data_1SVC
# 
_entry.id   1SVC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SVC         
RCSB  PDT022       
WWPDB D_1000176531 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SVC 
_pdbx_database_status.recvd_initial_deposition_date   1995-11-27 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mueller, C.W.'  1 
'Harrison, S.C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure of the NF-kappa B p50 homodimer bound to DNA.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            373 
_citation.page_first                311 
_citation.page_last                 317 
_citation.year                      1995 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7830764 
_citation.pdbx_database_id_DOI      10.1038/373311a0 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muller, C.W.'   1 
primary 'Rey, F.A.'      2 
primary 'Sodeoka, M.'    3 
primary 'Verdine, G.L.'  4 
primary 'Harrison, S.C.' 5 
# 
_cell.entry_id           1SVC 
_cell.length_a           137.000 
_cell.length_b           137.000 
_cell.length_c           57.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SVC 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*AP*GP*AP*TP*GP*GP*GP*GP*AP*AP*TP*CP*CP*CP*CP*TP*A P*GP*A)-3')
;
5878.824  1  ? ? ? ? 
2 polymer man 'PROTEIN (NUCLEAR FACTOR KAPPA-B (NF-KB))'                                 41128.859 1  ? ? ? ? 
3 water   nat water                                                                      18.015    63 ? ? ? ? 
# 
_entity_keywords.entity_id   2 
_entity_keywords.text        'MUTANT C62A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DG)(DA)(DT)(DG)(DG)(DG)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DA)(DG)(DA)' AGATGGGGAATCCCCTAGA 
D ? 
2 'polypeptide(L)'        no no 
;AEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKS
YPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEA
CIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKD
INITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQK
;
;AEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKS
YPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEA
CIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKD
INITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQK
;
P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DG  n 
1 3   DA  n 
1 4   DT  n 
1 5   DG  n 
1 6   DG  n 
1 7   DG  n 
1 8   DG  n 
1 9   DA  n 
1 10  DA  n 
1 11  DT  n 
1 12  DC  n 
1 13  DC  n 
1 14  DC  n 
1 15  DC  n 
1 16  DT  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
2 1   ALA n 
2 2   GLU n 
2 3   ASP n 
2 4   ASP n 
2 5   PRO n 
2 6   TYR n 
2 7   LEU n 
2 8   GLY n 
2 9   ARG n 
2 10  PRO n 
2 11  GLU n 
2 12  GLN n 
2 13  MET n 
2 14  PHE n 
2 15  HIS n 
2 16  LEU n 
2 17  ASP n 
2 18  PRO n 
2 19  SER n 
2 20  LEU n 
2 21  THR n 
2 22  HIS n 
2 23  THR n 
2 24  ILE n 
2 25  PHE n 
2 26  ASN n 
2 27  PRO n 
2 28  GLU n 
2 29  VAL n 
2 30  PHE n 
2 31  GLN n 
2 32  PRO n 
2 33  GLN n 
2 34  MET n 
2 35  ALA n 
2 36  LEU n 
2 37  PRO n 
2 38  THR n 
2 39  ALA n 
2 40  ASP n 
2 41  GLY n 
2 42  PRO n 
2 43  TYR n 
2 44  LEU n 
2 45  GLN n 
2 46  ILE n 
2 47  LEU n 
2 48  GLU n 
2 49  GLN n 
2 50  PRO n 
2 51  LYS n 
2 52  GLN n 
2 53  ARG n 
2 54  GLY n 
2 55  PHE n 
2 56  ARG n 
2 57  PHE n 
2 58  ARG n 
2 59  TYR n 
2 60  VAL n 
2 61  ALA n 
2 62  GLU n 
2 63  GLY n 
2 64  PRO n 
2 65  SER n 
2 66  HIS n 
2 67  GLY n 
2 68  GLY n 
2 69  LEU n 
2 70  PRO n 
2 71  GLY n 
2 72  ALA n 
2 73  SER n 
2 74  SER n 
2 75  GLU n 
2 76  LYS n 
2 77  ASN n 
2 78  LYS n 
2 79  LYS n 
2 80  SER n 
2 81  TYR n 
2 82  PRO n 
2 83  GLN n 
2 84  VAL n 
2 85  LYS n 
2 86  ILE n 
2 87  CYS n 
2 88  ASN n 
2 89  TYR n 
2 90  VAL n 
2 91  GLY n 
2 92  PRO n 
2 93  ALA n 
2 94  LYS n 
2 95  VAL n 
2 96  ILE n 
2 97  VAL n 
2 98  GLN n 
2 99  LEU n 
2 100 VAL n 
2 101 THR n 
2 102 ASN n 
2 103 GLY n 
2 104 LYS n 
2 105 ASN n 
2 106 ILE n 
2 107 HIS n 
2 108 LEU n 
2 109 HIS n 
2 110 ALA n 
2 111 HIS n 
2 112 SER n 
2 113 LEU n 
2 114 VAL n 
2 115 GLY n 
2 116 LYS n 
2 117 HIS n 
2 118 CYS n 
2 119 GLU n 
2 120 ASP n 
2 121 GLY n 
2 122 ILE n 
2 123 CYS n 
2 124 THR n 
2 125 VAL n 
2 126 THR n 
2 127 ALA n 
2 128 GLY n 
2 129 PRO n 
2 130 LYS n 
2 131 ASP n 
2 132 MET n 
2 133 VAL n 
2 134 VAL n 
2 135 GLY n 
2 136 PHE n 
2 137 ALA n 
2 138 ASN n 
2 139 LEU n 
2 140 GLY n 
2 141 ILE n 
2 142 LEU n 
2 143 HIS n 
2 144 VAL n 
2 145 THR n 
2 146 LYS n 
2 147 LYS n 
2 148 LYS n 
2 149 VAL n 
2 150 PHE n 
2 151 GLU n 
2 152 THR n 
2 153 LEU n 
2 154 GLU n 
2 155 ALA n 
2 156 ARG n 
2 157 MET n 
2 158 THR n 
2 159 GLU n 
2 160 ALA n 
2 161 CYS n 
2 162 ILE n 
2 163 ARG n 
2 164 GLY n 
2 165 TYR n 
2 166 ASN n 
2 167 PRO n 
2 168 GLY n 
2 169 LEU n 
2 170 LEU n 
2 171 VAL n 
2 172 HIS n 
2 173 PRO n 
2 174 ASP n 
2 175 LEU n 
2 176 ALA n 
2 177 TYR n 
2 178 LEU n 
2 179 GLN n 
2 180 ALA n 
2 181 GLU n 
2 182 GLY n 
2 183 GLY n 
2 184 GLY n 
2 185 ASP n 
2 186 ARG n 
2 187 GLN n 
2 188 LEU n 
2 189 GLY n 
2 190 ASP n 
2 191 ARG n 
2 192 GLU n 
2 193 LYS n 
2 194 GLU n 
2 195 LEU n 
2 196 ILE n 
2 197 ARG n 
2 198 GLN n 
2 199 ALA n 
2 200 ALA n 
2 201 LEU n 
2 202 GLN n 
2 203 GLN n 
2 204 THR n 
2 205 LYS n 
2 206 GLU n 
2 207 MET n 
2 208 ASP n 
2 209 LEU n 
2 210 SER n 
2 211 VAL n 
2 212 VAL n 
2 213 ARG n 
2 214 LEU n 
2 215 MET n 
2 216 PHE n 
2 217 THR n 
2 218 ALA n 
2 219 PHE n 
2 220 LEU n 
2 221 PRO n 
2 222 ASP n 
2 223 SER n 
2 224 THR n 
2 225 GLY n 
2 226 SER n 
2 227 PHE n 
2 228 THR n 
2 229 ARG n 
2 230 ARG n 
2 231 LEU n 
2 232 GLU n 
2 233 PRO n 
2 234 VAL n 
2 235 VAL n 
2 236 SER n 
2 237 ASP n 
2 238 ALA n 
2 239 ILE n 
2 240 TYR n 
2 241 ASP n 
2 242 SER n 
2 243 LYS n 
2 244 ALA n 
2 245 PRO n 
2 246 ASN n 
2 247 ALA n 
2 248 SER n 
2 249 ASN n 
2 250 LEU n 
2 251 LYS n 
2 252 ILE n 
2 253 VAL n 
2 254 ARG n 
2 255 MET n 
2 256 ASP n 
2 257 ARG n 
2 258 THR n 
2 259 ALA n 
2 260 GLY n 
2 261 CYS n 
2 262 VAL n 
2 263 THR n 
2 264 GLY n 
2 265 GLY n 
2 266 GLU n 
2 267 GLU n 
2 268 ILE n 
2 269 TYR n 
2 270 LEU n 
2 271 LEU n 
2 272 CYS n 
2 273 ASP n 
2 274 LYS n 
2 275 VAL n 
2 276 GLN n 
2 277 LYS n 
2 278 ASP n 
2 279 ASP n 
2 280 ILE n 
2 281 GLN n 
2 282 ILE n 
2 283 ARG n 
2 284 PHE n 
2 285 TYR n 
2 286 GLU n 
2 287 GLU n 
2 288 GLU n 
2 289 GLU n 
2 290 ASN n 
2 291 GLY n 
2 292 GLY n 
2 293 VAL n 
2 294 TRP n 
2 295 GLU n 
2 296 GLY n 
2 297 PHE n 
2 298 GLY n 
2 299 ASP n 
2 300 PHE n 
2 301 SER n 
2 302 PRO n 
2 303 THR n 
2 304 ASP n 
2 305 VAL n 
2 306 HIS n 
2 307 ARG n 
2 308 GLN n 
2 309 PHE n 
2 310 ALA n 
2 311 ILE n 
2 312 VAL n 
2 313 PHE n 
2 314 LYS n 
2 315 THR n 
2 316 PRO n 
2 317 LYS n 
2 318 TYR n 
2 319 LYS n 
2 320 ASP n 
2 321 ILE n 
2 322 ASN n 
2 323 ILE n 
2 324 THR n 
2 325 LYS n 
2 326 PRO n 
2 327 ALA n 
2 328 SER n 
2 329 VAL n 
2 330 PHE n 
2 331 VAL n 
2 332 GLN n 
2 333 LEU n 
2 334 ARG n 
2 335 ARG n 
2 336 LYS n 
2 337 SER n 
2 338 ASP n 
2 339 LEU n 
2 340 GLU n 
2 341 THR n 
2 342 SER n 
2 343 GLU n 
2 344 PRO n 
2 345 LYS n 
2 346 PRO n 
2 347 PHE n 
2 348 LEU n 
2 349 TYR n 
2 350 TYR n 
2 351 PRO n 
2 352 GLU n 
2 353 ILE n 
2 354 LYS n 
2 355 ASP n 
2 356 LYS n 
2 357 GLU n 
2 358 GLU n 
2 359 VAL n 
2 360 GLN n 
2 361 ARG n 
2 362 LYS n 
2 363 ARG n 
2 364 GLN n 
2 365 LYS n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP NFKB1_HUMAN 2 P19838 ? ? ? 
2 PDB 1SVC        1 1SVC   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SVC P 1 ? 365 ? P19838 2 ? 366 ? 2 366 
2 2 1SVC D 1 ? 19  ? 1SVC   1 ? 19  ? 1 19  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1SVC 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           P 
_struct_ref_seq_dif.seq_num                      61 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P19838 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          62 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            62 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1SVC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_percent_sol   56.51 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 WATER      ? ? ? 
1 2 1 'PEG 6000' ? ? ? 
1 3 1 NACL       ? ? ? 
1 4 1 HEPES      ? ? ? 
1 5 1 DTT        ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.entry_id                     1SVC 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             12.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   15658 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1SVC 
_refine.ls_number_reflns_obs                     15648 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             12.000 
_refine.ls_d_res_high                            2.600 
_refine.ls_percent_reflns_obs                    92.000 
_refine.ls_R_factor_obs                          0.2250000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2250000 
_refine.ls_R_factor_R_free                       0.2860000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2449 
_refine_hist.pdbx_number_atoms_nucleic_acid   391 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             63 
_refine_hist.number_atoms_total               2903 
_refine_hist.d_res_high                       2.600 
_refine_hist.d_res_low                        12.000 
# 
_struct.entry_id                  1SVC 
_struct.title                     'NFKB P50 HOMODIMER BOUND TO DNA' 
_struct.pdbx_descriptor           'NUCLEAR FACTOR KAPPA-B (NF-KB) MUTANT/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SVC 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'DNA-BINDING, TRANSCRIPTION REGULATION, ACTIVATOR, NUCLEAR PROTEIN, PHOSPHORYLATION, DNA, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL B 60  ? GLU B 62  ? VAL P 61  GLU P 63  5 ? 3  
HELX_P HELX_P2 2 LYS B 146 ? ARG B 163 ? LYS P 147 ARG P 164 5 ? 18 
HELX_P HELX_P3 3 PRO B 167 ? LEU B 170 ? PRO P 168 LEU P 171 1 ? 4  
HELX_P HELX_P4 4 PRO B 173 ? LEU B 178 ? PRO P 174 LEU P 179 5 ? 6  
HELX_P HELX_P5 5 ASP B 190 ? THR B 204 ? ASP P 191 THR P 205 1 ? 15 
HELX_P HELX_P6 6 PRO B 245 ? ALA B 247 ? PRO P 246 ALA P 248 5 ? 3  
HELX_P HELX_P7 7 LYS B 277 ? ASP B 279 ? LYS P 278 ASP P 280 5 ? 3  
HELX_P HELX_P8 8 PRO B 302 ? ASP B 304 ? PRO P 303 ASP P 305 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 5  N1 ? ? ? 1_555 A DC 15 N3 ? ? D DG 5  D DC 15 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 5  N2 ? ? ? 1_555 A DC 15 O2 ? ? D DG 5  D DC 15 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 5  O6 ? ? ? 1_555 A DC 15 N4 ? ? D DG 5  D DC 15 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 6  N1 ? ? ? 1_555 A DC 14 N3 ? ? D DG 6  D DC 14 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 6  N2 ? ? ? 1_555 A DC 14 O2 ? ? D DG 6  D DC 14 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 6  O6 ? ? ? 1_555 A DC 14 N4 ? ? D DG 6  D DC 14 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 7  N1 ? ? ? 1_555 A DC 13 N3 ? ? D DG 7  D DC 13 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 7  N2 ? ? ? 1_555 A DC 13 O2 ? ? D DG 7  D DC 13 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 7  O6 ? ? ? 1_555 A DC 13 N4 ? ? D DG 7  D DC 13 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DG 8  N1 ? ? ? 1_555 A DC 12 N3 ? ? D DG 8  D DC 12 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 8  N2 ? ? ? 1_555 A DC 12 O2 ? ? D DG 8  D DC 12 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 8  O6 ? ? ? 1_555 A DC 12 N4 ? ? D DG 8  D DC 12 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DA 9  N1 ? ? ? 1_555 A DT 11 N3 ? ? D DA 9  D DT 11 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DA 9  N6 ? ? ? 1_555 A DT 11 O4 ? ? D DA 9  D DT 11 7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 11 N3 ? ? ? 1_555 A DA 9  N1 ? ? D DT 11 D DA 9  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DT 11 O4 ? ? ? 1_555 A DA 9  N6 ? ? D DT 11 D DA 9  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 12 N3 ? ? ? 1_555 A DG 8  N1 ? ? D DC 12 D DG 8  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 12 N4 ? ? ? 1_555 A DG 8  O6 ? ? D DC 12 D DG 8  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DC 12 O2 ? ? ? 1_555 A DG 8  N2 ? ? D DC 12 D DG 8  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DC 13 N3 ? ? ? 1_555 A DG 7  N1 ? ? D DC 13 D DG 7  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DC 13 N4 ? ? ? 1_555 A DG 7  O6 ? ? D DC 13 D DG 7  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 13 O2 ? ? ? 1_555 A DG 7  N2 ? ? D DC 13 D DG 7  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 14 N3 ? ? ? 1_555 A DG 6  N1 ? ? D DC 14 D DG 6  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DC 14 N4 ? ? ? 1_555 A DG 6  O6 ? ? D DC 14 D DG 6  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DC 14 O2 ? ? ? 1_555 A DG 6  N2 ? ? D DC 14 D DG 6  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DC 15 N3 ? ? ? 1_555 A DG 5  N1 ? ? D DC 15 D DG 5  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DC 15 N4 ? ? ? 1_555 A DG 5  O6 ? ? D DC 15 D DG 5  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DC 15 O2 ? ? ? 1_555 A DG 5  N2 ? ? D DC 15 D DG 5  7_556 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 2 ? 
D ? 5 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL B 133 ? GLY B 135 ? VAL P 134 GLY P 136 
A 2 GLN B 83  ? CYS B 87  ? GLN P 84  CYS P 88  
A 3 TYR B 43  ? GLU B 48  ? TYR P 44  GLU P 49  
B 1 CYS B 123 ? THR B 126 ? CYS P 124 THR P 127 
B 2 LYS B 94  ? VAL B 100 ? LYS P 95  VAL P 101 
B 3 VAL B 211 ? PHE B 219 ? VAL P 212 PHE P 220 
B 4 ALA B 238 ? TYR B 240 ? ALA P 239 TYR P 241 
C 1 SER B 112 ? GLY B 115 ? SER P 113 GLY P 116 
C 2 LEU B 139 ? LEU B 142 ? LEU P 140 LEU P 143 
D 1 ALA B 259 ? CYS B 261 ? ALA P 260 CYS P 262 
D 2 LYS B 345 ? TYR B 350 ? LYS P 346 TYR P 351 
D 3 ALA B 327 ? ARG B 334 ? ALA P 328 ARG P 335 
D 4 GLN B 281 ? GLU B 288 ? GLN P 282 GLU P 289 
D 5 GLY B 292 ? PHE B 297 ? GLY P 293 PHE P 298 
E 1 ALA B 310 ? LYS B 314 ? ALA P 311 LYS P 315 
E 2 GLU B 267 ? CYS B 272 ? GLU P 268 CYS P 273 
E 3 ILE B 252 ? MET B 255 ? ILE P 253 MET P 256 
F 1 PHE B 219 ? PRO B 221 ? PHE P 220 PRO P 222 
F 2 PHE B 227 ? ARG B 230 ? PHE P 228 ARG P 231 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL B 134 ? O VAL P 135 N VAL B 84  ? N VAL P 85  
A 2 3 O GLN B 83  ? O GLN P 84  N GLU B 48  ? N GLU P 49  
B 1 2 O CYS B 123 ? O CYS P 124 N VAL B 97  ? N VAL P 98  
B 2 3 O LYS B 94  ? O LYS P 95  N PHE B 219 ? N PHE P 220 
B 3 4 O VAL B 212 ? O VAL P 213 N ILE B 239 ? N ILE P 240 
C 1 2 O SER B 112 ? O SER P 113 N LEU B 142 ? N LEU P 143 
D 1 2 O GLY B 260 ? O GLY P 261 N LEU B 348 ? N LEU P 349 
D 2 3 O LYS B 345 ? O LYS P 346 N VAL B 331 ? N VAL P 332 
D 3 4 O PHE B 330 ? O PHE P 331 N TYR B 285 ? N TYR P 286 
D 4 5 O PHE B 284 ? O PHE P 285 N GLY B 296 ? N GLY P 297 
E 1 2 O ILE B 311 ? O ILE P 312 N LEU B 270 ? N LEU P 271 
E 2 3 O LEU B 271 ? O LEU P 272 N ARG B 254 ? N ARG P 255 
F 1 2 O LEU B 220 ? O LEU P 221 N ARG B 229 ? N ARG P 230 
# 
_database_PDB_matrix.entry_id          1SVC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SVC 
_atom_sites.fract_transf_matrix[1][1]   0.007299 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007299 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017544 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 33.771 37.599  -4.818 1.00 91.94  ? 1   DA  D "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 33.460 36.223  -5.219 1.00 92.68  ? 1   DA  D "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 32.403 36.327  -6.294 1.00 90.97  ? 1   DA  D "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 32.043 35.022  -6.745 1.00 81.14  ? 1   DA  D "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 31.114 36.938  -5.770 1.00 90.02  ? 1   DA  D "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 31.045 38.319  -6.139 1.00 83.80  ? 1   DA  D "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 29.941 36.191  -6.331 1.00 80.44  ? 1   DA  D "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 30.604 34.927  -6.810 1.00 80.81  ? 1   DA  D "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 30.192 33.710  -6.126 1.00 63.00  ? 1   DA  D N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 28.930 33.222  -5.946 1.00 63.17  ? 1   DA  D C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 28.885 32.063  -5.347 1.00 66.34  ? 1   DA  D N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 30.223 31.769  -5.114 1.00 58.57  ? 1   DA  D C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 30.841 30.628  -4.560 1.00 63.35  ? 1   DA  D C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 30.182 29.568  -4.096 1.00 44.21  ? 1   DA  D N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 32.195 30.661  -4.549 1.00 67.95  ? 1   DA  D N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 32.915 31.701  -5.030 1.00 66.58  ? 1   DA  D C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 32.389 32.820  -5.576 1.00 61.77  ? 1   DA  D N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 31.040 32.774  -5.581 1.00 55.69  ? 1   DA  D C4    1 
ATOM   19   P P     . DG  A 1 2   ? 30.844 39.513  -5.070 1.00 97.69  ? 2   DG  D P     1 
ATOM   20   O OP1   . DG  A 1 2   ? 30.392 40.715  -5.797 1.00 92.07  ? 2   DG  D OP1   1 
ATOM   21   O OP2   . DG  A 1 2   ? 32.043 39.548  -4.214 1.00 93.99  ? 2   DG  D OP2   1 
ATOM   22   O "O5'" . DG  A 1 2   ? 29.604 38.975  -4.168 1.00 99.85  ? 2   DG  D "O5'" 1 
ATOM   23   C "C5'" . DG  A 1 2   ? 28.333 38.637  -4.788 1.00 102.11 ? 2   DG  D "C5'" 1 
ATOM   24   C "C4'" . DG  A 1 2   ? 27.456 38.006  -3.707 1.00 97.38  ? 2   DG  D "C4'" 1 
ATOM   25   O "O4'" . DG  A 1 2   ? 27.871 36.661  -3.417 1.00 91.55  ? 2   DG  D "O4'" 1 
ATOM   26   C "C3'" . DG  A 1 2   ? 27.565 38.752  -2.402 1.00 100.31 ? 2   DG  D "C3'" 1 
ATOM   27   O "O3'" . DG  A 1 2   ? 26.262 38.796  -1.840 1.00 108.32 ? 2   DG  D "O3'" 1 
ATOM   28   C "C2'" . DG  A 1 2   ? 28.478 37.987  -1.503 1.00 89.24  ? 2   DG  D "C2'" 1 
ATOM   29   C "C1'" . DG  A 1 2   ? 28.270 36.592  -2.036 1.00 81.33  ? 2   DG  D "C1'" 1 
ATOM   30   N N9    . DG  A 1 2   ? 29.435 35.720  -1.934 1.00 78.01  ? 2   DG  D N9    1 
ATOM   31   C C8    . DG  A 1 2   ? 30.761 36.057  -1.850 1.00 76.04  ? 2   DG  D C8    1 
ATOM   32   N N7    . DG  A 1 2   ? 31.570 35.033  -1.735 1.00 66.45  ? 2   DG  D N7    1 
ATOM   33   C C5    . DG  A 1 2   ? 30.707 33.934  -1.745 1.00 59.13  ? 2   DG  D C5    1 
ATOM   34   C C6    . DG  A 1 2   ? 30.952 32.536  -1.601 1.00 61.57  ? 2   DG  D C6    1 
ATOM   35   O O6    . DG  A 1 2   ? 32.055 31.988  -1.476 1.00 56.91  ? 2   DG  D O6    1 
ATOM   36   N N1    . DG  A 1 2   ? 29.825 31.762  -1.600 1.00 63.21  ? 2   DG  D N1    1 
ATOM   37   C C2    . DG  A 1 2   ? 28.569 32.279  -1.735 1.00 69.33  ? 2   DG  D C2    1 
ATOM   38   N N2    . DG  A 1 2   ? 27.576 31.397  -1.723 1.00 76.91  ? 2   DG  D N2    1 
ATOM   39   N N3    . DG  A 1 2   ? 28.273 33.585  -1.873 1.00 67.12  ? 2   DG  D N3    1 
ATOM   40   C C4    . DG  A 1 2   ? 29.390 34.342  -1.869 1.00 68.81  ? 2   DG  D C4    1 
ATOM   41   P P     . DA  A 1 3   ? 25.909 39.516  -0.464 1.00 108.77 ? 3   DA  D P     1 
ATOM   42   O OP1   . DA  A 1 3   ? 25.154 40.742  -0.775 1.00 108.29 ? 3   DA  D OP1   1 
ATOM   43   O OP2   . DA  A 1 3   ? 27.135 39.560  0.351  1.00 103.19 ? 3   DA  D OP2   1 
ATOM   44   O "O5'" . DA  A 1 3   ? 24.893 38.469  0.214  1.00 98.51  ? 3   DA  D "O5'" 1 
ATOM   45   C "C5'" . DA  A 1 3   ? 23.847 37.864  -0.585 1.00 96.10  ? 3   DA  D "C5'" 1 
ATOM   46   C "C4'" . DA  A 1 3   ? 23.402 36.632  0.169  1.00 92.21  ? 3   DA  D "C4'" 1 
ATOM   47   O "O4'" . DA  A 1 3   ? 24.432 35.633  0.121  1.00 92.88  ? 3   DA  D "O4'" 1 
ATOM   48   C "C3'" . DA  A 1 3   ? 23.196 36.955  1.635  1.00 95.40  ? 3   DA  D "C3'" 1 
ATOM   49   O "O3'" . DA  A 1 3   ? 21.917 36.478  2.056  1.00 110.65 ? 3   DA  D "O3'" 1 
ATOM   50   C "C2'" . DA  A 1 3   ? 24.271 36.316  2.457  1.00 80.35  ? 3   DA  D "C2'" 1 
ATOM   51   C "C1'" . DA  A 1 3   ? 24.958 35.421  1.447  1.00 68.87  ? 3   DA  D "C1'" 1 
ATOM   52   N N9    . DA  A 1 3   ? 26.398 35.608  1.412  1.00 55.25  ? 3   DA  D N9    1 
ATOM   53   C C8    . DA  A 1 3   ? 27.107 36.770  1.353  1.00 54.90  ? 3   DA  D C8    1 
ATOM   54   N N7    . DA  A 1 3   ? 28.405 36.612  1.385  1.00 60.57  ? 3   DA  D N7    1 
ATOM   55   C C5    . DA  A 1 3   ? 28.559 35.237  1.471  1.00 40.01  ? 3   DA  D C5    1 
ATOM   56   C C6    . DA  A 1 3   ? 29.715 34.432  1.639  1.00 54.07  ? 3   DA  D C6    1 
ATOM   57   N N6    . DA  A 1 3   ? 30.972 34.890  1.655  1.00 61.92  ? 3   DA  D N6    1 
ATOM   58   N N1    . DA  A 1 3   ? 29.468 33.115  1.792  1.00 52.44  ? 3   DA  D N1    1 
ATOM   59   C C2    . DA  A 1 3   ? 28.223 32.590  1.792  1.00 50.51  ? 3   DA  D C2    1 
ATOM   60   N N3    . DA  A 1 3   ? 27.081 33.293  1.637  1.00 47.45  ? 3   DA  D N3    1 
ATOM   61   C C4    . DA  A 1 3   ? 27.336 34.602  1.483  1.00 49.44  ? 3   DA  D C4    1 
ATOM   62   P P     . DT  A 1 4   ? 21.395 36.550  3.581  1.00 120.92 ? 4   DT  D P     1 
ATOM   63   O OP1   . DT  A 1 4   ? 19.947 36.278  3.569  1.00 117.88 ? 4   DT  D OP1   1 
ATOM   64   O OP2   . DT  A 1 4   ? 21.935 37.779  4.191  1.00 102.72 ? 4   DT  D OP2   1 
ATOM   65   O "O5'" . DT  A 1 4   ? 22.141 35.283  4.271  1.00 113.97 ? 4   DT  D "O5'" 1 
ATOM   66   C "C5'" . DT  A 1 4   ? 21.577 33.959  4.102  1.00 91.38  ? 4   DT  D "C5'" 1 
ATOM   67   C "C4'" . DT  A 1 4   ? 22.552 32.953  4.714  1.00 84.79  ? 4   DT  D "C4'" 1 
ATOM   68   O "O4'" . DT  A 1 4   ? 23.874 33.138  4.220  1.00 76.05  ? 4   DT  D "O4'" 1 
ATOM   69   C "C3'" . DT  A 1 4   ? 22.661 33.072  6.210  1.00 79.87  ? 4   DT  D "C3'" 1 
ATOM   70   O "O3'" . DT  A 1 4   ? 21.783 32.107  6.789  1.00 81.80  ? 4   DT  D "O3'" 1 
ATOM   71   C "C2'" . DT  A 1 4   ? 24.093 32.807  6.619  1.00 76.50  ? 4   DT  D "C2'" 1 
ATOM   72   C "C1'" . DT  A 1 4   ? 24.804 32.810  5.270  1.00 66.47  ? 4   DT  D "C1'" 1 
ATOM   73   N N1    . DT  A 1 4   ? 25.892 33.764  5.138  1.00 56.06  ? 4   DT  D N1    1 
ATOM   74   C C2    . DT  A 1 4   ? 27.181 33.250  4.998  1.00 63.04  ? 4   DT  D C2    1 
ATOM   75   O O2    . DT  A 1 4   ? 27.408 32.035  4.985  1.00 72.26  ? 4   DT  D O2    1 
ATOM   76   N N3    . DT  A 1 4   ? 28.208 34.136  4.860  1.00 60.22  ? 4   DT  D N3    1 
ATOM   77   C C4    . DT  A 1 4   ? 28.023 35.492  4.853  1.00 69.59  ? 4   DT  D C4    1 
ATOM   78   O O4    . DT  A 1 4   ? 29.015 36.222  4.722  1.00 60.88  ? 4   DT  D O4    1 
ATOM   79   C C5    . DT  A 1 4   ? 26.683 36.002  4.996  1.00 76.88  ? 4   DT  D C5    1 
ATOM   80   C C7    . DT  A 1 4   ? 26.403 37.495  4.987  1.00 72.66  ? 4   DT  D C7    1 
ATOM   81   C C6    . DT  A 1 4   ? 25.690 35.115  5.134  1.00 69.71  ? 4   DT  D C6    1 
ATOM   82   P P     . DG  A 1 5   ? 20.577 32.487  7.769  1.00 89.28  ? 5   DG  D P     1 
ATOM   83   O OP1   . DG  A 1 5   ? 19.536 31.456  7.633  1.00 78.16  ? 5   DG  D OP1   1 
ATOM   84   O OP2   . DG  A 1 5   ? 20.267 33.915  7.577  1.00 70.75  ? 5   DG  D OP2   1 
ATOM   85   O "O5'" . DG  A 1 5   ? 21.263 32.318  9.215  1.00 91.81  ? 5   DG  D "O5'" 1 
ATOM   86   C "C5'" . DG  A 1 5   ? 22.519 31.615  9.318  1.00 74.31  ? 5   DG  D "C5'" 1 
ATOM   87   C "C4'" . DG  A 1 5   ? 22.204 30.238  9.835  1.00 65.90  ? 5   DG  D "C4'" 1 
ATOM   88   O "O4'" . DG  A 1 5   ? 23.385 29.443  9.845  1.00 59.96  ? 5   DG  D "O4'" 1 
ATOM   89   C "C3'" . DG  A 1 5   ? 21.729 30.287  11.270 1.00 57.99  ? 5   DG  D "C3'" 1 
ATOM   90   O "O3'" . DG  A 1 5   ? 20.728 29.268  11.440 1.00 54.43  ? 5   DG  D "O3'" 1 
ATOM   91   C "C2'" . DG  A 1 5   ? 22.908 30.025  12.152 1.00 56.09  ? 5   DG  D "C2'" 1 
ATOM   92   C "C1'" . DG  A 1 5   ? 23.864 29.353  11.186 1.00 50.68  ? 5   DG  D "C1'" 1 
ATOM   93   N N9    . DG  A 1 5   ? 25.193 29.903  11.184 1.00 42.40  ? 5   DG  D N9    1 
ATOM   94   C C8    . DG  A 1 5   ? 25.589 31.200  11.110 1.00 50.71  ? 5   DG  D C8    1 
ATOM   95   N N7    . DG  A 1 5   ? 26.886 31.367  11.154 1.00 43.25  ? 5   DG  D N7    1 
ATOM   96   C C5    . DG  A 1 5   ? 27.369 30.072  11.268 1.00 31.10  ? 5   DG  D C5    1 
ATOM   97   C C6    . DG  A 1 5   ? 28.687 29.569  11.391 1.00 36.19  ? 5   DG  D C6    1 
ATOM   98   O O6    . DG  A 1 5   ? 29.728 30.226  11.407 1.00 59.02  ? 5   DG  D O6    1 
ATOM   99   N N1    . DG  A 1 5   ? 28.760 28.218  11.515 1.00 33.14  ? 5   DG  D N1    1 
ATOM   100  C C2    . DG  A 1 5   ? 27.659 27.410  11.509 1.00 33.85  ? 5   DG  D C2    1 
ATOM   101  N N2    . DG  A 1 5   ? 27.893 26.104  11.634 1.00 29.22  ? 5   DG  D N2    1 
ATOM   102  N N3    . DG  A 1 5   ? 26.391 27.828  11.405 1.00 32.02  ? 5   DG  D N3    1 
ATOM   103  C C4    . DG  A 1 5   ? 26.333 29.164  11.285 1.00 40.86  ? 5   DG  D C4    1 
ATOM   104  P P     . DG  A 1 6   ? 19.975 28.909  12.823 1.00 58.41  ? 6   DG  D P     1 
ATOM   105  O OP1   . DG  A 1 6   ? 18.883 27.970  12.514 1.00 52.35  ? 6   DG  D OP1   1 
ATOM   106  O OP2   . DG  A 1 6   ? 19.710 30.166  13.538 1.00 25.62  ? 6   DG  D OP2   1 
ATOM   107  O "O5'" . DG  A 1 6   ? 21.123 28.092  13.632 1.00 44.27  ? 6   DG  D "O5'" 1 
ATOM   108  C "C5'" . DG  A 1 6   ? 21.729 26.943  12.991 1.00 37.61  ? 6   DG  D "C5'" 1 
ATOM   109  C "C4'" . DG  A 1 6   ? 22.792 26.343  13.937 1.00 48.29  ? 6   DG  D "C4'" 1 
ATOM   110  O "O4'" . DG  A 1 6   ? 24.063 26.979  13.789 1.00 56.24  ? 6   DG  D "O4'" 1 
ATOM   111  C "C3'" . DG  A 1 6   ? 22.445 26.428  15.413 1.00 48.86  ? 6   DG  D "C3'" 1 
ATOM   112  O "O3'" . DG  A 1 6   ? 22.385 25.081  15.901 1.00 56.29  ? 6   DG  D "O3'" 1 
ATOM   113  C "C2'" . DG  A 1 6   ? 23.556 27.169  16.116 1.00 55.47  ? 6   DG  D "C2'" 1 
ATOM   114  C "C1'" . DG  A 1 6   ? 24.658 27.074  15.087 1.00 47.01  ? 6   DG  D "C1'" 1 
ATOM   115  N N9    . DG  A 1 6   ? 25.541 28.210  15.039 1.00 48.87  ? 6   DG  D N9    1 
ATOM   116  C C8    . DG  A 1 6   ? 25.227 29.538  14.968 1.00 46.26  ? 6   DG  D C8    1 
ATOM   117  N N7    . DG  A 1 6   ? 26.260 30.331  14.936 1.00 48.00  ? 6   DG  D N7    1 
ATOM   118  C C5    . DG  A 1 6   ? 27.343 29.453  14.991 1.00 45.82  ? 6   DG  D C5    1 
ATOM   119  C C6    . DG  A 1 6   ? 28.742 29.686  14.992 1.00 38.24  ? 6   DG  D C6    1 
ATOM   120  O O6    . DG  A 1 6   ? 29.302 30.780  14.941 1.00 59.96  ? 6   DG  D O6    1 
ATOM   121  N N1    . DG  A 1 6   ? 29.506 28.559  15.059 1.00 40.77  ? 6   DG  D N1    1 
ATOM   122  C C2    . DG  A 1 6   ? 28.979 27.310  15.115 1.00 38.27  ? 6   DG  D C2    1 
ATOM   123  N N2    . DG  A 1 6   ? 29.868 26.313  15.177 1.00 36.50  ? 6   DG  D N2    1 
ATOM   124  N N3    . DG  A 1 6   ? 27.656 27.021  15.117 1.00 35.19  ? 6   DG  D N3    1 
ATOM   125  C C4    . DG  A 1 6   ? 26.914 28.146  15.053 1.00 45.08  ? 6   DG  D C4    1 
ATOM   126  P P     . DG  A 1 7   ? 21.986 24.635  17.394 1.00 44.34  ? 7   DG  D P     1 
ATOM   127  O OP1   . DG  A 1 7   ? 21.035 23.524  17.289 1.00 42.37  ? 7   DG  D OP1   1 
ATOM   128  O OP2   . DG  A 1 7   ? 21.667 25.847  18.173 1.00 42.03  ? 7   DG  D OP2   1 
ATOM   129  O "O5'" . DG  A 1 7   ? 23.367 24.043  17.933 1.00 35.26  ? 7   DG  D "O5'" 1 
ATOM   130  C "C5'" . DG  A 1 7   ? 23.808 22.792  17.392 1.00 26.22  ? 7   DG  D "C5'" 1 
ATOM   131  C "C4'" . DG  A 1 7   ? 25.142 22.473  18.039 1.00 41.32  ? 7   DG  D "C4'" 1 
ATOM   132  O "O4'" . DG  A 1 7   ? 26.098 23.504  17.798 1.00 39.41  ? 7   DG  D "O4'" 1 
ATOM   133  C "C3'" . DG  A 1 7   ? 25.018 22.342  19.530 1.00 41.61  ? 7   DG  D "C3'" 1 
ATOM   134  O "O3'" . DG  A 1 7   ? 25.583 21.086  19.892 1.00 46.72  ? 7   DG  D "O3'" 1 
ATOM   135  C "C2'" . DG  A 1 7   ? 25.764 23.465  20.189 1.00 46.68  ? 7   DG  D "C2'" 1 
ATOM   136  C "C1'" . DG  A 1 7   ? 26.608 23.982  19.046 1.00 32.78  ? 7   DG  D "C1'" 1 
ATOM   137  N N9    . DG  A 1 7   ? 26.669 25.429  18.941 1.00 29.83  ? 7   DG  D N9    1 
ATOM   138  C C8    . DG  A 1 7   ? 25.654 26.342  18.967 1.00 24.78  ? 7   DG  D C8    1 
ATOM   139  N N7    . DG  A 1 7   ? 26.046 27.582  18.855 1.00 26.29  ? 7   DG  D N7    1 
ATOM   140  C C5    . DG  A 1 7   ? 27.431 27.475  18.746 1.00 14.96  ? 7   DG  D C5    1 
ATOM   141  C C6    . DG  A 1 7   ? 28.459 28.466  18.642 1.00 37.38  ? 7   DG  D C6    1 
ATOM   142  O O6    . DG  A 1 7   ? 28.304 29.695  18.587 1.00 45.47  ? 7   DG  D O6    1 
ATOM   143  N N1    . DG  A 1 7   ? 29.731 27.957  18.608 1.00 35.58  ? 7   DG  D N1    1 
ATOM   144  C C2    . DG  A 1 7   ? 29.996 26.620  18.663 1.00 34.40  ? 7   DG  D C2    1 
ATOM   145  N N2    . DG  A 1 7   ? 31.282 26.283  18.615 1.00 36.50  ? 7   DG  D N2    1 
ATOM   146  N N3    . DG  A 1 7   ? 29.072 25.643  18.762 1.00 24.86  ? 7   DG  D N3    1 
ATOM   147  C C4    . DG  A 1 7   ? 27.824 26.152  18.797 1.00 23.22  ? 7   DG  D C4    1 
ATOM   148  P P     . DG  A 1 8   ? 25.607 20.514  21.370 1.00 36.89  ? 8   DG  D P     1 
ATOM   149  O OP1   . DG  A 1 8   ? 25.848 19.064  21.298 1.00 43.05  ? 8   DG  D OP1   1 
ATOM   150  O OP2   . DG  A 1 8   ? 24.445 21.059  22.085 1.00 44.87  ? 8   DG  D OP2   1 
ATOM   151  O "O5'" . DG  A 1 8   ? 26.923 21.205  21.944 1.00 28.28  ? 8   DG  D "O5'" 1 
ATOM   152  C "C5'" . DG  A 1 8   ? 28.163 20.958  21.263 1.00 20.85  ? 8   DG  D "C5'" 1 
ATOM   153  C "C4'" . DG  A 1 8   ? 29.147 22.001  21.741 1.00 31.75  ? 8   DG  D "C4'" 1 
ATOM   154  O "O4'" . DG  A 1 8   ? 28.712 23.336  21.415 1.00 49.75  ? 8   DG  D "O4'" 1 
ATOM   155  C "C3'" . DG  A 1 8   ? 29.319 21.992  23.253 1.00 23.24  ? 8   DG  D "C3'" 1 
ATOM   156  O "O3'" . DG  A 1 8   ? 30.721 21.918  23.477 1.00 30.68  ? 8   DG  D "O3'" 1 
ATOM   157  C "C2'" . DG  A 1 8   ? 28.810 23.320  23.757 1.00 32.28  ? 8   DG  D "C2'" 1 
ATOM   158  C "C1'" . DG  A 1 8   ? 29.074 24.146  22.535 1.00 29.77  ? 8   DG  D "C1'" 1 
ATOM   159  N N9    . DG  A 1 8   ? 28.410 25.441  22.449 1.00 25.08  ? 8   DG  D N9    1 
ATOM   160  C C8    . DG  A 1 8   ? 27.092 25.746  22.621 1.00 14.88  ? 8   DG  D C8    1 
ATOM   161  N N7    . DG  A 1 8   ? 26.822 27.025  22.517 1.00 31.15  ? 8   DG  D N7    1 
ATOM   162  C C5    . DG  A 1 8   ? 28.066 27.607  22.255 1.00 28.01  ? 8   DG  D C5    1 
ATOM   163  C C6    . DG  A 1 8   ? 28.464 28.976  22.098 1.00 40.34  ? 8   DG  D C6    1 
ATOM   164  O O6    . DG  A 1 8   ? 27.734 29.970  22.134 1.00 51.74  ? 8   DG  D O6    1 
ATOM   165  N N1    . DG  A 1 8   ? 29.799 29.156  21.909 1.00 38.22  ? 8   DG  D N1    1 
ATOM   166  C C2    . DG  A 1 8   ? 30.685 28.130  21.874 1.00 31.54  ? 8   DG  D C2    1 
ATOM   167  N N2    . DG  A 1 8   ? 31.956 28.474  21.676 1.00 30.54  ? 8   DG  D N2    1 
ATOM   168  N N3    . DG  A 1 8   ? 30.375 26.822  22.020 1.00 38.73  ? 8   DG  D N3    1 
ATOM   169  C C4    . DG  A 1 8   ? 29.050 26.648  22.206 1.00 23.68  ? 8   DG  D C4    1 
ATOM   170  P P     . DA  A 1 9   ? 31.446 21.096  24.633 1.00 36.85  ? 9   DA  D P     1 
ATOM   171  O OP1   . DA  A 1 9   ? 31.854 19.801  24.070 1.00 49.27  ? 9   DA  D OP1   1 
ATOM   172  O OP2   . DA  A 1 9   ? 30.622 21.171  25.851 1.00 47.53  ? 9   DA  D OP2   1 
ATOM   173  O "O5'" . DA  A 1 9   ? 32.766 21.981  24.879 1.00 36.07  ? 9   DA  D "O5'" 1 
ATOM   174  C "C5'" . DA  A 1 9   ? 33.823 21.987  23.898 1.00 27.44  ? 9   DA  D "C5'" 1 
ATOM   175  C "C4'" . DA  A 1 9   ? 34.514 23.356  23.968 1.00 27.73  ? 9   DA  D "C4'" 1 
ATOM   176  O "O4'" . DA  A 1 9   ? 33.578 24.427  23.750 1.00 34.21  ? 9   DA  D "O4'" 1 
ATOM   177  C "C3'" . DA  A 1 9   ? 35.152 23.625  25.324 1.00 29.75  ? 9   DA  D "C3'" 1 
ATOM   178  O "O3'" . DA  A 1 9   ? 36.513 24.023  25.112 1.00 35.89  ? 9   DA  D "O3'" 1 
ATOM   179  C "C2'" . DA  A 1 9   ? 34.407 24.745  25.986 1.00 39.34  ? 9   DA  D "C2'" 1 
ATOM   180  C "C1'" . DA  A 1 9   ? 33.755 25.405  24.789 1.00 34.22  ? 9   DA  D "C1'" 1 
ATOM   181  N N9    . DA  A 1 9   ? 32.465 26.025  25.067 1.00 31.68  ? 9   DA  D N9    1 
ATOM   182  C C8    . DA  A 1 9   ? 31.303 25.446  25.479 1.00 33.96  ? 9   DA  D C8    1 
ATOM   183  N N7    . DA  A 1 9   ? 30.322 26.285  25.668 1.00 40.28  ? 9   DA  D N7    1 
ATOM   184  C C5    . DA  A 1 9   ? 30.888 27.511  25.353 1.00 31.55  ? 9   DA  D C5    1 
ATOM   185  C C6    . DA  A 1 9   ? 30.362 28.815  25.399 1.00 41.05  ? 9   DA  D C6    1 
ATOM   186  N N6    . DA  A 1 9   ? 29.106 29.119  25.743 1.00 33.07  ? 9   DA  D N6    1 
ATOM   187  N N1    . DA  A 1 9   ? 31.234 29.785  25.062 1.00 40.14  ? 9   DA  D N1    1 
ATOM   188  C C2    . DA  A 1 9   ? 32.513 29.541  24.711 1.00 39.01  ? 9   DA  D C2    1 
ATOM   189  N N3    . DA  A 1 9   ? 33.078 28.324  24.644 1.00 29.35  ? 9   DA  D N3    1 
ATOM   190  C C4    . DA  A 1 9   ? 32.201 27.367  24.978 1.00 30.57  ? 9   DA  D C4    1 
ATOM   191  P P     . DA  A 1 10  ? 37.628 24.132  26.274 1.00 50.57  ? 10  DA  D P     1 
ATOM   192  O OP1   . DA  A 1 10  ? 38.939 23.858  25.665 1.00 46.54  ? 10  DA  D OP1   1 
ATOM   193  O OP2   . DA  A 1 10  ? 37.158 23.359  27.444 1.00 33.89  ? 10  DA  D OP2   1 
ATOM   194  O "O5'" . DA  A 1 10  ? 37.554 25.719  26.632 1.00 28.47  ? 10  DA  D "O5'" 1 
ATOM   195  C "C5'" . DA  A 1 10  ? 38.147 26.673  25.720 1.00 38.82  ? 10  DA  D "C5'" 1 
ATOM   196  C "C4'" . DA  A 1 10  ? 37.981 28.073  26.322 1.00 38.81  ? 10  DA  D "C4'" 1 
ATOM   197  O "O4'" . DA  A 1 10  ? 36.605 28.415  26.462 1.00 41.58  ? 10  DA  D "O4'" 1 
ATOM   198  C "C3'" . DA  A 1 10  ? 38.582 28.188  27.695 1.00 38.71  ? 10  DA  D "C3'" 1 
ATOM   199  O "O3'" . DA  A 1 10  ? 39.355 29.377  27.742 1.00 40.21  ? 10  DA  D "O3'" 1 
ATOM   200  C "C2'" . DA  A 1 10  ? 37.481 28.271  28.701 1.00 43.20  ? 10  DA  D "C2'" 1 
ATOM   201  C "C1'" . DA  A 1 10  ? 36.331 28.705  27.831 1.00 37.19  ? 10  DA  D "C1'" 1 
ATOM   202  N N9    . DA  A 1 10  ? 35.068 28.077  28.136 1.00 42.37  ? 10  DA  D N9    1 
ATOM   203  C C8    . DA  A 1 10  ? 34.807 26.786  28.475 1.00 47.72  ? 10  DA  D C8    1 
ATOM   204  N N7    . DA  A 1 10  ? 33.541 26.534  28.692 1.00 32.76  ? 10  DA  D N7    1 
ATOM   205  C C5    . DA  A 1 10  ? 32.941 27.765  28.475 1.00 42.46  ? 10  DA  D C5    1 
ATOM   206  C C6    . DA  A 1 10  ? 31.594 28.161  28.559 1.00 45.51  ? 10  DA  D C6    1 
ATOM   207  N N6    . DA  A 1 10  ? 30.584 27.369  28.880 1.00 38.92  ? 10  DA  D N6    1 
ATOM   208  N N1    . DA  A 1 10  ? 31.379 29.460  28.283 1.00 51.79  ? 10  DA  D N1    1 
ATOM   209  C C2    . DA  A 1 10  ? 32.368 30.320  27.953 1.00 50.69  ? 10  DA  D C2    1 
ATOM   210  N N3    . DA  A 1 10  ? 33.669 30.003  27.858 1.00 40.56  ? 10  DA  D N3    1 
ATOM   211  C C4    . DA  A 1 10  ? 33.871 28.712  28.133 1.00 36.32  ? 10  DA  D C4    1 
ATOM   212  P P     . DT  A 1 11  ? 40.183 29.819  29.023 1.00 34.16  ? 11  DT  D P     1 
ATOM   213  O OP1   . DT  A 1 11  ? 41.263 30.709  28.573 1.00 41.39  ? 11  DT  D OP1   1 
ATOM   214  O OP2   . DT  A 1 11  ? 40.470 28.618  29.815 1.00 34.25  ? 11  DT  D OP2   1 
ATOM   215  O "O5'" . DT  A 1 11  ? 39.119 30.690  29.816 1.00 32.33  ? 11  DT  D "O5'" 1 
ATOM   216  C "C5'" . DT  A 1 11  ? 38.684 31.896  29.195 1.00 24.79  ? 11  DT  D "C5'" 1 
ATOM   217  C "C4'" . DT  A 1 11  ? 37.536 32.440  30.000 1.00 35.89  ? 11  DT  D "C4'" 1 
ATOM   218  O "O4'" . DT  A 1 11  ? 36.406 31.577  29.995 1.00 39.67  ? 11  DT  D "O4'" 1 
ATOM   219  C "C3'" . DT  A 1 11  ? 37.864 32.698  31.463 1.00 22.77  ? 11  DT  D "C3'" 1 
ATOM   220  O "O3'" . DT  A 1 11  ? 38.024 34.111  31.559 1.00 33.00  ? 11  DT  D "O3'" 1 
ATOM   221  C "C2'" . DT  A 1 11  ? 36.675 32.232  32.280 1.00 35.20  ? 11  DT  D "C2'" 1 
ATOM   222  C "C1'" . DT  A 1 11  ? 35.673 31.922  31.165 1.00 35.29  ? 11  DT  D "C1'" 1 
ATOM   223  N N1    . DT  A 1 11  ? 34.722 30.851  31.409 1.00 31.87  ? 11  DT  D N1    1 
ATOM   224  C C2    . DT  A 1 11  ? 33.380 31.185  31.366 1.00 25.30  ? 11  DT  D C2    1 
ATOM   225  O O2    . DT  A 1 11  ? 33.005 32.336  31.148 1.00 24.17  ? 11  DT  D O2    1 
ATOM   226  N N3    . DT  A 1 11  ? 32.468 30.206  31.587 1.00 27.46  ? 11  DT  D N3    1 
ATOM   227  C C4    . DT  A 1 11  ? 32.817 28.917  31.854 1.00 41.46  ? 11  DT  D C4    1 
ATOM   228  O O4    . DT  A 1 11  ? 31.919 28.092  32.058 1.00 55.12  ? 11  DT  D O4    1 
ATOM   229  C C5    . DT  A 1 11  ? 34.210 28.589  31.899 1.00 41.02  ? 11  DT  D C5    1 
ATOM   230  C C7    . DT  A 1 11  ? 34.669 27.179  32.203 1.00 64.52  ? 11  DT  D C7    1 
ATOM   231  C C6    . DT  A 1 11  ? 35.092 29.569  31.673 1.00 45.49  ? 11  DT  D C6    1 
ATOM   232  P P     . DC  A 1 12  ? 38.301 34.960  32.879 1.00 27.85  ? 12  DC  D P     1 
ATOM   233  O OP1   . DC  A 1 12  ? 38.709 36.316  32.473 1.00 38.30  ? 12  DC  D OP1   1 
ATOM   234  O OP2   . DC  A 1 12  ? 39.136 34.147  33.775 1.00 23.98  ? 12  DC  D OP2   1 
ATOM   235  O "O5'" . DC  A 1 12  ? 36.831 35.060  33.479 1.00 25.67  ? 12  DC  D "O5'" 1 
ATOM   236  C "C5'" . DC  A 1 12  ? 35.866 35.796  32.721 1.00 26.99  ? 12  DC  D "C5'" 1 
ATOM   237  C "C4'" . DC  A 1 12  ? 34.549 35.664  33.446 1.00 41.47  ? 12  DC  D "C4'" 1 
ATOM   238  O "O4'" . DC  A 1 12  ? 34.087 34.310  33.468 1.00 47.85  ? 12  DC  D "O4'" 1 
ATOM   239  C "C3'" . DC  A 1 12  ? 34.657 36.075  34.893 1.00 36.68  ? 12  DC  D "C3'" 1 
ATOM   240  O "O3'" . DC  A 1 12  ? 33.708 37.106  35.057 1.00 52.96  ? 12  DC  D "O3'" 1 
ATOM   241  C "C2'" . DC  A 1 12  ? 34.299 34.887  35.762 1.00 33.19  ? 12  DC  D "C2'" 1 
ATOM   242  C "C1'" . DC  A 1 12  ? 33.515 34.079  34.759 1.00 34.36  ? 12  DC  D "C1'" 1 
ATOM   243  N N1    . DC  A 1 12  ? 33.447 32.630  34.953 1.00 36.31  ? 12  DC  D N1    1 
ATOM   244  C C2    . DC  A 1 12  ? 32.171 32.053  34.922 1.00 38.62  ? 12  DC  D C2    1 
ATOM   245  O O2    . DC  A 1 12  ? 31.160 32.755  34.780 1.00 32.01  ? 12  DC  D O2    1 
ATOM   246  N N3    . DC  A 1 12  ? 32.078 30.695  35.052 1.00 27.12  ? 12  DC  D N3    1 
ATOM   247  C C4    . DC  A 1 12  ? 33.164 29.923  35.217 1.00 39.77  ? 12  DC  D C4    1 
ATOM   248  N N4    . DC  A 1 12  ? 33.014 28.604  35.313 1.00 60.54  ? 12  DC  D N4    1 
ATOM   249  C C5    . DC  A 1 12  ? 34.460 30.522  35.256 1.00 36.38  ? 12  DC  D C5    1 
ATOM   250  C C6    . DC  A 1 12  ? 34.543 31.846  35.125 1.00 22.64  ? 12  DC  D C6    1 
ATOM   251  P P     . DC  A 1 13  ? 33.703 38.156  36.236 1.00 55.99  ? 13  DC  D P     1 
ATOM   252  O OP1   . DC  A 1 13  ? 33.726 39.497  35.629 1.00 32.35  ? 13  DC  D OP1   1 
ATOM   253  O OP2   . DC  A 1 13  ? 34.702 37.743  37.239 1.00 44.23  ? 13  DC  D OP2   1 
ATOM   254  O "O5'" . DC  A 1 13  ? 32.257 37.898  36.847 1.00 38.27  ? 13  DC  D "O5'" 1 
ATOM   255  C "C5'" . DC  A 1 13  ? 31.132 38.151  36.007 1.00 33.04  ? 13  DC  D "C5'" 1 
ATOM   256  C "C4'" . DC  A 1 13  ? 29.977 37.495  36.656 1.00 34.17  ? 13  DC  D "C4'" 1 
ATOM   257  O "O4'" . DC  A 1 13  ? 30.138 36.078  36.656 1.00 41.91  ? 13  DC  D "O4'" 1 
ATOM   258  C "C3'" . DC  A 1 13  ? 29.883 37.901  38.102 1.00 38.92  ? 13  DC  D "C3'" 1 
ATOM   259  O "O3'" . DC  A 1 13  ? 28.673 38.637  38.245 1.00 52.34  ? 13  DC  D "O3'" 1 
ATOM   260  C "C2'" . DC  A 1 13  ? 29.855 36.660  38.947 1.00 46.15  ? 13  DC  D "C2'" 1 
ATOM   261  C "C1'" . DC  A 1 13  ? 29.612 35.607  37.889 1.00 38.63  ? 13  DC  D "C1'" 1 
ATOM   262  N N1    . DC  A 1 13  ? 30.194 34.306  38.160 1.00 28.47  ? 13  DC  D N1    1 
ATOM   263  C C2    . DC  A 1 13  ? 29.317 33.232  38.214 1.00 36.33  ? 13  DC  D C2    1 
ATOM   264  O O2    . DC  A 1 13  ? 28.112 33.391  38.012 1.00 43.20  ? 13  DC  D O2    1 
ATOM   265  N N3    . DC  A 1 13  ? 29.829 32.000  38.487 1.00 35.98  ? 13  DC  D N3    1 
ATOM   266  C C4    . DC  A 1 13  ? 31.142 31.804  38.703 1.00 36.22  ? 13  DC  D C4    1 
ATOM   267  N N4    . DC  A 1 13  ? 31.582 30.574  38.969 1.00 42.77  ? 13  DC  D N4    1 
ATOM   268  C C5    . DC  A 1 13  ? 32.035 32.912  38.646 1.00 29.89  ? 13  DC  D C5    1 
ATOM   269  C C6    . DC  A 1 13  ? 31.522 34.114  38.374 1.00 32.12  ? 13  DC  D C6    1 
ATOM   270  P P     . DC  A 1 14  ? 28.288 39.530  39.511 1.00 63.80  ? 14  DC  D P     1 
ATOM   271  O OP1   . DC  A 1 14  ? 27.504 40.683  39.032 1.00 52.52  ? 14  DC  D OP1   1 
ATOM   272  O OP2   . DC  A 1 14  ? 29.501 39.709  40.328 1.00 55.78  ? 14  DC  D OP2   1 
ATOM   273  O "O5'" . DC  A 1 14  ? 27.299 38.563  40.299 1.00 62.09  ? 14  DC  D "O5'" 1 
ATOM   274  C "C5'" . DC  A 1 14  ? 26.129 38.095  39.617 1.00 52.44  ? 14  DC  D "C5'" 1 
ATOM   275  C "C4'" . DC  A 1 14  ? 25.630 36.942  40.413 1.00 52.93  ? 14  DC  D "C4'" 1 
ATOM   276  O "O4'" . DC  A 1 14  ? 26.532 35.831  40.318 1.00 57.52  ? 14  DC  D "O4'" 1 
ATOM   277  C "C3'" . DC  A 1 14  ? 25.575 37.286  41.883 1.00 61.44  ? 14  DC  D "C3'" 1 
ATOM   278  O "O3'" . DC  A 1 14  ? 24.275 36.905  42.320 1.00 77.02  ? 14  DC  D "O3'" 1 
ATOM   279  C "C2'" . DC  A 1 14  ? 26.617 36.453  42.574 1.00 60.65  ? 14  DC  D "C2'" 1 
ATOM   280  C "C1'" . DC  A 1 14  ? 26.647 35.299  41.621 1.00 54.71  ? 14  DC  D "C1'" 1 
ATOM   281  N N1    . DC  A 1 14  ? 27.802 34.430  41.695 1.00 48.49  ? 14  DC  D N1    1 
ATOM   282  C C2    . DC  A 1 14  ? 27.571 33.048  41.558 1.00 59.29  ? 14  DC  D C2    1 
ATOM   283  O O2    . DC  A 1 14  ? 26.439 32.603  41.326 1.00 50.88  ? 14  DC  D O2    1 
ATOM   284  N N3    . DC  A 1 14  ? 28.637 32.212  41.675 1.00 49.14  ? 14  DC  D N3    1 
ATOM   285  C C4    . DC  A 1 14  ? 29.880 32.672  41.905 1.00 45.16  ? 14  DC  D C4    1 
ATOM   286  N N4    . DC  A 1 14  ? 30.875 31.806  42.016 1.00 36.38  ? 14  DC  D N4    1 
ATOM   287  C C5    . DC  A 1 14  ? 30.108 34.075  42.042 1.00 46.62  ? 14  DC  D C5    1 
ATOM   288  C C6    . DC  A 1 14  ? 29.061 34.892  41.919 1.00 48.12  ? 14  DC  D C6    1 
ATOM   289  P P     . DC  A 1 15  ? 23.598 37.338  43.707 1.00 73.60  ? 15  DC  D P     1 
ATOM   290  O OP1   . DC  A 1 15  ? 22.524 38.298  43.391 1.00 63.53  ? 15  DC  D OP1   1 
ATOM   291  O OP2   . DC  A 1 15  ? 24.674 37.675  44.660 1.00 50.84  ? 15  DC  D OP2   1 
ATOM   292  O "O5'" . DC  A 1 15  ? 22.911 35.953  44.199 1.00 57.59  ? 15  DC  D "O5'" 1 
ATOM   293  C "C5'" . DC  A 1 15  ? 21.788 35.433  43.450 1.00 44.90  ? 15  DC  D "C5'" 1 
ATOM   294  C "C4'" . DC  A 1 15  ? 21.780 33.928  43.634 1.00 51.62  ? 15  DC  D "C4'" 1 
ATOM   295  O "O4'" . DC  A 1 15  ? 23.049 33.372  43.338 1.00 71.28  ? 15  DC  D "O4'" 1 
ATOM   296  C "C3'" . DC  A 1 15  ? 21.517 33.532  45.048 1.00 63.04  ? 15  DC  D "C3'" 1 
ATOM   297  O "O3'" . DC  A 1 15  ? 20.135 33.262  45.179 1.00 79.60  ? 15  DC  D "O3'" 1 
ATOM   298  C "C2'" . DC  A 1 15  ? 22.304 32.302  45.367 1.00 58.79  ? 15  DC  D "C2'" 1 
ATOM   299  C "C1'" . DC  A 1 15  ? 23.292 32.282  44.244 1.00 53.79  ? 15  DC  D "C1'" 1 
ATOM   300  N N1    . DC  A 1 15  ? 24.694 32.345  44.649 1.00 45.13  ? 15  DC  D N1    1 
ATOM   301  C C2    . DC  A 1 15  ? 25.343 31.123  44.822 1.00 39.44  ? 15  DC  D C2    1 
ATOM   302  O O2    . DC  A 1 15  ? 24.738 30.053  44.674 1.00 38.13  ? 15  DC  D O2    1 
ATOM   303  N N3    . DC  A 1 15  ? 26.660 31.146  45.172 1.00 45.39  ? 15  DC  D N3    1 
ATOM   304  C C4    . DC  A 1 15  ? 27.337 32.299  45.354 1.00 53.64  ? 15  DC  D C4    1 
ATOM   305  N N4    . DC  A 1 15  ? 28.629 32.244  45.692 1.00 69.29  ? 15  DC  D N4    1 
ATOM   306  C C5    . DC  A 1 15  ? 26.664 33.547  45.180 1.00 35.90  ? 15  DC  D C5    1 
ATOM   307  C C6    . DC  A 1 15  ? 25.375 33.516  44.833 1.00 40.28  ? 15  DC  D C6    1 
ATOM   308  P P     . DT  A 1 16  ? 19.323 33.484  46.537 1.00 85.87  ? 16  DT  D P     1 
ATOM   309  O OP1   . DT  A 1 16  ? 17.903 33.635  46.185 1.00 75.66  ? 16  DT  D OP1   1 
ATOM   310  O OP2   . DT  A 1 16  ? 20.029 34.510  47.335 1.00 69.19  ? 16  DT  D OP2   1 
ATOM   311  O "O5'" . DT  A 1 16  ? 19.510 32.063  47.273 1.00 63.72  ? 16  DT  D "O5'" 1 
ATOM   312  C "C5'" . DT  A 1 16  ? 19.299 30.829  46.545 1.00 73.17  ? 16  DT  D "C5'" 1 
ATOM   313  C "C4'" . DT  A 1 16  ? 19.822 29.731  47.444 1.00 87.73  ? 16  DT  D "C4'" 1 
ATOM   314  O "O4'" . DT  A 1 16  ? 21.261 29.711  47.408 1.00 87.24  ? 16  DT  D "O4'" 1 
ATOM   315  C "C3'" . DT  A 1 16  ? 19.443 30.006  48.894 1.00 99.62  ? 16  DT  D "C3'" 1 
ATOM   316  O "O3'" . DT  A 1 16  ? 18.913 28.810  49.484 1.00 114.12 ? 16  DT  D "O3'" 1 
ATOM   317  C "C2'" . DT  A 1 16  ? 20.662 30.463  49.644 1.00 97.35  ? 16  DT  D "C2'" 1 
ATOM   318  C "C1'" . DT  A 1 16  ? 21.776 29.983  48.730 1.00 87.39  ? 16  DT  D "C1'" 1 
ATOM   319  N N1    . DT  A 1 16  ? 22.906 30.906  48.605 1.00 80.10  ? 16  DT  D N1    1 
ATOM   320  C C2    . DT  A 1 16  ? 24.182 30.346  48.603 1.00 72.81  ? 16  DT  D C2    1 
ATOM   321  O O2    . DT  A 1 16  ? 24.359 29.126  48.693 1.00 79.50  ? 16  DT  D O2    1 
ATOM   322  N N3    . DT  A 1 16  ? 25.253 31.191  48.502 1.00 63.26  ? 16  DT  D N3    1 
ATOM   323  C C4    . DT  A 1 16  ? 25.120 32.554  48.401 1.00 71.10  ? 16  DT  D C4    1 
ATOM   324  O O4    . DT  A 1 16  ? 26.144 33.247  48.314 1.00 70.29  ? 16  DT  D O4    1 
ATOM   325  C C5    . DT  A 1 16  ? 23.797 33.112  48.400 1.00 77.98  ? 16  DT  D C5    1 
ATOM   326  C C7    . DT  A 1 16  ? 23.583 34.610  48.289 1.00 83.33  ? 16  DT  D C7    1 
ATOM   327  C C6    . DT  A 1 16  ? 22.757 32.266  48.505 1.00 82.06  ? 16  DT  D C6    1 
ATOM   328  P P     . DA  A 1 17  ? 17.995 28.789  50.810 1.00 121.82 ? 17  DA  D P     1 
ATOM   329  O OP1   . DA  A 1 17  ? 16.787 28.003  50.505 1.00 119.04 ? 17  DA  D OP1   1 
ATOM   330  O OP2   . DA  A 1 17  ? 17.895 30.169  51.320 1.00 119.66 ? 17  DA  D OP2   1 
ATOM   331  O "O5'" . DA  A 1 17  ? 18.890 27.941  51.863 1.00 124.84 ? 17  DA  D "O5'" 1 
ATOM   332  C "C5'" . DA  A 1 17  ? 20.155 27.357  51.461 1.00 123.06 ? 17  DA  D "C5'" 1 
ATOM   333  C "C4'" . DA  A 1 17  ? 21.180 27.663  52.565 1.00 119.50 ? 17  DA  D "C4'" 1 
ATOM   334  O "O4'" . DA  A 1 17  ? 21.907 28.862  52.259 1.00 115.13 ? 17  DA  D "O4'" 1 
ATOM   335  C "C3'" . DA  A 1 17  ? 20.541 27.898  53.938 1.00 124.80 ? 17  DA  D "C3'" 1 
ATOM   336  O "O3'" . DA  A 1 17  ? 21.038 26.896  54.850 1.00 136.44 ? 17  DA  D "O3'" 1 
ATOM   337  C "C2'" . DA  A 1 17  ? 20.911 29.288  54.425 1.00 121.30 ? 17  DA  D "C2'" 1 
ATOM   338  C "C1'" . DA  A 1 17  ? 22.028 29.649  53.459 1.00 117.49 ? 17  DA  D "C1'" 1 
ATOM   339  N N9    . DA  A 1 17  ? 22.119 31.063  53.066 1.00 109.49 ? 17  DA  D N9    1 
ATOM   340  C C8    . DA  A 1 17  ? 21.129 32.005  52.968 1.00 101.29 ? 17  DA  D C8    1 
ATOM   341  N N7    . DA  A 1 17  ? 21.549 33.189  52.591 1.00 94.05  ? 17  DA  D N7    1 
ATOM   342  C C5    . DA  A 1 17  ? 22.922 33.012  52.429 1.00 90.68  ? 17  DA  D C5    1 
ATOM   343  C C6    . DA  A 1 17  ? 23.957 33.917  52.050 1.00 87.20  ? 17  DA  D C6    1 
ATOM   344  N N6    . DA  A 1 17  ? 23.774 35.202  51.739 1.00 81.37  ? 17  DA  D N6    1 
ATOM   345  N N1    . DA  A 1 17  ? 25.200 33.381  52.020 1.00 83.93  ? 17  DA  D N1    1 
ATOM   346  C C2    . DA  A 1 17  ? 25.460 32.085  52.319 1.00 80.73  ? 17  DA  D C2    1 
ATOM   347  N N3    . DA  A 1 17  ? 24.530 31.169  52.685 1.00 84.66  ? 17  DA  D N3    1 
ATOM   348  C C4    . DA  A 1 17  ? 23.290 31.712  52.712 1.00 96.92  ? 17  DA  D C4    1 
ATOM   349  P P     . DG  A 1 18  ? 20.222 26.322  56.126 1.00 148.04 ? 18  DG  D P     1 
ATOM   350  O OP1   . DG  A 1 18  ? 19.636 25.021  55.750 1.00 149.56 ? 18  DG  D OP1   1 
ATOM   351  O OP2   . DG  A 1 18  ? 19.384 27.411  56.657 1.00 146.98 ? 18  DG  D OP2   1 
ATOM   352  O "O5'" . DG  A 1 18  ? 21.396 26.047  57.181 1.00 152.35 ? 18  DG  D "O5'" 1 
ATOM   353  C "C5'" . DG  A 1 18  ? 21.228 25.000  58.166 1.00 159.65 ? 18  DG  D "C5'" 1 
ATOM   354  C "C4'" . DG  A 1 18  ? 21.814 25.534  59.464 1.00 158.24 ? 18  DG  D "C4'" 1 
ATOM   355  O "O4'" . DG  A 1 18  ? 23.117 26.099  59.211 1.00 159.33 ? 18  DG  D "O4'" 1 
ATOM   356  C "C3'" . DG  A 1 18  ? 20.975 26.691  60.035 1.00 156.56 ? 18  DG  D "C3'" 1 
ATOM   357  O "O3'" . DG  A 1 18  ? 20.951 26.573  61.477 1.00 154.40 ? 18  DG  D "O3'" 1 
ATOM   358  C "C2'" . DG  A 1 18  ? 21.670 27.963  59.644 1.00 152.40 ? 18  DG  D "C2'" 1 
ATOM   359  C "C1'" . DG  A 1 18  ? 23.094 27.473  59.644 1.00 149.22 ? 18  DG  D "C1'" 1 
ATOM   360  N N9    . DG  A 1 18  ? 24.038 28.238  58.845 1.00 139.05 ? 18  DG  D N9    1 
ATOM   361  C C8    . DG  A 1 18  ? 23.809 29.052  57.770 1.00 133.71 ? 18  DG  D C8    1 
ATOM   362  N N7    . DG  A 1 18  ? 24.886 29.612  57.290 1.00 127.39 ? 18  DG  D N7    1 
ATOM   363  C C5    . DG  A 1 18  ? 25.900 29.124  58.116 1.00 132.19 ? 18  DG  D C5    1 
ATOM   364  C C6    . DG  A 1 18  ? 27.315 29.315  58.104 1.00 133.48 ? 18  DG  D C6    1 
ATOM   365  O O6    . DG  A 1 18  ? 27.957 30.028  57.323 1.00 134.25 ? 18  DG  D O6    1 
ATOM   366  N N1    . DG  A 1 18  ? 27.993 28.616  59.064 1.00 124.24 ? 18  DG  D N1    1 
ATOM   367  C C2    . DG  A 1 18  ? 27.377 27.804  59.962 1.00 116.32 ? 18  DG  D C2    1 
ATOM   368  N N2    . DG  A 1 18  ? 28.182 27.184  60.826 1.00 118.82 ? 18  DG  D N2    1 
ATOM   369  N N3    . DG  A 1 18  ? 26.049 27.585  60.026 1.00 120.77 ? 18  DG  D N3    1 
ATOM   370  C C4    . DG  A 1 18  ? 25.389 28.277  59.075 1.00 129.72 ? 18  DG  D C4    1 
ATOM   371  P P     . DA  A 1 19  ? 20.398 27.705  62.526 1.00 155.46 ? 19  DA  D P     1 
ATOM   372  O OP1   . DA  A 1 19  ? 20.454 27.126  63.882 1.00 147.34 ? 19  DA  D OP1   1 
ATOM   373  O OP2   . DA  A 1 19  ? 19.138 28.243  61.984 1.00 156.02 ? 19  DA  D OP2   1 
ATOM   374  O "O5'" . DA  A 1 19  ? 21.531 28.882  62.431 1.00 140.36 ? 19  DA  D "O5'" 1 
ATOM   375  C "C5'" . DA  A 1 19  ? 22.486 29.114  63.513 1.00 126.29 ? 19  DA  D "C5'" 1 
ATOM   376  C "C4'" . DA  A 1 19  ? 23.710 28.246  63.225 1.00 115.23 ? 19  DA  D "C4'" 1 
ATOM   377  O "O4'" . DA  A 1 19  ? 24.967 28.881  63.565 1.00 99.24  ? 19  DA  D "O4'" 1 
ATOM   378  C "C3'" . DA  A 1 19  ? 23.704 26.938  64.053 1.00 114.26 ? 19  DA  D "C3'" 1 
ATOM   379  O "O3'" . DA  A 1 19  ? 23.562 25.797  63.173 1.00 126.68 ? 19  DA  D "O3'" 1 
ATOM   380  C "C2'" . DA  A 1 19  ? 24.987 26.907  64.835 1.00 96.98  ? 19  DA  D "C2'" 1 
ATOM   381  C "C1'" . DA  A 1 19  ? 25.786 27.762  63.921 1.00 81.50  ? 19  DA  D "C1'" 1 
ATOM   382  N N9    . DA  A 1 19  ? 27.155 28.102  64.318 1.00 57.74  ? 19  DA  D N9    1 
ATOM   383  C C8    . DA  A 1 19  ? 28.201 27.241  64.472 1.00 59.84  ? 19  DA  D C8    1 
ATOM   384  N N7    . DA  A 1 19  ? 29.328 27.807  64.803 1.00 62.96  ? 19  DA  D N7    1 
ATOM   385  C C5    . DA  A 1 19  ? 29.004 29.154  64.876 1.00 42.33  ? 19  DA  D C5    1 
ATOM   386  C C6    . DA  A 1 19  ? 29.790 30.271  65.195 1.00 42.98  ? 19  DA  D C6    1 
ATOM   387  N N6    . DA  A 1 19  ? 31.083 30.212  65.512 1.00 38.93  ? 19  DA  D N6    1 
ATOM   388  N N1    . DA  A 1 19  ? 29.137 31.444  65.177 1.00 43.63  ? 19  DA  D N1    1 
ATOM   389  C C2    . DA  A 1 19  ? 27.823 31.556  64.878 1.00 38.77  ? 19  DA  D C2    1 
ATOM   390  N N3    . DA  A 1 19  ? 27.005 30.530  64.563 1.00 47.31  ? 19  DA  D N3    1 
ATOM   391  C C4    . DA  A 1 19  ? 27.673 29.364  64.583 1.00 46.01  ? 19  DA  D C4    1 
ATOM   392  N N     . PRO B 2 42  ? 66.042 6.821   53.305 1.00 87.48  ? 43  PRO P N     1 
ATOM   393  C CA    . PRO B 2 42  ? 64.775 7.553   53.403 1.00 93.75  ? 43  PRO P CA    1 
ATOM   394  C C     . PRO B 2 42  ? 64.091 7.822   52.064 1.00 93.49  ? 43  PRO P C     1 
ATOM   395  O O     . PRO B 2 42  ? 64.689 8.399   51.156 1.00 96.18  ? 43  PRO P O     1 
ATOM   396  C CB    . PRO B 2 42  ? 65.190 8.860   54.085 1.00 93.36  ? 43  PRO P CB    1 
ATOM   397  C CG    . PRO B 2 42  ? 66.616 9.036   53.666 1.00 89.23  ? 43  PRO P CG    1 
ATOM   398  C CD    . PRO B 2 42  ? 67.151 7.638   53.826 1.00 88.00  ? 43  PRO P CD    1 
ATOM   399  N N     . TYR B 2 43  ? 62.843 7.384   51.937 1.00 90.70  ? 44  TYR P N     1 
ATOM   400  C CA    . TYR B 2 43  ? 62.085 7.608   50.710 1.00 88.79  ? 44  TYR P CA    1 
ATOM   401  C C     . TYR B 2 43  ? 60.690 8.135   51.067 1.00 86.74  ? 44  TYR P C     1 
ATOM   402  O O     . TYR B 2 43  ? 60.158 7.838   52.140 1.00 85.76  ? 44  TYR P O     1 
ATOM   403  C CB    . TYR B 2 43  ? 62.014 6.333   49.833 1.00 87.12  ? 44  TYR P CB    1 
ATOM   404  C CG    . TYR B 2 43  ? 61.197 5.183   50.399 1.00 89.65  ? 44  TYR P CG    1 
ATOM   405  C CD1   . TYR B 2 43  ? 61.522 4.609   51.630 1.00 87.37  ? 44  TYR P CD1   1 
ATOM   406  C CD2   . TYR B 2 43  ? 60.075 4.694   49.717 1.00 83.63  ? 44  TYR P CD2   1 
ATOM   407  C CE1   . TYR B 2 43  ? 60.754 3.584   52.177 1.00 87.24  ? 44  TYR P CE1   1 
ATOM   408  C CE2   . TYR B 2 43  ? 59.293 3.665   50.259 1.00 91.02  ? 44  TYR P CE2   1 
ATOM   409  C CZ    . TYR B 2 43  ? 59.639 3.120   51.495 1.00 91.66  ? 44  TYR P CZ    1 
ATOM   410  O OH    . TYR B 2 43  ? 58.859 2.145   52.084 1.00 78.66  ? 44  TYR P OH    1 
ATOM   411  N N     . LEU B 2 44  ? 60.151 8.986   50.201 1.00 86.24  ? 45  LEU P N     1 
ATOM   412  C CA    . LEU B 2 44  ? 58.830 9.569   50.392 1.00 81.05  ? 45  LEU P CA    1 
ATOM   413  C C     . LEU B 2 44  ? 57.829 8.713   49.596 1.00 76.91  ? 45  LEU P C     1 
ATOM   414  O O     . LEU B 2 44  ? 58.144 8.247   48.494 1.00 73.69  ? 45  LEU P O     1 
ATOM   415  C CB    . LEU B 2 44  ? 58.856 11.026  49.909 1.00 84.29  ? 45  LEU P CB    1 
ATOM   416  C CG    . LEU B 2 44  ? 57.634 11.935  50.055 1.00 98.66  ? 45  LEU P CG    1 
ATOM   417  C CD1   . LEU B 2 44  ? 58.071 13.370  49.984 1.00 101.83 ? 45  LEU P CD1   1 
ATOM   418  C CD2   . LEU B 2 44  ? 56.613 11.665  48.953 1.00 100.86 ? 45  LEU P CD2   1 
ATOM   419  N N     . GLN B 2 45  ? 56.656 8.468   50.182 1.00 75.14  ? 46  GLN P N     1 
ATOM   420  C CA    . GLN B 2 45  ? 55.597 7.668   49.558 1.00 79.78  ? 46  GLN P CA    1 
ATOM   421  C C     . GLN B 2 45  ? 54.209 8.329   49.691 1.00 80.64  ? 46  GLN P C     1 
ATOM   422  O O     . GLN B 2 45  ? 54.026 9.243   50.496 1.00 83.82  ? 46  GLN P O     1 
ATOM   423  C CB    . GLN B 2 45  ? 55.568 6.277   50.198 1.00 85.60  ? 46  GLN P CB    1 
ATOM   424  C CG    . GLN B 2 45  ? 54.242 5.560   50.048 1.00 99.43  ? 46  GLN P CG    1 
ATOM   425  C CD    . GLN B 2 45  ? 54.237 4.180   50.658 1.00 105.38 ? 46  GLN P CD    1 
ATOM   426  O OE1   . GLN B 2 45  ? 54.311 3.176   49.941 1.00 109.93 ? 46  GLN P OE1   1 
ATOM   427  N NE2   . GLN B 2 45  ? 54.149 4.114   51.982 1.00 96.79  ? 46  GLN P NE2   1 
ATOM   428  N N     . ILE B 2 46  ? 53.240 7.882   48.892 1.00 78.30  ? 47  ILE P N     1 
ATOM   429  C CA    . ILE B 2 46  ? 51.878 8.415   48.956 1.00 75.01  ? 47  ILE P CA    1 
ATOM   430  C C     . ILE B 2 46  ? 50.935 7.452   49.696 1.00 72.80  ? 47  ILE P C     1 
ATOM   431  O O     . ILE B 2 46  ? 50.692 6.336   49.238 1.00 71.00  ? 47  ILE P O     1 
ATOM   432  C CB    . ILE B 2 46  ? 51.317 8.691   47.536 1.00 76.01  ? 47  ILE P CB    1 
ATOM   433  C CG1   . ILE B 2 46  ? 52.087 9.837   46.881 1.00 72.60  ? 47  ILE P CG1   1 
ATOM   434  C CG2   . ILE B 2 46  ? 49.837 9.047   47.595 1.00 80.25  ? 47  ILE P CG2   1 
ATOM   435  C CD1   . ILE B 2 46  ? 51.606 10.169  45.484 1.00 59.77  ? 47  ILE P CD1   1 
ATOM   436  N N     . LEU B 2 47  ? 50.438 7.877   50.855 1.00 71.35  ? 48  LEU P N     1 
ATOM   437  C CA    . LEU B 2 47  ? 49.520 7.062   51.643 1.00 69.96  ? 48  LEU P CA    1 
ATOM   438  C C     . LEU B 2 47  ? 48.171 7.032   50.965 1.00 69.20  ? 48  LEU P C     1 
ATOM   439  O O     . LEU B 2 47  ? 47.574 5.969   50.809 1.00 73.72  ? 48  LEU P O     1 
ATOM   440  C CB    . LEU B 2 47  ? 49.354 7.653   53.033 1.00 68.02  ? 48  LEU P CB    1 
ATOM   441  C CG    . LEU B 2 47  ? 50.214 7.031   54.126 1.00 81.09  ? 48  LEU P CG    1 
ATOM   442  C CD1   . LEU B 2 47  ? 50.464 8.050   55.229 1.00 77.01  ? 48  LEU P CD1   1 
ATOM   443  C CD2   . LEU B 2 47  ? 49.534 5.779   54.669 1.00 78.05  ? 48  LEU P CD2   1 
ATOM   444  N N     . GLU B 2 48  ? 47.693 8.219   50.592 1.00 68.51  ? 49  GLU P N     1 
ATOM   445  C CA    . GLU B 2 48  ? 46.404 8.386   49.926 1.00 64.32  ? 49  GLU P CA    1 
ATOM   446  C C     . GLU B 2 48  ? 46.479 9.362   48.747 1.00 63.67  ? 49  GLU P C     1 
ATOM   447  O O     . GLU B 2 48  ? 46.819 10.533  48.905 1.00 61.92  ? 49  GLU P O     1 
ATOM   448  C CB    . GLU B 2 48  ? 45.360 8.880   50.928 1.00 67.02  ? 49  GLU P CB    1 
ATOM   449  C CG    . GLU B 2 48  ? 43.947 8.974   50.364 1.00 57.21  ? 49  GLU P CG    1 
ATOM   450  C CD    . GLU B 2 48  ? 42.967 9.583   51.339 1.00 58.62  ? 49  GLU P CD    1 
ATOM   451  O OE1   . GLU B 2 48  ? 43.380 9.926   52.464 1.00 73.07  ? 49  GLU P OE1   1 
ATOM   452  O OE2   . GLU B 2 48  ? 41.785 9.737   50.978 1.00 66.44  ? 49  GLU P OE2   1 
ATOM   453  N N     . GLN B 2 49  ? 46.167 8.871   47.558 1.00 63.20  ? 50  GLN P N     1 
ATOM   454  C CA    . GLN B 2 49  ? 46.182 9.709   46.371 1.00 62.97  ? 50  GLN P CA    1 
ATOM   455  C C     . GLN B 2 49  ? 45.062 10.737  46.470 1.00 63.41  ? 50  GLN P C     1 
ATOM   456  O O     . GLN B 2 49  ? 44.190 10.638  47.341 1.00 60.28  ? 50  GLN P O     1 
ATOM   457  C CB    . GLN B 2 49  ? 45.913 8.852   45.132 1.00 56.88  ? 50  GLN P CB    1 
ATOM   458  C CG    . GLN B 2 49  ? 46.999 7.855   44.794 1.00 52.79  ? 50  GLN P CG    1 
ATOM   459  C CD    . GLN B 2 49  ? 48.210 8.481   44.139 1.00 58.83  ? 50  GLN P CD    1 
ATOM   460  O OE1   . GLN B 2 49  ? 48.194 9.649   43.762 1.00 63.91  ? 50  GLN P OE1   1 
ATOM   461  N NE2   . GLN B 2 49  ? 49.267 7.695   43.986 1.00 54.68  ? 50  GLN P NE2   1 
ATOM   462  N N     . PRO B 2 50  ? 45.149 11.814  45.674 1.00 63.99  ? 51  PRO P N     1 
ATOM   463  C CA    . PRO B 2 50  ? 44.090 12.832  45.693 1.00 59.88  ? 51  PRO P CA    1 
ATOM   464  C C     . PRO B 2 50  ? 43.013 12.309  44.739 1.00 54.58  ? 51  PRO P C     1 
ATOM   465  O O     . PRO B 2 50  ? 43.316 11.530  43.831 1.00 53.02  ? 51  PRO P O     1 
ATOM   466  C CB    . PRO B 2 50  ? 44.789 14.062  45.128 1.00 50.33  ? 51  PRO P CB    1 
ATOM   467  C CG    . PRO B 2 50  ? 45.799 13.460  44.179 1.00 54.25  ? 51  PRO P CG    1 
ATOM   468  C CD    . PRO B 2 50  ? 46.352 12.313  44.982 1.00 64.10  ? 51  PRO P CD    1 
ATOM   469  N N     . LYS B 2 51  ? 41.756 12.657  44.974 1.00 53.46  ? 52  LYS P N     1 
ATOM   470  C CA    . LYS B 2 51  ? 40.694 12.178  44.100 1.00 51.68  ? 52  LYS P CA    1 
ATOM   471  C C     . LYS B 2 51  ? 40.933 12.700  42.678 1.00 52.20  ? 52  LYS P C     1 
ATOM   472  O O     . LYS B 2 51  ? 40.992 13.915  42.457 1.00 55.13  ? 52  LYS P O     1 
ATOM   473  C CB    . LYS B 2 51  ? 39.333 12.642  44.619 1.00 62.60  ? 52  LYS P CB    1 
ATOM   474  C CG    . LYS B 2 51  ? 38.146 11.978  43.937 1.00 74.03  ? 52  LYS P CG    1 
ATOM   475  C CD    . LYS B 2 51  ? 36.833 12.608  44.353 1.00 82.15  ? 52  LYS P CD    1 
ATOM   476  C CE    . LYS B 2 51  ? 35.689 11.989  43.572 1.00 86.01  ? 52  LYS P CE    1 
ATOM   477  N NZ    . LYS B 2 51  ? 34.403 12.717  43.788 1.00 103.30 ? 52  LYS P NZ    1 
ATOM   478  N N     . GLN B 2 52  ? 41.094 11.774  41.731 1.00 45.56  ? 53  GLN P N     1 
ATOM   479  C CA    . GLN B 2 52  ? 41.337 12.108  40.324 1.00 45.02  ? 53  GLN P CA    1 
ATOM   480  C C     . GLN B 2 52  ? 40.294 13.052  39.691 1.00 47.53  ? 53  GLN P C     1 
ATOM   481  O O     . GLN B 2 52  ? 40.638 14.166  39.280 1.00 52.80  ? 53  GLN P O     1 
ATOM   482  C CB    . GLN B 2 52  ? 41.444 10.832  39.484 1.00 46.39  ? 53  GLN P CB    1 
ATOM   483  C CG    . GLN B 2 52  ? 42.626 9.931   39.808 1.00 59.35  ? 53  GLN P CG    1 
ATOM   484  C CD    . GLN B 2 52  ? 43.108 9.151   38.594 1.00 58.79  ? 53  GLN P CD    1 
ATOM   485  O OE1   . GLN B 2 52  ? 42.584 8.086   38.282 1.00 60.99  ? 53  GLN P OE1   1 
ATOM   486  N NE2   . GLN B 2 52  ? 44.106 9.689   37.898 1.00 58.74  ? 53  GLN P NE2   1 
ATOM   487  N N     . ARG B 2 53  ? 39.047 12.581  39.567 1.00 47.81  ? 54  ARG P N     1 
ATOM   488  C CA    . ARG B 2 53  ? 37.936 13.359  38.995 1.00 44.79  ? 54  ARG P CA    1 
ATOM   489  C C     . ARG B 2 53  ? 36.993 13.914  40.060 1.00 44.28  ? 54  ARG P C     1 
ATOM   490  O O     . ARG B 2 53  ? 36.902 13.387  41.166 1.00 41.34  ? 54  ARG P O     1 
ATOM   491  C CB    . ARG B 2 53  ? 37.124 12.519  38.008 1.00 39.20  ? 54  ARG P CB    1 
ATOM   492  C CG    . ARG B 2 53  ? 37.780 12.339  36.653 1.00 47.57  ? 54  ARG P CG    1 
ATOM   493  C CD    . ARG B 2 53  ? 38.107 10.877  36.364 1.00 51.15  ? 54  ARG P CD    1 
ATOM   494  N NE    . ARG B 2 53  ? 39.015 10.725  35.225 1.00 64.52  ? 54  ARG P NE    1 
ATOM   495  C CZ    . ARG B 2 53  ? 38.730 11.074  33.966 1.00 79.69  ? 54  ARG P CZ    1 
ATOM   496  N NH1   . ARG B 2 53  ? 37.545 11.592  33.652 1.00 75.16  ? 54  ARG P NH1   1 
ATOM   497  N NH2   . ARG B 2 53  ? 39.652 10.946  33.015 1.00 77.55  ? 54  ARG P NH2   1 
ATOM   498  N N     . GLY B 2 54  ? 36.307 14.999  39.726 1.00 44.71  ? 55  GLY P N     1 
ATOM   499  C CA    . GLY B 2 54  ? 35.370 15.581  40.663 1.00 44.14  ? 55  GLY P CA    1 
ATOM   500  C C     . GLY B 2 54  ? 35.640 17.009  41.078 1.00 46.19  ? 55  GLY P C     1 
ATOM   501  O O     . GLY B 2 54  ? 34.716 17.815  41.142 1.00 45.34  ? 55  GLY P O     1 
ATOM   502  N N     . PHE B 2 55  ? 36.891 17.326  41.389 1.00 48.04  ? 56  PHE P N     1 
ATOM   503  C CA    . PHE B 2 55  ? 37.253 18.679  41.812 1.00 41.13  ? 56  PHE P CA    1 
ATOM   504  C C     . PHE B 2 55  ? 37.175 19.657  40.634 1.00 39.49  ? 56  PHE P C     1 
ATOM   505  O O     . PHE B 2 55  ? 37.320 19.260  39.488 1.00 41.91  ? 56  PHE P O     1 
ATOM   506  C CB    . PHE B 2 55  ? 38.661 18.660  42.403 1.00 42.53  ? 56  PHE P CB    1 
ATOM   507  C CG    . PHE B 2 55  ? 39.063 19.941  43.079 1.00 34.59  ? 56  PHE P CG    1 
ATOM   508  C CD1   . PHE B 2 55  ? 38.329 20.442  44.140 1.00 30.69  ? 56  PHE P CD1   1 
ATOM   509  C CD2   . PHE B 2 55  ? 40.190 20.638  42.658 1.00 38.18  ? 56  PHE P CD2   1 
ATOM   510  C CE1   . PHE B 2 55  ? 38.708 21.612  44.768 1.00 40.37  ? 56  PHE P CE1   1 
ATOM   511  C CE2   . PHE B 2 55  ? 40.577 21.810  43.282 1.00 37.94  ? 56  PHE P CE2   1 
ATOM   512  C CZ    . PHE B 2 55  ? 39.839 22.299  44.336 1.00 45.86  ? 56  PHE P CZ    1 
ATOM   513  N N     . ARG B 2 56  ? 36.980 20.936  40.916 1.00 37.82  ? 57  ARG P N     1 
ATOM   514  C CA    . ARG B 2 56  ? 36.862 21.938  39.870 1.00 32.38  ? 57  ARG P CA    1 
ATOM   515  C C     . ARG B 2 56  ? 37.871 23.056  40.019 1.00 33.87  ? 57  ARG P C     1 
ATOM   516  O O     . ARG B 2 56  ? 37.859 23.769  41.014 1.00 42.00  ? 57  ARG P O     1 
ATOM   517  C CB    . ARG B 2 56  ? 35.432 22.485  39.883 1.00 24.32  ? 57  ARG P CB    1 
ATOM   518  C CG    . ARG B 2 56  ? 35.235 23.866  39.311 1.00 32.80  ? 57  ARG P CG    1 
ATOM   519  C CD    . ARG B 2 56  ? 33.765 24.214  39.277 1.00 30.84  ? 57  ARG P CD    1 
ATOM   520  N NE    . ARG B 2 56  ? 33.531 25.580  38.810 1.00 48.52  ? 57  ARG P NE    1 
ATOM   521  C CZ    . ARG B 2 56  ? 32.325 26.108  38.596 1.00 52.27  ? 57  ARG P CZ    1 
ATOM   522  N NH1   . ARG B 2 56  ? 31.220 25.395  38.796 1.00 48.27  ? 57  ARG P NH1   1 
ATOM   523  N NH2   . ARG B 2 56  ? 32.219 27.369  38.205 1.00 58.26  ? 57  ARG P NH2   1 
ATOM   524  N N     . PHE B 2 57  ? 38.756 23.199  39.036 1.00 33.60  ? 58  PHE P N     1 
ATOM   525  C CA    . PHE B 2 57  ? 39.767 24.256  39.069 1.00 29.80  ? 58  PHE P CA    1 
ATOM   526  C C     . PHE B 2 57  ? 39.017 25.574  38.917 1.00 32.18  ? 58  PHE P C     1 
ATOM   527  O O     . PHE B 2 57  ? 38.059 25.673  38.135 1.00 34.03  ? 58  PHE P O     1 
ATOM   528  C CB    . PHE B 2 57  ? 40.779 24.127  37.923 1.00 33.13  ? 58  PHE P CB    1 
ATOM   529  C CG    . PHE B 2 57  ? 41.410 22.759  37.783 1.00 38.38  ? 58  PHE P CG    1 
ATOM   530  C CD1   . PHE B 2 57  ? 41.120 21.724  38.661 1.00 34.20  ? 58  PHE P CD1   1 
ATOM   531  C CD2   . PHE B 2 57  ? 42.274 22.498  36.726 1.00 24.86  ? 58  PHE P CD2   1 
ATOM   532  C CE1   . PHE B 2 57  ? 41.681 20.448  38.483 1.00 37.31  ? 58  PHE P CE1   1 
ATOM   533  C CE2   . PHE B 2 57  ? 42.839 21.220  36.545 1.00 35.71  ? 58  PHE P CE2   1 
ATOM   534  C CZ    . PHE B 2 57  ? 42.538 20.197  37.424 1.00 30.45  ? 58  PHE P CZ    1 
ATOM   535  N N     . ARG B 2 58  ? 39.499 26.602  39.604 1.00 29.79  ? 59  ARG P N     1 
ATOM   536  C CA    . ARG B 2 58  ? 38.860 27.922  39.592 1.00 32.12  ? 59  ARG P CA    1 
ATOM   537  C C     . ARG B 2 58  ? 39.692 29.040  38.992 1.00 33.42  ? 59  ARG P C     1 
ATOM   538  O O     . ARG B 2 58  ? 40.890 29.140  39.231 1.00 34.12  ? 59  ARG P O     1 
ATOM   539  C CB    . ARG B 2 58  ? 38.491 28.324  41.023 1.00 37.70  ? 59  ARG P CB    1 
ATOM   540  C CG    . ARG B 2 58  ? 37.558 27.358  41.736 1.00 38.38  ? 59  ARG P CG    1 
ATOM   541  C CD    . ARG B 2 58  ? 36.150 27.557  41.263 1.00 33.02  ? 59  ARG P CD    1 
ATOM   542  N NE    . ARG B 2 58  ? 35.216 26.714  41.981 1.00 41.52  ? 59  ARG P NE    1 
ATOM   543  C CZ    . ARG B 2 58  ? 33.909 26.916  41.978 1.00 38.20  ? 59  ARG P CZ    1 
ATOM   544  N NH1   . ARG B 2 58  ? 33.407 27.928  41.293 1.00 37.48  ? 59  ARG P NH1   1 
ATOM   545  N NH2   . ARG B 2 58  ? 33.112 26.135  42.689 1.00 40.98  ? 59  ARG P NH2   1 
ATOM   546  N N     . TYR B 2 59  ? 39.052 29.887  38.203 1.00 34.84  ? 60  TYR P N     1 
ATOM   547  C CA    . TYR B 2 59  ? 39.755 30.999  37.603 1.00 41.03  ? 60  TYR P CA    1 
ATOM   548  C C     . TYR B 2 59  ? 39.954 32.010  38.725 1.00 43.23  ? 60  TYR P C     1 
ATOM   549  O O     . TYR B 2 59  ? 39.138 32.058  39.640 1.00 45.20  ? 60  TYR P O     1 
ATOM   550  C CB    . TYR B 2 59  ? 38.944 31.579  36.439 1.00 36.97  ? 60  TYR P CB    1 
ATOM   551  C CG    . TYR B 2 59  ? 38.843 30.641  35.253 1.00 37.48  ? 60  TYR P CG    1 
ATOM   552  C CD1   . TYR B 2 59  ? 39.846 30.593  34.283 1.00 27.58  ? 60  TYR P CD1   1 
ATOM   553  C CD2   . TYR B 2 59  ? 37.754 29.783  35.114 1.00 31.27  ? 60  TYR P CD2   1 
ATOM   554  C CE1   . TYR B 2 59  ? 39.765 29.714  33.211 1.00 32.84  ? 60  TYR P CE1   1 
ATOM   555  C CE2   . TYR B 2 59  ? 37.662 28.899  34.044 1.00 21.19  ? 60  TYR P CE2   1 
ATOM   556  C CZ    . TYR B 2 59  ? 38.670 28.868  33.104 1.00 37.73  ? 60  TYR P CZ    1 
ATOM   557  O OH    . TYR B 2 59  ? 38.589 27.961  32.084 1.00 44.55  ? 60  TYR P OH    1 
ATOM   558  N N     . VAL B 2 60  ? 41.040 32.785  38.663 1.00 49.29  ? 61  VAL P N     1 
ATOM   559  C CA    . VAL B 2 60  ? 41.381 33.781  39.685 1.00 52.08  ? 61  VAL P CA    1 
ATOM   560  C C     . VAL B 2 60  ? 40.140 34.489  40.194 1.00 49.64  ? 61  VAL P C     1 
ATOM   561  O O     . VAL B 2 60  ? 39.881 34.513  41.393 1.00 54.54  ? 61  VAL P O     1 
ATOM   562  C CB    . VAL B 2 60  ? 42.380 34.872  39.183 1.00 55.45  ? 61  VAL P CB    1 
ATOM   563  C CG1   . VAL B 2 60  ? 42.599 35.892  40.271 1.00 60.89  ? 61  VAL P CG1   1 
ATOM   564  C CG2   . VAL B 2 60  ? 43.713 34.275  38.823 1.00 64.32  ? 61  VAL P CG2   1 
ATOM   565  N N     . ALA B 2 61  ? 39.349 35.002  39.261 1.00 50.28  ? 62  ALA P N     1 
ATOM   566  C CA    . ALA B 2 61  ? 38.120 35.731  39.561 1.00 55.61  ? 62  ALA P CA    1 
ATOM   567  C C     . ALA B 2 61  ? 37.134 34.989  40.459 1.00 55.51  ? 62  ALA P C     1 
ATOM   568  O O     . ALA B 2 61  ? 36.561 35.574  41.374 1.00 54.09  ? 62  ALA P O     1 
ATOM   569  C CB    . ALA B 2 61  ? 37.421 36.156  38.260 1.00 63.66  ? 62  ALA P CB    1 
ATOM   570  N N     . GLU B 2 62  ? 36.942 33.701  40.219 1.00 58.66  ? 63  GLU P N     1 
ATOM   571  C CA    . GLU B 2 62  ? 36.009 32.935  41.016 1.00 62.33  ? 63  GLU P CA    1 
ATOM   572  C C     . GLU B 2 62  ? 36.267 32.982  42.519 1.00 68.64  ? 63  GLU P C     1 
ATOM   573  O O     . GLU B 2 62  ? 35.474 32.471  43.299 1.00 66.27  ? 63  GLU P O     1 
ATOM   574  C CB    . GLU B 2 62  ? 35.961 31.508  40.525 1.00 58.27  ? 63  GLU P CB    1 
ATOM   575  C CG    . GLU B 2 62  ? 35.423 31.380  39.130 1.00 47.56  ? 63  GLU P CG    1 
ATOM   576  C CD    . GLU B 2 62  ? 35.309 29.942  38.719 1.00 50.56  ? 63  GLU P CD    1 
ATOM   577  O OE1   . GLU B 2 62  ? 34.390 29.268  39.210 1.00 51.96  ? 63  GLU P OE1   1 
ATOM   578  O OE2   . GLU B 2 62  ? 36.147 29.471  37.931 1.00 50.80  ? 63  GLU P OE2   1 
ATOM   579  N N     . GLY B 2 63  ? 37.347 33.627  42.930 1.00 73.78  ? 64  GLY P N     1 
ATOM   580  C CA    . GLY B 2 63  ? 37.629 33.735  44.344 1.00 82.31  ? 64  GLY P CA    1 
ATOM   581  C C     . GLY B 2 63  ? 38.334 32.520  44.898 1.00 87.47  ? 64  GLY P C     1 
ATOM   582  O O     . GLY B 2 63  ? 38.523 31.530  44.184 1.00 85.84  ? 64  GLY P O     1 
ATOM   583  N N     . PRO B 2 64  ? 38.724 32.566  46.186 1.00 91.51  ? 65  PRO P N     1 
ATOM   584  C CA    . PRO B 2 64  ? 39.424 31.472  46.870 1.00 91.86  ? 65  PRO P CA    1 
ATOM   585  C C     . PRO B 2 64  ? 38.546 30.589  47.772 1.00 89.80  ? 65  PRO P C     1 
ATOM   586  O O     . PRO B 2 64  ? 38.941 29.479  48.129 1.00 87.46  ? 65  PRO P O     1 
ATOM   587  C CB    . PRO B 2 64  ? 40.490 32.211  47.704 1.00 95.81  ? 65  PRO P CB    1 
ATOM   588  C CG    . PRO B 2 64  ? 40.120 33.742  47.584 1.00 99.92  ? 65  PRO P CG    1 
ATOM   589  C CD    . PRO B 2 64  ? 38.719 33.770  47.031 1.00 91.50  ? 65  PRO P CD    1 
ATOM   590  N N     . SER B 2 65  ? 37.338 31.050  48.086 1.00 87.52  ? 66  SER P N     1 
ATOM   591  C CA    . SER B 2 65  ? 36.444 30.314  48.982 1.00 85.67  ? 66  SER P CA    1 
ATOM   592  C C     . SER B 2 65  ? 35.607 29.181  48.398 1.00 77.63  ? 66  SER P C     1 
ATOM   593  O O     . SER B 2 65  ? 34.512 28.919  48.888 1.00 79.20  ? 66  SER P O     1 
ATOM   594  C CB    . SER B 2 65  ? 35.515 31.296  49.712 1.00 99.71  ? 66  SER P CB    1 
ATOM   595  O OG    . SER B 2 65  ? 36.207 32.044  50.706 1.00 113.12 ? 66  SER P OG    1 
ATOM   596  N N     . HIS B 2 66  ? 36.122 28.450  47.421 1.00 69.27  ? 67  HIS P N     1 
ATOM   597  C CA    . HIS B 2 66  ? 35.307 27.397  46.838 1.00 58.22  ? 67  HIS P CA    1 
ATOM   598  C C     . HIS B 2 66  ? 35.441 25.981  47.353 1.00 55.86  ? 67  HIS P C     1 
ATOM   599  O O     . HIS B 2 66  ? 34.460 25.244  47.387 1.00 57.79  ? 67  HIS P O     1 
ATOM   600  C CB    . HIS B 2 66  ? 35.373 27.455  45.316 1.00 57.69  ? 67  HIS P CB    1 
ATOM   601  C CG    . HIS B 2 66  ? 34.644 28.633  44.748 1.00 36.32  ? 67  HIS P CG    1 
ATOM   602  N ND1   . HIS B 2 66  ? 33.267 28.695  44.692 1.00 37.22  ? 67  HIS P ND1   1 
ATOM   603  C CD2   . HIS B 2 66  ? 35.091 29.837  44.325 1.00 29.97  ? 67  HIS P CD2   1 
ATOM   604  C CE1   . HIS B 2 66  ? 32.895 29.889  44.268 1.00 23.32  ? 67  HIS P CE1   1 
ATOM   605  N NE2   . HIS B 2 66  ? 33.983 30.602  44.039 1.00 24.29  ? 67  HIS P NE2   1 
ATOM   606  N N     . GLY B 2 67  ? 36.635 25.587  47.765 1.00 52.59  ? 68  GLY P N     1 
ATOM   607  C CA    . GLY B 2 67  ? 36.782 24.241  48.279 1.00 50.25  ? 68  GLY P CA    1 
ATOM   608  C C     . GLY B 2 67  ? 38.149 23.654  48.036 1.00 52.47  ? 68  GLY P C     1 
ATOM   609  O O     . GLY B 2 67  ? 38.890 24.137  47.178 1.00 57.87  ? 68  GLY P O     1 
ATOM   610  N N     . GLY B 2 68  ? 38.476 22.603  48.783 1.00 50.42  ? 69  GLY P N     1 
ATOM   611  C CA    . GLY B 2 68  ? 39.768 21.964  48.653 1.00 47.60  ? 69  GLY P CA    1 
ATOM   612  C C     . GLY B 2 68  ? 39.705 20.625  47.961 1.00 54.68  ? 69  GLY P C     1 
ATOM   613  O O     . GLY B 2 68  ? 38.698 19.920  47.999 1.00 55.65  ? 69  GLY P O     1 
ATOM   614  N N     . LEU B 2 69  ? 40.792 20.291  47.293 1.00 58.47  ? 70  LEU P N     1 
ATOM   615  C CA    . LEU B 2 69  ? 40.920 19.045  46.581 1.00 59.59  ? 70  LEU P CA    1 
ATOM   616  C C     . LEU B 2 69  ? 40.921 17.897  47.604 1.00 63.11  ? 70  LEU P C     1 
ATOM   617  O O     . LEU B 2 69  ? 41.639 17.969  48.599 1.00 66.03  ? 70  LEU P O     1 
ATOM   618  C CB    . LEU B 2 69  ? 42.230 19.123  45.812 1.00 53.19  ? 70  LEU P CB    1 
ATOM   619  C CG    . LEU B 2 69  ? 42.946 17.906  45.260 1.00 59.47  ? 70  LEU P CG    1 
ATOM   620  C CD1   . LEU B 2 69  ? 42.050 17.065  44.356 1.00 60.10  ? 70  LEU P CD1   1 
ATOM   621  C CD2   . LEU B 2 69  ? 44.137 18.437  44.507 1.00 60.40  ? 70  LEU P CD2   1 
ATOM   622  N N     . PRO B 2 70  ? 40.045 16.884  47.428 1.00 62.79  ? 71  PRO P N     1 
ATOM   623  C CA    . PRO B 2 70  ? 39.938 15.723  48.327 1.00 65.37  ? 71  PRO P CA    1 
ATOM   624  C C     . PRO B 2 70  ? 40.858 14.529  47.992 1.00 70.95  ? 71  PRO P C     1 
ATOM   625  O O     . PRO B 2 70  ? 41.601 14.550  47.003 1.00 76.59  ? 71  PRO P O     1 
ATOM   626  C CB    . PRO B 2 70  ? 38.477 15.332  48.175 1.00 55.85  ? 71  PRO P CB    1 
ATOM   627  C CG    . PRO B 2 70  ? 38.251 15.564  46.724 1.00 64.05  ? 71  PRO P CG    1 
ATOM   628  C CD    . PRO B 2 70  ? 38.905 16.910  46.491 1.00 66.48  ? 71  PRO P CD    1 
ATOM   629  N N     . GLY B 2 71  ? 40.800 13.490  48.825 1.00 71.15  ? 72  GLY P N     1 
ATOM   630  C CA    . GLY B 2 71  ? 41.605 12.294  48.632 1.00 64.54  ? 72  GLY P CA    1 
ATOM   631  C C     . GLY B 2 71  ? 40.812 11.223  47.909 1.00 62.79  ? 72  GLY P C     1 
ATOM   632  O O     . GLY B 2 71  ? 39.643 11.421  47.607 1.00 60.22  ? 72  GLY P O     1 
ATOM   633  N N     . ALA B 2 72  ? 41.429 10.076  47.659 1.00 67.61  ? 73  ALA P N     1 
ATOM   634  C CA    . ALA B 2 72  ? 40.766 8.994   46.937 1.00 75.98  ? 73  ALA P CA    1 
ATOM   635  C C     . ALA B 2 72  ? 39.709 8.187   47.713 1.00 81.24  ? 73  ALA P C     1 
ATOM   636  O O     . ALA B 2 72  ? 38.846 7.561   47.089 1.00 84.61  ? 73  ALA P O     1 
ATOM   637  C CB    . ALA B 2 72  ? 41.815 8.046   46.330 1.00 81.09  ? 73  ALA P CB    1 
ATOM   638  N N     . SER B 2 73  ? 39.762 8.198   49.049 1.00 83.32  ? 74  SER P N     1 
ATOM   639  C CA    . SER B 2 73  ? 38.815 7.427   49.866 1.00 87.63  ? 74  SER P CA    1 
ATOM   640  C C     . SER B 2 73  ? 37.324 7.824   49.907 1.00 91.88  ? 74  SER P C     1 
ATOM   641  O O     . SER B 2 73  ? 36.967 8.981   50.178 1.00 93.14  ? 74  SER P O     1 
ATOM   642  C CB    . SER B 2 73  ? 39.346 7.226   51.292 1.00 87.50  ? 74  SER P CB    1 
ATOM   643  O OG    . SER B 2 73  ? 39.836 8.428   51.844 1.00 93.48  ? 74  SER P OG    1 
ATOM   644  N N     . SER B 2 74  ? 36.464 6.822   49.699 1.00 95.41  ? 75  SER P N     1 
ATOM   645  C CA    . SER B 2 74  ? 35.011 6.982   49.683 1.00 96.05  ? 75  SER P CA    1 
ATOM   646  C C     . SER B 2 74  ? 34.323 6.547   50.988 1.00 98.61  ? 75  SER P C     1 
ATOM   647  O O     . SER B 2 74  ? 33.084 6.463   51.055 1.00 98.52  ? 75  SER P O     1 
ATOM   648  C CB    . SER B 2 74  ? 34.401 6.222   48.493 1.00 93.06  ? 75  SER P CB    1 
ATOM   649  O OG    . SER B 2 74  ? 34.735 4.840   48.523 1.00 93.45  ? 75  SER P OG    1 
ATOM   650  N N     . GLU B 2 75  ? 35.141 6.198   51.983 1.00 102.18 ? 76  GLU P N     1 
ATOM   651  C CA    . GLU B 2 75  ? 34.674 5.802   53.316 1.00 106.59 ? 76  GLU P CA    1 
ATOM   652  C C     . GLU B 2 75  ? 33.693 6.861   53.872 1.00 110.17 ? 76  GLU P C     1 
ATOM   653  O O     . GLU B 2 75  ? 33.970 8.068   53.811 1.00 109.08 ? 76  GLU P O     1 
ATOM   654  C CB    . GLU B 2 75  ? 35.883 5.649   54.253 1.00 108.58 ? 76  GLU P CB    1 
ATOM   655  C CG    . GLU B 2 75  ? 36.905 6.746   54.040 1.00 119.87 ? 76  GLU P CG    1 
ATOM   656  C CD    . GLU B 2 75  ? 38.201 6.539   54.803 1.00 120.21 ? 76  GLU P CD    1 
ATOM   657  O OE1   . GLU B 2 75  ? 38.458 5.401   55.257 1.00 110.91 ? 76  GLU P OE1   1 
ATOM   658  O OE2   . GLU B 2 75  ? 38.957 7.530   54.953 1.00 119.78 ? 76  GLU P OE2   1 
ATOM   659  N N     . LYS B 2 76  ? 32.546 6.412   54.393 1.00 112.77 ? 77  LYS P N     1 
ATOM   660  C CA    . LYS B 2 76  ? 31.510 7.314   54.941 1.00 116.17 ? 77  LYS P CA    1 
ATOM   661  C C     . LYS B 2 76  ? 31.999 8.156   56.132 1.00 115.90 ? 77  LYS P C     1 
ATOM   662  O O     . LYS B 2 76  ? 32.811 7.687   56.943 1.00 116.28 ? 77  LYS P O     1 
ATOM   663  C CB    . LYS B 2 76  ? 30.262 6.517   55.369 1.00 122.06 ? 77  LYS P CB    1 
ATOM   664  C CG    . LYS B 2 76  ? 29.448 5.845   54.250 1.00 123.37 ? 77  LYS P CG    1 
ATOM   665  C CD    . LYS B 2 76  ? 28.190 5.178   54.834 1.00 132.03 ? 77  LYS P CD    1 
ATOM   666  C CE    . LYS B 2 76  ? 27.393 4.388   53.788 1.00 138.32 ? 77  LYS P CE    1 
ATOM   667  N NZ    . LYS B 2 76  ? 26.141 3.745   54.338 1.00 139.12 ? 77  LYS P NZ    1 
ATOM   668  N N     . ASN B 2 77  ? 31.465 9.377   56.248 1.00 114.61 ? 78  ASN P N     1 
ATOM   669  C CA    . ASN B 2 77  ? 31.809 10.314  57.331 1.00 114.94 ? 78  ASN P CA    1 
ATOM   670  C C     . ASN B 2 77  ? 33.303 10.632  57.462 1.00 115.59 ? 78  ASN P C     1 
ATOM   671  O O     . ASN B 2 77  ? 33.826 10.749  58.576 1.00 116.05 ? 78  ASN P O     1 
ATOM   672  C CB    . ASN B 2 77  ? 31.293 9.790   58.671 1.00 118.98 ? 78  ASN P CB    1 
ATOM   673  C CG    . ASN B 2 77  ? 29.787 9.696   58.716 1.00 122.14 ? 78  ASN P CG    1 
ATOM   674  O OD1   . ASN B 2 77  ? 29.076 10.681  58.482 1.00 125.77 ? 78  ASN P OD1   1 
ATOM   675  N ND2   . ASN B 2 77  ? 29.285 8.496   58.988 1.00 118.18 ? 78  ASN P ND2   1 
ATOM   676  N N     . LYS B 2 78  ? 33.979 10.797  56.328 1.00 115.95 ? 79  LYS P N     1 
ATOM   677  C CA    . LYS B 2 78  ? 35.410 11.110  56.300 1.00 113.92 ? 79  LYS P CA    1 
ATOM   678  C C     . LYS B 2 78  ? 35.632 12.080  55.140 1.00 111.67 ? 79  LYS P C     1 
ATOM   679  O O     . LYS B 2 78  ? 35.298 11.771  53.989 1.00 110.07 ? 79  LYS P O     1 
ATOM   680  C CB    . LYS B 2 78  ? 36.250 9.840   56.083 1.00 111.50 ? 79  LYS P CB    1 
ATOM   681  C CG    . LYS B 2 78  ? 36.022 8.734   57.097 1.00 104.18 ? 79  LYS P CG    1 
ATOM   682  C CD    . LYS B 2 78  ? 36.409 9.178   58.488 1.00 107.00 ? 79  LYS P CD    1 
ATOM   683  C CE    . LYS B 2 78  ? 35.953 8.162   59.518 1.00 114.01 ? 79  LYS P CE    1 
ATOM   684  N NZ    . LYS B 2 78  ? 36.319 8.593   60.901 1.00 114.10 ? 79  LYS P NZ    1 
ATOM   685  N N     . LYS B 2 79  ? 36.175 13.257  55.445 1.00 110.14 ? 80  LYS P N     1 
ATOM   686  C CA    . LYS B 2 79  ? 36.432 14.257  54.414 1.00 110.94 ? 80  LYS P CA    1 
ATOM   687  C C     . LYS B 2 79  ? 37.677 13.921  53.563 1.00 110.47 ? 80  LYS P C     1 
ATOM   688  O O     . LYS B 2 79  ? 37.947 14.585  52.554 1.00 111.31 ? 80  LYS P O     1 
ATOM   689  C CB    . LYS B 2 79  ? 36.555 15.652  55.041 1.00 113.55 ? 80  LYS P CB    1 
ATOM   690  C CG    . LYS B 2 79  ? 36.072 16.778  54.134 1.00 121.42 ? 80  LYS P CG    1 
ATOM   691  C CD    . LYS B 2 79  ? 34.560 16.779  53.999 1.00 120.93 ? 80  LYS P CD    1 
ATOM   692  C CE    . LYS B 2 79  ? 34.085 17.839  52.998 1.00 123.99 ? 80  LYS P CE    1 
ATOM   693  N NZ    . LYS B 2 79  ? 32.595 18.045  53.050 1.00 125.60 ? 80  LYS P NZ    1 
ATOM   694  N N     . SER B 2 80  ? 38.431 12.909  54.003 1.00 106.69 ? 81  SER P N     1 
ATOM   695  C CA    . SER B 2 80  ? 39.649 12.407  53.344 1.00 102.17 ? 81  SER P CA    1 
ATOM   696  C C     . SER B 2 80  ? 40.461 13.340  52.431 1.00 100.46 ? 81  SER P C     1 
ATOM   697  O O     . SER B 2 80  ? 40.055 13.653  51.311 1.00 99.46  ? 81  SER P O     1 
ATOM   698  C CB    . SER B 2 80  ? 39.344 11.103  52.594 1.00 102.09 ? 81  SER P CB    1 
ATOM   699  O OG    . SER B 2 80  ? 38.275 11.259  51.677 1.00 101.46 ? 81  SER P OG    1 
ATOM   700  N N     . TYR B 2 81  ? 41.647 13.717  52.899 1.00 98.30  ? 82  TYR P N     1 
ATOM   701  C CA    . TYR B 2 81  ? 42.565 14.582  52.157 1.00 92.86  ? 82  TYR P CA    1 
ATOM   702  C C     . TYR B 2 81  ? 43.717 13.743  51.619 1.00 90.89  ? 82  TYR P C     1 
ATOM   703  O O     . TYR B 2 81  ? 44.124 12.774  52.261 1.00 94.46  ? 82  TYR P O     1 
ATOM   704  C CB    . TYR B 2 81  ? 43.143 15.624  53.101 1.00 87.02  ? 82  TYR P CB    1 
ATOM   705  C CG    . TYR B 2 81  ? 42.088 16.448  53.772 1.00 92.39  ? 82  TYR P CG    1 
ATOM   706  C CD1   . TYR B 2 81  ? 41.483 17.508  53.096 1.00 95.65  ? 82  TYR P CD1   1 
ATOM   707  C CD2   . TYR B 2 81  ? 41.686 16.173  55.084 1.00 96.90  ? 82  TYR P CD2   1 
ATOM   708  C CE1   . TYR B 2 81  ? 40.502 18.288  53.703 1.00 94.30  ? 82  TYR P CE1   1 
ATOM   709  C CE2   . TYR B 2 81  ? 40.699 16.946  55.711 1.00 96.99  ? 82  TYR P CE2   1 
ATOM   710  C CZ    . TYR B 2 81  ? 40.111 18.009  55.012 1.00 94.60  ? 82  TYR P CZ    1 
ATOM   711  O OH    . TYR B 2 81  ? 39.159 18.811  55.616 1.00 87.24  ? 82  TYR P OH    1 
ATOM   712  N N     . PRO B 2 82  ? 44.246 14.076  50.427 1.00 87.21  ? 83  PRO P N     1 
ATOM   713  C CA    . PRO B 2 82  ? 45.366 13.276  49.904 1.00 85.35  ? 83  PRO P CA    1 
ATOM   714  C C     . PRO B 2 82  ? 46.530 13.244  50.913 1.00 80.95  ? 83  PRO P C     1 
ATOM   715  O O     . PRO B 2 82  ? 46.797 14.247  51.586 1.00 76.47  ? 83  PRO P O     1 
ATOM   716  C CB    . PRO B 2 82  ? 45.727 13.997  48.600 1.00 85.81  ? 83  PRO P CB    1 
ATOM   717  C CG    . PRO B 2 82  ? 45.179 15.383  48.780 1.00 75.56  ? 83  PRO P CG    1 
ATOM   718  C CD    . PRO B 2 82  ? 43.883 15.152  49.492 1.00 79.99  ? 83  PRO P CD    1 
ATOM   719  N N     . GLN B 2 83  ? 47.191 12.091  51.044 1.00 78.79  ? 84  GLN P N     1 
ATOM   720  C CA    . GLN B 2 83  ? 48.284 11.923  52.005 1.00 78.30  ? 84  GLN P CA    1 
ATOM   721  C C     . GLN B 2 83  ? 49.629 11.367  51.518 1.00 77.93  ? 84  GLN P C     1 
ATOM   722  O O     . GLN B 2 83  ? 49.691 10.450  50.705 1.00 74.69  ? 84  GLN P O     1 
ATOM   723  C CB    . GLN B 2 83  ? 47.803 11.072  53.173 1.00 79.37  ? 84  GLN P CB    1 
ATOM   724  C CG    . GLN B 2 83  ? 46.673 11.686  53.941 1.00 78.62  ? 84  GLN P CG    1 
ATOM   725  C CD    . GLN B 2 83  ? 46.261 10.850  55.115 1.00 80.54  ? 84  GLN P CD    1 
ATOM   726  O OE1   . GLN B 2 83  ? 46.972 9.937   55.518 1.00 86.21  ? 84  GLN P OE1   1 
ATOM   727  N NE2   . GLN B 2 83  ? 45.114 11.164  55.684 1.00 89.61  ? 84  GLN P NE2   1 
ATOM   728  N N     . VAL B 2 84  ? 50.695 11.869  52.126 1.00 79.71  ? 85  VAL P N     1 
ATOM   729  C CA    . VAL B 2 84  ? 52.065 11.481  51.823 1.00 84.83  ? 85  VAL P CA    1 
ATOM   730  C C     . VAL B 2 84  ? 52.715 10.981  53.127 1.00 84.64  ? 85  VAL P C     1 
ATOM   731  O O     . VAL B 2 84  ? 52.218 11.262  54.217 1.00 86.64  ? 85  VAL P O     1 
ATOM   732  C CB    . VAL B 2 84  ? 52.837 12.707  51.274 1.00 91.23  ? 85  VAL P CB    1 
ATOM   733  C CG1   . VAL B 2 84  ? 54.310 12.424  51.157 1.00 95.00  ? 85  VAL P CG1   1 
ATOM   734  C CG2   . VAL B 2 84  ? 52.283 13.100  49.929 1.00 93.09  ? 85  VAL P CG2   1 
ATOM   735  N N     . LYS B 2 85  ? 53.817 10.243  53.018 1.00 86.35  ? 86  LYS P N     1 
ATOM   736  C CA    . LYS B 2 85  ? 54.516 9.709   54.186 1.00 87.39  ? 86  LYS P CA    1 
ATOM   737  C C     . LYS B 2 85  ? 56.013 9.636   53.920 1.00 85.27  ? 86  LYS P C     1 
ATOM   738  O O     . LYS B 2 85  ? 56.444 9.125   52.885 1.00 83.37  ? 86  LYS P O     1 
ATOM   739  C CB    . LYS B 2 85  ? 54.001 8.298   54.520 1.00 97.65  ? 86  LYS P CB    1 
ATOM   740  C CG    . LYS B 2 85  ? 54.649 7.615   55.747 1.00 98.49  ? 86  LYS P CG    1 
ATOM   741  C CD    . LYS B 2 85  ? 54.324 6.114   55.777 1.00 98.53  ? 86  LYS P CD    1 
ATOM   742  C CE    . LYS B 2 85  ? 54.905 5.394   56.998 1.00 98.51  ? 86  LYS P CE    1 
ATOM   743  N NZ    . LYS B 2 85  ? 53.990 5.420   58.176 1.00 96.92  ? 86  LYS P NZ    1 
ATOM   744  N N     . ILE B 2 86  ? 56.801 10.172  54.842 1.00 85.31  ? 87  ILE P N     1 
ATOM   745  C CA    . ILE B 2 86  ? 58.250 10.119  54.711 1.00 85.38  ? 87  ILE P CA    1 
ATOM   746  C C     . ILE B 2 86  ? 58.677 8.830   55.395 1.00 84.71  ? 87  ILE P C     1 
ATOM   747  O O     . ILE B 2 86  ? 58.765 8.766   56.625 1.00 86.55  ? 87  ILE P O     1 
ATOM   748  C CB    . ILE B 2 86  ? 58.938 11.307  55.407 1.00 82.58  ? 87  ILE P CB    1 
ATOM   749  C CG1   . ILE B 2 86  ? 58.518 12.612  54.739 1.00 68.23  ? 87  ILE P CG1   1 
ATOM   750  C CG2   . ILE B 2 86  ? 60.461 11.153  55.360 1.00 86.31  ? 87  ILE P CG2   1 
ATOM   751  C CD1   . ILE B 2 86  ? 59.096 13.821  55.405 1.00 53.35  ? 87  ILE P CD1   1 
ATOM   752  N N     . CYS B 2 87  ? 58.850 7.782   54.601 1.00 85.56  ? 88  CYS P N     1 
ATOM   753  C CA    . CYS B 2 87  ? 59.258 6.489   55.125 1.00 86.76  ? 88  CYS P CA    1 
ATOM   754  C C     . CYS B 2 87  ? 60.768 6.463   55.383 1.00 86.68  ? 88  CYS P C     1 
ATOM   755  O O     . CYS B 2 87  ? 61.559 6.951   54.566 1.00 84.31  ? 88  CYS P O     1 
ATOM   756  C CB    . CYS B 2 87  ? 58.843 5.365   54.168 1.00 88.52  ? 88  CYS P CB    1 
ATOM   757  S SG    . CYS B 2 87  ? 57.048 5.223   53.882 1.00 91.44  ? 88  CYS P SG    1 
ATOM   758  N N     . ASN B 2 88  ? 61.140 5.876   56.524 1.00 88.47  ? 89  ASN P N     1 
ATOM   759  C CA    . ASN B 2 88  ? 62.519 5.742   57.003 1.00 84.72  ? 89  ASN P CA    1 
ATOM   760  C C     . ASN B 2 88  ? 63.030 6.993   57.717 1.00 82.45  ? 89  ASN P C     1 
ATOM   761  O O     . ASN B 2 88  ? 64.072 7.557   57.382 1.00 75.99  ? 89  ASN P O     1 
ATOM   762  C CB    . ASN B 2 88  ? 63.471 5.248   55.905 1.00 88.31  ? 89  ASN P CB    1 
ATOM   763  C CG    . ASN B 2 88  ? 63.091 3.863   55.386 1.00 91.22  ? 89  ASN P CG    1 
ATOM   764  O OD1   . ASN B 2 88  ? 62.698 2.981   56.157 1.00 82.25  ? 89  ASN P OD1   1 
ATOM   765  N ND2   . ASN B 2 88  ? 63.163 3.683   54.072 1.00 99.54  ? 89  ASN P ND2   1 
ATOM   766  N N     . TYR B 2 89  ? 62.177 7.454   58.627 1.00 86.24  ? 90  TYR P N     1 
ATOM   767  C CA    . TYR B 2 89  ? 62.368 8.573   59.554 1.00 96.78  ? 90  TYR P CA    1 
ATOM   768  C C     . TYR B 2 89  ? 63.656 9.431   59.489 1.00 102.43 ? 90  TYR P C     1 
ATOM   769  O O     . TYR B 2 89  ? 64.737 8.972   59.882 1.00 108.29 ? 90  TYR P O     1 
ATOM   770  C CB    . TYR B 2 89  ? 62.319 7.944   60.943 1.00 101.41 ? 90  TYR P CB    1 
ATOM   771  C CG    . TYR B 2 89  ? 61.587 8.667   62.029 1.00 99.30  ? 90  TYR P CG    1 
ATOM   772  C CD1   . TYR B 2 89  ? 61.916 9.981   62.382 1.00 91.45  ? 90  TYR P CD1   1 
ATOM   773  C CD2   . TYR B 2 89  ? 60.639 7.977   62.796 1.00 98.82  ? 90  TYR P CD2   1 
ATOM   774  C CE1   . TYR B 2 89  ? 61.324 10.588  63.490 1.00 102.49 ? 90  TYR P CE1   1 
ATOM   775  C CE2   . TYR B 2 89  ? 60.040 8.556   63.898 1.00 107.25 ? 90  TYR P CE2   1 
ATOM   776  C CZ    . TYR B 2 89  ? 60.383 9.862   64.254 1.00 113.76 ? 90  TYR P CZ    1 
ATOM   777  O OH    . TYR B 2 89  ? 59.818 10.406  65.398 1.00 121.22 ? 90  TYR P OH    1 
ATOM   778  N N     . VAL B 2 90  ? 63.552 10.684  59.060 1.00 101.46 ? 91  VAL P N     1 
ATOM   779  C CA    . VAL B 2 90  ? 64.726 11.563  59.050 1.00 100.88 ? 91  VAL P CA    1 
ATOM   780  C C     . VAL B 2 90  ? 64.320 12.874  59.743 1.00 103.18 ? 91  VAL P C     1 
ATOM   781  O O     . VAL B 2 90  ? 63.163 13.006  60.165 1.00 105.21 ? 91  VAL P O     1 
ATOM   782  C CB    . VAL B 2 90  ? 65.304 11.786  57.620 1.00 101.94 ? 91  VAL P CB    1 
ATOM   783  C CG1   . VAL B 2 90  ? 66.600 12.603  57.675 1.00 102.31 ? 91  VAL P CG1   1 
ATOM   784  C CG2   . VAL B 2 90  ? 65.608 10.447  56.972 1.00 103.17 ? 91  VAL P CG2   1 
ATOM   785  N N     . GLY B 2 91  ? 65.271 13.798  59.930 1.00 104.89 ? 92  GLY P N     1 
ATOM   786  C CA    . GLY B 2 91  ? 64.992 15.066  60.595 1.00 104.54 ? 92  GLY P CA    1 
ATOM   787  C C     . GLY B 2 91  ? 63.760 15.779  60.064 1.00 106.41 ? 92  GLY P C     1 
ATOM   788  O O     . GLY B 2 91  ? 63.539 15.752  58.845 1.00 105.94 ? 92  GLY P O     1 
ATOM   789  N N     . PRO B 2 92  ? 62.971 16.458  60.938 1.00 106.22 ? 93  PRO P N     1 
ATOM   790  C CA    . PRO B 2 92  ? 61.737 17.209  60.631 1.00 106.08 ? 93  PRO P CA    1 
ATOM   791  C C     . PRO B 2 92  ? 61.747 17.801  59.212 1.00 104.29 ? 93  PRO P C     1 
ATOM   792  O O     . PRO B 2 92  ? 61.929 19.013  59.014 1.00 105.39 ? 93  PRO P O     1 
ATOM   793  C CB    . PRO B 2 92  ? 61.751 18.307  61.694 1.00 109.14 ? 93  PRO P CB    1 
ATOM   794  C CG    . PRO B 2 92  ? 62.265 17.573  62.879 1.00 104.85 ? 93  PRO P CG    1 
ATOM   795  C CD    . PRO B 2 92  ? 63.424 16.763  62.309 1.00 102.28 ? 93  PRO P CD    1 
ATOM   796  N N     . ALA B 2 93  ? 61.481 16.928  58.243 1.00 99.03  ? 94  ALA P N     1 
ATOM   797  C CA    . ALA B 2 93  ? 61.503 17.269  56.828 1.00 95.91  ? 94  ALA P CA    1 
ATOM   798  C C     . ALA B 2 93  ? 60.553 18.353  56.327 1.00 93.28  ? 94  ALA P C     1 
ATOM   799  O O     . ALA B 2 93  ? 59.527 18.665  56.952 1.00 92.32  ? 94  ALA P O     1 
ATOM   800  C CB    . ALA B 2 93  ? 61.345 16.007  55.996 1.00 93.24  ? 94  ALA P CB    1 
ATOM   801  N N     . LYS B 2 94  ? 60.918 18.897  55.169 1.00 89.96  ? 95  LYS P N     1 
ATOM   802  C CA    . LYS B 2 94  ? 60.172 19.936  54.482 1.00 82.65  ? 95  LYS P CA    1 
ATOM   803  C C     . LYS B 2 94  ? 59.575 19.330  53.207 1.00 82.19  ? 95  LYS P C     1 
ATOM   804  O O     . LYS B 2 94  ? 60.313 19.047  52.264 1.00 79.77  ? 95  LYS P O     1 
ATOM   805  C CB    . LYS B 2 94  ? 61.136 21.061  54.110 1.00 80.00  ? 95  LYS P CB    1 
ATOM   806  C CG    . LYS B 2 94  ? 60.560 22.138  53.241 1.00 79.84  ? 95  LYS P CG    1 
ATOM   807  C CD    . LYS B 2 94  ? 61.667 23.039  52.752 1.00 84.60  ? 95  LYS P CD    1 
ATOM   808  C CE    . LYS B 2 94  ? 61.092 24.231  52.040 1.00 87.86  ? 95  LYS P CE    1 
ATOM   809  N NZ    . LYS B 2 94  ? 62.136 25.216  51.665 1.00 88.84  ? 95  LYS P NZ    1 
ATOM   810  N N     . VAL B 2 95  ? 58.267 19.055  53.208 1.00 80.02  ? 96  VAL P N     1 
ATOM   811  C CA    . VAL B 2 95  ? 57.586 18.505  52.023 1.00 73.99  ? 96  VAL P CA    1 
ATOM   812  C C     . VAL B 2 95  ? 56.933 19.620  51.213 1.00 70.64  ? 96  VAL P C     1 
ATOM   813  O O     . VAL B 2 95  ? 56.204 20.456  51.764 1.00 68.90  ? 96  VAL P O     1 
ATOM   814  C CB    . VAL B 2 95  ? 56.463 17.481  52.364 1.00 72.97  ? 96  VAL P CB    1 
ATOM   815  C CG1   . VAL B 2 95  ? 56.998 16.060  52.318 1.00 58.35  ? 96  VAL P CG1   1 
ATOM   816  C CG2   . VAL B 2 95  ? 55.839 17.792  53.718 1.00 77.31  ? 96  VAL P CG2   1 
ATOM   817  N N     . ILE B 2 96  ? 57.220 19.654  49.915 1.00 66.76  ? 97  ILE P N     1 
ATOM   818  C CA    . ILE B 2 96  ? 56.627 20.660  49.041 1.00 64.37  ? 97  ILE P CA    1 
ATOM   819  C C     . ILE B 2 96  ? 55.771 19.985  47.970 1.00 63.88  ? 97  ILE P C     1 
ATOM   820  O O     . ILE B 2 96  ? 55.958 18.796  47.652 1.00 63.33  ? 97  ILE P O     1 
ATOM   821  C CB    . ILE B 2 96  ? 57.687 21.577  48.344 1.00 60.88  ? 97  ILE P CB    1 
ATOM   822  C CG1   . ILE B 2 96  ? 58.586 20.754  47.424 1.00 64.21  ? 97  ILE P CG1   1 
ATOM   823  C CG2   . ILE B 2 96  ? 58.501 22.345  49.373 1.00 53.06  ? 97  ILE P CG2   1 
ATOM   824  C CD1   . ILE B 2 96  ? 59.279 21.569  46.394 1.00 45.21  ? 97  ILE P CD1   1 
ATOM   825  N N     . VAL B 2 97  ? 54.801 20.740  47.456 1.00 63.57  ? 98  VAL P N     1 
ATOM   826  C CA    . VAL B 2 97  ? 53.909 20.262  46.405 1.00 57.99  ? 98  VAL P CA    1 
ATOM   827  C C     . VAL B 2 97  ? 53.987 21.257  45.247 1.00 55.42  ? 98  VAL P C     1 
ATOM   828  O O     . VAL B 2 97  ? 53.932 22.480  45.454 1.00 52.74  ? 98  VAL P O     1 
ATOM   829  C CB    . VAL B 2 97  ? 52.429 20.188  46.875 1.00 51.66  ? 98  VAL P CB    1 
ATOM   830  C CG1   . VAL B 2 97  ? 51.640 19.304  45.941 1.00 41.19  ? 98  VAL P CG1   1 
ATOM   831  C CG2   . VAL B 2 97  ? 52.324 19.686  48.299 1.00 47.97  ? 98  VAL P CG2   1 
ATOM   832  N N     . GLN B 2 98  ? 54.177 20.733  44.041 1.00 52.49  ? 99  GLN P N     1 
ATOM   833  C CA    . GLN B 2 98  ? 54.238 21.556  42.837 1.00 53.43  ? 99  GLN P CA    1 
ATOM   834  C C     . GLN B 2 98  ? 53.285 20.967  41.811 1.00 51.75  ? 99  GLN P C     1 
ATOM   835  O O     . GLN B 2 98  ? 53.073 19.757  41.781 1.00 52.69  ? 99  GLN P O     1 
ATOM   836  C CB    . GLN B 2 98  ? 55.640 21.554  42.237 1.00 50.24  ? 99  GLN P CB    1 
ATOM   837  C CG    . GLN B 2 98  ? 56.664 22.311  43.022 1.00 57.10  ? 99  GLN P CG    1 
ATOM   838  C CD    . GLN B 2 98  ? 58.043 22.160  42.427 1.00 58.04  ? 99  GLN P CD    1 
ATOM   839  O OE1   . GLN B 2 98  ? 58.474 22.985  41.626 1.00 50.93  ? 99  GLN P OE1   1 
ATOM   840  N NE2   . GLN B 2 98  ? 58.737 21.091  42.799 1.00 53.38  ? 99  GLN P NE2   1 
ATOM   841  N N     . LEU B 2 99  ? 52.681 21.821  40.996 1.00 50.61  ? 100 LEU P N     1 
ATOM   842  C CA    . LEU B 2 99  ? 51.778 21.344  39.959 1.00 48.21  ? 100 LEU P CA    1 
ATOM   843  C C     . LEU B 2 99  ? 52.612 21.041  38.703 1.00 49.97  ? 100 LEU P C     1 
ATOM   844  O O     . LEU B 2 99  ? 53.308 21.916  38.176 1.00 43.93  ? 100 LEU P O     1 
ATOM   845  C CB    . LEU B 2 99  ? 50.682 22.382  39.670 1.00 37.39  ? 100 LEU P CB    1 
ATOM   846  C CG    . LEU B 2 99  ? 49.488 22.463  40.636 1.00 38.66  ? 100 LEU P CG    1 
ATOM   847  C CD1   . LEU B 2 99  ? 48.540 23.565  40.241 1.00 34.19  ? 100 LEU P CD1   1 
ATOM   848  C CD2   . LEU B 2 99  ? 48.745 21.140  40.653 1.00 50.40  ? 100 LEU P CD2   1 
ATOM   849  N N     . VAL B 2 100 ? 52.600 19.782  38.274 1.00 52.52  ? 101 VAL P N     1 
ATOM   850  C CA    . VAL B 2 100 ? 53.346 19.362  37.091 1.00 53.66  ? 101 VAL P CA    1 
ATOM   851  C C     . VAL B 2 100 ? 52.367 18.869  36.050 1.00 53.16  ? 101 VAL P C     1 
ATOM   852  O O     . VAL B 2 100 ? 51.199 18.627  36.350 1.00 49.55  ? 101 VAL P O     1 
ATOM   853  C CB    . VAL B 2 100 ? 54.338 18.214  37.387 1.00 56.36  ? 101 VAL P CB    1 
ATOM   854  C CG1   . VAL B 2 100 ? 55.295 18.620  38.494 1.00 54.07  ? 101 VAL P CG1   1 
ATOM   855  C CG2   . VAL B 2 100 ? 53.587 16.930  37.736 1.00 46.92  ? 101 VAL P CG2   1 
ATOM   856  N N     . THR B 2 101 ? 52.854 18.720  34.827 1.00 53.94  ? 102 THR P N     1 
ATOM   857  C CA    . THR B 2 101 ? 52.031 18.263  33.731 1.00 51.48  ? 102 THR P CA    1 
ATOM   858  C C     . THR B 2 101 ? 51.822 16.765  33.777 1.00 50.83  ? 102 THR P C     1 
ATOM   859  O O     . THR B 2 101 ? 52.502 16.034  34.501 1.00 50.80  ? 102 THR P O     1 
ATOM   860  C CB    . THR B 2 101 ? 52.633 18.630  32.368 1.00 50.94  ? 102 THR P CB    1 
ATOM   861  O OG1   . THR B 2 101 ? 53.948 18.073  32.252 1.00 53.83  ? 102 THR P OG1   1 
ATOM   862  C CG2   . THR B 2 101 ? 52.713 20.124  32.219 1.00 61.55  ? 102 THR P CG2   1 
ATOM   863  N N     . ASN B 2 102 ? 50.899 16.330  32.934 1.00 52.58  ? 103 ASN P N     1 
ATOM   864  C CA    . ASN B 2 102 ? 50.513 14.939  32.797 1.00 53.04  ? 103 ASN P CA    1 
ATOM   865  C C     . ASN B 2 102 ? 50.939 14.488  31.392 1.00 62.31  ? 103 ASN P C     1 
ATOM   866  O O     . ASN B 2 102 ? 50.266 13.675  30.764 1.00 62.81  ? 103 ASN P O     1 
ATOM   867  C CB    . ASN B 2 102 ? 48.987 14.861  32.950 1.00 50.24  ? 103 ASN P CB    1 
ATOM   868  C CG    . ASN B 2 102 ? 48.473 13.453  33.114 1.00 56.67  ? 103 ASN P CG    1 
ATOM   869  O OD1   . ASN B 2 102 ? 48.900 12.722  34.012 1.00 64.32  ? 103 ASN P OD1   1 
ATOM   870  N ND2   . ASN B 2 102 ? 47.507 13.078  32.279 1.00 51.22  ? 103 ASN P ND2   1 
ATOM   871  N N     . GLY B 2 103 ? 52.000 15.092  30.860 1.00 68.15  ? 104 GLY P N     1 
ATOM   872  C CA    . GLY B 2 103 ? 52.480 14.722  29.535 1.00 72.85  ? 104 GLY P CA    1 
ATOM   873  C C     . GLY B 2 103 ? 53.407 13.525  29.603 1.00 76.41  ? 104 GLY P C     1 
ATOM   874  O O     . GLY B 2 103 ? 53.713 13.054  30.697 1.00 76.70  ? 104 GLY P O     1 
ATOM   875  N N     . LYS B 2 104 ? 53.865 13.032  28.453 1.00 82.29  ? 105 LYS P N     1 
ATOM   876  C CA    . LYS B 2 104 ? 54.772 11.884  28.446 1.00 85.43  ? 105 LYS P CA    1 
ATOM   877  C C     . LYS B 2 104 ? 55.967 12.207  29.344 1.00 85.44  ? 105 LYS P C     1 
ATOM   878  O O     . LYS B 2 104 ? 56.291 11.469  30.276 1.00 86.16  ? 105 LYS P O     1 
ATOM   879  C CB    . LYS B 2 104 ? 55.263 11.573  27.026 1.00 89.83  ? 105 LYS P CB    1 
ATOM   880  C CG    . LYS B 2 104 ? 56.224 10.372  26.970 1.00 100.50 ? 105 LYS P CG    1 
ATOM   881  C CD    . LYS B 2 104 ? 56.838 10.167  25.582 1.00 110.54 ? 105 LYS P CD    1 
ATOM   882  C CE    . LYS B 2 104 ? 57.860 9.015   25.573 1.00 112.75 ? 105 LYS P CE    1 
ATOM   883  N NZ    . LYS B 2 104 ? 57.240 7.690   25.913 1.00 116.29 ? 105 LYS P NZ    1 
ATOM   884  N N     . ASN B 2 105 ? 56.604 13.332  29.046 1.00 85.37  ? 106 ASN P N     1 
ATOM   885  C CA    . ASN B 2 105 ? 57.748 13.814  29.802 1.00 83.51  ? 106 ASN P CA    1 
ATOM   886  C C     . ASN B 2 105 ? 57.188 14.840  30.795 1.00 83.46  ? 106 ASN P C     1 
ATOM   887  O O     . ASN B 2 105 ? 56.316 15.636  30.428 1.00 83.38  ? 106 ASN P O     1 
ATOM   888  C CB    . ASN B 2 105 ? 58.744 14.490  28.847 1.00 87.43  ? 106 ASN P CB    1 
ATOM   889  C CG    . ASN B 2 105 ? 59.186 13.575  27.714 1.00 91.96  ? 106 ASN P CG    1 
ATOM   890  O OD1   . ASN B 2 105 ? 59.960 12.642  27.934 1.00 90.41  ? 106 ASN P OD1   1 
ATOM   891  N ND2   . ASN B 2 105 ? 58.693 13.828  26.501 1.00 88.21  ? 106 ASN P ND2   1 
ATOM   892  N N     . ILE B 2 106 ? 57.664 14.817  32.040 1.00 84.17  ? 107 ILE P N     1 
ATOM   893  C CA    . ILE B 2 106 ? 57.200 15.763  33.067 1.00 82.26  ? 107 ILE P CA    1 
ATOM   894  C C     . ILE B 2 106 ? 57.741 17.155  32.794 1.00 82.03  ? 107 ILE P C     1 
ATOM   895  O O     . ILE B 2 106 ? 58.888 17.311  32.370 1.00 87.22  ? 107 ILE P O     1 
ATOM   896  C CB    . ILE B 2 106 ? 57.720 15.418  34.461 1.00 85.77  ? 107 ILE P CB    1 
ATOM   897  C CG1   . ILE B 2 106 ? 57.333 14.004  34.855 1.00 88.10  ? 107 ILE P CG1   1 
ATOM   898  C CG2   . ILE B 2 106 ? 57.176 16.404  35.478 1.00 81.63  ? 107 ILE P CG2   1 
ATOM   899  C CD1   . ILE B 2 106 ? 58.073 13.538  36.099 1.00 85.28  ? 107 ILE P CD1   1 
ATOM   900  N N     . HIS B 2 107 ? 56.936 18.161  33.101 1.00 79.46  ? 108 HIS P N     1 
ATOM   901  C CA    . HIS B 2 107 ? 57.305 19.556  32.911 1.00 80.54  ? 108 HIS P CA    1 
ATOM   902  C C     . HIS B 2 107 ? 56.438 20.334  33.926 1.00 81.44  ? 108 HIS P C     1 
ATOM   903  O O     . HIS B 2 107 ? 55.378 19.843  34.320 1.00 86.58  ? 108 HIS P O     1 
ATOM   904  C CB    . HIS B 2 107 ? 56.995 19.997  31.448 1.00 79.76  ? 108 HIS P CB    1 
ATOM   905  C CG    . HIS B 2 107 ? 57.813 19.294  30.392 1.00 88.95  ? 108 HIS P CG    1 
ATOM   906  N ND1   . HIS B 2 107 ? 57.290 18.329  29.559 1.00 92.02  ? 108 HIS P ND1   1 
ATOM   907  C CD2   . HIS B 2 107 ? 59.119 19.422  30.035 1.00 91.14  ? 108 HIS P CD2   1 
ATOM   908  C CE1   . HIS B 2 107 ? 58.228 17.896  28.734 1.00 96.55  ? 108 HIS P CE1   1 
ATOM   909  N NE2   . HIS B 2 107 ? 59.350 18.543  29.004 1.00 95.71  ? 108 HIS P NE2   1 
ATOM   910  N N     . LEU B 2 108 ? 56.923 21.467  34.439 1.00 75.65  ? 109 LEU P N     1 
ATOM   911  C CA    . LEU B 2 108 ? 56.143 22.286  35.387 1.00 66.52  ? 109 LEU P CA    1 
ATOM   912  C C     . LEU B 2 108 ? 54.817 22.747  34.751 1.00 63.33  ? 109 LEU P C     1 
ATOM   913  O O     . LEU B 2 108 ? 54.772 23.070  33.562 1.00 61.60  ? 109 LEU P O     1 
ATOM   914  C CB    . LEU B 2 108 ? 56.923 23.545  35.770 1.00 60.17  ? 109 LEU P CB    1 
ATOM   915  C CG    . LEU B 2 108 ? 57.612 23.730  37.119 1.00 57.34  ? 109 LEU P CG    1 
ATOM   916  C CD1   . LEU B 2 108 ? 58.025 25.185  37.251 1.00 55.16  ? 109 LEU P CD1   1 
ATOM   917  C CD2   . LEU B 2 108 ? 56.690 23.360  38.241 1.00 63.87  ? 109 LEU P CD2   1 
ATOM   918  N N     . HIS B 2 109 ? 53.752 22.831  35.542 1.00 59.56  ? 110 HIS P N     1 
ATOM   919  C CA    . HIS B 2 109 ? 52.473 23.268  35.001 1.00 53.36  ? 110 HIS P CA    1 
ATOM   920  C C     . HIS B 2 109 ? 52.244 24.751  35.216 1.00 53.78  ? 110 HIS P C     1 
ATOM   921  O O     . HIS B 2 109 ? 52.792 25.334  36.147 1.00 54.39  ? 110 HIS P O     1 
ATOM   922  C CB    . HIS B 2 109 ? 51.326 22.491  35.613 1.00 48.49  ? 110 HIS P CB    1 
ATOM   923  C CG    . HIS B 2 109 ? 50.074 22.533  34.798 1.00 41.48  ? 110 HIS P CG    1 
ATOM   924  N ND1   . HIS B 2 109 ? 49.553 21.412  34.186 1.00 40.95  ? 110 HIS P ND1   1 
ATOM   925  C CD2   . HIS B 2 109 ? 49.239 23.554  34.489 1.00 33.99  ? 110 HIS P CD2   1 
ATOM   926  C CE1   . HIS B 2 109 ? 48.450 21.742  33.535 1.00 36.33  ? 110 HIS P CE1   1 
ATOM   927  N NE2   . HIS B 2 109 ? 48.237 23.036  33.703 1.00 41.06  ? 110 HIS P NE2   1 
ATOM   928  N N     . ALA B 2 110 ? 51.400 25.338  34.368 1.00 50.75  ? 111 ALA P N     1 
ATOM   929  C CA    . ALA B 2 110 ? 51.081 26.756  34.428 1.00 53.47  ? 111 ALA P CA    1 
ATOM   930  C C     . ALA B 2 110 ? 50.112 27.140  35.555 1.00 58.25  ? 111 ALA P C     1 
ATOM   931  O O     . ALA B 2 110 ? 50.109 28.282  36.024 1.00 55.51  ? 111 ALA P O     1 
ATOM   932  C CB    . ALA B 2 110 ? 50.545 27.206  33.096 1.00 44.70  ? 111 ALA P CB    1 
ATOM   933  N N     . HIS B 2 111 ? 49.238 26.211  35.931 1.00 57.51  ? 112 HIS P N     1 
ATOM   934  C CA    . HIS B 2 111 ? 48.287 26.454  37.007 1.00 57.46  ? 112 HIS P CA    1 
ATOM   935  C C     . HIS B 2 111 ? 49.018 26.607  38.338 1.00 58.77  ? 112 HIS P C     1 
ATOM   936  O O     . HIS B 2 111 ? 50.165 26.182  38.487 1.00 59.20  ? 112 HIS P O     1 
ATOM   937  C CB    . HIS B 2 111 ? 47.287 25.306  37.123 1.00 52.75  ? 112 HIS P CB    1 
ATOM   938  C CG    . HIS B 2 111 ? 46.324 25.224  35.984 1.00 58.26  ? 112 HIS P CG    1 
ATOM   939  N ND1   . HIS B 2 111 ? 46.117 26.266  35.107 1.00 47.62  ? 112 HIS P ND1   1 
ATOM   940  C CD2   . HIS B 2 111 ? 45.509 24.222  35.581 1.00 50.29  ? 112 HIS P CD2   1 
ATOM   941  C CE1   . HIS B 2 111 ? 45.214 25.910  34.213 1.00 41.04  ? 112 HIS P CE1   1 
ATOM   942  N NE2   . HIS B 2 111 ? 44.830 24.675  34.479 1.00 41.74  ? 112 HIS P NE2   1 
ATOM   943  N N     . SER B 2 112 ? 48.328 27.169  39.317 1.00 55.66  ? 113 SER P N     1 
ATOM   944  C CA    . SER B 2 112 ? 48.913 27.365  40.623 1.00 50.70  ? 113 SER P CA    1 
ATOM   945  C C     . SER B 2 112 ? 48.141 26.621  41.677 1.00 52.26  ? 113 SER P C     1 
ATOM   946  O O     . SER B 2 112 ? 46.939 26.389  41.541 1.00 49.40  ? 113 SER P O     1 
ATOM   947  C CB    . SER B 2 112 ? 48.865 28.837  40.991 1.00 40.43  ? 113 SER P CB    1 
ATOM   948  O OG    . SER B 2 112 ? 49.385 29.620  39.949 1.00 50.65  ? 113 SER P OG    1 
ATOM   949  N N     . LEU B 2 113 ? 48.853 26.175  42.696 1.00 52.67  ? 114 LEU P N     1 
ATOM   950  C CA    . LEU B 2 113 ? 48.205 25.546  43.821 1.00 52.11  ? 114 LEU P CA    1 
ATOM   951  C C     . LEU B 2 113 ? 47.957 26.777  44.684 1.00 55.74  ? 114 LEU P C     1 
ATOM   952  O O     . LEU B 2 113 ? 48.849 27.623  44.800 1.00 61.07  ? 114 LEU P O     1 
ATOM   953  C CB    . LEU B 2 113 ? 49.166 24.613  44.553 1.00 41.18  ? 114 LEU P CB    1 
ATOM   954  C CG    . LEU B 2 113 ? 49.162 23.121  44.245 1.00 48.87  ? 114 LEU P CG    1 
ATOM   955  C CD1   . LEU B 2 113 ? 50.227 22.444  45.077 1.00 42.60  ? 114 LEU P CD1   1 
ATOM   956  C CD2   . LEU B 2 113 ? 47.797 22.524  44.541 1.00 41.57  ? 114 LEU P CD2   1 
ATOM   957  N N     . VAL B 2 114 ? 46.729 26.968  45.157 1.00 54.01  ? 115 VAL P N     1 
ATOM   958  C CA    . VAL B 2 114 ? 46.416 28.097  46.037 1.00 58.62  ? 115 VAL P CA    1 
ATOM   959  C C     . VAL B 2 114 ? 45.592 27.553  47.189 1.00 65.04  ? 115 VAL P C     1 
ATOM   960  O O     . VAL B 2 114 ? 44.767 26.672  46.996 1.00 68.88  ? 115 VAL P O     1 
ATOM   961  C CB    . VAL B 2 114 ? 45.637 29.267  45.337 1.00 56.03  ? 115 VAL P CB    1 
ATOM   962  C CG1   . VAL B 2 114 ? 46.572 30.067  44.430 1.00 36.97  ? 115 VAL P CG1   1 
ATOM   963  C CG2   . VAL B 2 114 ? 44.423 28.743  44.571 1.00 43.65  ? 115 VAL P CG2   1 
ATOM   964  N N     . GLY B 2 115 ? 45.843 28.033  48.396 1.00 71.08  ? 116 GLY P N     1 
ATOM   965  C CA    . GLY B 2 115 ? 45.079 27.542  49.522 1.00 76.15  ? 116 GLY P CA    1 
ATOM   966  C C     . GLY B 2 115 ? 45.801 27.717  50.837 1.00 81.86  ? 116 GLY P C     1 
ATOM   967  O O     . GLY B 2 115 ? 46.686 28.568  50.958 1.00 81.42  ? 116 GLY P O     1 
ATOM   968  N N     . LYS B 2 116 ? 45.466 26.861  51.798 1.00 85.01  ? 117 LYS P N     1 
ATOM   969  C CA    . LYS B 2 116 ? 46.049 26.913  53.132 1.00 84.58  ? 117 LYS P CA    1 
ATOM   970  C C     . LYS B 2 116 ? 47.551 27.124  53.207 1.00 80.04  ? 117 LYS P C     1 
ATOM   971  O O     . LYS B 2 116 ? 47.994 28.201  53.572 1.00 80.35  ? 117 LYS P O     1 
ATOM   972  C CB    . LYS B 2 116 ? 45.624 25.701  53.952 1.00 95.16  ? 117 LYS P CB    1 
ATOM   973  C CG    . LYS B 2 116 ? 44.134 25.723  54.296 1.00 108.15 ? 117 LYS P CG    1 
ATOM   974  C CD    . LYS B 2 116 ? 43.691 27.077  54.899 1.00 108.10 ? 117 LYS P CD    1 
ATOM   975  C CE    . LYS B 2 116 ? 44.193 27.268  56.338 1.00 105.88 ? 117 LYS P CE    1 
ATOM   976  N NZ    . LYS B 2 116 ? 43.728 26.158  57.236 1.00 106.12 ? 117 LYS P NZ    1 
ATOM   977  N N     . HIS B 2 117 ? 48.333 26.109  52.867 1.00 76.32  ? 118 HIS P N     1 
ATOM   978  C CA    . HIS B 2 117 ? 49.784 26.265  52.933 1.00 77.80  ? 118 HIS P CA    1 
ATOM   979  C C     . HIS B 2 117 ? 50.412 26.553  51.570 1.00 79.64  ? 118 HIS P C     1 
ATOM   980  O O     . HIS B 2 117 ? 51.315 25.831  51.141 1.00 77.29  ? 118 HIS P O     1 
ATOM   981  C CB    . HIS B 2 117 ? 50.427 25.025  53.564 1.00 78.45  ? 118 HIS P CB    1 
ATOM   982  C CG    . HIS B 2 117 ? 50.369 25.006  55.062 1.00 84.20  ? 118 HIS P CG    1 
ATOM   983  N ND1   . HIS B 2 117 ? 51.482 25.198  55.855 1.00 92.07  ? 118 HIS P ND1   1 
ATOM   984  C CD2   . HIS B 2 117 ? 49.331 24.810  55.913 1.00 77.30  ? 118 HIS P CD2   1 
ATOM   985  C CE1   . HIS B 2 117 ? 51.134 25.119  57.128 1.00 94.22  ? 118 HIS P CE1   1 
ATOM   986  N NE2   . HIS B 2 117 ? 49.834 24.886  57.189 1.00 80.09  ? 118 HIS P NE2   1 
ATOM   987  N N     . CYS B 2 118 ? 49.987 27.633  50.915 1.00 79.86  ? 119 CYS P N     1 
ATOM   988  C CA    . CYS B 2 118 ? 50.514 27.958  49.587 1.00 79.47  ? 119 CYS P CA    1 
ATOM   989  C C     . CYS B 2 118 ? 50.989 29.406  49.367 1.00 83.79  ? 119 CYS P C     1 
ATOM   990  O O     . CYS B 2 118 ? 50.463 30.353  49.967 1.00 84.97  ? 119 CYS P O     1 
ATOM   991  C CB    . CYS B 2 118 ? 49.472 27.600  48.509 1.00 66.16  ? 119 CYS P CB    1 
ATOM   992  S SG    . CYS B 2 118 ? 48.847 25.876  48.492 1.00 61.77  ? 119 CYS P SG    1 
ATOM   993  N N     . GLU B 2 119 ? 51.974 29.553  48.478 1.00 84.65  ? 120 GLU P N     1 
ATOM   994  C CA    . GLU B 2 119 ? 52.552 30.843  48.093 1.00 85.39  ? 120 GLU P CA    1 
ATOM   995  C C     . GLU B 2 119 ? 53.188 30.695  46.717 1.00 88.63  ? 120 GLU P C     1 
ATOM   996  O O     . GLU B 2 119 ? 54.014 29.811  46.501 1.00 91.24  ? 120 GLU P O     1 
ATOM   997  C CB    . GLU B 2 119 ? 53.626 31.286  49.079 1.00 82.57  ? 120 GLU P CB    1 
ATOM   998  C CG    . GLU B 2 119 ? 54.415 32.507  48.608 1.00 89.74  ? 120 GLU P CG    1 
ATOM   999  C CD    . GLU B 2 119 ? 55.517 32.928  49.587 1.00 99.43  ? 120 GLU P CD    1 
ATOM   1000 O OE1   . GLU B 2 119 ? 55.202 33.699  50.532 1.00 104.05 ? 120 GLU P OE1   1 
ATOM   1001 O OE2   . GLU B 2 119 ? 56.690 32.492  49.411 1.00 95.22  ? 120 GLU P OE2   1 
ATOM   1002 N N     . ASP B 2 120 ? 52.777 31.543  45.781 1.00 90.47  ? 121 ASP P N     1 
ATOM   1003 C CA    . ASP B 2 120 ? 53.305 31.517  44.416 1.00 87.31  ? 121 ASP P CA    1 
ATOM   1004 C C     . ASP B 2 120 ? 53.228 30.148  43.746 1.00 82.14  ? 121 ASP P C     1 
ATOM   1005 O O     . ASP B 2 120 ? 54.230 29.621  43.270 1.00 79.58  ? 121 ASP P O     1 
ATOM   1006 C CB    . ASP B 2 120 ? 54.746 32.044  44.395 1.00 89.35  ? 121 ASP P CB    1 
ATOM   1007 C CG    . ASP B 2 120 ? 54.861 33.473  44.932 1.00 105.10 ? 121 ASP P CG    1 
ATOM   1008 O OD1   . ASP B 2 120 ? 53.881 33.997  45.527 1.00 114.94 ? 121 ASP P OD1   1 
ATOM   1009 O OD2   . ASP B 2 120 ? 55.948 34.070  44.765 1.00 119.32 ? 121 ASP P OD2   1 
ATOM   1010 N N     . GLY B 2 121 ? 52.032 29.568  43.750 1.00 77.05  ? 122 GLY P N     1 
ATOM   1011 C CA    . GLY B 2 121 ? 51.817 28.275  43.125 1.00 71.99  ? 122 GLY P CA    1 
ATOM   1012 C C     . GLY B 2 121 ? 52.303 27.015  43.827 1.00 70.65  ? 122 GLY P C     1 
ATOM   1013 O O     . GLY B 2 121 ? 51.867 25.916  43.469 1.00 66.64  ? 122 GLY P O     1 
ATOM   1014 N N     . ILE B 2 122 ? 53.194 27.156  44.808 1.00 72.88  ? 123 ILE P N     1 
ATOM   1015 C CA    . ILE B 2 122 ? 53.746 26.002  45.533 1.00 73.40  ? 123 ILE P CA    1 
ATOM   1016 C C     . ILE B 2 122 ? 53.181 25.855  46.952 1.00 71.48  ? 123 ILE P C     1 
ATOM   1017 O O     . ILE B 2 122 ? 52.834 26.845  47.600 1.00 71.09  ? 123 ILE P O     1 
ATOM   1018 C CB    . ILE B 2 122 ? 55.293 26.096  45.640 1.00 72.80  ? 123 ILE P CB    1 
ATOM   1019 C CG1   . ILE B 2 122 ? 55.891 26.625  44.330 1.00 79.30  ? 123 ILE P CG1   1 
ATOM   1020 C CG2   . ILE B 2 122 ? 55.874 24.731  45.952 1.00 70.08  ? 123 ILE P CG2   1 
ATOM   1021 C CD1   . ILE B 2 122 ? 57.384 26.902  44.382 1.00 71.51  ? 123 ILE P CD1   1 
ATOM   1022 N N     . CYS B 2 123 ? 53.111 24.618  47.432 1.00 68.58  ? 124 CYS P N     1 
ATOM   1023 C CA    . CYS B 2 123 ? 52.601 24.335  48.765 1.00 67.00  ? 124 CYS P CA    1 
ATOM   1024 C C     . CYS B 2 123 ? 53.755 23.861  49.635 1.00 70.48  ? 124 CYS P C     1 
ATOM   1025 O O     . CYS B 2 123 ? 54.496 22.974  49.211 1.00 69.68  ? 124 CYS P O     1 
ATOM   1026 C CB    . CYS B 2 123 ? 51.537 23.242  48.682 1.00 75.31  ? 124 CYS P CB    1 
ATOM   1027 S SG    . CYS B 2 123 ? 50.983 22.523  50.265 1.00 64.28  ? 124 CYS P SG    1 
ATOM   1028 N N     . THR B 2 124 ? 53.927 24.458  50.823 1.00 71.58  ? 125 THR P N     1 
ATOM   1029 C CA    . THR B 2 124 ? 55.002 24.071  51.752 1.00 68.74  ? 125 THR P CA    1 
ATOM   1030 C C     . THR B 2 124 ? 54.536 23.791  53.188 1.00 71.70  ? 125 THR P C     1 
ATOM   1031 O O     . THR B 2 124 ? 53.906 24.635  53.843 1.00 71.91  ? 125 THR P O     1 
ATOM   1032 C CB    . THR B 2 124 ? 56.111 25.124  51.844 1.00 58.25  ? 125 THR P CB    1 
ATOM   1033 O OG1   . THR B 2 124 ? 56.213 25.833  50.610 1.00 57.05  ? 125 THR P OG1   1 
ATOM   1034 C CG2   . THR B 2 124 ? 57.430 24.451  52.113 1.00 62.21  ? 125 THR P CG2   1 
ATOM   1035 N N     . VAL B 2 125 ? 54.893 22.612  53.682 1.00 75.59  ? 126 VAL P N     1 
ATOM   1036 C CA    . VAL B 2 125 ? 54.537 22.192  55.029 1.00 81.87  ? 126 VAL P CA    1 
ATOM   1037 C C     . VAL B 2 125 ? 55.650 21.287  55.579 1.00 84.76  ? 126 VAL P C     1 
ATOM   1038 O O     . VAL B 2 125 ? 56.351 20.616  54.816 1.00 81.52  ? 126 VAL P O     1 
ATOM   1039 C CB    . VAL B 2 125 ? 53.166 21.464  55.031 1.00 84.07  ? 126 VAL P CB    1 
ATOM   1040 C CG1   . VAL B 2 125 ? 53.231 20.206  54.185 1.00 80.95  ? 126 VAL P CG1   1 
ATOM   1041 C CG2   . VAL B 2 125 ? 52.706 21.166  56.457 1.00 93.92  ? 126 VAL P CG2   1 
ATOM   1042 N N     . THR B 2 126 ? 55.836 21.311  56.897 1.00 88.52  ? 127 THR P N     1 
ATOM   1043 C CA    . THR B 2 126 ? 56.871 20.522  57.569 1.00 90.66  ? 127 THR P CA    1 
ATOM   1044 C C     . THR B 2 126 ? 56.311 19.264  58.252 1.00 93.06  ? 127 THR P C     1 
ATOM   1045 O O     . THR B 2 126 ? 55.167 19.259  58.699 1.00 93.28  ? 127 THR P O     1 
ATOM   1046 C CB    . THR B 2 126 ? 57.584 21.392  58.625 1.00 91.45  ? 127 THR P CB    1 
ATOM   1047 O OG1   . THR B 2 126 ? 56.596 22.089  59.393 1.00 82.41  ? 127 THR P OG1   1 
ATOM   1048 C CG2   . THR B 2 126 ? 58.501 22.417  57.956 1.00 91.06  ? 127 THR P CG2   1 
ATOM   1049 N N     . ALA B 2 127 ? 57.122 18.215  58.351 1.00 96.65  ? 128 ALA P N     1 
ATOM   1050 C CA    . ALA B 2 127 ? 56.698 16.968  58.991 1.00 101.77 ? 128 ALA P CA    1 
ATOM   1051 C C     . ALA B 2 127 ? 57.241 16.829  60.430 1.00 103.65 ? 128 ALA P C     1 
ATOM   1052 O O     . ALA B 2 127 ? 58.445 16.607  60.624 1.00 102.44 ? 128 ALA P O     1 
ATOM   1053 C CB    . ALA B 2 127 ? 57.138 15.786  58.146 1.00 102.10 ? 128 ALA P CB    1 
ATOM   1054 N N     . GLY B 2 128 ? 56.353 16.947  61.424 1.00 104.95 ? 129 GLY P N     1 
ATOM   1055 C CA    . GLY B 2 128 ? 56.754 16.842  62.825 1.00 107.30 ? 129 GLY P CA    1 
ATOM   1056 C C     . GLY B 2 128 ? 57.235 15.444  63.197 1.00 109.61 ? 129 GLY P C     1 
ATOM   1057 O O     . GLY B 2 128 ? 56.682 14.468  62.686 1.00 113.58 ? 129 GLY P O     1 
ATOM   1058 N N     . PRO B 2 129 ? 58.229 15.302  64.108 1.00 108.57 ? 130 PRO P N     1 
ATOM   1059 C CA    . PRO B 2 129 ? 58.778 13.998  64.540 1.00 104.13 ? 130 PRO P CA    1 
ATOM   1060 C C     . PRO B 2 129 ? 57.747 12.931  64.938 1.00 102.04 ? 130 PRO P C     1 
ATOM   1061 O O     . PRO B 2 129 ? 57.854 11.774  64.537 1.00 98.80  ? 130 PRO P O     1 
ATOM   1062 C CB    . PRO B 2 129 ? 59.683 14.379  65.707 1.00 105.86 ? 130 PRO P CB    1 
ATOM   1063 C CG    . PRO B 2 129 ? 60.208 15.725  65.261 1.00 104.37 ? 130 PRO P CG    1 
ATOM   1064 C CD    . PRO B 2 129 ? 58.948 16.412  64.766 1.00 107.20 ? 130 PRO P CD    1 
ATOM   1065 N N     . LYS B 2 130 ? 56.742 13.318  65.715 1.00 103.27 ? 131 LYS P N     1 
ATOM   1066 C CA    . LYS B 2 130 ? 55.695 12.379  66.122 1.00 105.79 ? 131 LYS P CA    1 
ATOM   1067 C C     . LYS B 2 130 ? 54.582 12.399  65.068 1.00 105.66 ? 131 LYS P C     1 
ATOM   1068 O O     . LYS B 2 130 ? 53.412 12.167  65.381 1.00 104.93 ? 131 LYS P O     1 
ATOM   1069 C CB    . LYS B 2 130 ? 55.130 12.764  67.499 1.00 106.90 ? 131 LYS P CB    1 
ATOM   1070 C CG    . LYS B 2 130 ? 56.161 12.761  68.616 1.00 110.82 ? 131 LYS P CG    1 
ATOM   1071 C CD    . LYS B 2 130 ? 56.749 11.378  68.794 1.00 117.58 ? 131 LYS P CD    1 
ATOM   1072 C CE    . LYS B 2 130 ? 57.959 11.409  69.708 1.00 115.77 ? 131 LYS P CE    1 
ATOM   1073 N NZ    . LYS B 2 130 ? 58.423 10.012  69.966 1.00 110.44 ? 131 LYS P NZ    1 
ATOM   1074 N N     . ASP B 2 131 ? 54.963 12.684  63.824 1.00 105.52 ? 132 ASP P N     1 
ATOM   1075 C CA    . ASP B 2 131 ? 54.034 12.770  62.706 1.00 101.13 ? 132 ASP P CA    1 
ATOM   1076 C C     . ASP B 2 131 ? 54.778 12.868  61.372 1.00 99.14  ? 132 ASP P C     1 
ATOM   1077 O O     . ASP B 2 131 ? 54.766 13.923  60.732 1.00 97.37  ? 132 ASP P O     1 
ATOM   1078 C CB    . ASP B 2 131 ? 53.130 14.001  62.870 1.00 102.28 ? 132 ASP P CB    1 
ATOM   1079 C CG    . ASP B 2 131 ? 51.671 13.635  63.077 1.00 98.57  ? 132 ASP P CG    1 
ATOM   1080 O OD1   . ASP B 2 131 ? 51.226 12.587  62.553 1.00 92.13  ? 132 ASP P OD1   1 
ATOM   1081 O OD2   . ASP B 2 131 ? 50.962 14.407  63.757 1.00 92.07  ? 132 ASP P OD2   1 
ATOM   1082 N N     . MET B 2 132 ? 55.430 11.778  60.958 1.00 99.95  ? 133 MET P N     1 
ATOM   1083 C CA    . MET B 2 132 ? 56.161 11.744  59.680 1.00 100.34 ? 133 MET P CA    1 
ATOM   1084 C C     . MET B 2 132 ? 55.186 11.775  58.481 1.00 99.19  ? 133 MET P C     1 
ATOM   1085 O O     . MET B 2 132 ? 55.592 11.773  57.311 1.00 101.19 ? 133 MET P O     1 
ATOM   1086 C CB    . MET B 2 132 ? 57.082 10.512  59.600 1.00 97.54  ? 133 MET P CB    1 
ATOM   1087 C CG    . MET B 2 132 ? 58.569 10.850  59.455 1.00 88.36  ? 133 MET P CG    1 
ATOM   1088 S SD    . MET B 2 132 ? 59.197 11.781  60.879 1.00 98.41  ? 133 MET P SD    1 
ATOM   1089 C CE    . MET B 2 132 ? 59.437 13.463  60.191 1.00 90.62  ? 133 MET P CE    1 
ATOM   1090 N N     . VAL B 2 133 ? 53.897 11.765  58.796 1.00 96.08  ? 134 VAL P N     1 
ATOM   1091 C CA    . VAL B 2 133 ? 52.835 11.820  57.809 1.00 94.21  ? 134 VAL P CA    1 
ATOM   1092 C C     . VAL B 2 133 ? 52.319 13.256  57.768 1.00 94.59  ? 134 VAL P C     1 
ATOM   1093 O O     . VAL B 2 133 ? 52.067 13.864  58.813 1.00 94.19  ? 134 VAL P O     1 
ATOM   1094 C CB    . VAL B 2 133 ? 51.672 10.890  58.207 1.00 92.69  ? 134 VAL P CB    1 
ATOM   1095 C CG1   . VAL B 2 133 ? 50.461 11.113  57.313 1.00 89.96  ? 134 VAL P CG1   1 
ATOM   1096 C CG2   . VAL B 2 133 ? 52.122 9.454   58.138 1.00 87.04  ? 134 VAL P CG2   1 
ATOM   1097 N N     . VAL B 2 134 ? 52.205 13.811  56.568 1.00 92.24  ? 135 VAL P N     1 
ATOM   1098 C CA    . VAL B 2 134 ? 51.699 15.163  56.408 1.00 89.74  ? 135 VAL P CA    1 
ATOM   1099 C C     . VAL B 2 134 ? 50.595 15.131  55.351 1.00 87.07  ? 135 VAL P C     1 
ATOM   1100 O O     . VAL B 2 134 ? 50.845 14.809  54.187 1.00 86.58  ? 135 VAL P O     1 
ATOM   1101 C CB    . VAL B 2 134 ? 52.824 16.162  56.003 1.00 88.64  ? 135 VAL P CB    1 
ATOM   1102 C CG1   . VAL B 2 134 ? 52.257 17.560  55.867 1.00 83.80  ? 135 VAL P CG1   1 
ATOM   1103 C CG2   . VAL B 2 134 ? 53.938 16.159  57.042 1.00 91.59  ? 135 VAL P CG2   1 
ATOM   1104 N N     . GLY B 2 135 ? 49.358 15.351  55.789 1.00 83.20  ? 136 GLY P N     1 
ATOM   1105 C CA    . GLY B 2 135 ? 48.227 15.369  54.875 1.00 80.99  ? 136 GLY P CA    1 
ATOM   1106 C C     . GLY B 2 135 ? 47.954 16.785  54.380 1.00 82.76  ? 136 GLY P C     1 
ATOM   1107 O O     . GLY B 2 135 ? 48.290 17.764  55.063 1.00 84.03  ? 136 GLY P O     1 
ATOM   1108 N N     . PHE B 2 136 ? 47.322 16.908  53.215 1.00 79.18  ? 137 PHE P N     1 
ATOM   1109 C CA    . PHE B 2 136 ? 47.039 18.221  52.641 1.00 76.69  ? 137 PHE P CA    1 
ATOM   1110 C C     . PHE B 2 136 ? 45.557 18.608  52.591 1.00 76.10  ? 137 PHE P C     1 
ATOM   1111 O O     . PHE B 2 136 ? 44.771 18.022  51.851 1.00 76.86  ? 137 PHE P O     1 
ATOM   1112 C CB    . PHE B 2 136 ? 47.673 18.310  51.256 1.00 72.70  ? 137 PHE P CB    1 
ATOM   1113 C CG    . PHE B 2 136 ? 49.159 18.108  51.268 1.00 73.27  ? 137 PHE P CG    1 
ATOM   1114 C CD1   . PHE B 2 136 ? 50.021 19.190  51.441 1.00 76.98  ? 137 PHE P CD1   1 
ATOM   1115 C CD2   . PHE B 2 136 ? 49.700 16.835  51.140 1.00 70.03  ? 137 PHE P CD2   1 
ATOM   1116 C CE1   . PHE B 2 136 ? 51.398 19.004  51.488 1.00 68.19  ? 137 PHE P CE1   1 
ATOM   1117 C CE2   . PHE B 2 136 ? 51.080 16.638  51.186 1.00 71.70  ? 137 PHE P CE2   1 
ATOM   1118 C CZ    . PHE B 2 136 ? 51.929 17.726  51.361 1.00 67.94  ? 137 PHE P CZ    1 
ATOM   1119 N N     . ALA B 2 137 ? 45.188 19.605  53.385 1.00 76.41  ? 138 ALA P N     1 
ATOM   1120 C CA    . ALA B 2 137 ? 43.812 20.074  53.442 1.00 75.51  ? 138 ALA P CA    1 
ATOM   1121 C C     . ALA B 2 137 ? 43.680 21.484  52.882 1.00 77.22  ? 138 ALA P C     1 
ATOM   1122 O O     . ALA B 2 137 ? 44.440 22.386  53.246 1.00 79.85  ? 138 ALA P O     1 
ATOM   1123 C CB    . ALA B 2 137 ? 43.306 20.033  54.873 1.00 66.27  ? 138 ALA P CB    1 
ATOM   1124 N N     . ASN B 2 138 ? 42.688 21.666  52.018 1.00 77.93  ? 139 ASN P N     1 
ATOM   1125 C CA    . ASN B 2 138 ? 42.400 22.956  51.382 1.00 82.25  ? 139 ASN P CA    1 
ATOM   1126 C C     . ASN B 2 138 ? 43.367 23.442  50.313 1.00 79.73  ? 139 ASN P C     1 
ATOM   1127 O O     . ASN B 2 138 ? 43.912 24.548  50.400 1.00 83.90  ? 139 ASN P O     1 
ATOM   1128 C CB    . ASN B 2 138 ? 42.195 24.072  52.404 1.00 87.79  ? 139 ASN P CB    1 
ATOM   1129 C CG    . ASN B 2 138 ? 40.825 24.052  53.019 1.00 97.53  ? 139 ASN P CG    1 
ATOM   1130 O OD1   . ASN B 2 138 ? 39.824 23.798  52.343 1.00 104.45 ? 139 ASN P OD1   1 
ATOM   1131 N ND2   . ASN B 2 138 ? 40.763 24.338  54.311 1.00 100.89 ? 139 ASN P ND2   1 
ATOM   1132 N N     . LEU B 2 139 ? 43.608 22.592  49.328 1.00 73.33  ? 140 LEU P N     1 
ATOM   1133 C CA    . LEU B 2 139 ? 44.452 22.961  48.220 1.00 61.92  ? 140 LEU P CA    1 
ATOM   1134 C C     . LEU B 2 139 ? 43.473 23.193  47.104 1.00 56.03  ? 140 LEU P C     1 
ATOM   1135 O O     . LEU B 2 139 ? 42.576 22.380  46.880 1.00 54.03  ? 140 LEU P O     1 
ATOM   1136 C CB    . LEU B 2 139 ? 45.384 21.826  47.824 1.00 60.97  ? 140 LEU P CB    1 
ATOM   1137 C CG    . LEU B 2 139 ? 46.738 21.765  48.510 1.00 59.61  ? 140 LEU P CG    1 
ATOM   1138 C CD1   . LEU B 2 139 ? 47.570 20.699  47.816 1.00 61.18  ? 140 LEU P CD1   1 
ATOM   1139 C CD2   . LEU B 2 139 ? 47.430 23.115  48.433 1.00 56.95  ? 140 LEU P CD2   1 
ATOM   1140 N N     . GLY B 2 140 ? 43.592 24.346  46.474 1.00 51.56  ? 141 GLY P N     1 
ATOM   1141 C CA    . GLY B 2 140 ? 42.738 24.686  45.356 1.00 52.70  ? 141 GLY P CA    1 
ATOM   1142 C C     . GLY B 2 140 ? 43.628 24.753  44.125 1.00 51.54  ? 141 GLY P C     1 
ATOM   1143 O O     . GLY B 2 140 ? 44.856 24.839  44.244 1.00 49.43  ? 141 GLY P O     1 
ATOM   1144 N N     . ILE B 2 141 ? 43.044 24.656  42.939 1.00 50.25  ? 142 ILE P N     1 
ATOM   1145 C CA    . ILE B 2 141 ? 43.849 24.724  41.737 1.00 44.51  ? 142 ILE P CA    1 
ATOM   1146 C C     . ILE B 2 141 ? 43.385 25.916  40.931 1.00 42.48  ? 142 ILE P C     1 
ATOM   1147 O O     . ILE B 2 141 ? 42.227 25.984  40.518 1.00 44.53  ? 142 ILE P O     1 
ATOM   1148 C CB    . ILE B 2 141 ? 43.782 23.412  40.916 1.00 42.34  ? 142 ILE P CB    1 
ATOM   1149 C CG1   . ILE B 2 141 ? 44.340 22.252  41.754 1.00 46.44  ? 142 ILE P CG1   1 
ATOM   1150 C CG2   . ILE B 2 141 ? 44.607 23.545  39.639 1.00 42.01  ? 142 ILE P CG2   1 
ATOM   1151 C CD1   . ILE B 2 141 ? 44.143 20.865  41.166 1.00 47.54  ? 142 ILE P CD1   1 
ATOM   1152 N N     . LEU B 2 142 ? 44.267 26.907  40.847 1.00 40.68  ? 143 LEU P N     1 
ATOM   1153 C CA    . LEU B 2 142 ? 44.031 28.135  40.102 1.00 38.77  ? 143 LEU P CA    1 
ATOM   1154 C C     . LEU B 2 142 ? 44.213 27.839  38.618 1.00 40.48  ? 143 LEU P C     1 
ATOM   1155 O O     . LEU B 2 142 ? 45.263 27.353  38.187 1.00 43.92  ? 143 LEU P O     1 
ATOM   1156 C CB    . LEU B 2 142 ? 45.019 29.208  40.546 1.00 47.41  ? 143 LEU P CB    1 
ATOM   1157 C CG    . LEU B 2 142 ? 44.917 30.569  39.868 1.00 52.41  ? 143 LEU P CG    1 
ATOM   1158 C CD1   . LEU B 2 142 ? 43.474 31.004  39.856 1.00 56.60  ? 143 LEU P CD1   1 
ATOM   1159 C CD2   . LEU B 2 142 ? 45.794 31.584  40.598 1.00 53.99  ? 143 LEU P CD2   1 
ATOM   1160 N N     . HIS B 2 143 ? 43.181 28.141  37.844 1.00 39.12  ? 144 HIS P N     1 
ATOM   1161 C CA    . HIS B 2 143 ? 43.153 27.885  36.414 1.00 36.66  ? 144 HIS P CA    1 
ATOM   1162 C C     . HIS B 2 143 ? 43.578 29.121  35.647 1.00 41.03  ? 144 HIS P C     1 
ATOM   1163 O O     . HIS B 2 143 ? 42.894 30.130  35.691 1.00 41.35  ? 144 HIS P O     1 
ATOM   1164 C CB    . HIS B 2 143 ? 41.717 27.503  36.026 1.00 44.36  ? 144 HIS P CB    1 
ATOM   1165 C CG    . HIS B 2 143 ? 41.584 26.882  34.669 1.00 42.40  ? 144 HIS P CG    1 
ATOM   1166 N ND1   . HIS B 2 143 ? 40.969 25.665  34.472 1.00 42.81  ? 144 HIS P ND1   1 
ATOM   1167 C CD2   . HIS B 2 143 ? 41.962 27.313  33.446 1.00 35.80  ? 144 HIS P CD2   1 
ATOM   1168 C CE1   . HIS B 2 143 ? 40.975 25.376  33.184 1.00 36.11  ? 144 HIS P CE1   1 
ATOM   1169 N NE2   . HIS B 2 143 ? 41.572 26.358  32.540 1.00 35.12  ? 144 HIS P NE2   1 
ATOM   1170 N N     . VAL B 2 144 ? 44.696 29.038  34.938 1.00 42.03  ? 145 VAL P N     1 
ATOM   1171 C CA    . VAL B 2 144 ? 45.185 30.156  34.138 1.00 39.18  ? 145 VAL P CA    1 
ATOM   1172 C C     . VAL B 2 144 ? 44.423 30.115  32.806 1.00 36.31  ? 145 VAL P C     1 
ATOM   1173 O O     . VAL B 2 144 ? 43.889 29.069  32.444 1.00 37.66  ? 145 VAL P O     1 
ATOM   1174 C CB    . VAL B 2 144 ? 46.728 30.054  33.928 1.00 35.96  ? 145 VAL P CB    1 
ATOM   1175 C CG1   . VAL B 2 144 ? 47.088 28.738  33.295 1.00 35.20  ? 145 VAL P CG1   1 
ATOM   1176 C CG2   . VAL B 2 144 ? 47.233 31.200  33.086 1.00 41.83  ? 145 VAL P CG2   1 
ATOM   1177 N N     . THR B 2 145 ? 44.289 31.257  32.132 1.00 36.32  ? 146 THR P N     1 
ATOM   1178 C CA    . THR B 2 145 ? 43.581 31.305  30.854 1.00 35.85  ? 146 THR P CA    1 
ATOM   1179 C C     . THR B 2 145 ? 44.545 30.865  29.776 1.00 40.57  ? 146 THR P C     1 
ATOM   1180 O O     . THR B 2 145 ? 45.757 30.979  29.940 1.00 44.38  ? 146 THR P O     1 
ATOM   1181 C CB    . THR B 2 145 ? 43.093 32.730  30.477 1.00 32.13  ? 146 THR P CB    1 
ATOM   1182 O OG1   . THR B 2 145 ? 44.195 33.639  30.491 1.00 49.82  ? 146 THR P OG1   1 
ATOM   1183 C CG2   . THR B 2 145 ? 42.046 33.223  31.422 1.00 32.57  ? 146 THR P CG2   1 
ATOM   1184 N N     . LYS B 2 146 ? 43.999 30.422  28.650 1.00 40.66  ? 147 LYS P N     1 
ATOM   1185 C CA    . LYS B 2 146 ? 44.810 29.981  27.529 1.00 37.16  ? 147 LYS P CA    1 
ATOM   1186 C C     . LYS B 2 146 ? 45.722 31.113  27.059 1.00 39.93  ? 147 LYS P C     1 
ATOM   1187 O O     . LYS B 2 146 ? 46.929 30.933  26.917 1.00 41.37  ? 147 LYS P O     1 
ATOM   1188 C CB    . LYS B 2 146 ? 43.890 29.547  26.410 1.00 30.62  ? 147 LYS P CB    1 
ATOM   1189 C CG    . LYS B 2 146 ? 44.426 28.431  25.554 1.00 57.12  ? 147 LYS P CG    1 
ATOM   1190 C CD    . LYS B 2 146 ? 43.276 27.561  25.025 1.00 66.76  ? 147 LYS P CD    1 
ATOM   1191 C CE    . LYS B 2 146 ? 42.499 26.890  26.166 1.00 69.13  ? 147 LYS P CE    1 
ATOM   1192 N NZ    . LYS B 2 146 ? 41.346 26.087  25.680 1.00 62.53  ? 147 LYS P NZ    1 
ATOM   1193 N N     . LYS B 2 147 ? 45.146 32.304  26.928 1.00 41.34  ? 148 LYS P N     1 
ATOM   1194 C CA    . LYS B 2 147 ? 45.863 33.495  26.484 1.00 52.33  ? 148 LYS P CA    1 
ATOM   1195 C C     . LYS B 2 147 ? 46.971 34.007  27.396 1.00 55.57  ? 148 LYS P C     1 
ATOM   1196 O O     . LYS B 2 147 ? 47.766 34.845  26.979 1.00 64.69  ? 148 LYS P O     1 
ATOM   1197 C CB    . LYS B 2 147 ? 44.887 34.639  26.197 1.00 61.16  ? 148 LYS P CB    1 
ATOM   1198 C CG    . LYS B 2 147 ? 44.091 34.485  24.898 1.00 84.35  ? 148 LYS P CG    1 
ATOM   1199 C CD    . LYS B 2 147 ? 43.083 35.630  24.728 1.00 92.11  ? 148 LYS P CD    1 
ATOM   1200 C CE    . LYS B 2 147 ? 42.100 35.364  23.584 1.00 98.60  ? 148 LYS P CE    1 
ATOM   1201 N NZ    . LYS B 2 147 ? 40.944 36.315  23.609 1.00 100.61 ? 148 LYS P NZ    1 
ATOM   1202 N N     . LYS B 2 148 ? 47.021 33.536  28.636 1.00 54.21  ? 149 LYS P N     1 
ATOM   1203 C CA    . LYS B 2 148 ? 48.061 33.973  29.567 1.00 49.16  ? 149 LYS P CA    1 
ATOM   1204 C C     . LYS B 2 148 ? 48.966 32.832  30.010 1.00 50.22  ? 149 LYS P C     1 
ATOM   1205 O O     . LYS B 2 148 ? 49.756 32.976  30.949 1.00 49.03  ? 149 LYS P O     1 
ATOM   1206 C CB    . LYS B 2 148 ? 47.445 34.651  30.796 1.00 45.00  ? 149 LYS P CB    1 
ATOM   1207 C CG    . LYS B 2 148 ? 47.178 36.153  30.624 1.00 58.79  ? 149 LYS P CG    1 
ATOM   1208 C CD    . LYS B 2 148 ? 46.796 36.813  31.949 1.00 67.10  ? 149 LYS P CD    1 
ATOM   1209 C CE    . LYS B 2 148 ? 46.627 38.325  31.815 1.00 70.27  ? 149 LYS P CE    1 
ATOM   1210 N NZ    . LYS B 2 148 ? 45.984 38.900  33.033 1.00 82.58  ? 149 LYS P NZ    1 
ATOM   1211 N N     . VAL B 2 149 ? 48.901 31.719  29.287 1.00 52.54  ? 150 VAL P N     1 
ATOM   1212 C CA    . VAL B 2 149 ? 49.695 30.548  29.624 1.00 49.54  ? 150 VAL P CA    1 
ATOM   1213 C C     . VAL B 2 149 ? 51.218 30.741  29.636 1.00 54.83  ? 150 VAL P C     1 
ATOM   1214 O O     . VAL B 2 149 ? 51.876 30.347  30.601 1.00 59.10  ? 150 VAL P O     1 
ATOM   1215 C CB    . VAL B 2 149 ? 49.290 29.343  28.751 1.00 38.18  ? 150 VAL P CB    1 
ATOM   1216 C CG1   . VAL B 2 149 ? 50.278 28.205  28.902 1.00 22.28  ? 150 VAL P CG1   1 
ATOM   1217 C CG2   . VAL B 2 149 ? 47.920 28.868  29.159 1.00 40.55  ? 150 VAL P CG2   1 
ATOM   1218 N N     . PHE B 2 150 ? 51.782 31.361  28.599 1.00 55.48  ? 151 PHE P N     1 
ATOM   1219 C CA    . PHE B 2 150 ? 53.237 31.562  28.534 1.00 51.02  ? 151 PHE P CA    1 
ATOM   1220 C C     . PHE B 2 150 ? 53.804 32.385  29.688 1.00 52.93  ? 151 PHE P C     1 
ATOM   1221 O O     . PHE B 2 150 ? 54.644 31.898  30.453 1.00 44.22  ? 151 PHE P O     1 
ATOM   1222 C CB    . PHE B 2 150 ? 53.647 32.195  27.198 1.00 46.58  ? 151 PHE P CB    1 
ATOM   1223 C CG    . PHE B 2 150 ? 55.089 32.643  27.154 1.00 53.16  ? 151 PHE P CG    1 
ATOM   1224 C CD1   . PHE B 2 150 ? 56.130 31.713  27.185 1.00 57.61  ? 151 PHE P CD1   1 
ATOM   1225 C CD2   . PHE B 2 150 ? 55.411 33.998  27.104 1.00 67.42  ? 151 PHE P CD2   1 
ATOM   1226 C CE1   . PHE B 2 150 ? 57.471 32.124  27.171 1.00 55.10  ? 151 PHE P CE1   1 
ATOM   1227 C CE2   . PHE B 2 150 ? 56.755 34.419  27.090 1.00 68.26  ? 151 PHE P CE2   1 
ATOM   1228 C CZ    . PHE B 2 150 ? 57.781 33.475  27.122 1.00 62.13  ? 151 PHE P CZ    1 
ATOM   1229 N N     . GLU B 2 151 ? 53.344 33.627  29.810 1.00 55.80  ? 152 GLU P N     1 
ATOM   1230 C CA    . GLU B 2 151 ? 53.828 34.516  30.856 1.00 59.61  ? 152 GLU P CA    1 
ATOM   1231 C C     . GLU B 2 151 ? 53.656 33.989  32.274 1.00 62.16  ? 152 GLU P C     1 
ATOM   1232 O O     . GLU B 2 151 ? 54.336 34.441  33.191 1.00 65.63  ? 152 GLU P O     1 
ATOM   1233 C CB    . GLU B 2 151 ? 53.209 35.895  30.708 1.00 61.34  ? 152 GLU P CB    1 
ATOM   1234 C CG    . GLU B 2 151 ? 51.751 35.880  30.368 1.00 64.70  ? 152 GLU P CG    1 
ATOM   1235 C CD    . GLU B 2 151 ? 51.209 37.278  30.210 1.00 78.05  ? 152 GLU P CD    1 
ATOM   1236 O OE1   . GLU B 2 151 ? 51.298 38.058  31.186 1.00 71.89  ? 152 GLU P OE1   1 
ATOM   1237 O OE2   . GLU B 2 151 ? 50.700 37.601  29.114 1.00 79.99  ? 152 GLU P OE2   1 
ATOM   1238 N N     . THR B 2 152 ? 52.745 33.045  32.462 1.00 62.90  ? 153 THR P N     1 
ATOM   1239 C CA    . THR B 2 152 ? 52.547 32.458  33.775 1.00 60.77  ? 153 THR P CA    1 
ATOM   1240 C C     . THR B 2 152 ? 53.475 31.253  33.931 1.00 61.40  ? 153 THR P C     1 
ATOM   1241 O O     . THR B 2 152 ? 54.085 31.080  34.981 1.00 64.44  ? 153 THR P O     1 
ATOM   1242 C CB    . THR B 2 152 ? 51.087 32.041  33.989 1.00 59.49  ? 153 THR P CB    1 
ATOM   1243 O OG1   . THR B 2 152 ? 50.257 33.201  33.899 1.00 52.79  ? 153 THR P OG1   1 
ATOM   1244 C CG2   . THR B 2 152 ? 50.898 31.427  35.359 1.00 45.85  ? 153 THR P CG2   1 
ATOM   1245 N N     . LEU B 2 153 ? 53.620 30.453  32.874 1.00 60.42  ? 154 LEU P N     1 
ATOM   1246 C CA    . LEU B 2 153 ? 54.492 29.283  32.914 1.00 57.28  ? 154 LEU P CA    1 
ATOM   1247 C C     . LEU B 2 153 ? 55.900 29.766  33.202 1.00 61.92  ? 154 LEU P C     1 
ATOM   1248 O O     . LEU B 2 153 ? 56.598 29.206  34.037 1.00 63.30  ? 154 LEU P O     1 
ATOM   1249 C CB    . LEU B 2 153 ? 54.499 28.558  31.568 1.00 49.64  ? 154 LEU P CB    1 
ATOM   1250 C CG    . LEU B 2 153 ? 54.740 27.045  31.566 1.00 45.03  ? 154 LEU P CG    1 
ATOM   1251 C CD1   . LEU B 2 153 ? 55.301 26.648  30.243 1.00 49.39  ? 154 LEU P CD1   1 
ATOM   1252 C CD2   . LEU B 2 153 ? 55.670 26.611  32.671 1.00 40.36  ? 154 LEU P CD2   1 
ATOM   1253 N N     . GLU B 2 154 ? 56.304 30.821  32.510 1.00 64.00  ? 155 GLU P N     1 
ATOM   1254 C CA    . GLU B 2 154 ? 57.635 31.387  32.673 1.00 65.70  ? 155 GLU P CA    1 
ATOM   1255 C C     . GLU B 2 154 ? 57.877 31.868  34.108 1.00 68.01  ? 155 GLU P C     1 
ATOM   1256 O O     . GLU B 2 154 ? 58.921 31.579  34.702 1.00 72.51  ? 155 GLU P O     1 
ATOM   1257 C CB    . GLU B 2 154 ? 57.813 32.535  31.689 1.00 65.80  ? 155 GLU P CB    1 
ATOM   1258 C CG    . GLU B 2 154 ? 59.226 33.052  31.573 1.00 69.07  ? 155 GLU P CG    1 
ATOM   1259 C CD    . GLU B 2 154 ? 59.338 34.263  30.656 1.00 82.50  ? 155 GLU P CD    1 
ATOM   1260 O OE1   . GLU B 2 154 ? 58.469 34.445  29.775 1.00 89.77  ? 155 GLU P OE1   1 
ATOM   1261 O OE2   . GLU B 2 154 ? 60.302 35.041  30.819 1.00 81.67  ? 155 GLU P OE2   1 
ATOM   1262 N N     . ALA B 2 155 ? 56.900 32.580  34.663 1.00 67.50  ? 156 ALA P N     1 
ATOM   1263 C CA    . ALA B 2 155 ? 56.988 33.102  36.029 1.00 68.55  ? 156 ALA P CA    1 
ATOM   1264 C C     . ALA B 2 155 ? 57.107 31.983  37.068 1.00 70.05  ? 156 ALA P C     1 
ATOM   1265 O O     . ALA B 2 155 ? 57.820 32.126  38.069 1.00 75.63  ? 156 ALA P O     1 
ATOM   1266 C CB    . ALA B 2 155 ? 55.781 33.978  36.338 1.00 63.98  ? 156 ALA P CB    1 
ATOM   1267 N N     . ARG B 2 156 ? 56.410 30.875  36.823 1.00 70.34  ? 157 ARG P N     1 
ATOM   1268 C CA    . ARG B 2 156 ? 56.435 29.717  37.718 1.00 72.96  ? 157 ARG P CA    1 
ATOM   1269 C C     . ARG B 2 156 ? 57.810 29.034  37.666 1.00 72.58  ? 157 ARG P C     1 
ATOM   1270 O O     . ARG B 2 156 ? 58.306 28.557  38.687 1.00 71.72  ? 157 ARG P O     1 
ATOM   1271 C CB    . ARG B 2 156 ? 55.345 28.716  37.318 1.00 78.77  ? 157 ARG P CB    1 
ATOM   1272 C CG    . ARG B 2 156 ? 55.038 27.633  38.358 1.00 90.41  ? 157 ARG P CG    1 
ATOM   1273 C CD    . ARG B 2 156 ? 54.051 28.111  39.427 1.00 84.77  ? 157 ARG P CD    1 
ATOM   1274 N NE    . ARG B 2 156 ? 52.774 28.513  38.845 1.00 75.96  ? 157 ARG P NE    1 
ATOM   1275 C CZ    . ARG B 2 156 ? 52.368 29.774  38.737 1.00 78.94  ? 157 ARG P CZ    1 
ATOM   1276 N NH1   . ARG B 2 156 ? 53.128 30.773  39.180 1.00 70.41  ? 157 ARG P NH1   1 
ATOM   1277 N NH2   . ARG B 2 156 ? 51.214 30.041  38.145 1.00 80.85  ? 157 ARG P NH2   1 
ATOM   1278 N N     . MET B 2 157 ? 58.411 28.983  36.476 1.00 73.96  ? 158 MET P N     1 
ATOM   1279 C CA    . MET B 2 157 ? 59.731 28.377  36.287 1.00 74.27  ? 158 MET P CA    1 
ATOM   1280 C C     . MET B 2 157 ? 60.794 29.216  36.988 1.00 75.04  ? 158 MET P C     1 
ATOM   1281 O O     . MET B 2 157 ? 61.635 28.681  37.722 1.00 71.63  ? 158 MET P O     1 
ATOM   1282 C CB    . MET B 2 157 ? 60.069 28.268  34.800 1.00 68.39  ? 158 MET P CB    1 
ATOM   1283 C CG    . MET B 2 157 ? 59.044 27.488  34.030 1.00 62.68  ? 158 MET P CG    1 
ATOM   1284 S SD    . MET B 2 157 ? 59.401 27.400  32.310 1.00 58.16  ? 158 MET P SD    1 
ATOM   1285 C CE    . MET B 2 157 ? 59.897 25.757  32.236 1.00 59.43  ? 158 MET P CE    1 
ATOM   1286 N N     . THR B 2 158 ? 60.740 30.530  36.771 1.00 72.03  ? 159 THR P N     1 
ATOM   1287 C CA    . THR B 2 158 ? 61.681 31.454  37.390 1.00 70.61  ? 159 THR P CA    1 
ATOM   1288 C C     . THR B 2 158 ? 61.769 31.193  38.894 1.00 71.49  ? 159 THR P C     1 
ATOM   1289 O O     . THR B 2 158 ? 62.849 30.917  39.425 1.00 72.66  ? 159 THR P O     1 
ATOM   1290 C CB    . THR B 2 158 ? 61.241 32.898  37.159 1.00 61.86  ? 159 THR P CB    1 
ATOM   1291 O OG1   . THR B 2 158 ? 61.254 33.175  35.755 1.00 65.08  ? 159 THR P OG1   1 
ATOM   1292 C CG2   . THR B 2 158 ? 62.156 33.858  37.873 1.00 53.02  ? 159 THR P CG2   1 
ATOM   1293 N N     . GLU B 2 159 ? 60.618 31.204  39.559 1.00 69.30  ? 160 GLU P N     1 
ATOM   1294 C CA    . GLU B 2 159 ? 60.568 30.976  40.992 1.00 68.96  ? 160 GLU P CA    1 
ATOM   1295 C C     . GLU B 2 159 ? 61.179 29.653  41.449 1.00 68.91  ? 160 GLU P C     1 
ATOM   1296 O O     . GLU B 2 159 ? 62.015 29.645  42.346 1.00 70.41  ? 160 GLU P O     1 
ATOM   1297 C CB    . GLU B 2 159 ? 59.135 31.133  41.514 1.00 80.50  ? 160 GLU P CB    1 
ATOM   1298 C CG    . GLU B 2 159 ? 58.884 32.453  42.241 1.00 89.52  ? 160 GLU P CG    1 
ATOM   1299 C CD    . GLU B 2 159 ? 59.577 32.525  43.614 1.00 100.14 ? 160 GLU P CD    1 
ATOM   1300 O OE1   . GLU B 2 159 ? 60.789 32.203  43.715 1.00 107.47 ? 160 GLU P OE1   1 
ATOM   1301 O OE2   . GLU B 2 159 ? 58.900 32.906  44.601 1.00 105.80 ? 160 GLU P OE2   1 
ATOM   1302 N N     . ALA B 2 160 ? 60.798 28.541  40.827 1.00 71.17  ? 161 ALA P N     1 
ATOM   1303 C CA    . ALA B 2 160 ? 61.341 27.224  41.188 1.00 71.58  ? 161 ALA P CA    1 
ATOM   1304 C C     . ALA B 2 160 ? 62.846 27.119  40.963 1.00 72.29  ? 161 ALA P C     1 
ATOM   1305 O O     . ALA B 2 160 ? 63.507 26.289  41.591 1.00 70.99  ? 161 ALA P O     1 
ATOM   1306 C CB    . ALA B 2 160 ? 60.631 26.130  40.427 1.00 75.75  ? 161 ALA P CB    1 
ATOM   1307 N N     . CYS B 2 161 ? 63.362 27.909  40.017 1.00 71.37  ? 162 CYS P N     1 
ATOM   1308 C CA    . CYS B 2 161 ? 64.797 27.962  39.704 1.00 68.68  ? 162 CYS P CA    1 
ATOM   1309 C C     . CYS B 2 161 ? 65.481 28.687  40.858 1.00 66.51  ? 162 CYS P C     1 
ATOM   1310 O O     . CYS B 2 161 ? 66.538 28.284  41.336 1.00 64.72  ? 162 CYS P O     1 
ATOM   1311 C CB    . CYS B 2 161 ? 65.050 28.764  38.424 1.00 66.77  ? 162 CYS P CB    1 
ATOM   1312 S SG    . CYS B 2 161 ? 65.086 27.825  36.900 1.00 81.49  ? 162 CYS P SG    1 
ATOM   1313 N N     . ILE B 2 162 ? 64.853 29.781  41.272 1.00 63.93  ? 163 ILE P N     1 
ATOM   1314 C CA    . ILE B 2 162 ? 65.313 30.621  42.368 1.00 61.89  ? 163 ILE P CA    1 
ATOM   1315 C C     . ILE B 2 162 ? 65.143 29.917  43.717 1.00 65.15  ? 163 ILE P C     1 
ATOM   1316 O O     . ILE B 2 162 ? 65.841 30.241  44.682 1.00 65.61  ? 163 ILE P O     1 
ATOM   1317 C CB    . ILE B 2 162 ? 64.509 31.923  42.373 1.00 57.77  ? 163 ILE P CB    1 
ATOM   1318 C CG1   . ILE B 2 162 ? 64.966 32.823  41.224 1.00 61.76  ? 163 ILE P CG1   1 
ATOM   1319 C CG2   . ILE B 2 162 ? 64.545 32.574  43.728 1.00 41.36  ? 163 ILE P CG2   1 
ATOM   1320 C CD1   . ILE B 2 162 ? 64.139 34.096  41.058 1.00 49.72  ? 163 ILE P CD1   1 
ATOM   1321 N N     . ARG B 2 163 ? 64.185 28.994  43.788 1.00 70.63  ? 164 ARG P N     1 
ATOM   1322 C CA    . ARG B 2 163 ? 63.909 28.233  45.009 1.00 74.70  ? 164 ARG P CA    1 
ATOM   1323 C C     . ARG B 2 163 ? 64.587 26.859  45.009 1.00 75.07  ? 164 ARG P C     1 
ATOM   1324 O O     . ARG B 2 163 ? 64.616 26.177  46.037 1.00 73.27  ? 164 ARG P O     1 
ATOM   1325 C CB    . ARG B 2 163 ? 62.392 28.073  45.238 1.00 72.86  ? 164 ARG P CB    1 
ATOM   1326 C CG    . ARG B 2 163 ? 61.677 29.347  45.712 1.00 84.50  ? 164 ARG P CG    1 
ATOM   1327 C CD    . ARG B 2 163 ? 60.209 29.085  46.063 1.00 102.28 ? 164 ARG P CD    1 
ATOM   1328 N NE    . ARG B 2 163 ? 59.486 30.306  46.438 1.00 109.86 ? 164 ARG P NE    1 
ATOM   1329 C CZ    . ARG B 2 163 ? 58.162 30.399  46.549 1.00 114.31 ? 164 ARG P CZ    1 
ATOM   1330 N NH1   . ARG B 2 163 ? 57.398 29.343  46.310 1.00 119.87 ? 164 ARG P NH1   1 
ATOM   1331 N NH2   . ARG B 2 163 ? 57.596 31.557  46.869 1.00 106.93 ? 164 ARG P NH2   1 
ATOM   1332 N N     . GLY B 2 164 ? 65.108 26.457  43.850 1.00 76.14  ? 165 GLY P N     1 
ATOM   1333 C CA    . GLY B 2 164 ? 65.785 25.177  43.720 1.00 76.79  ? 165 GLY P CA    1 
ATOM   1334 C C     . GLY B 2 164 ? 64.833 24.003  43.780 1.00 78.38  ? 165 GLY P C     1 
ATOM   1335 O O     . GLY B 2 164 ? 65.209 22.885  44.154 1.00 78.38  ? 165 GLY P O     1 
ATOM   1336 N N     . TYR B 2 165 ? 63.599 24.239  43.366 1.00 77.51  ? 166 TYR P N     1 
ATOM   1337 C CA    . TYR B 2 165 ? 62.609 23.193  43.404 1.00 76.19  ? 166 TYR P CA    1 
ATOM   1338 C C     . TYR B 2 165 ? 62.564 22.381  42.125 1.00 73.64  ? 166 TYR P C     1 
ATOM   1339 O O     . TYR B 2 165 ? 61.784 22.641  41.216 1.00 72.53  ? 166 TYR P O     1 
ATOM   1340 C CB    . TYR B 2 165 ? 61.255 23.781  43.795 1.00 84.02  ? 166 TYR P CB    1 
ATOM   1341 C CG    . TYR B 2 165 ? 61.203 24.248  45.253 1.00 86.03  ? 166 TYR P CG    1 
ATOM   1342 C CD1   . TYR B 2 165 ? 62.201 23.880  46.173 1.00 81.13  ? 166 TYR P CD1   1 
ATOM   1343 C CD2   . TYR B 2 165 ? 60.139 25.031  45.722 1.00 86.93  ? 166 TYR P CD2   1 
ATOM   1344 C CE1   . TYR B 2 165 ? 62.133 24.279  47.511 1.00 79.31  ? 166 TYR P CE1   1 
ATOM   1345 C CE2   . TYR B 2 165 ? 60.068 25.432  47.060 1.00 89.65  ? 166 TYR P CE2   1 
ATOM   1346 C CZ    . TYR B 2 165 ? 61.064 25.050  47.936 1.00 84.45  ? 166 TYR P CZ    1 
ATOM   1347 O OH    . TYR B 2 165 ? 60.974 25.443  49.238 1.00 88.84  ? 166 TYR P OH    1 
ATOM   1348 N N     . ASN B 2 166 ? 63.501 21.445  42.048 1.00 72.66  ? 167 ASN P N     1 
ATOM   1349 C CA    . ASN B 2 166 ? 63.640 20.544  40.915 1.00 69.55  ? 167 ASN P CA    1 
ATOM   1350 C C     . ASN B 2 166 ? 63.676 21.238  39.568 1.00 67.69  ? 167 ASN P C     1 
ATOM   1351 O O     . ASN B 2 166 ? 63.039 20.784  38.615 1.00 59.27  ? 167 ASN P O     1 
ATOM   1352 C CB    . ASN B 2 166 ? 62.518 19.514  40.920 1.00 67.37  ? 167 ASN P CB    1 
ATOM   1353 C CG    . ASN B 2 166 ? 62.384 18.821  42.250 1.00 66.84  ? 167 ASN P CG    1 
ATOM   1354 O OD1   . ASN B 2 166 ? 61.917 19.416  43.218 1.00 69.06  ? 167 ASN P OD1   1 
ATOM   1355 N ND2   . ASN B 2 166 ? 62.824 17.572  42.321 1.00 60.77  ? 167 ASN P ND2   1 
ATOM   1356 N N     . PRO B 2 167 ? 64.466 22.317  39.451 1.00 69.22  ? 168 PRO P N     1 
ATOM   1357 C CA    . PRO B 2 167 ? 64.547 23.032  38.173 1.00 68.54  ? 168 PRO P CA    1 
ATOM   1358 C C     . PRO B 2 167 ? 65.166 22.185  37.042 1.00 71.02  ? 168 PRO P C     1 
ATOM   1359 O O     . PRO B 2 167 ? 64.790 22.333  35.873 1.00 69.87  ? 168 PRO P O     1 
ATOM   1360 C CB    . PRO B 2 167 ? 65.391 24.262  38.525 1.00 66.11  ? 168 PRO P CB    1 
ATOM   1361 C CG    . PRO B 2 167 ? 66.286 23.754  39.631 1.00 78.00  ? 168 PRO P CG    1 
ATOM   1362 C CD    . PRO B 2 167 ? 65.335 22.943  40.467 1.00 71.77  ? 168 PRO P CD    1 
ATOM   1363 N N     . GLY B 2 168 ? 66.085 21.283  37.394 1.00 72.38  ? 169 GLY P N     1 
ATOM   1364 C CA    . GLY B 2 168 ? 66.712 20.432  36.396 1.00 75.79  ? 169 GLY P CA    1 
ATOM   1365 C C     . GLY B 2 168 ? 65.673 19.538  35.753 1.00 79.07  ? 169 GLY P C     1 
ATOM   1366 O O     . GLY B 2 168 ? 65.665 19.328  34.541 1.00 78.31  ? 169 GLY P O     1 
ATOM   1367 N N     . LEU B 2 169 ? 64.782 19.021  36.588 1.00 82.23  ? 170 LEU P N     1 
ATOM   1368 C CA    . LEU B 2 169 ? 63.699 18.156  36.145 1.00 80.93  ? 170 LEU P CA    1 
ATOM   1369 C C     . LEU B 2 169 ? 62.646 18.953  35.370 1.00 78.72  ? 170 LEU P C     1 
ATOM   1370 O O     . LEU B 2 169 ? 62.486 18.777  34.165 1.00 80.00  ? 170 LEU P O     1 
ATOM   1371 C CB    . LEU B 2 169 ? 63.029 17.502  37.363 1.00 80.27  ? 170 LEU P CB    1 
ATOM   1372 C CG    . LEU B 2 169 ? 63.389 16.100  37.862 1.00 84.65  ? 170 LEU P CG    1 
ATOM   1373 C CD1   . LEU B 2 169 ? 62.366 15.107  37.344 1.00 87.46  ? 170 LEU P CD1   1 
ATOM   1374 C CD2   . LEU B 2 169 ? 64.811 15.706  37.461 1.00 94.48  ? 170 LEU P CD2   1 
ATOM   1375 N N     . LEU B 2 170 ? 62.007 19.890  36.073 1.00 75.05  ? 171 LEU P N     1 
ATOM   1376 C CA    . LEU B 2 170 ? 60.910 20.719  35.560 1.00 72.29  ? 171 LEU P CA    1 
ATOM   1377 C C     . LEU B 2 170 ? 61.126 21.847  34.538 1.00 74.36  ? 171 LEU P C     1 
ATOM   1378 O O     . LEU B 2 170 ? 60.139 22.369  34.002 1.00 72.89  ? 171 LEU P O     1 
ATOM   1379 C CB    . LEU B 2 170 ? 60.146 21.311  36.740 1.00 67.78  ? 171 LEU P CB    1 
ATOM   1380 C CG    . LEU B 2 170 ? 59.890 20.412  37.936 1.00 57.06  ? 171 LEU P CG    1 
ATOM   1381 C CD1   . LEU B 2 170 ? 59.328 21.242  39.041 1.00 65.69  ? 171 LEU P CD1   1 
ATOM   1382 C CD2   . LEU B 2 170 ? 58.952 19.302  37.559 1.00 52.30  ? 171 LEU P CD2   1 
ATOM   1383 N N     . VAL B 2 171 ? 62.362 22.296  34.328 1.00 75.52  ? 172 VAL P N     1 
ATOM   1384 C CA    . VAL B 2 171 ? 62.606 23.379  33.370 1.00 71.96  ? 172 VAL P CA    1 
ATOM   1385 C C     . VAL B 2 171 ? 63.591 22.962  32.271 1.00 75.74  ? 172 VAL P C     1 
ATOM   1386 O O     . VAL B 2 171 ? 63.221 22.845  31.096 1.00 73.76  ? 172 VAL P O     1 
ATOM   1387 C CB    . VAL B 2 171 ? 63.105 24.659  34.082 1.00 63.68  ? 172 VAL P CB    1 
ATOM   1388 C CG1   . VAL B 2 171 ? 63.263 25.781  33.096 1.00 61.54  ? 172 VAL P CG1   1 
ATOM   1389 C CG2   . VAL B 2 171 ? 62.139 25.069  35.166 1.00 64.87  ? 172 VAL P CG2   1 
ATOM   1390 N N     . HIS B 2 172 ? 64.844 22.730  32.656 1.00 77.19  ? 173 HIS P N     1 
ATOM   1391 C CA    . HIS B 2 172 ? 65.883 22.322  31.710 1.00 75.94  ? 173 HIS P CA    1 
ATOM   1392 C C     . HIS B 2 172 ? 66.964 21.582  32.490 1.00 76.47  ? 173 HIS P C     1 
ATOM   1393 O O     . HIS B 2 172 ? 67.457 22.091  33.500 1.00 72.87  ? 173 HIS P O     1 
ATOM   1394 C CB    . HIS B 2 172 ? 66.495 23.556  31.014 1.00 75.48  ? 173 HIS P CB    1 
ATOM   1395 C CG    . HIS B 2 172 ? 67.382 23.230  29.845 1.00 77.69  ? 173 HIS P CG    1 
ATOM   1396 N ND1   . HIS B 2 172 ? 67.092 23.631  28.558 1.00 84.53  ? 173 HIS P ND1   1 
ATOM   1397 C CD2   . HIS B 2 172 ? 68.547 22.540  29.766 1.00 65.25  ? 173 HIS P CD2   1 
ATOM   1398 C CE1   . HIS B 2 172 ? 68.035 23.200  27.739 1.00 82.81  ? 173 HIS P CE1   1 
ATOM   1399 N NE2   . HIS B 2 172 ? 68.930 22.535  28.448 1.00 70.36  ? 173 HIS P NE2   1 
ATOM   1400 N N     . PRO B 2 173 ? 67.394 20.402  31.993 1.00 79.76  ? 174 PRO P N     1 
ATOM   1401 C CA    . PRO B 2 173 ? 68.435 19.601  32.661 1.00 80.29  ? 174 PRO P CA    1 
ATOM   1402 C C     . PRO B 2 173 ? 69.741 20.367  32.946 1.00 80.20  ? 174 PRO P C     1 
ATOM   1403 O O     . PRO B 2 173 ? 70.504 19.994  33.838 1.00 77.59  ? 174 PRO P O     1 
ATOM   1404 C CB    . PRO B 2 173 ? 68.641 18.416  31.700 1.00 72.83  ? 174 PRO P CB    1 
ATOM   1405 C CG    . PRO B 2 173 ? 68.129 18.933  30.365 1.00 75.37  ? 174 PRO P CG    1 
ATOM   1406 C CD    . PRO B 2 173 ? 66.919 19.735  30.766 1.00 75.89  ? 174 PRO P CD    1 
ATOM   1407 N N     . ASP B 2 174 ? 69.957 21.468  32.223 1.00 80.41  ? 175 ASP P N     1 
ATOM   1408 C CA    . ASP B 2 174 ? 71.142 22.310  32.380 1.00 80.39  ? 175 ASP P CA    1 
ATOM   1409 C C     . ASP B 2 174 ? 71.102 23.218  33.599 1.00 79.87  ? 175 ASP P C     1 
ATOM   1410 O O     . ASP B 2 174 ? 72.091 23.876  33.918 1.00 84.20  ? 175 ASP P O     1 
ATOM   1411 C CB    . ASP B 2 174 ? 71.378 23.171  31.137 1.00 81.28  ? 175 ASP P CB    1 
ATOM   1412 C CG    . ASP B 2 174 ? 72.079 22.418  30.025 1.00 82.23  ? 175 ASP P CG    1 
ATOM   1413 O OD1   . ASP B 2 174 ? 72.419 21.227  30.207 1.00 74.92  ? 175 ASP P OD1   1 
ATOM   1414 O OD2   . ASP B 2 174 ? 72.300 23.033  28.962 1.00 90.43  ? 175 ASP P OD2   1 
ATOM   1415 N N     . LEU B 2 175 ? 69.953 23.302  34.254 1.00 74.71  ? 176 LEU P N     1 
ATOM   1416 C CA    . LEU B 2 175 ? 69.853 24.136  35.438 1.00 70.47  ? 176 LEU P CA    1 
ATOM   1417 C C     . LEU B 2 175 ? 69.926 23.275  36.703 1.00 70.10  ? 176 LEU P C     1 
ATOM   1418 O O     . LEU B 2 175 ? 69.618 23.745  37.800 1.00 67.58  ? 176 LEU P O     1 
ATOM   1419 C CB    . LEU B 2 175 ? 68.573 24.966  35.386 1.00 67.60  ? 176 LEU P CB    1 
ATOM   1420 C CG    . LEU B 2 175 ? 68.451 25.814  34.117 1.00 61.33  ? 176 LEU P CG    1 
ATOM   1421 C CD1   . LEU B 2 175 ? 67.197 26.655  34.176 1.00 47.83  ? 176 LEU P CD1   1 
ATOM   1422 C CD2   . LEU B 2 175 ? 69.680 26.689  33.961 1.00 48.42  ? 176 LEU P CD2   1 
ATOM   1423 N N     . ALA B 2 176 ? 70.392 22.031  36.539 1.00 73.47  ? 177 ALA P N     1 
ATOM   1424 C CA    . ALA B 2 176 ? 70.533 21.047  37.627 1.00 73.95  ? 177 ALA P CA    1 
ATOM   1425 C C     . ALA B 2 176 ? 71.327 21.571  38.812 1.00 76.68  ? 177 ALA P C     1 
ATOM   1426 O O     . ALA B 2 176 ? 71.045 21.229  39.958 1.00 78.19  ? 177 ALA P O     1 
ATOM   1427 C CB    . ALA B 2 176 ? 71.173 19.766  37.106 1.00 66.26  ? 177 ALA P CB    1 
ATOM   1428 N N     . TYR B 2 177 ? 72.333 22.389  38.528 1.00 79.43  ? 178 TYR P N     1 
ATOM   1429 C CA    . TYR B 2 177 ? 73.161 22.985  39.571 1.00 81.77  ? 178 TYR P CA    1 
ATOM   1430 C C     . TYR B 2 177 ? 72.326 23.883  40.493 1.00 87.03  ? 178 TYR P C     1 
ATOM   1431 O O     . TYR B 2 177 ? 72.582 23.974  41.698 1.00 88.37  ? 178 TYR P O     1 
ATOM   1432 C CB    . TYR B 2 177 ? 74.291 23.795  38.936 1.00 72.41  ? 178 TYR P CB    1 
ATOM   1433 C CG    . TYR B 2 177 ? 73.825 24.892  38.005 1.00 69.17  ? 178 TYR P CG    1 
ATOM   1434 C CD1   . TYR B 2 177 ? 73.408 26.128  38.500 1.00 66.39  ? 178 TYR P CD1   1 
ATOM   1435 C CD2   . TYR B 2 177 ? 73.820 24.703  36.630 1.00 67.52  ? 178 TYR P CD2   1 
ATOM   1436 C CE1   . TYR B 2 177 ? 73.002 27.142  37.650 1.00 76.48  ? 178 TYR P CE1   1 
ATOM   1437 C CE2   . TYR B 2 177 ? 73.416 25.716  35.772 1.00 83.37  ? 178 TYR P CE2   1 
ATOM   1438 C CZ    . TYR B 2 177 ? 73.009 26.931  36.289 1.00 82.73  ? 178 TYR P CZ    1 
ATOM   1439 O OH    . TYR B 2 177 ? 72.628 27.940  35.446 1.00 86.33  ? 178 TYR P OH    1 
ATOM   1440 N N     . LEU B 2 178 ? 71.320 24.539  39.917 1.00 89.92  ? 179 LEU P N     1 
ATOM   1441 C CA    . LEU B 2 178 ? 70.439 25.418  40.669 1.00 90.64  ? 179 LEU P CA    1 
ATOM   1442 C C     . LEU B 2 178 ? 69.628 24.670  41.719 1.00 94.11  ? 179 LEU P C     1 
ATOM   1443 O O     . LEU B 2 178 ? 68.818 25.268  42.416 1.00 96.39  ? 179 LEU P O     1 
ATOM   1444 C CB    . LEU B 2 178 ? 69.494 26.172  39.741 1.00 80.61  ? 179 LEU P CB    1 
ATOM   1445 C CG    . LEU B 2 178 ? 70.052 27.459  39.150 1.00 76.54  ? 179 LEU P CG    1 
ATOM   1446 C CD1   . LEU B 2 178 ? 69.039 28.027  38.193 1.00 73.38  ? 179 LEU P CD1   1 
ATOM   1447 C CD2   . LEU B 2 178 ? 70.380 28.460  40.248 1.00 78.59  ? 179 LEU P CD2   1 
ATOM   1448 N N     . GLN B 2 179 ? 69.808 23.358  41.795 1.00 94.30  ? 180 GLN P N     1 
ATOM   1449 C CA    . GLN B 2 179 ? 69.115 22.549  42.778 1.00 95.66  ? 180 GLN P CA    1 
ATOM   1450 C C     . GLN B 2 179 ? 69.496 23.070  44.176 1.00 97.04  ? 180 GLN P C     1 
ATOM   1451 O O     . GLN B 2 179 ? 70.679 23.271  44.460 1.00 97.47  ? 180 GLN P O     1 
ATOM   1452 C CB    . GLN B 2 179 ? 69.546 21.096  42.634 1.00 98.04  ? 180 GLN P CB    1 
ATOM   1453 C CG    . GLN B 2 179 ? 68.854 20.135  43.569 1.00 106.82 ? 180 GLN P CG    1 
ATOM   1454 C CD    . GLN B 2 179 ? 69.482 18.746  43.526 1.00 110.74 ? 180 GLN P CD    1 
ATOM   1455 O OE1   . GLN B 2 179 ? 70.435 18.494  42.769 1.00 106.54 ? 180 GLN P OE1   1 
ATOM   1456 N NE2   . GLN B 2 179 ? 68.957 17.836  44.347 1.00 113.71 ? 180 GLN P NE2   1 
ATOM   1457 N N     . ALA B 2 180 ? 68.487 23.315  45.019 1.00 98.93  ? 181 ALA P N     1 
ATOM   1458 C CA    . ALA B 2 180 ? 68.663 23.826  46.392 1.00 99.58  ? 181 ALA P CA    1 
ATOM   1459 C C     . ALA B 2 180 ? 69.463 25.138  46.470 1.00 102.45 ? 181 ALA P C     1 
ATOM   1460 O O     . ALA B 2 180 ? 70.047 25.468  47.520 1.00 102.97 ? 181 ALA P O     1 
ATOM   1461 C CB    . ALA B 2 180 ? 69.299 22.746  47.300 1.00 101.14 ? 181 ALA P CB    1 
ATOM   1462 N N     . GLU B 2 181 ? 69.458 25.881  45.359 1.00 104.28 ? 182 GLU P N     1 
ATOM   1463 C CA    . GLU B 2 181 ? 70.170 27.161  45.210 1.00 106.95 ? 182 GLU P CA    1 
ATOM   1464 C C     . GLU B 2 181 ? 69.397 28.113  44.271 1.00 107.19 ? 182 GLU P C     1 
ATOM   1465 O O     . GLU B 2 181 ? 68.342 27.747  43.743 1.00 108.85 ? 182 GLU P O     1 
ATOM   1466 C CB    . GLU B 2 181 ? 71.564 26.913  44.630 1.00 104.19 ? 182 GLU P CB    1 
ATOM   1467 C CG    . GLU B 2 181 ? 72.472 26.063  45.503 1.00 103.16 ? 182 GLU P CG    1 
ATOM   1468 C CD    . GLU B 2 181 ? 73.603 25.419  44.712 1.00 104.48 ? 182 GLU P CD    1 
ATOM   1469 O OE1   . GLU B 2 181 ? 73.956 25.953  43.627 1.00 109.06 ? 182 GLU P OE1   1 
ATOM   1470 O OE2   . GLU B 2 181 ? 74.127 24.375  45.176 1.00 107.59 ? 182 GLU P OE2   1 
ATOM   1471 N N     . GLY B 2 182 ? 69.917 29.324  44.066 1.00 104.78 ? 183 GLY P N     1 
ATOM   1472 C CA    . GLY B 2 182 ? 69.239 30.266  43.191 1.00 102.44 ? 183 GLY P CA    1 
ATOM   1473 C C     . GLY B 2 182 ? 69.236 31.719  43.640 1.00 102.16 ? 183 GLY P C     1 
ATOM   1474 O O     . GLY B 2 182 ? 69.422 32.608  42.809 1.00 102.61 ? 183 GLY P O     1 
ATOM   1475 N N     . GLY B 2 183 ? 68.996 31.963  44.931 1.00 101.78 ? 184 GLY P N     1 
ATOM   1476 C CA    . GLY B 2 183 ? 68.985 33.319  45.471 1.00 102.99 ? 184 GLY P CA    1 
ATOM   1477 C C     . GLY B 2 183 ? 67.976 34.243  44.798 1.00 105.45 ? 184 GLY P C     1 
ATOM   1478 O O     . GLY B 2 183 ? 68.261 34.797  43.731 1.00 106.12 ? 184 GLY P O     1 
ATOM   1479 N N     . GLY B 2 184 ? 66.829 34.449  45.455 1.00 108.81 ? 185 GLY P N     1 
ATOM   1480 C CA    . GLY B 2 184 ? 65.728 35.275  44.943 1.00 109.62 ? 185 GLY P CA    1 
ATOM   1481 C C     . GLY B 2 184 ? 65.963 36.541  44.123 1.00 110.96 ? 185 GLY P C     1 
ATOM   1482 O O     . GLY B 2 184 ? 66.029 37.635  44.700 1.00 112.44 ? 185 GLY P O     1 
ATOM   1483 N N     . ASP B 2 185 ? 65.995 36.406  42.789 1.00 110.33 ? 186 ASP P N     1 
ATOM   1484 C CA    . ASP B 2 185 ? 66.237 37.515  41.844 1.00 111.03 ? 186 ASP P CA    1 
ATOM   1485 C C     . ASP B 2 185 ? 67.714 37.955  41.927 1.00 111.73 ? 186 ASP P C     1 
ATOM   1486 O O     . ASP B 2 185 ? 68.402 38.108  40.903 1.00 111.96 ? 186 ASP P O     1 
ATOM   1487 C CB    . ASP B 2 185 ? 65.284 38.697  42.125 1.00 109.40 ? 186 ASP P CB    1 
ATOM   1488 C CG    . ASP B 2 185 ? 65.317 39.775  41.034 1.00 108.23 ? 186 ASP P CG    1 
ATOM   1489 O OD1   . ASP B 2 185 ? 64.788 39.524  39.924 1.00 102.17 ? 186 ASP P OD1   1 
ATOM   1490 O OD2   . ASP B 2 185 ? 65.861 40.876  41.293 1.00 103.13 ? 186 ASP P OD2   1 
ATOM   1491 N N     . ARG B 2 186 ? 68.191 38.080  43.167 1.00 110.71 ? 187 ARG P N     1 
ATOM   1492 C CA    . ARG B 2 186 ? 69.555 38.470  43.514 1.00 110.00 ? 187 ARG P CA    1 
ATOM   1493 C C     . ARG B 2 186 ? 70.584 37.624  42.771 1.00 108.69 ? 187 ARG P C     1 
ATOM   1494 O O     . ARG B 2 186 ? 71.520 38.158  42.161 1.00 109.87 ? 187 ARG P O     1 
ATOM   1495 C CB    . ARG B 2 186 ? 69.800 38.282  45.028 1.00 114.35 ? 187 ARG P CB    1 
ATOM   1496 C CG    . ARG B 2 186 ? 68.760 38.888  45.959 1.00 118.19 ? 187 ARG P CG    1 
ATOM   1497 C CD    . ARG B 2 186 ? 68.693 40.402  45.793 1.00 127.37 ? 187 ARG P CD    1 
ATOM   1498 N NE    . ARG B 2 186 ? 67.837 41.005  46.809 1.00 125.64 ? 187 ARG P NE    1 
ATOM   1499 C CZ    . ARG B 2 186 ? 68.257 41.368  48.017 1.00 128.10 ? 187 ARG P CZ    1 
ATOM   1500 N NH1   . ARG B 2 186 ? 69.527 41.189  48.362 1.00 128.62 ? 187 ARG P NH1   1 
ATOM   1501 N NH2   . ARG B 2 186 ? 67.402 41.901  48.884 1.00 123.10 ? 187 ARG P NH2   1 
ATOM   1502 N N     . GLN B 2 187 ? 70.416 36.304  42.863 1.00 104.72 ? 188 GLN P N     1 
ATOM   1503 C CA    . GLN B 2 187 ? 71.332 35.350  42.252 1.00 100.78 ? 188 GLN P CA    1 
ATOM   1504 C C     . GLN B 2 187 ? 70.889 34.733  40.916 1.00 95.08  ? 188 GLN P C     1 
ATOM   1505 O O     . GLN B 2 187 ? 71.660 34.003  40.295 1.00 95.64  ? 188 GLN P O     1 
ATOM   1506 C CB    . GLN B 2 187 ? 71.713 34.250  43.263 1.00 105.59 ? 188 GLN P CB    1 
ATOM   1507 C CG    . GLN B 2 187 ? 73.220 34.110  43.577 1.00 102.29 ? 188 GLN P CG    1 
ATOM   1508 C CD    . GLN B 2 187 ? 73.652 34.870  44.834 1.00 100.34 ? 188 GLN P CD    1 
ATOM   1509 O OE1   . GLN B 2 187 ? 73.323 34.482  45.959 1.00 95.47  ? 188 GLN P OE1   1 
ATOM   1510 N NE2   . GLN B 2 187 ? 74.397 35.950  44.644 1.00 107.11 ? 188 GLN P NE2   1 
ATOM   1511 N N     . LEU B 2 188 ? 69.665 34.977  40.467 1.00 90.55  ? 189 LEU P N     1 
ATOM   1512 C CA    . LEU B 2 188 ? 69.282 34.406  39.180 1.00 90.19  ? 189 LEU P CA    1 
ATOM   1513 C C     . LEU B 2 188 ? 69.810 35.353  38.102 1.00 91.46  ? 189 LEU P C     1 
ATOM   1514 O O     . LEU B 2 188 ? 69.390 36.512  38.011 1.00 93.22  ? 189 LEU P O     1 
ATOM   1515 C CB    . LEU B 2 188 ? 67.765 34.214  39.056 1.00 89.27  ? 189 LEU P CB    1 
ATOM   1516 C CG    . LEU B 2 188 ? 67.325 33.184  38.000 1.00 73.61  ? 189 LEU P CG    1 
ATOM   1517 C CD1   . LEU B 2 188 ? 67.450 31.777  38.543 1.00 63.31  ? 189 LEU P CD1   1 
ATOM   1518 C CD2   . LEU B 2 188 ? 65.900 33.427  37.595 1.00 69.75  ? 189 LEU P CD2   1 
ATOM   1519 N N     . GLY B 2 189 ? 70.775 34.865  37.328 1.00 91.03  ? 190 GLY P N     1 
ATOM   1520 C CA    . GLY B 2 189 ? 71.382 35.674  36.287 1.00 90.80  ? 190 GLY P CA    1 
ATOM   1521 C C     . GLY B 2 189 ? 70.805 35.505  34.897 1.00 91.11  ? 190 GLY P C     1 
ATOM   1522 O O     . GLY B 2 189 ? 69.968 34.632  34.657 1.00 89.90  ? 190 GLY P O     1 
ATOM   1523 N N     . ASP B 2 190 ? 71.341 36.289  33.964 1.00 91.69  ? 191 ASP P N     1 
ATOM   1524 C CA    . ASP B 2 190 ? 70.911 36.303  32.559 1.00 93.36  ? 191 ASP P CA    1 
ATOM   1525 C C     . ASP B 2 190 ? 70.865 34.953  31.839 1.00 91.93  ? 191 ASP P C     1 
ATOM   1526 O O     . ASP B 2 190 ? 69.933 34.688  31.076 1.00 94.56  ? 191 ASP P O     1 
ATOM   1527 C CB    . ASP B 2 190 ? 71.777 37.277  31.744 1.00 97.45  ? 191 ASP P CB    1 
ATOM   1528 C CG    . ASP B 2 190 ? 71.722 38.716  32.268 1.00 103.48 ? 191 ASP P CG    1 
ATOM   1529 O OD1   . ASP B 2 190 ? 71.126 38.963  33.346 1.00 105.27 ? 191 ASP P OD1   1 
ATOM   1530 O OD2   . ASP B 2 190 ? 72.288 39.605  31.589 1.00 103.51 ? 191 ASP P OD2   1 
ATOM   1531 N N     . ARG B 2 191 ? 71.883 34.124  32.043 1.00 92.49  ? 192 ARG P N     1 
ATOM   1532 C CA    . ARG B 2 191 ? 71.931 32.817  31.398 1.00 93.03  ? 192 ARG P CA    1 
ATOM   1533 C C     . ARG B 2 191 ? 70.710 31.981  31.770 1.00 93.21  ? 192 ARG P C     1 
ATOM   1534 O O     . ARG B 2 191 ? 69.945 31.571  30.889 1.00 94.65  ? 192 ARG P O     1 
ATOM   1535 C CB    . ARG B 2 191 ? 73.231 32.083  31.752 1.00 91.05  ? 192 ARG P CB    1 
ATOM   1536 C CG    . ARG B 2 191 ? 73.220 30.581  31.493 1.00 82.96  ? 192 ARG P CG    1 
ATOM   1537 C CD    . ARG B 2 191 ? 72.944 30.212  30.042 1.00 71.25  ? 192 ARG P CD    1 
ATOM   1538 N NE    . ARG B 2 191 ? 72.957 28.760  29.881 1.00 75.19  ? 192 ARG P NE    1 
ATOM   1539 C CZ    . ARG B 2 191 ? 72.800 28.123  28.724 1.00 84.69  ? 192 ARG P CZ    1 
ATOM   1540 N NH1   . ARG B 2 191 ? 72.613 28.810  27.602 1.00 86.84  ? 192 ARG P NH1   1 
ATOM   1541 N NH2   . ARG B 2 191 ? 72.857 26.794  28.688 1.00 75.45  ? 192 ARG P NH2   1 
ATOM   1542 N N     . GLU B 2 192 ? 70.513 31.756  33.070 1.00 90.50  ? 193 GLU P N     1 
ATOM   1543 C CA    . GLU B 2 192 ? 69.374 30.970  33.539 1.00 88.25  ? 193 GLU P CA    1 
ATOM   1544 C C     . GLU B 2 192 ? 68.068 31.563  33.031 1.00 88.66  ? 193 GLU P C     1 
ATOM   1545 O O     . GLU B 2 192 ? 67.165 30.829  32.629 1.00 88.86  ? 193 GLU P O     1 
ATOM   1546 C CB    . GLU B 2 192 ? 69.338 30.838  35.076 1.00 86.26  ? 193 GLU P CB    1 
ATOM   1547 C CG    . GLU B 2 192 ? 70.241 31.780  35.883 1.00 90.38  ? 193 GLU P CG    1 
ATOM   1548 C CD    . GLU B 2 192 ? 71.542 31.125  36.338 1.00 88.82  ? 193 GLU P CD    1 
ATOM   1549 O OE1   . GLU B 2 192 ? 72.367 30.786  35.469 1.00 93.89  ? 193 GLU P OE1   1 
ATOM   1550 O OE2   . GLU B 2 192 ? 71.744 30.948  37.561 1.00 97.32  ? 193 GLU P OE2   1 
ATOM   1551 N N     . LYS B 2 193 ? 68.006 32.893  32.979 1.00 87.61  ? 194 LYS P N     1 
ATOM   1552 C CA    . LYS B 2 193 ? 66.817 33.604  32.504 1.00 85.75  ? 194 LYS P CA    1 
ATOM   1553 C C     . LYS B 2 193 ? 66.423 33.238  31.067 1.00 85.00  ? 194 LYS P C     1 
ATOM   1554 O O     . LYS B 2 193 ? 65.260 32.912  30.789 1.00 87.30  ? 194 LYS P O     1 
ATOM   1555 C CB    . LYS B 2 193 ? 67.006 35.127  32.613 1.00 84.70  ? 194 LYS P CB    1 
ATOM   1556 C CG    . LYS B 2 193 ? 67.030 35.679  34.043 1.00 85.13  ? 194 LYS P CG    1 
ATOM   1557 C CD    . LYS B 2 193 ? 67.078 37.201  34.048 1.00 83.74  ? 194 LYS P CD    1 
ATOM   1558 C CE    . LYS B 2 193 ? 67.144 37.754  35.455 1.00 77.02  ? 194 LYS P CE    1 
ATOM   1559 N NZ    . LYS B 2 193 ? 67.151 39.237  35.414 1.00 74.79  ? 194 LYS P NZ    1 
ATOM   1560 N N     . GLU B 2 194 ? 67.378 33.286  30.148 1.00 83.09  ? 195 GLU P N     1 
ATOM   1561 C CA    . GLU B 2 194 ? 67.054 32.954  28.778 1.00 83.90  ? 195 GLU P CA    1 
ATOM   1562 C C     . GLU B 2 194 ? 66.632 31.496  28.652 1.00 81.39  ? 195 GLU P C     1 
ATOM   1563 O O     . GLU B 2 194 ? 65.747 31.178  27.858 1.00 83.15  ? 195 GLU P O     1 
ATOM   1564 C CB    . GLU B 2 194 ? 68.205 33.286  27.830 1.00 89.01  ? 195 GLU P CB    1 
ATOM   1565 C CG    . GLU B 2 194 ? 67.760 33.378  26.362 1.00 92.82  ? 195 GLU P CG    1 
ATOM   1566 C CD    . GLU B 2 194 ? 66.535 34.296  26.139 1.00 93.08  ? 195 GLU P CD    1 
ATOM   1567 O OE1   . GLU B 2 194 ? 66.395 35.340  26.828 1.00 90.20  ? 195 GLU P OE1   1 
ATOM   1568 O OE2   . GLU B 2 194 ? 65.707 33.963  25.262 1.00 93.48  ? 195 GLU P OE2   1 
ATOM   1569 N N     . LEU B 2 195 ? 67.233 30.618  29.455 1.00 78.54  ? 196 LEU P N     1 
ATOM   1570 C CA    . LEU B 2 195 ? 66.875 29.195  29.423 1.00 76.77  ? 196 LEU P CA    1 
ATOM   1571 C C     . LEU B 2 195 ? 65.427 29.010  29.892 1.00 76.16  ? 196 LEU P C     1 
ATOM   1572 O O     . LEU B 2 195 ? 64.699 28.170  29.357 1.00 77.79  ? 196 LEU P O     1 
ATOM   1573 C CB    . LEU B 2 195 ? 67.833 28.338  30.281 1.00 71.67  ? 196 LEU P CB    1 
ATOM   1574 C CG    . LEU B 2 195 ? 69.041 27.659  29.601 1.00 74.22  ? 196 LEU P CG    1 
ATOM   1575 C CD1   . LEU B 2 195 ? 69.796 26.750  30.580 1.00 62.82  ? 196 LEU P CD1   1 
ATOM   1576 C CD2   . LEU B 2 195 ? 68.573 26.850  28.394 1.00 75.65  ? 196 LEU P CD2   1 
ATOM   1577 N N     . ILE B 2 196 ? 65.007 29.822  30.862 1.00 71.89  ? 197 ILE P N     1 
ATOM   1578 C CA    . ILE B 2 196 ? 63.647 29.757  31.389 1.00 63.13  ? 197 ILE P CA    1 
ATOM   1579 C C     . ILE B 2 196 ? 62.685 30.229  30.308 1.00 59.45  ? 197 ILE P C     1 
ATOM   1580 O O     . ILE B 2 196 ? 61.618 29.649  30.127 1.00 56.78  ? 197 ILE P O     1 
ATOM   1581 C CB    . ILE B 2 196 ? 63.505 30.580  32.709 1.00 65.21  ? 197 ILE P CB    1 
ATOM   1582 C CG1   . ILE B 2 196 ? 64.330 29.906  33.821 1.00 52.72  ? 197 ILE P CG1   1 
ATOM   1583 C CG2   . ILE B 2 196 ? 62.038 30.682  33.135 1.00 64.25  ? 197 ILE P CG2   1 
ATOM   1584 C CD1   . ILE B 2 196 ? 64.530 30.735  35.075 1.00 50.78  ? 197 ILE P CD1   1 
ATOM   1585 N N     . ARG B 2 197 ? 63.097 31.232  29.542 1.00 61.06  ? 198 ARG P N     1 
ATOM   1586 C CA    . ARG B 2 197 ? 62.258 31.729  28.463 1.00 66.05  ? 198 ARG P CA    1 
ATOM   1587 C C     . ARG B 2 197 ? 62.129 30.668  27.350 1.00 65.38  ? 198 ARG P C     1 
ATOM   1588 O O     . ARG B 2 197 ? 61.042 30.457  26.802 1.00 65.60  ? 198 ARG P O     1 
ATOM   1589 C CB    . ARG B 2 197 ? 62.813 33.041  27.890 1.00 66.20  ? 198 ARG P CB    1 
ATOM   1590 C CG    . ARG B 2 197 ? 61.917 33.609  26.804 1.00 74.54  ? 198 ARG P CG    1 
ATOM   1591 C CD    . ARG B 2 197 ? 62.408 34.896  26.194 1.00 75.19  ? 198 ARG P CD    1 
ATOM   1592 N NE    . ARG B 2 197 ? 61.427 35.391  25.227 1.00 90.08  ? 198 ARG P NE    1 
ATOM   1593 C CZ    . ARG B 2 197 ? 60.312 36.051  25.548 1.00 98.32  ? 198 ARG P CZ    1 
ATOM   1594 N NH1   . ARG B 2 197 ? 60.025 36.309  26.817 1.00 96.14  ? 198 ARG P NH1   1 
ATOM   1595 N NH2   . ARG B 2 197 ? 59.471 36.446  24.598 1.00 95.18  ? 198 ARG P NH2   1 
ATOM   1596 N N     . GLN B 2 198 ? 63.228 29.970  27.065 1.00 63.02  ? 199 GLN P N     1 
ATOM   1597 C CA    . GLN B 2 198 ? 63.265 28.934  26.021 1.00 67.41  ? 199 GLN P CA    1 
ATOM   1598 C C     . GLN B 2 198 ? 62.382 27.714  26.304 1.00 67.03  ? 199 GLN P C     1 
ATOM   1599 O O     . GLN B 2 198 ? 61.780 27.141  25.393 1.00 69.22  ? 199 GLN P O     1 
ATOM   1600 C CB    . GLN B 2 198 ? 64.713 28.470  25.779 1.00 76.53  ? 199 GLN P CB    1 
ATOM   1601 C CG    . GLN B 2 198 ? 65.684 29.568  25.286 1.00 92.84  ? 199 GLN P CG    1 
ATOM   1602 C CD    . GLN B 2 198 ? 65.471 30.001  23.812 1.00 103.13 ? 199 GLN P CD    1 
ATOM   1603 O OE1   . GLN B 2 198 ? 64.373 29.760  23.237 1.00 100.06 ? 199 GLN P OE1   1 
ATOM   1604 N NE2   . GLN B 2 198 ? 66.422 30.593  23.234 1.00 101.92 ? 199 GLN P NE2   1 
ATOM   1605 N N     . ALA B 2 199 ? 62.330 27.318  27.570 1.00 69.37  ? 200 ALA P N     1 
ATOM   1606 C CA    . ALA B 2 199 ? 61.534 26.176  28.003 1.00 68.21  ? 200 ALA P CA    1 
ATOM   1607 C C     . ALA B 2 199 ? 60.059 26.559  28.024 1.00 68.97  ? 200 ALA P C     1 
ATOM   1608 O O     . ALA B 2 199 ? 59.206 25.796  27.568 1.00 67.13  ? 200 ALA P O     1 
ATOM   1609 C CB    . ALA B 2 199 ? 61.988 25.725  29.389 1.00 61.94  ? 200 ALA P CB    1 
ATOM   1610 N N     . ALA B 2 200 ? 59.769 27.748  28.546 1.00 66.01  ? 201 ALA P N     1 
ATOM   1611 C CA    . ALA B 2 200 ? 58.407 28.246  28.624 1.00 63.44  ? 201 ALA P CA    1 
ATOM   1612 C C     . ALA B 2 200 ? 57.784 28.247  27.237 1.00 64.39  ? 201 ALA P C     1 
ATOM   1613 O O     . ALA B 2 200 ? 56.777 27.583  27.013 1.00 65.92  ? 201 ALA P O     1 
ATOM   1614 C CB    . ALA B 2 200 ? 58.392 29.642  29.219 1.00 65.83  ? 201 ALA P CB    1 
ATOM   1615 N N     . LEU B 2 201 ? 58.420 28.938  26.294 1.00 66.97  ? 202 LEU P N     1 
ATOM   1616 C CA    . LEU B 2 201 ? 57.924 29.022  24.914 1.00 65.28  ? 202 LEU P CA    1 
ATOM   1617 C C     . LEU B 2 201 ? 57.660 27.644  24.337 1.00 63.90  ? 202 LEU P C     1 
ATOM   1618 O O     . LEU B 2 201 ? 56.632 27.410  23.712 1.00 63.13  ? 202 LEU P O     1 
ATOM   1619 C CB    . LEU B 2 201 ? 58.943 29.719  24.016 1.00 64.30  ? 202 LEU P CB    1 
ATOM   1620 C CG    . LEU B 2 201 ? 59.331 31.167  24.279 1.00 65.58  ? 202 LEU P CG    1 
ATOM   1621 C CD1   . LEU B 2 201 ? 60.666 31.421  23.627 1.00 66.10  ? 202 LEU P CD1   1 
ATOM   1622 C CD2   . LEU B 2 201 ? 58.268 32.113  23.756 1.00 63.26  ? 202 LEU P CD2   1 
ATOM   1623 N N     . GLN B 2 202 ? 58.615 26.744  24.531 1.00 66.94  ? 203 GLN P N     1 
ATOM   1624 C CA    . GLN B 2 202 ? 58.512 25.378  24.037 1.00 77.11  ? 203 GLN P CA    1 
ATOM   1625 C C     . GLN B 2 202 ? 57.326 24.601  24.632 1.00 78.85  ? 203 GLN P C     1 
ATOM   1626 O O     . GLN B 2 202 ? 56.600 23.909  23.910 1.00 82.65  ? 203 GLN P O     1 
ATOM   1627 C CB    . GLN B 2 202 ? 59.814 24.635  24.343 1.00 88.29  ? 203 GLN P CB    1 
ATOM   1628 C CG    . GLN B 2 202 ? 59.779 23.131  24.082 1.00 100.75 ? 203 GLN P CG    1 
ATOM   1629 C CD    . GLN B 2 202 ? 61.009 22.412  24.636 1.00 115.85 ? 203 GLN P CD    1 
ATOM   1630 O OE1   . GLN B 2 202 ? 61.773 22.978  25.429 1.00 124.21 ? 203 GLN P OE1   1 
ATOM   1631 N NE2   . GLN B 2 202 ? 61.201 21.156  24.225 1.00 117.02 ? 203 GLN P NE2   1 
ATOM   1632 N N     . GLN B 2 203 ? 57.109 24.758  25.936 1.00 75.55  ? 204 GLN P N     1 
ATOM   1633 C CA    . GLN B 2 203 ? 56.052 24.038  26.650 1.00 68.89  ? 204 GLN P CA    1 
ATOM   1634 C C     . GLN B 2 203 ? 54.624 24.577  26.686 1.00 66.25  ? 204 GLN P C     1 
ATOM   1635 O O     . GLN B 2 203 ? 53.682 23.792  26.860 1.00 64.78  ? 204 GLN P O     1 
ATOM   1636 C CB    . GLN B 2 203 ? 56.489 23.786  28.086 1.00 74.05  ? 204 GLN P CB    1 
ATOM   1637 C CG    . GLN B 2 203 ? 57.834 23.119  28.233 1.00 76.98  ? 204 GLN P CG    1 
ATOM   1638 C CD    . GLN B 2 203 ? 58.277 23.091  29.678 1.00 83.56  ? 204 GLN P CD    1 
ATOM   1639 O OE1   . GLN B 2 203 ? 58.725 22.070  30.179 1.00 81.37  ? 204 GLN P OE1   1 
ATOM   1640 N NE2   . GLN B 2 203 ? 58.133 24.213  30.362 1.00 73.65  ? 204 GLN P NE2   1 
ATOM   1641 N N     . THR B 2 204 ? 54.444 25.889  26.547 1.00 63.46  ? 205 THR P N     1 
ATOM   1642 C CA    . THR B 2 204 ? 53.099 26.454  26.618 1.00 65.21  ? 205 THR P CA    1 
ATOM   1643 C C     . THR B 2 204 ? 52.158 25.958  25.522 1.00 67.44  ? 205 THR P C     1 
ATOM   1644 O O     . THR B 2 204 ? 50.953 25.860  25.734 1.00 70.67  ? 205 THR P O     1 
ATOM   1645 C CB    . THR B 2 204 ? 53.111 27.991  26.642 1.00 58.87  ? 205 THR P CB    1 
ATOM   1646 O OG1   . THR B 2 204 ? 53.407 28.496  25.344 1.00 57.82  ? 205 THR P OG1   1 
ATOM   1647 C CG2   . THR B 2 204 ? 54.147 28.501  27.600 1.00 57.39  ? 205 THR P CG2   1 
ATOM   1648 N N     . LYS B 2 205 ? 52.713 25.598  24.372 1.00 71.36  ? 206 LYS P N     1 
ATOM   1649 C CA    . LYS B 2 205 ? 51.908 25.112  23.258 1.00 72.07  ? 206 LYS P CA    1 
ATOM   1650 C C     . LYS B 2 205 ? 51.302 23.736  23.535 1.00 69.00  ? 206 LYS P C     1 
ATOM   1651 O O     . LYS B 2 205 ? 50.190 23.461  23.093 1.00 67.68  ? 206 LYS P O     1 
ATOM   1652 C CB    . LYS B 2 205 ? 52.746 25.054  21.972 1.00 81.76  ? 206 LYS P CB    1 
ATOM   1653 C CG    . LYS B 2 205 ? 53.499 26.340  21.638 1.00 93.14  ? 206 LYS P CG    1 
ATOM   1654 C CD    . LYS B 2 205 ? 52.549 27.491  21.285 1.00 102.37 ? 206 LYS P CD    1 
ATOM   1655 C CE    . LYS B 2 205 ? 52.489 27.733  19.777 1.00 106.56 ? 206 LYS P CE    1 
ATOM   1656 N NZ    . LYS B 2 205 ? 51.985 26.551  19.001 1.00 109.14 ? 206 LYS P NZ    1 
ATOM   1657 N N     . GLU B 2 206 ? 52.042 22.877  24.243 1.00 68.22  ? 207 GLU P N     1 
ATOM   1658 C CA    . GLU B 2 206 ? 51.591 21.507  24.564 1.00 68.98  ? 207 GLU P CA    1 
ATOM   1659 C C     . GLU B 2 206 ? 50.646 21.440  25.773 1.00 64.97  ? 207 GLU P C     1 
ATOM   1660 O O     . GLU B 2 206 ? 49.842 20.519  25.895 1.00 64.43  ? 207 GLU P O     1 
ATOM   1661 C CB    . GLU B 2 206 ? 52.778 20.583  24.878 1.00 75.09  ? 207 GLU P CB    1 
ATOM   1662 C CG    . GLU B 2 206 ? 54.128 20.913  24.244 1.00 70.78  ? 207 GLU P CG    1 
ATOM   1663 C CD    . GLU B 2 206 ? 55.263 20.056  24.834 1.00 78.79  ? 207 GLU P CD    1 
ATOM   1664 O OE1   . GLU B 2 206 ? 55.135 18.808  24.855 1.00 80.23  ? 207 GLU P OE1   1 
ATOM   1665 O OE2   . GLU B 2 206 ? 56.283 20.626  25.291 1.00 77.28  ? 207 GLU P OE2   1 
ATOM   1666 N N     . MET B 2 207 ? 50.888 22.336  26.725 1.00 58.35  ? 208 MET P N     1 
ATOM   1667 C CA    . MET B 2 207 ? 50.143 22.497  27.974 1.00 48.14  ? 208 MET P CA    1 
ATOM   1668 C C     . MET B 2 207 ? 48.653 22.100  27.990 1.00 47.38  ? 208 MET P C     1 
ATOM   1669 O O     . MET B 2 207 ? 47.834 22.712  27.301 1.00 44.29  ? 208 MET P O     1 
ATOM   1670 C CB    . MET B 2 207 ? 50.271 23.969  28.377 1.00 42.67  ? 208 MET P CB    1 
ATOM   1671 C CG    . MET B 2 207 ? 49.695 24.342  29.709 1.00 50.01  ? 208 MET P CG    1 
ATOM   1672 S SD    . MET B 2 207 ? 50.773 23.847  31.001 1.00 48.05  ? 208 MET P SD    1 
ATOM   1673 C CE    . MET B 2 207 ? 52.254 24.725  30.526 1.00 52.37  ? 208 MET P CE    1 
ATOM   1674 N N     . ASP B 2 208 ? 48.290 21.113  28.809 1.00 45.42  ? 209 ASP P N     1 
ATOM   1675 C CA    . ASP B 2 208 ? 46.894 20.706  28.920 1.00 40.59  ? 209 ASP P CA    1 
ATOM   1676 C C     . ASP B 2 208 ? 46.337 21.361  30.175 1.00 41.14  ? 209 ASP P C     1 
ATOM   1677 O O     . ASP B 2 208 ? 46.586 20.919  31.290 1.00 47.24  ? 209 ASP P O     1 
ATOM   1678 C CB    . ASP B 2 208 ? 46.753 19.181  29.013 1.00 43.92  ? 209 ASP P CB    1 
ATOM   1679 C CG    . ASP B 2 208 ? 45.296 18.706  28.833 1.00 47.53  ? 209 ASP P CG    1 
ATOM   1680 O OD1   . ASP B 2 208 ? 44.372 19.517  28.998 1.00 51.94  ? 209 ASP P OD1   1 
ATOM   1681 O OD2   . ASP B 2 208 ? 45.058 17.524  28.513 1.00 43.15  ? 209 ASP P OD2   1 
ATOM   1682 N N     . LEU B 2 209 ? 45.539 22.394  29.993 1.00 36.75  ? 210 LEU P N     1 
ATOM   1683 C CA    . LEU B 2 209 ? 44.977 23.097  31.120 1.00 35.91  ? 210 LEU P CA    1 
ATOM   1684 C C     . LEU B 2 209 ? 43.941 22.323  31.916 1.00 39.69  ? 210 LEU P C     1 
ATOM   1685 O O     . LEU B 2 209 ? 43.532 22.768  32.988 1.00 42.46  ? 210 LEU P O     1 
ATOM   1686 C CB    . LEU B 2 209 ? 44.365 24.412  30.652 1.00 27.77  ? 210 LEU P CB    1 
ATOM   1687 C CG    . LEU B 2 209 ? 45.343 25.333  29.938 1.00 36.32  ? 210 LEU P CG    1 
ATOM   1688 C CD1   . LEU B 2 209 ? 44.715 26.711  29.752 1.00 30.30  ? 210 LEU P CD1   1 
ATOM   1689 C CD2   . LEU B 2 209 ? 46.623 25.411  30.733 1.00 19.51  ? 210 LEU P CD2   1 
ATOM   1690 N N     . SER B 2 210 ? 43.519 21.169  31.427 1.00 37.64  ? 211 SER P N     1 
ATOM   1691 C CA    . SER B 2 210 ? 42.491 20.419  32.131 1.00 36.78  ? 211 SER P CA    1 
ATOM   1692 C C     . SER B 2 210 ? 42.949 19.348  33.109 1.00 36.56  ? 211 SER P C     1 
ATOM   1693 O O     . SER B 2 210 ? 42.139 18.842  33.879 1.00 38.34  ? 211 SER P O     1 
ATOM   1694 C CB    . SER B 2 210 ? 41.506 19.812  31.134 1.00 36.67  ? 211 SER P CB    1 
ATOM   1695 O OG    . SER B 2 210 ? 42.131 18.831  30.321 1.00 59.93  ? 211 SER P OG    1 
ATOM   1696 N N     . VAL B 2 211 ? 44.225 18.989  33.101 1.00 38.04  ? 212 VAL P N     1 
ATOM   1697 C CA    . VAL B 2 211 ? 44.683 17.951  34.015 1.00 39.34  ? 212 VAL P CA    1 
ATOM   1698 C C     . VAL B 2 211 ? 46.032 18.322  34.565 1.00 39.64  ? 212 VAL P C     1 
ATOM   1699 O O     . VAL B 2 211 ? 46.849 18.907  33.847 1.00 38.68  ? 212 VAL P O     1 
ATOM   1700 C CB    . VAL B 2 211 ? 44.732 16.555  33.324 1.00 48.87  ? 212 VAL P CB    1 
ATOM   1701 C CG1   . VAL B 2 211 ? 45.523 16.623  32.037 1.00 45.75  ? 212 VAL P CG1   1 
ATOM   1702 C CG2   . VAL B 2 211 ? 45.317 15.513  34.255 1.00 26.97  ? 212 VAL P CG2   1 
ATOM   1703 N N     . VAL B 2 212 ? 46.232 18.033  35.851 1.00 40.01  ? 213 VAL P N     1 
ATOM   1704 C CA    . VAL B 2 212 ? 47.484 18.329  36.549 1.00 37.32  ? 213 VAL P CA    1 
ATOM   1705 C C     . VAL B 2 212 ? 47.893 17.126  37.397 1.00 46.12  ? 213 VAL P C     1 
ATOM   1706 O O     . VAL B 2 212 ? 47.134 16.167  37.531 1.00 45.18  ? 213 VAL P O     1 
ATOM   1707 C CB    . VAL B 2 212 ? 47.337 19.557  37.499 1.00 39.30  ? 213 VAL P CB    1 
ATOM   1708 C CG1   . VAL B 2 212 ? 46.831 20.768  36.745 1.00 30.94  ? 213 VAL P CG1   1 
ATOM   1709 C CG2   . VAL B 2 212 ? 46.401 19.240  38.653 1.00 47.28  ? 213 VAL P CG2   1 
ATOM   1710 N N     . ARG B 2 213 ? 49.110 17.160  37.927 1.00 51.02  ? 214 ARG P N     1 
ATOM   1711 C CA    . ARG B 2 213 ? 49.611 16.107  38.804 1.00 50.87  ? 214 ARG P CA    1 
ATOM   1712 C C     . ARG B 2 213 ? 50.275 16.814  39.952 1.00 53.26  ? 214 ARG P C     1 
ATOM   1713 O O     . ARG B 2 213 ? 50.757 17.938  39.799 1.00 58.71  ? 214 ARG P O     1 
ATOM   1714 C CB    . ARG B 2 213 ? 50.671 15.251  38.130 1.00 46.26  ? 214 ARG P CB    1 
ATOM   1715 C CG    . ARG B 2 213 ? 50.166 14.405  37.032 1.00 58.75  ? 214 ARG P CG    1 
ATOM   1716 C CD    . ARG B 2 213 ? 51.248 13.497  36.587 1.00 61.90  ? 214 ARG P CD    1 
ATOM   1717 N NE    . ARG B 2 213 ? 50.871 12.124  36.856 1.00 72.03  ? 214 ARG P NE    1 
ATOM   1718 C CZ    . ARG B 2 213 ? 51.422 11.079  36.259 1.00 85.43  ? 214 ARG P CZ    1 
ATOM   1719 N NH1   . ARG B 2 213 ? 52.380 11.259  35.361 1.00 93.75  ? 214 ARG P NH1   1 
ATOM   1720 N NH2   . ARG B 2 213 ? 50.988 9.860   36.530 1.00 80.84  ? 214 ARG P NH2   1 
ATOM   1721 N N     . LEU B 2 214 ? 50.291 16.169  41.107 1.00 52.67  ? 215 LEU P N     1 
ATOM   1722 C CA    . LEU B 2 214 ? 50.932 16.745  42.280 1.00 51.78  ? 215 LEU P CA    1 
ATOM   1723 C C     . LEU B 2 214 ? 52.304 16.115  42.415 1.00 54.41  ? 215 LEU P C     1 
ATOM   1724 O O     . LEU B 2 214 ? 52.442 14.896  42.270 1.00 51.91  ? 215 LEU P O     1 
ATOM   1725 C CB    . LEU B 2 214 ? 50.142 16.415  43.531 1.00 51.38  ? 215 LEU P CB    1 
ATOM   1726 C CG    . LEU B 2 214 ? 48.715 16.921  43.596 1.00 54.81  ? 215 LEU P CG    1 
ATOM   1727 C CD1   . LEU B 2 214 ? 48.006 16.171  44.700 1.00 41.48  ? 215 LEU P CD1   1 
ATOM   1728 C CD2   . LEU B 2 214 ? 48.705 18.426  43.816 1.00 39.34  ? 215 LEU P CD2   1 
ATOM   1729 N N     . MET B 2 215 ? 53.319 16.935  42.666 1.00 57.06  ? 216 MET P N     1 
ATOM   1730 C CA    . MET B 2 215 ? 54.664 16.413  42.855 1.00 58.31  ? 216 MET P CA    1 
ATOM   1731 C C     . MET B 2 215 ? 55.202 16.845  44.214 1.00 59.30  ? 216 MET P C     1 
ATOM   1732 O O     . MET B 2 215 ? 55.386 18.041  44.488 1.00 57.18  ? 216 MET P O     1 
ATOM   1733 C CB    . MET B 2 215 ? 55.605 16.857  41.745 1.00 58.74  ? 216 MET P CB    1 
ATOM   1734 C CG    . MET B 2 215 ? 56.874 16.040  41.719 1.00 61.96  ? 216 MET P CG    1 
ATOM   1735 S SD    . MET B 2 215 ? 58.083 16.740  40.637 1.00 58.93  ? 216 MET P SD    1 
ATOM   1736 C CE    . MET B 2 215 ? 58.939 15.280  40.031 1.00 78.31  ? 216 MET P CE    1 
ATOM   1737 N N     . PHE B 2 216 ? 55.394 15.854  45.075 1.00 60.64  ? 217 PHE P N     1 
ATOM   1738 C CA    . PHE B 2 216 ? 55.896 16.075  46.418 1.00 65.05  ? 217 PHE P CA    1 
ATOM   1739 C C     . PHE B 2 216 ? 57.369 15.791  46.469 1.00 70.69  ? 217 PHE P C     1 
ATOM   1740 O O     . PHE B 2 216 ? 57.839 14.780  45.938 1.00 71.41  ? 217 PHE P O     1 
ATOM   1741 C CB    . PHE B 2 216 ? 55.204 15.146  47.395 1.00 62.81  ? 217 PHE P CB    1 
ATOM   1742 C CG    . PHE B 2 216 ? 53.735 15.230  47.333 1.00 60.34  ? 217 PHE P CG    1 
ATOM   1743 C CD1   . PHE B 2 216 ? 53.074 16.286  47.927 1.00 56.46  ? 217 PHE P CD1   1 
ATOM   1744 C CD2   . PHE B 2 216 ? 53.011 14.287  46.627 1.00 59.07  ? 217 PHE P CD2   1 
ATOM   1745 C CE1   . PHE B 2 216 ? 51.712 16.402  47.816 1.00 52.63  ? 217 PHE P CE1   1 
ATOM   1746 C CE2   . PHE B 2 216 ? 51.643 14.397  46.511 1.00 50.29  ? 217 PHE P CE2   1 
ATOM   1747 C CZ    . PHE B 2 216 ? 50.993 15.458  47.105 1.00 46.59  ? 217 PHE P CZ    1 
ATOM   1748 N N     . THR B 2 217 ? 58.092 16.674  47.138 1.00 74.50  ? 218 THR P N     1 
ATOM   1749 C CA    . THR B 2 217 ? 59.524 16.518  47.286 1.00 76.59  ? 218 THR P CA    1 
ATOM   1750 C C     . THR B 2 217 ? 59.798 16.699  48.772 1.00 78.37  ? 218 THR P C     1 
ATOM   1751 O O     . THR B 2 217 ? 59.268 17.627  49.386 1.00 75.71  ? 218 THR P O     1 
ATOM   1752 C CB    . THR B 2 217 ? 60.272 17.581  46.470 1.00 74.85  ? 218 THR P CB    1 
ATOM   1753 O OG1   . THR B 2 217 ? 59.614 17.764  45.210 1.00 70.45  ? 218 THR P OG1   1 
ATOM   1754 C CG2   . THR B 2 217 ? 61.690 17.129  46.215 1.00 74.50  ? 218 THR P CG2   1 
ATOM   1755 N N     . ALA B 2 218 ? 60.532 15.763  49.369 1.00 81.17  ? 219 ALA P N     1 
ATOM   1756 C CA    . ALA B 2 218 ? 60.862 15.846  50.797 1.00 85.38  ? 219 ALA P CA    1 
ATOM   1757 C C     . ALA B 2 218 ? 62.311 16.308  51.029 1.00 86.53  ? 219 ALA P C     1 
ATOM   1758 O O     . ALA B 2 218 ? 63.261 15.576  50.733 1.00 85.71  ? 219 ALA P O     1 
ATOM   1759 C CB    . ALA B 2 218 ? 60.612 14.500  51.484 1.00 80.63  ? 219 ALA P CB    1 
ATOM   1760 N N     . PHE B 2 219 ? 62.464 17.525  51.550 1.00 90.06  ? 220 PHE P N     1 
ATOM   1761 C CA    . PHE B 2 219 ? 63.773 18.126  51.838 1.00 93.79  ? 220 PHE P CA    1 
ATOM   1762 C C     . PHE B 2 219 ? 64.238 17.931  53.288 1.00 97.79  ? 220 PHE P C     1 
ATOM   1763 O O     . PHE B 2 219 ? 63.851 18.703  54.181 1.00 99.32  ? 220 PHE P O     1 
ATOM   1764 C CB    . PHE B 2 219 ? 63.749 19.633  51.544 1.00 94.51  ? 220 PHE P CB    1 
ATOM   1765 C CG    . PHE B 2 219 ? 63.661 19.972  50.094 1.00 87.59  ? 220 PHE P CG    1 
ATOM   1766 C CD1   . PHE B 2 219 ? 62.428 20.127  49.475 1.00 86.50  ? 220 PHE P CD1   1 
ATOM   1767 C CD2   . PHE B 2 219 ? 64.814 20.149  49.348 1.00 79.50  ? 220 PHE P CD2   1 
ATOM   1768 C CE1   . PHE B 2 219 ? 62.346 20.458  48.143 1.00 87.27  ? 220 PHE P CE1   1 
ATOM   1769 C CE2   . PHE B 2 219 ? 64.746 20.481  48.016 1.00 86.63  ? 220 PHE P CE2   1 
ATOM   1770 C CZ    . PHE B 2 219 ? 63.508 20.634  47.407 1.00 91.50  ? 220 PHE P CZ    1 
ATOM   1771 N N     . LEU B 2 220 ? 65.076 16.919  53.511 1.00 98.54  ? 221 LEU P N     1 
ATOM   1772 C CA    . LEU B 2 220 ? 65.618 16.625  54.839 1.00 100.13 ? 221 LEU P CA    1 
ATOM   1773 C C     . LEU B 2 220 ? 66.689 17.685  55.193 1.00 105.59 ? 221 LEU P C     1 
ATOM   1774 O O     . LEU B 2 220 ? 67.198 18.392  54.298 1.00 104.05 ? 221 LEU P O     1 
ATOM   1775 C CB    . LEU B 2 220 ? 66.217 15.204  54.871 1.00 91.80  ? 221 LEU P CB    1 
ATOM   1776 C CG    . LEU B 2 220 ? 65.361 14.039  54.338 1.00 93.30  ? 221 LEU P CG    1 
ATOM   1777 C CD1   . LEU B 2 220 ? 66.188 12.760  54.305 1.00 88.49  ? 221 LEU P CD1   1 
ATOM   1778 C CD2   . LEU B 2 220 ? 64.100 13.845  55.169 1.00 96.14  ? 221 LEU P CD2   1 
ATOM   1779 N N     . PRO B 2 221 ? 67.008 17.843  56.500 1.00 110.59 ? 222 PRO P N     1 
ATOM   1780 C CA    . PRO B 2 221 ? 68.009 18.819  56.979 1.00 112.47 ? 222 PRO P CA    1 
ATOM   1781 C C     . PRO B 2 221 ? 69.486 18.351  56.950 1.00 114.12 ? 222 PRO P C     1 
ATOM   1782 O O     . PRO B 2 221 ? 69.787 17.197  57.283 1.00 112.25 ? 222 PRO P O     1 
ATOM   1783 C CB    . PRO B 2 221 ? 67.539 19.092  58.410 1.00 110.58 ? 222 PRO P CB    1 
ATOM   1784 C CG    . PRO B 2 221 ? 67.049 17.729  58.845 1.00 108.15 ? 222 PRO P CG    1 
ATOM   1785 C CD    . PRO B 2 221 ? 66.288 17.220  57.633 1.00 110.56 ? 222 PRO P CD    1 
ATOM   1786 N N     . ASP B 2 222 ? 70.397 19.250  56.555 1.00 116.37 ? 223 ASP P N     1 
ATOM   1787 C CA    . ASP B 2 222 ? 71.843 18.946  56.488 1.00 122.06 ? 223 ASP P CA    1 
ATOM   1788 C C     . ASP B 2 222 ? 72.658 19.656  57.574 1.00 125.17 ? 223 ASP P C     1 
ATOM   1789 O O     . ASP B 2 222 ? 73.030 19.056  58.581 1.00 122.72 ? 223 ASP P O     1 
ATOM   1790 C CB    . ASP B 2 222 ? 72.434 19.364  55.141 1.00 123.05 ? 223 ASP P CB    1 
ATOM   1791 C CG    . ASP B 2 222 ? 71.972 18.508  53.991 1.00 131.92 ? 223 ASP P CG    1 
ATOM   1792 O OD1   . ASP B 2 222 ? 71.218 17.523  54.215 1.00 140.59 ? 223 ASP P OD1   1 
ATOM   1793 O OD2   . ASP B 2 222 ? 72.405 18.835  52.859 1.00 133.71 ? 223 ASP P OD2   1 
ATOM   1794 N N     . SER B 2 223 ? 73.043 20.899  57.271 1.00 128.07 ? 224 SER P N     1 
ATOM   1795 C CA    . SER B 2 223 ? 73.797 21.722  58.211 1.00 126.94 ? 224 SER P CA    1 
ATOM   1796 C C     . SER B 2 223 ? 72.770 22.158  59.249 1.00 126.35 ? 224 SER P C     1 
ATOM   1797 O O     . SER B 2 223 ? 71.559 22.120  58.982 1.00 126.91 ? 224 SER P O     1 
ATOM   1798 C CB    . SER B 2 223 ? 74.400 22.949  57.509 1.00 126.59 ? 224 SER P CB    1 
ATOM   1799 O OG    . SER B 2 223 ? 75.386 22.549  56.573 1.00 135.54 ? 224 SER P OG    1 
ATOM   1800 N N     . THR B 2 224 ? 73.254 22.619  60.398 1.00 126.80 ? 225 THR P N     1 
ATOM   1801 C CA    . THR B 2 224 ? 72.378 23.058  61.489 1.00 128.10 ? 225 THR P CA    1 
ATOM   1802 C C     . THR B 2 224 ? 71.216 23.977  61.067 1.00 128.12 ? 225 THR P C     1 
ATOM   1803 O O     . THR B 2 224 ? 71.408 25.150  60.678 1.00 126.51 ? 225 THR P O     1 
ATOM   1804 C CB    . THR B 2 224 ? 73.195 23.674  62.682 1.00 128.45 ? 225 THR P CB    1 
ATOM   1805 O OG1   . THR B 2 224 ? 73.975 24.793  62.230 1.00 123.76 ? 225 THR P OG1   1 
ATOM   1806 C CG2   . THR B 2 224 ? 74.127 22.606  63.283 1.00 129.20 ? 225 THR P CG2   1 
ATOM   1807 N N     . GLY B 2 225 ? 70.007 23.416  61.112 1.00 128.14 ? 226 GLY P N     1 
ATOM   1808 C CA    . GLY B 2 225 ? 68.796 24.148  60.763 1.00 125.41 ? 226 GLY P CA    1 
ATOM   1809 C C     . GLY B 2 225 ? 68.278 23.979  59.341 1.00 121.83 ? 226 GLY P C     1 
ATOM   1810 O O     . GLY B 2 225 ? 67.165 23.476  59.114 1.00 120.42 ? 226 GLY P O     1 
ATOM   1811 N N     . SER B 2 226 ? 69.110 24.386  58.387 1.00 119.26 ? 227 SER P N     1 
ATOM   1812 C CA    . SER B 2 226 ? 68.786 24.323  56.959 1.00 118.70 ? 227 SER P CA    1 
ATOM   1813 C C     . SER B 2 226 ? 68.373 22.952  56.383 1.00 118.09 ? 227 SER P C     1 
ATOM   1814 O O     . SER B 2 226 ? 69.078 21.941  56.554 1.00 116.01 ? 227 SER P O     1 
ATOM   1815 C CB    . SER B 2 226 ? 69.953 24.904  56.135 1.00 116.20 ? 227 SER P CB    1 
ATOM   1816 O OG    . SER B 2 226 ? 70.225 26.247  56.506 1.00 115.42 ? 227 SER P OG    1 
ATOM   1817 N N     . PHE B 2 227 ? 67.211 22.939  55.721 1.00 117.27 ? 228 PHE P N     1 
ATOM   1818 C CA    . PHE B 2 227 ? 66.658 21.749  55.052 1.00 113.95 ? 228 PHE P CA    1 
ATOM   1819 C C     . PHE B 2 227 ? 67.076 21.956  53.605 1.00 112.89 ? 228 PHE P C     1 
ATOM   1820 O O     . PHE B 2 227 ? 66.629 22.912  52.965 1.00 111.87 ? 228 PHE P O     1 
ATOM   1821 C CB    . PHE B 2 227 ? 65.120 21.732  55.130 1.00 106.85 ? 228 PHE P CB    1 
ATOM   1822 C CG    . PHE B 2 227 ? 64.579 21.893  56.525 1.00 101.23 ? 228 PHE P CG    1 
ATOM   1823 C CD1   . PHE B 2 227 ? 64.390 20.777  57.341 1.00 92.88  ? 228 PHE P CD1   1 
ATOM   1824 C CD2   . PHE B 2 227 ? 64.272 23.163  57.034 1.00 91.51  ? 228 PHE P CD2   1 
ATOM   1825 C CE1   . PHE B 2 227 ? 63.906 20.917  58.639 1.00 94.72  ? 228 PHE P CE1   1 
ATOM   1826 C CE2   . PHE B 2 227 ? 63.784 23.317  58.333 1.00 95.91  ? 228 PHE P CE2   1 
ATOM   1827 C CZ    . PHE B 2 227 ? 63.601 22.188  59.137 1.00 105.21 ? 228 PHE P CZ    1 
ATOM   1828 N N     . THR B 2 228 ? 67.936 21.084  53.089 1.00 110.77 ? 229 THR P N     1 
ATOM   1829 C CA    . THR B 2 228 ? 68.431 21.251  51.722 1.00 108.66 ? 229 THR P CA    1 
ATOM   1830 C C     . THR B 2 228 ? 68.523 20.020  50.827 1.00 107.90 ? 229 THR P C     1 
ATOM   1831 O O     . THR B 2 228 ? 68.604 20.147  49.595 1.00 110.08 ? 229 THR P O     1 
ATOM   1832 C CB    . THR B 2 228 ? 69.808 21.948  51.716 1.00 106.98 ? 229 THR P CB    1 
ATOM   1833 O OG1   . THR B 2 228 ? 70.491 21.678  52.948 1.00 117.61 ? 229 THR P OG1   1 
ATOM   1834 C CG2   . THR B 2 228 ? 69.653 23.459  51.520 1.00 108.50 ? 229 THR P CG2   1 
ATOM   1835 N N     . ARG B 2 229 ? 68.543 18.832  51.422 1.00 105.08 ? 230 ARG P N     1 
ATOM   1836 C CA    . ARG B 2 229 ? 68.641 17.627  50.602 1.00 105.18 ? 230 ARG P CA    1 
ATOM   1837 C C     . ARG B 2 229 ? 67.357 16.837  50.536 1.00 103.58 ? 230 ARG P C     1 
ATOM   1838 O O     . ARG B 2 229 ? 66.867 16.313  51.536 1.00 103.34 ? 230 ARG P O     1 
ATOM   1839 C CB    . ARG B 2 229 ? 69.804 16.736  51.032 1.00 111.22 ? 230 ARG P CB    1 
ATOM   1840 C CG    . ARG B 2 229 ? 71.183 17.341  50.741 1.00 114.05 ? 230 ARG P CG    1 
ATOM   1841 C CD    . ARG B 2 229 ? 71.460 17.559  49.253 1.00 113.11 ? 230 ARG P CD    1 
ATOM   1842 N NE    . ARG B 2 229 ? 71.977 16.343  48.625 1.00 114.14 ? 230 ARG P NE    1 
ATOM   1843 C CZ    . ARG B 2 229 ? 71.498 15.810  47.506 1.00 110.32 ? 230 ARG P CZ    1 
ATOM   1844 N NH1   . ARG B 2 229 ? 70.482 16.386  46.878 1.00 103.36 ? 230 ARG P NH1   1 
ATOM   1845 N NH2   . ARG B 2 229 ? 72.021 14.685  47.033 1.00 112.65 ? 230 ARG P NH2   1 
ATOM   1846 N N     . ARG B 2 230 ? 66.810 16.773  49.335 1.00 101.53 ? 231 ARG P N     1 
ATOM   1847 C CA    . ARG B 2 230 ? 65.573 16.072  49.120 1.00 99.19  ? 231 ARG P CA    1 
ATOM   1848 C C     . ARG B 2 230 ? 65.773 14.660  48.633 1.00 96.16  ? 231 ARG P C     1 
ATOM   1849 O O     . ARG B 2 230 ? 66.825 14.312  48.096 1.00 95.46  ? 231 ARG P O     1 
ATOM   1850 C CB    . ARG B 2 230 ? 64.690 16.859  48.148 1.00 101.44 ? 231 ARG P CB    1 
ATOM   1851 C CG    . ARG B 2 230 ? 65.360 17.236  46.831 1.00 89.10  ? 231 ARG P CG    1 
ATOM   1852 C CD    . ARG B 2 230 ? 65.406 16.064  45.873 1.00 83.82  ? 231 ARG P CD    1 
ATOM   1853 N NE    . ARG B 2 230 ? 65.265 16.503  44.492 1.00 78.19  ? 231 ARG P NE    1 
ATOM   1854 C CZ    . ARG B 2 230 ? 66.161 16.277  43.541 1.00 71.76  ? 231 ARG P CZ    1 
ATOM   1855 N NH1   . ARG B 2 230 ? 67.272 15.607  43.814 1.00 77.60  ? 231 ARG P NH1   1 
ATOM   1856 N NH2   . ARG B 2 230 ? 65.968 16.767  42.328 1.00 70.37  ? 231 ARG P NH2   1 
ATOM   1857 N N     . LEU B 2 231 ? 64.742 13.855  48.853 1.00 94.29  ? 232 LEU P N     1 
ATOM   1858 C CA    . LEU B 2 231 ? 64.703 12.467  48.426 1.00 89.10  ? 232 LEU P CA    1 
ATOM   1859 C C     . LEU B 2 231 ? 64.131 12.537  47.006 1.00 86.76  ? 232 LEU P C     1 
ATOM   1860 O O     . LEU B 2 231 ? 63.886 13.631  46.489 1.00 86.63  ? 232 LEU P O     1 
ATOM   1861 C CB    . LEU B 2 231 ? 63.757 11.677  49.348 1.00 87.30  ? 232 LEU P CB    1 
ATOM   1862 C CG    . LEU B 2 231 ? 63.962 11.857  50.863 1.00 85.69  ? 232 LEU P CG    1 
ATOM   1863 C CD1   . LEU B 2 231 ? 62.814 11.262  51.661 1.00 79.98  ? 232 LEU P CD1   1 
ATOM   1864 C CD2   . LEU B 2 231 ? 65.275 11.234  51.283 1.00 83.55  ? 232 LEU P CD2   1 
ATOM   1865 N N     . GLU B 2 232 ? 63.926 11.392  46.366 1.00 85.64  ? 233 GLU P N     1 
ATOM   1866 C CA    . GLU B 2 232 ? 63.364 11.391  45.020 1.00 82.27  ? 233 GLU P CA    1 
ATOM   1867 C C     . GLU B 2 232 ? 61.908 11.867  45.120 1.00 85.23  ? 233 GLU P C     1 
ATOM   1868 O O     . GLU B 2 232 ? 61.142 11.372  45.958 1.00 85.78  ? 233 GLU P O     1 
ATOM   1869 C CB    . GLU B 2 232 ? 63.445 9.987   44.406 1.00 69.45  ? 233 GLU P CB    1 
ATOM   1870 C CG    . GLU B 2 232 ? 63.007 9.898   42.948 1.00 79.03  ? 233 GLU P CG    1 
ATOM   1871 C CD    . GLU B 2 232 ? 63.873 10.724  41.993 1.00 92.74  ? 233 GLU P CD    1 
ATOM   1872 O OE1   . GLU B 2 232 ? 64.973 11.177  42.392 1.00 100.18 ? 233 GLU P OE1   1 
ATOM   1873 O OE2   . GLU B 2 232 ? 63.448 10.916  40.830 1.00 91.61  ? 233 GLU P OE2   1 
ATOM   1874 N N     . PRO B 2 233 ? 61.546 12.910  44.345 1.00 86.60  ? 234 PRO P N     1 
ATOM   1875 C CA    . PRO B 2 233 ? 60.186 13.461  44.344 1.00 82.45  ? 234 PRO P CA    1 
ATOM   1876 C C     . PRO B 2 233 ? 59.196 12.424  43.850 1.00 76.59  ? 234 PRO P C     1 
ATOM   1877 O O     . PRO B 2 233 ? 59.544 11.561  43.040 1.00 69.38  ? 234 PRO P O     1 
ATOM   1878 C CB    . PRO B 2 233 ? 60.283 14.612  43.349 1.00 85.90  ? 234 PRO P CB    1 
ATOM   1879 C CG    . PRO B 2 233 ? 61.704 15.030  43.462 1.00 93.94  ? 234 PRO P CG    1 
ATOM   1880 C CD    . PRO B 2 233 ? 62.429 13.722  43.489 1.00 87.79  ? 234 PRO P CD    1 
ATOM   1881 N N     . VAL B 2 234 ? 57.962 12.508  44.331 1.00 74.52  ? 235 VAL P N     1 
ATOM   1882 C CA    . VAL B 2 234 ? 56.927 11.570  43.921 1.00 70.38  ? 235 VAL P CA    1 
ATOM   1883 C C     . VAL B 2 234 ? 55.788 12.319  43.229 1.00 70.23  ? 235 VAL P C     1 
ATOM   1884 O O     . VAL B 2 234 ? 55.375 13.396  43.670 1.00 69.98  ? 235 VAL P O     1 
ATOM   1885 C CB    . VAL B 2 234 ? 56.403 10.740  45.127 1.00 63.27  ? 235 VAL P CB    1 
ATOM   1886 C CG1   . VAL B 2 234 ? 55.448 9.646   44.658 1.00 54.47  ? 235 VAL P CG1   1 
ATOM   1887 C CG2   . VAL B 2 234 ? 57.574 10.110  45.863 1.00 68.46  ? 235 VAL P CG2   1 
ATOM   1888 N N     . VAL B 2 235 ? 55.345 11.778  42.100 1.00 66.19  ? 236 VAL P N     1 
ATOM   1889 C CA    . VAL B 2 235 ? 54.272 12.376  41.329 1.00 66.51  ? 236 VAL P CA    1 
ATOM   1890 C C     . VAL B 2 235 ? 52.996 11.562  41.548 1.00 64.49  ? 236 VAL P C     1 
ATOM   1891 O O     . VAL B 2 235 ? 53.024 10.326  41.502 1.00 59.19  ? 236 VAL P O     1 
ATOM   1892 C CB    . VAL B 2 235 ? 54.642 12.429  39.830 1.00 62.57  ? 236 VAL P CB    1 
ATOM   1893 C CG1   . VAL B 2 235 ? 54.790 11.021  39.267 1.00 75.17  ? 236 VAL P CG1   1 
ATOM   1894 C CG2   . VAL B 2 235 ? 53.615 13.223  39.053 1.00 71.95  ? 236 VAL P CG2   1 
ATOM   1895 N N     . SER B 2 236 ? 51.897 12.260  41.839 1.00 62.67  ? 237 SER P N     1 
ATOM   1896 C CA    . SER B 2 236 ? 50.606 11.627  42.091 1.00 60.42  ? 237 SER P CA    1 
ATOM   1897 C C     . SER B 2 236 ? 49.872 11.290  40.807 1.00 60.06  ? 237 SER P C     1 
ATOM   1898 O O     . SER B 2 236 ? 50.402 11.443  39.702 1.00 60.59  ? 237 SER P O     1 
ATOM   1899 C CB    . SER B 2 236 ? 49.715 12.542  42.929 1.00 53.32  ? 237 SER P CB    1 
ATOM   1900 O OG    . SER B 2 236 ? 49.281 13.646  42.165 1.00 53.08  ? 237 SER P OG    1 
ATOM   1901 N N     . ASP B 2 237 ? 48.645 10.817  40.962 1.00 61.46  ? 238 ASP P N     1 
ATOM   1902 C CA    . ASP B 2 237 ? 47.827 10.501  39.814 1.00 60.41  ? 238 ASP P CA    1 
ATOM   1903 C C     . ASP B 2 237 ? 47.373 11.834  39.233 1.00 56.12  ? 238 ASP P C     1 
ATOM   1904 O O     . ASP B 2 237 ? 47.517 12.887  39.863 1.00 49.01  ? 238 ASP P O     1 
ATOM   1905 C CB    . ASP B 2 237 ? 46.607 9.669   40.229 1.00 68.54  ? 238 ASP P CB    1 
ATOM   1906 C CG    . ASP B 2 237 ? 46.961 8.234   40.600 1.00 78.94  ? 238 ASP P CG    1 
ATOM   1907 O OD1   . ASP B 2 237 ? 48.142 7.837   40.485 1.00 92.16  ? 238 ASP P OD1   1 
ATOM   1908 O OD2   . ASP B 2 237 ? 46.042 7.490   41.000 1.00 73.55  ? 238 ASP P OD2   1 
ATOM   1909 N N     . ALA B 2 238 ? 46.815 11.770  38.034 1.00 55.80  ? 239 ALA P N     1 
ATOM   1910 C CA    . ALA B 2 238 ? 46.326 12.948  37.345 1.00 53.34  ? 239 ALA P CA    1 
ATOM   1911 C C     . ALA B 2 238 ? 45.009 13.424  37.957 1.00 55.57  ? 239 ALA P C     1 
ATOM   1912 O O     . ALA B 2 238 ? 44.138 12.603  38.261 1.00 57.22  ? 239 ALA P O     1 
ATOM   1913 C CB    . ALA B 2 238 ? 46.127 12.613  35.879 1.00 56.20  ? 239 ALA P CB    1 
ATOM   1914 N N     . ILE B 2 239 ? 44.876 14.739  38.141 1.00 55.05  ? 240 ILE P N     1 
ATOM   1915 C CA    . ILE B 2 239 ? 43.663 15.365  38.681 1.00 50.47  ? 240 ILE P CA    1 
ATOM   1916 C C     . ILE B 2 239 ? 43.005 16.109  37.527 1.00 50.85  ? 240 ILE P C     1 
ATOM   1917 O O     . ILE B 2 239 ? 43.533 17.115  37.037 1.00 53.00  ? 240 ILE P O     1 
ATOM   1918 C CB    . ILE B 2 239 ? 43.985 16.410  39.744 1.00 46.40  ? 240 ILE P CB    1 
ATOM   1919 C CG1   . ILE B 2 239 ? 44.851 15.803  40.835 1.00 41.82  ? 240 ILE P CG1   1 
ATOM   1920 C CG2   . ILE B 2 239 ? 42.713 16.969  40.331 1.00 47.53  ? 240 ILE P CG2   1 
ATOM   1921 C CD1   . ILE B 2 239 ? 45.499 16.856  41.707 1.00 36.38  ? 240 ILE P CD1   1 
ATOM   1922 N N     . TYR B 2 240 ? 41.863 15.607  37.084 1.00 46.81  ? 241 TYR P N     1 
ATOM   1923 C CA    . TYR B 2 240 ? 41.150 16.225  35.982 1.00 46.11  ? 241 TYR P CA    1 
ATOM   1924 C C     . TYR B 2 240 ? 40.071 17.201  36.435 1.00 45.08  ? 241 TYR P C     1 
ATOM   1925 O O     . TYR B 2 240 ? 39.205 16.865  37.248 1.00 47.23  ? 241 TYR P O     1 
ATOM   1926 C CB    . TYR B 2 240 ? 40.514 15.163  35.087 1.00 49.20  ? 241 TYR P CB    1 
ATOM   1927 C CG    . TYR B 2 240 ? 41.458 14.098  34.601 1.00 46.33  ? 241 TYR P CG    1 
ATOM   1928 C CD1   . TYR B 2 240 ? 41.773 13.007  35.406 1.00 50.90  ? 241 TYR P CD1   1 
ATOM   1929 C CD2   . TYR B 2 240 ? 42.019 14.167  33.334 1.00 48.80  ? 241 TYR P CD2   1 
ATOM   1930 C CE1   . TYR B 2 240 ? 42.626 12.005  34.958 1.00 50.05  ? 241 TYR P CE1   1 
ATOM   1931 C CE2   . TYR B 2 240 ? 42.874 13.170  32.871 1.00 60.61  ? 241 TYR P CE2   1 
ATOM   1932 C CZ    . TYR B 2 240 ? 43.175 12.088  33.690 1.00 60.55  ? 241 TYR P CZ    1 
ATOM   1933 O OH    . TYR B 2 240 ? 44.023 11.087  33.249 1.00 64.56  ? 241 TYR P OH    1 
ATOM   1934 N N     . ASP B 2 241 ? 40.116 18.398  35.865 1.00 43.44  ? 242 ASP P N     1 
ATOM   1935 C CA    . ASP B 2 241 ? 39.153 19.450  36.149 1.00 43.11  ? 242 ASP P CA    1 
ATOM   1936 C C     . ASP B 2 241 ? 37.767 18.957  35.770 1.00 40.85  ? 242 ASP P C     1 
ATOM   1937 O O     . ASP B 2 241 ? 37.546 18.586  34.635 1.00 41.79  ? 242 ASP P O     1 
ATOM   1938 C CB    . ASP B 2 241 ? 39.501 20.667  35.305 1.00 39.51  ? 242 ASP P CB    1 
ATOM   1939 C CG    . ASP B 2 241 ? 38.657 21.872  35.624 1.00 45.27  ? 242 ASP P CG    1 
ATOM   1940 O OD1   . ASP B 2 241 ? 37.671 21.759  36.379 1.00 46.35  ? 242 ASP P OD1   1 
ATOM   1941 O OD2   . ASP B 2 241 ? 39.000 22.954  35.114 1.00 40.80  ? 242 ASP P OD2   1 
ATOM   1942 N N     . SER B 2 242 ? 36.828 19.029  36.705 1.00 41.81  ? 243 SER P N     1 
ATOM   1943 C CA    . SER B 2 242 ? 35.454 18.580  36.493 1.00 39.28  ? 243 SER P CA    1 
ATOM   1944 C C     . SER B 2 242 ? 34.697 19.505  35.572 1.00 41.15  ? 243 SER P C     1 
ATOM   1945 O O     . SER B 2 242 ? 33.633 19.154  35.075 1.00 48.08  ? 243 SER P O     1 
ATOM   1946 C CB    . SER B 2 242 ? 34.718 18.552  37.823 1.00 43.26  ? 243 SER P CB    1 
ATOM   1947 O OG    . SER B 2 242 ? 34.655 19.867  38.369 1.00 46.22  ? 243 SER P OG    1 
ATOM   1948 N N     . LYS B 2 243 ? 35.194 20.725  35.432 1.00 40.48  ? 244 LYS P N     1 
ATOM   1949 C CA    . LYS B 2 243 ? 34.569 21.715  34.569 1.00 39.11  ? 244 LYS P CA    1 
ATOM   1950 C C     . LYS B 2 243 ? 35.000 21.494  33.100 1.00 40.78  ? 244 LYS P C     1 
ATOM   1951 O O     . LYS B 2 243 ? 34.553 22.185  32.188 1.00 40.05  ? 244 LYS P O     1 
ATOM   1952 C CB    . LYS B 2 243 ? 34.937 23.117  35.063 1.00 35.13  ? 244 LYS P CB    1 
ATOM   1953 C CG    . LYS B 2 243 ? 33.902 24.202  34.788 1.00 30.44  ? 244 LYS P CG    1 
ATOM   1954 C CD    . LYS B 2 243 ? 32.529 23.826  35.337 1.00 27.83  ? 244 LYS P CD    1 
ATOM   1955 C CE    . LYS B 2 243 ? 31.504 24.962  35.182 1.00 28.70  ? 244 LYS P CE    1 
ATOM   1956 N NZ    . LYS B 2 243 ? 31.206 25.396  33.767 1.00 35.65  ? 244 LYS P NZ    1 
ATOM   1957 N N     . ALA B 2 244 ? 35.874 20.520  32.879 1.00 45.93  ? 245 ALA P N     1 
ATOM   1958 C CA    . ALA B 2 244 ? 36.350 20.206  31.541 1.00 48.08  ? 245 ALA P CA    1 
ATOM   1959 C C     . ALA B 2 244 ? 35.332 19.310  30.879 1.00 52.88  ? 245 ALA P C     1 
ATOM   1960 O O     . ALA B 2 244 ? 34.870 18.340  31.465 1.00 50.69  ? 245 ALA P O     1 
ATOM   1961 C CB    . ALA B 2 244 ? 37.697 19.509  31.598 1.00 37.47  ? 245 ALA P CB    1 
ATOM   1962 N N     . PRO B 2 245 ? 35.018 19.589  29.614 1.00 60.88  ? 246 PRO P N     1 
ATOM   1963 C CA    . PRO B 2 245 ? 34.043 18.804  28.861 1.00 58.00  ? 246 PRO P CA    1 
ATOM   1964 C C     . PRO B 2 245 ? 34.287 17.294  28.857 1.00 55.21  ? 246 PRO P C     1 
ATOM   1965 O O     . PRO B 2 245 ? 33.353 16.519  29.014 1.00 55.18  ? 246 PRO P O     1 
ATOM   1966 C CB    . PRO B 2 245 ? 34.137 19.414  27.463 1.00 67.69  ? 246 PRO P CB    1 
ATOM   1967 C CG    . PRO B 2 245 ? 35.547 19.989  27.413 1.00 76.34  ? 246 PRO P CG    1 
ATOM   1968 C CD    . PRO B 2 245 ? 35.651 20.610  28.760 1.00 68.02  ? 246 PRO P CD    1 
ATOM   1969 N N     . ASN B 2 246 ? 35.547 16.887  28.750 1.00 58.55  ? 247 ASN P N     1 
ATOM   1970 C CA    . ASN B 2 246 ? 35.915 15.463  28.694 1.00 57.38  ? 247 ASN P CA    1 
ATOM   1971 C C     . ASN B 2 246 ? 36.179 14.730  30.019 1.00 58.84  ? 247 ASN P C     1 
ATOM   1972 O O     . ASN B 2 246 ? 36.549 13.556  30.025 1.00 62.20  ? 247 ASN P O     1 
ATOM   1973 C CB    . ASN B 2 246 ? 37.111 15.259  27.739 1.00 50.59  ? 247 ASN P CB    1 
ATOM   1974 C CG    . ASN B 2 246 ? 38.301 16.154  28.077 1.00 49.57  ? 247 ASN P CG    1 
ATOM   1975 O OD1   . ASN B 2 246 ? 38.277 17.355  27.815 1.00 62.40  ? 247 ASN P OD1   1 
ATOM   1976 N ND2   . ASN B 2 246 ? 39.342 15.572  28.658 1.00 65.27  ? 247 ASN P ND2   1 
ATOM   1977 N N     . ALA B 2 247 ? 36.015 15.414  31.140 1.00 57.41  ? 248 ALA P N     1 
ATOM   1978 C CA    . ALA B 2 247 ? 36.246 14.782  32.431 1.00 52.91  ? 248 ALA P CA    1 
ATOM   1979 C C     . ALA B 2 247 ? 35.105 15.155  33.362 1.00 53.01  ? 248 ALA P C     1 
ATOM   1980 O O     . ALA B 2 247 ? 35.258 15.151  34.591 1.00 56.24  ? 248 ALA P O     1 
ATOM   1981 C CB    . ALA B 2 247 ? 37.580 15.231  33.008 1.00 48.57  ? 248 ALA P CB    1 
ATOM   1982 N N     . SER B 2 248 ? 33.964 15.481  32.755 1.00 51.37  ? 249 SER P N     1 
ATOM   1983 C CA    . SER B 2 248 ? 32.761 15.877  33.480 1.00 54.27  ? 249 SER P CA    1 
ATOM   1984 C C     . SER B 2 248 ? 32.241 14.762  34.364 1.00 56.59  ? 249 SER P C     1 
ATOM   1985 O O     . SER B 2 248 ? 32.628 13.605  34.228 1.00 57.69  ? 249 SER P O     1 
ATOM   1986 C CB    . SER B 2 248 ? 31.653 16.311  32.502 1.00 61.31  ? 249 SER P CB    1 
ATOM   1987 O OG    . SER B 2 248 ? 30.443 16.662  33.172 1.00 56.60  ? 249 SER P OG    1 
ATOM   1988 N N     . ASN B 2 249 ? 31.370 15.131  35.292 1.00 58.79  ? 250 ASN P N     1 
ATOM   1989 C CA    . ASN B 2 249 ? 30.778 14.167  36.193 1.00 59.18  ? 250 ASN P CA    1 
ATOM   1990 C C     . ASN B 2 249 ? 29.713 13.415  35.400 1.00 56.40  ? 250 ASN P C     1 
ATOM   1991 O O     . ASN B 2 249 ? 28.904 14.035  34.693 1.00 61.23  ? 250 ASN P O     1 
ATOM   1992 C CB    . ASN B 2 249 ? 30.146 14.884  37.403 1.00 68.31  ? 250 ASN P CB    1 
ATOM   1993 C CG    . ASN B 2 249 ? 31.175 15.303  38.446 1.00 74.79  ? 250 ASN P CG    1 
ATOM   1994 O OD1   . ASN B 2 249 ? 32.010 14.506  38.858 1.00 75.16  ? 250 ASN P OD1   1 
ATOM   1995 N ND2   . ASN B 2 249 ? 31.103 16.549  38.890 1.00 76.25  ? 250 ASN P ND2   1 
ATOM   1996 N N     . LEU B 2 250 ? 29.760 12.087  35.448 1.00 51.11  ? 251 LEU P N     1 
ATOM   1997 C CA    . LEU B 2 250 ? 28.770 11.272  34.756 1.00 46.44  ? 251 LEU P CA    1 
ATOM   1998 C C     . LEU B 2 250 ? 27.643 10.927  35.718 1.00 42.80  ? 251 LEU P C     1 
ATOM   1999 O O     . LEU B 2 250 ? 27.872 10.268  36.731 1.00 42.48  ? 251 LEU P O     1 
ATOM   2000 C CB    . LEU B 2 250 ? 29.408 10.001  34.194 1.00 46.14  ? 251 LEU P CB    1 
ATOM   2001 C CG    . LEU B 2 250 ? 30.376 10.236  33.033 1.00 44.50  ? 251 LEU P CG    1 
ATOM   2002 C CD1   . LEU B 2 250 ? 30.977 8.934   32.597 1.00 37.15  ? 251 LEU P CD1   1 
ATOM   2003 C CD2   . LEU B 2 250 ? 29.643 10.896  31.868 1.00 52.50  ? 251 LEU P CD2   1 
ATOM   2004 N N     . LYS B 2 251 ? 26.431 11.381  35.410 1.00 42.75  ? 252 LYS P N     1 
ATOM   2005 C CA    . LYS B 2 251 ? 25.277 11.114  36.261 1.00 42.81  ? 252 LYS P CA    1 
ATOM   2006 C C     . LYS B 2 251 ? 23.986 11.061  35.484 1.00 43.56  ? 252 LYS P C     1 
ATOM   2007 O O     . LYS B 2 251 ? 23.721 11.933  34.666 1.00 47.11  ? 252 LYS P O     1 
ATOM   2008 C CB    . LYS B 2 251 ? 25.145 12.181  37.359 1.00 42.81  ? 252 LYS P CB    1 
ATOM   2009 C CG    . LYS B 2 251 ? 23.839 12.101  38.159 1.00 51.41  ? 252 LYS P CG    1 
ATOM   2010 C CD    . LYS B 2 251 ? 23.909 12.900  39.441 1.00 54.34  ? 252 LYS P CD    1 
ATOM   2011 C CE    . LYS B 2 251 ? 24.138 14.373  39.175 1.00 79.31  ? 252 LYS P CE    1 
ATOM   2012 N NZ    . LYS B 2 251 ? 24.558 15.082  40.413 1.00 84.17  ? 252 LYS P NZ    1 
ATOM   2013 N N     . ILE B 2 252 ? 23.210 10.006  35.713 1.00 43.15  ? 253 ILE P N     1 
ATOM   2014 C CA    . ILE B 2 252 ? 21.902 9.846   35.089 1.00 43.75  ? 253 ILE P CA    1 
ATOM   2015 C C     . ILE B 2 252 ? 20.984 10.495  36.119 1.00 41.43  ? 253 ILE P C     1 
ATOM   2016 O O     . ILE B 2 252 ? 20.884 10.003  37.234 1.00 42.35  ? 253 ILE P O     1 
ATOM   2017 C CB    . ILE B 2 252 ? 21.492 8.352   34.959 1.00 43.02  ? 253 ILE P CB    1 
ATOM   2018 C CG1   . ILE B 2 252 ? 22.424 7.604   34.007 1.00 50.40  ? 253 ILE P CG1   1 
ATOM   2019 C CG2   . ILE B 2 252 ? 20.074 8.235   34.454 1.00 36.21  ? 253 ILE P CG2   1 
ATOM   2020 C CD1   . ILE B 2 252 ? 22.108 6.112   33.898 1.00 32.03  ? 253 ILE P CD1   1 
ATOM   2021 N N     . VAL B 2 253 ? 20.377 11.628  35.782 1.00 41.66  ? 254 VAL P N     1 
ATOM   2022 C CA    . VAL B 2 253 ? 19.488 12.327  36.720 1.00 40.97  ? 254 VAL P CA    1 
ATOM   2023 C C     . VAL B 2 253 ? 18.133 11.654  36.923 1.00 43.11  ? 254 VAL P C     1 
ATOM   2024 O O     . VAL B 2 253 ? 17.639 11.541  38.042 1.00 43.63  ? 254 VAL P O     1 
ATOM   2025 C CB    . VAL B 2 253 ? 19.262 13.787  36.289 1.00 36.61  ? 254 VAL P CB    1 
ATOM   2026 C CG1   . VAL B 2 253 ? 18.039 14.381  37.006 1.00 32.38  ? 254 VAL P CG1   1 
ATOM   2027 C CG2   . VAL B 2 253 ? 20.504 14.603  36.592 1.00 31.14  ? 254 VAL P CG2   1 
ATOM   2028 N N     . ARG B 2 254 ? 17.510 11.264  35.823 1.00 46.34  ? 255 ARG P N     1 
ATOM   2029 C CA    . ARG B 2 254 ? 16.217 10.604  35.873 1.00 42.97  ? 255 ARG P CA    1 
ATOM   2030 C C     . ARG B 2 254 ? 15.898 9.958   34.523 1.00 42.07  ? 255 ARG P C     1 
ATOM   2031 O O     . ARG B 2 254 ? 16.313 10.437  33.462 1.00 36.96  ? 255 ARG P O     1 
ATOM   2032 C CB    . ARG B 2 254 ? 15.112 11.579  36.327 1.00 43.82  ? 255 ARG P CB    1 
ATOM   2033 C CG    . ARG B 2 254 ? 14.871 12.784  35.433 1.00 50.20  ? 255 ARG P CG    1 
ATOM   2034 C CD    . ARG B 2 254 ? 13.915 13.769  36.090 1.00 57.46  ? 255 ARG P CD    1 
ATOM   2035 N NE    . ARG B 2 254 ? 12.669 13.124  36.509 1.00 55.68  ? 255 ARG P NE    1 
ATOM   2036 C CZ    . ARG B 2 254 ? 11.683 13.736  37.165 1.00 63.36  ? 255 ARG P CZ    1 
ATOM   2037 N NH1   . ARG B 2 254 ? 11.778 15.024  37.491 1.00 49.55  ? 255 ARG P NH1   1 
ATOM   2038 N NH2   . ARG B 2 254 ? 10.592 13.058  37.500 1.00 62.59  ? 255 ARG P NH2   1 
ATOM   2039 N N     . MET B 2 255 ? 15.236 8.813   34.584 1.00 44.13  ? 256 MET P N     1 
ATOM   2040 C CA    . MET B 2 255 ? 14.883 8.085   33.390 1.00 46.23  ? 256 MET P CA    1 
ATOM   2041 C C     . MET B 2 255 ? 13.394 8.075   33.177 1.00 53.41  ? 256 MET P C     1 
ATOM   2042 O O     . MET B 2 255 ? 12.600 8.231   34.103 1.00 57.38  ? 256 MET P O     1 
ATOM   2043 C CB    . MET B 2 255 ? 15.366 6.645   33.466 1.00 46.07  ? 256 MET P CB    1 
ATOM   2044 C CG    . MET B 2 255 ? 16.856 6.478   33.439 1.00 53.14  ? 256 MET P CG    1 
ATOM   2045 S SD    . MET B 2 255 ? 17.262 4.893   32.724 1.00 65.86  ? 256 MET P SD    1 
ATOM   2046 C CE    . MET B 2 255 ? 17.079 3.814   34.136 1.00 70.18  ? 256 MET P CE    1 
ATOM   2047 N N     . ASP B 2 256 ? 13.046 7.861   31.925 1.00 58.04  ? 257 ASP P N     1 
ATOM   2048 C CA    . ASP B 2 256 ? 11.686 7.784   31.455 1.00 59.62  ? 257 ASP P CA    1 
ATOM   2049 C C     . ASP B 2 256 ? 11.024 6.523   32.003 1.00 65.18  ? 257 ASP P C     1 
ATOM   2050 O O     . ASP B 2 256 ? 10.006 6.577   32.699 1.00 63.54  ? 257 ASP P O     1 
ATOM   2051 C CB    . ASP B 2 256 ? 11.758 7.673   29.949 1.00 54.15  ? 257 ASP P CB    1 
ATOM   2052 C CG    . ASP B 2 256 ? 10.624 8.320   29.275 1.00 50.62  ? 257 ASP P CG    1 
ATOM   2053 O OD1   . ASP B 2 256 ? 9.744  8.849   29.974 1.00 46.50  ? 257 ASP P OD1   1 
ATOM   2054 O OD2   . ASP B 2 256 ? 10.625 8.297   28.036 1.00 53.20  ? 257 ASP P OD2   1 
ATOM   2055 N N     . ARG B 2 257 ? 11.587 5.385   31.604 1.00 69.20  ? 258 ARG P N     1 
ATOM   2056 C CA    . ARG B 2 257 ? 11.114 4.068   32.009 1.00 72.07  ? 258 ARG P CA    1 
ATOM   2057 C C     . ARG B 2 257 ? 12.211 3.341   32.784 1.00 71.43  ? 258 ARG P C     1 
ATOM   2058 O O     . ARG B 2 257 ? 13.374 3.372   32.387 1.00 71.37  ? 258 ARG P O     1 
ATOM   2059 C CB    . ARG B 2 257 ? 10.753 3.252   30.777 1.00 72.25  ? 258 ARG P CB    1 
ATOM   2060 C CG    . ARG B 2 257 ? 9.675  3.864   29.924 1.00 84.48  ? 258 ARG P CG    1 
ATOM   2061 C CD    . ARG B 2 257 ? 9.356  2.925   28.790 1.00 100.52 ? 258 ARG P CD    1 
ATOM   2062 N NE    . ARG B 2 257 ? 8.304  3.442   27.920 1.00 107.06 ? 258 ARG P NE    1 
ATOM   2063 C CZ    . ARG B 2 257 ? 8.233  3.192   26.615 1.00 108.58 ? 258 ARG P CZ    1 
ATOM   2064 N NH1   . ARG B 2 257 ? 9.161  2.433   26.036 1.00 112.12 ? 258 ARG P NH1   1 
ATOM   2065 N NH2   . ARG B 2 257 ? 7.232  3.691   25.892 1.00 101.86 ? 258 ARG P NH2   1 
ATOM   2066 N N     . THR B 2 258 ? 11.833 2.668   33.869 1.00 73.14  ? 259 THR P N     1 
ATOM   2067 C CA    . THR B 2 258 ? 12.785 1.937   34.711 1.00 72.50  ? 259 THR P CA    1 
ATOM   2068 C C     . THR B 2 258 ? 12.731 0.428   34.491 1.00 75.02  ? 259 THR P C     1 
ATOM   2069 O O     . THR B 2 258 ? 13.371 -0.350  35.207 1.00 77.20  ? 259 THR P O     1 
ATOM   2070 C CB    . THR B 2 258 ? 12.519 2.217   36.199 1.00 68.64  ? 259 THR P CB    1 
ATOM   2071 O OG1   . THR B 2 258 ? 11.117 2.089   36.463 1.00 83.59  ? 259 THR P OG1   1 
ATOM   2072 C CG2   . THR B 2 258 ? 12.972 3.620   36.566 1.00 62.09  ? 259 THR P CG2   1 
ATOM   2073 N N     . ALA B 2 259 ? 11.957 0.022   33.498 1.00 72.69  ? 260 ALA P N     1 
ATOM   2074 C CA    . ALA B 2 259 ? 11.802 -1.377  33.177 1.00 72.81  ? 260 ALA P CA    1 
ATOM   2075 C C     . ALA B 2 259 ? 11.543 -1.484  31.680 1.00 76.25  ? 260 ALA P C     1 
ATOM   2076 O O     . ALA B 2 259 ? 11.174 -0.495  31.044 1.00 78.81  ? 260 ALA P O     1 
ATOM   2077 C CB    . ALA B 2 259 ? 10.648 -1.954  33.966 1.00 74.23  ? 260 ALA P CB    1 
ATOM   2078 N N     . GLY B 2 260 ? 11.754 -2.670  31.116 1.00 77.58  ? 261 GLY P N     1 
ATOM   2079 C CA    . GLY B 2 260 ? 11.542 -2.860  29.692 1.00 80.72  ? 261 GLY P CA    1 
ATOM   2080 C C     . GLY B 2 260 ? 11.466 -4.322  29.311 1.00 82.62  ? 261 GLY P C     1 
ATOM   2081 O O     . GLY B 2 260 ? 11.959 -5.191  30.034 1.00 82.51  ? 261 GLY P O     1 
ATOM   2082 N N     . CYS B 2 261 ? 10.820 -4.599  28.185 1.00 87.72  ? 262 CYS P N     1 
ATOM   2083 C CA    . CYS B 2 261 ? 10.679 -5.966  27.718 1.00 90.73  ? 262 CYS P CA    1 
ATOM   2084 C C     . CYS B 2 261 ? 12.040 -6.557  27.361 1.00 89.26  ? 262 CYS P C     1 
ATOM   2085 O O     . CYS B 2 261 ? 12.884 -5.893  26.752 1.00 84.54  ? 262 CYS P O     1 
ATOM   2086 C CB    . CYS B 2 261 ? 9.734  -6.031  26.523 1.00 95.43  ? 262 CYS P CB    1 
ATOM   2087 S SG    . CYS B 2 261 ? 9.406  -7.720  26.008 1.00 104.13 ? 262 CYS P SG    1 
ATOM   2088 N N     . VAL B 2 262 ? 12.221 -7.822  27.723 1.00 86.89  ? 263 VAL P N     1 
ATOM   2089 C CA    . VAL B 2 262 ? 13.458 -8.555  27.499 1.00 84.47  ? 263 VAL P CA    1 
ATOM   2090 C C     . VAL B 2 262 ? 14.024 -8.527  26.073 1.00 83.58  ? 263 VAL P C     1 
ATOM   2091 O O     . VAL B 2 262 ? 15.230 -8.649  25.878 1.00 84.83  ? 263 VAL P O     1 
ATOM   2092 C CB    . VAL B 2 262 ? 13.310 -9.998  28.048 1.00 85.65  ? 263 VAL P CB    1 
ATOM   2093 C CG1   . VAL B 2 262 ? 14.292 -10.939 27.408 1.00 82.22  ? 263 VAL P CG1   1 
ATOM   2094 C CG2   . VAL B 2 262 ? 13.515 -9.992  29.557 1.00 79.88  ? 263 VAL P CG2   1 
ATOM   2095 N N     . THR B 2 263 ? 13.173 -8.323  25.080 1.00 82.71  ? 264 THR P N     1 
ATOM   2096 C CA    . THR B 2 263 ? 13.634 -8.268  23.693 1.00 80.24  ? 264 THR P CA    1 
ATOM   2097 C C     . THR B 2 263 ? 14.318 -6.954  23.327 1.00 82.47  ? 264 THR P C     1 
ATOM   2098 O O     . THR B 2 263 ? 15.028 -6.876  22.314 1.00 80.94  ? 264 THR P O     1 
ATOM   2099 C CB    . THR B 2 263 ? 12.473 -8.472  22.726 1.00 73.59  ? 264 THR P CB    1 
ATOM   2100 O OG1   . THR B 2 263 ? 11.235 -8.277  23.424 1.00 58.87  ? 264 THR P OG1   1 
ATOM   2101 C CG2   . THR B 2 263 ? 12.526 -9.862  22.132 1.00 77.22  ? 264 THR P CG2   1 
ATOM   2102 N N     . GLY B 2 264 ? 14.084 -5.927  24.145 1.00 82.40  ? 265 GLY P N     1 
ATOM   2103 C CA    . GLY B 2 264 ? 14.659 -4.614  23.905 1.00 78.60  ? 265 GLY P CA    1 
ATOM   2104 C C     . GLY B 2 264 ? 13.793 -3.773  22.979 1.00 76.65  ? 265 GLY P C     1 
ATOM   2105 O O     . GLY B 2 264 ? 12.597 -4.059  22.821 1.00 74.65  ? 265 GLY P O     1 
ATOM   2106 N N     . GLY B 2 265 ? 14.381 -2.713  22.414 1.00 74.13  ? 266 GLY P N     1 
ATOM   2107 C CA    . GLY B 2 265 ? 13.668 -1.833  21.493 1.00 69.65  ? 266 GLY P CA    1 
ATOM   2108 C C     . GLY B 2 265 ? 12.831 -0.702  22.082 1.00 68.08  ? 266 GLY P C     1 
ATOM   2109 O O     . GLY B 2 265 ? 12.399 0.189   21.341 1.00 63.86  ? 266 GLY P O     1 
ATOM   2110 N N     . GLU B 2 266 ? 12.577 -0.753  23.394 1.00 68.96  ? 267 GLU P N     1 
ATOM   2111 C CA    . GLU B 2 266 ? 11.794 0.274   24.100 1.00 68.97  ? 267 GLU P CA    1 
ATOM   2112 C C     . GLU B 2 266 ? 12.532 1.617   24.148 1.00 67.82  ? 267 GLU P C     1 
ATOM   2113 O O     . GLU B 2 266 ? 13.719 1.677   24.496 1.00 63.58  ? 267 GLU P O     1 
ATOM   2114 C CB    . GLU B 2 266 ? 11.443 -0.164  25.537 1.00 65.91  ? 267 GLU P CB    1 
ATOM   2115 C CG    . GLU B 2 266 ? 10.148 -0.987  25.690 1.00 89.72  ? 267 GLU P CG    1 
ATOM   2116 C CD    . GLU B 2 266 ? 10.343 -2.491  25.505 1.00 97.66  ? 267 GLU P CD    1 
ATOM   2117 O OE1   . GLU B 2 266 ? 11.352 -3.032  26.013 1.00 104.27 ? 267 GLU P OE1   1 
ATOM   2118 O OE2   . GLU B 2 266 ? 9.476  -3.133  24.868 1.00 96.17  ? 267 GLU P OE2   1 
ATOM   2119 N N     . GLU B 2 267 ? 11.815 2.682   23.789 1.00 66.97  ? 268 GLU P N     1 
ATOM   2120 C CA    . GLU B 2 267 ? 12.339 4.047   23.765 1.00 61.73  ? 268 GLU P CA    1 
ATOM   2121 C C     . GLU B 2 267 ? 12.346 4.711   25.143 1.00 60.08  ? 268 GLU P C     1 
ATOM   2122 O O     . GLU B 2 267 ? 11.295 4.904   25.759 1.00 52.89  ? 268 GLU P O     1 
ATOM   2123 C CB    . GLU B 2 267 ? 11.519 4.894   22.790 1.00 59.91  ? 268 GLU P CB    1 
ATOM   2124 C CG    . GLU B 2 267 ? 11.960 6.335   22.718 1.00 59.37  ? 268 GLU P CG    1 
ATOM   2125 C CD    . GLU B 2 267 ? 12.124 6.819   21.295 1.00 63.02  ? 268 GLU P CD    1 
ATOM   2126 O OE1   . GLU B 2 267 ? 12.949 6.233   20.564 1.00 60.11  ? 268 GLU P OE1   1 
ATOM   2127 O OE2   . GLU B 2 267 ? 11.440 7.794   20.915 1.00 59.81  ? 268 GLU P OE2   1 
ATOM   2128 N N     . ILE B 2 268 ? 13.528 5.119   25.592 1.00 62.12  ? 269 ILE P N     1 
ATOM   2129 C CA    . ILE B 2 268 ? 13.671 5.745   26.899 1.00 62.95  ? 269 ILE P CA    1 
ATOM   2130 C C     . ILE B 2 268 ? 14.285 7.131   26.787 1.00 62.23  ? 269 ILE P C     1 
ATOM   2131 O O     . ILE B 2 268 ? 15.177 7.363   25.973 1.00 61.85  ? 269 ILE P O     1 
ATOM   2132 C CB    . ILE B 2 268 ? 14.545 4.863   27.824 1.00 64.59  ? 269 ILE P CB    1 
ATOM   2133 C CG1   . ILE B 2 268 ? 13.853 3.522   28.058 1.00 67.21  ? 269 ILE P CG1   1 
ATOM   2134 C CG2   . ILE B 2 268 ? 14.825 5.562   29.150 1.00 49.62  ? 269 ILE P CG2   1 
ATOM   2135 C CD1   . ILE B 2 268 ? 14.741 2.495   28.681 1.00 63.80  ? 269 ILE P CD1   1 
ATOM   2136 N N     . TYR B 2 269 ? 13.720 8.070   27.533 1.00 56.60  ? 270 TYR P N     1 
ATOM   2137 C CA    . TYR B 2 269 ? 14.224 9.433   27.579 1.00 59.05  ? 270 TYR P CA    1 
ATOM   2138 C C     . TYR B 2 269 ? 15.044 9.518   28.858 1.00 56.50  ? 270 TYR P C     1 
ATOM   2139 O O     . TYR B 2 269 ? 14.496 9.473   29.963 1.00 55.71  ? 270 TYR P O     1 
ATOM   2140 C CB    . TYR B 2 269 ? 13.080 10.450  27.638 1.00 62.11  ? 270 TYR P CB    1 
ATOM   2141 C CG    . TYR B 2 269 ? 12.523 10.880  26.298 1.00 64.94  ? 270 TYR P CG    1 
ATOM   2142 C CD1   . TYR B 2 269 ? 12.408 9.981   25.242 1.00 63.22  ? 270 TYR P CD1   1 
ATOM   2143 C CD2   . TYR B 2 269 ? 12.128 12.200  26.082 1.00 66.97  ? 270 TYR P CD2   1 
ATOM   2144 C CE1   . TYR B 2 269 ? 11.920 10.388  24.008 1.00 61.61  ? 270 TYR P CE1   1 
ATOM   2145 C CE2   . TYR B 2 269 ? 11.640 12.612  24.853 1.00 67.77  ? 270 TYR P CE2   1 
ATOM   2146 C CZ    . TYR B 2 269 ? 11.543 11.703  23.822 1.00 60.41  ? 270 TYR P CZ    1 
ATOM   2147 O OH    . TYR B 2 269 ? 11.100 12.115  22.596 1.00 63.29  ? 270 TYR P OH    1 
ATOM   2148 N N     . LEU B 2 270 ? 16.356 9.605   28.707 1.00 54.22  ? 271 LEU P N     1 
ATOM   2149 C CA    . LEU B 2 270 ? 17.251 9.677   29.845 1.00 50.73  ? 271 LEU P CA    1 
ATOM   2150 C C     . LEU B 2 270 ? 17.788 11.092  30.030 1.00 52.25  ? 271 LEU P C     1 
ATOM   2151 O O     . LEU B 2 270 ? 18.254 11.712  29.075 1.00 51.33  ? 271 LEU P O     1 
ATOM   2152 C CB    . LEU B 2 270 ? 18.389 8.679   29.631 1.00 44.56  ? 271 LEU P CB    1 
ATOM   2153 C CG    . LEU B 2 270 ? 19.437 8.364   30.691 1.00 45.50  ? 271 LEU P CG    1 
ATOM   2154 C CD1   . LEU B 2 270 ? 20.053 7.006   30.391 1.00 51.43  ? 271 LEU P CD1   1 
ATOM   2155 C CD2   . LEU B 2 270 ? 20.501 9.435   30.700 1.00 47.70  ? 271 LEU P CD2   1 
ATOM   2156 N N     . LEU B 2 271 ? 17.624 11.640  31.229 1.00 49.59  ? 272 LEU P N     1 
ATOM   2157 C CA    . LEU B 2 271 ? 18.140 12.966  31.537 1.00 44.15  ? 272 LEU P CA    1 
ATOM   2158 C C     . LEU B 2 271 ? 19.470 12.716  32.257 1.00 47.33  ? 272 LEU P C     1 
ATOM   2159 O O     . LEU B 2 271 ? 19.566 11.828  33.109 1.00 45.00  ? 272 LEU P O     1 
ATOM   2160 C CB    . LEU B 2 271 ? 17.160 13.742  32.415 1.00 36.88  ? 272 LEU P CB    1 
ATOM   2161 C CG    . LEU B 2 271 ? 15.803 14.079  31.795 1.00 41.33  ? 272 LEU P CG    1 
ATOM   2162 C CD1   . LEU B 2 271 ? 15.045 15.019  32.697 1.00 31.87  ? 272 LEU P CD1   1 
ATOM   2163 C CD2   . LEU B 2 271 ? 16.011 14.716  30.457 1.00 42.13  ? 272 LEU P CD2   1 
ATOM   2164 N N     . CYS B 2 272 ? 20.497 13.487  31.916 1.00 49.33  ? 273 CYS P N     1 
ATOM   2165 C CA    . CYS B 2 272 ? 21.826 13.302  32.501 1.00 44.79  ? 273 CYS P CA    1 
ATOM   2166 C C     . CYS B 2 272 ? 22.599 14.608  32.648 1.00 41.78  ? 273 CYS P C     1 
ATOM   2167 O O     . CYS B 2 272 ? 22.062 15.678  32.370 1.00 47.42  ? 273 CYS P O     1 
ATOM   2168 C CB    . CYS B 2 272 ? 22.629 12.363  31.603 1.00 51.57  ? 273 CYS P CB    1 
ATOM   2169 S SG    . CYS B 2 272 ? 22.761 12.928  29.871 1.00 39.12  ? 273 CYS P SG    1 
ATOM   2170 N N     . ASP B 2 273 ? 23.819 14.529  33.171 1.00 41.37  ? 274 ASP P N     1 
ATOM   2171 C CA    . ASP B 2 273 ? 24.667 15.712  33.302 1.00 49.17  ? 274 ASP P CA    1 
ATOM   2172 C C     . ASP B 2 273 ? 25.357 15.922  31.943 1.00 51.93  ? 274 ASP P C     1 
ATOM   2173 O O     . ASP B 2 273 ? 25.342 15.026  31.100 1.00 51.58  ? 274 ASP P O     1 
ATOM   2174 C CB    . ASP B 2 273 ? 25.717 15.524  34.409 1.00 57.04  ? 274 ASP P CB    1 
ATOM   2175 C CG    . ASP B 2 273 ? 25.321 16.184  35.731 1.00 69.21  ? 274 ASP P CG    1 
ATOM   2176 O OD1   . ASP B 2 273 ? 24.115 16.397  35.987 1.00 68.52  ? 274 ASP P OD1   1 
ATOM   2177 O OD2   . ASP B 2 273 ? 26.228 16.487  36.534 1.00 73.14  ? 274 ASP P OD2   1 
ATOM   2178 N N     . LYS B 2 274 ? 25.950 17.097  31.736 1.00 49.06  ? 275 LYS P N     1 
ATOM   2179 C CA    . LYS B 2 274 ? 26.620 17.421  30.481 1.00 45.43  ? 275 LYS P CA    1 
ATOM   2180 C C     . LYS B 2 274 ? 27.481 16.284  29.946 1.00 44.42  ? 275 LYS P C     1 
ATOM   2181 O O     . LYS B 2 274 ? 28.347 15.778  30.653 1.00 46.35  ? 275 LYS P O     1 
ATOM   2182 C CB    . LYS B 2 274 ? 27.472 18.683  30.661 1.00 39.82  ? 275 LYS P CB    1 
ATOM   2183 C CG    . LYS B 2 274 ? 28.267 19.127  29.442 1.00 41.03  ? 275 LYS P CG    1 
ATOM   2184 C CD    . LYS B 2 274 ? 29.176 20.301  29.786 1.00 48.10  ? 275 LYS P CD    1 
ATOM   2185 C CE    . LYS B 2 274 ? 28.581 21.637  29.398 1.00 64.40  ? 275 LYS P CE    1 
ATOM   2186 N NZ    . LYS B 2 274 ? 29.140 22.118  28.094 1.00 76.06  ? 275 LYS P NZ    1 
ATOM   2187 N N     . VAL B 2 275 ? 27.163 15.832  28.732 1.00 45.03  ? 276 VAL P N     1 
ATOM   2188 C CA    . VAL B 2 275 ? 27.922 14.788  28.038 1.00 44.46  ? 276 VAL P CA    1 
ATOM   2189 C C     . VAL B 2 275 ? 28.252 15.305  26.638 1.00 45.18  ? 276 VAL P C     1 
ATOM   2190 O O     . VAL B 2 275 ? 27.915 16.442  26.298 1.00 48.36  ? 276 VAL P O     1 
ATOM   2191 C CB    . VAL B 2 275 ? 27.156 13.450  27.898 1.00 42.12  ? 276 VAL P CB    1 
ATOM   2192 C CG1   . VAL B 2 275 ? 26.967 12.815  29.252 1.00 54.87  ? 276 VAL P CG1   1 
ATOM   2193 C CG2   . VAL B 2 275 ? 25.827 13.657  27.189 1.00 45.47  ? 276 VAL P CG2   1 
ATOM   2194 N N     . GLN B 2 276 ? 28.920 14.481  25.832 1.00 47.71  ? 277 GLN P N     1 
ATOM   2195 C CA    . GLN B 2 276 ? 29.294 14.844  24.463 1.00 45.88  ? 277 GLN P CA    1 
ATOM   2196 C C     . GLN B 2 276 ? 28.881 13.735  23.500 1.00 48.91  ? 277 GLN P C     1 
ATOM   2197 O O     . GLN B 2 276 ? 29.551 12.712  23.421 1.00 46.63  ? 277 GLN P O     1 
ATOM   2198 C CB    . GLN B 2 276 ? 30.792 15.033  24.376 1.00 40.95  ? 277 GLN P CB    1 
ATOM   2199 C CG    . GLN B 2 276 ? 31.340 16.083  25.296 1.00 33.64  ? 277 GLN P CG    1 
ATOM   2200 C CD    . GLN B 2 276 ? 32.840 16.110  25.224 1.00 54.18  ? 277 GLN P CD    1 
ATOM   2201 O OE1   . GLN B 2 276 ? 33.499 15.129  25.556 1.00 67.79  ? 277 GLN P OE1   1 
ATOM   2202 N NE2   . GLN B 2 276 ? 33.393 17.203  24.728 1.00 34.66  ? 277 GLN P NE2   1 
ATOM   2203 N N     . LYS B 2 277 ? 27.810 13.972  22.742 1.00 53.35  ? 278 LYS P N     1 
ATOM   2204 C CA    . LYS B 2 277 ? 27.255 12.995  21.806 1.00 57.89  ? 278 LYS P CA    1 
ATOM   2205 C C     . LYS B 2 277 ? 28.183 11.931  21.219 1.00 63.23  ? 278 LYS P C     1 
ATOM   2206 O O     . LYS B 2 277 ? 27.842 10.750  21.215 1.00 66.62  ? 278 LYS P O     1 
ATOM   2207 C CB    . LYS B 2 277 ? 26.451 13.688  20.693 1.00 57.31  ? 278 LYS P CB    1 
ATOM   2208 C CG    . LYS B 2 277 ? 26.973 15.058  20.201 1.00 58.23  ? 278 LYS P CG    1 
ATOM   2209 C CD    . LYS B 2 277 ? 26.198 15.546  18.940 1.00 57.13  ? 278 LYS P CD    1 
ATOM   2210 C CE    . LYS B 2 277 ? 26.284 17.071  18.669 1.00 58.30  ? 278 LYS P CE    1 
ATOM   2211 N NZ    . LYS B 2 277 ? 27.657 17.607  18.419 1.00 57.30  ? 278 LYS P NZ    1 
ATOM   2212 N N     . ASP B 2 278 ? 29.365 12.334  20.767 1.00 66.52  ? 279 ASP P N     1 
ATOM   2213 C CA    . ASP B 2 278 ? 30.319 11.400  20.159 1.00 72.44  ? 279 ASP P CA    1 
ATOM   2214 C C     . ASP B 2 278 ? 31.023 10.443  21.111 1.00 72.65  ? 279 ASP P C     1 
ATOM   2215 O O     . ASP B 2 278 ? 31.381 9.323   20.737 1.00 77.44  ? 279 ASP P O     1 
ATOM   2216 C CB    . ASP B 2 278 ? 31.392 12.165  19.372 1.00 77.34  ? 279 ASP P CB    1 
ATOM   2217 C CG    . ASP B 2 278 ? 30.904 12.644  18.008 1.00 84.84  ? 279 ASP P CG    1 
ATOM   2218 O OD1   . ASP B 2 278 ? 30.106 11.921  17.366 1.00 85.40  ? 279 ASP P OD1   1 
ATOM   2219 O OD2   . ASP B 2 278 ? 31.340 13.736  17.572 1.00 79.98  ? 279 ASP P OD2   1 
ATOM   2220 N N     . ASP B 2 279 ? 31.237 10.899  22.336 1.00 71.19  ? 280 ASP P N     1 
ATOM   2221 C CA    . ASP B 2 279 ? 31.950 10.120  23.334 1.00 64.80  ? 280 ASP P CA    1 
ATOM   2222 C C     . ASP B 2 279 ? 31.068 9.724   24.517 1.00 63.35  ? 280 ASP P C     1 
ATOM   2223 O O     . ASP B 2 279 ? 31.414 9.960   25.676 1.00 64.00  ? 280 ASP P O     1 
ATOM   2224 C CB    . ASP B 2 279 ? 33.158 10.943  23.799 1.00 60.78  ? 280 ASP P CB    1 
ATOM   2225 C CG    . ASP B 2 279 ? 34.105 10.164  24.687 1.00 63.64  ? 280 ASP P CG    1 
ATOM   2226 O OD1   . ASP B 2 279 ? 34.038 8.925   24.709 1.00 56.95  ? 280 ASP P OD1   1 
ATOM   2227 O OD2   . ASP B 2 279 ? 34.928 10.805  25.364 1.00 60.11  ? 280 ASP P OD2   1 
ATOM   2228 N N     . ILE B 2 280 ? 29.952 9.074   24.238 1.00 60.54  ? 281 ILE P N     1 
ATOM   2229 C CA    . ILE B 2 280 ? 29.067 8.675   25.315 1.00 59.87  ? 281 ILE P CA    1 
ATOM   2230 C C     . ILE B 2 280 ? 28.415 7.344   24.982 1.00 59.38  ? 281 ILE P C     1 
ATOM   2231 O O     . ILE B 2 280 ? 28.192 7.034   23.819 1.00 65.53  ? 281 ILE P O     1 
ATOM   2232 C CB    . ILE B 2 280 ? 27.984 9.762   25.556 1.00 55.59  ? 281 ILE P CB    1 
ATOM   2233 C CG1   . ILE B 2 280 ? 27.174 9.464   26.812 1.00 56.24  ? 281 ILE P CG1   1 
ATOM   2234 C CG2   . ILE B 2 280 ? 27.069 9.871   24.362 1.00 67.45  ? 281 ILE P CG2   1 
ATOM   2235 C CD1   . ILE B 2 280 ? 27.935 9.703   28.066 1.00 51.87  ? 281 ILE P CD1   1 
ATOM   2236 N N     . GLN B 2 281 ? 28.183 6.530   26.001 1.00 54.00  ? 282 GLN P N     1 
ATOM   2237 C CA    . GLN B 2 281 ? 27.534 5.241   25.822 1.00 50.90  ? 282 GLN P CA    1 
ATOM   2238 C C     . GLN B 2 281 ? 26.530 5.066   26.944 1.00 52.24  ? 282 GLN P C     1 
ATOM   2239 O O     . GLN B 2 281 ? 26.637 5.730   27.977 1.00 53.85  ? 282 GLN P O     1 
ATOM   2240 C CB    . GLN B 2 281 ? 28.528 4.104   25.980 1.00 44.72  ? 282 GLN P CB    1 
ATOM   2241 C CG    . GLN B 2 281 ? 29.716 4.076   25.077 1.00 59.78  ? 282 GLN P CG    1 
ATOM   2242 C CD    . GLN B 2 281 ? 30.541 2.830   25.332 1.00 71.13  ? 282 GLN P CD    1 
ATOM   2243 O OE1   . GLN B 2 281 ? 30.546 2.301   26.442 1.00 74.71  ? 282 GLN P OE1   1 
ATOM   2244 N NE2   . GLN B 2 281 ? 31.204 2.332   24.308 1.00 67.40  ? 282 GLN P NE2   1 
ATOM   2245 N N     . ILE B 2 282 ? 25.548 4.193   26.742 1.00 53.49  ? 283 ILE P N     1 
ATOM   2246 C CA    . ILE B 2 282 ? 24.588 3.881   27.802 1.00 56.57  ? 283 ILE P CA    1 
ATOM   2247 C C     . ILE B 2 282 ? 24.739 2.375   27.992 1.00 58.76  ? 283 ILE P C     1 
ATOM   2248 O O     . ILE B 2 282 ? 24.357 1.585   27.128 1.00 64.60  ? 283 ILE P O     1 
ATOM   2249 C CB    . ILE B 2 282 ? 23.135 4.254   27.457 1.00 54.26  ? 283 ILE P CB    1 
ATOM   2250 C CG1   . ILE B 2 282 ? 23.032 5.763   27.192 1.00 54.07  ? 283 ILE P CG1   1 
ATOM   2251 C CG2   . ILE B 2 282 ? 22.216 3.870   28.631 1.00 39.04  ? 283 ILE P CG2   1 
ATOM   2252 C CD1   . ILE B 2 282 ? 21.650 6.237   26.824 1.00 46.17  ? 283 ILE P CD1   1 
ATOM   2253 N N     . ARG B 2 283 ? 25.370 2.000   29.099 1.00 59.75  ? 284 ARG P N     1 
ATOM   2254 C CA    . ARG B 2 283 ? 25.664 0.610   29.423 1.00 56.09  ? 284 ARG P CA    1 
ATOM   2255 C C     . ARG B 2 283 ? 24.720 -0.123  30.369 1.00 54.18  ? 284 ARG P C     1 
ATOM   2256 O O     . ARG B 2 283 ? 24.446 0.324   31.482 1.00 49.33  ? 284 ARG P O     1 
ATOM   2257 C CB    . ARG B 2 283 ? 27.082 0.540   29.974 1.00 58.15  ? 284 ARG P CB    1 
ATOM   2258 C CG    . ARG B 2 283 ? 27.556 -0.825  30.360 1.00 66.53  ? 284 ARG P CG    1 
ATOM   2259 C CD    . ARG B 2 283 ? 29.036 -0.766  30.614 1.00 72.96  ? 284 ARG P CD    1 
ATOM   2260 N NE    . ARG B 2 283 ? 29.548 -2.077  30.964 1.00 74.46  ? 284 ARG P NE    1 
ATOM   2261 C CZ    . ARG B 2 283 ? 29.621 -2.532  32.205 1.00 76.16  ? 284 ARG P CZ    1 
ATOM   2262 N NH1   . ARG B 2 283 ? 29.224 -1.769  33.211 1.00 82.62  ? 284 ARG P NH1   1 
ATOM   2263 N NH2   . ARG B 2 283 ? 30.054 -3.761  32.438 1.00 74.25  ? 284 ARG P NH2   1 
ATOM   2264 N N     . PHE B 2 284 ? 24.204 -1.248  29.896 1.00 58.42  ? 285 PHE P N     1 
ATOM   2265 C CA    . PHE B 2 284 ? 23.331 -2.097  30.689 1.00 55.64  ? 285 PHE P CA    1 
ATOM   2266 C C     . PHE B 2 284 ? 24.251 -3.221  31.120 1.00 50.79  ? 285 PHE P C     1 
ATOM   2267 O O     . PHE B 2 284 ? 25.117 -3.647  30.356 1.00 40.36  ? 285 PHE P O     1 
ATOM   2268 C CB    . PHE B 2 284 ? 22.177 -2.646  29.843 1.00 54.96  ? 285 PHE P CB    1 
ATOM   2269 C CG    . PHE B 2 284 ? 21.086 -1.650  29.591 1.00 57.05  ? 285 PHE P CG    1 
ATOM   2270 C CD1   . PHE B 2 284 ? 21.265 -0.615  28.687 1.00 57.69  ? 285 PHE P CD1   1 
ATOM   2271 C CD2   . PHE B 2 284 ? 19.881 -1.736  30.276 1.00 58.39  ? 285 PHE P CD2   1 
ATOM   2272 C CE1   . PHE B 2 284 ? 20.263 0.321   28.473 1.00 64.17  ? 285 PHE P CE1   1 
ATOM   2273 C CE2   . PHE B 2 284 ? 18.874 -0.806  30.066 1.00 51.38  ? 285 PHE P CE2   1 
ATOM   2274 C CZ    . PHE B 2 284 ? 19.065 0.225   29.165 1.00 51.43  ? 285 PHE P CZ    1 
ATOM   2275 N N     . TYR B 2 285 ? 24.116 -3.680  32.349 1.00 54.29  ? 286 TYR P N     1 
ATOM   2276 C CA    . TYR B 2 285 ? 24.989 -4.744  32.775 1.00 61.91  ? 286 TYR P CA    1 
ATOM   2277 C C     . TYR B 2 285 ? 24.466 -5.448  33.987 1.00 65.41  ? 286 TYR P C     1 
ATOM   2278 O O     . TYR B 2 285 ? 23.702 -4.877  34.769 1.00 66.26  ? 286 TYR P O     1 
ATOM   2279 C CB    . TYR B 2 285 ? 26.393 -4.212  33.068 1.00 62.31  ? 286 TYR P CB    1 
ATOM   2280 C CG    . TYR B 2 285 ? 26.487 -3.399  34.335 1.00 63.85  ? 286 TYR P CG    1 
ATOM   2281 C CD1   . TYR B 2 285 ? 26.528 -4.016  35.582 1.00 66.20  ? 286 TYR P CD1   1 
ATOM   2282 C CD2   . TYR B 2 285 ? 26.513 -2.015  34.291 1.00 62.24  ? 286 TYR P CD2   1 
ATOM   2283 C CE1   . TYR B 2 285 ? 26.589 -3.281  36.749 1.00 65.44  ? 286 TYR P CE1   1 
ATOM   2284 C CE2   . TYR B 2 285 ? 26.578 -1.263  35.456 1.00 62.02  ? 286 TYR P CE2   1 
ATOM   2285 C CZ    . TYR B 2 285 ? 26.614 -1.901  36.686 1.00 67.57  ? 286 TYR P CZ    1 
ATOM   2286 O OH    . TYR B 2 285 ? 26.675 -1.156  37.852 1.00 53.09  ? 286 TYR P OH    1 
ATOM   2287 N N     . GLU B 2 286 ? 24.952 -6.670  34.163 1.00 66.31  ? 287 GLU P N     1 
ATOM   2288 C CA    . GLU B 2 286 ? 24.587 -7.529  35.282 1.00 69.86  ? 287 GLU P CA    1 
ATOM   2289 C C     . GLU B 2 286 ? 25.853 -8.285  35.659 1.00 72.63  ? 287 GLU P C     1 
ATOM   2290 O O     . GLU B 2 286 ? 26.551 -8.819  34.786 1.00 71.17  ? 287 GLU P O     1 
ATOM   2291 C CB    . GLU B 2 286 ? 23.488 -8.515  34.864 1.00 68.34  ? 287 GLU P CB    1 
ATOM   2292 C CG    . GLU B 2 286 ? 22.973 -9.451  35.958 1.00 68.58  ? 287 GLU P CG    1 
ATOM   2293 C CD    . GLU B 2 286 ? 21.902 -10.397 35.434 1.00 69.95  ? 287 GLU P CD    1 
ATOM   2294 O OE1   . GLU B 2 286 ? 22.249 -11.363 34.726 1.00 64.57  ? 287 GLU P OE1   1 
ATOM   2295 O OE2   . GLU B 2 286 ? 20.708 -10.164 35.713 1.00 74.18  ? 287 GLU P OE2   1 
ATOM   2296 N N     . GLU B 2 287 ? 26.187 -8.260  36.946 1.00 76.14  ? 288 GLU P N     1 
ATOM   2297 C CA    . GLU B 2 287 ? 27.372 -8.944  37.443 1.00 80.01  ? 288 GLU P CA    1 
ATOM   2298 C C     . GLU B 2 287 ? 26.938 -10.230 38.141 1.00 84.90  ? 288 GLU P C     1 
ATOM   2299 O O     . GLU B 2 287 ? 26.149 -10.188 39.086 1.00 86.33  ? 288 GLU P O     1 
ATOM   2300 C CB    . GLU B 2 287 ? 28.145 -8.034  38.414 1.00 77.15  ? 288 GLU P CB    1 
ATOM   2301 C CG    . GLU B 2 287 ? 28.622 -6.701  37.797 1.00 72.00  ? 288 GLU P CG    1 
ATOM   2302 C CD    . GLU B 2 287 ? 29.336 -5.776  38.791 1.00 76.30  ? 288 GLU P CD    1 
ATOM   2303 O OE1   . GLU B 2 287 ? 29.273 -6.040  40.015 1.00 69.59  ? 288 GLU P OE1   1 
ATOM   2304 O OE2   . GLU B 2 287 ? 29.957 -4.775  38.342 1.00 74.88  ? 288 GLU P OE2   1 
ATOM   2305 N N     . GLU B 2 288 ? 27.380 -11.371 37.621 1.00 90.07  ? 289 GLU P N     1 
ATOM   2306 C CA    . GLU B 2 288 ? 27.040 -12.661 38.212 1.00 94.35  ? 289 GLU P CA    1 
ATOM   2307 C C     . GLU B 2 288 ? 28.153 -13.055 39.192 1.00 94.18  ? 289 GLU P C     1 
ATOM   2308 O O     . GLU B 2 288 ? 29.335 -12.978 38.849 1.00 94.77  ? 289 GLU P O     1 
ATOM   2309 C CB    . GLU B 2 288 ? 26.881 -13.700 37.107 1.00 100.73 ? 289 GLU P CB    1 
ATOM   2310 C CG    . GLU B 2 288 ? 25.739 -13.400 36.142 1.00 107.92 ? 289 GLU P CG    1 
ATOM   2311 C CD    . GLU B 2 288 ? 24.544 -14.340 36.318 1.00 116.43 ? 289 GLU P CD    1 
ATOM   2312 O OE1   . GLU B 2 288 ? 24.596 -15.252 37.176 1.00 120.38 ? 289 GLU P OE1   1 
ATOM   2313 O OE2   . GLU B 2 288 ? 23.554 -14.178 35.573 1.00 119.54 ? 289 GLU P OE2   1 
ATOM   2314 N N     . GLU B 2 289 ? 27.764 -13.470 40.402 1.00 96.31  ? 290 GLU P N     1 
ATOM   2315 C CA    . GLU B 2 289 ? 28.683 -13.858 41.495 1.00 98.28  ? 290 GLU P CA    1 
ATOM   2316 C C     . GLU B 2 289 ? 30.073 -14.410 41.141 1.00 97.97  ? 290 GLU P C     1 
ATOM   2317 O O     . GLU B 2 289 ? 31.028 -14.230 41.908 1.00 95.80  ? 290 GLU P O     1 
ATOM   2318 C CB    . GLU B 2 289 ? 28.006 -14.836 42.475 1.00 104.44 ? 290 GLU P CB    1 
ATOM   2319 C CG    . GLU B 2 289 ? 27.105 -14.200 43.537 1.00 107.75 ? 290 GLU P CG    1 
ATOM   2320 C CD    . GLU B 2 289 ? 25.670 -13.959 43.061 1.00 108.10 ? 290 GLU P CD    1 
ATOM   2321 O OE1   . GLU B 2 289 ? 25.338 -14.278 41.887 1.00 105.53 ? 290 GLU P OE1   1 
ATOM   2322 O OE2   . GLU B 2 289 ? 24.869 -13.452 43.882 1.00 103.52 ? 290 GLU P OE2   1 
ATOM   2323 N N     . ASN B 2 290 ? 30.177 -15.089 40.000 1.00 95.87  ? 291 ASN P N     1 
ATOM   2324 C CA    . ASN B 2 290 ? 31.436 -15.685 39.556 1.00 91.82  ? 291 ASN P CA    1 
ATOM   2325 C C     . ASN B 2 290 ? 32.463 -14.731 38.932 1.00 90.53  ? 291 ASN P C     1 
ATOM   2326 O O     . ASN B 2 290 ? 33.527 -15.173 38.492 1.00 89.50  ? 291 ASN P O     1 
ATOM   2327 C CB    . ASN B 2 290 ? 31.158 -16.842 38.587 1.00 91.83  ? 291 ASN P CB    1 
ATOM   2328 C CG    . ASN B 2 290 ? 30.586 -16.376 37.261 1.00 93.27  ? 291 ASN P CG    1 
ATOM   2329 O OD1   . ASN B 2 290 ? 29.372 -16.252 37.113 1.00 96.94  ? 291 ASN P OD1   1 
ATOM   2330 N ND2   . ASN B 2 290 ? 31.459 -16.114 36.291 1.00 95.17  ? 291 ASN P ND2   1 
ATOM   2331 N N     . GLY B 2 291 ? 32.148 -13.441 38.864 1.00 88.04  ? 292 GLY P N     1 
ATOM   2332 C CA    . GLY B 2 291 ? 33.081 -12.488 38.279 1.00 87.85  ? 292 GLY P CA    1 
ATOM   2333 C C     . GLY B 2 291 ? 32.844 -12.193 36.808 1.00 86.71  ? 292 GLY P C     1 
ATOM   2334 O O     . GLY B 2 291 ? 33.524 -11.355 36.205 1.00 81.17  ? 292 GLY P O     1 
ATOM   2335 N N     . GLY B 2 292 ? 31.924 -12.938 36.209 1.00 87.84  ? 293 GLY P N     1 
ATOM   2336 C CA    . GLY B 2 292 ? 31.593 -12.721 34.816 1.00 88.42  ? 293 GLY P CA    1 
ATOM   2337 C C     . GLY B 2 292 ? 30.597 -11.580 34.805 1.00 87.95  ? 293 GLY P C     1 
ATOM   2338 O O     . GLY B 2 292 ? 29.862 -11.390 35.786 1.00 84.48  ? 293 GLY P O     1 
ATOM   2339 N N     . VAL B 2 293 ? 30.558 -10.825 33.713 1.00 86.56  ? 294 VAL P N     1 
ATOM   2340 C CA    . VAL B 2 293 ? 29.647 -9.686  33.611 1.00 86.81  ? 294 VAL P CA    1 
ATOM   2341 C C     . VAL B 2 293 ? 28.939 -9.589  32.269 1.00 85.09  ? 294 VAL P C     1 
ATOM   2342 O O     . VAL B 2 293 ? 29.543 -9.805  31.224 1.00 85.15  ? 294 VAL P O     1 
ATOM   2343 C CB    . VAL B 2 293 ? 30.379 -8.326  33.867 1.00 82.36  ? 294 VAL P CB    1 
ATOM   2344 C CG1   . VAL B 2 293 ? 30.667 -8.149  35.348 1.00 84.48  ? 294 VAL P CG1   1 
ATOM   2345 C CG2   . VAL B 2 293 ? 31.685 -8.257  33.075 1.00 85.05  ? 294 VAL P CG2   1 
ATOM   2346 N N     . TRP B 2 294 ? 27.642 -9.330  32.296 1.00 86.49  ? 295 TRP P N     1 
ATOM   2347 C CA    . TRP B 2 294 ? 26.917 -9.166  31.051 1.00 87.48  ? 295 TRP P CA    1 
ATOM   2348 C C     . TRP B 2 294 ? 26.744 -7.687  30.806 1.00 88.84  ? 295 TRP P C     1 
ATOM   2349 O O     . TRP B 2 294 ? 26.433 -6.928  31.726 1.00 88.58  ? 295 TRP P O     1 
ATOM   2350 C CB    . TRP B 2 294 ? 25.528 -9.788  31.090 1.00 82.26  ? 295 TRP P CB    1 
ATOM   2351 C CG    . TRP B 2 294 ? 24.714 -9.354  29.895 1.00 74.12  ? 295 TRP P CG    1 
ATOM   2352 C CD1   . TRP B 2 294 ? 24.978 -9.637  28.587 1.00 75.20  ? 295 TRP P CD1   1 
ATOM   2353 C CD2   . TRP B 2 294 ? 23.539 -8.525  29.897 1.00 73.20  ? 295 TRP P CD2   1 
ATOM   2354 N NE1   . TRP B 2 294 ? 24.045 -9.039  27.772 1.00 82.87  ? 295 TRP P NE1   1 
ATOM   2355 C CE2   . TRP B 2 294 ? 23.150 -8.350  28.548 1.00 74.81  ? 295 TRP P CE2   1 
ATOM   2356 C CE3   . TRP B 2 294 ? 22.782 -7.911  30.904 1.00 72.26  ? 295 TRP P CE3   1 
ATOM   2357 C CZ2   . TRP B 2 294 ? 22.030 -7.591  28.177 1.00 68.76  ? 295 TRP P CZ2   1 
ATOM   2358 C CZ3   . TRP B 2 294 ? 21.665 -7.153  30.534 1.00 77.93  ? 295 TRP P CZ3   1 
ATOM   2359 C CH2   . TRP B 2 294 ? 21.303 -7.001  29.179 1.00 68.93  ? 295 TRP P CH2   1 
ATOM   2360 N N     . GLU B 2 295 ? 26.894 -7.290  29.554 1.00 85.48  ? 296 GLU P N     1 
ATOM   2361 C CA    . GLU B 2 295 ? 26.715 -5.905  29.196 1.00 80.93  ? 296 GLU P CA    1 
ATOM   2362 C C     . GLU B 2 295 ? 26.042 -5.790  27.838 1.00 78.94  ? 296 GLU P C     1 
ATOM   2363 O O     . GLU B 2 295 ? 26.286 -6.594  26.929 1.00 77.41  ? 296 GLU P O     1 
ATOM   2364 C CB    . GLU B 2 295 ? 28.046 -5.152  29.219 1.00 74.44  ? 296 GLU P CB    1 
ATOM   2365 C CG    . GLU B 2 295 ? 29.096 -5.700  28.281 1.00 68.45  ? 296 GLU P CG    1 
ATOM   2366 C CD    . GLU B 2 295 ? 30.262 -4.751  28.108 1.00 73.49  ? 296 GLU P CD    1 
ATOM   2367 O OE1   . GLU B 2 295 ? 30.611 -4.048  29.079 1.00 64.13  ? 296 GLU P OE1   1 
ATOM   2368 O OE2   . GLU B 2 295 ? 30.829 -4.700  26.997 1.00 75.14  ? 296 GLU P OE2   1 
ATOM   2369 N N     . GLY B 2 296 ? 25.148 -4.816  27.739 1.00 74.63  ? 297 GLY P N     1 
ATOM   2370 C CA    . GLY B 2 296 ? 24.426 -4.564  26.509 1.00 71.13  ? 297 GLY P CA    1 
ATOM   2371 C C     . GLY B 2 296 ? 24.254 -3.070  26.415 1.00 72.26  ? 297 GLY P C     1 
ATOM   2372 O O     . GLY B 2 296 ? 23.797 -2.432  27.360 1.00 70.75  ? 297 GLY P O     1 
ATOM   2373 N N     . PHE B 2 297 ? 24.634 -2.506  25.282 1.00 73.48  ? 298 PHE P N     1 
ATOM   2374 C CA    . PHE B 2 297 ? 24.542 -1.071  25.097 1.00 73.10  ? 298 PHE P CA    1 
ATOM   2375 C C     . PHE B 2 297 ? 23.295 -0.604  24.362 1.00 72.06  ? 298 PHE P C     1 
ATOM   2376 O O     . PHE B 2 297 ? 22.925 -1.174  23.332 1.00 79.36  ? 298 PHE P O     1 
ATOM   2377 C CB    . PHE B 2 297 ? 25.790 -0.587  24.377 1.00 74.96  ? 298 PHE P CB    1 
ATOM   2378 C CG    . PHE B 2 297 ? 27.059 -0.931  25.096 1.00 83.74  ? 298 PHE P CG    1 
ATOM   2379 C CD1   . PHE B 2 297 ? 27.437 -0.230  26.235 1.00 84.11  ? 298 PHE P CD1   1 
ATOM   2380 C CD2   . PHE B 2 297 ? 27.873 -1.961  24.642 1.00 83.62  ? 298 PHE P CD2   1 
ATOM   2381 C CE1   . PHE B 2 297 ? 28.605 -0.549  26.907 1.00 85.41  ? 298 PHE P CE1   1 
ATOM   2382 C CE2   . PHE B 2 297 ? 29.042 -2.285  25.309 1.00 75.39  ? 298 PHE P CE2   1 
ATOM   2383 C CZ    . PHE B 2 297 ? 29.408 -1.578  26.444 1.00 83.96  ? 298 PHE P CZ    1 
ATOM   2384 N N     . GLY B 2 298 ? 22.633 0.409   24.917 1.00 66.11  ? 299 GLY P N     1 
ATOM   2385 C CA    . GLY B 2 298 ? 21.438 0.961   24.299 1.00 66.22  ? 299 GLY P CA    1 
ATOM   2386 C C     . GLY B 2 298 ? 21.757 1.655   22.984 1.00 68.20  ? 299 GLY P C     1 
ATOM   2387 O O     . GLY B 2 298 ? 22.860 2.178   22.804 1.00 67.54  ? 299 GLY P O     1 
ATOM   2388 N N     . ASP B 2 299 ? 20.801 1.679   22.064 1.00 70.31  ? 300 ASP P N     1 
ATOM   2389 C CA    . ASP B 2 299 ? 21.056 2.307   20.787 1.00 71.92  ? 300 ASP P CA    1 
ATOM   2390 C C     . ASP B 2 299 ? 20.487 3.709   20.613 1.00 66.93  ? 300 ASP P C     1 
ATOM   2391 O O     . ASP B 2 299 ? 19.308 3.962   20.877 1.00 67.15  ? 300 ASP P O     1 
ATOM   2392 C CB    . ASP B 2 299 ? 20.600 1.407   19.648 1.00 84.24  ? 300 ASP P CB    1 
ATOM   2393 C CG    . ASP B 2 299 ? 21.161 1.848   18.308 1.00 101.11 ? 300 ASP P CG    1 
ATOM   2394 O OD1   . ASP B 2 299 ? 22.274 2.431   18.286 1.00 111.14 ? 300 ASP P OD1   1 
ATOM   2395 O OD2   . ASP B 2 299 ? 20.488 1.619   17.280 1.00 100.62 ? 300 ASP P OD2   1 
ATOM   2396 N N     . PHE B 2 300 ? 21.354 4.609   20.163 1.00 60.44  ? 301 PHE P N     1 
ATOM   2397 C CA    . PHE B 2 300 ? 21.022 6.007   19.906 1.00 60.06  ? 301 PHE P CA    1 
ATOM   2398 C C     . PHE B 2 300 ? 22.136 6.570   19.029 1.00 59.05  ? 301 PHE P C     1 
ATOM   2399 O O     . PHE B 2 300 ? 23.244 6.032   19.004 1.00 55.90  ? 301 PHE P O     1 
ATOM   2400 C CB    . PHE B 2 300 ? 20.913 6.813   21.217 1.00 61.13  ? 301 PHE P CB    1 
ATOM   2401 C CG    . PHE B 2 300 ? 22.207 6.912   21.997 1.00 64.98  ? 301 PHE P CG    1 
ATOM   2402 C CD1   . PHE B 2 300 ? 23.106 7.949   21.759 1.00 54.60  ? 301 PHE P CD1   1 
ATOM   2403 C CD2   . PHE B 2 300 ? 22.530 5.967   22.966 1.00 65.83  ? 301 PHE P CD2   1 
ATOM   2404 C CE1   . PHE B 2 300 ? 24.304 8.040   22.470 1.00 50.97  ? 301 PHE P CE1   1 
ATOM   2405 C CE2   . PHE B 2 300 ? 23.731 6.053   23.683 1.00 60.36  ? 301 PHE P CE2   1 
ATOM   2406 C CZ    . PHE B 2 300 ? 24.615 7.090   23.432 1.00 52.84  ? 301 PHE P CZ    1 
ATOM   2407 N N     . SER B 2 301 ? 21.840 7.640   18.305 1.00 60.78  ? 302 SER P N     1 
ATOM   2408 C CA    . SER B 2 301 ? 22.810 8.279   17.420 1.00 65.84  ? 302 SER P CA    1 
ATOM   2409 C C     . SER B 2 301 ? 23.255 9.611   18.023 1.00 64.07  ? 302 SER P C     1 
ATOM   2410 O O     . SER B 2 301 ? 22.538 10.169  18.846 1.00 60.97  ? 302 SER P O     1 
ATOM   2411 C CB    . SER B 2 301 ? 22.153 8.518   16.058 1.00 75.16  ? 302 SER P CB    1 
ATOM   2412 O OG    . SER B 2 301 ? 22.984 9.265   15.188 1.00 87.76  ? 302 SER P OG    1 
ATOM   2413 N N     . PRO B 2 302 ? 24.430 10.145  17.627 1.00 63.93  ? 303 PRO P N     1 
ATOM   2414 C CA    . PRO B 2 302 ? 24.891 11.426  18.175 1.00 65.77  ? 303 PRO P CA    1 
ATOM   2415 C C     . PRO B 2 302 ? 23.767 12.445  18.152 1.00 64.28  ? 303 PRO P C     1 
ATOM   2416 O O     . PRO B 2 302 ? 23.647 13.280  19.037 1.00 62.88  ? 303 PRO P O     1 
ATOM   2417 C CB    . PRO B 2 302 ? 26.002 11.808  17.209 1.00 64.93  ? 303 PRO P CB    1 
ATOM   2418 C CG    . PRO B 2 302 ? 26.649 10.499  16.962 1.00 61.68  ? 303 PRO P CG    1 
ATOM   2419 C CD    . PRO B 2 302 ? 25.464 9.572   16.742 1.00 66.94  ? 303 PRO P CD    1 
ATOM   2420 N N     . THR B 2 303 ? 22.904 12.296  17.160 1.00 64.08  ? 304 THR P N     1 
ATOM   2421 C CA    . THR B 2 303 ? 21.758 13.157  16.966 1.00 60.29  ? 304 THR P CA    1 
ATOM   2422 C C     . THR B 2 303 ? 20.694 13.045  18.062 1.00 57.63  ? 304 THR P C     1 
ATOM   2423 O O     . THR B 2 303 ? 19.984 14.005  18.341 1.00 58.53  ? 304 THR P O     1 
ATOM   2424 C CB    . THR B 2 303 ? 21.148 12.874  15.583 1.00 61.71  ? 304 THR P CB    1 
ATOM   2425 O OG1   . THR B 2 303 ? 21.392 14.000  14.736 1.00 55.80  ? 304 THR P OG1   1 
ATOM   2426 C CG2   . THR B 2 303 ? 19.648 12.549  15.659 1.00 38.46  ? 304 THR P CG2   1 
ATOM   2427 N N     . ASP B 2 304 ? 20.567 11.867  18.661 1.00 53.48  ? 305 ASP P N     1 
ATOM   2428 C CA    . ASP B 2 304 ? 19.581 11.641  19.713 1.00 50.08  ? 305 ASP P CA    1 
ATOM   2429 C C     . ASP B 2 304 ? 19.973 12.251  21.060 1.00 42.95  ? 305 ASP P C     1 
ATOM   2430 O O     . ASP B 2 304 ? 19.143 12.328  21.964 1.00 39.37  ? 305 ASP P O     1 
ATOM   2431 C CB    . ASP B 2 304 ? 19.293 10.139  19.854 1.00 63.56  ? 305 ASP P CB    1 
ATOM   2432 C CG    . ASP B 2 304 ? 18.684 9.531   18.585 1.00 75.22  ? 305 ASP P CG    1 
ATOM   2433 O OD1   . ASP B 2 304 ? 17.469 9.722   18.350 1.00 75.12  ? 305 ASP P OD1   1 
ATOM   2434 O OD2   . ASP B 2 304 ? 19.412 8.860   17.821 1.00 71.51  ? 305 ASP P OD2   1 
ATOM   2435 N N     . VAL B 2 305 ? 21.233 12.681  21.177 1.00 39.70  ? 306 VAL P N     1 
ATOM   2436 C CA    . VAL B 2 305 ? 21.766 13.307  22.389 1.00 35.15  ? 306 VAL P CA    1 
ATOM   2437 C C     . VAL B 2 305 ? 21.306 14.767  22.387 1.00 35.20  ? 306 VAL P C     1 
ATOM   2438 O O     . VAL B 2 305 ? 21.868 15.600  21.690 1.00 31.92  ? 306 VAL P O     1 
ATOM   2439 C CB    . VAL B 2 305 ? 23.325 13.272  22.418 1.00 37.95  ? 306 VAL P CB    1 
ATOM   2440 C CG1   . VAL B 2 305 ? 23.846 13.754  23.754 1.00 36.24  ? 306 VAL P CG1   1 
ATOM   2441 C CG2   . VAL B 2 305 ? 23.828 11.877  22.156 1.00 44.97  ? 306 VAL P CG2   1 
ATOM   2442 N N     . HIS B 2 306 ? 20.293 15.075  23.188 1.00 33.71  ? 307 HIS P N     1 
ATOM   2443 C CA    . HIS B 2 306 ? 19.743 16.419  23.252 1.00 36.22  ? 307 HIS P CA    1 
ATOM   2444 C C     . HIS B 2 306 ? 20.556 17.458  24.038 1.00 38.22  ? 307 HIS P C     1 
ATOM   2445 O O     . HIS B 2 306 ? 20.588 17.438  25.267 1.00 39.25  ? 307 HIS P O     1 
ATOM   2446 C CB    . HIS B 2 306 ? 18.304 16.365  23.783 1.00 46.77  ? 307 HIS P CB    1 
ATOM   2447 C CG    . HIS B 2 306 ? 17.640 17.704  23.850 1.00 45.78  ? 307 HIS P CG    1 
ATOM   2448 N ND1   . HIS B 2 306 ? 17.556 18.545  22.760 1.00 43.50  ? 307 HIS P ND1   1 
ATOM   2449 C CD2   . HIS B 2 306 ? 17.077 18.370  24.887 1.00 49.74  ? 307 HIS P CD2   1 
ATOM   2450 C CE1   . HIS B 2 306 ? 16.976 19.677  23.124 1.00 33.69  ? 307 HIS P CE1   1 
ATOM   2451 N NE2   . HIS B 2 306 ? 16.675 19.597  24.410 1.00 40.80  ? 307 HIS P NE2   1 
ATOM   2452 N N     . ARG B 2 307 ? 21.170 18.391  23.314 1.00 39.46  ? 308 ARG P N     1 
ATOM   2453 C CA    . ARG B 2 307 ? 21.958 19.474  23.901 1.00 35.49  ? 308 ARG P CA    1 
ATOM   2454 C C     . ARG B 2 307 ? 22.797 19.116  25.124 1.00 37.01  ? 308 ARG P C     1 
ATOM   2455 O O     . ARG B 2 307 ? 22.817 19.847  26.109 1.00 38.02  ? 308 ARG P O     1 
ATOM   2456 C CB    . ARG B 2 307 ? 21.065 20.682  24.199 1.00 38.84  ? 308 ARG P CB    1 
ATOM   2457 C CG    . ARG B 2 307 ? 20.548 21.443  22.949 1.00 47.51  ? 308 ARG P CG    1 
ATOM   2458 C CD    . ARG B 2 307 ? 21.684 21.991  22.069 1.00 53.96  ? 308 ARG P CD    1 
ATOM   2459 N NE    . ARG B 2 307 ? 21.798 23.455  22.070 1.00 44.03  ? 308 ARG P NE    1 
ATOM   2460 C CZ    . ARG B 2 307 ? 22.878 24.137  22.458 1.00 63.18  ? 308 ARG P CZ    1 
ATOM   2461 N NH1   . ARG B 2 307 ? 23.974 23.514  22.902 1.00 51.98  ? 308 ARG P NH1   1 
ATOM   2462 N NH2   . ARG B 2 307 ? 22.877 25.458  22.369 1.00 75.08  ? 308 ARG P NH2   1 
ATOM   2463 N N     . GLN B 2 308 ? 23.497 17.989  25.045 1.00 38.98  ? 309 GLN P N     1 
ATOM   2464 C CA    . GLN B 2 308 ? 24.361 17.519  26.120 1.00 31.67  ? 309 GLN P CA    1 
ATOM   2465 C C     . GLN B 2 308 ? 23.676 17.140  27.426 1.00 34.08  ? 309 GLN P C     1 
ATOM   2466 O O     . GLN B 2 308 ? 24.348 16.631  28.320 1.00 39.21  ? 309 GLN P O     1 
ATOM   2467 C CB    . GLN B 2 308 ? 25.411 18.566  26.451 1.00 27.30  ? 309 GLN P CB    1 
ATOM   2468 C CG    . GLN B 2 308 ? 26.292 18.962  25.322 1.00 28.04  ? 309 GLN P CG    1 
ATOM   2469 C CD    . GLN B 2 308 ? 27.396 19.870  25.786 1.00 32.51  ? 309 GLN P CD    1 
ATOM   2470 O OE1   . GLN B 2 308 ? 27.177 21.053  26.044 1.00 29.96  ? 309 GLN P OE1   1 
ATOM   2471 N NE2   . GLN B 2 308 ? 28.588 19.319  25.930 1.00 34.14  ? 309 GLN P NE2   1 
ATOM   2472 N N     . PHE B 2 309 ? 22.367 17.367  27.551 1.00 33.60  ? 310 PHE P N     1 
ATOM   2473 C CA    . PHE B 2 309 ? 21.665 17.065  28.806 1.00 37.10  ? 310 PHE P CA    1 
ATOM   2474 C C     . PHE B 2 309 ? 20.549 16.043  28.790 1.00 35.11  ? 310 PHE P C     1 
ATOM   2475 O O     . PHE B 2 309 ? 19.850 15.883  29.791 1.00 43.71  ? 310 PHE P O     1 
ATOM   2476 C CB    . PHE B 2 309 ? 21.149 18.350  29.461 1.00 25.08  ? 310 PHE P CB    1 
ATOM   2477 C CG    . PHE B 2 309 ? 22.241 19.272  29.901 1.00 45.40  ? 310 PHE P CG    1 
ATOM   2478 C CD1   . PHE B 2 309 ? 23.058 18.932  30.969 1.00 44.46  ? 310 PHE P CD1   1 
ATOM   2479 C CD2   . PHE B 2 309 ? 22.462 20.477  29.246 1.00 52.04  ? 310 PHE P CD2   1 
ATOM   2480 C CE1   . PHE B 2 309 ? 24.078 19.774  31.381 1.00 34.21  ? 310 PHE P CE1   1 
ATOM   2481 C CE2   . PHE B 2 309 ? 23.483 21.333  29.651 1.00 40.03  ? 310 PHE P CE2   1 
ATOM   2482 C CZ    . PHE B 2 309 ? 24.292 20.978  30.721 1.00 33.24  ? 310 PHE P CZ    1 
ATOM   2483 N N     . ALA B 2 310 ? 20.375 15.352  27.676 1.00 35.40  ? 311 ALA P N     1 
ATOM   2484 C CA    . ALA B 2 310 ? 19.329 14.347  27.564 1.00 38.21  ? 311 ALA P CA    1 
ATOM   2485 C C     . ALA B 2 310 ? 19.721 13.432  26.446 1.00 37.90  ? 311 ALA P C     1 
ATOM   2486 O O     . ALA B 2 310 ? 20.419 13.850  25.526 1.00 41.27  ? 311 ALA P O     1 
ATOM   2487 C CB    . ALA B 2 310 ? 17.996 14.995  27.249 1.00 31.21  ? 311 ALA P CB    1 
ATOM   2488 N N     . ILE B 2 311 ? 19.326 12.173  26.549 1.00 34.84  ? 312 ILE P N     1 
ATOM   2489 C CA    . ILE B 2 311 ? 19.622 11.199  25.511 1.00 38.15  ? 312 ILE P CA    1 
ATOM   2490 C C     . ILE B 2 311 ? 18.396 10.305  25.302 1.00 40.29  ? 312 ILE P C     1 
ATOM   2491 O O     . ILE B 2 311 ? 17.770 9.863   26.270 1.00 42.36  ? 312 ILE P O     1 
ATOM   2492 C CB    . ILE B 2 311 ? 20.836 10.301  25.867 1.00 33.26  ? 312 ILE P CB    1 
ATOM   2493 C CG1   . ILE B 2 311 ? 22.113 11.122  26.040 1.00 43.78  ? 312 ILE P CG1   1 
ATOM   2494 C CG2   . ILE B 2 311 ? 21.062 9.280   24.764 1.00 36.80  ? 312 ILE P CG2   1 
ATOM   2495 C CD1   . ILE B 2 311 ? 23.308 10.268  26.457 1.00 50.45  ? 312 ILE P CD1   1 
ATOM   2496 N N     . VAL B 2 312 ? 18.002 10.128  24.044 1.00 44.09  ? 313 VAL P N     1 
ATOM   2497 C CA    . VAL B 2 312 ? 16.877 9.265   23.714 1.00 52.34  ? 313 VAL P CA    1 
ATOM   2498 C C     . VAL B 2 312 ? 17.485 8.046   23.022 1.00 58.40  ? 313 VAL P C     1 
ATOM   2499 O O     . VAL B 2 312 ? 18.178 8.172   22.004 1.00 52.30  ? 313 VAL P O     1 
ATOM   2500 C CB    . VAL B 2 312 ? 15.870 9.952   22.792 1.00 49.84  ? 313 VAL P CB    1 
ATOM   2501 C CG1   . VAL B 2 312 ? 14.709 9.021   22.523 1.00 47.09  ? 313 VAL P CG1   1 
ATOM   2502 C CG2   . VAL B 2 312 ? 15.371 11.236  23.426 1.00 43.90  ? 313 VAL P CG2   1 
ATOM   2503 N N     . PHE B 2 313 ? 17.270 6.879   23.619 1.00 62.72  ? 314 PHE P N     1 
ATOM   2504 C CA    . PHE B 2 313 ? 17.823 5.635   23.100 1.00 64.15  ? 314 PHE P CA    1 
ATOM   2505 C C     . PHE B 2 313 ? 16.802 4.512   23.157 1.00 64.82  ? 314 PHE P C     1 
ATOM   2506 O O     . PHE B 2 313 ? 15.734 4.664   23.755 1.00 63.83  ? 314 PHE P O     1 
ATOM   2507 C CB    . PHE B 2 313 ? 19.055 5.241   23.928 1.00 58.80  ? 314 PHE P CB    1 
ATOM   2508 C CG    . PHE B 2 313 ? 18.739 4.869   25.353 1.00 52.32  ? 314 PHE P CG    1 
ATOM   2509 C CD1   . PHE B 2 313 ? 18.288 5.819   26.254 1.00 54.70  ? 314 PHE P CD1   1 
ATOM   2510 C CD2   . PHE B 2 313 ? 18.871 3.558   25.786 1.00 52.42  ? 314 PHE P CD2   1 
ATOM   2511 C CE1   . PHE B 2 313 ? 17.968 5.471   27.562 1.00 65.51  ? 314 PHE P CE1   1 
ATOM   2512 C CE2   . PHE B 2 313 ? 18.551 3.203   27.091 1.00 59.79  ? 314 PHE P CE2   1 
ATOM   2513 C CZ    . PHE B 2 313 ? 18.100 4.164   27.979 1.00 67.59  ? 314 PHE P CZ    1 
ATOM   2514 N N     . LYS B 2 314 ? 17.129 3.393   22.525 1.00 64.07  ? 315 LYS P N     1 
ATOM   2515 C CA    . LYS B 2 314 ? 16.256 2.230   22.530 1.00 69.67  ? 315 LYS P CA    1 
ATOM   2516 C C     . LYS B 2 314 ? 16.985 1.098   23.267 1.00 70.41  ? 315 LYS P C     1 
ATOM   2517 O O     . LYS B 2 314 ? 18.158 0.834   22.993 1.00 70.49  ? 315 LYS P O     1 
ATOM   2518 C CB    . LYS B 2 314 ? 15.901 1.822   21.100 1.00 75.60  ? 315 LYS P CB    1 
ATOM   2519 C CG    . LYS B 2 314 ? 15.135 2.891   20.316 1.00 79.65  ? 315 LYS P CG    1 
ATOM   2520 C CD    . LYS B 2 314 ? 14.844 2.424   18.887 1.00 80.60  ? 315 LYS P CD    1 
ATOM   2521 C CE    . LYS B 2 314 ? 14.365 3.565   17.977 1.00 88.82  ? 315 LYS P CE    1 
ATOM   2522 N NZ    . LYS B 2 314 ? 14.359 3.190   16.523 1.00 87.64  ? 315 LYS P NZ    1 
ATOM   2523 N N     . THR B 2 315 ? 16.299 0.465   24.219 1.00 68.86  ? 316 THR P N     1 
ATOM   2524 C CA    . THR B 2 315 ? 16.867 -0.612  25.027 1.00 71.29  ? 316 THR P CA    1 
ATOM   2525 C C     . THR B 2 315 ? 17.504 -1.728  24.223 1.00 74.29  ? 316 THR P C     1 
ATOM   2526 O O     . THR B 2 315 ? 17.039 -2.069  23.141 1.00 79.13  ? 316 THR P O     1 
ATOM   2527 C CB    . THR B 2 315 ? 15.808 -1.246  25.939 1.00 68.48  ? 316 THR P CB    1 
ATOM   2528 O OG1   . THR B 2 315 ? 14.601 -1.455  25.200 1.00 76.83  ? 316 THR P OG1   1 
ATOM   2529 C CG2   . THR B 2 315 ? 15.515 -0.355  27.109 1.00 77.19  ? 316 THR P CG2   1 
ATOM   2530 N N     . PRO B 2 316 ? 18.584 -2.315  24.750 1.00 77.93  ? 317 PRO P N     1 
ATOM   2531 C CA    . PRO B 2 316 ? 19.273 -3.407  24.062 1.00 81.01  ? 317 PRO P CA    1 
ATOM   2532 C C     . PRO B 2 316 ? 18.571 -4.721  24.399 1.00 81.17  ? 317 PRO P C     1 
ATOM   2533 O O     . PRO B 2 316 ? 17.820 -4.801  25.387 1.00 75.75  ? 317 PRO P O     1 
ATOM   2534 C CB    . PRO B 2 316 ? 20.663 -3.354  24.677 1.00 78.97  ? 317 PRO P CB    1 
ATOM   2535 C CG    . PRO B 2 316 ? 20.346 -3.033  26.113 1.00 80.47  ? 317 PRO P CG    1 
ATOM   2536 C CD    . PRO B 2 316 ? 19.269 -1.965  26.008 1.00 79.26  ? 317 PRO P CD    1 
ATOM   2537 N N     . LYS B 2 317 ? 18.767 -5.741  23.568 1.00 82.29  ? 318 LYS P N     1 
ATOM   2538 C CA    . LYS B 2 317 ? 18.139 -7.030  23.844 1.00 85.88  ? 318 LYS P CA    1 
ATOM   2539 C C     . LYS B 2 317 ? 18.812 -7.634  25.063 1.00 86.35  ? 318 LYS P C     1 
ATOM   2540 O O     . LYS B 2 317 ? 20.007 -7.422  25.300 1.00 84.03  ? 318 LYS P O     1 
ATOM   2541 C CB    . LYS B 2 317 ? 18.236 -7.999  22.656 1.00 90.12  ? 318 LYS P CB    1 
ATOM   2542 C CG    . LYS B 2 317 ? 17.635 -9.386  22.974 1.00 93.78  ? 318 LYS P CG    1 
ATOM   2543 C CD    . LYS B 2 317 ? 18.033 -10.486 21.984 1.00 101.79 ? 318 LYS P CD    1 
ATOM   2544 C CE    . LYS B 2 317 ? 18.006 -11.856 22.678 1.00 109.27 ? 318 LYS P CE    1 
ATOM   2545 N NZ    . LYS B 2 317 ? 17.824 -13.007 21.744 1.00 118.25 ? 318 LYS P NZ    1 
ATOM   2546 N N     . TYR B 2 318 ? 18.037 -8.369  25.847 1.00 89.23  ? 319 TYR P N     1 
ATOM   2547 C CA    . TYR B 2 318 ? 18.557 -9.023  27.030 1.00 90.43  ? 319 TYR P CA    1 
ATOM   2548 C C     . TYR B 2 318 ? 19.489 -10.175 26.651 1.00 93.96  ? 319 TYR P C     1 
ATOM   2549 O O     . TYR B 2 318 ? 19.690 -10.487 25.470 1.00 93.62  ? 319 TYR P O     1 
ATOM   2550 C CB    . TYR B 2 318 ? 17.398 -9.556  27.880 1.00 88.76  ? 319 TYR P CB    1 
ATOM   2551 C CG    . TYR B 2 318 ? 17.843 -10.026 29.232 1.00 92.81  ? 319 TYR P CG    1 
ATOM   2552 C CD1   . TYR B 2 318 ? 18.605 -9.201  30.039 1.00 99.42  ? 319 TYR P CD1   1 
ATOM   2553 C CD2   . TYR B 2 318 ? 17.554 -11.312 29.678 1.00 95.37  ? 319 TYR P CD2   1 
ATOM   2554 C CE1   . TYR B 2 318 ? 19.074 -9.634  31.260 1.00 94.98  ? 319 TYR P CE1   1 
ATOM   2555 C CE2   . TYR B 2 318 ? 18.020 -11.761 30.903 1.00 91.11  ? 319 TYR P CE2   1 
ATOM   2556 C CZ    . TYR B 2 318 ? 18.784 -10.914 31.691 1.00 89.35  ? 319 TYR P CZ    1 
ATOM   2557 O OH    . TYR B 2 318 ? 19.256 -11.329 32.910 1.00 81.12  ? 319 TYR P OH    1 
ATOM   2558 N N     . LYS B 2 319 ? 20.052 -10.807 27.671 1.00 97.08  ? 320 LYS P N     1 
ATOM   2559 C CA    . LYS B 2 319 ? 20.944 -11.932 27.479 1.00 100.30 ? 320 LYS P CA    1 
ATOM   2560 C C     . LYS B 2 319 ? 20.151 -13.153 27.002 1.00 101.46 ? 320 LYS P C     1 
ATOM   2561 O O     . LYS B 2 319 ? 20.489 -13.767 25.988 1.00 99.55  ? 320 LYS P O     1 
ATOM   2562 C CB    . LYS B 2 319 ? 21.669 -12.243 28.791 1.00 97.13  ? 320 LYS P CB    1 
ATOM   2563 C CG    . LYS B 2 319 ? 22.854 -13.173 28.615 1.00 102.35 ? 320 LYS P CG    1 
ATOM   2564 C CD    . LYS B 2 319 ? 23.798 -13.097 29.810 1.00 98.44  ? 320 LYS P CD    1 
ATOM   2565 C CE    . LYS B 2 319 ? 25.136 -13.798 29.517 1.00 102.28 ? 320 LYS P CE    1 
ATOM   2566 N NZ    . LYS B 2 319 ? 26.185 -13.496 30.544 1.00 92.95  ? 320 LYS P NZ    1 
ATOM   2567 N N     . ASP B 2 320 ? 19.098 -13.495 27.747 1.00 102.95 ? 321 ASP P N     1 
ATOM   2568 C CA    . ASP B 2 320 ? 18.228 -14.639 27.444 1.00 106.67 ? 321 ASP P CA    1 
ATOM   2569 C C     . ASP B 2 320 ? 16.783 -14.157 27.321 1.00 107.19 ? 321 ASP P C     1 
ATOM   2570 O O     . ASP B 2 320 ? 16.295 -13.473 28.218 1.00 105.42 ? 321 ASP P O     1 
ATOM   2571 C CB    . ASP B 2 320 ? 18.288 -15.676 28.576 1.00 113.58 ? 321 ASP P CB    1 
ATOM   2572 C CG    . ASP B 2 320 ? 19.708 -16.217 28.840 1.00 118.88 ? 321 ASP P CG    1 
ATOM   2573 O OD1   . ASP B 2 320 ? 20.662 -15.882 28.092 1.00 122.11 ? 321 ASP P OD1   1 
ATOM   2574 O OD2   . ASP B 2 320 ? 19.862 -16.993 29.814 1.00 114.43 ? 321 ASP P OD2   1 
ATOM   2575 N N     . ILE B 2 321 ? 16.088 -14.562 26.256 1.00 108.58 ? 322 ILE P N     1 
ATOM   2576 C CA    . ILE B 2 321 ? 14.697 -14.139 26.035 1.00 109.19 ? 322 ILE P CA    1 
ATOM   2577 C C     . ILE B 2 321 ? 13.648 -14.833 26.916 1.00 108.27 ? 322 ILE P C     1 
ATOM   2578 O O     . ILE B 2 321 ? 12.898 -14.190 27.663 1.00 106.98 ? 322 ILE P O     1 
ATOM   2579 C CB    . ILE B 2 321 ? 14.269 -14.317 24.545 1.00 111.80 ? 322 ILE P CB    1 
ATOM   2580 C CG1   . ILE B 2 321 ? 15.078 -13.384 23.640 1.00 112.89 ? 322 ILE P CG1   1 
ATOM   2581 C CG2   . ILE B 2 321 ? 12.763 -14.043 24.381 1.00 111.13 ? 322 ILE P CG2   1 
ATOM   2582 C CD1   . ILE B 2 321 ? 14.856 -11.910 23.925 1.00 119.15 ? 322 ILE P CD1   1 
ATOM   2583 N N     . ASN B 2 322 ? 13.564 -16.148 26.760 1.00 107.99 ? 323 ASN P N     1 
ATOM   2584 C CA    . ASN B 2 322 ? 12.606 -16.971 27.487 1.00 106.80 ? 323 ASN P CA    1 
ATOM   2585 C C     . ASN B 2 322 ? 12.987 -17.112 28.975 1.00 107.05 ? 323 ASN P C     1 
ATOM   2586 O O     . ASN B 2 322 ? 13.886 -17.892 29.311 1.00 107.55 ? 323 ASN P O     1 
ATOM   2587 C CB    . ASN B 2 322 ? 12.504 -18.351 26.805 1.00 105.23 ? 323 ASN P CB    1 
ATOM   2588 C CG    . ASN B 2 322 ? 12.292 -18.247 25.287 1.00 103.79 ? 323 ASN P CG    1 
ATOM   2589 O OD1   . ASN B 2 322 ? 11.236 -17.814 24.827 1.00 103.16 ? 323 ASN P OD1   1 
ATOM   2590 N ND2   . ASN B 2 322 ? 13.306 -18.622 24.511 1.00 99.13  ? 323 ASN P ND2   1 
ATOM   2591 N N     . ILE B 2 323 ? 12.321 -16.346 29.849 1.00 107.29 ? 324 ILE P N     1 
ATOM   2592 C CA    . ILE B 2 323 ? 12.569 -16.352 31.304 1.00 108.17 ? 324 ILE P CA    1 
ATOM   2593 C C     . ILE B 2 323 ? 11.220 -16.270 32.057 1.00 108.15 ? 324 ILE P C     1 
ATOM   2594 O O     . ILE B 2 323 ? 10.237 -15.771 31.503 1.00 108.97 ? 324 ILE P O     1 
ATOM   2595 C CB    . ILE B 2 323 ? 13.494 -15.142 31.742 1.00 109.72 ? 324 ILE P CB    1 
ATOM   2596 C CG1   . ILE B 2 323 ? 14.811 -15.120 30.941 1.00 108.77 ? 324 ILE P CG1   1 
ATOM   2597 C CG2   . ILE B 2 323 ? 13.819 -15.224 33.237 1.00 114.13 ? 324 ILE P CG2   1 
ATOM   2598 C CD1   . ILE B 2 323 ? 15.765 -16.273 31.239 1.00 106.55 ? 324 ILE P CD1   1 
ATOM   2599 N N     . THR B 2 324 ? 11.157 -16.782 33.291 1.00 108.51 ? 325 THR P N     1 
ATOM   2600 C CA    . THR B 2 324 ? 9.918  -16.761 34.089 1.00 109.22 ? 325 THR P CA    1 
ATOM   2601 C C     . THR B 2 324 ? 9.776  -15.566 35.046 1.00 109.15 ? 325 THR P C     1 
ATOM   2602 O O     . THR B 2 324 ? 8.767  -14.861 35.006 1.00 110.90 ? 325 THR P O     1 
ATOM   2603 C CB    . THR B 2 324 ? 9.700  -18.090 34.877 1.00 111.67 ? 325 THR P CB    1 
ATOM   2604 O OG1   . THR B 2 324 ? 10.952 -18.583 35.377 1.00 104.31 ? 325 THR P OG1   1 
ATOM   2605 C CG2   . THR B 2 324 ? 9.040  -19.143 33.987 1.00 114.58 ? 325 THR P CG2   1 
ATOM   2606 N N     . LYS B 2 325 ? 10.726 -15.407 35.969 1.00 108.81 ? 326 LYS P N     1 
ATOM   2607 C CA    . LYS B 2 325 ? 10.714 -14.282 36.910 1.00 106.70 ? 326 LYS P CA    1 
ATOM   2608 C C     . LYS B 2 325 ? 11.629 -13.213 36.297 1.00 105.24 ? 326 LYS P C     1 
ATOM   2609 O O     . LYS B 2 325 ? 12.556 -13.537 35.531 1.00 103.64 ? 326 LYS P O     1 
ATOM   2610 C CB    . LYS B 2 325 ? 11.223 -14.700 38.301 1.00 109.14 ? 326 LYS P CB    1 
ATOM   2611 C CG    . LYS B 2 325 ? 10.281 -15.603 39.072 1.00 116.15 ? 326 LYS P CG    1 
ATOM   2612 C CD    . LYS B 2 325 ? 10.849 -15.984 40.435 1.00 124.54 ? 326 LYS P CD    1 
ATOM   2613 C CE    . LYS B 2 325 ? 9.912  -16.969 41.158 1.00 125.98 ? 326 LYS P CE    1 
ATOM   2614 N NZ    . LYS B 2 325 ? 10.417 -17.414 42.501 1.00 129.34 ? 326 LYS P NZ    1 
ATOM   2615 N N     . PRO B 2 326 ? 11.365 -11.926 36.599 1.00 104.10 ? 327 PRO P N     1 
ATOM   2616 C CA    . PRO B 2 326 ? 12.189 -10.833 36.053 1.00 100.18 ? 327 PRO P CA    1 
ATOM   2617 C C     . PRO B 2 326 ? 13.669 -10.778 36.502 1.00 95.35  ? 327 PRO P C     1 
ATOM   2618 O O     . PRO B 2 326 ? 14.044 -11.350 37.537 1.00 92.79  ? 327 PRO P O     1 
ATOM   2619 C CB    . PRO B 2 326 ? 11.403 -9.580  36.462 1.00 101.71 ? 327 PRO P CB    1 
ATOM   2620 C CG    . PRO B 2 326 ? 10.672 -10.011 37.715 1.00 98.14  ? 327 PRO P CG    1 
ATOM   2621 C CD    . PRO B 2 326 ? 10.215 -11.400 37.363 1.00 97.58  ? 327 PRO P CD    1 
ATOM   2622 N N     . ALA B 2 327 ? 14.491 -10.074 35.714 1.00 91.56  ? 328 ALA P N     1 
ATOM   2623 C CA    . ALA B 2 327 ? 15.926 -9.909  35.988 1.00 88.58  ? 328 ALA P CA    1 
ATOM   2624 C C     . ALA B 2 327 ? 16.330 -8.428  36.167 1.00 83.10  ? 328 ALA P C     1 
ATOM   2625 O O     . ALA B 2 327 ? 16.098 -7.599  35.286 1.00 83.64  ? 328 ALA P O     1 
ATOM   2626 C CB    . ALA B 2 327 ? 16.764 -10.565 34.860 1.00 82.85  ? 328 ALA P CB    1 
ATOM   2627 N N     . SER B 2 328 ? 16.887 -8.099  37.329 1.00 75.49  ? 329 SER P N     1 
ATOM   2628 C CA    . SER B 2 328 ? 17.326 -6.746  37.615 1.00 74.27  ? 329 SER P CA    1 
ATOM   2629 C C     . SER B 2 328 ? 18.760 -6.554  37.159 1.00 75.60  ? 329 SER P C     1 
ATOM   2630 O O     . SER B 2 328 ? 19.663 -7.262  37.603 1.00 76.29  ? 329 SER P O     1 
ATOM   2631 C CB    . SER B 2 328 ? 17.249 -6.467  39.109 1.00 75.71  ? 329 SER P CB    1 
ATOM   2632 O OG    . SER B 2 328 ? 15.913 -6.492  39.562 1.00 82.21  ? 329 SER P OG    1 
ATOM   2633 N N     . VAL B 2 329 ? 18.957 -5.623  36.239 1.00 73.66  ? 330 VAL P N     1 
ATOM   2634 C CA    . VAL B 2 329 ? 20.283 -5.314  35.730 1.00 71.19  ? 330 VAL P CA    1 
ATOM   2635 C C     . VAL B 2 329 ? 20.563 -3.856  36.090 1.00 72.49  ? 330 VAL P C     1 
ATOM   2636 O O     . VAL B 2 329 ? 19.814 -3.263  36.871 1.00 72.39  ? 330 VAL P O     1 
ATOM   2637 C CB    . VAL B 2 329 ? 20.373 -5.516  34.195 1.00 67.57  ? 330 VAL P CB    1 
ATOM   2638 C CG1   . VAL B 2 329 ? 20.181 -6.975  33.844 1.00 57.09  ? 330 VAL P CG1   1 
ATOM   2639 C CG2   . VAL B 2 329 ? 19.340 -4.666  33.488 1.00 61.65  ? 330 VAL P CG2   1 
ATOM   2640 N N     . PHE B 2 330 ? 21.627 -3.279  35.534 1.00 73.22  ? 331 PHE P N     1 
ATOM   2641 C CA    . PHE B 2 330 ? 21.975 -1.888  35.815 1.00 68.79  ? 331 PHE P CA    1 
ATOM   2642 C C     . PHE B 2 330 ? 22.163 -1.061  34.536 1.00 65.81  ? 331 PHE P C     1 
ATOM   2643 O O     . PHE B 2 330 ? 22.520 -1.598  33.480 1.00 62.84  ? 331 PHE P O     1 
ATOM   2644 C CB    . PHE B 2 330 ? 23.240 -1.813  36.683 1.00 71.80  ? 331 PHE P CB    1 
ATOM   2645 C CG    . PHE B 2 330 ? 23.023 -2.179  38.134 1.00 77.15  ? 331 PHE P CG    1 
ATOM   2646 C CD1   . PHE B 2 330 ? 22.432 -1.274  39.012 1.00 74.86  ? 331 PHE P CD1   1 
ATOM   2647 C CD2   . PHE B 2 330 ? 23.435 -3.416  38.629 1.00 81.30  ? 331 PHE P CD2   1 
ATOM   2648 C CE1   . PHE B 2 330 ? 22.254 -1.593  40.361 1.00 68.22  ? 331 PHE P CE1   1 
ATOM   2649 C CE2   . PHE B 2 330 ? 23.260 -3.741  39.975 1.00 70.16  ? 331 PHE P CE2   1 
ATOM   2650 C CZ    . PHE B 2 330 ? 22.668 -2.826  40.839 1.00 71.64  ? 331 PHE P CZ    1 
ATOM   2651 N N     . VAL B 2 331 ? 21.882 0.237   34.645 1.00 64.31  ? 332 VAL P N     1 
ATOM   2652 C CA    . VAL B 2 331 ? 22.013 1.197   33.548 1.00 61.89  ? 332 VAL P CA    1 
ATOM   2653 C C     . VAL B 2 331 ? 22.960 2.288   34.015 1.00 62.78  ? 332 VAL P C     1 
ATOM   2654 O O     . VAL B 2 331 ? 22.881 2.737   35.160 1.00 66.93  ? 332 VAL P O     1 
ATOM   2655 C CB    . VAL B 2 331 ? 20.672 1.870   33.217 1.00 55.52  ? 332 VAL P CB    1 
ATOM   2656 C CG1   . VAL B 2 331 ? 20.879 3.026   32.271 1.00 61.95  ? 332 VAL P CG1   1 
ATOM   2657 C CG2   . VAL B 2 331 ? 19.741 0.880   32.601 1.00 62.86  ? 332 VAL P CG2   1 
ATOM   2658 N N     . GLN B 2 332 ? 23.833 2.732   33.122 1.00 58.78  ? 333 GLN P N     1 
ATOM   2659 C CA    . GLN B 2 332 ? 24.791 3.769   33.452 1.00 54.45  ? 333 GLN P CA    1 
ATOM   2660 C C     . GLN B 2 332 ? 25.454 4.338   32.209 1.00 56.52  ? 333 GLN P C     1 
ATOM   2661 O O     . GLN B 2 332 ? 25.548 3.676   31.180 1.00 56.92  ? 333 GLN P O     1 
ATOM   2662 C CB    . GLN B 2 332 ? 25.870 3.195   34.358 1.00 44.12  ? 333 GLN P CB    1 
ATOM   2663 C CG    . GLN B 2 332 ? 26.644 2.063   33.718 1.00 50.14  ? 333 GLN P CG    1 
ATOM   2664 C CD    . GLN B 2 332 ? 27.898 1.716   34.476 1.00 60.10  ? 333 GLN P CD    1 
ATOM   2665 O OE1   . GLN B 2 332 ? 28.887 1.265   33.890 1.00 57.09  ? 333 GLN P OE1   1 
ATOM   2666 N NE2   . GLN B 2 332 ? 27.872 1.924   35.791 1.00 59.26  ? 333 GLN P NE2   1 
ATOM   2667 N N     . LEU B 2 333 ? 25.904 5.579   32.309 1.00 54.83  ? 334 LEU P N     1 
ATOM   2668 C CA    . LEU B 2 333 ? 26.593 6.234   31.209 1.00 48.02  ? 334 LEU P CA    1 
ATOM   2669 C C     . LEU B 2 333 ? 28.051 5.785   31.277 1.00 44.71  ? 334 LEU P C     1 
ATOM   2670 O O     . LEU B 2 333 ? 28.540 5.452   32.350 1.00 47.28  ? 334 LEU P O     1 
ATOM   2671 C CB    . LEU B 2 333 ? 26.521 7.744   31.410 1.00 40.58  ? 334 LEU P CB    1 
ATOM   2672 C CG    . LEU B 2 333 ? 25.103 8.248   31.629 1.00 45.38  ? 334 LEU P CG    1 
ATOM   2673 C CD1   . LEU B 2 333 ? 25.104 9.642   32.206 1.00 40.35  ? 334 LEU P CD1   1 
ATOM   2674 C CD2   . LEU B 2 333 ? 24.368 8.172   30.315 1.00 44.70  ? 334 LEU P CD2   1 
ATOM   2675 N N     . ARG B 2 334 ? 28.732 5.734   30.142 1.00 42.57  ? 335 ARG P N     1 
ATOM   2676 C CA    . ARG B 2 334 ? 30.141 5.359   30.111 1.00 42.12  ? 335 ARG P CA    1 
ATOM   2677 C C     . ARG B 2 334 ? 30.788 6.199   29.030 1.00 44.96  ? 335 ARG P C     1 
ATOM   2678 O O     . ARG B 2 334 ? 30.234 6.370   27.942 1.00 51.09  ? 335 ARG P O     1 
ATOM   2679 C CB    . ARG B 2 334 ? 30.328 3.872   29.799 1.00 43.45  ? 335 ARG P CB    1 
ATOM   2680 C CG    . ARG B 2 334 ? 31.706 3.331   30.171 1.00 38.50  ? 335 ARG P CG    1 
ATOM   2681 C CD    . ARG B 2 334 ? 31.798 1.812   30.009 1.00 56.54  ? 335 ARG P CD    1 
ATOM   2682 N NE    . ARG B 2 334 ? 32.237 1.429   28.668 1.00 64.63  ? 335 ARG P NE    1 
ATOM   2683 C CZ    . ARG B 2 334 ? 32.427 0.174   28.269 1.00 66.53  ? 335 ARG P CZ    1 
ATOM   2684 N NH1   . ARG B 2 334 ? 32.209 -0.827  29.110 1.00 67.77  ? 335 ARG P NH1   1 
ATOM   2685 N NH2   . ARG B 2 334 ? 32.870 -0.076  27.039 1.00 64.41  ? 335 ARG P NH2   1 
ATOM   2686 N N     . ARG B 2 335 ? 31.934 6.771   29.351 1.00 48.51  ? 336 ARG P N     1 
ATOM   2687 C CA    . ARG B 2 335 ? 32.649 7.607   28.411 1.00 49.29  ? 336 ARG P CA    1 
ATOM   2688 C C     . ARG B 2 335 ? 33.602 6.712   27.638 1.00 53.61  ? 336 ARG P C     1 
ATOM   2689 O O     . ARG B 2 335 ? 34.482 6.113   28.237 1.00 56.52  ? 336 ARG P O     1 
ATOM   2690 C CB    . ARG B 2 335 ? 33.416 8.666   29.190 1.00 46.89  ? 336 ARG P CB    1 
ATOM   2691 C CG    . ARG B 2 335 ? 34.139 9.666   28.335 1.00 58.79  ? 336 ARG P CG    1 
ATOM   2692 C CD    . ARG B 2 335 ? 34.851 10.707  29.185 1.00 61.33  ? 336 ARG P CD    1 
ATOM   2693 N NE    . ARG B 2 335 ? 33.912 11.523  29.947 1.00 60.66  ? 336 ARG P NE    1 
ATOM   2694 C CZ    . ARG B 2 335 ? 34.016 11.777  31.246 1.00 62.10  ? 336 ARG P CZ    1 
ATOM   2695 N NH1   . ARG B 2 335 ? 35.023 11.282  31.954 1.00 51.67  ? 336 ARG P NH1   1 
ATOM   2696 N NH2   . ARG B 2 335 ? 33.111 12.539  31.830 1.00 47.99  ? 336 ARG P NH2   1 
ATOM   2697 N N     . LYS B 2 336 ? 33.421 6.602   26.320 1.00 57.25  ? 337 LYS P N     1 
ATOM   2698 C CA    . LYS B 2 336 ? 34.288 5.753   25.491 1.00 56.55  ? 337 LYS P CA    1 
ATOM   2699 C C     . LYS B 2 336 ? 35.770 6.042   25.757 1.00 61.08  ? 337 LYS P C     1 
ATOM   2700 O O     . LYS B 2 336 ? 36.526 5.153   26.148 1.00 65.00  ? 337 LYS P O     1 
ATOM   2701 C CB    . LYS B 2 336 ? 34.039 5.965   23.984 1.00 53.08  ? 337 LYS P CB    1 
ATOM   2702 C CG    . LYS B 2 336 ? 32.632 5.717   23.445 1.00 64.09  ? 337 LYS P CG    1 
ATOM   2703 C CD    . LYS B 2 336 ? 32.581 6.064   21.932 1.00 79.64  ? 337 LYS P CD    1 
ATOM   2704 C CE    . LYS B 2 336 ? 31.163 6.026   21.339 1.00 82.59  ? 337 LYS P CE    1 
ATOM   2705 N NZ    . LYS B 2 336 ? 30.514 4.677   21.357 1.00 89.72  ? 337 LYS P NZ    1 
ATOM   2706 N N     . SER B 2 337 ? 36.167 7.296   25.558 1.00 60.55  ? 338 SER P N     1 
ATOM   2707 C CA    . SER B 2 337 ? 37.546 7.724   25.736 1.00 62.14  ? 338 SER P CA    1 
ATOM   2708 C C     . SER B 2 337 ? 38.257 7.158   26.965 1.00 62.32  ? 338 SER P C     1 
ATOM   2709 O O     . SER B 2 337 ? 39.133 6.307   26.830 1.00 68.56  ? 338 SER P O     1 
ATOM   2710 C CB    . SER B 2 337 ? 37.636 9.256   25.716 1.00 65.96  ? 338 SER P CB    1 
ATOM   2711 O OG    . SER B 2 337 ? 36.884 9.853   26.762 1.00 63.09  ? 338 SER P OG    1 
ATOM   2712 N N     . ASP B 2 338 ? 37.881 7.618   28.156 1.00 61.43  ? 339 ASP P N     1 
ATOM   2713 C CA    . ASP B 2 338 ? 38.521 7.146   29.382 1.00 62.93  ? 339 ASP P CA    1 
ATOM   2714 C C     . ASP B 2 338 ? 37.796 6.015   30.110 1.00 64.82  ? 339 ASP P C     1 
ATOM   2715 O O     . ASP B 2 338 ? 38.304 5.481   31.089 1.00 68.80  ? 339 ASP P O     1 
ATOM   2716 C CB    . ASP B 2 338 ? 38.826 8.320   30.342 1.00 63.35  ? 339 ASP P CB    1 
ATOM   2717 C CG    . ASP B 2 338 ? 37.587 9.131   30.730 1.00 59.62  ? 339 ASP P CG    1 
ATOM   2718 O OD1   . ASP B 2 338 ? 36.496 8.551   30.895 1.00 61.33  ? 339 ASP P OD1   1 
ATOM   2719 O OD2   . ASP B 2 338 ? 37.717 10.362  30.899 1.00 63.24  ? 339 ASP P OD2   1 
ATOM   2720 N N     . LEU B 2 339 ? 36.596 5.681   29.655 1.00 64.97  ? 340 LEU P N     1 
ATOM   2721 C CA    . LEU B 2 339 ? 35.802 4.616   30.258 1.00 64.89  ? 340 LEU P CA    1 
ATOM   2722 C C     . LEU B 2 339 ? 35.231 4.925   31.633 1.00 61.43  ? 340 LEU P C     1 
ATOM   2723 O O     . LEU B 2 339 ? 34.714 4.039   32.312 1.00 60.45  ? 340 LEU P O     1 
ATOM   2724 C CB    . LEU B 2 339 ? 36.594 3.312   30.283 1.00 66.68  ? 340 LEU P CB    1 
ATOM   2725 C CG    . LEU B 2 339 ? 36.759 2.727   28.885 1.00 63.83  ? 340 LEU P CG    1 
ATOM   2726 C CD1   . LEU B 2 339 ? 37.801 1.634   28.879 1.00 51.89  ? 340 LEU P CD1   1 
ATOM   2727 C CD2   . LEU B 2 339 ? 35.421 2.199   28.410 1.00 65.41  ? 340 LEU P CD2   1 
ATOM   2728 N N     . GLU B 2 340 ? 35.277 6.193   32.021 1.00 57.87  ? 341 GLU P N     1 
ATOM   2729 C CA    . GLU B 2 340 ? 34.739 6.610   33.309 1.00 58.87  ? 341 GLU P CA    1 
ATOM   2730 C C     . GLU B 2 340 ? 33.253 6.316   33.266 1.00 54.53  ? 341 GLU P C     1 
ATOM   2731 O O     . GLU B 2 340 ? 32.653 6.375   32.194 1.00 60.14  ? 341 GLU P O     1 
ATOM   2732 C CB    . GLU B 2 340 ? 34.948 8.109   33.519 1.00 63.37  ? 341 GLU P CB    1 
ATOM   2733 C CG    . GLU B 2 340 ? 34.874 8.553   34.965 1.00 68.58  ? 341 GLU P CG    1 
ATOM   2734 C CD    . GLU B 2 340 ? 35.991 7.961   35.813 1.00 88.44  ? 341 GLU P CD    1 
ATOM   2735 O OE1   . GLU B 2 340 ? 37.094 7.679   35.272 1.00 95.54  ? 341 GLU P OE1   1 
ATOM   2736 O OE2   . GLU B 2 340 ? 35.757 7.784   37.029 1.00 85.68  ? 341 GLU P OE2   1 
ATOM   2737 N N     . THR B 2 341 ? 32.659 6.016   34.417 1.00 51.72  ? 342 THR P N     1 
ATOM   2738 C CA    . THR B 2 341 ? 31.231 5.706   34.487 1.00 48.77  ? 342 THR P CA    1 
ATOM   2739 C C     . THR B 2 341 ? 30.443 6.556   35.496 1.00 47.01  ? 342 THR P C     1 
ATOM   2740 O O     . THR B 2 341 ? 31.013 7.287   36.309 1.00 50.67  ? 342 THR P O     1 
ATOM   2741 C CB    . THR B 2 341 ? 30.999 4.190   34.811 1.00 50.32  ? 342 THR P CB    1 
ATOM   2742 O OG1   . THR B 2 341 ? 31.660 3.845   36.038 1.00 62.08  ? 342 THR P OG1   1 
ATOM   2743 C CG2   . THR B 2 341 ? 31.532 3.296   33.694 1.00 41.98  ? 342 THR P CG2   1 
ATOM   2744 N N     . SER B 2 342 ? 29.121 6.510   35.386 1.00 49.09  ? 343 SER P N     1 
ATOM   2745 C CA    . SER B 2 342 ? 28.241 7.220   36.301 1.00 51.92  ? 343 SER P CA    1 
ATOM   2746 C C     . SER B 2 342 ? 27.760 6.167   37.287 1.00 54.82  ? 343 SER P C     1 
ATOM   2747 O O     . SER B 2 342 ? 27.871 4.967   37.005 1.00 52.99  ? 343 SER P O     1 
ATOM   2748 C CB    . SER B 2 342 ? 27.042 7.788   35.549 1.00 51.04  ? 343 SER P CB    1 
ATOM   2749 O OG    . SER B 2 342 ? 26.310 6.774   34.890 1.00 50.95  ? 343 SER P OG    1 
ATOM   2750 N N     . GLU B 2 343 ? 27.246 6.588   38.442 1.00 59.48  ? 344 GLU P N     1 
ATOM   2751 C CA    . GLU B 2 343 ? 26.747 5.614   39.411 1.00 64.27  ? 344 GLU P CA    1 
ATOM   2752 C C     . GLU B 2 343 ? 25.655 4.839   38.687 1.00 67.19  ? 344 GLU P C     1 
ATOM   2753 O O     . GLU B 2 343 ? 24.968 5.383   37.827 1.00 66.92  ? 344 GLU P O     1 
ATOM   2754 C CB    . GLU B 2 343 ? 26.173 6.287   40.666 1.00 65.07  ? 344 GLU P CB    1 
ATOM   2755 C CG    . GLU B 2 343 ? 27.173 7.106   41.498 1.00 89.44  ? 344 GLU P CG    1 
ATOM   2756 C CD    . GLU B 2 343 ? 28.343 6.287   42.080 1.00 104.17 ? 344 GLU P CD    1 
ATOM   2757 O OE1   . GLU B 2 343 ? 28.204 5.047   42.235 1.00 102.50 ? 344 GLU P OE1   1 
ATOM   2758 O OE2   . GLU B 2 343 ? 29.405 6.895   42.389 1.00 110.04 ? 344 GLU P OE2   1 
ATOM   2759 N N     . PRO B 2 344 ? 25.573 3.532   38.923 1.00 71.30  ? 345 PRO P N     1 
ATOM   2760 C CA    . PRO B 2 344 ? 24.544 2.733   38.257 1.00 70.98  ? 345 PRO P CA    1 
ATOM   2761 C C     . PRO B 2 344 ? 23.105 3.028   38.677 1.00 68.67  ? 345 PRO P C     1 
ATOM   2762 O O     . PRO B 2 344 ? 22.837 3.487   39.791 1.00 63.13  ? 345 PRO P O     1 
ATOM   2763 C CB    . PRO B 2 344 ? 24.959 1.307   38.596 1.00 72.79  ? 345 PRO P CB    1 
ATOM   2764 C CG    . PRO B 2 344 ? 25.684 1.462   39.906 1.00 73.51  ? 345 PRO P CG    1 
ATOM   2765 C CD    . PRO B 2 344 ? 26.509 2.681   39.672 1.00 71.33  ? 345 PRO P CD    1 
ATOM   2766 N N     . LYS B 2 345 ? 22.184 2.767   37.760 1.00 69.76  ? 346 LYS P N     1 
ATOM   2767 C CA    . LYS B 2 345 ? 20.768 2.977   38.003 1.00 73.93  ? 346 LYS P CA    1 
ATOM   2768 C C     . LYS B 2 345 ? 20.092 1.634   37.838 1.00 73.47  ? 346 LYS P C     1 
ATOM   2769 O O     . LYS B 2 345 ? 20.498 0.826   37.004 1.00 74.56  ? 346 LYS P O     1 
ATOM   2770 C CB    . LYS B 2 345 ? 20.185 3.974   36.998 1.00 79.44  ? 346 LYS P CB    1 
ATOM   2771 C CG    . LYS B 2 345 ? 19.511 5.182   37.640 1.00 74.18  ? 346 LYS P CG    1 
ATOM   2772 C CD    . LYS B 2 345 ? 20.450 5.851   38.647 1.00 77.68  ? 346 LYS P CD    1 
ATOM   2773 C CE    . LYS B 2 345 ? 19.994 7.252   39.046 1.00 76.65  ? 346 LYS P CE    1 
ATOM   2774 N NZ    . LYS B 2 345 ? 18.660 7.289   39.705 1.00 72.31  ? 346 LYS P NZ    1 
ATOM   2775 N N     . PRO B 2 346 ? 19.085 1.353   38.670 1.00 71.14  ? 347 PRO P N     1 
ATOM   2776 C CA    . PRO B 2 346 ? 18.350 0.084   38.611 1.00 68.07  ? 347 PRO P CA    1 
ATOM   2777 C C     . PRO B 2 346 ? 17.495 -0.032  37.340 1.00 71.97  ? 347 PRO P C     1 
ATOM   2778 O O     . PRO B 2 346 ? 17.024 0.979   36.820 1.00 76.86  ? 347 PRO P O     1 
ATOM   2779 C CB    . PRO B 2 346 ? 17.473 0.150   39.862 1.00 60.86  ? 347 PRO P CB    1 
ATOM   2780 C CG    . PRO B 2 346 ? 18.207 1.125   40.779 1.00 67.43  ? 347 PRO P CG    1 
ATOM   2781 C CD    . PRO B 2 346 ? 18.644 2.170   39.814 1.00 68.28  ? 347 PRO P CD    1 
ATOM   2782 N N     . PHE B 2 347 ? 17.309 -1.254  36.838 1.00 72.36  ? 348 PHE P N     1 
ATOM   2783 C CA    . PHE B 2 347 ? 16.490 -1.498  35.645 1.00 71.07  ? 348 PHE P CA    1 
ATOM   2784 C C     . PHE B 2 347 ? 15.987 -2.930  35.632 1.00 69.04  ? 348 PHE P C     1 
ATOM   2785 O O     . PHE B 2 347 ? 16.773 -3.878  35.604 1.00 66.39  ? 348 PHE P O     1 
ATOM   2786 C CB    . PHE B 2 347 ? 17.274 -1.224  34.367 1.00 69.52  ? 348 PHE P CB    1 
ATOM   2787 C CG    . PHE B 2 347 ? 16.442 -1.316  33.125 1.00 75.98  ? 348 PHE P CG    1 
ATOM   2788 C CD1   . PHE B 2 347 ? 15.662 -0.243  32.719 1.00 75.30  ? 348 PHE P CD1   1 
ATOM   2789 C CD2   . PHE B 2 347 ? 16.457 -2.466  32.349 1.00 76.41  ? 348 PHE P CD2   1 
ATOM   2790 C CE1   . PHE B 2 347 ? 14.914 -0.313  31.559 1.00 68.66  ? 348 PHE P CE1   1 
ATOM   2791 C CE2   . PHE B 2 347 ? 15.713 -2.546  31.188 1.00 69.41  ? 348 PHE P CE2   1 
ATOM   2792 C CZ    . PHE B 2 347 ? 14.941 -1.466  30.790 1.00 67.15  ? 348 PHE P CZ    1 
ATOM   2793 N N     . LEU B 2 348 ? 14.671 -3.082  35.589 1.00 70.31  ? 349 LEU P N     1 
ATOM   2794 C CA    . LEU B 2 348 ? 14.049 -4.402  35.614 1.00 70.45  ? 349 LEU P CA    1 
ATOM   2795 C C     . LEU B 2 348 ? 13.556 -4.964  34.283 1.00 70.39  ? 349 LEU P C     1 
ATOM   2796 O O     . LEU B 2 348 ? 12.598 -4.456  33.704 1.00 68.12  ? 349 LEU P O     1 
ATOM   2797 C CB    . LEU B 2 348 ? 12.882 -4.386  36.600 1.00 69.87  ? 349 LEU P CB    1 
ATOM   2798 C CG    . LEU B 2 348 ? 12.253 -5.744  36.865 1.00 72.82  ? 349 LEU P CG    1 
ATOM   2799 C CD1   . LEU B 2 348 ? 13.303 -6.634  37.502 1.00 72.02  ? 349 LEU P CD1   1 
ATOM   2800 C CD2   . LEU B 2 348 ? 11.040 -5.591  37.763 1.00 77.49  ? 349 LEU P CD2   1 
ATOM   2801 N N     . TYR B 2 349 ? 14.182 -6.044  33.832 1.00 74.99  ? 350 TYR P N     1 
ATOM   2802 C CA    . TYR B 2 349 ? 13.800 -6.717  32.588 1.00 81.81  ? 350 TYR P CA    1 
ATOM   2803 C C     . TYR B 2 349 ? 12.679 -7.744  32.807 1.00 86.17  ? 350 TYR P C     1 
ATOM   2804 O O     . TYR B 2 349 ? 12.859 -8.687  33.586 1.00 85.39  ? 350 TYR P O     1 
ATOM   2805 C CB    . TYR B 2 349 ? 14.995 -7.484  32.045 1.00 79.55  ? 350 TYR P CB    1 
ATOM   2806 C CG    . TYR B 2 349 ? 15.825 -6.732  31.076 1.00 75.67  ? 350 TYR P CG    1 
ATOM   2807 C CD1   . TYR B 2 349 ? 15.406 -6.572  29.768 1.00 77.85  ? 350 TYR P CD1   1 
ATOM   2808 C CD2   . TYR B 2 349 ? 17.069 -6.246  31.436 1.00 86.28  ? 350 TYR P CD2   1 
ATOM   2809 C CE1   . TYR B 2 349 ? 16.208 -5.955  28.831 1.00 82.35  ? 350 TYR P CE1   1 
ATOM   2810 C CE2   . TYR B 2 349 ? 17.888 -5.625  30.513 1.00 87.46  ? 350 TYR P CE2   1 
ATOM   2811 C CZ    . TYR B 2 349 ? 17.455 -5.483  29.204 1.00 90.50  ? 350 TYR P CZ    1 
ATOM   2812 O OH    . TYR B 2 349 ? 18.276 -4.895  28.262 1.00 91.12  ? 350 TYR P OH    1 
ATOM   2813 N N     . TYR B 2 350 ? 11.541 -7.592  32.127 1.00 85.88  ? 351 TYR P N     1 
ATOM   2814 C CA    . TYR B 2 350 ? 10.458 -8.576  32.264 1.00 84.47  ? 351 TYR P CA    1 
ATOM   2815 C C     . TYR B 2 350 ? 10.269 -9.393  30.963 1.00 80.88  ? 351 TYR P C     1 
ATOM   2816 O O     . TYR B 2 350 ? 10.652 -8.929  29.877 1.00 73.79  ? 351 TYR P O     1 
ATOM   2817 C CB    . TYR B 2 350 ? 9.153  -7.950  32.794 1.00 90.11  ? 351 TYR P CB    1 
ATOM   2818 C CG    . TYR B 2 350 ? 8.710  -6.689  32.117 1.00 92.98  ? 351 TYR P CG    1 
ATOM   2819 C CD1   . TYR B 2 350 ? 8.436  -6.663  30.744 1.00 96.51  ? 351 TYR P CD1   1 
ATOM   2820 C CD2   . TYR B 2 350 ? 8.559  -5.512  32.846 1.00 95.47  ? 351 TYR P CD2   1 
ATOM   2821 C CE1   . TYR B 2 350 ? 8.024  -5.493  30.107 1.00 94.93  ? 351 TYR P CE1   1 
ATOM   2822 C CE2   . TYR B 2 350 ? 8.149  -4.331  32.227 1.00 102.05 ? 351 TYR P CE2   1 
ATOM   2823 C CZ    . TYR B 2 350 ? 7.881  -4.323  30.851 1.00 99.68  ? 351 TYR P CZ    1 
ATOM   2824 O OH    . TYR B 2 350 ? 7.478  -3.153  30.224 1.00 98.54  ? 351 TYR P OH    1 
ATOM   2825 N N     . PRO B 2 351 ? 9.732  -10.640 31.074 1.00 81.06  ? 352 PRO P N     1 
ATOM   2826 C CA    . PRO B 2 351 ? 9.451  -11.649 30.029 1.00 80.81  ? 352 PRO P CA    1 
ATOM   2827 C C     . PRO B 2 351 ? 8.542  -11.410 28.805 1.00 83.58  ? 352 PRO P C     1 
ATOM   2828 O O     . PRO B 2 351 ? 7.504  -10.736 28.886 1.00 84.30  ? 352 PRO P O     1 
ATOM   2829 C CB    . PRO B 2 351 ? 8.996  -12.869 30.843 1.00 74.26  ? 352 PRO P CB    1 
ATOM   2830 C CG    . PRO B 2 351 ? 8.402  -12.260 32.076 1.00 79.36  ? 352 PRO P CG    1 
ATOM   2831 C CD    . PRO B 2 351 ? 9.396  -11.192 32.409 1.00 76.09  ? 352 PRO P CD    1 
ATOM   2832 N N     . GLU B 2 352 ? 8.916  -12.084 27.709 1.00 86.57  ? 353 GLU P N     1 
ATOM   2833 C CA    . GLU B 2 352 ? 8.233  -12.038 26.400 1.00 92.04  ? 353 GLU P CA    1 
ATOM   2834 C C     . GLU B 2 352 ? 6.695  -12.061 26.501 1.00 94.50  ? 353 GLU P C     1 
ATOM   2835 O O     . GLU B 2 352 ? 5.983  -11.765 25.529 1.00 90.55  ? 353 GLU P O     1 
ATOM   2836 C CB    . GLU B 2 352 ? 8.734  -13.211 25.535 1.00 97.82  ? 353 GLU P CB    1 
ATOM   2837 C CG    . GLU B 2 352 ? 8.214  -13.252 24.083 1.00 106.69 ? 353 GLU P CG    1 
ATOM   2838 C CD    . GLU B 2 352 ? 9.005  -12.375 23.126 1.00 108.39 ? 353 GLU P CD    1 
ATOM   2839 O OE1   . GLU B 2 352 ? 10.235 -12.240 23.321 1.00 117.27 ? 353 GLU P OE1   1 
ATOM   2840 O OE2   . GLU B 2 352 ? 8.402  -11.843 22.166 1.00 105.87 ? 353 GLU P OE2   1 
HETATM 2841 O O     . HOH C 3 .   ? 27.354 26.376  26.546 1.00 38.08  ? 406 HOH D O     1 
HETATM 2842 O O     . HOH C 3 .   ? 21.693 31.414  14.979 1.00 31.60  ? 409 HOH D O     1 
HETATM 2843 O O     . HOH C 3 .   ? 41.154 25.430  29.234 1.00 40.48  ? 412 HOH D O     1 
HETATM 2844 O O     . HOH C 3 .   ? 23.711 33.121  40.194 1.00 51.40  ? 419 HOH D O     1 
HETATM 2845 O O     . HOH C 3 .   ? 28.843 35.356  33.581 1.00 35.71  ? 421 HOH D O     1 
HETATM 2846 O O     . HOH C 3 .   ? 32.027 35.382  30.205 1.00 48.18  ? 422 HOH D O     1 
HETATM 2847 O O     . HOH C 3 .   ? 29.755 25.213  30.751 1.00 71.47  ? 425 HOH D O     1 
HETATM 2848 O O     . HOH C 3 .   ? 39.882 23.182  31.575 1.00 52.74  ? 427 HOH D O     1 
HETATM 2849 O O     . HOH C 3 .   ? 41.468 34.425  35.022 1.00 43.70  ? 430 HOH D O     1 
HETATM 2850 O O     . HOH C 3 .   ? 31.930 37.353  32.093 1.00 56.99  ? 434 HOH D O     1 
HETATM 2851 O O     . HOH C 3 .   ? 32.796 32.817  43.416 1.00 48.01  ? 437 HOH D O     1 
HETATM 2852 O O     . HOH C 3 .   ? 31.726 34.208  -9.922 1.00 44.38  ? 454 HOH D O     1 
HETATM 2853 O O     . HOH C 3 .   ? 24.564 24.590  67.640 1.00 61.65  ? 455 HOH D O     1 
HETATM 2854 O O     . HOH C 3 .   ? 16.678 28.924  60.547 1.00 56.12  ? 457 HOH D O     1 
HETATM 2855 O O     . HOH C 3 .   ? 37.868 37.832  29.807 1.00 80.96  ? 463 HOH D O     1 
HETATM 2856 O O     . HOH D 3 .   ? 27.791 20.299  16.241 1.00 49.67  ? 401 HOH P O     1 
HETATM 2857 O O     . HOH D 3 .   ? 18.469 18.630  20.164 1.00 54.83  ? 402 HOH P O     1 
HETATM 2858 O O     . HOH D 3 .   ? 24.612 21.991  26.196 1.00 35.42  ? 403 HOH P O     1 
HETATM 2859 O O     . HOH D 3 .   ? 24.873 24.812  26.771 1.00 60.69  ? 404 HOH P O     1 
HETATM 2860 O O     . HOH D 3 .   ? 24.541 8.393   37.731 1.00 54.26  ? 405 HOH P O     1 
HETATM 2861 O O     . HOH D 3 .   ? 52.030 34.075  42.525 1.00 80.14  ? 407 HOH P O     1 
HETATM 2862 O O     . HOH D 3 .   ? 34.762 20.531  42.517 1.00 39.30  ? 408 HOH P O     1 
HETATM 2863 O O     . HOH D 3 .   ? 29.920 23.191  38.350 1.00 68.33  ? 410 HOH P O     1 
HETATM 2864 O O     . HOH D 3 .   ? 55.409 23.360  30.903 1.00 63.11  ? 411 HOH P O     1 
HETATM 2865 O O     . HOH D 3 .   ? 47.010 9.018   36.832 1.00 47.38  ? 413 HOH P O     1 
HETATM 2866 O O     . HOH D 3 .   ? 56.175 25.031  41.243 1.00 58.46  ? 414 HOH P O     1 
HETATM 2867 O O     . HOH D 3 .   ? 55.179 9.011   33.864 1.00 49.26  ? 415 HOH P O     1 
HETATM 2868 O O     . HOH D 3 .   ? 31.439 13.005  26.792 1.00 47.37  ? 416 HOH P O     1 
HETATM 2869 O O     . HOH D 3 .   ? 17.285 15.492  20.797 1.00 63.60  ? 417 HOH P O     1 
HETATM 2870 O O     . HOH D 3 .   ? 34.270 0.954   32.700 1.00 46.08  ? 418 HOH P O     1 
HETATM 2871 O O     . HOH D 3 .   ? 39.573 35.455  36.614 1.00 53.19  ? 420 HOH P O     1 
HETATM 2872 O O     . HOH D 3 .   ? 32.983 12.222  39.302 1.00 47.65  ? 423 HOH P O     1 
HETATM 2873 O O     . HOH D 3 .   ? 26.466 12.877  32.973 1.00 40.24  ? 424 HOH P O     1 
HETATM 2874 O O     . HOH D 3 .   ? 42.683 15.192  30.363 1.00 72.95  ? 426 HOH P O     1 
HETATM 2875 O O     . HOH D 3 .   ? 42.478 32.656  27.013 1.00 40.57  ? 428 HOH P O     1 
HETATM 2876 O O     . HOH D 3 .   ? 42.921 32.669  36.529 1.00 32.39  ? 429 HOH P O     1 
HETATM 2877 O O     . HOH D 3 .   ? 47.182 21.971  52.942 1.00 49.63  ? 431 HOH P O     1 
HETATM 2878 O O     . HOH D 3 .   ? 48.599 30.444  37.372 1.00 63.07  ? 432 HOH P O     1 
HETATM 2879 O O     . HOH D 3 .   ? 53.478 24.795  38.859 1.00 56.72  ? 433 HOH P O     1 
HETATM 2880 O O     . HOH D 3 .   ? 50.299 19.331  29.651 1.00 77.71  ? 435 HOH P O     1 
HETATM 2881 O O     . HOH D 3 .   ? 35.377 26.959  36.842 1.00 43.22  ? 436 HOH P O     1 
HETATM 2882 O O     . HOH D 3 .   ? 37.486 25.022  34.915 1.00 41.66  ? 438 HOH P O     1 
HETATM 2883 O O     . HOH D 3 .   ? 24.255 27.145  25.643 1.00 68.86  ? 439 HOH P O     1 
HETATM 2884 O O     . HOH D 3 .   ? 73.147 27.547  32.555 1.00 70.76  ? 440 HOH P O     1 
HETATM 2885 O O     . HOH D 3 .   ? 31.128 -1.846  37.942 1.00 62.63  ? 441 HOH P O     1 
HETATM 2886 O O     . HOH D 3 .   ? 43.923 22.620  27.769 1.00 55.96  ? 442 HOH P O     1 
HETATM 2887 O O     . HOH D 3 .   ? 45.988 25.600  26.271 1.00 57.65  ? 443 HOH P O     1 
HETATM 2888 O O     . HOH D 3 .   ? 12.315 8.129   37.543 1.00 62.39  ? 444 HOH P O     1 
HETATM 2889 O O     . HOH D 3 .   ? 10.141 10.279  36.828 1.00 46.17  ? 445 HOH P O     1 
HETATM 2890 O O     . HOH D 3 .   ? 10.116 4.435   37.450 1.00 76.02  ? 446 HOH P O     1 
HETATM 2891 O O     . HOH D 3 .   ? 9.343  7.938   23.020 1.00 59.62  ? 447 HOH P O     1 
HETATM 2892 O O     . HOH D 3 .   ? 26.702 19.271  34.193 1.00 44.78  ? 448 HOH P O     1 
HETATM 2893 O O     . HOH D 3 .   ? 28.495 24.475  34.501 1.00 63.73  ? 449 HOH P O     1 
HETATM 2894 O O     . HOH D 3 .   ? 17.432 21.429  20.003 1.00 53.98  ? 450 HOH P O     1 
HETATM 2895 O O     . HOH D 3 .   ? 19.424 23.922  21.138 1.00 70.08  ? 451 HOH P O     1 
HETATM 2896 O O     . HOH D 3 .   ? 34.362 11.626  34.453 1.00 55.64  ? 452 HOH P O     1 
HETATM 2897 O O     . HOH D 3 .   ? 30.593 19.887  36.926 1.00 79.83  ? 453 HOH P O     1 
HETATM 2898 O O     . HOH D 3 .   ? 42.180 12.295  29.418 1.00 58.16  ? 456 HOH P O     1 
HETATM 2899 O O     . HOH D 3 .   ? 21.042 -14.967 35.635 1.00 55.67  ? 458 HOH P O     1 
HETATM 2900 O O     . HOH D 3 .   ? 39.444 38.636  23.167 1.00 52.74  ? 459 HOH P O     1 
HETATM 2901 O O     . HOH D 3 .   ? 47.518 36.876  24.010 1.00 51.83  ? 460 HOH P O     1 
HETATM 2902 O O     . HOH D 3 .   ? 35.130 14.937  22.255 1.00 65.07  ? 461 HOH P O     1 
HETATM 2903 O O     . HOH D 3 .   ? 49.194 28.958  57.027 1.00 57.22  ? 462 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   D . n 
A 1 2   DG  2   2   2   DG  G   D . n 
A 1 3   DA  3   3   3   DA  A   D . n 
A 1 4   DT  4   4   4   DT  T   D . n 
A 1 5   DG  5   5   5   DG  G   D . n 
A 1 6   DG  6   6   6   DG  G   D . n 
A 1 7   DG  7   7   7   DG  G   D . n 
A 1 8   DG  8   8   8   DG  G   D . n 
A 1 9   DA  9   9   9   DA  A   D . n 
A 1 10  DA  10  10  10  DA  A   D . n 
A 1 11  DT  11  11  11  DT  T   D . n 
A 1 12  DC  12  12  12  DC  C   D . n 
A 1 13  DC  13  13  13  DC  C   D . n 
A 1 14  DC  14  14  14  DC  C   D . n 
A 1 15  DC  15  15  15  DC  C   D . n 
A 1 16  DT  16  16  16  DT  T   D . n 
A 1 17  DA  17  17  17  DA  A   D . n 
A 1 18  DG  18  18  18  DG  G   D . n 
A 1 19  DA  19  19  19  DA  A   D . n 
B 2 1   ALA 1   2   ?   ?   ?   P . n 
B 2 2   GLU 2   3   ?   ?   ?   P . n 
B 2 3   ASP 3   4   ?   ?   ?   P . n 
B 2 4   ASP 4   5   ?   ?   ?   P . n 
B 2 5   PRO 5   6   ?   ?   ?   P . n 
B 2 6   TYR 6   7   ?   ?   ?   P . n 
B 2 7   LEU 7   8   ?   ?   ?   P . n 
B 2 8   GLY 8   9   ?   ?   ?   P . n 
B 2 9   ARG 9   10  ?   ?   ?   P . n 
B 2 10  PRO 10  11  ?   ?   ?   P . n 
B 2 11  GLU 11  12  ?   ?   ?   P . n 
B 2 12  GLN 12  13  ?   ?   ?   P . n 
B 2 13  MET 13  14  ?   ?   ?   P . n 
B 2 14  PHE 14  15  ?   ?   ?   P . n 
B 2 15  HIS 15  16  ?   ?   ?   P . n 
B 2 16  LEU 16  17  ?   ?   ?   P . n 
B 2 17  ASP 17  18  ?   ?   ?   P . n 
B 2 18  PRO 18  19  ?   ?   ?   P . n 
B 2 19  SER 19  20  ?   ?   ?   P . n 
B 2 20  LEU 20  21  ?   ?   ?   P . n 
B 2 21  THR 21  22  ?   ?   ?   P . n 
B 2 22  HIS 22  23  ?   ?   ?   P . n 
B 2 23  THR 23  24  ?   ?   ?   P . n 
B 2 24  ILE 24  25  ?   ?   ?   P . n 
B 2 25  PHE 25  26  ?   ?   ?   P . n 
B 2 26  ASN 26  27  ?   ?   ?   P . n 
B 2 27  PRO 27  28  ?   ?   ?   P . n 
B 2 28  GLU 28  29  ?   ?   ?   P . n 
B 2 29  VAL 29  30  ?   ?   ?   P . n 
B 2 30  PHE 30  31  ?   ?   ?   P . n 
B 2 31  GLN 31  32  ?   ?   ?   P . n 
B 2 32  PRO 32  33  ?   ?   ?   P . n 
B 2 33  GLN 33  34  ?   ?   ?   P . n 
B 2 34  MET 34  35  ?   ?   ?   P . n 
B 2 35  ALA 35  36  ?   ?   ?   P . n 
B 2 36  LEU 36  37  ?   ?   ?   P . n 
B 2 37  PRO 37  38  ?   ?   ?   P . n 
B 2 38  THR 38  39  ?   ?   ?   P . n 
B 2 39  ALA 39  40  ?   ?   ?   P . n 
B 2 40  ASP 40  41  ?   ?   ?   P . n 
B 2 41  GLY 41  42  ?   ?   ?   P . n 
B 2 42  PRO 42  43  43  PRO PRO P . n 
B 2 43  TYR 43  44  44  TYR TYR P . n 
B 2 44  LEU 44  45  45  LEU LEU P . n 
B 2 45  GLN 45  46  46  GLN GLN P . n 
B 2 46  ILE 46  47  47  ILE ILE P . n 
B 2 47  LEU 47  48  48  LEU LEU P . n 
B 2 48  GLU 48  49  49  GLU GLU P . n 
B 2 49  GLN 49  50  50  GLN GLN P . n 
B 2 50  PRO 50  51  51  PRO PRO P . n 
B 2 51  LYS 51  52  52  LYS LYS P . n 
B 2 52  GLN 52  53  53  GLN GLN P . n 
B 2 53  ARG 53  54  54  ARG ARG P . n 
B 2 54  GLY 54  55  55  GLY GLY P . n 
B 2 55  PHE 55  56  56  PHE PHE P . n 
B 2 56  ARG 56  57  57  ARG ARG P . n 
B 2 57  PHE 57  58  58  PHE PHE P . n 
B 2 58  ARG 58  59  59  ARG ARG P . n 
B 2 59  TYR 59  60  60  TYR TYR P . n 
B 2 60  VAL 60  61  61  VAL VAL P . n 
B 2 61  ALA 61  62  62  ALA ALA P . n 
B 2 62  GLU 62  63  63  GLU GLU P . n 
B 2 63  GLY 63  64  64  GLY GLY P . n 
B 2 64  PRO 64  65  65  PRO PRO P . n 
B 2 65  SER 65  66  66  SER SER P . n 
B 2 66  HIS 66  67  67  HIS HIS P . n 
B 2 67  GLY 67  68  68  GLY GLY P . n 
B 2 68  GLY 68  69  69  GLY GLY P . n 
B 2 69  LEU 69  70  70  LEU LEU P . n 
B 2 70  PRO 70  71  71  PRO PRO P . n 
B 2 71  GLY 71  72  72  GLY GLY P . n 
B 2 72  ALA 72  73  73  ALA ALA P . n 
B 2 73  SER 73  74  74  SER SER P . n 
B 2 74  SER 74  75  75  SER SER P . n 
B 2 75  GLU 75  76  76  GLU GLU P . n 
B 2 76  LYS 76  77  77  LYS LYS P . n 
B 2 77  ASN 77  78  78  ASN ASN P . n 
B 2 78  LYS 78  79  79  LYS LYS P . n 
B 2 79  LYS 79  80  80  LYS LYS P . n 
B 2 80  SER 80  81  81  SER SER P . n 
B 2 81  TYR 81  82  82  TYR TYR P . n 
B 2 82  PRO 82  83  83  PRO PRO P . n 
B 2 83  GLN 83  84  84  GLN GLN P . n 
B 2 84  VAL 84  85  85  VAL VAL P . n 
B 2 85  LYS 85  86  86  LYS LYS P . n 
B 2 86  ILE 86  87  87  ILE ILE P . n 
B 2 87  CYS 87  88  88  CYS CYS P . n 
B 2 88  ASN 88  89  89  ASN ASN P . n 
B 2 89  TYR 89  90  90  TYR TYR P . n 
B 2 90  VAL 90  91  91  VAL VAL P . n 
B 2 91  GLY 91  92  92  GLY GLY P . n 
B 2 92  PRO 92  93  93  PRO PRO P . n 
B 2 93  ALA 93  94  94  ALA ALA P . n 
B 2 94  LYS 94  95  95  LYS LYS P . n 
B 2 95  VAL 95  96  96  VAL VAL P . n 
B 2 96  ILE 96  97  97  ILE ILE P . n 
B 2 97  VAL 97  98  98  VAL VAL P . n 
B 2 98  GLN 98  99  99  GLN GLN P . n 
B 2 99  LEU 99  100 100 LEU LEU P . n 
B 2 100 VAL 100 101 101 VAL VAL P . n 
B 2 101 THR 101 102 102 THR THR P . n 
B 2 102 ASN 102 103 103 ASN ASN P . n 
B 2 103 GLY 103 104 104 GLY GLY P . n 
B 2 104 LYS 104 105 105 LYS LYS P . n 
B 2 105 ASN 105 106 106 ASN ASN P . n 
B 2 106 ILE 106 107 107 ILE ILE P . n 
B 2 107 HIS 107 108 108 HIS HIS P . n 
B 2 108 LEU 108 109 109 LEU LEU P . n 
B 2 109 HIS 109 110 110 HIS HIS P . n 
B 2 110 ALA 110 111 111 ALA ALA P . n 
B 2 111 HIS 111 112 112 HIS HIS P . n 
B 2 112 SER 112 113 113 SER SER P . n 
B 2 113 LEU 113 114 114 LEU LEU P . n 
B 2 114 VAL 114 115 115 VAL VAL P . n 
B 2 115 GLY 115 116 116 GLY GLY P . n 
B 2 116 LYS 116 117 117 LYS LYS P . n 
B 2 117 HIS 117 118 118 HIS HIS P . n 
B 2 118 CYS 118 119 119 CYS CYS P . n 
B 2 119 GLU 119 120 120 GLU GLU P . n 
B 2 120 ASP 120 121 121 ASP ASP P . n 
B 2 121 GLY 121 122 122 GLY GLY P . n 
B 2 122 ILE 122 123 123 ILE ILE P . n 
B 2 123 CYS 123 124 124 CYS CYS P . n 
B 2 124 THR 124 125 125 THR THR P . n 
B 2 125 VAL 125 126 126 VAL VAL P . n 
B 2 126 THR 126 127 127 THR THR P . n 
B 2 127 ALA 127 128 128 ALA ALA P . n 
B 2 128 GLY 128 129 129 GLY GLY P . n 
B 2 129 PRO 129 130 130 PRO PRO P . n 
B 2 130 LYS 130 131 131 LYS LYS P . n 
B 2 131 ASP 131 132 132 ASP ASP P . n 
B 2 132 MET 132 133 133 MET MET P . n 
B 2 133 VAL 133 134 134 VAL VAL P . n 
B 2 134 VAL 134 135 135 VAL VAL P . n 
B 2 135 GLY 135 136 136 GLY GLY P . n 
B 2 136 PHE 136 137 137 PHE PHE P . n 
B 2 137 ALA 137 138 138 ALA ALA P . n 
B 2 138 ASN 138 139 139 ASN ASN P . n 
B 2 139 LEU 139 140 140 LEU LEU P . n 
B 2 140 GLY 140 141 141 GLY GLY P . n 
B 2 141 ILE 141 142 142 ILE ILE P . n 
B 2 142 LEU 142 143 143 LEU LEU P . n 
B 2 143 HIS 143 144 144 HIS HIS P . n 
B 2 144 VAL 144 145 145 VAL VAL P . n 
B 2 145 THR 145 146 146 THR THR P . n 
B 2 146 LYS 146 147 147 LYS LYS P . n 
B 2 147 LYS 147 148 148 LYS LYS P . n 
B 2 148 LYS 148 149 149 LYS LYS P . n 
B 2 149 VAL 149 150 150 VAL VAL P . n 
B 2 150 PHE 150 151 151 PHE PHE P . n 
B 2 151 GLU 151 152 152 GLU GLU P . n 
B 2 152 THR 152 153 153 THR THR P . n 
B 2 153 LEU 153 154 154 LEU LEU P . n 
B 2 154 GLU 154 155 155 GLU GLU P . n 
B 2 155 ALA 155 156 156 ALA ALA P . n 
B 2 156 ARG 156 157 157 ARG ARG P . n 
B 2 157 MET 157 158 158 MET MET P . n 
B 2 158 THR 158 159 159 THR THR P . n 
B 2 159 GLU 159 160 160 GLU GLU P . n 
B 2 160 ALA 160 161 161 ALA ALA P . n 
B 2 161 CYS 161 162 162 CYS CYS P . n 
B 2 162 ILE 162 163 163 ILE ILE P . n 
B 2 163 ARG 163 164 164 ARG ARG P . n 
B 2 164 GLY 164 165 165 GLY GLY P . n 
B 2 165 TYR 165 166 166 TYR TYR P . n 
B 2 166 ASN 166 167 167 ASN ASN P . n 
B 2 167 PRO 167 168 168 PRO PRO P . n 
B 2 168 GLY 168 169 169 GLY GLY P . n 
B 2 169 LEU 169 170 170 LEU LEU P . n 
B 2 170 LEU 170 171 171 LEU LEU P . n 
B 2 171 VAL 171 172 172 VAL VAL P . n 
B 2 172 HIS 172 173 173 HIS HIS P . n 
B 2 173 PRO 173 174 174 PRO PRO P . n 
B 2 174 ASP 174 175 175 ASP ASP P . n 
B 2 175 LEU 175 176 176 LEU LEU P . n 
B 2 176 ALA 176 177 177 ALA ALA P . n 
B 2 177 TYR 177 178 178 TYR TYR P . n 
B 2 178 LEU 178 179 179 LEU LEU P . n 
B 2 179 GLN 179 180 180 GLN GLN P . n 
B 2 180 ALA 180 181 181 ALA ALA P . n 
B 2 181 GLU 181 182 182 GLU GLU P . n 
B 2 182 GLY 182 183 183 GLY GLY P . n 
B 2 183 GLY 183 184 184 GLY GLY P . n 
B 2 184 GLY 184 185 185 GLY GLY P . n 
B 2 185 ASP 185 186 186 ASP ASP P . n 
B 2 186 ARG 186 187 187 ARG ARG P . n 
B 2 187 GLN 187 188 188 GLN GLN P . n 
B 2 188 LEU 188 189 189 LEU LEU P . n 
B 2 189 GLY 189 190 190 GLY GLY P . n 
B 2 190 ASP 190 191 191 ASP ASP P . n 
B 2 191 ARG 191 192 192 ARG ARG P . n 
B 2 192 GLU 192 193 193 GLU GLU P . n 
B 2 193 LYS 193 194 194 LYS LYS P . n 
B 2 194 GLU 194 195 195 GLU GLU P . n 
B 2 195 LEU 195 196 196 LEU LEU P . n 
B 2 196 ILE 196 197 197 ILE ILE P . n 
B 2 197 ARG 197 198 198 ARG ARG P . n 
B 2 198 GLN 198 199 199 GLN GLN P . n 
B 2 199 ALA 199 200 200 ALA ALA P . n 
B 2 200 ALA 200 201 201 ALA ALA P . n 
B 2 201 LEU 201 202 202 LEU LEU P . n 
B 2 202 GLN 202 203 203 GLN GLN P . n 
B 2 203 GLN 203 204 204 GLN GLN P . n 
B 2 204 THR 204 205 205 THR THR P . n 
B 2 205 LYS 205 206 206 LYS LYS P . n 
B 2 206 GLU 206 207 207 GLU GLU P . n 
B 2 207 MET 207 208 208 MET MET P . n 
B 2 208 ASP 208 209 209 ASP ASP P . n 
B 2 209 LEU 209 210 210 LEU LEU P . n 
B 2 210 SER 210 211 211 SER SER P . n 
B 2 211 VAL 211 212 212 VAL VAL P . n 
B 2 212 VAL 212 213 213 VAL VAL P . n 
B 2 213 ARG 213 214 214 ARG ARG P . n 
B 2 214 LEU 214 215 215 LEU LEU P . n 
B 2 215 MET 215 216 216 MET MET P . n 
B 2 216 PHE 216 217 217 PHE PHE P . n 
B 2 217 THR 217 218 218 THR THR P . n 
B 2 218 ALA 218 219 219 ALA ALA P . n 
B 2 219 PHE 219 220 220 PHE PHE P . n 
B 2 220 LEU 220 221 221 LEU LEU P . n 
B 2 221 PRO 221 222 222 PRO PRO P . n 
B 2 222 ASP 222 223 223 ASP ASP P . n 
B 2 223 SER 223 224 224 SER SER P . n 
B 2 224 THR 224 225 225 THR THR P . n 
B 2 225 GLY 225 226 226 GLY GLY P . n 
B 2 226 SER 226 227 227 SER SER P . n 
B 2 227 PHE 227 228 228 PHE PHE P . n 
B 2 228 THR 228 229 229 THR THR P . n 
B 2 229 ARG 229 230 230 ARG ARG P . n 
B 2 230 ARG 230 231 231 ARG ARG P . n 
B 2 231 LEU 231 232 232 LEU LEU P . n 
B 2 232 GLU 232 233 233 GLU GLU P . n 
B 2 233 PRO 233 234 234 PRO PRO P . n 
B 2 234 VAL 234 235 235 VAL VAL P . n 
B 2 235 VAL 235 236 236 VAL VAL P . n 
B 2 236 SER 236 237 237 SER SER P . n 
B 2 237 ASP 237 238 238 ASP ASP P . n 
B 2 238 ALA 238 239 239 ALA ALA P . n 
B 2 239 ILE 239 240 240 ILE ILE P . n 
B 2 240 TYR 240 241 241 TYR TYR P . n 
B 2 241 ASP 241 242 242 ASP ASP P . n 
B 2 242 SER 242 243 243 SER SER P . n 
B 2 243 LYS 243 244 244 LYS LYS P . n 
B 2 244 ALA 244 245 245 ALA ALA P . n 
B 2 245 PRO 245 246 246 PRO PRO P . n 
B 2 246 ASN 246 247 247 ASN ASN P . n 
B 2 247 ALA 247 248 248 ALA ALA P . n 
B 2 248 SER 248 249 249 SER SER P . n 
B 2 249 ASN 249 250 250 ASN ASN P . n 
B 2 250 LEU 250 251 251 LEU LEU P . n 
B 2 251 LYS 251 252 252 LYS LYS P . n 
B 2 252 ILE 252 253 253 ILE ILE P . n 
B 2 253 VAL 253 254 254 VAL VAL P . n 
B 2 254 ARG 254 255 255 ARG ARG P . n 
B 2 255 MET 255 256 256 MET MET P . n 
B 2 256 ASP 256 257 257 ASP ASP P . n 
B 2 257 ARG 257 258 258 ARG ARG P . n 
B 2 258 THR 258 259 259 THR THR P . n 
B 2 259 ALA 259 260 260 ALA ALA P . n 
B 2 260 GLY 260 261 261 GLY GLY P . n 
B 2 261 CYS 261 262 262 CYS CYS P . n 
B 2 262 VAL 262 263 263 VAL VAL P . n 
B 2 263 THR 263 264 264 THR THR P . n 
B 2 264 GLY 264 265 265 GLY GLY P . n 
B 2 265 GLY 265 266 266 GLY GLY P . n 
B 2 266 GLU 266 267 267 GLU GLU P . n 
B 2 267 GLU 267 268 268 GLU GLU P . n 
B 2 268 ILE 268 269 269 ILE ILE P . n 
B 2 269 TYR 269 270 270 TYR TYR P . n 
B 2 270 LEU 270 271 271 LEU LEU P . n 
B 2 271 LEU 271 272 272 LEU LEU P . n 
B 2 272 CYS 272 273 273 CYS CYS P . n 
B 2 273 ASP 273 274 274 ASP ASP P . n 
B 2 274 LYS 274 275 275 LYS LYS P . n 
B 2 275 VAL 275 276 276 VAL VAL P . n 
B 2 276 GLN 276 277 277 GLN GLN P . n 
B 2 277 LYS 277 278 278 LYS LYS P . n 
B 2 278 ASP 278 279 279 ASP ASP P . n 
B 2 279 ASP 279 280 280 ASP ASP P . n 
B 2 280 ILE 280 281 281 ILE ILE P . n 
B 2 281 GLN 281 282 282 GLN GLN P . n 
B 2 282 ILE 282 283 283 ILE ILE P . n 
B 2 283 ARG 283 284 284 ARG ARG P . n 
B 2 284 PHE 284 285 285 PHE PHE P . n 
B 2 285 TYR 285 286 286 TYR TYR P . n 
B 2 286 GLU 286 287 287 GLU GLU P . n 
B 2 287 GLU 287 288 288 GLU GLU P . n 
B 2 288 GLU 288 289 289 GLU GLU P . n 
B 2 289 GLU 289 290 290 GLU GLU P . n 
B 2 290 ASN 290 291 291 ASN ASN P . n 
B 2 291 GLY 291 292 292 GLY GLY P . n 
B 2 292 GLY 292 293 293 GLY GLY P . n 
B 2 293 VAL 293 294 294 VAL VAL P . n 
B 2 294 TRP 294 295 295 TRP TRP P . n 
B 2 295 GLU 295 296 296 GLU GLU P . n 
B 2 296 GLY 296 297 297 GLY GLY P . n 
B 2 297 PHE 297 298 298 PHE PHE P . n 
B 2 298 GLY 298 299 299 GLY GLY P . n 
B 2 299 ASP 299 300 300 ASP ASP P . n 
B 2 300 PHE 300 301 301 PHE PHE P . n 
B 2 301 SER 301 302 302 SER SER P . n 
B 2 302 PRO 302 303 303 PRO PRO P . n 
B 2 303 THR 303 304 304 THR THR P . n 
B 2 304 ASP 304 305 305 ASP ASP P . n 
B 2 305 VAL 305 306 306 VAL VAL P . n 
B 2 306 HIS 306 307 307 HIS HIS P . n 
B 2 307 ARG 307 308 308 ARG ARG P . n 
B 2 308 GLN 308 309 309 GLN GLN P . n 
B 2 309 PHE 309 310 310 PHE PHE P . n 
B 2 310 ALA 310 311 311 ALA ALA P . n 
B 2 311 ILE 311 312 312 ILE ILE P . n 
B 2 312 VAL 312 313 313 VAL VAL P . n 
B 2 313 PHE 313 314 314 PHE PHE P . n 
B 2 314 LYS 314 315 315 LYS LYS P . n 
B 2 315 THR 315 316 316 THR THR P . n 
B 2 316 PRO 316 317 317 PRO PRO P . n 
B 2 317 LYS 317 318 318 LYS LYS P . n 
B 2 318 TYR 318 319 319 TYR TYR P . n 
B 2 319 LYS 319 320 320 LYS LYS P . n 
B 2 320 ASP 320 321 321 ASP ASP P . n 
B 2 321 ILE 321 322 322 ILE ILE P . n 
B 2 322 ASN 322 323 323 ASN ASN P . n 
B 2 323 ILE 323 324 324 ILE ILE P . n 
B 2 324 THR 324 325 325 THR THR P . n 
B 2 325 LYS 325 326 326 LYS LYS P . n 
B 2 326 PRO 326 327 327 PRO PRO P . n 
B 2 327 ALA 327 328 328 ALA ALA P . n 
B 2 328 SER 328 329 329 SER SER P . n 
B 2 329 VAL 329 330 330 VAL VAL P . n 
B 2 330 PHE 330 331 331 PHE PHE P . n 
B 2 331 VAL 331 332 332 VAL VAL P . n 
B 2 332 GLN 332 333 333 GLN GLN P . n 
B 2 333 LEU 333 334 334 LEU LEU P . n 
B 2 334 ARG 334 335 335 ARG ARG P . n 
B 2 335 ARG 335 336 336 ARG ARG P . n 
B 2 336 LYS 336 337 337 LYS LYS P . n 
B 2 337 SER 337 338 338 SER SER P . n 
B 2 338 ASP 338 339 339 ASP ASP P . n 
B 2 339 LEU 339 340 340 LEU LEU P . n 
B 2 340 GLU 340 341 341 GLU GLU P . n 
B 2 341 THR 341 342 342 THR THR P . n 
B 2 342 SER 342 343 343 SER SER P . n 
B 2 343 GLU 343 344 344 GLU GLU P . n 
B 2 344 PRO 344 345 345 PRO PRO P . n 
B 2 345 LYS 345 346 346 LYS LYS P . n 
B 2 346 PRO 346 347 347 PRO PRO P . n 
B 2 347 PHE 347 348 348 PHE PHE P . n 
B 2 348 LEU 348 349 349 LEU LEU P . n 
B 2 349 TYR 349 350 350 TYR TYR P . n 
B 2 350 TYR 350 351 351 TYR TYR P . n 
B 2 351 PRO 351 352 352 PRO PRO P . n 
B 2 352 GLU 352 353 353 GLU GLU P . n 
B 2 353 ILE 353 354 ?   ?   ?   P . n 
B 2 354 LYS 354 355 ?   ?   ?   P . n 
B 2 355 ASP 355 356 ?   ?   ?   P . n 
B 2 356 LYS 356 357 ?   ?   ?   P . n 
B 2 357 GLU 357 358 ?   ?   ?   P . n 
B 2 358 GLU 358 359 ?   ?   ?   P . n 
B 2 359 VAL 359 360 ?   ?   ?   P . n 
B 2 360 GLN 360 361 ?   ?   ?   P . n 
B 2 361 ARG 361 362 ?   ?   ?   P . n 
B 2 362 LYS 362 363 ?   ?   ?   P . n 
B 2 363 ARG 363 364 ?   ?   ?   P . n 
B 2 364 GLN 364 365 ?   ?   ?   P . n 
B 2 365 LYS 365 366 ?   ?   ?   P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  406 406 HOH HOH D . 
C 3 HOH 2  409 409 HOH HOH D . 
C 3 HOH 3  412 412 HOH HOH D . 
C 3 HOH 4  419 419 HOH HOH D . 
C 3 HOH 5  421 421 HOH HOH D . 
C 3 HOH 6  422 422 HOH HOH D . 
C 3 HOH 7  425 425 HOH HOH D . 
C 3 HOH 8  427 427 HOH HOH D . 
C 3 HOH 9  430 430 HOH HOH D . 
C 3 HOH 10 434 434 HOH HOH D . 
C 3 HOH 11 437 437 HOH HOH D . 
C 3 HOH 12 454 454 HOH HOH D . 
C 3 HOH 13 455 455 HOH HOH D . 
C 3 HOH 14 457 457 HOH HOH D . 
C 3 HOH 15 463 463 HOH HOH D . 
D 3 HOH 1  401 401 HOH HOH P . 
D 3 HOH 2  402 402 HOH HOH P . 
D 3 HOH 3  403 403 HOH HOH P . 
D 3 HOH 4  404 404 HOH HOH P . 
D 3 HOH 5  405 405 HOH HOH P . 
D 3 HOH 6  407 407 HOH HOH P . 
D 3 HOH 7  408 408 HOH HOH P . 
D 3 HOH 8  410 410 HOH HOH P . 
D 3 HOH 9  411 411 HOH HOH P . 
D 3 HOH 10 413 413 HOH HOH P . 
D 3 HOH 11 414 414 HOH HOH P . 
D 3 HOH 12 415 415 HOH HOH P . 
D 3 HOH 13 416 416 HOH HOH P . 
D 3 HOH 14 417 417 HOH HOH P . 
D 3 HOH 15 418 418 HOH HOH P . 
D 3 HOH 16 420 420 HOH HOH P . 
D 3 HOH 17 423 423 HOH HOH P . 
D 3 HOH 18 424 424 HOH HOH P . 
D 3 HOH 19 426 426 HOH HOH P . 
D 3 HOH 20 428 428 HOH HOH P . 
D 3 HOH 21 429 429 HOH HOH P . 
D 3 HOH 22 431 431 HOH HOH P . 
D 3 HOH 23 432 432 HOH HOH P . 
D 3 HOH 24 433 433 HOH HOH P . 
D 3 HOH 25 435 435 HOH HOH P . 
D 3 HOH 26 436 436 HOH HOH P . 
D 3 HOH 27 438 438 HOH HOH P . 
D 3 HOH 28 439 439 HOH HOH P . 
D 3 HOH 29 440 440 HOH HOH P . 
D 3 HOH 30 441 441 HOH HOH P . 
D 3 HOH 31 442 442 HOH HOH P . 
D 3 HOH 32 443 443 HOH HOH P . 
D 3 HOH 33 444 444 HOH HOH P . 
D 3 HOH 34 445 445 HOH HOH P . 
D 3 HOH 35 446 446 HOH HOH P . 
D 3 HOH 36 447 447 HOH HOH P . 
D 3 HOH 37 448 448 HOH HOH P . 
D 3 HOH 38 449 449 HOH HOH P . 
D 3 HOH 39 450 450 HOH HOH P . 
D 3 HOH 40 451 451 HOH HOH P . 
D 3 HOH 41 452 452 HOH HOH P . 
D 3 HOH 42 453 453 HOH HOH P . 
D 3 HOH 43 456 456 HOH HOH P . 
D 3 HOH 44 458 458 HOH HOH P . 
D 3 HOH 45 459 459 HOH HOH P . 
D 3 HOH 46 460 460 HOH HOH P . 
D 3 HOH 47 461 461 HOH HOH P . 
D 3 HOH 48 462 462 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 57.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-06-10 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             X-PLOR 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C4'" D DA  1   ? ? "C3'" D DA  1   ? ? "C2'" D DA  1   ? ? 109.52 103.10 6.42  0.90 N 
2  1 "O4'" D DA  1   ? ? "C1'" D DA  1   ? ? "C2'" D DA  1   ? ? 111.68 106.80 4.88  0.50 N 
3  1 C6    D DA  1   ? ? N1    D DA  1   ? ? C2    D DA  1   ? ? 123.21 118.60 4.61  0.60 N 
4  1 N1    D DA  1   ? ? C2    D DA  1   ? ? N3    D DA  1   ? ? 124.94 129.30 -4.36 0.50 N 
5  1 "C4'" D DA  3   ? ? "C3'" D DA  3   ? ? "C2'" D DA  3   ? ? 110.04 103.10 6.94  0.90 N 
6  1 "O4'" D DA  3   ? ? "C1'" D DA  3   ? ? "C2'" D DA  3   ? ? 111.16 106.80 4.36  0.50 N 
7  1 C6    D DA  3   ? ? N1    D DA  3   ? ? C2    D DA  3   ? ? 123.24 118.60 4.64  0.60 N 
8  1 N1    D DA  3   ? ? C2    D DA  3   ? ? N3    D DA  3   ? ? 125.25 129.30 -4.05 0.50 N 
9  1 "C4'" D DT  4   ? ? "C3'" D DT  4   ? ? "C2'" D DT  4   ? ? 108.88 103.10 5.78  0.90 N 
10 1 "O4'" D DT  4   ? ? "C1'" D DT  4   ? ? "C2'" D DT  4   ? ? 110.14 106.80 3.34  0.50 N 
11 1 C2    D DT  4   ? ? N3    D DT  4   ? ? C4    D DT  4   ? ? 122.86 127.20 -4.34 0.60 N 
12 1 "O4'" D DG  5   ? ? "C1'" D DG  5   ? ? "C2'" D DG  5   ? ? 111.05 106.80 4.25  0.50 N 
13 1 C5    D DG  6   ? ? C6    D DG  6   ? ? N1    D DG  6   ? ? 114.65 111.50 3.15  0.50 N 
14 1 "C4'" D DG  7   ? ? "C3'" D DG  7   ? ? "C2'" D DG  7   ? ? 109.25 103.10 6.15  0.90 N 
15 1 "O4'" D DG  7   ? ? "C1'" D DG  7   ? ? "C2'" D DG  7   ? ? 110.26 106.80 3.46  0.50 N 
16 1 C6    D DA  9   ? ? N1    D DA  9   ? ? C2    D DA  9   ? ? 123.28 118.60 4.68  0.60 N 
17 1 N1    D DA  9   ? ? C2    D DA  9   ? ? N3    D DA  9   ? ? 125.15 129.30 -4.15 0.50 N 
18 1 C5    D DA  9   ? ? C6    D DA  9   ? ? N1    D DA  9   ? ? 114.66 117.70 -3.04 0.50 N 
19 1 "C4'" D DA  10  ? ? "C3'" D DA  10  ? ? "C2'" D DA  10  ? ? 108.95 103.10 5.85  0.90 N 
20 1 "O4'" D DA  10  ? ? "C1'" D DA  10  ? ? "C2'" D DA  10  ? ? 110.44 106.80 3.64  0.50 N 
21 1 C6    D DA  10  ? ? N1    D DA  10  ? ? C2    D DA  10  ? ? 123.20 118.60 4.60  0.60 N 
22 1 N1    D DA  10  ? ? C2    D DA  10  ? ? N3    D DA  10  ? ? 125.18 129.30 -4.12 0.50 N 
23 1 C5    D DA  10  ? ? C6    D DA  10  ? ? N1    D DA  10  ? ? 114.37 117.70 -3.33 0.50 N 
24 1 N1    D DT  11  ? ? C2    D DT  11  ? ? N3    D DT  11  ? ? 118.23 114.60 3.63  0.60 N 
25 1 C2    D DT  11  ? ? N3    D DT  11  ? ? C4    D DT  11  ? ? 122.88 127.20 -4.32 0.60 N 
26 1 "C3'" D DT  11  ? ? "O3'" D DT  11  ? ? P     D DC  12  ? ? 127.12 119.70 7.42  1.20 Y 
27 1 "C4'" D DC  12  ? ? "C3'" D DC  12  ? ? "C2'" D DC  12  ? ? 108.65 103.10 5.55  0.90 N 
28 1 "C4'" D DC  13  ? ? "C3'" D DC  13  ? ? "C2'" D DC  13  ? ? 108.60 103.10 5.50  0.90 N 
29 1 N3    D DC  13  ? ? C4    D DC  13  ? ? C5    D DC  13  ? ? 119.49 121.90 -2.41 0.40 N 
30 1 "C4'" D DC  15  ? ? "C3'" D DC  15  ? ? "C2'" D DC  15  ? ? 109.14 103.10 6.04  0.90 N 
31 1 "O4'" D DC  15  ? ? "C1'" D DC  15  ? ? "C2'" D DC  15  ? ? 110.56 106.80 3.76  0.50 N 
32 1 "C4'" D DT  16  ? ? "C3'" D DT  16  ? ? "C2'" D DT  16  ? ? 109.15 103.10 6.05  0.90 N 
33 1 "O4'" D DT  16  ? ? "C1'" D DT  16  ? ? "C2'" D DT  16  ? ? 110.41 106.80 3.61  0.50 N 
34 1 C2    D DT  16  ? ? N3    D DT  16  ? ? C4    D DT  16  ? ? 122.87 127.20 -4.33 0.60 N 
35 1 "C4'" D DA  17  ? ? "C3'" D DA  17  ? ? "C2'" D DA  17  ? ? 109.03 103.10 5.93  0.90 N 
36 1 C6    D DA  17  ? ? N1    D DA  17  ? ? C2    D DA  17  ? ? 123.35 118.60 4.75  0.60 N 
37 1 N1    D DA  17  ? ? C2    D DA  17  ? ? N3    D DA  17  ? ? 125.04 129.30 -4.26 0.50 N 
38 1 C5    D DG  18  ? ? C6    D DG  18  ? ? N1    D DG  18  ? ? 114.65 111.50 3.15  0.50 N 
39 1 "C1'" D DA  19  ? ? "O4'" D DA  19  ? ? "C4'" D DA  19  ? ? 102.25 110.10 -7.85 1.00 N 
40 1 "C3'" D DA  19  ? ? "C2'" D DA  19  ? ? "C1'" D DA  19  ? ? 97.31  102.40 -5.09 0.80 N 
41 1 "O4'" D DA  19  ? ? "C1'" D DA  19  ? ? N9    D DA  19  ? ? 114.86 108.30 6.56  0.30 N 
42 1 C6    D DA  19  ? ? N1    D DA  19  ? ? C2    D DA  19  ? ? 123.23 118.60 4.63  0.60 N 
43 1 N1    D DA  19  ? ? C2    D DA  19  ? ? N3    D DA  19  ? ? 125.29 129.30 -4.01 0.50 N 
44 1 C     P TYR 351 ? ? N     P PRO 352 ? ? CA    P PRO 352 ? ? 129.91 119.30 10.61 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU P 63  ? ? -55.30  -4.46   
2  1 SER P 66  ? ? -82.47  34.26   
3  1 SER P 81  ? ? 24.93   110.05  
4  1 ASN P 89  ? ? 82.67   48.26   
5  1 TYR P 90  ? ? 3.74    110.60  
6  1 PRO P 93  ? ? -30.11  77.97   
7  1 LYS P 117 ? ? -43.99  -72.89  
8  1 HIS P 118 ? ? -99.74  58.22   
9  1 ASP P 132 ? ? -170.07 69.78   
10 1 ASN P 139 ? ? 72.18   53.31   
11 1 VAL P 172 ? ? -122.36 -66.78  
12 1 ASP P 186 ? ? 71.29   -44.83  
13 1 MET P 208 ? ? -28.81  117.74  
14 1 ASP P 223 ? ? -108.97 -85.49  
15 1 THR P 225 ? ? -46.37  108.53  
16 1 LYS P 278 ? ? -26.24  -45.76  
17 1 ASP P 280 ? ? -114.83 55.09   
18 1 GLU P 290 ? ? -27.67  -30.86  
19 1 ARG P 308 ? ? 37.87   45.46   
20 1 GLN P 309 ? ? 64.92   -5.78   
21 1 VAL P 330 ? ? -118.09 -169.07 
22 1 SER P 338 ? ? -42.01  -71.48  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P ALA 2   ? B ALA 1   
2  1 Y 1 P GLU 3   ? B GLU 2   
3  1 Y 1 P ASP 4   ? B ASP 3   
4  1 Y 1 P ASP 5   ? B ASP 4   
5  1 Y 1 P PRO 6   ? B PRO 5   
6  1 Y 1 P TYR 7   ? B TYR 6   
7  1 Y 1 P LEU 8   ? B LEU 7   
8  1 Y 1 P GLY 9   ? B GLY 8   
9  1 Y 1 P ARG 10  ? B ARG 9   
10 1 Y 1 P PRO 11  ? B PRO 10  
11 1 Y 1 P GLU 12  ? B GLU 11  
12 1 Y 1 P GLN 13  ? B GLN 12  
13 1 Y 1 P MET 14  ? B MET 13  
14 1 Y 1 P PHE 15  ? B PHE 14  
15 1 Y 1 P HIS 16  ? B HIS 15  
16 1 Y 1 P LEU 17  ? B LEU 16  
17 1 Y 1 P ASP 18  ? B ASP 17  
18 1 Y 1 P PRO 19  ? B PRO 18  
19 1 Y 1 P SER 20  ? B SER 19  
20 1 Y 1 P LEU 21  ? B LEU 20  
21 1 Y 1 P THR 22  ? B THR 21  
22 1 Y 1 P HIS 23  ? B HIS 22  
23 1 Y 1 P THR 24  ? B THR 23  
24 1 Y 1 P ILE 25  ? B ILE 24  
25 1 Y 1 P PHE 26  ? B PHE 25  
26 1 Y 1 P ASN 27  ? B ASN 26  
27 1 Y 1 P PRO 28  ? B PRO 27  
28 1 Y 1 P GLU 29  ? B GLU 28  
29 1 Y 1 P VAL 30  ? B VAL 29  
30 1 Y 1 P PHE 31  ? B PHE 30  
31 1 Y 1 P GLN 32  ? B GLN 31  
32 1 Y 1 P PRO 33  ? B PRO 32  
33 1 Y 1 P GLN 34  ? B GLN 33  
34 1 Y 1 P MET 35  ? B MET 34  
35 1 Y 1 P ALA 36  ? B ALA 35  
36 1 Y 1 P LEU 37  ? B LEU 36  
37 1 Y 1 P PRO 38  ? B PRO 37  
38 1 Y 1 P THR 39  ? B THR 38  
39 1 Y 1 P ALA 40  ? B ALA 39  
40 1 Y 1 P ASP 41  ? B ASP 40  
41 1 Y 1 P GLY 42  ? B GLY 41  
42 1 Y 1 P ILE 354 ? B ILE 353 
43 1 Y 1 P LYS 355 ? B LYS 354 
44 1 Y 1 P ASP 356 ? B ASP 355 
45 1 Y 1 P LYS 357 ? B LYS 356 
46 1 Y 1 P GLU 358 ? B GLU 357 
47 1 Y 1 P GLU 359 ? B GLU 358 
48 1 Y 1 P VAL 360 ? B VAL 359 
49 1 Y 1 P GLN 361 ? B GLN 360 
50 1 Y 1 P ARG 362 ? B ARG 361 
51 1 Y 1 P LYS 363 ? B LYS 362 
52 1 Y 1 P ARG 364 ? B ARG 363 
53 1 Y 1 P GLN 365 ? B GLN 364 
54 1 Y 1 P LYS 366 ? B LYS 365 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1SVC 'double helix'         
1SVC 'b-form double helix'  
1SVC 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 5  1_555 A DC 15 7_556 0.163  -0.103 0.160  3.521  -10.339 2.488  1  D_DG5:DC15_D D 5  ? D 15 ? 19 1 
1 A DG 6  1_555 A DC 14 7_556 0.291  -0.330 -0.365 -4.270 -6.313  -5.399 2  D_DG6:DC14_D D 6  ? D 14 ? 19 1 
1 A DG 7  1_555 A DC 13 7_556 -0.139 -0.056 0.243  8.761  -10.613 0.642  3  D_DG7:DC13_D D 7  ? D 13 ? 19 1 
1 A DG 8  1_555 A DC 12 7_556 -0.464 0.025  -0.081 8.022  -11.576 3.658  4  D_DG8:DC12_D D 8  ? D 12 ? 19 1 
1 A DA 9  1_555 A DT 11 7_556 -0.279 -0.145 -0.143 2.246  -28.971 1.361  5  D_DA9:DT11_D D 9  ? D 11 ? 20 1 
1 A DT 11 1_555 A DA 9  7_556 0.279  -0.145 -0.143 -2.246 -28.971 1.361  6  D_DT11:DA9_D D 11 ? D 9  ? 20 1 
1 A DC 12 1_555 A DG 8  7_556 0.464  0.025  -0.081 -8.022 -11.576 3.658  7  D_DC12:DG8_D D 12 ? D 8  ? 19 1 
1 A DC 13 1_555 A DG 7  7_556 0.139  -0.056 0.243  -8.761 -10.613 0.642  8  D_DC13:DG7_D D 13 ? D 7  ? 19 1 
1 A DC 14 1_555 A DG 6  7_556 -0.291 -0.330 -0.365 4.270  -6.313  -5.399 9  D_DC14:DG6_D D 14 ? D 6  ? 19 1 
1 A DC 15 1_555 A DG 5  7_556 -0.163 -0.103 0.160  -3.521 -10.339 2.488  10 D_DC15:DG5_D D 15 ? D 5  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 5  1_555 A DC 15 7_556 A DG 6  1_555 A DC 14 7_556 0.304  -0.345 3.834 4.131  -2.536 34.846 -0.124 0.225  3.858 -4.209 
-6.856 35.171 1 DD_DG5DG6:DC14DC15_DD D 5  ? D 15 ? D 6  ? D 14 ? 
1 A DG 6  1_555 A DC 14 7_556 A DG 7  1_555 A DC 13 7_556 -0.454 0.260  3.137 -4.395 0.721  31.611 0.346  0.053  3.174 1.316  
8.017  31.916 2 DD_DG6DG7:DC13DC14_DD D 6  ? D 14 ? D 7  ? D 13 ? 
1 A DG 7  1_555 A DC 13 7_556 A DG 8  1_555 A DC 12 7_556 1.012  -0.314 3.593 2.241  -3.218 28.334 0.178  -1.482 3.672 -6.534 
-4.551 28.599 3 DD_DG7DG8:DC12DC13_DD D 7  ? D 13 ? D 8  ? D 12 ? 
1 A DG 8  1_555 A DC 12 7_556 A DA 9  1_555 A DT 11 7_556 -1.006 0.018  3.435 -2.354 -1.615 39.662 0.226  1.189  3.483 -2.377 
3.463  39.761 4 DD_DG8DA9:DT11DC12_DD D 8  ? D 12 ? D 9  ? D 11 ? 
1 A DA 9  1_555 A DT 11 7_556 A DT 11 1_555 A DA 9  7_556 0.000  -0.301 6.406 0.000  6.329  72.686 -0.656 0.000  6.365 5.330  
0.000  72.923 5 DD_DA9DT11:DA9DT11_DD D 9  ? D 11 ? D 11 ? D 9  ? 
1 A DT 11 1_555 A DA 9  7_556 A DC 12 1_555 A DG 8  7_556 1.006  0.018  3.435 2.354  -1.615 39.662 0.226  -1.189 3.483 -2.377 
-3.463 39.761 6 DD_DT11DC12:DG8DA9_DD D 11 ? D 9  ? D 12 ? D 8  ? 
1 A DC 12 1_555 A DG 8  7_556 A DC 13 1_555 A DG 7  7_556 -1.012 -0.314 3.592 -2.241 -3.218 28.334 0.178  1.482  3.672 -6.534 
4.551  28.599 7 DD_DC12DC13:DG7DG8_DD D 12 ? D 8  ? D 13 ? D 7  ? 
1 A DC 13 1_555 A DG 7  7_556 A DC 14 1_555 A DG 6  7_556 0.454  0.260  3.137 4.395  0.721  31.611 0.346  -0.053 3.174 1.316  
-8.017 31.916 8 DD_DC13DC14:DG6DG7_DD D 13 ? D 7  ? D 14 ? D 6  ? 
1 A DC 14 1_555 A DG 6  7_556 A DC 15 1_555 A DG 5  7_556 -0.304 -0.345 3.834 -4.131 -2.536 34.846 -0.124 -0.225 3.858 -4.209 
6.856  35.171 9 DD_DC14DC15:DG5DG6_DD D 14 ? D 6  ? D 15 ? D 5  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#