4 CD2 1 
ATOM 9186  N N   . GLU D 1 160 ? 58.729  35.496  200.471 1.00 18.61  ? 160 GLU 4 N   1 
ATOM 9187  C CA  . GLU D 1 160 ? 59.265  36.813  200.698 1.00 21.57  ? 160 GLU 4 CA  1 
ATOM 9188  C C   . GLU D 1 160 ? 58.561  37.444  201.884 1.00 17.89  ? 160 GLU 4 C   1 
ATOM 9189  O O   . GLU D 1 160 ? 57.340  37.446  201.978 1.00 23.23  ? 160 GLU 4 O   1 
ATOM 9190  C CB  . GLU D 1 160 ? 59.107  37.623  199.412 1.00 21.18  ? 160 GLU 4 CB  1 
ATOM 9191  C CG  . GLU D 1 160 ? 59.824  36.944  198.256 1.00 37.58  ? 160 GLU 4 CG  1 
ATOM 9192  C CD  . GLU D 1 160 ? 59.402  37.422  196.875 1.00 48.15  ? 160 GLU 4 CD  1 
ATOM 9193  O OE1 . GLU D 1 160 ? 58.283  37.064  196.401 1.00 69.82  ? 160 GLU 4 OE1 1 
ATOM 9194  O OE2 . GLU D 1 160 ? 60.238  38.110  196.248 1.00 31.95  ? 160 GLU 4 OE2 1 
ATOM 9195  N N   . LEU D 1 161 ? 59.344  37.870  202.854 1.00 19.24  ? 161 LEU 4 N   1 
ATOM 9196  C CA  . LEU D 1 161 ? 58.779  38.465  204.040 1.00 25.56  ? 161 LEU 4 CA  1 
ATOM 9197  C C   . LEU D 1 161 ? 58.945  39.928  204.054 1.00 25.42  ? 161 LEU 4 C   1 
ATOM 9198  O O   . LEU D 1 161 ? 59.434  40.532  203.090 1.00 27.58  ? 161 LEU 4 O   1 
ATOM 9199  C CB  . LEU D 1 161 ? 59.415  37.890  205.280 1.00 24.36  ? 161 LEU 4 CB  1 
ATOM 9200  C CG  . LEU D 1 161 ? 59.480  36.389  205.084 1.00 27.33  ? 161 LEU 4 CG  1 
ATOM 9201  C CD1 . LEU D 1 161 ? 59.956  35.729  206.318 1.00 28.89  ? 161 LEU 4 CD1 1 
ATOM 9202  C CD2 . LEU D 1 161 ? 58.118  35.882  204.729 1.00 42.08  ? 161 LEU 4 CD2 1 
ATOM 9203  N N   . GLN D 1 162 ? 58.402  40.481  205.122 1.00 13.79  ? 162 GLN 4 N   1 
ATOM 9204  C CA  . GLN D 1 162 ? 58.426  41.889  205.400 1.00 21.09  ? 162 GLN 4 CA  1 
ATOM 9205  C C   . GLN D 1 162 ? 58.293  41.873  206.900 1.00 25.79  ? 162 GLN 4 C   1 
ATOM 9206  O O   . GLN D 1 162 ? 57.445  41.166  207.462 1.00 22.80  ? 162 GLN 4 O   1 
ATOM 9207  C CB  . GLN D 1 162 ? 57.253  42.612  204.752 1.00 16.70  ? 162 GLN 4 CB  1 
ATOM 9208  C CG  . GLN D 1 162 ? 56.821  43.866  205.512 1.00 26.30  ? 162 GLN 4 CG  1 
ATOM 9209  C CD  . GLN D 1 162 ? 57.894  44.906  205.597 1.00 29.80  ? 162 GLN 4 CD  1 
ATOM 9210  O OE1 . GLN D 1 162 ? 58.376  45.233  206.680 1.00 35.23  ? 162 GLN 4 OE1 1 
ATOM 9211  N NE2 . GLN D 1 162 ? 58.289  45.429  204.450 1.00 12.24  ? 162 GLN 4 NE2 1 
ATOM 9212  N N   . GLY D 1 163 ? 59.164  42.628  207.541 1.00 28.34  ? 163 GLY 4 N   1 
ATOM 9213  C CA  . GLY D 1 163 ? 59.189  42.648  208.973 1.00 23.82  ? 163 GLY 4 CA  1 
ATOM 9214  C C   . GLY D 1 163 ? 58.447  43.812  209.534 1.00 33.42  ? 163 GLY 4 C   1 
ATOM 9215  O O   . GLY D 1 163 ? 58.511  44.970  209.061 1.00 43.08  ? 163 GLY 4 O   1 
ATOM 9216  N N   . VAL D 1 164 ? 57.782  43.492  210.621 1.00 19.80  ? 164 VAL 4 N   1 
ATOM 9217  C CA  . VAL D 1 164 ? 56.998  44.459  211.338 1.00 36.56  ? 164 VAL 4 CA  1 
ATOM 9218  C C   . VAL D 1 164 ? 56.941  43.866  212.703 1.00 41.09  ? 164 VAL 4 C   1 
ATOM 9219  O O   . VAL D 1 164 ? 56.763  42.642  212.831 1.00 49.04  ? 164 VAL 4 O   1 
ATOM 9220  C CB  . VAL D 1 164 ? 55.557  44.508  210.810 1.00 32.85  ? 164 VAL 4 CB  1 
ATOM 9221  C CG1 . VAL D 1 164 ? 54.708  45.350  211.708 1.00 43.25  ? 164 VAL 4 CG1 1 
ATOM 9222  C CG2 . VAL D 1 164 ? 55.542  45.079  209.428 1.00 63.77  ? 164 VAL 4 CG2 1 
ATOM 9223  N N   . LEU D 1 165 ? 57.091  44.709  213.721 1.00 42.87  ? 165 LEU 4 N   1 
ATOM 9224  C CA  . LEU D 1 165 ? 57.017  44.217  215.089 1.00 47.45  ? 165 LEU 4 CA  1 
ATOM 9225  C C   . LEU D 1 165 ? 56.537  45.245  216.107 1.00 44.22  ? 165 LEU 4 C   1 
ATOM 9226  O O   . LEU D 1 165 ? 56.473  46.455  215.821 1.00 32.94  ? 165 LEU 4 O   1 
ATOM 9227  C CB  . LEU D 1 165 ? 58.347  43.601  215.499 1.00 45.88  ? 165 LEU 4 CB  1 
ATOM 9228  C CG  . LEU D 1 165 ? 59.533  44.531  215.311 1.00 45.91  ? 165 LEU 4 CG  1 
ATOM 9229  C CD1 . LEU D 1 165 ? 59.887  45.038  216.677 1.00 63.30  ? 165 LEU 4 CD1 1 
ATOM 9230  C CD2 . LEU D 1 165 ? 60.718  43.812  214.691 1.00 19.03  ? 165 LEU 4 CD2 1 
ATOM 9231  N N   . ALA D 1 166 ? 56.036  44.743  217.230 1.00 29.17  ? 166 ALA 4 N   1 
ATOM 9232  C CA  . ALA D 1 166 ? 55.597  45.654  218.256 1.00 44.37  ? 166 ALA 4 CA  1 
ATOM 9233  C C   . ALA D 1 166 ? 56.860  45.683  219.043 1.00 59.88  ? 166 ALA 4 C   1 
ATOM 9234  O O   . ALA D 1 166 ? 57.549  44.653  219.132 1.00 78.64  ? 166 ALA 4 O   1 
ATOM 9235  C CB  . ALA D 1 166 ? 54.487  45.066  219.083 1.00 54.90  ? 166 ALA 4 CB  1 
ATOM 9236  N N   . ASN D 1 167 ? 57.243  46.870  219.490 1.00 62.29  ? 167 ASN 4 N   1 
ATOM 9237  C CA  . ASN D 1 167 ? 58.446  47.020  220.309 1.00 62.42  ? 167 ASN 4 CA  1 
ATOM 9238  C C   . ASN D 1 167 ? 59.726  46.743  219.555 1.00 44.51  ? 167 ASN 4 C   1 
ATOM 9239  O O   . ASN D 1 167 ? 60.307  45.671  219.686 1.00 29.30  ? 167 ASN 4 O   1 
ATOM 9240  C CB  . ASN D 1 167 ? 58.368  46.071  221.515 1.00 64.23  ? 167 ASN 4 CB  1 
ATOM 9241  C CG  . ASN D 1 167 ? 59.539  46.199  222.415 1.00 54.88  ? 167 ASN 4 CG  1 
ATOM 9242  O OD1 . ASN D 1 167 ? 60.218  47.247  222.423 1.00 43.46  ? 167 ASN 4 OD1 1 
ATOM 9243  N ND2 . ASN D 1 167 ? 59.821  45.135  223.167 1.00 58.22  ? 167 ASN 4 ND2 1 
ATOM 9244  N N   . TYR D 1 168 ? 60.221  47.731  218.832 1.00 41.35  ? 168 TYR 4 N   1 
ATOM 9245  C CA  . TYR D 1 168 ? 61.434  47.497  218.079 1.00 47.81  ? 168 TYR 4 CA  1 
ATOM 9246  C C   . TYR D 1 168 ? 62.632  47.290  218.994 1.00 55.49  ? 168 TYR 4 C   1 
ATOM 9247  O O   . TYR D 1 168 ? 63.675  46.780  218.594 1.00 69.91  ? 168 TYR 4 O   1 
ATOM 9248  C CB  . TYR D 1 168 ? 61.656  48.613  217.069 1.00 46.97  ? 168 TYR 4 CB  1 
ATOM 9249  C CG  . TYR D 1 168 ? 61.909  49.947  217.675 1.00 51.55  ? 168 TYR 4 CG  1 
ATOM 9250  C CD1 . TYR D 1 168 ? 60.895  50.669  218.275 1.00 50.83  ? 168 TYR 4 CD1 1 
ATOM 9251  C CD2 . TYR D 1 168 ? 63.183  50.480  217.663 1.00 60.26  ? 168 TYR 4 CD2 1 
ATOM 9252  C CE1 . TYR D 1 168 ? 61.163  51.903  218.857 1.00 72.59  ? 168 TYR 4 CE1 1 
ATOM 9253  C CE2 . TYR D 1 168 ? 63.459  51.696  218.232 1.00 65.37  ? 168 TYR 4 CE2 1 
ATOM 9254  C CZ  . TYR D 1 168 ? 62.462  52.407  218.831 1.00 67.06  ? 168 TYR 4 CZ  1 
ATOM 9255  O OH  . TYR D 1 168 ? 62.805  53.605  219.411 1.00 67.41  ? 168 TYR 4 OH  1 
ATOM 9256  N N   . ARG D 1 169 ? 62.440  47.583  220.263 1.00 58.42  ? 169 ARG 4 N   1 
ATOM 9257  C CA  . ARG D 1 169 ? 63.513  47.424  221.213 1.00 59.80  ? 169 ARG 4 CA  1 
ATOM 9258  C C   . ARG D 1 169 ? 63.542  46.014  221.798 1.00 56.07  ? 169 ARG 4 C   1 
ATOM 9259  O O   . ARG D 1 169 ? 64.166  45.765  222.832 1.00 57.71  ? 169 ARG 4 O   1 
ATOM 9260  C CB  . ARG D 1 169 ? 63.369  48.499  222.291 1.00 74.17  ? 169 ARG 4 CB  1 
ATOM 9261  C CG  . ARG D 1 169 ? 63.324  49.910  221.683 1.00 84.65  ? 169 ARG 4 CG  1 
ATOM 9262  C CD  . ARG D 1 169 ? 62.007  50.616  221.932 1.00 94.28  ? 169 ARG 4 CD  1 
ATOM 9263  N NE  . ARG D 1 169 ? 62.025  51.349  223.193 1.00 102.25 ? 169 ARG 4 NE  1 
ATOM 9264  C CZ  . ARG D 1 169 ? 60.949  51.891  223.753 1.00 110.46 ? 169 ARG 4 CZ  1 
ATOM 9265  N NH1 . ARG D 1 169 ? 59.770  51.771  223.155 1.00 126.76 ? 169 ARG 4 NH1 1 
ATOM 9266  N NH2 . ARG D 1 169 ? 61.051  52.553  224.906 1.00 118.04 ? 169 ARG 4 NH2 1 
ATOM 9267  N N   . THR D 1 170 ? 62.839  45.083  221.169 1.00 54.50  ? 170 THR 4 N   1 
ATOM 9268  C CA  . THR D 1 170 ? 62.871  43.736  221.694 1.00 54.95  ? 170 THR 4 CA  1 
ATOM 9269  C C   . THR D 1 170 ? 64.207  43.175  221.259 1.00 60.01  ? 170 THR 4 C   1 
ATOM 9270  O O   . THR D 1 170 ? 64.587  43.303  220.086 1.00 56.44  ? 170 THR 4 O   1 
ATOM 9271  C CB  . THR D 1 170 ? 61.757  42.860  221.152 1.00 51.57  ? 170 THR 4 CB  1 
ATOM 9272  O OG1 . THR D 1 170 ? 60.485  43.458  221.438 1.00 61.06  ? 170 THR 4 OG1 1 
ATOM 9273  C CG2 . THR D 1 170 ? 61.825  41.497  221.815 1.00 43.93  ? 170 THR 4 CG2 1 
ATOM 9274  N N   . LYS D 1 171 ? 64.967  42.703  222.243 1.00 62.75  ? 171 LYS 4 N   1 
ATOM 9275  C CA  . LYS D 1 171 ? 66.283  42.114  222.025 1.00 74.91  ? 171 LYS 4 CA  1 
ATOM 9276  C C   . LYS D 1 171 ? 66.077  40.668  221.606 1.00 67.81  ? 171 LYS 4 C   1 
ATOM 9277  O O   . LYS D 1 171 ? 65.551  39.838  222.374 1.00 62.82  ? 171 LYS 4 O   1 
ATOM 9278  C CB  . LYS D 1 171 ? 67.119  42.189  223.306 1.00 107.55 ? 171 LYS 4 CB  1 
ATOM 9279  C CG  . LYS D 1 171 ? 67.320  43.610  223.875 1.00 146.32 ? 171 LYS 4 CG  1 
ATOM 9280  C CD  . LYS D 1 171 ? 68.066  43.601  225.239 1.00 173.80 ? 171 LYS 4 CD  1 
ATOM 9281  C CE  . LYS D 1 171 ? 68.289  45.021  225.819 1.00 186.94 ? 171 LYS 4 CE  1 
ATOM 9282  N NZ  . LYS D 1 171 ? 69.000  45.043  227.151 1.00 191.55 ? 171 LYS 4 NZ  1 
ATOM 9283  N N   . TYR D 1 172 ? 66.532  40.355  220.400 1.00 57.23  ? 172 TYR 4 N   1 
ATOM 9284  C CA  . TYR D 1 172 ? 66.308  39.030  219.872 1.00 58.49  ? 172 TYR 4 CA  1 
ATOM 9285  C C   . TYR D 1 172 ? 67.397  37.993  219.973 1.00 56.60  ? 172 TYR 4 C   1 
ATOM 9286  O O   . TYR D 1 172 ? 68.562  38.289  219.736 1.00 66.44  ? 172 TYR 4 O   1 
ATOM 9287  C CB  . TYR D 1 172 ? 65.798  39.124  218.417 1.00 59.36  ? 172 TYR 4 CB  1 
ATOM 9288  C CG  . TYR D 1 172 ? 64.313  39.458  218.311 1.00 53.73  ? 172 TYR 4 CG  1 
ATOM 9289  C CD1 . TYR D 1 172 ? 63.358  38.614  218.856 1.00 49.91  ? 172 TYR 4 CD1 1 
ATOM 9290  C CD2 . TYR D 1 172 ? 63.870  40.655  217.746 1.00 63.03  ? 172 TYR 4 CD2 1 
ATOM 9291  C CE1 . TYR D 1 172 ? 61.991  38.950  218.861 1.00 59.87  ? 172 TYR 4 CE1 1 
ATOM 9292  C CE2 . TYR D 1 172 ? 62.495  41.000  217.746 1.00 63.67  ? 172 TYR 4 CE2 1 
ATOM 9293  C CZ  . TYR D 1 172 ? 61.562  40.139  218.314 1.00 59.88  ? 172 TYR 4 CZ  1 
ATOM 9294  O OH  . TYR D 1 172 ? 60.216  40.458  218.394 1.00 58.81  ? 172 TYR 4 OH  1 
ATOM 9295  N N   . PRO D 1 173 ? 67.022  36.766  220.377 1.00 51.22  ? 173 PRO 4 N   1 
ATOM 9296  C CA  . PRO D 1 173 ? 67.867  35.589  220.532 1.00 53.87  ? 173 PRO 4 CA  1 
ATOM 9297  C C   . PRO D 1 173 ? 68.829  35.453  219.379 1.00 58.15  ? 173 PRO 4 C   1 
ATOM 9298  O O   . PRO D 1 173 ? 68.614  35.952  218.275 1.00 52.37  ? 173 PRO 4 O   1 
ATOM 9299  C CB  . PRO D 1 173 ? 66.861  34.454  220.531 1.00 49.18  ? 173 PRO 4 CB  1 
ATOM 9300  C CG  . PRO D 1 173 ? 65.787  35.018  221.380 1.00 57.59  ? 173 PRO 4 CG  1 
ATOM 9301  C CD  . PRO D 1 173 ? 65.743  36.538  221.066 1.00 59.38  ? 173 PRO 4 CD  1 
ATOM 9302  N N   . ALA D 1 174 ? 69.868  34.691  219.635 1.00 67.37  ? 174 ALA 4 N   1 
ATOM 9303  C CA  . ALA D 1 174 ? 70.914  34.541  218.672 1.00 77.76  ? 174 ALA 4 CA  1 
ATOM 9304  C C   . ALA D 1 174 ? 70.602  33.670  217.493 1.00 76.59  ? 174 ALA 4 C   1 
ATOM 9305  O O   . ALA D 1 174 ? 70.945  33.980  216.343 1.00 76.05  ? 174 ALA 4 O   1 
ATOM 9306  C CB  . ALA D 1 174 ? 72.137  34.028  219.376 1.00 101.68 ? 174 ALA 4 CB  1 
ATOM 9307  N N   . GLN D 1 175 ? 69.970  32.554  217.779 1.00 64.63  ? 175 GLN 4 N   1 
ATOM 9308  C CA  . GLN D 1 175 ? 69.700  31.623  216.720 1.00 69.78  ? 175 GLN 4 CA  1 
ATOM 9309  C C   . GLN D 1 175 ? 68.573  32.009  215.775 1.00 66.18  ? 175 GLN 4 C   1 
ATOM 9310  O O   . GLN D 1 175 ? 68.145  31.194  214.950 1.00 65.87  ? 175 GLN 4 O   1 
ATOM 9311  C CB  . GLN D 1 175 ? 69.464  30.265  217.355 1.00 85.71  ? 175 GLN 4 CB  1 
ATOM 9312  C CG  . GLN D 1 175 ? 70.732  29.658  217.911 1.00 107.83 ? 175 GLN 4 CG  1 
ATOM 9313  C CD  . GLN D 1 175 ? 71.678  29.218  216.802 1.00 121.42 ? 175 GLN 4 CD  1 
ATOM 9314  O OE1 . GLN D 1 175 ? 71.818  28.024  216.538 1.00 128.19 ? 175 GLN 4 OE1 1 
ATOM 9315  N NE2 . GLN D 1 175 ? 72.298  30.183  216.118 1.00 127.74 ? 175 GLN 4 NE2 1 
ATOM 9316  N N   . THR D 1 176 ? 68.167  33.271  215.825 1.00 55.11  ? 176 THR 4 N   1 
ATOM 9317  C CA  . THR D 1 176 ? 67.044  33.743  215.039 1.00 41.91  ? 176 THR 4 CA  1 
ATOM 9318  C C   . THR D 1 176 ? 67.323  34.854  214.061 1.00 45.60  ? 176 THR 4 C   1 
ATOM 9319  O O   . THR D 1 176 ? 68.125  35.766  214.313 1.00 56.27  ? 176 THR 4 O   1 
ATOM 9320  C CB  . THR D 1 176 ? 65.995  34.309  215.968 1.00 43.65  ? 176 THR 4 CB  1 
ATOM 9321  O OG1 . THR D 1 176 ? 66.415  35.609  216.413 1.00 59.79  ? 176 THR 4 OG1 1 
ATOM 9322  C CG2 . THR D 1 176 ? 65.865  33.432  217.198 1.00 45.18  ? 176 THR 4 CG2 1 
ATOM 9323  N N   . VAL D 1 177 ? 66.499  34.895  213.035 1.00 40.81  ? 177 VAL 4 N   1 
ATOM 9324  C CA  . VAL D 1 177 ? 66.645  35.940  212.051 1.00 43.93  ? 177 VAL 4 CA  1 
ATOM 9325  C C   . VAL D 1 177 ? 65.575  36.954  212.326 1.00 43.41  ? 177 VAL 4 C   1 
ATOM 9326  O O   . VAL D 1 177 ? 64.399  36.618  212.338 1.00 55.21  ? 177 VAL 4 O   1 
ATOM 9327  C CB  . VAL D 1 177 ? 66.414  35.426  210.692 1.00 35.98  ? 177 VAL 4 CB  1 
ATOM 9328  C CG1 . VAL D 1 177 ? 66.952  36.382  209.732 1.00 22.70  ? 177 VAL 4 CG1 1 
ATOM 9329  C CG2 . VAL D 1 177 ? 67.064  34.105  210.541 1.00 50.58  ? 177 VAL 4 CG2 1 
ATOM 9330  N N   . THR D 1 178 ? 65.974  38.188  212.566 1.00 43.58  ? 178 THR 4 N   1 
ATOM 9331  C CA  . THR D 1 178 ? 65.000  39.215  212.859 1.00 40.65  ? 178 THR 4 CA  1 
ATOM 9332  C C   . THR D 1 178 ? 65.246  40.432  212.025 1.00 41.40  ? 178 THR 4 C   1 
ATOM 9333  O O   . THR D 1 178 ? 66.239  40.504  211.298 1.00 49.43  ? 178 THR 4 O   1 
ATOM 9334  C CB  . THR D 1 178 ? 64.999  39.600  214.338 1.00 40.84  ? 178 THR 4 CB  1 
ATOM 9335  O OG1 . THR D 1 178 ? 66.324  39.971  214.755 1.00 66.74  ? 178 THR 4 OG1 1 
ATOM 9336  C CG2 . THR D 1 178 ? 64.482  38.450  215.152 1.00 17.38  ? 178 THR 4 CG2 1 
ATOM 9337  N N   . PRO D 1 179 ? 64.297  41.371  212.043 1.00 41.36  ? 179 PRO 4 N   1 
ATOM 9338  C CA  . PRO D 1 179 ? 64.460  42.582  211.255 1.00 49.53  ? 179 PRO 4 CA  1 
ATOM 9339  C C   . PRO D 1 179 ? 65.677  43.269  211.748 1.00 60.15  ? 179 PRO 4 C   1 
ATOM 9340  O O   . PRO D 1 179 ? 65.952  43.341  212.964 1.00 55.36  ? 179 PRO 4 O   1 
ATOM 9341  C CB  . PRO D 1 179 ? 63.201  43.359  211.558 1.00 51.80  ? 179 PRO 4 CB  1 
ATOM 9342  C CG  . PRO D 1 179 ? 62.204  42.254  211.750 1.00 55.21  ? 179 PRO 4 CG  1 
ATOM 9343  C CD  . PRO D 1 179 ? 62.955  41.315  212.633 1.00 42.15  ? 179 PRO 4 CD  1 
ATOM 9344  N N   . LYS D 1 180 ? 66.445  43.708  210.774 1.00 68.24  ? 180 LYS 4 N   1 
ATOM 9345  C CA  . LYS D 1 180 ? 67.680  44.346  211.073 1.00 81.18  ? 180 LYS 4 CA  1 
ATOM 9346  C C   . LYS D 1 180 ? 67.585  45.829  211.132 1.00 81.86  ? 180 LYS 4 C   1 
ATOM 9347  O O   . LYS D 1 180 ? 66.916  46.435  210.299 1.00 92.18  ? 180 LYS 4 O   1 
ATOM 9348  C CB  . LYS D 1 180 ? 68.712  43.908  210.056 1.00 101.79 ? 180 LYS 4 CB  1 
ATOM 9349  C CG  . LYS D 1 180 ? 69.237  42.537  210.387 1.00 141.72 ? 180 LYS 4 CG  1 
ATOM 9350  C CD  . LYS D 1 180 ? 69.672  42.537  211.856 1.00 174.74 ? 180 LYS 4 CD  1 
ATOM 9351  C CE  . LYS D 1 180 ? 70.284  41.219  212.301 1.00 197.25 ? 180 LYS 4 CE  1 
ATOM 9352  N NZ  . LYS D 1 180 ? 71.075  41.444  213.548 1.00 212.13 ? 180 LYS 4 NZ  1 
ATOM 9353  N N   . ASN D 1 181 ? 68.245  46.410  212.129 1.00 77.72  ? 181 ASN 4 N   1 
ATOM 9354  C CA  . ASN D 1 181 ? 68.259  47.850  212.278 1.00 82.98  ? 181 ASN 4 CA  1 
ATOM 9355  C C   . ASN D 1 181 ? 66.886  48.339  212.586 1.00 75.82  ? 181 ASN 4 C   1 
ATOM 9356  O O   . ASN D 1 181 ? 66.334  49.150  211.841 1.00 71.72  ? 181 ASN 4 O   1 
ATOM 9357  C CB  . ASN D 1 181 ? 68.719  48.540  210.991 1.00 111.90 ? 181 ASN 4 CB  1 
ATOM 9358  C CG  . ASN D 1 181 ? 70.222  48.523  210.813 1.00 146.73 ? 181 ASN 4 CG  1 
ATOM 9359  O OD1 . ASN D 1 181 ? 70.740  49.097  209.849 1.00 169.55 ? 181 ASN 4 OD1 1 
ATOM 9360  N ND2 . ASN D 1 181 ? 70.940  47.873  211.738 1.00 159.25 ? 181 ASN 4 ND2 1 
ATOM 9361  N N   . ALA D 1 182 ? 66.311  47.808  213.654 1.00 69.39  ? 182 ALA 4 N   1 
ATOM 9362  C CA  . ALA D 1 182 ? 64.983  48.229  214.072 1.00 63.23  ? 182 ALA 4 CA  1 
ATOM 9363  C C   . ALA D 1 182 ? 64.973  49.749  214.266 1.00 57.10  ? 182 ALA 4 C   1 
ATOM 9364  O O   . ALA D 1 182 ? 66.018  50.361  214.476 1.00 76.53  ? 182 ALA 4 O   1 
ATOM 9365  C CB  . ALA D 1 182 ? 64.624  47.547  215.366 1.00 68.11  ? 182 ALA 4 CB  1 
ATOM 9366  N N   . THR D 1 183 ? 63.806  50.358  214.137 1.00 46.45  ? 183 THR 4 N   1 
ATOM 9367  C CA  . THR D 1 183 ? 63.643  51.794  214.324 1.00 43.03  ? 183 THR 4 CA  1 
ATOM 9368  C C   . THR D 1 183 ? 62.235  51.860  214.847 1.00 41.16  ? 183 THR 4 C   1 
ATOM 9369  O O   . THR D 1 183 ? 61.560  50.833  214.916 1.00 39.82  ? 183 THR 4 O   1 
ATOM 9370  C CB  . THR D 1 183 ? 63.690  52.595  212.989 1.00 44.13  ? 183 THR 4 CB  1 
ATOM 9371  O OG1 . THR D 1 183 ? 62.372  52.695  212.433 1.00 49.54  ? 183 THR 4 OG1 1 
ATOM 9372  C CG2 . THR D 1 183 ? 64.586  51.913  211.980 1.00 40.73  ? 183 THR 4 CG2 1 
ATOM 9373  N N   . VAL D 1 184 ? 61.736  53.046  215.135 1.00 39.54  ? 184 VAL 4 N   1 
ATOM 9374  C CA  . VAL D 1 184 ? 60.378  53.080  215.629 1.00 47.28  ? 184 VAL 4 CA  1 
ATOM 9375  C C   . VAL D 1 184 ? 59.458  52.671  214.519 1.00 42.06  ? 184 VAL 4 C   1 
ATOM 9376  O O   . VAL D 1 184 ? 58.434  52.043  214.748 1.00 50.99  ? 184 VAL 4 O   1 
ATOM 9377  C CB  . VAL D 1 184 ? 59.944  54.430  216.068 1.00 54.42  ? 184 VAL 4 CB  1 
ATOM 9378  C CG1 . VAL D 1 184 ? 58.982  54.255  217.248 1.00 48.82  ? 184 VAL 4 CG1 1 
ATOM 9379  C CG2 . VAL D 1 184 ? 61.157  55.299  216.374 1.00 68.88  ? 184 VAL 4 CG2 1 
ATOM 9380  N N   . ASP D 1 185 ? 59.859  52.988  213.305 1.00 30.13  ? 185 ASP 4 N   1 
ATOM 9381  C CA  . ASP D 1 185 ? 59.070  52.657  212.137 1.00 41.75  ? 185 ASP 4 CA  1 
ATOM 9382  C C   . ASP D 1 185 ? 58.826  51.167  211.950 1.00 40.71  ? 185 ASP 4 C   1 
ATOM 9383  O O   . ASP D 1 185 ? 57.899  50.740  211.267 1.00 39.00  ? 185 ASP 4 O   1 
ATOM 9384  C CB  . ASP D 1 185 ? 59.753  53.221  210.908 1.00 54.60  ? 185 ASP 4 CB  1 
ATOM 9385  C CG  . ASP D 1 185 ? 59.871  54.714  210.964 1.00 62.68  ? 185 ASP 4 CG  1 
ATOM 9386  O OD1 . ASP D 1 185 ? 59.798  55.264  212.087 1.00 82.50  ? 185 ASP 4 OD1 1 
ATOM 9387  O OD2 . ASP D 1 185 ? 60.018  55.344  209.895 1.00 82.07  ? 185 ASP 4 OD2 1 
ATOM 9388  N N   . SER D 1 186 ? 59.669  50.358  212.546 1.00 39.06  ? 186 SER 4 N   1 
ATOM 9389  C CA  . SER D 1 186 ? 59.483  48.944  212.395 1.00 39.13  ? 186 SER 4 CA  1 
ATOM 9390  C C   . SER D 1 186 ? 58.252  48.504  213.173 1.00 37.39  ? 186 SER 4 C   1 
ATOM 9391  O O   . SER D 1 186 ? 57.726  47.412  212.943 1.00 41.76  ? 186 SER 4 O   1 
ATOM 9392  C CB  . SER D 1 186 ? 60.743  48.259  212.861 1.00 47.77  ? 186 SER 4 CB  1 
ATOM 9393  O OG  . SER D 1 186 ? 61.835  48.892  212.226 1.00 32.41  ? 186 SER 4 OG  1 
ATOM 9394  N N   . GLN D 1 187 ? 57.806  49.364  214.092 1.00 28.32  ? 187 GLN 4 N   1 
ATOM 9395  C CA  . GLN D 1 187 ? 56.613  49.097  214.886 1.00 39.57  ? 187 GLN 4 CA  1 
ATOM 9396  C C   . GLN D 1 187 ? 55.427  49.225  213.919 1.00 38.30  ? 187 GLN 4 C   1 
ATOM 9397  O O   . GLN D 1 187 ? 54.287  48.828  214.233 1.00 40.07  ? 187 GLN 4 O   1 
ATOM 9398  C CB  . GLN D 1 187 ? 56.500  50.047  216.102 1.00 44.67  ? 187 GLN 4 CB  1 
ATOM 9399  C CG  . GLN D 1 187 ? 57.443  49.698  217.269 1.00 35.47  ? 187 GLN 4 CG  1 
ATOM 9400  C CD  . GLN D 1 187 ? 56.756  49.762  218.629 1.00 69.34  ? 187 GLN 4 CD  1 
ATOM 9401  O OE1 . GLN D 1 187 ? 55.676  49.180  218.834 1.00 88.84  ? 187 GLN 4 OE1 1 
ATOM 9402  N NE2 . GLN D 1 187 ? 57.395  50.428  219.582 1.00 80.44  ? 187 GLN 4 NE2 1 
ATOM 9403  N N   . GLN D 1 188 ? 55.744  49.747  212.731 1.00 15.36  ? 188 GLN 4 N   1 
ATOM 9404  C CA  . GLN D 1 188 ? 54.811  49.896  211.636 1.00 20.35  ? 188 GLN 4 CA  1 
ATOM 9405  C C   . GLN D 1 188 ? 55.487  49.498  210.293 1.00 26.59  ? 188 GLN 4 C   1 
ATOM 9406  O O   . GLN D 1 188 ? 56.362  48.588  210.266 1.00 33.86  ? 188 GLN 4 O   1 
ATOM 9407  C CB  . GLN D 1 188 ? 54.245  51.307  211.599 1.00 24.89  ? 188 GLN 4 CB  1 
ATOM 9408  C CG  . GLN D 1 188 ? 55.222  52.356  211.146 1.00 47.66  ? 188 GLN 4 CG  1 
ATOM 9409  C CD  . GLN D 1 188 ? 54.633  53.763  211.075 1.00 59.91  ? 188 GLN 4 CD  1 
ATOM 9410  O OE1 . GLN D 1 188 ? 55.071  54.581  210.261 1.00 82.00  ? 188 GLN 4 OE1 1 
ATOM 9411  N NE2 . GLN D 1 188 ? 53.673  54.068  211.945 1.00 43.60  ? 188 GLN 4 NE2 1 
ATOM 9412  N N   . MET D 1 189 ? 55.132  50.171  209.190 1.00 18.29  ? 189 MET 4 N   1 
ATOM 9413  C CA  . MET D 1 189 ? 55.717  49.788  207.917 1.00 23.96  ? 189 MET 4 CA  1 
ATOM 9414  C C   . MET D 1 189 ? 57.161  50.159  207.733 1.00 37.40  ? 189 MET 4 C   1 
ATOM 9415  O O   . MET D 1 189 ? 57.480  51.208  207.172 1.00 31.47  ? 189 MET 4 O   1 
ATOM 9416  C CB  . MET D 1 189 ? 54.913  50.269  206.710 1.00 14.39  ? 189 MET 4 CB  1 
ATOM 9417  C CG  . MET D 1 189 ? 55.447  49.739  205.356 1.00 14.26  ? 189 MET 4 CG  1 
ATOM 9418  S SD  . MET D 1 189 ? 55.665  47.916  205.376 1.00 42.15  ? 189 MET 4 SD  1 
ATOM 9419  C CE  . MET D 1 189 ? 55.855  47.549  203.635 1.00 40.60  ? 189 MET 4 CE  1 
ATOM 9420  N N   . ASN D 1 190 ? 58.054  49.285  208.174 1.00 50.04  ? 190 ASN 4 N   1 
ATOM 9421  C CA  . ASN D 1 190 ? 59.430  49.607  207.955 1.00 50.65  ? 190 ASN 4 CA  1 
ATOM 9422  C C   . ASN D 1 190 ? 59.964  48.921  206.734 1.00 40.22  ? 190 ASN 4 C   1 
ATOM 9423  O O   . ASN D 1 190 ? 60.462  47.805  206.798 1.00 48.35  ? 190 ASN 4 O   1 
ATOM 9424  C CB  . ASN D 1 190 ? 60.296  49.283  209.138 1.00 63.57  ? 190 ASN 4 CB  1 
ATOM 9425  C CG  . ASN D 1 190 ? 61.696  49.833  208.967 1.00 64.36  ? 190 ASN 4 CG  1 
ATOM 9426  O OD1 . ASN D 1 190 ? 62.551  49.622  209.818 1.00 63.68  ? 190 ASN 4 OD1 1 
ATOM 9427  N ND2 . ASN D 1 190 ? 61.932  50.571  207.872 1.00 37.28  ? 190 ASN 4 ND2 1 
ATOM 9428  N N   . THR D 1 191 ? 59.971  49.654  205.644 1.00 28.89  ? 191 THR 4 N   1 
ATOM 9429  C CA  . THR D 1 191 ? 60.442  49.139  204.360 1.00 40.41  ? 191 THR 4 CA  1 
ATOM 9430  C C   . THR D 1 191 ? 61.833  48.521  204.285 1.00 52.52  ? 191 THR 4 C   1 
ATOM 9431  O O   . THR D 1 191 ? 62.279  48.133  203.200 1.00 54.23  ? 191 THR 4 O   1 
ATOM 9432  C CB  . THR D 1 191 ? 60.481  50.244  203.363 1.00 40.22  ? 191 THR 4 CB  1 
ATOM 9433  O OG1 . THR D 1 191 ? 59.764  51.372  203.897 1.00 79.67  ? 191 THR 4 OG1 1 
ATOM 9434  C CG2 . THR D 1 191 ? 59.885  49.782  202.060 1.00 27.73  ? 191 THR 4 CG2 1 
ATOM 9435  N N   . ASP D 1 192 ? 62.561  48.517  205.390 1.00 59.95  ? 192 ASP 4 N   1 
ATOM 9436  C CA  . ASP D 1 192 ? 63.894  47.944  205.373 1.00 64.55  ? 192 ASP 4 CA  1 
ATOM 9437  C C   . ASP D 1 192 ? 63.790  46.468  205.657 1.00 56.76  ? 192 ASP 4 C   1 
ATOM 9438  O O   . ASP D 1 192 ? 64.650  45.672  205.308 1.00 67.55  ? 192 ASP 4 O   1 
ATOM 9439  C CB  . ASP D 1 192 ? 64.760  48.576  206.464 1.00 85.18  ? 192 ASP 4 CB  1 
ATOM 9440  C CG  . ASP D 1 192 ? 65.048  50.053  206.224 1.00 91.87  ? 192 ASP 4 CG  1 
ATOM 9441  O OD1 . ASP D 1 192 ? 65.137  50.477  205.049 1.00 83.96  ? 192 ASP 4 OD1 1 
ATOM 9442  O OD2 . ASP D 1 192 ? 65.196  50.789  207.229 1.00 105.34 ? 192 ASP 4 OD2 1 
ATOM 9443  N N   . HIS D 1 193 ? 62.703  46.094  206.288 1.00 43.13  ? 193 HIS 4 N   1 
ATOM 9444  C CA  . HIS D 1 193 ? 62.536  44.727  206.669 1.00 36.99  ? 193 HIS 4 CA  1 
ATOM 9445  C C   . HIS D 1 193 ? 62.034  43.784  205.664 1.00 39.47  ? 193 HIS 4 C   1 
ATOM 9446  O O   . HIS D 1 193 ? 61.087  43.047  205.912 1.00 51.60  ? 193 HIS 4 O   1 
ATOM 9447  C CB  . HIS D 1 193 ? 61.744  44.706  207.920 1.00 29.75  ? 193 HIS 4 CB  1 
ATOM 9448  C CG  . HIS D 1 193 ? 62.344  45.607  208.924 1.00 38.37  ? 193 HIS 4 CG  1 
ATOM 9449  N ND1 . HIS D 1 193 ? 63.663  45.993  208.832 1.00 29.54  ? 193 HIS 4 ND1 1 
ATOM 9450  C CD2 . HIS D 1 193 ? 61.816  46.281  209.967 1.00 41.58  ? 193 HIS 4 CD2 1 
ATOM 9451  C CE1 . HIS D 1 193 ? 63.918  46.871  209.779 1.00 48.18  ? 193 HIS 4 CE1 1 
ATOM 9452  N NE2 . HIS D 1 193 ? 62.817  47.064  210.482 1.00 32.42  ? 193 HIS 4 NE2 1 
ATOM 9453  N N   . LYS D 1 194 ? 62.659  43.811  204.502 1.00 34.16  ? 194 LYS 4 N   1 
ATOM 9454  C CA  . LYS D 1 194 ? 62.266  42.872  203.485 1.00 48.15  ? 194 LYS 4 CA  1 
ATOM 9455  C C   . LYS D 1 194 ? 63.238  41.705  203.656 1.00 50.03  ? 194 LYS 4 C   1 
ATOM 9456  O O   . LYS D 1 194 ? 64.415  41.913  203.905 1.00 51.96  ? 194 LYS 4 O   1 
ATOM 9457  C CB  . LYS D 1 194 ? 62.313  43.522  202.109 1.00 47.55  ? 194 LYS 4 CB  1 
ATOM 9458  C CG  . LYS D 1 194 ? 61.345  44.730  201.939 1.00 50.63  ? 194 LYS 4 CG  1 
ATOM 9459  C CD  . LYS D 1 194 ? 59.842  44.358  201.996 1.00 53.18  ? 194 LYS 4 CD  1 
ATOM 9460  C CE  . LYS D 1 194 ? 58.944  45.498  201.460 1.00 27.13  ? 194 LYS 4 CE  1 
ATOM 9461  N NZ  . LYS D 1 194 ? 57.453  45.226  201.402 1.00 50.84  ? 194 LYS 4 NZ  1 
ATOM 9462  N N   . ALA D 1 195 ? 62.727  40.482  203.624 1.00 56.86  ? 195 ALA 4 N   1 
ATOM 9463  C CA  . ALA D 1 195 ? 63.576  39.325  203.838 1.00 48.76  ? 195 ALA 4 CA  1 
ATOM 9464  C C   . ALA D 1 195 ? 62.964  38.093  203.214 1.00 46.33  ? 195 ALA 4 C   1 
ATOM 9465  O O   . ALA D 1 195 ? 61.848  38.157  202.731 1.00 55.96  ? 195 ALA 4 O   1 
ATOM 9466  C CB  . ALA D 1 195 ? 63.738  39.127  205.303 1.00 40.49  ? 195 ALA 4 CB  1 
ATOM 9467  N N   . VAL D 1 196 ? 63.667  36.967  203.236 1.00 36.16  ? 196 VAL 4 N   1 
ATOM 9468  C CA  . VAL D 1 196 ? 63.109  35.756  202.643 1.00 34.00  ? 196 VAL 4 CA  1 
ATOM 9469  C C   . VAL D 1 196 ? 63.219  34.534  203.534 1.00 30.46  ? 196 VAL 4 C   1 
ATOM 9470  O O   . VAL D 1 196 ? 64.295  34.199  204.014 1.00 37.08  ? 196 VAL 4 O   1 
ATOM 9471  C CB  . VAL D 1 196 ? 63.714  35.445  201.272 1.00 10.71  ? 196 VAL 4 CB  1 
ATOM 9472  C CG1 . VAL D 1 196 ? 65.191  35.671  201.297 1.00 45.70  ? 196 VAL 4 CG1 1 
ATOM 9473  C CG2 . VAL D 1 196 ? 63.460  34.004  200.946 1.00 27.11  ? 196 VAL 4 CG2 1 
ATOM 9474  N N   . LEU D 1 197 ? 62.093  33.859  203.717 1.00 27.43  ? 197 LEU 4 N   1 
ATOM 9475  C CA  . LEU D 1 197 ? 62.039  32.686  204.562 1.00 27.51  ? 197 LEU 4 CA  1 
ATOM 9476  C C   . LEU D 1 197 ? 62.835  31.613  203.882 1.00 32.14  ? 197 LEU 4 C   1 
ATOM 9477  O O   . LEU D 1 197 ? 62.270  30.853  203.066 1.00 29.66  ? 197 LEU 4 O   1 
ATOM 9478  C CB  . LEU D 1 197 ? 60.609  32.211  204.725 1.00 16.69  ? 197 LEU 4 CB  1 
ATOM 9479  C CG  . LEU D 1 197 ? 60.560  30.965  205.578 1.00 15.30  ? 197 LEU 4 CG  1 
ATOM 9480  C CD1 . LEU D 1 197 ? 61.363  31.193  206.831 1.00 53.13  ? 197 LEU 4 CD1 1 
ATOM 9481  C CD2 . LEU D 1 197 ? 59.156  30.650  205.937 1.00 22.59  ? 197 LEU 4 CD2 1 
ATOM 9482  N N   . ASP D 1 198 ? 64.109  31.532  204.275 1.00 18.98  ? 198 ASP 4 N   1 
ATOM 9483  C CA  . ASP D 1 198 ? 65.072  30.596  203.707 1.00 23.93  ? 198 ASP 4 CA  1 
ATOM 9484  C C   . ASP D 1 198 ? 65.638  29.623  204.722 1.00 29.40  ? 198 ASP 4 C   1 
ATOM 9485  O O   . ASP D 1 198 ? 66.549  28.841  204.411 1.00 35.13  ? 198 ASP 4 O   1 
ATOM 9486  C CB  . ASP D 1 198 ? 66.240  31.383  203.154 1.00 21.81  ? 198 ASP 4 CB  1 
ATOM 9487  C CG  . ASP D 1 198 ? 66.914  32.207  204.222 1.00 43.30  ? 198 ASP 4 CG  1 
ATOM 9488  O OD1 . ASP D 1 198 ? 66.581  32.001  205.412 1.00 36.64  ? 198 ASP 4 OD1 1 
ATOM 9489  O OD2 . ASP D 1 198 ? 67.754  33.065  203.891 1.00 56.75  ? 198 ASP 4 OD2 1 
ATOM 9490  N N   . LYS D 1 199 ? 65.198  29.748  205.964 1.00 18.96  ? 199 LYS 4 N   1 
ATOM 9491  C CA  . LYS D 1 199 ? 65.699  28.857  206.979 1.00 16.78  ? 199 LYS 4 CA  1 
ATOM 9492  C C   . LYS D 1 199 ? 64.620  28.439  207.958 1.00 23.97  ? 199 LYS 4 C   1 
ATOM 9493  O O   . LYS D 1 199 ? 63.962  29.262  208.653 1.00 33.42  ? 199 LYS 4 O   1 
ATOM 9494  C CB  . LYS D 1 199 ? 66.888  29.497  207.671 1.00 40.12  ? 199 LYS 4 CB  1 
ATOM 9495  C CG  . LYS D 1 199 ? 67.334  28.806  208.932 1.00 82.19  ? 199 LYS 4 CG  1 
ATOM 9496  C CD  . LYS D 1 199 ? 67.638  27.338  208.698 1.00 126.21 ? 199 LYS 4 CD  1 
ATOM 9497  C CE  . LYS D 1 199 ? 68.328  26.732  209.913 1.00 148.36 ? 199 LYS 4 CE  1 
ATOM 9498  N NZ  . LYS D 1 199 ? 69.626  27.431  210.210 1.00 168.73 ? 199 LYS 4 NZ  1 
ATOM 9499  N N   . ASP D 1 200 ? 64.408  27.136  207.991 1.00 15.74  ? 200 ASP 4 N   1 
ATOM 9500  C CA  . ASP D 1 200 ? 63.390  26.610  208.868 1.00 21.09  ? 200 ASP 4 CA  1 
ATOM 9501  C C   . ASP D 1 200 ? 63.725  26.896  210.315 1.00 17.37  ? 200 ASP 4 C   1 
ATOM 9502  O O   . ASP D 1 200 ? 64.888  26.891  210.695 1.00 20.94  ? 200 ASP 4 O   1 
ATOM 9503  C CB  . ASP D 1 200 ? 63.221  25.124  208.643 1.00 26.45  ? 200 ASP 4 CB  1 
ATOM 9504  C CG  . ASP D 1 200 ? 62.226  24.531  209.583 1.00 38.77  ? 200 ASP 4 CG  1 
ATOM 9505  O OD1 . ASP D 1 200 ? 61.029  24.662  209.307 1.00 45.33  ? 200 ASP 4 OD1 1 
ATOM 9506  O OD2 . ASP D 1 200 ? 62.632  23.992  210.624 1.00 41.98  ? 200 ASP 4 OD2 1 
ATOM 9507  N N   . ASN D 1 201 ? 62.699  27.139  211.116 1.00 23.52  ? 201 ASN 4 N   1 
ATOM 9508  C CA  . ASN D 1 201 ? 62.856  27.448  212.544 1.00 31.05  ? 201 ASN 4 CA  1 
ATOM 9509  C C   . ASN D 1 201 ? 63.861  28.523  212.689 1.00 35.84  ? 201 ASN 4 C   1 
ATOM 9510  O O   . ASN D 1 201 ? 64.873  28.314  213.345 1.00 37.94  ? 201 ASN 4 O   1 
ATOM 9511  C CB  . ASN D 1 201 ? 63.370  26.274  213.400 1.00 14.90  ? 201 ASN 4 CB  1 
ATOM 9512  C CG  . ASN D 1 201 ? 63.142  26.503  214.919 1.00 46.56  ? 201 ASN 4 CG  1 
ATOM 9513  O OD1 . ASN D 1 201 ? 62.954  25.560  215.689 1.00 51.09  ? 201 ASN 4 OD1 1 
ATOM 9514  N ND2 . ASN D 1 201 ? 63.093  27.767  215.332 1.00 74.48  ? 201 ASN 4 ND2 1 
ATOM 9515  N N   . ALA D 1 202 ? 63.590  29.699  212.166 1.00 44.05  ? 202 ALA 4 N   1 
ATOM 9516  C CA  . ALA D 1 202 ? 64.618  30.693  212.304 1.00 36.74  ? 202 ALA 4 CA  1 
ATOM 9517  C C   . ALA D 1 202 ? 64.004  32.022  212.388 1.00 37.05  ? 202 ALA 4 C   1 
ATOM 9518  O O   . ALA D 1 202 ? 64.421  32.873  213.160 1.00 39.35  ? 202 ALA 4 O   1 
ATOM 9519  C CB  . ALA D 1 202 ? 65.499  30.619  211.112 1.00 37.49  ? 202 ALA 4 CB  1 
ATOM 9520  N N   . TYR D 1 203 ? 63.071  32.218  211.484 1.00 37.46  ? 203 TYR 4 N   1 
ATOM 9521  C CA  . TYR D 1 203 ? 62.361  33.441  211.417 1.00 31.10  ? 203 TYR 4 CA  1 
ATOM 9522  C C   . TYR D 1 203 ? 61.169  33.254  212.289 1.00 33.04  ? 203 TYR 4 C   1 
ATOM 9523  O O   . TYR D 1 203 ? 60.322  32.420  211.996 1.00 43.19  ? 203 TYR 4 O   1 
ATOM 9524  C CB  . TYR D 1 203 ? 61.911  33.577  210.029 1.00 39.83  ? 203 TYR 4 CB  1 
ATOM 9525  C CG  . TYR D 1 203 ? 63.040  33.740  209.103 1.00 38.88  ? 203 TYR 4 CG  1 
ATOM 9526  C CD1 . TYR D 1 203 ? 63.691  32.643  208.550 1.00 37.16  ? 203 TYR 4 CD1 1 
ATOM 9527  C CD2 . TYR D 1 203 ? 63.376  34.997  208.666 1.00 34.38  ? 203 TYR 4 CD2 1 
ATOM 9528  C CE1 . TYR D 1 203 ? 64.654  32.823  207.544 1.00 42.29  ? 203 TYR 4 CE1 1 
ATOM 9529  C CE2 . TYR D 1 203 ? 64.310  35.178  207.691 1.00 46.25  ? 203 TYR 4 CE2 1 
ATOM 9530  C CZ  . TYR D 1 203 ? 64.948  34.109  207.129 1.00 38.83  ? 203 TYR 4 CZ  1 
ATOM 9531  O OH  . TYR D 1 203 ? 65.859  34.422  206.165 1.00 46.96  ? 203 TYR 4 OH  1 
ATOM 9532  N N   . PRO D 1 204 ? 61.124  33.963  213.414 1.00 31.25  ? 204 PRO 4 N   1 
ATOM 9533  C CA  . PRO D 1 204 ? 60.046  33.922  214.406 1.00 35.60  ? 204 PRO 4 CA  1 
ATOM 9534  C C   . PRO D 1 204 ? 58.813  34.523  213.805 1.00 30.78  ? 204 PRO 4 C   1 
ATOM 9535  O O   . PRO D 1 204 ? 58.883  35.623  213.249 1.00 34.35  ? 204 PRO 4 O   1 
ATOM 9536  C CB  . PRO D 1 204 ? 60.602  34.777  215.534 1.00 47.46  ? 204 PRO 4 CB  1 
ATOM 9537  C CG  . PRO D 1 204 ? 61.499  35.738  214.810 1.00 38.80  ? 204 PRO 4 CG  1 
ATOM 9538  C CD  . PRO D 1 204 ? 62.197  34.877  213.832 1.00 29.95  ? 204 PRO 4 CD  1 
ATOM 9539  N N   . VAL D 1 205 ? 57.680  33.834  213.921 1.00 28.20  ? 205 VAL 4 N   1 
ATOM 9540  C CA  . VAL D 1 205 ? 56.464  34.346  213.291 1.00 36.65  ? 205 VAL 4 CA  1 
ATOM 9541  C C   . VAL D 1 205 ? 56.139  35.716  213.747 1.00 40.24  ? 205 VAL 4 C   1 
ATOM 9542  O O   . VAL D 1 205 ? 55.609  36.518  212.979 1.00 43.08  ? 205 VAL 4 O   1 
ATOM 9543  C CB  . VAL D 1 205 ? 55.208  33.518  213.538 1.00 27.05  ? 205 VAL 4 CB  1 
ATOM 9544  C CG1 . VAL D 1 205 ? 55.293  32.206  212.839 1.00 38.79  ? 205 VAL 4 CG1 1 
ATOM 9545  C CG2 . VAL D 1 205 ? 55.016  33.328  214.985 1.00 61.90  ? 205 VAL 4 CG2 1 
ATOM 9546  N N   . GLU D 1 206 ? 56.498  36.010  214.985 1.00 38.54  ? 206 GLU 4 N   1 
ATOM 9547  C CA  . GLU D 1 206 ? 56.174  37.313  215.501 1.00 42.02  ? 206 GLU 4 CA  1 
ATOM 9548  C C   . GLU D 1 206 ? 56.970  38.481  214.949 1.00 38.37  ? 206 GLU 4 C   1 
ATOM 9549  O O   . GLU D 1 206 ? 56.786  39.601  215.398 1.00 45.70  ? 206 GLU 4 O   1 
ATOM 9550  C CB  . GLU D 1 206 ? 56.168  37.319  217.023 1.00 58.95  ? 206 GLU 4 CB  1 
ATOM 9551  C CG  . GLU D 1 206 ? 57.466  36.938  217.679 1.00 72.27  ? 206 GLU 4 CG  1 
ATOM 9552  C CD  . GLU D 1 206 ? 57.481  37.357  219.133 1.00 71.30  ? 206 GLU 4 CD  1 
ATOM 9553  O OE1 . GLU D 1 206 ? 56.892  36.596  219.955 1.00 70.82  ? 206 GLU 4 OE1 1 
ATOM 9554  O OE2 . GLU D 1 206 ? 58.060  38.444  219.436 1.00 36.51  ? 206 GLU 4 OE2 1 
ATOM 9555  N N   . CYS D 1 207 ? 57.797  38.253  213.934 1.00 40.80  ? 207 CYS 4 N   1 
ATOM 9556  C CA  . CYS D 1 207 ? 58.574  39.353  213.357 1.00 43.74  ? 207 CYS 4 CA  1 
ATOM 9557  C C   . CYS D 1 207 ? 58.300  39.521  211.873 1.00 47.92  ? 207 CYS 4 C   1 
ATOM 9558  O O   . CYS D 1 207 ? 58.589  40.570  211.260 1.00 42.91  ? 207 CYS 4 O   1 
ATOM 9559  C CB  . CYS D 1 207 ? 60.069  39.117  213.545 1.00 42.17  ? 207 CYS 4 CB  1 
ATOM 9560  S SG  . CYS D 1 207 ? 60.577  38.959  215.248 1.00 48.86  ? 207 CYS 4 SG  1 
ATOM 9561  N N   . TRP D 1 208 ? 57.710  38.502  211.280 1.00 41.01  ? 208 TRP 4 N   1 
ATOM 9562  C CA  . TRP D 1 208 ? 57.486  38.612  209.868 1.00 41.71  ? 208 TRP 4 CA  1 
ATOM 9563  C C   . TRP D 1 208 ? 56.103  38.319  209.417 1.00 34.58  ? 208 TRP 4 C   1 
ATOM 9564  O O   . TRP D 1 208 ? 55.250  37.893  210.181 1.00 40.21  ? 208 TRP 4 O   1 
ATOM 9565  C CB  . TRP D 1 208 ? 58.434  37.684  209.152 1.00 52.14  ? 208 TRP 4 CB  1 
ATOM 9566  C CG  . TRP D 1 208 ? 59.787  37.789  209.697 1.00 51.41  ? 208 TRP 4 CG  1 
ATOM 9567  C CD1 . TRP D 1 208 ? 60.298  37.135  210.786 1.00 54.27  ? 208 TRP 4 CD1 1 
ATOM 9568  C CD2 . TRP D 1 208 ? 60.810  38.629  209.210 1.00 41.63  ? 208 TRP 4 CD2 1 
ATOM 9569  N NE1 . TRP D 1 208 ? 61.585  37.528  211.000 1.00 44.06  ? 208 TRP 4 NE1 1 
ATOM 9570  C CE2 . TRP D 1 208 ? 61.924  38.451  210.045 1.00 39.25  ? 208 TRP 4 CE2 1 
ATOM 9571  C CE3 . TRP D 1 208 ? 60.896  39.528  208.141 1.00 43.18  ? 208 TRP 4 CE3 1 
ATOM 9572  C CZ2 . TRP D 1 208 ? 63.103  39.136  209.850 1.00 48.04  ? 208 TRP 4 CZ2 1 
ATOM 9573  C CZ3 . TRP D 1 208 ? 62.067  40.209  207.944 1.00 22.40  ? 208 TRP 4 CZ3 1 
ATOM 9574  C CH2 . TRP D 1 208 ? 63.157  40.014  208.793 1.00 40.66  ? 208 TRP 4 CH2 1 
ATOM 9575  N N   . VAL D 1 209 ? 55.904  38.597  208.148 1.00 28.75  ? 209 VAL 4 N   1 
ATOM 9576  C CA  . VAL D 1 209 ? 54.666  38.347  207.472 1.00 28.14  ? 209 VAL 4 CA  1 
ATOM 9577  C C   . VAL D 1 209 ? 55.052  38.311  206.018 1.00 25.42  ? 209 VAL 4 C   1 
ATOM 9578  O O   . VAL D 1 209 ? 56.064  38.915  205.578 1.00 16.16  ? 209 VAL 4 O   1 
ATOM 9579  C CB  . VAL D 1 209 ? 53.641  39.481  207.610 1.00 32.84  ? 209 VAL 4 CB  1 
ATOM 9580  C CG1 . VAL D 1 209 ? 52.914  39.430  208.965 1.00 29.34  ? 209 VAL 4 CG1 1 
ATOM 9581  C CG2 . VAL D 1 209 ? 54.332  40.794  207.381 1.00 34.49  ? 209 VAL 4 CG2 1 
ATOM 9582  N N   . PRO D 1 210 ? 54.320  37.505  205.264 1.00 16.47  ? 210 PRO 4 N   1 
ATOM 9583  C CA  . PRO D 1 210 ? 54.614  37.425  203.846 1.00 19.59  ? 210 PRO 4 CA  1 
ATOM 9584  C C   . PRO D 1 210 ? 54.450  38.851  203.371 1.00 22.07  ? 210 PRO 4 C   1 
ATOM 9585  O O   . PRO D 1 210 ? 53.545  39.582  203.816 1.00 18.70  ? 210 PRO 4 O   1 
ATOM 9586  C CB  . PRO D 1 210 ? 53.496  36.511  203.313 1.00 23.61  ? 210 PRO 4 CB  1 
ATOM 9587  C CG  . PRO D 1 210 ? 52.406  36.586  204.366 1.00 27.19  ? 210 PRO 4 CG  1 
ATOM 9588  C CD  . PRO D 1 210 ? 53.209  36.617  205.639 1.00 14.24  ? 210 PRO 4 CD  1 
ATOM 9589  N N   . ASP D 1 211 ? 55.411  39.290  202.593 1.00 17.92  ? 211 ASP 4 N   1 
ATOM 9590  C CA  . ASP D 1 211 ? 55.347  40.621  202.081 1.00 24.13  ? 211 ASP 4 CA  1 
ATOM 9591  C C   . ASP D 1 211 ? 54.492  40.590  200.839 1.00 17.39  ? 211 ASP 4 C   1 
ATOM 9592  O O   . ASP D 1 211 ? 54.874  40.078  199.793 1.00 32.09  ? 211 ASP 4 O   1 
ATOM 9593  C CB  . ASP D 1 211 ? 56.734  41.141  201.780 1.00 28.23  ? 211 ASP 4 CB  1 
ATOM 9594  C CG  . ASP D 1 211 ? 56.721  42.372  200.927 1.00 36.66  ? 211 ASP 4 CG  1 
ATOM 9595  O OD1 . ASP D 1 211 ? 55.662  43.052  200.721 1.00 30.66  ? 211 ASP 4 OD1 1 
ATOM 9596  O OD2 . ASP D 1 211 ? 57.831  42.659  200.465 1.00 41.45  ? 211 ASP 4 OD2 1 
ATOM 9597  N N   . PRO D 1 212 ? 53.347  41.231  200.927 1.00 15.09  ? 212 PRO 4 N   1 
ATOM 9598  C CA  . PRO D 1 212 ? 52.291  41.398  199.936 1.00 17.30  ? 212 PRO 4 CA  1 
ATOM 9599  C C   . PRO D 1 212 ? 52.694  42.033  198.632 1.00 17.09  ? 212 PRO 4 C   1 
ATOM 9600  O O   . PRO D 1 212 ? 52.235  41.603  197.544 1.00 37.02  ? 212 PRO 4 O   1 
ATOM 9601  C CB  . PRO D 1 212 ? 51.300  42.271  200.666 1.00 9.70   ? 212 PRO 4 CB  1 
ATOM 9602  C CG  . PRO D 1 212 ? 52.184  43.045  201.612 1.00 20.22  ? 212 PRO 4 CG  1 
ATOM 9603  C CD  . PRO D 1 212 ? 53.023  41.962  202.154 1.00 7.40   ? 212 PRO 4 CD  1 
ATOM 9604  N N   . SER D 1 213 ? 53.591  43.007  198.718 1.00 14.83  ? 213 SER 4 N   1 
ATOM 9605  C CA  . SER D 1 213 ? 53.986  43.719  197.504 1.00 35.32  ? 213 SER 4 CA  1 
ATOM 9606  C C   . SER D 1 213 ? 54.677  42.795  196.567 1.00 40.93  ? 213 SER 4 C   1 
ATOM 9607  O O   . SER D 1 213 ? 54.752  43.023  195.349 1.00 25.67  ? 213 SER 4 O   1 
ATOM 9608  C CB  . SER D 1 213 ? 54.961  44.825  197.847 1.00 32.12  ? 213 SER 4 CB  1 
ATOM 9609  O OG  . SER D 1 213 ? 56.131  44.267  198.371 1.00 27.79  ? 213 SER 4 OG  1 
ATOM 9610  N N   . LYS D 1 214 ? 55.151  41.706  197.145 1.00 37.94  ? 214 LYS 4 N   1 
ATOM 9611  C CA  . LYS D 1 214 ? 55.909  40.881  196.313 1.00 43.77  ? 214 LYS 4 CA  1 
ATOM 9612  C C   . LYS D 1 214 ? 55.849  39.415  196.208 1.00 47.40  ? 214 LYS 4 C   1 
ATOM 9613  O O   . LYS D 1 214 ? 56.611  38.865  195.428 1.00 81.23  ? 214 LYS 4 O   1 
ATOM 9614  C CB  . LYS D 1 214 ? 57.357  41.313  196.428 1.00 54.51  ? 214 LYS 4 CB  1 
ATOM 9615  C CG  . LYS D 1 214 ? 57.895  41.436  197.828 1.00 64.12  ? 214 LYS 4 CG  1 
ATOM 9616  C CD  . LYS D 1 214 ? 59.299  42.056  197.773 1.00 84.24  ? 214 LYS 4 CD  1 
ATOM 9617  C CE  . LYS D 1 214 ? 59.262  43.381  196.991 1.00 104.87 ? 214 LYS 4 CE  1 
ATOM 9618  N NZ  . LYS D 1 214 ? 60.475  43.622  196.154 1.00 119.97 ? 214 LYS 4 NZ  1 
ATOM 9619  N N   . ASN D 1 215 ? 55.014  38.703  196.919 1.00 27.33  ? 215 ASN 4 N   1 
ATOM 9620  C CA  . ASN D 1 215 ? 55.134  37.287  196.636 1.00 21.70  ? 215 ASN 4 CA  1 
ATOM 9621  C C   . ASN D 1 215 ? 54.432  37.048  195.344 1.00 36.79  ? 215 ASN 4 C   1 
ATOM 9622  O O   . ASN D 1 215 ? 53.257  36.678  195.286 1.00 46.38  ? 215 ASN 4 O   1 
ATOM 9623  C CB  . ASN D 1 215 ? 54.645  36.468  197.765 1.00 18.98  ? 215 ASN 4 CB  1 
ATOM 9624  C CG  . ASN D 1 215 ? 55.664  36.383  198.844 1.00 32.58  ? 215 ASN 4 CG  1 
ATOM 9625  O OD1 . ASN D 1 215 ? 56.647  35.631  198.721 1.00 48.12  ? 215 ASN 4 OD1 1 
ATOM 9626  N ND2 . ASN D 1 215 ? 55.482  37.187  199.903 1.00 19.79  ? 215 ASN 4 ND2 1 
ATOM 9627  N N   . GLU D 1 216 ? 55.174  37.294  194.277 1.00 37.36  ? 216 GLU 4 N   1 
ATOM 9628  C CA  . GLU D 1 216 ? 54.572  37.222  192.980 1.00 31.53  ? 216 GLU 4 CA  1 
ATOM 9629  C C   . GLU D 1 216 ? 54.470  35.788  192.445 1.00 16.62  ? 216 GLU 4 C   1 
ATOM 9630  O O   . GLU D 1 216 ? 53.526  35.472  191.745 1.00 28.42  ? 216 GLU 4 O   1 
ATOM 9631  C CB  . GLU D 1 216 ? 55.164  38.328  192.015 1.00 26.28  ? 216 GLU 4 CB  1 
ATOM 9632  C CG  . GLU D 1 216 ? 54.249  39.677  191.722 1.00 34.70  ? 216 GLU 4 CG  1 
ATOM 9633  C CD  . GLU D 1 216 ? 54.496  40.956  192.661 1.00 67.71  ? 216 GLU 4 CD  1 
ATOM 9634  O OE1 . GLU D 1 216 ? 55.666  41.179  193.037 1.00 76.36  ? 216 GLU 4 OE1 1 
ATOM 9635  O OE2 . GLU D 1 216 ? 53.562  41.780  192.954 1.00 47.34  ? 216 GLU 4 OE2 1 
ATOM 9636  N N   . ASN D 1 217 ? 55.307  34.861  192.898 1.00 28.53  ? 217 ASN 4 N   1 
ATOM 9637  C CA  . ASN D 1 217 ? 55.173  33.484  192.363 1.00 17.02  ? 217 ASN 4 CA  1 
ATOM 9638  C C   . ASN D 1 217 ? 54.808  32.450  193.422 1.00 21.55  ? 217 ASN 4 C   1 
ATOM 9639  O O   . ASN D 1 217 ? 55.050  31.254  193.272 1.00 32.69  ? 217 ASN 4 O   1 
ATOM 9640  C CB  . ASN D 1 217 ? 56.425  33.058  191.575 1.00 20.40  ? 217 ASN 4 CB  1 
ATOM 9641  C CG  . ASN D 1 217 ? 56.218  31.792  190.730 1.00 35.25  ? 217 ASN 4 CG  1 
ATOM 9642  O OD1 . ASN D 1 217 ? 55.178  31.598  190.067 1.00 61.94  ? 217 ASN 4 OD1 1 
ATOM 9643  N ND2 . ASN D 1 217 ? 57.227  30.932  190.734 1.00 16.95  ? 217 ASN 4 ND2 1 
ATOM 9644  N N   . THR D 1 218 ? 54.181  32.904  194.489 1.00 17.47  ? 218 THR 4 N   1 
ATOM 9645  C CA  . THR D 1 218 ? 53.763  31.987  195.518 1.00 17.14  ? 218 THR 4 CA  1 
ATOM 9646  C C   . THR D 1 218 ? 52.370  32.441  196.002 1.00 16.53  ? 218 THR 4 C   1 
ATOM 9647  O O   . THR D 1 218 ? 51.975  33.565  195.728 1.00 25.07  ? 218 THR 4 O   1 
ATOM 9648  C CB  . THR D 1 218 ? 54.830  31.930  196.640 1.00 24.23  ? 218 THR 4 CB  1 
ATOM 9649  O OG1 . THR D 1 218 ? 54.204  32.211  197.901 1.00 27.99  ? 218 THR 4 OG1 1 
ATOM 9650  C CG2 . THR D 1 218 ? 56.021  32.942  196.359 1.00 29.48  ? 218 THR 4 CG2 1 
ATOM 9651  N N   . ARG D 1 219 ? 51.573  31.554  196.588 1.00 17.63  ? 219 ARG 4 N   1 
ATOM 9652  C CA  . ARG D 1 219 ? 50.257  31.953  197.089 1.00 12.65  ? 219 ARG 4 CA  1 
ATOM 9653  C C   . ARG D 1 219 ? 50.278  31.698  198.559 1.00 18.47  ? 219 ARG 4 C   1 
ATOM 9654  O O   . ARG D 1 219 ? 50.809  30.685  199.015 1.00 28.92  ? 219 ARG 4 O   1 
ATOM 9655  C CB  . ARG D 1 219 ? 49.156  31.105  196.508 1.00 2.00   ? 219 ARG 4 CB  1 
ATOM 9656  C CG  . ARG D 1 219 ? 49.170  30.978  195.025 1.00 17.61  ? 219 ARG 4 CG  1 
ATOM 9657  C CD  . ARG D 1 219 ? 49.091  32.294  194.247 1.00 14.70  ? 219 ARG 4 CD  1 
ATOM 9658  N NE  . ARG D 1 219 ? 49.038  31.957  192.821 1.00 41.02  ? 219 ARG 4 NE  1 
ATOM 9659  C CZ  . ARG D 1 219 ? 49.853  32.454  191.888 1.00 48.40  ? 219 ARG 4 CZ  1 
ATOM 9660  N NH1 . ARG D 1 219 ? 50.772  33.354  192.254 1.00 45.09  ? 219 ARG 4 NH1 1 
ATOM 9661  N NH2 . ARG D 1 219 ? 49.826  31.970  190.626 1.00 31.70  ? 219 ARG 4 NH2 1 
ATOM 9662  N N   . TYR D 1 220 ? 49.712  32.606  199.318 1.00 7.93   ? 220 TYR 4 N   1 
ATOM 9663  C CA  . TYR D 1 220 ? 49.713  32.399  200.740 1.00 10.78  ? 220 TYR 4 CA  1 
ATOM 9664  C C   . TYR D 1 220 ? 48.382  32.688  201.325 1.00 15.22  ? 220 TYR 4 C   1 
ATOM 9665  O O   . TYR D 1 220 ? 47.535  33.364  200.738 1.00 23.24  ? 220 TYR 4 O   1 
ATOM 9666  C CB  . TYR D 1 220 ? 50.758  33.235  201.448 1.00 5.39   ? 220 TYR 4 CB  1 
ATOM 9667  C CG  . TYR D 1 220 ? 50.489  34.727  201.440 1.00 12.39  ? 220 TYR 4 CG  1 
ATOM 9668  C CD1 . TYR D 1 220 ? 49.740  35.340  202.438 1.00 23.63  ? 220 TYR 4 CD1 1 
ATOM 9669  C CD2 . TYR D 1 220 ? 51.027  35.531  200.450 1.00 12.70  ? 220 TYR 4 CD2 1 
ATOM 9670  C CE1 . TYR D 1 220 ? 49.542  36.724  202.434 1.00 36.82  ? 220 TYR 4 CE1 1 
ATOM 9671  C CE2 . TYR D 1 220 ? 50.840  36.904  200.440 1.00 14.76  ? 220 TYR 4 CE2 1 
ATOM 9672  C CZ  . TYR D 1 220 ? 50.104  37.493  201.428 1.00 31.97  ? 220 TYR 4 CZ  1 
ATOM 9673  O OH  . TYR D 1 220 ? 49.950  38.850  201.384 1.00 36.33  ? 220 TYR 4 OH  1 
ATOM 9674  N N   . PHE D 1 221 ? 48.227  32.189  202.532 1.00 15.65  ? 221 PHE 4 N   1 
ATOM 9675  C CA  . PHE D 1 221 ? 46.992  32.303  203.235 1.00 4.80   ? 221 PHE 4 CA  1 
ATOM 9676  C C   . PHE D 1 221 ? 47.285  32.125  204.707 1.00 20.76  ? 221 PHE 4 C   1 
ATOM 9677  O O   . PHE D 1 221 ? 48.103  31.269  205.096 1.00 27.48  ? 221 PHE 4 O   1 
ATOM 9678  C CB  . PHE D 1 221 ? 46.121  31.140  202.834 1.00 3.22   ? 221 PHE 4 CB  1 
ATOM 9679  C CG  . PHE D 1 221 ? 46.110  30.841  201.361 1.00 14.83  ? 221 PHE 4 CG  1 
ATOM 9680  C CD1 . PHE D 1 221 ? 47.126  30.109  200.775 1.00 22.13  ? 221 PHE 4 CD1 1 
ATOM 9681  C CD2 . PHE D 1 221 ? 45.044  31.242  200.573 1.00 12.86  ? 221 PHE 4 CD2 1 
ATOM 9682  C CE1 . PHE D 1 221 ? 47.065  29.779  199.442 1.00 23.96  ? 221 PHE 4 CE1 1 
ATOM 9683  C CE2 . PHE D 1 221 ? 44.978  30.911  199.230 1.00 11.36  ? 221 PHE 4 CE2 1 
ATOM 9684  C CZ  . PHE D 1 221 ? 45.981  30.180  198.666 1.00 15.23  ? 221 PHE 4 CZ  1 
ATOM 9685  N N   . GLY D 1 222 ? 46.591  32.910  205.518 1.00 22.79  ? 222 GLY 4 N   1 
ATOM 9686  C CA  . GLY D 1 222 ? 46.733  32.831  206.954 1.00 25.67  ? 222 GLY 4 CA  1 
ATOM 9687  C C   . GLY D 1 222 ? 45.664  33.689  207.614 1.00 31.76  ? 222 GLY 4 C   1 
ATOM 9688  O O   . GLY D 1 222 ? 45.050  34.544  206.939 1.00 28.58  ? 222 GLY 4 O   1 
ATOM 9689  N N   . THR D 1 223 ? 45.395  33.421  208.899 1.00 18.11  ? 223 THR 4 N   1 
ATOM 9690  C CA  . THR D 1 223 ? 44.419  34.180  209.660 1.00 19.95  ? 223 THR 4 CA  1 
ATOM 9691  C C   . THR D 1 223 ? 44.760  34.349  211.149 1.00 27.74  ? 223 THR 4 C   1 
ATOM 9692  O O   . THR D 1 223 ? 44.751  33.391  211.936 1.00 30.09  ? 223 THR 4 O   1 
ATOM 9693  C CB  . THR D 1 223 ? 43.033  33.571  209.551 1.00 13.99  ? 223 THR 4 CB  1 
ATOM 9694  O OG1 . THR D 1 223 ? 42.878  32.565  210.554 1.00 69.92  ? 223 THR 4 OG1 1 
ATOM 9695  C CG2 . THR D 1 223 ? 42.840  32.925  208.210 1.00 24.46  ? 223 THR 4 CG2 1 
ATOM 9696  N N   . TYR D 1 224 ? 45.048  35.576  211.543 1.00 21.55  ? 224 TYR 4 N   1 
ATOM 9697  C CA  . TYR D 1 224 ? 45.361  35.805  212.922 1.00 25.83  ? 224 TYR 4 CA  1 
ATOM 9698  C C   . TYR D 1 224 ? 44.059  35.913  213.633 1.00 27.86  ? 224 TYR 4 C   1 
ATOM 9699  O O   . TYR D 1 224 ? 43.109  36.520  213.142 1.00 32.54  ? 224 TYR 4 O   1 
ATOM 9700  C CB  . TYR D 1 224 ? 46.111  37.103  213.121 1.00 27.81  ? 224 TYR 4 CB  1 
ATOM 9701  C CG  . TYR D 1 224 ? 46.330  37.384  214.570 1.00 21.49  ? 224 TYR 4 CG  1 
ATOM 9702  C CD1 . TYR D 1 224 ? 47.000  36.487  215.363 1.00 26.93  ? 224 TYR 4 CD1 1 
ATOM 9703  C CD2 . TYR D 1 224 ? 45.870  38.538  215.139 1.00 29.99  ? 224 TYR 4 CD2 1 
ATOM 9704  C CE1 . TYR D 1 224 ? 47.207  36.731  216.693 1.00 41.79  ? 224 TYR 4 CE1 1 
ATOM 9705  C CE2 . TYR D 1 224 ? 46.074  38.804  216.468 1.00 47.54  ? 224 TYR 4 CE2 1 
ATOM 9706  C CZ  . TYR D 1 224 ? 46.750  37.901  217.257 1.00 50.63  ? 224 TYR 4 CZ  1 
ATOM 9707  O OH  . TYR D 1 224 ? 46.981  38.173  218.606 1.00 48.54  ? 224 TYR 4 OH  1 
ATOM 9708  N N   . THR D 1 225 ? 44.039  35.399  214.835 1.00 23.44  ? 225 THR 4 N   1 
ATOM 9709  C CA  . THR D 1 225 ? 42.826  35.479  215.578 1.00 25.97  ? 225 THR 4 CA  1 
ATOM 9710  C C   . THR D 1 225 ? 43.205  35.736  216.990 1.00 27.48  ? 225 THR 4 C   1 
ATOM 9711  O O   . THR D 1 225 ? 43.276  34.827  217.786 1.00 21.22  ? 225 THR 4 O   1 
ATOM 9712  C CB  . THR D 1 225 ? 42.148  34.200  215.497 1.00 31.27  ? 225 THR 4 CB  1 
ATOM 9713  O OG1 . THR D 1 225 ? 42.140  33.787  214.125 1.00 49.82  ? 225 THR 4 OG1 1 
ATOM 9714  C CG2 . THR D 1 225 ? 40.782  34.332  216.039 1.00 18.30  ? 225 THR 4 CG2 1 
ATOM 9715  N N   . GLY D 1 226 ? 43.591  36.964  217.266 1.00 40.47  ? 226 GLY 4 N   1 
ATOM 9716  C CA  . GLY D 1 226 ? 43.975  37.300  218.619 1.00 48.45  ? 226 GLY 4 CA  1 
ATOM 9717  C C   . GLY D 1 226 ? 42.850  37.086  219.605 1.00 45.50  ? 226 GLY 4 C   1 
ATOM 9718  O O   . GLY D 1 226 ? 41.684  37.231  219.248 1.00 47.98  ? 226 GLY 4 O   1 
ATOM 9719  N N   . GLY D 1 227 ? 43.211  36.736  220.838 1.00 44.90  ? 227 GLY 4 N   1 
ATOM 9720  C CA  . GLY D 1 227 ? 42.233  36.498  221.884 1.00 38.94  ? 227 GLY 4 CA  1 
ATOM 9721  C C   . GLY D 1 227 ? 42.832  35.779  223.085 1.00 49.11  ? 227 GLY 4 C   1 
ATOM 9722  O O   . GLY D 1 227 ? 43.623  34.843  222.959 1.00 54.20  ? 227 GLY 4 O   1 
ATOM 9723  N N   . GLU D 1 228 ? 42.448  36.222  224.270 1.00 53.42  ? 228 GLU 4 N   1 
ATOM 9724  C CA  . GLU D 1 228 ? 42.937  35.641  225.506 1.00 51.61  ? 228 GLU 4 CA  1 
ATOM 9725  C C   . GLU D 1 228 ? 42.386  34.214  225.643 1.00 48.59  ? 228 GLU 4 C   1 
ATOM 9726  O O   . GLU D 1 228 ? 43.082  33.302  226.105 1.00 52.91  ? 228 GLU 4 O   1 
ATOM 9727  C CB  . GLU D 1 228 ? 42.469  36.533  226.638 1.00 44.01  ? 228 GLU 4 CB  1 
ATOM 9728  C CG  . GLU D 1 228 ? 43.078  36.303  227.963 1.00 83.99  ? 228 GLU 4 CG  1 
ATOM 9729  C CD  . GLU D 1 228 ? 42.408  37.165  229.026 1.00 112.05 ? 228 GLU 4 CD  1 
ATOM 9730  O OE1 . GLU D 1 228 ? 41.755  38.182  228.670 1.00 118.84 ? 228 GLU 4 OE1 1 
ATOM 9731  O OE2 . GLU D 1 228 ? 42.528  36.826  230.223 1.00 140.69 ? 228 GLU 4 OE2 1 
ATOM 9732  N N   . ASN D 1 229 ? 41.153  34.016  225.179 1.00 43.82  ? 229 ASN 4 N   1 
ATOM 9733  C CA  . ASN D 1 229 ? 40.515  32.707  225.252 1.00 54.22  ? 229 ASN 4 CA  1 
ATOM 9734  C C   . ASN D 1 229 ? 39.775  32.331  223.974 1.00 56.16  ? 229 ASN 4 C   1 
ATOM 9735  O O   . ASN D 1 229 ? 38.664  31.771  223.995 1.00 46.42  ? 229 ASN 4 O   1 
ATOM 9736  C CB  . ASN D 1 229 ? 39.549  32.608  226.429 1.00 66.07  ? 229 ASN 4 CB  1 
ATOM 9737  C CG  . ASN D 1 229 ? 39.673  33.746  227.364 1.00 88.17  ? 229 ASN 4 CG  1 
ATOM 9738  O OD1 . ASN D 1 229 ? 40.147  33.585  228.493 1.00 103.97 ? 229 ASN 4 OD1 1 
ATOM 9739  N ND2 . ASN D 1 229 ? 39.266  34.936  226.903 1.00 109.43 ? 229 ASN 4 ND2 1 
ATOM 9740  N N   . VAL D 1 230 ? 40.394  32.622  222.844 1.00 54.26  ? 230 VAL 4 N   1 
ATOM 9741  C CA  . VAL D 1 230 ? 39.757  32.269  221.597 1.00 45.08  ? 230 VAL 4 CA  1 
ATOM 9742  C C   . VAL D 1 230 ? 39.856  30.783  221.381 1.00 39.77  ? 230 VAL 4 C   1 
ATOM 9743  O O   . VAL D 1 230 ? 40.940  30.197  221.347 1.00 51.57  ? 230 VAL 4 O   1 
ATOM 9744  C CB  . VAL D 1 230 ? 40.361  32.977  220.387 1.00 40.43  ? 230 VAL 4 CB  1 
ATOM 9745  C CG1 . VAL D 1 230 ? 39.731  34.300  220.188 1.00 49.93  ? 230 VAL 4 CG1 1 
ATOM 9746  C CG2 . VAL D 1 230 ? 41.818  33.146  220.563 1.00 51.71  ? 230 VAL 4 CG2 1 
ATOM 9747  N N   . PRO D 1 231 ? 38.714  30.142  221.254 1.00 32.93  ? 231 PRO 4 N   1 
ATOM 9748  C CA  . PRO D 1 231 ? 38.603  28.707  221.028 1.00 31.15  ? 231 PRO 4 CA  1 
ATOM 9749  C C   . PRO D 1 231 ? 39.052  28.451  219.624 1.00 30.64  ? 231 PRO 4 C   1 
ATOM 9750  O O   . PRO D 1 231 ? 38.729  29.195  218.693 1.00 33.20  ? 231 PRO 4 O   1 
ATOM 9751  C CB  . PRO D 1 231 ? 37.121  28.475  221.124 1.00 28.30  ? 231 PRO 4 CB  1 
ATOM 9752  C CG  . PRO D 1 231 ? 36.592  29.715  220.535 1.00 32.43  ? 231 PRO 4 CG  1 
ATOM 9753  C CD  . PRO D 1 231 ? 37.400  30.778  221.213 1.00 29.97  ? 231 PRO 4 CD  1 
ATOM 9754  N N   . PRO D 1 232 ? 39.914  27.479  219.461 1.00 30.27  ? 232 PRO 4 N   1 
ATOM 9755  C CA  . PRO D 1 232 ? 40.345  27.225  218.102 1.00 38.97  ? 232 PRO 4 CA  1 
ATOM 9756  C C   . PRO D 1 232 ? 39.248  26.410  217.435 1.00 37.36  ? 232 PRO 4 C   1 
ATOM 9757  O O   . PRO D 1 232 ? 38.289  25.926  218.074 1.00 23.59  ? 232 PRO 4 O   1 
ATOM 9758  C CB  . PRO D 1 232 ? 41.612  26.421  218.325 1.00 36.94  ? 232 PRO 4 CB  1 
ATOM 9759  C CG  . PRO D 1 232 ? 41.218  25.595  219.518 1.00 19.29  ? 232 PRO 4 CG  1 
ATOM 9760  C CD  . PRO D 1 232 ? 40.643  26.649  220.418 1.00 29.66  ? 232 PRO 4 CD  1 
ATOM 9761  N N   . VAL D 1 233 ? 39.351  26.311  216.130 1.00 34.37  ? 233 VAL 4 N   1 
ATOM 9762  C CA  . VAL D 1 233 ? 38.365  25.549  215.406 1.00 27.57  ? 233 VAL 4 CA  1 
ATOM 9763  C C   . VAL D 1 233 ? 39.154  25.065  214.252 1.00 21.22  ? 233 VAL 4 C   1 
ATOM 9764  O O   . VAL D 1 233 ? 39.874  25.855  213.639 1.00 23.29  ? 233 VAL 4 O   1 
ATOM 9765  C CB  . VAL D 1 233 ? 37.289  26.432  214.830 1.00 11.51  ? 233 VAL 4 CB  1 
ATOM 9766  C CG1 . VAL D 1 233 ? 36.004  25.765  214.947 1.00 34.32  ? 233 VAL 4 CG1 1 
ATOM 9767  C CG2 . VAL D 1 233 ? 37.270  27.776  215.503 1.00 39.64  ? 233 VAL 4 CG2 1 
ATOM 9768  N N   . LEU D 1 234 ? 39.002  23.796  213.921 1.00 14.36  ? 234 LEU 4 N   1 
ATOM 9769  C CA  . LEU D 1 234 ? 39.769  23.231  212.833 1.00 4.42   ? 234 LEU 4 CA  1 
ATOM 9770  C C   . LEU D 1 234 ? 38.972  22.150  212.173 1.00 11.12  ? 234 LEU 4 C   1 
ATOM 9771  O O   . LEU D 1 234 ? 38.190  21.472  212.841 1.00 15.48  ? 234 LEU 4 O   1 
ATOM 9772  C CB  . LEU D 1 234 ? 41.013  22.583  213.410 1.00 11.37  ? 234 LEU 4 CB  1 
ATOM 9773  C CG  . LEU D 1 234 ? 41.905  23.490  214.245 1.00 14.19  ? 234 LEU 4 CG  1 
ATOM 9774  C CD1 . LEU D 1 234 ? 42.882  22.687  215.050 1.00 47.33  ? 234 LEU 4 CD1 1 
ATOM 9775  C CD2 . LEU D 1 234 ? 42.620  24.394  213.335 1.00 28.18  ? 234 LEU 4 CD2 1 
ATOM 9776  N N   . HIS D 1 235 ? 39.138  22.001  210.861 1.00 15.04  ? 235 HIS 4 N   1 
ATOM 9777  C CA  . HIS D 1 235 ? 38.442  20.932  210.157 1.00 31.68  ? 235 HIS 4 CA  1 
ATOM 9778  C C   . HIS D 1 235 ? 39.419  20.035  209.502 1.00 32.24  ? 235 HIS 4 C   1 
ATOM 9779  O O   . HIS D 1 235 ? 40.491  20.431  209.034 1.00 51.79  ? 235 HIS 4 O   1 
ATOM 9780  C CB  . HIS D 1 235 ? 37.504  21.434  209.088 1.00 51.53  ? 235 HIS 4 CB  1 
ATOM 9781  C CG  . HIS D 1 235 ? 36.702  22.608  209.514 1.00 86.76  ? 235 HIS 4 CG  1 
ATOM 9782  N ND1 . HIS D 1 235 ? 37.217  23.891  209.535 1.00 108.88 ? 235 HIS 4 ND1 1 
ATOM 9783  C CD2 . HIS D 1 235 ? 35.423  22.715  209.947 1.00 93.79  ? 235 HIS 4 CD2 1 
ATOM 9784  C CE1 . HIS D 1 235 ? 36.290  24.727  209.955 1.00 112.26 ? 235 HIS 4 CE1 1 
ATOM 9785  N NE2 . HIS D 1 235 ? 35.190  24.040  210.214 1.00 91.04  ? 235 HIS 4 NE2 1 
ATOM 9786  N N   . ILE D 1 236 ? 38.969  18.837  209.327 1.00 20.41  ? 236 ILE 4 N   1 
ATOM 9787  C CA  . ILE D 1 236 ? 39.814  17.888  208.749 1.00 18.55  ? 236 ILE 4 CA  1 
ATOM 9788  C C   . ILE D 1 236 ? 38.869  17.294  207.714 1.00 24.74  ? 236 ILE 4 C   1 
ATOM 9789  O O   . ILE D 1 236 ? 37.670  17.080  207.986 1.00 10.40  ? 236 ILE 4 O   1 
ATOM 9790  C CB  . ILE D 1 236 ? 40.296  16.950  209.906 1.00 29.69  ? 236 ILE 4 CB  1 
ATOM 9791  C CG1 . ILE D 1 236 ? 41.403  16.017  209.431 1.00 67.09  ? 236 ILE 4 CG1 1 
ATOM 9792  C CG2 . ILE D 1 236 ? 39.140  16.138  210.523 1.00 2.00   ? 236 ILE 4 CG2 1 
ATOM 9793  C CD1 . ILE D 1 236 ? 42.572  15.783  210.457 1.00 92.16  ? 236 ILE 4 CD1 1 
ATOM 9794  N N   . THR D 1 237 ? 39.328  17.304  206.473 1.00 21.33  ? 237 THR 4 N   1 
ATOM 9795  C CA  . THR D 1 237 ? 38.573  16.715  205.386 1.00 13.76  ? 237 THR 4 CA  1 
ATOM 9796  C C   . THR D 1 237 ? 39.431  16.493  204.219 1.00 26.33  ? 237 THR 4 C   1 
ATOM 9797  O O   . THR D 1 237 ? 40.069  17.411  203.710 1.00 39.12  ? 237 THR 4 O   1 
ATOM 9798  C CB  . THR D 1 237 ? 37.572  17.578  204.821 1.00 15.46  ? 237 THR 4 CB  1 
ATOM 9799  O OG1 . THR D 1 237 ? 36.826  18.160  205.884 1.00 73.09  ? 237 THR 4 OG1 1 
ATOM 9800  C CG2 . THR D 1 237 ? 36.685  16.743  203.960 1.00 3.85   ? 237 THR 4 CG2 1 
ATOM 9801  N N   . ASN D 1 238 ? 39.260  15.327  203.647 1.00 20.02  ? 238 ASN 4 N   1 
ATOM 9802  C CA  . ASN D 1 238 ? 40.053  15.005  202.503 1.00 29.45  ? 238 ASN 4 CA  1 
ATOM 9803  C C   . ASN D 1 238 ? 39.239  15.322  201.280 1.00 25.99  ? 238 ASN 4 C   1 
ATOM 9804  O O   . ASN D 1 238 ? 39.457  14.735  200.225 1.00 35.99  ? 238 ASN 4 O   1 
ATOM 9805  C CB  . ASN D 1 238 ? 40.411  13.524  202.534 1.00 39.86  ? 238 ASN 4 CB  1 
ATOM 9806  C CG  . ASN D 1 238 ? 39.195  12.643  202.493 1.00 43.16  ? 238 ASN 4 CG  1 
ATOM 9807  O OD1 . ASN D 1 238 ? 38.199  12.888  203.191 1.00 58.34  ? 238 ASN 4 OD1 1 
ATOM 9808  N ND2 . ASN D 1 238 ? 39.250  11.625  201.661 1.00 53.40  ? 238 ASN 4 ND2 1 
ATOM 9809  N N   . THR D 1 239 ? 38.300  16.248  201.384 1.00 27.04  ? 239 THR 4 N   1 
ATOM 9810  C CA  . THR D 1 239 ? 37.492  16.526  200.203 1.00 33.48  ? 239 THR 4 CA  1 
ATOM 9811  C C   . THR D 1 239 ? 37.676  17.889  199.592 1.00 28.48  ? 239 THR 4 C   1 
ATOM 9812  O O   . THR D 1 239 ? 37.214  18.147  198.482 1.00 40.64  ? 239 THR 4 O   1 
ATOM 9813  C CB  . THR D 1 239 ? 36.025  16.303  200.477 1.00 22.17  ? 239 THR 4 CB  1 
ATOM 9814  O OG1 . THR D 1 239 ? 35.642  17.091  201.594 1.00 32.41  ? 239 THR 4 OG1 1 
ATOM 9815  C CG2 . THR D 1 239 ? 35.777  14.853  200.797 1.00 47.32  ? 239 THR 4 CG2 1 
ATOM 9816  N N   . ALA D 1 240 ? 38.473  18.719  200.242 1.00 26.43  ? 240 ALA 4 N   1 
ATOM 9817  C CA  . ALA D 1 240 ? 38.666  20.056  199.738 1.00 19.31  ? 240 ALA 4 CA  1 
ATOM 9818  C C   . ALA D 1 240 ? 40.004  20.408  199.145 1.00 37.70  ? 240 ALA 4 C   1 
ATOM 9819  O O   . ALA D 1 240 ? 41.058  20.213  199.775 1.00 54.14  ? 240 ALA 4 O   1 
ATOM 9820  C CB  . ALA D 1 240 ? 38.331  21.021  200.783 1.00 35.47  ? 240 ALA 4 CB  1 
ATOM 9821  N N   . THR D 1 241 ? 39.914  21.114  198.024 1.00 32.54  ? 241 THR 4 N   1 
ATOM 9822  C CA  . THR D 1 241 ? 41.067  21.547  197.270 1.00 29.93  ? 241 THR 4 CA  1 
ATOM 9823  C C   . THR D 1 241 ? 41.179  23.044  197.127 1.00 25.71  ? 241 THR 4 C   1 
ATOM 9824  O O   . THR D 1 241 ? 40.180  23.747  197.060 1.00 60.00  ? 241 THR 4 O   1 
ATOM 9825  C CB  . THR D 1 241 ? 40.933  21.050  195.889 1.00 24.39  ? 241 THR 4 CB  1 
ATOM 9826  O OG1 . THR D 1 241 ? 40.385  19.728  195.933 1.00 43.24  ? 241 THR 4 OG1 1 
ATOM 9827  C CG2 . THR D 1 241 ? 42.267  21.076  195.207 1.00 42.30  ? 241 THR 4 CG2 1 
ATOM 9828  N N   . THR D 1 242 ? 42.398  23.510  196.943 1.00 28.97  ? 242 THR 4 N   1 
ATOM 9829  C CA  . THR D 1 242 ? 42.653  24.915  196.758 1.00 18.08  ? 242 THR 4 CA  1 
ATOM 9830  C C   . THR D 1 242 ? 43.359  25.137  195.463 1.00 32.02  ? 242 THR 4 C   1 
ATOM 9831  O O   . THR D 1 242 ? 44.369  24.447  195.146 1.00 40.78  ? 242 THR 4 O   1 
ATOM 9832  C CB  . THR D 1 242 ? 43.567  25.441  197.811 1.00 9.27   ? 242 THR 4 CB  1 
ATOM 9833  O OG1 . THR D 1 242 ? 42.869  25.515  199.056 1.00 31.09  ? 242 THR 4 OG1 1 
ATOM 9834  C CG2 . THR D 1 242 ? 44.060  26.803  197.422 1.00 21.72  ? 242 THR 4 CG2 1 
ATOM 9835  N N   . VAL D 1 243 ? 42.896  26.155  194.747 1.00 16.49  ? 243 VAL 4 N   1 
ATOM 9836  C CA  . VAL D 1 243 ? 43.547  26.440  193.492 1.00 21.01  ? 243 VAL 4 CA  1 
ATOM 9837  C C   . VAL D 1 243 ? 44.681  27.442  193.607 1.00 22.58  ? 243 VAL 4 C   1 
ATOM 9838  O O   . VAL D 1 243 ? 44.578  28.431  194.305 1.00 39.87  ? 243 VAL 4 O   1 
ATOM 9839  C CB  . VAL D 1 243 ? 42.582  26.895  192.476 1.00 9.47   ? 243 VAL 4 CB  1 
ATOM 9840  C CG1 . VAL D 1 243 ? 43.300  27.109  191.169 1.00 26.40  ? 243 VAL 4 CG1 1 
ATOM 9841  C CG2 . VAL D 1 243 ? 41.525  25.870  192.318 1.00 6.29   ? 243 VAL 4 CG2 1 
ATOM 9842  N N   . LEU D 1 244 ? 45.737  27.206  192.858 1.00 15.33  ? 244 LEU 4 N   1 
ATOM 9843  C CA  . LEU D 1 244 ? 46.889  28.063  192.907 1.00 17.27  ? 244 LEU 4 CA  1 
ATOM 9844  C C   . LEU D 1 244 ? 46.979  28.924  191.669 1.00 28.01  ? 244 LEU 4 C   1 
ATOM 9845  O O   . LEU D 1 244 ? 47.839  29.804  191.574 1.00 32.92  ? 244 LEU 4 O   1 
ATOM 9846  C CB  . LEU D 1 244 ? 48.104  27.162  193.000 1.00 16.51  ? 244 LEU 4 CB  1 
ATOM 9847  C CG  . LEU D 1 244 ? 47.895  26.362  194.266 1.00 18.05  ? 244 LEU 4 CG  1 
ATOM 9848  C CD1 . LEU D 1 244 ? 48.925  25.274  194.417 1.00 14.44  ? 244 LEU 4 CD1 1 
ATOM 9849  C CD2 . LEU D 1 244 ? 47.947  27.370  195.392 1.00 2.00   ? 244 LEU 4 CD2 1 
ATOM 9850  N N   . LEU D 1 245 ? 46.118  28.650  190.699 1.00 16.12  ? 245 LEU 4 N   1 
ATOM 9851  C CA  . LEU D 1 245 ? 46.155  29.387  189.448 1.00 13.06  ? 245 LEU 4 CA  1 
ATOM 9852  C C   . LEU D 1 245 ? 45.928  30.850  189.640 1.00 18.05  ? 245 LEU 4 C   1 
ATOM 9853  O O   . LEU D 1 245 ? 45.059  31.255  190.402 1.00 12.77  ? 245 LEU 4 O   1 
ATOM 9854  C CB  . LEU D 1 245 ? 45.131  28.857  188.489 1.00 8.67   ? 245 LEU 4 CB  1 
ATOM 9855  C CG  . LEU D 1 245 ? 45.304  27.413  188.091 1.00 17.27  ? 245 LEU 4 CG  1 
ATOM 9856  C CD1 . LEU D 1 245 ? 45.103  27.408  186.602 1.00 48.63  ? 245 LEU 4 CD1 1 
ATOM 9857  C CD2 . LEU D 1 245 ? 46.708  26.906  188.418 1.00 48.20  ? 245 LEU 4 CD2 1 
ATOM 9858  N N   . ASP D 1 246 ? 46.712  31.645  188.928 1.00 31.22  ? 246 ASP 4 N   1 
ATOM 9859  C CA  . ASP D 1 246 ? 46.614  33.083  189.051 1.00 20.28  ? 246 ASP 4 CA  1 
ATOM 9860  C C   . ASP D 1 246 ? 45.522  33.554  188.161 1.00 17.21  ? 246 ASP 4 C   1 
ATOM 9861  O O   . ASP D 1 246 ? 44.774  32.764  187.608 1.00 16.35  ? 246 ASP 4 O   1 
ATOM 9862  C CB  . ASP D 1 246 ? 47.935  33.793  188.712 1.00 15.64  ? 246 ASP 4 CB  1 
ATOM 9863  C CG  . ASP D 1 246 ? 48.299  33.726  187.249 1.00 39.46  ? 246 ASP 4 CG  1 
ATOM 9864  O OD1 . ASP D 1 246 ? 47.584  33.076  186.437 1.00 27.65  ? 246 ASP 4 OD1 1 
ATOM 9865  O OD2 . ASP D 1 246 ? 49.337  34.339  186.923 1.00 51.24  ? 246 ASP 4 OD2 1 
ATOM 9866  N N   . GLU D 1 247 ? 45.488  34.856  187.971 1.00 29.85  ? 247 GLU 4 N   1 
ATOM 9867  C CA  . GLU D 1 247 ? 44.479  35.491  187.163 1.00 31.49  ? 247 GLU 4 CA  1 
ATOM 9868  C C   . GLU D 1 247 ? 44.522  34.931  185.744 1.00 33.87  ? 247 GLU 4 C   1 
ATOM 9869  O O   . GLU D 1 247 ? 43.482  34.778  185.115 1.00 43.28  ? 247 GLU 4 O   1 
ATOM 9870  C CB  . GLU D 1 247 ? 44.694  37.021  187.179 1.00 46.89  ? 247 GLU 4 CB  1 
ATOM 9871  C CG  . GLU D 1 247 ? 44.396  37.764  188.523 1.00 73.34  ? 247 GLU 4 CG  1 
ATOM 9872  C CD  . GLU D 1 247 ? 45.524  37.724  189.580 1.00 90.08  ? 247 GLU 4 CD  1 
ATOM 9873  O OE1 . GLU D 1 247 ? 46.584  38.354  189.343 1.00 90.76  ? 247 GLU 4 OE1 1 
ATOM 9874  O OE2 . GLU D 1 247 ? 45.324  37.121  190.678 1.00 99.46  ? 247 GLU 4 OE2 1 
ATOM 9875  N N   . GLN D 1 248 ? 45.704  34.564  185.254 1.00 24.00  ? 248 GLN 4 N   1 
ATOM 9876  C CA  . GLN D 1 248 ? 45.787  34.066  183.888 1.00 27.15  ? 248 GLN 4 CA  1 
ATOM 9877  C C   . GLN D 1 248 ? 45.733  32.586  183.873 1.00 33.09  ? 248 GLN 4 C   1 
ATOM 9878  O O   . GLN D 1 248 ? 46.027  31.951  182.856 1.00 46.47  ? 248 GLN 4 O   1 
ATOM 9879  C CB  . GLN D 1 248 ? 47.083  34.499  183.244 1.00 40.07  ? 248 GLN 4 CB  1 
ATOM 9880  C CG  . GLN D 1 248 ? 47.526  35.886  183.616 1.00 51.27  ? 248 GLN 4 CG  1 
ATOM 9881  C CD  . GLN D 1 248 ? 46.501  36.928  183.250 1.00 64.70  ? 248 GLN 4 CD  1 
ATOM 9882  O OE1 . GLN D 1 248 ? 45.876  36.870  182.178 1.00 76.59  ? 248 GLN 4 OE1 1 
ATOM 9883  N NE2 . GLN D 1 248 ? 46.305  37.891  184.148 1.00 87.91  ? 248 GLN 4 NE2 1 
ATOM 9884  N N   . GLY D 1 249 ? 45.458  32.028  185.037 1.00 28.31  ? 249 GLY 4 N   1 
ATOM 9885  C CA  . GLY D 1 249 ? 45.365  30.597  185.134 1.00 33.03  ? 249 GLY 4 CA  1 
ATOM 9886  C C   . GLY D 1 249 ? 46.713  29.942  185.153 1.00 29.59  ? 249 GLY 4 C   1 
ATOM 9887  O O   . GLY D 1 249 ? 46.967  29.002  184.383 1.00 36.56  ? 249 GLY 4 O   1 
ATOM 9888  N N   . VAL D 1 250 ? 47.597  30.455  185.995 1.00 9.09   ? 250 VAL 4 N   1 
ATOM 9889  C CA  . VAL D 1 250 ? 48.890  29.841  186.098 1.00 19.44  ? 250 VAL 4 CA  1 
ATOM 9890  C C   . VAL D 1 250 ? 49.229  29.786  187.544 1.00 11.45  ? 250 VAL 4 C   1 
ATOM 9891  O O   . VAL D 1 250 ? 48.981  30.708  188.294 1.00 20.39  ? 250 VAL 4 O   1 
ATOM 9892  C CB  . VAL D 1 250 ? 49.969  30.555  185.289 1.00 8.63   ? 250 VAL 4 CB  1 
ATOM 9893  C CG1 . VAL D 1 250 ? 49.348  31.278  184.170 1.00 2.00   ? 250 VAL 4 CG1 1 
ATOM 9894  C CG2 . VAL D 1 250 ? 50.822  31.451  186.158 1.00 38.63  ? 250 VAL 4 CG2 1 
ATOM 9895  N N   . GLY D 1 251 ? 49.755  28.669  187.969 1.00 15.23  ? 251 GLY 4 N   1 
ATOM 9896  C CA  . GLY D 1 251 ? 50.081  28.567  189.356 1.00 17.03  ? 251 GLY 4 CA  1 
ATOM 9897  C C   . GLY D 1 251 ? 51.518  28.948  189.418 1.00 15.91  ? 251 GLY 4 C   1 
ATOM 9898  O O   . GLY D 1 251 ? 52.152  29.372  188.436 1.00 10.61  ? 251 GLY 4 O   1 
ATOM 9899  N N   . PRO D 1 252 ? 52.050  28.828  190.611 1.00 12.21  ? 252 PRO 4 N   1 
ATOM 9900  C CA  . PRO D 1 252 ? 53.448  29.151  190.847 1.00 16.90  ? 252 PRO 4 CA  1 
ATOM 9901  C C   . PRO D 1 252 ? 54.236  28.276  189.901 1.00 21.50  ? 252 PRO 4 C   1 
ATOM 9902  O O   . PRO D 1 252 ? 53.830  27.133  189.631 1.00 8.42   ? 252 PRO 4 O   1 
ATOM 9903  C CB  . PRO D 1 252 ? 53.660  28.707  192.285 1.00 15.34  ? 252 PRO 4 CB  1 
ATOM 9904  C CG  . PRO D 1 252 ? 52.302  28.904  192.877 1.00 19.60  ? 252 PRO 4 CG  1 
ATOM 9905  C CD  . PRO D 1 252 ? 51.381  28.351  191.817 1.00 2.00   ? 252 PRO 4 CD  1 
ATOM 9906  N N   . LEU D 1 253 ? 55.268  28.866  189.307 1.00 22.09  ? 253 LEU 4 N   1 
ATOM 9907  C CA  . LEU D 1 253 ? 56.167  28.178  188.395 1.00 13.76  ? 253 LEU 4 CA  1 
ATOM 9908  C C   . LEU D 1 253 ? 57.425  27.897  189.136 1.00 26.57  ? 253 LEU 4 C   1 
ATOM 9909  O O   . LEU D 1 253 ? 58.021  28.789  189.719 1.00 18.37  ? 253 LEU 4 O   1 
ATOM 9910  C CB  . LEU D 1 253 ? 56.526  29.085  187.249 1.00 9.85   ? 253 LEU 4 CB  1 
ATOM 9911  C CG  . LEU D 1 253 ? 55.238  29.385  186.527 1.00 22.17  ? 253 LEU 4 CG  1 
ATOM 9912  C CD1 . LEU D 1 253 ? 55.506  30.147  185.288 1.00 14.03  ? 253 LEU 4 CD1 1 
ATOM 9913  C CD2 . LEU D 1 253 ? 54.607  28.073  186.180 1.00 22.44  ? 253 LEU 4 CD2 1 
ATOM 9914  N N   . CYS D 1 254 ? 57.775  26.639  189.246 1.00 36.34  ? 254 CYS 4 N   1 
ATOM 9915  C CA  . CYS D 1 254 ? 59.017  26.321  189.906 1.00 36.91  ? 254 CYS 4 CA  1 
ATOM 9916  C C   . CYS D 1 254 ? 60.118  26.601  188.916 1.00 34.77  ? 254 CYS 4 C   1 
ATOM 9917  O O   . CYS D 1 254 ? 60.476  25.715  188.092 1.00 31.70  ? 254 CYS 4 O   1 
ATOM 9918  C CB  . CYS D 1 254 ? 59.029  24.869  190.222 1.00 8.91   ? 254 CYS 4 CB  1 
ATOM 9919  S SG  . CYS D 1 254 ? 57.647  24.425  191.221 1.00 47.17  ? 254 CYS 4 SG  1 
ATOM 9920  N N   . LYS D 1 255 ? 60.590  27.846  188.986 1.00 31.91  ? 255 LYS 4 N   1 
ATOM 9921  C CA  . LYS D 1 255 ? 61.650  28.395  188.131 1.00 29.44  ? 255 LYS 4 CA  1 
ATOM 9922  C C   . LYS D 1 255 ? 62.893  27.548  188.251 1.00 41.59  ? 255 LYS 4 C   1 
ATOM 9923  O O   . LYS D 1 255 ? 63.456  27.141  187.248 1.00 38.03  ? 255 LYS 4 O   1 
ATOM 9924  C CB  . LYS D 1 255 ? 62.061  29.763  188.614 1.00 26.55  ? 255 LYS 4 CB  1 
ATOM 9925  C CG  . LYS D 1 255 ? 61.063  30.868  188.497 1.00 32.30  ? 255 LYS 4 CG  1 
ATOM 9926  C CD  . LYS D 1 255 ? 61.281  31.913  189.644 1.00 19.58  ? 255 LYS 4 CD  1 
ATOM 9927  C CE  . LYS D 1 255 ? 62.399  32.917  189.369 1.00 37.88  ? 255 LYS 4 CE  1 
ATOM 9928  N NZ  . LYS D 1 255 ? 62.482  34.083  190.332 1.00 33.40  ? 255 LYS 4 NZ  1 
ATOM 9929  N N   . ALA D 1 256 ? 63.476  27.565  189.451 1.00 54.16  ? 256 ALA 4 N   1 
ATOM 9930  C CA  . ALA D 1 256 ? 64.634  26.720  189.754 1.00 50.15  ? 256 ALA 4 CA  1 
ATOM 9931  C C   . ALA D 1 256 ? 63.748  25.564  190.056 1.00 58.11  ? 256 ALA 4 C   1 
ATOM 9932  O O   . ALA D 1 256 ? 62.647  25.764  190.623 1.00 73.46  ? 256 ALA 4 O   1 
ATOM 9933  C CB  . ALA D 1 256 ? 65.323  27.151  191.016 1.00 62.81  ? 256 ALA 4 CB  1 
ATOM 9934  N N   . ASP D 1 257 ? 64.181  24.363  189.739 1.00 34.31  ? 257 ASP 4 N   1 
ATOM 9935  C CA  . ASP D 1 257 ? 63.263  23.280  189.960 1.00 43.63  ? 257 ASP 4 CA  1 
ATOM 9936  C C   . ASP D 1 257 ? 63.115  22.880  191.407 1.00 39.20  ? 257 ASP 4 C   1 
ATOM 9937  O O   . ASP D 1 257 ? 63.600  21.872  191.896 1.00 56.20  ? 257 ASP 4 O   1 
ATOM 9938  C CB  . ASP D 1 257 ? 63.566  22.184  188.982 1.00 54.12  ? 257 ASP 4 CB  1 
ATOM 9939  C CG  . ASP D 1 257 ? 63.693  22.731  187.568 1.00 59.48  ? 257 ASP 4 CG  1 
ATOM 9940  O OD1 . ASP D 1 257 ? 62.655  23.149  186.961 1.00 66.75  ? 257 ASP 4 OD1 1 
ATOM 9941  O OD2 . ASP D 1 257 ? 64.853  22.796  187.104 1.00 45.66  ? 257 ASP 4 OD2 1 
ATOM 9942  N N   . SER D 1 258 ? 62.368  23.710  192.096 1.00 42.46  ? 258 SER 4 N   1 
ATOM 9943  C CA  . SER D 1 258 ? 62.171  23.554  193.499 1.00 45.05  ? 258 SER 4 CA  1 
ATOM 9944  C C   . SER D 1 258 ? 60.777  23.999  193.818 1.00 40.56  ? 258 SER 4 C   1 
ATOM 9945  O O   . SER D 1 258 ? 60.215  24.887  193.184 1.00 44.46  ? 258 SER 4 O   1 
ATOM 9946  C CB  . SER D 1 258 ? 63.184  24.419  194.232 1.00 44.59  ? 258 SER 4 CB  1 
ATOM 9947  O OG  . SER D 1 258 ? 64.499  24.153  193.751 1.00 59.75  ? 258 SER 4 OG  1 
ATOM 9948  N N   . LEU D 1 259 ? 60.249  23.389  194.850 1.00 32.26  ? 259 LEU 4 N   1 
ATOM 9949  C CA  . LEU D 1 259 ? 58.927  23.650  195.268 1.00 19.10  ? 259 LEU 4 CA  1 
ATOM 9950  C C   . LEU D 1 259 ? 59.063  24.074  196.691 1.00 25.47  ? 259 LEU 4 C   1 
ATOM 9951  O O   . LEU D 1 259 ? 59.785  23.438  197.465 1.00 24.60  ? 259 LEU 4 O   1 
ATOM 9952  C CB  . LEU D 1 259 ? 58.137  22.373  195.182 1.00 17.07  ? 259 LEU 4 CB  1 
ATOM 9953  C CG  . LEU D 1 259 ? 56.731  22.700  195.607 1.00 35.71  ? 259 LEU 4 CG  1 
ATOM 9954  C CD1 . LEU D 1 259 ? 56.345  24.078  195.074 1.00 34.64  ? 259 LEU 4 CD1 1 
ATOM 9955  C CD2 . LEU D 1 259 ? 55.786  21.653  195.096 1.00 27.93  ? 259 LEU 4 CD2 1 
ATOM 9956  N N   . TYR D 1 260 ? 58.405  25.168  197.038 1.00 18.15  ? 260 TYR 4 N   1 
ATOM 9957  C CA  . TYR D 1 260 ? 58.519  25.635  198.395 1.00 26.21  ? 260 TYR 4 CA  1 
ATOM 9958  C C   . TYR D 1 260 ? 57.199  25.650  199.139 1.00 29.16  ? 260 TYR 4 C   1 
ATOM 9959  O O   . TYR D 1 260 ? 56.156  26.140  198.692 1.00 35.23  ? 260 TYR 4 O   1 
ATOM 9960  C CB  . TYR D 1 260 ? 59.201  26.991  198.454 1.00 33.51  ? 260 TYR 4 CB  1 
ATOM 9961  C CG  . TYR D 1 260 ? 60.514  27.108  197.698 1.00 30.36  ? 260 TYR 4 CG  1 
ATOM 9962  C CD1 . TYR D 1 260 ? 60.556  27.086  196.297 1.00 35.06  ? 260 TYR 4 CD1 1 
ATOM 9963  C CD2 . TYR D 1 260 ? 61.701  27.339  198.381 1.00 24.91  ? 260 TYR 4 CD2 1 
ATOM 9964  C CE1 . TYR D 1 260 ? 61.762  27.299  195.609 1.00 54.73  ? 260 TYR 4 CE1 1 
ATOM 9965  C CE2 . TYR D 1 260 ? 62.907  27.551  197.707 1.00 37.12  ? 260 TYR 4 CE2 1 
ATOM 9966  C CZ  . TYR D 1 260 ? 62.938  27.536  196.334 1.00 49.04  ? 260 TYR 4 CZ  1 
ATOM 9967  O OH  . TYR D 1 260 ? 64.152  27.766  195.711 1.00 69.53  ? 260 TYR 4 OH  1 
ATOM 9968  N N   . VAL D 1 261 ? 57.308  25.168  200.346 1.00 23.64  ? 261 VAL 4 N   1 
ATOM 9969  C CA  . VAL D 1 261 ? 56.188  25.012  201.185 1.00 9.80   ? 261 VAL 4 CA  1 
ATOM 9970  C C   . VAL D 1 261 ? 56.574  25.614  202.473 1.00 25.54  ? 261 VAL 4 C   1 
ATOM 9971  O O   . VAL D 1 261 ? 57.662  25.341  202.995 1.00 38.95  ? 261 VAL 4 O   1 
ATOM 9972  C CB  . VAL D 1 261 ? 56.002  23.559  201.397 1.00 9.21   ? 261 VAL 4 CB  1 
ATOM 9973  C CG1 . VAL D 1 261 ? 55.131  23.316  202.564 1.00 44.79  ? 261 VAL 4 CG1 1 
ATOM 9974  C CG2 . VAL D 1 261 ? 55.400  22.996  200.189 1.00 2.00   ? 261 VAL 4 CG2 1 
ATOM 9975  N N   . SER D 1 262 ? 55.604  26.274  203.076 1.00 27.66  ? 262 SER 4 N   1 
ATOM 9976  C CA  . SER D 1 262 ? 55.825  26.958  204.327 1.00 21.61  ? 262 SER 4 CA  1 
ATOM 9977  C C   . SER D 1 262 ? 54.477  27.025  204.973 1.00 24.74  ? 262 SER 4 C   1 
ATOM 9978  O O   . SER D 1 262 ? 53.443  27.077  204.284 1.00 33.86  ? 262 SER 4 O   1 
ATOM 9979  C CB  . SER D 1 262 ? 56.337  28.357  204.022 1.00 9.11   ? 262 SER 4 CB  1 
ATOM 9980  O OG  . SER D 1 262 ? 56.411  28.522  202.596 1.00 51.80  ? 262 SER 4 OG  1 
ATOM 9981  N N   . ALA D 1 263 ? 54.484  27.019  206.294 1.00 21.70  ? 263 ALA 4 N   1 
ATOM 9982  C CA  . ALA D 1 263 ? 53.252  27.065  207.037 1.00 20.76  ? 263 ALA 4 CA  1 
ATOM 9983  C C   . ALA D 1 263 ? 53.552  27.469  208.456 1.00 17.04  ? 263 ALA 4 C   1 
ATOM 9984  O O   . ALA D 1 263 ? 54.715  27.595  208.821 1.00 32.45  ? 263 ALA 4 O   1 
ATOM 9985  C CB  . ALA D 1 263 ? 52.641  25.708  207.019 1.00 24.10  ? 263 ALA 4 CB  1 
ATOM 9986  N N   . VAL D 1 264 ? 52.512  27.719  209.242 1.00 5.29   ? 264 VAL 4 N   1 
ATOM 9987  C CA  . VAL D 1 264 ? 52.662  28.069  210.644 1.00 10.82  ? 264 VAL 4 CA  1 
ATOM 9988  C C   . VAL D 1 264 ? 51.357  27.703  211.308 1.00 20.55  ? 264 VAL 4 C   1 
ATOM 9989  O O   . VAL D 1 264 ? 50.302  28.086  210.812 1.00 25.92  ? 264 VAL 4 O   1 
ATOM 9990  C CB  . VAL D 1 264 ? 52.798  29.541  210.847 1.00 13.23  ? 264 VAL 4 CB  1 
ATOM 9991  C CG1 . VAL D 1 264 ? 52.811  29.805  212.319 1.00 14.88  ? 264 VAL 4 CG1 1 
ATOM 9992  C CG2 . VAL D 1 264 ? 54.045  30.074  210.201 1.00 8.05   ? 264 VAL 4 CG2 1 
ATOM 9993  N N   . ASP D 1 265 ? 51.407  27.054  212.464 1.00 23.90  ? 265 ASP 4 N   1 
ATOM 9994  C CA  . ASP D 1 265 ? 50.161  26.665  213.108 1.00 13.78  ? 265 ASP 4 CA  1 
ATOM 9995  C C   . ASP D 1 265 ? 50.108  26.742  214.592 1.00 22.20  ? 265 ASP 4 C   1 
ATOM 9996  O O   . ASP D 1 265 ? 50.049  25.707  215.264 1.00 19.32  ? 265 ASP 4 O   1 
ATOM 9997  C CB  . ASP D 1 265 ? 49.798  25.256  212.732 1.00 12.36  ? 265 ASP 4 CB  1 
ATOM 9998  C CG  . ASP D 1 265 ? 49.432  25.135  211.292 1.00 38.48  ? 265 ASP 4 CG  1 
ATOM 9999  O OD1 . ASP D 1 265 ? 48.257  25.470  210.984 1.00 22.32  ? 265 ASP 4 OD1 1 
ATOM 10000 O OD2 . ASP D 1 265 ? 50.321  24.731  210.484 1.00 42.89  ? 265 ASP 4 OD2 1 
ATOM 10001 N N   . ILE D 1 266 ? 50.116  27.952  215.118 1.00 17.79  ? 266 ILE 4 N   1 
ATOM 10002 C CA  . ILE D 1 266 ? 50.010  28.084  216.543 1.00 12.93  ? 266 ILE 4 CA  1 
ATOM 10003 C C   . ILE D 1 266 ? 48.564  27.734  216.786 1.00 19.30  ? 266 ILE 4 C   1 
ATOM 10004 O O   . ILE D 1 266 ? 47.687  28.546  216.489 1.00 20.15  ? 266 ILE 4 O   1 
ATOM 10005 C CB  . ILE D 1 266 ? 50.112  29.518  217.016 1.00 12.73  ? 266 ILE 4 CB  1 
ATOM 10006 C CG1 . ILE D 1 266 ? 51.522  30.084  216.842 1.00 16.80  ? 266 ILE 4 CG1 1 
ATOM 10007 C CG2 . ILE D 1 266 ? 49.666  29.570  218.465 1.00 29.16  ? 266 ILE 4 CG2 1 
ATOM 10008 C CD1 . ILE D 1 266 ? 52.025  30.025  215.453 1.00 17.93  ? 266 ILE 4 CD1 1 
ATOM 10009 N N   . CYS D 1 267 ? 48.289  26.534  217.269 1.00 15.82  ? 267 CYS 4 N   1 
ATOM 10010 C CA  . CYS D 1 267 ? 46.919  26.164  217.530 1.00 14.83  ? 267 CYS 4 CA  1 
ATOM 10011 C C   . CYS D 1 267 ? 46.309  26.981  218.672 1.00 32.39  ? 267 CYS 4 C   1 
ATOM 10012 O O   . CYS D 1 267 ? 45.074  27.158  218.744 1.00 37.83  ? 267 CYS 4 O   1 
ATOM 10013 C CB  . CYS D 1 267 ? 46.871  24.707  217.856 1.00 2.00   ? 267 CYS 4 CB  1 
ATOM 10014 S SG  . CYS D 1 267 ? 47.435  23.715  216.501 1.00 43.29  ? 267 CYS 4 SG  1 
ATOM 10015 N N   . GLY D 1 268 ? 47.178  27.496  219.538 1.00 22.09  ? 268 GLY 4 N   1 
ATOM 10016 C CA  . GLY D 1 268 ? 46.718  28.279  220.669 1.00 36.09  ? 268 GLY 4 CA  1 
ATOM 10017 C C   . GLY D 1 268 ? 47.655  28.132  221.864 1.00 48.21  ? 268 GLY 4 C   1 
ATOM 10018 O O   . GLY D 1 268 ? 48.855  27.887  221.681 1.00 64.67  ? 268 GLY 4 O   1 
ATOM 10019 N N   . LEU D 1 269 ? 47.116  28.228  223.082 1.00 47.05  ? 269 LEU 4 N   1 
ATOM 10020 C CA  . LEU D 1 269 ? 47.916  28.124  224.312 1.00 43.01  ? 269 LEU 4 CA  1 
ATOM 10021 C C   . LEU D 1 269 ? 47.581  27.014  225.286 1.00 50.59  ? 269 LEU 4 C   1 
ATOM 10022 O O   . LEU D 1 269 ? 46.403  26.785  225.633 1.00 59.29  ? 269 LEU 4 O   1 
ATOM 10023 C CB  . LEU D 1 269 ? 47.867  29.425  225.095 1.00 32.17  ? 269 LEU 4 CB  1 
ATOM 10024 C CG  . LEU D 1 269 ? 48.736  30.496  224.462 1.00 41.08  ? 269 LEU 4 CG  1 
ATOM 10025 C CD1 . LEU D 1 269 ? 48.652  31.791  225.256 1.00 30.25  ? 269 LEU 4 CD1 1 
ATOM 10026 C CD2 . LEU D 1 269 ? 50.158  29.982  224.408 1.00 46.95  ? 269 LEU 4 CD2 1 
ATOM 10027 N N   . PHE D 1 270 ? 48.637  26.361  225.773 1.00 51.69  ? 270 PHE 4 N   1 
ATOM 10028 C CA  . PHE D 1 270 ? 48.493  25.295  226.756 1.00 48.99  ? 270 PHE 4 CA  1 
ATOM 10029 C C   . PHE D 1 270 ? 48.685  25.972  228.076 1.00 58.85  ? 270 PHE 4 C   1 
ATOM 10030 O O   . PHE D 1 270 ? 49.709  26.639  228.327 1.00 46.93  ? 270 PHE 4 O   1 
ATOM 10031 C CB  . PHE D 1 270 ? 49.574  24.242  226.629 1.00 50.14  ? 270 PHE 4 CB  1 
ATOM 10032 C CG  . PHE D 1 270 ? 49.386  23.052  227.546 1.00 60.29  ? 270 PHE 4 CG  1 
ATOM 10033 C CD1 . PHE D 1 270 ? 49.067  23.215  228.878 1.00 80.68  ? 270 PHE 4 CD1 1 
ATOM 10034 C CD2 . PHE D 1 270 ? 49.539  21.759  227.056 1.00 74.99  ? 270 PHE 4 CD2 1 
ATOM 10035 C CE1 . PHE D 1 270 ? 48.900  22.124  229.708 1.00 100.86 ? 270 PHE 4 CE1 1 
ATOM 10036 C CE2 . PHE D 1 270 ? 49.375  20.650  227.872 1.00 82.08  ? 270 PHE 4 CE2 1 
ATOM 10037 C CZ  . PHE D 1 270 ? 49.054  20.830  229.200 1.00 101.42 ? 270 PHE 4 CZ  1 
ATOM 10038 N N   . THR D 1 271 ? 47.704  25.784  228.934 1.00 60.39  ? 271 THR 4 N   1 
ATOM 10039 C CA  . THR D 1 271 ? 47.798  26.375  230.224 1.00 53.51  ? 271 THR 4 CA  1 
ATOM 10040 C C   . THR D 1 271 ? 48.023  25.194  231.133 1.00 67.20  ? 271 THR 4 C   1 
ATOM 10041 O O   . THR D 1 271 ? 47.191  24.263  231.214 1.00 69.41  ? 271 THR 4 O   1 
ATOM 10042 C CB  . THR D 1 271 ? 46.543  27.106  230.551 1.00 55.80  ? 271 THR 4 CB  1 
ATOM 10043 O OG1 . THR D 1 271 ? 46.106  27.867  229.404 1.00 74.02  ? 271 THR 4 OG1 1 
ATOM 10044 C CG2 . THR D 1 271 ? 46.812  28.026  231.679 1.00 44.74  ? 271 THR 4 CG2 1 
ATOM 10045 N N   . ASN D 1 272 ? 49.244  25.176  231.659 1.00 71.11  ? 272 ASN 4 N   1 
ATOM 10046 C CA  . ASN D 1 272 ? 49.780  24.147  232.554 1.00 70.84  ? 272 ASN 4 CA  1 
ATOM 10047 C C   . ASN D 1 272 ? 49.113  24.100  233.895 1.00 75.03  ? 272 ASN 4 C   1 
ATOM 10048 O O   . ASN D 1 272 ? 48.548  25.088  234.338 1.00 86.98  ? 272 ASN 4 O   1 
ATOM 10049 C CB  . ASN D 1 272 ? 51.232  24.467  232.862 1.00 58.62  ? 272 ASN 4 CB  1 
ATOM 10050 C CG  . ASN D 1 272 ? 52.156  24.161  231.732 1.00 67.49  ? 272 ASN 4 CG  1 
ATOM 10051 O OD1 . ASN D 1 272 ? 52.368  23.004  231.373 1.00 59.65  ? 272 ASN 4 OD1 1 
ATOM 10052 N ND2 . ASN D 1 272 ? 52.773  25.191  231.201 1.00 76.56  ? 272 ASN 4 ND2 1 
ATOM 10053 N N   . THR D 1 273 ? 49.321  22.999  234.606 1.00 71.98  ? 273 THR 4 N   1 
ATOM 10054 C CA  . THR D 1 273 ? 48.823  22.846  235.974 1.00 65.31  ? 273 THR 4 CA  1 
ATOM 10055 C C   . THR D 1 273 ? 49.373  24.039  236.763 1.00 63.89  ? 273 THR 4 C   1 
ATOM 10056 O O   . THR D 1 273 ? 48.701  24.632  237.599 1.00 44.17  ? 273 THR 4 O   1 
ATOM 10057 C CB  . THR D 1 273 ? 49.465  21.642  236.627 1.00 67.68  ? 273 THR 4 CB  1 
ATOM 10058 O OG1 . THR D 1 273 ? 50.470  21.096  235.748 1.00 95.05  ? 273 THR 4 OG1 1 
ATOM 10059 C CG2 . THR D 1 273 ? 48.444  20.621  236.958 1.00 34.25  ? 273 THR 4 CG2 1 
ATOM 10060 N N   . SER D 1 274 ? 50.622  24.383  236.472 1.00 72.03  ? 274 SER 4 N   1 
ATOM 10061 C CA  . SER D 1 274 ? 51.281  25.498  237.138 1.00 80.45  ? 274 SER 4 CA  1 
ATOM 10062 C C   . SER D 1 274 ? 50.658  26.850  236.842 1.00 71.35  ? 274 SER 4 C   1 
ATOM 10063 O O   . SER D 1 274 ? 50.794  27.772  237.630 1.00 67.70  ? 274 SER 4 O   1 
ATOM 10064 C CB  . SER D 1 274 ? 52.789  25.529  236.813 1.00 96.26  ? 274 SER 4 CB  1 
ATOM 10065 O OG  . SER D 1 274 ? 53.100  24.918  235.564 1.00 120.05 ? 274 SER 4 OG  1 
ATOM 10066 N N   . GLY D 1 275 ? 49.981  26.965  235.705 1.00 72.47  ? 275 GLY 4 N   1 
ATOM 10067 C CA  . GLY D 1 275 ? 49.381  28.237  235.336 1.00 76.52  ? 275 GLY 4 CA  1 
ATOM 10068 C C   . GLY D 1 275 ? 50.210  28.969  234.285 1.00 70.25  ? 275 GLY 4 C   1 
ATOM 10069 O O   . GLY D 1 275 ? 49.861  30.073  233.836 1.00 59.22  ? 275 GLY 4 O   1 
ATOM 10070 N N   . THR D 1 276 ? 51.346  28.384  233.930 1.00 65.37  ? 276 THR 4 N   1 
ATOM 10071 C CA  . THR D 1 276 ? 52.187  28.975  232.915 1.00 64.54  ? 276 THR 4 CA  1 
ATOM 10072 C C   . THR D 1 276 ? 51.540  28.541  231.638 1.00 69.21  ? 276 THR 4 C   1 
ATOM 10073 O O   . THR D 1 276 ? 50.812  27.525  231.603 1.00 63.59  ? 276 THR 4 O   1 
ATOM 10074 C CB  . THR D 1 276 ? 53.573  28.383  232.899 1.00 69.56  ? 276 THR 4 CB  1 
ATOM 10075 O OG1 . THR D 1 276 ? 53.538  27.061  233.458 1.00 69.86  ? 276 THR 4 OG1 1 
ATOM 10076 C CG2 . THR D 1 276 ? 54.534  29.269  233.626 1.00 70.62  ? 276 THR 4 CG2 1 
ATOM 10077 N N   . GLN D 1 277 ? 51.882  29.245  230.572 1.00 62.19  ? 277 GLN 4 N   1 
ATOM 10078 C CA  . GLN D 1 277 ? 51.306  28.934  229.298 1.00 49.57  ? 277 GLN 4 CA  1 
ATOM 10079 C C   . GLN D 1 277 ? 52.386  28.829  228.254 1.00 40.00  ? 277 GLN 4 C   1 
ATOM 10080 O O   . GLN D 1 277 ? 53.422  29.464  228.376 1.00 42.37  ? 277 GLN 4 O   1 
ATOM 10081 C CB  . GLN D 1 277 ? 50.302  30.027  228.941 1.00 50.16  ? 277 GLN 4 CB  1 
ATOM 10082 C CG  . GLN D 1 277 ? 48.976  29.878  229.656 1.00 40.26  ? 277 GLN 4 CG  1 
ATOM 10083 C CD  . GLN D 1 277 ? 48.074  31.058  229.460 1.00 52.10  ? 277 GLN 4 CD  1 
ATOM 10084 O OE1 . GLN D 1 277 ? 46.874  30.906  229.204 1.00 79.39  ? 277 GLN 4 OE1 1 
ATOM 10085 N NE2 . GLN D 1 277 ? 48.624  32.253  229.640 1.00 53.78  ? 277 GLN 4 NE2 1 
ATOM 10086 N N   . GLN D 1 278 ? 52.164  27.992  227.253 1.00 34.54  ? 278 GLN 4 N   1 
ATOM 10087 C CA  . GLN D 1 278 ? 53.121  27.863  226.161 1.00 47.20  ? 278 GLN 4 CA  1 
ATOM 10088 C C   . GLN D 1 278 ? 52.394  27.459  224.850 1.00 43.29  ? 278 GLN 4 C   1 
ATOM 10089 O O   . GLN D 1 278 ? 51.379  26.757  224.874 1.00 41.33  ? 278 GLN 4 O   1 
ATOM 10090 C CB  . GLN D 1 278 ? 54.245  26.892  226.550 1.00 58.76  ? 278 GLN 4 CB  1 
ATOM 10091 C CG  . GLN D 1 278 ? 53.756  25.546  227.087 1.00 72.91  ? 278 GLN 4 CG  1 
ATOM 10092 C CD  . GLN D 1 278 ? 54.879  24.625  227.584 1.00 76.19  ? 278 GLN 4 CD  1 
ATOM 10093 O OE1 . GLN D 1 278 ? 54.776  24.007  228.651 1.00 70.48  ? 278 GLN 4 OE1 1 
ATOM 10094 N NE2 . GLN D 1 278 ? 55.914  24.481  226.788 1.00 75.34  ? 278 GLN 4 NE2 1 
ATOM 10095 N N   . TRP D 1 279 ? 52.851  28.007  223.729 1.00 20.76  ? 279 TRP 4 N   1 
ATOM 10096 C CA  . TRP D 1 279 ? 52.260  27.744  222.423 1.00 19.05  ? 279 TRP 4 CA  1 
ATOM 10097 C C   . TRP D 1 279 ? 52.237  26.285  222.051 1.00 27.29  ? 279 TRP 4 C   1 
ATOM 10098 O O   . TRP D 1 279 ? 53.133  25.538  222.446 1.00 36.01  ? 279 TRP 4 O   1 
ATOM 10099 C CB  . TRP D 1 279 ? 53.086  28.426  221.343 1.00 22.76  ? 279 TRP 4 CB  1 
ATOM 10100 C CG  . TRP D 1 279 ? 53.296  29.875  221.554 1.00 30.38  ? 279 TRP 4 CG  1 
ATOM 10101 C CD1 . TRP D 1 279 ? 54.491  30.511  221.740 1.00 52.62  ? 279 TRP 4 CD1 1 
ATOM 10102 C CD2 . TRP D 1 279 ? 52.301  30.896  221.517 1.00 28.93  ? 279 TRP 4 CD2 1 
ATOM 10103 N NE1 . TRP D 1 279 ? 54.307  31.876  221.805 1.00 41.42  ? 279 TRP 4 NE1 1 
ATOM 10104 C CE2 . TRP D 1 279 ? 52.969  32.138  221.668 1.00 34.03  ? 279 TRP 4 CE2 1 
ATOM 10105 C CE3 . TRP D 1 279 ? 50.913  30.891  221.349 1.00 20.30  ? 279 TRP 4 CE3 1 
ATOM 10106 C CZ2 . TRP D 1 279 ? 52.290  33.359  221.657 1.00 33.04  ? 279 TRP 4 CZ2 1 
ATOM 10107 C CZ3 . TRP D 1 279 ? 50.242  32.104  221.333 1.00 23.46  ? 279 TRP 4 CZ3 1 
ATOM 10108 C CH2 . TRP D 1 279 ? 50.935  33.323  221.484 1.00 22.74  ? 279 TRP 4 CH2 1 
ATOM 10109 N N   . LYS D 1 280 ? 51.238  25.891  221.266 1.00 21.85  ? 280 LYS 4 N   1 
ATOM 10110 C CA  . LYS D 1 280 ? 51.157  24.526  220.777 1.00 27.22  ? 280 LYS 4 CA  1 
ATOM 10111 C C   . LYS D 1 280 ? 51.012  24.612  219.291 1.00 30.36  ? 280 LYS 4 C   1 
ATOM 10112 O O   . LYS D 1 280 ? 50.207  25.417  218.790 1.00 31.92  ? 280 LYS 4 O   1 
ATOM 10113 C CB  . LYS D 1 280 ? 49.961  23.723  221.289 1.00 2.75   ? 280 LYS 4 CB  1 
ATOM 10114 C CG  . LYS D 1 280 ? 49.895  22.316  220.548 1.00 21.22  ? 280 LYS 4 CG  1 
ATOM 10115 C CD  . LYS D 1 280 ? 49.594  21.105  221.485 1.00 35.12  ? 280 LYS 4 CD  1 
ATOM 10116 C CE  . LYS D 1 280 ? 50.756  20.064  221.599 1.00 39.27  ? 280 LYS 4 CE  1 
ATOM 10117 N NZ  . LYS D 1 280 ? 50.691  18.825  220.726 1.00 35.02  ? 280 LYS 4 NZ  1 
ATOM 10118 N N   . GLY D 1 281 ? 51.788  23.790  218.595 1.00 17.82  ? 281 GLY 4 N   1 
ATOM 10119 C CA  . GLY D 1 281 ? 51.719  23.765  217.152 1.00 21.38  ? 281 GLY 4 CA  1 
ATOM 10120 C C   . GLY D 1 281 ? 51.380  22.367  216.687 1.00 32.00  ? 281 GLY 4 C   1 
ATOM 10121 O O   . GLY D 1 281 ? 51.453  21.403  217.466 1.00 39.23  ? 281 GLY 4 O   1 
ATOM 10122 N N   . LEU D 1 282 ? 50.960  22.258  215.435 1.00 16.54  ? 282 LEU 4 N   1 
ATOM 10123 C CA  . LEU D 1 282 ? 50.651  20.963  214.858 1.00 14.65  ? 282 LEU 4 CA  1 
ATOM 10124 C C   . LEU D 1 282 ? 51.207  20.939  213.488 1.00 20.23  ? 282 LEU 4 C   1 
ATOM 10125 O O   . LEU D 1 282 ? 51.341  21.957  212.798 1.00 32.36  ? 282 LEU 4 O   1 
ATOM 10126 C CB  . LEU D 1 282 ? 49.160  20.672  214.793 1.00 20.18  ? 282 LEU 4 CB  1 
ATOM 10127 C CG  . LEU D 1 282 ? 48.540  20.256  216.120 1.00 19.14  ? 282 LEU 4 CG  1 
ATOM 10128 C CD1 . LEU D 1 282 ? 47.143  19.689  215.926 1.00 28.47  ? 282 LEU 4 CD1 1 
ATOM 10129 C CD2 . LEU D 1 282 ? 49.424  19.194  216.690 1.00 21.07  ? 282 LEU 4 CD2 1 
ATOM 10130 N N   . PRO D 1 283 ? 51.632  19.780  213.083 1.00 26.61  ? 283 PRO 4 N   1 
ATOM 10131 C CA  . PRO D 1 283 ? 52.197  19.690  211.746 1.00 35.49  ? 283 PRO 4 CA  1 
ATOM 10132 C C   . PRO D 1 283 ? 51.072  19.871  210.764 1.00 30.20  ? 283 PRO 4 C   1 
ATOM 10133 O O   . PRO D 1 283 ? 49.895  19.701  211.116 1.00 21.35  ? 283 PRO 4 O   1 
ATOM 10134 C CB  . PRO D 1 283 ? 52.734  18.273  211.720 1.00 29.03  ? 283 PRO 4 CB  1 
ATOM 10135 C CG  . PRO D 1 283 ? 51.685  17.565  212.487 1.00 28.97  ? 283 PRO 4 CG  1 
ATOM 10136 C CD  . PRO D 1 283 ? 51.458  18.465  213.687 1.00 5.52   ? 283 PRO 4 CD  1 
ATOM 10137 N N   . ARG D 1 284 ? 51.451  20.205  209.542 1.00 22.00  ? 284 ARG 4 N   1 
ATOM 10138 C CA  . ARG D 1 284 ? 50.505  20.402  208.468 1.00 22.87  ? 284 ARG 4 CA  1 
ATOM 10139 C C   . ARG D 1 284 ? 50.831  19.470  207.326 1.00 26.91  ? 284 ARG 4 C   1 
ATOM 10140 O O   . ARG D 1 284 ? 52.005  19.144  207.078 1.00 31.22  ? 284 ARG 4 O   1 
ATOM 10141 C CB  . ARG D 1 284 ? 50.559  21.845  207.985 1.00 32.08  ? 284 ARG 4 CB  1 
ATOM 10142 C CG  . ARG D 1 284 ? 49.908  22.065  206.639 1.00 32.42  ? 284 ARG 4 CG  1 
ATOM 10143 C CD  . ARG D 1 284 ? 49.809  23.551  206.309 1.00 38.63  ? 284 ARG 4 CD  1 
ATOM 10144 N NE  . ARG D 1 284 ? 48.417  23.998  206.313 1.00 45.48  ? 284 ARG 4 NE  1 
ATOM 10145 C CZ  . ARG D 1 284 ? 47.832  24.599  207.343 1.00 38.80  ? 284 ARG 4 CZ  1 
ATOM 10146 N NH1 . ARG D 1 284 ? 48.523  24.841  208.458 1.00 23.69  ? 284 ARG 4 NH1 1 
ATOM 10147 N NH2 . ARG D 1 284 ? 46.533  24.886  207.280 1.00 35.00  ? 284 ARG 4 NH2 1 
ATOM 10148 N N   . TYR D 1 285 ? 49.794  19.119  206.581 1.00 17.07  ? 285 TYR 4 N   1 
ATOM 10149 C CA  . TYR D 1 285 ? 49.938  18.205  205.467 1.00 15.11  ? 285 TYR 4 CA  1 
ATOM 10150 C C   . TYR D 1 285 ? 49.739  18.918  204.159 1.00 23.18  ? 285 TYR 4 C   1 
ATOM 10151 O O   . TYR D 1 285 ? 49.011  19.909  204.108 1.00 32.57  ? 285 TYR 4 O   1 
ATOM 10152 C CB  . TYR D 1 285 ? 48.839  17.165  205.597 1.00 15.21  ? 285 TYR 4 CB  1 
ATOM 10153 C CG  . TYR D 1 285 ? 48.506  16.417  204.322 1.00 28.62  ? 285 TYR 4 CG  1 
ATOM 10154 C CD1 . TYR D 1 285 ? 47.640  16.946  203.387 1.00 26.73  ? 285 TYR 4 CD1 1 
ATOM 10155 C CD2 . TYR D 1 285 ? 48.988  15.137  204.095 1.00 46.45  ? 285 TYR 4 CD2 1 
ATOM 10156 C CE1 . TYR D 1 285 ? 47.262  16.214  202.278 1.00 24.53  ? 285 TYR 4 CE1 1 
ATOM 10157 C CE2 . TYR D 1 285 ? 48.599  14.399  202.982 1.00 32.56  ? 285 TYR 4 CE2 1 
ATOM 10158 C CZ  . TYR D 1 285 ? 47.734  14.942  202.089 1.00 23.72  ? 285 TYR 4 CZ  1 
ATOM 10159 O OH  . TYR D 1 285 ? 47.276  14.193  201.043 1.00 29.31  ? 285 TYR 4 OH  1 
ATOM 10160 N N   . PHE D 1 286 ? 50.359  18.433  203.090 1.00 9.13   ? 286 PHE 4 N   1 
ATOM 10161 C CA  . PHE D 1 286 ? 50.089  19.057  201.797 1.00 14.01  ? 286 PHE 4 CA  1 
ATOM 10162 C C   . PHE D 1 286 ? 50.024  18.037  200.696 1.00 23.29  ? 286 PHE 4 C   1 
ATOM 10163 O O   . PHE D 1 286 ? 50.728  17.024  200.728 1.00 34.53  ? 286 PHE 4 O   1 
ATOM 10164 C CB  . PHE D 1 286 ? 51.143  20.048  201.367 1.00 18.02  ? 286 PHE 4 CB  1 
ATOM 10165 C CG  . PHE D 1 286 ? 51.427  21.112  202.347 1.00 15.48  ? 286 PHE 4 CG  1 
ATOM 10166 C CD1 . PHE D 1 286 ? 51.930  20.803  203.586 1.00 27.24  ? 286 PHE 4 CD1 1 
ATOM 10167 C CD2 . PHE D 1 286 ? 51.323  22.436  201.984 1.00 17.16  ? 286 PHE 4 CD2 1 
ATOM 10168 C CE1 . PHE D 1 286 ? 52.335  21.791  204.428 1.00 33.57  ? 286 PHE 4 CE1 1 
ATOM 10169 C CE2 . PHE D 1 286 ? 51.731  23.445  202.832 1.00 8.50   ? 286 PHE 4 CE2 1 
ATOM 10170 C CZ  . PHE D 1 286 ? 52.234  23.130  204.043 1.00 24.01  ? 286 PHE 4 CZ  1 
ATOM 10171 N N   . LYS D 1 287 ? 49.235  18.356  199.683 1.00 18.48  ? 287 LYS 4 N   1 
ATOM 10172 C CA  . LYS D 1 287 ? 49.093  17.502  198.531 1.00 17.38  ? 287 LYS 4 CA  1 
ATOM 10173 C C   . LYS D 1 287 ? 49.052  18.471  197.381 1.00 24.66  ? 287 LYS 4 C   1 
ATOM 10174 O O   . LYS D 1 287 ? 48.044  19.149  197.081 1.00 30.16  ? 287 LYS 4 O   1 
ATOM 10175 C CB  . LYS D 1 287 ? 47.838  16.642  198.625 1.00 17.49  ? 287 LYS 4 CB  1 
ATOM 10176 C CG  . LYS D 1 287 ? 47.522  15.755  197.404 1.00 24.72  ? 287 LYS 4 CG  1 
ATOM 10177 C CD  . LYS D 1 287 ? 46.427  14.712  197.747 1.00 57.97  ? 287 LYS 4 CD  1 
ATOM 10178 C CE  . LYS D 1 287 ? 46.090  13.719  196.612 1.00 77.17  ? 287 LYS 4 CE  1 
ATOM 10179 N NZ  . LYS D 1 287 ? 45.736  12.326  197.119 1.00 105.09 ? 287 LYS 4 NZ  1 
ATOM 10180 N N   . ILE D 1 288 ? 50.228  18.636  196.825 1.00 21.55  ? 288 ILE 4 N   1 
ATOM 10181 C CA  . ILE D 1 288 ? 50.368  19.529  195.720 1.00 21.75  ? 288 ILE 4 CA  1 
ATOM 10182 C C   . ILE D 1 288 ? 50.329  18.783  194.433 1.00 18.65  ? 288 ILE 4 C   1 
ATOM 10183 O O   . ILE D 1 288 ? 50.898  17.714  194.272 1.00 23.01  ? 288 ILE 4 O   1 
ATOM 10184 C CB  . ILE D 1 288 ? 51.587  20.279  195.851 1.00 13.22  ? 288 ILE 4 CB  1 
ATOM 10185 C CG1 . ILE D 1 288 ? 51.703  20.677  197.307 1.00 18.27  ? 288 ILE 4 CG1 1 
ATOM 10186 C CG2 . ILE D 1 288 ? 51.498  21.479  194.989 1.00 28.73  ? 288 ILE 4 CG2 1 
ATOM 10187 C CD1 . ILE D 1 288 ? 52.920  21.387  197.595 1.00 27.53  ? 288 ILE 4 CD1 1 
ATOM 10188 N N   . THR D 1 289 ? 49.691  19.405  193.484 1.00 18.31  ? 289 THR 4 N   1 
ATOM 10189 C CA  . THR D 1 289 ? 49.482  18.764  192.236 1.00 17.75  ? 289 THR 4 CA  1 
ATOM 10190 C C   . THR D 1 289 ? 50.207  19.583  191.231 1.00 26.41  ? 289 THR 4 C   1 
ATOM 10191 O O   . THR D 1 289 ? 49.914  20.771  191.046 1.00 38.72  ? 289 THR 4 O   1 
ATOM 10192 C CB  . THR D 1 289 ? 48.006  18.755  192.010 1.00 26.81  ? 289 THR 4 CB  1 
ATOM 10193 O OG1 . THR D 1 289 ? 47.331  18.513  193.276 1.00 29.90  ? 289 THR 4 OG1 1 
ATOM 10194 C CG2 . THR D 1 289 ? 47.677  17.687  191.070 1.00 10.32  ? 289 THR 4 CG2 1 
ATOM 10195 N N   . LEU D 1 290 ? 51.207  18.960  190.636 1.00 21.72  ? 290 LEU 4 N   1 
ATOM 10196 C CA  . LEU D 1 290 ? 52.051  19.620  189.670 1.00 12.42  ? 290 LEU 4 CA  1 
ATOM 10197 C C   . LEU D 1 290 ? 51.827  19.212  188.262 1.00 16.81  ? 290 LEU 4 C   1 
ATOM 10198 O O   . LEU D 1 290 ? 51.427  18.074  187.992 1.00 24.24  ? 290 LEU 4 O   1 
ATOM 10199 C CB  . LEU D 1 290 ? 53.477  19.303  190.006 1.00 15.77  ? 290 LEU 4 CB  1 
ATOM 10200 C CG  . LEU D 1 290 ? 53.746  19.905  191.365 1.00 20.00  ? 290 LEU 4 CG  1 
ATOM 10201 C CD1 . LEU D 1 290 ? 55.078  19.514  191.962 1.00 12.74  ? 290 LEU 4 CD1 1 
ATOM 10202 C CD2 . LEU D 1 290 ? 53.722  21.365  191.107 1.00 34.15  ? 290 LEU 4 CD2 1 
ATOM 10203 N N   . ARG D 1 291 ? 52.117  20.132  187.356 1.00 9.16   ? 291 ARG 4 N   1 
ATOM 10204 C CA  . ARG D 1 291 ? 52.025  19.825  185.935 1.00 18.35  ? 291 ARG 4 CA  1 
ATOM 10205 C C   . ARG D 1 291 ? 53.147  20.511  185.137 1.00 28.12  ? 291 ARG 4 C   1 
ATOM 10206 O O   . ARG D 1 291 ? 53.820  21.450  185.612 1.00 15.12  ? 291 ARG 4 O   1 
ATOM 10207 C CB  . ARG D 1 291 ? 50.677  20.189  185.357 1.00 11.86  ? 291 ARG 4 CB  1 
ATOM 10208 C CG  . ARG D 1 291 ? 50.487  21.680  185.204 1.00 46.32  ? 291 ARG 4 CG  1 
ATOM 10209 C CD  . ARG D 1 291 ? 49.204  22.071  184.449 1.00 42.75  ? 291 ARG 4 CD  1 
ATOM 10210 N NE  . ARG D 1 291 ? 48.985  23.504  184.626 1.00 68.27  ? 291 ARG 4 NE  1 
ATOM 10211 C CZ  . ARG D 1 291 ? 47.827  24.140  184.480 1.00 69.27  ? 291 ARG 4 CZ  1 
ATOM 10212 N NH1 . ARG D 1 291 ? 46.736  23.467  184.143 1.00 68.00  ? 291 ARG 4 NH1 1 
ATOM 10213 N NH2 . ARG D 1 291 ? 47.766  25.457  184.686 1.00 86.31  ? 291 ARG 4 NH2 1 
ATOM 10214 N N   . LYS D 1 292 ? 53.344  20.031  183.917 1.00 30.09  ? 292 LYS 4 N   1 
ATOM 10215 C CA  . LYS D 1 292 ? 54.401  20.561  183.080 1.00 26.73  ? 292 LYS 4 CA  1 
ATOM 10216 C C   . LYS D 1 292 ? 53.918  21.767  182.271 1.00 27.25  ? 292 LYS 4 C   1 
ATOM 10217 O O   . LYS D 1 292 ? 53.065  21.632  181.373 1.00 41.08  ? 292 LYS 4 O   1 
ATOM 10218 C CB  . LYS D 1 292 ? 54.916  19.443  182.167 1.00 30.75  ? 292 LYS 4 CB  1 
ATOM 10219 C CG  . LYS D 1 292 ? 55.531  18.250  182.898 1.00 16.38  ? 292 LYS 4 CG  1 
ATOM 10220 C CD  . LYS D 1 292 ? 56.003  17.155  181.919 1.00 37.00  ? 292 LYS 4 CD  1 
ATOM 10221 C CE  . LYS D 1 292 ? 56.922  16.134  182.594 1.00 42.50  ? 292 LYS 4 CE  1 
ATOM 10222 N NZ  . LYS D 1 292 ? 57.752  15.334  181.620 1.00 73.59  ? 292 LYS 4 NZ  1 
ATOM 10223 N N   . ARG D 1 293 ? 54.467  22.946  182.569 1.00 31.82  ? 293 ARG 4 N   1 
ATOM 10224 C CA  . ARG D 1 293 ? 54.049  24.163  181.855 1.00 34.46  ? 293 ARG 4 CA  1 
ATOM 10225 C C   . ARG D 1 293 ? 55.032  24.663  180.853 1.00 28.19  ? 293 ARG 4 C   1 
ATOM 10226 O O   . ARG D 1 293 ? 56.244  24.679  181.083 1.00 20.53  ? 293 ARG 4 O   1 
ATOM 10227 C CB  . ARG D 1 293 ? 53.706  25.325  182.799 1.00 27.68  ? 293 ARG 4 CB  1 
ATOM 10228 C CG  . ARG D 1 293 ? 53.148  26.585  182.112 1.00 31.75  ? 293 ARG 4 CG  1 
ATOM 10229 C CD  . ARG D 1 293 ? 52.062  26.273  181.034 1.00 64.50  ? 293 ARG 4 CD  1 
ATOM 10230 N NE  . ARG D 1 293 ? 51.002  27.287  180.918 1.00 55.86  ? 293 ARG 4 NE  1 
ATOM 10231 C CZ  . ARG D 1 293 ? 50.159  27.606  181.909 1.00 34.94  ? 293 ARG 4 CZ  1 
ATOM 10232 N NH1 . ARG D 1 293 ? 50.259  27.022  183.081 1.00 14.58  ? 293 ARG 4 NH1 1 
ATOM 10233 N NH2 . ARG D 1 293 ? 49.108  28.384  181.697 1.00 40.19  ? 293 ARG 4 NH2 1 
ATOM 10234 N N   . SER D 1 294 ? 54.481  25.050  179.720 1.00 27.08  ? 294 SER 4 N   1 
ATOM 10235 C CA  . SER D 1 294 ? 55.277  25.595  178.668 1.00 28.01  ? 294 SER 4 CA  1 
ATOM 10236 C C   . SER D 1 294 ? 55.476  27.088  178.907 1.00 24.36  ? 294 SER 4 C   1 
ATOM 10237 O O   . SER D 1 294 ? 54.506  27.816  179.153 1.00 38.18  ? 294 SER 4 O   1 
ATOM 10238 C CB  . SER D 1 294 ? 54.539  25.374  177.378 1.00 29.44  ? 294 SER 4 CB  1 
ATOM 10239 O OG  . SER D 1 294 ? 55.318  25.919  176.354 1.00 50.01  ? 294 SER 4 OG  1 
ATOM 10240 N N   . VAL D 1 295 ? 56.715  27.553  178.863 1.00 12.62  ? 295 VAL 4 N   1 
ATOM 10241 C CA  . VAL D 1 295 ? 56.966  28.976  179.074 1.00 32.63  ? 295 VAL 4 CA  1 
ATOM 10242 C C   . VAL D 1 295 ? 58.142  29.429  178.245 1.00 32.54  ? 295 VAL 4 C   1 
ATOM 10243 O O   . VAL D 1 295 ? 58.968  28.602  177.900 1.00 45.95  ? 295 VAL 4 O   1 
ATOM 10244 C CB  . VAL D 1 295 ? 57.259  29.301  180.559 1.00 35.23  ? 295 VAL 4 CB  1 
ATOM 10245 C CG1 . VAL D 1 295 ? 56.486  28.380  181.419 1.00 35.45  ? 295 VAL 4 CG1 1 
ATOM 10246 C CG2 . VAL D 1 295 ? 58.740  29.227  180.886 1.00 11.57  ? 295 VAL 4 CG2 1 
ATOM 10247 N N   . LYS D 1 296 ? 58.249  30.726  177.950 1.00 33.31  ? 296 LYS 4 N   1 
ATOM 10248 C CA  . LYS D 1 296 ? 59.384  31.218  177.154 1.00 36.15  ? 296 LYS 4 CA  1 
ATOM 10249 C C   . LYS D 1 296 ? 60.379  31.879  178.057 1.00 29.20  ? 296 LYS 4 C   1 
ATOM 10250 O O   . LYS D 1 296 ? 60.010  32.409  179.103 1.00 18.03  ? 296 LYS 4 O   1 
ATOM 10251 C CB  . LYS D 1 296 ? 58.972  32.171  176.011 1.00 36.19  ? 296 LYS 4 CB  1 
ATOM 10252 C CG  . LYS D 1 296 ? 58.985  33.699  176.300 1.00 64.11  ? 296 LYS 4 CG  1 
ATOM 10253 C CD  . LYS D 1 296 ? 58.404  34.479  175.059 1.00 96.07  ? 296 LYS 4 CD  1 
ATOM 10254 C CE  . LYS D 1 296 ? 58.238  36.043  175.157 1.00 98.85  ? 296 LYS 4 CE  1 
ATOM 10255 N NZ  . LYS D 1 296 ? 57.225  36.610  176.122 1.00 97.78  ? 296 LYS 4 NZ  1 
ATOM 10256 N N   . ASN D 1 297 ? 61.647  31.784  177.670 1.00 31.60  ? 297 ASN 4 N   1 
ATOM 10257 C CA  . ASN D 1 297 ? 62.722  32.365  178.440 1.00 24.98  ? 297 ASN 4 CA  1 
ATOM 10258 C C   . ASN D 1 297 ? 62.766  33.835  178.136 1.00 25.87  ? 297 ASN 4 C   1 
ATOM 10259 O O   . ASN D 1 297 ? 63.043  34.231  177.016 1.00 34.88  ? 297 ASN 4 O   1 
ATOM 10260 C CB  . ASN D 1 297 ? 64.043  31.740  178.062 1.00 28.39  ? 297 ASN 4 CB  1 
ATOM 10261 C CG  . ASN D 1 297 ? 65.212  32.642  178.368 1.00 42.89  ? 297 ASN 4 CG  1 
ATOM 10262 O OD1 . ASN D 1 297 ? 65.272  33.309  179.423 1.00 27.50  ? 297 ASN 4 OD1 1 
ATOM 10263 N ND2 . ASN D 1 297 ? 66.150  32.686  177.435 1.00 47.07  ? 297 ASN 4 ND2 1 
ATOM 10264 N N   . PRO D 1 298 ? 62.545  34.657  179.149 1.00 22.57  ? 298 PRO 4 N   1 
ATOM 10265 C CA  . PRO D 1 298 ? 62.527  36.112  179.101 1.00 30.09  ? 298 PRO 4 CA  1 
ATOM 10266 C C   . PRO D 1 298 ? 63.850  36.722  178.728 1.00 42.76  ? 298 PRO 4 C   1 
ATOM 10267 O O   . PRO D 1 298 ? 63.894  37.696  177.981 1.00 52.81  ? 298 PRO 4 O   1 
ATOM 10268 C CB  . PRO D 1 298 ? 62.218  36.478  180.538 1.00 37.87  ? 298 PRO 4 CB  1 
ATOM 10269 C CG  . PRO D 1 298 ? 62.962  35.463  181.292 1.00 37.58  ? 298 PRO 4 CG  1 
ATOM 10270 C CD  . PRO D 1 298 ? 62.563  34.197  180.543 1.00 36.44  ? 298 PRO 4 CD  1 
ATOM 10271 N N   . TYR D 1 299 ? 64.905  36.193  179.330 1.00 35.37  ? 299 TYR 4 N   1 
ATOM 10272 C CA  . TYR D 1 299 ? 66.258  36.662  179.138 1.00 29.68  ? 299 TYR 4 CA  1 
ATOM 10273 C C   . TYR D 1 299 ? 66.924  36.174  177.846 1.00 50.50  ? 299 TYR 4 C   1 
ATOM 10274 O O   . TYR D 1 299 ? 66.377  35.348  177.115 1.00 57.43  ? 299 TYR 4 O   1 
ATOM 10275 C CB  . TYR D 1 299 ? 67.044  36.202  180.313 1.00 27.67  ? 299 TYR 4 CB  1 
ATOM 10276 C CG  . TYR D 1 299 ? 66.333  36.496  181.584 1.00 26.89  ? 299 TYR 4 CG  1 
ATOM 10277 C CD1 . TYR D 1 299 ? 66.215  37.794  182.028 1.00 24.06  ? 299 TYR 4 CD1 1 
ATOM 10278 C CD2 . TYR D 1 299 ? 65.806  35.482  182.362 1.00 27.97  ? 299 TYR 4 CD2 1 
ATOM 10279 C CE1 . TYR D 1 299 ? 65.599  38.086  183.210 1.00 20.54  ? 299 TYR 4 CE1 1 
ATOM 10280 C CE2 . TYR D 1 299 ? 65.172  35.771  183.557 1.00 35.87  ? 299 TYR 4 CE2 1 
ATOM 10281 C CZ  . TYR D 1 299 ? 65.089  37.080  183.972 1.00 30.36  ? 299 TYR 4 CZ  1 
ATOM 10282 O OH  . TYR D 1 299 ? 64.550  37.393  185.173 1.00 27.23  ? 299 TYR 4 OH  1 
ATOM 10283 N N   . PRO D 1 300 ? 68.082  36.791  177.497 1.00 61.68  ? 300 PRO 4 N   1 
ATOM 10284 C CA  . PRO D 1 300 ? 68.934  36.477  176.330 1.00 60.88  ? 300 PRO 4 CA  1 
ATOM 10285 C C   . PRO D 1 300 ? 70.233  35.726  176.706 1.00 62.41  ? 300 PRO 4 C   1 
ATOM 10286 O O   . PRO D 1 300 ? 71.056  36.138  177.570 1.00 39.16  ? 300 PRO 4 O   1 
ATOM 10287 C CB  . PRO D 1 300 ? 69.222  37.874  175.797 1.00 66.56  ? 300 PRO 4 CB  1 
ATOM 10288 C CG  . PRO D 1 300 ? 69.475  38.625  177.097 1.00 52.98  ? 300 PRO 4 CG  1 
ATOM 10289 C CD  . PRO D 1 300 ? 68.364  38.131  178.007 1.00 61.36  ? 300 PRO 4 CD  1 
ATOM 10290 N N   . ILE D 1 301 ? 70.405  34.611  176.001 1.00 60.13  ? 301 ILE 4 N   1 
ATOM 10291 C CA  . ILE D 1 301 ? 71.505  33.661  176.155 1.00 56.89  ? 301 ILE 4 CA  1 
ATOM 10292 C C   . ILE D 1 301 ? 72.813  34.317  176.490 1.00 52.79  ? 301 ILE 4 C   1 
ATOM 10293 O O   . ILE D 1 301 ? 73.415  34.059  177.534 1.00 37.48  ? 301 ILE 4 O   1 
ATOM 10294 C CB  . ILE D 1 301 ? 71.704  32.876  174.872 1.00 65.89  ? 301 ILE 4 CB  1 
ATOM 10295 C CG1 . ILE D 1 301 ? 70.581  33.180  173.870 1.00 89.50  ? 301 ILE 4 CG1 1 
ATOM 10296 C CG2 . ILE D 1 301 ? 71.715  31.403  175.182 1.00 82.66  ? 301 ILE 4 CG2 1 
ATOM 10297 C CD1 . ILE D 1 301 ? 69.224  32.564  174.242 1.00 88.95  ? 301 ILE 4 CD1 1 
ATOM 10298 N N   . SER D 1 302 ? 73.247  35.134  175.543 1.00 54.18  ? 302 SER 4 N   1 
ATOM 10299 C CA  . SER D 1 302 ? 74.458  35.927  175.627 1.00 59.36  ? 302 SER 4 CA  1 
ATOM 10300 C C   . SER D 1 302 ? 74.723  36.248  177.096 1.00 57.58  ? 302 SER 4 C   1 
ATOM 10301 O O   . SER D 1 302 ? 75.766  35.899  177.666 1.00 56.39  ? 302 SER 4 O   1 
ATOM 10302 C CB  . SER D 1 302 ? 74.200  37.227  174.851 1.00 65.81  ? 302 SER 4 CB  1 
ATOM 10303 O OG  . SER D 1 302 ? 73.379  36.979  173.701 1.00 72.92  ? 302 SER 4 OG  1 
ATOM 10304 N N   . PHE D 1 303 ? 73.693  36.818  177.709 1.00 50.17  ? 303 PHE 4 N   1 
ATOM 10305 C CA  . PHE D 1 303 ? 73.707  37.210  179.098 1.00 47.72  ? 303 PHE 4 CA  1 
ATOM 10306 C C   . PHE D 1 303 ? 73.714  35.995  179.984 1.00 44.07  ? 303 PHE 4 C   1 
ATOM 10307 O O   . PHE D 1 303 ? 74.584  35.836  180.854 1.00 37.15  ? 303 PHE 4 O   1 
ATOM 10308 C CB  . PHE D 1 303 ? 72.454  38.034  179.405 1.00 53.57  ? 303 PHE 4 CB  1 
ATOM 10309 C CG  . PHE D 1 303 ? 72.203  38.252  180.880 1.00 77.75  ? 303 PHE 4 CG  1 
ATOM 10310 C CD1 . PHE D 1 303 ? 73.224  38.668  181.731 1.00 91.47  ? 303 PHE 4 CD1 1 
ATOM 10311 C CD2 . PHE D 1 303 ? 70.931  38.060  181.419 1.00 91.58  ? 303 PHE 4 CD2 1 
ATOM 10312 C CE1 . PHE D 1 303 ? 72.982  38.892  183.103 1.00 103.20 ? 303 PHE 4 CE1 1 
ATOM 10313 C CE2 . PHE D 1 303 ? 70.680  38.282  182.791 1.00 100.28 ? 303 PHE 4 CE2 1 
ATOM 10314 C CZ  . PHE D 1 303 ? 71.710  38.700  183.630 1.00 96.38  ? 303 PHE 4 CZ  1 
ATOM 10315 N N   . LEU D 1 304 ? 72.711  35.152  179.785 1.00 33.22  ? 304 LEU 4 N   1 
ATOM 10316 C CA  . LEU D 1 304 ? 72.590  33.976  180.619 1.00 33.82  ? 304 LEU 4 CA  1 
ATOM 10317 C C   . LEU D 1 304 ? 73.945  33.314  180.751 1.00 36.21  ? 304 LEU 4 C   1 
ATOM 10318 O O   . LEU D 1 304 ? 74.574  33.361  181.833 1.00 22.62  ? 304 LEU 4 O   1 
ATOM 10319 C CB  . LEU D 1 304 ? 71.505  33.047  180.072 1.00 33.73  ? 304 LEU 4 CB  1 
ATOM 10320 C CG  . LEU D 1 304 ? 70.110  33.523  180.538 1.00 38.57  ? 304 LEU 4 CG  1 
ATOM 10321 C CD1 . LEU D 1 304 ? 68.954  32.643  179.999 1.00 34.91  ? 304 LEU 4 CD1 1 
ATOM 10322 C CD2 . LEU D 1 304 ? 70.097  33.560  182.084 1.00 14.86  ? 304 LEU 4 CD2 1 
ATOM 10323 N N   . LEU D 1 305 ? 74.444  32.883  179.593 1.00 30.33  ? 305 LEU 4 N   1 
ATOM 10324 C CA  . LEU D 1 305 ? 75.733  32.238  179.458 1.00 28.78  ? 305 LEU 4 CA  1 
ATOM 10325 C C   . LEU D 1 305 ? 76.790  33.012  180.198 1.00 24.99  ? 305 LEU 4 C   1 
ATOM 10326 O O   . LEU D 1 305 ? 77.417  32.536  181.146 1.00 21.32  ? 305 LEU 4 O   1 
ATOM 10327 C CB  . LEU D 1 305 ? 76.113  32.195  177.995 1.00 27.06  ? 305 LEU 4 CB  1 
ATOM 10328 C CG  . LEU D 1 305 ? 77.339  31.334  177.671 1.00 44.75  ? 305 LEU 4 CG  1 
ATOM 10329 C CD1 . LEU D 1 305 ? 77.666  30.344  178.804 1.00 22.86  ? 305 LEU 4 CD1 1 
ATOM 10330 C CD2 . LEU D 1 305 ? 77.043  30.567  176.363 1.00 47.15  ? 305 LEU 4 CD2 1 
ATOM 10331 N N   . SER D 1 306 ? 76.974  34.227  179.746 1.00 25.35  ? 306 SER 4 N   1 
ATOM 10332 C CA  . SER D 1 306 ? 77.934  35.069  180.357 1.00 36.01  ? 306 SER 4 CA  1 
ATOM 10333 C C   . SER D 1 306 ? 77.761  35.083  181.872 1.00 38.13  ? 306 SER 4 C   1 
ATOM 10334 O O   . SER D 1 306 ? 78.518  34.436  182.593 1.00 36.90  ? 306 SER 4 O   1 
ATOM 10335 C CB  . SER D 1 306 ? 77.793  36.466  179.788 1.00 45.94  ? 306 SER 4 CB  1 
ATOM 10336 O OG  . SER D 1 306 ? 78.420  37.404  180.640 1.00 87.30  ? 306 SER 4 OG  1 
ATOM 10337 N N   . ASP D 1 307 ? 76.701  35.737  182.326 1.00 43.13  ? 307 ASP 4 N   1 
ATOM 10338 C CA  . ASP D 1 307 ? 76.438  35.911  183.743 1.00 46.58  ? 307 ASP 4 CA  1 
ATOM 10339 C C   . ASP D 1 307 ? 76.579  34.662  184.548 1.00 46.14  ? 307 ASP 4 C   1 
ATOM 10340 O O   . ASP D 1 307 ? 77.121  34.679  185.666 1.00 37.39  ? 307 ASP 4 O   1 
ATOM 10341 C CB  . ASP D 1 307 ? 75.050  36.502  183.983 1.00 63.32  ? 307 ASP 4 CB  1 
ATOM 10342 C CG  . ASP D 1 307 ? 74.892  37.083  185.396 1.00 78.02  ? 307 ASP 4 CG  1 
ATOM 10343 O OD1 . ASP D 1 307 ? 75.679  37.974  185.798 1.00 85.52  ? 307 ASP 4 OD1 1 
ATOM 10344 O OD2 . ASP D 1 307 ? 73.969  36.660  186.122 1.00 86.04  ? 307 ASP 4 OD2 1 
ATOM 10345 N N   . LEU D 1 308 ? 76.102  33.561  183.995 1.00 42.34  ? 308 LEU 4 N   1 
ATOM 10346 C CA  . LEU D 1 308 ? 76.199  32.334  184.746 1.00 43.79  ? 308 LEU 4 CA  1 
ATOM 10347 C C   . LEU D 1 308 ? 77.672  32.070  184.952 1.00 43.80  ? 308 LEU 4 C   1 
ATOM 10348 O O   . LEU D 1 308 ? 78.155  32.110  186.090 1.00 32.97  ? 308 LEU 4 O   1 
ATOM 10349 C CB  . LEU D 1 308 ? 75.533  31.176  184.011 1.00 55.06  ? 308 LEU 4 CB  1 
ATOM 10350 C CG  . LEU D 1 308 ? 75.651  29.820  184.717 1.00 55.20  ? 308 LEU 4 CG  1 
ATOM 10351 C CD1 . LEU D 1 308 ? 75.434  30.000  186.210 1.00 33.08  ? 308 LEU 4 CD1 1 
ATOM 10352 C CD2 . LEU D 1 308 ? 74.640  28.837  184.117 1.00 62.16  ? 308 LEU 4 CD2 1 
ATOM 10353 N N   . ILE D 1 309 ? 78.385  31.946  183.829 1.00 44.07  ? 309 ILE 4 N   1 
ATOM 10354 C CA  . ILE D 1 309 ? 79.827  31.665  183.794 1.00 39.75  ? 309 ILE 4 CA  1 
ATOM 10355 C C   . ILE D 1 309 ? 80.533  32.596  184.728 1.00 34.56  ? 309 ILE 4 C   1 
ATOM 10356 O O   . ILE D 1 309 ? 81.477  32.248  185.422 1.00 34.40  ? 309 ILE 4 O   1 
ATOM 10357 C CB  . ILE D 1 309 ? 80.432  31.961  182.414 1.00 34.53  ? 309 ILE 4 CB  1 
ATOM 10358 C CG1 . ILE D 1 309 ? 79.909  31.000  181.353 1.00 49.14  ? 309 ILE 4 CG1 1 
ATOM 10359 C CG2 . ILE D 1 309 ? 81.912  31.840  182.476 1.00 16.57  ? 309 ILE 4 CG2 1 
ATOM 10360 C CD1 . ILE D 1 309 ? 80.465  31.279  179.960 1.00 35.90  ? 309 ILE 4 CD1 1 
ATOM 10361 N N   . ASN D 1 310 ? 80.070  33.818  184.678 1.00 38.31  ? 310 ASN 4 N   1 
ATOM 10362 C CA  . ASN D 1 310 ? 80.609  34.877  185.466 1.00 53.64  ? 310 ASN 4 CA  1 
ATOM 10363 C C   . ASN D 1 310 ? 80.465  34.582  186.962 1.00 55.88  ? 310 ASN 4 C   1 
ATOM 10364 O O   . ASN D 1 310 ? 81.401  34.787  187.750 1.00 46.67  ? 310 ASN 4 O   1 
ATOM 10365 C CB  . ASN D 1 310 ? 79.847  36.141  185.083 1.00 77.21  ? 310 ASN 4 CB  1 
ATOM 10366 C CG  . ASN D 1 310 ? 80.701  37.376  185.142 1.00 100.96 ? 310 ASN 4 CG  1 
ATOM 10367 O OD1 . ASN D 1 310 ? 80.635  38.225  184.245 1.00 129.38 ? 310 ASN 4 OD1 1 
ATOM 10368 N ND2 . ASN D 1 310 ? 81.519  37.494  186.193 1.00 98.38  ? 310 ASN 4 ND2 1 
ATOM 10369 N N   . ARG D 1 311 ? 79.282  34.118  187.353 1.00 60.12  ? 311 ARG 4 N   1 
ATOM 10370 C CA  . ARG D 1 311 ? 79.011  33.839  188.753 1.00 63.86  ? 311 ARG 4 CA  1 
ATOM 10371 C C   . ARG D 1 311 ? 79.768  32.620  189.191 1.00 67.98  ? 311 ARG 4 C   1 
ATOM 10372 O O   . ARG D 1 311 ? 80.312  32.584  190.301 1.00 72.21  ? 311 ARG 4 O   1 
ATOM 10373 C CB  . ARG D 1 311 ? 77.519  33.638  188.972 1.00 68.65  ? 311 ARG 4 CB  1 
ATOM 10374 C CG  . ARG D 1 311 ? 76.886  34.654  189.904 1.00 77.30  ? 311 ARG 4 CG  1 
ATOM 10375 C CD  . ARG D 1 311 ? 75.759  35.373  189.183 1.00 78.61  ? 311 ARG 4 CD  1 
ATOM 10376 N NE  . ARG D 1 311 ? 75.162  36.399  190.029 1.00 89.65  ? 311 ARG 4 NE  1 
ATOM 10377 C CZ  . ARG D 1 311 ? 74.769  37.589  189.584 1.00 97.09  ? 311 ARG 4 CZ  1 
ATOM 10378 N NH1 . ARG D 1 311 ? 74.905  37.897  188.298 1.00 95.77  ? 311 ARG 4 NH1 1 
ATOM 10379 N NH2 . ARG D 1 311 ? 74.273  38.486  190.437 1.00 112.84 ? 311 ARG 4 NH2 1 
ATOM 10380 N N   . ARG D 1 312 ? 79.780  31.626  188.302 1.00 71.73  ? 312 ARG 4 N   1 
ATOM 10381 C CA  . ARG D 1 312 ? 80.468  30.359  188.519 1.00 79.97  ? 312 ARG 4 CA  1 
ATOM 10382 C C   . ARG D 1 312 ? 81.972  30.592  188.650 1.00 78.20  ? 312 ARG 4 C   1 
ATOM 10383 O O   . ARG D 1 312 ? 82.675  29.867  189.354 1.00 80.88  ? 312 ARG 4 O   1 
ATOM 10384 C CB  . ARG D 1 312 ? 80.200  29.389  187.353 1.00 89.80  ? 312 ARG 4 CB  1 
ATOM 10385 C CG  . ARG D 1 312 ? 78.769  28.876  187.274 1.00 91.99  ? 312 ARG 4 CG  1 
ATOM 10386 C CD  . ARG D 1 312 ? 78.719  27.362  187.109 1.00 97.91  ? 312 ARG 4 CD  1 
ATOM 10387 N NE  . ARG D 1 312 ? 77.599  26.789  187.860 1.00 103.09 ? 312 ARG 4 NE  1 
ATOM 10388 C CZ  . ARG D 1 312 ? 77.074  25.579  187.653 1.00 115.30 ? 312 ARG 4 CZ  1 
ATOM 10389 N NH1 . ARG D 1 312 ? 77.558  24.783  186.703 1.00 125.99 ? 312 ARG 4 NH1 1 
ATOM 10390 N NH2 . ARG D 1 312 ? 76.064  25.153  188.407 1.00 126.11 ? 312 ARG 4 NH2 1 
ATOM 10391 N N   . THR D 1 313 ? 82.465  31.614  187.974 1.00 71.21  ? 313 THR 4 N   1 
ATOM 10392 C CA  . THR D 1 313 ? 83.873  31.907  188.031 1.00 62.95  ? 313 THR 4 CA  1 
ATOM 10393 C C   . THR D 1 313 ? 84.313  32.767  189.209 1.00 64.44  ? 313 THR 4 C   1 
ATOM 10394 O O   . THR D 1 313 ? 83.550  33.579  189.762 1.00 66.08  ? 313 THR 4 O   1 
ATOM 10395 C CB  . THR D 1 313 ? 84.353  32.480  186.703 1.00 55.19  ? 313 THR 4 CB  1 
ATOM 10396 O OG1 . THR D 1 313 ? 84.511  31.405  185.764 1.00 70.16  ? 313 THR 4 OG1 1 
ATOM 10397 C CG2 . THR D 1 313 ? 85.658  33.189  186.874 1.00 39.36  ? 313 THR 4 CG2 1 
ATOM 10398 N N   . GLN D 1 314 ? 85.548  32.512  189.619 1.00 55.80  ? 314 GLN 4 N   1 
ATOM 10399 C CA  . GLN D 1 314 ? 86.180  33.213  190.708 1.00 57.35  ? 314 GLN 4 CA  1 
ATOM 10400 C C   . GLN D 1 314 ? 86.529  34.663  190.368 1.00 63.79  ? 314 GLN 4 C   1 
ATOM 10401 O O   . GLN D 1 314 ? 86.692  35.043  189.197 1.00 68.79  ? 314 GLN 4 O   1 
ATOM 10402 C CB  . GLN D 1 314 ? 87.435  32.457  191.100 1.00 60.71  ? 314 GLN 4 CB  1 
ATOM 10403 C CG  . GLN D 1 314 ? 87.278  31.638  192.334 1.00 89.40  ? 314 GLN 4 CG  1 
ATOM 10404 C CD  . GLN D 1 314 ? 87.217  32.502  193.580 1.00 115.11 ? 314 GLN 4 CD  1 
ATOM 10405 O OE1 . GLN D 1 314 ? 86.780  33.658  193.538 1.00 125.45 ? 314 GLN 4 OE1 1 
ATOM 10406 N NE2 . GLN D 1 314 ? 87.655  31.941  194.703 1.00 137.21 ? 314 GLN 4 NE2 1 
ATOM 10407 N N   . ARG D 1 315 ? 86.636  35.488  191.397 1.00 62.81  ? 315 ARG 4 N   1 
ATOM 10408 C CA  . ARG D 1 315 ? 86.969  36.878  191.181 1.00 65.48  ? 315 ARG 4 CA  1 
ATOM 10409 C C   . ARG D 1 315 ? 88.422  37.011  191.433 1.00 62.03  ? 315 ARG 4 C   1 
ATOM 10410 O O   . ARG D 1 315 ? 88.978  36.361  192.331 1.00 61.20  ? 315 ARG 4 O   1 
ATOM 10411 C CB  . ARG D 1 315 ? 86.235  37.782  192.150 1.00 92.74  ? 315 ARG 4 CB  1 
ATOM 10412 C CG  . ARG D 1 315 ? 84.748  37.622  192.086 1.00 141.08 ? 315 ARG 4 CG  1 
ATOM 10413 C CD  . ARG D 1 315 ? 84.253  37.768  190.654 1.00 171.40 ? 315 ARG 4 CD  1 
ATOM 10414 N NE  . ARG D 1 315 ? 82.808  37.967  190.623 1.00 196.18 ? 315 ARG 4 NE  1 
ATOM 10415 C CZ  . ARG D 1 315 ? 82.195  39.045  191.110 1.00 203.39 ? 315 ARG 4 CZ  1 
ATOM 10416 N NH1 . ARG D 1 315 ? 82.909  40.028  191.665 1.00 203.78 ? 315 ARG 4 NH1 1 
ATOM 10417 N NH2 . ARG D 1 315 ? 80.869  39.134  191.063 1.00 208.52 ? 315 ARG 4 NH2 1 
ATOM 10418 N N   . VAL D 1 316 ? 89.037  37.907  190.684 1.00 57.85  ? 316 VAL 4 N   1 
ATOM 10419 C CA  . VAL D 1 316 ? 90.454  38.108  190.857 1.00 52.80  ? 316 VAL 4 CA  1 
ATOM 10420 C C   . VAL D 1 316 ? 90.833  39.532  191.228 1.00 54.42  ? 316 VAL 4 C   1 
ATOM 10421 O O   . VAL D 1 316 ? 90.378  40.523  190.626 1.00 46.61  ? 316 VAL 4 O   1 
ATOM 10422 C CB  . VAL D 1 316 ? 91.239  37.604  189.639 1.00 55.76  ? 316 VAL 4 CB  1 
ATOM 10423 C CG1 . VAL D 1 316 ? 92.129  36.451  190.057 1.00 36.37  ? 316 VAL 4 CG1 1 
ATOM 10424 C CG2 . VAL D 1 316 ? 90.255  37.141  188.528 1.00 67.60  ? 316 VAL 4 CG2 1 
ATOM 10425 N N   . ASP D 1 317 ? 91.580  39.611  192.317 1.00 60.00  ? 317 ASP 4 N   1 
ATOM 10426 C CA  . ASP D 1 317 ? 92.064  40.868  192.828 1.00 67.04  ? 317 ASP 4 CA  1 
ATOM 10427 C C   . ASP D 1 317 ? 93.536  40.827  192.500 1.00 67.94  ? 317 ASP 4 C   1 
ATOM 10428 O O   . ASP D 1 317 ? 94.338  40.092  193.116 1.00 54.61  ? 317 ASP 4 O   1 
ATOM 10429 C CB  . ASP D 1 317 ? 91.846  40.973  194.337 1.00 97.26  ? 317 ASP 4 CB  1 
ATOM 10430 C CG  . ASP D 1 317 ? 92.182  42.354  194.877 1.00 125.08 ? 317 ASP 4 CG  1 
ATOM 10431 O OD1 . ASP D 1 317 ? 91.767  43.349  194.235 1.00 152.69 ? 317 ASP 4 OD1 1 
ATOM 10432 O OD2 . ASP D 1 317 ? 92.866  42.447  195.925 1.00 129.47 ? 317 ASP 4 OD2 1 
ATOM 10433 N N   . GLY D 1 318 ? 93.864  41.533  191.434 1.00 70.11  ? 318 GLY 4 N   1 
ATOM 10434 C CA  . GLY D 1 318 ? 95.235  41.559  190.993 1.00 75.13  ? 318 GLY 4 CA  1 
ATOM 10435 C C   . GLY D 1 318 ? 95.524  42.913  190.444 1.00 68.99  ? 318 GLY 4 C   1 
ATOM 10436 O O   . GLY D 1 318 ? 94.612  43.737  190.313 1.00 81.74  ? 318 GLY 4 O   1 
ATOM 10437 N N   . GLN D 1 319 ? 96.769  43.081  190.016 1.00 54.88  ? 319 GLN 4 N   1 
ATOM 10438 C CA  . GLN D 1 319 ? 97.248  44.340  189.498 1.00 41.60  ? 319 GLN 4 CA  1 
ATOM 10439 C C   . GLN D 1 319 ? 96.215  45.029  188.595 1.00 43.80  ? 319 GLN 4 C   1 
ATOM 10440 O O   . GLN D 1 319 ? 95.456  44.387  187.842 1.00 50.16  ? 319 GLN 4 O   1 
ATOM 10441 C CB  . GLN D 1 319 ? 98.627  44.149  188.864 1.00 38.49  ? 319 GLN 4 CB  1 
ATOM 10442 C CG  . GLN D 1 319 ? 99.673  43.621  189.875 1.00 16.34  ? 319 GLN 4 CG  1 
ATOM 10443 C CD  . GLN D 1 319 ? 101.063 43.375  189.276 1.00 37.78  ? 319 GLN 4 CD  1 
ATOM 10444 O OE1 . GLN D 1 319 ? 101.452 44.004  188.291 1.00 63.75  ? 319 GLN 4 OE1 1 
ATOM 10445 N NE2 . GLN D 1 319 ? 101.814 42.444  189.866 1.00 37.14  ? 319 GLN 4 NE2 1 
ATOM 10446 N N   . PRO D 1 320 ? 96.048  46.330  188.814 1.00 36.64  ? 320 PRO 4 N   1 
ATOM 10447 C CA  . PRO D 1 320 ? 95.111  47.172  188.080 1.00 34.67  ? 320 PRO 4 CA  1 
ATOM 10448 C C   . PRO D 1 320 ? 95.367  47.236  186.608 1.00 31.04  ? 320 PRO 4 C   1 
ATOM 10449 O O   . PRO D 1 320 ? 96.500  47.386  186.168 1.00 33.81  ? 320 PRO 4 O   1 
ATOM 10450 C CB  . PRO D 1 320 ? 95.296  48.526  188.740 1.00 43.22  ? 320 PRO 4 CB  1 
ATOM 10451 C CG  . PRO D 1 320 ? 96.730  48.471  189.244 1.00 48.70  ? 320 PRO 4 CG  1 
ATOM 10452 C CD  . PRO D 1 320 ? 96.784  47.106  189.828 1.00 26.97  ? 320 PRO 4 CD  1 
ATOM 10453 N N   . MET D 1 321 ? 94.295  47.131  185.848 1.00 26.48  ? 321 MET 4 N   1 
ATOM 10454 C CA  . MET D 1 321 ? 94.387  47.185  184.410 1.00 33.33  ? 321 MET 4 CA  1 
ATOM 10455 C C   . MET D 1 321 ? 93.321  48.146  183.970 1.00 45.03  ? 321 MET 4 C   1 
ATOM 10456 O O   . MET D 1 321 ? 93.090  48.361  182.777 1.00 48.33  ? 321 MET 4 O   1 
ATOM 10457 C CB  . MET D 1 321 ? 94.069  45.814  183.793 1.00 43.92  ? 321 MET 4 CB  1 
ATOM 10458 C CG  . MET D 1 321 ? 95.160  44.763  183.855 1.00 30.36  ? 321 MET 4 CG  1 
ATOM 10459 S SD  . MET D 1 321 ? 96.741  45.405  183.329 1.00 57.97  ? 321 MET 4 SD  1 
ATOM 10460 C CE  . MET D 1 321 ? 97.789  44.722  184.605 1.00 23.42  ? 321 MET 4 CE  1 
ATOM 10461 N N   . ILE D 1 322 ? 92.631  48.729  184.925 1.00 55.98  ? 322 ILE 4 N   1 
ATOM 10462 C CA  . ILE D 1 322 ? 91.582  49.634  184.518 1.00 68.54  ? 322 ILE 4 CA  1 
ATOM 10463 C C   . ILE D 1 322 ? 91.656  51.019  185.147 1.00 76.97  ? 322 ILE 4 C   1 
ATOM 10464 O O   . ILE D 1 322 ? 91.937  51.170  186.353 1.00 66.58  ? 322 ILE 4 O   1 
ATOM 10465 C CB  . ILE D 1 322 ? 90.231  49.020  184.754 1.00 67.35  ? 322 ILE 4 CB  1 
ATOM 10466 C CG1 . ILE D 1 322 ? 89.166  49.822  184.008 1.00 70.19  ? 322 ILE 4 CG1 1 
ATOM 10467 C CG2 . ILE D 1 322 ? 89.972  48.915  186.263 1.00 74.12  ? 322 ILE 4 CG2 1 
ATOM 10468 C CD1 . ILE D 1 322 ? 88.434  49.022  182.955 1.00 70.38  ? 322 ILE 4 CD1 1 
ATOM 10469 N N   . GLY D 1 323 ? 91.457  52.017  184.286 1.00 82.01  ? 323 GLY 4 N   1 
ATOM 10470 C CA  . GLY D 1 323 ? 91.510  53.409  184.689 1.00 95.89  ? 323 GLY 4 CA  1 
ATOM 10471 C C   . GLY D 1 323 ? 92.742  53.798  185.497 1.00 102.88 ? 323 GLY 4 C   1 
ATOM 10472 O O   . GLY D 1 323 ? 93.889  53.668  185.058 1.00 100.07 ? 323 GLY 4 O   1 
ATOM 10473 N N   . MET D 1 324 ? 92.465  54.251  186.713 1.00 113.80 ? 324 MET 4 N   1 
ATOM 10474 C CA  . MET D 1 324 ? 93.453  54.709  187.686 1.00 115.19 ? 324 MET 4 CA  1 
ATOM 10475 C C   . MET D 1 324 ? 94.925  54.347  187.381 1.00 96.08  ? 324 MET 4 C   1 
ATOM 10476 O O   . MET D 1 324 ? 95.662  55.168  186.839 1.00 78.58  ? 324 MET 4 O   1 
ATOM 10477 C CB  . MET D 1 324 ? 93.043  54.257  189.115 1.00 139.32 ? 324 MET 4 CB  1 
ATOM 10478 C CG  . MET D 1 324 ? 91.506  54.068  189.397 1.00 155.61 ? 324 MET 4 CG  1 
ATOM 10479 S SD  . MET D 1 324 ? 90.345  55.491  189.250 1.00 164.18 ? 324 MET 4 SD  1 
ATOM 10480 C CE  . MET D 1 324 ? 90.353  56.090  190.937 1.00 160.64 ? 324 MET 4 CE  1 
ATOM 10481 N N   . SER D 1 325 ? 95.324  53.113  187.679 1.00 85.66  ? 325 SER 4 N   1 
ATOM 10482 C CA  . SER D 1 325 ? 96.706  52.667  187.458 1.00 78.69  ? 325 SER 4 CA  1 
ATOM 10483 C C   . SER D 1 325 ? 96.860  51.551  186.416 1.00 66.44  ? 325 SER 4 C   1 
ATOM 10484 O O   . SER D 1 325 ? 97.832  50.758  186.488 1.00 54.18  ? 325 SER 4 O   1 
ATOM 10485 C CB  . SER D 1 325 ? 97.333  52.203  188.783 1.00 86.98  ? 325 SER 4 CB  1 
ATOM 10486 O OG  . SER D 1 325 ? 97.160  53.168  189.806 1.00 101.60 ? 325 SER 4 OG  1 
ATOM 10487 N N   . SER D 1 326 ? 95.884  51.484  185.496 1.00 43.75  ? 326 SER 4 N   1 
ATOM 10488 C CA  . SER D 1 326 ? 95.835  50.506  184.411 1.00 31.03  ? 326 SER 4 CA  1 
ATOM 10489 C C   . SER D 1 326 ? 97.247  50.218  183.990 1.00 42.35  ? 326 SER 4 C   1 
ATOM 10490 O O   . SER D 1 326 ? 97.959  51.122  183.553 1.00 57.36  ? 326 SER 4 O   1 
ATOM 10491 C CB  . SER D 1 326 ? 95.108  51.113  183.218 1.00 36.36  ? 326 SER 4 CB  1 
ATOM 10492 O OG  . SER D 1 326 ? 95.288  50.336  182.049 1.00 59.03  ? 326 SER 4 OG  1 
ATOM 10493 N N   . GLN D 1 327 ? 97.689  48.981  184.159 1.00 40.73  ? 327 GLN 4 N   1 
ATOM 10494 C CA  . GLN D 1 327 ? 99.057  48.654  183.771 1.00 36.11  ? 327 GLN 4 CA  1 
ATOM 10495 C C   . GLN D 1 327 ? 99.037  48.200  182.323 1.00 38.29  ? 327 GLN 4 C   1 
ATOM 10496 O O   . GLN D 1 327 ? 99.896  47.426  181.851 1.00 44.81  ? 327 GLN 4 O   1 
ATOM 10497 C CB  . GLN D 1 327 ? 99.663  47.627  184.715 1.00 13.36  ? 327 GLN 4 CB  1 
ATOM 10498 C CG  . GLN D 1 327 ? 99.414  47.998  186.176 1.00 36.28  ? 327 GLN 4 CG  1 
ATOM 10499 C CD  . GLN D 1 327 ? 100.200 47.136  187.143 1.00 44.65  ? 327 GLN 4 CD  1 
ATOM 10500 O OE1 . GLN D 1 327 ? 100.256 47.415  188.349 1.00 44.74  ? 327 GLN 4 OE1 1 
ATOM 10501 N NE2 . GLN D 1 327 ? 100.821 46.085  186.623 1.00 51.70  ? 327 GLN 4 NE2 1 
ATOM 10502 N N   . VAL D 1 328 ? 97.966  48.624  181.662 1.00 18.51  ? 328 VAL 4 N   1 
ATOM 10503 C CA  . VAL D 1 328 ? 97.766  48.377  180.267 1.00 24.45  ? 328 VAL 4 CA  1 
ATOM 10504 C C   . VAL D 1 328 ? 98.410  49.589  179.646 1.00 40.26  ? 328 VAL 4 C   1 
ATOM 10505 O O   . VAL D 1 328 ? 97.887  50.703  179.740 1.00 54.58  ? 328 VAL 4 O   1 
ATOM 10506 C CB  . VAL D 1 328 ? 96.293  48.390  179.919 1.00 29.06  ? 328 VAL 4 CB  1 
ATOM 10507 C CG1 . VAL D 1 328 ? 96.086  48.351  178.375 1.00 16.36  ? 328 VAL 4 CG1 1 
ATOM 10508 C CG2 . VAL D 1 328 ? 95.612  47.231  180.632 1.00 34.38  ? 328 VAL 4 CG2 1 
ATOM 10509 N N   . GLU D 1 329 ? 99.584  49.373  179.073 1.00 51.87  ? 329 GLU 4 N   1 
ATOM 10510 C CA  . GLU D 1 329 ? 100.339 50.431  178.433 1.00 41.67  ? 329 GLU 4 CA  1 
ATOM 10511 C C   . GLU D 1 329 ? 99.766  50.941  177.108 1.00 36.09  ? 329 GLU 4 C   1 
ATOM 10512 O O   . GLU D 1 329 ? 100.043 52.073  176.745 1.00 51.70  ? 329 GLU 4 O   1 
ATOM 10513 C CB  . GLU D 1 329 ? 101.781 49.995  178.234 1.00 42.63  ? 329 GLU 4 CB  1 
ATOM 10514 C CG  . GLU D 1 329 ? 102.614 50.013  179.479 1.00 50.53  ? 329 GLU 4 CG  1 
ATOM 10515 C CD  . GLU D 1 329 ? 103.952 50.673  179.237 1.00 67.28  ? 329 GLU 4 CD  1 
ATOM 10516 O OE1 . GLU D 1 329 ? 103.959 51.794  178.665 1.00 79.64  ? 329 GLU 4 OE1 1 
ATOM 10517 O OE2 . GLU D 1 329 ? 104.988 50.067  179.599 1.00 68.24  ? 329 GLU 4 OE2 1 
ATOM 10518 N N   . GLU D 1 330 ? 98.981  50.141  176.387 1.00 22.72  ? 330 GLU 4 N   1 
ATOM 10519 C CA  . GLU D 1 330 ? 98.420  50.600  175.114 1.00 30.09  ? 330 GLU 4 CA  1 
ATOM 10520 C C   . GLU D 1 330 ? 97.598  49.532  174.423 1.00 32.66  ? 330 GLU 4 C   1 
ATOM 10521 O O   . GLU D 1 330 ? 97.836  48.335  174.573 1.00 53.53  ? 330 GLU 4 O   1 
ATOM 10522 C CB  . GLU D 1 330 ? 99.537  51.088  174.164 1.00 45.03  ? 330 GLU 4 CB  1 
ATOM 10523 C CG  . GLU D 1 330 ? 99.123  51.505  172.713 1.00 72.36  ? 330 GLU 4 CG  1 
ATOM 10524 C CD  . GLU D 1 330 ? 100.215 52.319  171.982 1.00 87.72  ? 330 GLU 4 CD  1 
ATOM 10525 O OE1 . GLU D 1 330 ? 101.240 51.753  171.512 1.00 92.92  ? 330 GLU 4 OE1 1 
ATOM 10526 O OE2 . GLU D 1 330 ? 100.050 53.549  171.889 1.00 107.30 ? 330 GLU 4 OE2 1 
ATOM 10527 N N   . VAL D 1 331 ? 96.658  49.975  173.616 1.00 17.92  ? 331 VAL 4 N   1 
ATOM 10528 C CA  . VAL D 1 331 ? 95.818  49.060  172.909 1.00 33.92  ? 331 VAL 4 CA  1 
ATOM 10529 C C   . VAL D 1 331 ? 95.667  49.599  171.527 1.00 41.38  ? 331 VAL 4 C   1 
ATOM 10530 O O   . VAL D 1 331 ? 95.407  50.788  171.336 1.00 50.88  ? 331 VAL 4 O   1 
ATOM 10531 C CB  . VAL D 1 331 ? 94.422  49.005  173.529 1.00 36.70  ? 331 VAL 4 CB  1 
ATOM 10532 C CG1 . VAL D 1 331 ? 93.537  48.041  172.740 1.00 41.16  ? 331 VAL 4 CG1 1 
ATOM 10533 C CG2 . VAL D 1 331 ? 94.519  48.597  174.986 1.00 20.28  ? 331 VAL 4 CG2 1 
ATOM 10534 N N   . ARG D 1 332 ? 95.827  48.732  170.553 1.00 38.56  ? 332 ARG 4 N   1 
ATOM 10535 C CA  . ARG D 1 332 ? 95.659  49.176  169.198 1.00 41.37  ? 332 ARG 4 CA  1 
ATOM 10536 C C   . ARG D 1 332 ? 94.672  48.224  168.600 1.00 31.26  ? 332 ARG 4 C   1 
ATOM 10537 O O   . ARG D 1 332 ? 94.530  47.081  169.045 1.00 29.44  ? 332 ARG 4 O   1 
ATOM 10538 C CB  . ARG D 1 332 ? 96.981  49.113  168.458 1.00 62.51  ? 332 ARG 4 CB  1 
ATOM 10539 C CG  . ARG D 1 332 ? 98.109  49.787  169.198 1.00 75.74  ? 332 ARG 4 CG  1 
ATOM 10540 C CD  . ARG D 1 332 ? 99.442  49.530  168.511 1.00 91.29  ? 332 ARG 4 CD  1 
ATOM 10541 N NE  . ARG D 1 332 ? 100.444 50.484  168.969 1.00 96.14  ? 332 ARG 4 NE  1 
ATOM 10542 C CZ  . ARG D 1 332 ? 101.129 51.296  168.170 1.00 95.69  ? 332 ARG 4 CZ  1 
ATOM 10543 N NH1 . ARG D 1 332 ? 100.937 51.267  166.846 1.00 84.13  ? 332 ARG 4 NH1 1 
ATOM 10544 N NH2 . ARG D 1 332 ? 101.954 52.188  168.710 1.00 100.89 ? 332 ARG 4 NH2 1 
ATOM 10545 N N   . VAL D 1 333 ? 93.999  48.678  167.569 1.00 15.58  ? 333 VAL 4 N   1 
ATOM 10546 C CA  . VAL D 1 333 ? 93.016  47.836  166.954 1.00 21.21  ? 333 VAL 4 CA  1 
ATOM 10547 C C   . VAL D 1 333 ? 93.036  48.011  165.477 1.00 29.56  ? 333 VAL 4 C   1 
ATOM 10548 O O   . VAL D 1 333 ? 92.889  49.126  164.964 1.00 38.80  ? 333 VAL 4 O   1 
ATOM 10549 C CB  . VAL D 1 333 ? 91.642  48.209  167.412 1.00 21.74  ? 333 VAL 4 CB  1 
ATOM 10550 C CG1 . VAL D 1 333 ? 90.617  47.272  166.769 1.00 33.27  ? 333 VAL 4 CG1 1 
ATOM 10551 C CG2 . VAL D 1 333 ? 91.579  48.164  168.933 1.00 28.21  ? 333 VAL 4 CG2 1 
ATOM 10552 N N   . TYR D 1 334 ? 93.115  46.897  164.779 1.00 26.09  ? 334 TYR 4 N   1 
ATOM 10553 C CA  . TYR D 1 334 ? 93.162  46.980  163.348 1.00 42.72  ? 334 TYR 4 CA  1 
ATOM 10554 C C   . TYR D 1 334 ? 91.894  46.389  162.848 1.00 47.80  ? 334 TYR 4 C   1 
ATOM 10555 O O   . TYR D 1 334 ? 91.302  45.559  163.537 1.00 48.93  ? 334 TYR 4 O   1 
ATOM 10556 C CB  . TYR D 1 334 ? 94.329  46.152  162.848 1.00 46.08  ? 334 TYR 4 CB  1 
ATOM 10557 C CG  . TYR D 1 334 ? 95.612  46.490  163.558 1.00 40.36  ? 334 TYR 4 CG  1 
ATOM 10558 C CD1 . TYR D 1 334 ? 95.737  46.307  164.930 1.00 35.07  ? 334 TYR 4 CD1 1 
ATOM 10559 C CD2 . TYR D 1 334 ? 96.681  47.039  162.868 1.00 54.96  ? 334 TYR 4 CD2 1 
ATOM 10560 C CE1 . TYR D 1 334 ? 96.886  46.669  165.603 1.00 47.58  ? 334 TYR 4 CE1 1 
ATOM 10561 C CE2 . TYR D 1 334 ? 97.849  47.404  163.531 1.00 69.94  ? 334 TYR 4 CE2 1 
ATOM 10562 C CZ  . TYR D 1 334 ? 97.941  47.221  164.903 1.00 60.37  ? 334 TYR 4 CZ  1 
ATOM 10563 O OH  . TYR D 1 334 ? 99.071  47.641  165.569 1.00 65.35  ? 334 TYR 4 OH  1 
ATOM 10564 N N   . GLU D 1 335 ? 91.387  46.897  161.736 1.00 56.02  ? 335 GLU 4 N   1 
ATOM 10565 C CA  . GLU D 1 335 ? 90.212  46.270  161.184 1.00 72.08  ? 335 GLU 4 CA  1 
ATOM 10566 C C   . GLU D 1 335 ? 90.732  45.618  159.943 1.00 91.30  ? 335 GLU 4 C   1 
ATOM 10567 O O   . GLU D 1 335 ? 91.220  44.492  160.009 1.00 115.03 ? 335 GLU 4 O   1 
ATOM 10568 C CB  . GLU D 1 335 ? 89.121  47.267  160.828 1.00 86.22  ? 335 GLU 4 CB  1 
ATOM 10569 C CG  . GLU D 1 335 ? 87.678  46.642  160.721 1.00 95.61  ? 335 GLU 4 CG  1 
ATOM 10570 C CD  . GLU D 1 335 ? 86.648  47.552  160.117 1.00 137.31 ? 335 GLU 4 CD  1 
ATOM 10571 O OE1 . GLU D 1 335 ? 86.960  48.774  159.918 1.00 151.66 ? 335 GLU 4 OE1 1 
ATOM 10572 O OE2 . GLU D 1 335 ? 85.499  47.039  159.799 1.00 137.21 ? 335 GLU 4 OE2 1 
ATOM 10573 N N   . ASP D 1 336 ? 90.847  46.379  158.862 1.00 90.43  ? 336 ASP 4 N   1 
ATOM 10574 C CA  . ASP D 1 336 ? 91.292  45.774  157.624 1.00 111.67 ? 336 ASP 4 CA  1 
ATOM 10575 C C   . ASP D 1 336 ? 92.735  46.040  157.206 1.00 115.21 ? 336 ASP 4 C   1 
ATOM 10576 O O   . ASP D 1 336 ? 93.690  45.888  157.994 1.00 113.53 ? 336 ASP 4 O   1 
ATOM 10577 C CB  . ASP D 1 336 ? 90.283  46.073  156.489 1.00 112.65 ? 336 ASP 4 CB  1 
ATOM 10578 C CG  . ASP D 1 336 ? 89.036  45.233  156.587 1.00 128.36 ? 336 ASP 4 CG  1 
ATOM 10579 O OD1 . ASP D 1 336 ? 88.935  44.433  157.566 1.00 157.92 ? 336 ASP 4 OD1 1 
ATOM 10580 O OD2 . ASP D 1 336 ? 88.174  45.361  155.678 1.00 145.91 ? 336 ASP 4 OD2 1 
ATOM 10581 N N   . THR D 1 337 ? 92.865  46.474  155.959 1.00 123.52 ? 337 THR 4 N   1 
ATOM 10582 C CA  . THR D 1 337 ? 94.124  46.740  155.319 1.00 122.49 ? 337 THR 4 CA  1 
ATOM 10583 C C   . THR D 1 337 ? 94.047  47.998  154.479 1.00 125.66 ? 337 THR 4 C   1 
ATOM 10584 O O   . THR D 1 337 ? 92.971  48.560  154.238 1.00 132.52 ? 337 THR 4 O   1 
ATOM 10585 C CB  . THR D 1 337 ? 94.409  45.603  154.291 1.00 119.71 ? 337 THR 4 CB  1 
ATOM 10586 O OG1 . THR D 1 337 ? 93.359  45.569  153.299 1.00 118.56 ? 337 THR 4 OG1 1 
ATOM 10587 C CG2 . THR D 1 337 ? 94.465  44.260  154.978 1.00 125.87 ? 337 THR 4 CG2 1 
ATOM 10588 N N   . GLU D 1 338 ? 95.223  48.462  154.104 1.00 118.98 ? 338 GLU 4 N   1 
ATOM 10589 C CA  . GLU D 1 338 ? 95.406  49.558  153.161 1.00 123.81 ? 338 GLU 4 CA  1 
ATOM 10590 C C   . GLU D 1 338 ? 96.866  49.869  152.951 1.00 114.74 ? 338 GLU 4 C   1 
ATOM 10591 O O   . GLU D 1 338 ? 97.730  49.214  153.532 1.00 103.13 ? 338 GLU 4 O   1 
ATOM 10592 C CB  . GLU D 1 338 ? 94.541  50.833  153.347 1.00 139.30 ? 338 GLU 4 CB  1 
ATOM 10593 C CG  . GLU D 1 338 ? 94.096  51.253  154.728 1.00 159.10 ? 338 GLU 4 CG  1 
ATOM 10594 C CD  . GLU D 1 338 ? 93.528  52.678  154.738 1.00 173.64 ? 338 GLU 4 CD  1 
ATOM 10595 O OE1 . GLU D 1 338 ? 94.269  53.627  154.386 1.00 172.29 ? 338 GLU 4 OE1 1 
ATOM 10596 O OE2 . GLU D 1 338 ? 92.338  52.850  155.087 1.00 185.66 ? 338 GLU 4 OE2 1 
ATOM 10597 N N   . GLU D 1 339 ? 97.126  50.840  152.087 1.00 113.53 ? 339 GLU 4 N   1 
ATOM 10598 C CA  . GLU D 1 339 ? 98.480  51.244  151.744 1.00 109.08 ? 339 GLU 4 CA  1 
ATOM 10599 C C   . GLU D 1 339 ? 99.392  51.536  152.923 1.00 101.58 ? 339 GLU 4 C   1 
ATOM 10600 O O   . GLU D 1 339 ? 99.202  52.507  153.654 1.00 95.43  ? 339 GLU 4 O   1 
ATOM 10601 C CB  . GLU D 1 339 ? 98.427  52.430  150.787 1.00 121.76 ? 339 GLU 4 CB  1 
ATOM 10602 C CG  . GLU D 1 339 ? 97.547  52.152  149.564 1.00 135.86 ? 339 GLU 4 CG  1 
ATOM 10603 C CD  . GLU D 1 339 ? 97.957  52.956  148.331 1.00 147.09 ? 339 GLU 4 CD  1 
ATOM 10604 O OE1 . GLU D 1 339 ? 98.862  53.819  148.431 1.00 156.45 ? 339 GLU 4 OE1 1 
ATOM 10605 O OE2 . GLU D 1 339 ? 97.376  52.713  147.251 1.00 144.05 ? 339 GLU 4 OE2 1 
ATOM 10606 N N   . LEU D 1 340 ? 100.386 50.664  153.078 1.00 97.86  ? 340 LEU 4 N   1 
ATOM 10607 C CA  . LEU D 1 340 ? 101.385 50.743  154.128 1.00 101.93 ? 340 LEU 4 CA  1 
ATOM 10608 C C   . LEU D 1 340 ? 101.837 52.171  154.418 1.00 110.28 ? 340 LEU 4 C   1 
ATOM 10609 O O   . LEU D 1 340 ? 101.995 52.989  153.501 1.00 115.41 ? 340 LEU 4 O   1 
ATOM 10610 C CB  . LEU D 1 340 ? 102.597 49.888  153.741 1.00 82.25  ? 340 LEU 4 CB  1 
ATOM 10611 C CG  . LEU D 1 340 ? 103.962 50.301  154.279 1.00 77.69  ? 340 LEU 4 CG  1 
ATOM 10612 C CD1 . LEU D 1 340 ? 104.033 50.266  155.819 1.00 77.09  ? 340 LEU 4 CD1 1 
ATOM 10613 C CD2 . LEU D 1 340 ? 104.967 49.381  153.635 1.00 72.90  ? 340 LEU 4 CD2 1 
ATOM 10614 N N   . PRO D 1 341 ? 101.944 52.513  155.704 1.00 116.81 ? 341 PRO 4 N   1 
ATOM 10615 C CA  . PRO D 1 341 ? 102.333 53.840  156.143 1.00 117.89 ? 341 PRO 4 CA  1 
ATOM 10616 C C   . PRO D 1 341 ? 103.102 53.922  157.476 1.00 120.83 ? 341 PRO 4 C   1 
ATOM 10617 O O   . PRO D 1 341 ? 102.582 53.618  158.560 1.00 113.02 ? 341 PRO 4 O   1 
ATOM 10618 C CB  . PRO D 1 341 ? 101.006 54.540  156.263 1.00 122.44 ? 341 PRO 4 CB  1 
ATOM 10619 C CG  . PRO D 1 341 ? 100.101 53.392  156.801 1.00 126.52 ? 341 PRO 4 CG  1 
ATOM 10620 C CD  . PRO D 1 341 ? 100.849 52.067  156.587 1.00 119.40 ? 341 PRO 4 CD  1 
ATOM 10621 N N   . GLY D 1 342 ? 104.321 54.402  157.374 1.00 127.92 ? 342 GLY 4 N   1 
ATOM 10622 C CA  . GLY D 1 342 ? 105.170 54.601  158.531 1.00 139.02 ? 342 GLY 4 CA  1 
ATOM 10623 C C   . GLY D 1 342 ? 106.007 55.799  158.134 1.00 149.45 ? 342 GLY 4 C   1 
ATOM 10624 O O   . GLY D 1 342 ? 107.122 55.980  158.630 1.00 153.98 ? 342 GLY 4 O   1 
ATOM 10625 N N   . ASP D 1 343 ? 105.377 56.650  157.309 1.00 152.07 ? 343 ASP 4 N   1 
ATOM 10626 C CA  . ASP D 1 343 ? 105.924 57.856  156.635 1.00 153.25 ? 343 ASP 4 CA  1 
ATOM 10627 C C   . ASP D 1 343 ? 106.349 59.156  157.334 1.00 141.62 ? 343 ASP 4 C   1 
ATOM 10628 O O   . ASP D 1 343 ? 106.829 60.098  156.666 1.00 120.47 ? 343 ASP 4 O   1 
ATOM 10629 C CB  . ASP D 1 343 ? 104.985 58.218  155.473 1.00 163.14 ? 343 ASP 4 CB  1 
ATOM 10630 C CG  . ASP D 1 343 ? 104.491 56.987  154.711 1.00 171.14 ? 343 ASP 4 CG  1 
ATOM 10631 O OD1 . ASP D 1 343 ? 103.635 56.254  155.257 1.00 157.58 ? 343 ASP 4 OD1 1 
ATOM 10632 O OD2 . ASP D 1 343 ? 104.967 56.742  153.580 1.00 182.59 ? 343 ASP 4 OD2 1 
ATOM 10633 N N   . LYS E 1 15  ? -9.218  22.120  181.463 1.00 163.91 ? 15  LYS 5 N   1 
ATOM 10634 C CA  . LYS E 1 15  ? -7.971  21.702  182.088 1.00 162.02 ? 15  LYS 5 CA  1 
ATOM 10635 C C   . LYS E 1 15  ? -8.012  20.241  182.552 1.00 164.97 ? 15  LYS 5 C   1 
ATOM 10636 O O   . LYS E 1 15  ? -8.976  19.783  183.198 1.00 161.82 ? 15  LYS 5 O   1 
ATOM 10637 C CB  . LYS E 1 15  ? -7.607  22.642  183.250 1.00 152.53 ? 15  LYS 5 CB  1 
ATOM 10638 C CG  . LYS E 1 15  ? -8.743  22.866  184.220 1.00 152.84 ? 15  LYS 5 CG  1 
ATOM 10639 C CD  . LYS E 1 15  ? -8.440  23.949  185.220 1.00 157.09 ? 15  LYS 5 CD  1 
ATOM 10640 C CE  . LYS E 1 15  ? -9.741  24.441  185.830 1.00 170.07 ? 15  LYS 5 CE  1 
ATOM 10641 N NZ  . LYS E 1 15  ? -10.597 23.366  186.443 1.00 182.08 ? 15  LYS 5 NZ  1 
ATOM 10642 N N   . LYS E 1 16  ? -6.963  19.533  182.158 1.00 168.01 ? 16  LYS 5 N   1 
ATOM 10643 C CA  . LYS E 1 16  ? -6.755  18.128  182.462 1.00 168.98 ? 16  LYS 5 CA  1 
ATOM 10644 C C   . LYS E 1 16  ? -5.469  18.149  183.296 1.00 171.10 ? 16  LYS 5 C   1 
ATOM 10645 O O   . LYS E 1 16  ? -4.597  19.015  183.057 1.00 171.47 ? 16  LYS 5 O   1 
ATOM 10646 C CB  . LYS E 1 16  ? -6.533  17.344  181.129 1.00 171.30 ? 16  LYS 5 CB  1 
ATOM 10647 C CG  . LYS E 1 16  ? -5.162  16.628  180.945 1.00 172.96 ? 16  LYS 5 CG  1 
ATOM 10648 C CD  . LYS E 1 16  ? -4.648  16.507  179.481 1.00 171.50 ? 16  LYS 5 CD  1 
ATOM 10649 C CE  . LYS E 1 16  ? -4.033  17.819  178.912 1.00 171.88 ? 16  LYS 5 CE  1 
ATOM 10650 N NZ  . LYS E 1 16  ? -2.691  18.241  179.462 1.00 162.18 ? 16  LYS 5 NZ  1 
ATOM 10651 N N   . PRO E 1 17  ? -5.393  17.332  184.366 1.00 171.83 ? 17  PRO 5 N   1 
ATOM 10652 C CA  . PRO E 1 17  ? -4.152  17.343  185.148 1.00 170.73 ? 17  PRO 5 CA  1 
ATOM 10653 C C   . PRO E 1 17  ? -3.099  16.860  184.133 1.00 173.39 ? 17  PRO 5 C   1 
ATOM 10654 O O   . PRO E 1 17  ? -3.450  16.524  183.004 1.00 180.24 ? 17  PRO 5 O   1 
ATOM 10655 C CB  . PRO E 1 17  ? -4.421  16.306  186.230 1.00 167.79 ? 17  PRO 5 CB  1 
ATOM 10656 C CG  . PRO E 1 17  ? -5.945  16.350  186.391 1.00 167.26 ? 17  PRO 5 CG  1 
ATOM 10657 C CD  . PRO E 1 17  ? -6.409  16.432  184.957 1.00 166.24 ? 17  PRO 5 CD  1 
ATOM 10658 N N   . LYS E 1 18  ? -1.836  16.749  184.494 1.00 171.77 ? 18  LYS 5 N   1 
ATOM 10659 C CA  . LYS E 1 18  ? -0.952  16.318  183.430 1.00 174.15 ? 18  LYS 5 CA  1 
ATOM 10660 C C   . LYS E 1 18  ? -0.860  14.804  183.378 1.00 172.05 ? 18  LYS 5 C   1 
ATOM 10661 O O   . LYS E 1 18  ? -1.606  14.139  182.652 1.00 171.68 ? 18  LYS 5 O   1 
ATOM 10662 C CB  . LYS E 1 18  ? 0.381   17.038  183.548 1.00 179.68 ? 18  LYS 5 CB  1 
ATOM 10663 C CG  . LYS E 1 18  ? 0.141   18.522  183.345 1.00 184.72 ? 18  LYS 5 CG  1 
ATOM 10664 C CD  . LYS E 1 18  ? 1.259   19.392  183.791 1.00 190.01 ? 18  LYS 5 CD  1 
ATOM 10665 C CE  . LYS E 1 18  ? 0.836   20.843  183.739 1.00 192.96 ? 18  LYS 5 CE  1 
ATOM 10666 N NZ  . LYS E 1 18  ? 2.008   21.730  183.884 1.00 203.24 ? 18  LYS 5 NZ  1 
ATOM 10667 N N   . GLU E 1 19  ? 0.029   14.273  184.192 1.00 164.89 ? 19  GLU 5 N   1 
ATOM 10668 C CA  . GLU E 1 19  ? 0.213   12.846  184.310 1.00 162.26 ? 19  GLU 5 CA  1 
ATOM 10669 C C   . GLU E 1 19  ? 1.118   12.707  185.515 1.00 152.08 ? 19  GLU 5 C   1 
ATOM 10670 O O   . GLU E 1 19  ? 1.972   13.576  185.757 1.00 147.98 ? 19  GLU 5 O   1 
ATOM 10671 C CB  . GLU E 1 19  ? 0.909   12.271  183.072 1.00 173.08 ? 19  GLU 5 CB  1 
ATOM 10672 C CG  . GLU E 1 19  ? 0.836   10.737  182.967 1.00 196.50 ? 19  GLU 5 CG  1 
ATOM 10673 C CD  . GLU E 1 19  ? 1.919   10.117  182.075 1.00 209.99 ? 19  GLU 5 CD  1 
ATOM 10674 O OE1 . GLU E 1 19  ? 2.232   10.690  181.008 1.00 218.77 ? 19  GLU 5 OE1 1 
ATOM 10675 O OE2 . GLU E 1 19  ? 2.458   9.049   182.452 1.00 217.03 ? 19  GLU 5 OE2 1 
ATOM 10676 N N   . PRO E 1 20  ? 0.834   11.716  186.378 1.00 143.78 ? 20  PRO 5 N   1 
ATOM 10677 C CA  . PRO E 1 20  ? 1.677   11.513  187.559 1.00 142.28 ? 20  PRO 5 CA  1 
ATOM 10678 C C   . PRO E 1 20  ? 3.117   11.426  187.016 1.00 150.72 ? 20  PRO 5 C   1 
ATOM 10679 O O   . PRO E 1 20  ? 3.404   10.640  186.102 1.00 151.15 ? 20  PRO 5 O   1 
ATOM 10680 C CB  . PRO E 1 20  ? 1.187   10.168  188.090 1.00 128.65 ? 20  PRO 5 CB  1 
ATOM 10681 C CG  . PRO E 1 20  ? -0.260  10.161  187.686 1.00 125.27 ? 20  PRO 5 CG  1 
ATOM 10682 C CD  . PRO E 1 20  ? -0.274  10.742  186.319 1.00 136.13 ? 20  PRO 5 CD  1 
ATOM 10683 N N   . VAL E 1 21  ? 3.995   12.287  187.521 1.00 156.99 ? 21  VAL 5 N   1 
ATOM 10684 C CA  . VAL E 1 21  ? 5.388   12.334  187.058 1.00 159.23 ? 21  VAL 5 CA  1 
ATOM 10685 C C   . VAL E 1 21  ? 6.224   11.107  187.453 1.00 153.40 ? 21  VAL 5 C   1 
ATOM 10686 O O   . VAL E 1 21  ? 6.142   10.637  188.597 1.00 158.25 ? 21  VAL 5 O   1 
ATOM 10687 C CB  . VAL E 1 21  ? 6.081   13.625  187.552 1.00 167.51 ? 21  VAL 5 CB  1 
ATOM 10688 C CG1 . VAL E 1 21  ? 7.400   13.841  186.799 1.00 172.13 ? 21  VAL 5 CG1 1 
ATOM 10689 C CG2 . VAL E 1 21  ? 5.134   14.832  187.380 1.00 172.64 ? 21  VAL 5 CG2 1 
ATOM 10690 N N   . GLN E 1 22  ? 7.052   10.619  186.521 1.00 143.39 ? 22  GLN 5 N   1 
ATOM 10691 C CA  . GLN E 1 22  ? 7.876   9.435   186.776 1.00 130.28 ? 22  GLN 5 CA  1 
ATOM 10692 C C   . GLN E 1 22  ? 9.103   9.578   187.677 1.00 113.16 ? 22  GLN 5 C   1 
ATOM 10693 O O   . GLN E 1 22  ? 10.181  9.990   187.246 1.00 109.43 ? 22  GLN 5 O   1 
ATOM 10694 C CB  . GLN E 1 22  ? 8.220   8.691   185.476 1.00 132.50 ? 22  GLN 5 CB  1 
ATOM 10695 C CG  . GLN E 1 22  ? 7.077   7.757   185.020 1.00 149.57 ? 22  GLN 5 CG  1 
ATOM 10696 C CD  . GLN E 1 22  ? 7.469   6.745   183.936 1.00 160.13 ? 22  GLN 5 CD  1 
ATOM 10697 O OE1 . GLN E 1 22  ? 8.651   6.530   183.660 1.00 168.00 ? 22  GLN 5 OE1 1 
ATOM 10698 N NE2 . GLN E 1 22  ? 6.466   6.115   183.324 1.00 163.60 ? 22  GLN 5 NE2 1 
ATOM 10699 N N   . VAL E 1 23  ? 8.889   9.255   188.948 1.00 92.55  ? 23  VAL 5 N   1 
ATOM 10700 C CA  . VAL E 1 23  ? 9.914   9.280   189.968 1.00 76.11  ? 23  VAL 5 CA  1 
ATOM 10701 C C   . VAL E 1 23  ? 10.685  7.952   189.860 1.00 83.71  ? 23  VAL 5 C   1 
ATOM 10702 O O   . VAL E 1 23  ? 10.378  7.112   189.002 1.00 82.14  ? 23  VAL 5 O   1 
ATOM 10703 C CB  . VAL E 1 23  ? 9.257   9.386   191.367 1.00 66.55  ? 23  VAL 5 CB  1 
ATOM 10704 C CG1 . VAL E 1 23  ? 8.721   10.759  191.573 1.00 72.66  ? 23  VAL 5 CG1 1 
ATOM 10705 C CG2 . VAL E 1 23  ? 8.128   8.380   191.515 1.00 57.89  ? 23  VAL 5 CG2 1 
ATOM 10706 N N   . PRO E 1 24  ? 11.719  7.752   190.695 1.00 80.01  ? 24  PRO 5 N   1 
ATOM 10707 C CA  . PRO E 1 24  ? 12.434  6.486   190.591 1.00 68.49  ? 24  PRO 5 CA  1 
ATOM 10708 C C   . PRO E 1 24  ? 11.505  5.440   191.209 1.00 67.27  ? 24  PRO 5 C   1 
ATOM 10709 O O   . PRO E 1 24  ? 10.834  5.694   192.224 1.00 64.13  ? 24  PRO 5 O   1 
ATOM 10710 C CB  . PRO E 1 24  ? 13.656  6.733   191.458 1.00 65.03  ? 24  PRO 5 CB  1 
ATOM 10711 C CG  . PRO E 1 24  ? 13.082  7.544   192.581 1.00 70.99  ? 24  PRO 5 CG  1 
ATOM 10712 C CD  . PRO E 1 24  ? 12.218  8.536   191.841 1.00 83.29  ? 24  PRO 5 CD  1 
ATOM 10713 N N   . LYS E 1 25  ? 11.436  4.282   190.575 1.00 59.65  ? 25  LYS 5 N   1 
ATOM 10714 C CA  . LYS E 1 25  ? 10.576  3.213   191.038 1.00 49.85  ? 25  LYS 5 CA  1 
ATOM 10715 C C   . LYS E 1 25  ? 11.209  2.379   192.132 1.00 46.26  ? 25  LYS 5 C   1 
ATOM 10716 O O   . LYS E 1 25  ? 12.192  1.674   191.895 1.00 53.48  ? 25  LYS 5 O   1 
ATOM 10717 C CB  . LYS E 1 25  ? 10.227  2.332   189.849 1.00 59.85  ? 25  LYS 5 CB  1 
ATOM 10718 C CG  . LYS E 1 25  ? 9.768   0.923   190.177 1.00 76.07  ? 25  LYS 5 CG  1 
ATOM 10719 C CD  . LYS E 1 25  ? 10.183  -0.028  189.045 1.00 97.96  ? 25  LYS 5 CD  1 
ATOM 10720 C CE  . LYS E 1 25  ? 9.659   -1.441  189.244 1.00 106.95 ? 25  LYS 5 CE  1 
ATOM 10721 N NZ  . LYS E 1 25  ? 8.189   -1.536  189.032 1.00 111.73 ? 25  LYS 5 NZ  1 
ATOM 10722 N N   . LEU E 1 26  ? 10.691  2.489   193.348 1.00 39.85  ? 26  LEU 5 N   1 
ATOM 10723 C CA  . LEU E 1 26  ? 11.217  1.663   194.429 1.00 40.32  ? 26  LEU 5 CA  1 
ATOM 10724 C C   . LEU E 1 26  ? 10.942  0.247   193.977 1.00 43.68  ? 26  LEU 5 C   1 
ATOM 10725 O O   . LEU E 1 26  ? 10.069  0.025   193.156 1.00 52.31  ? 26  LEU 5 O   1 
ATOM 10726 C CB  . LEU E 1 26  ? 10.461  1.894   195.732 1.00 16.25  ? 26  LEU 5 CB  1 
ATOM 10727 C CG  . LEU E 1 26  ? 10.750  0.846   196.817 1.00 27.01  ? 26  LEU 5 CG  1 
ATOM 10728 C CD1 . LEU E 1 26  ? 12.242  0.666   196.998 1.00 46.78  ? 26  LEU 5 CD1 1 
ATOM 10729 C CD2 . LEU E 1 26  ? 10.139  1.280   198.130 1.00 31.03  ? 26  LEU 5 CD2 1 
ATOM 10730 N N   . VAL E 1 27  ? 11.698  -0.717  194.458 1.00 49.20  ? 27  VAL 5 N   1 
ATOM 10731 C CA  . VAL E 1 27  ? 11.425  -2.060  194.028 1.00 43.30  ? 27  VAL 5 CA  1 
ATOM 10732 C C   . VAL E 1 27  ? 11.255  -2.942  195.217 1.00 39.52  ? 27  VAL 5 C   1 
ATOM 10733 O O   . VAL E 1 27  ? 10.618  -3.984  195.153 1.00 51.64  ? 27  VAL 5 O   1 
ATOM 10734 C CB  . VAL E 1 27  ? 12.519  -2.561  193.155 1.00 35.61  ? 27  VAL 5 CB  1 
ATOM 10735 C CG1 . VAL E 1 27  ? 12.132  -3.878  192.584 1.00 55.51  ? 27  VAL 5 CG1 1 
ATOM 10736 C CG2 . VAL E 1 27  ? 12.743  -1.575  192.044 1.00 53.28  ? 27  VAL 5 CG2 1 
ATOM 10737 N N   . ILE E 1 28  ? 11.832  -2.534  196.322 1.00 23.29  ? 28  ILE 5 N   1 
ATOM 10738 C CA  . ILE E 1 28  ? 11.685  -3.322  197.503 1.00 31.17  ? 28  ILE 5 CA  1 
ATOM 10739 C C   . ILE E 1 28  ? 12.319  -2.583  198.610 1.00 34.97  ? 28  ILE 5 C   1 
ATOM 10740 O O   . ILE E 1 28  ? 13.342  -1.926  198.449 1.00 49.30  ? 28  ILE 5 O   1 
ATOM 10741 C CB  . ILE E 1 28  ? 12.305  -4.676  197.356 1.00 45.60  ? 28  ILE 5 CB  1 
ATOM 10742 C CG1 . ILE E 1 28  ? 12.603  -5.240  198.738 1.00 46.41  ? 28  ILE 5 CG1 1 
ATOM 10743 C CG2 . ILE E 1 28  ? 13.490  -4.611  196.412 1.00 33.68  ? 28  ILE 5 CG2 1 
ATOM 10744 C CD1 . ILE E 1 28  ? 12.026  -6.597  198.934 1.00 87.70  ? 28  ILE 5 CD1 1 
ATOM 10745 N N   . LYS E 1 29  ? 11.726  -2.748  199.763 1.00 32.59  ? 29  LYS 5 N   1 
ATOM 10746 C CA  . LYS E 1 29  ? 12.146  -2.041  200.939 1.00 35.93  ? 29  LYS 5 CA  1 
ATOM 10747 C C   . LYS E 1 29  ? 12.411  -3.125  201.933 1.00 36.41  ? 29  LYS 5 C   1 
ATOM 10748 O O   . LYS E 1 29  ? 12.204  -4.293  201.623 1.00 40.39  ? 29  LYS 5 O   1 
ATOM 10749 C CB  . LYS E 1 29  ? 10.945  -1.199  201.345 1.00 44.81  ? 29  LYS 5 CB  1 
ATOM 10750 C CG  . LYS E 1 29  ? 10.982  -0.442  202.634 1.00 69.82  ? 29  LYS 5 CG  1 
ATOM 10751 C CD  . LYS E 1 29  ? 9.627   0.259   202.727 1.00 100.11 ? 29  LYS 5 CD  1 
ATOM 10752 C CE  . LYS E 1 29  ? 9.551   1.291   203.847 1.00 128.60 ? 29  LYS 5 CE  1 
ATOM 10753 N NZ  . LYS E 1 29  ? 8.325   2.156   203.736 1.00 145.03 ? 29  LYS 5 NZ  1 
ATOM 10754 N N   . GLY E 1 30  ? 12.871  -2.751  203.117 1.00 31.67  ? 30  GLY 5 N   1 
ATOM 10755 C CA  . GLY E 1 30  ? 13.128  -3.734  204.138 1.00 36.21  ? 30  GLY 5 CA  1 
ATOM 10756 C C   . GLY E 1 30  ? 14.352  -3.412  204.955 1.00 56.13  ? 30  GLY 5 C   1 
ATOM 10757 O O   . GLY E 1 30  ? 14.758  -2.258  205.058 1.00 71.53  ? 30  GLY 5 O   1 
ATOM 10758 N N   . GLY E 1 31  ? 14.947  -4.461  205.514 1.00 61.57  ? 31  GLY 5 N   1 
ATOM 10759 C CA  . GLY E 1 31  ? 16.134  -4.351  206.347 1.00 62.07  ? 31  GLY 5 CA  1 
ATOM 10760 C C   . GLY E 1 31  ? 17.382  -4.817  205.610 1.00 67.16  ? 31  GLY 5 C   1 
ATOM 10761 O O   . GLY E 1 31  ? 17.357  -5.076  204.384 1.00 55.92  ? 31  GLY 5 O   1 
ATOM 10762 N N   . ILE E 1 32  ? 18.460  -5.018  206.363 1.00 56.69  ? 32  ILE 5 N   1 
ATOM 10763 C CA  . ILE E 1 32  ? 19.720  -5.373  205.729 1.00 56.91  ? 32  ILE 5 CA  1 
ATOM 10764 C C   . ILE E 1 32  ? 19.614  -6.542  204.760 1.00 49.04  ? 32  ILE 5 C   1 
ATOM 10765 O O   . ILE E 1 32  ? 20.062  -6.494  203.597 1.00 38.71  ? 32  ILE 5 O   1 
ATOM 10766 C CB  . ILE E 1 32  ? 20.829  -5.579  206.777 1.00 51.07  ? 32  ILE 5 CB  1 
ATOM 10767 C CG1 . ILE E 1 32  ? 22.119  -6.012  206.086 1.00 60.59  ? 32  ILE 5 CG1 1 
ATOM 10768 C CG2 . ILE E 1 32  ? 20.369  -6.522  207.857 1.00 70.48  ? 32  ILE 5 CG2 1 
ATOM 10769 C CD1 . ILE E 1 32  ? 22.532  -5.107  204.918 1.00 48.96  ? 32  ILE 5 CD1 1 
ATOM 10770 N N   . GLU E 1 33  ? 18.891  -7.540  205.211 1.00 53.02  ? 33  GLU 5 N   1 
ATOM 10771 C CA  . GLU E 1 33  ? 18.714  -8.723  204.419 1.00 68.22  ? 33  GLU 5 CA  1 
ATOM 10772 C C   . GLU E 1 33  ? 18.225  -8.418  203.019 1.00 54.32  ? 33  GLU 5 C   1 
ATOM 10773 O O   . GLU E 1 33  ? 18.660  -9.058  202.066 1.00 56.01  ? 33  GLU 5 O   1 
ATOM 10774 C CB  . GLU E 1 33  ? 17.775  -9.698  205.133 1.00 93.35  ? 33  GLU 5 CB  1 
ATOM 10775 C CG  . GLU E 1 33  ? 16.770  -9.056  206.065 1.00 121.61 ? 33  GLU 5 CG  1 
ATOM 10776 C CD  . GLU E 1 33  ? 15.779  -8.187  205.331 1.00 141.60 ? 33  GLU 5 CD  1 
ATOM 10777 O OE1 . GLU E 1 33  ? 15.214  -8.644  204.326 1.00 155.97 ? 33  GLU 5 OE1 1 
ATOM 10778 O OE2 . GLU E 1 33  ? 15.554  -7.065  205.770 1.00 155.43 ? 33  GLU 5 OE2 1 
ATOM 10779 N N   . VAL E 1 34  ? 17.414  -7.378  202.884 1.00 45.43  ? 34  VAL 5 N   1 
ATOM 10780 C CA  . VAL E 1 34  ? 16.861  -7.038  201.583 1.00 51.99  ? 34  VAL 5 CA  1 
ATOM 10781 C C   . VAL E 1 34  ? 17.894  -7.059  200.485 1.00 55.57  ? 34  VAL 5 C   1 
ATOM 10782 O O   . VAL E 1 34  ? 17.617  -7.456  199.336 1.00 42.76  ? 34  VAL 5 O   1 
ATOM 10783 C CB  . VAL E 1 34  ? 16.239  -5.653  201.567 1.00 61.95  ? 34  VAL 5 CB  1 
ATOM 10784 C CG1 . VAL E 1 34  ? 15.484  -5.444  200.243 1.00 65.36  ? 34  VAL 5 CG1 1 
ATOM 10785 C CG2 . VAL E 1 34  ? 15.311  -5.488  202.722 1.00 48.19  ? 34  VAL 5 CG2 1 
ATOM 10786 N N   . LEU E 1 35  ? 19.102  -6.668  200.870 1.00 61.50  ? 35  LEU 5 N   1 
ATOM 10787 C CA  . LEU E 1 35  ? 20.217  -6.583  199.949 1.00 59.89  ? 35  LEU 5 CA  1 
ATOM 10788 C C   . LEU E 1 35  ? 20.374  -7.752  199.025 1.00 59.61  ? 35  LEU 5 C   1 
ATOM 10789 O O   . LEU E 1 35  ? 20.635  -7.572  197.835 1.00 66.96  ? 35  LEU 5 O   1 
ATOM 10790 C CB  . LEU E 1 35  ? 21.490  -6.307  200.715 1.00 49.01  ? 35  LEU 5 CB  1 
ATOM 10791 C CG  . LEU E 1 35  ? 21.517  -4.788  200.848 1.00 52.42  ? 35  LEU 5 CG  1 
ATOM 10792 C CD1 . LEU E 1 35  ? 22.638  -4.339  201.756 1.00 54.50  ? 35  LEU 5 CD1 1 
ATOM 10793 C CD2 . LEU E 1 35  ? 21.612  -4.161  199.431 1.00 25.94  ? 35  LEU 5 CD2 1 
ATOM 10794 N N   . GLY E 1 36  ? 20.070  -8.926  199.568 1.00 63.70  ? 36  GLY 5 N   1 
ATOM 10795 C CA  . GLY E 1 36  ? 20.177  -10.173 198.844 1.00 70.73  ? 36  GLY 5 CA  1 
ATOM 10796 C C   . GLY E 1 36  ? 19.479  -10.349 197.505 1.00 80.39  ? 36  GLY 5 C   1 
ATOM 10797 O O   . GLY E 1 36  ? 19.789  -11.305 196.779 1.00 96.34  ? 36  GLY 5 O   1 
ATOM 10798 N N   . VAL E 1 37  ? 18.573  -9.463  197.121 1.00 67.57  ? 37  VAL 5 N   1 
ATOM 10799 C CA  . VAL E 1 37  ? 17.925  -9.697  195.842 1.00 65.10  ? 37  VAL 5 CA  1 
ATOM 10800 C C   . VAL E 1 37  ? 18.620  -9.217  194.582 1.00 57.24  ? 37  VAL 5 C   1 
ATOM 10801 O O   . VAL E 1 37  ? 19.138  -8.090  194.508 1.00 73.05  ? 37  VAL 5 O   1 
ATOM 10802 C CB  . VAL E 1 37  ? 16.504  -9.202  195.841 1.00 75.04  ? 37  VAL 5 CB  1 
ATOM 10803 C CG1 . VAL E 1 37  ? 15.799  -9.624  194.541 1.00 66.42  ? 37  VAL 5 CG1 1 
ATOM 10804 C CG2 . VAL E 1 37  ? 15.789  -9.750  197.066 1.00 96.01  ? 37  VAL 5 CG2 1 
ATOM 10805 N N   . LYS E 1 38  ? 18.602  -10.083 193.577 1.00 42.29  ? 38  LYS 5 N   1 
ATOM 10806 C CA  . LYS E 1 38  ? 19.201  -9.769  192.298 1.00 56.81  ? 38  LYS 5 CA  1 
ATOM 10807 C C   . LYS E 1 38  ? 18.351  -8.669  191.760 1.00 51.55  ? 38  LYS 5 C   1 
ATOM 10808 O O   . LYS E 1 38  ? 17.137  -8.737  191.846 1.00 50.87  ? 38  LYS 5 O   1 
ATOM 10809 C CB  . LYS E 1 38  ? 19.162  -10.970 191.361 1.00 86.39  ? 38  LYS 5 CB  1 
ATOM 10810 C CG  . LYS E 1 38  ? 19.984  -12.161 191.864 1.00 129.01 ? 38  LYS 5 CG  1 
ATOM 10811 C CD  . LYS E 1 38  ? 21.234  -12.400 191.006 1.00 157.77 ? 38  LYS 5 CD  1 
ATOM 10812 C CE  . LYS E 1 38  ? 22.127  -13.506 191.590 1.00 172.41 ? 38  LYS 5 CE  1 
ATOM 10813 N NZ  . LYS E 1 38  ? 23.265  -13.897 190.685 1.00 182.30 ? 38  LYS 5 NZ  1 
ATOM 10814 N N   . THR E 1 39  ? 19.009  -7.644  191.238 1.00 57.77  ? 39  THR 5 N   1 
ATOM 10815 C CA  . THR E 1 39  ? 18.358  -6.456  190.714 1.00 57.71  ? 39  THR 5 CA  1 
ATOM 10816 C C   . THR E 1 39  ? 19.098  -6.043  189.467 1.00 62.35  ? 39  THR 5 C   1 
ATOM 10817 O O   . THR E 1 39  ? 20.229  -6.508  189.218 1.00 56.80  ? 39  THR 5 O   1 
ATOM 10818 C CB  . THR E 1 39  ? 18.503  -5.348  191.719 1.00 54.99  ? 39  THR 5 CB  1 
ATOM 10819 O OG1 . THR E 1 39  ? 19.861  -5.337  192.192 1.00 78.27  ? 39  THR 5 OG1 1 
ATOM 10820 C CG2 . THR E 1 39  ? 17.620  -5.614  192.904 1.00 60.42  ? 39  THR 5 CG2 1 
ATOM 10821 N N   . GLY E 1 40  ? 18.482  -5.152  188.696 1.00 68.20  ? 40  GLY 5 N   1 
ATOM 10822 C CA  . GLY E 1 40  ? 19.120  -4.693  187.477 1.00 71.34  ? 40  GLY 5 CA  1 
ATOM 10823 C C   . GLY E 1 40  ? 20.517  -4.145  187.736 1.00 66.95  ? 40  GLY 5 C   1 
ATOM 10824 O O   . GLY E 1 40  ? 20.922  -3.863  188.875 1.00 48.91  ? 40  GLY 5 O   1 
ATOM 10825 N N   . VAL E 1 41  ? 21.294  -4.051  186.675 1.00 60.54  ? 41  VAL 5 N   1 
ATOM 10826 C CA  . VAL E 1 41  ? 22.632  -3.501  186.788 1.00 58.58  ? 41  VAL 5 CA  1 
ATOM 10827 C C   . VAL E 1 41  ? 22.516  -2.010  187.130 1.00 63.66  ? 41  VAL 5 C   1 
ATOM 10828 O O   . VAL E 1 41  ? 23.439  -1.385  187.673 1.00 72.67  ? 41  VAL 5 O   1 
ATOM 10829 C CB  . VAL E 1 41  ? 23.381  -3.654  185.463 1.00 53.61  ? 41  VAL 5 CB  1 
ATOM 10830 C CG1 . VAL E 1 41  ? 22.544  -3.127  184.320 1.00 72.60  ? 41  VAL 5 CG1 1 
ATOM 10831 C CG2 . VAL E 1 41  ? 24.695  -2.907  185.512 1.00 91.82  ? 41  VAL 5 CG2 1 
ATOM 10832 N N   . ASP E 1 42  ? 21.359  -1.447  186.817 1.00 65.48  ? 42  ASP 5 N   1 
ATOM 10833 C CA  . ASP E 1 42  ? 21.118  -0.045  187.077 1.00 63.91  ? 42  ASP 5 CA  1 
ATOM 10834 C C   . ASP E 1 42  ? 20.296  0.203   188.329 1.00 59.02  ? 42  ASP 5 C   1 
ATOM 10835 O O   . ASP E 1 42  ? 19.784  1.297   188.527 1.00 65.06  ? 42  ASP 5 O   1 
ATOM 10836 C CB  . ASP E 1 42  ? 20.441  0.593   185.869 1.00 83.52  ? 42  ASP 5 CB  1 
ATOM 10837 C CG  . ASP E 1 42  ? 21.388  0.762   184.693 1.00 109.49 ? 42  ASP 5 CG  1 
ATOM 10838 O OD1 . ASP E 1 42  ? 22.504  1.299   184.900 1.00 127.91 ? 42  ASP 5 OD1 1 
ATOM 10839 O OD2 . ASP E 1 42  ? 21.019  0.371   183.559 1.00 123.52 ? 42  ASP 5 OD2 1 
ATOM 10840 N N   . SER E 1 43  ? 20.143  -0.796  189.186 1.00 50.79  ? 43  SER 5 N   1 
ATOM 10841 C CA  . SER E 1 43  ? 19.363  -0.554  190.385 1.00 51.03  ? 43  SER 5 CA  1 
ATOM 10842 C C   . SER E 1 43  ? 20.272  0.249   191.288 1.00 46.45  ? 43  SER 5 C   1 
ATOM 10843 O O   . SER E 1 43  ? 21.382  0.614   190.891 1.00 59.47  ? 43  SER 5 O   1 
ATOM 10844 C CB  . SER E 1 43  ? 18.985  -1.871  191.067 1.00 68.17  ? 43  SER 5 CB  1 
ATOM 10845 O OG  . SER E 1 43  ? 19.977  -2.287  191.997 1.00 86.61  ? 43  SER 5 OG  1 
ATOM 10846 N N   . PHE E 1 44  ? 19.806  0.516   192.501 1.00 42.35  ? 44  PHE 5 N   1 
ATOM 10847 C CA  . PHE E 1 44  ? 20.594  1.229   193.485 1.00 36.86  ? 44  PHE 5 CA  1 
ATOM 10848 C C   . PHE E 1 44  ? 19.895  1.196   194.803 1.00 24.50  ? 44  PHE 5 C   1 
ATOM 10849 O O   . PHE E 1 44  ? 18.678  1.049   194.886 1.00 37.73  ? 44  PHE 5 O   1 
ATOM 10850 C CB  . PHE E 1 44  ? 20.874  2.662   193.076 1.00 46.06  ? 44  PHE 5 CB  1 
ATOM 10851 C CG  . PHE E 1 44  ? 19.724  3.583   193.252 1.00 52.71  ? 44  PHE 5 CG  1 
ATOM 10852 C CD1 . PHE E 1 44  ? 19.449  4.142   194.490 1.00 58.02  ? 44  PHE 5 CD1 1 
ATOM 10853 C CD2 . PHE E 1 44  ? 18.954  3.964   192.160 1.00 73.81  ? 44  PHE 5 CD2 1 
ATOM 10854 C CE1 . PHE E 1 44  ? 18.411  5.094   194.639 1.00 79.37  ? 44  PHE 5 CE1 1 
ATOM 10855 C CE2 . PHE E 1 44  ? 17.917  4.909   192.292 1.00 78.47  ? 44  PHE 5 CE2 1 
ATOM 10856 C CZ  . PHE E 1 44  ? 17.645  5.478   193.536 1.00 60.37  ? 44  PHE 5 CZ  1 
ATOM 10857 N N   . THR E 1 45  ? 20.631  1.407   195.857 1.00 9.76   ? 45  THR 5 N   1 
ATOM 10858 C CA  . THR E 1 45  ? 19.951  1.303   197.089 1.00 26.53  ? 45  THR 5 CA  1 
ATOM 10859 C C   . THR E 1 45  ? 20.394  2.327   198.042 1.00 32.25  ? 45  THR 5 C   1 
ATOM 10860 O O   . THR E 1 45  ? 21.500  2.859   197.970 1.00 36.36  ? 45  THR 5 O   1 
ATOM 10861 C CB  . THR E 1 45  ? 20.136  -0.089  197.705 1.00 37.66  ? 45  THR 5 CB  1 
ATOM 10862 O OG1 . THR E 1 45  ? 20.903  0.004   198.918 1.00 46.28  ? 45  THR 5 OG1 1 
ATOM 10863 C CG2 . THR E 1 45  ? 20.839  -1.018  196.719 1.00 24.73  ? 45  THR 5 CG2 1 
ATOM 10864 N N   . GLU E 1 46  ? 19.542  2.486   199.023 1.00 28.67  ? 46  GLU 5 N   1 
ATOM 10865 C CA  . GLU E 1 46  ? 19.762  3.424   200.056 1.00 26.90  ? 46  GLU 5 CA  1 
ATOM 10866 C C   . GLU E 1 46  ? 19.849  2.567   201.277 1.00 23.44  ? 46  GLU 5 C   1 
ATOM 10867 O O   . GLU E 1 46  ? 19.087  1.626   201.446 1.00 39.80  ? 46  GLU 5 O   1 
ATOM 10868 C CB  . GLU E 1 46  ? 18.561  4.361   200.127 1.00 54.39  ? 46  GLU 5 CB  1 
ATOM 10869 C CG  . GLU E 1 46  ? 18.201  5.031   198.775 1.00 62.54  ? 46  GLU 5 CG  1 
ATOM 10870 C CD  . GLU E 1 46  ? 17.277  6.246   198.913 1.00 69.44  ? 46  GLU 5 CD  1 
ATOM 10871 O OE1 . GLU E 1 46  ? 16.435  6.290   199.851 1.00 72.28  ? 46  GLU 5 OE1 1 
ATOM 10872 O OE2 . GLU E 1 46  ? 17.406  7.169   198.078 1.00 78.16  ? 46  GLU 5 OE2 1 
ATOM 10873 N N   . VAL E 1 47  ? 20.757  2.929   202.152 1.00 25.87  ? 47  VAL 5 N   1 
ATOM 10874 C CA  . VAL E 1 47  ? 20.973  2.185   203.360 1.00 19.83  ? 47  VAL 5 CA  1 
ATOM 10875 C C   . VAL E 1 47  ? 20.938  3.110   204.564 1.00 24.35  ? 47  VAL 5 C   1 
ATOM 10876 O O   . VAL E 1 47  ? 21.868  3.885   204.802 1.00 35.25  ? 47  VAL 5 O   1 
ATOM 10877 C CB  . VAL E 1 47  ? 22.335  1.503   203.263 1.00 19.46  ? 47  VAL 5 CB  1 
ATOM 10878 C CG1 . VAL E 1 47  ? 22.616  0.705   204.526 1.00 8.06   ? 47  VAL 5 CG1 1 
ATOM 10879 C CG2 . VAL E 1 47  ? 22.411  0.639   201.971 1.00 9.01   ? 47  VAL 5 CG2 1 
ATOM 10880 N N   . GLU E 1 48  ? 19.811  3.132   205.249 1.00 30.11  ? 48  GLU 5 N   1 
ATOM 10881 C CA  . GLU E 1 48  ? 19.696  3.971   206.440 1.00 43.97  ? 48  GLU 5 CA  1 
ATOM 10882 C C   . GLU E 1 48  ? 20.328  3.134   207.529 1.00 29.61  ? 48  GLU 5 C   1 
ATOM 10883 O O   . GLU E 1 48  ? 20.275  1.928   207.445 1.00 37.35  ? 48  GLU 5 O   1 
ATOM 10884 C CB  . GLU E 1 48  ? 18.212  4.276   206.763 1.00 53.86  ? 48  GLU 5 CB  1 
ATOM 10885 C CG  . GLU E 1 48  ? 17.666  5.649   206.246 1.00 45.40  ? 48  GLU 5 CG  1 
ATOM 10886 C CD  . GLU E 1 48  ? 16.429  5.561   205.318 1.00 61.26  ? 48  GLU 5 CD  1 
ATOM 10887 O OE1 . GLU E 1 48  ? 16.451  4.757   204.350 1.00 54.78  ? 48  GLU 5 OE1 1 
ATOM 10888 O OE2 . GLU E 1 48  ? 15.455  6.334   205.523 1.00 68.15  ? 48  GLU 5 OE2 1 
ATOM 10889 N N   . CYS E 1 49  ? 20.933  3.755   208.531 1.00 30.64  ? 49  CYS 5 N   1 
ATOM 10890 C CA  . CYS E 1 49  ? 21.569  3.006   209.605 1.00 24.58  ? 49  CYS 5 CA  1 
ATOM 10891 C C   . CYS E 1 49  ? 22.185  3.984   210.587 1.00 26.68  ? 49  CYS 5 C   1 
ATOM 10892 O O   . CYS E 1 49  ? 22.107  5.213   210.391 1.00 30.10  ? 49  CYS 5 O   1 
ATOM 10893 C CB  . CYS E 1 49  ? 22.702  2.189   209.021 1.00 32.34  ? 49  CYS 5 CB  1 
ATOM 10894 S SG  . CYS E 1 49  ? 24.214  3.119   209.018 1.00 42.92  ? 49  CYS 5 SG  1 
ATOM 10895 N N   . PHE E 1 50  ? 22.943  3.470   211.549 1.00 9.94   ? 50  PHE 5 N   1 
ATOM 10896 C CA  . PHE E 1 50  ? 23.528  4.399   212.490 1.00 19.22  ? 50  PHE 5 CA  1 
ATOM 10897 C C   . PHE E 1 50  ? 24.563  3.792   213.372 1.00 24.56  ? 50  PHE 5 C   1 
ATOM 10898 O O   . PHE E 1 50  ? 24.680  2.575   213.416 1.00 34.98  ? 50  PHE 5 O   1 
ATOM 10899 C CB  . PHE E 1 50  ? 22.465  4.923   213.385 1.00 19.21  ? 50  PHE 5 CB  1 
ATOM 10900 C CG  . PHE E 1 50  ? 21.927  3.889   214.306 1.00 43.87  ? 50  PHE 5 CG  1 
ATOM 10901 C CD1 . PHE E 1 50  ? 21.040  2.927   213.842 1.00 41.48  ? 50  PHE 5 CD1 1 
ATOM 10902 C CD2 . PHE E 1 50  ? 22.339  3.845   215.636 1.00 54.79  ? 50  PHE 5 CD2 1 
ATOM 10903 C CE1 . PHE E 1 50  ? 20.573  1.937   214.686 1.00 43.31  ? 50  PHE 5 CE1 1 
ATOM 10904 C CE2 . PHE E 1 50  ? 21.873  2.854   216.481 1.00 59.13  ? 50  PHE 5 CE2 1 
ATOM 10905 C CZ  . PHE E 1 50  ? 20.989  1.900   216.004 1.00 48.28  ? 50  PHE 5 CZ  1 
ATOM 10906 N N   . LEU E 1 51  ? 25.195  4.646   214.180 1.00 11.15  ? 51  LEU 5 N   1 
ATOM 10907 C CA  . LEU E 1 51  ? 26.248  4.228   215.086 1.00 14.09  ? 51  LEU 5 CA  1 
ATOM 10908 C C   . LEU E 1 51  ? 26.075  4.923   216.375 1.00 20.20  ? 51  LEU 5 C   1 
ATOM 10909 O O   . LEU E 1 51  ? 25.795  6.112   216.426 1.00 25.53  ? 51  LEU 5 O   1 
ATOM 10910 C CB  . LEU E 1 51  ? 27.640  4.638   214.607 1.00 18.08  ? 51  LEU 5 CB  1 
ATOM 10911 C CG  . LEU E 1 51  ? 28.068  4.321   213.185 1.00 26.28  ? 51  LEU 5 CG  1 
ATOM 10912 C CD1 . LEU E 1 51  ? 29.550  4.571   213.050 1.00 41.69  ? 51  LEU 5 CD1 1 
ATOM 10913 C CD2 . LEU E 1 51  ? 27.755  2.888   212.863 1.00 43.82  ? 51  LEU 5 CD2 1 
ATOM 10914 N N   . ASN E 1 52  ? 26.339  4.183   217.427 1.00 30.07  ? 52  ASN 5 N   1 
ATOM 10915 C CA  . ASN E 1 52  ? 26.241  4.729   218.752 1.00 32.62  ? 52  ASN 5 CA  1 
ATOM 10916 C C   . ASN E 1 52  ? 27.598  5.239   219.138 1.00 28.10  ? 52  ASN 5 C   1 
ATOM 10917 O O   . ASN E 1 52  ? 28.620  4.921   218.517 1.00 33.24  ? 52  ASN 5 O   1 
ATOM 10918 C CB  . ASN E 1 52  ? 25.770  3.680   219.757 1.00 44.92  ? 52  ASN 5 CB  1 
ATOM 10919 C CG  . ASN E 1 52  ? 24.300  3.346   219.608 1.00 69.40  ? 52  ASN 5 CG  1 
ATOM 10920 O OD1 . ASN E 1 52  ? 23.429  4.087   220.083 1.00 82.78  ? 52  ASN 5 OD1 1 
ATOM 10921 N ND2 . ASN E 1 52  ? 24.010  2.223   218.959 1.00 81.25  ? 52  ASN 5 ND2 1 
ATOM 10922 N N   . PRO E 1 53  ? 27.610  6.120   220.110 1.00 16.84  ? 53  PRO 5 N   1 
ATOM 10923 C CA  . PRO E 1 53  ? 28.827  6.734   220.621 1.00 37.64  ? 53  PRO 5 CA  1 
ATOM 10924 C C   . PRO E 1 53  ? 29.507  5.945   221.683 1.00 45.07  ? 53  PRO 5 C   1 
ATOM 10925 O O   . PRO E 1 53  ? 28.867  5.363   222.551 1.00 59.20  ? 53  PRO 5 O   1 
ATOM 10926 C CB  . PRO E 1 53  ? 28.345  8.080   221.186 1.00 48.17  ? 53  PRO 5 CB  1 
ATOM 10927 C CG  . PRO E 1 53  ? 26.912  7.864   221.500 1.00 37.25  ? 53  PRO 5 CG  1 
ATOM 10928 C CD  . PRO E 1 53  ? 26.430  6.952   220.372 1.00 21.94  ? 53  PRO 5 CD  1 
ATOM 10929 N N   . GLN E 1 54  ? 30.821  6.034   221.680 1.00 50.03  ? 54  GLN 5 N   1 
ATOM 10930 C CA  . GLN E 1 54  ? 31.600  5.330   222.658 1.00 45.60  ? 54  GLN 5 CA  1 
ATOM 10931 C C   . GLN E 1 54  ? 32.334  6.376   223.449 1.00 49.31  ? 54  GLN 5 C   1 
ATOM 10932 O O   . GLN E 1 54  ? 33.451  6.772   223.109 1.00 53.83  ? 54  GLN 5 O   1 
ATOM 10933 C CB  . GLN E 1 54  ? 32.548  4.431   221.918 1.00 52.11  ? 54  GLN 5 CB  1 
ATOM 10934 C CG  . GLN E 1 54  ? 31.832  3.540   220.925 1.00 58.31  ? 54  GLN 5 CG  1 
ATOM 10935 C CD  . GLN E 1 54  ? 31.086  2.436   221.614 1.00 55.28  ? 54  GLN 5 CD  1 
ATOM 10936 O OE1 . GLN E 1 54  ? 30.903  2.471   222.835 1.00 67.54  ? 54  GLN 5 OE1 1 
ATOM 10937 N NE2 . GLN E 1 54  ? 30.681  1.428   220.856 1.00 57.94  ? 54  GLN 5 NE2 1 
ATOM 10938 N N   . MET E 1 55  ? 31.682  6.895   224.472 1.00 48.83  ? 55  MET 5 N   1 
ATOM 10939 C CA  . MET E 1 55  ? 32.333  7.925   225.256 1.00 63.36  ? 55  MET 5 CA  1 
ATOM 10940 C C   . MET E 1 55  ? 33.104  7.344   226.417 1.00 71.03  ? 55  MET 5 C   1 
ATOM 10941 O O   . MET E 1 55  ? 33.806  8.069   227.122 1.00 69.31  ? 55  MET 5 O   1 
ATOM 10942 C CB  . MET E 1 55  ? 31.312  8.948   225.746 1.00 66.73  ? 55  MET 5 CB  1 
ATOM 10943 C CG  . MET E 1 55  ? 30.481  9.560   224.625 1.00 68.32  ? 55  MET 5 CG  1 
ATOM 10944 S SD  . MET E 1 55  ? 31.472  10.313  223.316 1.00 51.89  ? 55  MET 5 SD  1 
ATOM 10945 C CE  . MET E 1 55  ? 32.322  11.429  224.280 1.00 24.55  ? 55  MET 5 CE  1 
ATOM 10946 N N   . GLY E 1 56  ? 32.980  6.028   226.591 1.00 84.14  ? 56  GLY 5 N   1 
ATOM 10947 C CA  . GLY E 1 56  ? 33.640  5.328   227.685 1.00 96.91  ? 56  GLY 5 CA  1 
ATOM 10948 C C   . GLY E 1 56  ? 32.635  4.402   228.350 1.00 97.63  ? 56  GLY 5 C   1 
ATOM 10949 O O   . GLY E 1 56  ? 32.854  3.186   228.425 1.00 106.07 ? 56  GLY 5 O   1 
ATOM 10950 N N   . ASN E 1 57  ? 31.513  4.992   228.780 1.00 87.61  ? 57  ASN 5 N   1 
ATOM 10951 C CA  . ASN E 1 57  ? 30.390  4.296   229.424 1.00 73.14  ? 57  ASN 5 CA  1 
ATOM 10952 C C   . ASN E 1 57  ? 30.732  3.671   230.771 1.00 66.44  ? 57  ASN 5 C   1 
ATOM 10953 O O   . ASN E 1 57  ? 30.582  2.460   230.939 1.00 62.17  ? 57  ASN 5 O   1 
ATOM 10954 C CB  . ASN E 1 57  ? 29.833  3.200   228.504 1.00 79.67  ? 57  ASN 5 CB  1 
ATOM 10955 C CG  . ASN E 1 57  ? 29.294  3.740   227.200 1.00 78.30  ? 57  ASN 5 CG  1 
ATOM 10956 O OD1 . ASN E 1 57  ? 28.706  4.816   227.154 1.00 94.11  ? 57  ASN 5 OD1 1 
ATOM 10957 N ND2 . ASN E 1 57  ? 29.491  2.989   226.127 1.00 94.29  ? 57  ASN 5 ND2 1 
ATOM 10958 N N   . PRO E 1 58  ? 31.131  4.490   231.766 1.00 63.59  ? 58  PRO 5 N   1 
ATOM 10959 C CA  . PRO E 1 58  ? 31.492  3.990   233.099 1.00 77.14  ? 58  PRO 5 CA  1 
ATOM 10960 C C   . PRO E 1 58  ? 30.614  2.876   233.682 1.00 84.81  ? 58  PRO 5 C   1 
ATOM 10961 O O   . PRO E 1 58  ? 31.034  1.706   233.734 1.00 86.76  ? 58  PRO 5 O   1 
ATOM 10962 C CB  . PRO E 1 58  ? 31.520  5.264   233.966 1.00 72.31  ? 58  PRO 5 CB  1 
ATOM 10963 C CG  . PRO E 1 58  ? 30.843  6.310   233.131 1.00 71.64  ? 58  PRO 5 CG  1 
ATOM 10964 C CD  . PRO E 1 58  ? 31.238  5.952   231.733 1.00 68.06  ? 58  PRO 5 CD  1 
ATOM 10965 N N   . ASP E 1 59  ? 29.424  3.229   234.151 1.00 84.17  ? 59  ASP 5 N   1 
ATOM 10966 C CA  . ASP E 1 59  ? 28.535  2.229   234.706 1.00 80.41  ? 59  ASP 5 CA  1 
ATOM 10967 C C   . ASP E 1 59  ? 27.568  1.746   233.632 1.00 75.25  ? 59  ASP 5 C   1 
ATOM 10968 O O   . ASP E 1 59  ? 27.809  1.934   232.444 1.00 71.27  ? 59  ASP 5 O   1 
ATOM 10969 C CB  . ASP E 1 59  ? 27.810  2.769   235.936 1.00 85.02  ? 59  ASP 5 CB  1 
ATOM 10970 C CG  . ASP E 1 59  ? 26.847  3.845   235.598 1.00 98.38  ? 59  ASP 5 CG  1 
ATOM 10971 O OD1 . ASP E 1 59  ? 27.288  4.852   235.036 1.00 113.35 ? 59  ASP 5 OD1 1 
ATOM 10972 O OD2 . ASP E 1 59  ? 25.642  3.674   235.853 1.00 117.82 ? 59  ASP 5 OD2 1 
ATOM 10973 N N   . GLU E 1 60  ? 26.485  1.102   234.033 1.00 84.53  ? 60  GLU 5 N   1 
ATOM 10974 C CA  . GLU E 1 60  ? 25.547  0.582   233.048 1.00 100.89 ? 60  GLU 5 CA  1 
ATOM 10975 C C   . GLU E 1 60  ? 24.427  1.549   232.769 1.00 91.66  ? 60  GLU 5 C   1 
ATOM 10976 O O   . GLU E 1 60  ? 23.598  1.306   231.913 1.00 89.37  ? 60  GLU 5 O   1 
ATOM 10977 C CB  . GLU E 1 60  ? 24.966  -0.764  233.495 1.00 123.61 ? 60  GLU 5 CB  1 
ATOM 10978 C CG  . GLU E 1 60  ? 24.228  -0.721  234.828 1.00 161.45 ? 60  GLU 5 CG  1 
ATOM 10979 C CD  . GLU E 1 60  ? 23.545  -2.038  235.172 1.00 185.11 ? 60  GLU 5 CD  1 
ATOM 10980 O OE1 . GLU E 1 60  ? 24.245  -2.969  235.639 1.00 199.19 ? 60  GLU 5 OE1 1 
ATOM 10981 O OE2 . GLU E 1 60  ? 22.306  -2.129  234.987 1.00 195.68 ? 60  GLU 5 OE2 1 
ATOM 10982 N N   . HIS E 1 61  ? 24.404  2.651   233.494 1.00 85.38  ? 61  HIS 5 N   1 
ATOM 10983 C CA  . HIS E 1 61  ? 23.355  3.630   233.310 1.00 87.29  ? 61  HIS 5 CA  1 
ATOM 10984 C C   . HIS E 1 61  ? 23.903  4.790   232.501 1.00 82.18  ? 61  HIS 5 C   1 
ATOM 10985 O O   . HIS E 1 61  ? 23.227  5.353   231.639 1.00 85.83  ? 61  HIS 5 O   1 
ATOM 10986 C CB  . HIS E 1 61  ? 22.857  4.131   234.671 1.00 109.80 ? 61  HIS 5 CB  1 
ATOM 10987 C CG  . HIS E 1 61  ? 22.362  3.046   235.585 1.00 115.57 ? 61  HIS 5 CG  1 
ATOM 10988 N ND1 . HIS E 1 61  ? 22.575  3.070   236.949 1.00 113.36 ? 61  HIS 5 ND1 1 
ATOM 10989 C CD2 . HIS E 1 61  ? 21.661  1.915   235.333 1.00 115.32 ? 61  HIS 5 CD2 1 
ATOM 10990 C CE1 . HIS E 1 61  ? 22.025  2.001   237.497 1.00 122.78 ? 61  HIS 5 CE1 1 
ATOM 10991 N NE2 . HIS E 1 61  ? 21.464  1.284   236.537 1.00 122.26 ? 61  HIS 5 NE2 1 
ATOM 10992 N N   . GLN E 1 62  ? 25.147  5.138   232.769 1.00 69.62  ? 62  GLN 5 N   1 
ATOM 10993 C CA  . GLN E 1 62  ? 25.754  6.228   232.065 1.00 55.37  ? 62  GLN 5 CA  1 
ATOM 10994 C C   . GLN E 1 62  ? 26.224  5.929   230.641 1.00 53.58  ? 62  GLN 5 C   1 
ATOM 10995 O O   . GLN E 1 62  ? 27.350  6.276   230.263 1.00 52.64  ? 62  GLN 5 O   1 
ATOM 10996 C CB  . GLN E 1 62  ? 26.844  6.858   232.916 1.00 48.64  ? 62  GLN 5 CB  1 
ATOM 10997 C CG  . GLN E 1 62  ? 26.270  7.636   234.086 1.00 70.27  ? 62  GLN 5 CG  1 
ATOM 10998 C CD  . GLN E 1 62  ? 27.343  8.216   235.005 1.00 88.05  ? 62  GLN 5 CD  1 
ATOM 10999 O OE1 . GLN E 1 62  ? 28.394  7.604   235.222 1.00 95.45  ? 62  GLN 5 OE1 1 
ATOM 11000 N NE2 . GLN E 1 62  ? 27.078  9.406   235.554 1.00 98.82  ? 62  GLN 5 NE2 1 
ATOM 11001 N N   . LYS E 1 63  ? 25.380  5.256   229.859 1.00 42.01  ? 63  LYS 5 N   1 
ATOM 11002 C CA  . LYS E 1 63  ? 25.718  5.032   228.468 1.00 50.72  ? 63  LYS 5 CA  1 
ATOM 11003 C C   . LYS E 1 63  ? 25.759  6.421   227.804 1.00 63.79  ? 63  LYS 5 C   1 
ATOM 11004 O O   . LYS E 1 63  ? 25.004  7.331   228.175 1.00 66.97  ? 63  LYS 5 O   1 
ATOM 11005 C CB  . LYS E 1 63  ? 24.681  4.178   227.786 1.00 50.71  ? 63  LYS 5 CB  1 
ATOM 11006 C CG  . LYS E 1 63  ? 25.067  2.738   227.730 1.00 69.53  ? 63  LYS 5 CG  1 
ATOM 11007 C CD  . LYS E 1 63  ? 24.097  1.987   226.849 1.00 92.15  ? 63  LYS 5 CD  1 
ATOM 11008 C CE  . LYS E 1 63  ? 24.569  0.570   226.541 1.00 110.06 ? 63  LYS 5 CE  1 
ATOM 11009 N NZ  . LYS E 1 63  ? 23.654  -0.111  225.559 1.00 130.27 ? 63  LYS 5 NZ  1 
ATOM 11010 N N   . GLY E 1 64  ? 26.660  6.585   226.841 1.00 66.47  ? 64  GLY 5 N   1 
ATOM 11011 C CA  . GLY E 1 64  ? 26.812  7.862   226.173 1.00 51.84  ? 64  GLY 5 CA  1 
ATOM 11012 C C   . GLY E 1 64  ? 27.585  8.887   226.993 1.00 46.32  ? 64  GLY 5 C   1 
ATOM 11013 O O   . GLY E 1 64  ? 27.532  10.094  226.732 1.00 45.92  ? 64  GLY 5 O   1 
ATOM 11014 N N   . LEU E 1 65  ? 28.339  8.432   227.974 1.00 36.34  ? 65  LEU 5 N   1 
ATOM 11015 C CA  . LEU E 1 65  ? 29.084  9.373   228.772 1.00 43.56  ? 65  LEU 5 CA  1 
ATOM 11016 C C   . LEU E 1 65  ? 30.448  8.842   229.072 1.00 51.39  ? 65  LEU 5 C   1 
ATOM 11017 O O   . LEU E 1 65  ? 30.640  7.630   229.087 1.00 59.53  ? 65  LEU 5 O   1 
ATOM 11018 C CB  . LEU E 1 65  ? 28.332  9.613   230.051 1.00 50.16  ? 65  LEU 5 CB  1 
ATOM 11019 C CG  . LEU E 1 65  ? 27.222  10.576  229.694 1.00 69.69  ? 65  LEU 5 CG  1 
ATOM 11020 C CD1 . LEU E 1 65  ? 25.849  10.159  230.228 1.00 82.39  ? 65  LEU 5 CD1 1 
ATOM 11021 C CD2 . LEU E 1 65  ? 27.682  11.921  230.180 1.00 70.19  ? 65  LEU 5 CD2 1 
ATOM 11022 N N   . SER E 1 66  ? 31.429  9.721   229.216 1.00 49.18  ? 66  SER 5 N   1 
ATOM 11023 C CA  . SER E 1 66  ? 32.749  9.222   229.551 1.00 50.91  ? 66  SER 5 CA  1 
ATOM 11024 C C   . SER E 1 66  ? 32.726  9.058   231.053 1.00 56.80  ? 66  SER 5 C   1 
ATOM 11025 O O   . SER E 1 66  ? 31.766  9.448   231.717 1.00 50.63  ? 66  SER 5 O   1 
ATOM 11026 C CB  . SER E 1 66  ? 33.851  10.209  229.176 1.00 50.51  ? 66  SER 5 CB  1 
ATOM 11027 O OG  . SER E 1 66  ? 33.845  11.342  230.037 1.00 56.84  ? 66  SER 5 OG  1 
ATOM 11028 N N   . LYS E 1 67  ? 33.770  8.456   231.590 1.00 61.36  ? 67  LYS 5 N   1 
ATOM 11029 C CA  . LYS E 1 67  ? 33.860  8.294   233.015 1.00 61.23  ? 67  LYS 5 CA  1 
ATOM 11030 C C   . LYS E 1 67  ? 34.227  9.680   233.460 1.00 57.19  ? 67  LYS 5 C   1 
ATOM 11031 O O   . LYS E 1 67  ? 34.729  10.480  232.672 1.00 59.75  ? 67  LYS 5 O   1 
ATOM 11032 C CB  . LYS E 1 67  ? 34.998  7.346   233.357 1.00 83.50  ? 67  LYS 5 CB  1 
ATOM 11033 C CG  . LYS E 1 67  ? 35.049  6.901   234.820 1.00 113.16 ? 67  LYS 5 CG  1 
ATOM 11034 C CD  . LYS E 1 67  ? 36.110  5.817   234.986 1.00 127.22 ? 67  LYS 5 CD  1 
ATOM 11035 C CE  . LYS E 1 67  ? 36.207  5.259   236.391 1.00 130.87 ? 67  LYS 5 CE  1 
ATOM 11036 N NZ  . LYS E 1 67  ? 37.354  4.303   236.440 1.00 144.96 ? 67  LYS 5 NZ  1 
ATOM 11037 N N   . SER E 1 68  ? 33.977  9.962   234.723 1.00 61.98  ? 68  SER 5 N   1 
ATOM 11038 C CA  . SER E 1 68  ? 34.300  11.254  235.296 1.00 69.40  ? 68  SER 5 CA  1 
ATOM 11039 C C   . SER E 1 68  ? 35.694  11.623  234.805 1.00 60.59  ? 68  SER 5 C   1 
ATOM 11040 O O   . SER E 1 68  ? 36.623  10.822  234.852 1.00 51.95  ? 68  SER 5 O   1 
ATOM 11041 C CB  . SER E 1 68  ? 34.245  11.148  236.822 1.00 88.53  ? 68  SER 5 CB  1 
ATOM 11042 O OG  . SER E 1 68  ? 33.122  10.357  237.236 1.00 112.30 ? 68  SER 5 OG  1 
ATOM 11043 N N   . LEU E 1 69  ? 35.814  12.795  234.216 1.00 68.06  ? 69  LEU 5 N   1 
ATOM 11044 C CA  . LEU E 1 69  ? 37.099  13.184  233.685 1.00 74.40  ? 69  LEU 5 CA  1 
ATOM 11045 C C   . LEU E 1 69  ? 38.134  13.690  234.676 1.00 77.37  ? 69  LEU 5 C   1 
ATOM 11046 O O   . LEU E 1 69  ? 37.854  14.476  235.601 1.00 73.26  ? 69  LEU 5 O   1 
ATOM 11047 C CB  . LEU E 1 69  ? 36.937  14.103  232.470 1.00 66.65  ? 69  LEU 5 CB  1 
ATOM 11048 C CG  . LEU E 1 69  ? 36.551  13.263  231.244 1.00 68.41  ? 69  LEU 5 CG  1 
ATOM 11049 C CD1 . LEU E 1 69  ? 35.602  14.037  230.384 1.00 70.54  ? 69  LEU 5 CD1 1 
ATOM 11050 C CD2 . LEU E 1 69  ? 37.797  12.820  230.445 1.00 80.35  ? 69  LEU 5 CD2 1 
ATOM 11051 N N   . ALA E 1 70  ? 39.331  13.151  234.465 1.00 81.95  ? 70  ALA 5 N   1 
ATOM 11052 C CA  . ALA E 1 70  ? 40.534  13.425  235.238 1.00 83.07  ? 70  ALA 5 CA  1 
ATOM 11053 C C   . ALA E 1 70  ? 41.163  14.741  234.837 1.00 73.53  ? 70  ALA 5 C   1 
ATOM 11054 O O   . ALA E 1 70  ? 41.159  15.095  233.656 1.00 77.99  ? 70  ALA 5 O   1 
ATOM 11055 C CB  . ALA E 1 70  ? 41.519  12.307  235.017 1.00 106.06 ? 70  ALA 5 CB  1 
ATOM 11056 N N   . ALA E 1 71  ? 41.879  15.359  235.765 1.00 60.91  ? 71  ALA 5 N   1 
ATOM 11057 C CA  . ALA E 1 71  ? 42.428  16.656  235.461 1.00 65.32  ? 71  ALA 5 CA  1 
ATOM 11058 C C   . ALA E 1 71  ? 43.913  16.994  235.418 1.00 64.84  ? 71  ALA 5 C   1 
ATOM 11059 O O   . ALA E 1 71  ? 44.493  17.068  234.335 1.00 72.46  ? 71  ALA 5 O   1 
ATOM 11060 C CB  . ALA E 1 71  ? 41.679  17.707  236.273 1.00 81.46  ? 71  ALA 5 CB  1 
ATOM 11061 N N   . GLU E 1 72  ? 44.515  17.251  236.575 1.00 48.47  ? 72  GLU 5 N   1 
ATOM 11062 C CA  . GLU E 1 72  ? 45.902  17.701  236.615 1.00 53.45  ? 72  GLU 5 CA  1 
ATOM 11063 C C   . GLU E 1 72  ? 47.087  16.695  236.585 1.00 56.67  ? 72  GLU 5 C   1 
ATOM 11064 O O   . GLU E 1 72  ? 48.248  17.085  236.839 1.00 53.50  ? 72  GLU 5 O   1 
ATOM 11065 C CB  . GLU E 1 72  ? 46.043  18.717  237.762 1.00 54.56  ? 72  GLU 5 CB  1 
ATOM 11066 C CG  . GLU E 1 72  ? 44.957  19.815  237.777 1.00 80.06  ? 72  GLU 5 CG  1 
ATOM 11067 C CD  . GLU E 1 72  ? 45.229  20.979  238.760 1.00 103.00 ? 72  GLU 5 CD  1 
ATOM 11068 O OE1 . GLU E 1 72  ? 44.814  20.894  239.939 1.00 121.12 ? 72  GLU 5 OE1 1 
ATOM 11069 O OE2 . GLU E 1 72  ? 45.807  22.012  238.345 1.00 113.28 ? 72  GLU 5 OE2 1 
ATOM 11070 N N   . LYS E 1 73  ? 46.807  15.441  236.201 1.00 54.36  ? 73  LYS 5 N   1 
ATOM 11071 C CA  . LYS E 1 73  ? 47.813  14.364  236.117 1.00 63.18  ? 73  LYS 5 CA  1 
ATOM 11072 C C   . LYS E 1 73  ? 49.212  14.782  235.698 1.00 67.10  ? 73  LYS 5 C   1 
ATOM 11073 O O   . LYS E 1 73  ? 49.401  15.497  234.727 1.00 65.80  ? 73  LYS 5 O   1 
ATOM 11074 C CB  . LYS E 1 73  ? 47.363  13.245  235.174 1.00 66.62  ? 73  LYS 5 CB  1 
ATOM 11075 C CG  . LYS E 1 73  ? 46.879  11.987  235.888 1.00 107.33 ? 73  LYS 5 CG  1 
ATOM 11076 C CD  . LYS E 1 73  ? 46.359  10.931  234.902 1.00 129.46 ? 73  LYS 5 CD  1 
ATOM 11077 C CE  . LYS E 1 73  ? 45.722  9.741   235.627 1.00 146.91 ? 73  LYS 5 CE  1 
ATOM 11078 N NZ  . LYS E 1 73  ? 44.805  8.948   234.747 1.00 156.31 ? 73  LYS 5 NZ  1 
ATOM 11079 N N   . GLN E 1 74  ? 50.206  14.325  236.444 1.00 78.24  ? 74  GLN 5 N   1 
ATOM 11080 C CA  . GLN E 1 74  ? 51.572  14.659  236.104 1.00 75.85  ? 74  GLN 5 CA  1 
ATOM 11081 C C   . GLN E 1 74  ? 51.822  13.943  234.774 1.00 61.37  ? 74  GLN 5 C   1 
ATOM 11082 O O   . GLN E 1 74  ? 51.163  12.943  234.478 1.00 52.00  ? 74  GLN 5 O   1 
ATOM 11083 C CB  . GLN E 1 74  ? 52.527  14.211  237.226 1.00 94.46  ? 74  GLN 5 CB  1 
ATOM 11084 C CG  . GLN E 1 74  ? 53.999  14.625  237.041 1.00 121.08 ? 74  GLN 5 CG  1 
ATOM 11085 C CD  . GLN E 1 74  ? 54.197  15.877  236.166 1.00 131.22 ? 74  GLN 5 CD  1 
ATOM 11086 O OE1 . GLN E 1 74  ? 53.451  16.855  236.269 1.00 141.59 ? 74  GLN 5 OE1 1 
ATOM 11087 N NE2 . GLN E 1 74  ? 55.197  15.830  235.284 1.00 121.25 ? 74  GLN 5 NE2 1 
ATOM 11088 N N   . PHE E 1 75  ? 52.695  14.513  233.945 1.00 51.52  ? 75  PHE 5 N   1 
ATOM 11089 C CA  . PHE E 1 75  ? 53.025  13.958  232.625 1.00 56.95  ? 75  PHE 5 CA  1 
ATOM 11090 C C   . PHE E 1 75  ? 53.502  12.525  232.671 1.00 64.87  ? 75  PHE 5 C   1 
ATOM 11091 O O   . PHE E 1 75  ? 53.070  11.655  231.905 1.00 59.48  ? 75  PHE 5 O   1 
ATOM 11092 C CB  . PHE E 1 75  ? 54.126  14.781  231.967 1.00 52.14  ? 75  PHE 5 CB  1 
ATOM 11093 C CG  . PHE E 1 75  ? 53.622  15.902  231.110 1.00 70.68  ? 75  PHE 5 CG  1 
ATOM 11094 C CD1 . PHE E 1 75  ? 52.926  15.631  229.940 1.00 70.62  ? 75  PHE 5 CD1 1 
ATOM 11095 C CD2 . PHE E 1 75  ? 53.885  17.235  231.446 1.00 76.72  ? 75  PHE 5 CD2 1 
ATOM 11096 C CE1 . PHE E 1 75  ? 52.506  16.658  229.115 1.00 78.36  ? 75  PHE 5 CE1 1 
ATOM 11097 C CE2 . PHE E 1 75  ? 53.466  18.279  230.619 1.00 73.69  ? 75  PHE 5 CE2 1 
ATOM 11098 C CZ  . PHE E 1 75  ? 52.777  17.985  229.454 1.00 83.20  ? 75  PHE 5 CZ  1 
ATOM 11099 N N   . THR E 1 76  ? 54.455  12.308  233.560 1.00 80.90  ? 76  THR 5 N   1 
ATOM 11100 C CA  . THR E 1 76  ? 55.056  11.010  233.724 1.00 85.11  ? 76  THR 5 CA  1 
ATOM 11101 C C   . THR E 1 76  ? 54.083  10.009  234.289 1.00 84.05  ? 76  THR 5 C   1 
ATOM 11102 O O   . THR E 1 76  ? 54.194  8.821   234.019 1.00 86.85  ? 76  THR 5 O   1 
ATOM 11103 C CB  . THR E 1 76  ? 56.288  11.110  234.602 1.00 92.04  ? 76  THR 5 CB  1 
ATOM 11104 O OG1 . THR E 1 76  ? 56.452  12.470  235.051 1.00 99.95  ? 76  THR 5 OG1 1 
ATOM 11105 C CG2 . THR E 1 76  ? 57.511  10.687  233.797 1.00 105.71 ? 76  THR 5 CG2 1 
ATOM 11106 N N   . ASP E 1 77  ? 53.096  10.492  235.029 1.00 88.01  ? 77  ASP 5 N   1 
ATOM 11107 C CA  . ASP E 1 77  ? 52.119  9.597   235.613 1.00 94.15  ? 77  ASP 5 CA  1 
ATOM 11108 C C   . ASP E 1 77  ? 50.733  9.719   234.978 1.00 86.52  ? 77  ASP 5 C   1 
ATOM 11109 O O   . ASP E 1 77  ? 49.712  9.659   235.663 1.00 90.25  ? 77  ASP 5 O   1 
ATOM 11110 C CB  . ASP E 1 77  ? 52.046  9.824   237.124 1.00 108.49 ? 77  ASP 5 CB  1 
ATOM 11111 C CG  . ASP E 1 77  ? 51.476  8.626   237.860 1.00 125.97 ? 77  ASP 5 CG  1 
ATOM 11112 O OD1 . ASP E 1 77  ? 51.790  7.472   237.461 1.00 127.27 ? 77  ASP 5 OD1 1 
ATOM 11113 O OD2 . ASP E 1 77  ? 50.715  8.841   238.830 1.00 137.66 ? 77  ASP 5 OD2 1 
ATOM 11114 N N   . ASP E 1 78  ? 50.673  9.832   233.662 1.00 70.94  ? 78  ASP 5 N   1 
ATOM 11115 C CA  . ASP E 1 78  ? 49.367  9.967   233.058 1.00 70.31  ? 78  ASP 5 CA  1 
ATOM 11116 C C   . ASP E 1 78  ? 48.850  8.631   232.585 1.00 63.71  ? 78  ASP 5 C   1 
ATOM 11117 O O   . ASP E 1 78  ? 49.254  8.116   231.547 1.00 52.99  ? 78  ASP 5 O   1 
ATOM 11118 C CB  . ASP E 1 78  ? 49.409  10.985  231.928 1.00 85.65  ? 78  ASP 5 CB  1 
ATOM 11119 C CG  . ASP E 1 78  ? 48.029  11.390  231.436 1.00 94.04  ? 78  ASP 5 CG  1 
ATOM 11120 O OD1 . ASP E 1 78  ? 46.995  10.818  231.905 1.00 77.42  ? 78  ASP 5 OD1 1 
ATOM 11121 O OD2 . ASP E 1 78  ? 48.007  12.287  230.548 1.00 86.90  ? 78  ASP 5 OD2 1 
ATOM 11122 N N   . SER E 1 79  ? 48.014  8.015   233.398 1.00 58.19  ? 79  SER 5 N   1 
ATOM 11123 C CA  . SER E 1 79  ? 47.467  6.745   232.994 1.00 67.42  ? 79  SER 5 CA  1 
ATOM 11124 C C   . SER E 1 79  ? 45.978  6.766   233.079 1.00 69.54  ? 79  SER 5 C   1 
ATOM 11125 O O   . SER E 1 79  ? 45.395  6.356   234.076 1.00 80.30  ? 79  SER 5 O   1 
ATOM 11126 C CB  . SER E 1 79  ? 47.974  5.620   233.858 1.00 80.76  ? 79  SER 5 CB  1 
ATOM 11127 O OG  . SER E 1 79  ? 47.376  4.418   233.398 1.00 108.94 ? 79  SER 5 OG  1 
ATOM 11128 N N   . PRO E 1 80  ? 45.333  7.351   232.087 1.00 67.57  ? 80  PRO 5 N   1 
ATOM 11129 C CA  . PRO E 1 80  ? 43.876  7.435   232.052 1.00 59.76  ? 80  PRO 5 CA  1 
ATOM 11130 C C   . PRO E 1 80  ? 43.294  6.024   232.022 1.00 50.38  ? 80  PRO 5 C   1 
ATOM 11131 O O   . PRO E 1 80  ? 44.044  5.067   231.895 1.00 48.51  ? 80  PRO 5 O   1 
ATOM 11132 C CB  . PRO E 1 80  ? 43.640  8.163   230.750 1.00 68.72  ? 80  PRO 5 CB  1 
ATOM 11133 C CG  . PRO E 1 80  ? 44.796  7.654   229.887 1.00 68.12  ? 80  PRO 5 CG  1 
ATOM 11134 C CD  . PRO E 1 80  ? 45.930  7.818   230.830 1.00 68.13  ? 80  PRO 5 CD  1 
ATOM 11135 N N   . ASP E 1 81  ? 41.977  5.908   232.160 1.00 47.05  ? 81  ASP 5 N   1 
ATOM 11136 C CA  . ASP E 1 81  ? 41.274  4.622   232.155 1.00 50.68  ? 81  ASP 5 CA  1 
ATOM 11137 C C   . ASP E 1 81  ? 40.504  4.574   230.887 1.00 42.99  ? 81  ASP 5 C   1 
ATOM 11138 O O   . ASP E 1 81  ? 39.944  5.589   230.483 1.00 45.30  ? 81  ASP 5 O   1 
ATOM 11139 C CB  . ASP E 1 81  ? 40.249  4.551   233.281 1.00 67.04  ? 81  ASP 5 CB  1 
ATOM 11140 C CG  . ASP E 1 81  ? 40.882  4.629   234.643 1.00 90.04  ? 81  ASP 5 CG  1 
ATOM 11141 O OD1 . ASP E 1 81  ? 41.548  3.647   235.018 1.00 111.51 ? 81  ASP 5 OD1 1 
ATOM 11142 O OD2 . ASP E 1 81  ? 40.705  5.652   235.346 1.00 92.18  ? 81  ASP 5 OD2 1 
ATOM 11143 N N   . LYS E 1 82  ? 40.346  3.391   230.317 1.00 33.44  ? 82  LYS 5 N   1 
ATOM 11144 C CA  . LYS E 1 82  ? 39.629  3.306   229.059 1.00 24.72  ? 82  LYS 5 CA  1 
ATOM 11145 C C   . LYS E 1 82  ? 38.298  4.007   229.067 1.00 43.44  ? 82  LYS 5 C   1 
ATOM 11146 O O   . LYS E 1 82  ? 37.868  4.550   228.058 1.00 55.41  ? 82  LYS 5 O   1 
ATOM 11147 C CB  . LYS E 1 82  ? 39.415  1.877   228.625 1.00 18.49  ? 82  LYS 5 CB  1 
ATOM 11148 C CG  . LYS E 1 82  ? 38.443  1.771   227.451 1.00 43.32  ? 82  LYS 5 CG  1 
ATOM 11149 C CD  . LYS E 1 82  ? 38.597  0.459   226.711 1.00 70.08  ? 82  LYS 5 CD  1 
ATOM 11150 C CE  . LYS E 1 82  ? 37.642  0.370   225.522 1.00 90.45  ? 82  LYS 5 CE  1 
ATOM 11151 N NZ  . LYS E 1 82  ? 37.930  -0.754  224.547 1.00 94.53  ? 82  LYS 5 NZ  1 
ATOM 11152 N N   . GLU E 1 83  ? 37.639  4.009   230.209 1.00 60.28  ? 83  GLU 5 N   1 
ATOM 11153 C CA  . GLU E 1 83  ? 36.338  4.643   230.284 1.00 65.15  ? 83  GLU 5 CA  1 
ATOM 11154 C C   . GLU E 1 83  ? 36.414  6.156   230.218 1.00 53.59  ? 83  GLU 5 C   1 
ATOM 11155 O O   . GLU E 1 83  ? 35.394  6.820   230.104 1.00 63.88  ? 83  GLU 5 O   1 
ATOM 11156 C CB  . GLU E 1 83  ? 35.578  4.191   231.530 1.00 89.32  ? 83  GLU 5 CB  1 
ATOM 11157 C CG  . GLU E 1 83  ? 35.173  2.707   231.556 1.00 101.45 ? 83  GLU 5 CG  1 
ATOM 11158 C CD  . GLU E 1 83  ? 36.313  1.760   231.899 1.00 111.61 ? 83  GLU 5 CD  1 
ATOM 11159 O OE1 . GLU E 1 83  ? 37.328  2.187   232.511 1.00 121.28 ? 83  GLU 5 OE1 1 
ATOM 11160 O OE2 . GLU E 1 83  ? 36.183  0.572   231.550 1.00 113.45 ? 83  GLU 5 OE2 1 
ATOM 11161 N N   . GLN E 1 84  ? 37.606  6.715   230.325 1.00 39.27  ? 84  GLN 5 N   1 
ATOM 11162 C CA  . GLN E 1 84  ? 37.723  8.162   230.225 1.00 49.15  ? 84  GLN 5 CA  1 
ATOM 11163 C C   . GLN E 1 84  ? 38.199  8.547   228.819 1.00 50.10  ? 84  GLN 5 C   1 
ATOM 11164 O O   . GLN E 1 84  ? 38.413  9.727   228.499 1.00 52.63  ? 84  GLN 5 O   1 
ATOM 11165 C CB  . GLN E 1 84  ? 38.708  8.695   231.236 1.00 41.27  ? 84  GLN 5 CB  1 
ATOM 11166 C CG  . GLN E 1 84  ? 38.959  7.811   232.397 1.00 60.97  ? 84  GLN 5 CG  1 
ATOM 11167 C CD  . GLN E 1 84  ? 39.928  8.455   233.348 1.00 79.99  ? 84  GLN 5 CD  1 
ATOM 11168 O OE1 . GLN E 1 84  ? 41.151  8.250   233.268 1.00 89.43  ? 84  GLN 5 OE1 1 
ATOM 11169 N NE2 . GLN E 1 84  ? 39.402  9.310   234.212 1.00 86.11  ? 84  GLN 5 NE2 1 
ATOM 11170 N N   . LEU E 1 85  ? 38.358  7.546   227.970 1.00 44.10  ? 85  LEU 5 N   1 
ATOM 11171 C CA  . LEU E 1 85  ? 38.829  7.797   226.627 1.00 44.87  ? 85  LEU 5 CA  1 
ATOM 11172 C C   . LEU E 1 85  ? 37.800  7.514   225.570 1.00 44.55  ? 85  LEU 5 C   1 
ATOM 11173 O O   . LEU E 1 85  ? 37.541  6.359   225.204 1.00 43.44  ? 85  LEU 5 O   1 
ATOM 11174 C CB  . LEU E 1 85  ? 40.068  6.967   226.352 1.00 46.34  ? 85  LEU 5 CB  1 
ATOM 11175 C CG  . LEU E 1 85  ? 41.113  7.209   227.425 1.00 30.41  ? 85  LEU 5 CG  1 
ATOM 11176 C CD1 . LEU E 1 85  ? 42.343  6.411   227.116 1.00 49.13  ? 85  LEU 5 CD1 1 
ATOM 11177 C CD2 . LEU E 1 85  ? 41.429  8.690   227.497 1.00 48.54  ? 85  LEU 5 CD2 1 
ATOM 11178 N N   . PRO E 1 86  ? 37.207  8.572   225.038 1.00 36.50  ? 86  PRO 5 N   1 
ATOM 11179 C CA  . PRO E 1 86  ? 36.206  8.324   224.005 1.00 25.13  ? 86  PRO 5 CA  1 
ATOM 11180 C C   . PRO E 1 86  ? 36.981  7.794   222.816 1.00 26.03  ? 86  PRO 5 C   1 
ATOM 11181 O O   . PRO E 1 86  ? 38.163  8.169   222.601 1.00 33.59  ? 86  PRO 5 O   1 
ATOM 11182 C CB  . PRO E 1 86  ? 35.633  9.708   223.744 1.00 26.84  ? 86  PRO 5 CB  1 
ATOM 11183 C CG  . PRO E 1 86  ? 35.992  10.505  225.009 1.00 27.08  ? 86  PRO 5 CG  1 
ATOM 11184 C CD  . PRO E 1 86  ? 37.376  10.002  225.313 1.00 24.19  ? 86  PRO 5 CD  1 
ATOM 11185 N N   . CYS E 1 87  ? 36.312  6.944   222.047 1.00 15.33  ? 87  CYS 5 N   1 
ATOM 11186 C CA  . CYS E 1 87  ? 36.908  6.306   220.882 1.00 35.03  ? 87  CYS 5 CA  1 
ATOM 11187 C C   . CYS E 1 87  ? 36.076  6.372   219.630 1.00 30.35  ? 87  CYS 5 C   1 
ATOM 11188 O O   . CYS E 1 87  ? 34.848  6.423   219.663 1.00 29.35  ? 87  CYS 5 O   1 
ATOM 11189 C CB  . CYS E 1 87  ? 37.109  4.815   221.134 1.00 48.48  ? 87  CYS 5 CB  1 
ATOM 11190 S SG  . CYS E 1 87  ? 37.861  4.422   222.671 1.00 66.85  ? 87  CYS 5 SG  1 
ATOM 11191 N N   . TYR E 1 88  ? 36.756  6.201   218.515 1.00 36.93  ? 88  TYR 5 N   1 
ATOM 11192 C CA  . TYR E 1 88  ? 36.074  6.209   217.244 1.00 37.62  ? 88  TYR 5 CA  1 
ATOM 11193 C C   . TYR E 1 88  ? 35.166  5.008   217.236 1.00 34.57  ? 88  TYR 5 C   1 
ATOM 11194 O O   . TYR E 1 88  ? 35.584  3.904   217.627 1.00 53.31  ? 88  TYR 5 O   1 
ATOM 11195 C CB  . TYR E 1 88  ? 37.058  6.096   216.075 1.00 35.15  ? 88  TYR 5 CB  1 
ATOM 11196 C CG  . TYR E 1 88  ? 37.870  7.335   215.816 1.00 21.62  ? 88  TYR 5 CG  1 
ATOM 11197 C CD1 . TYR E 1 88  ? 38.788  7.786   216.744 1.00 27.80  ? 88  TYR 5 CD1 1 
ATOM 11198 C CD2 . TYR E 1 88  ? 37.763  8.024   214.609 1.00 29.45  ? 88  TYR 5 CD2 1 
ATOM 11199 C CE1 . TYR E 1 88  ? 39.597  8.889   216.475 1.00 43.37  ? 88  TYR 5 CE1 1 
ATOM 11200 C CE2 . TYR E 1 88  ? 38.567  9.128   214.334 1.00 15.04  ? 88  TYR 5 CE2 1 
ATOM 11201 C CZ  . TYR E 1 88  ? 39.485  9.545   215.271 1.00 29.81  ? 88  TYR 5 CZ  1 
ATOM 11202 O OH  . TYR E 1 88  ? 40.346  10.573  214.993 1.00 41.88  ? 88  TYR 5 OH  1 
ATOM 11203 N N   . SER E 1 89  ? 33.908  5.276   216.906 1.00 25.51  ? 89  SER 5 N   1 
ATOM 11204 C CA  . SER E 1 89  ? 32.873  4.266   216.786 1.00 28.54  ? 89  SER 5 CA  1 
ATOM 11205 C C   . SER E 1 89  ? 32.952  3.892   215.303 1.00 32.50  ? 89  SER 5 C   1 
ATOM 11206 O O   . SER E 1 89  ? 33.025  4.781   214.440 1.00 42.55  ? 89  SER 5 O   1 
ATOM 11207 C CB  . SER E 1 89  ? 31.495  4.879   217.130 1.00 29.13  ? 89  SER 5 CB  1 
ATOM 11208 O OG  . SER E 1 89  ? 31.544  5.727   218.300 1.00 40.60  ? 89  SER 5 OG  1 
ATOM 11209 N N   . VAL E 1 90  ? 33.008  2.604   214.987 1.00 31.95  ? 90  VAL 5 N   1 
ATOM 11210 C CA  . VAL E 1 90  ? 33.098  2.196   213.577 1.00 37.07  ? 90  VAL 5 CA  1 
ATOM 11211 C C   . VAL E 1 90  ? 32.177  1.017   213.262 1.00 33.23  ? 90  VAL 5 C   1 
ATOM 11212 O O   . VAL E 1 90  ? 31.617  0.422   214.185 1.00 44.18  ? 90  VAL 5 O   1 
ATOM 11213 C CB  . VAL E 1 90  ? 34.568  1.829   213.194 1.00 46.09  ? 90  VAL 5 CB  1 
ATOM 11214 C CG1 . VAL E 1 90  ? 34.980  0.511   213.807 1.00 22.27  ? 90  VAL 5 CG1 1 
ATOM 11215 C CG2 . VAL E 1 90  ? 34.755  1.797   211.675 1.00 58.34  ? 90  VAL 5 CG2 1 
ATOM 11216 N N   . ALA E 1 91  ? 32.012  0.687   211.975 1.00 21.23  ? 91  ALA 5 N   1 
ATOM 11217 C CA  . ALA E 1 91  ? 31.167  -0.441  211.575 1.00 20.42  ? 91  ALA 5 CA  1 
ATOM 11218 C C   . ALA E 1 91  ? 31.273  -0.834  210.091 1.00 31.40  ? 91  ALA 5 C   1 
ATOM 11219 O O   . ALA E 1 91  ? 31.581  0.001   209.220 1.00 37.32  ? 91  ALA 5 O   1 
ATOM 11220 C CB  . ALA E 1 91  ? 29.732  -0.160  211.942 1.00 27.16  ? 91  ALA 5 CB  1 
ATOM 11221 N N   . ARG E 1 92  ? 30.990  -2.097  209.790 1.00 25.64  ? 92  ARG 5 N   1 
ATOM 11222 C CA  . ARG E 1 92  ? 31.085  -2.544  208.415 1.00 30.13  ? 92  ARG 5 CA  1 
ATOM 11223 C C   . ARG E 1 92  ? 29.764  -3.022  207.898 1.00 29.83  ? 92  ARG 5 C   1 
ATOM 11224 O O   . ARG E 1 92  ? 29.100  -3.833  208.523 1.00 44.20  ? 92  ARG 5 O   1 
ATOM 11225 C CB  . ARG E 1 92  ? 32.110  -3.662  208.271 1.00 35.63  ? 92  ARG 5 CB  1 
ATOM 11226 C CG  . ARG E 1 92  ? 32.015  -4.353  206.930 1.00 74.28  ? 92  ARG 5 CG  1 
ATOM 11227 C CD  . ARG E 1 92  ? 33.239  -5.184  206.658 1.00 105.51 ? 92  ARG 5 CD  1 
ATOM 11228 N NE  . ARG E 1 92  ? 33.441  -6.244  207.642 1.00 125.04 ? 92  ARG 5 NE  1 
ATOM 11229 C CZ  . ARG E 1 92  ? 32.971  -7.483  207.514 1.00 133.87 ? 92  ARG 5 CZ  1 
ATOM 11230 N NH1 . ARG E 1 92  ? 32.263  -7.820  206.436 1.00 121.33 ? 92  ARG 5 NH1 1 
ATOM 11231 N NH2 . ARG E 1 92  ? 33.243  -8.393  208.450 1.00 147.57 ? 92  ARG 5 NH2 1 
ATOM 11232 N N   . ILE E 1 93  ? 29.408  -2.555  206.723 1.00 21.14  ? 93  ILE 5 N   1 
ATOM 11233 C CA  . ILE E 1 93  ? 28.173  -2.960  206.148 1.00 26.93  ? 93  ILE 5 CA  1 
ATOM 11234 C C   . ILE E 1 93  ? 28.433  -3.775  204.933 1.00 33.26  ? 93  ILE 5 C   1 
ATOM 11235 O O   . ILE E 1 93  ? 28.941  -3.316  203.918 1.00 48.67  ? 93  ILE 5 O   1 
ATOM 11236 C CB  . ILE E 1 93  ? 27.258  -1.818  205.852 1.00 32.12  ? 93  ILE 5 CB  1 
ATOM 11237 C CG1 . ILE E 1 93  ? 26.873  -1.158  207.168 1.00 19.77  ? 93  ILE 5 CG1 1 
ATOM 11238 C CG2 . ILE E 1 93  ? 26.036  -2.349  205.142 1.00 20.28  ? 93  ILE 5 CG2 1 
ATOM 11239 C CD1 . ILE E 1 93  ? 26.233  0.157   206.979 1.00 63.69  ? 93  ILE 5 CD1 1 
ATOM 11240 N N   . PRO E 1 94  ? 28.120  -5.038  205.058 1.00 31.20  ? 94  PRO 5 N   1 
ATOM 11241 C CA  . PRO E 1 94  ? 28.195  -6.195  204.182 1.00 27.61  ? 94  PRO 5 CA  1 
ATOM 11242 C C   . PRO E 1 94  ? 27.359  -6.087  202.971 1.00 24.49  ? 94  PRO 5 C   1 
ATOM 11243 O O   . PRO E 1 94  ? 26.148  -6.225  203.045 1.00 46.40  ? 94  PRO 5 O   1 
ATOM 11244 C CB  . PRO E 1 94  ? 27.620  -7.286  205.046 1.00 23.00  ? 94  PRO 5 CB  1 
ATOM 11245 C CG  . PRO E 1 94  ? 27.912  -6.796  206.442 1.00 38.69  ? 94  PRO 5 CG  1 
ATOM 11246 C CD  . PRO E 1 94  ? 27.550  -5.401  206.360 1.00 20.64  ? 94  PRO 5 CD  1 
ATOM 11247 N N   . LEU E 1 95  ? 27.982  -5.909  201.832 1.00 25.89  ? 95  LEU 5 N   1 
ATOM 11248 C CA  . LEU E 1 95  ? 27.176  -5.856  200.625 1.00 42.67  ? 95  LEU 5 CA  1 
ATOM 11249 C C   . LEU E 1 95  ? 27.431  -7.134  199.868 1.00 41.55  ? 95  LEU 5 C   1 
ATOM 11250 O O   . LEU E 1 95  ? 28.449  -7.781  200.037 1.00 56.01  ? 95  LEU 5 O   1 
ATOM 11251 C CB  . LEU E 1 95  ? 27.528  -4.659  199.759 1.00 40.84  ? 95  LEU 5 CB  1 
ATOM 11252 C CG  . LEU E 1 95  ? 27.890  -3.360  200.457 1.00 47.39  ? 95  LEU 5 CG  1 
ATOM 11253 C CD1 . LEU E 1 95  ? 27.589  -2.276  199.478 1.00 36.27  ? 95  LEU 5 CD1 1 
ATOM 11254 C CD2 . LEU E 1 95  ? 27.087  -3.165  201.746 1.00 30.86  ? 95  LEU 5 CD2 1 
ATOM 11255 N N   . PRO E 1 96  ? 26.478  -7.560  199.075 1.00 43.23  ? 96  PRO 5 N   1 
ATOM 11256 C CA  . PRO E 1 96  ? 26.679  -8.792  198.320 1.00 55.30  ? 96  PRO 5 CA  1 
ATOM 11257 C C   . PRO E 1 96  ? 27.554  -8.609  197.108 1.00 47.05  ? 96  PRO 5 C   1 
ATOM 11258 O O   . PRO E 1 96  ? 27.451  -7.578  196.462 1.00 50.85  ? 96  PRO 5 O   1 
ATOM 11259 C CB  . PRO E 1 96  ? 25.263  -9.126  197.869 1.00 70.01  ? 96  PRO 5 CB  1 
ATOM 11260 C CG  . PRO E 1 96  ? 24.634  -7.783  197.708 1.00 58.68  ? 96  PRO 5 CG  1 
ATOM 11261 C CD  . PRO E 1 96  ? 25.088  -7.106  198.985 1.00 52.94  ? 96  PRO 5 CD  1 
ATOM 11262 N N   . ASN E 1 97  ? 28.358  -9.621  196.758 1.00 55.92  ? 97  ASN 5 N   1 
ATOM 11263 C CA  . ASN E 1 97  ? 29.187  -9.518  195.544 1.00 64.76  ? 97  ASN 5 CA  1 
ATOM 11264 C C   . ASN E 1 97  ? 28.246  -9.422  194.348 1.00 52.77  ? 97  ASN 5 C   1 
ATOM 11265 O O   . ASN E 1 97  ? 27.176  -10.016 194.325 1.00 52.38  ? 97  ASN 5 O   1 
ATOM 11266 C CB  . ASN E 1 97  ? 30.179  -10.674 195.353 1.00 74.56  ? 97  ASN 5 CB  1 
ATOM 11267 C CG  . ASN E 1 97  ? 31.020  -10.514 194.068 1.00 92.13  ? 97  ASN 5 CG  1 
ATOM 11268 O OD1 . ASN E 1 97  ? 30.541  -10.796 192.963 1.00 81.73  ? 97  ASN 5 OD1 1 
ATOM 11269 N ND2 . ASN E 1 97  ? 32.246  -9.997  194.208 1.00 100.78 ? 97  ASN 5 ND2 1 
ATOM 11270 N N   . ILE E 1 98  ? 28.671  -8.701  193.338 1.00 45.19  ? 98  ILE 5 N   1 
ATOM 11271 C CA  . ILE E 1 98  ? 27.815  -8.462  192.215 1.00 52.70  ? 98  ILE 5 CA  1 
ATOM 11272 C C   . ILE E 1 98  ? 28.219  -9.200  190.961 1.00 57.00  ? 98  ILE 5 C   1 
ATOM 11273 O O   . ILE E 1 98  ? 27.401  -9.432  190.049 1.00 59.13  ? 98  ILE 5 O   1 
ATOM 11274 C CB  . ILE E 1 98  ? 27.761  -6.928  192.039 1.00 53.28  ? 98  ILE 5 CB  1 
ATOM 11275 C CG1 . ILE E 1 98  ? 26.953  -6.338  193.205 1.00 27.50  ? 98  ILE 5 CG1 1 
ATOM 11276 C CG2 . ILE E 1 98  ? 27.248  -6.520  190.677 1.00 58.69  ? 98  ILE 5 CG2 1 
ATOM 11277 C CD1 . ILE E 1 98  ? 27.050  -4.862  193.336 1.00 39.10  ? 98  ILE 5 CD1 1 
ATOM 11278 N N   . ASN E 1 99  ? 29.449  -9.670  190.971 1.00 60.19  ? 99  ASN 5 N   1 
ATOM 11279 C CA  . ASN E 1 99  ? 29.977  -10.340 189.816 1.00 76.70  ? 99  ASN 5 CA  1 
ATOM 11280 C C   . ASN E 1 99  ? 29.746  -11.838 189.658 1.00 88.65  ? 99  ASN 5 C   1 
ATOM 11281 O O   . ASN E 1 99  ? 30.096  -12.639 190.513 1.00 93.41  ? 99  ASN 5 O   1 
ATOM 11282 C CB  . ASN E 1 99  ? 31.453  -9.987  189.666 1.00 68.75  ? 99  ASN 5 CB  1 
ATOM 11283 C CG  . ASN E 1 99  ? 31.667  -8.499  189.523 1.00 74.32  ? 99  ASN 5 CG  1 
ATOM 11284 O OD1 . ASN E 1 99  ? 32.153  -7.833  190.440 1.00 67.92  ? 99  ASN 5 OD1 1 
ATOM 11285 N ND2 . ASN E 1 99  ? 31.282  -7.961  188.376 1.00 76.90  ? 99  ASN 5 ND2 1 
ATOM 11286 N N   . GLU E 1 100 ? 29.070  -12.169 188.564 1.00 108.34 ? 100 GLU 5 N   1 
ATOM 11287 C CA  . GLU E 1 100 ? 28.775  -13.539 188.112 1.00 124.17 ? 100 GLU 5 CA  1 
ATOM 11288 C C   . GLU E 1 100 ? 29.024  -13.397 186.617 1.00 135.19 ? 100 GLU 5 C   1 
ATOM 11289 O O   . GLU E 1 100 ? 28.585  -14.217 185.797 1.00 130.92 ? 100 GLU 5 O   1 
ATOM 11290 C CB  . GLU E 1 100 ? 27.304  -13.897 188.343 1.00 129.56 ? 100 GLU 5 CB  1 
ATOM 11291 C CG  . GLU E 1 100 ? 26.834  -13.750 189.789 1.00 147.35 ? 100 GLU 5 CG  1 
ATOM 11292 C CD  . GLU E 1 100 ? 27.577  -14.656 190.782 1.00 154.62 ? 100 GLU 5 CD  1 
ATOM 11293 O OE1 . GLU E 1 100 ? 28.584  -15.301 190.402 1.00 154.19 ? 100 GLU 5 OE1 1 
ATOM 11294 O OE2 . GLU E 1 100 ? 27.131  -14.734 191.951 1.00 162.15 ? 100 GLU 5 OE2 1 
ATOM 11295 N N   . ASP E 1 101 ? 29.694  -12.286 186.297 1.00 150.86 ? 101 ASP 5 N   1 
ATOM 11296 C CA  . ASP E 1 101 ? 30.064  -11.836 184.958 1.00 154.77 ? 101 ASP 5 CA  1 
ATOM 11297 C C   . ASP E 1 101 ? 31.328  -12.590 184.521 1.00 158.54 ? 101 ASP 5 C   1 
ATOM 11298 O O   . ASP E 1 101 ? 32.467  -12.308 184.914 1.00 153.84 ? 101 ASP 5 O   1 
ATOM 11299 C CB  . ASP E 1 101 ? 30.231  -10.304 184.975 1.00 157.34 ? 101 ASP 5 CB  1 
ATOM 11300 C CG  . ASP E 1 101 ? 29.100  -9.595  185.762 1.00 158.92 ? 101 ASP 5 CG  1 
ATOM 11301 O OD1 . ASP E 1 101 ? 27.959  -9.503  185.255 1.00 164.70 ? 101 ASP 5 OD1 1 
ATOM 11302 O OD2 . ASP E 1 101 ? 29.350  -9.148  186.905 1.00 148.75 ? 101 ASP 5 OD2 1 
ATOM 11303 N N   . LEU E 1 102 ? 31.066  -13.535 183.629 1.00 165.98 ? 102 LEU 5 N   1 
ATOM 11304 C CA  . LEU E 1 102 ? 32.005  -14.509 183.103 1.00 180.28 ? 102 LEU 5 CA  1 
ATOM 11305 C C   . LEU E 1 102 ? 33.558  -14.427 183.109 1.00 184.26 ? 102 LEU 5 C   1 
ATOM 11306 O O   . LEU E 1 102 ? 34.222  -14.904 184.059 1.00 181.30 ? 102 LEU 5 O   1 
ATOM 11307 C CB  . LEU E 1 102 ? 31.452  -15.045 181.758 1.00 184.66 ? 102 LEU 5 CB  1 
ATOM 11308 C CG  . LEU E 1 102 ? 31.959  -16.383 181.176 1.00 192.10 ? 102 LEU 5 CG  1 
ATOM 11309 C CD1 . LEU E 1 102 ? 32.250  -17.420 182.283 1.00 192.21 ? 102 LEU 5 CD1 1 
ATOM 11310 C CD2 . LEU E 1 102 ? 30.940  -16.939 180.165 1.00 186.84 ? 102 LEU 5 CD2 1 
ATOM 11311 N N   . THR E 1 103 ? 34.141  -13.839 182.073 1.00 188.27 ? 103 THR 5 N   1 
ATOM 11312 C CA  . THR E 1 103 ? 35.591  -13.843 181.954 1.00 194.81 ? 103 THR 5 CA  1 
ATOM 11313 C C   . THR E 1 103 ? 36.319  -12.722 182.668 1.00 186.92 ? 103 THR 5 C   1 
ATOM 11314 O O   . THR E 1 103 ? 36.333  -12.668 183.898 1.00 185.58 ? 103 THR 5 O   1 
ATOM 11315 C CB  . THR E 1 103 ? 36.017  -13.896 180.433 1.00 201.55 ? 103 THR 5 CB  1 
ATOM 11316 O OG1 . THR E 1 103 ? 35.329  -12.857 179.706 1.00 206.02 ? 103 THR 5 OG1 1 
ATOM 11317 C CG2 . THR E 1 103 ? 35.693  -15.273 179.810 1.00 203.44 ? 103 THR 5 CG2 1 
ATOM 11318 N N   . CYS E 1 104 ? 36.914  -11.841 181.872 1.00 185.42 ? 104 CYS 5 N   1 
ATOM 11319 C CA  . CYS E 1 104 ? 37.666  -10.713 182.376 1.00 182.01 ? 104 CYS 5 CA  1 
ATOM 11320 C C   . CYS E 1 104 ? 36.960  -9.406  182.014 1.00 174.05 ? 104 CYS 5 C   1 
ATOM 11321 O O   . CYS E 1 104 ? 36.184  -9.347  181.054 1.00 174.26 ? 104 CYS 5 O   1 
ATOM 11322 C CB  . CYS E 1 104 ? 39.080  -10.678 181.747 1.00 191.20 ? 104 CYS 5 CB  1 
ATOM 11323 S SG  . CYS E 1 104 ? 40.070  -12.221 181.786 1.00 212.03 ? 104 CYS 5 SG  1 
ATOM 11324 N N   . GLY E 1 105 ? 37.191  -8.387  182.844 1.00 163.80 ? 105 GLY 5 N   1 
ATOM 11325 C CA  . GLY E 1 105 ? 36.684  -7.048  182.596 1.00 148.97 ? 105 GLY 5 CA  1 
ATOM 11326 C C   . GLY E 1 105 ? 35.347  -6.576  183.139 1.00 135.69 ? 105 GLY 5 C   1 
ATOM 11327 O O   . GLY E 1 105 ? 35.205  -5.420  183.538 1.00 131.56 ? 105 GLY 5 O   1 
ATOM 11328 N N   . ASN E 1 106 ? 34.352  -7.451  183.114 1.00 126.66 ? 106 ASN 5 N   1 
ATOM 11329 C CA  . ASN E 1 106 ? 33.038  -7.078  183.612 1.00 116.65 ? 106 ASN 5 CA  1 
ATOM 11330 C C   . ASN E 1 106 ? 33.057  -7.198  185.113 1.00 89.74  ? 106 ASN 5 C   1 
ATOM 11331 O O   . ASN E 1 106 ? 32.781  -8.256  185.660 1.00 87.15  ? 106 ASN 5 O   1 
ATOM 11332 C CB  . ASN E 1 106 ? 31.962  -7.999  183.031 1.00 137.86 ? 106 ASN 5 CB  1 
ATOM 11333 C CG  . ASN E 1 106 ? 32.017  -8.103  181.519 1.00 156.37 ? 106 ASN 5 CG  1 
ATOM 11334 O OD1 . ASN E 1 106 ? 32.012  -9.206  180.965 1.00 167.87 ? 106 ASN 5 OD1 1 
ATOM 11335 N ND2 . ASN E 1 106 ? 32.056  -6.956  180.837 1.00 166.95 ? 106 ASN 5 ND2 1 
ATOM 11336 N N   . ILE E 1 107 ? 33.485  -6.155  185.792 1.00 59.98  ? 107 ILE 5 N   1 
ATOM 11337 C CA  . ILE E 1 107 ? 33.498  -6.237  187.225 1.00 39.58  ? 107 ILE 5 CA  1 
ATOM 11338 C C   . ILE E 1 107 ? 32.639  -5.126  187.709 1.00 32.97  ? 107 ILE 5 C   1 
ATOM 11339 O O   . ILE E 1 107 ? 32.621  -4.052  187.119 1.00 42.52  ? 107 ILE 5 O   1 
ATOM 11340 C CB  . ILE E 1 107 ? 34.883  -6.106  187.769 1.00 40.54  ? 107 ILE 5 CB  1 
ATOM 11341 C CG1 . ILE E 1 107 ? 35.797  -7.101  187.058 1.00 48.89  ? 107 ILE 5 CG1 1 
ATOM 11342 C CG2 . ILE E 1 107 ? 34.889  -6.385  189.250 1.00 41.16  ? 107 ILE 5 CG2 1 
ATOM 11343 C CD1 . ILE E 1 107 ? 35.346  -8.527  187.160 1.00 70.75  ? 107 ILE 5 CD1 1 
ATOM 11344 N N   . LEU E 1 108 ? 31.886  -5.389  188.761 1.00 17.12  ? 108 LEU 5 N   1 
ATOM 11345 C CA  . LEU E 1 108 ? 30.988  -4.386  189.288 1.00 26.94  ? 108 LEU 5 CA  1 
ATOM 11346 C C   . LEU E 1 108 ? 31.218  -4.314  190.747 1.00 31.08  ? 108 LEU 5 C   1 
ATOM 11347 O O   . LEU E 1 108 ? 31.209  -5.345  191.436 1.00 36.70  ? 108 LEU 5 O   1 
ATOM 11348 C CB  . LEU E 1 108 ? 29.524  -4.762  189.053 1.00 20.92  ? 108 LEU 5 CB  1 
ATOM 11349 C CG  . LEU E 1 108 ? 29.215  -4.889  187.563 1.00 32.17  ? 108 LEU 5 CG  1 
ATOM 11350 C CD1 . LEU E 1 108 ? 27.850  -5.503  187.322 1.00 34.88  ? 108 LEU 5 CD1 1 
ATOM 11351 C CD2 . LEU E 1 108 ? 29.334  -3.532  186.914 1.00 23.57  ? 108 LEU 5 CD2 1 
ATOM 11352 N N   . MET E 1 109 ? 31.459  -3.100  191.220 1.00 27.31  ? 109 MET 5 N   1 
ATOM 11353 C CA  . MET E 1 109 ? 31.671  -2.903  192.640 1.00 36.58  ? 109 MET 5 CA  1 
ATOM 11354 C C   . MET E 1 109 ? 30.605  -1.933  193.175 1.00 39.69  ? 109 MET 5 C   1 
ATOM 11355 O O   . MET E 1 109 ? 29.999  -1.129  192.433 1.00 32.78  ? 109 MET 5 O   1 
ATOM 11356 C CB  . MET E 1 109 ? 33.090  -2.365  192.938 1.00 44.47  ? 109 MET 5 CB  1 
ATOM 11357 C CG  . MET E 1 109 ? 34.307  -3.147  192.359 1.00 24.96  ? 109 MET 5 CG  1 
ATOM 11358 S SD  . MET E 1 109 ? 35.781  -3.057  193.516 1.00 51.38  ? 109 MET 5 SD  1 
ATOM 11359 C CE  . MET E 1 109 ? 37.058  -3.104  192.303 1.00 54.50  ? 109 MET 5 CE  1 
ATOM 11360 N N   . TRP E 1 110 ? 30.331  -2.061  194.460 1.00 33.61  ? 110 TRP 5 N   1 
ATOM 11361 C CA  . TRP E 1 110 ? 29.381  -1.182  195.092 1.00 35.20  ? 110 TRP 5 CA  1 
ATOM 11362 C C   . TRP E 1 110 ? 29.995  0.193   195.292 1.00 41.62  ? 110 TRP 5 C   1 
ATOM 11363 O O   . TRP E 1 110 ? 30.982  0.320   196.040 1.00 40.71  ? 110 TRP 5 O   1 
ATOM 11364 C CB  . TRP E 1 110 ? 29.029  -1.737  196.458 1.00 48.29  ? 110 TRP 5 CB  1 
ATOM 11365 C CG  . TRP E 1 110 ? 27.938  -2.688  196.392 1.00 59.04  ? 110 TRP 5 CG  1 
ATOM 11366 C CD1 . TRP E 1 110 ? 27.910  -3.934  196.900 1.00 57.50  ? 110 TRP 5 CD1 1 
ATOM 11367 C CD2 . TRP E 1 110 ? 26.677  -2.468  195.788 1.00 70.12  ? 110 TRP 5 CD2 1 
ATOM 11368 N NE1 . TRP E 1 110 ? 26.701  -4.518  196.657 1.00 52.75  ? 110 TRP 5 NE1 1 
ATOM 11369 C CE2 . TRP E 1 110 ? 25.923  -3.635  195.967 1.00 53.71  ? 110 TRP 5 CE2 1 
ATOM 11370 C CE3 . TRP E 1 110 ? 26.110  -1.396  195.096 1.00 86.05  ? 110 TRP 5 CE3 1 
ATOM 11371 C CZ2 . TRP E 1 110 ? 24.634  -3.765  195.488 1.00 61.08  ? 110 TRP 5 CZ2 1 
ATOM 11372 C CZ3 . TRP E 1 110 ? 24.826  -1.526  194.618 1.00 88.64  ? 110 TRP 5 CZ3 1 
ATOM 11373 C CH2 . TRP E 1 110 ? 24.101  -2.705  194.812 1.00 72.12  ? 110 TRP 5 CH2 1 
ATOM 11374 N N   . GLU E 1 111 ? 29.424  1.213   194.649 1.00 34.41  ? 111 GLU 5 N   1 
ATOM 11375 C CA  . GLU E 1 111 ? 29.923  2.573   194.823 1.00 25.07  ? 111 GLU 5 CA  1 
ATOM 11376 C C   . GLU E 1 111 ? 29.045  3.473   195.657 1.00 24.47  ? 111 GLU 5 C   1 
ATOM 11377 O O   . GLU E 1 111 ? 27.861  3.637   195.365 1.00 24.55  ? 111 GLU 5 O   1 
ATOM 11378 C CB  . GLU E 1 111 ? 30.090  3.242   193.511 1.00 23.66  ? 111 GLU 5 CB  1 
ATOM 11379 C CG  . GLU E 1 111 ? 30.497  4.692   193.613 1.00 27.95  ? 111 GLU 5 CG  1 
ATOM 11380 C CD  . GLU E 1 111 ? 30.536  5.298   192.230 1.00 50.44  ? 111 GLU 5 CD  1 
ATOM 11381 O OE1 . GLU E 1 111 ? 30.071  4.602   191.287 1.00 27.19  ? 111 GLU 5 OE1 1 
ATOM 11382 O OE2 . GLU E 1 111 ? 31.010  6.445   192.044 1.00 42.31  ? 111 GLU 5 OE2 1 
ATOM 11383 N N   . ALA E 1 112 ? 29.647  4.069   196.680 1.00 21.27  ? 112 ALA 5 N   1 
ATOM 11384 C CA  . ALA E 1 112 ? 28.961  5.011   197.565 1.00 28.96  ? 112 ALA 5 CA  1 
ATOM 11385 C C   . ALA E 1 112 ? 29.019  6.291   196.824 1.00 40.24  ? 112 ALA 5 C   1 
ATOM 11386 O O   . ALA E 1 112 ? 30.094  6.738   196.422 1.00 55.49  ? 112 ALA 5 O   1 
ATOM 11387 C CB  . ALA E 1 112 ? 29.689  5.202   198.824 1.00 29.23  ? 112 ALA 5 CB  1 
ATOM 11388 N N   . VAL E 1 113 ? 27.907  6.985   196.863 1.00 34.11  ? 113 VAL 5 N   1 
ATOM 11389 C CA  . VAL E 1 113 ? 27.775  8.198   196.113 1.00 27.82  ? 113 VAL 5 CA  1 
ATOM 11390 C C   . VAL E 1 113 ? 27.376  9.414   196.945 1.00 31.80  ? 113 VAL 5 C   1 
ATOM 11391 O O   . VAL E 1 113 ? 27.944  10.526  196.859 1.00 15.52  ? 113 VAL 5 O   1 
ATOM 11392 C CB  . VAL E 1 113 ? 26.684  7.907   195.078 1.00 4.72   ? 113 VAL 5 CB  1 
ATOM 11393 C CG1 . VAL E 1 113 ? 26.410  9.101   194.274 1.00 28.14  ? 113 VAL 5 CG1 1 
ATOM 11394 C CG2 . VAL E 1 113 ? 27.116  6.761   194.175 1.00 6.30   ? 113 VAL 5 CG2 1 
ATOM 11395 N N   . THR E 1 114 ? 26.463  9.135   197.845 1.00 23.77  ? 114 THR 5 N   1 
ATOM 11396 C CA  . THR E 1 114 ? 25.896  10.156  198.623 1.00 17.45  ? 114 THR 5 CA  1 
ATOM 11397 C C   . THR E 1 114 ? 25.660  9.771   200.017 1.00 22.35  ? 114 THR 5 C   1 
ATOM 11398 O O   . THR E 1 114 ? 25.343  8.608   200.333 1.00 26.30  ? 114 THR 5 O   1 
ATOM 11399 C CB  . THR E 1 114 ? 24.598  10.423  197.980 1.00 19.93  ? 114 THR 5 CB  1 
ATOM 11400 O OG1 . THR E 1 114 ? 24.807  11.486  197.079 1.00 28.50  ? 114 THR 5 OG1 1 
ATOM 11401 C CG2 . THR E 1 114 ? 23.471  10.700  198.984 1.00 50.31  ? 114 THR 5 CG2 1 
ATOM 11402 N N   . VAL E 1 115 ? 25.698  10.766  200.866 1.00 15.12  ? 115 VAL 5 N   1 
ATOM 11403 C CA  . VAL E 1 115 ? 25.391  10.416  202.204 1.00 27.25  ? 115 VAL 5 CA  1 
ATOM 11404 C C   . VAL E 1 115 ? 24.711  11.531  202.870 1.00 31.04  ? 115 VAL 5 C   1 
ATOM 11405 O O   . VAL E 1 115 ? 25.038  12.684  202.612 1.00 40.99  ? 115 VAL 5 O   1 
ATOM 11406 C CB  . VAL E 1 115 ? 26.607  10.101  202.983 1.00 17.21  ? 115 VAL 5 CB  1 
ATOM 11407 C CG1 . VAL E 1 115 ? 27.514  11.286  203.005 1.00 32.42  ? 115 VAL 5 CG1 1 
ATOM 11408 C CG2 . VAL E 1 115 ? 26.205  9.719   204.377 1.00 29.31  ? 115 VAL 5 CG2 1 
ATOM 11409 N N   . LYS E 1 116 ? 23.698  11.190  203.654 1.00 30.75  ? 116 LYS 5 N   1 
ATOM 11410 C CA  . LYS E 1 116 ? 22.988  12.188  204.449 1.00 30.81  ? 116 LYS 5 CA  1 
ATOM 11411 C C   . LYS E 1 116 ? 23.272  11.717  205.859 1.00 23.23  ? 116 LYS 5 C   1 
ATOM 11412 O O   . LYS E 1 116 ? 23.300  10.499  206.106 1.00 29.75  ? 116 LYS 5 O   1 
ATOM 11413 C CB  . LYS E 1 116 ? 21.472  12.160  204.218 1.00 25.29  ? 116 LYS 5 CB  1 
ATOM 11414 C CG  . LYS E 1 116 ? 20.937  12.478  202.808 1.00 52.05  ? 116 LYS 5 CG  1 
ATOM 11415 C CD  . LYS E 1 116 ? 19.431  12.913  202.862 1.00 58.12  ? 116 LYS 5 CD  1 
ATOM 11416 C CE  . LYS E 1 116 ? 18.791  13.052  201.460 1.00 82.21  ? 116 LYS 5 CE  1 
ATOM 11417 N NZ  . LYS E 1 116 ? 17.404  13.652  201.444 1.00 90.34  ? 116 LYS 5 NZ  1 
ATOM 11418 N N   . THR E 1 117 ? 23.552  12.627  206.782 1.00 15.81  ? 117 THR 5 N   1 
ATOM 11419 C CA  . THR E 1 117 ? 23.819  12.155  208.142 1.00 25.38  ? 117 THR 5 CA  1 
ATOM 11420 C C   . THR E 1 117 ? 23.307  13.188  209.097 1.00 31.12  ? 117 THR 5 C   1 
ATOM 11421 O O   . THR E 1 117 ? 23.086  14.328  208.689 1.00 48.67  ? 117 THR 5 O   1 
ATOM 11422 C CB  . THR E 1 117 ? 25.328  11.868  208.419 1.00 21.10  ? 117 THR 5 CB  1 
ATOM 11423 O OG1 . THR E 1 117 ? 25.864  12.840  209.321 1.00 25.68  ? 117 THR 5 OG1 1 
ATOM 11424 C CG2 . THR E 1 117 ? 26.130  11.928  207.163 1.00 34.38  ? 117 THR 5 CG2 1 
ATOM 11425 N N   . GLU E 1 118 ? 23.163  12.809  210.364 1.00 27.22  ? 118 GLU 5 N   1 
ATOM 11426 C CA  . GLU E 1 118 ? 22.661  13.734  211.362 1.00 26.15  ? 118 GLU 5 CA  1 
ATOM 11427 C C   . GLU E 1 118 ? 22.905  13.162  212.712 1.00 32.92  ? 118 GLU 5 C   1 
ATOM 11428 O O   . GLU E 1 118 ? 22.945  11.935  212.870 1.00 40.38  ? 118 GLU 5 O   1 
ATOM 11429 C CB  . GLU E 1 118 ? 21.179  13.835  211.209 1.00 30.90  ? 118 GLU 5 CB  1 
ATOM 11430 C CG  . GLU E 1 118 ? 20.499  14.998  211.850 1.00 33.67  ? 118 GLU 5 CG  1 
ATOM 11431 C CD  . GLU E 1 118 ? 19.167  15.155  211.174 1.00 50.84  ? 118 GLU 5 CD  1 
ATOM 11432 O OE1 . GLU E 1 118 ? 19.184  15.715  210.060 1.00 46.92  ? 118 GLU 5 OE1 1 
ATOM 11433 O OE2 . GLU E 1 118 ? 18.139  14.614  211.673 1.00 36.09  ? 118 GLU 5 OE2 1 
ATOM 11434 N N   . VAL E 1 119 ? 23.090  14.042  213.683 1.00 13.55  ? 119 VAL 5 N   1 
ATOM 11435 C CA  . VAL E 1 119 ? 23.289  13.595  215.035 1.00 23.42  ? 119 VAL 5 CA  1 
ATOM 11436 C C   . VAL E 1 119 ? 21.950  13.380  215.682 1.00 35.45  ? 119 VAL 5 C   1 
ATOM 11437 O O   . VAL E 1 119 ? 21.069  14.249  215.649 1.00 47.94  ? 119 VAL 5 O   1 
ATOM 11438 C CB  . VAL E 1 119 ? 24.012  14.617  215.858 1.00 32.82  ? 119 VAL 5 CB  1 
ATOM 11439 C CG1 . VAL E 1 119 ? 23.810  14.347  217.390 1.00 32.64  ? 119 VAL 5 CG1 1 
ATOM 11440 C CG2 . VAL E 1 119 ? 25.452  14.569  215.491 1.00 38.90  ? 119 VAL 5 CG2 1 
ATOM 11441 N N   . ILE E 1 120 ? 21.826  12.284  216.399 1.00 33.19  ? 120 ILE 5 N   1 
ATOM 11442 C CA  . ILE E 1 120 ? 20.559  12.053  217.008 1.00 23.45  ? 120 ILE 5 CA  1 
ATOM 11443 C C   . ILE E 1 120 ? 20.386  12.547  218.423 1.00 34.34  ? 120 ILE 5 C   1 
ATOM 11444 O O   . ILE E 1 120 ? 21.280  12.396  219.295 1.00 17.82  ? 120 ILE 5 O   1 
ATOM 11445 C CB  . ILE E 1 120 ? 20.189  10.618  216.949 1.00 12.24  ? 120 ILE 5 CB  1 
ATOM 11446 C CG1 . ILE E 1 120 ? 20.008  10.183  215.505 1.00 20.52  ? 120 ILE 5 CG1 1 
ATOM 11447 C CG2 . ILE E 1 120 ? 18.924  10.389  217.693 1.00 34.47  ? 120 ILE 5 CG2 1 
ATOM 11448 C CD1 . ILE E 1 120 ? 21.319  9.797   214.840 1.00 61.05  ? 120 ILE 5 CD1 1 
ATOM 11449 N N   . GLY E 1 121 ? 19.215  13.161  218.609 1.00 30.72  ? 121 GLY 5 N   1 
ATOM 11450 C CA  . GLY E 1 121 ? 18.814  13.630  219.914 1.00 37.92  ? 121 GLY 5 CA  1 
ATOM 11451 C C   . GLY E 1 121 ? 19.592  14.809  220.365 1.00 36.45  ? 121 GLY 5 C   1 
ATOM 11452 O O   . GLY E 1 121 ? 20.059  14.915  221.495 1.00 29.63  ? 121 GLY 5 O   1 
ATOM 11453 N N   . VAL E 1 122 ? 19.712  15.735  219.457 1.00 38.21  ? 122 VAL 5 N   1 
ATOM 11454 C CA  . VAL E 1 122 ? 20.438  16.914  219.803 1.00 39.54  ? 122 VAL 5 CA  1 
ATOM 11455 C C   . VAL E 1 122 ? 19.645  17.610  220.918 1.00 35.11  ? 122 VAL 5 C   1 
ATOM 11456 O O   . VAL E 1 122 ? 20.241  18.188  221.844 1.00 29.35  ? 122 VAL 5 O   1 
ATOM 11457 C CB  . VAL E 1 122 ? 20.636  17.765  218.558 1.00 39.70  ? 122 VAL 5 CB  1 
ATOM 11458 C CG1 . VAL E 1 122 ? 19.825  17.185  217.396 1.00 42.97  ? 122 VAL 5 CG1 1 
ATOM 11459 C CG2 . VAL E 1 122 ? 20.242  19.178  218.809 1.00 22.20  ? 122 VAL 5 CG2 1 
ATOM 11460 N N   . THR E 1 123 ? 18.314  17.447  220.876 1.00 27.07  ? 123 THR 5 N   1 
ATOM 11461 C CA  . THR E 1 123 ? 17.414  18.077  221.868 1.00 38.82  ? 123 THR 5 CA  1 
ATOM 11462 C C   . THR E 1 123 ? 17.666  17.589  223.261 1.00 36.01  ? 123 THR 5 C   1 
ATOM 11463 O O   . THR E 1 123 ? 17.499  18.309  224.236 1.00 29.55  ? 123 THR 5 O   1 
ATOM 11464 C CB  . THR E 1 123 ? 15.938  17.768  221.641 1.00 24.49  ? 123 THR 5 CB  1 
ATOM 11465 O OG1 . THR E 1 123 ? 15.784  16.366  221.438 1.00 30.96  ? 123 THR 5 OG1 1 
ATOM 11466 C CG2 . THR E 1 123 ? 15.415  18.520  220.469 1.00 39.35  ? 123 THR 5 CG2 1 
ATOM 11467 N N   . ALA E 1 124 ? 18.011  16.324  223.349 1.00 37.38  ? 124 ALA 5 N   1 
ATOM 11468 C CA  . ALA E 1 124 ? 18.257  15.728  224.628 1.00 37.92  ? 124 ALA 5 CA  1 
ATOM 11469 C C   . ALA E 1 124 ? 19.037  16.632  225.546 1.00 35.12  ? 124 ALA 5 C   1 
ATOM 11470 O O   . ALA E 1 124 ? 18.713  16.748  226.710 1.00 50.78  ? 124 ALA 5 O   1 
ATOM 11471 C CB  . ALA E 1 124 ? 18.974  14.468  224.439 1.00 47.91  ? 124 ALA 5 CB  1 
ATOM 11472 N N   . MET E 1 125 ? 19.960  17.393  224.988 1.00 35.98  ? 125 MET 5 N   1 
ATOM 11473 C CA  . MET E 1 125 ? 20.805  18.259  225.791 1.00 38.05  ? 125 MET 5 CA  1 
ATOM 11474 C C   . MET E 1 125 ? 20.076  19.369  226.508 1.00 42.26  ? 125 MET 5 C   1 
ATOM 11475 O O   . MET E 1 125 ? 20.687  20.155  227.252 1.00 47.93  ? 125 MET 5 O   1 
ATOM 11476 C CB  . MET E 1 125 ? 21.895  18.821  224.919 1.00 54.99  ? 125 MET 5 CB  1 
ATOM 11477 C CG  . MET E 1 125 ? 22.423  17.810  223.911 1.00 63.42  ? 125 MET 5 CG  1 
ATOM 11478 S SD  . MET E 1 125 ? 23.994  18.350  223.372 1.00 55.88  ? 125 MET 5 SD  1 
ATOM 11479 C CE  . MET E 1 125 ? 24.415  19.644  224.793 1.00 20.02  ? 125 MET 5 CE  1 
ATOM 11480 N N   . LEU E 1 126 ? 18.764  19.400  226.297 1.00 36.90  ? 126 LEU 5 N   1 
ATOM 11481 C CA  . LEU E 1 126 ? 17.871  20.371  226.912 1.00 54.46  ? 126 LEU 5 CA  1 
ATOM 11482 C C   . LEU E 1 126 ? 17.467  20.033  228.371 1.00 65.20  ? 126 LEU 5 C   1 
ATOM 11483 O O   . LEU E 1 126 ? 17.094  20.924  229.146 1.00 82.15  ? 126 LEU 5 O   1 
ATOM 11484 C CB  . LEU E 1 126 ? 16.627  20.529  226.048 1.00 51.40  ? 126 LEU 5 CB  1 
ATOM 11485 C CG  . LEU E 1 126 ? 16.790  21.279  224.718 1.00 48.18  ? 126 LEU 5 CG  1 
ATOM 11486 C CD1 . LEU E 1 126 ? 15.730  20.829  223.685 1.00 51.11  ? 126 LEU 5 CD1 1 
ATOM 11487 C CD2 . LEU E 1 126 ? 16.692  22.767  224.968 1.00 23.50  ? 126 LEU 5 CD2 1 
ATOM 11488 N N   . ASN E 1 127 ? 17.526  18.760  228.750 1.00 58.06  ? 127 ASN 5 N   1 
ATOM 11489 C CA  . ASN E 1 127 ? 17.208  18.340  230.118 1.00 49.38  ? 127 ASN 5 CA  1 
ATOM 11490 C C   . ASN E 1 127 ? 18.156  19.052  231