data_1SWI
# 
_entry.id   1SWI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1SWI         pdb_00001swi 10.2210/pdb1swi/pdb 
WWPDB D_1000176546 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SWI 
_pdbx_database_status.recvd_initial_deposition_date   1996-05-09 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gonzalez, L.' 1 
'Plecs, J.'    2 
'Alber, T.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'An engineered allosteric switch in leucine-zipper oligomerization.'                           Nat.Struct.Biol. 3   510  
515 1996 NSBIEW US 1072-8368 2024 ? 8646536 10.1038/nsb0696-510 
1       'Crystal Structure of an Isoleucine-Zipper Trimer'                                             Nature           371 80   ? 
1994 NATUAS UK 0028-0836 0006 ? ?       ?                   
2       'A Switch between Two-, Three-, and Four-Stranded Coiled Coils in GCN4 Leucine Zipper Mutants' Science          262 1401 ? 
1993 SCIEAS US 0036-8075 0038 ? ?       ?                   
3       'X-Ray Structure of the GCN4 Leucine Zipper'                                                   Science          254 539  ? 
1991 SCIEAS US 0036-8075 0038 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gonzalez Jr., L.' 1  ? 
primary 'Plecs, J.J.'      2  ? 
primary 'Alber, T.'        3  ? 
1       'Harbury, P.B.'    4  ? 
1       'Kim, P.S.'        5  ? 
1       'Alber, T.'        6  ? 
2       'Harbury, P.B.'    7  ? 
2       'Zhang, T.'        8  ? 
2       'Kim, P.S.'        9  ? 
2       'Alber, T.'        10 ? 
3       
;O'Shea, E.K.
;
11 ? 
3       'Klemm, J.D.'      12 ? 
3       'Kim, P.S.'        13 ? 
3       'Alber, T.'        14 ? 
# 
_cell.entry_id           1SWI 
_cell.length_a           37.210 
_cell.length_b           46.410 
_cell.length_c           52.050 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SWI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man GCN4P1  3962.639 3  ? N16A ? ? 
2 non-polymer syn BENZENE 78.112   1  ? ?    ? ? 
3 water       nat water   18.015   29 ? ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       RMKQLEDKVEELLSKAYHLENEVARLKKLVGER 
_entity_poly.pdbx_seq_one_letter_code_can   RMKQLEDKVEELLSKAYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  MET n 
1 3  LYS n 
1 4  GLN n 
1 5  LEU n 
1 6  GLU n 
1 7  ASP n 
1 8  LYS n 
1 9  VAL n 
1 10 GLU n 
1 11 GLU n 
1 12 LEU n 
1 13 LEU n 
1 14 SER n 
1 15 LYS n 
1 16 ALA n 
1 17 TYR n 
1 18 HIS n 
1 19 LEU n 
1 20 GLU n 
1 21 ASN n 
1 22 GLU n 
1 23 VAL n 
1 24 ALA n 
1 25 ARG n 
1 26 LEU n 
1 27 LYS n 
1 28 LYS n 
1 29 LEU n 
1 30 VAL n 
1 31 GLY n 
1 32 GLU n 
1 33 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           249 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SWI A 1 ? 33 ? P03069 249 ? 281 ? 1 33 
2 1 1SWI B 1 ? 33 ? P03069 249 ? 281 ? 1 33 
3 1 1SWI C 1 ? 33 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SWI ALA A 16 ? UNP P03069 ASN 264 'engineered mutation' 16 1 
2 1SWI ALA B 16 ? UNP P03069 ASN 264 'engineered mutation' 16 2 
3 1SWI ALA C 16 ? UNP P03069 ASN 264 'engineered mutation' 16 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BNZ non-polymer         . BENZENE         ? 'C6 H6'          78.112  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SWI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.88 
_exptl_crystal.density_percent_sol   34. 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1994-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SWI 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   2618 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         86. 
_reflns.pdbx_Rmerge_I_obs            0.0970000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.3 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1SWI 
_refine.ls_number_reflns_obs                     2367 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.6 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1870000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1870000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               44. 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;ELECTRON DENSITY FOR THE N-TERMINAL HEPTAD (RESIDUES 1 - 7)
IS COMPARATIVELY WEAK, AND THE MAIN CHAIN B VALUES ARE
ABOVE AVERAGE.  THE N-TERMINAL HEPTAD MAKES RELATIVELY
FEW CRYSTAL CONTACTS AND MAY BE DYNAMICALLY DISORDERED.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        754 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             29 
_refine_hist.number_atoms_total               789 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.019 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.15  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1SWI 
_struct.title                     'GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A COMPLEXED WITH BENZENE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SWI 
_struct_keywords.pdbx_keywords   'LEUCINE ZIPPER' 
_struct_keywords.text            'COILED COIL, LEUCINE ZIPPER' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A1 ARG A 1 ? VAL A 30 ? ARG A 1 VAL A 30 1 ? 30 
HELX_P HELX_P2 B1 ARG B 1 ? VAL B 30 ? ARG B 1 VAL B 30 1 ? 30 
HELX_P HELX_P3 C1 ARG C 1 ? VAL C 30 ? ARG C 1 VAL C 30 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    B 
_struct_site.pdbx_auth_comp_id    BNZ 
_struct_site.pdbx_auth_seq_id     100 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE BNZ B 100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 LEU A 12 ? LEU A 12 . ? 1_555 ? 
2 AC1 4 ALA B 16 ? ALA B 16 . ? 1_555 ? 
3 AC1 4 LEU C 12 ? LEU C 12 . ? 1_555 ? 
4 AC1 4 ALA C 16 ? ALA C 16 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SWI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SWI 
_atom_sites.fract_transf_matrix[1][1]   0.026874 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021547 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019212 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ARG A 1 1  ? -14.665 -29.653 37.225 1.00 100.00 ? 1   ARG A N   1 
ATOM   2   C CA  . ARG A 1 1  ? -13.696 -28.563 37.208 1.00 100.00 ? 1   ARG A CA  1 
ATOM   3   C C   . ARG A 1 1  ? -13.924 -27.529 36.055 1.00 100.00 ? 1   ARG A C   1 
ATOM   4   O O   . ARG A 1 1  ? -13.476 -26.373 36.141 1.00 62.76  ? 1   ARG A O   1 
ATOM   5   C CB  . ARG A 1 1  ? -12.250 -29.082 37.397 1.00 62.76  ? 1   ARG A CB  1 
ATOM   6   C CG  . ARG A 1 1  ? -11.319 -28.344 38.377 1.00 62.76  ? 1   ARG A CG  1 
ATOM   7   C CD  . ARG A 1 1  ? -10.859 -29.158 39.586 1.00 62.76  ? 1   ARG A CD  1 
ATOM   8   N NE  . ARG A 1 1  ? -11.656 -28.828 40.787 1.00 62.76  ? 1   ARG A NE  1 
ATOM   9   C CZ  . ARG A 1 1  ? -12.129 -29.646 41.777 1.00 62.76  ? 1   ARG A CZ  1 
ATOM   10  N NH1 . ARG A 1 1  ? -11.914 -30.981 41.859 1.00 62.76  ? 1   ARG A NH1 1 
ATOM   11  N NH2 . ARG A 1 1  ? -12.853 -29.070 42.742 1.00 62.76  ? 1   ARG A NH2 1 
ATOM   12  N N   . MET A 1 2  ? -14.656 -27.881 34.968 1.00 52.74  ? 2   MET A N   1 
ATOM   13  C CA  . MET A 1 2  ? -14.933 -26.860 33.951 1.00 52.74  ? 2   MET A CA  1 
ATOM   14  C C   . MET A 1 2  ? -15.943 -25.785 34.362 1.00 52.74  ? 2   MET A C   1 
ATOM   15  O O   . MET A 1 2  ? -15.879 -24.652 33.910 1.00 45.59  ? 2   MET A O   1 
ATOM   16  C CB  . MET A 1 2  ? -14.535 -27.021 32.463 1.00 45.59  ? 2   MET A CB  1 
ATOM   17  C CG  . MET A 1 2  ? -13.085 -27.452 32.296 1.00 45.59  ? 2   MET A CG  1 
ATOM   18  S SD  . MET A 1 2  ? -12.759 -28.908 31.220 1.00 45.59  ? 2   MET A SD  1 
ATOM   19  C CE  . MET A 1 2  ? -12.039 -30.105 32.392 1.00 45.59  ? 2   MET A CE  1 
ATOM   20  N N   . LYS A 1 3  ? -16.845 -26.105 35.315 1.00 27.86  ? 3   LYS A N   1 
ATOM   21  C CA  . LYS A 1 3  ? -17.758 -25.087 35.805 1.00 27.86  ? 3   LYS A CA  1 
ATOM   22  C C   . LYS A 1 3  ? -17.041 -23.790 36.127 1.00 27.86  ? 3   LYS A C   1 
ATOM   23  O O   . LYS A 1 3  ? -17.270 -22.754 35.518 1.00 70.51  ? 3   LYS A O   1 
ATOM   24  C CB  . LYS A 1 3  ? -18.587 -25.504 37.000 1.00 70.51  ? 3   LYS A CB  1 
ATOM   25  C CG  . LYS A 1 3  ? -19.947 -24.788 36.969 1.00 70.51  ? 3   LYS A CG  1 
ATOM   26  C CD  . LYS A 1 3  ? -20.690 -24.862 35.616 1.00 70.51  ? 3   LYS A CD  1 
ATOM   27  C CE  . LYS A 1 3  ? -22.218 -24.795 35.721 1.00 70.51  ? 3   LYS A CE  1 
ATOM   28  N NZ  . LYS A 1 3  ? -22.724 -23.899 36.785 1.00 70.51  ? 3   LYS A NZ  1 
ATOM   29  N N   . GLN A 1 4  ? -16.156 -23.891 37.102 1.00 100.00 ? 4   GLN A N   1 
ATOM   30  C CA  . GLN A 1 4  ? -15.378 -22.766 37.562 1.00 100.00 ? 4   GLN A CA  1 
ATOM   31  C C   . GLN A 1 4  ? -14.674 -22.006 36.428 1.00 100.00 ? 4   GLN A C   1 
ATOM   32  O O   . GLN A 1 4  ? -14.973 -20.821 36.187 1.00 69.46  ? 4   GLN A O   1 
ATOM   33  C CB  . GLN A 1 4  ? -14.469 -23.160 38.760 1.00 69.46  ? 4   GLN A CB  1 
ATOM   34  C CG  . GLN A 1 4  ? -15.237 -24.050 39.778 1.00 69.46  ? 4   GLN A CG  1 
ATOM   35  C CD  . GLN A 1 4  ? -14.565 -24.307 41.127 1.00 69.46  ? 4   GLN A CD  1 
ATOM   36  O OE1 . GLN A 1 4  ? -15.224 -24.663 42.145 1.00 69.46  ? 4   GLN A OE1 1 
ATOM   37  N NE2 . GLN A 1 4  ? -13.243 -24.165 41.121 1.00 69.46  ? 4   GLN A NE2 1 
ATOM   38  N N   . LEU A 1 5  ? -13.760 -22.698 35.710 1.00 33.53  ? 5   LEU A N   1 
ATOM   39  C CA  . LEU A 1 5  ? -12.984 -22.076 34.638 1.00 33.53  ? 5   LEU A CA  1 
ATOM   40  C C   . LEU A 1 5  ? -13.783 -21.399 33.551 1.00 33.53  ? 5   LEU A C   1 
ATOM   41  O O   . LEU A 1 5  ? -13.488 -20.261 33.215 1.00 82.94  ? 5   LEU A O   1 
ATOM   42  C CB  . LEU A 1 5  ? -11.757 -22.815 34.138 1.00 82.94  ? 5   LEU A CB  1 
ATOM   43  C CG  . LEU A 1 5  ? -10.584 -21.852 34.163 1.00 82.94  ? 5   LEU A CG  1 
ATOM   44  C CD1 . LEU A 1 5  ? -9.683  -22.189 35.326 1.00 82.94  ? 5   LEU A CD1 1 
ATOM   45  C CD2 . LEU A 1 5  ? -9.830  -21.847 32.828 1.00 82.94  ? 5   LEU A CD2 1 
ATOM   46  N N   . GLU A 1 6  ? -14.828 -22.080 33.049 1.00 31.67  ? 6   GLU A N   1 
ATOM   47  C CA  . GLU A 1 6  ? -15.723 -21.534 32.032 1.00 31.67  ? 6   GLU A CA  1 
ATOM   48  C C   . GLU A 1 6  ? -16.758 -20.545 32.587 1.00 31.67  ? 6   GLU A C   1 
ATOM   49  O O   . GLU A 1 6  ? -17.643 -20.106 31.878 1.00 100.00 ? 6   GLU A O   1 
ATOM   50  C CB  . GLU A 1 6  ? -16.250 -22.593 31.068 1.00 100.00 ? 6   GLU A CB  1 
ATOM   51  C CG  . GLU A 1 6  ? -15.185 -22.953 29.999 1.00 100.00 ? 6   GLU A CG  1 
ATOM   52  C CD  . GLU A 1 6  ? -14.010 -23.818 30.456 1.00 100.00 ? 6   GLU A CD  1 
ATOM   53  O OE1 . GLU A 1 6  ? -13.638 -23.952 31.617 1.00 100.00 ? 6   GLU A OE1 1 
ATOM   54  O OE2 . GLU A 1 6  ? -13.411 -24.415 29.453 1.00 100.00 ? 6   GLU A OE2 1 
ATOM   55  N N   . ASP A 1 7  ? -16.584 -20.158 33.854 1.00 77.17  ? 7   ASP A N   1 
ATOM   56  C CA  . ASP A 1 7  ? -17.432 -19.174 34.528 1.00 77.17  ? 7   ASP A CA  1 
ATOM   57  C C   . ASP A 1 7  ? -16.618 -17.845 34.857 1.00 77.17  ? 7   ASP A C   1 
ATOM   58  O O   . ASP A 1 7  ? -17.135 -16.660 34.939 1.00 37.89  ? 7   ASP A O   1 
ATOM   59  C CB  . ASP A 1 7  ? -18.210 -19.815 35.737 1.00 37.89  ? 7   ASP A CB  1 
ATOM   60  C CG  . ASP A 1 7  ? -19.479 -20.684 35.479 1.00 37.89  ? 7   ASP A CG  1 
ATOM   61  O OD1 . ASP A 1 7  ? -20.064 -20.854 34.389 1.00 37.89  ? 7   ASP A OD1 1 
ATOM   62  O OD2 . ASP A 1 7  ? -19.921 -21.249 36.601 1.00 37.89  ? 7   ASP A OD2 1 
ATOM   63  N N   . LYS A 1 8  ? -15.282 -18.051 35.018 1.00 24.38  ? 8   LYS A N   1 
ATOM   64  C CA  . LYS A 1 8  ? -14.345 -16.955 35.294 1.00 24.38  ? 8   LYS A CA  1 
ATOM   65  C C   . LYS A 1 8  ? -13.938 -16.342 34.007 1.00 24.38  ? 8   LYS A C   1 
ATOM   66  O O   . LYS A 1 8  ? -13.704 -15.152 33.963 1.00 68.88  ? 8   LYS A O   1 
ATOM   67  C CB  . LYS A 1 8  ? -13.181 -17.172 36.276 1.00 68.88  ? 8   LYS A CB  1 
ATOM   68  C CG  . LYS A 1 8  ? -13.283 -16.330 37.562 1.00 68.88  ? 8   LYS A CG  1 
ATOM   69  C CD  . LYS A 1 8  ? -13.346 -17.134 38.871 1.00 68.88  ? 8   LYS A CD  1 
ATOM   70  C CE  . LYS A 1 8  ? -12.628 -18.496 38.829 1.00 68.88  ? 8   LYS A CE  1 
ATOM   71  N NZ  . LYS A 1 8  ? -12.480 -19.169 40.137 1.00 68.88  ? 8   LYS A NZ  1 
ATOM   72  N N   . VAL A 1 9  ? -13.977 -17.163 32.974 1.00 17.28  ? 9   VAL A N   1 
ATOM   73  C CA  . VAL A 1 9  ? -13.757 -16.679 31.653 1.00 17.28  ? 9   VAL A CA  1 
ATOM   74  C C   . VAL A 1 9  ? -15.051 -15.961 31.228 1.00 17.28  ? 9   VAL A C   1 
ATOM   75  O O   . VAL A 1 9  ? -15.245 -15.474 30.080 1.00 14.77  ? 9   VAL A O   1 
ATOM   76  C CB  . VAL A 1 9  ? -13.401 -17.830 30.766 1.00 14.77  ? 9   VAL A CB  1 
ATOM   77  C CG1 . VAL A 1 9  ? -13.251 -17.459 29.279 1.00 14.77  ? 9   VAL A CG1 1 
ATOM   78  C CG2 . VAL A 1 9  ? -12.220 -18.589 31.368 1.00 14.77  ? 9   VAL A CG2 1 
ATOM   79  N N   . GLU A 1 10 ? -16.008 -15.876 32.182 1.00 18.03  ? 10  GLU A N   1 
ATOM   80  C CA  . GLU A 1 10 ? -17.230 -15.097 31.904 1.00 18.03  ? 10  GLU A CA  1 
ATOM   81  C C   . GLU A 1 10 ? -17.091 -13.789 32.658 1.00 18.03  ? 10  GLU A C   1 
ATOM   82  O O   . GLU A 1 10 ? -17.105 -12.700 32.059 1.00 100.00 ? 10  GLU A O   1 
ATOM   83  C CB  . GLU A 1 10 ? -18.554 -15.763 32.295 1.00 100.00 ? 10  GLU A CB  1 
ATOM   84  C CG  . GLU A 1 10 ? -19.757 -15.027 31.664 1.00 100.00 ? 10  GLU A CG  1 
ATOM   85  C CD  . GLU A 1 10 ? -20.986 -15.087 32.523 1.00 100.00 ? 10  GLU A CD  1 
ATOM   86  O OE1 . GLU A 1 10 ? -21.337 -16.097 33.104 1.00 100.00 ? 10  GLU A OE1 1 
ATOM   87  O OE2 . GLU A 1 10 ? -21.617 -13.938 32.578 1.00 100.00 ? 10  GLU A OE2 1 
ATOM   88  N N   . GLU A 1 11 ? -16.830 -13.921 33.970 1.00 23.32  ? 11  GLU A N   1 
ATOM   89  C CA  . GLU A 1 11 ? -16.488 -12.740 34.744 1.00 23.32  ? 11  GLU A CA  1 
ATOM   90  C C   . GLU A 1 11 ? -15.426 -11.757 34.068 1.00 23.32  ? 11  GLU A C   1 
ATOM   91  O O   . GLU A 1 11 ? -15.427 -10.546 34.276 1.00 96.02  ? 11  GLU A O   1 
ATOM   92  C CB  . GLU A 1 11 ? -15.922 -13.176 36.126 1.00 96.02  ? 11  GLU A CB  1 
ATOM   93  C CG  . GLU A 1 11 ? -15.211 -12.042 36.911 1.00 96.02  ? 11  GLU A CG  1 
ATOM   94  C CD  . GLU A 1 11 ? -15.769 -11.811 38.295 1.00 96.02  ? 11  GLU A CD  1 
ATOM   95  O OE1 . GLU A 1 11 ? -16.787 -10.973 38.322 1.00 96.02  ? 11  GLU A OE1 1 
ATOM   96  O OE2 . GLU A 1 11 ? -15.326 -12.373 39.282 1.00 96.02  ? 11  GLU A OE2 1 
ATOM   97  N N   . LEU A 1 12 ? -14.431 -12.281 33.348 1.00 34.33  ? 12  LEU A N   1 
ATOM   98  C CA  . LEU A 1 12 ? -13.423 -11.455 32.753 1.00 34.33  ? 12  LEU A CA  1 
ATOM   99  C C   . LEU A 1 12 ? -13.950 -11.042 31.414 1.00 34.33  ? 12  LEU A C   1 
ATOM   100 O O   . LEU A 1 12 ? -13.481 -10.050 30.892 1.00 43.67  ? 12  LEU A O   1 
ATOM   101 C CB  . LEU A 1 12 ? -12.131 -12.231 32.390 1.00 43.67  ? 12  LEU A CB  1 
ATOM   102 C CG  . LEU A 1 12 ? -11.086 -12.612 33.453 1.00 43.67  ? 12  LEU A CG  1 
ATOM   103 C CD1 . LEU A 1 12 ? -9.818  -12.998 32.710 1.00 43.67  ? 12  LEU A CD1 1 
ATOM   104 C CD2 . LEU A 1 12 ? -10.776 -11.518 34.486 1.00 43.67  ? 12  LEU A CD2 1 
ATOM   105 N N   . LEU A 1 13 ? -14.797 -11.862 30.775 1.00 44.50  ? 13  LEU A N   1 
ATOM   106 C CA  . LEU A 1 13 ? -15.286 -11.530 29.436 1.00 44.50  ? 13  LEU A CA  1 
ATOM   107 C C   . LEU A 1 13 ? -16.224 -10.345 29.629 1.00 44.50  ? 13  LEU A C   1 
ATOM   108 O O   . LEU A 1 13 ? -16.295 -9.335  28.895 1.00 15.58  ? 13  LEU A O   1 
ATOM   109 C CB  . LEU A 1 13 ? -16.067 -12.721 28.812 1.00 15.58  ? 13  LEU A CB  1 
ATOM   110 C CG  . LEU A 1 13 ? -15.384 -13.599 27.715 1.00 15.58  ? 13  LEU A CG  1 
ATOM   111 C CD1 . LEU A 1 13 ? -16.346 -14.673 27.150 1.00 15.58  ? 13  LEU A CD1 1 
ATOM   112 C CD2 . LEU A 1 13 ? -14.857 -12.745 26.566 1.00 15.58  ? 13  LEU A CD2 1 
ATOM   113 N N   . SER A 1 14 ? -16.949 -10.449 30.706 1.00 19.64  ? 14  SER A N   1 
ATOM   114 C CA  . SER A 1 14 ? -17.844 -9.380  30.882 1.00 19.64  ? 14  SER A CA  1 
ATOM   115 C C   . SER A 1 14 ? -17.053 -8.082  30.860 1.00 19.64  ? 14  SER A C   1 
ATOM   116 O O   . SER A 1 14 ? -17.271 -7.203  29.978 1.00 49.83  ? 14  SER A O   1 
ATOM   117 C CB  . SER A 1 14 ? -18.707 -9.531  32.117 1.00 49.83  ? 14  SER A CB  1 
ATOM   118 O OG  . SER A 1 14 ? -17.923 -9.602  33.290 1.00 49.83  ? 14  SER A OG  1 
ATOM   119 N N   . LYS A 1 15 ? -16.172 -8.007  31.899 1.00 23.11  ? 15  LYS A N   1 
ATOM   120 C CA  . LYS A 1 15 ? -15.247 -6.925  32.322 1.00 23.11  ? 15  LYS A CA  1 
ATOM   121 C C   . LYS A 1 15 ? -14.265 -6.378  31.283 1.00 23.11  ? 15  LYS A C   1 
ATOM   122 O O   . LYS A 1 15 ? -13.702 -5.364  31.467 1.00 37.09  ? 15  LYS A O   1 
ATOM   123 C CB  . LYS A 1 15 ? -14.555 -7.344  33.596 1.00 37.09  ? 15  LYS A CB  1 
ATOM   124 C CG  . LYS A 1 15 ? -15.551 -7.793  34.642 1.00 37.09  ? 15  LYS A CG  1 
ATOM   125 C CD  . LYS A 1 15 ? -14.858 -8.171  35.947 1.00 37.09  ? 15  LYS A CD  1 
ATOM   126 C CE  . LYS A 1 15 ? -15.649 -7.818  37.221 1.00 37.09  ? 15  LYS A CE  1 
ATOM   127 N NZ  . LYS A 1 15 ? -14.878 -8.004  38.483 1.00 37.09  ? 15  LYS A NZ  1 
ATOM   128 N N   . ALA A 1 16 ? -14.028 -7.064  30.219 1.00 3.93   ? 16  ALA A N   1 
ATOM   129 C CA  . ALA A 1 16 ? -13.196 -6.637  29.129 1.00 3.93   ? 16  ALA A CA  1 
ATOM   130 C C   . ALA A 1 16 ? -14.106 -5.799  28.240 1.00 3.93   ? 16  ALA A C   1 
ATOM   131 O O   . ALA A 1 16 ? -13.703 -4.920  27.492 1.00 28.71  ? 16  ALA A O   1 
ATOM   132 C CB  . ALA A 1 16 ? -12.634 -7.826  28.349 1.00 28.71  ? 16  ALA A CB  1 
ATOM   133 N N   . TYR A 1 17 ? -15.384 -6.081  28.295 1.00 15.01  ? 17  TYR A N   1 
ATOM   134 C CA  . TYR A 1 17 ? -16.348 -5.360  27.548 1.00 15.01  ? 17  TYR A CA  1 
ATOM   135 C C   . TYR A 1 17 ? -16.609 -4.043  28.301 1.00 15.01  ? 17  TYR A C   1 
ATOM   136 O O   . TYR A 1 17 ? -16.154 -3.057  27.807 1.00 14.29  ? 17  TYR A O   1 
ATOM   137 C CB  . TYR A 1 17 ? -17.531 -6.309  27.355 1.00 14.29  ? 17  TYR A CB  1 
ATOM   138 C CG  . TYR A 1 17 ? -18.890 -5.686  27.045 1.00 14.29  ? 17  TYR A CG  1 
ATOM   139 C CD1 . TYR A 1 17 ? -19.243 -5.401  25.719 1.00 14.29  ? 17  TYR A CD1 1 
ATOM   140 C CD2 . TYR A 1 17 ? -19.766 -5.385  28.087 1.00 14.29  ? 17  TYR A CD2 1 
ATOM   141 C CE1 . TYR A 1 17 ? -20.452 -4.791  25.413 1.00 14.29  ? 17  TYR A CE1 1 
ATOM   142 C CE2 . TYR A 1 17 ? -21.010 -4.861  27.788 1.00 14.29  ? 17  TYR A CE2 1 
ATOM   143 C CZ  . TYR A 1 17 ? -21.330 -4.589  26.466 1.00 14.29  ? 17  TYR A CZ  1 
ATOM   144 O OH  . TYR A 1 17 ? -22.574 -4.066  26.190 1.00 14.29  ? 17  TYR A OH  1 
ATOM   145 N N   . HIS A 1 18 ? -17.217 -3.991  29.532 1.00 2.00   ? 18  HIS A N   1 
ATOM   146 C CA  . HIS A 1 18 ? -17.374 -2.765  30.390 1.00 2.00   ? 18  HIS A CA  1 
ATOM   147 C C   . HIS A 1 18 ? -16.259 -1.786  30.170 1.00 2.00   ? 18  HIS A C   1 
ATOM   148 O O   . HIS A 1 18 ? -16.451 -0.794  29.481 1.00 50.44  ? 18  HIS A O   1 
ATOM   149 C CB  . HIS A 1 18 ? -17.332 -3.179  31.866 1.00 50.44  ? 18  HIS A CB  1 
ATOM   150 C CG  . HIS A 1 18 ? -17.491 -2.105  32.898 1.00 50.44  ? 18  HIS A CG  1 
ATOM   151 N ND1 . HIS A 1 18 ? -16.948 -2.255  34.173 1.00 50.44  ? 18  HIS A ND1 1 
ATOM   152 C CD2 . HIS A 1 18 ? -18.189 -0.930  32.868 1.00 50.44  ? 18  HIS A CD2 1 
ATOM   153 C CE1 . HIS A 1 18 ? -17.275 -1.173  34.857 1.00 50.44  ? 18  HIS A CE1 1 
ATOM   154 N NE2 . HIS A 1 18 ? -18.031 -0.361  34.106 1.00 50.44  ? 18  HIS A NE2 1 
ATOM   155 N N   . LEU A 1 19 ? -15.047 -2.170  30.651 1.00 17.46  ? 19  LEU A N   1 
ATOM   156 C CA  . LEU A 1 19 ? -13.764 -1.444  30.471 1.00 17.46  ? 19  LEU A CA  1 
ATOM   157 C C   . LEU A 1 19 ? -13.491 -1.045  29.067 1.00 17.46  ? 19  LEU A C   1 
ATOM   158 O O   . LEU A 1 19 ? -13.269 0.130   28.873 1.00 27.33  ? 19  LEU A O   1 
ATOM   159 C CB  . LEU A 1 19 ? -12.494 -2.111  30.895 1.00 27.33  ? 19  LEU A CB  1 
ATOM   160 C CG  . LEU A 1 19 ? -12.505 -2.320  32.362 1.00 27.33  ? 19  LEU A CG  1 
ATOM   161 C CD1 . LEU A 1 19 ? -11.826 -3.661  32.634 1.00 27.33  ? 19  LEU A CD1 1 
ATOM   162 C CD2 . LEU A 1 19 ? -11.767 -1.182  33.053 1.00 27.33  ? 19  LEU A CD2 1 
ATOM   163 N N   . GLU A 1 20 ? -13.462 -1.959  28.083 1.00 7.47   ? 20  GLU A N   1 
ATOM   164 C CA  . GLU A 1 20 ? -13.266 -1.463  26.714 1.00 7.47   ? 20  GLU A CA  1 
ATOM   165 C C   . GLU A 1 20 ? -14.217 -0.253  26.560 1.00 7.47   ? 20  GLU A C   1 
ATOM   166 O O   . GLU A 1 20 ? -13.858 0.855   26.130 1.00 40.01  ? 20  GLU A O   1 
ATOM   167 C CB  . GLU A 1 20 ? -13.638 -2.460  25.633 1.00 40.01  ? 20  GLU A CB  1 
ATOM   168 C CG  . GLU A 1 20 ? -12.469 -3.147  24.913 1.00 40.01  ? 20  GLU A CG  1 
ATOM   169 C CD  . GLU A 1 20 ? -12.965 -4.460  24.337 1.00 40.01  ? 20  GLU A CD  1 
ATOM   170 O OE1 . GLU A 1 20 ? -13.602 -5.245  25.037 1.00 40.01  ? 20  GLU A OE1 1 
ATOM   171 O OE2 . GLU A 1 20 ? -12.791 -4.616  23.006 1.00 40.01  ? 20  GLU A OE2 1 
ATOM   172 N N   . ASN A 1 21 ? -15.446 -0.466  27.001 1.00 30.58  ? 21  ASN A N   1 
ATOM   173 C CA  . ASN A 1 21 ? -16.438 0.563   26.916 1.00 30.58  ? 21  ASN A CA  1 
ATOM   174 C C   . ASN A 1 21 ? -16.101 1.830   27.641 1.00 30.58  ? 21  ASN A C   1 
ATOM   175 O O   . ASN A 1 21 ? -16.106 2.889   27.050 1.00 22.16  ? 21  ASN A O   1 
ATOM   176 C CB  . ASN A 1 21 ? -17.870 0.124   27.184 1.00 22.16  ? 21  ASN A CB  1 
ATOM   177 C CG  . ASN A 1 21 ? -18.426 -0.666  26.047 1.00 22.16  ? 21  ASN A CG  1 
ATOM   178 O OD1 . ASN A 1 21 ? -17.832 -0.918  24.989 1.00 22.16  ? 21  ASN A OD1 1 
ATOM   179 N ND2 . ASN A 1 21 ? -19.599 -1.169  26.331 1.00 22.16  ? 21  ASN A ND2 1 
ATOM   180 N N   . GLU A 1 22 ? -15.907 1.705   28.911 1.00 26.96  ? 22  GLU A N   1 
ATOM   181 C CA  . GLU A 1 22 ? -15.550 2.797   29.773 1.00 26.96  ? 22  GLU A CA  1 
ATOM   182 C C   . GLU A 1 22 ? -14.341 3.655   29.262 1.00 26.96  ? 22  GLU A C   1 
ATOM   183 O O   . GLU A 1 22 ? -14.468 4.864   29.060 1.00 50.70  ? 22  GLU A O   1 
ATOM   184 C CB  . GLU A 1 22 ? -15.297 2.178   31.145 1.00 50.70  ? 22  GLU A CB  1 
ATOM   185 C CG  . GLU A 1 22 ? -15.216 3.232   32.211 1.00 50.70  ? 22  GLU A CG  1 
ATOM   186 C CD  . GLU A 1 22 ? -16.538 3.799   32.561 1.00 50.70  ? 22  GLU A CD  1 
ATOM   187 O OE1 . GLU A 1 22 ? -17.018 4.513   31.603 1.00 50.70  ? 22  GLU A OE1 1 
ATOM   188 O OE2 . GLU A 1 22 ? -17.066 3.671   33.640 1.00 50.70  ? 22  GLU A OE2 1 
ATOM   189 N N   . VAL A 1 23 ? -13.177 3.021   28.958 1.00 41.27  ? 23  VAL A N   1 
ATOM   190 C CA  . VAL A 1 23 ? -11.956 3.664   28.457 1.00 41.27  ? 23  VAL A CA  1 
ATOM   191 C C   . VAL A 1 23 ? -12.314 4.503   27.298 1.00 41.27  ? 23  VAL A C   1 
ATOM   192 O O   . VAL A 1 23 ? -11.966 5.663   27.296 1.00 32.45  ? 23  VAL A O   1 
ATOM   193 C CB  . VAL A 1 23 ? -10.825 2.689   28.073 1.00 32.45  ? 23  VAL A CB  1 
ATOM   194 C CG1 . VAL A 1 23 ? -9.984  3.163   26.924 1.00 32.45  ? 23  VAL A CG1 1 
ATOM   195 C CG2 . VAL A 1 23 ? -9.884  2.526   29.234 1.00 32.45  ? 23  VAL A CG2 1 
ATOM   196 N N   . ALA A 1 24 ? -13.033 3.908   26.355 1.00 29.90  ? 24  ALA A N   1 
ATOM   197 C CA  . ALA A 1 24 ? -13.467 4.576   25.134 1.00 29.90  ? 24  ALA A CA  1 
ATOM   198 C C   . ALA A 1 24 ? -14.236 5.926   25.356 1.00 29.90  ? 24  ALA A C   1 
ATOM   199 O O   . ALA A 1 24 ? -14.020 6.901   24.578 1.00 29.84  ? 24  ALA A O   1 
ATOM   200 C CB  . ALA A 1 24 ? -14.204 3.594   24.209 1.00 29.84  ? 24  ALA A CB  1 
ATOM   201 N N   . ARG A 1 25 ? -15.137 5.919   26.404 1.00 19.48  ? 25  ARG A N   1 
ATOM   202 C CA  . ARG A 1 25 ? -15.990 7.025   26.857 1.00 19.48  ? 25  ARG A CA  1 
ATOM   203 C C   . ARG A 1 25 ? -14.968 8.137   27.201 1.00 19.48  ? 25  ARG A C   1 
ATOM   204 O O   . ARG A 1 25 ? -14.870 9.102   26.446 1.00 76.08  ? 25  ARG A O   1 
ATOM   205 C CB  . ARG A 1 25 ? -16.840 6.624   28.048 1.00 76.08  ? 25  ARG A CB  1 
ATOM   206 C CG  . ARG A 1 25 ? -18.201 7.285   28.065 1.00 76.08  ? 25  ARG A CG  1 
ATOM   207 C CD  . ARG A 1 25 ? -18.640 7.766   29.470 1.00 76.08  ? 25  ARG A CD  1 
ATOM   208 N NE  . ARG A 1 25 ? -19.681 8.837   29.453 1.00 76.08  ? 25  ARG A NE  1 
ATOM   209 C CZ  . ARG A 1 25 ? -19.803 9.895   30.296 1.00 76.08  ? 25  ARG A CZ  1 
ATOM   210 N NH1 . ARG A 1 25 ? -18.977 10.113  31.323 1.00 76.08  ? 25  ARG A NH1 1 
ATOM   211 N NH2 . ARG A 1 25 ? -20.787 10.780  30.090 1.00 76.08  ? 25  ARG A NH2 1 
ATOM   212 N N   . LEU A 1 26 ? -14.156 7.930   28.272 1.00 20.62  ? 26  LEU A N   1 
ATOM   213 C CA  . LEU A 1 26 ? -13.012 8.729   28.706 1.00 20.62  ? 26  LEU A CA  1 
ATOM   214 C C   . LEU A 1 26 ? -12.150 9.250   27.550 1.00 20.62  ? 26  LEU A C   1 
ATOM   215 O O   . LEU A 1 26 ? -11.738 10.388  27.426 1.00 20.57  ? 26  LEU A O   1 
ATOM   216 C CB  . LEU A 1 26 ? -12.106 7.700   29.333 1.00 20.57  ? 26  LEU A CB  1 
ATOM   217 C CG  . LEU A 1 26 ? -12.237 7.650   30.832 1.00 20.57  ? 26  LEU A CG  1 
ATOM   218 C CD1 . LEU A 1 26 ? -10.996 6.934   31.442 1.00 20.57  ? 26  LEU A CD1 1 
ATOM   219 C CD2 . LEU A 1 26 ? -12.360 9.089   31.310 1.00 20.57  ? 26  LEU A CD2 1 
ATOM   220 N N   . LYS A 1 27 ? -11.802 8.344   26.659 1.00 17.44  ? 27  LYS A N   1 
ATOM   221 C CA  . LYS A 1 27 ? -10.977 8.806   25.622 1.00 17.44  ? 27  LYS A CA  1 
ATOM   222 C C   . LYS A 1 27 ? -11.768 9.849   24.894 1.00 17.44  ? 27  LYS A C   1 
ATOM   223 O O   . LYS A 1 27 ? -11.292 10.925  24.671 1.00 28.03  ? 27  LYS A O   1 
ATOM   224 C CB  . LYS A 1 27 ? -10.457 7.653   24.782 1.00 28.03  ? 27  LYS A CB  1 
ATOM   225 C CG  . LYS A 1 27 ? -9.184  6.999   25.336 1.00 28.03  ? 27  LYS A CG  1 
ATOM   226 C CD  . LYS A 1 27 ? -8.439  6.190   24.322 1.00 28.03  ? 27  LYS A CD  1 
ATOM   227 C CE  . LYS A 1 27 ? -9.416  5.521   23.379 1.00 28.03  ? 27  LYS A CE  1 
ATOM   228 N NZ  . LYS A 1 27 ? -8.866  5.272   22.052 1.00 28.03  ? 27  LYS A NZ  1 
ATOM   229 N N   . LYS A 1 28 ? -13.001 9.565   24.527 1.00 41.25  ? 28  LYS A N   1 
ATOM   230 C CA  . LYS A 1 28 ? -13.841 10.562  23.860 1.00 41.25  ? 28  LYS A CA  1 
ATOM   231 C C   . LYS A 1 28 ? -13.991 11.903  24.621 1.00 41.25  ? 28  LYS A C   1 
ATOM   232 O O   . LYS A 1 28 ? -13.971 12.976  24.001 1.00 82.55  ? 28  LYS A O   1 
ATOM   233 C CB  . LYS A 1 28 ? -15.223 9.982   23.582 1.00 82.55  ? 28  LYS A CB  1 
ATOM   234 C CG  . LYS A 1 28 ? -15.351 9.281   22.236 1.00 82.55  ? 28  LYS A CG  1 
ATOM   235 C CD  . LYS A 1 28 ? -16.693 8.578   22.095 1.00 82.55  ? 28  LYS A CD  1 
ATOM   236 C CE  . LYS A 1 28 ? -17.385 8.393   23.447 1.00 82.55  ? 28  LYS A CE  1 
ATOM   237 N NZ  . LYS A 1 28 ? -18.628 7.590   23.388 1.00 82.55  ? 28  LYS A NZ  1 
ATOM   238 N N   . LEU A 1 29 ? -14.184 11.859  25.972 1.00 41.97  ? 29  LEU A N   1 
ATOM   239 C CA  . LEU A 1 29 ? -14.374 13.040  26.829 1.00 41.97  ? 29  LEU A CA  1 
ATOM   240 C C   . LEU A 1 29 ? -13.096 13.711  27.251 1.00 41.97  ? 29  LEU A C   1 
ATOM   241 O O   . LEU A 1 29 ? -13.022 14.329  28.327 1.00 20.38  ? 29  LEU A O   1 
ATOM   242 C CB  . LEU A 1 29 ? -14.984 12.732  28.199 1.00 20.38  ? 29  LEU A CB  1 
ATOM   243 C CG  . LEU A 1 29 ? -16.309 12.024  28.281 1.00 20.38  ? 29  LEU A CG  1 
ATOM   244 C CD1 . LEU A 1 29 ? -16.571 11.972  29.785 1.00 20.38  ? 29  LEU A CD1 1 
ATOM   245 C CD2 . LEU A 1 29 ? -17.462 12.700  27.485 1.00 20.38  ? 29  LEU A CD2 1 
ATOM   246 N N   . VAL A 1 30 ? -12.073 13.536  26.486 1.00 24.19  ? 30  VAL A N   1 
ATOM   247 C CA  . VAL A 1 30 ? -10.820 14.091  26.843 1.00 24.19  ? 30  VAL A CA  1 
ATOM   248 C C   . VAL A 1 30 ? -10.082 14.318  25.521 1.00 24.19  ? 30  VAL A C   1 
ATOM   249 O O   . VAL A 1 30 ? -8.967  14.841  25.473 1.00 37.20  ? 30  VAL A O   1 
ATOM   250 C CB  . VAL A 1 30 ? -10.150 13.266  27.968 1.00 37.20  ? 30  VAL A CB  1 
ATOM   251 C CG1 . VAL A 1 30 ? -8.626  13.078  27.869 1.00 37.20  ? 30  VAL A CG1 1 
ATOM   252 C CG2 . VAL A 1 30 ? -10.483 13.838  29.339 1.00 37.20  ? 30  VAL A CG2 1 
ATOM   253 N N   . GLY A 1 31 ? -10.813 14.040  24.431 1.00 16.14  ? 31  GLY A N   1 
ATOM   254 C CA  . GLY A 1 31 ? -10.349 14.230  23.064 1.00 16.14  ? 31  GLY A CA  1 
ATOM   255 C C   . GLY A 1 31 ? -8.940  13.700  22.853 1.00 16.14  ? 31  GLY A C   1 
ATOM   256 O O   . GLY A 1 31 ? -8.664  12.494  22.999 1.00 95.76  ? 31  GLY A O   1 
ATOM   257 N N   . ARG B 1 1  ? -2.449  -28.923 31.345 1.00 45.48  ? 1   ARG B N   1 
ATOM   258 C CA  . ARG B 1 1  ? -3.346  -28.257 30.406 1.00 45.48  ? 1   ARG B CA  1 
ATOM   259 C C   . ARG B 1 1  ? -4.302  -27.371 31.161 1.00 45.48  ? 1   ARG B C   1 
ATOM   260 O O   . ARG B 1 1  ? -4.434  -26.177 30.850 1.00 70.46  ? 1   ARG B O   1 
ATOM   261 C CB  . ARG B 1 1  ? -4.097  -29.186 29.423 1.00 70.46  ? 1   ARG B CB  1 
ATOM   262 C CG  . ARG B 1 1  ? -3.580  -29.086 27.970 1.00 70.46  ? 1   ARG B CG  1 
ATOM   263 C CD  . ARG B 1 1  ? -4.641  -29.207 26.856 1.00 70.46  ? 1   ARG B CD  1 
ATOM   264 N NE  . ARG B 1 1  ? -4.293  -28.514 25.594 1.00 70.46  ? 1   ARG B NE  1 
ATOM   265 C CZ  . ARG B 1 1  ? -4.970  -28.555 24.429 1.00 70.46  ? 1   ARG B CZ  1 
ATOM   266 N NH1 . ARG B 1 1  ? -6.073  -29.276 24.234 1.00 70.46  ? 1   ARG B NH1 1 
ATOM   267 N NH2 . ARG B 1 1  ? -4.526  -27.836 23.406 1.00 70.46  ? 1   ARG B NH2 1 
ATOM   268 N N   . MET B 1 2  ? -4.970  -27.979 32.156 1.00 29.18  ? 2   MET B N   1 
ATOM   269 C CA  . MET B 1 2  ? -5.934  -27.209 32.919 1.00 29.18  ? 2   MET B CA  1 
ATOM   270 C C   . MET B 1 2  ? -5.263  -26.217 33.838 1.00 29.18  ? 2   MET B C   1 
ATOM   271 O O   . MET B 1 2  ? -5.620  -25.026 33.843 1.00 62.87  ? 2   MET B O   1 
ATOM   272 C CB  . MET B 1 2  ? -6.978  -28.025 33.692 1.00 62.87  ? 2   MET B CB  1 
ATOM   273 C CG  . MET B 1 2  ? -8.231  -28.268 32.890 1.00 62.87  ? 2   MET B CG  1 
ATOM   274 S SD  . MET B 1 2  ? -8.032  -29.832 32.037 1.00 62.87  ? 2   MET B SD  1 
ATOM   275 C CE  . MET B 1 2  ? -8.116  -29.315 30.279 1.00 62.87  ? 2   MET B CE  1 
ATOM   276 N N   . LYS B 1 3  ? -4.304  -26.714 34.628 1.00 37.95  ? 3   LYS B N   1 
ATOM   277 C CA  . LYS B 1 3  ? -3.714  -25.812 35.571 1.00 37.95  ? 3   LYS B CA  1 
ATOM   278 C C   . LYS B 1 3  ? -3.403  -24.506 34.857 1.00 37.95  ? 3   LYS B C   1 
ATOM   279 O O   . LYS B 1 3  ? -3.846  -23.410 35.252 1.00 72.13  ? 3   LYS B O   1 
ATOM   280 C CB  . LYS B 1 3  ? -2.601  -26.398 36.414 1.00 72.13  ? 3   LYS B CB  1 
ATOM   281 C CG  . LYS B 1 3  ? -2.685  -25.921 37.866 1.00 53.04  ? 3   LYS B CG  1 
ATOM   282 C CD  . LYS B 1 3  ? -2.176  -26.940 38.895 1.00 53.04  ? 3   LYS B CD  1 
ATOM   283 C CE  . LYS B 1 3  ? -2.231  -26.436 40.339 1.00 53.04  ? 3   LYS B CE  1 
ATOM   284 N NZ  . LYS B 1 3  ? -3.347  -26.996 41.136 1.00 53.04  ? 3   LYS B NZ  1 
ATOM   285 N N   . GLN B 1 4  ? -2.660  -24.684 33.740 1.00 96.92  ? 4   GLN B N   1 
ATOM   286 C CA  . GLN B 1 4  ? -2.233  -23.605 32.853 1.00 96.92  ? 4   GLN B CA  1 
ATOM   287 C C   . GLN B 1 4  ? -3.394  -22.667 32.604 1.00 96.92  ? 4   GLN B C   1 
ATOM   288 O O   . GLN B 1 4  ? -3.320  -21.462 32.862 1.00 46.77  ? 4   GLN B O   1 
ATOM   289 C CB  . GLN B 1 4  ? -1.625  -24.152 31.537 1.00 46.77  ? 4   GLN B CB  1 
ATOM   290 C CG  . GLN B 1 4  ? -2.005  -23.439 30.191 1.00 46.77  ? 4   GLN B CG  1 
ATOM   291 C CD  . GLN B 1 4  ? -2.675  -24.276 29.066 1.00 46.77  ? 4   GLN B CD  1 
ATOM   292 O OE1 . GLN B 1 4  ? -3.831  -24.076 28.708 1.00 46.77  ? 4   GLN B OE1 1 
ATOM   293 N NE2 . GLN B 1 4  ? -1.979  -25.195 28.433 1.00 46.77  ? 4   GLN B NE2 1 
ATOM   294 N N   . LEU B 1 5  ? -4.500  -23.241 32.145 1.00 41.04  ? 5   LEU B N   1 
ATOM   295 C CA  . LEU B 1 5  ? -5.650  -22.421 31.887 1.00 41.04  ? 5   LEU B CA  1 
ATOM   296 C C   . LEU B 1 5  ? -6.150  -21.735 33.134 1.00 41.04  ? 5   LEU B C   1 
ATOM   297 O O   . LEU B 1 5  ? -6.769  -20.670 33.049 1.00 73.74  ? 5   LEU B O   1 
ATOM   298 C CB  . LEU B 1 5  ? -6.746  -23.044 30.996 1.00 73.74  ? 5   LEU B CB  1 
ATOM   299 C CG  . LEU B 1 5  ? -6.901  -22.271 29.671 1.00 73.74  ? 5   LEU B CG  1 
ATOM   300 C CD1 . LEU B 1 5  ? -6.654  -23.143 28.431 1.00 73.74  ? 5   LEU B CD1 1 
ATOM   301 C CD2 . LEU B 1 5  ? -8.272  -21.618 29.605 1.00 73.74  ? 5   LEU B CD2 1 
ATOM   302 N N   . GLU B 1 6  ? -5.829  -22.307 34.287 1.00 49.42  ? 6   GLU B N   1 
ATOM   303 C CA  . GLU B 1 6  ? -6.227  -21.655 35.517 1.00 49.42  ? 6   GLU B CA  1 
ATOM   304 C C   . GLU B 1 6  ? -5.111  -20.773 36.126 1.00 49.42  ? 6   GLU B C   1 
ATOM   305 O O   . GLU B 1 6  ? -5.318  -19.986 37.072 1.00 78.55  ? 6   GLU B O   1 
ATOM   306 C CB  . GLU B 1 6  ? -6.933  -22.584 36.496 1.00 78.55  ? 6   GLU B CB  1 
ATOM   307 C CG  . GLU B 1 6  ? -7.293  -23.930 35.860 1.00 78.55  ? 6   GLU B CG  1 
ATOM   308 C CD  . GLU B 1 6  ? -7.563  -24.926 36.940 1.00 78.55  ? 6   GLU B CD  1 
ATOM   309 O OE1 . GLU B 1 6  ? -7.181  -24.463 38.104 1.00 78.55  ? 6   GLU B OE1 1 
ATOM   310 O OE2 . GLU B 1 6  ? -8.096  -26.008 36.765 1.00 78.55  ? 6   GLU B OE2 1 
ATOM   311 N N   . ASP B 1 7  ? -3.907  -20.889 35.535 1.00 52.67  ? 7   ASP B N   1 
ATOM   312 C CA  . ASP B 1 7  ? -2.811  -20.016 35.903 1.00 52.67  ? 7   ASP B CA  1 
ATOM   313 C C   . ASP B 1 7  ? -3.231  -18.662 35.361 1.00 52.67  ? 7   ASP B C   1 
ATOM   314 O O   . ASP B 1 7  ? -3.587  -17.739 36.090 1.00 61.36  ? 7   ASP B O   1 
ATOM   315 C CB  . ASP B 1 7  ? -1.489  -20.473 35.241 1.00 61.36  ? 7   ASP B CB  1 
ATOM   316 C CG  . ASP B 1 7  ? -0.557  -21.143 36.222 1.00 61.36  ? 7   ASP B CG  1 
ATOM   317 O OD1 . ASP B 1 7  ? -0.910  -21.681 37.274 1.00 61.36  ? 7   ASP B OD1 1 
ATOM   318 O OD2 . ASP B 1 7  ? 0.691   -21.059 35.839 1.00 61.36  ? 7   ASP B OD2 1 
ATOM   319 N N   . LYS B 1 8  ? -3.235  -18.668 34.028 1.00 24.45  ? 8   LYS B N   1 
ATOM   320 C CA  . LYS B 1 8  ? -3.687  -17.658 33.056 1.00 24.45  ? 8   LYS B CA  1 
ATOM   321 C C   . LYS B 1 8  ? -4.870  -16.777 33.518 1.00 24.45  ? 8   LYS B C   1 
ATOM   322 O O   . LYS B 1 8  ? -4.813  -15.556 33.615 1.00 47.41  ? 8   LYS B O   1 
ATOM   323 C CB  . LYS B 1 8  ? -4.100  -18.394 31.761 1.00 47.41  ? 8   LYS B CB  1 
ATOM   324 C CG  . LYS B 1 8  ? -3.418  -17.846 30.539 1.00 47.41  ? 8   LYS B CG  1 
ATOM   325 C CD  . LYS B 1 8  ? -2.174  -17.024 30.897 1.00 47.41  ? 8   LYS B CD  1 
ATOM   326 C CE  . LYS B 1 8  ? -2.301  -15.505 30.612 1.00 47.41  ? 8   LYS B CE  1 
ATOM   327 N NZ  . LYS B 1 8  ? -1.097  -14.715 30.965 1.00 47.41  ? 8   LYS B NZ  1 
ATOM   328 N N   . VAL B 1 9  ? -5.953  -17.495 33.706 1.00 37.25  ? 9   VAL B N   1 
ATOM   329 C CA  . VAL B 1 9  ? -7.214  -17.025 34.163 1.00 37.25  ? 9   VAL B CA  1 
ATOM   330 C C   . VAL B 1 9  ? -7.091  -16.387 35.529 1.00 37.25  ? 9   VAL B C   1 
ATOM   331 O O   . VAL B 1 9  ? -7.644  -15.308 35.722 1.00 26.15  ? 9   VAL B O   1 
ATOM   332 C CB  . VAL B 1 9  ? -8.329  -18.078 34.029 1.00 26.15  ? 9   VAL B CB  1 
ATOM   333 C CG1 . VAL B 1 9  ? -9.506  -17.737 34.937 1.00 26.15  ? 9   VAL B CG1 1 
ATOM   334 C CG2 . VAL B 1 9  ? -8.794  -18.254 32.573 1.00 26.15  ? 9   VAL B CG2 1 
ATOM   335 N N   . GLU B 1 10 ? -6.320  -16.932 36.449 1.00 58.13  ? 10  GLU B N   1 
ATOM   336 C CA  . GLU B 1 10 ? -6.177  -16.232 37.732 1.00 58.13  ? 10  GLU B CA  1 
ATOM   337 C C   . GLU B 1 10 ? -5.457  -14.853 37.661 1.00 58.13  ? 10  GLU B C   1 
ATOM   338 O O   . GLU B 1 10 ? -5.947  -13.819 38.180 1.00 55.57  ? 10  GLU B O   1 
ATOM   339 C CB  . GLU B 1 10 ? -5.596  -17.091 38.856 1.00 55.57  ? 10  GLU B CB  1 
ATOM   340 C CG  . GLU B 1 10 ? -6.037  -16.478 40.184 1.00 55.57  ? 10  GLU B CG  1 
ATOM   341 C CD  . GLU B 1 10 ? -7.531  -16.562 40.374 1.00 55.57  ? 10  GLU B CD  1 
ATOM   342 O OE1 . GLU B 1 10 ? -8.275  -17.096 39.575 1.00 55.57  ? 10  GLU B OE1 1 
ATOM   343 O OE2 . GLU B 1 10 ? -7.949  -16.049 41.509 1.00 55.57  ? 10  GLU B OE2 1 
ATOM   344 N N   . GLU B 1 11 ? -4.263  -14.869 37.030 1.00 63.77  ? 11  GLU B N   1 
ATOM   345 C CA  . GLU B 1 11 ? -3.464  -13.682 36.812 1.00 63.77  ? 11  GLU B CA  1 
ATOM   346 C C   . GLU B 1 11 ? -4.401  -12.591 36.309 1.00 63.77  ? 11  GLU B C   1 
ATOM   347 O O   . GLU B 1 11 ? -4.547  -11.560 36.975 1.00 34.97  ? 11  GLU B O   1 
ATOM   348 C CB  . GLU B 1 11 ? -2.224  -13.927 35.891 1.00 34.97  ? 11  GLU B CB  1 
ATOM   349 C CG  . GLU B 1 11 ? -2.489  -13.881 34.366 1.00 34.97  ? 11  GLU B CG  1 
ATOM   350 C CD  . GLU B 1 11 ? -1.217  -13.645 33.549 1.00 34.97  ? 11  GLU B CD  1 
ATOM   351 O OE1 . GLU B 1 11 ? -0.346  -14.490 33.473 1.00 34.97  ? 11  GLU B OE1 1 
ATOM   352 O OE2 . GLU B 1 11 ? -1.090  -12.488 32.915 1.00 34.97  ? 11  GLU B OE2 1 
ATOM   353 N N   . LEU B 1 12 ? -5.056  -12.875 35.147 1.00 27.92  ? 12  LEU B N   1 
ATOM   354 C CA  . LEU B 1 12 ? -6.052  -12.038 34.475 1.00 27.92  ? 12  LEU B CA  1 
ATOM   355 C C   . LEU B 1 12 ? -7.121  -11.637 35.447 1.00 27.92  ? 12  LEU B C   1 
ATOM   356 O O   . LEU B 1 12 ? -7.839  -10.713 35.277 1.00 19.10  ? 12  LEU B O   1 
ATOM   357 C CB  . LEU B 1 12 ? -6.806  -12.781 33.368 1.00 19.10  ? 12  LEU B CB  1 
ATOM   358 C CG  . LEU B 1 12 ? -5.980  -13.211 32.174 1.00 19.10  ? 12  LEU B CG  1 
ATOM   359 C CD1 . LEU B 1 12 ? -6.852  -13.980 31.199 1.00 19.10  ? 12  LEU B CD1 1 
ATOM   360 C CD2 . LEU B 1 12 ? -5.570  -12.002 31.399 1.00 19.10  ? 12  LEU B CD2 1 
ATOM   361 N N   . LEU B 1 13 ? -7.352  -12.339 36.484 1.00 37.20  ? 13  LEU B N   1 
ATOM   362 C CA  . LEU B 1 13 ? -8.423  -11.804 37.232 1.00 37.20  ? 13  LEU B CA  1 
ATOM   363 C C   . LEU B 1 13 ? -7.856  -10.718 38.112 1.00 37.20  ? 13  LEU B C   1 
ATOM   364 O O   . LEU B 1 13 ? -8.576  -9.821  38.562 1.00 51.78  ? 13  LEU B O   1 
ATOM   365 C CB  . LEU B 1 13 ? -9.107  -12.924 37.986 1.00 51.78  ? 13  LEU B CB  1 
ATOM   366 C CG  . LEU B 1 13 ? -10.578 -12.685 38.204 1.00 51.78  ? 13  LEU B CG  1 
ATOM   367 C CD1 . LEU B 1 13 ? -11.342 -13.235 37.019 1.00 51.78  ? 13  LEU B CD1 1 
ATOM   368 C CD2 . LEU B 1 13 ? -10.997 -13.378 39.510 1.00 51.78  ? 13  LEU B CD2 1 
ATOM   369 N N   . SER B 1 14 ? -6.545  -10.747 38.343 1.00 48.52  ? 14  SER B N   1 
ATOM   370 C CA  . SER B 1 14 ? -5.940  -9.685  39.146 1.00 48.52  ? 14  SER B CA  1 
ATOM   371 C C   . SER B 1 14 ? -5.509  -8.390  38.361 1.00 48.52  ? 14  SER B C   1 
ATOM   372 O O   . SER B 1 14 ? -5.517  -7.300  38.960 1.00 51.08  ? 14  SER B O   1 
ATOM   373 C CB  . SER B 1 14 ? -4.872  -10.195 40.065 1.00 51.08  ? 14  SER B CB  1 
ATOM   374 O OG  . SER B 1 14 ? -3.660  -10.062 39.352 1.00 51.08  ? 14  SER B OG  1 
ATOM   375 N N   . LYS B 1 15 ? -5.079  -8.496  37.065 1.00 26.29  ? 15  LYS B N   1 
ATOM   376 C CA  . LYS B 1 15 ? -4.822  -7.386  36.171 1.00 26.29  ? 15  LYS B CA  1 
ATOM   377 C C   . LYS B 1 15 ? -6.184  -6.744  36.095 1.00 26.29  ? 15  LYS B C   1 
ATOM   378 O O   . LYS B 1 15 ? -6.357  -5.598  36.514 1.00 28.84  ? 15  LYS B O   1 
ATOM   379 C CB  . LYS B 1 15 ? -4.555  -7.782  34.729 1.00 28.84  ? 15  LYS B CB  1 
ATOM   380 C CG  . LYS B 1 15 ? -3.280  -8.557  34.509 1.00 28.84  ? 15  LYS B CG  1 
ATOM   381 C CD  . LYS B 1 15 ? -3.111  -9.085  33.092 1.00 28.84  ? 15  LYS B CD  1 
ATOM   382 C CE  . LYS B 1 15 ? -1.638  -9.189  32.684 1.00 28.84  ? 15  LYS B CE  1 
ATOM   383 N NZ  . LYS B 1 15 ? -1.356  -9.072  31.226 1.00 28.84  ? 15  LYS B NZ  1 
ATOM   384 N N   . ALA B 1 16 ? -7.172  -7.514  35.566 1.00 32.86  ? 16  ALA B N   1 
ATOM   385 C CA  . ALA B 1 16 ? -8.560  -7.080  35.449 1.00 32.86  ? 16  ALA B CA  1 
ATOM   386 C C   . ALA B 1 16 ? -9.081  -6.126  36.539 1.00 32.86  ? 16  ALA B C   1 
ATOM   387 O O   . ALA B 1 16 ? -9.730  -5.128  36.199 1.00 62.45  ? 16  ALA B O   1 
ATOM   388 C CB  . ALA B 1 16 ? -9.499  -8.262  35.411 1.00 62.45  ? 16  ALA B CB  1 
ATOM   389 N N   . TYR B 1 17 ? -8.900  -6.509  37.822 1.00 52.57  ? 17  TYR B N   1 
ATOM   390 C CA  . TYR B 1 17 ? -9.298  -5.792  39.039 1.00 52.57  ? 17  TYR B CA  1 
ATOM   391 C C   . TYR B 1 17 ? -8.575  -4.419  39.200 1.00 52.57  ? 17  TYR B C   1 
ATOM   392 O O   . TYR B 1 17 ? -9.180  -3.414  39.586 1.00 99.35  ? 17  TYR B O   1 
ATOM   393 C CB  . TYR B 1 17 ? -8.878  -6.726  40.191 1.00 99.35  ? 17  TYR B CB  1 
ATOM   394 C CG  . TYR B 1 17 ? -9.258  -6.388  41.623 1.00 99.35  ? 17  TYR B CG  1 
ATOM   395 C CD1 . TYR B 1 17 ? -10.575 -6.068  41.972 1.00 99.35  ? 17  TYR B CD1 1 
ATOM   396 C CD2 . TYR B 1 17 ? -8.323  -6.535  42.657 1.00 99.35  ? 17  TYR B CD2 1 
ATOM   397 C CE1 . TYR B 1 17 ? -10.951 -5.831  43.298 1.00 99.35  ? 17  TYR B CE1 1 
ATOM   398 C CE2 . TYR B 1 17 ? -8.683  -6.300  43.993 1.00 99.35  ? 17  TYR B CE2 1 
ATOM   399 C CZ  . TYR B 1 17 ? -9.999  -5.966  44.310 1.00 99.35  ? 17  TYR B CZ  1 
ATOM   400 O OH  . TYR B 1 17 ? -10.355 -5.739  45.611 1.00 99.35  ? 17  TYR B OH  1 
ATOM   401 N N   . HIS B 1 18 ? -7.242  -4.423  38.905 1.00 32.05  ? 18  HIS B N   1 
ATOM   402 C CA  . HIS B 1 18 ? -6.340  -3.278  39.000 1.00 32.05  ? 18  HIS B CA  1 
ATOM   403 C C   . HIS B 1 18 ? -6.736  -2.229  38.022 1.00 32.05  ? 18  HIS B C   1 
ATOM   404 O O   . HIS B 1 18 ? -6.660  -1.053  38.329 1.00 38.19  ? 18  HIS B O   1 
ATOM   405 C CB  . HIS B 1 18 ? -4.818  -3.594  39.000 1.00 38.19  ? 18  HIS B CB  1 
ATOM   406 C CG  . HIS B 1 18 ? -3.930  -2.479  38.467 1.00 38.19  ? 18  HIS B CG  1 
ATOM   407 N ND1 . HIS B 1 18 ? -3.062  -2.661  37.365 1.00 38.19  ? 18  HIS B ND1 1 
ATOM   408 C CD2 . HIS B 1 18 ? -3.753  -1.199  38.889 1.00 38.19  ? 18  HIS B CD2 1 
ATOM   409 C CE1 . HIS B 1 18 ? -2.463  -1.500  37.111 1.00 38.19  ? 18  HIS B CE1 1 
ATOM   410 N NE2 . HIS B 1 18 ? -2.832  -0.601  38.011 1.00 38.19  ? 18  HIS B NE2 1 
ATOM   411 N N   . LEU B 1 19 ? -7.238  -2.698  36.879 1.00 29.64  ? 19  LEU B N   1 
ATOM   412 C CA  . LEU B 1 19 ? -7.724  -1.842  35.816 1.00 29.64  ? 19  LEU B CA  1 
ATOM   413 C C   . LEU B 1 19 ? -9.091  -1.266  36.149 1.00 29.64  ? 19  LEU B C   1 
ATOM   414 O O   . LEU B 1 19 ? -9.419  -0.142  35.774 1.00 21.23  ? 19  LEU B O   1 
ATOM   415 C CB  . LEU B 1 19 ? -7.825  -2.598  34.506 1.00 21.23  ? 19  LEU B CB  1 
ATOM   416 C CG  . LEU B 1 19 ? -6.514  -2.852  33.801 1.00 21.23  ? 19  LEU B CG  1 
ATOM   417 C CD1 . LEU B 1 19 ? -6.845  -3.495  32.465 1.00 21.23  ? 19  LEU B CD1 1 
ATOM   418 C CD2 . LEU B 1 19 ? -5.886  -1.522  33.458 1.00 21.23  ? 19  LEU B CD2 1 
ATOM   419 N N   . GLU B 1 20 ? -9.908  -2.032  36.840 1.00 21.09  ? 20  GLU B N   1 
ATOM   420 C CA  . GLU B 1 20 ? -11.205 -1.482  37.166 1.00 21.09  ? 20  GLU B CA  1 
ATOM   421 C C   . GLU B 1 20 ? -11.029 -0.252  38.087 1.00 21.09  ? 20  GLU B C   1 
ATOM   422 O O   . GLU B 1 20 ? -11.634 0.824   37.897 1.00 53.04  ? 20  GLU B O   1 
ATOM   423 C CB  . GLU B 1 20 ? -12.198 -2.526  37.741 1.00 53.04  ? 20  GLU B CB  1 
ATOM   424 C CG  . GLU B 1 20 ? -12.926 -3.434  36.704 1.00 53.04  ? 20  GLU B CG  1 
ATOM   425 C CD  . GLU B 1 20 ? -14.055 -4.287  37.275 1.00 53.04  ? 20  GLU B CD  1 
ATOM   426 O OE1 . GLU B 1 20 ? -13.865 -4.699  38.515 1.00 53.04  ? 20  GLU B OE1 1 
ATOM   427 O OE2 . GLU B 1 20 ? -15.060 -4.552  36.634 1.00 53.04  ? 20  GLU B OE2 1 
ATOM   428 N N   . ASN B 1 21 ? -10.167 -0.396  39.111 1.00 43.75  ? 21  ASN B N   1 
ATOM   429 C CA  . ASN B 1 21 ? -9.911  0.719   39.991 1.00 43.75  ? 21  ASN B CA  1 
ATOM   430 C C   . ASN B 1 21 ? -9.505  1.893   39.083 1.00 43.75  ? 21  ASN B C   1 
ATOM   431 O O   . ASN B 1 21 ? -10.344 2.755   38.828 1.00 52.77  ? 21  ASN B O   1 
ATOM   432 C CB  . ASN B 1 21 ? -8.923  0.321   41.096 1.00 52.77  ? 21  ASN B CB  1 
ATOM   433 C CG  . ASN B 1 21 ? -9.563  -0.436  42.283 1.00 52.77  ? 21  ASN B CG  1 
ATOM   434 O OD1 . ASN B 1 21 ? -9.446  -1.686  42.411 1.00 52.77  ? 21  ASN B OD1 1 
ATOM   435 N ND2 . ASN B 1 21 ? -10.199 0.321   43.214 1.00 52.77  ? 21  ASN B ND2 1 
ATOM   436 N N   . GLU B 1 22 ? -8.292  1.808   38.471 1.00 30.49  ? 22  GLU B N   1 
ATOM   437 C CA  . GLU B 1 22 ? -7.699  2.708   37.439 1.00 30.49  ? 22  GLU B CA  1 
ATOM   438 C C   . GLU B 1 22 ? -8.674  3.549   36.647 1.00 30.49  ? 22  GLU B C   1 
ATOM   439 O O   . GLU B 1 22 ? -8.391  4.722   36.435 1.00 33.95  ? 22  GLU B O   1 
ATOM   440 C CB  . GLU B 1 22 ? -6.894  1.937   36.363 1.00 33.95  ? 22  GLU B CB  1 
ATOM   441 C CG  . GLU B 1 22 ? -5.364  2.020   36.480 1.00 33.95  ? 22  GLU B CG  1 
ATOM   442 C CD  . GLU B 1 22 ? -4.986  2.459   37.848 1.00 33.95  ? 22  GLU B CD  1 
ATOM   443 O OE1 . GLU B 1 22 ? -5.275  1.617   38.754 1.00 33.95  ? 22  GLU B OE1 1 
ATOM   444 O OE2 . GLU B 1 22 ? -4.542  3.536   38.120 1.00 33.95  ? 22  GLU B OE2 1 
ATOM   445 N N   . VAL B 1 23 ? -9.762  2.937   36.180 1.00 29.30  ? 23  VAL B N   1 
ATOM   446 C CA  . VAL B 1 23 ? -10.822 3.597   35.374 1.00 29.30  ? 23  VAL B CA  1 
ATOM   447 C C   . VAL B 1 23 ? -11.884 4.475   36.166 1.00 29.30  ? 23  VAL B C   1 
ATOM   448 O O   . VAL B 1 23 ? -12.757 5.190   35.621 1.00 26.14  ? 23  VAL B O   1 
ATOM   449 C CB  . VAL B 1 23 ? -11.455 2.559   34.450 1.00 26.14  ? 23  VAL B CB  1 
ATOM   450 C CG1 . VAL B 1 23 ? -12.865 2.890   34.033 1.00 26.14  ? 23  VAL B CG1 1 
ATOM   451 C CG2 . VAL B 1 23 ? -10.583 2.298   33.223 1.00 26.14  ? 23  VAL B CG2 1 
ATOM   452 N N   . ALA B 1 24 ? -11.783 4.402   37.496 1.00 50.10  ? 24  ALA B N   1 
ATOM   453 C CA  . ALA B 1 24 ? -12.599 5.123   38.432 1.00 50.10  ? 24  ALA B CA  1 
ATOM   454 C C   . ALA B 1 24 ? -11.830 6.352   38.898 1.00 50.10  ? 24  ALA B C   1 
ATOM   455 O O   . ALA B 1 24 ? -12.345 7.465   38.901 1.00 68.73  ? 24  ALA B O   1 
ATOM   456 C CB  . ALA B 1 24 ? -12.864 4.204   39.607 1.00 68.73  ? 24  ALA B CB  1 
ATOM   457 N N   . ARG B 1 25 ? -10.568 6.128   39.302 1.00 37.18  ? 25  ARG B N   1 
ATOM   458 C CA  . ARG B 1 25 ? -9.685  7.194   39.675 1.00 37.18  ? 25  ARG B CA  1 
ATOM   459 C C   . ARG B 1 25 ? -9.689  8.087   38.424 1.00 37.18  ? 25  ARG B C   1 
ATOM   460 O O   . ARG B 1 25 ? -9.806  9.312   38.506 1.00 60.28  ? 25  ARG B O   1 
ATOM   461 C CB  . ARG B 1 25 ? -8.293  6.665   40.085 1.00 60.28  ? 25  ARG B CB  1 
ATOM   462 C CG  . ARG B 1 25 ? -7.169  7.718   40.248 1.00 60.28  ? 25  ARG B CG  1 
ATOM   463 C CD  . ARG B 1 25 ? -6.586  7.931   41.686 1.00 60.28  ? 25  ARG B CD  1 
ATOM   464 N NE  . ARG B 1 25 ? -5.265  8.646   41.745 1.00 60.28  ? 25  ARG B NE  1 
ATOM   465 C CZ  . ARG B 1 25 ? -4.311  8.677   42.737 1.00 60.28  ? 25  ARG B CZ  1 
ATOM   466 N NH1 . ARG B 1 25 ? -4.386  8.074   43.937 1.00 60.28  ? 25  ARG B NH1 1 
ATOM   467 N NH2 . ARG B 1 25 ? -3.213  9.384   42.495 1.00 60.28  ? 25  ARG B NH2 1 
ATOM   468 N N   . LEU B 1 26 ? -9.623  7.460   37.227 1.00 35.92  ? 26  LEU B N   1 
ATOM   469 C CA  . LEU B 1 26 ? -9.593  8.269   36.032 1.00 35.92  ? 26  LEU B CA  1 
ATOM   470 C C   . LEU B 1 26 ? -10.865 9.069   35.928 1.00 35.92  ? 26  LEU B C   1 
ATOM   471 O O   . LEU B 1 26 ? -10.780 10.269  35.668 1.00 40.01  ? 26  LEU B O   1 
ATOM   472 C CB  . LEU B 1 26 ? -9.400  7.518   34.692 1.00 40.01  ? 26  LEU B CB  1 
ATOM   473 C CG  . LEU B 1 26 ? -8.011  7.020   34.263 1.00 40.01  ? 26  LEU B CG  1 
ATOM   474 C CD1 . LEU B 1 26 ? -7.814  7.089   32.730 1.00 40.01  ? 26  LEU B CD1 1 
ATOM   475 C CD2 . LEU B 1 26 ? -6.836  7.608   35.031 1.00 40.01  ? 26  LEU B CD2 1 
ATOM   476 N N   . LYS B 1 27 ? -12.001 8.347   36.106 1.00 30.17  ? 27  LYS B N   1 
ATOM   477 C CA  . LYS B 1 27 ? -13.378 8.805   36.003 1.00 30.17  ? 27  LYS B CA  1 
ATOM   478 C C   . LYS B 1 27 ? -13.691 10.036  36.828 1.00 30.17  ? 27  LYS B C   1 
ATOM   479 O O   . LYS B 1 27 ? -14.506 10.846  36.408 1.00 43.82  ? 27  LYS B O   1 
ATOM   480 C CB  . LYS B 1 27 ? -14.339 7.708   36.349 1.00 43.82  ? 27  LYS B CB  1 
ATOM   481 C CG  . LYS B 1 27 ? -15.003 7.058   35.156 1.00 43.82  ? 27  LYS B CG  1 
ATOM   482 C CD  . LYS B 1 27 ? -16.019 5.988   35.603 1.00 43.82  ? 27  LYS B CD  1 
ATOM   483 C CE  . LYS B 1 27 ? -15.421 4.800   36.387 1.00 43.82  ? 27  LYS B CE  1 
ATOM   484 N NZ  . LYS B 1 27 ? -16.368 3.688   36.596 1.00 43.82  ? 27  LYS B NZ  1 
ATOM   485 N N   . LYS B 1 28 ? -12.970 10.157  37.945 1.00 40.90  ? 28  LYS B N   1 
ATOM   486 C CA  . LYS B 1 28 ? -13.036 11.242  38.892 1.00 40.90  ? 28  LYS B CA  1 
ATOM   487 C C   . LYS B 1 28 ? -12.172 12.454  38.529 1.00 40.90  ? 28  LYS B C   1 
ATOM   488 O O   . LYS B 1 28 ? -12.656 13.610  38.547 1.00 71.76  ? 28  LYS B O   1 
ATOM   489 C CB  . LYS B 1 28 ? -12.853 10.791  40.318 1.00 71.76  ? 28  LYS B CB  1 
ATOM   490 C CG  . LYS B 1 28 ? -11.533 10.116  40.546 1.00 71.76  ? 28  LYS B CG  1 
ATOM   491 C CD  . LYS B 1 28 ? -11.618 9.219   41.749 1.00 71.76  ? 28  LYS B CD  1 
ATOM   492 C CE  . LYS B 1 28 ? -11.487 10.007  43.039 1.00 71.76  ? 28  LYS B CE  1 
ATOM   493 N NZ  . LYS B 1 28 ? -12.747 10.126  43.792 1.00 71.76  ? 28  LYS B NZ  1 
ATOM   494 N N   . LEU B 1 29 ? -10.915 12.189  38.129 1.00 82.43  ? 29  LEU B N   1 
ATOM   495 C CA  . LEU B 1 29 ? -9.982  13.215  37.657 1.00 82.43  ? 29  LEU B CA  1 
ATOM   496 C C   . LEU B 1 29 ? -10.400 13.767  36.285 1.00 82.43  ? 29  LEU B C   1 
ATOM   497 O O   . LEU B 1 29 ? -9.568  14.239  35.508 1.00 44.44  ? 29  LEU B O   1 
ATOM   498 C CB  . LEU B 1 29 ? -8.546  12.680  37.584 1.00 44.44  ? 29  LEU B CB  1 
ATOM   499 C CG  . LEU B 1 29 ? -8.101  11.968  38.855 1.00 44.44  ? 29  LEU B CG  1 
ATOM   500 C CD1 . LEU B 1 29 ? -6.582  12.074  38.988 1.00 44.44  ? 29  LEU B CD1 1 
ATOM   501 C CD2 . LEU B 1 29 ? -8.782  12.541  40.101 1.00 44.44  ? 29  LEU B CD2 1 
ATOM   502 N N   . VAL B 1 30 ? -11.716 13.647  36.027 1.00 47.50  ? 30  VAL B N   1 
ATOM   503 C CA  . VAL B 1 30 ? -12.484 14.098  34.860 1.00 47.50  ? 30  VAL B CA  1 
ATOM   504 C C   . VAL B 1 30 ? -13.966 14.143  35.262 1.00 47.50  ? 30  VAL B C   1 
ATOM   505 O O   . VAL B 1 30 ? -14.819 14.753  34.610 1.00 53.40  ? 30  VAL B O   1 
ATOM   506 C CB  . VAL B 1 30 ? -12.305 13.233  33.629 1.00 53.40  ? 30  VAL B CB  1 
ATOM   507 C CG1 . VAL B 1 30 ? -12.891 13.993  32.439 1.00 53.40  ? 30  VAL B CG1 1 
ATOM   508 C CG2 . VAL B 1 30 ? -10.826 12.938  33.392 1.00 53.40  ? 30  VAL B CG2 1 
ATOM   509 N N   . ARG C 1 1  ? -11.961 -27.254 21.836 1.00 54.20  ? 1   ARG C N   1 
ATOM   510 C CA  . ARG C 1 1  ? -12.424 -27.316 23.232 1.00 54.20  ? 1   ARG C CA  1 
ATOM   511 C C   . ARG C 1 1  ? -11.630 -26.356 24.113 1.00 54.20  ? 1   ARG C C   1 
ATOM   512 O O   . ARG C 1 1  ? -12.127 -25.322 24.621 1.00 60.35  ? 1   ARG C O   1 
ATOM   513 C CB  . ARG C 1 1  ? -12.311 -28.737 23.795 1.00 60.35  ? 1   ARG C CB  1 
ATOM   514 N N   . MET C 1 2  ? -10.349 -26.748 24.237 1.00 100.00 ? 2   MET C N   1 
ATOM   515 C CA  . MET C 1 2  ? -9.298  -26.071 24.982 1.00 100.00 ? 2   MET C CA  1 
ATOM   516 C C   . MET C 1 2  ? -8.375  -25.271 24.056 1.00 100.00 ? 2   MET C C   1 
ATOM   517 O O   . MET C 1 2  ? -7.746  -24.283 24.440 1.00 89.57  ? 2   MET C O   1 
ATOM   518 C CB  . MET C 1 2  ? -8.583  -27.086 25.876 1.00 89.57  ? 2   MET C CB  1 
ATOM   519 C CG  . MET C 1 2  ? -9.610  -27.943 26.598 1.00 89.57  ? 2   MET C CG  1 
ATOM   520 S SD  . MET C 1 2  ? -11.101 -27.014 27.086 1.00 89.57  ? 2   MET C SD  1 
ATOM   521 C CE  . MET C 1 2  ? -11.420 -27.792 28.681 1.00 89.57  ? 2   MET C CE  1 
ATOM   522 N N   . LYS C 1 3  ? -8.335  -25.686 22.799 1.00 76.63  ? 3   LYS C N   1 
ATOM   523 C CA  . LYS C 1 3  ? -7.626  -24.928 21.806 1.00 76.63  ? 3   LYS C CA  1 
ATOM   524 C C   . LYS C 1 3  ? -8.564  -23.770 21.496 1.00 76.63  ? 3   LYS C C   1 
ATOM   525 O O   . LYS C 1 3  ? -8.228  -22.782 20.814 1.00 30.98  ? 3   LYS C O   1 
ATOM   526 C CB  . LYS C 1 3  ? -7.403  -25.717 20.532 1.00 30.98  ? 3   LYS C CB  1 
ATOM   527 C CG  . LYS C 1 3  ? -6.075  -25.405 19.866 1.00 30.98  ? 3   LYS C CG  1 
ATOM   528 C CD  . LYS C 1 3  ? -6.181  -25.310 18.348 1.00 30.98  ? 3   LYS C CD  1 
ATOM   529 C CE  . LYS C 1 3  ? -4.785  -25.435 17.697 1.00 30.98  ? 3   LYS C CE  1 
ATOM   530 N NZ  . LYS C 1 3  ? -4.702  -26.221 16.432 1.00 30.98  ? 3   LYS C NZ  1 
ATOM   531 N N   . GLN C 1 4  ? -9.783  -23.954 22.015 1.00 100.00 ? 4   GLN C N   1 
ATOM   532 C CA  . GLN C 1 4  ? -10.876 -23.010 21.887 1.00 100.00 ? 4   GLN C CA  1 
ATOM   533 C C   . GLN C 1 4  ? -10.881 -22.052 23.065 1.00 100.00 ? 4   GLN C C   1 
ATOM   534 O O   . GLN C 1 4  ? -11.203 -20.847 22.882 1.00 61.69  ? 4   GLN C O   1 
ATOM   535 C CB  . GLN C 1 4  ? -12.222 -23.721 21.701 1.00 61.69  ? 4   GLN C CB  1 
ATOM   536 C CG  . GLN C 1 4  ? -12.508 -24.247 20.248 1.00 61.69  ? 4   GLN C CG  1 
ATOM   537 C CD  . GLN C 1 4  ? -11.416 -24.017 19.185 1.00 61.69  ? 4   GLN C CD  1 
ATOM   538 O OE1 . GLN C 1 4  ? -10.808 -22.921 19.093 1.00 61.69  ? 4   GLN C OE1 1 
ATOM   539 N NE2 . GLN C 1 4  ? -11.200 -25.051 18.340 1.00 61.69  ? 4   GLN C NE2 1 
ATOM   540 N N   . LEU C 1 5  ? -10.450 -22.646 24.219 1.00 47.97  ? 5   LEU C N   1 
ATOM   541 C CA  . LEU C 1 5  ? -10.226 -22.022 25.555 1.00 47.97  ? 5   LEU C CA  1 
ATOM   542 C C   . LEU C 1 5  ? -8.849  -21.358 25.778 1.00 47.97  ? 5   LEU C C   1 
ATOM   543 O O   . LEU C 1 5  ? -8.736  -20.376 26.521 1.00 38.87  ? 5   LEU C O   1 
ATOM   544 C CB  . LEU C 1 5  ? -10.547 -22.933 26.753 1.00 38.87  ? 5   LEU C CB  1 
ATOM   545 C CG  . LEU C 1 5  ? -11.492 -22.288 27.754 1.00 38.87  ? 5   LEU C CG  1 
ATOM   546 C CD1 . LEU C 1 5  ? -12.923 -22.648 27.335 1.00 38.87  ? 5   LEU C CD1 1 
ATOM   547 C CD2 . LEU C 1 5  ? -11.159 -22.803 29.171 1.00 38.87  ? 5   LEU C CD2 1 
ATOM   548 N N   . GLU C 1 6  ? -7.805  -21.905 25.171 1.00 100.00 ? 6   GLU C N   1 
ATOM   549 C CA  . GLU C 1 6  ? -6.484  -21.283 25.247 1.00 100.00 ? 6   GLU C CA  1 
ATOM   550 C C   . GLU C 1 6  ? -6.532  -20.174 24.181 1.00 100.00 ? 6   GLU C C   1 
ATOM   551 O O   . GLU C 1 6  ? -5.585  -19.403 23.954 1.00 69.40  ? 6   GLU C O   1 
ATOM   552 C CB  . GLU C 1 6  ? -5.284  -22.266 25.025 1.00 69.40  ? 6   GLU C CB  1 
ATOM   553 C CG  . GLU C 1 6  ? -4.575  -22.870 26.281 1.00 69.40  ? 6   GLU C CG  1 
ATOM   554 C CD  . GLU C 1 6  ? -3.942  -24.204 25.970 1.00 69.40  ? 6   GLU C CD  1 
ATOM   555 O OE1 . GLU C 1 6  ? -4.567  -25.149 25.594 1.00 69.40  ? 6   GLU C OE1 1 
ATOM   556 O OE2 . GLU C 1 6  ? -2.681  -24.299 26.269 1.00 69.40  ? 6   GLU C OE2 1 
ATOM   557 N N   . ASP C 1 7  ? -7.710  -20.173 23.525 1.00 97.35  ? 7   ASP C N   1 
ATOM   558 C CA  . ASP C 1 7  ? -8.127  -19.223 22.510 1.00 97.35  ? 7   ASP C CA  1 
ATOM   559 C C   . ASP C 1 7  ? -8.968  -18.192 23.191 1.00 97.35  ? 7   ASP C C   1 
ATOM   560 O O   . ASP C 1 7  ? -8.941  -17.006 22.866 1.00 50.50  ? 7   ASP C O   1 
ATOM   561 C CB  . ASP C 1 7  ? -8.890  -19.833 21.330 1.00 50.50  ? 7   ASP C CB  1 
ATOM   562 C CG  . ASP C 1 7  ? -7.911  -20.083 20.234 1.00 50.50  ? 7   ASP C CG  1 
ATOM   563 O OD1 . ASP C 1 7  ? -6.744  -20.438 20.490 1.00 50.50  ? 7   ASP C OD1 1 
ATOM   564 O OD2 . ASP C 1 7  ? -8.427  -19.914 19.023 1.00 50.50  ? 7   ASP C OD2 1 
ATOM   565 N N   . LYS C 1 8  ? -9.703  -18.656 24.184 1.00 39.69  ? 8   LYS C N   1 
ATOM   566 C CA  . LYS C 1 8  ? -10.424 -17.658 24.912 1.00 39.69  ? 8   LYS C CA  1 
ATOM   567 C C   . LYS C 1 8  ? -9.354  -16.908 25.662 1.00 39.69  ? 8   LYS C C   1 
ATOM   568 O O   . LYS C 1 8  ? -9.047  -15.761 25.361 1.00 45.16  ? 8   LYS C O   1 
ATOM   569 C CB  . LYS C 1 8  ? -11.525 -18.159 25.802 1.00 45.16  ? 8   LYS C CB  1 
ATOM   570 C CG  . LYS C 1 8  ? -12.852 -17.516 25.442 1.00 45.16  ? 8   LYS C CG  1 
ATOM   571 C CD  . LYS C 1 8  ? -12.860 -16.794 24.100 1.00 45.16  ? 8   LYS C CD  1 
ATOM   572 C CE  . LYS C 1 8  ? -13.948 -17.293 23.170 1.00 45.16  ? 8   LYS C CE  1 
ATOM   573 N NZ  . LYS C 1 8  ? -13.513 -17.372 21.769 1.00 45.16  ? 8   LYS C NZ  1 
ATOM   574 N N   . VAL C 1 9  ? -8.679  -17.594 26.560 1.00 31.03  ? 9   VAL C N   1 
ATOM   575 C CA  . VAL C 1 9  ? -7.587  -16.880 27.185 1.00 31.03  ? 9   VAL C CA  1 
ATOM   576 C C   . VAL C 1 9  ? -6.664  -16.133 26.174 1.00 31.03  ? 9   VAL C C   1 
ATOM   577 O O   . VAL C 1 9  ? -5.952  -15.225 26.573 1.00 41.00  ? 9   VAL C O   1 
ATOM   578 C CB  . VAL C 1 9  ? -6.869  -17.776 28.158 1.00 41.00  ? 9   VAL C CB  1 
ATOM   579 C CG1 . VAL C 1 9  ? -5.853  -17.016 29.009 1.00 41.00  ? 9   VAL C CG1 1 
ATOM   580 C CG2 . VAL C 1 9  ? -7.958  -18.419 29.011 1.00 41.00  ? 9   VAL C CG2 1 
ATOM   581 N N   . GLU C 1 10 ? -6.704  -16.494 24.869 1.00 32.35  ? 10  GLU C N   1 
ATOM   582 C CA  . GLU C 1 10 ? -5.940  -15.874 23.788 1.00 32.35  ? 10  GLU C CA  1 
ATOM   583 C C   . GLU C 1 10 ? -6.364  -14.424 23.417 1.00 32.35  ? 10  GLU C C   1 
ATOM   584 O O   . GLU C 1 10 ? -5.473  -13.571 23.133 1.00 43.53  ? 10  GLU C O   1 
ATOM   585 C CB  . GLU C 1 10 ? -6.064  -16.744 22.530 1.00 43.53  ? 10  GLU C CB  1 
ATOM   586 C CG  . GLU C 1 10 ? -5.742  -16.017 21.226 1.00 43.53  ? 10  GLU C CG  1 
ATOM   587 C CD  . GLU C 1 10 ? -6.575  -16.484 20.053 1.00 43.53  ? 10  GLU C CD  1 
ATOM   588 O OE1 . GLU C 1 10 ? -7.797  -16.653 20.074 1.00 43.53  ? 10  GLU C OE1 1 
ATOM   589 O OE2 . GLU C 1 10 ? -5.848  -16.642 18.965 1.00 43.53  ? 10  GLU C OE2 1 
ATOM   590 N N   . GLU C 1 11 ? -7.721  -14.208 23.356 1.00 18.66  ? 11  GLU C N   1 
ATOM   591 C CA  . GLU C 1 11 ? -8.481  -13.000 23.073 1.00 18.66  ? 11  GLU C CA  1 
ATOM   592 C C   . GLU C 1 11 ? -8.347  -12.034 24.252 1.00 18.66  ? 11  GLU C C   1 
ATOM   593 O O   . GLU C 1 11 ? -8.110  -10.859 24.024 1.00 69.19  ? 11  GLU C O   1 
ATOM   594 C CB  . GLU C 1 11 ? -9.967  -13.345 22.984 1.00 69.19  ? 11  GLU C CB  1 
ATOM   595 C CG  . GLU C 1 11 ? -10.510 -13.463 21.571 1.00 69.19  ? 11  GLU C CG  1 
ATOM   596 C CD  . GLU C 1 11 ? -11.061 -14.833 21.320 1.00 69.19  ? 11  GLU C CD  1 
ATOM   597 O OE1 . GLU C 1 11 ? -11.177 -15.669 22.198 1.00 69.19  ? 11  GLU C OE1 1 
ATOM   598 O OE2 . GLU C 1 11 ? -11.363 -15.044 20.058 1.00 69.19  ? 11  GLU C OE2 1 
ATOM   599 N N   . LEU C 1 12 ? -8.538  -12.557 25.524 1.00 22.62  ? 12  LEU C N   1 
ATOM   600 C CA  . LEU C 1 12 ? -8.445  -11.769 26.790 1.00 22.62  ? 12  LEU C CA  1 
ATOM   601 C C   . LEU C 1 12 ? -7.065  -11.198 27.115 1.00 22.62  ? 12  LEU C C   1 
ATOM   602 O O   . LEU C 1 12 ? -6.927  -10.381 27.972 1.00 21.94  ? 12  LEU C O   1 
ATOM   603 C CB  . LEU C 1 12 ? -8.899  -12.519 28.076 1.00 21.94  ? 12  LEU C CB  1 
ATOM   604 C CG  . LEU C 1 12 ? -10.317 -13.069 28.017 1.00 21.94  ? 12  LEU C CG  1 
ATOM   605 C CD1 . LEU C 1 12 ? -10.850 -13.535 29.369 1.00 21.94  ? 12  LEU C CD1 1 
ATOM   606 C CD2 . LEU C 1 12 ? -11.179 -11.972 27.390 1.00 21.94  ? 12  LEU C CD2 1 
ATOM   607 N N   . LEU C 1 13 ? -6.051  -11.761 26.524 1.00 33.04  ? 13  LEU C N   1 
ATOM   608 C CA  . LEU C 1 13 ? -4.671  -11.391 26.730 1.00 33.04  ? 13  LEU C CA  1 
ATOM   609 C C   . LEU C 1 13 ? -4.381  -10.186 25.848 1.00 33.04  ? 13  LEU C C   1 
ATOM   610 O O   . LEU C 1 13 ? -3.893  -9.123  26.279 1.00 33.77  ? 13  LEU C O   1 
ATOM   611 C CB  . LEU C 1 13 ? -3.744  -12.600 26.444 1.00 33.77  ? 13  LEU C CB  1 
ATOM   612 C CG  . LEU C 1 13 ? -3.602  -13.430 27.704 1.00 33.77  ? 13  LEU C CG  1 
ATOM   613 C CD1 . LEU C 1 13 ? -2.218  -14.055 27.937 1.00 33.77  ? 13  LEU C CD1 1 
ATOM   614 C CD2 . LEU C 1 13 ? -3.981  -12.510 28.859 1.00 33.77  ? 13  LEU C CD2 1 
ATOM   615 N N   . SER C 1 14 ? -4.749  -10.387 24.591 1.00 11.34  ? 14  SER C N   1 
ATOM   616 C CA  . SER C 1 14 ? -4.606  -9.392  23.605 1.00 11.34  ? 14  SER C CA  1 
ATOM   617 C C   . SER C 1 14 ? -5.291  -8.166  24.120 1.00 11.34  ? 14  SER C C   1 
ATOM   618 O O   . SER C 1 14 ? -4.671  -7.104  24.125 1.00 35.57  ? 14  SER C O   1 
ATOM   619 C CB  . SER C 1 14 ? -5.107  -9.801  22.234 1.00 35.57  ? 14  SER C CB  1 
ATOM   620 O OG  . SER C 1 14 ? -5.269  -8.687  21.364 1.00 35.57  ? 14  SER C OG  1 
ATOM   621 N N   . LYS C 1 15 ? -6.456  -8.350  24.727 1.00 17.40  ? 15  LYS C N   1 
ATOM   622 C CA  . LYS C 1 15 ? -7.275  -7.223  25.183 1.00 17.40  ? 15  LYS C CA  1 
ATOM   623 C C   . LYS C 1 15 ? -6.746  -6.477  26.382 1.00 17.40  ? 15  LYS C C   1 
ATOM   624 O O   . LYS C 1 15 ? -6.927  -5.285  26.427 1.00 43.81  ? 15  LYS C O   1 
ATOM   625 C CB  . LYS C 1 15 ? -8.748  -7.522  25.457 1.00 43.81  ? 15  LYS C CB  1 
ATOM   626 C CG  . LYS C 1 15 ? -9.602  -8.150  24.385 1.00 43.81  ? 15  LYS C CG  1 
ATOM   627 C CD  . LYS C 1 15 ? -10.896 -8.609  25.035 1.00 43.81  ? 15  LYS C CD  1 
ATOM   628 C CE  . LYS C 1 15 ? -11.950 -9.073  24.058 1.00 43.81  ? 15  LYS C CE  1 
ATOM   629 N NZ  . LYS C 1 15 ? -12.670 -7.943  23.453 1.00 43.81  ? 15  LYS C NZ  1 
ATOM   630 N N   . ALA C 1 16 ? -6.228  -7.179  27.384 1.00 20.70  ? 16  ALA C N   1 
ATOM   631 C CA  . ALA C 1 16 ? -5.730  -6.548  28.570 1.00 20.70  ? 16  ALA C CA  1 
ATOM   632 C C   . ALA C 1 16 ? -4.413  -5.837  28.218 1.00 20.70  ? 16  ALA C C   1 
ATOM   633 O O   . ALA C 1 16 ? -4.070  -4.785  28.756 1.00 27.30  ? 16  ALA C O   1 
ATOM   634 C CB  . ALA C 1 16 ? -5.508  -7.596  29.637 1.00 27.30  ? 16  ALA C CB  1 
ATOM   635 N N   . TYR C 1 17 ? -3.653  -6.382  27.271 1.00 38.57  ? 17  TYR C N   1 
ATOM   636 C CA  . TYR C 1 17 ? -2.492  -5.638  26.884 1.00 38.57  ? 17  TYR C CA  1 
ATOM   637 C C   . TYR C 1 17 ? -2.898  -4.244  26.289 1.00 38.57  ? 17  TYR C C   1 
ATOM   638 O O   . TYR C 1 17 ? -2.350  -3.240  26.700 1.00 21.00  ? 17  TYR C O   1 
ATOM   639 C CB  . TYR C 1 17 ? -1.614  -6.512  25.977 1.00 21.00  ? 17  TYR C CB  1 
ATOM   640 C CG  . TYR C 1 17 ? -0.622  -5.793  25.057 1.00 21.00  ? 17  TYR C CG  1 
ATOM   641 C CD1 . TYR C 1 17 ? 0.611   -5.352  25.543 1.00 21.00  ? 17  TYR C CD1 1 
ATOM   642 C CD2 . TYR C 1 17 ? -0.898  -5.688  23.686 1.00 21.00  ? 17  TYR C CD2 1 
ATOM   643 C CE1 . TYR C 1 17 ? 1.509   -4.698  24.699 1.00 21.00  ? 17  TYR C CE1 1 
ATOM   644 C CE2 . TYR C 1 17 ? -0.043  -5.042  22.800 1.00 21.00  ? 17  TYR C CE2 1 
ATOM   645 C CZ  . TYR C 1 17 ? 1.155   -4.563  23.348 1.00 21.00  ? 17  TYR C CZ  1 
ATOM   646 O OH  . TYR C 1 17 ? 2.028   -3.913  22.518 1.00 21.00  ? 17  TYR C OH  1 
ATOM   647 N N   . HIS C 1 18 ? -3.867  -4.147  25.324 1.00 19.35  ? 18  HIS C N   1 
ATOM   648 C CA  . HIS C 1 18 ? -4.299  -2.899  24.744 1.00 19.35  ? 18  HIS C CA  1 
ATOM   649 C C   . HIS C 1 18 ? -4.926  -2.026  25.827 1.00 19.35  ? 18  HIS C C   1 
ATOM   650 O O   . HIS C 1 18 ? -4.825  -0.810  25.817 1.00 67.08  ? 18  HIS C O   1 
ATOM   651 C CB  . HIS C 1 18 ? -5.297  -3.041  23.580 1.00 67.08  ? 18  HIS C CB  1 
ATOM   652 C CG  . HIS C 1 18 ? -4.790  -3.810  22.380 1.00 67.08  ? 18  HIS C CG  1 
ATOM   653 N ND1 . HIS C 1 18 ? -4.486  -3.204  21.172 1.00 67.08  ? 18  HIS C ND1 1 
ATOM   654 C CD2 . HIS C 1 18 ? -4.631  -5.156  22.192 1.00 67.08  ? 18  HIS C CD2 1 
ATOM   655 C CE1 . HIS C 1 18 ? -4.077  -4.179  20.350 1.00 67.08  ? 18  HIS C CE1 1 
ATOM   656 N NE2 . HIS C 1 18 ? -4.174  -5.374  20.922 1.00 67.08  ? 18  HIS C NE2 1 
ATOM   657 N N   . LEU C 1 19 ? -5.545  -2.639  26.815 1.00 17.59  ? 19  LEU C N   1 
ATOM   658 C CA  . LEU C 1 19 ? -6.223  -1.931  27.857 1.00 17.59  ? 19  LEU C CA  1 
ATOM   659 C C   . LEU C 1 19 ? -5.241  -1.400  28.844 1.00 17.59  ? 19  LEU C C   1 
ATOM   660 O O   . LEU C 1 19 ? -5.552  -0.895  29.911 1.00 16.92  ? 19  LEU C O   1 
ATOM   661 C CB  . LEU C 1 19 ? -7.263  -2.858  28.516 1.00 16.92  ? 19  LEU C CB  1 
ATOM   662 C CG  . LEU C 1 19 ? -8.547  -2.987  27.672 1.00 16.92  ? 19  LEU C CG  1 
ATOM   663 C CD1 . LEU C 1 19 ? -9.683  -3.491  28.539 1.00 16.92  ? 19  LEU C CD1 1 
ATOM   664 C CD2 . LEU C 1 19 ? -8.916  -1.620  27.218 1.00 16.92  ? 19  LEU C CD2 1 
ATOM   665 N N   . GLU C 1 20 ? -3.973  -1.584  28.586 1.00 30.26  ? 20  GLU C N   1 
ATOM   666 C CA  . GLU C 1 20 ? -3.116  -0.984  29.575 1.00 30.26  ? 20  GLU C CA  1 
ATOM   667 C C   . GLU C 1 20 ? -2.253  0.038   28.929 1.00 30.26  ? 20  GLU C C   1 
ATOM   668 O O   . GLU C 1 20 ? -1.841  0.966   29.580 1.00 30.65  ? 20  GLU C O   1 
ATOM   669 C CB  . GLU C 1 20 ? -2.407  -1.838  30.600 1.00 30.65  ? 20  GLU C CB  1 
ATOM   670 C CG  . GLU C 1 20 ? -3.022  -3.175  30.819 1.00 30.65  ? 20  GLU C CG  1 
ATOM   671 C CD  . GLU C 1 20 ? -2.003  -4.224  30.508 1.00 30.65  ? 20  GLU C CD  1 
ATOM   672 O OE1 . GLU C 1 20 ? -1.573  -4.399  29.348 1.00 30.65  ? 20  GLU C OE1 1 
ATOM   673 O OE2 . GLU C 1 20 ? -1.735  -4.980  31.597 1.00 30.65  ? 20  GLU C OE2 1 
ATOM   674 N N   . ASN C 1 21 ? -2.152  -0.167  27.623 1.00 12.47  ? 21  ASN C N   1 
ATOM   675 C CA  . ASN C 1 21 ? -1.437  0.670   26.731 1.00 12.47  ? 21  ASN C CA  1 
ATOM   676 C C   . ASN C 1 21 ? -2.293  1.889   26.486 1.00 12.47  ? 21  ASN C C   1 
ATOM   677 O O   . ASN C 1 21 ? -1.927  2.778   25.685 1.00 33.32  ? 21  ASN C O   1 
ATOM   678 C CB  . ASN C 1 21 ? -1.090  -0.009  25.393 1.00 33.32  ? 21  ASN C CB  1 
ATOM   679 C CG  . ASN C 1 21 ? -0.081  -1.177  25.512 1.00 33.32  ? 21  ASN C CG  1 
ATOM   680 O OD1 . ASN C 1 21 ? 0.211   -1.670  26.629 1.00 33.32  ? 21  ASN C OD1 1 
ATOM   681 N ND2 . ASN C 1 21 ? 0.474   -1.583  24.355 1.00 33.32  ? 21  ASN C ND2 1 
ATOM   682 N N   . GLU C 1 22 ? -3.422  1.944   27.187 1.00 19.04  ? 22  GLU C N   1 
ATOM   683 C CA  . GLU C 1 22 ? -4.372  3.027   26.976 1.00 19.04  ? 22  GLU C CA  1 
ATOM   684 C C   . GLU C 1 22 ? -4.814  3.637   28.272 1.00 19.04  ? 22  GLU C C   1 
ATOM   685 O O   . GLU C 1 22 ? -4.859  4.835   28.489 1.00 30.88  ? 22  GLU C O   1 
ATOM   686 C CB  . GLU C 1 22 ? -5.552  2.498   26.180 1.00 30.88  ? 22  GLU C CB  1 
ATOM   687 C CG  . GLU C 1 22 ? -5.322  2.640   24.672 1.00 30.88  ? 22  GLU C CG  1 
ATOM   688 C CD  . GLU C 1 22 ? -6.545  2.100   24.117 1.00 30.88  ? 22  GLU C CD  1 
ATOM   689 O OE1 . GLU C 1 22 ? -7.107  1.275   24.767 1.00 30.88  ? 22  GLU C OE1 1 
ATOM   690 O OE2 . GLU C 1 22 ? -7.051  2.694   23.060 1.00 30.88  ? 22  GLU C OE2 1 
ATOM   691 N N   . VAL C 1 23 ? -5.030  2.775   29.197 1.00 13.59  ? 23  VAL C N   1 
ATOM   692 C CA  . VAL C 1 23 ? -5.377  3.312   30.435 1.00 13.59  ? 23  VAL C CA  1 
ATOM   693 C C   . VAL C 1 23 ? -4.122  4.020   30.887 1.00 13.59  ? 23  VAL C C   1 
ATOM   694 O O   . VAL C 1 23 ? -4.145  4.919   31.712 1.00 18.52  ? 23  VAL C O   1 
ATOM   695 C CB  . VAL C 1 23 ? -5.930  2.340   31.456 1.00 18.52  ? 23  VAL C CB  1 
ATOM   696 C CG1 . VAL C 1 23 ? -6.028  3.144   32.727 1.00 18.52  ? 23  VAL C CG1 1 
ATOM   697 C CG2 . VAL C 1 23 ? -7.356  1.849   31.170 1.00 18.52  ? 23  VAL C CG2 1 
ATOM   698 N N   . ALA C 1 24 ? -2.988  3.622   30.350 1.00 66.45  ? 24  ALA C N   1 
ATOM   699 C CA  . ALA C 1 24 ? -1.765  4.289   30.715 1.00 66.45  ? 24  ALA C CA  1 
ATOM   700 C C   . ALA C 1 24 ? -1.436  5.430   29.790 1.00 66.45  ? 24  ALA C C   1 
ATOM   701 O O   . ALA C 1 24 ? -0.455  6.067   30.012 1.00 23.85  ? 24  ALA C O   1 
ATOM   702 C CB  . ALA C 1 24 ? -0.596  3.349   30.911 1.00 23.85  ? 24  ALA C CB  1 
ATOM   703 N N   . ARG C 1 25 ? -2.256  5.692   28.773 1.00 47.56  ? 25  ARG C N   1 
ATOM   704 C CA  . ARG C 1 25 ? -2.106  6.859   27.908 1.00 47.56  ? 25  ARG C CA  1 
ATOM   705 C C   . ARG C 1 25 ? -2.874  8.019   28.575 1.00 47.56  ? 25  ARG C C   1 
ATOM   706 O O   . ARG C 1 25 ? -2.317  9.012   29.125 1.00 38.59  ? 25  ARG C O   1 
ATOM   707 C CB  . ARG C 1 25 ? -2.521  6.622   26.458 1.00 38.59  ? 25  ARG C CB  1 
ATOM   708 C CG  . ARG C 1 25 ? -1.272  6.506   25.552 1.00 38.59  ? 25  ARG C CG  1 
ATOM   709 C CD  . ARG C 1 25 ? -1.545  6.165   24.090 1.00 38.59  ? 25  ARG C CD  1 
ATOM   710 N NE  . ARG C 1 25 ? -2.438  7.138   23.519 1.00 38.59  ? 25  ARG C NE  1 
ATOM   711 C CZ  . ARG C 1 25 ? -2.073  8.025   22.577 1.00 38.59  ? 25  ARG C CZ  1 
ATOM   712 N NH1 . ARG C 1 25 ? -0.847  8.046   22.049 1.00 38.59  ? 25  ARG C NH1 1 
ATOM   713 N NH2 . ARG C 1 25 ? -2.963  8.920   22.115 1.00 38.59  ? 25  ARG C NH2 1 
ATOM   714 N N   . LEU C 1 26 ? -4.183  7.817   28.619 1.00 18.68  ? 26  LEU C N   1 
ATOM   715 C CA  . LEU C 1 26 ? -5.042  8.692   29.329 1.00 18.68  ? 26  LEU C CA  1 
ATOM   716 C C   . LEU C 1 26 ? -4.285  9.245   30.521 1.00 18.68  ? 26  LEU C C   1 
ATOM   717 O O   . LEU C 1 26 ? -3.877  10.397  30.554 1.00 43.58  ? 26  LEU C O   1 
ATOM   718 C CB  . LEU C 1 26 ? -6.156  7.805   29.847 1.00 43.58  ? 26  LEU C CB  1 
ATOM   719 C CG  . LEU C 1 26 ? -7.073  7.334   28.726 1.00 43.58  ? 26  LEU C CG  1 
ATOM   720 C CD1 . LEU C 1 26 ? -8.270  6.585   29.357 1.00 43.58  ? 26  LEU C CD1 1 
ATOM   721 C CD2 . LEU C 1 26 ? -7.506  8.546   27.869 1.00 43.58  ? 26  LEU C CD2 1 
ATOM   722 N N   . LYS C 1 27 ? -4.095  8.376   31.482 1.00 15.59  ? 27  LYS C N   1 
ATOM   723 C CA  . LYS C 1 27 ? -3.391  8.649   32.745 1.00 15.59  ? 27  LYS C CA  1 
ATOM   724 C C   . LYS C 1 27 ? -2.280  9.683   32.592 1.00 15.59  ? 27  LYS C C   1 
ATOM   725 O O   . LYS C 1 27 ? -2.224  10.614  33.349 1.00 49.24  ? 27  LYS C O   1 
ATOM   726 C CB  . LYS C 1 27 ? -2.942  7.370   33.478 1.00 49.24  ? 27  LYS C CB  1 
ATOM   727 C CG  . LYS C 1 27 ? -1.633  7.451   34.257 1.00 49.24  ? 27  LYS C CG  1 
ATOM   728 C CD  . LYS C 1 27 ? -1.084  6.115   34.797 1.00 49.24  ? 27  LYS C CD  1 
ATOM   729 C CE  . LYS C 1 27 ? -1.300  5.961   36.315 1.00 49.24  ? 27  LYS C CE  1 
ATOM   730 N NZ  . LYS C 1 27 ? -0.266  5.197   37.063 1.00 49.24  ? 27  LYS C NZ  1 
ATOM   731 N N   . LYS C 1 28 ? -1.442  9.521   31.590 1.00 37.13  ? 28  LYS C N   1 
ATOM   732 C CA  . LYS C 1 28 ? -0.413  10.466  31.378 1.00 37.13  ? 28  LYS C CA  1 
ATOM   733 C C   . LYS C 1 28 ? -1.032  11.783  30.930 1.00 37.13  ? 28  LYS C C   1 
ATOM   734 O O   . LYS C 1 28 ? -0.930  12.785  31.674 1.00 50.67  ? 28  LYS C O   1 
ATOM   735 C CB  . LYS C 1 28 ? 0.648   9.948   30.476 1.00 50.67  ? 28  LYS C CB  1 
ATOM   736 C CG  . LYS C 1 28 ? 1.605   9.197   31.355 1.00 50.67  ? 28  LYS C CG  1 
ATOM   737 C CD  . LYS C 1 28 ? 3.006   9.044   30.781 1.00 50.67  ? 28  LYS C CD  1 
ATOM   738 C CE  . LYS C 1 28 ? 3.676   7.717   31.152 1.00 50.67  ? 28  LYS C CE  1 
ATOM   739 N NZ  . LYS C 1 28 ? 4.546   7.143   30.074 1.00 50.67  ? 28  LYS C NZ  1 
ATOM   740 N N   . LEU C 1 29 ? -1.729  11.776  29.752 1.00 17.04  ? 29  LEU C N   1 
ATOM   741 C CA  . LEU C 1 29 ? -2.358  12.958  29.208 1.00 17.04  ? 29  LEU C CA  1 
ATOM   742 C C   . LEU C 1 29 ? -3.313  13.670  30.115 1.00 17.04  ? 29  LEU C C   1 
ATOM   743 O O   . LEU C 1 29 ? -3.417  14.880  30.043 1.00 21.55  ? 29  LEU C O   1 
ATOM   744 C CB  . LEU C 1 29 ? -3.156  12.688  27.965 1.00 21.55  ? 29  LEU C CB  1 
ATOM   745 C CG  . LEU C 1 29 ? -2.658  11.622  27.044 1.00 21.55  ? 29  LEU C CG  1 
ATOM   746 C CD1 . LEU C 1 29 ? -3.216  12.007  25.678 1.00 21.55  ? 29  LEU C CD1 1 
ATOM   747 C CD2 . LEU C 1 29 ? -1.136  11.556  27.028 1.00 21.55  ? 29  LEU C CD2 1 
ATOM   748 N N   . VAL C 1 30 ? -4.163  12.943  30.823 1.00 19.49  ? 30  VAL C N   1 
ATOM   749 C CA  . VAL C 1 30 ? -5.167  13.664  31.644 1.00 19.49  ? 30  VAL C CA  1 
ATOM   750 C C   . VAL C 1 30 ? -4.482  14.446  32.711 1.00 19.49  ? 30  VAL C C   1 
ATOM   751 O O   . VAL C 1 30 ? -4.237  15.531  32.295 1.00 14.88  ? 30  VAL C O   1 
ATOM   752 C CB  . VAL C 1 30 ? -6.359  12.942  32.262 1.00 14.88  ? 30  VAL C CB  1 
ATOM   753 C CG1 . VAL C 1 30 ? -7.026  12.009  31.265 1.00 14.88  ? 30  VAL C CG1 1 
ATOM   754 C CG2 . VAL C 1 30 ? -5.968  12.328  33.611 1.00 14.88  ? 30  VAL C CG2 1 
HETATM 755 C C1  . BNZ D 2 .  ? -10.248 -9.558  31.480 1.00 27.37  ? 100 BNZ B C1  1 
HETATM 756 C C2  . BNZ D 2 .  ? -10.010 -8.648  32.511 1.00 27.37  ? 100 BNZ B C2  1 
HETATM 757 C C3  . BNZ D 2 .  ? -8.779  -7.983  32.540 1.00 27.37  ? 100 BNZ B C3  1 
HETATM 758 C C4  . BNZ D 2 .  ? -7.827  -8.144  31.532 1.00 27.37  ? 100 BNZ B C4  1 
HETATM 759 C C5  . BNZ D 2 .  ? -8.124  -8.997  30.470 1.00 27.37  ? 100 BNZ B C5  1 
HETATM 760 C C6  . BNZ D 2 .  ? -9.315  -9.722  30.458 1.00 27.37  ? 100 BNZ B C6  1 
HETATM 761 O O   . HOH E 3 .  ? -18.296 -5.419  35.083 1.00 40.47  ? 50  HOH A O   1 
HETATM 762 O O   . HOH E 3 .  ? -21.262 -2.794  23.674 1.00 40.47  ? 54  HOH A O   1 
HETATM 763 O O   . HOH E 3 .  ? -6.380  5.895   22.449 1.00 40.47  ? 56  HOH A O   1 
HETATM 764 O O   . HOH E 3 .  ? -16.073 -1.133  23.188 1.00 40.47  ? 58  HOH A O   1 
HETATM 765 O O   . HOH E 3 .  ? -12.216 -18.053 42.925 1.00 40.47  ? 59  HOH A O   1 
HETATM 766 O O   . HOH E 3 .  ? -14.426 -13.902 42.597 1.00 40.47  ? 63  HOH A O   1 
HETATM 767 O O   . HOH E 3 .  ? -20.531 5.474   33.516 1.00 40.47  ? 65  HOH A O   1 
HETATM 768 O O   . HOH E 3 .  ? -11.284 10.550  22.180 1.00 40.47  ? 66  HOH A O   1 
HETATM 769 O O   . HOH E 3 .  ? -15.575 -7.775  25.998 1.00 40.47  ? 69  HOH A O   1 
HETATM 770 O O   . HOH E 3 .  ? -16.239 17.256  28.994 1.00 40.47  ? 74  HOH A O   1 
HETATM 771 O O   . HOH E 3 .  ? -17.343 9.493   32.810 1.00 40.47  ? 75  HOH A O   1 
HETATM 772 O O   . HOH E 3 .  ? -21.359 -15.637 37.103 1.00 40.47  ? 78  HOH A O   1 
HETATM 773 O O   . HOH F 3 .  ? -15.851 15.051  31.274 1.00 40.47  ? 51  HOH B O   1 
HETATM 774 O O   . HOH F 3 .  ? -0.202  -26.049 27.299 1.00 40.47  ? 62  HOH B O   1 
HETATM 775 O O   . HOH F 3 .  ? -14.597 0.880   37.046 1.00 40.47  ? 64  HOH B O   1 
HETATM 776 O O   . HOH F 3 .  ? -3.288  -7.107  41.039 1.00 40.47  ? 68  HOH B O   1 
HETATM 777 O O   . HOH F 3 .  ? 4.066   -20.697 37.163 1.00 40.47  ? 72  HOH B O   1 
HETATM 778 O O   . HOH F 3 .  ? -1.278  -7.279  37.257 1.00 40.47  ? 73  HOH B O   1 
HETATM 779 O O   . HOH F 3 .  ? -7.310  -12.540 42.040 1.00 40.47  ? 76  HOH B O   1 
HETATM 780 O O   . HOH F 3 .  ? -6.371  -13.447 44.781 1.00 40.47  ? 77  HOH B O   1 
HETATM 781 O O   . HOH G 3 .  ? -1.455  -1.050  22.836 1.00 40.47  ? 52  HOH C O   1 
HETATM 782 O O   . HOH G 3 .  ? 1.925   4.826   28.114 1.00 40.47  ? 53  HOH C O   1 
HETATM 783 O O   . HOH G 3 .  ? -6.949  -22.547 18.284 1.00 40.47  ? 55  HOH C O   1 
HETATM 784 O O   . HOH G 3 .  ? -8.953  -4.260  24.493 1.00 40.47  ? 57  HOH C O   1 
HETATM 785 O O   . HOH G 3 .  ? 1.239   -5.071  28.242 1.00 40.47  ? 60  HOH C O   1 
HETATM 786 O O   . HOH G 3 .  ? -2.454  1.060   33.941 1.00 40.47  ? 61  HOH C O   1 
HETATM 787 O O   . HOH G 3 .  ? 0.348   16.221  34.415 1.00 40.47  ? 67  HOH C O   1 
HETATM 788 O O   . HOH G 3 .  ? -10.700 1.001   23.875 1.00 40.47  ? 70  HOH C O   1 
HETATM 789 O O   . HOH G 3 .  ? 0.378   -1.938  33.982 1.00 40.47  ? 71  HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ARG 1  1  1  ARG ARG A . n 
A 1 2  MET 2  2  2  MET MET A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  GLN 4  4  4  GLN GLN A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  ASP 7  7  7  ASP ASP A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 GLU 10 10 10 GLU GLU A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 TYR 17 17 17 TYR TYR A . n 
A 1 18 HIS 18 18 18 HIS HIS A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 ALA 24 24 24 ALA ALA A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 GLY 31 31 31 GLY GLY A . n 
A 1 32 GLU 32 32 ?  ?   ?   A . n 
A 1 33 ARG 33 33 ?  ?   ?   A . n 
B 1 1  ARG 1  1  1  ARG ARG B . n 
B 1 2  MET 2  2  2  MET MET B . n 
B 1 3  LYS 3  3  3  LYS LYS B . n 
B 1 4  GLN 4  4  4  GLN GLN B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  GLU 6  6  6  GLU GLU B . n 
B 1 7  ASP 7  7  7  ASP ASP B . n 
B 1 8  LYS 8  8  8  LYS LYS B . n 
B 1 9  VAL 9  9  9  VAL VAL B . n 
B 1 10 GLU 10 10 10 GLU GLU B . n 
B 1 11 GLU 11 11 11 GLU GLU B . n 
B 1 12 LEU 12 12 12 LEU LEU B . n 
B 1 13 LEU 13 13 13 LEU LEU B . n 
B 1 14 SER 14 14 14 SER SER B . n 
B 1 15 LYS 15 15 15 LYS LYS B . n 
B 1 16 ALA 16 16 16 ALA ALA B . n 
B 1 17 TYR 17 17 17 TYR TYR B . n 
B 1 18 HIS 18 18 18 HIS HIS B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 GLU 20 20 20 GLU GLU B . n 
B 1 21 ASN 21 21 21 ASN ASN B . n 
B 1 22 GLU 22 22 22 GLU GLU B . n 
B 1 23 VAL 23 23 23 VAL VAL B . n 
B 1 24 ALA 24 24 24 ALA ALA B . n 
B 1 25 ARG 25 25 25 ARG ARG B . n 
B 1 26 LEU 26 26 26 LEU LEU B . n 
B 1 27 LYS 27 27 27 LYS LYS B . n 
B 1 28 LYS 28 28 28 LYS LYS B . n 
B 1 29 LEU 29 29 29 LEU LEU B . n 
B 1 30 VAL 30 30 30 VAL VAL B . n 
B 1 31 GLY 31 31 ?  ?   ?   B . n 
B 1 32 GLU 32 32 ?  ?   ?   B . n 
B 1 33 ARG 33 33 ?  ?   ?   B . n 
C 1 1  ARG 1  1  1  ARG ARG C . n 
C 1 2  MET 2  2  2  MET MET C . n 
C 1 3  LYS 3  3  3  LYS LYS C . n 
C 1 4  GLN 4  4  4  GLN GLN C . n 
C 1 5  LEU 5  5  5  LEU LEU C . n 
C 1 6  GLU 6  6  6  GLU GLU C . n 
C 1 7  ASP 7  7  7  ASP ASP C . n 
C 1 8  LYS 8  8  8  LYS LYS C . n 
C 1 9  VAL 9  9  9  VAL VAL C . n 
C 1 10 GLU 10 10 10 GLU GLU C . n 
C 1 11 GLU 11 11 11 GLU GLU C . n 
C 1 12 LEU 12 12 12 LEU LEU C . n 
C 1 13 LEU 13 13 13 LEU LEU C . n 
C 1 14 SER 14 14 14 SER SER C . n 
C 1 15 LYS 15 15 15 LYS LYS C . n 
C 1 16 ALA 16 16 16 ALA ALA C . n 
C 1 17 TYR 17 17 17 TYR TYR C . n 
C 1 18 HIS 18 18 18 HIS HIS C . n 
C 1 19 LEU 19 19 19 LEU LEU C . n 
C 1 20 GLU 20 20 20 GLU GLU C . n 
C 1 21 ASN 21 21 21 ASN ASN C . n 
C 1 22 GLU 22 22 22 GLU GLU C . n 
C 1 23 VAL 23 23 23 VAL VAL C . n 
C 1 24 ALA 24 24 24 ALA ALA C . n 
C 1 25 ARG 25 25 25 ARG ARG C . n 
C 1 26 LEU 26 26 26 LEU LEU C . n 
C 1 27 LYS 27 27 27 LYS LYS C . n 
C 1 28 LYS 28 28 28 LYS LYS C . n 
C 1 29 LEU 29 29 29 LEU LEU C . n 
C 1 30 VAL 30 30 30 VAL VAL C . n 
C 1 31 GLY 31 31 ?  ?   ?   C . n 
C 1 32 GLU 32 32 ?  ?   ?   C . n 
C 1 33 ARG 33 33 ?  ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 BNZ 1  100 100 BNZ BNZ B . 
E 3 HOH 1  50  50  HOH HOH A . 
E 3 HOH 2  54  54  HOH HOH A . 
E 3 HOH 3  56  56  HOH HOH A . 
E 3 HOH 4  58  58  HOH HOH A . 
E 3 HOH 5  59  59  HOH HOH A . 
E 3 HOH 6  63  63  HOH HOH A . 
E 3 HOH 7  65  65  HOH HOH A . 
E 3 HOH 8  66  66  HOH HOH A . 
E 3 HOH 9  69  69  HOH HOH A . 
E 3 HOH 10 74  74  HOH HOH A . 
E 3 HOH 11 75  75  HOH HOH A . 
E 3 HOH 12 78  78  HOH HOH A . 
F 3 HOH 1  51  51  HOH HOH B . 
F 3 HOH 2  62  62  HOH HOH B . 
F 3 HOH 3  64  64  HOH HOH B . 
F 3 HOH 4  68  68  HOH HOH B . 
F 3 HOH 5  72  72  HOH HOH B . 
F 3 HOH 6  73  73  HOH HOH B . 
F 3 HOH 7  76  76  HOH HOH B . 
F 3 HOH 8  77  77  HOH HOH B . 
G 3 HOH 1  52  52  HOH HOH C . 
G 3 HOH 2  53  53  HOH HOH C . 
G 3 HOH 3  55  55  HOH HOH C . 
G 3 HOH 4  57  57  HOH HOH C . 
G 3 HOH 5  60  60  HOH HOH C . 
G 3 HOH 6  61  61  HOH HOH C . 
G 3 HOH 7  67  67  HOH HOH C . 
G 3 HOH 8  70  70  HOH HOH C . 
G 3 HOH 9  71  71  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3820 ? 
1 MORE         -34  ? 
1 'SSA (A^2)'  6330 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-11-08 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-07-17 
5 'Structure model' 1 4 2019-08-14 
6 'Structure model' 1 5 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
5 4 'Structure model' 'Refinement description'    
6 5 'Structure model' 'Data collection'           
7 6 'Structure model' 'Database references'       
8 6 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' software             
3 5 'Structure model' computing            
4 6 'Structure model' database_2           
5 6 'Structure model' struct_ref_seq_dif   
6 6 'Structure model' struct_site          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_status.process_site'  
2 4 'Structure model' '_software.classification'            
3 6 'Structure model' '_database_2.pdbx_DOI'                
4 6 'Structure model' '_database_2.pdbx_database_accession' 
5 6 'Structure model' '_struct_ref_seq_dif.details'         
6 6 'Structure model' '_struct_site.pdbx_auth_asym_id'      
7 6 'Structure model' '_struct_site.pdbx_auth_comp_id'      
8 6 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR refinement       . ? 1 
TNT    refinement       . ? 2 
X-PLOR 'model building' . ? 3 
R-AXIS 'data reduction' . ? 4 
X-PLOR phasing          . ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 11 ? ? OE1 A GLU 11 ? ? 1.319 1.252 0.067 0.011 N 
2 1 CD A GLU 20 ? ? OE2 A GLU 20 ? ? 1.351 1.252 0.099 0.011 N 
3 1 CD B GLU 11 ? ? OE2 B GLU 11 ? ? 1.325 1.252 0.073 0.011 N 
4 1 CD B GLU 20 ? ? OE1 B GLU 20 ? ? 1.320 1.252 0.068 0.011 N 
5 1 CD C GLU 10 ? ? OE2 C GLU 10 ? ? 1.318 1.252 0.066 0.011 N 
6 1 CD C GLU 20 ? ? OE2 C GLU 20 ? ? 1.353 1.252 0.101 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 1  ? ? CZ A ARG 1  ? ? NH1 A ARG 1  ? ? 125.31 120.30 5.01  0.50 N 
2  1 NE A ARG 1  ? ? CZ A ARG 1  ? ? NH2 A ARG 1  ? ? 116.86 120.30 -3.44 0.50 N 
3  1 N  A MET 2  ? ? CA A MET 2  ? ? CB  A MET 2  ? ? 123.03 110.60 12.43 1.80 N 
4  1 CB A ASP 7  ? ? CG A ASP 7  ? ? OD1 A ASP 7  ? ? 126.98 118.30 8.68  0.90 N 
5  1 CB A ASP 7  ? ? CG A ASP 7  ? ? OD2 A ASP 7  ? ? 111.54 118.30 -6.76 0.90 N 
6  1 NE B ARG 1  ? ? CZ B ARG 1  ? ? NH1 B ARG 1  ? ? 123.97 120.30 3.67  0.50 N 
7  1 CB B ASP 7  ? ? CG B ASP 7  ? ? OD1 B ASP 7  ? ? 124.83 118.30 6.53  0.90 N 
8  1 CB B ASP 7  ? ? CG B ASP 7  ? ? OD2 B ASP 7  ? ? 111.73 118.30 -6.57 0.90 N 
9  1 NE B ARG 25 ? ? CZ B ARG 25 ? ? NH1 B ARG 25 ? ? 126.45 120.30 6.15  0.50 N 
10 1 NE B ARG 25 ? ? CZ B ARG 25 ? ? NH2 B ARG 25 ? ? 116.97 120.30 -3.33 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 18 ? ? -29.56  -70.57 
2 1 VAL A 30 ? ? -152.61 4.44   
3 1 ASN B 21 ? ? -53.37  -70.26 
4 1 GLU B 22 ? ? -21.31  -45.54 
5 1 LEU B 29 ? ? -70.27  24.97  
6 1 VAL C 9  ? ? -47.52  -18.13 
7 1 GLU C 22 ? ? -131.94 -41.05 
8 1 LEU C 26 ? ? -31.86  -72.61 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    MET 
_pdbx_validate_chiral.auth_seq_id     2 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 C ARG 1 ? CG  ? C ARG 1 CG  
2 1 Y 1 C ARG 1 ? CD  ? C ARG 1 CD  
3 1 Y 1 C ARG 1 ? NE  ? C ARG 1 NE  
4 1 Y 1 C ARG 1 ? CZ  ? C ARG 1 CZ  
5 1 Y 1 C ARG 1 ? NH1 ? C ARG 1 NH1 
6 1 Y 1 C ARG 1 ? NH2 ? C ARG 1 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 32 ? A GLU 32 
2 1 Y 1 A ARG 33 ? A ARG 33 
3 1 Y 1 B GLY 31 ? B GLY 31 
4 1 Y 1 B GLU 32 ? B GLU 32 
5 1 Y 1 B ARG 33 ? B ARG 33 
6 1 Y 1 C GLY 31 ? C GLY 31 
7 1 Y 1 C GLU 32 ? C GLU 32 
8 1 Y 1 C ARG 33 ? C ARG 33 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 BENZENE BNZ 
3 water   HOH 
#