data_1SXG
# 
_entry.id   1SXG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SXG         
RCSB  RCSB022067   
WWPDB D_1000022067 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1SXH . unspecified 
PDB 1SXI . unspecified 
# 
_pdbx_database_status.entry_id                        1SXG 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schumacher, M.A.' 1 
'Allen, G.S.'      2 
'Diel, M.'         3 
'Seidel, G.'       4 
'Hillen, W.'       5 
'Brennan, R.G.'    6 
# 
_citation.id                        primary 
_citation.title                     'Structural studies on the apo transcription factor form B. megaterium' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            118 
_citation.page_first                731 
_citation.page_last                 741 
_citation.year                      2004 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15369672 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2004.08.027 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Schumacher, M.A.' 1 
primary 'Allen, G.S.'      2 
primary 'Diel, M.'         3 
primary 'Seidel, G.'       4 
primary 'Hillen, W.'       5 
primary 'Brennan, R.G.'    6 
# 
_cell.entry_id           1SXG 
_cell.length_a           375.390 
_cell.length_b           60.140 
_cell.length_c           75.650 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.59 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SXG 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.cell_setting                     monoclinic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-resistance amylase regulator' 30992.119 6   ? 'residues 53-332' ? ? 
2 non-polymer syn '2-PHENYLAMINO-ETHANESULFONIC ACID'    201.243   2   ? ?                 ? ? 
3 water       nat water                                  18.015    139 ? ?                 ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Catabolite control protein; ccpa' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RGLASKKTTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHV
EELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVR
DSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQ
PMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RGLASKKTTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHV
EELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVR
DSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQ
PMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK
;
_entity_poly.pdbx_strand_id                 A,D,B,I,P,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   GLY n 
1 3   LEU n 
1 4   ALA n 
1 5   SER n 
1 6   LYS n 
1 7   LYS n 
1 8   THR n 
1 9   THR n 
1 10  THR n 
1 11  VAL n 
1 12  GLY n 
1 13  VAL n 
1 14  ILE n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  ILE n 
1 19  SER n 
1 20  ASN n 
1 21  ILE n 
1 22  PHE n 
1 23  TYR n 
1 24  ALA n 
1 25  GLU n 
1 26  LEU n 
1 27  ALA n 
1 28  ARG n 
1 29  GLY n 
1 30  ILE n 
1 31  GLU n 
1 32  ASP n 
1 33  ILE n 
1 34  ALA n 
1 35  THR n 
1 36  MET n 
1 37  TYR n 
1 38  LYS n 
1 39  TYR n 
1 40  ASN n 
1 41  ILE n 
1 42  ILE n 
1 43  LEU n 
1 44  SER n 
1 45  ASN n 
1 46  SER n 
1 47  ASP n 
1 48  GLN n 
1 49  ASN n 
1 50  GLN n 
1 51  ASP n 
1 52  LYS n 
1 53  GLU n 
1 54  LEU n 
1 55  HIS n 
1 56  LEU n 
1 57  LEU n 
1 58  ASN n 
1 59  ASN n 
1 60  MET n 
1 61  LEU n 
1 62  GLY n 
1 63  LYS n 
1 64  GLN n 
1 65  VAL n 
1 66  ASP n 
1 67  GLY n 
1 68  ILE n 
1 69  ILE n 
1 70  PHE n 
1 71  MET n 
1 72  SER n 
1 73  GLY n 
1 74  ASN n 
1 75  VAL n 
1 76  THR n 
1 77  GLU n 
1 78  GLU n 
1 79  HIS n 
1 80  VAL n 
1 81  GLU n 
1 82  GLU n 
1 83  LEU n 
1 84  LYS n 
1 85  LYS n 
1 86  SER n 
1 87  PRO n 
1 88  VAL n 
1 89  PRO n 
1 90  VAL n 
1 91  VAL n 
1 92  LEU n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  ILE n 
1 97  GLU n 
1 98  SER n 
1 99  THR n 
1 100 ASN n 
1 101 GLN n 
1 102 ILE n 
1 103 PRO n 
1 104 SER n 
1 105 VAL n 
1 106 THR n 
1 107 ILE n 
1 108 ASP n 
1 109 TYR n 
1 110 GLU n 
1 111 GLN n 
1 112 ALA n 
1 113 ALA n 
1 114 PHE n 
1 115 ASP n 
1 116 ALA n 
1 117 VAL n 
1 118 GLN n 
1 119 SER n 
1 120 LEU n 
1 121 ILE n 
1 122 ASP n 
1 123 SER n 
1 124 GLY n 
1 125 HIS n 
1 126 LYS n 
1 127 ASN n 
1 128 ILE n 
1 129 ALA n 
1 130 PHE n 
1 131 VAL n 
1 132 SER n 
1 133 GLY n 
1 134 THR n 
1 135 LEU n 
1 136 GLU n 
1 137 GLU n 
1 138 PRO n 
1 139 ILE n 
1 140 ASN n 
1 141 HIS n 
1 142 ALA n 
1 143 LYS n 
1 144 LYS n 
1 145 VAL n 
1 146 LYS n 
1 147 GLY n 
1 148 TYR n 
1 149 LYS n 
1 150 ARG n 
1 151 ALA n 
1 152 LEU n 
1 153 THR n 
1 154 GLU n 
1 155 SER n 
1 156 GLY n 
1 157 LEU n 
1 158 PRO n 
1 159 VAL n 
1 160 ARG n 
1 161 ASP n 
1 162 SER n 
1 163 TYR n 
1 164 ILE n 
1 165 VAL n 
1 166 GLU n 
1 167 GLY n 
1 168 ASP n 
1 169 TYR n 
1 170 THR n 
1 171 TYR n 
1 172 ASP n 
1 173 SER n 
1 174 GLY n 
1 175 ILE n 
1 176 GLU n 
1 177 ALA n 
1 178 VAL n 
1 179 GLU n 
1 180 LYS n 
1 181 LEU n 
1 182 LEU n 
1 183 GLU n 
1 184 GLU n 
1 185 ASP n 
1 186 GLU n 
1 187 LYS n 
1 188 PRO n 
1 189 THR n 
1 190 ALA n 
1 191 ILE n 
1 192 PHE n 
1 193 VAL n 
1 194 GLY n 
1 195 THR n 
1 196 ASP n 
1 197 GLU n 
1 198 MET n 
1 199 ALA n 
1 200 LEU n 
1 201 GLY n 
1 202 VAL n 
1 203 ILE n 
1 204 HIS n 
1 205 GLY n 
1 206 ALA n 
1 207 GLN n 
1 208 ASP n 
1 209 ARG n 
1 210 GLY n 
1 211 LEU n 
1 212 ASN n 
1 213 VAL n 
1 214 PRO n 
1 215 ASN n 
1 216 ASP n 
1 217 LEU n 
1 218 GLU n 
1 219 ILE n 
1 220 ILE n 
1 221 GLY n 
1 222 PHE n 
1 223 ASP n 
1 224 ASN n 
1 225 THR n 
1 226 ARG n 
1 227 LEU n 
1 228 SER n 
1 229 THR n 
1 230 MET n 
1 231 VAL n 
1 232 ARG n 
1 233 PRO n 
1 234 GLN n 
1 235 LEU n 
1 236 THR n 
1 237 SER n 
1 238 VAL n 
1 239 VAL n 
1 240 GLN n 
1 241 PRO n 
1 242 MET n 
1 243 TYR n 
1 244 ASP n 
1 245 ILE n 
1 246 GLY n 
1 247 ALA n 
1 248 VAL n 
1 249 ALA n 
1 250 MET n 
1 251 ARG n 
1 252 LEU n 
1 253 LEU n 
1 254 THR n 
1 255 LYS n 
1 256 TYR n 
1 257 MET n 
1 258 ASN n 
1 259 LYS n 
1 260 GLU n 
1 261 THR n 
1 262 VAL n 
1 263 ASP n 
1 264 SER n 
1 265 SER n 
1 266 ILE n 
1 267 VAL n 
1 268 GLN n 
1 269 LEU n 
1 270 PRO n 
1 271 HIS n 
1 272 ARG n 
1 273 ILE n 
1 274 GLU n 
1 275 PHE n 
1 276 ARG n 
1 277 GLN n 
1 278 SER n 
1 279 THR n 
1 280 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacillus 
_entity_src_gen.pdbx_gene_src_gene                 CCpa 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus megaterium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1404 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCPA_BACME 
_struct_ref.pdbx_db_accession          P46828 
_struct_ref.pdbx_align_begin           53 
_struct_ref.pdbx_seq_one_letter_code   
;RGLASKKTTTVGVIIPDISNIFYAELARGIEDIASMYKYNIILSNSDQNQDKQLHLLNNMLGKQVDGIIFMSGNVTEEHV
EELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVR
DSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQ
PMYDIGAVAMRLLTKYMNKETVDSSIVELPHRIEFRQSTK
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SXG A 1 ? 280 ? P46828 53 ? 332 ? 53 332 
2 1 1SXG D 1 ? 280 ? P46828 53 ? 332 ? 53 332 
3 1 1SXG B 1 ? 280 ? P46828 53 ? 332 ? 53 332 
4 1 1SXG I 1 ? 280 ? P46828 53 ? 332 ? 53 332 
5 1 1SXG P 1 ? 280 ? P46828 53 ? 332 ? 53 332 
6 1 1SXG F 1 ? 280 ? P46828 53 ? 332 ? 53 332 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SXG THR A 35  ? UNP P46828 SER 87  CONFLICT 87  1  
1 1SXG GLU A 53  ? UNP P46828 GLN 105 CONFLICT 105 2  
1 1SXG GLN A 268 ? UNP P46828 GLU 320 CONFLICT 320 3  
2 1SXG THR D 35  ? UNP P46828 SER 87  CONFLICT 87  4  
2 1SXG GLU D 53  ? UNP P46828 GLN 105 CONFLICT 105 5  
2 1SXG GLN D 268 ? UNP P46828 GLU 320 CONFLICT 320 6  
3 1SXG THR B 35  ? UNP P46828 SER 87  CONFLICT 87  7  
3 1SXG GLU B 53  ? UNP P46828 GLN 105 CONFLICT 105 8  
3 1SXG GLN B 268 ? UNP P46828 GLU 320 CONFLICT 320 9  
4 1SXG THR I 35  ? UNP P46828 SER 87  CONFLICT 87  10 
4 1SXG GLU I 53  ? UNP P46828 GLN 105 CONFLICT 105 11 
4 1SXG GLN I 268 ? UNP P46828 GLU 320 CONFLICT 320 12 
5 1SXG THR P 35  ? UNP P46828 SER 87  CONFLICT 87  13 
5 1SXG GLU P 53  ? UNP P46828 GLN 105 CONFLICT 105 14 
5 1SXG GLN P 268 ? UNP P46828 GLU 320 CONFLICT 320 15 
6 1SXG THR F 35  ? UNP P46828 SER 87  CONFLICT 87  16 
6 1SXG GLU F 53  ? UNP P46828 GLN 105 CONFLICT 105 17 
6 1SXG GLN F 268 ? UNP P46828 GLU 320 CONFLICT 320 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
171 non-polymer         . '2-PHENYLAMINO-ETHANESULFONIC ACID' ? 'C8 H11 N O3 S'  201.243 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SXG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   47.1 
_exptl_crystal.density_Matthews      2.35 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.pH              9.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350, CHES, pH 9.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-02-13 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0800 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0800 
# 
_reflns.entry_id                     1SXG 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             75.29 
_reflns.d_resolution_high            2.71 
_reflns.number_obs                   44614 
_reflns.number_all                   44614 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.084 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        57.0 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.92 
_reflns_shell.percent_possible_all   98.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SXG 
_refine.ls_number_reflns_obs                     43817 
_refine.ls_number_reflns_all                     43833 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2087670.52 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             75.29 
_refine.ls_d_res_high                            2.75 
_refine.ls_percent_reflns_obs                    98.9 
_refine.ls_R_factor_obs                          0.2141 
_refine.ls_R_factor_all                          0.223 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  4413 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               43.6 
_refine.aniso_B[1][1]                            -3.74 
_refine.aniso_B[2][2]                            -2.81 
_refine.aniso_B[3][3]                            6.55 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.38 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.335193 
_refine.solvent_model_param_bsol                 37.0764 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'P212121 apo structure' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SXG 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.46 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.44 
_refine_analyze.Luzzati_sigma_a_free            0.56 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12774 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.number_atoms_solvent             139 
_refine_hist.number_atoms_total               12939 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        75.29 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.6  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.96  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.75 
_refine_ls_shell.d_res_low                        2.92 
_refine_ls_shell.number_reflns_R_work             6238 
_refine_ls_shell.R_factor_R_work                  0.334 
_refine_ls_shell.percent_reflns_obs               94.6 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            9.8 
_refine_ls_shell.number_reflns_R_free             681 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP                              'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM    WATER.TOP                                'X-RAY DIFFRACTION' 
3 CHES_XPLOR_PAR.TXT CHES_XPLOR_TOP.TXT                       'X-RAY DIFFRACTION' 
4 ION.PARAM          'ION.TOP OTHER REFINEMENT REMARKS: NULL' 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1SXG 
_struct.title                     'Structural studies on the apo transcription factor form B. megaterium' 
_struct.pdbx_descriptor           'Glucose-resistance amylase regulator' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SXG 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'allosterism; phosphoprotein; transcription regulation, transcription' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 20  ? LYS A 38  ? ASN A 72  LYS A 90  1 ? 19 
HELX_P HELX_P2  2  ASN A 49  ? LYS A 63  ? ASN A 101 LYS A 115 1 ? 15 
HELX_P HELX_P3  3  THR A 76  ? SER A 86  ? THR A 128 SER A 138 1 ? 11 
HELX_P HELX_P4  4  ASP A 108 ? ASP A 122 ? ASP A 160 ASP A 174 1 ? 15 
HELX_P HELX_P5  5  GLU A 137 ? ALA A 142 ? GLU A 189 ALA A 194 1 ? 6  
HELX_P HELX_P6  6  LYS A 143 ? SER A 155 ? LYS A 195 SER A 207 1 ? 13 
HELX_P HELX_P7  7  ARG A 160 ? SER A 162 ? ARG A 212 SER A 214 5 ? 3  
HELX_P HELX_P8  8  THR A 170 ? GLU A 183 ? THR A 222 GLU A 235 1 ? 14 
HELX_P HELX_P9  9  THR A 195 ? GLY A 210 ? THR A 247 GLY A 262 1 ? 16 
HELX_P HELX_P10 10 THR A 225 ? MET A 230 ? THR A 277 MET A 282 5 ? 6  
HELX_P HELX_P11 11 PRO A 241 ? ASN A 258 ? PRO A 293 ASN A 310 1 ? 18 
HELX_P HELX_P12 12 ASN B 20  ? TYR B 37  ? ASN D 72  TYR D 89  1 ? 18 
HELX_P HELX_P13 13 ASN B 49  ? LYS B 63  ? ASN D 101 LYS D 115 1 ? 15 
HELX_P HELX_P14 14 THR B 76  ? LYS B 85  ? THR D 128 LYS D 137 1 ? 10 
HELX_P HELX_P15 15 ASP B 108 ? SER B 123 ? ASP D 160 SER D 175 1 ? 16 
HELX_P HELX_P16 16 GLU B 137 ? ALA B 142 ? GLU D 189 ALA D 194 1 ? 6  
HELX_P HELX_P17 17 LYS B 143 ? SER B 155 ? LYS D 195 SER D 207 1 ? 13 
HELX_P HELX_P18 18 ARG B 160 ? SER B 162 ? ARG D 212 SER D 214 5 ? 3  
HELX_P HELX_P19 19 THR B 170 ? GLU B 183 ? THR D 222 GLU D 235 1 ? 14 
HELX_P HELX_P20 20 THR B 195 ? ARG B 209 ? THR D 247 ARG D 261 1 ? 15 
HELX_P HELX_P21 21 THR B 225 ? MET B 230 ? THR D 277 MET D 282 5 ? 6  
HELX_P HELX_P22 22 PRO B 241 ? ASN B 258 ? PRO D 293 ASN D 310 1 ? 18 
HELX_P HELX_P23 23 ASN C 20  ? LYS C 38  ? ASN B 72  LYS B 90  1 ? 19 
HELX_P HELX_P24 24 ASN C 49  ? LYS C 63  ? ASN B 101 LYS B 115 1 ? 15 
HELX_P HELX_P25 25 THR C 76  ? LYS C 85  ? THR B 128 LYS B 137 1 ? 10 
HELX_P HELX_P26 26 ASP C 108 ? HIS C 125 ? ASP B 160 HIS B 177 1 ? 18 
HELX_P HELX_P27 27 GLU C 137 ? ALA C 142 ? GLU B 189 ALA B 194 1 ? 6  
HELX_P HELX_P28 28 LYS C 143 ? GLU C 154 ? LYS B 195 GLU B 206 1 ? 12 
HELX_P HELX_P29 29 ARG C 160 ? ILE C 164 ? ARG B 212 ILE B 216 5 ? 5  
HELX_P HELX_P30 30 THR C 170 ? LEU C 182 ? THR B 222 LEU B 234 1 ? 13 
HELX_P HELX_P31 31 THR C 195 ? ARG C 209 ? THR B 247 ARG B 261 1 ? 15 
HELX_P HELX_P32 32 THR C 225 ? MET C 230 ? THR B 277 MET B 282 5 ? 6  
HELX_P HELX_P33 33 PRO C 241 ? ASN C 258 ? PRO B 293 ASN B 310 1 ? 18 
HELX_P HELX_P34 34 ASN D 20  ? TYR D 37  ? ASN I 72  TYR I 89  1 ? 18 
HELX_P HELX_P35 35 ASN D 49  ? LYS D 63  ? ASN I 101 LYS I 115 1 ? 15 
HELX_P HELX_P36 36 THR D 76  ? SER D 86  ? THR I 128 SER I 138 1 ? 11 
HELX_P HELX_P37 37 ASP D 108 ? ASP D 122 ? ASP I 160 ASP I 174 1 ? 15 
HELX_P HELX_P38 38 GLU D 137 ? LYS D 143 ? GLU I 189 LYS I 195 1 ? 7  
HELX_P HELX_P39 39 LYS D 143 ? SER D 155 ? LYS I 195 SER I 207 1 ? 13 
HELX_P HELX_P40 40 ARG D 160 ? SER D 162 ? ARG I 212 SER I 214 5 ? 3  
HELX_P HELX_P41 41 THR D 170 ? LEU D 182 ? THR I 222 LEU I 234 1 ? 13 
HELX_P HELX_P42 42 THR D 195 ? ARG D 209 ? THR I 247 ARG I 261 1 ? 15 
HELX_P HELX_P43 43 THR D 225 ? MET D 230 ? THR I 277 MET I 282 5 ? 6  
HELX_P HELX_P44 44 PRO D 241 ? MET D 257 ? PRO I 293 MET I 309 1 ? 17 
HELX_P HELX_P45 45 ASN E 20  ? TYR E 37  ? ASN P 72  TYR P 89  1 ? 18 
HELX_P HELX_P46 46 ASN E 49  ? LYS E 63  ? ASN P 101 LYS P 115 1 ? 15 
HELX_P HELX_P47 47 THR E 76  ? LEU E 83  ? THR P 128 LEU P 135 1 ? 8  
HELX_P HELX_P48 48 ASP E 108 ? SER E 123 ? ASP P 160 SER P 175 1 ? 16 
HELX_P HELX_P49 49 GLU E 137 ? ALA E 142 ? GLU P 189 ALA P 194 1 ? 6  
HELX_P HELX_P50 50 LYS E 143 ? SER E 155 ? LYS P 195 SER P 207 1 ? 13 
HELX_P HELX_P51 51 ARG E 160 ? SER E 162 ? ARG P 212 SER P 214 5 ? 3  
HELX_P HELX_P52 52 THR E 170 ? LEU E 182 ? THR P 222 LEU P 234 1 ? 13 
HELX_P HELX_P53 53 THR E 195 ? ARG E 209 ? THR P 247 ARG P 261 1 ? 15 
HELX_P HELX_P54 54 THR E 225 ? MET E 230 ? THR P 277 MET P 282 5 ? 6  
HELX_P HELX_P55 55 PRO E 241 ? LYS E 259 ? PRO P 293 LYS P 311 1 ? 19 
HELX_P HELX_P56 56 ASN F 20  ? TYR F 37  ? ASN F 72  TYR F 89  1 ? 18 
HELX_P HELX_P57 57 ASN F 49  ? LYS F 63  ? ASN F 101 LYS F 115 1 ? 15 
HELX_P HELX_P58 58 THR F 76  ? LYS F 85  ? THR F 128 LYS F 137 1 ? 10 
HELX_P HELX_P59 59 ASP F 108 ? ASP F 122 ? ASP F 160 ASP F 174 1 ? 15 
HELX_P HELX_P60 60 GLU F 137 ? ALA F 142 ? GLU F 189 ALA F 194 1 ? 6  
HELX_P HELX_P61 61 LYS F 143 ? GLU F 154 ? LYS F 195 GLU F 206 1 ? 12 
HELX_P HELX_P62 62 ARG F 160 ? SER F 162 ? ARG F 212 SER F 214 5 ? 3  
HELX_P HELX_P63 63 THR F 170 ? GLU F 183 ? THR F 222 GLU F 235 1 ? 14 
HELX_P HELX_P64 64 THR F 195 ? ARG F 209 ? THR F 247 ARG F 261 1 ? 15 
HELX_P HELX_P65 65 THR F 225 ? MET F 230 ? THR F 277 MET F 282 5 ? 6  
HELX_P HELX_P66 66 PRO F 241 ? ASN F 258 ? PRO F 293 ASN F 310 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  VAL 213 A . ? VAL 265 A PRO 214 A ? PRO 266 A 1 0.11  
2  ARG 232 A . ? ARG 284 A PRO 233 A ? PRO 285 A 1 -0.10 
3  VAL 213 B . ? VAL 265 D PRO 214 B ? PRO 266 D 1 0.59  
4  ARG 232 B . ? ARG 284 D PRO 233 B ? PRO 285 D 1 0.07  
5  VAL 213 C . ? VAL 265 B PRO 214 C ? PRO 266 B 1 -0.04 
6  ARG 232 C . ? ARG 284 B PRO 233 C ? PRO 285 B 1 -0.37 
7  VAL 213 D . ? VAL 265 I PRO 214 D ? PRO 266 I 1 0.54  
8  ARG 232 D . ? ARG 284 I PRO 233 D ? PRO 285 I 1 -0.23 
9  VAL 213 E . ? VAL 265 P PRO 214 E ? PRO 266 P 1 0.54  
10 ARG 232 E . ? ARG 284 P PRO 233 E ? PRO 285 P 1 0.05  
11 VAL 213 F . ? VAL 265 F PRO 214 F ? PRO 266 F 1 1.84  
12 ARG 232 F . ? ARG 284 F PRO 233 F ? PRO 285 F 1 -0.19 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
C ? 6 ? 
D ? 6 ? 
E ? 6 ? 
F ? 5 ? 
G ? 6 ? 
H ? 6 ? 
I ? 6 ? 
J ? 6 ? 
K ? 6 ? 
L ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 40  ? ASN A 45  ? ASN A 92  ASN A 97  
A 2 THR A 10  ? ILE A 15  ? THR A 62  ILE A 67  
A 3 GLY A 67  ? PHE A 70  ? GLY A 119 PHE A 122 
A 4 VAL A 90  ? ALA A 93  ? VAL A 142 ALA A 145 
A 5 SER A 104 ? ILE A 107 ? SER A 156 ILE A 159 
A 6 ILE A 266 ? LEU A 269 ? ILE A 318 LEU A 321 
B 1 ILE A 164 ? GLU A 166 ? ILE A 216 GLU A 218 
B 2 ILE A 128 ? SER A 132 ? ILE A 180 SER A 184 
B 3 ALA A 190 ? VAL A 193 ? ALA A 242 VAL A 245 
B 4 GLU A 218 ? ASP A 223 ? GLU A 270 ASP A 275 
B 5 THR A 236 ? VAL A 239 ? THR A 288 VAL A 291 
B 6 ARG A 272 ? GLU A 274 ? ARG A 324 GLU A 326 
C 1 ASN B 40  ? ASN B 45  ? ASN D 92  ASN D 97  
C 2 THR B 10  ? ILE B 15  ? THR D 62  ILE D 67  
C 3 GLY B 67  ? PHE B 70  ? GLY D 119 PHE D 122 
C 4 VAL B 90  ? ALA B 93  ? VAL D 142 ALA D 145 
C 5 SER B 104 ? THR B 106 ? SER D 156 THR D 158 
C 6 ILE B 266 ? GLN B 268 ? ILE D 318 GLN D 320 
D 1 ILE B 164 ? GLU B 166 ? ILE D 216 GLU D 218 
D 2 ILE B 128 ? SER B 132 ? ILE D 180 SER D 184 
D 3 ALA B 190 ? VAL B 193 ? ALA D 242 VAL D 245 
D 4 GLU B 218 ? ASP B 223 ? GLU D 270 ASP D 275 
D 5 THR B 236 ? VAL B 239 ? THR D 288 VAL D 291 
D 6 ARG B 272 ? GLU B 274 ? ARG D 324 GLU D 326 
E 1 ASN C 40  ? ASN C 45  ? ASN B 92  ASN B 97  
E 2 THR C 10  ? ILE C 15  ? THR B 62  ILE B 67  
E 3 GLY C 67  ? PHE C 70  ? GLY B 119 PHE B 122 
E 4 VAL C 90  ? ALA C 93  ? VAL B 142 ALA B 145 
E 5 SER C 104 ? ILE C 107 ? SER B 156 ILE B 159 
E 6 ILE C 266 ? LEU C 269 ? ILE B 318 LEU B 321 
F 1 ILE C 128 ? VAL C 131 ? ILE B 180 VAL B 183 
F 2 ALA C 190 ? VAL C 193 ? ALA B 242 VAL B 245 
F 3 GLU C 218 ? ASP C 223 ? GLU B 270 ASP B 275 
F 4 THR C 236 ? VAL C 239 ? THR B 288 VAL B 291 
F 5 ARG C 272 ? GLU C 274 ? ARG B 324 GLU B 326 
G 1 ASN D 40  ? ASN D 45  ? ASN I 92  ASN I 97  
G 2 THR D 10  ? ILE D 15  ? THR I 62  ILE I 67  
G 3 GLY D 67  ? PHE D 70  ? GLY I 119 PHE I 122 
G 4 VAL D 90  ? ALA D 93  ? VAL I 142 ALA I 145 
G 5 SER D 104 ? ILE D 107 ? SER I 156 ILE I 159 
G 6 ILE D 266 ? LEU D 269 ? ILE I 318 LEU I 321 
H 1 ILE D 164 ? GLU D 166 ? ILE I 216 GLU I 218 
H 2 ILE D 128 ? SER D 132 ? ILE I 180 SER I 184 
H 3 ALA D 190 ? VAL D 193 ? ALA I 242 VAL I 245 
H 4 GLU D 218 ? ASP D 223 ? GLU I 270 ASP I 275 
H 5 THR D 236 ? VAL D 239 ? THR I 288 VAL I 291 
H 6 ARG D 272 ? GLU D 274 ? ARG I 324 GLU I 326 
I 1 ASN E 40  ? ASN E 45  ? ASN P 92  ASN P 97  
I 2 THR E 10  ? ILE E 15  ? THR P 62  ILE P 67  
I 3 GLY E 67  ? PHE E 70  ? GLY P 119 PHE P 122 
I 4 VAL E 91  ? ALA E 93  ? VAL P 143 ALA P 145 
I 5 SER E 104 ? ILE E 107 ? SER P 156 ILE P 159 
I 6 ILE E 266 ? LEU E 269 ? ILE P 318 LEU P 321 
J 1 ILE E 164 ? GLU E 166 ? ILE P 216 GLU P 218 
J 2 ILE E 128 ? SER E 132 ? ILE P 180 SER P 184 
J 3 ALA E 190 ? VAL E 193 ? ALA P 242 VAL P 245 
J 4 GLU E 218 ? ASP E 223 ? GLU P 270 ASP P 275 
J 5 THR E 236 ? VAL E 239 ? THR P 288 VAL P 291 
J 6 ARG E 272 ? GLU E 274 ? ARG P 324 GLU P 326 
K 1 ASN F 40  ? ASN F 45  ? ASN F 92  ASN F 97  
K 2 THR F 10  ? ILE F 15  ? THR F 62  ILE F 67  
K 3 ILE F 68  ? PHE F 70  ? ILE F 120 PHE F 122 
K 4 VAL F 90  ? ALA F 93  ? VAL F 142 ALA F 145 
K 5 SER F 104 ? ILE F 107 ? SER F 156 ILE F 159 
K 6 ILE F 266 ? LEU F 269 ? ILE F 318 LEU F 321 
L 1 ILE F 164 ? GLU F 166 ? ILE F 216 GLU F 218 
L 2 ILE F 128 ? SER F 132 ? ILE F 180 SER F 184 
L 3 ALA F 190 ? VAL F 193 ? ALA F 242 VAL F 245 
L 4 GLU F 218 ? ASP F 223 ? GLU F 270 ASP F 275 
L 5 THR F 236 ? VAL F 239 ? THR F 288 VAL F 291 
L 6 ARG F 272 ? GLU F 274 ? ARG F 324 GLU F 326 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASN A 40  ? O ASN A 92  N VAL A 11  ? N VAL A 63  
A 2 3 N GLY A 12  ? N GLY A 64  O GLY A 67  ? O GLY A 119 
A 3 4 N ILE A 68  ? N ILE A 120 O VAL A 91  ? O VAL A 143 
A 4 5 N LEU A 92  ? N LEU A 144 O VAL A 105 ? O VAL A 157 
A 5 6 N THR A 106 ? N THR A 158 O LEU A 269 ? O LEU A 321 
B 1 2 O VAL A 165 ? O VAL A 217 N SER A 132 ? N SER A 184 
B 2 3 N ALA A 129 ? N ALA A 181 O PHE A 192 ? O PHE A 244 
B 3 4 N VAL A 193 ? N VAL A 245 O ILE A 220 ? O ILE A 272 
B 4 5 N GLY A 221 ? N GLY A 273 O THR A 236 ? O THR A 288 
B 5 6 N VAL A 239 ? N VAL A 291 O ARG A 272 ? O ARG A 324 
C 1 2 O ASN B 40  ? O ASN D 92  N VAL B 11  ? N VAL D 63  
C 2 3 N ILE B 14  ? N ILE D 66  O ILE B 69  ? O ILE D 121 
C 3 4 N PHE B 70  ? N PHE D 122 O ALA B 93  ? O ALA D 145 
C 4 5 N LEU B 92  ? N LEU D 144 O VAL B 105 ? O VAL D 157 
C 5 6 N SER B 104 ? N SER D 156 O VAL B 267 ? O VAL D 319 
D 1 2 O VAL B 165 ? O VAL D 217 N SER B 132 ? N SER D 184 
D 2 3 N ALA B 129 ? N ALA D 181 O PHE B 192 ? O PHE D 244 
D 3 4 N VAL B 193 ? N VAL D 245 O ILE B 220 ? O ILE D 272 
D 4 5 N ASP B 223 ? N ASP D 275 O VAL B 238 ? O VAL D 290 
D 5 6 N VAL B 239 ? N VAL D 291 O ARG B 272 ? O ARG D 324 
E 1 2 O ILE C 42  ? O ILE B 94  N VAL C 13  ? N VAL B 65  
E 2 3 N GLY C 12  ? N GLY B 64  O GLY C 67  ? O GLY B 119 
E 3 4 N ILE C 68  ? N ILE B 120 O VAL C 91  ? O VAL B 143 
E 4 5 N LEU C 92  ? N LEU B 144 O VAL C 105 ? O VAL B 157 
E 5 6 N THR C 106 ? N THR B 158 O LEU C 269 ? O LEU B 321 
F 1 2 N ALA C 129 ? N ALA B 181 O PHE C 192 ? O PHE B 244 
F 2 3 N ILE C 191 ? N ILE B 243 O GLU C 218 ? O GLU B 270 
F 3 4 N GLY C 221 ? N GLY B 273 O THR C 236 ? O THR B 288 
F 4 5 N SER C 237 ? N SER B 289 O GLU C 274 ? O GLU B 326 
G 1 2 O ILE D 42  ? O ILE I 94  N VAL D 13  ? N VAL I 65  
G 2 3 N GLY D 12  ? N GLY I 64  O GLY D 67  ? O GLY I 119 
G 3 4 N ILE D 68  ? N ILE I 120 O VAL D 91  ? O VAL I 143 
G 4 5 N LEU D 92  ? N LEU I 144 O VAL D 105 ? O VAL I 157 
G 5 6 N THR D 106 ? N THR I 158 O VAL D 267 ? O VAL I 319 
H 1 2 O VAL D 165 ? O VAL I 217 N SER D 132 ? N SER I 184 
H 2 3 N ALA D 129 ? N ALA I 181 O ALA D 190 ? O ALA I 242 
H 3 4 N VAL D 193 ? N VAL I 245 O ILE D 220 ? O ILE I 272 
H 4 5 N GLY D 221 ? N GLY I 273 O THR D 236 ? O THR I 288 
H 5 6 N VAL D 239 ? N VAL I 291 O ARG D 272 ? O ARG I 324 
I 1 2 O SER E 44  ? O SER P 96  N VAL E 13  ? N VAL P 65  
I 2 3 N GLY E 12  ? N GLY P 64  O GLY E 67  ? O GLY P 119 
I 3 4 N ILE E 68  ? N ILE P 120 O VAL E 91  ? O VAL P 143 
I 4 5 N LEU E 92  ? N LEU P 144 O VAL E 105 ? O VAL P 157 
I 5 6 N SER E 104 ? N SER P 156 O VAL E 267 ? O VAL P 319 
J 1 2 O VAL E 165 ? O VAL P 217 N SER E 132 ? N SER P 184 
J 2 3 N ALA E 129 ? N ALA P 181 O ALA E 190 ? O ALA P 242 
J 3 4 N ILE E 191 ? N ILE P 243 O GLU E 218 ? O GLU P 270 
J 4 5 N GLY E 221 ? N GLY P 273 O THR E 236 ? O THR P 288 
J 5 6 N VAL E 239 ? N VAL P 291 O ARG E 272 ? O ARG P 324 
K 1 2 O ILE F 42  ? O ILE F 94  N VAL F 11  ? N VAL F 63  
K 2 3 N ILE F 14  ? N ILE F 66  O ILE F 69  ? O ILE F 121 
K 3 4 N PHE F 70  ? N PHE F 122 O VAL F 91  ? O VAL F 143 
K 4 5 N LEU F 92  ? N LEU F 144 O VAL F 105 ? O VAL F 157 
K 5 6 N SER F 104 ? N SER F 156 O VAL F 267 ? O VAL F 319 
L 1 2 O VAL F 165 ? O VAL F 217 N SER F 132 ? N SER F 184 
L 2 3 N VAL F 131 ? N VAL F 183 O PHE F 192 ? O PHE F 244 
L 3 4 N VAL F 193 ? N VAL F 245 O ILE F 220 ? O ILE F 272 
L 4 5 N GLY F 221 ? N GLY F 273 O THR F 236 ? O THR F 288 
L 5 6 N VAL F 239 ? N VAL F 291 O ARG F 272 ? O ARG F 324 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 171 A 3256' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 171 B 5256' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ILE A 33  ? ILE A 85  . ? 1_555 ? 
2  AC1 7 MET A 36  ? MET A 88  . ? 1_555 ? 
3  AC1 7 ARG D 251 ? ARG I 303 . ? 4_546 ? 
4  AC1 7 LYS D 255 ? LYS I 307 . ? 4_546 ? 
5  AC1 7 VAL D 262 ? VAL I 314 . ? 4_546 ? 
6  AC1 7 ASP D 263 ? ASP I 315 . ? 4_546 ? 
7  AC1 7 SER D 264 ? SER I 316 . ? 4_546 ? 
8  AC2 7 TYR C 243 ? TYR B 295 . ? 1_555 ? 
9  AC2 7 ARG C 251 ? ARG B 303 . ? 1_555 ? 
10 AC2 7 ILE B 33  ? ILE D 85  . ? 4_555 ? 
11 AC2 7 ASP B 244 ? ASP D 296 . ? 4_555 ? 
12 AC2 7 ALA B 247 ? ALA D 299 . ? 4_555 ? 
13 AC2 7 VAL B 248 ? VAL D 300 . ? 4_555 ? 
14 AC2 7 ARG B 251 ? ARG D 303 . ? 4_555 ? 
# 
_atom_sites.entry_id                    1SXG 
_atom_sites.fract_transf_matrix[1][1]   0.002664 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000261 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016628 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013282 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LYS A 1 6   ? 136.611 -30.589 29.968 1.00 28.49 ? 58   LYS A N     1 
ATOM   2     C CA    . LYS A 1 6   ? 138.040 -30.986 29.982 1.00 28.91 ? 58   LYS A CA    1 
ATOM   3     C C     . LYS A 1 6   ? 138.752 -30.384 28.777 1.00 30.07 ? 58   LYS A C     1 
ATOM   4     O O     . LYS A 1 6   ? 139.741 -29.658 28.930 1.00 31.91 ? 58   LYS A O     1 
ATOM   5     C CB    . LYS A 1 6   ? 138.173 -32.505 29.928 1.00 29.72 ? 58   LYS A CB    1 
ATOM   6     C CG    . LYS A 1 6   ? 139.224 -33.092 30.855 1.00 30.26 ? 58   LYS A CG    1 
ATOM   7     C CD    . LYS A 1 6   ? 138.694 -33.203 32.265 1.00 31.93 ? 58   LYS A CD    1 
ATOM   8     C CE    . LYS A 1 6   ? 139.720 -33.819 33.204 1.00 34.82 ? 58   LYS A CE    1 
ATOM   9     N NZ    . LYS A 1 6   ? 140.980 -32.999 33.344 1.00 34.43 ? 58   LYS A NZ    1 
ATOM   10    N N     . LYS A 1 7   ? 138.246 -30.671 27.579 1.00 29.20 ? 59   LYS A N     1 
ATOM   11    C CA    . LYS A 1 7   ? 138.864 -30.174 26.349 1.00 29.09 ? 59   LYS A CA    1 
ATOM   12    C C     . LYS A 1 7   ? 139.175 -28.685 26.426 1.00 30.14 ? 59   LYS A C     1 
ATOM   13    O O     . LYS A 1 7   ? 138.276 -27.842 26.421 1.00 30.69 ? 59   LYS A O     1 
ATOM   14    C CB    . LYS A 1 7   ? 137.954 -30.454 25.154 1.00 28.12 ? 59   LYS A CB    1 
ATOM   15    C CG    . LYS A 1 7   ? 138.707 -30.744 23.850 1.00 28.17 ? 59   LYS A CG    1 
ATOM   16    C CD    . LYS A 1 7   ? 138.952 -29.514 23.004 1.00 27.20 ? 59   LYS A CD    1 
ATOM   17    C CE    . LYS A 1 7   ? 137.636 -28.935 22.476 1.00 28.00 ? 59   LYS A CE    1 
ATOM   18    N NZ    . LYS A 1 7   ? 137.825 -27.640 21.755 1.00 26.31 ? 59   LYS A NZ    1 
ATOM   19    N N     . THR A 1 8   ? 140.454 -28.354 26.505 1.00 30.14 ? 60   THR A N     1 
ATOM   20    C CA    . THR A 1 8   ? 140.824 -26.954 26.587 1.00 30.71 ? 60   THR A CA    1 
ATOM   21    C C     . THR A 1 8   ? 140.113 -26.166 25.507 1.00 31.00 ? 60   THR A C     1 
ATOM   22    O O     . THR A 1 8   ? 140.137 -26.541 24.347 1.00 30.26 ? 60   THR A O     1 
ATOM   23    C CB    . THR A 1 8   ? 142.325 -26.737 26.394 1.00 30.56 ? 60   THR A CB    1 
ATOM   24    O OG1   . THR A 1 8   ? 143.049 -27.397 27.440 1.00 31.42 ? 60   THR A OG1   1 
ATOM   25    C CG2   . THR A 1 8   ? 142.629 -25.263 26.428 1.00 28.16 ? 60   THR A CG2   1 
ATOM   26    N N     . THR A 1 9   ? 139.486 -25.067 25.898 1.00 32.56 ? 61   THR A N     1 
ATOM   27    C CA    . THR A 1 9   ? 138.779 -24.210 24.965 1.00 33.57 ? 61   THR A CA    1 
ATOM   28    C C     . THR A 1 9   ? 139.732 -23.172 24.373 1.00 33.31 ? 61   THR A C     1 
ATOM   29    O O     . THR A 1 9   ? 140.564 -22.616 25.090 1.00 33.72 ? 61   THR A O     1 
ATOM   30    C CB    . THR A 1 9   ? 137.646 -23.475 25.674 1.00 35.25 ? 61   THR A CB    1 
ATOM   31    O OG1   . THR A 1 9   ? 136.739 -24.437 26.230 1.00 36.21 ? 61   THR A OG1   1 
ATOM   32    C CG2   . THR A 1 9   ? 136.907 -22.553 24.693 1.00 35.81 ? 61   THR A CG2   1 
ATOM   33    N N     . THR A 1 10  ? 139.618 -22.921 23.071 1.00 32.23 ? 62   THR A N     1 
ATOM   34    C CA    . THR A 1 10  ? 140.465 -21.925 22.419 1.00 32.39 ? 62   THR A CA    1 
ATOM   35    C C     . THR A 1 10  ? 139.648 -20.891 21.625 1.00 30.14 ? 62   THR A C     1 
ATOM   36    O O     . THR A 1 10  ? 138.788 -21.240 20.822 1.00 28.75 ? 62   THR A O     1 
ATOM   37    C CB    . THR A 1 10  ? 141.490 -22.575 21.480 1.00 33.61 ? 62   THR A CB    1 
ATOM   38    O OG1   . THR A 1 10  ? 142.111 -21.556 20.692 1.00 37.69 ? 62   THR A OG1   1 
ATOM   39    C CG2   . THR A 1 10  ? 140.825 -23.554 20.559 1.00 36.62 ? 62   THR A CG2   1 
ATOM   40    N N     . VAL A 1 11  ? 139.908 -19.610 21.865 1.00 27.37 ? 63   VAL A N     1 
ATOM   41    C CA    . VAL A 1 11  ? 139.172 -18.594 21.151 1.00 24.92 ? 63   VAL A CA    1 
ATOM   42    C C     . VAL A 1 11  ? 140.082 -17.878 20.165 1.00 23.40 ? 63   VAL A C     1 
ATOM   43    O O     . VAL A 1 11  ? 141.286 -17.693 20.402 1.00 19.20 ? 63   VAL A O     1 
ATOM   44    C CB    . VAL A 1 11  ? 138.492 -17.575 22.118 1.00 25.61 ? 63   VAL A CB    1 
ATOM   45    C CG1   . VAL A 1 11  ? 138.052 -18.274 23.401 1.00 23.02 ? 63   VAL A CG1   1 
ATOM   46    C CG2   . VAL A 1 11  ? 139.406 -16.427 22.404 1.00 26.18 ? 63   VAL A CG2   1 
ATOM   47    N N     . GLY A 1 12  ? 139.486 -17.510 19.035 1.00 22.86 ? 64   GLY A N     1 
ATOM   48    C CA    . GLY A 1 12  ? 140.229 -16.843 17.992 1.00 21.88 ? 64   GLY A CA    1 
ATOM   49    C C     . GLY A 1 12  ? 139.962 -15.373 18.069 1.00 22.61 ? 64   GLY A C     1 
ATOM   50    O O     . GLY A 1 12  ? 138.839 -14.956 18.363 1.00 24.01 ? 64   GLY A O     1 
ATOM   51    N N     . VAL A 1 13  ? 140.994 -14.580 17.818 1.00 22.84 ? 65   VAL A N     1 
ATOM   52    C CA    . VAL A 1 13  ? 140.850 -13.138 17.861 1.00 25.30 ? 65   VAL A CA    1 
ATOM   53    C C     . VAL A 1 13  ? 141.435 -12.532 16.606 1.00 26.49 ? 65   VAL A C     1 
ATOM   54    O O     . VAL A 1 13  ? 142.566 -12.831 16.226 1.00 26.42 ? 65   VAL A O     1 
ATOM   55    C CB    . VAL A 1 13  ? 141.600 -12.505 19.064 1.00 25.65 ? 65   VAL A CB    1 
ATOM   56    C CG1   . VAL A 1 13  ? 141.119 -11.077 19.276 1.00 24.15 ? 65   VAL A CG1   1 
ATOM   57    C CG2   . VAL A 1 13  ? 141.404 -13.337 20.316 1.00 26.01 ? 65   VAL A CG2   1 
ATOM   58    N N     . ILE A 1 14  ? 140.666 -11.693 15.935 1.00 28.11 ? 66   ILE A N     1 
ATOM   59    C CA    . ILE A 1 14  ? 141.224 -11.054 14.765 1.00 29.47 ? 66   ILE A CA    1 
ATOM   60    C C     . ILE A 1 14  ? 141.140 -9.560  14.888 1.00 27.39 ? 66   ILE A C     1 
ATOM   61    O O     . ILE A 1 14  ? 140.117 -9.006  15.291 1.00 26.36 ? 66   ILE A O     1 
ATOM   62    C CB    . ILE A 1 14  ? 140.560 -11.510 13.433 1.00 32.14 ? 66   ILE A CB    1 
ATOM   63    C CG1   . ILE A 1 14  ? 139.059 -11.681 13.605 1.00 33.15 ? 66   ILE A CG1   1 
ATOM   64    C CG2   . ILE A 1 14  ? 141.223 -12.803 12.953 1.00 34.38 ? 66   ILE A CG2   1 
ATOM   65    C CD1   . ILE A 1 14  ? 138.431 -12.540 12.507 1.00 39.85 ? 66   ILE A CD1   1 
ATOM   66    N N     . ILE A 1 15  ? 142.257 -8.924  14.566 1.00 26.42 ? 67   ILE A N     1 
ATOM   67    C CA    . ILE A 1 15  ? 142.356 -7.488  14.601 1.00 26.14 ? 67   ILE A CA    1 
ATOM   68    C C     . ILE A 1 15  ? 142.573 -7.039  13.169 1.00 26.70 ? 67   ILE A C     1 
ATOM   69    O O     . ILE A 1 15  ? 143.124 -7.777  12.346 1.00 21.26 ? 67   ILE A O     1 
ATOM   70    C CB    . ILE A 1 15  ? 143.520 -7.030  15.499 1.00 26.08 ? 67   ILE A CB    1 
ATOM   71    C CG1   . ILE A 1 15  ? 144.861 -7.508  14.921 1.00 26.86 ? 67   ILE A CG1   1 
ATOM   72    C CG2   . ILE A 1 15  ? 143.298 -7.570  16.900 1.00 23.01 ? 67   ILE A CG2   1 
ATOM   73    C CD1   . ILE A 1 15  ? 146.073 -7.030  15.685 1.00 36.03 ? 67   ILE A CD1   1 
ATOM   74    N N     . PRO A 1 16  ? 142.125 -5.817  12.853 1.00 29.78 ? 68   PRO A N     1 
ATOM   75    C CA    . PRO A 1 16  ? 142.264 -5.263  11.507 1.00 33.40 ? 68   PRO A CA    1 
ATOM   76    C C     . PRO A 1 16  ? 143.697 -4.917  11.096 1.00 35.17 ? 68   PRO A C     1 
ATOM   77    O O     . PRO A 1 16  ? 144.032 -4.998  9.921  1.00 35.55 ? 68   PRO A O     1 
ATOM   78    C CB    . PRO A 1 16  ? 141.331 -4.056  11.543 1.00 32.29 ? 68   PRO A CB    1 
ATOM   79    C CG    . PRO A 1 16  ? 141.429 -3.612  12.934 1.00 32.11 ? 68   PRO A CG    1 
ATOM   80    C CD    . PRO A 1 16  ? 141.407 -4.881  13.734 1.00 29.77 ? 68   PRO A CD    1 
ATOM   81    N N     . ASP A 1 17  ? 144.542 -4.540  12.049 1.00 37.05 ? 69   ASP A N     1 
ATOM   82    C CA    . ASP A 1 17  ? 145.915 -4.234  11.695 1.00 40.96 ? 69   ASP A CA    1 
ATOM   83    C C     . ASP A 1 17  ? 146.905 -4.023  12.838 1.00 43.18 ? 69   ASP A C     1 
ATOM   84    O O     . ASP A 1 17  ? 146.542 -3.962  14.012 1.00 44.04 ? 69   ASP A O     1 
ATOM   85    C CB    . ASP A 1 17  ? 145.948 -3.024  10.758 1.00 43.41 ? 69   ASP A CB    1 
ATOM   86    C CG    . ASP A 1 17  ? 145.411 -1.763  11.403 1.00 45.68 ? 69   ASP A CG    1 
ATOM   87    O OD1   . ASP A 1 17  ? 146.021 -1.296  12.391 1.00 45.02 ? 69   ASP A OD1   1 
ATOM   88    O OD2   . ASP A 1 17  ? 144.380 -1.238  10.914 1.00 48.12 ? 69   ASP A OD2   1 
ATOM   89    N N     . ILE A 1 18  ? 148.174 -3.927  12.466 1.00 45.61 ? 70   ILE A N     1 
ATOM   90    C CA    . ILE A 1 18  ? 149.258 -3.707  13.407 1.00 48.26 ? 70   ILE A CA    1 
ATOM   91    C C     . ILE A 1 18  ? 149.435 -2.210  13.675 1.00 48.54 ? 70   ILE A C     1 
ATOM   92    O O     . ILE A 1 18  ? 150.017 -1.817  14.688 1.00 49.16 ? 70   ILE A O     1 
ATOM   93    C CB    . ILE A 1 18  ? 150.556 -4.325  12.844 1.00 50.48 ? 70   ILE A CB    1 
ATOM   94    C CG1   . ILE A 1 18  ? 150.627 -5.792  13.265 1.00 50.87 ? 70   ILE A CG1   1 
ATOM   95    C CG2   . ILE A 1 18  ? 151.788 -3.520  13.268 1.00 52.88 ? 70   ILE A CG2   1 
ATOM   96    C CD1   . ILE A 1 18  ? 149.459 -6.606  12.783 1.00 46.28 ? 70   ILE A CD1   1 
ATOM   97    N N     . SER A 1 19  ? 148.923 -1.385  12.762 1.00 48.46 ? 71   SER A N     1 
ATOM   98    C CA    . SER A 1 19  ? 148.996 0.071   12.888 1.00 48.33 ? 71   SER A CA    1 
ATOM   99    C C     . SER A 1 19  ? 148.271 0.570   14.130 1.00 47.93 ? 71   SER A C     1 
ATOM   100   O O     . SER A 1 19  ? 148.881 0.732   15.180 1.00 48.48 ? 71   SER A O     1 
ATOM   101   C CB    . SER A 1 19  ? 148.383 0.749   11.664 1.00 48.10 ? 71   SER A CB    1 
ATOM   102   O OG    . SER A 1 19  ? 149.214 0.588   10.539 1.00 51.34 ? 71   SER A OG    1 
ATOM   103   N N     . ASN A 1 20  ? 146.967 0.814   13.987 1.00 47.82 ? 72   ASN A N     1 
ATOM   104   C CA    . ASN A 1 20  ? 146.096 1.307   15.062 1.00 45.68 ? 72   ASN A CA    1 
ATOM   105   C C     . ASN A 1 20  ? 146.282 0.525   16.365 1.00 44.73 ? 72   ASN A C     1 
ATOM   106   O O     . ASN A 1 20  ? 145.567 -0.441  16.628 1.00 45.79 ? 72   ASN A O     1 
ATOM   107   C CB    . ASN A 1 20  ? 144.641 1.207   14.614 1.00 45.17 ? 72   ASN A CB    1 
ATOM   108   C CG    . ASN A 1 20  ? 143.733 2.141   15.373 1.00 46.49 ? 72   ASN A CG    1 
ATOM   109   O OD1   . ASN A 1 20  ? 144.044 2.565   16.492 1.00 46.97 ? 72   ASN A OD1   1 
ATOM   110   N ND2   . ASN A 1 20  ? 142.585 2.461   14.773 1.00 46.29 ? 72   ASN A ND2   1 
ATOM   111   N N     . ILE A 1 21  ? 147.224 0.970   17.190 1.00 43.16 ? 73   ILE A N     1 
ATOM   112   C CA    . ILE A 1 21  ? 147.536 0.290   18.434 1.00 40.91 ? 73   ILE A CA    1 
ATOM   113   C C     . ILE A 1 21  ? 146.362 0.086   19.371 1.00 39.77 ? 73   ILE A C     1 
ATOM   114   O O     . ILE A 1 21  ? 146.479 -0.663  20.327 1.00 42.00 ? 73   ILE A O     1 
ATOM   115   C CB    . ILE A 1 21  ? 148.720 0.994   19.220 1.00 42.54 ? 73   ILE A CB    1 
ATOM   116   C CG1   . ILE A 1 21  ? 148.198 1.966   20.289 1.00 40.17 ? 73   ILE A CG1   1 
ATOM   117   C CG2   . ILE A 1 21  ? 149.640 1.725   18.239 1.00 43.22 ? 73   ILE A CG2   1 
ATOM   118   C CD1   . ILE A 1 21  ? 147.640 3.236   19.754 1.00 42.45 ? 73   ILE A CD1   1 
ATOM   119   N N     . PHE A 1 22  ? 145.231 0.735   19.133 1.00 37.86 ? 74   PHE A N     1 
ATOM   120   C CA    . PHE A 1 22  ? 144.107 0.508   20.033 1.00 35.70 ? 74   PHE A CA    1 
ATOM   121   C C     . PHE A 1 22  ? 143.631 -0.936  19.892 1.00 35.44 ? 74   PHE A C     1 
ATOM   122   O O     . PHE A 1 22  ? 143.385 -1.619  20.881 1.00 35.21 ? 74   PHE A O     1 
ATOM   123   C CB    . PHE A 1 22  ? 142.950 1.460   19.737 1.00 34.03 ? 74   PHE A CB    1 
ATOM   124   C CG    . PHE A 1 22  ? 141.616 0.955   20.224 1.00 32.41 ? 74   PHE A CG    1 
ATOM   125   C CD1   . PHE A 1 22  ? 140.695 0.421   19.329 1.00 30.71 ? 74   PHE A CD1   1 
ATOM   126   C CD2   . PHE A 1 22  ? 141.288 0.989   21.581 1.00 31.74 ? 74   PHE A CD2   1 
ATOM   127   C CE1   . PHE A 1 22  ? 139.467 -0.075  19.778 1.00 31.28 ? 74   PHE A CE1   1 
ATOM   128   C CE2   . PHE A 1 22  ? 140.058 0.492   22.035 1.00 31.19 ? 74   PHE A CE2   1 
ATOM   129   C CZ    . PHE A 1 22  ? 139.148 -0.039  21.130 1.00 30.22 ? 74   PHE A CZ    1 
ATOM   130   N N     . TYR A 1 23  ? 143.504 -1.402  18.656 1.00 35.39 ? 75   TYR A N     1 
ATOM   131   C CA    . TYR A 1 23  ? 143.056 -2.764  18.420 1.00 35.07 ? 75   TYR A CA    1 
ATOM   132   C C     . TYR A 1 23  ? 143.955 -3.770  19.120 1.00 35.20 ? 75   TYR A C     1 
ATOM   133   O O     . TYR A 1 23  ? 143.465 -4.671  19.812 1.00 35.40 ? 75   TYR A O     1 
ATOM   134   C CB    . TYR A 1 23  ? 142.997 -3.047  16.919 1.00 34.98 ? 75   TYR A CB    1 
ATOM   135   C CG    . TYR A 1 23  ? 141.814 -2.384  16.250 1.00 38.11 ? 75   TYR A CG    1 
ATOM   136   C CD1   . TYR A 1 23  ? 140.510 -2.658  16.669 1.00 39.34 ? 75   TYR A CD1   1 
ATOM   137   C CD2   . TYR A 1 23  ? 141.993 -1.459  15.229 1.00 38.52 ? 75   TYR A CD2   1 
ATOM   138   C CE1   . TYR A 1 23  ? 139.423 -2.027  16.096 1.00 39.95 ? 75   TYR A CE1   1 
ATOM   139   C CE2   . TYR A 1 23  ? 140.911 -0.821  14.644 1.00 39.98 ? 75   TYR A CE2   1 
ATOM   140   C CZ    . TYR A 1 23  ? 139.626 -1.106  15.083 1.00 41.73 ? 75   TYR A CZ    1 
ATOM   141   O OH    . TYR A 1 23  ? 138.543 -0.455  14.510 1.00 45.42 ? 75   TYR A OH    1 
ATOM   142   N N     . ALA A 1 24  ? 145.265 -3.604  18.957 1.00 34.14 ? 76   ALA A N     1 
ATOM   143   C CA    . ALA A 1 24  ? 146.244 -4.498  19.573 1.00 33.65 ? 76   ALA A CA    1 
ATOM   144   C C     . ALA A 1 24  ? 146.111 -4.507  21.097 1.00 33.44 ? 76   ALA A C     1 
ATOM   145   O O     . ALA A 1 24  ? 146.155 -5.570  21.740 1.00 31.83 ? 76   ALA A O     1 
ATOM   146   C CB    . ALA A 1 24  ? 147.643 -4.074  19.178 1.00 34.44 ? 76   ALA A CB    1 
ATOM   147   N N     . GLU A 1 25  ? 145.959 -3.319  21.673 1.00 32.60 ? 77   GLU A N     1 
ATOM   148   C CA    . GLU A 1 25  ? 145.791 -3.202  23.111 1.00 32.34 ? 77   GLU A CA    1 
ATOM   149   C C     . GLU A 1 25  ? 144.526 -3.945  23.521 1.00 31.29 ? 77   GLU A C     1 
ATOM   150   O O     . GLU A 1 25  ? 144.533 -4.700  24.486 1.00 30.68 ? 77   GLU A O     1 
ATOM   151   C CB    . GLU A 1 25  ? 145.733 -1.726  23.524 1.00 33.10 ? 77   GLU A CB    1 
ATOM   152   C CG    . GLU A 1 25  ? 147.119 -1.112  23.694 1.00 36.99 ? 77   GLU A CG    1 
ATOM   153   C CD    . GLU A 1 25  ? 147.103 0.378   24.027 1.00 39.49 ? 77   GLU A CD    1 
ATOM   154   O OE1   . GLU A 1 25  ? 146.355 0.785   24.952 1.00 40.39 ? 77   GLU A OE1   1 
ATOM   155   O OE2   . GLU A 1 25  ? 147.855 1.135   23.368 1.00 36.72 ? 77   GLU A OE2   1 
ATOM   156   N N     . LEU A 1 26  ? 143.447 -3.752  22.773 1.00 32.18 ? 78   LEU A N     1 
ATOM   157   C CA    . LEU A 1 26  ? 142.191 -4.435  23.071 1.00 33.58 ? 78   LEU A CA    1 
ATOM   158   C C     . LEU A 1 26  ? 142.380 -5.948  22.953 1.00 33.95 ? 78   LEU A C     1 
ATOM   159   O O     . LEU A 1 26  ? 141.850 -6.714  23.756 1.00 33.26 ? 78   LEU A O     1 
ATOM   160   C CB    . LEU A 1 26  ? 141.091 -4.001  22.099 1.00 34.66 ? 78   LEU A CB    1 
ATOM   161   C CG    . LEU A 1 26  ? 139.643 -3.817  22.592 1.00 33.39 ? 78   LEU A CG    1 
ATOM   162   C CD1   . LEU A 1 26  ? 138.728 -3.883  21.386 1.00 36.82 ? 78   LEU A CD1   1 
ATOM   163   C CD2   . LEU A 1 26  ? 139.237 -4.864  23.592 1.00 33.48 ? 78   LEU A CD2   1 
ATOM   164   N N     . ALA A 1 27  ? 143.123 -6.382  21.940 1.00 34.49 ? 79   ALA A N     1 
ATOM   165   C CA    . ALA A 1 27  ? 143.359 -7.811  21.765 1.00 35.79 ? 79   ALA A CA    1 
ATOM   166   C C     . ALA A 1 27  ? 144.048 -8.304  23.023 1.00 36.88 ? 79   ALA A C     1 
ATOM   167   O O     . ALA A 1 27  ? 143.736 -9.371  23.560 1.00 36.60 ? 79   ALA A O     1 
ATOM   168   C CB    . ALA A 1 27  ? 144.240 -8.070  20.553 1.00 34.20 ? 79   ALA A CB    1 
ATOM   169   N N     . ARG A 1 28  ? 144.996 -7.511  23.495 1.00 38.13 ? 80   ARG A N     1 
ATOM   170   C CA    . ARG A 1 28  ? 145.714 -7.871  24.699 1.00 39.81 ? 80   ARG A CA    1 
ATOM   171   C C     . ARG A 1 28  ? 144.753 -7.907  25.872 1.00 39.67 ? 80   ARG A C     1 
ATOM   172   O O     . ARG A 1 28  ? 144.856 -8.776  26.734 1.00 41.42 ? 80   ARG A O     1 
ATOM   173   C CB    . ARG A 1 28  ? 146.823 -6.867  24.971 1.00 41.92 ? 80   ARG A CB    1 
ATOM   174   C CG    . ARG A 1 28  ? 148.169 -7.364  24.578 1.00 43.81 ? 80   ARG A CG    1 
ATOM   175   C CD    . ARG A 1 28  ? 149.083 -7.142  25.754 1.00 48.46 ? 80   ARG A CD    1 
ATOM   176   N NE    . ARG A 1 28  ? 150.226 -8.047  25.748 1.00 49.50 ? 80   ARG A NE    1 
ATOM   177   C CZ    . ARG A 1 28  ? 150.126 -9.367  25.665 1.00 48.91 ? 80   ARG A CZ    1 
ATOM   178   N NH1   . ARG A 1 28  ? 148.937 -9.945  25.572 1.00 47.00 ? 80   ARG A NH1   1 
ATOM   179   N NH2   . ARG A 1 28  ? 151.221 -10.107 25.696 1.00 51.74 ? 80   ARG A NH2   1 
ATOM   180   N N     . GLY A 1 29  ? 143.818 -6.961  25.905 1.00 38.26 ? 81   GLY A N     1 
ATOM   181   C CA    . GLY A 1 29  ? 142.851 -6.935  26.987 1.00 37.06 ? 81   GLY A CA    1 
ATOM   182   C C     . GLY A 1 29  ? 141.996 -8.186  26.955 1.00 36.00 ? 81   GLY A C     1 
ATOM   183   O O     . GLY A 1 29  ? 141.668 -8.759  27.987 1.00 35.58 ? 81   GLY A O     1 
ATOM   184   N N     . ILE A 1 30  ? 141.638 -8.611  25.750 1.00 35.70 ? 82   ILE A N     1 
ATOM   185   C CA    . ILE A 1 30  ? 140.828 -9.798  25.576 1.00 36.55 ? 82   ILE A CA    1 
ATOM   186   C C     . ILE A 1 30  ? 141.618 -11.023 26.050 1.00 37.48 ? 82   ILE A C     1 
ATOM   187   O O     . ILE A 1 30  ? 141.133 -11.826 26.847 1.00 36.42 ? 82   ILE A O     1 
ATOM   188   C CB    . ILE A 1 30  ? 140.395 -9.908  24.096 1.00 36.29 ? 82   ILE A CB    1 
ATOM   189   C CG1   . ILE A 1 30  ? 139.372 -8.801  23.803 1.00 37.45 ? 82   ILE A CG1   1 
ATOM   190   C CG2   . ILE A 1 30  ? 139.798 -11.268 23.808 1.00 34.72 ? 82   ILE A CG2   1 
ATOM   191   C CD1   . ILE A 1 30  ? 139.245 -8.393  22.354 1.00 40.52 ? 82   ILE A CD1   1 
ATOM   192   N N     . GLU A 1 31  ? 142.851 -11.148 25.584 1.00 38.92 ? 83   GLU A N     1 
ATOM   193   C CA    . GLU A 1 31  ? 143.688 -12.261 25.992 1.00 40.19 ? 83   GLU A CA    1 
ATOM   194   C C     . GLU A 1 31  ? 143.781 -12.348 27.515 1.00 41.11 ? 83   GLU A C     1 
ATOM   195   O O     . GLU A 1 31  ? 143.744 -13.429 28.091 1.00 42.49 ? 83   GLU A O     1 
ATOM   196   C CB    . GLU A 1 31  ? 145.080 -12.108 25.392 1.00 39.39 ? 83   GLU A CB    1 
ATOM   197   C CG    . GLU A 1 31  ? 146.109 -12.989 26.040 1.00 39.18 ? 83   GLU A CG    1 
ATOM   198   C CD    . GLU A 1 31  ? 147.253 -13.281 25.118 1.00 38.69 ? 83   GLU A CD    1 
ATOM   199   O OE1   . GLU A 1 31  ? 147.660 -12.356 24.388 1.00 39.03 ? 83   GLU A OE1   1 
ATOM   200   O OE2   . GLU A 1 31  ? 147.747 -14.430 25.128 1.00 38.60 ? 83   GLU A OE2   1 
ATOM   201   N N     . ASP A 1 32  ? 143.898 -11.205 28.168 1.00 42.76 ? 84   ASP A N     1 
ATOM   202   C CA    . ASP A 1 32  ? 143.984 -11.177 29.620 1.00 43.85 ? 84   ASP A CA    1 
ATOM   203   C C     . ASP A 1 32  ? 142.781 -11.840 30.280 1.00 43.01 ? 84   ASP A C     1 
ATOM   204   O O     . ASP A 1 32  ? 142.926 -12.760 31.088 1.00 42.13 ? 84   ASP A O     1 
ATOM   205   C CB    . ASP A 1 32  ? 144.097 -9.734  30.098 1.00 46.28 ? 84   ASP A CB    1 
ATOM   206   C CG    . ASP A 1 32  ? 145.420 -9.454  30.761 1.00 49.32 ? 84   ASP A CG    1 
ATOM   207   O OD1   . ASP A 1 32  ? 145.604 -9.925  31.902 1.00 51.21 ? 84   ASP A OD1   1 
ATOM   208   O OD2   . ASP A 1 32  ? 146.273 -8.777  30.142 1.00 51.20 ? 84   ASP A OD2   1 
ATOM   209   N N     . ILE A 1 33  ? 141.593 -11.356 29.937 1.00 42.04 ? 85   ILE A N     1 
ATOM   210   C CA    . ILE A 1 33  ? 140.366 -11.894 30.493 1.00 40.34 ? 85   ILE A CA    1 
ATOM   211   C C     . ILE A 1 33  ? 140.258 -13.366 30.140 1.00 38.98 ? 85   ILE A C     1 
ATOM   212   O O     . ILE A 1 33  ? 139.762 -14.173 30.920 1.00 38.72 ? 85   ILE A O     1 
ATOM   213   C CB    . ILE A 1 33  ? 139.141 -11.161 29.923 1.00 41.35 ? 85   ILE A CB    1 
ATOM   214   C CG1   . ILE A 1 33  ? 139.185 -9.687  30.333 1.00 41.18 ? 85   ILE A CG1   1 
ATOM   215   C CG2   . ILE A 1 33  ? 137.852 -11.839 30.402 1.00 41.53 ? 85   ILE A CG2   1 
ATOM   216   C CD1   . ILE A 1 33  ? 139.160 -9.473  31.835 1.00 43.78 ? 85   ILE A CD1   1 
ATOM   217   N N     . ALA A 1 34  ? 140.738 -13.716 28.959 1.00 38.02 ? 86   ALA A N     1 
ATOM   218   C CA    . ALA A 1 34  ? 140.655 -15.094 28.517 1.00 38.32 ? 86   ALA A CA    1 
ATOM   219   C C     . ALA A 1 34  ? 141.512 -16.015 29.366 1.00 38.59 ? 86   ALA A C     1 
ATOM   220   O O     . ALA A 1 34  ? 141.135 -17.158 29.630 1.00 38.80 ? 86   ALA A O     1 
ATOM   221   C CB    . ALA A 1 34  ? 141.052 -15.198 27.064 1.00 36.48 ? 86   ALA A CB    1 
ATOM   222   N N     . THR A 1 35  ? 142.661 -15.521 29.802 1.00 38.92 ? 87   THR A N     1 
ATOM   223   C CA    . THR A 1 35  ? 143.555 -16.329 30.618 1.00 39.60 ? 87   THR A CA    1 
ATOM   224   C C     . THR A 1 35  ? 142.898 -16.798 31.914 1.00 39.42 ? 87   THR A C     1 
ATOM   225   O O     . THR A 1 35  ? 143.173 -17.896 32.393 1.00 40.75 ? 87   THR A O     1 
ATOM   226   C CB    . THR A 1 35  ? 144.842 -15.561 30.953 1.00 39.15 ? 87   THR A CB    1 
ATOM   227   O OG1   . THR A 1 35  ? 145.599 -15.365 29.755 1.00 40.70 ? 87   THR A OG1   1 
ATOM   228   C CG2   . THR A 1 35  ? 145.685 -16.338 31.938 1.00 41.40 ? 87   THR A CG2   1 
ATOM   229   N N     . MET A 1 36  ? 142.022 -15.978 32.478 1.00 39.14 ? 88   MET A N     1 
ATOM   230   C CA    . MET A 1 36  ? 141.350 -16.346 33.715 1.00 38.50 ? 88   MET A CA    1 
ATOM   231   C C     . MET A 1 36  ? 140.251 -17.377 33.486 1.00 36.92 ? 88   MET A C     1 
ATOM   232   O O     . MET A 1 36  ? 139.927 -18.156 34.381 1.00 36.27 ? 88   MET A O     1 
ATOM   233   C CB    . MET A 1 36  ? 140.841 -15.086 34.405 1.00 40.18 ? 88   MET A CB    1 
ATOM   234   C CG    . MET A 1 36  ? 142.022 -14.215 34.842 1.00 43.32 ? 88   MET A CG    1 
ATOM   235   S SD    . MET A 1 36  ? 141.585 -12.659 35.582 1.00 48.36 ? 88   MET A SD    1 
ATOM   236   C CE    . MET A 1 36  ? 140.389 -12.089 34.311 1.00 46.17 ? 88   MET A CE    1 
ATOM   237   N N     . TYR A 1 37  ? 139.693 -17.390 32.279 1.00 35.17 ? 89   TYR A N     1 
ATOM   238   C CA    . TYR A 1 37  ? 138.690 -18.388 31.921 1.00 32.97 ? 89   TYR A CA    1 
ATOM   239   C C     . TYR A 1 37  ? 139.497 -19.658 31.686 1.00 32.19 ? 89   TYR A C     1 
ATOM   240   O O     . TYR A 1 37  ? 138.976 -20.763 31.723 1.00 31.68 ? 89   TYR A O     1 
ATOM   241   C CB    . TYR A 1 37  ? 137.970 -18.008 30.620 1.00 30.39 ? 89   TYR A CB    1 
ATOM   242   C CG    . TYR A 1 37  ? 136.786 -17.076 30.776 1.00 26.93 ? 89   TYR A CG    1 
ATOM   243   C CD1   . TYR A 1 37  ? 135.482 -17.554 30.650 1.00 23.42 ? 89   TYR A CD1   1 
ATOM   244   C CD2   . TYR A 1 37  ? 136.968 -15.712 31.029 1.00 26.10 ? 89   TYR A CD2   1 
ATOM   245   C CE1   . TYR A 1 37  ? 134.391 -16.705 30.768 1.00 22.15 ? 89   TYR A CE1   1 
ATOM   246   C CE2   . TYR A 1 37  ? 135.878 -14.853 31.149 1.00 23.76 ? 89   TYR A CE2   1 
ATOM   247   C CZ    . TYR A 1 37  ? 134.600 -15.363 31.017 1.00 23.07 ? 89   TYR A CZ    1 
ATOM   248   O OH    . TYR A 1 37  ? 133.529 -14.535 31.150 1.00 24.79 ? 89   TYR A OH    1 
ATOM   249   N N     . LYS A 1 38  ? 140.788 -19.462 31.447 1.00 33.19 ? 90   LYS A N     1 
ATOM   250   C CA    . LYS A 1 38  ? 141.736 -20.533 31.184 1.00 34.71 ? 90   LYS A CA    1 
ATOM   251   C C     . LYS A 1 38  ? 141.668 -20.969 29.728 1.00 35.39 ? 90   LYS A C     1 
ATOM   252   O O     . LYS A 1 38  ? 142.081 -22.069 29.383 1.00 35.97 ? 90   LYS A O     1 
ATOM   253   C CB    . LYS A 1 38  ? 141.483 -21.722 32.103 1.00 35.50 ? 90   LYS A CB    1 
ATOM   254   C CG    . LYS A 1 38  ? 142.638 -22.011 33.038 1.00 38.59 ? 90   LYS A CG    1 
ATOM   255   C CD    . LYS A 1 38  ? 142.928 -20.856 33.974 1.00 38.86 ? 90   LYS A CD    1 
ATOM   256   C CE    . LYS A 1 38  ? 144.114 -21.185 34.858 1.00 42.31 ? 90   LYS A CE    1 
ATOM   257   N NZ    . LYS A 1 38  ? 145.341 -21.521 34.059 1.00 42.82 ? 90   LYS A NZ    1 
ATOM   258   N N     . TYR A 1 39  ? 141.159 -20.081 28.881 1.00 35.24 ? 91   TYR A N     1 
ATOM   259   C CA    . TYR A 1 39  ? 141.027 -20.327 27.454 1.00 35.60 ? 91   TYR A CA    1 
ATOM   260   C C     . TYR A 1 39  ? 142.350 -20.135 26.715 1.00 36.88 ? 91   TYR A C     1 
ATOM   261   O O     . TYR A 1 39  ? 143.294 -19.555 27.246 1.00 37.11 ? 91   TYR A O     1 
ATOM   262   C CB    . TYR A 1 39  ? 140.040 -19.333 26.850 1.00 34.77 ? 91   TYR A CB    1 
ATOM   263   C CG    . TYR A 1 39  ? 138.601 -19.465 27.267 1.00 34.05 ? 91   TYR A CG    1 
ATOM   264   C CD1   . TYR A 1 39  ? 137.750 -18.368 27.195 1.00 33.30 ? 91   TYR A CD1   1 
ATOM   265   C CD2   . TYR A 1 39  ? 138.066 -20.686 27.662 1.00 34.51 ? 91   TYR A CD2   1 
ATOM   266   C CE1   . TYR A 1 39  ? 136.411 -18.479 27.495 1.00 32.21 ? 91   TYR A CE1   1 
ATOM   267   C CE2   . TYR A 1 39  ? 136.717 -20.804 27.967 1.00 32.80 ? 91   TYR A CE2   1 
ATOM   268   C CZ    . TYR A 1 39  ? 135.902 -19.690 27.877 1.00 32.21 ? 91   TYR A CZ    1 
ATOM   269   O OH    . TYR A 1 39  ? 134.564 -19.765 28.156 1.00 33.21 ? 91   TYR A OH    1 
ATOM   270   N N     . ASN A 1 40  ? 142.397 -20.613 25.476 1.00 37.90 ? 92   ASN A N     1 
ATOM   271   C CA    . ASN A 1 40  ? 143.560 -20.420 24.625 1.00 38.84 ? 92   ASN A CA    1 
ATOM   272   C C     . ASN A 1 40  ? 143.181 -19.310 23.671 1.00 38.26 ? 92   ASN A C     1 
ATOM   273   O O     . ASN A 1 40  ? 141.996 -19.109 23.366 1.00 37.84 ? 92   ASN A O     1 
ATOM   274   C CB    . ASN A 1 40  ? 143.894 -21.661 23.805 1.00 43.21 ? 92   ASN A CB    1 
ATOM   275   C CG    . ASN A 1 40  ? 144.531 -22.747 24.630 1.00 44.66 ? 92   ASN A CG    1 
ATOM   276   O OD1   . ASN A 1 40  ? 143.955 -23.809 24.813 1.00 49.02 ? 92   ASN A OD1   1 
ATOM   277   N ND2   . ASN A 1 40  ? 145.721 -22.489 25.132 1.00 43.61 ? 92   ASN A ND2   1 
ATOM   278   N N     . ILE A 1 41  ? 144.190 -18.593 23.198 1.00 36.74 ? 93   ILE A N     1 
ATOM   279   C CA    . ILE A 1 41  ? 143.948 -17.501 22.289 1.00 36.43 ? 93   ILE A CA    1 
ATOM   280   C C     . ILE A 1 41  ? 144.863 -17.521 21.081 1.00 35.81 ? 93   ILE A C     1 
ATOM   281   O O     . ILE A 1 41  ? 146.082 -17.593 21.204 1.00 35.89 ? 93   ILE A O     1 
ATOM   282   C CB    . ILE A 1 41  ? 144.094 -16.126 23.009 1.00 37.38 ? 93   ILE A CB    1 
ATOM   283   C CG1   . ILE A 1 41  ? 142.749 -15.663 23.565 1.00 37.10 ? 93   ILE A CG1   1 
ATOM   284   C CG2   . ILE A 1 41  ? 144.595 -15.065 22.041 1.00 38.81 ? 93   ILE A CG2   1 
ATOM   285   C CD1   . ILE A 1 41  ? 142.148 -16.602 24.554 1.00 41.49 ? 93   ILE A CD1   1 
ATOM   286   N N     . ILE A 1 42  ? 144.248 -17.457 19.909 1.00 35.74 ? 94   ILE A N     1 
ATOM   287   C CA    . ILE A 1 42  ? 144.972 -17.398 18.642 1.00 34.19 ? 94   ILE A CA    1 
ATOM   288   C C     . ILE A 1 42  ? 144.617 -16.032 18.051 1.00 32.37 ? 94   ILE A C     1 
ATOM   289   O O     . ILE A 1 42  ? 143.442 -15.694 17.905 1.00 31.58 ? 94   ILE A O     1 
ATOM   290   C CB    . ILE A 1 42  ? 144.518 -18.497 17.679 1.00 34.65 ? 94   ILE A CB    1 
ATOM   291   C CG1   . ILE A 1 42  ? 144.923 -19.860 18.237 1.00 35.02 ? 94   ILE A CG1   1 
ATOM   292   C CG2   . ILE A 1 42  ? 145.101 -18.246 16.305 1.00 32.03 ? 94   ILE A CG2   1 
ATOM   293   C CD1   . ILE A 1 42  ? 144.299 -21.022 17.514 1.00 39.65 ? 94   ILE A CD1   1 
ATOM   294   N N     . LEU A 1 43  ? 145.637 -15.254 17.720 1.00 30.47 ? 95   LEU A N     1 
ATOM   295   C CA    . LEU A 1 43  ? 145.446 -13.917 17.189 1.00 29.60 ? 95   LEU A CA    1 
ATOM   296   C C     . LEU A 1 43  ? 145.892 -13.816 15.725 1.00 27.97 ? 95   LEU A C     1 
ATOM   297   O O     . LEU A 1 43  ? 147.019 -14.150 15.396 1.00 28.59 ? 95   LEU A O     1 
ATOM   298   C CB    . LEU A 1 43  ? 146.260 -12.961 18.051 1.00 31.23 ? 95   LEU A CB    1 
ATOM   299   C CG    . LEU A 1 43  ? 145.867 -11.517 18.327 1.00 33.09 ? 95   LEU A CG    1 
ATOM   300   C CD1   . LEU A 1 43  ? 147.143 -10.805 18.753 1.00 32.40 ? 95   LEU A CD1   1 
ATOM   301   C CD2   . LEU A 1 43  ? 145.266 -10.831 17.100 1.00 34.62 ? 95   LEU A CD2   1 
ATOM   302   N N     . SER A 1 44  ? 145.003 -13.358 14.853 1.00 28.25 ? 96   SER A N     1 
ATOM   303   C CA    . SER A 1 44  ? 145.313 -13.194 13.431 1.00 28.01 ? 96   SER A CA    1 
ATOM   304   C C     . SER A 1 44  ? 145.125 -11.738 13.036 1.00 28.33 ? 96   SER A C     1 
ATOM   305   O O     . SER A 1 44  ? 144.365 -11.007 13.656 1.00 28.61 ? 96   SER A O     1 
ATOM   306   C CB    . SER A 1 44  ? 144.394 -14.059 12.582 1.00 28.69 ? 96   SER A CB    1 
ATOM   307   O OG    . SER A 1 44  ? 145.105 -15.109 11.960 1.00 28.77 ? 96   SER A OG    1 
ATOM   308   N N     . ASN A 1 45  ? 145.832 -11.315 12.005 1.00 29.82 ? 97   ASN A N     1 
ATOM   309   C CA    . ASN A 1 45  ? 145.736 -9.941  11.534 1.00 31.68 ? 97   ASN A CA    1 
ATOM   310   C C     . ASN A 1 45  ? 145.217 -9.917  10.097 1.00 33.57 ? 97   ASN A C     1 
ATOM   311   O O     . ASN A 1 45  ? 145.737 -10.621 9.237  1.00 35.31 ? 97   ASN A O     1 
ATOM   312   C CB    . ASN A 1 45  ? 147.108 -9.280  11.617 1.00 30.39 ? 97   ASN A CB    1 
ATOM   313   C CG    . ASN A 1 45  ? 147.172 -7.976  10.868 1.00 30.72 ? 97   ASN A CG    1 
ATOM   314   O OD1   . ASN A 1 45  ? 146.308 -7.112  11.016 1.00 31.18 ? 97   ASN A OD1   1 
ATOM   315   N ND2   . ASN A 1 45  ? 148.206 -7.818  10.058 1.00 32.88 ? 97   ASN A ND2   1 
ATOM   316   N N     . SER A 1 46  ? 144.215 -9.087  9.827  1.00 35.74 ? 98   SER A N     1 
ATOM   317   C CA    . SER A 1 46  ? 143.631 -9.036  8.494  1.00 37.30 ? 98   SER A CA    1 
ATOM   318   C C     . SER A 1 46  ? 144.015 -7.887  7.560  1.00 40.22 ? 98   SER A C     1 
ATOM   319   O O     . SER A 1 46  ? 143.651 -7.932  6.382  1.00 41.79 ? 98   SER A O     1 
ATOM   320   C CB    . SER A 1 46  ? 142.116 -9.048  8.615  1.00 33.99 ? 98   SER A CB    1 
ATOM   321   O OG    . SER A 1 46  ? 141.690 -7.850  9.231  1.00 31.35 ? 98   SER A OG    1 
ATOM   322   N N     . ASP A 1 47  ? 144.721 -6.866  8.050  1.00 41.02 ? 99   ASP A N     1 
ATOM   323   C CA    . ASP A 1 47  ? 145.080 -5.721  7.190  1.00 42.93 ? 99   ASP A CA    1 
ATOM   324   C C     . ASP A 1 47  ? 143.823 -5.109  6.529  1.00 43.93 ? 99   ASP A C     1 
ATOM   325   O O     . ASP A 1 47  ? 143.887 -4.493  5.461  1.00 43.78 ? 99   ASP A O     1 
ATOM   326   C CB    . ASP A 1 47  ? 146.048 -6.164  6.098  1.00 42.94 ? 99   ASP A CB    1 
ATOM   327   C CG    . ASP A 1 47  ? 147.300 -6.785  6.657  1.00 44.73 ? 99   ASP A CG    1 
ATOM   328   O OD1   . ASP A 1 47  ? 148.125 -6.039  7.230  1.00 44.98 ? 99   ASP A OD1   1 
ATOM   329   O OD2   . ASP A 1 47  ? 147.458 -8.021  6.530  1.00 45.81 ? 99   ASP A OD2   1 
ATOM   330   N N     . GLN A 1 48  ? 142.686 -5.304  7.189  1.00 44.91 ? 100  GLN A N     1 
ATOM   331   C CA    . GLN A 1 48  ? 141.378 -4.831  6.749  1.00 45.99 ? 100  GLN A CA    1 
ATOM   332   C C     . GLN A 1 48  ? 140.976 -5.048  5.266  1.00 46.87 ? 100  GLN A C     1 
ATOM   333   O O     . GLN A 1 48  ? 140.412 -4.155  4.623  1.00 45.36 ? 100  GLN A O     1 
ATOM   334   C CB    . GLN A 1 48  ? 141.185 -3.355  7.154  1.00 47.07 ? 100  GLN A CB    1 
ATOM   335   C CG    . GLN A 1 48  ? 139.708 -2.925  7.311  1.00 51.69 ? 100  GLN A CG    1 
ATOM   336   C CD    . GLN A 1 48  ? 139.090 -3.300  8.656  1.00 54.98 ? 100  GLN A CD    1 
ATOM   337   O OE1   . GLN A 1 48  ? 138.060 -2.752  9.044  1.00 56.96 ? 100  GLN A OE1   1 
ATOM   338   N NE2   . GLN A 1 48  ? 139.714 -4.236  9.363  1.00 57.48 ? 100  GLN A NE2   1 
ATOM   339   N N     . ASN A 1 49  ? 141.286 -6.215  4.704  1.00 46.79 ? 101  ASN A N     1 
ATOM   340   C CA    . ASN A 1 49  ? 140.795 -6.487  3.366  1.00 48.73 ? 101  ASN A CA    1 
ATOM   341   C C     . ASN A 1 49  ? 139.864 -7.686  3.577  1.00 48.59 ? 101  ASN A C     1 
ATOM   342   O O     . ASN A 1 49  ? 140.288 -8.762  3.995  1.00 48.61 ? 101  ASN A O     1 
ATOM   343   C CB    . ASN A 1 49  ? 141.942 -6.693  2.330  1.00 51.06 ? 101  ASN A CB    1 
ATOM   344   C CG    . ASN A 1 49  ? 142.286 -8.151  2.033  1.00 50.13 ? 101  ASN A CG    1 
ATOM   345   O OD1   . ASN A 1 49  ? 141.427 -9.022  1.936  1.00 51.18 ? 101  ASN A OD1   1 
ATOM   346   N ND2   . ASN A 1 49  ? 143.570 -8.401  1.832  1.00 51.02 ? 101  ASN A ND2   1 
ATOM   347   N N     . GLN A 1 50  ? 138.572 -7.441  3.364  1.00 47.64 ? 102  GLN A N     1 
ATOM   348   C CA    . GLN A 1 50  ? 137.522 -8.443  3.544  1.00 47.51 ? 102  GLN A CA    1 
ATOM   349   C C     . GLN A 1 50  ? 137.951 -9.877  3.295  1.00 46.40 ? 102  GLN A C     1 
ATOM   350   O O     . GLN A 1 50  ? 137.676 -10.768 4.097  1.00 44.86 ? 102  GLN A O     1 
ATOM   351   C CB    . GLN A 1 50  ? 136.329 -8.157  2.632  1.00 47.10 ? 102  GLN A CB    1 
ATOM   352   C CG    . GLN A 1 50  ? 135.606 -6.862  2.866  1.00 45.66 ? 102  GLN A CG    1 
ATOM   353   C CD    . GLN A 1 50  ? 134.255 -6.862  2.187  1.00 47.28 ? 102  GLN A CD    1 
ATOM   354   O OE1   . GLN A 1 50  ? 133.619 -5.821  2.042  1.00 48.95 ? 102  GLN A OE1   1 
ATOM   355   N NE2   . GLN A 1 50  ? 133.801 -8.044  1.774  1.00 46.42 ? 102  GLN A NE2   1 
ATOM   356   N N     . ASP A 1 51  ? 138.600 -10.092 2.159  1.00 46.52 ? 103  ASP A N     1 
ATOM   357   C CA    . ASP A 1 51  ? 139.060 -11.416 1.790  1.00 46.45 ? 103  ASP A CA    1 
ATOM   358   C C     . ASP A 1 51  ? 139.763 -12.085 2.944  1.00 44.48 ? 103  ASP A C     1 
ATOM   359   O O     . ASP A 1 51  ? 139.285 -13.094 3.450  1.00 44.75 ? 103  ASP A O     1 
ATOM   360   C CB    . ASP A 1 51  ? 139.977 -11.337 0.573  1.00 48.30 ? 103  ASP A CB    1 
ATOM   361   C CG    . ASP A 1 51  ? 139.200 -11.162 -0.722 1.00 50.92 ? 103  ASP A CG    1 
ATOM   362   O OD1   . ASP A 1 51  ? 139.835 -10.860 -1.754 1.00 53.52 ? 103  ASP A OD1   1 
ATOM   363   O OD2   . ASP A 1 51  ? 137.956 -11.335 -0.710 1.00 49.60 ? 103  ASP A OD2   1 
ATOM   364   N N     . LYS A 1 52  ? 140.882 -11.515 3.376  1.00 42.60 ? 104  LYS A N     1 
ATOM   365   C CA    . LYS A 1 52  ? 141.630 -12.089 4.484  1.00 39.81 ? 104  LYS A CA    1 
ATOM   366   C C     . LYS A 1 52  ? 140.719 -12.225 5.703  1.00 37.85 ? 104  LYS A C     1 
ATOM   367   O O     . LYS A 1 52  ? 140.769 -13.234 6.403  1.00 36.28 ? 104  LYS A O     1 
ATOM   368   C CB    . LYS A 1 52  ? 142.844 -11.220 4.808  1.00 40.83 ? 104  LYS A CB    1 
ATOM   369   C CG    . LYS A 1 52  ? 143.992 -11.980 5.440  1.00 41.57 ? 104  LYS A CG    1 
ATOM   370   C CD    . LYS A 1 52  ? 145.219 -11.106 5.536  1.00 43.56 ? 104  LYS A CD    1 
ATOM   371   C CE    . LYS A 1 52  ? 146.382 -11.833 6.186  1.00 44.93 ? 104  LYS A CE    1 
ATOM   372   N NZ    . LYS A 1 52  ? 147.538 -10.914 6.437  1.00 47.09 ? 104  LYS A NZ    1 
ATOM   373   N N     . GLU A 1 53  ? 139.879 -11.219 5.949  1.00 36.90 ? 105  GLU A N     1 
ATOM   374   C CA    . GLU A 1 53  ? 138.940 -11.272 7.079  1.00 35.86 ? 105  GLU A CA    1 
ATOM   375   C C     . GLU A 1 53  ? 138.025 -12.481 6.919  1.00 35.64 ? 105  GLU A C     1 
ATOM   376   O O     . GLU A 1 53  ? 137.870 -13.287 7.844  1.00 34.81 ? 105  GLU A O     1 
ATOM   377   C CB    . GLU A 1 53  ? 138.065 -10.013 7.145  1.00 34.80 ? 105  GLU A CB    1 
ATOM   378   C CG    . GLU A 1 53  ? 138.839 -8.720  7.294  1.00 35.97 ? 105  GLU A CG    1 
ATOM   379   C CD    . GLU A 1 53  ? 137.947 -7.509  7.482  1.00 35.53 ? 105  GLU A CD    1 
ATOM   380   O OE1   . GLU A 1 53  ? 137.101 -7.231  6.602  1.00 34.59 ? 105  GLU A OE1   1 
ATOM   381   O OE2   . GLU A 1 53  ? 138.101 -6.829  8.518  1.00 36.50 ? 105  GLU A OE2   1 
ATOM   382   N N     . LEU A 1 54  ? 137.420 -12.599 5.739  1.00 35.08 ? 106  LEU A N     1 
ATOM   383   C CA    . LEU A 1 54  ? 136.516 -13.701 5.454  1.00 34.66 ? 106  LEU A CA    1 
ATOM   384   C C     . LEU A 1 54  ? 137.226 -15.058 5.434  1.00 34.34 ? 106  LEU A C     1 
ATOM   385   O O     . LEU A 1 54  ? 136.643 -16.067 5.813  1.00 34.27 ? 106  LEU A O     1 
ATOM   386   C CB    . LEU A 1 54  ? 135.782 -13.451 4.130  1.00 35.10 ? 106  LEU A CB    1 
ATOM   387   C CG    . LEU A 1 54  ? 134.766 -12.289 4.087  1.00 36.95 ? 106  LEU A CG    1 
ATOM   388   C CD1   . LEU A 1 54  ? 134.450 -11.922 2.645  1.00 37.24 ? 106  LEU A CD1   1 
ATOM   389   C CD2   . LEU A 1 54  ? 133.495 -12.657 4.826  1.00 35.35 ? 106  LEU A CD2   1 
ATOM   390   N N     . HIS A 1 55  ? 138.481 -15.093 5.003  1.00 34.37 ? 107  HIS A N     1 
ATOM   391   C CA    . HIS A 1 55  ? 139.211 -16.353 4.975  1.00 34.70 ? 107  HIS A CA    1 
ATOM   392   C C     . HIS A 1 55  ? 139.612 -16.712 6.390  1.00 36.07 ? 107  HIS A C     1 
ATOM   393   O O     . HIS A 1 55  ? 139.566 -17.873 6.780  1.00 35.07 ? 107  HIS A O     1 
ATOM   394   C CB    . HIS A 1 55  ? 140.459 -16.251 4.096  1.00 34.36 ? 107  HIS A CB    1 
ATOM   395   C CG    . HIS A 1 55  ? 141.330 -17.472 4.143  1.00 34.70 ? 107  HIS A CG    1 
ATOM   396   N ND1   . HIS A 1 55  ? 142.503 -17.520 4.864  1.00 32.68 ? 107  HIS A ND1   1 
ATOM   397   C CD2   . HIS A 1 55  ? 141.188 -18.692 3.574  1.00 33.75 ? 107  HIS A CD2   1 
ATOM   398   C CE1   . HIS A 1 55  ? 143.047 -18.715 4.735  1.00 33.25 ? 107  HIS A CE1   1 
ATOM   399   N NE2   . HIS A 1 55  ? 142.270 -19.445 3.957  1.00 34.07 ? 107  HIS A NE2   1 
ATOM   400   N N     . LEU A 1 56  ? 140.020 -15.706 7.155  1.00 38.37 ? 108  LEU A N     1 
ATOM   401   C CA    . LEU A 1 56  ? 140.398 -15.916 8.548  1.00 40.56 ? 108  LEU A CA    1 
ATOM   402   C C     . LEU A 1 56  ? 139.271 -16.663 9.262  1.00 42.64 ? 108  LEU A C     1 
ATOM   403   O O     . LEU A 1 56  ? 139.515 -17.423 10.201 1.00 43.22 ? 108  LEU A O     1 
ATOM   404   C CB    . LEU A 1 56  ? 140.668 -14.571 9.242  1.00 38.13 ? 108  LEU A CB    1 
ATOM   405   C CG    . LEU A 1 56  ? 142.075 -14.034 9.008  1.00 34.30 ? 108  LEU A CG    1 
ATOM   406   C CD1   . LEU A 1 56  ? 142.227 -12.678 9.616  1.00 33.58 ? 108  LEU A CD1   1 
ATOM   407   C CD2   . LEU A 1 56  ? 143.065 -15.001 9.614  1.00 34.18 ? 108  LEU A CD2   1 
ATOM   408   N N     . LEU A 1 57  ? 138.039 -16.432 8.814  1.00 45.19 ? 109  LEU A N     1 
ATOM   409   C CA    . LEU A 1 57  ? 136.878 -17.114 9.374  1.00 48.45 ? 109  LEU A CA    1 
ATOM   410   C C     . LEU A 1 57  ? 136.912 -18.607 9.025  1.00 50.18 ? 109  LEU A C     1 
ATOM   411   O O     . LEU A 1 57  ? 136.222 -19.414 9.633  1.00 51.29 ? 109  LEU A O     1 
ATOM   412   C CB    . LEU A 1 57  ? 135.590 -16.497 8.838  1.00 48.30 ? 109  LEU A CB    1 
ATOM   413   C CG    . LEU A 1 57  ? 134.952 -15.413 9.705  1.00 49.51 ? 109  LEU A CG    1 
ATOM   414   C CD1   . LEU A 1 57  ? 134.735 -15.974 11.109 1.00 49.96 ? 109  LEU A CD1   1 
ATOM   415   C CD2   . LEU A 1 57  ? 135.831 -14.174 9.747  1.00 50.69 ? 109  LEU A CD2   1 
ATOM   416   N N     . ASN A 1 58  ? 137.728 -18.950 8.037  1.00 52.50 ? 110  ASN A N     1 
ATOM   417   C CA    . ASN A 1 58  ? 137.912 -20.321 7.574  1.00 54.04 ? 110  ASN A CA    1 
ATOM   418   C C     . ASN A 1 58  ? 139.268 -20.882 8.094  1.00 53.65 ? 110  ASN A C     1 
ATOM   419   O O     . ASN A 1 58  ? 139.480 -22.096 8.151  1.00 52.41 ? 110  ASN A O     1 
ATOM   420   C CB    . ASN A 1 58  ? 137.849 -20.318 6.039  1.00 56.84 ? 110  ASN A CB    1 
ATOM   421   C CG    . ASN A 1 58  ? 138.451 -21.552 5.424  1.00 59.07 ? 110  ASN A CG    1 
ATOM   422   O OD1   . ASN A 1 58  ? 137.983 -22.673 5.646  1.00 60.19 ? 110  ASN A OD1   1 
ATOM   423   N ND2   . ASN A 1 58  ? 139.503 -21.353 4.637  1.00 60.27 ? 110  ASN A ND2   1 
ATOM   424   N N     . ASN A 1 59  ? 140.175 -19.983 8.477  1.00 53.51 ? 111  ASN A N     1 
ATOM   425   C CA    . ASN A 1 59  ? 141.477 -20.367 9.016  1.00 53.05 ? 111  ASN A CA    1 
ATOM   426   C C     . ASN A 1 59  ? 141.336 -20.582 10.519 1.00 54.39 ? 111  ASN A C     1 
ATOM   427   O O     . ASN A 1 59  ? 142.115 -21.319 11.114 1.00 55.07 ? 111  ASN A O     1 
ATOM   428   C CB    . ASN A 1 59  ? 142.512 -19.267 8.785  1.00 52.74 ? 111  ASN A CB    1 
ATOM   429   C CG    . ASN A 1 59  ? 143.913 -19.672 9.236  1.00 52.73 ? 111  ASN A CG    1 
ATOM   430   O OD1   . ASN A 1 59  ? 144.660 -20.270 8.476  1.00 53.38 ? 111  ASN A OD1   1 
ATOM   431   N ND2   . ASN A 1 59  ? 144.264 -19.351 10.478 1.00 52.33 ? 111  ASN A ND2   1 
ATOM   432   N N     . MET A 1 60  ? 140.350 -19.923 11.127 1.00 55.48 ? 112  MET A N     1 
ATOM   433   C CA    . MET A 1 60  ? 140.102 -20.043 12.562 1.00 56.85 ? 112  MET A CA    1 
ATOM   434   C C     . MET A 1 60  ? 139.372 -21.326 12.905 1.00 59.20 ? 112  MET A C     1 
ATOM   435   O O     . MET A 1 60  ? 139.568 -21.880 13.984 1.00 60.51 ? 112  MET A O     1 
ATOM   436   C CB    . MET A 1 60  ? 139.279 -18.864 13.080 1.00 57.29 ? 112  MET A CB    1 
ATOM   437   C CG    . MET A 1 60  ? 139.985 -17.512 13.037 1.00 55.67 ? 112  MET A CG    1 
ATOM   438   S SD    . MET A 1 60  ? 141.713 -17.623 13.523 1.00 57.06 ? 112  MET A SD    1 
ATOM   439   C CE    . MET A 1 60  ? 141.590 -18.144 15.205 1.00 55.32 ? 112  MET A CE    1 
ATOM   440   N N     . LEU A 1 61  ? 138.513 -21.789 12.000 1.00 61.77 ? 113  LEU A N     1 
ATOM   441   C CA    . LEU A 1 61  ? 137.777 -23.033 12.217 1.00 62.87 ? 113  LEU A CA    1 
ATOM   442   C C     . LEU A 1 61  ? 138.746 -24.172 11.921 1.00 63.92 ? 113  LEU A C     1 
ATOM   443   O O     . LEU A 1 61  ? 138.869 -25.128 12.687 1.00 63.59 ? 113  LEU A O     1 
ATOM   444   C CB    . LEU A 1 61  ? 136.591 -23.123 11.266 1.00 63.85 ? 113  LEU A CB    1 
ATOM   445   C CG    . LEU A 1 61  ? 135.654 -21.912 11.198 1.00 65.84 ? 113  LEU A CG    1 
ATOM   446   C CD1   . LEU A 1 61  ? 134.763 -22.018 9.951  1.00 65.00 ? 113  LEU A CD1   1 
ATOM   447   C CD2   . LEU A 1 61  ? 134.827 -21.823 12.464 1.00 65.33 ? 113  LEU A CD2   1 
ATOM   448   N N     . GLY A 1 62  ? 139.438 -24.054 10.793 1.00 65.37 ? 114  GLY A N     1 
ATOM   449   C CA    . GLY A 1 62  ? 140.410 -25.064 10.414 1.00 66.83 ? 114  GLY A CA    1 
ATOM   450   C C     . GLY A 1 62  ? 141.434 -25.231 11.521 1.00 67.34 ? 114  GLY A C     1 
ATOM   451   O O     . GLY A 1 62  ? 141.987 -26.327 11.715 1.00 69.03 ? 114  GLY A O     1 
ATOM   452   N N     . LYS A 1 63  ? 141.685 -24.139 12.245 1.00 65.62 ? 115  LYS A N     1 
ATOM   453   C CA    . LYS A 1 63  ? 142.621 -24.150 13.358 1.00 63.44 ? 115  LYS A CA    1 
ATOM   454   C C     . LYS A 1 63  ? 141.847 -24.482 14.634 1.00 61.62 ? 115  LYS A C     1 
ATOM   455   O O     . LYS A 1 63  ? 142.295 -24.188 15.751 1.00 62.63 ? 115  LYS A O     1 
ATOM   456   C CB    . LYS A 1 63  ? 143.341 -22.796 13.468 1.00 62.51 ? 115  LYS A CB    1 
ATOM   457   C CG    . LYS A 1 63  ? 144.676 -22.876 14.157 1.00 63.46 ? 115  LYS A CG    1 
ATOM   458   C CD    . LYS A 1 63  ? 145.636 -23.837 13.443 1.00 66.13 ? 115  LYS A CD    1 
ATOM   459   C CE    . LYS A 1 63  ? 146.482 -23.162 12.341 1.00 67.44 ? 115  LYS A CE    1 
ATOM   460   N NZ    . LYS A 1 63  ? 145.771 -22.889 11.047 1.00 68.42 ? 115  LYS A NZ    1 
ATOM   461   N N     . GLN A 1 64  ? 140.666 -25.077 14.434 1.00 58.81 ? 116  GLN A N     1 
ATOM   462   C CA    . GLN A 1 64  ? 139.759 -25.549 15.500 1.00 57.13 ? 116  GLN A CA    1 
ATOM   463   C C     . GLN A 1 64  ? 139.574 -24.630 16.718 1.00 54.59 ? 116  GLN A C     1 
ATOM   464   O O     . GLN A 1 64  ? 139.850 -25.020 17.857 1.00 55.53 ? 116  GLN A O     1 
ATOM   465   C CB    . GLN A 1 64  ? 140.206 -26.991 15.913 1.00 57.56 ? 116  GLN A CB    1 
ATOM   466   C CG    . GLN A 1 64  ? 139.771 -27.479 17.314 1.00 56.97 ? 116  GLN A CG    1 
ATOM   467   C CD    . GLN A 1 64  ? 138.265 -27.618 17.507 1.00 56.40 ? 116  GLN A CD    1 
ATOM   468   O OE1   . GLN A 1 64  ? 137.644 -28.550 16.994 1.00 57.02 ? 116  GLN A OE1   1 
ATOM   469   N NE2   . GLN A 1 64  ? 137.675 -26.694 18.262 1.00 55.61 ? 116  GLN A NE2   1 
ATOM   470   N N     . VAL A 1 65  ? 139.149 -23.393 16.475 1.00 48.78 ? 117  VAL A N     1 
ATOM   471   C CA    . VAL A 1 65  ? 138.888 -22.514 17.602 1.00 44.04 ? 117  VAL A CA    1 
ATOM   472   C C     . VAL A 1 65  ? 137.414 -22.683 17.917 1.00 41.20 ? 117  VAL A C     1 
ATOM   473   O O     . VAL A 1 65  ? 136.614 -22.920 17.021 1.00 41.35 ? 117  VAL A O     1 
ATOM   474   C CB    . VAL A 1 65  ? 139.189 -21.047 17.277 1.00 43.23 ? 117  VAL A CB    1 
ATOM   475   C CG1   . VAL A 1 65  ? 140.627 -20.903 16.893 1.00 41.83 ? 117  VAL A CG1   1 
ATOM   476   C CG2   . VAL A 1 65  ? 138.252 -20.551 16.176 1.00 43.80 ? 117  VAL A CG2   1 
ATOM   477   N N     . ASP A 1 66  ? 137.066 -22.568 19.191 1.00 38.62 ? 118  ASP A N     1 
ATOM   478   C CA    . ASP A 1 66  ? 135.685 -22.734 19.635 1.00 37.20 ? 118  ASP A CA    1 
ATOM   479   C C     . ASP A 1 66  ? 134.854 -21.442 19.579 1.00 35.67 ? 118  ASP A C     1 
ATOM   480   O O     . ASP A 1 66  ? 133.626 -21.470 19.710 1.00 37.26 ? 118  ASP A O     1 
ATOM   481   C CB    . ASP A 1 66  ? 135.683 -23.291 21.065 1.00 37.70 ? 118  ASP A CB    1 
ATOM   482   C CG    . ASP A 1 66  ? 136.624 -24.494 21.231 1.00 39.83 ? 118  ASP A CG    1 
ATOM   483   O OD1   . ASP A 1 66  ? 137.847 -24.298 21.462 1.00 37.21 ? 118  ASP A OD1   1 
ATOM   484   O OD2   . ASP A 1 66  ? 136.133 -25.642 21.113 1.00 40.44 ? 118  ASP A OD2   1 
ATOM   485   N N     . GLY A 1 67  ? 135.523 -20.311 19.381 1.00 32.55 ? 119  GLY A N     1 
ATOM   486   C CA    . GLY A 1 67  ? 134.822 -19.043 19.331 1.00 28.14 ? 119  GLY A CA    1 
ATOM   487   C C     . GLY A 1 67  ? 135.745 -17.947 18.855 1.00 26.30 ? 119  GLY A C     1 
ATOM   488   O O     . GLY A 1 67  ? 136.973 -18.052 18.972 1.00 24.57 ? 119  GLY A O     1 
ATOM   489   N N     . ILE A 1 68  ? 135.151 -16.879 18.337 1.00 24.70 ? 120  ILE A N     1 
ATOM   490   C CA    . ILE A 1 68  ? 135.926 -15.771 17.803 1.00 24.98 ? 120  ILE A CA    1 
ATOM   491   C C     . ILE A 1 68  ? 135.477 -14.376 18.233 1.00 25.41 ? 120  ILE A C     1 
ATOM   492   O O     . ILE A 1 68  ? 134.278 -14.076 18.283 1.00 24.27 ? 120  ILE A O     1 
ATOM   493   C CB    . ILE A 1 68  ? 135.890 -15.782 16.238 1.00 25.47 ? 120  ILE A CB    1 
ATOM   494   C CG1   . ILE A 1 68  ? 136.501 -17.075 15.699 1.00 24.93 ? 120  ILE A CG1   1 
ATOM   495   C CG2   . ILE A 1 68  ? 136.621 -14.568 15.686 1.00 19.84 ? 120  ILE A CG2   1 
ATOM   496   C CD1   . ILE A 1 68  ? 136.028 -17.427 14.322 1.00 35.16 ? 120  ILE A CD1   1 
ATOM   497   N N     . ILE A 1 69  ? 136.451 -13.536 18.569 1.00 24.91 ? 121  ILE A N     1 
ATOM   498   C CA    . ILE A 1 69  ? 136.156 -12.144 18.855 1.00 25.46 ? 121  ILE A CA    1 
ATOM   499   C C     . ILE A 1 69  ? 136.726 -11.535 17.577 1.00 24.81 ? 121  ILE A C     1 
ATOM   500   O O     . ILE A 1 69  ? 137.910 -11.707 17.256 1.00 21.13 ? 121  ILE A O     1 
ATOM   501   C CB    . ILE A 1 69  ? 136.895 -11.571 20.075 1.00 27.90 ? 121  ILE A CB    1 
ATOM   502   C CG1   . ILE A 1 69  ? 136.326 -12.157 21.363 1.00 28.73 ? 121  ILE A CG1   1 
ATOM   503   C CG2   . ILE A 1 69  ? 136.746 -10.073 20.103 1.00 25.89 ? 121  ILE A CG2   1 
ATOM   504   C CD1   . ILE A 1 69  ? 136.985 -13.445 21.758 1.00 38.90 ? 121  ILE A CD1   1 
ATOM   505   N N     . PHE A 1 70  ? 135.846 -10.869 16.837 1.00 25.23 ? 122  PHE A N     1 
ATOM   506   C CA    . PHE A 1 70  ? 136.154 -10.252 15.551 1.00 25.87 ? 122  PHE A CA    1 
ATOM   507   C C     . PHE A 1 70  ? 136.130 -8.717  15.656 1.00 26.85 ? 122  PHE A C     1 
ATOM   508   O O     . PHE A 1 70  ? 135.123 -8.128  16.056 1.00 27.71 ? 122  PHE A O     1 
ATOM   509   C CB    . PHE A 1 70  ? 135.106 -10.765 14.542 1.00 25.76 ? 122  PHE A CB    1 
ATOM   510   C CG    . PHE A 1 70  ? 135.218 -10.196 13.145 1.00 27.08 ? 122  PHE A CG    1 
ATOM   511   C CD1   . PHE A 1 70  ? 134.065 -9.830  12.453 1.00 26.92 ? 122  PHE A CD1   1 
ATOM   512   C CD2   . PHE A 1 70  ? 136.440 -10.091 12.493 1.00 27.90 ? 122  PHE A CD2   1 
ATOM   513   C CE1   . PHE A 1 70  ? 134.128 -9.372  11.139 1.00 26.35 ? 122  PHE A CE1   1 
ATOM   514   C CE2   . PHE A 1 70  ? 136.509 -9.634  11.176 1.00 26.76 ? 122  PHE A CE2   1 
ATOM   515   C CZ    . PHE A 1 70  ? 135.351 -9.277  10.502 1.00 26.46 ? 122  PHE A CZ    1 
ATOM   516   N N     . MET A 1 71  ? 137.255 -8.082  15.334 1.00 26.76 ? 123  MET A N     1 
ATOM   517   C CA    . MET A 1 71  ? 137.356 -6.629  15.339 1.00 26.97 ? 123  MET A CA    1 
ATOM   518   C C     . MET A 1 71  ? 137.422 -6.214  13.870 1.00 25.51 ? 123  MET A C     1 
ATOM   519   O O     . MET A 1 71  ? 138.011 -6.926  13.059 1.00 23.10 ? 123  MET A O     1 
ATOM   520   C CB    . MET A 1 71  ? 138.620 -6.190  16.080 1.00 29.66 ? 123  MET A CB    1 
ATOM   521   C CG    . MET A 1 71  ? 138.556 -6.447  17.574 1.00 34.47 ? 123  MET A CG    1 
ATOM   522   S SD    . MET A 1 71  ? 140.054 -5.996  18.464 1.00 37.81 ? 123  MET A SD    1 
ATOM   523   C CE    . MET A 1 71  ? 140.594 -7.603  19.017 1.00 37.55 ? 123  MET A CE    1 
ATOM   524   N N     . SER A 1 72  ? 136.814 -5.079  13.523 1.00 25.92 ? 124  SER A N     1 
ATOM   525   C CA    . SER A 1 72  ? 136.820 -4.622  12.135 1.00 26.62 ? 124  SER A CA    1 
ATOM   526   C C     . SER A 1 72  ? 136.247 -3.231  11.922 1.00 27.34 ? 124  SER A C     1 
ATOM   527   O O     . SER A 1 72  ? 135.331 -2.800  12.610 1.00 27.47 ? 124  SER A O     1 
ATOM   528   C CB    . SER A 1 72  ? 136.059 -5.619  11.252 1.00 26.53 ? 124  SER A CB    1 
ATOM   529   O OG    . SER A 1 72  ? 136.080 -5.225  9.899  1.00 24.04 ? 124  SER A OG    1 
ATOM   530   N N     . GLY A 1 73  ? 136.796 -2.546  10.927 1.00 30.37 ? 125  GLY A N     1 
ATOM   531   C CA    . GLY A 1 73  ? 136.377 -1.196  10.596 1.00 30.40 ? 125  GLY A CA    1 
ATOM   532   C C     . GLY A 1 73  ? 135.324 -1.100  9.517  1.00 31.23 ? 125  GLY A C     1 
ATOM   533   O O     . GLY A 1 73  ? 134.987 0.000   9.091  1.00 34.20 ? 125  GLY A O     1 
ATOM   534   N N     . ASN A 1 74  ? 134.814 -2.234  9.052  1.00 30.92 ? 126  ASN A N     1 
ATOM   535   C CA    . ASN A 1 74  ? 133.761 -2.228  8.044  1.00 30.26 ? 126  ASN A CA    1 
ATOM   536   C C     . ASN A 1 74  ? 133.129 -3.599  7.907  1.00 28.78 ? 126  ASN A C     1 
ATOM   537   O O     . ASN A 1 74  ? 133.515 -4.389  7.066  1.00 25.55 ? 126  ASN A O     1 
ATOM   538   C CB    . ASN A 1 74  ? 134.289 -1.760  6.685  1.00 31.75 ? 126  ASN A CB    1 
ATOM   539   C CG    . ASN A 1 74  ? 133.204 -1.090  5.844  1.00 32.77 ? 126  ASN A CG    1 
ATOM   540   O OD1   . ASN A 1 74  ? 133.491 -0.217  5.032  1.00 32.23 ? 126  ASN A OD1   1 
ATOM   541   N ND2   . ASN A 1 74  ? 131.951 -1.501  6.041  1.00 33.90 ? 126  ASN A ND2   1 
ATOM   542   N N     . VAL A 1 75  ? 132.160 -3.881  8.765  1.00 30.72 ? 127  VAL A N     1 
ATOM   543   C CA    . VAL A 1 75  ? 131.485 -5.156  8.716  1.00 31.65 ? 127  VAL A CA    1 
ATOM   544   C C     . VAL A 1 75  ? 130.330 -4.929  7.770  1.00 33.46 ? 127  VAL A C     1 
ATOM   545   O O     . VAL A 1 75  ? 129.230 -4.527  8.161  1.00 32.27 ? 127  VAL A O     1 
ATOM   546   C CB    . VAL A 1 75  ? 130.967 -5.601  10.097 1.00 31.71 ? 127  VAL A CB    1 
ATOM   547   C CG1   . VAL A 1 75  ? 130.607 -7.063  10.041 1.00 32.09 ? 127  VAL A CG1   1 
ATOM   548   C CG2   . VAL A 1 75  ? 132.021 -5.378  11.168 1.00 29.64 ? 127  VAL A CG2   1 
ATOM   549   N N     . THR A 1 76  ? 130.634 -5.164  6.500  1.00 35.93 ? 128  THR A N     1 
ATOM   550   C CA    . THR A 1 76  ? 129.703 -5.011  5.398  1.00 35.07 ? 128  THR A CA    1 
ATOM   551   C C     . THR A 1 76  ? 128.639 -6.064  5.467  1.00 36.64 ? 128  THR A C     1 
ATOM   552   O O     . THR A 1 76  ? 128.788 -7.075  6.138  1.00 35.80 ? 128  THR A O     1 
ATOM   553   C CB    . THR A 1 76  ? 130.402 -5.185  4.080  1.00 33.95 ? 128  THR A CB    1 
ATOM   554   O OG1   . THR A 1 76  ? 130.676 -6.578  3.882  1.00 32.92 ? 128  THR A OG1   1 
ATOM   555   C CG2   . THR A 1 76  ? 131.695 -4.401  4.075  1.00 29.90 ? 128  THR A CG2   1 
ATOM   556   N N     . GLU A 1 77  ? 127.564 -5.829  4.736  1.00 41.07 ? 129  GLU A N     1 
ATOM   557   C CA    . GLU A 1 77  ? 126.451 -6.750  4.730  1.00 44.67 ? 129  GLU A CA    1 
ATOM   558   C C     . GLU A 1 77  ? 126.906 -8.087  4.184  1.00 45.17 ? 129  GLU A C     1 
ATOM   559   O O     . GLU A 1 77  ? 126.311 -9.115  4.483  1.00 44.07 ? 129  GLU A O     1 
ATOM   560   C CB    . GLU A 1 77  ? 125.291 -6.143  3.937  1.00 48.70 ? 129  GLU A CB    1 
ATOM   561   C CG    . GLU A 1 77  ? 124.652 -4.906  4.645  1.00 55.02 ? 129  GLU A CG    1 
ATOM   562   C CD    . GLU A 1 77  ? 125.633 -3.719  4.855  1.00 58.65 ? 129  GLU A CD    1 
ATOM   563   O OE1   . GLU A 1 77  ? 125.499 -2.983  5.872  1.00 58.20 ? 129  GLU A OE1   1 
ATOM   564   O OE2   . GLU A 1 77  ? 126.531 -3.516  3.998  1.00 59.35 ? 129  GLU A OE2   1 
ATOM   565   N N     . GLU A 1 78  ? 127.985 -8.078  3.406  1.00 47.20 ? 130  GLU A N     1 
ATOM   566   C CA    . GLU A 1 78  ? 128.520 -9.329  2.886  1.00 49.53 ? 130  GLU A CA    1 
ATOM   567   C C     . GLU A 1 78  ? 129.118 -10.097 4.067  1.00 50.08 ? 130  GLU A C     1 
ATOM   568   O O     . GLU A 1 78  ? 128.892 -11.295 4.223  1.00 50.01 ? 130  GLU A O     1 
ATOM   569   C CB    . GLU A 1 78  ? 129.611 -9.084  1.853  1.00 50.86 ? 130  GLU A CB    1 
ATOM   570   C CG    . GLU A 1 78  ? 130.200 -10.387 1.353  1.00 56.21 ? 130  GLU A CG    1 
ATOM   571   C CD    . GLU A 1 78  ? 131.451 -10.199 0.524  1.00 60.96 ? 130  GLU A CD    1 
ATOM   572   O OE1   . GLU A 1 78  ? 132.047 -11.224 0.113  1.00 61.52 ? 130  GLU A OE1   1 
ATOM   573   O OE2   . GLU A 1 78  ? 131.838 -9.028  0.287  1.00 64.94 ? 130  GLU A OE2   1 
ATOM   574   N N     . HIS A 1 79  ? 129.894 -9.392  4.888  1.00 50.68 ? 131  HIS A N     1 
ATOM   575   C CA    . HIS A 1 79  ? 130.503 -9.980  6.076  1.00 50.34 ? 131  HIS A CA    1 
ATOM   576   C C     . HIS A 1 79  ? 129.401 -10.687 6.844  1.00 50.35 ? 131  HIS A C     1 
ATOM   577   O O     . HIS A 1 79  ? 129.462 -11.880 7.113  1.00 51.75 ? 131  HIS A O     1 
ATOM   578   C CB    . HIS A 1 79  ? 131.087 -8.895  6.994  1.00 50.47 ? 131  HIS A CB    1 
ATOM   579   C CG    . HIS A 1 79  ? 132.487 -8.477  6.656  1.00 49.91 ? 131  HIS A CG    1 
ATOM   580   N ND1   . HIS A 1 79  ? 132.772 -7.472  5.758  1.00 50.17 ? 131  HIS A ND1   1 
ATOM   581   C CD2   . HIS A 1 79  ? 133.681 -8.908  7.129  1.00 49.59 ? 131  HIS A CD2   1 
ATOM   582   C CE1   . HIS A 1 79  ? 134.080 -7.299  5.694  1.00 50.09 ? 131  HIS A CE1   1 
ATOM   583   N NE2   . HIS A 1 79  ? 134.655 -8.158  6.517  1.00 49.83 ? 131  HIS A NE2   1 
ATOM   584   N N     . VAL A 1 80  ? 128.391 -9.909  7.195  1.00 50.54 ? 132  VAL A N     1 
ATOM   585   C CA    . VAL A 1 80  ? 127.244 -10.387 7.940  1.00 51.17 ? 132  VAL A CA    1 
ATOM   586   C C     . VAL A 1 80  ? 126.735 -11.743 7.481  1.00 52.34 ? 132  VAL A C     1 
ATOM   587   O O     . VAL A 1 80  ? 126.401 -12.590 8.304  1.00 52.78 ? 132  VAL A O     1 
ATOM   588   C CB    . VAL A 1 80  ? 126.088 -9.381  7.836  1.00 50.75 ? 132  VAL A CB    1 
ATOM   589   C CG1   . VAL A 1 80  ? 124.983 -9.758  8.794  1.00 49.93 ? 132  VAL A CG1   1 
ATOM   590   C CG2   . VAL A 1 80  ? 126.598 -7.978  8.115  1.00 51.45 ? 132  VAL A CG2   1 
ATOM   591   N N     . GLU A 1 81  ? 126.671 -11.953 6.170  1.00 54.11 ? 133  GLU A N     1 
ATOM   592   C CA    . GLU A 1 81  ? 126.163 -13.215 5.642  1.00 56.02 ? 133  GLU A CA    1 
ATOM   593   C C     . GLU A 1 81  ? 127.052 -14.400 5.961  1.00 55.81 ? 133  GLU A C     1 
ATOM   594   O O     . GLU A 1 81  ? 126.593 -15.400 6.523  1.00 56.03 ? 133  GLU A O     1 
ATOM   595   C CB    . GLU A 1 81  ? 125.943 -13.128 4.125  1.00 58.09 ? 133  GLU A CB    1 
ATOM   596   C CG    . GLU A 1 81  ? 124.467 -12.952 3.722  1.00 62.58 ? 133  GLU A CG    1 
ATOM   597   C CD    . GLU A 1 81  ? 123.968 -11.507 3.821  1.00 65.06 ? 133  GLU A CD    1 
ATOM   598   O OE1   . GLU A 1 81  ? 124.292 -10.713 2.905  1.00 67.51 ? 133  GLU A OE1   1 
ATOM   599   O OE2   . GLU A 1 81  ? 123.258 -11.166 4.805  1.00 63.81 ? 133  GLU A OE2   1 
ATOM   600   N N     . GLU A 1 82  ? 128.323 -14.287 5.601  1.00 55.18 ? 134  GLU A N     1 
ATOM   601   C CA    . GLU A 1 82  ? 129.273 -15.354 5.853  1.00 54.78 ? 134  GLU A CA    1 
ATOM   602   C C     . GLU A 1 82  ? 129.297 -15.600 7.356  1.00 53.68 ? 134  GLU A C     1 
ATOM   603   O O     . GLU A 1 82  ? 129.384 -16.744 7.815  1.00 53.85 ? 134  GLU A O     1 
ATOM   604   C CB    . GLU A 1 82  ? 130.659 -14.939 5.357  1.00 55.69 ? 134  GLU A CB    1 
ATOM   605   C CG    . GLU A 1 82  ? 131.455 -16.056 4.684  1.00 58.41 ? 134  GLU A CG    1 
ATOM   606   C CD    . GLU A 1 82  ? 130.852 -16.503 3.360  1.00 59.56 ? 134  GLU A CD    1 
ATOM   607   O OE1   . GLU A 1 82  ? 131.394 -17.454 2.750  1.00 59.64 ? 134  GLU A OE1   1 
ATOM   608   O OE2   . GLU A 1 82  ? 129.842 -15.905 2.928  1.00 60.38 ? 134  GLU A OE2   1 
ATOM   609   N N     . LEU A 1 83  ? 129.187 -14.507 8.106  1.00 52.43 ? 135  LEU A N     1 
ATOM   610   C CA    . LEU A 1 83  ? 129.204 -14.523 9.569  1.00 51.71 ? 135  LEU A CA    1 
ATOM   611   C C     . LEU A 1 83  ? 128.073 -15.368 10.160 1.00 52.73 ? 135  LEU A C     1 
ATOM   612   O O     . LEU A 1 83  ? 128.317 -16.314 10.920 1.00 52.32 ? 135  LEU A O     1 
ATOM   613   C CB    . LEU A 1 83  ? 129.124 -13.082 10.086 1.00 49.08 ? 135  LEU A CB    1 
ATOM   614   C CG    . LEU A 1 83  ? 130.053 -12.626 11.218 1.00 48.66 ? 135  LEU A CG    1 
ATOM   615   C CD1   . LEU A 1 83  ? 131.498 -13.019 10.950 1.00 47.50 ? 135  LEU A CD1   1 
ATOM   616   C CD2   . LEU A 1 83  ? 129.944 -11.112 11.349 1.00 48.88 ? 135  LEU A CD2   1 
ATOM   617   N N     . LYS A 1 84  ? 126.835 -15.026 9.812  1.00 53.65 ? 136  LYS A N     1 
ATOM   618   C CA    . LYS A 1 84  ? 125.679 -15.769 10.306 1.00 55.06 ? 136  LYS A CA    1 
ATOM   619   C C     . LYS A 1 84  ? 125.824 -17.266 10.054 1.00 55.96 ? 136  LYS A C     1 
ATOM   620   O O     . LYS A 1 84  ? 125.358 -18.076 10.854 1.00 56.85 ? 136  LYS A O     1 
ATOM   621   C CB    . LYS A 1 84  ? 124.385 -15.270 9.644  1.00 55.45 ? 136  LYS A CB    1 
ATOM   622   C CG    . LYS A 1 84  ? 123.745 -14.076 10.339 1.00 55.15 ? 136  LYS A CG    1 
ATOM   623   C CD    . LYS A 1 84  ? 122.384 -13.732 9.772  1.00 52.65 ? 136  LYS A CD    1 
ATOM   624   C CE    . LYS A 1 84  ? 121.813 -12.525 10.492 1.00 52.94 ? 136  LYS A CE    1 
ATOM   625   N NZ    . LYS A 1 84  ? 120.575 -12.013 9.852  1.00 53.87 ? 136  LYS A NZ    1 
ATOM   626   N N     . LYS A 1 85  ? 126.477 -17.621 8.948  1.00 55.73 ? 137  LYS A N     1 
ATOM   627   C CA    . LYS A 1 85  ? 126.687 -19.017 8.568  1.00 55.60 ? 137  LYS A CA    1 
ATOM   628   C C     . LYS A 1 85  ? 127.784 -19.688 9.374  1.00 55.32 ? 137  LYS A C     1 
ATOM   629   O O     . LYS A 1 85  ? 127.886 -20.911 9.386  1.00 56.20 ? 137  LYS A O     1 
ATOM   630   C CB    . LYS A 1 85  ? 127.079 -19.122 7.092  1.00 56.95 ? 137  LYS A CB    1 
ATOM   631   C CG    . LYS A 1 85  ? 126.128 -18.487 6.092  1.00 58.05 ? 137  LYS A CG    1 
ATOM   632   C CD    . LYS A 1 85  ? 126.752 -18.548 4.694  1.00 58.58 ? 137  LYS A CD    1 
ATOM   633   C CE    . LYS A 1 85  ? 125.880 -17.878 3.633  1.00 59.10 ? 137  LYS A CE    1 
ATOM   634   N NZ    . LYS A 1 85  ? 126.507 -17.954 2.278  1.00 57.41 ? 137  LYS A NZ    1 
ATOM   635   N N     . SER A 1 86  ? 128.616 -18.886 10.026 1.00 54.85 ? 138  SER A N     1 
ATOM   636   C CA    . SER A 1 86  ? 129.734 -19.404 10.810 1.00 54.01 ? 138  SER A CA    1 
ATOM   637   C C     . SER A 1 86  ? 129.425 -20.674 11.595 1.00 52.82 ? 138  SER A C     1 
ATOM   638   O O     . SER A 1 86  ? 128.301 -20.877 12.038 1.00 53.28 ? 138  SER A O     1 
ATOM   639   C CB    . SER A 1 86  ? 130.225 -18.330 11.778 1.00 54.52 ? 138  SER A CB    1 
ATOM   640   O OG    . SER A 1 86  ? 131.353 -18.784 12.504 1.00 54.49 ? 138  SER A OG    1 
ATOM   641   N N     . PRO A 1 87  ? 130.429 -21.550 11.772 1.00 52.25 ? 139  PRO A N     1 
ATOM   642   C CA    . PRO A 1 87  ? 130.274 -22.809 12.515 1.00 50.37 ? 139  PRO A CA    1 
ATOM   643   C C     . PRO A 1 87  ? 130.390 -22.510 14.000 1.00 48.31 ? 139  PRO A C     1 
ATOM   644   O O     . PRO A 1 87  ? 129.581 -22.968 14.810 1.00 48.37 ? 139  PRO A O     1 
ATOM   645   C CB    . PRO A 1 87  ? 131.460 -23.653 12.051 1.00 51.68 ? 139  PRO A CB    1 
ATOM   646   C CG    . PRO A 1 87  ? 131.960 -22.954 10.806 1.00 52.96 ? 139  PRO A CG    1 
ATOM   647   C CD    . PRO A 1 87  ? 131.743 -21.506 11.110 1.00 53.04 ? 139  PRO A CD    1 
ATOM   648   N N     . VAL A 1 88  ? 131.428 -21.744 14.335 1.00 45.82 ? 140  VAL A N     1 
ATOM   649   C CA    . VAL A 1 88  ? 131.706 -21.341 15.710 1.00 42.43 ? 140  VAL A CA    1 
ATOM   650   C C     . VAL A 1 88  ? 131.117 -19.967 15.990 1.00 40.47 ? 140  VAL A C     1 
ATOM   651   O O     . VAL A 1 88  ? 130.959 -19.150 15.084 1.00 41.31 ? 140  VAL A O     1 
ATOM   652   C CB    . VAL A 1 88  ? 133.216 -21.275 15.974 1.00 41.08 ? 140  VAL A CB    1 
ATOM   653   C CG1   . VAL A 1 88  ? 133.851 -22.621 15.679 1.00 41.29 ? 140  VAL A CG1   1 
ATOM   654   C CG2   . VAL A 1 88  ? 133.838 -20.183 15.132 1.00 39.31 ? 140  VAL A CG2   1 
ATOM   655   N N     . PRO A 1 89  ? 130.784 -19.690 17.253 1.00 38.25 ? 141  PRO A N     1 
ATOM   656   C CA    . PRO A 1 89  ? 130.215 -18.385 17.586 1.00 37.63 ? 141  PRO A CA    1 
ATOM   657   C C     . PRO A 1 89  ? 131.242 -17.260 17.440 1.00 36.46 ? 141  PRO A C     1 
ATOM   658   O O     . PRO A 1 89  ? 132.418 -17.428 17.765 1.00 36.73 ? 141  PRO A O     1 
ATOM   659   C CB    . PRO A 1 89  ? 129.771 -18.557 19.040 1.00 38.52 ? 141  PRO A CB    1 
ATOM   660   C CG    . PRO A 1 89  ? 129.659 -20.043 19.216 1.00 39.37 ? 141  PRO A CG    1 
ATOM   661   C CD    . PRO A 1 89  ? 130.821 -20.559 18.437 1.00 38.33 ? 141  PRO A CD    1 
ATOM   662   N N     . VAL A 1 90  ? 130.792 -16.114 16.947 1.00 34.81 ? 142  VAL A N     1 
ATOM   663   C CA    . VAL A 1 90  ? 131.668 -14.968 16.777 1.00 34.16 ? 142  VAL A CA    1 
ATOM   664   C C     . VAL A 1 90  ? 130.931 -13.726 17.227 1.00 31.82 ? 142  VAL A C     1 
ATOM   665   O O     . VAL A 1 90  ? 129.743 -13.570 16.947 1.00 32.47 ? 142  VAL A O     1 
ATOM   666   C CB    . VAL A 1 90  ? 132.111 -14.808 15.300 1.00 35.34 ? 142  VAL A CB    1 
ATOM   667   C CG1   . VAL A 1 90  ? 130.941 -15.014 14.399 1.00 37.39 ? 142  VAL A CG1   1 
ATOM   668   C CG2   . VAL A 1 90  ? 132.690 -13.422 15.057 1.00 36.41 ? 142  VAL A CG2   1 
ATOM   669   N N     . VAL A 1 91  ? 131.617 -12.870 17.970 1.00 28.39 ? 143  VAL A N     1 
ATOM   670   C CA    . VAL A 1 91  ? 131.002 -11.635 18.414 1.00 27.84 ? 143  VAL A CA    1 
ATOM   671   C C     . VAL A 1 91  ? 131.987 -10.516 18.123 1.00 26.70 ? 143  VAL A C     1 
ATOM   672   O O     . VAL A 1 91  ? 133.195 -10.722 18.138 1.00 26.62 ? 143  VAL A O     1 
ATOM   673   C CB    . VAL A 1 91  ? 130.614 -11.675 19.932 1.00 28.03 ? 143  VAL A CB    1 
ATOM   674   C CG1   . VAL A 1 91  ? 130.531 -13.106 20.395 1.00 28.43 ? 143  VAL A CG1   1 
ATOM   675   C CG2   . VAL A 1 91  ? 131.581 -10.869 20.780 1.00 27.44 ? 143  VAL A CG2   1 
ATOM   676   N N     . LEU A 1 92  ? 131.463 -9.335  17.826 1.00 26.33 ? 144  LEU A N     1 
ATOM   677   C CA    . LEU A 1 92  ? 132.297 -8.184  17.516 1.00 25.27 ? 144  LEU A CA    1 
ATOM   678   C C     . LEU A 1 92  ? 132.732 -7.464  18.782 1.00 23.80 ? 144  LEU A C     1 
ATOM   679   O O     . LEU A 1 92  ? 132.074 -7.527  19.817 1.00 21.28 ? 144  LEU A O     1 
ATOM   680   C CB    . LEU A 1 92  ? 131.528 -7.200  16.623 1.00 26.71 ? 144  LEU A CB    1 
ATOM   681   C CG    . LEU A 1 92  ? 130.758 -7.801  15.436 1.00 29.17 ? 144  LEU A CG    1 
ATOM   682   C CD1   . LEU A 1 92  ? 129.813 -6.767  14.877 1.00 29.05 ? 144  LEU A CD1   1 
ATOM   683   C CD2   . LEU A 1 92  ? 131.720 -8.284  14.354 1.00 28.73 ? 144  LEU A CD2   1 
ATOM   684   N N     . ALA A 1 93  ? 133.871 -6.798  18.687 1.00 24.35 ? 145  ALA A N     1 
ATOM   685   C CA    . ALA A 1 93  ? 134.403 -6.016  19.784 1.00 23.83 ? 145  ALA A CA    1 
ATOM   686   C C     . ALA A 1 93  ? 134.821 -4.729  19.114 1.00 24.87 ? 145  ALA A C     1 
ATOM   687   O O     . ALA A 1 93  ? 135.541 -4.763  18.109 1.00 23.05 ? 145  ALA A O     1 
ATOM   688   C CB    . ALA A 1 93  ? 135.602 -6.695  20.399 1.00 20.81 ? 145  ALA A CB    1 
ATOM   689   N N     . ALA A 1 94  ? 134.319 -3.613  19.644 1.00 27.31 ? 146  ALA A N     1 
ATOM   690   C CA    . ALA A 1 94  ? 134.637 -2.271  19.152 1.00 29.11 ? 146  ALA A CA    1 
ATOM   691   C C     . ALA A 1 94  ? 134.476 -2.134  17.644 1.00 30.50 ? 146  ALA A C     1 
ATOM   692   O O     . ALA A 1 94  ? 135.371 -1.630  16.941 1.00 30.30 ? 146  ALA A O     1 
ATOM   693   C CB    . ALA A 1 94  ? 136.062 -1.903  19.560 1.00 28.95 ? 146  ALA A CB    1 
ATOM   694   N N     . SER A 1 95  ? 133.334 -2.591  17.150 1.00 30.69 ? 147  SER A N     1 
ATOM   695   C CA    . SER A 1 95  ? 133.064 -2.519  15.729 1.00 32.09 ? 147  SER A CA    1 
ATOM   696   C C     . SER A 1 95  ? 131.571 -2.384  15.488 1.00 33.53 ? 147  SER A C     1 
ATOM   697   O O     . SER A 1 95  ? 130.766 -3.186  15.963 1.00 34.15 ? 147  SER A O     1 
ATOM   698   C CB    . SER A 1 95  ? 133.608 -3.767  15.038 1.00 30.28 ? 147  SER A CB    1 
ATOM   699   O OG    . SER A 1 95  ? 134.985 -3.929  15.333 1.00 29.02 ? 147  SER A OG    1 
ATOM   700   N N     . ILE A 1 96  ? 131.206 -1.339  14.763 1.00 35.37 ? 148  ILE A N     1 
ATOM   701   C CA    . ILE A 1 96  ? 129.816 -1.093  14.447 1.00 36.15 ? 148  ILE A CA    1 
ATOM   702   C C     . ILE A 1 96  ? 129.387 -2.005  13.285 1.00 37.23 ? 148  ILE A C     1 
ATOM   703   O O     . ILE A 1 96  ? 130.135 -2.250  12.332 1.00 36.60 ? 148  ILE A O     1 
ATOM   704   C CB    . ILE A 1 96  ? 129.595 0.441   14.157 1.00 35.00 ? 148  ILE A CB    1 
ATOM   705   C CG1   . ILE A 1 96  ? 128.298 0.678   13.379 1.00 36.70 ? 148  ILE A CG1   1 
ATOM   706   C CG2   . ILE A 1 96  ? 130.799 1.020   13.453 1.00 34.12 ? 148  ILE A CG2   1 
ATOM   707   C CD1   . ILE A 1 96  ? 128.389 0.479   11.878 1.00 40.38 ? 148  ILE A CD1   1 
ATOM   708   N N     . GLU A 1 97  ? 128.181 -2.542  13.412 1.00 39.39 ? 149  GLU A N     1 
ATOM   709   C CA    . GLU A 1 97  ? 127.586 -3.435  12.421 1.00 41.60 ? 149  GLU A CA    1 
ATOM   710   C C     . GLU A 1 97  ? 126.101 -3.062  12.453 1.00 42.90 ? 149  GLU A C     1 
ATOM   711   O O     . GLU A 1 97  ? 125.262 -3.825  12.916 1.00 41.88 ? 149  GLU A O     1 
ATOM   712   C CB    . GLU A 1 97  ? 127.804 -4.880  12.864 1.00 41.69 ? 149  GLU A CB    1 
ATOM   713   C CG    . GLU A 1 97  ? 127.571 -5.911  11.803 1.00 42.94 ? 149  GLU A CG    1 
ATOM   714   C CD    . GLU A 1 97  ? 126.122 -6.041  11.448 1.00 45.06 ? 149  GLU A CD    1 
ATOM   715   O OE1   . GLU A 1 97  ? 125.332 -6.412  12.343 1.00 44.65 ? 149  GLU A OE1   1 
ATOM   716   O OE2   . GLU A 1 97  ? 125.777 -5.766  10.276 1.00 46.39 ? 149  GLU A OE2   1 
ATOM   717   N N     . SER A 1 98  ? 125.829 -1.856  11.958 1.00 46.27 ? 150  SER A N     1 
ATOM   718   C CA    . SER A 1 98  ? 124.520 -1.198  11.914 1.00 48.10 ? 150  SER A CA    1 
ATOM   719   C C     . SER A 1 98  ? 123.227 -1.993  11.840 1.00 48.47 ? 150  SER A C     1 
ATOM   720   O O     . SER A 1 98  ? 122.196 -1.533  12.337 1.00 49.47 ? 150  SER A O     1 
ATOM   721   C CB    . SER A 1 98  ? 124.522 -0.134  10.804 1.00 49.75 ? 150  SER A CB    1 
ATOM   722   O OG    . SER A 1 98  ? 125.324 0.992   11.169 1.00 52.49 ? 150  SER A OG    1 
ATOM   723   N N     . THR A 1 99  ? 123.256 -3.172  11.234 1.00 48.24 ? 151  THR A N     1 
ATOM   724   C CA    . THR A 1 99  ? 122.039 -3.968  11.144 1.00 47.32 ? 151  THR A CA    1 
ATOM   725   C C     . THR A 1 99  ? 121.681 -4.570  12.491 1.00 46.41 ? 151  THR A C     1 
ATOM   726   O O     . THR A 1 99  ? 120.532 -4.889  12.738 1.00 47.67 ? 151  THR A O     1 
ATOM   727   C CB    . THR A 1 99  ? 122.191 -5.112  10.153 1.00 47.97 ? 151  THR A CB    1 
ATOM   728   O OG1   . THR A 1 99  ? 123.281 -5.939  10.570 1.00 49.02 ? 151  THR A OG1   1 
ATOM   729   C CG2   . THR A 1 99  ? 122.445 -4.581  8.738  1.00 48.00 ? 151  THR A CG2   1 
ATOM   730   N N     . ASN A 1 100 ? 122.673 -4.731  13.355 1.00 45.87 ? 152  ASN A N     1 
ATOM   731   C CA    . ASN A 1 100 ? 122.467 -5.299  14.676 1.00 45.01 ? 152  ASN A CA    1 
ATOM   732   C C     . ASN A 1 100 ? 122.080 -6.784  14.587 1.00 45.28 ? 152  ASN A C     1 
ATOM   733   O O     . ASN A 1 100 ? 121.337 -7.300  15.424 1.00 45.71 ? 152  ASN A O     1 
ATOM   734   C CB    . ASN A 1 100 ? 121.396 -4.500  15.445 1.00 44.63 ? 152  ASN A CB    1 
ATOM   735   C CG    . ASN A 1 100 ? 121.903 -3.133  15.948 1.00 45.56 ? 152  ASN A CG    1 
ATOM   736   O OD1   . ASN A 1 100 ? 121.239 -2.460  16.747 1.00 45.16 ? 152  ASN A OD1   1 
ATOM   737   N ND2   . ASN A 1 100 ? 123.074 -2.728  15.485 1.00 44.46 ? 152  ASN A ND2   1 
ATOM   738   N N     . GLN A 1 101 ? 122.604 -7.477  13.578 1.00 44.61 ? 153  GLN A N     1 
ATOM   739   C CA    . GLN A 1 101 ? 122.313 -8.900  13.396 1.00 43.23 ? 153  GLN A CA    1 
ATOM   740   C C     . GLN A 1 101 ? 123.432 -9.820  13.905 1.00 40.98 ? 153  GLN A C     1 
ATOM   741   O O     . GLN A 1 101 ? 123.330 -11.032 13.816 1.00 40.89 ? 153  GLN A O     1 
ATOM   742   C CB    . GLN A 1 101 ? 122.072 -9.220  11.927 1.00 45.08 ? 153  GLN A CB    1 
ATOM   743   C CG    . GLN A 1 101 ? 121.328 -8.172  11.147 1.00 49.07 ? 153  GLN A CG    1 
ATOM   744   C CD    . GLN A 1 101 ? 121.504 -8.381  9.651  1.00 52.57 ? 153  GLN A CD    1 
ATOM   745   O OE1   . GLN A 1 101 ? 121.367 -7.450  8.851  1.00 53.78 ? 153  GLN A OE1   1 
ATOM   746   N NE2   . GLN A 1 101 ? 121.809 -9.617  9.264  1.00 54.25 ? 153  GLN A NE2   1 
ATOM   747   N N     . ILE A 1 102 ? 124.520 -9.260  14.399 1.00 39.79 ? 154  ILE A N     1 
ATOM   748   C CA    . ILE A 1 102 ? 125.585 -10.101 14.926 1.00 39.13 ? 154  ILE A CA    1 
ATOM   749   C C     . ILE A 1 102 ? 125.856 -9.647  16.342 1.00 37.01 ? 154  ILE A C     1 
ATOM   750   O O     . ILE A 1 102 ? 125.779 -8.457  16.644 1.00 36.97 ? 154  ILE A O     1 
ATOM   751   C CB    . ILE A 1 102 ? 126.901 -10.006 14.087 1.00 40.67 ? 154  ILE A CB    1 
ATOM   752   C CG1   . ILE A 1 102 ? 126.953 -11.144 13.068 1.00 40.79 ? 154  ILE A CG1   1 
ATOM   753   C CG2   . ILE A 1 102 ? 128.131 -10.126 14.986 1.00 39.46 ? 154  ILE A CG2   1 
ATOM   754   C CD1   . ILE A 1 102 ? 125.779 -11.191 12.130 1.00 43.17 ? 154  ILE A CD1   1 
ATOM   755   N N     . PRO A 1 103 ? 126.140 -10.595 17.239 1.00 34.81 ? 155  PRO A N     1 
ATOM   756   C CA    . PRO A 1 103 ? 126.419 -10.232 18.627 1.00 33.77 ? 155  PRO A CA    1 
ATOM   757   C C     . PRO A 1 103 ? 127.606 -9.279  18.654 1.00 33.26 ? 155  PRO A C     1 
ATOM   758   O O     . PRO A 1 103 ? 128.613 -9.505  17.983 1.00 33.58 ? 155  PRO A O     1 
ATOM   759   C CB    . PRO A 1 103 ? 126.706 -11.581 19.282 1.00 33.65 ? 155  PRO A CB    1 
ATOM   760   C CG    . PRO A 1 103 ? 127.175 -12.428 18.135 1.00 34.90 ? 155  PRO A CG    1 
ATOM   761   C CD    . PRO A 1 103 ? 126.248 -12.046 17.039 1.00 33.83 ? 155  PRO A CD    1 
ATOM   762   N N     . SER A 1 104 ? 127.483 -8.195  19.412 1.00 31.81 ? 156  SER A N     1 
ATOM   763   C CA    . SER A 1 104 ? 128.562 -7.231  19.466 1.00 27.46 ? 156  SER A CA    1 
ATOM   764   C C     . SER A 1 104 ? 128.566 -6.452  20.755 1.00 25.46 ? 156  SER A C     1 
ATOM   765   O O     . SER A 1 104 ? 127.538 -6.323  21.410 1.00 24.41 ? 156  SER A O     1 
ATOM   766   C CB    . SER A 1 104 ? 128.418 -6.247  18.329 1.00 26.64 ? 156  SER A CB    1 
ATOM   767   O OG    . SER A 1 104 ? 127.418 -5.317  18.666 1.00 27.30 ? 156  SER A OG    1 
ATOM   768   N N     . VAL A 1 105 ? 129.744 -5.948  21.109 1.00 24.47 ? 157  VAL A N     1 
ATOM   769   C CA    . VAL A 1 105 ? 129.934 -5.114  22.291 1.00 23.37 ? 157  VAL A CA    1 
ATOM   770   C C     . VAL A 1 105 ? 130.865 -3.960  21.885 1.00 23.86 ? 157  VAL A C     1 
ATOM   771   O O     . VAL A 1 105 ? 131.967 -4.166  21.364 1.00 23.57 ? 157  VAL A O     1 
ATOM   772   C CB    . VAL A 1 105 ? 130.487 -5.929  23.515 1.00 21.17 ? 157  VAL A CB    1 
ATOM   773   C CG1   . VAL A 1 105 ? 131.307 -7.086  23.052 1.00 21.99 ? 157  VAL A CG1   1 
ATOM   774   C CG2   . VAL A 1 105 ? 131.308 -5.036  24.422 1.00 19.27 ? 157  VAL A CG2   1 
ATOM   775   N N     . THR A 1 106 ? 130.375 -2.740  22.091 1.00 24.35 ? 158  THR A N     1 
ATOM   776   C CA    . THR A 1 106 ? 131.097 -1.513  21.755 1.00 23.76 ? 158  THR A CA    1 
ATOM   777   C C     . THR A 1 106 ? 130.538 -0.416  22.646 1.00 22.87 ? 158  THR A C     1 
ATOM   778   O O     . THR A 1 106 ? 129.661 -0.668  23.456 1.00 22.60 ? 158  THR A O     1 
ATOM   779   C CB    . THR A 1 106 ? 130.833 -1.075  20.275 1.00 23.93 ? 158  THR A CB    1 
ATOM   780   O OG1   . THR A 1 106 ? 129.440 -0.818  20.092 1.00 22.98 ? 158  THR A OG1   1 
ATOM   781   C CG2   . THR A 1 106 ? 131.244 -2.149  19.298 1.00 26.09 ? 158  THR A CG2   1 
ATOM   782   N N     . ILE A 1 107 ? 131.053 0.798   22.506 1.00 24.02 ? 159  ILE A N     1 
ATOM   783   C CA    . ILE A 1 107 ? 130.526 1.928   23.260 1.00 24.78 ? 159  ILE A CA    1 
ATOM   784   C C     . ILE A 1 107 ? 129.749 2.674   22.201 1.00 26.59 ? 159  ILE A C     1 
ATOM   785   O O     . ILE A 1 107 ? 129.868 2.358   21.020 1.00 26.79 ? 159  ILE A O     1 
ATOM   786   C CB    . ILE A 1 107 ? 131.610 2.905   23.744 1.00 25.49 ? 159  ILE A CB    1 
ATOM   787   C CG1   . ILE A 1 107 ? 132.345 3.491   22.535 1.00 25.61 ? 159  ILE A CG1   1 
ATOM   788   C CG2   . ILE A 1 107 ? 132.533 2.222   24.726 1.00 22.49 ? 159  ILE A CG2   1 
ATOM   789   C CD1   . ILE A 1 107 ? 133.183 4.691   22.847 1.00 35.06 ? 159  ILE A CD1   1 
ATOM   790   N N     . ASP A 1 108 ? 128.959 3.662   22.605 1.00 28.64 ? 160  ASP A N     1 
ATOM   791   C CA    . ASP A 1 108 ? 128.225 4.456   21.622 1.00 29.46 ? 160  ASP A CA    1 
ATOM   792   C C     . ASP A 1 108 ? 129.127 5.590   21.115 1.00 27.97 ? 160  ASP A C     1 
ATOM   793   O O     . ASP A 1 108 ? 129.134 6.685   21.664 1.00 27.35 ? 160  ASP A O     1 
ATOM   794   C CB    . ASP A 1 108 ? 126.946 5.032   22.234 1.00 30.98 ? 160  ASP A CB    1 
ATOM   795   C CG    . ASP A 1 108 ? 126.204 5.951   21.271 1.00 31.00 ? 160  ASP A CG    1 
ATOM   796   O OD1   . ASP A 1 108 ? 126.371 5.795   20.034 1.00 28.28 ? 160  ASP A OD1   1 
ATOM   797   O OD2   . ASP A 1 108 ? 125.454 6.818   21.766 1.00 29.48 ? 160  ASP A OD2   1 
ATOM   798   N N     . TYR A 1 109 ? 129.882 5.313   20.060 1.00 27.96 ? 161  TYR A N     1 
ATOM   799   C CA    . TYR A 1 109 ? 130.803 6.284   19.492 1.00 28.58 ? 161  TYR A CA    1 
ATOM   800   C C     . TYR A 1 109 ? 130.206 7.657   19.200 1.00 28.74 ? 161  TYR A C     1 
ATOM   801   O O     . TYR A 1 109 ? 130.865 8.682   19.422 1.00 26.50 ? 161  TYR A O     1 
ATOM   802   C CB    . TYR A 1 109 ? 131.421 5.713   18.233 1.00 30.69 ? 161  TYR A CB    1 
ATOM   803   C CG    . TYR A 1 109 ? 132.178 4.430   18.469 1.00 33.11 ? 161  TYR A CG    1 
ATOM   804   C CD1   . TYR A 1 109 ? 131.542 3.198   18.383 1.00 34.22 ? 161  TYR A CD1   1 
ATOM   805   C CD2   . TYR A 1 109 ? 133.542 4.448   18.749 1.00 35.19 ? 161  TYR A CD2   1 
ATOM   806   C CE1   . TYR A 1 109 ? 132.247 2.015   18.560 1.00 37.56 ? 161  TYR A CE1   1 
ATOM   807   C CE2   . TYR A 1 109 ? 134.257 3.267   18.929 1.00 37.38 ? 161  TYR A CE2   1 
ATOM   808   C CZ    . TYR A 1 109 ? 133.605 2.057   18.829 1.00 37.59 ? 161  TYR A CZ    1 
ATOM   809   O OH    . TYR A 1 109 ? 134.316 0.891   18.974 1.00 40.07 ? 161  TYR A OH    1 
ATOM   810   N N     . GLU A 1 110 ? 128.966 7.672   18.710 1.00 28.09 ? 162  GLU A N     1 
ATOM   811   C CA    . GLU A 1 110 ? 128.263 8.911   18.403 1.00 27.79 ? 162  GLU A CA    1 
ATOM   812   C C     . GLU A 1 110 ? 128.226 9.815   19.640 1.00 28.78 ? 162  GLU A C     1 
ATOM   813   O O     . GLU A 1 110 ? 128.582 10.999  19.555 1.00 28.15 ? 162  GLU A O     1 
ATOM   814   C CB    . GLU A 1 110 ? 126.849 8.588   17.920 1.00 28.71 ? 162  GLU A CB    1 
ATOM   815   C CG    . GLU A 1 110 ? 125.734 9.521   18.423 1.00 32.03 ? 162  GLU A CG    1 
ATOM   816   C CD    . GLU A 1 110 ? 125.749 10.878  17.760 1.00 33.72 ? 162  GLU A CD    1 
ATOM   817   O OE1   . GLU A 1 110 ? 126.068 10.943  16.551 1.00 38.06 ? 162  GLU A OE1   1 
ATOM   818   O OE2   . GLU A 1 110 ? 125.425 11.873  18.437 1.00 33.65 ? 162  GLU A OE2   1 
ATOM   819   N N     . GLN A 1 111 ? 127.797 9.256   20.778 1.00 28.07 ? 163  GLN A N     1 
ATOM   820   C CA    . GLN A 1 111 ? 127.739 9.996   22.048 1.00 28.43 ? 163  GLN A CA    1 
ATOM   821   C C     . GLN A 1 111 ? 129.135 10.394  22.532 1.00 28.47 ? 163  GLN A C     1 
ATOM   822   O O     . GLN A 1 111 ? 129.334 11.479  23.088 1.00 28.23 ? 163  GLN A O     1 
ATOM   823   C CB    . GLN A 1 111 ? 127.079 9.159   23.154 1.00 29.39 ? 163  GLN A CB    1 
ATOM   824   C CG    . GLN A 1 111 ? 125.636 9.505   23.422 1.00 32.83 ? 163  GLN A CG    1 
ATOM   825   C CD    . GLN A 1 111 ? 125.438 10.971  23.717 1.00 34.04 ? 163  GLN A CD    1 
ATOM   826   O OE1   . GLN A 1 111 ? 124.422 11.548  23.346 1.00 37.42 ? 163  GLN A OE1   1 
ATOM   827   N NE2   . GLN A 1 111 ? 126.403 11.583  24.392 1.00 34.76 ? 163  GLN A NE2   1 
ATOM   828   N N     . ALA A 1 112 ? 130.100 9.502   22.354 1.00 27.51 ? 164  ALA A N     1 
ATOM   829   C CA    . ALA A 1 112 ? 131.456 9.812   22.770 1.00 28.27 ? 164  ALA A CA    1 
ATOM   830   C C     . ALA A 1 112 ? 131.895 11.106  22.050 1.00 27.65 ? 164  ALA A C     1 
ATOM   831   O O     . ALA A 1 112 ? 132.220 12.108  22.692 1.00 26.28 ? 164  ALA A O     1 
ATOM   832   C CB    . ALA A 1 112 ? 132.384 8.647   22.422 1.00 27.71 ? 164  ALA A CB    1 
ATOM   833   N N     . ALA A 1 113 ? 131.869 11.067  20.716 1.00 26.41 ? 165  ALA A N     1 
ATOM   834   C CA    . ALA A 1 113 ? 132.236 12.198  19.876 1.00 24.47 ? 165  ALA A CA    1 
ATOM   835   C C     . ALA A 1 113 ? 131.519 13.478  20.305 1.00 24.39 ? 165  ALA A C     1 
ATOM   836   O O     . ALA A 1 113 ? 132.152 14.520  20.467 1.00 23.47 ? 165  ALA A O     1 
ATOM   837   C CB    . ALA A 1 113 ? 131.918 11.880  18.425 1.00 23.96 ? 165  ALA A CB    1 
ATOM   838   N N     . PHE A 1 114 ? 130.201 13.392  20.480 1.00 24.48 ? 166  PHE A N     1 
ATOM   839   C CA    . PHE A 1 114 ? 129.388 14.530  20.907 1.00 23.60 ? 166  PHE A CA    1 
ATOM   840   C C     . PHE A 1 114 ? 129.850 15.037  22.274 1.00 24.30 ? 166  PHE A C     1 
ATOM   841   O O     . PHE A 1 114 ? 130.042 16.238  22.459 1.00 25.88 ? 166  PHE A O     1 
ATOM   842   C CB    . PHE A 1 114 ? 127.900 14.131  20.958 1.00 22.47 ? 166  PHE A CB    1 
ATOM   843   C CG    . PHE A 1 114 ? 126.998 15.185  21.546 1.00 20.80 ? 166  PHE A CG    1 
ATOM   844   C CD1   . PHE A 1 114 ? 126.972 15.415  22.927 1.00 21.16 ? 166  PHE A CD1   1 
ATOM   845   C CD2   . PHE A 1 114 ? 126.195 15.966  20.724 1.00 20.06 ? 166  PHE A CD2   1 
ATOM   846   C CE1   . PHE A 1 114 ? 126.159 16.420  23.487 1.00 19.52 ? 166  PHE A CE1   1 
ATOM   847   C CE2   . PHE A 1 114 ? 125.376 16.974  21.269 1.00 22.12 ? 166  PHE A CE2   1 
ATOM   848   C CZ    . PHE A 1 114 ? 125.360 17.201  22.658 1.00 19.78 ? 166  PHE A CZ    1 
ATOM   849   N N     . ASP A 1 115 ? 130.023 14.133  23.233 1.00 24.14 ? 167  ASP A N     1 
ATOM   850   C CA    . ASP A 1 115 ? 130.461 14.542  24.559 1.00 23.51 ? 167  ASP A CA    1 
ATOM   851   C C     . ASP A 1 115 ? 131.811 15.262  24.457 1.00 23.18 ? 167  ASP A C     1 
ATOM   852   O O     . ASP A 1 115 ? 132.030 16.283  25.105 1.00 21.98 ? 167  ASP A O     1 
ATOM   853   C CB    . ASP A 1 115 ? 130.590 13.330  25.501 1.00 25.56 ? 167  ASP A CB    1 
ATOM   854   C CG    . ASP A 1 115 ? 129.238 12.728  25.908 1.00 27.72 ? 167  ASP A CG    1 
ATOM   855   O OD1   . ASP A 1 115 ? 128.217 13.449  25.893 1.00 30.31 ? 167  ASP A OD1   1 
ATOM   856   O OD2   . ASP A 1 115 ? 129.201 11.526  26.269 1.00 28.63 ? 167  ASP A OD2   1 
ATOM   857   N N     . ALA A 1 116 ? 132.709 14.729  23.634 1.00 22.53 ? 168  ALA A N     1 
ATOM   858   C CA    . ALA A 1 116 ? 134.027 15.313  23.462 1.00 22.78 ? 168  ALA A CA    1 
ATOM   859   C C     . ALA A 1 116 ? 133.950 16.758  22.955 1.00 25.35 ? 168  ALA A C     1 
ATOM   860   O O     . ALA A 1 116 ? 134.498 17.663  23.580 1.00 26.81 ? 168  ALA A O     1 
ATOM   861   C CB    . ALA A 1 116 ? 134.832 14.467  22.518 1.00 21.25 ? 168  ALA A CB    1 
ATOM   862   N N     . VAL A 1 117 ? 133.280 16.976  21.825 1.00 25.17 ? 169  VAL A N     1 
ATOM   863   C CA    . VAL A 1 117 ? 133.140 18.319  21.278 1.00 24.62 ? 169  VAL A CA    1 
ATOM   864   C C     . VAL A 1 117 ? 132.328 19.184  22.257 1.00 23.84 ? 169  VAL A C     1 
ATOM   865   O O     . VAL A 1 117 ? 132.646 20.354  22.492 1.00 21.94 ? 169  VAL A O     1 
ATOM   866   C CB    . VAL A 1 117 ? 132.437 18.302  19.872 1.00 24.91 ? 169  VAL A CB    1 
ATOM   867   C CG1   . VAL A 1 117 ? 132.217 19.737  19.374 1.00 21.07 ? 169  VAL A CG1   1 
ATOM   868   C CG2   . VAL A 1 117 ? 133.292 17.536  18.869 1.00 20.86 ? 169  VAL A CG2   1 
ATOM   869   N N     . GLN A 1 118 ? 131.284 18.606  22.832 1.00 22.14 ? 170  GLN A N     1 
ATOM   870   C CA    . GLN A 1 118 ? 130.476 19.357  23.777 1.00 24.18 ? 170  GLN A CA    1 
ATOM   871   C C     . GLN A 1 118 ? 131.432 19.888  24.835 1.00 24.64 ? 170  GLN A C     1 
ATOM   872   O O     . GLN A 1 118 ? 131.357 21.047  25.246 1.00 24.65 ? 170  GLN A O     1 
ATOM   873   C CB    . GLN A 1 118 ? 129.411 18.453  24.412 1.00 23.96 ? 170  GLN A CB    1 
ATOM   874   C CG    . GLN A 1 118 ? 128.473 19.168  25.361 1.00 25.24 ? 170  GLN A CG    1 
ATOM   875   C CD    . GLN A 1 118 ? 127.811 20.385  24.725 1.00 27.99 ? 170  GLN A CD    1 
ATOM   876   O OE1   . GLN A 1 118 ? 127.156 20.275  23.688 1.00 29.19 ? 170  GLN A OE1   1 
ATOM   877   N NE2   . GLN A 1 118 ? 127.981 21.555  25.348 1.00 27.53 ? 170  GLN A NE2   1 
ATOM   878   N N     . SER A 1 119 ? 132.347 19.023  25.254 1.00 26.05 ? 171  SER A N     1 
ATOM   879   C CA    . SER A 1 119 ? 133.346 19.376  26.249 1.00 25.76 ? 171  SER A CA    1 
ATOM   880   C C     . SER A 1 119 ? 134.007 20.702  25.882 1.00 25.12 ? 171  SER A C     1 
ATOM   881   O O     . SER A 1 119 ? 134.138 21.599  26.702 1.00 22.71 ? 171  SER A O     1 
ATOM   882   C CB    . SER A 1 119 ? 134.400 18.276  26.311 1.00 25.21 ? 171  SER A CB    1 
ATOM   883   O OG    . SER A 1 119 ? 135.609 18.750  26.870 1.00 29.48 ? 171  SER A OG    1 
ATOM   884   N N     . LEU A 1 120 ? 134.409 20.808  24.627 1.00 25.80 ? 172  LEU A N     1 
ATOM   885   C CA    . LEU A 1 120 ? 135.072 21.988  24.140 1.00 26.24 ? 172  LEU A CA    1 
ATOM   886   C C     . LEU A 1 120 ? 134.118 23.165  23.948 1.00 30.26 ? 172  LEU A C     1 
ATOM   887   O O     . LEU A 1 120 ? 134.527 24.322  24.103 1.00 30.84 ? 172  LEU A O     1 
ATOM   888   C CB    . LEU A 1 120 ? 135.801 21.632  22.854 1.00 24.01 ? 172  LEU A CB    1 
ATOM   889   C CG    . LEU A 1 120 ? 136.906 20.579  23.052 1.00 21.43 ? 172  LEU A CG    1 
ATOM   890   C CD1   . LEU A 1 120 ? 137.118 19.801  21.771 1.00 20.64 ? 172  LEU A CD1   1 
ATOM   891   C CD2   . LEU A 1 120 ? 138.202 21.252  23.469 1.00 20.89 ? 172  LEU A CD2   1 
ATOM   892   N N     . ILE A 1 121 ? 132.855 22.892  23.615 1.00 32.54 ? 173  ILE A N     1 
ATOM   893   C CA    . ILE A 1 121 ? 131.890 23.976  23.449 1.00 33.26 ? 173  ILE A CA    1 
ATOM   894   C C     . ILE A 1 121 ? 131.875 24.704  24.771 1.00 33.66 ? 173  ILE A C     1 
ATOM   895   O O     . ILE A 1 121 ? 131.992 25.923  24.822 1.00 33.73 ? 173  ILE A O     1 
ATOM   896   C CB    . ILE A 1 121 ? 130.446 23.493  23.261 1.00 35.06 ? 173  ILE A CB    1 
ATOM   897   C CG1   . ILE A 1 121 ? 130.355 22.450  22.146 1.00 37.57 ? 173  ILE A CG1   1 
ATOM   898   C CG2   . ILE A 1 121 ? 129.555 24.685  22.981 1.00 33.35 ? 173  ILE A CG2   1 
ATOM   899   C CD1   . ILE A 1 121 ? 130.785 22.942  20.798 1.00 42.82 ? 173  ILE A CD1   1 
ATOM   900   N N     . ASP A 1 122 ? 131.725 23.922  25.837 1.00 33.76 ? 174  ASP A N     1 
ATOM   901   C CA    . ASP A 1 122 ? 131.645 24.436  27.191 1.00 34.44 ? 174  ASP A CA    1 
ATOM   902   C C     . ASP A 1 122 ? 132.910 25.140  27.674 1.00 34.74 ? 174  ASP A C     1 
ATOM   903   O O     . ASP A 1 122 ? 132.880 25.862  28.667 1.00 36.43 ? 174  ASP A O     1 
ATOM   904   C CB    . ASP A 1 122 ? 131.295 23.300  28.145 1.00 38.34 ? 174  ASP A CB    1 
ATOM   905   C CG    . ASP A 1 122 ? 130.059 22.514  27.709 1.00 42.82 ? 174  ASP A CG    1 
ATOM   906   O OD1   . ASP A 1 122 ? 129.004 23.134  27.456 1.00 44.23 ? 174  ASP A OD1   1 
ATOM   907   O OD2   . ASP A 1 122 ? 130.135 21.263  27.637 1.00 45.52 ? 174  ASP A OD2   1 
ATOM   908   N N     . SER A 1 123 ? 134.025 24.920  26.987 1.00 34.53 ? 175  SER A N     1 
ATOM   909   C CA    . SER A 1 123 ? 135.286 25.563  27.349 1.00 33.57 ? 175  SER A CA    1 
ATOM   910   C C     . SER A 1 123 ? 135.266 26.940  26.729 1.00 32.84 ? 175  SER A C     1 
ATOM   911   O O     . SER A 1 123 ? 136.097 27.777  27.053 1.00 34.14 ? 175  SER A O     1 
ATOM   912   C CB    . SER A 1 123 ? 136.498 24.810  26.780 1.00 36.02 ? 175  SER A CB    1 
ATOM   913   O OG    . SER A 1 123 ? 136.706 23.536  27.377 1.00 39.57 ? 175  SER A OG    1 
ATOM   914   N N     . GLY A 1 124 ? 134.334 27.150  25.803 1.00 31.86 ? 176  GLY A N     1 
ATOM   915   C CA    . GLY A 1 124 ? 134.208 28.432  25.137 1.00 30.87 ? 176  GLY A CA    1 
ATOM   916   C C     . GLY A 1 124 ? 134.567 28.431  23.665 1.00 31.72 ? 176  GLY A C     1 
ATOM   917   O O     . GLY A 1 124 ? 134.557 29.476  23.014 1.00 31.34 ? 176  GLY A O     1 
ATOM   918   N N     . HIS A 1 125 ? 134.883 27.265  23.121 1.00 32.09 ? 177  HIS A N     1 
ATOM   919   C CA    . HIS A 1 125 ? 135.239 27.199  21.716 1.00 33.09 ? 177  HIS A CA    1 
ATOM   920   C C     . HIS A 1 125 ? 134.010 27.261  20.833 1.00 33.38 ? 177  HIS A C     1 
ATOM   921   O O     . HIS A 1 125 ? 133.003 26.613  21.088 1.00 33.73 ? 177  HIS A O     1 
ATOM   922   C CB    . HIS A 1 125 ? 136.052 25.936  21.456 1.00 32.71 ? 177  HIS A CB    1 
ATOM   923   C CG    . HIS A 1 125 ? 137.302 25.877  22.273 1.00 32.27 ? 177  HIS A CG    1 
ATOM   924   N ND1   . HIS A 1 125 ? 138.522 26.305  21.798 1.00 32.61 ? 177  HIS A ND1   1 
ATOM   925   C CD2   . HIS A 1 125 ? 137.501 25.537  23.568 1.00 32.05 ? 177  HIS A CD2   1 
ATOM   926   C CE1   . HIS A 1 125 ? 139.419 26.232  22.765 1.00 31.79 ? 177  HIS A CE1   1 
ATOM   927   N NE2   . HIS A 1 125 ? 138.824 25.770  23.850 1.00 31.48 ? 177  HIS A NE2   1 
ATOM   928   N N     . LYS A 1 126 ? 134.092 28.079  19.796 1.00 35.22 ? 178  LYS A N     1 
ATOM   929   C CA    . LYS A 1 126 ? 132.977 28.222  18.884 1.00 34.85 ? 178  LYS A CA    1 
ATOM   930   C C     . LYS A 1 126 ? 133.291 27.528  17.567 1.00 33.43 ? 178  LYS A C     1 
ATOM   931   O O     . LYS A 1 126 ? 132.417 26.903  16.979 1.00 33.88 ? 178  LYS A O     1 
ATOM   932   C CB    . LYS A 1 126 ? 132.617 29.711  18.739 1.00 35.10 ? 178  LYS A CB    1 
ATOM   933   C CG    . LYS A 1 126 ? 132.018 30.262  20.072 1.00 37.53 ? 178  LYS A CG    1 
ATOM   934   C CD    . LYS A 1 126 ? 131.753 31.763  20.088 1.00 38.28 ? 178  LYS A CD    1 
ATOM   935   C CE    . LYS A 1 126 ? 133.044 32.554  19.874 1.00 41.93 ? 178  LYS A CE    1 
ATOM   936   N NZ    . LYS A 1 126 ? 132.824 34.022  19.616 1.00 44.10 ? 178  LYS A NZ    1 
ATOM   937   N N     . ASN A 1 127 ? 134.525 27.600  17.089 1.00 32.76 ? 179  ASN A N     1 
ATOM   938   C CA    . ASN A 1 127 ? 134.807 26.862  15.870 1.00 33.25 ? 179  ASN A CA    1 
ATOM   939   C C     . ASN A 1 127 ? 135.896 25.802  16.107 1.00 31.76 ? 179  ASN A C     1 
ATOM   940   O O     . ASN A 1 127 ? 137.096 26.087  16.227 1.00 31.54 ? 179  ASN A O     1 
ATOM   941   C CB    . ASN A 1 127 ? 135.086 27.797  14.673 1.00 34.57 ? 179  ASN A CB    1 
ATOM   942   C CG    . ASN A 1 127 ? 136.117 28.838  14.961 1.00 36.21 ? 179  ASN A CG    1 
ATOM   943   O OD1   . ASN A 1 127 ? 137.262 28.514  15.261 1.00 39.33 ? 179  ASN A OD1   1 
ATOM   944   N ND2   . ASN A 1 127 ? 135.728 30.108  14.857 1.00 34.92 ? 179  ASN A ND2   1 
ATOM   945   N N     . ILE A 1 128 ? 135.394 24.569  16.202 1.00 29.09 ? 180  ILE A N     1 
ATOM   946   C CA    . ILE A 1 128 ? 136.134 23.343  16.483 1.00 26.56 ? 180  ILE A CA    1 
ATOM   947   C C     . ILE A 1 128 ? 136.197 22.426  15.262 1.00 25.38 ? 180  ILE A C     1 
ATOM   948   O O     . ILE A 1 128 ? 135.163 22.064  14.692 1.00 23.66 ? 180  ILE A O     1 
ATOM   949   C CB    . ILE A 1 128 ? 135.426 22.562  17.621 1.00 27.08 ? 180  ILE A CB    1 
ATOM   950   C CG1   . ILE A 1 128 ? 135.004 23.531  18.732 1.00 28.88 ? 180  ILE A CG1   1 
ATOM   951   C CG2   . ILE A 1 128 ? 136.351 21.495  18.193 1.00 26.02 ? 180  ILE A CG2   1 
ATOM   952   C CD1   . ILE A 1 128 ? 133.585 23.325  19.252 1.00 36.06 ? 180  ILE A CD1   1 
ATOM   953   N N     . ALA A 1 129 ? 137.407 22.025  14.888 1.00 24.10 ? 181  ALA A N     1 
ATOM   954   C CA    . ALA A 1 129 ? 137.601 21.149  13.746 1.00 25.17 ? 181  ALA A CA    1 
ATOM   955   C C     . ALA A 1 129 ? 137.608 19.672  14.164 1.00 26.67 ? 181  ALA A C     1 
ATOM   956   O O     . ALA A 1 129 ? 137.675 19.364  15.354 1.00 25.98 ? 181  ALA A O     1 
ATOM   957   C CB    . ALA A 1 129 ? 138.892 21.504  13.060 1.00 26.08 ? 181  ALA A CB    1 
ATOM   958   N N     . PHE A 1 130 ? 137.535 18.770  13.180 1.00 28.23 ? 182  PHE A N     1 
ATOM   959   C CA    . PHE A 1 130 ? 137.529 17.315  13.419 1.00 29.26 ? 182  PHE A CA    1 
ATOM   960   C C     . PHE A 1 130 ? 138.459 16.528  12.498 1.00 29.27 ? 182  PHE A C     1 
ATOM   961   O O     . PHE A 1 130 ? 138.215 16.444  11.292 1.00 28.08 ? 182  PHE A O     1 
ATOM   962   C CB    . PHE A 1 130 ? 136.128 16.738  13.226 1.00 29.77 ? 182  PHE A CB    1 
ATOM   963   C CG    . PHE A 1 130 ? 136.060 15.249  13.426 1.00 29.90 ? 182  PHE A CG    1 
ATOM   964   C CD1   . PHE A 1 130 ? 135.264 14.460  12.610 1.00 28.65 ? 182  PHE A CD1   1 
ATOM   965   C CD2   . PHE A 1 130 ? 136.798 14.633  14.432 1.00 29.42 ? 182  PHE A CD2   1 
ATOM   966   C CE1   . PHE A 1 130 ? 135.205 13.094  12.790 1.00 27.38 ? 182  PHE A CE1   1 
ATOM   967   C CE2   . PHE A 1 130 ? 136.737 13.264  14.613 1.00 27.46 ? 182  PHE A CE2   1 
ATOM   968   C CZ    . PHE A 1 130 ? 135.941 12.497  13.790 1.00 26.98 ? 182  PHE A CZ    1 
ATOM   969   N N     . VAL A 1 131 ? 139.506 15.926  13.053 1.00 29.25 ? 183  VAL A N     1 
ATOM   970   C CA    . VAL A 1 131 ? 140.422 15.155  12.221 1.00 29.62 ? 183  VAL A CA    1 
ATOM   971   C C     . VAL A 1 131 ? 140.081 13.707  12.428 1.00 31.75 ? 183  VAL A C     1 
ATOM   972   O O     . VAL A 1 131 ? 140.299 13.158  13.505 1.00 32.03 ? 183  VAL A O     1 
ATOM   973   C CB    . VAL A 1 131 ? 141.892 15.380  12.603 1.00 28.52 ? 183  VAL A CB    1 
ATOM   974   C CG1   . VAL A 1 131 ? 142.784 14.449  11.781 1.00 27.21 ? 183  VAL A CG1   1 
ATOM   975   C CG2   . VAL A 1 131 ? 142.272 16.829  12.358 1.00 23.87 ? 183  VAL A CG2   1 
ATOM   976   N N     . SER A 1 132 ? 139.555 13.074  11.389 1.00 33.87 ? 184  SER A N     1 
ATOM   977   C CA    . SER A 1 132 ? 139.147 11.693  11.533 1.00 36.29 ? 184  SER A CA    1 
ATOM   978   C C     . SER A 1 132 ? 139.964 10.677  10.771 1.00 36.83 ? 184  SER A C     1 
ATOM   979   O O     . SER A 1 132 ? 140.992 10.983  10.164 1.00 36.46 ? 184  SER A O     1 
ATOM   980   C CB    . SER A 1 132 ? 137.685 11.537  11.120 1.00 36.09 ? 184  SER A CB    1 
ATOM   981   O OG    . SER A 1 132 ? 137.585 11.487  9.714  1.00 40.15 ? 184  SER A OG    1 
ATOM   982   N N     . GLY A 1 133 ? 139.473 9.446   10.828 1.00 37.12 ? 185  GLY A N     1 
ATOM   983   C CA    . GLY A 1 133 ? 140.112 8.365   10.126 1.00 38.03 ? 185  GLY A CA    1 
ATOM   984   C C     . GLY A 1 133 ? 139.375 8.180   8.814  1.00 38.96 ? 185  GLY A C     1 
ATOM   985   O O     . GLY A 1 133 ? 138.442 8.929   8.486  1.00 39.27 ? 185  GLY A O     1 
ATOM   986   N N     . THR A 1 134 ? 139.806 7.174   8.064  1.00 38.86 ? 186  THR A N     1 
ATOM   987   C CA    . THR A 1 134 ? 139.222 6.834   6.782  1.00 38.56 ? 186  THR A CA    1 
ATOM   988   C C     . THR A 1 134 ? 137.707 6.940   6.833  1.00 37.67 ? 186  THR A C     1 
ATOM   989   O O     . THR A 1 134 ? 137.029 6.120   7.446  1.00 36.19 ? 186  THR A O     1 
ATOM   990   C CB    . THR A 1 134 ? 139.624 5.420   6.404  1.00 40.17 ? 186  THR A CB    1 
ATOM   991   O OG1   . THR A 1 134 ? 140.985 5.195   6.821  1.00 41.47 ? 186  THR A OG1   1 
ATOM   992   C CG2   . THR A 1 134 ? 139.518 5.232   4.905  1.00 39.91 ? 186  THR A CG2   1 
ATOM   993   N N     . LEU A 1 135 ? 137.195 7.970   6.178  1.00 37.81 ? 187  LEU A N     1 
ATOM   994   C CA    . LEU A 1 135 ? 135.773 8.242   6.141  1.00 37.86 ? 187  LEU A CA    1 
ATOM   995   C C     . LEU A 1 135 ? 134.904 7.085   5.702  1.00 38.11 ? 187  LEU A C     1 
ATOM   996   O O     . LEU A 1 135 ? 133.756 6.983   6.126  1.00 37.56 ? 187  LEU A O     1 
ATOM   997   C CB    . LEU A 1 135 ? 135.512 9.440   5.241  1.00 37.20 ? 187  LEU A CB    1 
ATOM   998   C CG    . LEU A 1 135 ? 135.641 10.762  5.988  1.00 38.78 ? 187  LEU A CG    1 
ATOM   999   C CD1   . LEU A 1 135 ? 135.542 11.921  5.010  1.00 38.74 ? 187  LEU A CD1   1 
ATOM   1000  C CD2   . LEU A 1 135 ? 134.556 10.834  7.058  1.00 36.15 ? 187  LEU A CD2   1 
ATOM   1001  N N     . GLU A 1 136 ? 135.443 6.213   4.858  1.00 38.84 ? 188  GLU A N     1 
ATOM   1002  C CA    . GLU A 1 136 ? 134.675 5.077   4.370  1.00 40.39 ? 188  GLU A CA    1 
ATOM   1003  C C     . GLU A 1 136 ? 134.201 4.146   5.475  1.00 40.60 ? 188  GLU A C     1 
ATOM   1004  O O     . GLU A 1 136 ? 133.193 3.463   5.323  1.00 39.56 ? 188  GLU A O     1 
ATOM   1005  C CB    . GLU A 1 136 ? 135.485 4.293   3.349  1.00 41.94 ? 188  GLU A CB    1 
ATOM   1006  C CG    . GLU A 1 136 ? 136.050 5.171   2.266  1.00 47.02 ? 188  GLU A CG    1 
ATOM   1007  C CD    . GLU A 1 136 ? 137.461 5.631   2.581  1.00 51.91 ? 188  GLU A CD    1 
ATOM   1008  O OE1   . GLU A 1 136 ? 138.398 4.850   2.305  1.00 55.16 ? 188  GLU A OE1   1 
ATOM   1009  O OE2   . GLU A 1 136 ? 137.644 6.756   3.111  1.00 54.03 ? 188  GLU A OE2   1 
ATOM   1010  N N     . GLU A 1 137 ? 134.917 4.126   6.593  1.00 41.76 ? 189  GLU A N     1 
ATOM   1011  C CA    . GLU A 1 137 ? 134.539 3.270   7.709  1.00 41.18 ? 189  GLU A CA    1 
ATOM   1012  C C     . GLU A 1 137 ? 133.371 3.823   8.512  1.00 40.96 ? 189  GLU A C     1 
ATOM   1013  O O     . GLU A 1 137 ? 133.333 5.004   8.871  1.00 39.62 ? 189  GLU A O     1 
ATOM   1014  C CB    . GLU A 1 137 ? 135.722 3.065   8.637  1.00 42.81 ? 189  GLU A CB    1 
ATOM   1015  C CG    . GLU A 1 137 ? 136.914 2.458   7.964  1.00 44.77 ? 189  GLU A CG    1 
ATOM   1016  C CD    . GLU A 1 137 ? 138.036 2.184   8.938  1.00 45.42 ? 189  GLU A CD    1 
ATOM   1017  O OE1   . GLU A 1 137 ? 139.129 1.812   8.463  1.00 46.59 ? 189  GLU A OE1   1 
ATOM   1018  O OE2   . GLU A 1 137 ? 137.824 2.333   10.165 1.00 44.57 ? 189  GLU A OE2   1 
ATOM   1019  N N     . PRO A 1 138 ? 132.405 2.961   8.829  1.00 41.06 ? 190  PRO A N     1 
ATOM   1020  C CA    . PRO A 1 138 ? 131.240 3.398   9.597  1.00 41.09 ? 190  PRO A CA    1 
ATOM   1021  C C     . PRO A 1 138 ? 131.521 4.164   10.898 1.00 41.12 ? 190  PRO A C     1 
ATOM   1022  O O     . PRO A 1 138 ? 130.953 5.230   11.081 1.00 44.19 ? 190  PRO A O     1 
ATOM   1023  C CB    . PRO A 1 138 ? 130.471 2.099   9.816  1.00 40.85 ? 190  PRO A CB    1 
ATOM   1024  C CG    . PRO A 1 138 ? 130.775 1.331   8.563  1.00 40.16 ? 190  PRO A CG    1 
ATOM   1025  C CD    . PRO A 1 138 ? 132.265 1.554   8.411  1.00 40.65 ? 190  PRO A CD    1 
ATOM   1026  N N     . ILE A 1 139 ? 132.368 3.655   11.799 1.00 39.78 ? 191  ILE A N     1 
ATOM   1027  C CA    . ILE A 1 139 ? 132.638 4.385   13.055 1.00 38.97 ? 191  ILE A CA    1 
ATOM   1028  C C     . ILE A 1 139 ? 132.921 5.870   12.814 1.00 37.48 ? 191  ILE A C     1 
ATOM   1029  O O     . ILE A 1 139 ? 132.755 6.701   13.704 1.00 36.21 ? 191  ILE A O     1 
ATOM   1030  C CB    . ILE A 1 139 ? 133.866 3.831   13.836 1.00 40.34 ? 191  ILE A CB    1 
ATOM   1031  C CG1   . ILE A 1 139 ? 135.025 3.593   12.864 1.00 42.80 ? 191  ILE A CG1   1 
ATOM   1032  C CG2   . ILE A 1 139 ? 133.484 2.601   14.628 1.00 39.58 ? 191  ILE A CG2   1 
ATOM   1033  C CD1   . ILE A 1 139 ? 136.339 3.259   13.529 1.00 44.69 ? 191  ILE A CD1   1 
ATOM   1034  N N     . ASN A 1 140 ? 133.364 6.196   11.609 1.00 36.54 ? 192  ASN A N     1 
ATOM   1035  C CA    . ASN A 1 140 ? 133.673 7.570   11.278 1.00 36.26 ? 192  ASN A CA    1 
ATOM   1036  C C     . ASN A 1 140 ? 132.528 8.325   10.617 1.00 36.77 ? 192  ASN A C     1 
ATOM   1037  O O     . ASN A 1 140 ? 131.931 9.211   11.220 1.00 37.62 ? 192  ASN A O     1 
ATOM   1038  C CB    . ASN A 1 140 ? 134.884 7.626   10.359 1.00 37.08 ? 192  ASN A CB    1 
ATOM   1039  C CG    . ASN A 1 140 ? 136.169 7.309   11.075 1.00 37.62 ? 192  ASN A CG    1 
ATOM   1040  O OD1   . ASN A 1 140 ? 136.886 6.382   10.704 1.00 36.04 ? 192  ASN A OD1   1 
ATOM   1041  N ND2   . ASN A 1 140 ? 136.476 8.087   12.109 1.00 41.11 ? 192  ASN A ND2   1 
ATOM   1042  N N     . HIS A 1 141 ? 132.219 7.970   9.375  1.00 35.66 ? 193  HIS A N     1 
ATOM   1043  C CA    . HIS A 1 141 ? 131.176 8.667   8.647  1.00 33.60 ? 193  HIS A CA    1 
ATOM   1044  C C     . HIS A 1 141 ? 129.801 8.540   9.257  1.00 33.54 ? 193  HIS A C     1 
ATOM   1045  O O     . HIS A 1 141 ? 128.949 9.409   9.052  1.00 35.87 ? 193  HIS A O     1 
ATOM   1046  C CB    . HIS A 1 141 ? 131.129 8.193   7.187  1.00 31.20 ? 193  HIS A CB    1 
ATOM   1047  C CG    . HIS A 1 141 ? 130.432 6.883   6.985  1.00 30.05 ? 193  HIS A CG    1 
ATOM   1048  N ND1   . HIS A 1 141 ? 131.076 5.766   6.496  1.00 29.96 ? 193  HIS A ND1   1 
ATOM   1049  C CD2   . HIS A 1 141 ? 129.146 6.511   7.196  1.00 27.97 ? 193  HIS A CD2   1 
ATOM   1050  C CE1   . HIS A 1 141 ? 130.220 4.763   6.418  1.00 27.40 ? 193  HIS A CE1   1 
ATOM   1051  N NE2   . HIS A 1 141 ? 129.042 5.189   6.838  1.00 25.90 ? 193  HIS A NE2   1 
ATOM   1052  N N     . ALA A 1 142 ? 129.583 7.473   10.017 1.00 31.63 ? 194  ALA A N     1 
ATOM   1053  C CA    . ALA A 1 142 ? 128.275 7.230   10.598 1.00 30.96 ? 194  ALA A CA    1 
ATOM   1054  C C     . ALA A 1 142 ? 128.098 7.536   12.066 1.00 31.90 ? 194  ALA A C     1 
ATOM   1055  O O     . ALA A 1 142 ? 126.962 7.644   12.529 1.00 32.87 ? 194  ALA A O     1 
ATOM   1056  C CB    . ALA A 1 142 ? 127.868 5.791   10.344 1.00 26.85 ? 194  ALA A CB    1 
ATOM   1057  N N     . LYS A 1 143 ? 129.195 7.685   12.801 1.00 32.46 ? 195  LYS A N     1 
ATOM   1058  C CA    . LYS A 1 143 ? 129.095 7.914   14.240 1.00 32.90 ? 195  LYS A CA    1 
ATOM   1059  C C     . LYS A 1 143 ? 129.876 9.091   14.810 1.00 33.12 ? 195  LYS A C     1 
ATOM   1060  O O     . LYS A 1 143 ? 129.313 9.953   15.490 1.00 33.30 ? 195  LYS A O     1 
ATOM   1061  C CB    . LYS A 1 143 ? 129.535 6.650   14.972 1.00 33.03 ? 195  LYS A CB    1 
ATOM   1062  C CG    . LYS A 1 143 ? 128.954 5.365   14.420 1.00 31.64 ? 195  LYS A CG    1 
ATOM   1063  C CD    . LYS A 1 143 ? 127.509 5.156   14.821 1.00 32.59 ? 195  LYS A CD    1 
ATOM   1064  C CE    . LYS A 1 143 ? 127.074 3.744   14.424 1.00 33.44 ? 195  LYS A CE    1 
ATOM   1065  N NZ    . LYS A 1 143 ? 125.615 3.481   14.584 1.00 32.40 ? 195  LYS A NZ    1 
ATOM   1066  N N     . LYS A 1 144 ? 131.181 9.092   14.566 1.00 33.38 ? 196  LYS A N     1 
ATOM   1067  C CA    . LYS A 1 144 ? 132.063 10.139  15.058 1.00 33.46 ? 196  LYS A CA    1 
ATOM   1068  C C     . LYS A 1 144 ? 131.833 11.465  14.342 1.00 33.64 ? 196  LYS A C     1 
ATOM   1069  O O     . LYS A 1 144 ? 131.793 12.513  14.982 1.00 34.48 ? 196  LYS A O     1 
ATOM   1070  C CB    . LYS A 1 144 ? 133.527 9.687   14.934 1.00 33.79 ? 196  LYS A CB    1 
ATOM   1071  C CG    . LYS A 1 144 ? 133.910 8.590   15.931 1.00 31.83 ? 196  LYS A CG    1 
ATOM   1072  C CD    . LYS A 1 144 ? 135.320 8.072   15.700 1.00 32.17 ? 196  LYS A CD    1 
ATOM   1073  C CE    . LYS A 1 144 ? 135.813 7.235   16.882 1.00 30.71 ? 196  LYS A CE    1 
ATOM   1074  N NZ    . LYS A 1 144 ? 137.127 6.592   16.619 1.00 28.06 ? 196  LYS A NZ    1 
ATOM   1075  N N     . VAL A 1 145 ? 131.673 11.430  13.023 1.00 32.90 ? 197  VAL A N     1 
ATOM   1076  C CA    . VAL A 1 145 ? 131.419 12.659  12.282 1.00 32.36 ? 197  VAL A CA    1 
ATOM   1077  C C     . VAL A 1 145 ? 130.081 13.223  12.746 1.00 32.88 ? 197  VAL A C     1 
ATOM   1078  O O     . VAL A 1 145 ? 129.936 14.427  12.925 1.00 34.12 ? 197  VAL A O     1 
ATOM   1079  C CB    . VAL A 1 145 ? 131.326 12.423  10.743 1.00 31.84 ? 197  VAL A CB    1 
ATOM   1080  C CG1   . VAL A 1 145 ? 131.008 13.722  10.047 1.00 29.41 ? 197  VAL A CG1   1 
ATOM   1081  C CG2   . VAL A 1 145 ? 132.627 11.866  10.201 1.00 30.71 ? 197  VAL A CG2   1 
ATOM   1082  N N     . LYS A 1 146 ? 129.114 12.335  12.959 1.00 33.22 ? 198  LYS A N     1 
ATOM   1083  C CA    . LYS A 1 146 ? 127.764 12.720  13.367 1.00 33.00 ? 198  LYS A CA    1 
ATOM   1084  C C     . LYS A 1 146 ? 127.616 13.220  14.801 1.00 32.20 ? 198  LYS A C     1 
ATOM   1085  O O     . LYS A 1 146 ? 126.795 14.094  15.073 1.00 33.66 ? 198  LYS A O     1 
ATOM   1086  C CB    . LYS A 1 146 ? 126.804 11.552  13.101 1.00 33.56 ? 198  LYS A CB    1 
ATOM   1087  C CG    . LYS A 1 146 ? 126.903 11.042  11.664 1.00 36.56 ? 198  LYS A CG    1 
ATOM   1088  C CD    . LYS A 1 146 ? 125.626 11.238  10.862 1.00 39.46 ? 198  LYS A CD    1 
ATOM   1089  C CE    . LYS A 1 146 ? 124.618 10.119  11.150 1.00 42.95 ? 198  LYS A CE    1 
ATOM   1090  N NZ    . LYS A 1 146 ? 123.366 10.198  10.334 1.00 42.27 ? 198  LYS A NZ    1 
ATOM   1091  N N     . GLY A 1 147 ? 128.394 12.665  15.721 1.00 31.87 ? 199  GLY A N     1 
ATOM   1092  C CA    . GLY A 1 147 ? 128.326 13.113  17.101 1.00 29.66 ? 199  GLY A CA    1 
ATOM   1093  C C     . GLY A 1 147 ? 129.026 14.452  17.183 1.00 28.47 ? 199  GLY A C     1 
ATOM   1094  O O     . GLY A 1 147 ? 128.737 15.275  18.033 1.00 29.46 ? 199  GLY A O     1 
ATOM   1095  N N     . TYR A 1 148 ? 129.970 14.667  16.283 1.00 27.81 ? 200  TYR A N     1 
ATOM   1096  C CA    . TYR A 1 148 ? 130.699 15.919  16.235 1.00 28.29 ? 200  TYR A CA    1 
ATOM   1097  C C     . TYR A 1 148 ? 129.745 17.003  15.727 1.00 29.81 ? 200  TYR A C     1 
ATOM   1098  O O     . TYR A 1 148 ? 129.542 18.035  16.380 1.00 30.14 ? 200  TYR A O     1 
ATOM   1099  C CB    . TYR A 1 148 ? 131.921 15.759  15.313 1.00 27.38 ? 200  TYR A CB    1 
ATOM   1100  C CG    . TYR A 1 148 ? 132.459 17.032  14.688 1.00 25.62 ? 200  TYR A CG    1 
ATOM   1101  C CD1   . TYR A 1 148 ? 132.149 17.367  13.374 1.00 25.18 ? 200  TYR A CD1   1 
ATOM   1102  C CD2   . TYR A 1 148 ? 133.317 17.866  15.391 1.00 24.44 ? 200  TYR A CD2   1 
ATOM   1103  C CE1   . TYR A 1 148 ? 132.698 18.492  12.777 1.00 24.80 ? 200  TYR A CE1   1 
ATOM   1104  C CE2   . TYR A 1 148 ? 133.864 18.991  14.806 1.00 24.15 ? 200  TYR A CE2   1 
ATOM   1105  C CZ    . TYR A 1 148 ? 133.559 19.293  13.501 1.00 24.55 ? 200  TYR A CZ    1 
ATOM   1106  O OH    . TYR A 1 148 ? 134.161 20.369  12.912 1.00 25.00 ? 200  TYR A OH    1 
ATOM   1107  N N     . LYS A 1 149 ? 129.150 16.759  14.564 1.00 30.25 ? 201  LYS A N     1 
ATOM   1108  C CA    . LYS A 1 149 ? 128.212 17.709  13.991 1.00 30.58 ? 201  LYS A CA    1 
ATOM   1109  C C     . LYS A 1 149 ? 127.016 17.956  14.925 1.00 30.51 ? 201  LYS A C     1 
ATOM   1110  O O     . LYS A 1 149 ? 126.553 19.091  15.073 1.00 31.17 ? 201  LYS A O     1 
ATOM   1111  C CB    . LYS A 1 149 ? 127.775 17.213  12.610 1.00 28.89 ? 201  LYS A CB    1 
ATOM   1112  C CG    . LYS A 1 149 ? 128.957 17.195  11.658 1.00 31.22 ? 201  LYS A CG    1 
ATOM   1113  C CD    . LYS A 1 149 ? 128.708 16.447  10.373 1.00 31.51 ? 201  LYS A CD    1 
ATOM   1114  C CE    . LYS A 1 149 ? 127.798 17.194  9.466  1.00 33.59 ? 201  LYS A CE    1 
ATOM   1115  N NZ    . LYS A 1 149 ? 127.554 16.367  8.262  1.00 37.90 ? 201  LYS A NZ    1 
ATOM   1116  N N     . ARG A 1 150 ? 126.525 16.916  15.581 1.00 29.53 ? 202  ARG A N     1 
ATOM   1117  C CA    . ARG A 1 150 ? 125.407 17.120  16.480 1.00 30.32 ? 202  ARG A CA    1 
ATOM   1118  C C     . ARG A 1 150 ? 125.801 18.182  17.521 1.00 31.55 ? 202  ARG A C     1 
ATOM   1119  O O     . ARG A 1 150 ? 125.088 19.171  17.716 1.00 30.34 ? 202  ARG A O     1 
ATOM   1120  C CB    . ARG A 1 150 ? 125.046 15.811  17.180 1.00 30.07 ? 202  ARG A CB    1 
ATOM   1121  C CG    . ARG A 1 150 ? 123.555 15.597  17.356 1.00 28.88 ? 202  ARG A CG    1 
ATOM   1122  C CD    . ARG A 1 150 ? 123.280 14.356  18.173 1.00 27.09 ? 202  ARG A CD    1 
ATOM   1123  N NE    . ARG A 1 150 ? 123.154 14.701  19.577 1.00 29.21 ? 202  ARG A NE    1 
ATOM   1124  C CZ    . ARG A 1 150 ? 123.607 13.952  20.576 1.00 30.04 ? 202  ARG A CZ    1 
ATOM   1125  N NH1   . ARG A 1 150 ? 124.217 12.809  20.312 1.00 31.03 ? 202  ARG A NH1   1 
ATOM   1126  N NH2   . ARG A 1 150 ? 123.460 14.352  21.836 1.00 28.80 ? 202  ARG A NH2   1 
ATOM   1127  N N     . ALA A 1 151 ? 126.950 17.978  18.167 1.00 31.31 ? 203  ALA A N     1 
ATOM   1128  C CA    . ALA A 1 151 ? 127.446 18.893  19.198 1.00 31.36 ? 203  ALA A CA    1 
ATOM   1129  C C     . ALA A 1 151 ? 127.454 20.343  18.733 1.00 30.75 ? 203  ALA A C     1 
ATOM   1130  O O     . ALA A 1 151 ? 126.948 21.230  19.422 1.00 29.35 ? 203  ALA A O     1 
ATOM   1131  C CB    . ALA A 1 151 ? 128.857 18.476  19.642 1.00 30.75 ? 203  ALA A CB    1 
ATOM   1132  N N     . LEU A 1 152 ? 128.039 20.582  17.564 1.00 30.39 ? 204  LEU A N     1 
ATOM   1133  C CA    . LEU A 1 152 ? 128.093 21.925  17.027 1.00 30.06 ? 204  LEU A CA    1 
ATOM   1134  C C     . LEU A 1 152 ? 126.706 22.480  16.702 1.00 32.83 ? 204  LEU A C     1 
ATOM   1135  O O     . LEU A 1 152 ? 126.310 23.514  17.250 1.00 32.99 ? 204  LEU A O     1 
ATOM   1136  C CB    . LEU A 1 152 ? 128.980 21.962  15.787 1.00 27.69 ? 204  LEU A CB    1 
ATOM   1137  C CG    . LEU A 1 152 ? 130.486 21.855  16.057 1.00 24.69 ? 204  LEU A CG    1 
ATOM   1138  C CD1   . LEU A 1 152 ? 131.273 21.939  14.761 1.00 21.75 ? 204  LEU A CD1   1 
ATOM   1139  C CD2   . LEU A 1 152 ? 130.910 22.967  16.991 1.00 24.59 ? 204  LEU A CD2   1 
ATOM   1140  N N     . THR A 1 153 ? 125.954 21.798  15.840 1.00 34.15 ? 205  THR A N     1 
ATOM   1141  C CA    . THR A 1 153 ? 124.632 22.302  15.487 1.00 35.14 ? 205  THR A CA    1 
ATOM   1142  C C     . THR A 1 153 ? 123.745 22.507  16.713 1.00 35.95 ? 205  THR A C     1 
ATOM   1143  O O     . THR A 1 153 ? 123.024 23.497  16.787 1.00 38.00 ? 205  THR A O     1 
ATOM   1144  C CB    . THR A 1 153 ? 123.893 21.391  14.455 1.00 34.52 ? 205  THR A CB    1 
ATOM   1145  O OG1   . THR A 1 153 ? 123.380 20.234  15.105 1.00 36.17 ? 205  THR A OG1   1 
ATOM   1146  C CG2   . THR A 1 153 ? 124.840 20.955  13.342 1.00 33.94 ? 205  THR A CG2   1 
ATOM   1147  N N     . GLU A 1 154 ? 123.793 21.601  17.684 1.00 36.46 ? 206  GLU A N     1 
ATOM   1148  C CA    . GLU A 1 154 ? 122.954 21.773  18.866 1.00 36.13 ? 206  GLU A CA    1 
ATOM   1149  C C     . GLU A 1 154 ? 123.306 23.057  19.603 1.00 37.34 ? 206  GLU A C     1 
ATOM   1150  O O     . GLU A 1 154 ? 122.436 23.689  20.207 1.00 37.67 ? 206  GLU A O     1 
ATOM   1151  C CB    . GLU A 1 154 ? 123.055 20.561  19.802 1.00 35.83 ? 206  GLU A CB    1 
ATOM   1152  C CG    . GLU A 1 154 ? 121.931 19.547  19.580 1.00 37.50 ? 206  GLU A CG    1 
ATOM   1153  C CD    . GLU A 1 154 ? 122.115 18.224  20.330 1.00 39.89 ? 206  GLU A CD    1 
ATOM   1154  O OE1   . GLU A 1 154 ? 122.381 18.240  21.564 1.00 40.88 ? 206  GLU A OE1   1 
ATOM   1155  O OE2   . GLU A 1 154 ? 121.976 17.163  19.673 1.00 39.15 ? 206  GLU A OE2   1 
ATOM   1156  N N     . SER A 1 155 ? 124.572 23.459  19.545 1.00 38.76 ? 207  SER A N     1 
ATOM   1157  C CA    . SER A 1 155 ? 124.989 24.691  20.209 1.00 39.64 ? 207  SER A CA    1 
ATOM   1158  C C     . SER A 1 155 ? 124.937 25.872  19.232 1.00 40.21 ? 207  SER A C     1 
ATOM   1159  O O     . SER A 1 155 ? 125.480 26.950  19.478 1.00 39.64 ? 207  SER A O     1 
ATOM   1160  C CB    . SER A 1 155 ? 126.387 24.521  20.812 1.00 39.66 ? 207  SER A CB    1 
ATOM   1161  O OG    . SER A 1 155 ? 126.320 23.683  21.956 1.00 39.44 ? 207  SER A OG    1 
ATOM   1162  N N     . GLY A 1 156 ? 124.257 25.649  18.117 1.00 41.27 ? 208  GLY A N     1 
ATOM   1163  C CA    . GLY A 1 156 ? 124.107 26.686  17.123 1.00 41.73 ? 208  GLY A CA    1 
ATOM   1164  C C     . GLY A 1 156 ? 125.414 27.179  16.564 1.00 42.31 ? 208  GLY A C     1 
ATOM   1165  O O     . GLY A 1 156 ? 125.571 28.374  16.336 1.00 43.85 ? 208  GLY A O     1 
ATOM   1166  N N     . LEU A 1 157 ? 126.355 26.267  16.352 1.00 42.25 ? 209  LEU A N     1 
ATOM   1167  C CA    . LEU A 1 157 ? 127.650 26.629  15.791 1.00 42.07 ? 209  LEU A CA    1 
ATOM   1168  C C     . LEU A 1 157 ? 127.647 26.263  14.314 1.00 43.39 ? 209  LEU A C     1 
ATOM   1169  O O     . LEU A 1 157 ? 126.833 25.449  13.875 1.00 44.59 ? 209  LEU A O     1 
ATOM   1170  C CB    . LEU A 1 157 ? 128.760 25.888  16.528 1.00 39.28 ? 209  LEU A CB    1 
ATOM   1171  C CG    . LEU A 1 157 ? 128.870 26.322  17.988 1.00 38.48 ? 209  LEU A CG    1 
ATOM   1172  C CD1   . LEU A 1 157 ? 129.678 25.314  18.789 1.00 36.64 ? 209  LEU A CD1   1 
ATOM   1173  C CD2   . LEU A 1 157 ? 129.488 27.711  18.050 1.00 35.83 ? 209  LEU A CD2   1 
ATOM   1174  N N     . PRO A 1 158 ? 128.550 26.857  13.519 1.00 43.92 ? 210  PRO A N     1 
ATOM   1175  C CA    . PRO A 1 158 ? 128.576 26.533  12.092 1.00 44.44 ? 210  PRO A CA    1 
ATOM   1176  C C     . PRO A 1 158 ? 129.298 25.211  11.811 1.00 44.40 ? 210  PRO A C     1 
ATOM   1177  O O     . PRO A 1 158 ? 130.221 24.828  12.534 1.00 43.76 ? 210  PRO A O     1 
ATOM   1178  C CB    . PRO A 1 158 ? 129.324 27.716  11.503 1.00 44.42 ? 210  PRO A CB    1 
ATOM   1179  C CG    . PRO A 1 158 ? 130.395 27.919  12.525 1.00 43.86 ? 210  PRO A CG    1 
ATOM   1180  C CD    . PRO A 1 158 ? 129.613 27.824  13.845 1.00 44.14 ? 210  PRO A CD    1 
ATOM   1181  N N     . VAL A 1 159 ? 128.872 24.515  10.765 1.00 43.32 ? 211  VAL A N     1 
ATOM   1182  C CA    . VAL A 1 159 ? 129.519 23.271  10.400 1.00 43.01 ? 211  VAL A CA    1 
ATOM   1183  C C     . VAL A 1 159 ? 130.187 23.439  9.040  1.00 44.41 ? 211  VAL A C     1 
ATOM   1184  O O     . VAL A 1 159 ? 129.543 23.367  7.997  1.00 45.49 ? 211  VAL A O     1 
ATOM   1185  C CB    . VAL A 1 159 ? 128.518 22.114  10.377 1.00 40.99 ? 211  VAL A CB    1 
ATOM   1186  C CG1   . VAL A 1 159 ? 129.131 20.904  9.727  1.00 40.80 ? 211  VAL A CG1   1 
ATOM   1187  C CG2   . VAL A 1 159 ? 128.122 21.774  11.793 1.00 41.03 ? 211  VAL A CG2   1 
ATOM   1188  N N     . ARG A 1 160 ? 131.491 23.684  9.067  1.00 45.01 ? 212  ARG A N     1 
ATOM   1189  C CA    . ARG A 1 160 ? 132.266 23.872  7.854  1.00 46.23 ? 212  ARG A CA    1 
ATOM   1190  C C     . ARG A 1 160 ? 132.739 22.511  7.339  1.00 46.23 ? 212  ARG A C     1 
ATOM   1191  O O     . ARG A 1 160 ? 133.070 21.634  8.132  1.00 46.86 ? 212  ARG A O     1 
ATOM   1192  C CB    . ARG A 1 160 ? 133.481 24.753  8.160  1.00 47.64 ? 212  ARG A CB    1 
ATOM   1193  C CG    . ARG A 1 160 ? 133.268 25.747  9.306  1.00 51.64 ? 212  ARG A CG    1 
ATOM   1194  C CD    . ARG A 1 160 ? 134.523 26.586  9.560  1.00 55.33 ? 212  ARG A CD    1 
ATOM   1195  N NE    . ARG A 1 160 ? 134.443 27.397  10.779 1.00 58.88 ? 212  ARG A NE    1 
ATOM   1196  C CZ    . ARG A 1 160 ? 133.614 28.425  10.952 1.00 60.49 ? 212  ARG A CZ    1 
ATOM   1197  N NH1   . ARG A 1 160 ? 132.781 28.782  9.987  1.00 60.66 ? 212  ARG A NH1   1 
ATOM   1198  N NH2   . ARG A 1 160 ? 133.617 29.101  12.095 1.00 62.40 ? 212  ARG A NH2   1 
ATOM   1199  N N     . ASP A 1 161 ? 132.764 22.324  6.023  1.00 45.68 ? 213  ASP A N     1 
ATOM   1200  C CA    . ASP A 1 161 ? 133.241 21.063  5.464  1.00 46.03 ? 213  ASP A CA    1 
ATOM   1201  C C     . ASP A 1 161 ? 134.744 21.005  5.683  1.00 45.80 ? 213  ASP A C     1 
ATOM   1202  O O     . ASP A 1 161 ? 135.298 19.984  6.082  1.00 46.15 ? 213  ASP A O     1 
ATOM   1203  C CB    . ASP A 1 161 ? 132.968 20.984  3.961  1.00 48.33 ? 213  ASP A CB    1 
ATOM   1204  C CG    . ASP A 1 161 ? 131.504 20.818  3.641  1.00 50.72 ? 213  ASP A CG    1 
ATOM   1205  O OD1   . ASP A 1 161 ? 130.911 19.825  4.118  1.00 52.67 ? 213  ASP A OD1   1 
ATOM   1206  O OD2   . ASP A 1 161 ? 130.950 21.677  2.915  1.00 51.88 ? 213  ASP A OD2   1 
ATOM   1207  N N     . SER A 1 162 ? 135.398 22.126  5.410  1.00 45.19 ? 214  SER A N     1 
ATOM   1208  C CA    . SER A 1 162 ? 136.837 22.245  5.564  1.00 43.99 ? 214  SER A CA    1 
ATOM   1209  C C     . SER A 1 162 ? 137.292 22.039  7.018  1.00 44.53 ? 214  SER A C     1 
ATOM   1210  O O     . SER A 1 162 ? 138.491 22.019  7.301  1.00 45.02 ? 214  SER A O     1 
ATOM   1211  C CB    . SER A 1 162 ? 137.280 23.623  5.085  1.00 42.83 ? 214  SER A CB    1 
ATOM   1212  O OG    . SER A 1 162 ? 136.696 24.636  5.886  1.00 42.95 ? 214  SER A OG    1 
ATOM   1213  N N     . TYR A 1 163 ? 136.353 21.898  7.946  1.00 43.41 ? 215  TYR A N     1 
ATOM   1214  C CA    . TYR A 1 163 ? 136.739 21.700  9.333  1.00 43.18 ? 215  TYR A CA    1 
ATOM   1215  C C     . TYR A 1 163 ? 136.722 20.249  9.743  1.00 42.13 ? 215  TYR A C     1 
ATOM   1216  O O     . TYR A 1 163 ? 136.818 19.933  10.926 1.00 42.25 ? 215  TYR A O     1 
ATOM   1217  C CB    . TYR A 1 163 ? 135.842 22.489  10.264 1.00 44.63 ? 215  TYR A CB    1 
ATOM   1218  C CG    . TYR A 1 163 ? 136.455 23.766  10.789 1.00 46.98 ? 215  TYR A CG    1 
ATOM   1219  C CD1   . TYR A 1 163 ? 137.321 24.533  10.005 1.00 46.37 ? 215  TYR A CD1   1 
ATOM   1220  C CD2   . TYR A 1 163 ? 136.065 24.270  12.028 1.00 48.57 ? 215  TYR A CD2   1 
ATOM   1221  C CE1   . TYR A 1 163 ? 137.766 25.769  10.441 1.00 48.35 ? 215  TYR A CE1   1 
ATOM   1222  C CE2   . TYR A 1 163 ? 136.500 25.499  12.469 1.00 49.70 ? 215  TYR A CE2   1 
ATOM   1223  C CZ    . TYR A 1 163 ? 137.344 26.245  11.675 1.00 50.56 ? 215  TYR A CZ    1 
ATOM   1224  O OH    . TYR A 1 163 ? 137.731 27.481  12.121 1.00 53.80 ? 215  TYR A OH    1 
ATOM   1225  N N     . ILE A 1 164 ? 136.570 19.366  8.768  1.00 40.69 ? 216  ILE A N     1 
ATOM   1226  C CA    . ILE A 1 164 ? 136.599 17.943  9.043  1.00 39.92 ? 216  ILE A CA    1 
ATOM   1227  C C     . ILE A 1 164 ? 137.590 17.342  8.053  1.00 38.53 ? 216  ILE A C     1 
ATOM   1228  O O     . ILE A 1 164 ? 137.330 17.260  6.864  1.00 37.31 ? 216  ILE A O     1 
ATOM   1229  C CB    . ILE A 1 164 ? 135.171 17.310  8.965  1.00 40.21 ? 216  ILE A CB    1 
ATOM   1230  C CG1   . ILE A 1 164 ? 135.266 15.816  8.660  1.00 41.55 ? 216  ILE A CG1   1 
ATOM   1231  C CG2   . ILE A 1 164 ? 134.305 18.071  7.992  1.00 41.39 ? 216  ILE A CG2   1 
ATOM   1232  C CD1   . ILE A 1 164 ? 135.286 15.468  7.187  1.00 44.51 ? 216  ILE A CD1   1 
ATOM   1233  N N     . VAL A 1 165 ? 138.761 16.968  8.559  1.00 39.38 ? 217  VAL A N     1 
ATOM   1234  C CA    . VAL A 1 165 ? 139.801 16.415  7.708  1.00 40.48 ? 217  VAL A CA    1 
ATOM   1235  C C     . VAL A 1 165 ? 140.075 14.932  7.954  1.00 40.67 ? 217  VAL A C     1 
ATOM   1236  O O     . VAL A 1 165 ? 140.235 14.466  9.091  1.00 39.37 ? 217  VAL A O     1 
ATOM   1237  C CB    . VAL A 1 165 ? 141.126 17.235  7.828  1.00 40.25 ? 217  VAL A CB    1 
ATOM   1238  C CG1   . VAL A 1 165 ? 140.817 18.723  7.779  1.00 37.72 ? 217  VAL A CG1   1 
ATOM   1239  C CG2   . VAL A 1 165 ? 141.858 16.882  9.089  1.00 42.31 ? 217  VAL A CG2   1 
ATOM   1240  N N     . GLU A 1 166 ? 140.104 14.201  6.848  1.00 41.66 ? 218  GLU A N     1 
ATOM   1241  C CA    . GLU A 1 166 ? 140.323 12.770  6.859  1.00 43.18 ? 218  GLU A CA    1 
ATOM   1242  C C     . GLU A 1 166 ? 141.812 12.456  6.879  1.00 42.55 ? 218  GLU A C     1 
ATOM   1243  O O     . GLU A 1 166 ? 142.586 12.993  6.079  1.00 42.74 ? 218  GLU A O     1 
ATOM   1244  C CB    . GLU A 1 166 ? 139.645 12.141  5.624  1.00 45.06 ? 218  GLU A CB    1 
ATOM   1245  C CG    . GLU A 1 166 ? 139.860 10.627  5.443  1.00 49.27 ? 218  GLU A CG    1 
ATOM   1246  C CD    . GLU A 1 166 ? 139.041 10.018  4.299  1.00 49.50 ? 218  GLU A CD    1 
ATOM   1247  O OE1   . GLU A 1 166 ? 139.164 8.789   4.064  1.00 48.12 ? 218  GLU A OE1   1 
ATOM   1248  O OE2   . GLU A 1 166 ? 138.276 10.767  3.649  1.00 50.08 ? 218  GLU A OE2   1 
ATOM   1249  N N     . GLY A 1 167 ? 142.202 11.601  7.821  1.00 41.18 ? 219  GLY A N     1 
ATOM   1250  C CA    . GLY A 1 167 ? 143.584 11.181  7.934  1.00 39.74 ? 219  GLY A CA    1 
ATOM   1251  C C     . GLY A 1 167 ? 143.547 9.684   7.739  1.00 39.73 ? 219  GLY A C     1 
ATOM   1252  O O     . GLY A 1 167 ? 142.476 9.134   7.500  1.00 39.29 ? 219  GLY A O     1 
ATOM   1253  N N     . ASP A 1 168 ? 144.689 9.014   7.836  1.00 40.17 ? 220  ASP A N     1 
ATOM   1254  C CA    . ASP A 1 168 ? 144.701 7.568   7.663  1.00 39.05 ? 220  ASP A CA    1 
ATOM   1255  C C     . ASP A 1 168 ? 145.207 6.809   8.875  1.00 37.70 ? 220  ASP A C     1 
ATOM   1256  O O     . ASP A 1 168 ? 145.819 5.759   8.724  1.00 38.16 ? 220  ASP A O     1 
ATOM   1257  C CB    . ASP A 1 168 ? 145.523 7.188   6.437  1.00 39.77 ? 220  ASP A CB    1 
ATOM   1258  C CG    . ASP A 1 168 ? 146.864 7.883   6.398  1.00 41.61 ? 220  ASP A CG    1 
ATOM   1259  O OD1   . ASP A 1 168 ? 147.732 7.570   7.231  1.00 41.03 ? 220  ASP A OD1   1 
ATOM   1260  O OD2   . ASP A 1 168 ? 147.048 8.757   5.526  1.00 44.55 ? 220  ASP A OD2   1 
ATOM   1261  N N     . TYR A 1 169 ? 144.943 7.342   10.069 1.00 35.73 ? 221  TYR A N     1 
ATOM   1262  C CA    . TYR A 1 169 ? 145.335 6.716   11.334 1.00 33.40 ? 221  TYR A CA    1 
ATOM   1263  C C     . TYR A 1 169 ? 146.816 6.714   11.637 1.00 33.22 ? 221  TYR A C     1 
ATOM   1264  O O     . TYR A 1 169 ? 147.225 6.192   12.663 1.00 34.89 ? 221  TYR A O     1 
ATOM   1265  C CB    . TYR A 1 169 ? 144.844 5.270   11.410 1.00 32.86 ? 221  TYR A CB    1 
ATOM   1266  C CG    . TYR A 1 169 ? 143.351 5.114   11.367 1.00 32.92 ? 221  TYR A CG    1 
ATOM   1267  C CD1   . TYR A 1 169 ? 142.539 5.701   12.331 1.00 34.35 ? 221  TYR A CD1   1 
ATOM   1268  C CD2   . TYR A 1 169 ? 142.744 4.403   10.346 1.00 33.94 ? 221  TYR A CD2   1 
ATOM   1269  C CE1   . TYR A 1 169 ? 141.157 5.585   12.272 1.00 33.65 ? 221  TYR A CE1   1 
ATOM   1270  C CE2   . TYR A 1 169 ? 141.368 4.282   10.282 1.00 33.94 ? 221  TYR A CE2   1 
ATOM   1271  C CZ    . TYR A 1 169 ? 140.586 4.873   11.245 1.00 32.62 ? 221  TYR A CZ    1 
ATOM   1272  O OH    . TYR A 1 169 ? 139.230 4.732   11.194 1.00 33.50 ? 221  TYR A OH    1 
ATOM   1273  N N     . THR A 1 170 ? 147.634 7.261   10.750 1.00 33.27 ? 222  THR A N     1 
ATOM   1274  C CA    . THR A 1 170 ? 149.062 7.295   11.023 1.00 32.44 ? 222  THR A CA    1 
ATOM   1275  C C     . THR A 1 170 ? 149.353 8.583   11.739 1.00 33.05 ? 222  THR A C     1 
ATOM   1276  O O     . THR A 1 170 ? 148.618 9.558   11.625 1.00 34.77 ? 222  THR A O     1 
ATOM   1277  C CB    . THR A 1 170 ? 149.917 7.318   9.763  1.00 32.24 ? 222  THR A CB    1 
ATOM   1278  O OG1   . THR A 1 170 ? 149.640 8.516   9.032  1.00 34.05 ? 222  THR A OG1   1 
ATOM   1279  C CG2   . THR A 1 170 ? 149.643 6.106   8.902  1.00 31.19 ? 222  THR A CG2   1 
ATOM   1280  N N     . TYR A 1 171 ? 150.441 8.595   12.481 1.00 33.21 ? 223  TYR A N     1 
ATOM   1281  C CA    . TYR A 1 171 ? 150.810 9.796   13.182 1.00 30.93 ? 223  TYR A CA    1 
ATOM   1282  C C     . TYR A 1 171 ? 151.055 10.912  12.159 1.00 31.42 ? 223  TYR A C     1 
ATOM   1283  O O     . TYR A 1 171 ? 150.651 12.048  12.371 1.00 31.69 ? 223  TYR A O     1 
ATOM   1284  C CB    . TYR A 1 171 ? 152.031 9.505   14.030 1.00 25.86 ? 223  TYR A CB    1 
ATOM   1285  C CG    . TYR A 1 171 ? 152.744 10.714  14.516 1.00 23.64 ? 223  TYR A CG    1 
ATOM   1286  C CD1   . TYR A 1 171 ? 153.786 11.251  13.781 1.00 23.61 ? 223  TYR A CD1   1 
ATOM   1287  C CD2   . TYR A 1 171 ? 152.432 11.289  15.751 1.00 23.01 ? 223  TYR A CD2   1 
ATOM   1288  C CE1   . TYR A 1 171 ? 154.517 12.315  14.261 1.00 23.60 ? 223  TYR A CE1   1 
ATOM   1289  C CE2   . TYR A 1 171 ? 153.154 12.360  16.238 1.00 22.16 ? 223  TYR A CE2   1 
ATOM   1290  C CZ    . TYR A 1 171 ? 154.202 12.858  15.487 1.00 23.29 ? 223  TYR A CZ    1 
ATOM   1291  O OH    . TYR A 1 171 ? 154.991 13.861  15.975 1.00 26.91 ? 223  TYR A OH    1 
ATOM   1292  N N     . ASP A 1 172 ? 151.670 10.593  11.029 1.00 32.33 ? 224  ASP A N     1 
ATOM   1293  C CA    . ASP A 1 172 ? 151.909 11.623  10.022 1.00 34.90 ? 224  ASP A CA    1 
ATOM   1294  C C     . ASP A 1 172 ? 150.646 12.288  9.466  1.00 33.90 ? 224  ASP A C     1 
ATOM   1295  O O     . ASP A 1 172 ? 150.637 13.490  9.189  1.00 33.09 ? 224  ASP A O     1 
ATOM   1296  C CB    . ASP A 1 172 ? 152.702 11.052  8.857  1.00 38.97 ? 224  ASP A CB    1 
ATOM   1297  C CG    . ASP A 1 172 ? 154.039 10.517  9.285  1.00 44.06 ? 224  ASP A CG    1 
ATOM   1298  O OD1   . ASP A 1 172 ? 154.742 11.243  10.030 1.00 46.18 ? 224  ASP A OD1   1 
ATOM   1299  O OD2   . ASP A 1 172 ? 154.386 9.383   8.876  1.00 46.22 ? 224  ASP A OD2   1 
ATOM   1300  N N     . SER A 1 173 ? 149.581 11.515  9.288  1.00 33.02 ? 225  SER A N     1 
ATOM   1301  C CA    . SER A 1 173 ? 148.356 12.085  8.745  1.00 32.43 ? 225  SER A CA    1 
ATOM   1302  C C     . SER A 1 173 ? 147.852 13.166  9.689  1.00 30.43 ? 225  SER A C     1 
ATOM   1303  O O     . SER A 1 173 ? 147.273 14.157  9.251  1.00 28.94 ? 225  SER A O     1 
ATOM   1304  C CB    . SER A 1 173 ? 147.285 10.997  8.535  1.00 34.16 ? 225  SER A CB    1 
ATOM   1305  O OG    . SER A 1 173 ? 146.749 10.514  9.760  1.00 37.31 ? 225  SER A OG    1 
ATOM   1306  N N     . GLY A 1 174 ? 148.094 12.966  10.982 1.00 29.24 ? 226  GLY A N     1 
ATOM   1307  C CA    . GLY A 1 174 ? 147.677 13.927  11.983 1.00 29.11 ? 226  GLY A CA    1 
ATOM   1308  C C     . GLY A 1 174 ? 148.389 15.257  11.803 1.00 30.54 ? 226  GLY A C     1 
ATOM   1309  O O     . GLY A 1 174 ? 147.766 16.326  11.865 1.00 29.47 ? 226  GLY A O     1 
ATOM   1310  N N     . ILE A 1 175 ? 149.701 15.202  11.592 1.00 30.91 ? 227  ILE A N     1 
ATOM   1311  C CA    . ILE A 1 175 ? 150.469 16.416  11.384 1.00 32.48 ? 227  ILE A CA    1 
ATOM   1312  C C     . ILE A 1 175 ? 149.899 17.150  10.184 1.00 34.71 ? 227  ILE A C     1 
ATOM   1313  O O     . ILE A 1 175 ? 149.464 18.294  10.293 1.00 35.66 ? 227  ILE A O     1 
ATOM   1314  C CB    . ILE A 1 175 ? 151.938 16.120  11.086 1.00 32.68 ? 227  ILE A CB    1 
ATOM   1315  C CG1   . ILE A 1 175 ? 152.592 15.461  12.292 1.00 33.44 ? 227  ILE A CG1   1 
ATOM   1316  C CG2   . ILE A 1 175 ? 152.651 17.401  10.729 1.00 30.42 ? 227  ILE A CG2   1 
ATOM   1317  C CD1   . ILE A 1 175 ? 153.996 15.011  12.020 1.00 40.40 ? 227  ILE A CD1   1 
ATOM   1318  N N     . GLU A 1 176 ? 149.889 16.484  9.034  1.00 36.67 ? 228  GLU A N     1 
ATOM   1319  C CA    . GLU A 1 176 ? 149.379 17.123  7.838  1.00 39.60 ? 228  GLU A CA    1 
ATOM   1320  C C     . GLU A 1 176 ? 147.986 17.691  8.073  1.00 38.83 ? 228  GLU A C     1 
ATOM   1321  O O     . GLU A 1 176 ? 147.618 18.725  7.517  1.00 40.94 ? 228  GLU A O     1 
ATOM   1322  C CB    . GLU A 1 176 ? 149.374 16.140  6.660  1.00 44.04 ? 228  GLU A CB    1 
ATOM   1323  C CG    . GLU A 1 176 ? 148.142 15.249  6.537  1.00 50.50 ? 228  GLU A CG    1 
ATOM   1324  C CD    . GLU A 1 176 ? 148.207 14.368  5.292  1.00 53.24 ? 228  GLU A CD    1 
ATOM   1325  O OE1   . GLU A 1 176 ? 148.599 14.893  4.227  1.00 52.72 ? 228  GLU A OE1   1 
ATOM   1326  O OE2   . GLU A 1 176 ? 147.866 13.162  5.375  1.00 56.71 ? 228  GLU A OE2   1 
ATOM   1327  N N     . ALA A 1 177 ? 147.213 17.027  8.914  1.00 36.58 ? 229  ALA A N     1 
ATOM   1328  C CA    . ALA A 1 177 ? 145.879 17.494  9.193  1.00 34.72 ? 229  ALA A CA    1 
ATOM   1329  C C     . ALA A 1 177 ? 145.871 18.853  9.887  1.00 34.70 ? 229  ALA A C     1 
ATOM   1330  O O     . ALA A 1 177 ? 145.064 19.714  9.536  1.00 32.27 ? 229  ALA A O     1 
ATOM   1331  C CB    . ALA A 1 177 ? 145.148 16.471  10.026 1.00 35.25 ? 229  ALA A CB    1 
ATOM   1332  N N     . VAL A 1 178 ? 146.752 19.053  10.869 1.00 35.89 ? 230  VAL A N     1 
ATOM   1333  C CA    . VAL A 1 178 ? 146.794 20.340  11.573 1.00 37.83 ? 230  VAL A CA    1 
ATOM   1334  C C     . VAL A 1 178 ? 147.293 21.434  10.650 1.00 39.23 ? 230  VAL A C     1 
ATOM   1335  O O     . VAL A 1 178 ? 146.903 22.590  10.778 1.00 39.28 ? 230  VAL A O     1 
ATOM   1336  C CB    . VAL A 1 178 ? 147.722 20.349  12.806 1.00 37.21 ? 230  VAL A CB    1 
ATOM   1337  C CG1   . VAL A 1 178 ? 146.976 20.954  13.987 1.00 34.61 ? 230  VAL A CG1   1 
ATOM   1338  C CG2   . VAL A 1 178 ? 148.239 18.964  13.107 1.00 37.06 ? 230  VAL A CG2   1 
ATOM   1339  N N     . GLU A 1 179 ? 148.172 21.076  9.725  1.00 41.03 ? 231  GLU A N     1 
ATOM   1340  C CA    . GLU A 1 179 ? 148.674 22.068  8.798  1.00 43.38 ? 231  GLU A CA    1 
ATOM   1341  C C     . GLU A 1 179 ? 147.553 22.528  7.886  1.00 42.31 ? 231  GLU A C     1 
ATOM   1342  O O     . GLU A 1 179 ? 147.341 23.724  7.739  1.00 41.89 ? 231  GLU A O     1 
ATOM   1343  C CB    . GLU A 1 179 ? 149.840 21.517  7.978  1.00 47.01 ? 231  GLU A CB    1 
ATOM   1344  C CG    . GLU A 1 179 ? 151.089 21.268  8.804  1.00 52.12 ? 231  GLU A CG    1 
ATOM   1345  C CD    . GLU A 1 179 ? 152.352 21.306  7.974  1.00 55.86 ? 231  GLU A CD    1 
ATOM   1346  O OE1   . GLU A 1 179 ? 153.327 20.614  8.355  1.00 56.73 ? 231  GLU A OE1   1 
ATOM   1347  O OE2   . GLU A 1 179 ? 152.368 22.033  6.950  1.00 57.85 ? 231  GLU A OE2   1 
ATOM   1348  N N     . LYS A 1 180 ? 146.837 21.587  7.277  1.00 41.67 ? 232  LYS A N     1 
ATOM   1349  C CA    . LYS A 1 180 ? 145.730 21.956  6.407  1.00 42.18 ? 232  LYS A CA    1 
ATOM   1350  C C     . LYS A 1 180 ? 144.816 22.884  7.193  1.00 42.04 ? 232  LYS A C     1 
ATOM   1351  O O     . LYS A 1 180 ? 144.438 23.950  6.716  1.00 42.70 ? 232  LYS A O     1 
ATOM   1352  C CB    . LYS A 1 180 ? 144.912 20.736  5.975  1.00 42.76 ? 232  LYS A CB    1 
ATOM   1353  C CG    . LYS A 1 180 ? 145.714 19.594  5.374  1.00 46.86 ? 232  LYS A CG    1 
ATOM   1354  C CD    . LYS A 1 180 ? 144.809 18.378  5.090  1.00 48.22 ? 232  LYS A CD    1 
ATOM   1355  C CE    . LYS A 1 180 ? 145.608 17.132  4.704  1.00 47.06 ? 232  LYS A CE    1 
ATOM   1356  N NZ    . LYS A 1 180 ? 144.741 15.940  4.485  1.00 47.57 ? 232  LYS A NZ    1 
ATOM   1357  N N     . LEU A 1 181 ? 144.465 22.476  8.407  1.00 42.05 ? 233  LEU A N     1 
ATOM   1358  C CA    . LEU A 1 181 ? 143.577 23.264  9.248  1.00 42.26 ? 233  LEU A CA    1 
ATOM   1359  C C     . LEU A 1 181 ? 144.119 24.650  9.595  1.00 43.41 ? 233  LEU A C     1 
ATOM   1360  O O     . LEU A 1 181 ? 143.365 25.630  9.657  1.00 42.82 ? 233  LEU A O     1 
ATOM   1361  C CB    . LEU A 1 181 ? 143.246 22.473  10.515 1.00 42.09 ? 233  LEU A CB    1 
ATOM   1362  C CG    . LEU A 1 181 ? 142.217 21.350  10.316 1.00 41.08 ? 233  LEU A CG    1 
ATOM   1363  C CD1   . LEU A 1 181 ? 142.162 20.437  11.536 1.00 39.73 ? 233  LEU A CD1   1 
ATOM   1364  C CD2   . LEU A 1 181 ? 140.858 21.982  10.046 1.00 39.35 ? 233  LEU A CD2   1 
ATOM   1365  N N     . LEU A 1 182 ? 145.425 24.745  9.807  1.00 44.80 ? 234  LEU A N     1 
ATOM   1366  C CA    . LEU A 1 182 ? 146.016 26.027  10.132 1.00 45.61 ? 234  LEU A CA    1 
ATOM   1367  C C     . LEU A 1 182 ? 146.193 26.897  8.896  1.00 47.98 ? 234  LEU A C     1 
ATOM   1368  O O     . LEU A 1 182 ? 146.569 28.059  9.004  1.00 50.09 ? 234  LEU A O     1 
ATOM   1369  C CB    . LEU A 1 182 ? 147.338 25.826  10.865 1.00 44.56 ? 234  LEU A CB    1 
ATOM   1370  C CG    . LEU A 1 182 ? 147.119 25.243  12.267 1.00 44.30 ? 234  LEU A CG    1 
ATOM   1371  C CD1   . LEU A 1 182 ? 148.440 25.054  12.986 1.00 43.08 ? 234  LEU A CD1   1 
ATOM   1372  C CD2   . LEU A 1 182 ? 146.208 26.170  13.060 1.00 43.51 ? 234  LEU A CD2   1 
ATOM   1373  N N     . GLU A 1 183 ? 145.918 26.340  7.720  1.00 50.15 ? 235  GLU A N     1 
ATOM   1374  C CA    . GLU A 1 183 ? 146.004 27.106  6.478  1.00 53.45 ? 235  GLU A CA    1 
ATOM   1375  C C     . GLU A 1 183 ? 144.597 27.608  6.207  1.00 53.99 ? 235  GLU A C     1 
ATOM   1376  O O     . GLU A 1 183 ? 144.313 28.119  5.127  1.00 53.73 ? 235  GLU A O     1 
ATOM   1377  C CB    . GLU A 1 183 ? 146.408 26.230  5.294  1.00 56.33 ? 235  GLU A CB    1 
ATOM   1378  C CG    . GLU A 1 183 ? 147.780 25.590  5.366  1.00 63.32 ? 235  GLU A CG    1 
ATOM   1379  C CD    . GLU A 1 183 ? 147.881 24.393  4.426  1.00 66.93 ? 235  GLU A CD    1 
ATOM   1380  O OE1   . GLU A 1 183 ? 147.493 24.544  3.243  1.00 68.94 ? 235  GLU A OE1   1 
ATOM   1381  O OE2   . GLU A 1 183 ? 148.338 23.308  4.866  1.00 69.02 ? 235  GLU A OE2   1 
ATOM   1382  N N     . GLU A 1 184 ? 143.714 27.448  7.189  1.00 55.02 ? 236  GLU A N     1 
ATOM   1383  C CA    . GLU A 1 184 ? 142.327 27.862  7.028  1.00 56.20 ? 236  GLU A CA    1 
ATOM   1384  C C     . GLU A 1 184 ? 142.079 29.345  7.276  1.00 56.60 ? 236  GLU A C     1 
ATOM   1385  O O     . GLU A 1 184 ? 142.825 30.007  8.012  1.00 57.37 ? 236  GLU A O     1 
ATOM   1386  C CB    . GLU A 1 184 ? 141.421 27.045  7.948  1.00 57.14 ? 236  GLU A CB    1 
ATOM   1387  C CG    . GLU A 1 184 ? 140.104 26.681  7.296  1.00 59.35 ? 236  GLU A CG    1 
ATOM   1388  C CD    . GLU A 1 184 ? 140.288 25.726  6.124  1.00 61.28 ? 236  GLU A CD    1 
ATOM   1389  O OE1   . GLU A 1 184 ? 139.530 25.834  5.138  1.00 62.75 ? 236  GLU A OE1   1 
ATOM   1390  O OE2   . GLU A 1 184 ? 141.185 24.855  6.188  1.00 62.17 ? 236  GLU A OE2   1 
ATOM   1391  N N     . ASP A 1 185 ? 141.022 29.853  6.643  1.00 56.26 ? 237  ASP A N     1 
ATOM   1392  C CA    . ASP A 1 185 ? 140.621 31.245  6.774  1.00 55.53 ? 237  ASP A CA    1 
ATOM   1393  C C     . ASP A 1 185 ? 140.746 31.515  8.262  1.00 53.45 ? 237  ASP A C     1 
ATOM   1394  O O     . ASP A 1 185 ? 141.741 32.087  8.718  1.00 52.13 ? 237  ASP A O     1 
ATOM   1395  C CB    . ASP A 1 185 ? 139.169 31.408  6.304  1.00 59.07 ? 237  ASP A CB    1 
ATOM   1396  C CG    . ASP A 1 185 ? 138.862 32.819  5.798  1.00 62.09 ? 237  ASP A CG    1 
ATOM   1397  O OD1   . ASP A 1 185 ? 139.627 33.327  4.943  1.00 62.67 ? 237  ASP A OD1   1 
ATOM   1398  O OD2   . ASP A 1 185 ? 137.849 33.411  6.246  1.00 63.34 ? 237  ASP A OD2   1 
ATOM   1399  N N     . GLU A 1 186 ? 139.743 31.091  9.025  1.00 51.11 ? 238  GLU A N     1 
ATOM   1400  C CA    . GLU A 1 186 ? 139.819 31.257  10.462 1.00 48.28 ? 238  GLU A CA    1 
ATOM   1401  C C     . GLU A 1 186 ? 140.149 29.895  11.040 1.00 45.57 ? 238  GLU A C     1 
ATOM   1402  O O     . GLU A 1 186 ? 139.451 28.917  10.793 1.00 46.05 ? 238  GLU A O     1 
ATOM   1403  C CB    . GLU A 1 186 ? 138.523 31.838  11.037 1.00 48.38 ? 238  GLU A CB    1 
ATOM   1404  C CG    . GLU A 1 186 ? 137.267 31.028  10.916 1.00 48.23 ? 238  GLU A CG    1 
ATOM   1405  C CD    . GLU A 1 186 ? 136.058 31.810  11.442 1.00 48.48 ? 238  GLU A CD    1 
ATOM   1406  O OE1   . GLU A 1 186 ? 136.174 32.462  12.508 1.00 43.64 ? 238  GLU A OE1   1 
ATOM   1407  O OE2   . GLU A 1 186 ? 134.991 31.768  10.792 1.00 50.42 ? 238  GLU A OE2   1 
ATOM   1408  N N     . LYS A 1 187 ? 141.259 29.847  11.772 1.00 42.68 ? 239  LYS A N     1 
ATOM   1409  C CA    . LYS A 1 187 ? 141.762 28.622  12.378 1.00 38.56 ? 239  LYS A CA    1 
ATOM   1410  C C     . LYS A 1 187 ? 140.820 28.049  13.421 1.00 34.34 ? 239  LYS A C     1 
ATOM   1411  O O     . LYS A 1 187 ? 139.886 28.702  13.852 1.00 33.72 ? 239  LYS A O     1 
ATOM   1412  C CB    . LYS A 1 187 ? 143.108 28.877  13.070 1.00 40.35 ? 239  LYS A CB    1 
ATOM   1413  C CG    . LYS A 1 187 ? 144.002 29.954  12.473 1.00 42.09 ? 239  LYS A CG    1 
ATOM   1414  C CD    . LYS A 1 187 ? 144.523 29.618  11.090 1.00 43.54 ? 239  LYS A CD    1 
ATOM   1415  C CE    . LYS A 1 187 ? 145.827 30.359  10.839 1.00 44.21 ? 239  LYS A CE    1 
ATOM   1416  N NZ    . LYS A 1 187 ? 145.735 31.801  11.236 1.00 45.30 ? 239  LYS A NZ    1 
ATOM   1417  N N     . PRO A 1 188 ? 141.047 26.796  13.824 1.00 31.55 ? 240  PRO A N     1 
ATOM   1418  C CA    . PRO A 1 188 ? 140.160 26.249  14.842 1.00 28.51 ? 240  PRO A CA    1 
ATOM   1419  C C     . PRO A 1 188 ? 140.877 26.491  16.164 1.00 26.92 ? 240  PRO A C     1 
ATOM   1420  O O     . PRO A 1 188 ? 142.109 26.566  16.200 1.00 23.44 ? 240  PRO A O     1 
ATOM   1421  C CB    . PRO A 1 188 ? 140.109 24.760  14.508 1.00 28.69 ? 240  PRO A CB    1 
ATOM   1422  C CG    . PRO A 1 188 ? 140.683 24.657  13.100 1.00 30.49 ? 240  PRO A CG    1 
ATOM   1423  C CD    . PRO A 1 188 ? 141.732 25.713  13.103 1.00 31.23 ? 240  PRO A CD    1 
ATOM   1424  N N     . THR A 1 189 ? 140.117 26.636  17.245 1.00 26.31 ? 241  THR A N     1 
ATOM   1425  C CA    . THR A 1 189 ? 140.740 26.818  18.540 1.00 24.95 ? 241  THR A CA    1 
ATOM   1426  C C     . THR A 1 189 ? 140.722 25.478  19.268 1.00 25.02 ? 241  THR A C     1 
ATOM   1427  O O     . THR A 1 189 ? 141.355 25.304  20.305 1.00 27.11 ? 241  THR A O     1 
ATOM   1428  C CB    . THR A 1 189 ? 140.038 27.901  19.359 1.00 23.82 ? 241  THR A CB    1 
ATOM   1429  O OG1   . THR A 1 189 ? 138.621 27.713  19.319 1.00 25.67 ? 241  THR A OG1   1 
ATOM   1430  C CG2   . THR A 1 189 ? 140.381 29.261  18.798 1.00 23.75 ? 241  THR A CG2   1 
ATOM   1431  N N     . ALA A 1 190 ? 140.007 24.514  18.708 1.00 24.44 ? 242  ALA A N     1 
ATOM   1432  C CA    . ALA A 1 190 ? 139.957 23.190  19.304 1.00 23.52 ? 242  ALA A CA    1 
ATOM   1433  C C     . ALA A 1 190 ? 139.760 22.155  18.212 1.00 23.91 ? 242  ALA A C     1 
ATOM   1434  O O     . ALA A 1 190 ? 138.938 22.343  17.309 1.00 23.90 ? 242  ALA A O     1 
ATOM   1435  C CB    . ALA A 1 190 ? 138.825 23.104  20.317 1.00 23.81 ? 242  ALA A CB    1 
ATOM   1436  N N     . ILE A 1 191 ? 140.531 21.073  18.282 1.00 23.03 ? 243  ILE A N     1 
ATOM   1437  C CA    . ILE A 1 191 ? 140.404 20.008  17.305 1.00 22.06 ? 243  ILE A CA    1 
ATOM   1438  C C     . ILE A 1 191 ? 140.190 18.665  17.981 1.00 22.48 ? 243  ILE A C     1 
ATOM   1439  O O     . ILE A 1 191 ? 140.986 18.231  18.810 1.00 25.27 ? 243  ILE A O     1 
ATOM   1440  C CB    . ILE A 1 191 ? 141.650 19.858  16.452 1.00 24.08 ? 243  ILE A CB    1 
ATOM   1441  C CG1   . ILE A 1 191 ? 142.102 21.215  15.916 1.00 22.30 ? 243  ILE A CG1   1 
ATOM   1442  C CG2   . ILE A 1 191 ? 141.370 18.827  15.361 1.00 20.72 ? 243  ILE A CG2   1 
ATOM   1443  C CD1   . ILE A 1 191 ? 143.466 21.173  15.270 1.00 32.69 ? 243  ILE A CD1   1 
ATOM   1444  N N     . PHE A 1 192 ? 139.110 18.004  17.616 1.00 23.27 ? 244  PHE A N     1 
ATOM   1445  C CA    . PHE A 1 192 ? 138.786 16.689  18.143 1.00 23.97 ? 244  PHE A CA    1 
ATOM   1446  C C     . PHE A 1 192 ? 139.388 15.721  17.136 1.00 23.27 ? 244  PHE A C     1 
ATOM   1447  O O     . PHE A 1 192 ? 139.181 15.871  15.929 1.00 23.79 ? 244  PHE A O     1 
ATOM   1448  C CB    . PHE A 1 192 ? 137.265 16.545  18.197 1.00 26.86 ? 244  PHE A CB    1 
ATOM   1449  C CG    . PHE A 1 192 ? 136.780 15.159  18.481 1.00 29.30 ? 244  PHE A CG    1 
ATOM   1450  C CD1   . PHE A 1 192 ? 137.171 14.488  19.635 1.00 31.02 ? 244  PHE A CD1   1 
ATOM   1451  C CD2   . PHE A 1 192 ? 135.877 14.544  17.620 1.00 28.79 ? 244  PHE A CD2   1 
ATOM   1452  C CE1   . PHE A 1 192 ? 136.656 13.214  19.927 1.00 31.17 ? 244  PHE A CE1   1 
ATOM   1453  C CE2   . PHE A 1 192 ? 135.365 13.283  17.905 1.00 29.67 ? 244  PHE A CE2   1 
ATOM   1454  C CZ    . PHE A 1 192 ? 135.754 12.616  19.062 1.00 28.80 ? 244  PHE A CZ    1 
ATOM   1455  N N     . VAL A 1 193 ? 140.154 14.752  17.622 1.00 23.24 ? 245  VAL A N     1 
ATOM   1456  C CA    . VAL A 1 193 ? 140.773 13.775  16.739 1.00 24.15 ? 245  VAL A CA    1 
ATOM   1457  C C     . VAL A 1 193 ? 140.219 12.378  16.981 1.00 24.00 ? 245  VAL A C     1 
ATOM   1458  O O     . VAL A 1 193 ? 140.021 11.978  18.116 1.00 24.01 ? 245  VAL A O     1 
ATOM   1459  C CB    . VAL A 1 193 ? 142.299 13.726  16.917 1.00 23.82 ? 245  VAL A CB    1 
ATOM   1460  C CG1   . VAL A 1 193 ? 142.889 12.828  15.865 1.00 25.79 ? 245  VAL A CG1   1 
ATOM   1461  C CG2   . VAL A 1 193 ? 142.894 15.104  16.803 1.00 22.29 ? 245  VAL A CG2   1 
ATOM   1462  N N     . GLY A 1 194 ? 139.973 11.649  15.896 1.00 25.00 ? 246  GLY A N     1 
ATOM   1463  C CA    . GLY A 1 194 ? 139.439 10.298  15.976 1.00 26.12 ? 246  GLY A CA    1 
ATOM   1464  C C     . GLY A 1 194 ? 140.215 9.231   16.747 1.00 27.09 ? 246  GLY A C     1 
ATOM   1465  O O     . GLY A 1 194 ? 139.597 8.299   17.238 1.00 28.98 ? 246  GLY A O     1 
ATOM   1466  N N     . THR A 1 195 ? 141.543 9.312   16.833 1.00 28.02 ? 247  THR A N     1 
ATOM   1467  C CA    . THR A 1 195 ? 142.325 8.325   17.615 1.00 28.02 ? 247  THR A CA    1 
ATOM   1468  C C     . THR A 1 195 ? 143.560 8.993   18.196 1.00 27.16 ? 247  THR A C     1 
ATOM   1469  O O     . THR A 1 195 ? 144.045 9.993   17.665 1.00 26.43 ? 247  THR A O     1 
ATOM   1470  C CB    . THR A 1 195 ? 142.823 7.102   16.782 1.00 27.93 ? 247  THR A CB    1 
ATOM   1471  O OG1   . THR A 1 195 ? 143.865 7.510   15.877 1.00 27.30 ? 247  THR A OG1   1 
ATOM   1472  C CG2   . THR A 1 195 ? 141.677 6.475   16.020 1.00 25.85 ? 247  THR A CG2   1 
ATOM   1473  N N     . ASP A 1 196 ? 144.087 8.424   19.268 1.00 26.33 ? 248  ASP A N     1 
ATOM   1474  C CA    . ASP A 1 196 ? 145.245 9.010   19.911 1.00 26.64 ? 248  ASP A CA    1 
ATOM   1475  C C     . ASP A 1 196 ? 146.452 9.283   19.024 1.00 27.27 ? 248  ASP A C     1 
ATOM   1476  O O     . ASP A 1 196 ? 146.969 10.388  19.042 1.00 29.77 ? 248  ASP A O     1 
ATOM   1477  C CB    . ASP A 1 196 ? 145.671 8.169   21.107 1.00 26.92 ? 248  ASP A CB    1 
ATOM   1478  C CG    . ASP A 1 196 ? 144.629 8.151   22.200 1.00 29.14 ? 248  ASP A CG    1 
ATOM   1479  O OD1   . ASP A 1 196 ? 143.739 9.037   22.199 1.00 31.58 ? 248  ASP A OD1   1 
ATOM   1480  O OD2   . ASP A 1 196 ? 144.705 7.258   23.069 1.00 26.39 ? 248  ASP A OD2   1 
ATOM   1481  N N     . GLU A 1 197 ? 146.913 8.313   18.244 1.00 27.15 ? 249  GLU A N     1 
ATOM   1482  C CA    . GLU A 1 197 ? 148.091 8.554   17.412 1.00 26.16 ? 249  GLU A CA    1 
ATOM   1483  C C     . GLU A 1 197 ? 147.988 9.730   16.436 1.00 25.00 ? 249  GLU A C     1 
ATOM   1484  O O     . GLU A 1 197 ? 148.955 10.462  16.242 1.00 25.92 ? 249  GLU A O     1 
ATOM   1485  C CB    . GLU A 1 197 ? 148.472 7.305   16.639 1.00 28.80 ? 249  GLU A CB    1 
ATOM   1486  C CG    . GLU A 1 197 ? 149.888 7.370   16.132 1.00 31.22 ? 249  GLU A CG    1 
ATOM   1487  C CD    . GLU A 1 197 ? 150.320 6.084   15.500 1.00 31.90 ? 249  GLU A CD    1 
ATOM   1488  O OE1   . GLU A 1 197 ? 149.850 5.026   15.960 1.00 32.48 ? 249  GLU A OE1   1 
ATOM   1489  O OE2   . GLU A 1 197 ? 151.136 6.130   14.558 1.00 34.09 ? 249  GLU A OE2   1 
ATOM   1490  N N     . MET A 1 198 ? 146.847 9.920   15.791 1.00 22.44 ? 250  MET A N     1 
ATOM   1491  C CA    . MET A 1 198 ? 146.753 11.066  14.901 1.00 20.15 ? 250  MET A CA    1 
ATOM   1492  C C     . MET A 1 198 ? 146.779 12.288  15.803 1.00 17.88 ? 250  MET A C     1 
ATOM   1493  O O     . MET A 1 198 ? 147.417 13.291  15.503 1.00 16.61 ? 250  MET A O     1 
ATOM   1494  C CB    . MET A 1 198 ? 145.462 11.032  14.081 1.00 19.83 ? 250  MET A CB    1 
ATOM   1495  C CG    . MET A 1 198 ? 145.565 10.191  12.820 1.00 20.76 ? 250  MET A CG    1 
ATOM   1496  S SD    . MET A 1 198 ? 144.012 10.104  11.892 1.00 27.12 ? 250  MET A SD    1 
ATOM   1497  C CE    . MET A 1 198 ? 142.821 9.713   13.251 1.00 20.19 ? 250  MET A CE    1 
ATOM   1498  N N     . ALA A 1 199 ? 146.090 12.176  16.931 1.00 17.13 ? 251  ALA A N     1 
ATOM   1499  C CA    . ALA A 1 199 ? 146.027 13.252  17.899 1.00 16.65 ? 251  ALA A CA    1 
ATOM   1500  C C     . ALA A 1 199 ? 147.438 13.693  18.252 1.00 17.14 ? 251  ALA A C     1 
ATOM   1501  O O     . ALA A 1 199 ? 147.749 14.872  18.213 1.00 18.07 ? 251  ALA A O     1 
ATOM   1502  C CB    . ALA A 1 199 ? 145.283 12.791  19.136 1.00 14.88 ? 251  ALA A CB    1 
ATOM   1503  N N     . LEU A 1 200 ? 148.299 12.744  18.588 1.00 18.42 ? 252  LEU A N     1 
ATOM   1504  C CA    . LEU A 1 200 ? 149.676 13.075  18.915 1.00 20.86 ? 252  LEU A CA    1 
ATOM   1505  C C     . LEU A 1 200 ? 150.309 13.852  17.751 1.00 21.52 ? 252  LEU A C     1 
ATOM   1506  O O     . LEU A 1 200 ? 151.113 14.766  17.960 1.00 20.76 ? 252  LEU A O     1 
ATOM   1507  C CB    . LEU A 1 200 ? 150.472 11.796  19.226 1.00 20.39 ? 252  LEU A CB    1 
ATOM   1508  C CG    . LEU A 1 200 ? 150.625 11.429  20.717 1.00 20.81 ? 252  LEU A CG    1 
ATOM   1509  C CD1   . LEU A 1 200 ? 149.256 11.241  21.401 1.00 17.48 ? 252  LEU A CD1   1 
ATOM   1510  C CD2   . LEU A 1 200 ? 151.480 10.170  20.839 1.00 19.61 ? 252  LEU A CD2   1 
ATOM   1511  N N     . GLY A 1 201 ? 149.929 13.492  16.527 1.00 22.17 ? 253  GLY A N     1 
ATOM   1512  C CA    . GLY A 1 201 ? 150.444 14.186  15.355 1.00 21.80 ? 253  GLY A CA    1 
ATOM   1513  C C     . GLY A 1 201 ? 149.884 15.601  15.252 1.00 22.03 ? 253  GLY A C     1 
ATOM   1514  O O     . GLY A 1 201 ? 150.539 16.516  14.747 1.00 22.44 ? 253  GLY A O     1 
ATOM   1515  N N     . VAL A 1 202 ? 148.660 15.783  15.733 1.00 21.15 ? 254  VAL A N     1 
ATOM   1516  C CA    . VAL A 1 202 ? 148.027 17.089  15.716 1.00 20.72 ? 254  VAL A CA    1 
ATOM   1517  C C     . VAL A 1 202 ? 148.766 18.008  16.690 1.00 21.73 ? 254  VAL A C     1 
ATOM   1518  O O     . VAL A 1 202 ? 149.136 19.135  16.346 1.00 21.98 ? 254  VAL A O     1 
ATOM   1519  C CB    . VAL A 1 202 ? 146.551 16.960  16.122 1.00 21.02 ? 254  VAL A CB    1 
ATOM   1520  C CG1   . VAL A 1 202 ? 145.909 18.318  16.234 1.00 19.37 ? 254  VAL A CG1   1 
ATOM   1521  C CG2   . VAL A 1 202 ? 145.805 16.097  15.088 1.00 22.39 ? 254  VAL A CG2   1 
ATOM   1522  N N     . ILE A 1 203 ? 148.988 17.512  17.905 1.00 21.99 ? 255  ILE A N     1 
ATOM   1523  C CA    . ILE A 1 203 ? 149.679 18.268  18.943 1.00 21.80 ? 255  ILE A CA    1 
ATOM   1524  C C     . ILE A 1 203 ? 150.994 18.754  18.376 1.00 23.90 ? 255  ILE A C     1 
ATOM   1525  O O     . ILE A 1 203 ? 151.295 19.952  18.367 1.00 24.81 ? 255  ILE A O     1 
ATOM   1526  C CB    . ILE A 1 203 ? 150.069 17.389  20.158 1.00 23.36 ? 255  ILE A CB    1 
ATOM   1527  C CG1   . ILE A 1 203 ? 148.843 16.736  20.805 1.00 23.47 ? 255  ILE A CG1   1 
ATOM   1528  C CG2   . ILE A 1 203 ? 150.860 18.226  21.150 1.00 20.43 ? 255  ILE A CG2   1 
ATOM   1529  C CD1   . ILE A 1 203 ? 148.058 17.634  21.663 1.00 36.18 ? 255  ILE A CD1   1 
ATOM   1530  N N     . HIS A 1 204 ? 151.780 17.797  17.895 1.00 24.15 ? 256  HIS A N     1 
ATOM   1531  C CA    . HIS A 1 204 ? 153.100 18.098  17.384 1.00 24.17 ? 256  HIS A CA    1 
ATOM   1532  C C     . HIS A 1 204 ? 153.155 19.101  16.246 1.00 24.50 ? 256  HIS A C     1 
ATOM   1533  O O     . HIS A 1 204 ? 153.933 20.054  16.309 1.00 24.03 ? 256  HIS A O     1 
ATOM   1534  C CB    . HIS A 1 204 ? 153.829 16.785  17.060 1.00 22.18 ? 256  HIS A CB    1 
ATOM   1535  C CG    . HIS A 1 204 ? 154.309 16.068  18.289 1.00 22.41 ? 256  HIS A CG    1 
ATOM   1536  N ND1   . HIS A 1 204 ? 154.651 14.733  18.302 1.00 22.63 ? 256  HIS A ND1   1 
ATOM   1537  C CD2   . HIS A 1 204 ? 154.475 16.507  19.561 1.00 21.49 ? 256  HIS A CD2   1 
ATOM   1538  C CE1   . HIS A 1 204 ? 154.999 14.378  19.526 1.00 20.01 ? 256  HIS A CE1   1 
ATOM   1539  N NE2   . HIS A 1 204 ? 154.901 15.438  20.308 1.00 20.64 ? 256  HIS A NE2   1 
ATOM   1540  N N     . GLY A 1 205 ? 152.331 18.918  15.223 1.00 24.80 ? 257  GLY A N     1 
ATOM   1541  C CA    . GLY A 1 205 ? 152.346 19.871  14.130 1.00 25.31 ? 257  GLY A CA    1 
ATOM   1542  C C     . GLY A 1 205 ? 151.986 21.252  14.651 1.00 26.43 ? 257  GLY A C     1 
ATOM   1543  O O     . GLY A 1 205 ? 152.601 22.250  14.287 1.00 26.19 ? 257  GLY A O     1 
ATOM   1544  N N     . ALA A 1 206 ? 150.982 21.317  15.517 1.00 26.48 ? 258  ALA A N     1 
ATOM   1545  C CA    . ALA A 1 206 ? 150.575 22.594  16.052 1.00 26.77 ? 258  ALA A CA    1 
ATOM   1546  C C     . ALA A 1 206 ? 151.725 23.171  16.855 1.00 28.67 ? 258  ALA A C     1 
ATOM   1547  O O     . ALA A 1 206 ? 151.961 24.375  16.805 1.00 31.65 ? 258  ALA A O     1 
ATOM   1548  C CB    . ALA A 1 206 ? 149.364 22.425  16.918 1.00 27.12 ? 258  ALA A CB    1 
ATOM   1549  N N     . GLN A 1 207 ? 152.442 22.310  17.589 1.00 28.51 ? 259  GLN A N     1 
ATOM   1550  C CA    . GLN A 1 207 ? 153.582 22.728  18.413 1.00 26.41 ? 259  GLN A CA    1 
ATOM   1551  C C     . GLN A 1 207 ? 154.815 23.151  17.607 1.00 25.45 ? 259  GLN A C     1 
ATOM   1552  O O     . GLN A 1 207 ? 155.639 23.929  18.085 1.00 23.22 ? 259  GLN A O     1 
ATOM   1553  C CB    . GLN A 1 207 ? 153.984 21.613  19.368 1.00 26.67 ? 259  GLN A CB    1 
ATOM   1554  C CG    . GLN A 1 207 ? 152.997 21.330  20.464 1.00 29.47 ? 259  GLN A CG    1 
ATOM   1555  C CD    . GLN A 1 207 ? 153.526 20.320  21.491 1.00 32.25 ? 259  GLN A CD    1 
ATOM   1556  O OE1   . GLN A 1 207 ? 154.178 19.328  21.137 1.00 34.48 ? 259  GLN A OE1   1 
ATOM   1557  N NE2   . GLN A 1 207 ? 153.222 20.559  22.765 1.00 31.94 ? 259  GLN A NE2   1 
ATOM   1558  N N     . ASP A 1 208 ? 154.956 22.618  16.397 1.00 26.57 ? 260  ASP A N     1 
ATOM   1559  C CA    . ASP A 1 208 ? 156.074 22.982  15.523 1.00 27.65 ? 260  ASP A CA    1 
ATOM   1560  C C     . ASP A 1 208 ? 155.810 24.300  14.784 1.00 28.94 ? 260  ASP A C     1 
ATOM   1561  O O     . ASP A 1 208 ? 156.749 24.987  14.387 1.00 30.45 ? 260  ASP A O     1 
ATOM   1562  C CB    . ASP A 1 208 ? 156.341 21.903  14.482 1.00 25.74 ? 260  ASP A CB    1 
ATOM   1563  C CG    . ASP A 1 208 ? 156.769 20.598  15.090 1.00 25.96 ? 260  ASP A CG    1 
ATOM   1564  O OD1   . ASP A 1 208 ? 157.259 20.582  16.240 1.00 26.92 ? 260  ASP A OD1   1 
ATOM   1565  O OD2   . ASP A 1 208 ? 156.629 19.579  14.393 1.00 25.77 ? 260  ASP A OD2   1 
ATOM   1566  N N     . ARG A 1 209 ? 154.539 24.641  14.584 1.00 29.00 ? 261  ARG A N     1 
ATOM   1567  C CA    . ARG A 1 209 ? 154.190 25.881  13.914 1.00 30.30 ? 261  ARG A CA    1 
ATOM   1568  C C     . ARG A 1 209 ? 154.348 27.025  14.913 1.00 30.54 ? 261  ARG A C     1 
ATOM   1569  O O     . ARG A 1 209 ? 154.511 28.175  14.527 1.00 32.88 ? 261  ARG A O     1 
ATOM   1570  C CB    . ARG A 1 209 ? 152.743 25.850  13.417 1.00 32.85 ? 261  ARG A CB    1 
ATOM   1571  C CG    . ARG A 1 209 ? 152.426 24.808  12.358 1.00 36.16 ? 261  ARG A CG    1 
ATOM   1572  C CD    . ARG A 1 209 ? 153.119 25.099  11.054 1.00 42.39 ? 261  ARG A CD    1 
ATOM   1573  N NE    . ARG A 1 209 ? 152.247 24.879  9.897  1.00 49.29 ? 261  ARG A NE    1 
ATOM   1574  C CZ    . ARG A 1 209 ? 151.403 25.791  9.410  1.00 52.76 ? 261  ARG A CZ    1 
ATOM   1575  N NH1   . ARG A 1 209 ? 151.317 26.994  9.980  1.00 54.28 ? 261  ARG A NH1   1 
ATOM   1576  N NH2   . ARG A 1 209 ? 150.637 25.502  8.358  1.00 53.93 ? 261  ARG A NH2   1 
ATOM   1577  N N     . GLY A 1 210 ? 154.288 26.713  16.201 1.00 30.55 ? 262  GLY A N     1 
ATOM   1578  C CA    . GLY A 1 210 ? 154.440 27.753  17.202 1.00 29.36 ? 262  GLY A CA    1 
ATOM   1579  C C     . GLY A 1 210 ? 153.249 27.926  18.120 1.00 29.16 ? 262  GLY A C     1 
ATOM   1580  O O     . GLY A 1 210 ? 153.267 28.810  18.989 1.00 28.68 ? 262  GLY A O     1 
ATOM   1581  N N     . LEU A 1 211 ? 152.220 27.098  17.929 1.00 28.06 ? 263  LEU A N     1 
ATOM   1582  C CA    . LEU A 1 211 ? 151.020 27.157  18.761 1.00 27.43 ? 263  LEU A CA    1 
ATOM   1583  C C     . LEU A 1 211 ? 151.237 26.343  20.013 1.00 27.29 ? 263  LEU A C     1 
ATOM   1584  O O     . LEU A 1 211 ? 151.972 25.362  19.982 1.00 26.55 ? 263  LEU A O     1 
ATOM   1585  C CB    . LEU A 1 211 ? 149.815 26.588  18.027 1.00 27.72 ? 263  LEU A CB    1 
ATOM   1586  C CG    . LEU A 1 211 ? 149.184 27.429  16.928 1.00 28.50 ? 263  LEU A CG    1 
ATOM   1587  C CD1   . LEU A 1 211 ? 147.857 26.808  16.494 1.00 27.41 ? 263  LEU A CD1   1 
ATOM   1588  C CD2   . LEU A 1 211 ? 148.958 28.824  17.460 1.00 31.01 ? 263  LEU A CD2   1 
ATOM   1589  N N     . ASN A 1 212 ? 150.582 26.752  21.099 1.00 28.58 ? 264  ASN A N     1 
ATOM   1590  C CA    . ASN A 1 212 ? 150.669 26.083  22.403 1.00 28.66 ? 264  ASN A CA    1 
ATOM   1591  C C     . ASN A 1 212 ? 149.397 25.323  22.745 1.00 29.45 ? 264  ASN A C     1 
ATOM   1592  O O     . ASN A 1 212 ? 148.283 25.849  22.600 1.00 28.19 ? 264  ASN A O     1 
ATOM   1593  C CB    . ASN A 1 212 ? 150.928 27.108  23.519 1.00 29.32 ? 264  ASN A CB    1 
ATOM   1594  C CG    . ASN A 1 212 ? 150.744 26.523  24.914 1.00 30.65 ? 264  ASN A CG    1 
ATOM   1595  O OD1   . ASN A 1 212 ? 149.652 26.094  25.287 1.00 32.60 ? 264  ASN A OD1   1 
ATOM   1596  N ND2   . ASN A 1 212 ? 151.815 26.503  25.690 1.00 31.33 ? 264  ASN A ND2   1 
ATOM   1597  N N     . VAL A 1 213 ? 149.577 24.087  23.204 1.00 28.88 ? 265  VAL A N     1 
ATOM   1598  C CA    . VAL A 1 213 ? 148.464 23.245  23.619 1.00 28.90 ? 265  VAL A CA    1 
ATOM   1599  C C     . VAL A 1 213 ? 148.531 23.220  25.156 1.00 28.88 ? 265  VAL A C     1 
ATOM   1600  O O     . VAL A 1 213 ? 149.549 22.867  25.734 1.00 29.62 ? 265  VAL A O     1 
ATOM   1601  C CB    . VAL A 1 213 ? 148.627 21.817  23.055 1.00 28.82 ? 265  VAL A CB    1 
ATOM   1602  C CG1   . VAL A 1 213 ? 147.540 20.903  23.594 1.00 28.60 ? 265  VAL A CG1   1 
ATOM   1603  C CG2   . VAL A 1 213 ? 148.588 21.854  21.552 1.00 26.33 ? 265  VAL A CG2   1 
ATOM   1604  N N     . PRO A 1 214 ? 147.422 23.535  25.841 1.00 28.74 ? 266  PRO A N     1 
ATOM   1605  C CA    . PRO A 1 214 ? 146.083 23.918  25.377 1.00 29.78 ? 266  PRO A CA    1 
ATOM   1606  C C     . PRO A 1 214 ? 145.779 25.423  25.274 1.00 32.08 ? 266  PRO A C     1 
ATOM   1607  O O     . PRO A 1 214 ? 144.669 25.817  24.901 1.00 32.61 ? 266  PRO A O     1 
ATOM   1608  C CB    . PRO A 1 214 ? 145.206 23.270  26.425 1.00 27.65 ? 266  PRO A CB    1 
ATOM   1609  C CG    . PRO A 1 214 ? 145.972 23.569  27.650 1.00 25.64 ? 266  PRO A CG    1 
ATOM   1610  C CD    . PRO A 1 214 ? 147.381 23.205  27.273 1.00 26.23 ? 266  PRO A CD    1 
ATOM   1611  N N     . ASN A 1 215 ? 146.751 26.260  25.611 1.00 33.68 ? 267  ASN A N     1 
ATOM   1612  C CA    . ASN A 1 215 ? 146.557 27.706  25.597 1.00 32.72 ? 267  ASN A CA    1 
ATOM   1613  C C     . ASN A 1 215 ? 146.205 28.373  24.276 1.00 32.88 ? 267  ASN A C     1 
ATOM   1614  O O     . ASN A 1 215 ? 145.758 29.513  24.268 1.00 33.10 ? 267  ASN A O     1 
ATOM   1615  C CB    . ASN A 1 215 ? 147.784 28.371  26.197 1.00 34.40 ? 267  ASN A CB    1 
ATOM   1616  C CG    . ASN A 1 215 ? 147.896 28.112  27.672 1.00 35.84 ? 267  ASN A CG    1 
ATOM   1617  O OD1   . ASN A 1 215 ? 147.108 28.625  28.456 1.00 39.88 ? 267  ASN A OD1   1 
ATOM   1618  N ND2   . ASN A 1 215 ? 148.860 27.296  28.061 1.00 39.72 ? 267  ASN A ND2   1 
ATOM   1619  N N     . ASP A 1 216 ? 146.400 27.681  23.160 1.00 32.80 ? 268  ASP A N     1 
ATOM   1620  C CA    . ASP A 1 216 ? 146.079 28.259  21.862 1.00 31.38 ? 268  ASP A CA    1 
ATOM   1621  C C     . ASP A 1 216 ? 145.179 27.313  21.072 1.00 30.26 ? 268  ASP A C     1 
ATOM   1622  O O     . ASP A 1 216 ? 144.331 27.744  20.293 1.00 29.66 ? 268  ASP A O     1 
ATOM   1623  C CB    . ASP A 1 216 ? 147.368 28.527  21.077 1.00 33.29 ? 268  ASP A CB    1 
ATOM   1624  C CG    . ASP A 1 216 ? 148.182 29.684  21.649 1.00 35.90 ? 268  ASP A CG    1 
ATOM   1625  O OD1   . ASP A 1 216 ? 149.424 29.672  21.487 1.00 37.17 ? 268  ASP A OD1   1 
ATOM   1626  O OD2   . ASP A 1 216 ? 147.591 30.615  22.245 1.00 36.26 ? 268  ASP A OD2   1 
ATOM   1627  N N     . LEU A 1 217 ? 145.365 26.017  21.303 1.00 28.51 ? 269  LEU A N     1 
ATOM   1628  C CA    . LEU A 1 217 ? 144.616 24.982  20.608 1.00 25.12 ? 269  LEU A CA    1 
ATOM   1629  C C     . LEU A 1 217 ? 144.345 23.830  21.555 1.00 23.85 ? 269  LEU A C     1 
ATOM   1630  O O     . LEU A 1 217 ? 145.266 23.153  21.972 1.00 23.16 ? 269  LEU A O     1 
ATOM   1631  C CB    . LEU A 1 217 ? 145.449 24.490  19.425 1.00 24.48 ? 269  LEU A CB    1 
ATOM   1632  C CG    . LEU A 1 217 ? 144.962 23.450  18.411 1.00 24.79 ? 269  LEU A CG    1 
ATOM   1633  C CD1   . LEU A 1 217 ? 143.816 24.026  17.587 1.00 26.66 ? 269  LEU A CD1   1 
ATOM   1634  C CD2   . LEU A 1 217 ? 146.106 23.075  17.476 1.00 21.88 ? 269  LEU A CD2   1 
ATOM   1635  N N     . GLU A 1 218 ? 143.089 23.620  21.927 1.00 23.87 ? 270  GLU A N     1 
ATOM   1636  C CA    . GLU A 1 218 ? 142.769 22.503  22.803 1.00 23.65 ? 270  GLU A CA    1 
ATOM   1637  C C     . GLU A 1 218 ? 142.537 21.291  21.895 1.00 23.73 ? 270  GLU A C     1 
ATOM   1638  O O     . GLU A 1 218 ? 141.965 21.410  20.804 1.00 23.56 ? 270  GLU A O     1 
ATOM   1639  C CB    . GLU A 1 218 ? 141.530 22.817  23.669 1.00 23.50 ? 270  GLU A CB    1 
ATOM   1640  C CG    . GLU A 1 218 ? 141.771 23.915  24.719 1.00 24.15 ? 270  GLU A CG    1 
ATOM   1641  C CD    . GLU A 1 218 ? 140.707 23.993  25.831 1.00 26.76 ? 270  GLU A CD    1 
ATOM   1642  O OE1   . GLU A 1 218 ? 140.379 22.958  26.461 1.00 25.55 ? 270  GLU A OE1   1 
ATOM   1643  O OE2   . GLU A 1 218 ? 140.213 25.115  26.097 1.00 29.83 ? 270  GLU A OE2   1 
ATOM   1644  N N     . ILE A 1 219 ? 143.006 20.126  22.323 1.00 23.63 ? 271  ILE A N     1 
ATOM   1645  C CA    . ILE A 1 219 ? 142.851 18.920  21.516 1.00 23.22 ? 271  ILE A CA    1 
ATOM   1646  C C     . ILE A 1 219 ? 142.383 17.721  22.313 1.00 22.99 ? 271  ILE A C     1 
ATOM   1647  O O     . ILE A 1 219 ? 142.875 17.492  23.409 1.00 23.57 ? 271  ILE A O     1 
ATOM   1648  C CB    . ILE A 1 219 ? 144.172 18.525  20.898 1.00 25.03 ? 271  ILE A CB    1 
ATOM   1649  C CG1   . ILE A 1 219 ? 144.752 19.711  20.118 1.00 26.94 ? 271  ILE A CG1   1 
ATOM   1650  C CG2   . ILE A 1 219 ? 143.968 17.280  20.047 1.00 25.59 ? 271  ILE A CG2   1 
ATOM   1651  C CD1   . ILE A 1 219 ? 146.151 19.502  19.608 1.00 35.15 ? 271  ILE A CD1   1 
ATOM   1652  N N     . ILE A 1 220 ? 141.422 16.965  21.791 1.00 22.63 ? 272  ILE A N     1 
ATOM   1653  C CA    . ILE A 1 220 ? 140.994 15.752  22.487 1.00 23.59 ? 272  ILE A CA    1 
ATOM   1654  C C     . ILE A 1 220 ? 141.196 14.621  21.491 1.00 23.71 ? 272  ILE A C     1 
ATOM   1655  O O     . ILE A 1 220 ? 140.944 14.794  20.305 1.00 24.82 ? 272  ILE A O     1 
ATOM   1656  C CB    . ILE A 1 220 ? 139.491 15.731  22.918 1.00 26.19 ? 272  ILE A CB    1 
ATOM   1657  C CG1   . ILE A 1 220 ? 139.239 16.620  24.129 1.00 25.52 ? 272  ILE A CG1   1 
ATOM   1658  C CG2   . ILE A 1 220 ? 139.100 14.315  23.360 1.00 24.65 ? 272  ILE A CG2   1 
ATOM   1659  C CD1   . ILE A 1 220 ? 138.891 18.006  23.788 1.00 37.61 ? 272  ILE A CD1   1 
ATOM   1660  N N     . GLY A 1 221 ? 141.661 13.475  21.982 1.00 23.35 ? 273  GLY A N     1 
ATOM   1661  C CA    . GLY A 1 221 ? 141.887 12.317  21.135 1.00 21.97 ? 273  GLY A CA    1 
ATOM   1662  C C     . GLY A 1 221 ? 140.858 11.239  21.411 1.00 21.52 ? 273  GLY A C     1 
ATOM   1663  O O     . GLY A 1 221 ? 139.848 11.494  22.056 1.00 18.65 ? 273  GLY A O     1 
ATOM   1664  N N     . PHE A 1 222 ? 141.118 10.019  20.956 1.00 24.08 ? 274  PHE A N     1 
ATOM   1665  C CA    . PHE A 1 222 ? 140.147 8.942   21.153 1.00 26.61 ? 274  PHE A CA    1 
ATOM   1666  C C     . PHE A 1 222 ? 140.807 7.574   21.269 1.00 27.40 ? 274  PHE A C     1 
ATOM   1667  O O     . PHE A 1 222 ? 141.804 7.297   20.587 1.00 27.65 ? 274  PHE A O     1 
ATOM   1668  C CB    . PHE A 1 222 ? 139.167 8.953   19.979 1.00 25.85 ? 274  PHE A CB    1 
ATOM   1669  C CG    . PHE A 1 222 ? 137.853 8.298   20.250 1.00 24.32 ? 274  PHE A CG    1 
ATOM   1670  C CD1   . PHE A 1 222 ? 137.732 6.921   20.252 1.00 24.91 ? 274  PHE A CD1   1 
ATOM   1671  C CD2   . PHE A 1 222 ? 136.708 9.072   20.420 1.00 26.31 ? 274  PHE A CD2   1 
ATOM   1672  C CE1   . PHE A 1 222 ? 136.475 6.312   20.411 1.00 26.37 ? 274  PHE A CE1   1 
ATOM   1673  C CE2   . PHE A 1 222 ? 135.446 8.480   20.578 1.00 24.84 ? 274  PHE A CE2   1 
ATOM   1674  C CZ    . PHE A 1 222 ? 135.333 7.099   20.572 1.00 25.97 ? 274  PHE A CZ    1 
ATOM   1675  N N     . ASP A 1 223 ? 140.223 6.741   22.136 1.00 27.90 ? 275  ASP A N     1 
ATOM   1676  C CA    . ASP A 1 223 ? 140.663 5.366   22.411 1.00 28.99 ? 275  ASP A CA    1 
ATOM   1677  C C     . ASP A 1 223 ? 141.377 5.267   23.761 1.00 29.10 ? 275  ASP A C     1 
ATOM   1678  O O     . ASP A 1 223 ? 141.306 4.236   24.446 1.00 29.30 ? 275  ASP A O     1 
ATOM   1679  C CB    . ASP A 1 223 ? 141.585 4.839   21.295 1.00 28.92 ? 275  ASP A CB    1 
ATOM   1680  C CG    . ASP A 1 223 ? 140.819 4.443   20.029 1.00 30.18 ? 275  ASP A CG    1 
ATOM   1681  O OD1   . ASP A 1 223 ? 141.468 4.342   18.957 1.00 30.65 ? 275  ASP A OD1   1 
ATOM   1682  O OD2   . ASP A 1 223 ? 139.582 4.220   20.108 1.00 26.80 ? 275  ASP A OD2   1 
ATOM   1683  N N     . ASN A 1 224 ? 142.049 6.352   24.144 1.00 27.65 ? 276  ASN A N     1 
ATOM   1684  C CA    . ASN A 1 224 ? 142.782 6.386   25.393 1.00 25.04 ? 276  ASN A CA    1 
ATOM   1685  C C     . ASN A 1 224 ? 143.742 5.197   25.421 1.00 25.54 ? 276  ASN A C     1 
ATOM   1686  O O     . ASN A 1 224 ? 143.638 4.295   26.252 1.00 25.26 ? 276  ASN A O     1 
ATOM   1687  C CB    . ASN A 1 224 ? 141.807 6.330   26.565 1.00 23.66 ? 276  ASN A CB    1 
ATOM   1688  C CG    . ASN A 1 224 ? 142.506 6.340   27.900 1.00 22.07 ? 276  ASN A CG    1 
ATOM   1689  O OD1   . ASN A 1 224 ? 143.322 7.218   28.183 1.00 20.95 ? 276  ASN A OD1   1 
ATOM   1690  N ND2   . ASN A 1 224 ? 142.189 5.361   28.735 1.00 23.34 ? 276  ASN A ND2   1 
ATOM   1691  N N     . THR A 1 225 ? 144.669 5.204   24.473 1.00 25.75 ? 277  THR A N     1 
ATOM   1692  C CA    . THR A 1 225 ? 145.665 4.163   24.352 1.00 25.94 ? 277  THR A CA    1 
ATOM   1693  C C     . THR A 1 225 ? 146.895 4.584   25.163 1.00 27.41 ? 277  THR A C     1 
ATOM   1694  O O     . THR A 1 225 ? 146.883 5.604   25.848 1.00 26.43 ? 277  THR A O     1 
ATOM   1695  C CB    . THR A 1 225 ? 146.016 3.925   22.856 1.00 24.81 ? 277  THR A CB    1 
ATOM   1696  O OG1   . THR A 1 225 ? 146.378 5.162   22.238 1.00 25.79 ? 277  THR A OG1   1 
ATOM   1697  C CG2   . THR A 1 225 ? 144.813 3.373   22.110 1.00 24.80 ? 277  THR A CG2   1 
ATOM   1698  N N     . ARG A 1 226 ? 147.950 3.784   25.107 1.00 30.17 ? 278  ARG A N     1 
ATOM   1699  C CA    . ARG A 1 226 ? 149.160 4.080   25.855 1.00 30.76 ? 278  ARG A CA    1 
ATOM   1700  C C     . ARG A 1 226 ? 149.754 5.425   25.447 1.00 29.70 ? 278  ARG A C     1 
ATOM   1701  O O     . ARG A 1 226 ? 150.322 6.139   26.278 1.00 31.20 ? 278  ARG A O     1 
ATOM   1702  C CB    . ARG A 1 226 ? 150.178 2.949   25.652 1.00 33.94 ? 278  ARG A CB    1 
ATOM   1703  C CG    . ARG A 1 226 ? 149.791 1.625   26.321 1.00 39.79 ? 278  ARG A CG    1 
ATOM   1704  C CD    . ARG A 1 226 ? 150.718 0.465   25.939 1.00 43.82 ? 278  ARG A CD    1 
ATOM   1705  N NE    . ARG A 1 226 ? 152.088 0.920   25.722 1.00 49.67 ? 278  ARG A NE    1 
ATOM   1706  C CZ    . ARG A 1 226 ? 152.681 0.970   24.529 1.00 52.78 ? 278  ARG A CZ    1 
ATOM   1707  N NH1   . ARG A 1 226 ? 152.030 0.586   23.434 1.00 54.29 ? 278  ARG A NH1   1 
ATOM   1708  N NH2   . ARG A 1 226 ? 153.926 1.414   24.427 1.00 52.75 ? 278  ARG A NH2   1 
ATOM   1709  N N     . LEU A 1 227 ? 149.611 5.772   24.172 1.00 27.05 ? 279  LEU A N     1 
ATOM   1710  C CA    . LEU A 1 227 ? 150.140 7.026   23.656 1.00 25.24 ? 279  LEU A CA    1 
ATOM   1711  C C     . LEU A 1 227 ? 149.587 8.256   24.385 1.00 24.68 ? 279  LEU A C     1 
ATOM   1712  O O     . LEU A 1 227 ? 150.222 9.313   24.402 1.00 23.64 ? 279  LEU A O     1 
ATOM   1713  C CB    . LEU A 1 227 ? 149.829 7.133   22.167 1.00 24.61 ? 279  LEU A CB    1 
ATOM   1714  C CG    . LEU A 1 227 ? 150.490 6.046   21.328 1.00 26.17 ? 279  LEU A CG    1 
ATOM   1715  C CD1   . LEU A 1 227 ? 150.032 6.134   19.875 1.00 26.34 ? 279  LEU A CD1   1 
ATOM   1716  C CD2   . LEU A 1 227 ? 151.992 6.208   21.410 1.00 27.38 ? 279  LEU A CD2   1 
ATOM   1717  N N     . SER A 1 228 ? 148.410 8.103   24.987 1.00 22.67 ? 280  SER A N     1 
ATOM   1718  C CA    . SER A 1 228 ? 147.740 9.179   25.699 1.00 22.12 ? 280  SER A CA    1 
ATOM   1719  C C     . SER A 1 228 ? 148.596 9.909   26.713 1.00 22.41 ? 280  SER A C     1 
ATOM   1720  O O     . SER A 1 228 ? 148.488 11.124  26.850 1.00 21.54 ? 280  SER A O     1 
ATOM   1721  C CB    . SER A 1 228 ? 146.518 8.640   26.427 1.00 22.23 ? 280  SER A CB    1 
ATOM   1722  O OG    . SER A 1 228 ? 145.681 7.942   25.543 1.00 26.45 ? 280  SER A OG    1 
ATOM   1723  N N     . THR A 1 229 ? 149.417 9.160   27.445 1.00 23.10 ? 281  THR A N     1 
ATOM   1724  C CA    . THR A 1 229 ? 150.270 9.734   28.484 1.00 22.18 ? 281  THR A CA    1 
ATOM   1725  C C     . THR A 1 229 ? 151.726 9.784   28.070 1.00 22.12 ? 281  THR A C     1 
ATOM   1726  O O     . THR A 1 229 ? 152.601 10.082  28.886 1.00 21.47 ? 281  THR A O     1 
ATOM   1727  C CB    . THR A 1 229 ? 150.174 8.923   29.771 1.00 22.27 ? 281  THR A CB    1 
ATOM   1728  O OG1   . THR A 1 229 ? 150.536 7.562   29.499 1.00 23.49 ? 281  THR A OG1   1 
ATOM   1729  C CG2   . THR A 1 229 ? 148.764 8.961   30.309 1.00 22.73 ? 281  THR A CG2   1 
ATOM   1730  N N     . MET A 1 230 ? 151.973 9.465   26.804 1.00 22.54 ? 282  MET A N     1 
ATOM   1731  C CA    . MET A 1 230 ? 153.310 9.488   26.247 1.00 23.60 ? 282  MET A CA    1 
ATOM   1732  C C     . MET A 1 230 ? 153.535 10.748  25.406 1.00 23.82 ? 282  MET A C     1 
ATOM   1733  O O     . MET A 1 230 ? 154.234 10.738  24.382 1.00 23.11 ? 282  MET A O     1 
ATOM   1734  C CB    . MET A 1 230 ? 153.544 8.243   25.411 1.00 24.79 ? 282  MET A CB    1 
ATOM   1735  C CG    . MET A 1 230 ? 153.856 7.030   26.222 1.00 25.15 ? 282  MET A CG    1 
ATOM   1736  S SD    . MET A 1 230 ? 153.771 5.591   25.185 1.00 28.41 ? 282  MET A SD    1 
ATOM   1737  C CE    . MET A 1 230 ? 155.321 5.804   24.196 1.00 25.04 ? 282  MET A CE    1 
ATOM   1738  N N     . VAL A 1 231 ? 152.917 11.839  25.837 1.00 23.84 ? 283  VAL A N     1 
ATOM   1739  C CA    . VAL A 1 231 ? 153.106 13.107  25.161 1.00 25.53 ? 283  VAL A CA    1 
ATOM   1740  C C     . VAL A 1 231 ? 152.968 14.232  26.123 1.00 24.99 ? 283  VAL A C     1 
ATOM   1741  O O     . VAL A 1 231 ? 152.455 14.056  27.226 1.00 24.50 ? 283  VAL A O     1 
ATOM   1742  C CB    . VAL A 1 231 ? 152.106 13.364  24.006 1.00 26.41 ? 283  VAL A CB    1 
ATOM   1743  C CG1   . VAL A 1 231 ? 152.594 12.627  22.766 1.00 30.06 ? 283  VAL A CG1   1 
ATOM   1744  C CG2   . VAL A 1 231 ? 150.685 12.944  24.409 1.00 22.40 ? 283  VAL A CG2   1 
ATOM   1745  N N     . ARG A 1 232 ? 153.447 15.387  25.675 1.00 26.14 ? 284  ARG A N     1 
ATOM   1746  C CA    . ARG A 1 232 ? 153.389 16.635  26.421 1.00 26.03 ? 284  ARG A CA    1 
ATOM   1747  C C     . ARG A 1 232 ? 152.773 17.668  25.463 1.00 25.33 ? 284  ARG A C     1 
ATOM   1748  O O     . ARG A 1 232 ? 153.300 17.935  24.383 1.00 25.02 ? 284  ARG A O     1 
ATOM   1749  C CB    . ARG A 1 232 ? 154.797 17.082  26.847 1.00 23.72 ? 284  ARG A CB    1 
ATOM   1750  C CG    . ARG A 1 232 ? 155.554 16.137  27.780 1.00 24.10 ? 284  ARG A CG    1 
ATOM   1751  C CD    . ARG A 1 232 ? 154.896 15.964  29.161 1.00 24.39 ? 284  ARG A CD    1 
ATOM   1752  N NE    . ARG A 1 232 ? 154.169 14.695  29.218 1.00 29.13 ? 284  ARG A NE    1 
ATOM   1753  C CZ    . ARG A 1 232 ? 154.603 13.578  29.804 1.00 28.88 ? 284  ARG A CZ    1 
ATOM   1754  N NH1   . ARG A 1 232 ? 155.771 13.545  30.423 1.00 29.80 ? 284  ARG A NH1   1 
ATOM   1755  N NH2   . ARG A 1 232 ? 153.881 12.467  29.726 1.00 29.26 ? 284  ARG A NH2   1 
ATOM   1756  N N     . PRO A 1 233 ? 151.621 18.227  25.829 1.00 25.14 ? 285  PRO A N     1 
ATOM   1757  C CA    . PRO A 1 233 ? 150.896 17.938  27.062 1.00 25.86 ? 285  PRO A CA    1 
ATOM   1758  C C     . PRO A 1 233 ? 150.143 16.606  26.966 1.00 26.67 ? 285  PRO A C     1 
ATOM   1759  O O     . PRO A 1 233 ? 149.645 16.235  25.906 1.00 26.15 ? 285  PRO A O     1 
ATOM   1760  C CB    . PRO A 1 233 ? 149.960 19.134  27.181 1.00 25.47 ? 285  PRO A CB    1 
ATOM   1761  C CG    . PRO A 1 233 ? 149.617 19.413  25.754 1.00 25.45 ? 285  PRO A CG    1 
ATOM   1762  C CD    . PRO A 1 233 ? 150.961 19.304  25.069 1.00 25.62 ? 285  PRO A CD    1 
ATOM   1763  N N     . GLN A 1 234 ? 150.055 15.892  28.079 1.00 27.55 ? 286  GLN A N     1 
ATOM   1764  C CA    . GLN A 1 234 ? 149.354 14.627  28.078 1.00 27.17 ? 286  GLN A CA    1 
ATOM   1765  C C     . GLN A 1 234 ? 147.994 14.853  27.468 1.00 25.95 ? 286  GLN A C     1 
ATOM   1766  O O     . GLN A 1 234 ? 147.318 15.819  27.781 1.00 26.46 ? 286  GLN A O     1 
ATOM   1767  C CB    . GLN A 1 234 ? 149.221 14.069  29.494 1.00 29.38 ? 286  GLN A CB    1 
ATOM   1768  C CG    . GLN A 1 234 ? 150.532 13.622  30.102 1.00 29.17 ? 286  GLN A CG    1 
ATOM   1769  C CD    . GLN A 1 234 ? 150.310 12.619  31.199 1.00 32.13 ? 286  GLN A CD    1 
ATOM   1770  O OE1   . GLN A 1 234 ? 149.439 12.809  32.044 1.00 34.34 ? 286  GLN A OE1   1 
ATOM   1771  N NE2   . GLN A 1 234 ? 151.091 11.537  31.197 1.00 34.86 ? 286  GLN A NE2   1 
ATOM   1772  N N     . LEU A 1 235 ? 147.610 13.929  26.600 1.00 25.18 ? 287  LEU A N     1 
ATOM   1773  C CA    . LEU A 1 235 ? 146.371 13.970  25.852 1.00 22.52 ? 287  LEU A CA    1 
ATOM   1774  C C     . LEU A 1 235 ? 145.097 13.542  26.554 1.00 23.50 ? 287  LEU A C     1 
ATOM   1775  O O     . LEU A 1 235 ? 144.971 12.379  26.958 1.00 24.57 ? 287  LEU A O     1 
ATOM   1776  C CB    . LEU A 1 235 ? 146.548 13.111  24.600 1.00 21.83 ? 287  LEU A CB    1 
ATOM   1777  C CG    . LEU A 1 235 ? 145.388 12.886  23.631 1.00 20.34 ? 287  LEU A CG    1 
ATOM   1778  C CD1   . LEU A 1 235 ? 145.138 14.148  22.849 1.00 17.55 ? 287  LEU A CD1   1 
ATOM   1779  C CD2   . LEU A 1 235 ? 145.718 11.739  22.697 1.00 17.84 ? 287  LEU A CD2   1 
ATOM   1780  N N     . THR A 1 236 ? 144.141 14.462  26.690 1.00 22.87 ? 288  THR A N     1 
ATOM   1781  C CA    . THR A 1 236 ? 142.863 14.082  27.278 1.00 22.88 ? 288  THR A CA    1 
ATOM   1782  C C     . THR A 1 236 ? 142.269 13.250  26.132 1.00 22.14 ? 288  THR A C     1 
ATOM   1783  O O     . THR A 1 236 ? 142.424 13.596  24.961 1.00 21.99 ? 288  THR A O     1 
ATOM   1784  C CB    . THR A 1 236 ? 141.939 15.295  27.598 1.00 22.77 ? 288  THR A CB    1 
ATOM   1785  O OG1   . THR A 1 236 ? 140.984 15.463  26.546 1.00 24.15 ? 288  THR A OG1   1 
ATOM   1786  C CG2   . THR A 1 236 ? 142.731 16.555  27.790 1.00 20.19 ? 288  THR A CG2   1 
ATOM   1787  N N     . SER A 1 237 ? 141.600 12.155  26.449 1.00 21.80 ? 289  SER A N     1 
ATOM   1788  C CA    . SER A 1 237 ? 141.095 11.292  25.383 1.00 21.25 ? 289  SER A CA    1 
ATOM   1789  C C     . SER A 1 237 ? 139.846 10.529  25.774 1.00 20.26 ? 289  SER A C     1 
ATOM   1790  O O     . SER A 1 237 ? 139.640 10.201  26.949 1.00 19.23 ? 289  SER A O     1 
ATOM   1791  C CB    . SER A 1 237 ? 142.219 10.317  24.966 1.00 20.65 ? 289  SER A CB    1 
ATOM   1792  O OG    . SER A 1 237 ? 141.754 9.189   24.254 1.00 21.40 ? 289  SER A OG    1 
ATOM   1793  N N     . VAL A 1 238 ? 138.991 10.281  24.789 1.00 19.65 ? 290  VAL A N     1 
ATOM   1794  C CA    . VAL A 1 238 ? 137.773 9.533   25.050 1.00 20.34 ? 290  VAL A CA    1 
ATOM   1795  C C     . VAL A 1 238 ? 138.188 8.102   25.397 1.00 21.63 ? 290  VAL A C     1 
ATOM   1796  O O     . VAL A 1 238 ? 138.980 7.471   24.690 1.00 21.25 ? 290  VAL A O     1 
ATOM   1797  C CB    . VAL A 1 238 ? 136.830 9.530   23.830 1.00 18.16 ? 290  VAL A CB    1 
ATOM   1798  C CG1   . VAL A 1 238 ? 135.777 8.454   23.995 1.00 14.16 ? 290  VAL A CG1   1 
ATOM   1799  C CG2   . VAL A 1 238 ? 136.178 10.898  23.682 1.00 16.51 ? 290  VAL A CG2   1 
ATOM   1800  N N     . VAL A 1 239 ? 137.662 7.605   26.502 1.00 22.75 ? 291  VAL A N     1 
ATOM   1801  C CA    . VAL A 1 239 ? 137.996 6.274   26.943 1.00 25.86 ? 291  VAL A CA    1 
ATOM   1802  C C     . VAL A 1 239 ? 137.036 5.222   26.432 1.00 28.82 ? 291  VAL A C     1 
ATOM   1803  O O     . VAL A 1 239 ? 135.829 5.325   26.631 1.00 29.81 ? 291  VAL A O     1 
ATOM   1804  C CB    . VAL A 1 239 ? 137.985 6.159   28.481 1.00 24.65 ? 291  VAL A CB    1 
ATOM   1805  C CG1   . VAL A 1 239 ? 138.277 4.724   28.873 1.00 22.17 ? 291  VAL A CG1   1 
ATOM   1806  C CG2   . VAL A 1 239 ? 138.993 7.106   29.101 1.00 21.57 ? 291  VAL A CG2   1 
ATOM   1807  N N     . GLN A 1 240 ? 137.586 4.212   25.774 1.00 31.50 ? 292  GLN A N     1 
ATOM   1808  C CA    . GLN A 1 240 ? 136.799 3.089   25.304 1.00 33.00 ? 292  GLN A CA    1 
ATOM   1809  C C     . GLN A 1 240 ? 137.378 1.977   26.190 1.00 35.53 ? 292  GLN A C     1 
ATOM   1810  O O     . GLN A 1 240 ? 138.419 1.396   25.870 1.00 37.04 ? 292  GLN A O     1 
ATOM   1811  C CB    . GLN A 1 240 ? 137.077 2.837   23.836 1.00 32.16 ? 292  GLN A CB    1 
ATOM   1812  C CG    . GLN A 1 240 ? 135.989 2.058   23.195 1.00 35.10 ? 292  GLN A CG    1 
ATOM   1813  C CD    . GLN A 1 240 ? 136.109 1.974   21.687 1.00 37.62 ? 292  GLN A CD    1 
ATOM   1814  O OE1   . GLN A 1 240 ? 135.233 1.408   21.031 1.00 39.11 ? 292  GLN A OE1   1 
ATOM   1815  N NE2   . GLN A 1 240 ? 137.188 2.526   21.127 1.00 35.77 ? 292  GLN A NE2   1 
ATOM   1816  N N     . PRO A 1 241 ? 136.717 1.685   27.335 1.00 36.13 ? 293  PRO A N     1 
ATOM   1817  C CA    . PRO A 1 241 ? 137.137 0.666   28.312 1.00 34.87 ? 293  PRO A CA    1 
ATOM   1818  C C     . PRO A 1 241 ? 137.457 -0.694  27.720 1.00 33.78 ? 293  PRO A C     1 
ATOM   1819  O O     . PRO A 1 241 ? 136.584 -1.542  27.575 1.00 34.23 ? 293  PRO A O     1 
ATOM   1820  C CB    . PRO A 1 241 ? 135.966 0.623   29.286 1.00 34.05 ? 293  PRO A CB    1 
ATOM   1821  C CG    . PRO A 1 241 ? 134.813 0.869   28.399 1.00 34.88 ? 293  PRO A CG    1 
ATOM   1822  C CD    . PRO A 1 241 ? 135.298 2.026   27.551 1.00 35.49 ? 293  PRO A CD    1 
ATOM   1823  N N     . MET A 1 242 ? 138.728 -0.897  27.400 1.00 33.45 ? 294  MET A N     1 
ATOM   1824  C CA    . MET A 1 242 ? 139.184 -2.145  26.799 1.00 33.29 ? 294  MET A CA    1 
ATOM   1825  C C     . MET A 1 242 ? 138.895 -3.406  27.610 1.00 32.52 ? 294  MET A C     1 
ATOM   1826  O O     . MET A 1 242 ? 138.588 -4.440  27.030 1.00 33.47 ? 294  MET A O     1 
ATOM   1827  C CB    . MET A 1 242 ? 140.677 -2.045  26.486 1.00 33.58 ? 294  MET A CB    1 
ATOM   1828  C CG    . MET A 1 242 ? 141.064 -0.648  26.036 1.00 36.86 ? 294  MET A CG    1 
ATOM   1829  S SD    . MET A 1 242 ? 142.510 -0.586  24.979 1.00 42.07 ? 294  MET A SD    1 
ATOM   1830  C CE    . MET A 1 242 ? 143.863 -0.922  26.198 1.00 44.94 ? 294  MET A CE    1 
ATOM   1831  N N     . TYR A 1 243 ? 138.990 -3.344  28.934 1.00 32.02 ? 295  TYR A N     1 
ATOM   1832  C CA    . TYR A 1 243 ? 138.710 -4.537  29.724 1.00 32.93 ? 295  TYR A CA    1 
ATOM   1833  C C     . TYR A 1 243 ? 137.210 -4.792  29.836 1.00 32.05 ? 295  TYR A C     1 
ATOM   1834  O O     . TYR A 1 243 ? 136.778 -5.939  29.913 1.00 30.90 ? 295  TYR A O     1 
ATOM   1835  C CB    . TYR A 1 243 ? 139.345 -4.448  31.120 1.00 36.38 ? 295  TYR A CB    1 
ATOM   1836  C CG    . TYR A 1 243 ? 140.846 -4.705  31.135 1.00 39.90 ? 295  TYR A CG    1 
ATOM   1837  C CD1   . TYR A 1 243 ? 141.760 -3.644  31.248 1.00 41.10 ? 295  TYR A CD1   1 
ATOM   1838  C CD2   . TYR A 1 243 ? 141.354 -6.004  31.004 1.00 39.63 ? 295  TYR A CD2   1 
ATOM   1839  C CE1   . TYR A 1 243 ? 143.140 -3.870  31.230 1.00 41.47 ? 295  TYR A CE1   1 
ATOM   1840  C CE2   . TYR A 1 243 ? 142.726 -6.236  30.984 1.00 41.53 ? 295  TYR A CE2   1 
ATOM   1841  C CZ    . TYR A 1 243 ? 143.614 -5.161  31.096 1.00 42.76 ? 295  TYR A CZ    1 
ATOM   1842  O OH    . TYR A 1 243 ? 144.974 -5.376  31.056 1.00 44.65 ? 295  TYR A OH    1 
ATOM   1843  N N     . ASP A 1 244 ? 136.413 -3.731  29.864 1.00 31.42 ? 296  ASP A N     1 
ATOM   1844  C CA    . ASP A 1 244 ? 134.971 -3.912  29.915 1.00 31.92 ? 296  ASP A CA    1 
ATOM   1845  C C     . ASP A 1 244 ? 134.589 -4.637  28.619 1.00 31.21 ? 296  ASP A C     1 
ATOM   1846  O O     . ASP A 1 244 ? 133.846 -5.632  28.637 1.00 30.18 ? 296  ASP A O     1 
ATOM   1847  C CB    . ASP A 1 244 ? 134.240 -2.568  29.959 1.00 35.25 ? 296  ASP A CB    1 
ATOM   1848  C CG    . ASP A 1 244 ? 134.146 -1.991  31.349 1.00 37.07 ? 296  ASP A CG    1 
ATOM   1849  O OD1   . ASP A 1 244 ? 133.388 -1.011  31.530 1.00 38.78 ? 296  ASP A OD1   1 
ATOM   1850  O OD2   . ASP A 1 244 ? 134.825 -2.514  32.254 1.00 39.51 ? 296  ASP A OD2   1 
ATOM   1851  N N     . ILE A 1 245 ? 135.102 -4.123  27.498 1.00 28.92 ? 297  ILE A N     1 
ATOM   1852  C CA    . ILE A 1 245 ? 134.845 -4.714  26.185 1.00 28.10 ? 297  ILE A CA    1 
ATOM   1853  C C     . ILE A 1 245 ? 135.246 -6.198  26.225 1.00 27.24 ? 297  ILE A C     1 
ATOM   1854  O O     . ILE A 1 245 ? 134.444 -7.081  25.916 1.00 27.29 ? 297  ILE A O     1 
ATOM   1855  C CB    . ILE A 1 245 ? 135.667 -4.012  25.082 1.00 30.04 ? 297  ILE A CB    1 
ATOM   1856  C CG1   . ILE A 1 245 ? 135.435 -2.495  25.109 1.00 30.43 ? 297  ILE A CG1   1 
ATOM   1857  C CG2   . ILE A 1 245 ? 135.279 -4.565  23.737 1.00 29.63 ? 297  ILE A CG2   1 
ATOM   1858  C CD1   . ILE A 1 245 ? 134.014 -2.088  24.866 1.00 38.28 ? 297  ILE A CD1   1 
ATOM   1859  N N     . GLY A 1 246 ? 136.490 -6.465  26.616 1.00 25.78 ? 298  GLY A N     1 
ATOM   1860  C CA    . GLY A 1 246 ? 136.965 -7.833  26.714 1.00 23.58 ? 298  GLY A CA    1 
ATOM   1861  C C     . GLY A 1 246 ? 136.098 -8.736  27.576 1.00 22.99 ? 298  GLY A C     1 
ATOM   1862  O O     . GLY A 1 246 ? 135.731 -9.821  27.152 1.00 23.46 ? 298  GLY A O     1 
ATOM   1863  N N     . ALA A 1 247 ? 135.763 -8.299  28.784 1.00 24.17 ? 299  ALA A N     1 
ATOM   1864  C CA    . ALA A 1 247 ? 134.938 -9.092  29.704 1.00 24.65 ? 299  ALA A CA    1 
ATOM   1865  C C     . ALA A 1 247 ? 133.561 -9.474  29.160 1.00 25.08 ? 299  ALA A C     1 
ATOM   1866  O O     . ALA A 1 247 ? 133.195 -10.658 29.151 1.00 23.35 ? 299  ALA A O     1 
ATOM   1867  C CB    . ALA A 1 247 ? 134.770 -8.343  31.000 1.00 23.51 ? 299  ALA A CB    1 
ATOM   1868  N N     . VAL A 1 248 ? 132.803 -8.458  28.732 1.00 26.11 ? 300  VAL A N     1 
ATOM   1869  C CA    . VAL A 1 248 ? 131.457 -8.644  28.176 1.00 25.11 ? 300  VAL A CA    1 
ATOM   1870  C C     . VAL A 1 248 ? 131.547 -9.561  26.974 1.00 25.04 ? 300  VAL A C     1 
ATOM   1871  O O     . VAL A 1 248 ? 130.817 -10.539 26.872 1.00 26.74 ? 300  VAL A O     1 
ATOM   1872  C CB    . VAL A 1 248 ? 130.835 -7.300  27.741 1.00 24.31 ? 300  VAL A CB    1 
ATOM   1873  C CG1   . VAL A 1 248 ? 129.466 -7.522  27.180 1.00 23.49 ? 300  VAL A CG1   1 
ATOM   1874  C CG2   . VAL A 1 248 ? 130.750 -6.355  28.921 1.00 23.92 ? 300  VAL A CG2   1 
ATOM   1875  N N     . ALA A 1 249 ? 132.454 -9.249  26.061 1.00 25.20 ? 301  ALA A N     1 
ATOM   1876  C CA    . ALA A 1 249 ? 132.647 -10.087 24.889 1.00 27.20 ? 301  ALA A CA    1 
ATOM   1877  C C     . ALA A 1 249 ? 132.908 -11.558 25.275 1.00 28.62 ? 301  ALA A C     1 
ATOM   1878  O O     . ALA A 1 249 ? 132.461 -12.456 24.574 1.00 29.04 ? 301  ALA A O     1 
ATOM   1879  C CB    . ALA A 1 249 ? 133.797 -9.550  24.052 1.00 26.06 ? 301  ALA A CB    1 
ATOM   1880  N N     . MET A 1 250 ? 133.623 -11.811 26.375 1.00 30.94 ? 302  MET A N     1 
ATOM   1881  C CA    . MET A 1 250 ? 133.897 -13.192 26.806 1.00 32.92 ? 302  MET A CA    1 
ATOM   1882  C C     . MET A 1 250 ? 132.688 -13.916 27.384 1.00 33.63 ? 302  MET A C     1 
ATOM   1883  O O     . MET A 1 250 ? 132.419 -15.060 27.019 1.00 32.50 ? 302  MET A O     1 
ATOM   1884  C CB    . MET A 1 250 ? 135.009 -13.252 27.848 1.00 34.95 ? 302  MET A CB    1 
ATOM   1885  C CG    . MET A 1 250 ? 136.412 -13.195 27.292 1.00 36.87 ? 302  MET A CG    1 
ATOM   1886  S SD    . MET A 1 250 ? 136.773 -14.492 26.112 1.00 39.52 ? 302  MET A SD    1 
ATOM   1887  C CE    . MET A 1 250 ? 137.772 -13.610 24.953 1.00 36.00 ? 302  MET A CE    1 
ATOM   1888  N N     . ARG A 1 251 ? 131.962 -13.287 28.303 1.00 34.32 ? 303  ARG A N     1 
ATOM   1889  C CA    . ARG A 1 251 ? 130.801 -13.991 28.829 1.00 36.30 ? 303  ARG A CA    1 
ATOM   1890  C C     . ARG A 1 251 ? 129.862 -14.276 27.685 1.00 34.57 ? 303  ARG A C     1 
ATOM   1891  O O     . ARG A 1 251 ? 129.306 -15.366 27.595 1.00 34.93 ? 303  ARG A O     1 
ATOM   1892  C CB    . ARG A 1 251 ? 130.066 -13.195 29.907 1.00 38.69 ? 303  ARG A CB    1 
ATOM   1893  C CG    . ARG A 1 251 ? 130.216 -11.705 29.837 1.00 44.99 ? 303  ARG A CG    1 
ATOM   1894  C CD    . ARG A 1 251 ? 129.502 -11.071 31.033 1.00 50.02 ? 303  ARG A CD    1 
ATOM   1895  N NE    . ARG A 1 251 ? 129.730 -11.823 32.276 1.00 55.26 ? 303  ARG A NE    1 
ATOM   1896  C CZ    . ARG A 1 251 ? 130.895 -11.906 32.924 1.00 56.15 ? 303  ARG A CZ    1 
ATOM   1897  N NH1   . ARG A 1 251 ? 131.969 -11.275 32.461 1.00 57.41 ? 303  ARG A NH1   1 
ATOM   1898  N NH2   . ARG A 1 251 ? 130.990 -12.631 34.034 1.00 55.25 ? 303  ARG A NH2   1 
ATOM   1899  N N     . LEU A 1 252 ? 129.715 -13.294 26.799 1.00 33.27 ? 304  LEU A N     1 
ATOM   1900  C CA    . LEU A 1 252 ? 128.837 -13.414 25.642 1.00 31.01 ? 304  LEU A CA    1 
ATOM   1901  C C     . LEU A 1 252 ? 129.281 -14.581 24.775 1.00 29.25 ? 304  LEU A C     1 
ATOM   1902  O O     . LEU A 1 252 ? 128.504 -15.488 24.490 1.00 28.75 ? 304  LEU A O     1 
ATOM   1903  C CB    . LEU A 1 252 ? 128.864 -12.119 24.843 1.00 30.72 ? 304  LEU A CB    1 
ATOM   1904  C CG    . LEU A 1 252 ? 127.613 -11.729 24.058 1.00 32.55 ? 304  LEU A CG    1 
ATOM   1905  C CD1   . LEU A 1 252 ? 126.429 -11.562 24.984 1.00 33.16 ? 304  LEU A CD1   1 
ATOM   1906  C CD2   . LEU A 1 252 ? 127.875 -10.419 23.352 1.00 33.82 ? 304  LEU A CD2   1 
ATOM   1907  N N     . LEU A 1 253 ? 130.545 -14.573 24.382 1.00 27.29 ? 305  LEU A N     1 
ATOM   1908  C CA    . LEU A 1 253 ? 131.067 -15.644 23.555 1.00 26.88 ? 305  LEU A CA    1 
ATOM   1909  C C     . LEU A 1 253 ? 131.018 -16.998 24.252 1.00 28.16 ? 305  LEU A C     1 
ATOM   1910  O O     . LEU A 1 253 ? 130.768 -18.014 23.607 1.00 27.67 ? 305  LEU A O     1 
ATOM   1911  C CB    . LEU A 1 253 ? 132.503 -15.340 23.143 1.00 23.71 ? 305  LEU A CB    1 
ATOM   1912  C CG    . LEU A 1 253 ? 133.037 -16.273 22.066 1.00 21.32 ? 305  LEU A CG    1 
ATOM   1913  C CD1   . LEU A 1 253 ? 132.224 -16.107 20.793 1.00 22.12 ? 305  LEU A CD1   1 
ATOM   1914  C CD2   . LEU A 1 253 ? 134.483 -15.976 21.812 1.00 20.21 ? 305  LEU A CD2   1 
ATOM   1915  N N     . THR A 1 254 ? 131.260 -17.010 25.565 1.00 31.06 ? 306  THR A N     1 
ATOM   1916  C CA    . THR A 1 254 ? 131.243 -18.254 26.350 1.00 32.51 ? 306  THR A CA    1 
ATOM   1917  C C     . THR A 1 254 ? 129.838 -18.832 26.374 1.00 34.04 ? 306  THR A C     1 
ATOM   1918  O O     . THR A 1 254 ? 129.641 -20.029 26.149 1.00 34.58 ? 306  THR A O     1 
ATOM   1919  C CB    . THR A 1 254 ? 131.687 -18.040 27.807 1.00 30.88 ? 306  THR A CB    1 
ATOM   1920  O OG1   . THR A 1 254 ? 133.019 -17.534 27.839 1.00 32.27 ? 306  THR A OG1   1 
ATOM   1921  C CG2   . THR A 1 254 ? 131.692 -19.342 28.544 1.00 30.59 ? 306  THR A CG2   1 
ATOM   1922  N N     . LYS A 1 255 ? 128.865 -17.982 26.665 1.00 34.42 ? 307  LYS A N     1 
ATOM   1923  C CA    . LYS A 1 255 ? 127.490 -18.419 26.677 1.00 35.65 ? 307  LYS A CA    1 
ATOM   1924  C C     . LYS A 1 255 ? 127.275 -19.145 25.359 1.00 36.43 ? 307  LYS A C     1 
ATOM   1925  O O     . LYS A 1 255 ? 126.852 -20.296 25.305 1.00 36.23 ? 307  LYS A O     1 
ATOM   1926  C CB    . LYS A 1 255 ? 126.572 -17.205 26.767 1.00 36.06 ? 307  LYS A CB    1 
ATOM   1927  C CG    . LYS A 1 255 ? 126.606 -16.516 28.107 1.00 37.67 ? 307  LYS A CG    1 
ATOM   1928  C CD    . LYS A 1 255 ? 125.731 -15.282 28.097 1.00 40.60 ? 307  LYS A CD    1 
ATOM   1929  C CE    . LYS A 1 255 ? 125.443 -14.789 29.521 1.00 42.94 ? 307  LYS A CE    1 
ATOM   1930  N NZ    . LYS A 1 255 ? 124.640 -15.777 30.316 1.00 42.24 ? 307  LYS A NZ    1 
ATOM   1931  N N     . TYR A 1 256 ? 127.608 -18.460 24.283 1.00 37.24 ? 308  TYR A N     1 
ATOM   1932  C CA    . TYR A 1 256 ? 127.442 -19.053 22.977 1.00 38.89 ? 308  TYR A CA    1 
ATOM   1933  C C     . TYR A 1 256 ? 128.141 -20.409 22.907 1.00 41.34 ? 308  TYR A C     1 
ATOM   1934  O O     . TYR A 1 256 ? 127.498 -21.421 22.640 1.00 43.08 ? 308  TYR A O     1 
ATOM   1935  C CB    . TYR A 1 256 ? 127.978 -18.113 21.899 1.00 38.13 ? 308  TYR A CB    1 
ATOM   1936  C CG    . TYR A 1 256 ? 127.076 -16.918 21.664 1.00 38.43 ? 308  TYR A CG    1 
ATOM   1937  C CD1   . TYR A 1 256 ? 125.774 -17.088 21.186 1.00 37.23 ? 308  TYR A CD1   1 
ATOM   1938  C CD2   . TYR A 1 256 ? 127.510 -15.614 21.947 1.00 38.88 ? 308  TYR A CD2   1 
ATOM   1939  C CE1   . TYR A 1 256 ? 124.926 -15.994 20.998 1.00 37.36 ? 308  TYR A CE1   1 
ATOM   1940  C CE2   . TYR A 1 256 ? 126.665 -14.515 21.763 1.00 38.75 ? 308  TYR A CE2   1 
ATOM   1941  C CZ    . TYR A 1 256 ? 125.377 -14.718 21.289 1.00 38.56 ? 308  TYR A CZ    1 
ATOM   1942  O OH    . TYR A 1 256 ? 124.530 -13.647 21.126 1.00 40.65 ? 308  TYR A OH    1 
ATOM   1943  N N     . MET A 1 257 ? 129.448 -20.446 23.153 1.00 42.14 ? 309  MET A N     1 
ATOM   1944  C CA    . MET A 1 257 ? 130.163 -21.709 23.092 1.00 42.57 ? 309  MET A CA    1 
ATOM   1945  C C     . MET A 1 257 ? 129.478 -22.834 23.877 1.00 44.74 ? 309  MET A C     1 
ATOM   1946  O O     . MET A 1 257 ? 129.512 -23.991 23.463 1.00 44.12 ? 309  MET A O     1 
ATOM   1947  C CB    . MET A 1 257 ? 131.591 -21.510 23.580 1.00 41.00 ? 309  MET A CB    1 
ATOM   1948  C CG    . MET A 1 257 ? 132.496 -20.920 22.520 1.00 40.00 ? 309  MET A CG    1 
ATOM   1949  S SD    . MET A 1 257 ? 134.095 -20.297 23.075 1.00 37.98 ? 309  MET A SD    1 
ATOM   1950  C CE    . MET A 1 257 ? 133.777 -18.864 23.732 1.00 40.97 ? 309  MET A CE    1 
ATOM   1951  N N     . ASN A 1 258 ? 128.847 -22.498 24.999 1.00 48.57 ? 310  ASN A N     1 
ATOM   1952  C CA    . ASN A 1 258 ? 128.168 -23.505 25.814 1.00 51.53 ? 310  ASN A CA    1 
ATOM   1953  C C     . ASN A 1 258 ? 126.716 -23.629 25.431 1.00 52.58 ? 310  ASN A C     1 
ATOM   1954  O O     . ASN A 1 258 ? 125.896 -24.116 26.202 1.00 53.37 ? 310  ASN A O     1 
ATOM   1955  C CB    . ASN A 1 258 ? 128.287 -23.157 27.291 1.00 52.46 ? 310  ASN A CB    1 
ATOM   1956  C CG    . ASN A 1 258 ? 129.691 -23.353 27.809 1.00 54.20 ? 310  ASN A CG    1 
ATOM   1957  O OD1   . ASN A 1 258 ? 130.103 -22.714 28.770 1.00 55.40 ? 310  ASN A OD1   1 
ATOM   1958  N ND2   . ASN A 1 258 ? 130.435 -24.255 27.177 1.00 55.59 ? 310  ASN A ND2   1 
ATOM   1959  N N     . LYS A 1 259 ? 126.414 -23.171 24.225 1.00 55.19 ? 311  LYS A N     1 
ATOM   1960  C CA    . LYS A 1 259 ? 125.070 -23.220 23.668 1.00 57.42 ? 311  LYS A CA    1 
ATOM   1961  C C     . LYS A 1 259 ? 123.970 -22.719 24.572 1.00 58.51 ? 311  LYS A C     1 
ATOM   1962  O O     . LYS A 1 259 ? 122.903 -23.323 24.679 1.00 57.65 ? 311  LYS A O     1 
ATOM   1963  C CB    . LYS A 1 259 ? 124.766 -24.633 23.193 1.00 57.61 ? 311  LYS A CB    1 
ATOM   1964  C CG    . LYS A 1 259 ? 125.626 -25.020 22.017 1.00 59.55 ? 311  LYS A CG    1 
ATOM   1965  C CD    . LYS A 1 259 ? 125.213 -26.354 21.450 1.00 61.90 ? 311  LYS A CD    1 
ATOM   1966  C CE    . LYS A 1 259 ? 125.800 -27.494 22.264 1.00 64.44 ? 311  LYS A CE    1 
ATOM   1967  N NZ    . LYS A 1 259 ? 127.304 -27.550 22.137 1.00 65.21 ? 311  LYS A NZ    1 
ATOM   1968  N N     . GLU A 1 260 ? 124.251 -21.588 25.208 1.00 60.80 ? 312  GLU A N     1 
ATOM   1969  C CA    . GLU A 1 260 ? 123.303 -20.940 26.090 1.00 61.99 ? 312  GLU A CA    1 
ATOM   1970  C C     . GLU A 1 260 ? 122.554 -19.856 25.341 1.00 63.52 ? 312  GLU A C     1 
ATOM   1971  O O     . GLU A 1 260 ? 122.648 -19.747 24.113 1.00 63.43 ? 312  GLU A O     1 
ATOM   1972  C CB    . GLU A 1 260 ? 124.021 -20.353 27.294 1.00 61.88 ? 312  GLU A CB    1 
ATOM   1973  C CG    . GLU A 1 260 ? 124.360 -21.406 28.329 1.00 63.00 ? 312  GLU A CG    1 
ATOM   1974  C CD    . GLU A 1 260 ? 125.407 -20.945 29.316 1.00 63.55 ? 312  GLU A CD    1 
ATOM   1975  O OE1   . GLU A 1 260 ? 125.299 -19.795 29.802 1.00 62.97 ? 312  GLU A OE1   1 
ATOM   1976  O OE2   . GLU A 1 260 ? 126.330 -21.742 29.608 1.00 63.92 ? 312  GLU A OE2   1 
ATOM   1977  N N     . THR A 1 261 ? 121.811 -19.048 26.083 1.00 65.65 ? 313  THR A N     1 
ATOM   1978  C CA    . THR A 1 261 ? 121.022 -17.996 25.465 1.00 67.32 ? 313  THR A CA    1 
ATOM   1979  C C     . THR A 1 261 ? 121.470 -16.592 25.842 1.00 68.03 ? 313  THR A C     1 
ATOM   1980  O O     . THR A 1 261 ? 121.912 -16.330 26.968 1.00 67.52 ? 313  THR A O     1 
ATOM   1981  C CB    . THR A 1 261 ? 119.533 -18.160 25.819 1.00 67.85 ? 313  THR A CB    1 
ATOM   1982  O OG1   . THR A 1 261 ? 119.354 -17.973 27.229 1.00 67.99 ? 313  THR A OG1   1 
ATOM   1983  C CG2   . THR A 1 261 ? 119.049 -19.556 25.430 1.00 67.24 ? 313  THR A CG2   1 
ATOM   1984  N N     . VAL A 1 262 ? 121.350 -15.690 24.878 1.00 68.75 ? 314  VAL A N     1 
ATOM   1985  C CA    . VAL A 1 262 ? 121.731 -14.307 25.084 1.00 70.15 ? 314  VAL A CA    1 
ATOM   1986  C C     . VAL A 1 262 ? 120.501 -13.414 25.006 1.00 70.06 ? 314  VAL A C     1 
ATOM   1987  O O     . VAL A 1 262 ? 119.896 -13.249 23.946 1.00 69.84 ? 314  VAL A O     1 
ATOM   1988  C CB    . VAL A 1 262 ? 122.765 -13.864 24.034 1.00 70.82 ? 314  VAL A CB    1 
ATOM   1989  C CG1   . VAL A 1 262 ? 123.115 -12.398 24.228 1.00 71.50 ? 314  VAL A CG1   1 
ATOM   1990  C CG2   . VAL A 1 262 ? 124.011 -14.723 24.156 1.00 70.66 ? 314  VAL A CG2   1 
ATOM   1991  N N     . ASP A 1 263 ? 120.138 -12.851 26.151 1.00 70.25 ? 315  ASP A N     1 
ATOM   1992  C CA    . ASP A 1 263 ? 118.983 -11.968 26.261 1.00 70.72 ? 315  ASP A CA    1 
ATOM   1993  C C     . ASP A 1 263 ? 119.286 -10.592 25.663 1.00 69.79 ? 315  ASP A C     1 
ATOM   1994  O O     . ASP A 1 263 ? 118.385 -9.892  25.185 1.00 70.66 ? 315  ASP A O     1 
ATOM   1995  C CB    . ASP A 1 263 ? 118.584 -11.849 27.738 1.00 73.13 ? 315  ASP A CB    1 
ATOM   1996  C CG    . ASP A 1 263 ? 119.775 -11.554 28.652 1.00 73.84 ? 315  ASP A CG    1 
ATOM   1997  O OD1   . ASP A 1 263 ? 120.880 -12.105 28.415 1.00 72.57 ? 315  ASP A OD1   1 
ATOM   1998  O OD2   . ASP A 1 263 ? 119.588 -10.779 29.620 1.00 74.71 ? 315  ASP A OD2   1 
ATOM   1999  N N     . SER A 1 264 ? 120.569 -10.227 25.694 1.00 67.30 ? 316  SER A N     1 
ATOM   2000  C CA    . SER A 1 264 ? 121.077 -8.962  25.163 1.00 62.03 ? 316  SER A CA    1 
ATOM   2001  C C     . SER A 1 264 ? 122.312 -9.346  24.338 1.00 58.16 ? 316  SER A C     1 
ATOM   2002  O O     . SER A 1 264 ? 123.388 -9.582  24.880 1.00 58.41 ? 316  SER A O     1 
ATOM   2003  C CB    . SER A 1 264 ? 121.469 -8.030  26.319 1.00 62.63 ? 316  SER A CB    1 
ATOM   2004  O OG    . SER A 1 264 ? 120.441 -7.957  27.298 1.00 61.53 ? 316  SER A OG    1 
ATOM   2005  N N     . SER A 1 265 ? 122.148 -9.425  23.026 1.00 53.80 ? 317  SER A N     1 
ATOM   2006  C CA    . SER A 1 265 ? 123.239 -9.817  22.141 1.00 49.11 ? 317  SER A CA    1 
ATOM   2007  C C     . SER A 1 265 ? 124.055 -8.634  21.630 1.00 46.11 ? 317  SER A C     1 
ATOM   2008  O O     . SER A 1 265 ? 125.229 -8.773  21.275 1.00 45.04 ? 317  SER A O     1 
ATOM   2009  C CB    . SER A 1 265 ? 122.664 -10.589 20.961 1.00 49.05 ? 317  SER A CB    1 
ATOM   2010  O OG    . SER A 1 265 ? 123.689 -11.041 20.116 1.00 48.51 ? 317  SER A OG    1 
ATOM   2011  N N     . ILE A 1 266 ? 123.417 -7.472  21.589 1.00 42.44 ? 318  ILE A N     1 
ATOM   2012  C CA    . ILE A 1 266 ? 124.057 -6.256  21.129 1.00 38.00 ? 318  ILE A CA    1 
ATOM   2013  C C     . ILE A 1 266 ? 124.230 -5.348  22.328 1.00 36.53 ? 318  ILE A C     1 
ATOM   2014  O O     . ILE A 1 266 ? 123.422 -4.459  22.555 1.00 36.25 ? 318  ILE A O     1 
ATOM   2015  C CB    . ILE A 1 266 ? 123.197 -5.535  20.047 1.00 37.18 ? 318  ILE A CB    1 
ATOM   2016  C CG1   . ILE A 1 266 ? 123.123 -6.383  18.772 1.00 33.92 ? 318  ILE A CG1   1 
ATOM   2017  C CG2   . ILE A 1 266 ? 123.786 -4.170  19.721 1.00 36.32 ? 318  ILE A CG2   1 
ATOM   2018  C CD1   . ILE A 1 266 ? 121.931 -7.286  18.723 1.00 41.09 ? 318  ILE A CD1   1 
ATOM   2019  N N     . VAL A 1 267 ? 125.291 -5.574  23.090 1.00 36.61 ? 319  VAL A N     1 
ATOM   2020  C CA    . VAL A 1 267 ? 125.559 -4.778  24.280 1.00 38.47 ? 319  VAL A CA    1 
ATOM   2021  C C     . VAL A 1 267 ? 126.416 -3.541  24.009 1.00 38.86 ? 319  VAL A C     1 
ATOM   2022  O O     . VAL A 1 267 ? 127.411 -3.607  23.288 1.00 40.45 ? 319  VAL A O     1 
ATOM   2023  C CB    . VAL A 1 267 ? 126.279 -5.610  25.347 1.00 39.78 ? 319  VAL A CB    1 
ATOM   2024  C CG1   . VAL A 1 267 ? 125.761 -5.234  26.732 1.00 40.27 ? 319  VAL A CG1   1 
ATOM   2025  C CG2   . VAL A 1 267 ? 126.103 -7.089  25.062 1.00 39.46 ? 319  VAL A CG2   1 
ATOM   2026  N N     . GLN A 1 268 ? 126.033 -2.419  24.608 1.00 38.40 ? 320  GLN A N     1 
ATOM   2027  C CA    . GLN A 1 268 ? 126.767 -1.166  24.446 1.00 38.13 ? 320  GLN A CA    1 
ATOM   2028  C C     . GLN A 1 268 ? 127.257 -0.670  25.815 1.00 36.99 ? 320  GLN A C     1 
ATOM   2029  O O     . GLN A 1 268 ? 126.471 -0.264  26.667 1.00 37.22 ? 320  GLN A O     1 
ATOM   2030  C CB    . GLN A 1 268 ? 125.865 -0.122  23.787 1.00 39.13 ? 320  GLN A CB    1 
ATOM   2031  C CG    . GLN A 1 268 ? 126.530 1.212   23.502 1.00 42.19 ? 320  GLN A CG    1 
ATOM   2032  C CD    . GLN A 1 268 ? 125.657 2.120   22.650 1.00 43.26 ? 320  GLN A CD    1 
ATOM   2033  O OE1   . GLN A 1 268 ? 124.721 2.760   23.147 1.00 41.82 ? 320  GLN A OE1   1 
ATOM   2034  N NE2   . GLN A 1 268 ? 125.949 2.163   21.345 1.00 43.48 ? 320  GLN A NE2   1 
ATOM   2035  N N     . LEU A 1 269 ? 128.566 -0.711  26.018 1.00 35.13 ? 321  LEU A N     1 
ATOM   2036  C CA    . LEU A 1 269 ? 129.152 -0.293  27.276 1.00 33.37 ? 321  LEU A CA    1 
ATOM   2037  C C     . LEU A 1 269 ? 129.348 1.203   27.415 1.00 31.99 ? 321  LEU A C     1 
ATOM   2038  O O     . LEU A 1 269 ? 129.552 1.912   26.442 1.00 33.00 ? 321  LEU A O     1 
ATOM   2039  C CB    . LEU A 1 269 ? 130.485 -1.009  27.473 1.00 33.16 ? 321  LEU A CB    1 
ATOM   2040  C CG    . LEU A 1 269 ? 130.302 -2.426  28.009 1.00 33.19 ? 321  LEU A CG    1 
ATOM   2041  C CD1   . LEU A 1 269 ? 131.566 -3.246  27.870 1.00 33.08 ? 321  LEU A CD1   1 
ATOM   2042  C CD2   . LEU A 1 269 ? 129.878 -2.305  29.469 1.00 35.89 ? 321  LEU A CD2   1 
ATOM   2043  N N     . PRO A 1 270 ? 129.264 1.710   28.645 1.00 31.10 ? 322  PRO A N     1 
ATOM   2044  C CA    . PRO A 1 270 ? 129.452 3.147   28.854 1.00 30.79 ? 322  PRO A CA    1 
ATOM   2045  C C     . PRO A 1 270 ? 130.854 3.663   28.499 1.00 30.29 ? 322  PRO A C     1 
ATOM   2046  O O     . PRO A 1 270 ? 131.793 2.888   28.315 1.00 28.61 ? 322  PRO A O     1 
ATOM   2047  C CB    . PRO A 1 270 ? 129.117 3.328   30.339 1.00 28.29 ? 322  PRO A CB    1 
ATOM   2048  C CG    . PRO A 1 270 ? 129.269 1.967   30.919 1.00 27.43 ? 322  PRO A CG    1 
ATOM   2049  C CD    . PRO A 1 270 ? 128.734 1.071   29.857 1.00 29.15 ? 322  PRO A CD    1 
ATOM   2050  N N     . HIS A 1 271 ? 130.981 4.982   28.409 1.00 30.29 ? 323  HIS A N     1 
ATOM   2051  C CA    . HIS A 1 271 ? 132.257 5.602   28.087 1.00 30.18 ? 323  HIS A CA    1 
ATOM   2052  C C     . HIS A 1 271 ? 132.475 6.836   28.941 1.00 30.38 ? 323  HIS A C     1 
ATOM   2053  O O     . HIS A 1 271 ? 131.538 7.399   29.507 1.00 30.46 ? 323  HIS A O     1 
ATOM   2054  C CB    . HIS A 1 271 ? 132.299 6.012   26.615 1.00 30.41 ? 323  HIS A CB    1 
ATOM   2055  C CG    . HIS A 1 271 ? 131.325 7.095   26.268 1.00 30.73 ? 323  HIS A CG    1 
ATOM   2056  N ND1   . HIS A 1 271 ? 129.997 6.844   26.003 1.00 30.99 ? 323  HIS A ND1   1 
ATOM   2057  C CD2   . HIS A 1 271 ? 131.474 8.440   26.199 1.00 30.93 ? 323  HIS A CD2   1 
ATOM   2058  C CE1   . HIS A 1 271 ? 129.371 7.988   25.787 1.00 31.48 ? 323  HIS A CE1   1 
ATOM   2059  N NE2   . HIS A 1 271 ? 130.245 8.972   25.900 1.00 29.38 ? 323  HIS A NE2   1 
ATOM   2060  N N     . ARG A 1 272 ? 133.727 7.257   29.015 1.00 31.40 ? 324  ARG A N     1 
ATOM   2061  C CA    . ARG A 1 272 ? 134.104 8.430   29.781 1.00 32.87 ? 324  ARG A CA    1 
ATOM   2062  C C     . ARG A 1 272 ? 135.230 9.134   29.015 1.00 33.63 ? 324  ARG A C     1 
ATOM   2063  O O     . ARG A 1 272 ? 135.768 8.578   28.047 1.00 33.99 ? 324  ARG A O     1 
ATOM   2064  C CB    . ARG A 1 272 ? 134.564 8.008   31.193 1.00 32.74 ? 324  ARG A CB    1 
ATOM   2065  C CG    . ARG A 1 272 ? 135.613 6.909   31.236 1.00 34.03 ? 324  ARG A CG    1 
ATOM   2066  C CD    . ARG A 1 272 ? 136.047 6.607   32.661 1.00 37.74 ? 324  ARG A CD    1 
ATOM   2067  N NE    . ARG A 1 272 ? 137.247 5.762   32.741 1.00 42.34 ? 324  ARG A NE    1 
ATOM   2068  C CZ    . ARG A 1 272 ? 137.297 4.467   32.417 1.00 44.79 ? 324  ARG A CZ    1 
ATOM   2069  N NH1   . ARG A 1 272 ? 136.211 3.831   31.980 1.00 44.25 ? 324  ARG A NH1   1 
ATOM   2070  N NH2   . ARG A 1 272 ? 138.442 3.796   32.535 1.00 44.90 ? 324  ARG A NH2   1 
ATOM   2071  N N     . ILE A 1 273 ? 135.550 10.364  29.418 1.00 32.99 ? 325  ILE A N     1 
ATOM   2072  C CA    . ILE A 1 273 ? 136.628 11.137  28.797 1.00 31.56 ? 325  ILE A CA    1 
ATOM   2073  C C     . ILE A 1 273 ? 137.705 11.301  29.864 1.00 30.95 ? 325  ILE A C     1 
ATOM   2074  O O     . ILE A 1 273 ? 137.441 11.875  30.914 1.00 29.02 ? 325  ILE A O     1 
ATOM   2075  C CB    . ILE A 1 273 ? 136.195 12.586  28.384 1.00 31.76 ? 325  ILE A CB    1 
ATOM   2076  C CG1   . ILE A 1 273 ? 135.168 12.578  27.249 1.00 33.43 ? 325  ILE A CG1   1 
ATOM   2077  C CG2   . ILE A 1 273 ? 137.394 13.358  27.921 1.00 30.29 ? 325  ILE A CG2   1 
ATOM   2078  C CD1   . ILE A 1 273 ? 133.772 12.150  27.662 1.00 40.87 ? 325  ILE A CD1   1 
ATOM   2079  N N     . GLU A 1 274 ? 138.907 10.792  29.609 1.00 31.44 ? 326  GLU A N     1 
ATOM   2080  C CA    . GLU A 1 274 ? 140.000 10.957  30.568 1.00 30.44 ? 326  GLU A CA    1 
ATOM   2081  C C     . GLU A 1 274 ? 140.624 12.306  30.241 1.00 28.26 ? 326  GLU A C     1 
ATOM   2082  O O     . GLU A 1 274 ? 141.258 12.476  29.200 1.00 25.60 ? 326  GLU A O     1 
ATOM   2083  C CB    . GLU A 1 274 ? 141.043 9.839   30.424 1.00 33.02 ? 326  GLU A CB    1 
ATOM   2084  C CG    . GLU A 1 274 ? 142.081 9.811   31.544 1.00 36.66 ? 326  GLU A CG    1 
ATOM   2085  C CD    . GLU A 1 274 ? 141.468 9.982   32.937 1.00 40.01 ? 326  GLU A CD    1 
ATOM   2086  O OE1   . GLU A 1 274 ? 140.466 9.298   33.267 1.00 42.24 ? 326  GLU A OE1   1 
ATOM   2087  O OE2   . GLU A 1 274 ? 142.004 10.802  33.710 1.00 41.27 ? 326  GLU A OE2   1 
ATOM   2088  N N     . PHE A 1 275 ? 140.410 13.268  31.126 1.00 27.88 ? 327  PHE A N     1 
ATOM   2089  C CA    . PHE A 1 275 ? 140.924 14.614  30.936 1.00 28.95 ? 327  PHE A CA    1 
ATOM   2090  C C     . PHE A 1 275 ? 142.341 14.824  31.458 1.00 28.59 ? 327  PHE A C     1 
ATOM   2091  O O     . PHE A 1 275 ? 142.635 14.567  32.629 1.00 28.69 ? 327  PHE A O     1 
ATOM   2092  C CB    . PHE A 1 275 ? 139.978 15.636  31.594 1.00 30.75 ? 327  PHE A CB    1 
ATOM   2093  C CG    . PHE A 1 275 ? 138.658 15.775  30.899 1.00 32.44 ? 327  PHE A CG    1 
ATOM   2094  C CD1   . PHE A 1 275 ? 137.536 15.099  31.364 1.00 32.80 ? 327  PHE A CD1   1 
ATOM   2095  C CD2   . PHE A 1 275 ? 138.548 16.554  29.748 1.00 34.34 ? 327  PHE A CD2   1 
ATOM   2096  C CE1   . PHE A 1 275 ? 136.327 15.192  30.696 1.00 34.70 ? 327  PHE A CE1   1 
ATOM   2097  C CE2   . PHE A 1 275 ? 137.338 16.656  29.066 1.00 35.96 ? 327  PHE A CE2   1 
ATOM   2098  C CZ    . PHE A 1 275 ? 136.223 15.973  29.541 1.00 36.12 ? 327  PHE A CZ    1 
ATOM   2099  N N     . ARG A 1 276 ? 143.213 15.312  30.583 1.00 28.56 ? 328  ARG A N     1 
ATOM   2100  C CA    . ARG A 1 276 ? 144.599 15.571  30.958 1.00 29.63 ? 328  ARG A CA    1 
ATOM   2101  C C     . ARG A 1 276 ? 145.029 17.031  30.651 1.00 30.01 ? 328  ARG A C     1 
ATOM   2102  O O     . ARG A 1 276 ? 144.276 17.966  30.918 1.00 31.54 ? 328  ARG A O     1 
ATOM   2103  C CB    . ARG A 1 276 ? 145.503 14.539  30.263 1.00 27.60 ? 328  ARG A CB    1 
ATOM   2104  C CG    . ARG A 1 276 ? 145.062 13.082  30.490 1.00 23.25 ? 328  ARG A CG    1 
ATOM   2105  C CD    . ARG A 1 276 ? 146.148 12.106  30.071 1.00 23.56 ? 328  ARG A CD    1 
ATOM   2106  N NE    . ARG A 1 276 ? 145.880 10.718  30.441 1.00 23.01 ? 328  ARG A NE    1 
ATOM   2107  C CZ    . ARG A 1 276 ? 145.114 9.887   29.740 1.00 24.62 ? 328  ARG A CZ    1 
ATOM   2108  N NH1   . ARG A 1 276 ? 144.526 10.295  28.623 1.00 26.38 ? 328  ARG A NH1   1 
ATOM   2109  N NH2   . ARG A 1 276 ? 144.944 8.641   30.149 1.00 22.81 ? 328  ARG A NH2   1 
ATOM   2110  N N     . GLN A 1 277 ? 146.216 17.238  30.091 1.00 30.73 ? 329  GLN A N     1 
ATOM   2111  C CA    . GLN A 1 277 ? 146.685 18.598  29.803 1.00 32.01 ? 329  GLN A CA    1 
ATOM   2112  C C     . GLN A 1 277 ? 146.489 19.132  28.397 1.00 31.79 ? 329  GLN A C     1 
ATOM   2113  O O     . GLN A 1 277 ? 146.931 20.238  28.093 1.00 29.80 ? 329  GLN A O     1 
ATOM   2114  C CB    . GLN A 1 277 ? 148.165 18.736  30.136 1.00 33.47 ? 329  GLN A CB    1 
ATOM   2115  C CG    . GLN A 1 277 ? 148.464 18.812  31.595 1.00 34.52 ? 329  GLN A CG    1 
ATOM   2116  C CD    . GLN A 1 277 ? 147.916 17.633  32.335 1.00 37.58 ? 329  GLN A CD    1 
ATOM   2117  O OE1   . GLN A 1 277 ? 146.834 17.708  32.910 1.00 40.05 ? 329  GLN A OE1   1 
ATOM   2118  N NE2   . GLN A 1 277 ? 148.650 16.517  32.315 1.00 37.07 ? 329  GLN A NE2   1 
ATOM   2119  N N     . SER A 1 278 ? 145.845 18.359  27.536 1.00 33.02 ? 330  SER A N     1 
ATOM   2120  C CA    . SER A 1 278 ? 145.632 18.822  26.177 1.00 34.77 ? 330  SER A CA    1 
ATOM   2121  C C     . SER A 1 278 ? 144.381 19.706  26.105 1.00 35.06 ? 330  SER A C     1 
ATOM   2122  O O     . SER A 1 278 ? 144.012 20.203  25.037 1.00 34.81 ? 330  SER A O     1 
ATOM   2123  C CB    . SER A 1 278 ? 145.537 17.631  25.215 1.00 34.80 ? 330  SER A CB    1 
ATOM   2124  O OG    . SER A 1 278 ? 144.484 16.750  25.558 1.00 36.40 ? 330  SER A OG    1 
ATOM   2125  N N     . THR A 1 279 ? 143.745 19.908  27.256 1.00 34.95 ? 331  THR A N     1 
ATOM   2126  C CA    . THR A 1 279 ? 142.560 20.753  27.356 1.00 35.53 ? 331  THR A CA    1 
ATOM   2127  C C     . THR A 1 279 ? 142.749 21.625  28.577 1.00 37.92 ? 331  THR A C     1 
ATOM   2128  O O     . THR A 1 279 ? 143.305 21.167  29.574 1.00 40.31 ? 331  THR A O     1 
ATOM   2129  C CB    . THR A 1 279 ? 141.282 19.934  27.570 1.00 34.02 ? 331  THR A CB    1 
ATOM   2130  O OG1   . THR A 1 279 ? 141.491 19.002  28.638 1.00 33.23 ? 331  THR A OG1   1 
ATOM   2131  C CG2   . THR A 1 279 ? 140.887 19.204  26.298 1.00 30.29 ? 331  THR A CG2   1 
ATOM   2132  N N     . LYS A 1 280 ? 142.307 22.877  28.502 1.00 40.28 ? 332  LYS A N     1 
ATOM   2133  C CA    . LYS A 1 280 ? 142.423 23.794  29.636 1.00 42.22 ? 332  LYS A CA    1 
ATOM   2134  C C     . LYS A 1 280 ? 141.476 23.313  30.733 1.00 43.36 ? 332  LYS A C     1 
ATOM   2135  O O     . LYS A 1 280 ? 141.910 23.199  31.899 1.00 43.47 ? 332  LYS A O     1 
ATOM   2136  C CB    . LYS A 1 280 ? 142.046 25.233  29.244 1.00 42.75 ? 332  LYS A CB    1 
ATOM   2137  C CG    . LYS A 1 280 ? 143.169 26.067  28.646 1.00 44.53 ? 332  LYS A CG    1 
ATOM   2138  C CD    . LYS A 1 280 ? 142.791 27.555  28.577 1.00 46.82 ? 332  LYS A CD    1 
ATOM   2139  C CE    . LYS A 1 280 ? 143.280 28.331  29.805 1.00 49.86 ? 332  LYS A CE    1 
ATOM   2140  N NZ    . LYS A 1 280 ? 142.965 29.798  29.765 1.00 49.83 ? 332  LYS A NZ    1 
ATOM   2141  O OXT   . LYS A 1 280 ? 140.296 23.061  30.407 1.00 45.82 ? 332  LYS A OXT   1 
ATOM   2142  N N     . THR B 1 8   ? 148.497 -25.357 2.225  1.00 46.55 ? 60   THR D N     1 
ATOM   2143  C CA    . THR B 1 8   ? 147.892 -24.645 3.396  1.00 47.04 ? 60   THR D CA    1 
ATOM   2144  C C     . THR B 1 8   ? 148.902 -24.308 4.502  1.00 45.13 ? 60   THR D C     1 
ATOM   2145  O O     . THR B 1 8   ? 148.639 -24.516 5.692  1.00 46.54 ? 60   THR D O     1 
ATOM   2146  C CB    . THR B 1 8   ? 146.737 -25.474 3.997  1.00 48.05 ? 60   THR D CB    1 
ATOM   2147  O OG1   . THR B 1 8   ? 146.966 -26.875 3.748  1.00 48.46 ? 60   THR D OG1   1 
ATOM   2148  C CG2   . THR B 1 8   ? 145.406 -25.041 3.383  1.00 48.07 ? 60   THR D CG2   1 
ATOM   2149  N N     . THR B 1 9   ? 150.044 -23.764 4.094  1.00 42.17 ? 61   THR D N     1 
ATOM   2150  C CA    . THR B 1 9   ? 151.117 -23.389 5.007  1.00 39.66 ? 61   THR D CA    1 
ATOM   2151  C C     . THR B 1 9   ? 150.695 -22.297 5.958  1.00 37.44 ? 61   THR D C     1 
ATOM   2152  O O     . THR B 1 9   ? 150.023 -21.358 5.576  1.00 37.60 ? 61   THR D O     1 
ATOM   2153  C CB    . THR B 1 9   ? 152.336 -22.859 4.256  1.00 40.11 ? 61   THR D CB    1 
ATOM   2154  O OG1   . THR B 1 9   ? 152.453 -23.534 2.992  1.00 40.82 ? 61   THR D OG1   1 
ATOM   2155  C CG2   . THR B 1 9   ? 153.597 -23.078 5.084  1.00 39.26 ? 61   THR D CG2   1 
ATOM   2156  N N     . THR B 1 10  ? 151.105 -22.426 7.207  1.00 36.55 ? 62   THR D N     1 
ATOM   2157  C CA    . THR B 1 10  ? 150.782 -21.439 8.222  1.00 35.73 ? 62   THR D CA    1 
ATOM   2158  C C     . THR B 1 10  ? 151.847 -21.457 9.322  1.00 34.55 ? 62   THR D C     1 
ATOM   2159  O O     . THR B 1 10  ? 152.163 -22.500 9.892  1.00 34.06 ? 62   THR D O     1 
ATOM   2160  C CB    . THR B 1 10  ? 149.351 -21.666 8.813  1.00 35.59 ? 62   THR D CB    1 
ATOM   2161  O OG1   . THR B 1 10  ? 149.378 -21.505 10.237 1.00 33.21 ? 62   THR D OG1   1 
ATOM   2162  C CG2   . THR B 1 10  ? 148.818 -23.044 8.440  1.00 38.13 ? 62   THR D CG2   1 
ATOM   2163  N N     . VAL B 1 11  ? 152.427 -20.293 9.587  1.00 32.98 ? 63   VAL D N     1 
ATOM   2164  C CA    . VAL B 1 11  ? 153.458 -20.192 10.605 1.00 30.93 ? 63   VAL D CA    1 
ATOM   2165  C C     . VAL B 1 11  ? 152.981 -19.407 11.819 1.00 29.30 ? 63   VAL D C     1 
ATOM   2166  O O     . VAL B 1 11  ? 152.223 -18.440 11.703 1.00 29.20 ? 63   VAL D O     1 
ATOM   2167  C CB    . VAL B 1 11  ? 154.769 -19.565 10.019 1.00 30.85 ? 63   VAL D CB    1 
ATOM   2168  C CG1   . VAL B 1 11  ? 154.439 -18.698 8.831  1.00 30.63 ? 63   VAL D CG1   1 
ATOM   2169  C CG2   . VAL B 1 11  ? 155.498 -18.755 11.074 1.00 27.76 ? 63   VAL D CG2   1 
ATOM   2170  N N     . GLY B 1 12  ? 153.407 -19.867 12.989 1.00 27.51 ? 64   GLY D N     1 
ATOM   2171  C CA    . GLY B 1 12  ? 153.043 -19.208 14.219 1.00 26.22 ? 64   GLY D CA    1 
ATOM   2172  C C     . GLY B 1 12  ? 154.222 -18.374 14.660 1.00 25.58 ? 64   GLY D C     1 
ATOM   2173  O O     . GLY B 1 12  ? 155.360 -18.697 14.345 1.00 25.58 ? 64   GLY D O     1 
ATOM   2174  N N     . VAL B 1 13  ? 153.966 -17.283 15.364 1.00 25.51 ? 65   VAL D N     1 
ATOM   2175  C CA    . VAL B 1 13  ? 155.055 -16.462 15.846 1.00 26.28 ? 65   VAL D CA    1 
ATOM   2176  C C     . VAL B 1 13  ? 154.793 -16.091 17.312 1.00 26.08 ? 65   VAL D C     1 
ATOM   2177  O O     . VAL B 1 13  ? 153.666 -15.769 17.704 1.00 26.57 ? 65   VAL D O     1 
ATOM   2178  C CB    . VAL B 1 13  ? 155.272 -15.187 14.921 1.00 26.77 ? 65   VAL D CB    1 
ATOM   2179  C CG1   . VAL B 1 13  ? 154.381 -15.268 13.691 1.00 25.69 ? 65   VAL D CG1   1 
ATOM   2180  C CG2   . VAL B 1 13  ? 155.030 -13.904 15.675 1.00 25.72 ? 65   VAL D CG2   1 
ATOM   2181  N N     . ILE B 1 14  ? 155.841 -16.172 18.118 1.00 24.34 ? 66   ILE D N     1 
ATOM   2182  C CA    . ILE B 1 14  ? 155.748 -15.851 19.529 1.00 24.39 ? 66   ILE D CA    1 
ATOM   2183  C C     . ILE B 1 14  ? 156.551 -14.586 19.881 1.00 24.91 ? 66   ILE D C     1 
ATOM   2184  O O     . ILE B 1 14  ? 157.778 -14.615 19.891 1.00 22.76 ? 66   ILE D O     1 
ATOM   2185  C CB    . ILE B 1 14  ? 156.335 -16.981 20.403 1.00 26.39 ? 66   ILE D CB    1 
ATOM   2186  C CG1   . ILE B 1 14  ? 155.818 -18.360 19.961 1.00 27.31 ? 66   ILE D CG1   1 
ATOM   2187  C CG2   . ILE B 1 14  ? 156.055 -16.680 21.863 1.00 24.67 ? 66   ILE D CG2   1 
ATOM   2188  C CD1   . ILE B 1 14  ? 154.337 -18.567 20.097 1.00 37.06 ? 66   ILE D CD1   1 
ATOM   2189  N N     . ILE B 1 15  ? 155.874 -13.475 20.148 1.00 25.84 ? 67   ILE D N     1 
ATOM   2190  C CA    . ILE B 1 15  ? 156.572 -12.269 20.573 1.00 27.46 ? 67   ILE D CA    1 
ATOM   2191  C C     . ILE B 1 15  ? 156.011 -11.966 21.945 1.00 29.67 ? 67   ILE D C     1 
ATOM   2192  O O     . ILE B 1 15  ? 155.011 -12.551 22.370 1.00 29.03 ? 67   ILE D O     1 
ATOM   2193  C CB    . ILE B 1 15  ? 156.332 -11.039 19.663 1.00 29.61 ? 67   ILE D CB    1 
ATOM   2194  C CG1   . ILE B 1 15  ? 154.840 -10.775 19.514 1.00 28.88 ? 67   ILE D CG1   1 
ATOM   2195  C CG2   . ILE B 1 15  ? 157.024 -11.232 18.308 1.00 28.49 ? 67   ILE D CG2   1 
ATOM   2196  C CD1   . ILE B 1 15  ? 154.547 -9.464  18.861 1.00 37.21 ? 67   ILE D CD1   1 
ATOM   2197  N N     . PRO B 1 16  ? 156.648 -11.059 22.677 1.00 31.82 ? 68   PRO D N     1 
ATOM   2198  C CA    . PRO B 1 16  ? 156.012 -10.860 23.978 1.00 33.40 ? 68   PRO D CA    1 
ATOM   2199  C C     . PRO B 1 16  ? 154.848 -9.857  24.058 1.00 35.23 ? 68   PRO D C     1 
ATOM   2200  O O     . PRO B 1 16  ? 154.137 -9.840  25.062 1.00 36.49 ? 68   PRO D O     1 
ATOM   2201  C CB    . PRO B 1 16  ? 157.194 -10.498 24.880 1.00 34.97 ? 68   PRO D CB    1 
ATOM   2202  C CG    . PRO B 1 16  ? 158.149 -9.816  23.944 1.00 33.42 ? 68   PRO D CG    1 
ATOM   2203  C CD    . PRO B 1 16  ? 158.071 -10.678 22.707 1.00 32.58 ? 68   PRO D CD    1 
ATOM   2204  N N     . ASP B 1 17  ? 154.638 -9.029  23.029 1.00 36.07 ? 69   ASP D N     1 
ATOM   2205  C CA    . ASP B 1 17  ? 153.524 -8.072  23.066 1.00 36.10 ? 69   ASP D CA    1 
ATOM   2206  C C     . ASP B 1 17  ? 153.229 -7.307  21.768 1.00 36.20 ? 69   ASP D C     1 
ATOM   2207  O O     . ASP B 1 17  ? 153.802 -6.250  21.512 1.00 36.70 ? 69   ASP D O     1 
ATOM   2208  C CB    . ASP B 1 17  ? 153.730 -7.070  24.208 1.00 37.34 ? 69   ASP D CB    1 
ATOM   2209  C CG    . ASP B 1 17  ? 152.531 -6.149  24.396 1.00 38.81 ? 69   ASP D CG    1 
ATOM   2210  O OD1   . ASP B 1 17  ? 151.423 -6.545  23.977 1.00 37.43 ? 69   ASP D OD1   1 
ATOM   2211  O OD2   . ASP B 1 17  ? 152.693 -5.044  24.966 1.00 37.93 ? 69   ASP D OD2   1 
ATOM   2212  N N     . ILE B 1 18  ? 152.305 -7.841  20.974 1.00 35.94 ? 70   ILE D N     1 
ATOM   2213  C CA    . ILE B 1 18  ? 151.893 -7.253  19.699 1.00 34.92 ? 70   ILE D CA    1 
ATOM   2214  C C     . ILE B 1 18  ? 151.447 -5.796  19.832 1.00 35.69 ? 70   ILE D C     1 
ATOM   2215  O O     . ILE B 1 18  ? 151.638 -5.005  18.916 1.00 35.52 ? 70   ILE D O     1 
ATOM   2216  C CB    . ILE B 1 18  ? 150.723 -8.089  19.045 1.00 34.58 ? 70   ILE D CB    1 
ATOM   2217  C CG1   . ILE B 1 18  ? 150.367 -7.543  17.657 1.00 35.46 ? 70   ILE D CG1   1 
ATOM   2218  C CG2   . ILE B 1 18  ? 149.481 -8.046  19.920 1.00 29.60 ? 70   ILE D CG2   1 
ATOM   2219  C CD1   . ILE B 1 18  ? 151.317 -7.944  16.550 1.00 39.76 ? 70   ILE D CD1   1 
ATOM   2220  N N     . SER B 1 19  ? 150.854 -5.432  20.963 1.00 36.37 ? 71   SER D N     1 
ATOM   2221  C CA    . SER B 1 19  ? 150.398 -4.055  21.130 1.00 38.27 ? 71   SER D CA    1 
ATOM   2222  C C     . SER B 1 19  ? 151.575 -3.076  21.245 1.00 40.03 ? 71   SER D C     1 
ATOM   2223  O O     . SER B 1 19  ? 151.429 -1.880  21.003 1.00 41.34 ? 71   SER D O     1 
ATOM   2224  C CB    . SER B 1 19  ? 149.473 -3.930  22.356 1.00 36.92 ? 71   SER D CB    1 
ATOM   2225  O OG    . SER B 1 19  ? 150.164 -4.170  23.571 1.00 34.83 ? 71   SER D OG    1 
ATOM   2226  N N     . ASN B 1 20  ? 152.743 -3.579  21.616 1.00 40.73 ? 72   ASN D N     1 
ATOM   2227  C CA    . ASN B 1 20  ? 153.907 -2.719  21.737 1.00 41.84 ? 72   ASN D CA    1 
ATOM   2228  C C     . ASN B 1 20  ? 154.443 -2.364  20.343 1.00 41.40 ? 72   ASN D C     1 
ATOM   2229  O O     . ASN B 1 20  ? 154.913 -3.238  19.604 1.00 41.29 ? 72   ASN D O     1 
ATOM   2230  C CB    . ASN B 1 20  ? 154.986 -3.427  22.545 1.00 44.09 ? 72   ASN D CB    1 
ATOM   2231  C CG    . ASN B 1 20  ? 156.268 -2.652  22.582 1.00 46.49 ? 72   ASN D CG    1 
ATOM   2232  O OD1   . ASN B 1 20  ? 157.333 -3.209  22.844 1.00 50.40 ? 72   ASN D OD1   1 
ATOM   2233  N ND2   . ASN B 1 20  ? 156.182 -1.352  22.321 1.00 47.09 ? 72   ASN D ND2   1 
ATOM   2234  N N     . ILE B 1 21  ? 154.382 -1.082  19.991 1.00 39.76 ? 73   ILE D N     1 
ATOM   2235  C CA    . ILE B 1 21  ? 154.840 -0.643  18.681 1.00 37.59 ? 73   ILE D CA    1 
ATOM   2236  C C     . ILE B 1 21  ? 156.141 -1.303  18.229 1.00 36.58 ? 73   ILE D C     1 
ATOM   2237  O O     . ILE B 1 21  ? 156.351 -1.509  17.039 1.00 35.47 ? 73   ILE D O     1 
ATOM   2238  C CB    . ILE B 1 21  ? 154.990 0.891   18.639 1.00 37.73 ? 73   ILE D CB    1 
ATOM   2239  C CG1   . ILE B 1 21  ? 153.599 1.533   18.537 1.00 39.42 ? 73   ILE D CG1   1 
ATOM   2240  C CG2   . ILE B 1 21  ? 155.839 1.306   17.455 1.00 36.90 ? 73   ILE D CG2   1 
ATOM   2241  C CD1   . ILE B 1 21  ? 153.586 3.063   18.483 1.00 39.98 ? 73   ILE D CD1   1 
ATOM   2242  N N     . PHE B 1 22  ? 157.002 -1.659  19.171 1.00 35.58 ? 74   PHE D N     1 
ATOM   2243  C CA    . PHE B 1 22  ? 158.272 -2.273  18.823 1.00 35.89 ? 74   PHE D CA    1 
ATOM   2244  C C     . PHE B 1 22  ? 158.133 -3.637  18.168 1.00 35.91 ? 74   PHE D C     1 
ATOM   2245  O O     . PHE B 1 22  ? 158.676 -3.865  17.092 1.00 35.69 ? 74   PHE D O     1 
ATOM   2246  C CB    . PHE B 1 22  ? 159.151 -2.387  20.066 1.00 38.09 ? 74   PHE D CB    1 
ATOM   2247  C CG    . PHE B 1 22  ? 160.405 -3.196  19.859 1.00 41.35 ? 74   PHE D CG    1 
ATOM   2248  C CD1   . PHE B 1 22  ? 160.540 -4.458  20.438 1.00 42.57 ? 74   PHE D CD1   1 
ATOM   2249  C CD2   . PHE B 1 22  ? 161.458 -2.694  19.102 1.00 42.15 ? 74   PHE D CD2   1 
ATOM   2250  C CE1   . PHE B 1 22  ? 161.705 -5.204  20.267 1.00 42.54 ? 74   PHE D CE1   1 
ATOM   2251  C CE2   . PHE B 1 22  ? 162.628 -3.434  18.926 1.00 42.16 ? 74   PHE D CE2   1 
ATOM   2252  C CZ    . PHE B 1 22  ? 162.748 -4.688  19.511 1.00 42.89 ? 74   PHE D CZ    1 
ATOM   2253  N N     . TYR B 1 23  ? 157.419 -4.544  18.826 1.00 36.11 ? 75   TYR D N     1 
ATOM   2254  C CA    . TYR B 1 23  ? 157.216 -5.895  18.321 1.00 35.33 ? 75   TYR D CA    1 
ATOM   2255  C C     . TYR B 1 23  ? 156.279 -5.911  17.128 1.00 36.15 ? 75   TYR D C     1 
ATOM   2256  O O     . TYR B 1 23  ? 156.239 -6.878  16.360 1.00 35.54 ? 75   TYR D O     1 
ATOM   2257  C CB    . TYR B 1 23  ? 156.640 -6.766  19.421 1.00 35.68 ? 75   TYR D CB    1 
ATOM   2258  C CG    . TYR B 1 23  ? 157.571 -6.898  20.580 1.00 38.61 ? 75   TYR D CG    1 
ATOM   2259  C CD1   . TYR B 1 23  ? 158.664 -7.745  20.508 1.00 39.20 ? 75   TYR D CD1   1 
ATOM   2260  C CD2   . TYR B 1 23  ? 157.404 -6.124  21.730 1.00 40.03 ? 75   TYR D CD2   1 
ATOM   2261  C CE1   . TYR B 1 23  ? 159.577 -7.819  21.544 1.00 41.45 ? 75   TYR D CE1   1 
ATOM   2262  C CE2   . TYR B 1 23  ? 158.316 -6.188  22.773 1.00 40.92 ? 75   TYR D CE2   1 
ATOM   2263  C CZ    . TYR B 1 23  ? 159.406 -7.037  22.669 1.00 41.18 ? 75   TYR D CZ    1 
ATOM   2264  O OH    . TYR B 1 23  ? 160.363 -7.088  23.659 1.00 43.45 ? 75   TYR D OH    1 
ATOM   2265  N N     . ALA B 1 24  ? 155.517 -4.837  16.973 1.00 35.97 ? 76   ALA D N     1 
ATOM   2266  C CA    . ALA B 1 24  ? 154.579 -4.752  15.870 1.00 35.26 ? 76   ALA D CA    1 
ATOM   2267  C C     . ALA B 1 24  ? 155.278 -4.474  14.545 1.00 35.30 ? 76   ALA D C     1 
ATOM   2268  O O     . ALA B 1 24  ? 154.823 -4.932  13.493 1.00 37.53 ? 76   ALA D O     1 
ATOM   2269  C CB    . ALA B 1 24  ? 153.549 -3.692  16.155 1.00 34.71 ? 76   ALA D CB    1 
ATOM   2270  N N     . GLU B 1 25  ? 156.379 -3.732  14.584 1.00 33.11 ? 77   GLU D N     1 
ATOM   2271  C CA    . GLU B 1 25  ? 157.097 -3.427  13.359 1.00 33.00 ? 77   GLU D CA    1 
ATOM   2272  C C     . GLU B 1 25  ? 157.725 -4.700  12.816 1.00 32.19 ? 77   GLU D C     1 
ATOM   2273  O O     . GLU B 1 25  ? 157.830 -4.896  11.602 1.00 31.84 ? 77   GLU D O     1 
ATOM   2274  C CB    . GLU B 1 25  ? 158.162 -2.358  13.611 1.00 33.77 ? 77   GLU D CB    1 
ATOM   2275  C CG    . GLU B 1 25  ? 157.573 -1.006  13.979 1.00 36.68 ? 77   GLU D CG    1 
ATOM   2276  C CD    . GLU B 1 25  ? 158.590 0.121   13.903 1.00 40.40 ? 77   GLU D CD    1 
ATOM   2277  O OE1   . GLU B 1 25  ? 158.190 1.309   14.007 1.00 39.50 ? 77   GLU D OE1   1 
ATOM   2278  O OE2   . GLU B 1 25  ? 159.792 -0.187  13.734 1.00 44.62 ? 77   GLU D OE2   1 
ATOM   2279  N N     . LEU B 1 26  ? 158.132 -5.570  13.730 1.00 30.52 ? 78   LEU D N     1 
ATOM   2280  C CA    . LEU B 1 26  ? 158.727 -6.839  13.368 1.00 28.59 ? 78   LEU D CA    1 
ATOM   2281  C C     . LEU B 1 26  ? 157.618 -7.639  12.722 1.00 30.03 ? 78   LEU D C     1 
ATOM   2282  O O     . LEU B 1 26  ? 157.786 -8.216  11.654 1.00 31.02 ? 78   LEU D O     1 
ATOM   2283  C CB    . LEU B 1 26  ? 159.203 -7.549  14.618 1.00 27.68 ? 78   LEU D CB    1 
ATOM   2284  C CG    . LEU B 1 26  ? 159.814 -8.925  14.422 1.00 28.33 ? 78   LEU D CG    1 
ATOM   2285  C CD1   . LEU B 1 26  ? 161.180 -8.770  13.790 1.00 30.93 ? 78   LEU D CD1   1 
ATOM   2286  C CD2   . LEU B 1 26  ? 159.929 -9.626  15.758 1.00 27.17 ? 78   LEU D CD2   1 
ATOM   2287  N N     . ALA B 1 27  ? 156.469 -7.660  13.386 1.00 31.77 ? 79   ALA D N     1 
ATOM   2288  C CA    . ALA B 1 27  ? 155.299 -8.380  12.894 1.00 33.31 ? 79   ALA D CA    1 
ATOM   2289  C C     . ALA B 1 27  ? 154.918 -7.929  11.493 1.00 35.48 ? 79   ALA D C     1 
ATOM   2290  O O     . ALA B 1 27  ? 154.314 -8.683  10.739 1.00 36.61 ? 79   ALA D O     1 
ATOM   2291  C CB    . ALA B 1 27  ? 154.122 -8.156  13.828 1.00 32.42 ? 79   ALA D CB    1 
ATOM   2292  N N     . ARG B 1 28  ? 155.254 -6.687  11.159 1.00 36.96 ? 80   ARG D N     1 
ATOM   2293  C CA    . ARG B 1 28  ? 154.936 -6.126  9.855  1.00 37.87 ? 80   ARG D CA    1 
ATOM   2294  C C     . ARG B 1 28  ? 155.713 -6.851  8.744  1.00 38.09 ? 80   ARG D C     1 
ATOM   2295  O O     . ARG B 1 28  ? 155.157 -7.179  7.690  1.00 36.36 ? 80   ARG D O     1 
ATOM   2296  C CB    . ARG B 1 28  ? 155.273 -4.632  9.866  1.00 40.81 ? 80   ARG D CB    1 
ATOM   2297  C CG    . ARG B 1 28  ? 154.614 -3.802  8.777  1.00 42.28 ? 80   ARG D CG    1 
ATOM   2298  C CD    . ARG B 1 28  ? 153.110 -3.928  8.837  1.00 46.24 ? 80   ARG D CD    1 
ATOM   2299  N NE    . ARG B 1 28  ? 152.627 -4.963  7.925  1.00 50.39 ? 80   ARG D NE    1 
ATOM   2300  C CZ    . ARG B 1 28  ? 151.348 -5.291  7.774  1.00 51.69 ? 80   ARG D CZ    1 
ATOM   2301  N NH1   . ARG B 1 28  ? 150.414 -4.669  8.479  1.00 53.77 ? 80   ARG D NH1   1 
ATOM   2302  N NH2   . ARG B 1 28  ? 151.000 -6.237  6.913  1.00 52.34 ? 80   ARG D NH2   1 
ATOM   2303  N N     . GLY B 1 29  ? 157.000 -7.093  8.980  1.00 37.53 ? 81   GLY D N     1 
ATOM   2304  C CA    . GLY B 1 29  ? 157.800 -7.785  7.993  1.00 37.44 ? 81   GLY D CA    1 
ATOM   2305  C C     . GLY B 1 29  ? 157.425 -9.258  7.983  1.00 38.47 ? 81   GLY D C     1 
ATOM   2306  O O     . GLY B 1 29  ? 157.442 -9.917  6.943  1.00 39.96 ? 81   GLY D O     1 
ATOM   2307  N N     . ILE B 1 30  ? 157.088 -9.792  9.150  1.00 36.23 ? 82   ILE D N     1 
ATOM   2308  C CA    . ILE B 1 30  ? 156.717 -11.186 9.218  1.00 34.83 ? 82   ILE D CA    1 
ATOM   2309  C C     . ILE B 1 30  ? 155.530 -11.341 8.284  1.00 33.09 ? 82   ILE D C     1 
ATOM   2310  O O     . ILE B 1 30  ? 155.548 -12.152 7.365  1.00 32.68 ? 82   ILE D O     1 
ATOM   2311  C CB    . ILE B 1 30  ? 156.282 -11.587 10.644 1.00 36.07 ? 82   ILE D CB    1 
ATOM   2312  C CG1   . ILE B 1 30  ? 157.294 -11.086 11.676 1.00 34.79 ? 82   ILE D CG1   1 
ATOM   2313  C CG2   . ILE B 1 30  ? 156.160 -13.110 10.740 1.00 34.68 ? 82   ILE D CG2   1 
ATOM   2314  C CD1   . ILE B 1 30  ? 158.543 -11.880 11.725 1.00 39.66 ? 82   ILE D CD1   1 
ATOM   2315  N N     . GLU B 1 31  ? 154.511 -10.527 8.530  1.00 31.86 ? 83   GLU D N     1 
ATOM   2316  C CA    . GLU B 1 31  ? 153.273 -10.526 7.767  1.00 31.83 ? 83   GLU D CA    1 
ATOM   2317  C C     . GLU B 1 31  ? 153.422 -10.284 6.257  1.00 31.74 ? 83   GLU D C     1 
ATOM   2318  O O     . GLU B 1 31  ? 152.684 -10.875 5.451  1.00 32.05 ? 83   GLU D O     1 
ATOM   2319  C CB    . GLU B 1 31  ? 152.311 -9.494  8.368  1.00 32.95 ? 83   GLU D CB    1 
ATOM   2320  C CG    . GLU B 1 31  ? 151.533 -9.964  9.597  1.00 38.56 ? 83   GLU D CG    1 
ATOM   2321  C CD    . GLU B 1 31  ? 150.363 -10.885 9.233  1.00 43.89 ? 83   GLU D CD    1 
ATOM   2322  O OE1   . GLU B 1 31  ? 149.572 -11.256 10.133 1.00 47.13 ? 83   GLU D OE1   1 
ATOM   2323  O OE2   . GLU B 1 31  ? 150.226 -11.241 8.041  1.00 46.34 ? 83   GLU D OE2   1 
ATOM   2324  N N     . ASP B 1 32  ? 154.360 -9.424  5.863  1.00 30.78 ? 84   ASP D N     1 
ATOM   2325  C CA    . ASP B 1 32  ? 154.550 -9.139  4.441  1.00 29.77 ? 84   ASP D CA    1 
ATOM   2326  C C     . ASP B 1 32  ? 155.120 -10.291 3.654  1.00 29.88 ? 84   ASP D C     1 
ATOM   2327  O O     . ASP B 1 32  ? 154.580 -10.645 2.606  1.00 30.64 ? 84   ASP D O     1 
ATOM   2328  C CB    . ASP B 1 32  ? 155.429 -7.920  4.237  1.00 29.39 ? 84   ASP D CB    1 
ATOM   2329  C CG    . ASP B 1 32  ? 154.654 -6.632  4.340  1.00 29.49 ? 84   ASP D CG    1 
ATOM   2330  O OD1   . ASP B 1 32  ? 153.404 -6.690  4.494  1.00 28.01 ? 84   ASP D OD1   1 
ATOM   2331  O OD2   . ASP B 1 32  ? 155.304 -5.565  4.262  1.00 28.54 ? 84   ASP D OD2   1 
ATOM   2332  N N     . ILE B 1 33  ? 156.223 -10.860 4.119  1.00 28.92 ? 85   ILE D N     1 
ATOM   2333  C CA    . ILE B 1 33  ? 156.764 -12.005 3.423  1.00 31.08 ? 85   ILE D CA    1 
ATOM   2334  C C     . ILE B 1 33  ? 155.650 -13.047 3.468  1.00 32.99 ? 85   ILE D C     1 
ATOM   2335  O O     . ILE B 1 33  ? 155.482 -13.833 2.539  1.00 33.26 ? 85   ILE D O     1 
ATOM   2336  C CB    . ILE B 1 33  ? 158.019 -12.557 4.122  1.00 32.73 ? 85   ILE D CB    1 
ATOM   2337  C CG1   . ILE B 1 33  ? 159.259 -11.842 3.591  1.00 31.61 ? 85   ILE D CG1   1 
ATOM   2338  C CG2   . ILE B 1 33  ? 158.134 -14.071 3.892  1.00 30.26 ? 85   ILE D CG2   1 
ATOM   2339  C CD1   . ILE B 1 33  ? 159.194 -10.373 3.714  1.00 39.18 ? 85   ILE D CD1   1 
ATOM   2340  N N     . ALA B 1 34  ? 154.882 -13.030 4.554  1.00 34.60 ? 86   ALA D N     1 
ATOM   2341  C CA    . ALA B 1 34  ? 153.777 -13.960 4.725  1.00 36.75 ? 86   ALA D CA    1 
ATOM   2342  C C     . ALA B 1 34  ? 152.785 -13.866 3.584  1.00 38.22 ? 86   ALA D C     1 
ATOM   2343  O O     . ALA B 1 34  ? 152.426 -14.884 3.002  1.00 40.30 ? 86   ALA D O     1 
ATOM   2344  C CB    . ALA B 1 34  ? 153.069 -13.707 6.032  1.00 37.84 ? 86   ALA D CB    1 
ATOM   2345  N N     . THR B 1 35  ? 152.326 -12.667 3.250  1.00 38.32 ? 87   THR D N     1 
ATOM   2346  C CA    . THR B 1 35  ? 151.377 -12.575 2.151  1.00 39.93 ? 87   THR D CA    1 
ATOM   2347  C C     . THR B 1 35  ? 152.049 -12.831 0.800  1.00 41.43 ? 87   THR D C     1 
ATOM   2348  O O     . THR B 1 35  ? 151.433 -13.403 -0.108 1.00 41.76 ? 87   THR D O     1 
ATOM   2349  C CB    . THR B 1 35  ? 150.693 -11.225 2.093  1.00 38.45 ? 87   THR D CB    1 
ATOM   2350  O OG1   . THR B 1 35  ? 151.436 -10.365 1.233  1.00 39.21 ? 87   THR D OG1   1 
ATOM   2351  C CG2   . THR B 1 35  ? 150.600 -10.627 3.481  1.00 39.49 ? 87   THR D CG2   1 
ATOM   2352  N N     . MET B 1 36  ? 153.307 -12.418 0.658  1.00 42.19 ? 88   MET D N     1 
ATOM   2353  C CA    . MET B 1 36  ? 154.018 -12.653 -0.597 1.00 43.72 ? 88   MET D CA    1 
ATOM   2354  C C     . MET B 1 36  ? 153.971 -14.149 -0.933 1.00 45.65 ? 88   MET D C     1 
ATOM   2355  O O     . MET B 1 36  ? 153.565 -14.542 -2.034 1.00 46.23 ? 88   MET D O     1 
ATOM   2356  C CB    . MET B 1 36  ? 155.479 -12.205 -0.499 1.00 43.05 ? 88   MET D CB    1 
ATOM   2357  C CG    . MET B 1 36  ? 156.265 -12.402 -1.794 1.00 45.30 ? 88   MET D CG    1 
ATOM   2358  S SD    . MET B 1 36  ? 158.025 -11.926 -1.714 1.00 47.79 ? 88   MET D SD    1 
ATOM   2359  C CE    . MET B 1 36  ? 157.844 -10.162 -1.500 1.00 48.17 ? 88   MET D CE    1 
ATOM   2360  N N     . TYR B 1 37  ? 154.382 -14.975 0.027  1.00 45.96 ? 89   TYR D N     1 
ATOM   2361  C CA    . TYR B 1 37  ? 154.395 -16.420 -0.149 1.00 45.45 ? 89   TYR D CA    1 
ATOM   2362  C C     . TYR B 1 37  ? 152.995 -17.002 0.052  1.00 45.26 ? 89   TYR D C     1 
ATOM   2363  O O     . TYR B 1 37  ? 152.826 -18.221 0.095  1.00 44.83 ? 89   TYR D O     1 
ATOM   2364  C CB    . TYR B 1 37  ? 155.363 -17.065 0.853  1.00 45.70 ? 89   TYR D CB    1 
ATOM   2365  C CG    . TYR B 1 37  ? 156.821 -16.695 0.680  1.00 46.85 ? 89   TYR D CG    1 
ATOM   2366  C CD1   . TYR B 1 37  ? 157.760 -17.032 1.653  1.00 46.92 ? 89   TYR D CD1   1 
ATOM   2367  C CD2   . TYR B 1 37  ? 157.268 -16.032 -0.466 1.00 48.65 ? 89   TYR D CD2   1 
ATOM   2368  C CE1   . TYR B 1 37  ? 159.116 -16.716 1.494  1.00 49.29 ? 89   TYR D CE1   1 
ATOM   2369  C CE2   . TYR B 1 37  ? 158.618 -15.715 -0.641 1.00 50.12 ? 89   TYR D CE2   1 
ATOM   2370  C CZ    . TYR B 1 37  ? 159.543 -16.058 0.344  1.00 50.34 ? 89   TYR D CZ    1 
ATOM   2371  O OH    . TYR B 1 37  ? 160.883 -15.744 0.171  1.00 50.04 ? 89   TYR D OH    1 
ATOM   2372  N N     . LYS B 1 38  ? 151.988 -16.145 0.173  1.00 43.59 ? 90   LYS D N     1 
ATOM   2373  C CA    . LYS B 1 38  ? 150.651 -16.663 0.381  1.00 43.91 ? 90   LYS D CA    1 
ATOM   2374  C C     . LYS B 1 38  ? 150.657 -17.549 1.639  1.00 43.02 ? 90   LYS D C     1 
ATOM   2375  O O     . LYS B 1 38  ? 150.308 -18.721 1.567  1.00 43.71 ? 90   LYS D O     1 
ATOM   2376  C CB    . LYS B 1 38  ? 150.227 -17.517 -0.824 1.00 45.81 ? 90   LYS D CB    1 
ATOM   2377  C CG    . LYS B 1 38  ? 149.787 -16.765 -2.081 1.00 47.53 ? 90   LYS D CG    1 
ATOM   2378  C CD    . LYS B 1 38  ? 150.935 -16.069 -2.805 1.00 49.28 ? 90   LYS D CD    1 
ATOM   2379  C CE    . LYS B 1 38  ? 150.405 -15.173 -3.930 1.00 49.01 ? 90   LYS D CE    1 
ATOM   2380  N NZ    . LYS B 1 38  ? 151.456 -14.261 -4.465 1.00 49.49 ? 90   LYS D NZ    1 
ATOM   2381  N N     . TYR B 1 39  ? 151.049 -17.001 2.786  1.00 41.47 ? 91   TYR D N     1 
ATOM   2382  C CA    . TYR B 1 39  ? 151.110 -17.782 4.024  1.00 40.06 ? 91   TYR D CA    1 
ATOM   2383  C C     . TYR B 1 39  ? 150.248 -17.252 5.166  1.00 38.99 ? 91   TYR D C     1 
ATOM   2384  O O     . TYR B 1 39  ? 150.030 -16.056 5.292  1.00 39.36 ? 91   TYR D O     1 
ATOM   2385  C CB    . TYR B 1 39  ? 152.563 -17.870 4.533  1.00 40.47 ? 91   TYR D CB    1 
ATOM   2386  C CG    . TYR B 1 39  ? 153.459 -18.866 3.820  1.00 38.77 ? 91   TYR D CG    1 
ATOM   2387  C CD1   . TYR B 1 39  ? 152.952 -19.715 2.844  1.00 39.01 ? 91   TYR D CD1   1 
ATOM   2388  C CD2   . TYR B 1 39  ? 154.814 -18.960 4.135  1.00 37.28 ? 91   TYR D CD2   1 
ATOM   2389  C CE1   . TYR B 1 39  ? 153.765 -20.632 2.201  1.00 39.78 ? 91   TYR D CE1   1 
ATOM   2390  C CE2   . TYR B 1 39  ? 155.638 -19.872 3.498  1.00 37.49 ? 91   TYR D CE2   1 
ATOM   2391  C CZ    . TYR B 1 39  ? 155.106 -20.709 2.530  1.00 38.85 ? 91   TYR D CZ    1 
ATOM   2392  O OH    . TYR B 1 39  ? 155.893 -21.641 1.890  1.00 39.35 ? 91   TYR D OH    1 
ATOM   2393  N N     . ASN B 1 40  ? 149.766 -18.147 6.015  1.00 38.10 ? 92   ASN D N     1 
ATOM   2394  C CA    . ASN B 1 40  ? 148.982 -17.719 7.155  1.00 38.45 ? 92   ASN D CA    1 
ATOM   2395  C C     . ASN B 1 40  ? 149.905 -17.462 8.337  1.00 38.48 ? 92   ASN D C     1 
ATOM   2396  O O     . ASN B 1 40  ? 150.959 -18.104 8.482  1.00 38.09 ? 92   ASN D O     1 
ATOM   2397  C CB    . ASN B 1 40  ? 147.961 -18.777 7.531  1.00 40.79 ? 92   ASN D CB    1 
ATOM   2398  C CG    . ASN B 1 40  ? 146.896 -18.936 6.483  1.00 44.81 ? 92   ASN D CG    1 
ATOM   2399  O OD1   . ASN B 1 40  ? 146.799 -19.977 5.829  1.00 47.01 ? 92   ASN D OD1   1 
ATOM   2400  N ND2   . ASN B 1 40  ? 146.085 -17.895 6.303  1.00 45.25 ? 92   ASN D ND2   1 
ATOM   2401  N N     . ILE B 1 41  ? 149.513 -16.518 9.183  1.00 35.97 ? 93   ILE D N     1 
ATOM   2402  C CA    . ILE B 1 41  ? 150.307 -16.193 10.349 1.00 33.22 ? 93   ILE D CA    1 
ATOM   2403  C C     . ILE B 1 41  ? 149.419 -16.239 11.569 1.00 32.90 ? 93   ILE D C     1 
ATOM   2404  O O     . ILE B 1 41  ? 148.255 -15.876 11.494 1.00 33.09 ? 93   ILE D O     1 
ATOM   2405  C CB    . ILE B 1 41  ? 150.904 -14.784 10.216 1.00 32.58 ? 93   ILE D CB    1 
ATOM   2406  C CG1   . ILE B 1 41  ? 151.965 -14.776 9.109  1.00 31.75 ? 93   ILE D CG1   1 
ATOM   2407  C CG2   . ILE B 1 41  ? 151.453 -14.313 11.549 1.00 31.00 ? 93   ILE D CG2   1 
ATOM   2408  C CD1   . ILE B 1 41  ? 153.197 -15.590 9.405  1.00 37.08 ? 93   ILE D CD1   1 
ATOM   2409  N N     . ILE B 1 42  ? 149.963 -16.704 12.685 1.00 32.93 ? 94   ILE D N     1 
ATOM   2410  C CA    . ILE B 1 42  ? 149.219 -16.745 13.947 1.00 34.00 ? 94   ILE D CA    1 
ATOM   2411  C C     . ILE B 1 42  ? 150.115 -16.119 15.022 1.00 33.06 ? 94   ILE D C     1 
ATOM   2412  O O     . ILE B 1 42  ? 151.244 -16.553 15.202 1.00 33.94 ? 94   ILE D O     1 
ATOM   2413  C CB    . ILE B 1 42  ? 148.875 -18.201 14.380 1.00 35.93 ? 94   ILE D CB    1 
ATOM   2414  C CG1   . ILE B 1 42  ? 147.585 -18.684 13.713 1.00 37.94 ? 94   ILE D CG1   1 
ATOM   2415  C CG2   . ILE B 1 42  ? 148.682 -18.264 15.870 1.00 37.21 ? 94   ILE D CG2   1 
ATOM   2416  C CD1   . ILE B 1 42  ? 147.698 -18.961 12.228 1.00 42.75 ? 94   ILE D CD1   1 
ATOM   2417  N N     . LEU B 1 43  ? 149.641 -15.099 15.732 1.00 31.85 ? 95   LEU D N     1 
ATOM   2418  C CA    . LEU B 1 43  ? 150.486 -14.507 16.768 1.00 31.47 ? 95   LEU D CA    1 
ATOM   2419  C C     . LEU B 1 43  ? 150.121 -14.993 18.143 1.00 30.26 ? 95   LEU D C     1 
ATOM   2420  O O     . LEU B 1 43  ? 148.970 -15.318 18.409 1.00 27.59 ? 95   LEU D O     1 
ATOM   2421  C CB    . LEU B 1 43  ? 150.405 -12.979 16.790 1.00 31.27 ? 95   LEU D CB    1 
ATOM   2422  C CG    . LEU B 1 43  ? 150.754 -12.225 15.520 1.00 32.44 ? 95   LEU D CG    1 
ATOM   2423  C CD1   . LEU B 1 43  ? 151.740 -13.056 14.709 1.00 31.24 ? 95   LEU D CD1   1 
ATOM   2424  C CD2   . LEU B 1 43  ? 149.470 -11.950 14.730 1.00 31.04 ? 95   LEU D CD2   1 
ATOM   2425  N N     . SER B 1 44  ? 151.128 -15.027 19.008 1.00 31.22 ? 96   SER D N     1 
ATOM   2426  C CA    . SER B 1 44  ? 150.975 -15.433 20.401 1.00 32.25 ? 96   SER D CA    1 
ATOM   2427  C C     . SER B 1 44  ? 151.709 -14.405 21.249 1.00 31.67 ? 96   SER D C     1 
ATOM   2428  O O     . SER B 1 44  ? 152.840 -14.045 20.958 1.00 29.04 ? 96   SER D O     1 
ATOM   2429  C CB    . SER B 1 44  ? 151.573 -16.826 20.645 1.00 32.08 ? 96   SER D CB    1 
ATOM   2430  O OG    . SER B 1 44  ? 150.560 -17.814 20.709 1.00 33.69 ? 96   SER D OG    1 
ATOM   2431  N N     . ASN B 1 45  ? 151.058 -13.924 22.296 1.00 33.69 ? 97   ASN D N     1 
ATOM   2432  C CA    . ASN B 1 45  ? 151.678 -12.933 23.150 1.00 35.87 ? 97   ASN D CA    1 
ATOM   2433  C C     . ASN B 1 45  ? 152.260 -13.595 24.366 1.00 38.16 ? 97   ASN D C     1 
ATOM   2434  O O     . ASN B 1 45  ? 151.577 -14.356 25.049 1.00 39.40 ? 97   ASN D O     1 
ATOM   2435  C CB    . ASN B 1 45  ? 150.649 -11.888 23.535 1.00 34.26 ? 97   ASN D CB    1 
ATOM   2436  C CG    . ASN B 1 45  ? 150.282 -11.011 22.370 1.00 33.58 ? 97   ASN D CG    1 
ATOM   2437  O OD1   . ASN B 1 45  ? 151.091 -10.219 21.915 1.00 33.92 ? 97   ASN D OD1   1 
ATOM   2438  N ND2   . ASN B 1 45  ? 149.070 -11.163 21.864 1.00 34.25 ? 97   ASN D ND2   1 
ATOM   2439  N N     . SER B 1 46  ? 153.523 -13.296 24.641 1.00 40.07 ? 98   SER D N     1 
ATOM   2440  C CA    . SER B 1 46  ? 154.213 -13.907 25.767 1.00 42.76 ? 98   SER D CA    1 
ATOM   2441  C C     . SER B 1 46  ? 154.367 -13.092 27.049 1.00 42.85 ? 98   SER D C     1 
ATOM   2442  O O     . SER B 1 46  ? 154.315 -13.642 28.148 1.00 41.67 ? 98   SER D O     1 
ATOM   2443  C CB    . SER B 1 46  ? 155.597 -14.347 25.316 1.00 44.20 ? 98   SER D CB    1 
ATOM   2444  O OG    . SER B 1 46  ? 156.302 -14.892 26.409 1.00 47.25 ? 98   SER D OG    1 
ATOM   2445  N N     . ASP B 1 47  ? 154.562 -11.786 26.897 1.00 44.42 ? 99   ASP D N     1 
ATOM   2446  C CA    . ASP B 1 47  ? 154.786 -10.880 28.023 1.00 43.66 ? 99   ASP D CA    1 
ATOM   2447  C C     . ASP B 1 47  ? 156.114 -11.251 28.641 1.00 43.51 ? 99   ASP D C     1 
ATOM   2448  O O     . ASP B 1 47  ? 156.391 -10.946 29.799 1.00 43.43 ? 99   ASP D O     1 
ATOM   2449  C CB    . ASP B 1 47  ? 153.672 -10.988 29.050 1.00 43.40 ? 99   ASP D CB    1 
ATOM   2450  C CG    . ASP B 1 47  ? 152.376 -10.437 28.533 1.00 44.13 ? 99   ASP D CG    1 
ATOM   2451  O OD1   . ASP B 1 47  ? 152.385 -9.269  28.074 1.00 42.59 ? 99   ASP D OD1   1 
ATOM   2452  O OD2   . ASP B 1 47  ? 151.364 -11.171 28.581 1.00 43.68 ? 99   ASP D OD2   1 
ATOM   2453  N N     . GLN B 1 48  ? 156.927 -11.914 27.824 1.00 43.56 ? 100  GLN D N     1 
ATOM   2454  C CA    . GLN B 1 48  ? 158.250 -12.366 28.201 1.00 43.21 ? 100  GLN D CA    1 
ATOM   2455  C C     . GLN B 1 48  ? 158.265 -13.232 29.443 1.00 40.42 ? 100  GLN D C     1 
ATOM   2456  O O     . GLN B 1 48  ? 159.274 -13.345 30.120 1.00 39.86 ? 100  GLN D O     1 
ATOM   2457  C CB    . GLN B 1 48  ? 159.183 -11.165 28.340 1.00 45.57 ? 100  GLN D CB    1 
ATOM   2458  C CG    . GLN B 1 48  ? 159.890 -10.821 27.012 1.00 51.33 ? 100  GLN D CG    1 
ATOM   2459  C CD    . GLN B 1 48  ? 160.581 -9.466  27.051 1.00 55.34 ? 100  GLN D CD    1 
ATOM   2460  O OE1   . GLN B 1 48  ? 161.579 -9.235  26.352 1.00 56.81 ? 100  GLN D OE1   1 
ATOM   2461  N NE2   . GLN B 1 48  ? 160.046 -8.553  27.868 1.00 56.40 ? 100  GLN D NE2   1 
ATOM   2462  N N     . ASN B 1 49  ? 157.125 -13.852 29.719 1.00 38.77 ? 101  ASN D N     1 
ATOM   2463  C CA    . ASN B 1 49  ? 156.987 -14.742 30.849 1.00 37.65 ? 101  ASN D CA    1 
ATOM   2464  C C     . ASN B 1 49  ? 157.340 -16.144 30.390 1.00 37.42 ? 101  ASN D C     1 
ATOM   2465  O O     . ASN B 1 49  ? 156.613 -16.755 29.608 1.00 37.73 ? 101  ASN D O     1 
ATOM   2466  C CB    . ASN B 1 49  ? 155.563 -14.727 31.360 1.00 39.36 ? 101  ASN D CB    1 
ATOM   2467  C CG    . ASN B 1 49  ? 155.299 -15.834 32.344 1.00 41.49 ? 101  ASN D CG    1 
ATOM   2468  O OD1   . ASN B 1 49  ? 155.278 -17.011 31.985 1.00 42.79 ? 101  ASN D OD1   1 
ATOM   2469  N ND2   . ASN B 1 49  ? 155.104 -15.467 33.601 1.00 43.15 ? 101  ASN D ND2   1 
ATOM   2470  N N     . GLN B 1 50  ? 158.461 -16.641 30.892 1.00 36.55 ? 102  GLN D N     1 
ATOM   2471  C CA    . GLN B 1 50  ? 158.986 -17.954 30.561 1.00 36.08 ? 102  GLN D CA    1 
ATOM   2472  C C     . GLN B 1 50  ? 157.944 -19.067 30.495 1.00 34.81 ? 102  GLN D C     1 
ATOM   2473  O O     . GLN B 1 50  ? 157.832 -19.786 29.501 1.00 32.12 ? 102  GLN D O     1 
ATOM   2474  C CB    . GLN B 1 50  ? 160.057 -18.307 31.581 1.00 38.45 ? 102  GLN D CB    1 
ATOM   2475  C CG    . GLN B 1 50  ? 160.999 -19.374 31.124 1.00 43.84 ? 102  GLN D CG    1 
ATOM   2476  C CD    . GLN B 1 50  ? 162.276 -19.367 31.917 1.00 46.85 ? 102  GLN D CD    1 
ATOM   2477  O OE1   . GLN B 1 50  ? 162.949 -18.334 32.030 1.00 47.57 ? 102  GLN D OE1   1 
ATOM   2478  N NE2   . GLN B 1 50  ? 162.631 -20.523 32.473 1.00 50.98 ? 102  GLN D NE2   1 
ATOM   2479  N N     . ASP B 1 51  ? 157.186 -19.213 31.569 1.00 35.23 ? 103  ASP D N     1 
ATOM   2480  C CA    . ASP B 1 51  ? 156.157 -20.232 31.636 1.00 35.25 ? 103  ASP D CA    1 
ATOM   2481  C C     . ASP B 1 51  ? 155.179 -20.131 30.485 1.00 34.42 ? 103  ASP D C     1 
ATOM   2482  O O     . ASP B 1 51  ? 154.689 -21.142 29.996 1.00 34.28 ? 103  ASP D O     1 
ATOM   2483  C CB    . ASP B 1 51  ? 155.402 -20.114 32.954 1.00 38.07 ? 103  ASP D CB    1 
ATOM   2484  C CG    . ASP B 1 51  ? 156.172 -20.697 34.116 1.00 40.33 ? 103  ASP D CG    1 
ATOM   2485  O OD1   . ASP B 1 51  ? 156.302 -21.942 34.168 1.00 40.28 ? 103  ASP D OD1   1 
ATOM   2486  O OD2   . ASP B 1 51  ? 156.649 -19.914 34.969 1.00 42.46 ? 103  ASP D OD2   1 
ATOM   2487  N N     . LYS B 1 52  ? 154.892 -18.904 30.062 1.00 34.65 ? 104  LYS D N     1 
ATOM   2488  C CA    . LYS B 1 52  ? 153.963 -18.673 28.968 1.00 35.18 ? 104  LYS D CA    1 
ATOM   2489  C C     . LYS B 1 52  ? 154.623 -18.977 27.637 1.00 35.59 ? 104  LYS D C     1 
ATOM   2490  O O     . LYS B 1 52  ? 153.958 -19.360 26.682 1.00 35.25 ? 104  LYS D O     1 
ATOM   2491  C CB    . LYS B 1 52  ? 153.466 -17.229 28.977 1.00 36.44 ? 104  LYS D CB    1 
ATOM   2492  C CG    . LYS B 1 52  ? 152.286 -17.021 28.055 1.00 39.06 ? 104  LYS D CG    1 
ATOM   2493  C CD    . LYS B 1 52  ? 151.594 -15.689 28.288 1.00 42.86 ? 104  LYS D CD    1 
ATOM   2494  C CE    . LYS B 1 52  ? 150.371 -15.568 27.369 1.00 45.07 ? 104  LYS D CE    1 
ATOM   2495  N NZ    . LYS B 1 52  ? 149.550 -14.333 27.574 1.00 46.47 ? 104  LYS D NZ    1 
ATOM   2496  N N     . GLU B 1 53  ? 155.936 -18.799 27.574 1.00 35.81 ? 105  GLU D N     1 
ATOM   2497  C CA    . GLU B 1 53  ? 156.666 -19.087 26.356 1.00 35.72 ? 105  GLU D CA    1 
ATOM   2498  C C     . GLU B 1 53  ? 156.564 -20.571 26.061 1.00 36.97 ? 105  GLU D C     1 
ATOM   2499  O O     . GLU B 1 53  ? 156.191 -20.955 24.951 1.00 37.67 ? 105  GLU D O     1 
ATOM   2500  C CB    . GLU B 1 53  ? 158.129 -18.676 26.499 1.00 34.98 ? 105  GLU D CB    1 
ATOM   2501  C CG    . GLU B 1 53  ? 158.275 -17.208 26.807 1.00 36.89 ? 105  GLU D CG    1 
ATOM   2502  C CD    . GLU B 1 53  ? 159.679 -16.680 26.589 1.00 39.13 ? 105  GLU D CD    1 
ATOM   2503  O OE1   . GLU B 1 53  ? 160.624 -17.189 27.235 1.00 41.05 ? 105  GLU D OE1   1 
ATOM   2504  O OE2   . GLU B 1 53  ? 159.833 -15.740 25.775 1.00 40.04 ? 105  GLU D OE2   1 
ATOM   2505  N N     . LEU B 1 54  ? 156.878 -21.401 27.058 1.00 37.68 ? 106  LEU D N     1 
ATOM   2506  C CA    . LEU B 1 54  ? 156.819 -22.856 26.903 1.00 38.44 ? 106  LEU D CA    1 
ATOM   2507  C C     . LEU B 1 54  ? 155.423 -23.237 26.421 1.00 38.08 ? 106  LEU D C     1 
ATOM   2508  O O     . LEU B 1 54  ? 155.242 -24.010 25.473 1.00 37.61 ? 106  LEU D O     1 
ATOM   2509  C CB    . LEU B 1 54  ? 157.091 -23.539 28.242 1.00 40.60 ? 106  LEU D CB    1 
ATOM   2510  C CG    . LEU B 1 54  ? 157.662 -24.967 28.205 1.00 44.79 ? 106  LEU D CG    1 
ATOM   2511  C CD1   . LEU B 1 54  ? 157.609 -25.575 29.611 1.00 45.14 ? 106  LEU D CD1   1 
ATOM   2512  C CD2   . LEU B 1 54  ? 156.878 -25.841 27.238 1.00 44.75 ? 106  LEU D CD2   1 
ATOM   2513  N N     . HIS B 1 55  ? 154.439 -22.677 27.103 1.00 36.97 ? 107  HIS D N     1 
ATOM   2514  C CA    . HIS B 1 55  ? 153.042 -22.906 26.803 1.00 36.86 ? 107  HIS D CA    1 
ATOM   2515  C C     . HIS B 1 55  ? 152.690 -22.540 25.349 1.00 37.12 ? 107  HIS D C     1 
ATOM   2516  O O     . HIS B 1 55  ? 152.114 -23.348 24.594 1.00 35.84 ? 107  HIS D O     1 
ATOM   2517  C CB    . HIS B 1 55  ? 152.225 -22.073 27.774 1.00 36.65 ? 107  HIS D CB    1 
ATOM   2518  C CG    . HIS B 1 55  ? 150.751 -22.212 27.602 1.00 39.10 ? 107  HIS D CG    1 
ATOM   2519  N ND1   . HIS B 1 55  ? 150.116 -23.434 27.599 1.00 40.85 ? 107  HIS D ND1   1 
ATOM   2520  C CD2   . HIS B 1 55  ? 149.779 -21.279 27.471 1.00 40.17 ? 107  HIS D CD2   1 
ATOM   2521  C CE1   . HIS B 1 55  ? 148.813 -23.248 27.476 1.00 42.58 ? 107  HIS D CE1   1 
ATOM   2522  N NE2   . HIS B 1 55  ? 148.583 -21.949 27.397 1.00 41.81 ? 107  HIS D NE2   1 
ATOM   2523  N N     . LEU B 1 56  ? 153.037 -21.313 24.967 1.00 35.32 ? 108  LEU D N     1 
ATOM   2524  C CA    . LEU B 1 56  ? 152.754 -20.829 23.634 1.00 32.52 ? 108  LEU D CA    1 
ATOM   2525  C C     . LEU B 1 56  ? 153.430 -21.743 22.630 1.00 32.46 ? 108  LEU D C     1 
ATOM   2526  O O     . LEU B 1 56  ? 152.902 -21.988 21.547 1.00 33.65 ? 108  LEU D O     1 
ATOM   2527  C CB    . LEU B 1 56  ? 153.232 -19.380 23.490 1.00 30.94 ? 108  LEU D CB    1 
ATOM   2528  C CG    . LEU B 1 56  ? 152.519 -18.408 24.439 1.00 30.65 ? 108  LEU D CG    1 
ATOM   2529  C CD1   . LEU B 1 56  ? 153.051 -17.007 24.295 1.00 29.20 ? 108  LEU D CD1   1 
ATOM   2530  C CD2   . LEU B 1 56  ? 151.044 -18.433 24.159 1.00 29.57 ? 108  LEU D CD2   1 
ATOM   2531  N N     . LEU B 1 57  ? 154.587 -22.274 22.997 1.00 31.25 ? 109  LEU D N     1 
ATOM   2532  C CA    . LEU B 1 57  ? 155.306 -23.178 22.114 1.00 30.57 ? 109  LEU D CA    1 
ATOM   2533  C C     . LEU B 1 57  ? 154.535 -24.475 21.915 1.00 30.96 ? 109  LEU D C     1 
ATOM   2534  O O     . LEU B 1 57  ? 154.430 -24.988 20.799 1.00 30.52 ? 109  LEU D O     1 
ATOM   2535  C CB    . LEU B 1 57  ? 156.667 -23.493 22.698 1.00 32.21 ? 109  LEU D CB    1 
ATOM   2536  C CG    . LEU B 1 57  ? 157.883 -23.150 21.846 1.00 34.60 ? 109  LEU D CG    1 
ATOM   2537  C CD1   . LEU B 1 57  ? 157.787 -21.714 21.346 1.00 33.51 ? 109  LEU D CD1   1 
ATOM   2538  C CD2   . LEU B 1 57  ? 159.138 -23.366 22.702 1.00 34.61 ? 109  LEU D CD2   1 
ATOM   2539  N N     . ASN B 1 58  ? 153.991 -25.012 22.998 1.00 31.87 ? 110  ASN D N     1 
ATOM   2540  C CA    . ASN B 1 58  ? 153.237 -26.252 22.899 1.00 33.01 ? 110  ASN D CA    1 
ATOM   2541  C C     . ASN B 1 58  ? 151.950 -26.060 22.133 1.00 33.86 ? 110  ASN D C     1 
ATOM   2542  O O     . ASN B 1 58  ? 151.583 -26.889 21.290 1.00 33.08 ? 110  ASN D O     1 
ATOM   2543  C CB    . ASN B 1 58  ? 152.927 -26.798 24.284 1.00 33.02 ? 110  ASN D CB    1 
ATOM   2544  C CG    . ASN B 1 58  ? 154.166 -27.236 25.013 1.00 32.63 ? 110  ASN D CG    1 
ATOM   2545  O OD1   . ASN B 1 58  ? 155.053 -27.874 24.432 1.00 28.61 ? 110  ASN D OD1   1 
ATOM   2546  N ND2   . ASN B 1 58  ? 154.238 -26.908 26.299 1.00 35.05 ? 110  ASN D ND2   1 
ATOM   2547  N N     . ASN B 1 59  ? 151.259 -24.964 22.430 1.00 35.44 ? 111  ASN D N     1 
ATOM   2548  C CA    . ASN B 1 59  ? 150.010 -24.674 21.750 1.00 36.18 ? 111  ASN D CA    1 
ATOM   2549  C C     . ASN B 1 59  ? 150.265 -24.546 20.241 1.00 36.42 ? 111  ASN D C     1 
ATOM   2550  O O     . ASN B 1 59  ? 149.519 -25.109 19.445 1.00 35.56 ? 111  ASN D O     1 
ATOM   2551  C CB    . ASN B 1 59  ? 149.386 -23.409 22.346 1.00 38.34 ? 111  ASN D CB    1 
ATOM   2552  C CG    . ASN B 1 59  ? 148.930 -23.607 23.804 1.00 41.27 ? 111  ASN D CG    1 
ATOM   2553  O OD1   . ASN B 1 59  ? 148.453 -22.675 24.457 1.00 42.31 ? 111  ASN D OD1   1 
ATOM   2554  N ND2   . ASN B 1 59  ? 149.071 -24.826 24.308 1.00 41.13 ? 111  ASN D ND2   1 
ATOM   2555  N N     . MET B 1 60  ? 151.331 -23.842 19.851 1.00 36.65 ? 112  MET D N     1 
ATOM   2556  C CA    . MET B 1 60  ? 151.670 -23.685 18.436 1.00 38.44 ? 112  MET D CA    1 
ATOM   2557  C C     . MET B 1 60  ? 151.850 -25.056 17.766 1.00 39.42 ? 112  MET D C     1 
ATOM   2558  O O     . MET B 1 60  ? 151.332 -25.299 16.673 1.00 38.41 ? 112  MET D O     1 
ATOM   2559  C CB    . MET B 1 60  ? 152.970 -22.893 18.264 1.00 39.19 ? 112  MET D CB    1 
ATOM   2560  C CG    . MET B 1 60  ? 152.934 -21.441 18.698 1.00 42.13 ? 112  MET D CG    1 
ATOM   2561  S SD    . MET B 1 60  ? 152.224 -20.273 17.516 1.00 45.44 ? 112  MET D SD    1 
ATOM   2562  C CE    . MET B 1 60  ? 150.442 -20.560 17.807 1.00 43.68 ? 112  MET D CE    1 
ATOM   2563  N N     . LEU B 1 61  ? 152.591 -25.951 18.417 1.00 40.16 ? 113  LEU D N     1 
ATOM   2564  C CA    . LEU B 1 61  ? 152.823 -27.280 17.851 1.00 40.05 ? 113  LEU D CA    1 
ATOM   2565  C C     . LEU B 1 61  ? 151.511 -28.009 17.811 1.00 39.83 ? 113  LEU D C     1 
ATOM   2566  O O     . LEU B 1 61  ? 151.237 -28.770 16.888 1.00 40.19 ? 113  LEU D O     1 
ATOM   2567  C CB    . LEU B 1 61  ? 153.814 -28.084 18.696 1.00 40.49 ? 113  LEU D CB    1 
ATOM   2568  C CG    . LEU B 1 61  ? 155.207 -27.492 18.950 1.00 40.18 ? 113  LEU D CG    1 
ATOM   2569  C CD1   . LEU B 1 61  ? 156.062 -28.549 19.632 1.00 39.59 ? 113  LEU D CD1   1 
ATOM   2570  C CD2   . LEU B 1 61  ? 155.849 -27.041 17.636 1.00 38.35 ? 113  LEU D CD2   1 
ATOM   2571  N N     . GLY B 1 62  ? 150.696 -27.764 18.825 1.00 39.46 ? 114  GLY D N     1 
ATOM   2572  C CA    . GLY B 1 62  ? 149.404 -28.409 18.889 1.00 40.72 ? 114  GLY D CA    1 
ATOM   2573  C C     . GLY B 1 62  ? 148.483 -27.974 17.773 1.00 40.99 ? 114  GLY D C     1 
ATOM   2574  O O     . GLY B 1 62  ? 147.508 -28.648 17.482 1.00 41.63 ? 114  GLY D O     1 
ATOM   2575  N N     . LYS B 1 63  ? 148.786 -26.849 17.142 1.00 42.70 ? 115  LYS D N     1 
ATOM   2576  C CA    . LYS B 1 63  ? 147.946 -26.351 16.061 1.00 44.88 ? 115  LYS D CA    1 
ATOM   2577  C C     . LYS B 1 63  ? 148.511 -26.648 14.674 1.00 43.73 ? 115  LYS D C     1 
ATOM   2578  O O     . LYS B 1 63  ? 148.098 -26.065 13.676 1.00 44.52 ? 115  LYS D O     1 
ATOM   2579  C CB    . LYS B 1 63  ? 147.700 -24.847 16.245 1.00 47.51 ? 115  LYS D CB    1 
ATOM   2580  C CG    . LYS B 1 63  ? 146.757 -24.539 17.410 1.00 50.99 ? 115  LYS D CG    1 
ATOM   2581  C CD    . LYS B 1 63  ? 145.406 -25.228 17.193 1.00 55.14 ? 115  LYS D CD    1 
ATOM   2582  C CE    . LYS B 1 63  ? 144.547 -25.243 18.450 1.00 57.10 ? 115  LYS D CE    1 
ATOM   2583  N NZ    . LYS B 1 63  ? 144.277 -23.873 18.967 1.00 59.44 ? 115  LYS D NZ    1 
ATOM   2584  N N     . GLN B 1 64  ? 149.462 -27.566 14.631 1.00 42.56 ? 116  GLN D N     1 
ATOM   2585  C CA    . GLN B 1 64  ? 150.079 -27.984 13.389 1.00 41.37 ? 116  GLN D CA    1 
ATOM   2586  C C     . GLN B 1 64  ? 150.727 -26.912 12.529 1.00 39.60 ? 116  GLN D C     1 
ATOM   2587  O O     . GLN B 1 64  ? 150.750 -27.058 11.307 1.00 40.90 ? 116  GLN D O     1 
ATOM   2588  C CB    . GLN B 1 64  ? 149.065 -28.760 12.544 1.00 43.24 ? 116  GLN D CB    1 
ATOM   2589  C CG    . GLN B 1 64  ? 148.727 -30.140 13.103 1.00 47.97 ? 116  GLN D CG    1 
ATOM   2590  C CD    . GLN B 1 64  ? 149.920 -31.089 13.060 1.00 51.50 ? 116  GLN D CD    1 
ATOM   2591  O OE1   . GLN B 1 64  ? 150.145 -31.785 12.057 1.00 52.12 ? 116  GLN D OE1   1 
ATOM   2592  N NE2   . GLN B 1 64  ? 150.706 -31.108 14.144 1.00 52.30 ? 116  GLN D NE2   1 
ATOM   2593  N N     . VAL B 1 65  ? 151.255 -25.848 13.134 1.00 36.90 ? 117  VAL D N     1 
ATOM   2594  C CA    . VAL B 1 65  ? 151.929 -24.815 12.339 1.00 34.94 ? 117  VAL D CA    1 
ATOM   2595  C C     . VAL B 1 65  ? 153.128 -25.484 11.688 1.00 35.18 ? 117  VAL D C     1 
ATOM   2596  O O     . VAL B 1 65  ? 153.679 -26.446 12.236 1.00 34.97 ? 117  VAL D O     1 
ATOM   2597  C CB    . VAL B 1 65  ? 152.449 -23.630 13.183 1.00 32.96 ? 117  VAL D CB    1 
ATOM   2598  C CG1   . VAL B 1 65  ? 151.299 -22.926 13.859 1.00 33.73 ? 117  VAL D CG1   1 
ATOM   2599  C CG2   . VAL B 1 65  ? 153.454 -24.108 14.193 1.00 30.34 ? 117  VAL D CG2   1 
ATOM   2600  N N     . ASP B 1 66  ? 153.535 -24.979 10.528 1.00 34.60 ? 118  ASP D N     1 
ATOM   2601  C CA    . ASP B 1 66  ? 154.654 -25.567 9.794  1.00 34.90 ? 118  ASP D CA    1 
ATOM   2602  C C     . ASP B 1 66  ? 155.993 -24.923 10.107 1.00 33.19 ? 118  ASP D C     1 
ATOM   2603  O O     . ASP B 1 66  ? 157.045 -25.424 9.721  1.00 33.17 ? 118  ASP D O     1 
ATOM   2604  C CB    . ASP B 1 66  ? 154.385 -25.489 8.287  1.00 36.63 ? 118  ASP D CB    1 
ATOM   2605  C CG    . ASP B 1 66  ? 152.972 -25.919 7.925  1.00 37.25 ? 118  ASP D CG    1 
ATOM   2606  O OD1   . ASP B 1 66  ? 152.136 -25.034 7.661  1.00 37.38 ? 118  ASP D OD1   1 
ATOM   2607  O OD2   . ASP B 1 66  ? 152.691 -27.139 7.917  1.00 39.69 ? 118  ASP D OD2   1 
ATOM   2608  N N     . GLY B 1 67  ? 155.938 -23.808 10.812 1.00 32.38 ? 119  GLY D N     1 
ATOM   2609  C CA    . GLY B 1 67  ? 157.143 -23.101 11.175 1.00 31.88 ? 119  GLY D CA    1 
ATOM   2610  C C     . GLY B 1 67  ? 156.799 -22.155 12.297 1.00 30.94 ? 119  GLY D C     1 
ATOM   2611  O O     . GLY B 1 67  ? 155.636 -21.854 12.537 1.00 30.61 ? 119  GLY D O     1 
ATOM   2612  N N     . ILE B 1 68  ? 157.816 -21.675 12.985 1.00 30.26 ? 120  ILE D N     1 
ATOM   2613  C CA    . ILE B 1 68  ? 157.605 -20.785 14.098 1.00 28.32 ? 120  ILE D CA    1 
ATOM   2614  C C     . ILE B 1 68  ? 158.680 -19.721 14.127 1.00 29.55 ? 120  ILE D C     1 
ATOM   2615  O O     . ILE B 1 68  ? 159.871 -20.006 13.963 1.00 30.07 ? 120  ILE D O     1 
ATOM   2616  C CB    . ILE B 1 68  ? 157.686 -21.555 15.436 1.00 28.78 ? 120  ILE D CB    1 
ATOM   2617  C CG1   . ILE B 1 68  ? 156.618 -22.648 15.492 1.00 29.58 ? 120  ILE D CG1   1 
ATOM   2618  C CG2   . ILE B 1 68  ? 157.564 -20.593 16.595 1.00 25.65 ? 120  ILE D CG2   1 
ATOM   2619  C CD1   . ILE B 1 68  ? 156.843 -23.673 16.590 1.00 36.70 ? 120  ILE D CD1   1 
ATOM   2620  N N     . ILE B 1 69  ? 158.259 -18.482 14.307 1.00 30.21 ? 121  ILE D N     1 
ATOM   2621  C CA    . ILE B 1 69  ? 159.214 -17.408 14.453 1.00 30.94 ? 121  ILE D CA    1 
ATOM   2622  C C     . ILE B 1 69  ? 159.064 -17.093 15.944 1.00 31.60 ? 121  ILE D C     1 
ATOM   2623  O O     . ILE B 1 69  ? 157.947 -16.865 16.425 1.00 31.73 ? 121  ILE D O     1 
ATOM   2624  C CB    . ILE B 1 69  ? 158.854 -16.195 13.591 1.00 31.06 ? 121  ILE D CB    1 
ATOM   2625  C CG1   . ILE B 1 69  ? 159.047 -16.545 12.115 1.00 32.15 ? 121  ILE D CG1   1 
ATOM   2626  C CG2   . ILE B 1 69  ? 159.738 -15.022 13.966 1.00 29.99 ? 121  ILE D CG2   1 
ATOM   2627  C CD1   . ILE B 1 69  ? 158.657 -15.454 11.166 1.00 38.64 ? 121  ILE D CD1   1 
ATOM   2628  N N     . PHE B 1 70  ? 160.178 -17.135 16.672 1.00 30.25 ? 122  PHE D N     1 
ATOM   2629  C CA    . PHE B 1 70  ? 160.185 -16.881 18.107 1.00 30.04 ? 122  PHE D CA    1 
ATOM   2630  C C     . PHE B 1 70  ? 161.095 -15.690 18.435 1.00 30.49 ? 122  PHE D C     1 
ATOM   2631  O O     . PHE B 1 70  ? 162.169 -15.517 17.852 1.00 29.94 ? 122  PHE D O     1 
ATOM   2632  C CB    . PHE B 1 70  ? 160.673 -18.147 18.837 1.00 29.90 ? 122  PHE D CB    1 
ATOM   2633  C CG    . PHE B 1 70  ? 160.619 -18.073 20.342 1.00 29.84 ? 122  PHE D CG    1 
ATOM   2634  C CD1   . PHE B 1 70  ? 161.597 -18.705 21.108 1.00 31.95 ? 122  PHE D CD1   1 
ATOM   2635  C CD2   . PHE B 1 70  ? 159.596 -17.409 20.999 1.00 30.29 ? 122  PHE D CD2   1 
ATOM   2636  C CE1   . PHE B 1 70  ? 161.556 -18.672 22.513 1.00 32.71 ? 122  PHE D CE1   1 
ATOM   2637  C CE2   . PHE B 1 70  ? 159.549 -17.371 22.411 1.00 31.19 ? 122  PHE D CE2   1 
ATOM   2638  C CZ    . PHE B 1 70  ? 160.529 -18.002 23.161 1.00 30.07 ? 122  PHE D CZ    1 
ATOM   2639  N N     . MET B 1 71  ? 160.638 -14.860 19.359 1.00 30.82 ? 123  MET D N     1 
ATOM   2640  C CA    . MET B 1 71  ? 161.396 -13.714 19.813 1.00 31.76 ? 123  MET D CA    1 
ATOM   2641  C C     . MET B 1 71  ? 161.187 -13.675 21.336 1.00 32.04 ? 123  MET D C     1 
ATOM   2642  O O     . MET B 1 71  ? 160.056 -13.816 21.806 1.00 30.67 ? 123  MET D O     1 
ATOM   2643  C CB    . MET B 1 71  ? 160.880 -12.439 19.155 1.00 32.08 ? 123  MET D CB    1 
ATOM   2644  C CG    . MET B 1 71  ? 161.678 -11.236 19.580 1.00 37.13 ? 123  MET D CG    1 
ATOM   2645  S SD    . MET B 1 71  ? 160.995 -9.642  19.112 1.00 43.30 ? 123  MET D SD    1 
ATOM   2646  C CE    . MET B 1 71  ? 162.382 -8.545  19.643 1.00 40.18 ? 123  MET D CE    1 
ATOM   2647  N N     . SER B 1 72  ? 162.268 -13.501 22.101 1.00 32.64 ? 124  SER D N     1 
ATOM   2648  C CA    . SER B 1 72  ? 162.185 -13.496 23.565 1.00 33.82 ? 124  SER D CA    1 
ATOM   2649  C C     . SER B 1 72  ? 163.295 -12.705 24.242 1.00 34.78 ? 124  SER D C     1 
ATOM   2650  O O     . SER B 1 72  ? 164.429 -12.683 23.764 1.00 35.14 ? 124  SER D O     1 
ATOM   2651  C CB    . SER B 1 72  ? 162.217 -14.934 24.082 1.00 34.49 ? 124  SER D CB    1 
ATOM   2652  O OG    . SER B 1 72  ? 162.258 -14.970 25.493 1.00 36.07 ? 124  SER D OG    1 
ATOM   2653  N N     . GLY B 1 73  ? 162.966 -12.059 25.361 1.00 36.33 ? 125  GLY D N     1 
ATOM   2654  C CA    . GLY B 1 73  ? 163.961 -11.278 26.086 1.00 37.20 ? 125  GLY D CA    1 
ATOM   2655  C C     . GLY B 1 73  ? 165.086 -12.128 26.666 1.00 38.19 ? 125  GLY D C     1 
ATOM   2656  O O     . GLY B 1 73  ? 166.223 -11.670 26.816 1.00 39.56 ? 125  GLY D O     1 
ATOM   2657  N N     . ASN B 1 74  ? 164.778 -13.377 26.987 1.00 37.71 ? 126  ASN D N     1 
ATOM   2658  C CA    . ASN B 1 74  ? 165.770 -14.263 27.550 1.00 38.71 ? 126  ASN D CA    1 
ATOM   2659  C C     . ASN B 1 74  ? 165.600 -15.696 27.092 1.00 39.91 ? 126  ASN D C     1 
ATOM   2660  O O     . ASN B 1 74  ? 164.718 -16.405 27.566 1.00 40.57 ? 126  ASN D O     1 
ATOM   2661  C CB    . ASN B 1 74  ? 165.707 -14.191 29.073 1.00 40.86 ? 126  ASN D CB    1 
ATOM   2662  C CG    . ASN B 1 74  ? 166.560 -15.252 29.749 1.00 40.12 ? 126  ASN D CG    1 
ATOM   2663  O OD1   . ASN B 1 74  ? 166.067 -16.306 30.120 1.00 42.75 ? 126  ASN D OD1   1 
ATOM   2664  N ND2   . ASN B 1 74  ? 167.844 -14.978 29.899 1.00 41.29 ? 126  ASN D ND2   1 
ATOM   2665  N N     . VAL B 1 75  ? 166.446 -16.123 26.163 1.00 41.17 ? 127  VAL D N     1 
ATOM   2666  C CA    . VAL B 1 75  ? 166.383 -17.489 25.664 1.00 42.23 ? 127  VAL D CA    1 
ATOM   2667  C C     . VAL B 1 75  ? 167.260 -18.381 26.532 1.00 43.91 ? 127  VAL D C     1 
ATOM   2668  O O     . VAL B 1 75  ? 168.458 -18.525 26.284 1.00 43.67 ? 127  VAL D O     1 
ATOM   2669  C CB    . VAL B 1 75  ? 166.866 -17.582 24.200 1.00 41.13 ? 127  VAL D CB    1 
ATOM   2670  C CG1   . VAL B 1 75  ? 166.754 -19.016 23.697 1.00 40.39 ? 127  VAL D CG1   1 
ATOM   2671  C CG2   . VAL B 1 75  ? 166.047 -16.660 23.337 1.00 39.38 ? 127  VAL D CG2   1 
ATOM   2672  N N     . THR B 1 76  ? 166.662 -18.975 27.557 1.00 46.31 ? 128  THR D N     1 
ATOM   2673  C CA    . THR B 1 76  ? 167.414 -19.839 28.447 1.00 49.44 ? 128  THR D CA    1 
ATOM   2674  C C     . THR B 1 76  ? 167.904 -21.103 27.771 1.00 52.33 ? 128  THR D C     1 
ATOM   2675  O O     . THR B 1 76  ? 167.586 -21.397 26.615 1.00 53.01 ? 128  THR D O     1 
ATOM   2676  C CB    . THR B 1 76  ? 166.598 -20.279 29.660 1.00 49.03 ? 128  THR D CB    1 
ATOM   2677  O OG1   . THR B 1 76  ? 165.434 -20.996 29.221 1.00 49.05 ? 128  THR D OG1   1 
ATOM   2678  C CG2   . THR B 1 76  ? 166.202 -19.079 30.491 1.00 48.33 ? 128  THR D CG2   1 
ATOM   2679  N N     . GLU B 1 77  ? 168.671 -21.857 28.544 1.00 54.14 ? 129  GLU D N     1 
ATOM   2680  C CA    . GLU B 1 77  ? 169.272 -23.105 28.123 1.00 55.78 ? 129  GLU D CA    1 
ATOM   2681  C C     . GLU B 1 77  ? 168.208 -24.194 28.023 1.00 55.93 ? 129  GLU D C     1 
ATOM   2682  O O     . GLU B 1 77  ? 168.320 -25.112 27.206 1.00 54.63 ? 129  GLU D O     1 
ATOM   2683  C CB    . GLU B 1 77  ? 170.373 -23.468 29.130 1.00 57.43 ? 129  GLU D CB    1 
ATOM   2684  C CG    . GLU B 1 77  ? 170.290 -22.654 30.446 1.00 61.22 ? 129  GLU D CG    1 
ATOM   2685  C CD    . GLU B 1 77  ? 170.367 -21.121 30.247 1.00 62.94 ? 129  GLU D CD    1 
ATOM   2686  O OE1   . GLU B 1 77  ? 169.918 -20.362 31.146 1.00 61.63 ? 129  GLU D OE1   1 
ATOM   2687  O OE2   . GLU B 1 77  ? 170.882 -20.676 29.192 1.00 64.99 ? 129  GLU D OE2   1 
ATOM   2688  N N     . GLU B 1 78  ? 167.172 -24.072 28.852 1.00 56.66 ? 130  GLU D N     1 
ATOM   2689  C CA    . GLU B 1 78  ? 166.065 -25.024 28.864 1.00 57.63 ? 130  GLU D CA    1 
ATOM   2690  C C     . GLU B 1 78  ? 165.245 -24.796 27.595 1.00 56.97 ? 130  GLU D C     1 
ATOM   2691  O O     . GLU B 1 78  ? 164.650 -25.720 27.028 1.00 55.61 ? 130  GLU D O     1 
ATOM   2692  C CB    . GLU B 1 78  ? 165.186 -24.802 30.105 1.00 59.47 ? 130  GLU D CB    1 
ATOM   2693  C CG    . GLU B 1 78  ? 165.934 -24.885 31.445 1.00 63.48 ? 130  GLU D CG    1 
ATOM   2694  C CD    . GLU B 1 78  ? 166.603 -23.573 31.861 1.00 66.30 ? 130  GLU D CD    1 
ATOM   2695  O OE1   . GLU B 1 78  ? 165.887 -22.613 32.240 1.00 67.37 ? 130  GLU D OE1   1 
ATOM   2696  O OE2   . GLU B 1 78  ? 167.850 -23.501 31.813 1.00 66.75 ? 130  GLU D OE2   1 
ATOM   2697  N N     . HIS B 1 79  ? 165.235 -23.539 27.163 1.00 56.82 ? 131  HIS D N     1 
ATOM   2698  C CA    . HIS B 1 79  ? 164.522 -23.115 25.967 1.00 56.43 ? 131  HIS D CA    1 
ATOM   2699  C C     . HIS B 1 79  ? 165.092 -23.810 24.741 1.00 57.07 ? 131  HIS D C     1 
ATOM   2700  O O     . HIS B 1 79  ? 164.362 -24.455 23.997 1.00 56.69 ? 131  HIS D O     1 
ATOM   2701  C CB    . HIS B 1 79  ? 164.663 -21.601 25.776 1.00 55.13 ? 131  HIS D CB    1 
ATOM   2702  C CG    . HIS B 1 79  ? 163.677 -20.785 26.550 1.00 52.55 ? 131  HIS D CG    1 
ATOM   2703  N ND1   . HIS B 1 79  ? 163.954 -19.505 26.978 1.00 51.99 ? 131  HIS D ND1   1 
ATOM   2704  C CD2   . HIS B 1 79  ? 162.409 -21.044 26.940 1.00 52.92 ? 131  HIS D CD2   1 
ATOM   2705  C CE1   . HIS B 1 79  ? 162.900 -19.011 27.600 1.00 51.57 ? 131  HIS D CE1   1 
ATOM   2706  N NE2   . HIS B 1 79  ? 161.948 -19.924 27.591 1.00 52.33 ? 131  HIS D NE2   1 
ATOM   2707  N N     . VAL B 1 80  ? 166.398 -23.665 24.521 1.00 57.96 ? 132  VAL D N     1 
ATOM   2708  C CA    . VAL B 1 80  ? 167.024 -24.283 23.360 1.00 59.28 ? 132  VAL D CA    1 
ATOM   2709  C C     . VAL B 1 80  ? 166.798 -25.779 23.408 1.00 61.28 ? 132  VAL D C     1 
ATOM   2710  O O     . VAL B 1 80  ? 166.632 -26.426 22.377 1.00 62.38 ? 132  VAL D O     1 
ATOM   2711  C CB    . VAL B 1 80  ? 168.536 -24.005 23.298 1.00 58.06 ? 132  VAL D CB    1 
ATOM   2712  C CG1   . VAL B 1 80  ? 168.785 -22.516 23.380 1.00 57.80 ? 132  VAL D CG1   1 
ATOM   2713  C CG2   . VAL B 1 80  ? 169.250 -24.741 24.412 1.00 59.17 ? 132  VAL D CG2   1 
ATOM   2714  N N     . GLU B 1 81  ? 166.790 -26.328 24.614 1.00 63.13 ? 133  GLU D N     1 
ATOM   2715  C CA    . GLU B 1 81  ? 166.558 -27.744 24.776 1.00 64.21 ? 133  GLU D CA    1 
ATOM   2716  C C     . GLU B 1 81  ? 165.218 -28.071 24.155 1.00 63.33 ? 133  GLU D C     1 
ATOM   2717  O O     . GLU B 1 81  ? 165.145 -28.785 23.158 1.00 63.46 ? 133  GLU D O     1 
ATOM   2718  C CB    . GLU B 1 81  ? 166.552 -28.109 26.253 1.00 67.53 ? 133  GLU D CB    1 
ATOM   2719  C CG    . GLU B 1 81  ? 167.942 -28.202 26.851 1.00 74.27 ? 133  GLU D CG    1 
ATOM   2720  C CD    . GLU B 1 81  ? 167.919 -28.392 28.358 1.00 78.04 ? 133  GLU D CD    1 
ATOM   2721  O OE1   . GLU B 1 81  ? 167.072 -29.172 28.850 1.00 79.80 ? 133  GLU D OE1   1 
ATOM   2722  O OE2   . GLU B 1 81  ? 168.757 -27.768 29.051 1.00 80.63 ? 133  GLU D OE2   1 
ATOM   2723  N N     . GLU B 1 82  ? 164.154 -27.526 24.727 1.00 62.57 ? 134  GLU D N     1 
ATOM   2724  C CA    . GLU B 1 82  ? 162.820 -27.797 24.210 1.00 61.89 ? 134  GLU D CA    1 
ATOM   2725  C C     . GLU B 1 82  ? 162.590 -27.318 22.781 1.00 60.16 ? 134  GLU D C     1 
ATOM   2726  O O     . GLU B 1 82  ? 161.766 -27.865 22.051 1.00 60.39 ? 134  GLU D O     1 
ATOM   2727  C CB    . GLU B 1 82  ? 161.770 -27.196 25.141 1.00 62.91 ? 134  GLU D CB    1 
ATOM   2728  C CG    . GLU B 1 82  ? 161.614 -27.975 26.429 1.00 67.25 ? 134  GLU D CG    1 
ATOM   2729  C CD    . GLU B 1 82  ? 160.164 -28.264 26.751 1.00 69.59 ? 134  GLU D CD    1 
ATOM   2730  O OE1   . GLU B 1 82  ? 159.459 -28.773 25.852 1.00 69.94 ? 134  GLU D OE1   1 
ATOM   2731  O OE2   . GLU B 1 82  ? 159.733 -27.988 27.897 1.00 71.38 ? 134  GLU D OE2   1 
ATOM   2732  N N     . LEU B 1 83  ? 163.330 -26.303 22.373 1.00 58.27 ? 135  LEU D N     1 
ATOM   2733  C CA    . LEU B 1 83  ? 163.174 -25.764 21.041 1.00 56.48 ? 135  LEU D CA    1 
ATOM   2734  C C     . LEU B 1 83  ? 163.845 -26.717 20.050 1.00 56.38 ? 135  LEU D C     1 
ATOM   2735  O O     . LEU B 1 83  ? 163.515 -26.725 18.863 1.00 55.40 ? 135  LEU D O     1 
ATOM   2736  C CB    . LEU B 1 83  ? 163.798 -24.368 21.006 1.00 56.06 ? 135  LEU D CB    1 
ATOM   2737  C CG    . LEU B 1 83  ? 163.198 -23.237 20.168 1.00 54.81 ? 135  LEU D CG    1 
ATOM   2738  C CD1   . LEU B 1 83  ? 161.673 -23.212 20.261 1.00 52.05 ? 135  LEU D CD1   1 
ATOM   2739  C CD2   . LEU B 1 83  ? 163.808 -21.928 20.667 1.00 52.74 ? 135  LEU D CD2   1 
ATOM   2740  N N     . LYS B 1 84  ? 164.782 -27.525 20.551 1.00 55.72 ? 136  LYS D N     1 
ATOM   2741  C CA    . LYS B 1 84  ? 165.486 -28.503 19.720 1.00 54.78 ? 136  LYS D CA    1 
ATOM   2742  C C     . LYS B 1 84  ? 164.546 -29.643 19.395 1.00 53.87 ? 136  LYS D C     1 
ATOM   2743  O O     . LYS B 1 84  ? 164.648 -30.260 18.344 1.00 53.94 ? 136  LYS D O     1 
ATOM   2744  C CB    . LYS B 1 84  ? 166.694 -29.098 20.445 1.00 56.48 ? 136  LYS D CB    1 
ATOM   2745  C CG    . LYS B 1 84  ? 167.991 -28.302 20.379 1.00 57.83 ? 136  LYS D CG    1 
ATOM   2746  C CD    . LYS B 1 84  ? 169.074 -29.040 21.176 1.00 58.22 ? 136  LYS D CD    1 
ATOM   2747  C CE    . LYS B 1 84  ? 170.165 -28.097 21.674 1.00 58.75 ? 136  LYS D CE    1 
ATOM   2748  N NZ    . LYS B 1 84  ? 170.653 -28.487 23.037 1.00 56.61 ? 136  LYS D NZ    1 
ATOM   2749  N N     . LYS B 1 85  ? 163.637 -29.934 20.314 1.00 53.00 ? 137  LYS D N     1 
ATOM   2750  C CA    . LYS B 1 85  ? 162.680 -31.013 20.104 1.00 53.18 ? 137  LYS D CA    1 
ATOM   2751  C C     . LYS B 1 85  ? 161.626 -30.653 19.061 1.00 51.91 ? 137  LYS D C     1 
ATOM   2752  O O     . LYS B 1 85  ? 160.723 -31.451 18.802 1.00 53.10 ? 137  LYS D O     1 
ATOM   2753  C CB    . LYS B 1 85  ? 161.940 -31.349 21.405 1.00 53.53 ? 137  LYS D CB    1 
ATOM   2754  C CG    . LYS B 1 85  ? 162.802 -31.760 22.568 1.00 55.97 ? 137  LYS D CG    1 
ATOM   2755  C CD    . LYS B 1 85  ? 161.959 -31.797 23.844 1.00 58.40 ? 137  LYS D CD    1 
ATOM   2756  C CE    . LYS B 1 85  ? 162.834 -31.667 25.084 1.00 59.40 ? 137  LYS D CE    1 
ATOM   2757  N NZ    . LYS B 1 85  ? 162.036 -31.324 26.289 1.00 60.53 ? 137  LYS D NZ    1 
ATOM   2758  N N     . SER B 1 86  ? 161.718 -29.471 18.461 1.00 49.51 ? 138  SER D N     1 
ATOM   2759  C CA    . SER B 1 86  ? 160.689 -29.066 17.502 1.00 47.51 ? 138  SER D CA    1 
ATOM   2760  C C     . SER B 1 86  ? 160.659 -29.779 16.158 1.00 44.70 ? 138  SER D C     1 
ATOM   2761  O O     . SER B 1 86  ? 161.655 -29.817 15.434 1.00 42.63 ? 138  SER D O     1 
ATOM   2762  C CB    . SER B 1 86  ? 160.742 -27.562 17.246 1.00 48.54 ? 138  SER D CB    1 
ATOM   2763  O OG    . SER B 1 86  ? 159.731 -27.193 16.323 1.00 47.23 ? 138  SER D OG    1 
ATOM   2764  N N     . PRO B 1 87  ? 159.498 -30.360 15.820 1.00 42.60 ? 139  PRO D N     1 
ATOM   2765  C CA    . PRO B 1 87  ? 159.258 -31.086 14.569 1.00 41.14 ? 139  PRO D CA    1 
ATOM   2766  C C     . PRO B 1 87  ? 159.123 -30.098 13.410 1.00 39.15 ? 139  PRO D C     1 
ATOM   2767  O O     . PRO B 1 87  ? 159.218 -30.473 12.244 1.00 36.93 ? 139  PRO D O     1 
ATOM   2768  C CB    . PRO B 1 87  ? 157.956 -31.837 14.850 1.00 41.76 ? 139  PRO D CB    1 
ATOM   2769  C CG    . PRO B 1 87  ? 157.229 -30.899 15.787 1.00 42.41 ? 139  PRO D CG    1 
ATOM   2770  C CD    . PRO B 1 87  ? 158.346 -30.497 16.733 1.00 42.38 ? 139  PRO D CD    1 
ATOM   2771  N N     . VAL B 1 88  ? 158.888 -28.831 13.749 1.00 38.18 ? 140  VAL D N     1 
ATOM   2772  C CA    . VAL B 1 88  ? 158.770 -27.778 12.745 1.00 36.36 ? 140  VAL D CA    1 
ATOM   2773  C C     . VAL B 1 88  ? 159.902 -26.763 12.895 1.00 34.03 ? 140  VAL D C     1 
ATOM   2774  O O     . VAL B 1 88  ? 160.367 -26.487 14.003 1.00 33.60 ? 140  VAL D O     1 
ATOM   2775  C CB    . VAL B 1 88  ? 157.429 -27.038 12.855 1.00 36.90 ? 140  VAL D CB    1 
ATOM   2776  C CG1   . VAL B 1 88  ? 156.299 -28.023 12.685 1.00 38.88 ? 140  VAL D CG1   1 
ATOM   2777  C CG2   . VAL B 1 88  ? 157.324 -26.328 14.190 1.00 36.52 ? 140  VAL D CG2   1 
ATOM   2778  N N     . PRO B 1 89  ? 160.372 -26.202 11.774 1.00 32.44 ? 141  PRO D N     1 
ATOM   2779  C CA    . PRO B 1 89  ? 161.456 -25.224 11.876 1.00 31.75 ? 141  PRO D CA    1 
ATOM   2780  C C     . PRO B 1 89  ? 161.109 -24.078 12.830 1.00 31.40 ? 141  PRO D C     1 
ATOM   2781  O O     . PRO B 1 89  ? 159.952 -23.644 12.937 1.00 29.88 ? 141  PRO D O     1 
ATOM   2782  C CB    . PRO B 1 89  ? 161.635 -24.753 10.437 1.00 31.61 ? 141  PRO D CB    1 
ATOM   2783  C CG    . PRO B 1 89  ? 161.224 -25.946 9.639  1.00 31.68 ? 141  PRO D CG    1 
ATOM   2784  C CD    . PRO B 1 89  ? 159.997 -26.434 10.368 1.00 31.91 ? 141  PRO D CD    1 
ATOM   2785  N N     . VAL B 1 90  ? 162.129 -23.611 13.532 1.00 30.93 ? 142  VAL D N     1 
ATOM   2786  C CA    . VAL B 1 90  ? 161.982 -22.524 14.476 1.00 30.18 ? 142  VAL D CA    1 
ATOM   2787  C C     . VAL B 1 90  ? 163.125 -21.568 14.190 1.00 31.35 ? 142  VAL D C     1 
ATOM   2788  O O     . VAL B 1 90  ? 164.273 -21.995 14.038 1.00 31.65 ? 142  VAL D O     1 
ATOM   2789  C CB    . VAL B 1 90  ? 162.105 -23.030 15.914 1.00 28.16 ? 142  VAL D CB    1 
ATOM   2790  C CG1   . VAL B 1 90  ? 162.065 -21.868 16.871 1.00 26.14 ? 142  VAL D CG1   1 
ATOM   2791  C CG2   . VAL B 1 90  ? 160.994 -24.030 16.206 1.00 28.62 ? 142  VAL D CG2   1 
ATOM   2792  N N     . VAL B 1 91  ? 162.813 -20.285 14.072 1.00 30.71 ? 143  VAL D N     1 
ATOM   2793  C CA    . VAL B 1 91  ? 163.843 -19.290 13.832 1.00 30.64 ? 143  VAL D CA    1 
ATOM   2794  C C     . VAL B 1 91  ? 163.618 -18.180 14.837 1.00 29.32 ? 143  VAL D C     1 
ATOM   2795  O O     . VAL B 1 91  ? 162.490 -17.685 14.986 1.00 28.28 ? 143  VAL D O     1 
ATOM   2796  C CB    . VAL B 1 91  ? 163.771 -18.712 12.408 1.00 32.46 ? 143  VAL D CB    1 
ATOM   2797  C CG1   . VAL B 1 91  ? 162.379 -18.212 12.136 1.00 35.36 ? 143  VAL D CG1   1 
ATOM   2798  C CG2   . VAL B 1 91  ? 164.768 -17.568 12.258 1.00 33.40 ? 143  VAL D CG2   1 
ATOM   2799  N N     . LEU B 1 92  ? 164.690 -17.804 15.535 1.00 27.24 ? 144  LEU D N     1 
ATOM   2800  C CA    . LEU B 1 92  ? 164.614 -16.761 16.546 1.00 25.39 ? 144  LEU D CA    1 
ATOM   2801  C C     . LEU B 1 92  ? 164.760 -15.409 15.898 1.00 25.37 ? 144  LEU D C     1 
ATOM   2802  O O     . LEU B 1 92  ? 165.682 -15.189 15.122 1.00 26.36 ? 144  LEU D O     1 
ATOM   2803  C CB    . LEU B 1 92  ? 165.720 -16.943 17.588 1.00 26.59 ? 144  LEU D CB    1 
ATOM   2804  C CG    . LEU B 1 92  ? 165.760 -18.222 18.441 1.00 25.45 ? 144  LEU D CG    1 
ATOM   2805  C CD1   . LEU B 1 92  ? 166.923 -18.123 19.394 1.00 25.72 ? 144  LEU D CD1   1 
ATOM   2806  C CD2   . LEU B 1 92  ? 164.472 -18.401 19.219 1.00 25.89 ? 144  LEU D CD2   1 
ATOM   2807  N N     . ALA B 1 93  ? 163.843 -14.502 16.202 1.00 24.35 ? 145  ALA D N     1 
ATOM   2808  C CA    . ALA B 1 93  ? 163.909 -13.165 15.643 1.00 24.04 ? 145  ALA D CA    1 
ATOM   2809  C C     . ALA B 1 93  ? 164.298 -12.152 16.718 1.00 25.70 ? 145  ALA D C     1 
ATOM   2810  O O     . ALA B 1 93  ? 163.747 -12.160 17.816 1.00 26.10 ? 145  ALA D O     1 
ATOM   2811  C CB    . ALA B 1 93  ? 162.582 -12.800 15.053 1.00 23.70 ? 145  ALA D CB    1 
ATOM   2812  N N     . ALA B 1 94  ? 165.268 -11.299 16.401 1.00 26.96 ? 146  ALA D N     1 
ATOM   2813  C CA    . ALA B 1 94  ? 165.729 -10.248 17.308 1.00 27.52 ? 146  ALA D CA    1 
ATOM   2814  C C     . ALA B 1 94  ? 165.941 -10.734 18.722 1.00 29.29 ? 146  ALA D C     1 
ATOM   2815  O O     . ALA B 1 94  ? 165.596 -10.037 19.680 1.00 30.19 ? 146  ALA D O     1 
ATOM   2816  C CB    . ALA B 1 94  ? 164.727 -9.096  17.317 1.00 27.38 ? 146  ALA D CB    1 
ATOM   2817  N N     . SER B 1 95  ? 166.509 -11.921 18.863 1.00 30.50 ? 147  SER D N     1 
ATOM   2818  C CA    . SER B 1 95  ? 166.736 -12.469 20.185 1.00 33.19 ? 147  SER D CA    1 
ATOM   2819  C C     . SER B 1 95  ? 168.089 -13.114 20.179 1.00 35.12 ? 147  SER D C     1 
ATOM   2820  O O     . SER B 1 95  ? 168.484 -13.699 19.171 1.00 37.18 ? 147  SER D O     1 
ATOM   2821  C CB    . SER B 1 95  ? 165.666 -13.502 20.493 1.00 34.05 ? 147  SER D CB    1 
ATOM   2822  O OG    . SER B 1 95  ? 164.390 -13.005 20.125 1.00 35.26 ? 147  SER D OG    1 
ATOM   2823  N N     . ILE B 1 96  ? 168.806 -13.029 21.293 1.00 36.54 ? 148  ILE D N     1 
ATOM   2824  C CA    . ILE B 1 96  ? 170.137 -13.619 21.323 1.00 37.99 ? 148  ILE D CA    1 
ATOM   2825  C C     . ILE B 1 96  ? 170.238 -14.941 22.048 1.00 38.63 ? 148  ILE D C     1 
ATOM   2826  O O     . ILE B 1 96  ? 169.602 -15.145 23.073 1.00 39.51 ? 148  ILE D O     1 
ATOM   2827  C CB    . ILE B 1 96  ? 171.177 -12.666 21.958 1.00 38.02 ? 148  ILE D CB    1 
ATOM   2828  C CG1   . ILE B 1 96  ? 171.426 -13.037 23.413 1.00 37.51 ? 148  ILE D CG1   1 
ATOM   2829  C CG2   . ILE B 1 96  ? 170.684 -11.236 21.891 1.00 39.21 ? 148  ILE D CG2   1 
ATOM   2830  C CD1   . ILE B 1 96  ? 172.600 -12.319 24.010 1.00 41.37 ? 148  ILE D CD1   1 
ATOM   2831  N N     . GLU B 1 97  ? 171.033 -15.845 21.490 1.00 40.99 ? 149  GLU D N     1 
ATOM   2832  C CA    . GLU B 1 97  ? 171.301 -17.138 22.113 1.00 42.94 ? 149  GLU D CA    1 
ATOM   2833  C C     . GLU B 1 97  ? 172.682 -17.604 21.587 1.00 43.31 ? 149  GLU D C     1 
ATOM   2834  O O     . GLU B 1 97  ? 172.827 -18.130 20.484 1.00 43.67 ? 149  GLU D O     1 
ATOM   2835  C CB    . GLU B 1 97  ? 170.138 -18.119 21.848 1.00 44.20 ? 149  GLU D CB    1 
ATOM   2836  C CG    . GLU B 1 97  ? 170.218 -18.971 20.614 1.00 47.83 ? 149  GLU D CG    1 
ATOM   2837  C CD    . GLU B 1 97  ? 170.844 -20.315 20.899 1.00 49.65 ? 149  GLU D CD    1 
ATOM   2838  O OE1   . GLU B 1 97  ? 171.475 -20.447 21.968 1.00 49.77 ? 149  GLU D OE1   1 
ATOM   2839  O OE2   . GLU B 1 97  ? 170.713 -21.230 20.054 1.00 51.93 ? 149  GLU D OE2   1 
ATOM   2840  N N     . SER B 1 98  ? 173.699 -17.321 22.402 1.00 44.37 ? 150  SER D N     1 
ATOM   2841  C CA    . SER B 1 98  ? 175.114 -17.604 22.141 1.00 45.28 ? 150  SER D CA    1 
ATOM   2842  C C     . SER B 1 98  ? 175.525 -18.848 21.353 1.00 45.44 ? 150  SER D C     1 
ATOM   2843  O O     . SER B 1 98  ? 176.336 -18.753 20.434 1.00 45.42 ? 150  SER D O     1 
ATOM   2844  C CB    . SER B 1 98  ? 175.885 -17.583 23.471 1.00 46.79 ? 150  SER D CB    1 
ATOM   2845  O OG    . SER B 1 98  ? 175.233 -18.346 24.486 1.00 48.82 ? 150  SER D OG    1 
ATOM   2846  N N     . THR B 1 99  ? 174.991 -20.008 21.716 1.00 45.16 ? 151  THR D N     1 
ATOM   2847  C CA    . THR B 1 99  ? 175.341 -21.247 21.028 1.00 46.16 ? 151  THR D CA    1 
ATOM   2848  C C     . THR B 1 99  ? 175.060 -21.227 19.517 1.00 46.58 ? 151  THR D C     1 
ATOM   2849  O O     . THR B 1 99  ? 175.670 -21.983 18.753 1.00 47.01 ? 151  THR D O     1 
ATOM   2850  C CB    . THR B 1 99  ? 174.592 -22.434 21.630 1.00 45.19 ? 151  THR D CB    1 
ATOM   2851  O OG1   . THR B 1 99  ? 173.192 -22.254 21.423 1.00 45.68 ? 151  THR D OG1   1 
ATOM   2852  C CG2   . THR B 1 99  ? 174.856 -22.529 23.110 1.00 44.61 ? 151  THR D CG2   1 
ATOM   2853  N N     . ASN B 1 100 ? 174.143 -20.364 19.086 1.00 45.44 ? 152  ASN D N     1 
ATOM   2854  C CA    . ASN B 1 100 ? 173.797 -20.272 17.672 1.00 44.11 ? 152  ASN D CA    1 
ATOM   2855  C C     . ASN B 1 100 ? 173.328 -21.623 17.160 1.00 43.07 ? 152  ASN D C     1 
ATOM   2856  O O     . ASN B 1 100 ? 173.642 -21.992 16.038 1.00 43.36 ? 152  ASN D O     1 
ATOM   2857  C CB    . ASN B 1 100 ? 175.000 -19.851 16.814 1.00 44.82 ? 152  ASN D CB    1 
ATOM   2858  C CG    . ASN B 1 100 ? 175.620 -18.543 17.254 1.00 46.72 ? 152  ASN D CG    1 
ATOM   2859  O OD1   . ASN B 1 100 ? 174.955 -17.511 17.320 1.00 49.00 ? 152  ASN D OD1   1 
ATOM   2860  N ND2   . ASN B 1 100 ? 176.912 -18.576 17.542 1.00 46.63 ? 152  ASN D ND2   1 
ATOM   2861  N N     . GLN B 1 101 ? 172.593 -22.377 17.964 1.00 42.60 ? 153  GLN D N     1 
ATOM   2862  C CA    . GLN B 1 101 ? 172.138 -23.673 17.480 1.00 41.72 ? 153  GLN D CA    1 
ATOM   2863  C C     . GLN B 1 101 ? 170.666 -23.694 17.088 1.00 39.52 ? 153  GLN D C     1 
ATOM   2864  O O     . GLN B 1 101 ? 170.081 -24.747 16.850 1.00 38.65 ? 153  GLN D O     1 
ATOM   2865  C CB    . GLN B 1 101 ? 172.478 -24.779 18.488 1.00 42.97 ? 153  GLN D CB    1 
ATOM   2866  C CG    . GLN B 1 101 ? 172.177 -24.470 19.929 1.00 45.29 ? 153  GLN D CG    1 
ATOM   2867  C CD    . GLN B 1 101 ? 172.818 -25.482 20.868 1.00 47.28 ? 153  GLN D CD    1 
ATOM   2868  O OE1   . GLN B 1 101 ? 172.906 -26.665 20.543 1.00 47.70 ? 153  GLN D OE1   1 
ATOM   2869  N NE2   . GLN B 1 101 ? 173.253 -25.023 22.044 1.00 47.71 ? 153  GLN D NE2   1 
ATOM   2870  N N     . ILE B 1 102 ? 170.089 -22.501 17.022 1.00 38.14 ? 154  ILE D N     1 
ATOM   2871  C CA    . ILE B 1 102 ? 168.712 -22.283 16.601 1.00 37.33 ? 154  ILE D CA    1 
ATOM   2872  C C     . ILE B 1 102 ? 168.923 -21.159 15.601 1.00 36.57 ? 154  ILE D C     1 
ATOM   2873  O O     . ILE B 1 102 ? 169.389 -20.088 15.975 1.00 37.84 ? 154  ILE D O     1 
ATOM   2874  C CB    . ILE B 1 102 ? 167.829 -21.743 17.736 1.00 38.21 ? 154  ILE D CB    1 
ATOM   2875  C CG1   . ILE B 1 102 ? 167.632 -22.802 18.831 1.00 38.56 ? 154  ILE D CG1   1 
ATOM   2876  C CG2   . ILE B 1 102 ? 166.510 -21.284 17.153 1.00 37.34 ? 154  ILE D CG2   1 
ATOM   2877  C CD1   . ILE B 1 102 ? 166.824 -24.012 18.381 1.00 42.66 ? 154  ILE D CD1   1 
ATOM   2878  N N     . PRO B 1 103 ? 168.611 -21.378 14.319 1.00 35.46 ? 155  PRO D N     1 
ATOM   2879  C CA    . PRO B 1 103 ? 168.842 -20.262 13.394 1.00 34.80 ? 155  PRO D CA    1 
ATOM   2880  C C     . PRO B 1 103 ? 168.216 -18.965 13.888 1.00 33.41 ? 155  PRO D C     1 
ATOM   2881  O O     . PRO B 1 103 ? 167.182 -18.984 14.567 1.00 34.61 ? 155  PRO D O     1 
ATOM   2882  C CB    . PRO B 1 103 ? 168.255 -20.764 12.068 1.00 34.15 ? 155  PRO D CB    1 
ATOM   2883  C CG    . PRO B 1 103 ? 167.300 -21.826 12.468 1.00 36.01 ? 155  PRO D CG    1 
ATOM   2884  C CD    . PRO B 1 103 ? 167.957 -22.506 13.642 1.00 35.76 ? 155  PRO D CD    1 
ATOM   2885  N N     . SER B 1 104 ? 168.853 -17.841 13.569 1.00 29.74 ? 156  SER D N     1 
ATOM   2886  C CA    . SER B 1 104 ? 168.341 -16.562 14.021 1.00 27.06 ? 156  SER D CA    1 
ATOM   2887  C C     . SER B 1 104 ? 168.876 -15.370 13.247 1.00 26.69 ? 156  SER D C     1 
ATOM   2888  O O     . SER B 1 104 ? 169.996 -15.395 12.749 1.00 25.80 ? 156  SER D O     1 
ATOM   2889  C CB    . SER B 1 104 ? 168.661 -16.387 15.503 1.00 24.03 ? 156  SER D CB    1 
ATOM   2890  O OG    . SER B 1 104 ? 170.055 -16.456 15.716 1.00 22.00 ? 156  SER D OG    1 
ATOM   2891  N N     . VAL B 1 105 ? 168.059 -14.324 13.149 1.00 26.97 ? 157  VAL D N     1 
ATOM   2892  C CA    . VAL B 1 105 ? 168.456 -13.105 12.462 1.00 27.30 ? 157  VAL D CA    1 
ATOM   2893  C C     . VAL B 1 105 ? 168.370 -11.947 13.441 1.00 28.55 ? 157  VAL D C     1 
ATOM   2894  O O     . VAL B 1 105 ? 167.326 -11.690 14.030 1.00 30.01 ? 157  VAL D O     1 
ATOM   2895  C CB    . VAL B 1 105 ? 167.604 -12.852 11.191 1.00 24.16 ? 157  VAL D CB    1 
ATOM   2896  C CG1   . VAL B 1 105 ? 166.372 -13.689 11.222 1.00 23.79 ? 157  VAL D CG1   1 
ATOM   2897  C CG2   . VAL B 1 105 ? 167.291 -11.387 11.050 1.00 22.73 ? 157  VAL D CG2   1 
ATOM   2898  N N     . THR B 1 106 ? 169.496 -11.262 13.612 1.00 30.30 ? 158  THR D N     1 
ATOM   2899  C CA    . THR B 1 106 ? 169.616 -10.159 14.554 1.00 29.95 ? 158  THR D CA    1 
ATOM   2900  C C     . THR B 1 106 ? 170.600 -9.103  14.062 1.00 31.27 ? 158  THR D C     1 
ATOM   2901  O O     . THR B 1 106 ? 170.852 -8.991  12.866 1.00 31.70 ? 158  THR D O     1 
ATOM   2902  C CB    . THR B 1 106 ? 170.142 -10.695 15.851 1.00 29.31 ? 158  THR D CB    1 
ATOM   2903  O OG1   . THR B 1 106 ? 171.214 -11.605 15.558 1.00 28.63 ? 158  THR D OG1   1 
ATOM   2904  C CG2   . THR B 1 106 ? 169.046 -11.413 16.617 1.00 29.09 ? 158  THR D CG2   1 
ATOM   2905  N N     . ILE B 1 107 ? 171.135 -8.321  15.000 1.00 32.56 ? 159  ILE D N     1 
ATOM   2906  C CA    . ILE B 1 107 ? 172.132 -7.287  14.703 1.00 34.07 ? 159  ILE D CA    1 
ATOM   2907  C C     . ILE B 1 107 ? 173.139 -7.330  15.840 1.00 35.33 ? 159  ILE D C     1 
ATOM   2908  O O     . ILE B 1 107 ? 172.855 -7.890  16.901 1.00 35.62 ? 159  ILE D O     1 
ATOM   2909  C CB    . ILE B 1 107 ? 171.555 -5.861  14.680 1.00 33.19 ? 159  ILE D CB    1 
ATOM   2910  C CG1   . ILE B 1 107 ? 171.077 -5.484  16.081 1.00 33.62 ? 159  ILE D CG1   1 
ATOM   2911  C CG2   . ILE B 1 107 ? 170.454 -5.753  13.629 1.00 32.91 ? 159  ILE D CG2   1 
ATOM   2912  C CD1   . ILE B 1 107 ? 171.087 -3.986  16.339 1.00 39.39 ? 159  ILE D CD1   1 
ATOM   2913  N N     . ASP B 1 108 ? 174.308 -6.736  15.638 1.00 35.56 ? 160  ASP D N     1 
ATOM   2914  C CA    . ASP B 1 108 ? 175.293 -6.766  16.694 1.00 36.13 ? 160  ASP D CA    1 
ATOM   2915  C C     . ASP B 1 108 ? 174.901 -5.780  17.781 1.00 37.30 ? 160  ASP D C     1 
ATOM   2916  O O     . ASP B 1 108 ? 175.298 -4.612  17.755 1.00 38.46 ? 160  ASP D O     1 
ATOM   2917  C CB    . ASP B 1 108 ? 176.684 -6.441  16.158 1.00 35.64 ? 160  ASP D CB    1 
ATOM   2918  C CG    . ASP B 1 108 ? 177.770 -6.683  17.195 1.00 37.37 ? 160  ASP D CG    1 
ATOM   2919  O OD1   . ASP B 1 108 ? 177.430 -7.060  18.344 1.00 36.45 ? 160  ASP D OD1   1 
ATOM   2920  O OD2   . ASP B 1 108 ? 178.961 -6.499  16.866 1.00 38.55 ? 160  ASP D OD2   1 
ATOM   2921  N N     . TYR B 1 109 ? 174.116 -6.254  18.739 1.00 36.76 ? 161  TYR D N     1 
ATOM   2922  C CA    . TYR B 1 109 ? 173.670 -5.402  19.826 1.00 38.18 ? 161  TYR D CA    1 
ATOM   2923  C C     . TYR B 1 109 ? 174.803 -4.789  20.640 1.00 38.34 ? 161  TYR D C     1 
ATOM   2924  O O     . TYR B 1 109 ? 174.691 -3.653  21.106 1.00 39.31 ? 161  TYR D O     1 
ATOM   2925  C CB    . TYR B 1 109 ? 172.744 -6.177  20.757 1.00 40.01 ? 161  TYR D CB    1 
ATOM   2926  C CG    . TYR B 1 109 ? 171.528 -6.745  20.071 1.00 41.90 ? 161  TYR D CG    1 
ATOM   2927  C CD1   . TYR B 1 109 ? 171.442 -8.103  19.777 1.00 42.24 ? 161  TYR D CD1   1 
ATOM   2928  C CD2   . TYR B 1 109 ? 170.462 -5.921  19.708 1.00 42.58 ? 161  TYR D CD2   1 
ATOM   2929  C CE1   . TYR B 1 109 ? 170.319 -8.628  19.139 1.00 44.74 ? 161  TYR D CE1   1 
ATOM   2930  C CE2   . TYR B 1 109 ? 169.338 -6.433  19.070 1.00 44.17 ? 161  TYR D CE2   1 
ATOM   2931  C CZ    . TYR B 1 109 ? 169.267 -7.785  18.788 1.00 44.46 ? 161  TYR D CZ    1 
ATOM   2932  O OH    . TYR B 1 109 ? 168.143 -8.295  18.171 1.00 44.53 ? 161  TYR D OH    1 
ATOM   2933  N N     . GLU B 1 110 ? 175.893 -5.524  20.819 1.00 37.88 ? 162  GLU D N     1 
ATOM   2934  C CA    . GLU B 1 110 ? 177.001 -4.991  21.604 1.00 38.37 ? 162  GLU D CA    1 
ATOM   2935  C C     . GLU B 1 110 ? 177.633 -3.789  20.885 1.00 38.03 ? 162  GLU D C     1 
ATOM   2936  O O     . GLU B 1 110 ? 177.944 -2.761  21.506 1.00 36.24 ? 162  GLU D O     1 
ATOM   2937  C CB    . GLU B 1 110 ? 178.032 -6.098  21.863 1.00 38.61 ? 162  GLU D CB    1 
ATOM   2938  C CG    . GLU B 1 110 ? 179.134 -5.740  22.850 1.00 38.41 ? 162  GLU D CG    1 
ATOM   2939  C CD    . GLU B 1 110 ? 180.179 -4.811  22.256 1.00 39.75 ? 162  GLU D CD    1 
ATOM   2940  O OE1   . GLU B 1 110 ? 180.628 -5.071  21.116 1.00 39.30 ? 162  GLU D OE1   1 
ATOM   2941  O OE2   . GLU B 1 110 ? 180.561 -3.829  22.933 1.00 40.91 ? 162  GLU D OE2   1 
ATOM   2942  N N     . GLN B 1 111 ? 177.797 -3.921  19.571 1.00 37.43 ? 163  GLN D N     1 
ATOM   2943  C CA    . GLN B 1 111 ? 178.372 -2.853  18.752 1.00 37.52 ? 163  GLN D CA    1 
ATOM   2944  C C     . GLN B 1 111 ? 177.418 -1.673  18.573 1.00 36.61 ? 163  GLN D C     1 
ATOM   2945  O O     . GLN B 1 111 ? 177.833 -0.515  18.618 1.00 37.45 ? 163  GLN D O     1 
ATOM   2946  C CB    . GLN B 1 111 ? 178.759 -3.384  17.365 1.00 37.42 ? 163  GLN D CB    1 
ATOM   2947  C CG    . GLN B 1 111 ? 180.253 -3.505  17.147 1.00 39.03 ? 163  GLN D CG    1 
ATOM   2948  C CD    . GLN B 1 111 ? 180.970 -2.214  17.449 1.00 39.00 ? 163  GLN D CD    1 
ATOM   2949  O OE1   . GLN B 1 111 ? 180.562 -1.140  17.001 1.00 38.24 ? 163  GLN D OE1   1 
ATOM   2950  N NE2   . GLN B 1 111 ? 182.051 -2.309  18.214 1.00 39.95 ? 163  GLN D NE2   1 
ATOM   2951  N N     . ALA B 1 112 ? 176.142 -1.968  18.351 1.00 34.32 ? 164  ALA D N     1 
ATOM   2952  C CA    . ALA B 1 112 ? 175.174 -0.913  18.161 1.00 32.78 ? 164  ALA D CA    1 
ATOM   2953  C C     . ALA B 1 112 ? 175.169 -0.069  19.423 1.00 32.64 ? 164  ALA D C     1 
ATOM   2954  O O     . ALA B 1 112 ? 175.174 1.157   19.358 1.00 31.17 ? 164  ALA D O     1 
ATOM   2955  C CB    . ALA B 1 112 ? 173.803 -1.507  17.904 1.00 31.95 ? 164  ALA D CB    1 
ATOM   2956  N N     . ALA B 1 113 ? 175.181 -0.728  20.576 1.00 33.49 ? 165  ALA D N     1 
ATOM   2957  C CA    . ALA B 1 113 ? 175.169 -0.011  21.846 1.00 34.47 ? 165  ALA D CA    1 
ATOM   2958  C C     . ALA B 1 113 ? 176.416 0.855   21.966 1.00 35.49 ? 165  ALA D C     1 
ATOM   2959  O O     . ALA B 1 113 ? 176.346 2.042   22.289 1.00 34.69 ? 165  ALA D O     1 
ATOM   2960  C CB    . ALA B 1 113 ? 175.099 -0.994  22.991 1.00 32.96 ? 165  ALA D CB    1 
ATOM   2961  N N     . PHE B 1 114 ? 177.560 0.244   21.689 1.00 36.73 ? 166  PHE D N     1 
ATOM   2962  C CA    . PHE B 1 114 ? 178.838 0.927   21.759 1.00 37.56 ? 166  PHE D CA    1 
ATOM   2963  C C     . PHE B 1 114 ? 178.828 2.177   20.882 1.00 38.12 ? 166  PHE D C     1 
ATOM   2964  O O     . PHE B 1 114 ? 179.109 3.278   21.352 1.00 38.92 ? 166  PHE D O     1 
ATOM   2965  C CB    . PHE B 1 114 ? 179.923 -0.036  21.319 1.00 38.35 ? 166  PHE D CB    1 
ATOM   2966  C CG    . PHE B 1 114 ? 181.285 0.553   21.308 1.00 41.25 ? 166  PHE D CG    1 
ATOM   2967  C CD1   . PHE B 1 114 ? 181.634 1.532   20.379 1.00 43.27 ? 166  PHE D CD1   1 
ATOM   2968  C CD2   . PHE B 1 114 ? 182.244 0.098   22.197 1.00 42.93 ? 166  PHE D CD2   1 
ATOM   2969  C CE1   . PHE B 1 114 ? 182.921 2.042   20.337 1.00 43.10 ? 166  PHE D CE1   1 
ATOM   2970  C CE2   . PHE B 1 114 ? 183.535 0.600   22.163 1.00 43.85 ? 166  PHE D CE2   1 
ATOM   2971  C CZ    . PHE B 1 114 ? 183.875 1.573   21.231 1.00 44.43 ? 166  PHE D CZ    1 
ATOM   2972  N N     . ASP B 1 115 ? 178.504 2.000   19.607 1.00 38.06 ? 167  ASP D N     1 
ATOM   2973  C CA    . ASP B 1 115 ? 178.444 3.108   18.669 1.00 37.69 ? 167  ASP D CA    1 
ATOM   2974  C C     . ASP B 1 115 ? 177.612 4.246   19.209 1.00 38.64 ? 167  ASP D C     1 
ATOM   2975  O O     . ASP B 1 115 ? 177.980 5.410   19.086 1.00 40.21 ? 167  ASP D O     1 
ATOM   2976  C CB    . ASP B 1 115 ? 177.840 2.647   17.362 1.00 38.23 ? 167  ASP D CB    1 
ATOM   2977  C CG    . ASP B 1 115 ? 178.700 1.640   16.662 1.00 40.73 ? 167  ASP D CG    1 
ATOM   2978  O OD1   . ASP B 1 115 ? 178.327 1.229   15.548 1.00 41.80 ? 167  ASP D OD1   1 
ATOM   2979  O OD2   . ASP B 1 115 ? 179.752 1.262   17.226 1.00 42.27 ? 167  ASP D OD2   1 
ATOM   2980  N N     . ALA B 1 116 ? 176.481 3.906   19.808 1.00 38.66 ? 168  ALA D N     1 
ATOM   2981  C CA    . ALA B 1 116 ? 175.596 4.909   20.368 1.00 38.75 ? 168  ALA D CA    1 
ATOM   2982  C C     . ALA B 1 116 ? 176.285 5.775   21.424 1.00 39.78 ? 168  ALA D C     1 
ATOM   2983  O O     . ALA B 1 116 ? 176.369 6.997   21.267 1.00 40.70 ? 168  ALA D O     1 
ATOM   2984  C CB    . ALA B 1 116 ? 174.376 4.238   20.966 1.00 40.26 ? 168  ALA D CB    1 
ATOM   2985  N N     . VAL B 1 117 ? 176.778 5.149   22.495 1.00 39.86 ? 169  VAL D N     1 
ATOM   2986  C CA    . VAL B 1 117 ? 177.431 5.892   23.573 1.00 39.89 ? 169  VAL D CA    1 
ATOM   2987  C C     . VAL B 1 117 ? 178.719 6.520   23.065 1.00 39.04 ? 169  VAL D C     1 
ATOM   2988  O O     . VAL B 1 117 ? 179.211 7.510   23.614 1.00 38.56 ? 169  VAL D O     1 
ATOM   2989  C CB    . VAL B 1 117 ? 177.697 4.975   24.816 1.00 40.37 ? 169  VAL D CB    1 
ATOM   2990  C CG1   . VAL B 1 117 ? 178.371 3.708   24.378 1.00 41.43 ? 169  VAL D CG1   1 
ATOM   2991  C CG2   . VAL B 1 117 ? 178.528 5.709   25.871 1.00 38.44 ? 169  VAL D CG2   1 
ATOM   2992  N N     . GLN B 1 118 ? 179.240 5.956   21.984 1.00 38.10 ? 170  GLN D N     1 
ATOM   2993  C CA    . GLN B 1 118 ? 180.457 6.461   21.388 1.00 38.04 ? 170  GLN D CA    1 
ATOM   2994  C C     . GLN B 1 118 ? 180.221 7.817   20.743 1.00 38.70 ? 170  GLN D C     1 
ATOM   2995  O O     . GLN B 1 118 ? 180.993 8.751   20.951 1.00 39.59 ? 170  GLN D O     1 
ATOM   2996  C CB    . GLN B 1 118 ? 180.979 5.481   20.347 1.00 38.89 ? 170  GLN D CB    1 
ATOM   2997  C CG    . GLN B 1 118 ? 182.229 5.982   19.649 1.00 39.61 ? 170  GLN D CG    1 
ATOM   2998  C CD    . GLN B 1 118 ? 183.328 6.294   20.627 1.00 39.01 ? 170  GLN D CD    1 
ATOM   2999  O OE1   . GLN B 1 118 ? 184.085 7.243   20.440 1.00 39.23 ? 170  GLN D OE1   1 
ATOM   3000  N NE2   . GLN B 1 118 ? 183.427 5.494   21.681 1.00 39.97 ? 170  GLN D NE2   1 
ATOM   3001  N N     . SER B 1 119 ? 179.163 7.924   19.944 1.00 39.51 ? 171  SER D N     1 
ATOM   3002  C CA    . SER B 1 119 ? 178.837 9.189   19.296 1.00 39.17 ? 171  SER D CA    1 
ATOM   3003  C C     . SER B 1 119 ? 178.804 10.232  20.397 1.00 39.34 ? 171  SER D C     1 
ATOM   3004  O O     . SER B 1 119 ? 179.301 11.337  20.231 1.00 39.59 ? 171  SER D O     1 
ATOM   3005  C CB    . SER B 1 119 ? 177.459 9.125   18.657 1.00 39.02 ? 171  SER D CB    1 
ATOM   3006  O OG    . SER B 1 119 ? 176.462 9.199   19.663 1.00 38.86 ? 171  SER D OG    1 
ATOM   3007  N N     . LEU B 1 120 ? 178.207 9.865   21.526 1.00 39.00 ? 172  LEU D N     1 
ATOM   3008  C CA    . LEU B 1 120 ? 178.116 10.766  22.652 1.00 40.01 ? 172  LEU D CA    1 
ATOM   3009  C C     . LEU B 1 120 ? 179.493 11.173  23.166 1.00 41.56 ? 172  LEU D C     1 
ATOM   3010  O O     . LEU B 1 120 ? 179.719 12.353  23.442 1.00 43.25 ? 172  LEU D O     1 
ATOM   3011  C CB    . LEU B 1 120 ? 177.282 10.137  23.776 1.00 40.68 ? 172  LEU D CB    1 
ATOM   3012  C CG    . LEU B 1 120 ? 175.750 10.173  23.609 1.00 41.35 ? 172  LEU D CG    1 
ATOM   3013  C CD1   . LEU B 1 120 ? 175.083 9.512   24.802 1.00 40.40 ? 172  LEU D CD1   1 
ATOM   3014  C CD2   . LEU B 1 120 ? 175.263 11.624  23.484 1.00 40.49 ? 172  LEU D CD2   1 
ATOM   3015  N N     . ILE B 1 121 ? 180.416 10.215  23.289 1.00 42.15 ? 173  ILE D N     1 
ATOM   3016  C CA    . ILE B 1 121 ? 181.769 10.520  23.771 1.00 41.12 ? 173  ILE D CA    1 
ATOM   3017  C C     . ILE B 1 121 ? 182.388 11.588  22.878 1.00 42.10 ? 173  ILE D C     1 
ATOM   3018  O O     . ILE B 1 121 ? 183.019 12.529  23.361 1.00 42.56 ? 173  ILE D O     1 
ATOM   3019  C CB    . ILE B 1 121 ? 182.736 9.313   23.693 1.00 40.53 ? 173  ILE D CB    1 
ATOM   3020  C CG1   . ILE B 1 121 ? 182.112 8.048   24.285 1.00 40.73 ? 173  ILE D CG1   1 
ATOM   3021  C CG2   . ILE B 1 121 ? 184.022 9.660   24.415 1.00 37.46 ? 173  ILE D CG2   1 
ATOM   3022  C CD1   . ILE B 1 121 ? 182.104 7.989   25.778 1.00 42.06 ? 173  ILE D CD1   1 
ATOM   3023  N N     . ASP B 1 122 ? 182.214 11.418  21.571 1.00 42.49 ? 174  ASP D N     1 
ATOM   3024  C CA    . ASP B 1 122 ? 182.768 12.340  20.588 1.00 44.37 ? 174  ASP D CA    1 
ATOM   3025  C C     . ASP B 1 122 ? 182.337 13.778  20.818 1.00 44.85 ? 174  ASP D C     1 
ATOM   3026  O O     . ASP B 1 122 ? 183.142 14.695  20.727 1.00 44.69 ? 174  ASP D O     1 
ATOM   3027  C CB    . ASP B 1 122 ? 182.360 11.913  19.179 1.00 45.79 ? 174  ASP D CB    1 
ATOM   3028  C CG    . ASP B 1 122 ? 183.147 10.718  18.670 1.00 47.30 ? 174  ASP D CG    1 
ATOM   3029  O OD1   . ASP B 1 122 ? 183.437 9.795   19.460 1.00 47.84 ? 174  ASP D OD1   1 
ATOM   3030  O OD2   . ASP B 1 122 ? 183.459 10.697  17.458 1.00 50.10 ? 174  ASP D OD2   1 
ATOM   3031  N N     . SER B 1 123 ? 181.062 13.975  21.116 1.00 46.40 ? 175  SER D N     1 
ATOM   3032  C CA    . SER B 1 123 ? 180.539 15.310  21.347 1.00 47.75 ? 175  SER D CA    1 
ATOM   3033  C C     . SER B 1 123 ? 181.082 15.865  22.657 1.00 48.85 ? 175  SER D C     1 
ATOM   3034  O O     . SER B 1 123 ? 180.619 16.898  23.150 1.00 49.12 ? 175  SER D O     1 
ATOM   3035  C CB    . SER B 1 123 ? 179.021 15.256  21.386 1.00 48.10 ? 175  SER D CB    1 
ATOM   3036  O OG    . SER B 1 123 ? 178.544 14.468  20.314 1.00 50.28 ? 175  SER D OG    1 
ATOM   3037  N N     . GLY B 1 124 ? 182.058 15.160  23.221 1.00 49.08 ? 176  GLY D N     1 
ATOM   3038  C CA    . GLY B 1 124 ? 182.678 15.590  24.458 1.00 49.14 ? 176  GLY D CA    1 
ATOM   3039  C C     . GLY B 1 124 ? 181.895 15.278  25.714 1.00 50.15 ? 176  GLY D C     1 
ATOM   3040  O O     . GLY B 1 124 ? 181.952 16.036  26.688 1.00 51.50 ? 176  GLY D O     1 
ATOM   3041  N N     . HIS B 1 125 ? 181.161 14.172  25.710 1.00 49.83 ? 177  HIS D N     1 
ATOM   3042  C CA    . HIS B 1 125 ? 180.387 13.799  26.890 1.00 49.88 ? 177  HIS D CA    1 
ATOM   3043  C C     . HIS B 1 125 ? 181.244 12.900  27.768 1.00 50.17 ? 177  HIS D C     1 
ATOM   3044  O O     . HIS B 1 125 ? 181.847 11.943  27.277 1.00 51.12 ? 177  HIS D O     1 
ATOM   3045  C CB    . HIS B 1 125 ? 179.082 13.109  26.467 1.00 47.96 ? 177  HIS D CB    1 
ATOM   3046  C CG    . HIS B 1 125 ? 178.044 14.061  25.949 1.00 47.91 ? 177  HIS D CG    1 
ATOM   3047  N ND1   . HIS B 1 125 ? 177.289 14.866  26.779 1.00 46.87 ? 177  HIS D ND1   1 
ATOM   3048  C CD2   . HIS B 1 125 ? 177.670 14.374  24.685 1.00 47.33 ? 177  HIS D CD2   1 
ATOM   3049  C CE1   . HIS B 1 125 ? 176.496 15.631  26.050 1.00 45.78 ? 177  HIS D CE1   1 
ATOM   3050  N NE2   . HIS B 1 125 ? 176.708 15.352  24.776 1.00 45.96 ? 177  HIS D NE2   1 
ATOM   3051  N N     . LYS B 1 126 ? 181.335 13.229  29.055 1.00 49.73 ? 178  LYS D N     1 
ATOM   3052  C CA    . LYS B 1 126 ? 182.148 12.434  29.970 1.00 49.84 ? 178  LYS D CA    1 
ATOM   3053  C C     . LYS B 1 126 ? 181.263 11.632  30.884 1.00 48.94 ? 178  LYS D C     1 
ATOM   3054  O O     . LYS B 1 126 ? 181.466 10.437  31.059 1.00 51.02 ? 178  LYS D O     1 
ATOM   3055  C CB    . LYS B 1 126 ? 183.087 13.317  30.814 1.00 50.59 ? 178  LYS D CB    1 
ATOM   3056  C CG    . LYS B 1 126 ? 184.373 13.750  30.108 1.00 49.89 ? 178  LYS D CG    1 
ATOM   3057  C CD    . LYS B 1 126 ? 185.285 14.629  31.001 1.00 52.06 ? 178  LYS D CD    1 
ATOM   3058  C CE    . LYS B 1 126 ? 186.119 13.818  32.022 1.00 52.57 ? 178  LYS D CE    1 
ATOM   3059  N NZ    . LYS B 1 126 ? 187.221 14.611  32.688 1.00 50.18 ? 178  LYS D NZ    1 
ATOM   3060  N N     . ASN B 1 127 ? 180.277 12.286  31.475 1.00 47.93 ? 179  ASN D N     1 
ATOM   3061  C CA    . ASN B 1 127 ? 179.378 11.571  32.363 1.00 47.20 ? 179  ASN D CA    1 
ATOM   3062  C C     . ASN B 1 127 ? 178.098 11.171  31.623 1.00 45.14 ? 179  ASN D C     1 
ATOM   3063  O O     . ASN B 1 127 ? 177.096 11.891  31.600 1.00 45.22 ? 179  ASN D O     1 
ATOM   3064  C CB    . ASN B 1 127 ? 179.128 12.416  33.614 1.00 48.71 ? 179  ASN D CB    1 
ATOM   3065  C CG    . ASN B 1 127 ? 180.325 12.383  34.575 1.00 51.74 ? 179  ASN D CG    1 
ATOM   3066  O OD1   . ASN B 1 127 ? 180.695 13.401  35.168 1.00 52.31 ? 179  ASN D OD1   1 
ATOM   3067  N ND2   . ASN B 1 127 ? 180.934 11.198  34.729 1.00 52.20 ? 179  ASN D ND2   1 
ATOM   3068  N N     . ILE B 1 128 ? 178.186 9.995   31.001 1.00 42.55 ? 180  ILE D N     1 
ATOM   3069  C CA    . ILE B 1 128 ? 177.127 9.394   30.192 1.00 39.96 ? 180  ILE D CA    1 
ATOM   3070  C C     . ILE B 1 128 ? 176.448 8.258   30.950 1.00 37.83 ? 180  ILE D C     1 
ATOM   3071  O O     . ILE B 1 128 ? 177.112 7.348   31.411 1.00 37.42 ? 180  ILE D O     1 
ATOM   3072  C CB    . ILE B 1 128 ? 177.725 8.805   28.889 1.00 39.88 ? 180  ILE D CB    1 
ATOM   3073  C CG1   . ILE B 1 128 ? 178.448 9.899   28.093 1.00 37.91 ? 180  ILE D CG1   1 
ATOM   3074  C CG2   . ILE B 1 128 ? 176.631 8.148   28.073 1.00 40.29 ? 180  ILE D CG2   1 
ATOM   3075  C CD1   . ILE B 1 128 ? 179.096 9.412   26.823 1.00 39.46 ? 180  ILE D CD1   1 
ATOM   3076  N N     . ALA B 1 129 ? 175.127 8.289   31.064 1.00 37.27 ? 181  ALA D N     1 
ATOM   3077  C CA    . ALA B 1 129 ? 174.427 7.229   31.795 1.00 36.83 ? 181  ALA D CA    1 
ATOM   3078  C C     . ALA B 1 129 ? 173.752 6.223   30.871 1.00 37.01 ? 181  ALA D C     1 
ATOM   3079  O O     . ALA B 1 129 ? 173.796 6.353   29.642 1.00 37.16 ? 181  ALA D O     1 
ATOM   3080  C CB    . ALA B 1 129 ? 173.394 7.838   32.757 1.00 35.11 ? 181  ALA D CB    1 
ATOM   3081  N N     . PHE B 1 130 ? 173.134 5.212   31.473 1.00 36.95 ? 182  PHE D N     1 
ATOM   3082  C CA    . PHE B 1 130 ? 172.442 4.177   30.718 1.00 37.13 ? 182  PHE D CA    1 
ATOM   3083  C C     . PHE B 1 130 ? 171.142 3.770   31.389 1.00 37.30 ? 182  PHE D C     1 
ATOM   3084  O O     . PHE B 1 130 ? 171.145 3.247   32.506 1.00 37.48 ? 182  PHE D O     1 
ATOM   3085  C CB    . PHE B 1 130 ? 173.319 2.935   30.586 1.00 37.93 ? 182  PHE D CB    1 
ATOM   3086  C CG    . PHE B 1 130 ? 172.695 1.831   29.776 1.00 40.01 ? 182  PHE D CG    1 
ATOM   3087  C CD1   . PHE B 1 130 ? 173.007 0.491   30.044 1.00 39.99 ? 182  PHE D CD1   1 
ATOM   3088  C CD2   . PHE B 1 130 ? 171.834 2.121   28.713 1.00 39.65 ? 182  PHE D CD2   1 
ATOM   3089  C CE1   . PHE B 1 130 ? 172.477 -0.546  29.266 1.00 38.80 ? 182  PHE D CE1   1 
ATOM   3090  C CE2   . PHE B 1 130 ? 171.299 1.089   27.928 1.00 40.11 ? 182  PHE D CE2   1 
ATOM   3091  C CZ    . PHE B 1 130 ? 171.625 -0.249  28.206 1.00 38.85 ? 182  PHE D CZ    1 
ATOM   3092  N N     . VAL B 1 131 ? 170.031 4.025   30.713 1.00 37.23 ? 183  VAL D N     1 
ATOM   3093  C CA    . VAL B 1 131 ? 168.729 3.626   31.226 1.00 38.15 ? 183  VAL D CA    1 
ATOM   3094  C C     . VAL B 1 131 ? 168.411 2.334   30.472 1.00 38.86 ? 183  VAL D C     1 
ATOM   3095  O O     . VAL B 1 131 ? 167.990 2.341   29.309 1.00 38.97 ? 183  VAL D O     1 
ATOM   3096  C CB    . VAL B 1 131 ? 167.682 4.713   30.964 1.00 37.27 ? 183  VAL D CB    1 
ATOM   3097  C CG1   . VAL B 1 131 ? 166.286 4.188   31.231 1.00 36.97 ? 183  VAL D CG1   1 
ATOM   3098  C CG2   . VAL B 1 131 ? 167.974 5.894   31.863 1.00 38.02 ? 183  VAL D CG2   1 
ATOM   3099  N N     . SER B 1 132 ? 168.659 1.220   31.143 1.00 38.45 ? 184  SER D N     1 
ATOM   3100  C CA    . SER B 1 132 ? 168.455 -0.080  30.540 1.00 39.30 ? 184  SER D CA    1 
ATOM   3101  C C     . SER B 1 132 ? 167.189 -0.755  30.990 1.00 39.81 ? 184  SER D C     1 
ATOM   3102  O O     . SER B 1 132 ? 166.439 -0.220  31.801 1.00 39.93 ? 184  SER D O     1 
ATOM   3103  C CB    . SER B 1 132 ? 169.630 -1.000  30.868 1.00 39.11 ? 184  SER D CB    1 
ATOM   3104  O OG    . SER B 1 132 ? 169.320 -2.337  30.511 1.00 39.09 ? 184  SER D OG    1 
ATOM   3105  N N     . GLY B 1 133 ? 166.961 -1.941  30.439 1.00 40.10 ? 185  GLY D N     1 
ATOM   3106  C CA    . GLY B 1 133 ? 165.806 -2.721  30.814 1.00 40.99 ? 185  GLY D CA    1 
ATOM   3107  C C     . GLY B 1 133 ? 166.334 -3.865  31.655 1.00 41.58 ? 185  GLY D C     1 
ATOM   3108  O O     . GLY B 1 133 ? 167.548 -4.005  31.799 1.00 40.72 ? 185  GLY D O     1 
ATOM   3109  N N     . THR B 1 134 ? 165.427 -4.666  32.210 1.00 42.39 ? 186  THR D N     1 
ATOM   3110  C CA    . THR B 1 134 ? 165.773 -5.811  33.041 1.00 42.61 ? 186  THR D CA    1 
ATOM   3111  C C     . THR B 1 134 ? 167.173 -6.327  32.729 1.00 43.87 ? 186  THR D C     1 
ATOM   3112  O O     . THR B 1 134 ? 167.399 -6.941  31.689 1.00 44.58 ? 186  THR D O     1 
ATOM   3113  C CB    . THR B 1 134 ? 164.766 -6.929  32.814 1.00 42.96 ? 186  THR D CB    1 
ATOM   3114  O OG1   . THR B 1 134 ? 163.444 -6.375  32.835 1.00 45.09 ? 186  THR D OG1   1 
ATOM   3115  C CG2   . THR B 1 134 ? 164.886 -7.983  33.895 1.00 44.07 ? 186  THR D CG2   1 
ATOM   3116  N N     . LEU B 1 135 ? 168.113 -6.069  33.632 1.00 44.79 ? 187  LEU D N     1 
ATOM   3117  C CA    . LEU B 1 135 ? 169.495 -6.489  33.447 1.00 45.15 ? 187  LEU D CA    1 
ATOM   3118  C C     . LEU B 1 135 ? 169.596 -7.993  33.370 1.00 46.65 ? 187  LEU D C     1 
ATOM   3119  O O     . LEU B 1 135 ? 170.525 -8.525  32.763 1.00 47.45 ? 187  LEU D O     1 
ATOM   3120  C CB    . LEU B 1 135 ? 170.358 -5.996  34.605 1.00 44.04 ? 187  LEU D CB    1 
ATOM   3121  C CG    . LEU B 1 135 ? 170.499 -4.483  34.748 1.00 43.52 ? 187  LEU D CG    1 
ATOM   3122  C CD1   . LEU B 1 135 ? 170.375 -4.097  36.212 1.00 41.48 ? 187  LEU D CD1   1 
ATOM   3123  C CD2   . LEU B 1 135 ? 171.819 -4.026  34.137 1.00 42.24 ? 187  LEU D CD2   1 
ATOM   3124  N N     . GLU B 1 136 ? 168.644 -8.678  33.994 1.00 47.21 ? 188  GLU D N     1 
ATOM   3125  C CA    . GLU B 1 136 ? 168.651 -10.135 34.001 1.00 48.46 ? 188  GLU D CA    1 
ATOM   3126  C C     . GLU B 1 136 ? 168.615 -10.657 32.578 1.00 46.97 ? 188  GLU D C     1 
ATOM   3127  O O     . GLU B 1 136 ? 168.951 -11.809 32.336 1.00 48.17 ? 188  GLU D O     1 
ATOM   3128  C CB    . GLU B 1 136 ? 167.431 -10.690 34.743 1.00 52.54 ? 188  GLU D CB    1 
ATOM   3129  C CG    . GLU B 1 136 ? 166.950 -9.881  35.948 1.00 57.85 ? 188  GLU D CG    1 
ATOM   3130  C CD    . GLU B 1 136 ? 167.871 -9.991  37.140 1.00 60.69 ? 188  GLU D CD    1 
ATOM   3131  O OE1   . GLU B 1 136 ? 168.867 -9.229  37.193 1.00 61.91 ? 188  GLU D OE1   1 
ATOM   3132  O OE2   . GLU B 1 136 ? 167.596 -10.849 38.016 1.00 61.28 ? 188  GLU D OE2   1 
ATOM   3133  N N     . GLU B 1 137 ? 168.197 -9.815  31.639 1.00 44.96 ? 189  GLU D N     1 
ATOM   3134  C CA    . GLU B 1 137 ? 168.107 -10.229 30.246 1.00 44.98 ? 189  GLU D CA    1 
ATOM   3135  C C     . GLU B 1 137 ? 169.438 -10.140 29.515 1.00 43.62 ? 189  GLU D C     1 
ATOM   3136  O O     . GLU B 1 137 ? 170.130 -9.132  29.564 1.00 41.91 ? 189  GLU D O     1 
ATOM   3137  C CB    . GLU B 1 137 ? 167.035 -9.412  29.515 1.00 46.52 ? 189  GLU D CB    1 
ATOM   3138  C CG    . GLU B 1 137 ? 165.648 -9.584  30.135 1.00 49.88 ? 189  GLU D CG    1 
ATOM   3139  C CD    . GLU B 1 137 ? 164.524 -8.939  29.336 1.00 51.21 ? 189  GLU D CD    1 
ATOM   3140  O OE1   . GLU B 1 137 ? 163.366 -8.977  29.823 1.00 51.35 ? 189  GLU D OE1   1 
ATOM   3141  O OE2   . GLU B 1 137 ? 164.790 -8.404  28.232 1.00 51.54 ? 189  GLU D OE2   1 
ATOM   3142  N N     . PRO B 1 138 ? 169.809 -11.217 28.814 1.00 43.58 ? 190  PRO D N     1 
ATOM   3143  C CA    . PRO B 1 138 ? 171.059 -11.313 28.055 1.00 43.55 ? 190  PRO D CA    1 
ATOM   3144  C C     . PRO B 1 138 ? 171.375 -10.140 27.121 1.00 44.16 ? 190  PRO D C     1 
ATOM   3145  O O     . PRO B 1 138 ? 172.506 -9.649  27.101 1.00 44.43 ? 190  PRO D O     1 
ATOM   3146  C CB    . PRO B 1 138 ? 170.896 -12.631 27.305 1.00 42.25 ? 190  PRO D CB    1 
ATOM   3147  C CG    . PRO B 1 138 ? 170.060 -13.439 28.249 1.00 41.87 ? 190  PRO D CG    1 
ATOM   3148  C CD    . PRO B 1 138 ? 169.018 -12.452 28.678 1.00 41.66 ? 190  PRO D CD    1 
ATOM   3149  N N     . ILE B 1 139 ? 170.393 -9.706  26.336 1.00 44.17 ? 191  ILE D N     1 
ATOM   3150  C CA    . ILE B 1 139 ? 170.611 -8.596  25.418 1.00 44.83 ? 191  ILE D CA    1 
ATOM   3151  C C     . ILE B 1 139 ? 171.148 -7.405  26.214 1.00 46.04 ? 191  ILE D C     1 
ATOM   3152  O O     . ILE B 1 139 ? 171.930 -6.598  25.706 1.00 46.37 ? 191  ILE D O     1 
ATOM   3153  C CB    . ILE B 1 139 ? 169.292 -8.196  24.688 1.00 44.66 ? 191  ILE D CB    1 
ATOM   3154  C CG1   . ILE B 1 139 ? 169.544 -7.029  23.747 1.00 42.41 ? 191  ILE D CG1   1 
ATOM   3155  C CG2   . ILE B 1 139 ? 168.215 -7.809  25.697 1.00 45.15 ? 191  ILE D CG2   1 
ATOM   3156  C CD1   . ILE B 1 139 ? 168.303 -6.527  23.101 1.00 43.33 ? 191  ILE D CD1   1 
ATOM   3157  N N     . ASN B 1 140 ? 170.746 -7.315  27.477 1.00 46.34 ? 192  ASN D N     1 
ATOM   3158  C CA    . ASN B 1 140 ? 171.179 -6.219  28.323 1.00 46.50 ? 192  ASN D CA    1 
ATOM   3159  C C     . ASN B 1 140 ? 172.532 -6.457  28.955 1.00 47.28 ? 192  ASN D C     1 
ATOM   3160  O O     . ASN B 1 140 ? 173.536 -5.922  28.490 1.00 48.09 ? 192  ASN D O     1 
ATOM   3161  C CB    . ASN B 1 140 ? 170.149 -5.962  29.420 1.00 46.60 ? 192  ASN D CB    1 
ATOM   3162  C CG    . ASN B 1 140 ? 168.820 -5.532  28.869 1.00 44.99 ? 192  ASN D CG    1 
ATOM   3163  O OD1   . ASN B 1 140 ? 167.835 -5.433  29.597 1.00 45.92 ? 192  ASN D OD1   1 
ATOM   3164  N ND2   . ASN B 1 140 ? 168.780 -5.269  27.575 1.00 44.45 ? 192  ASN D ND2   1 
ATOM   3165  N N     . HIS B 1 141 ? 172.558 -7.268  30.010 1.00 48.09 ? 193  HIS D N     1 
ATOM   3166  C CA    . HIS B 1 141 ? 173.798 -7.534  30.722 1.00 48.20 ? 193  HIS D CA    1 
ATOM   3167  C C     . HIS B 1 141 ? 174.911 -8.038  29.820 1.00 47.75 ? 193  HIS D C     1 
ATOM   3168  O O     . HIS B 1 141 ? 176.066 -7.678  30.001 1.00 49.19 ? 193  HIS D O     1 
ATOM   3169  C CB    . HIS B 1 141 ? 173.572 -8.515  31.895 1.00 48.04 ? 193  HIS D CB    1 
ATOM   3170  C CG    . HIS B 1 141 ? 173.402 -9.952  31.490 1.00 49.87 ? 193  HIS D CG    1 
ATOM   3171  N ND1   . HIS B 1 141 ? 172.173 -10.578 31.450 1.00 50.90 ? 193  HIS D ND1   1 
ATOM   3172  C CD2   . HIS B 1 141 ? 174.311 -10.898 31.149 1.00 49.43 ? 193  HIS D CD2   1 
ATOM   3173  C CE1   . HIS B 1 141 ? 172.331 -11.844 31.107 1.00 48.31 ? 193  HIS D CE1   1 
ATOM   3174  N NE2   . HIS B 1 141 ? 173.619 -12.065 30.919 1.00 48.50 ? 193  HIS D NE2   1 
ATOM   3175  N N     . ALA B 1 142 ? 174.570 -8.833  28.821 1.00 47.18 ? 194  ALA D N     1 
ATOM   3176  C CA    . ALA B 1 142 ? 175.598 -9.376  27.953 1.00 47.57 ? 194  ALA D CA    1 
ATOM   3177  C C     . ALA B 1 142 ? 175.837 -8.697  26.604 1.00 46.51 ? 194  ALA D C     1 
ATOM   3178  O O     . ALA B 1 142 ? 176.710 -9.129  25.855 1.00 46.39 ? 194  ALA D O     1 
ATOM   3179  C CB    . ALA B 1 142 ? 175.333 -10.858 27.737 1.00 48.64 ? 194  ALA D CB    1 
ATOM   3180  N N     . LYS B 1 143 ? 175.093 -7.649  26.278 1.00 44.89 ? 195  LYS D N     1 
ATOM   3181  C CA    . LYS B 1 143 ? 175.310 -7.006  24.989 1.00 45.67 ? 195  LYS D CA    1 
ATOM   3182  C C     . LYS B 1 143 ? 175.291 -5.490  25.004 1.00 45.46 ? 195  LYS D C     1 
ATOM   3183  O O     . LYS B 1 143 ? 176.286 -4.853  24.657 1.00 45.77 ? 195  LYS D O     1 
ATOM   3184  C CB    . LYS B 1 143 ? 174.288 -7.512  23.975 1.00 46.16 ? 195  LYS D CB    1 
ATOM   3185  C CG    . LYS B 1 143 ? 174.385 -9.002  23.685 1.00 46.10 ? 195  LYS D CG    1 
ATOM   3186  C CD    . LYS B 1 143 ? 175.583 -9.354  22.824 1.00 45.18 ? 195  LYS D CD    1 
ATOM   3187  C CE    . LYS B 1 143 ? 175.628 -10.859 22.596 1.00 45.69 ? 195  LYS D CE    1 
ATOM   3188  N NZ    . LYS B 1 143 ? 176.684 -11.296 21.634 1.00 46.46 ? 195  LYS D NZ    1 
ATOM   3189  N N     . LYS B 1 144 ? 174.156 -4.914  25.383 1.00 45.49 ? 196  LYS D N     1 
ATOM   3190  C CA    . LYS B 1 144 ? 174.022 -3.465  25.434 1.00 45.42 ? 196  LYS D CA    1 
ATOM   3191  C C     . LYS B 1 144 ? 174.811 -2.895  26.606 1.00 46.02 ? 196  LYS D C     1 
ATOM   3192  O O     . LYS B 1 144 ? 175.672 -2.038  26.413 1.00 46.04 ? 196  LYS D O     1 
ATOM   3193  C CB    . LYS B 1 144 ? 172.549 -3.070  25.549 1.00 44.57 ? 196  LYS D CB    1 
ATOM   3194  C CG    . LYS B 1 144 ? 171.726 -3.361  24.311 1.00 43.69 ? 196  LYS D CG    1 
ATOM   3195  C CD    . LYS B 1 144 ? 170.243 -3.214  24.601 1.00 44.02 ? 196  LYS D CD    1 
ATOM   3196  C CE    . LYS B 1 144 ? 169.415 -3.170  23.330 1.00 43.31 ? 196  LYS D CE    1 
ATOM   3197  N NZ    . LYS B 1 144 ? 167.993 -2.822  23.622 1.00 42.88 ? 196  LYS D NZ    1 
ATOM   3198  N N     . VAL B 1 145 ? 174.530 -3.374  27.817 1.00 47.16 ? 197  VAL D N     1 
ATOM   3199  C CA    . VAL B 1 145 ? 175.241 -2.879  29.000 1.00 48.20 ? 197  VAL D CA    1 
ATOM   3200  C C     . VAL B 1 145 ? 176.739 -3.013  28.768 1.00 47.07 ? 197  VAL D C     1 
ATOM   3201  O O     . VAL B 1 145 ? 177.497 -2.071  28.982 1.00 46.14 ? 197  VAL D O     1 
ATOM   3202  C CB    . VAL B 1 145 ? 174.878 -3.671  30.291 1.00 49.25 ? 197  VAL D CB    1 
ATOM   3203  C CG1   . VAL B 1 145 ? 175.695 -3.136  31.466 1.00 49.59 ? 197  VAL D CG1   1 
ATOM   3204  C CG2   . VAL B 1 145 ? 173.388 -3.556  30.592 1.00 49.24 ? 197  VAL D CG2   1 
ATOM   3205  N N     . LYS B 1 146 ? 177.146 -4.195  28.316 1.00 46.35 ? 198  LYS D N     1 
ATOM   3206  C CA    . LYS B 1 146 ? 178.545 -4.489  28.043 1.00 45.64 ? 198  LYS D CA    1 
ATOM   3207  C C     . LYS B 1 146 ? 179.119 -3.409  27.132 1.00 46.05 ? 198  LYS D C     1 
ATOM   3208  O O     . LYS B 1 146 ? 180.033 -2.684  27.523 1.00 46.85 ? 198  LYS D O     1 
ATOM   3209  C CB    . LYS B 1 146 ? 178.665 -5.859  27.374 1.00 45.31 ? 198  LYS D CB    1 
ATOM   3210  C CG    . LYS B 1 146 ? 179.921 -6.635  27.724 1.00 47.21 ? 198  LYS D CG    1 
ATOM   3211  C CD    . LYS B 1 146 ? 179.634 -7.821  28.656 1.00 49.19 ? 198  LYS D CD    1 
ATOM   3212  C CE    . LYS B 1 146 ? 179.167 -7.394  30.054 1.00 50.81 ? 198  LYS D CE    1 
ATOM   3213  N NZ    . LYS B 1 146 ? 180.182 -6.618  30.840 1.00 52.67 ? 198  LYS D NZ    1 
ATOM   3214  N N     . GLY B 1 147 ? 178.572 -3.295  25.924 1.00 45.96 ? 199  GLY D N     1 
ATOM   3215  C CA    . GLY B 1 147 ? 179.043 -2.297  24.975 1.00 45.26 ? 199  GLY D CA    1 
ATOM   3216  C C     . GLY B 1 147 ? 179.075 -0.864  25.488 1.00 44.88 ? 199  GLY D C     1 
ATOM   3217  O O     . GLY B 1 147 ? 179.893 -0.050  25.037 1.00 45.12 ? 199  GLY D O     1 
ATOM   3218  N N     . TYR B 1 148 ? 178.181 -0.539  26.417 1.00 43.40 ? 200  TYR D N     1 
ATOM   3219  C CA    . TYR B 1 148 ? 178.143 0.806   26.984 1.00 41.85 ? 200  TYR D CA    1 
ATOM   3220  C C     . TYR B 1 148 ? 179.326 1.005   27.889 1.00 41.10 ? 200  TYR D C     1 
ATOM   3221  O O     . TYR B 1 148 ? 179.807 2.113   28.037 1.00 40.25 ? 200  TYR D O     1 
ATOM   3222  C CB    . TYR B 1 148 ? 176.869 1.022   27.790 1.00 40.97 ? 200  TYR D CB    1 
ATOM   3223  C CG    . TYR B 1 148 ? 176.970 2.084   28.862 1.00 38.71 ? 200  TYR D CG    1 
ATOM   3224  C CD1   . TYR B 1 148 ? 176.983 1.735   30.209 1.00 39.00 ? 200  TYR D CD1   1 
ATOM   3225  C CD2   . TYR B 1 148 ? 176.965 3.432   28.540 1.00 38.50 ? 200  TYR D CD2   1 
ATOM   3226  C CE1   . TYR B 1 148 ? 176.971 2.703   31.205 1.00 36.72 ? 200  TYR D CE1   1 
ATOM   3227  C CE2   . TYR B 1 148 ? 176.953 4.406   29.533 1.00 37.12 ? 200  TYR D CE2   1 
ATOM   3228  C CZ    . TYR B 1 148 ? 176.948 4.031   30.856 1.00 35.12 ? 200  TYR D CZ    1 
ATOM   3229  O OH    . TYR B 1 148 ? 176.843 4.981   31.830 1.00 34.82 ? 200  TYR D OH    1 
ATOM   3230  N N     . LYS B 1 149 ? 179.773 -0.078  28.512 1.00 41.60 ? 201  LYS D N     1 
ATOM   3231  C CA    . LYS B 1 149 ? 180.915 -0.019  29.406 1.00 42.84 ? 201  LYS D CA    1 
ATOM   3232  C C     . LYS B 1 149 ? 182.197 -0.027  28.597 1.00 44.48 ? 201  LYS D C     1 
ATOM   3233  O O     . LYS B 1 149 ? 183.214 0.544   29.009 1.00 45.95 ? 201  LYS D O     1 
ATOM   3234  C CB    . LYS B 1 149 ? 180.926 -1.207  30.366 1.00 41.27 ? 201  LYS D CB    1 
ATOM   3235  C CG    . LYS B 1 149 ? 180.020 -1.059  31.558 1.00 41.38 ? 201  LYS D CG    1 
ATOM   3236  C CD    . LYS B 1 149 ? 180.236 -2.210  32.511 1.00 43.69 ? 201  LYS D CD    1 
ATOM   3237  C CE    . LYS B 1 149 ? 179.052 -2.365  33.455 1.00 46.35 ? 201  LYS D CE    1 
ATOM   3238  N NZ    . LYS B 1 149 ? 179.136 -3.600  34.288 1.00 46.05 ? 201  LYS D NZ    1 
ATOM   3239  N N     . ARG B 1 150 ? 182.155 -0.672  27.440 1.00 44.61 ? 202  ARG D N     1 
ATOM   3240  C CA    . ARG B 1 150 ? 183.344 -0.735  26.626 1.00 43.70 ? 202  ARG D CA    1 
ATOM   3241  C C     . ARG B 1 150 ? 183.657 0.621   26.029 1.00 43.59 ? 202  ARG D C     1 
ATOM   3242  O O     . ARG B 1 150 ? 184.810 1.058   26.040 1.00 44.46 ? 202  ARG D O     1 
ATOM   3243  C CB    . ARG B 1 150 ? 183.193 -1.775  25.525 1.00 42.25 ? 202  ARG D CB    1 
ATOM   3244  C CG    . ARG B 1 150 ? 184.492 -1.991  24.796 1.00 40.86 ? 202  ARG D CG    1 
ATOM   3245  C CD    . ARG B 1 150 ? 184.485 -3.303  24.100 1.00 41.20 ? 202  ARG D CD    1 
ATOM   3246  N NE    . ARG B 1 150 ? 183.521 -3.331  23.013 1.00 41.99 ? 202  ARG D NE    1 
ATOM   3247  C CZ    . ARG B 1 150 ? 183.764 -2.878  21.791 1.00 43.03 ? 202  ARG D CZ    1 
ATOM   3248  N NH1   . ARG B 1 150 ? 184.948 -2.358  21.495 1.00 43.89 ? 202  ARG D NH1   1 
ATOM   3249  N NH2   . ARG B 1 150 ? 182.825 -2.963  20.859 1.00 44.29 ? 202  ARG D NH2   1 
ATOM   3250  N N     . ALA B 1 151 ? 182.632 1.293   25.518 1.00 43.11 ? 203  ALA D N     1 
ATOM   3251  C CA    . ALA B 1 151 ? 182.833 2.603   24.924 1.00 42.45 ? 203  ALA D CA    1 
ATOM   3252  C C     . ALA B 1 151 ? 183.388 3.530   25.991 1.00 42.18 ? 203  ALA D C     1 
ATOM   3253  O O     . ALA B 1 151 ? 184.328 4.290   25.746 1.00 41.61 ? 203  ALA D O     1 
ATOM   3254  C CB    . ALA B 1 151 ? 181.525 3.139   24.395 1.00 42.04 ? 203  ALA D CB    1 
ATOM   3255  N N     . LEU B 1 152 ? 182.803 3.447   27.179 1.00 42.44 ? 204  LEU D N     1 
ATOM   3256  C CA    . LEU B 1 152 ? 183.216 4.266   28.304 1.00 43.95 ? 204  LEU D CA    1 
ATOM   3257  C C     . LEU B 1 152 ? 184.674 3.980   28.689 1.00 46.63 ? 204  LEU D C     1 
ATOM   3258  O O     . LEU B 1 152 ? 185.486 4.905   28.776 1.00 47.60 ? 204  LEU D O     1 
ATOM   3259  C CB    . LEU B 1 152 ? 182.284 4.024   29.502 1.00 41.40 ? 204  LEU D CB    1 
ATOM   3260  C CG    . LEU B 1 152 ? 181.591 5.251   30.127 1.00 41.97 ? 204  LEU D CG    1 
ATOM   3261  C CD1   . LEU B 1 152 ? 180.950 6.086   29.021 1.00 40.71 ? 204  LEU D CD1   1 
ATOM   3262  C CD2   . LEU B 1 152 ? 180.529 4.823   31.162 1.00 38.81 ? 204  LEU D CD2   1 
ATOM   3263  N N     . THR B 1 153 ? 185.027 2.715   28.902 1.00 47.81 ? 205  THR D N     1 
ATOM   3264  C CA    . THR B 1 153 ? 186.403 2.417   29.285 1.00 49.82 ? 205  THR D CA    1 
ATOM   3265  C C     . THR B 1 153 ? 187.414 2.634   28.157 1.00 49.47 ? 205  THR D C     1 
ATOM   3266  O O     . THR B 1 153 ? 188.463 3.249   28.373 1.00 49.09 ? 205  THR D O     1 
ATOM   3267  C CB    . THR B 1 153 ? 186.569 0.974   29.815 1.00 50.48 ? 205  THR D CB    1 
ATOM   3268  O OG1   . THR B 1 153 ? 186.454 0.050   28.729 1.00 52.98 ? 205  THR D OG1   1 
ATOM   3269  C CG2   . THR B 1 153 ? 185.514 0.664   30.875 1.00 51.82 ? 205  THR D CG2   1 
ATOM   3270  N N     . GLU B 1 154 ? 187.116 2.144   26.960 1.00 47.94 ? 206  GLU D N     1 
ATOM   3271  C CA    . GLU B 1 154 ? 188.055 2.318   25.861 1.00 48.05 ? 206  GLU D CA    1 
ATOM   3272  C C     . GLU B 1 154 ? 188.375 3.786   25.613 1.00 48.63 ? 206  GLU D C     1 
ATOM   3273  O O     . GLU B 1 154 ? 189.372 4.124   24.960 1.00 47.79 ? 206  GLU D O     1 
ATOM   3274  C CB    . GLU B 1 154 ? 187.510 1.700   24.585 1.00 47.25 ? 206  GLU D CB    1 
ATOM   3275  C CG    . GLU B 1 154 ? 187.301 0.218   24.689 1.00 47.08 ? 206  GLU D CG    1 
ATOM   3276  C CD    . GLU B 1 154 ? 187.227 -0.422  23.329 1.00 48.03 ? 206  GLU D CD    1 
ATOM   3277  O OE1   . GLU B 1 154 ? 187.073 0.324   22.332 1.00 47.79 ? 206  GLU D OE1   1 
ATOM   3278  O OE2   . GLU B 1 154 ? 187.321 -1.667  23.253 1.00 48.58 ? 206  GLU D OE2   1 
ATOM   3279  N N     . SER B 1 155 ? 187.520 4.657   26.139 1.00 48.53 ? 207  SER D N     1 
ATOM   3280  C CA    . SER B 1 155 ? 187.704 6.089   25.981 1.00 47.60 ? 207  SER D CA    1 
ATOM   3281  C C     . SER B 1 155 ? 188.149 6.690   27.308 1.00 47.48 ? 207  SER D C     1 
ATOM   3282  O O     . SER B 1 155 ? 188.210 7.906   27.467 1.00 46.06 ? 207  SER D O     1 
ATOM   3283  C CB    . SER B 1 155 ? 186.400 6.721   25.518 1.00 47.27 ? 207  SER D CB    1 
ATOM   3284  O OG    . SER B 1 155 ? 186.522 8.124   25.487 1.00 49.86 ? 207  SER D OG    1 
ATOM   3285  N N     . GLY B 1 156 ? 188.446 5.811   28.260 1.00 48.39 ? 208  GLY D N     1 
ATOM   3286  C CA    . GLY B 1 156 ? 188.905 6.229   29.575 1.00 50.60 ? 208  GLY D CA    1 
ATOM   3287  C C     . GLY B 1 156 ? 187.922 7.015   30.416 1.00 51.39 ? 208  GLY D C     1 
ATOM   3288  O O     . GLY B 1 156 ? 188.225 8.120   30.854 1.00 51.46 ? 208  GLY D O     1 
ATOM   3289  N N     . LEU B 1 157 ? 186.753 6.442   30.670 1.00 52.62 ? 209  LEU D N     1 
ATOM   3290  C CA    . LEU B 1 157 ? 185.744 7.136   31.449 1.00 53.70 ? 209  LEU D CA    1 
ATOM   3291  C C     . LEU B 1 157 ? 185.283 6.341   32.662 1.00 53.84 ? 209  LEU D C     1 
ATOM   3292  O O     . LEU B 1 157 ? 185.246 5.110   32.631 1.00 54.61 ? 209  LEU D O     1 
ATOM   3293  C CB    . LEU B 1 157 ? 184.542 7.475   30.560 1.00 54.97 ? 209  LEU D CB    1 
ATOM   3294  C CG    . LEU B 1 157 ? 184.776 8.344   29.316 1.00 55.02 ? 209  LEU D CG    1 
ATOM   3295  C CD1   . LEU B 1 157 ? 183.436 8.664   28.692 1.00 55.54 ? 209  LEU D CD1   1 
ATOM   3296  C CD2   . LEU B 1 157 ? 185.479 9.637   29.681 1.00 55.58 ? 209  LEU D CD2   1 
ATOM   3297  N N     . PRO B 1 158 ? 184.902 7.047   33.741 1.00 53.44 ? 210  PRO D N     1 
ATOM   3298  C CA    . PRO B 1 158 ? 184.432 6.471   35.005 1.00 53.27 ? 210  PRO D CA    1 
ATOM   3299  C C     . PRO B 1 158 ? 183.095 5.731   34.934 1.00 52.66 ? 210  PRO D C     1 
ATOM   3300  O O     . PRO B 1 158 ? 182.032 6.344   35.056 1.00 52.85 ? 210  PRO D O     1 
ATOM   3301  C CB    . PRO B 1 158 ? 184.354 7.691   35.923 1.00 53.11 ? 210  PRO D CB    1 
ATOM   3302  C CG    . PRO B 1 158 ? 183.900 8.758   34.989 1.00 52.21 ? 210  PRO D CG    1 
ATOM   3303  C CD    . PRO B 1 158 ? 184.805 8.520   33.786 1.00 53.13 ? 210  PRO D CD    1 
ATOM   3304  N N     . VAL B 1 159 ? 183.151 4.415   34.763 1.00 51.28 ? 211  VAL D N     1 
ATOM   3305  C CA    . VAL B 1 159 ? 181.938 3.618   34.694 1.00 50.93 ? 211  VAL D CA    1 
ATOM   3306  C C     . VAL B 1 159 ? 181.206 3.636   36.041 1.00 51.92 ? 211  VAL D C     1 
ATOM   3307  O O     . VAL B 1 159 ? 181.351 2.729   36.857 1.00 52.41 ? 211  VAL D O     1 
ATOM   3308  C CB    . VAL B 1 159 ? 182.263 2.173   34.295 1.00 49.86 ? 211  VAL D CB    1 
ATOM   3309  C CG1   . VAL B 1 159 ? 180.983 1.404   34.064 1.00 50.26 ? 211  VAL D CG1   1 
ATOM   3310  C CG2   . VAL B 1 159 ? 183.119 2.165   33.031 1.00 50.40 ? 211  VAL D CG2   1 
ATOM   3311  N N     . ARG B 1 160 ? 180.412 4.685   36.246 1.00 52.98 ? 212  ARG D N     1 
ATOM   3312  C CA    . ARG B 1 160 ? 179.634 4.912   37.466 1.00 53.89 ? 212  ARG D CA    1 
ATOM   3313  C C     . ARG B 1 160 ? 178.484 3.914   37.654 1.00 53.69 ? 212  ARG D C     1 
ATOM   3314  O O     . ARG B 1 160 ? 177.517 3.937   36.906 1.00 53.74 ? 212  ARG D O     1 
ATOM   3315  C CB    . ARG B 1 160 ? 179.064 6.336   37.418 1.00 55.75 ? 212  ARG D CB    1 
ATOM   3316  C CG    . ARG B 1 160 ? 178.535 6.881   38.737 1.00 58.34 ? 212  ARG D CG    1 
ATOM   3317  C CD    . ARG B 1 160 ? 179.668 7.488   39.546 1.00 60.39 ? 212  ARG D CD    1 
ATOM   3318  N NE    . ARG B 1 160 ? 180.301 8.593   38.828 1.00 61.28 ? 212  ARG D NE    1 
ATOM   3319  C CZ    . ARG B 1 160 ? 180.074 9.878   39.084 1.00 61.51 ? 212  ARG D CZ    1 
ATOM   3320  N NH1   . ARG B 1 160 ? 179.226 10.222  40.048 1.00 61.50 ? 212  ARG D NH1   1 
ATOM   3321  N NH2   . ARG B 1 160 ? 180.696 10.818  38.380 1.00 59.54 ? 212  ARG D NH2   1 
ATOM   3322  N N     . ASP B 1 161 ? 178.569 3.055   38.664 1.00 54.35 ? 213  ASP D N     1 
ATOM   3323  C CA    . ASP B 1 161 ? 177.508 2.078   38.896 1.00 54.69 ? 213  ASP D CA    1 
ATOM   3324  C C     . ASP B 1 161 ? 176.118 2.680   39.024 1.00 53.82 ? 213  ASP D C     1 
ATOM   3325  O O     . ASP B 1 161 ? 175.133 2.025   38.683 1.00 54.59 ? 213  ASP D O     1 
ATOM   3326  C CB    . ASP B 1 161 ? 177.790 1.236   40.145 1.00 57.51 ? 213  ASP D CB    1 
ATOM   3327  C CG    . ASP B 1 161 ? 178.862 0.183   39.911 1.00 60.95 ? 213  ASP D CG    1 
ATOM   3328  O OD1   . ASP B 1 161 ? 178.753 -0.559  38.906 1.00 61.87 ? 213  ASP D OD1   1 
ATOM   3329  O OD2   . ASP B 1 161 ? 179.806 0.092   40.733 1.00 62.64 ? 213  ASP D OD2   1 
ATOM   3330  N N     . SER B 1 162 ? 176.023 3.911   39.517 1.00 52.47 ? 214  SER D N     1 
ATOM   3331  C CA    . SER B 1 162 ? 174.715 4.548   39.670 1.00 51.48 ? 214  SER D CA    1 
ATOM   3332  C C     . SER B 1 162 ? 174.275 5.269   38.397 1.00 49.56 ? 214  SER D C     1 
ATOM   3333  O O     . SER B 1 162 ? 173.260 5.954   38.394 1.00 50.40 ? 214  SER D O     1 
ATOM   3334  C CB    . SER B 1 162 ? 174.711 5.542   40.847 1.00 53.09 ? 214  SER D CB    1 
ATOM   3335  O OG    . SER B 1 162 ? 175.306 6.787   40.505 1.00 55.37 ? 214  SER D OG    1 
ATOM   3336  N N     . TYR B 1 163 ? 175.051 5.124   37.328 1.00 47.22 ? 215  TYR D N     1 
ATOM   3337  C CA    . TYR B 1 163 ? 174.730 5.738   36.039 1.00 45.48 ? 215  TYR D CA    1 
ATOM   3338  C C     . TYR B 1 163 ? 174.076 4.675   35.150 1.00 44.29 ? 215  TYR D C     1 
ATOM   3339  O O     . TYR B 1 163 ? 173.774 4.917   33.982 1.00 44.68 ? 215  TYR D O     1 
ATOM   3340  C CB    . TYR B 1 163 ? 176.005 6.252   35.360 1.00 45.06 ? 215  TYR D CB    1 
ATOM   3341  C CG    . TYR B 1 163 ? 176.327 7.725   35.572 1.00 45.22 ? 215  TYR D CG    1 
ATOM   3342  C CD1   . TYR B 1 163 ? 175.722 8.471   36.588 1.00 45.02 ? 215  TYR D CD1   1 
ATOM   3343  C CD2   . TYR B 1 163 ? 177.273 8.365   34.764 1.00 44.48 ? 215  TYR D CD2   1 
ATOM   3344  C CE1   . TYR B 1 163 ? 176.058 9.821   36.787 1.00 43.79 ? 215  TYR D CE1   1 
ATOM   3345  C CE2   . TYR B 1 163 ? 177.606 9.697   34.959 1.00 43.80 ? 215  TYR D CE2   1 
ATOM   3346  C CZ    . TYR B 1 163 ? 176.998 10.416  35.967 1.00 42.63 ? 215  TYR D CZ    1 
ATOM   3347  O OH    . TYR B 1 163 ? 177.333 11.731  36.142 1.00 42.76 ? 215  TYR D OH    1 
ATOM   3348  N N     . ILE B 1 164 ? 173.883 3.493   35.719 1.00 42.06 ? 216  ILE D N     1 
ATOM   3349  C CA    . ILE B 1 164 ? 173.266 2.375   35.027 1.00 40.28 ? 216  ILE D CA    1 
ATOM   3350  C C     . ILE B 1 164 ? 171.950 2.097   35.744 1.00 41.10 ? 216  ILE D C     1 
ATOM   3351  O O     . ILE B 1 164 ? 171.931 1.357   36.724 1.00 42.91 ? 216  ILE D O     1 
ATOM   3352  C CB    . ILE B 1 164 ? 174.171 1.126   35.114 1.00 38.89 ? 216  ILE D CB    1 
ATOM   3353  C CG1   . ILE B 1 164 ? 175.399 1.336   34.241 1.00 36.55 ? 216  ILE D CG1   1 
ATOM   3354  C CG2   . ILE B 1 164 ? 173.403 -0.144  34.715 1.00 36.02 ? 216  ILE D CG2   1 
ATOM   3355  C CD1   . ILE B 1 164 ? 176.288 0.116   34.156 1.00 40.27 ? 216  ILE D CD1   1 
ATOM   3356  N N     . VAL B 1 165 ? 170.855 2.690   35.276 1.00 40.37 ? 217  VAL D N     1 
ATOM   3357  C CA    . VAL B 1 165 ? 169.564 2.482   35.926 1.00 41.36 ? 217  VAL D CA    1 
ATOM   3358  C C     . VAL B 1 165 ? 168.728 1.453   35.200 1.00 42.89 ? 217  VAL D C     1 
ATOM   3359  O O     . VAL B 1 165 ? 168.626 1.486   33.975 1.00 43.86 ? 217  VAL D O     1 
ATOM   3360  C CB    . VAL B 1 165 ? 168.748 3.776   35.996 1.00 41.20 ? 217  VAL D CB    1 
ATOM   3361  C CG1   . VAL B 1 165 ? 167.379 3.490   36.559 1.00 41.15 ? 217  VAL D CG1   1 
ATOM   3362  C CG2   . VAL B 1 165 ? 169.460 4.792   36.853 1.00 41.02 ? 217  VAL D CG2   1 
ATOM   3363  N N     . GLU B 1 166 ? 168.126 0.545   35.965 1.00 44.52 ? 218  GLU D N     1 
ATOM   3364  C CA    . GLU B 1 166 ? 167.288 -0.511  35.404 1.00 45.00 ? 218  GLU D CA    1 
ATOM   3365  C C     . GLU B 1 166 ? 165.814 -0.114  35.410 1.00 45.47 ? 218  GLU D C     1 
ATOM   3366  O O     . GLU B 1 166 ? 165.207 0.101   36.464 1.00 44.75 ? 218  GLU D O     1 
ATOM   3367  C CB    . GLU B 1 166 ? 167.480 -1.824  36.188 1.00 46.74 ? 218  GLU D CB    1 
ATOM   3368  C CG    . GLU B 1 166 ? 166.599 -3.000  35.728 1.00 49.04 ? 218  GLU D CG    1 
ATOM   3369  C CD    . GLU B 1 166 ? 166.835 -4.285  36.531 1.00 50.52 ? 218  GLU D CD    1 
ATOM   3370  O OE1   . GLU B 1 166 ? 167.308 -5.285  35.940 1.00 50.29 ? 218  GLU D OE1   1 
ATOM   3371  O OE2   . GLU B 1 166 ? 166.549 -4.296  37.753 1.00 51.41 ? 218  GLU D OE2   1 
ATOM   3372  N N     . GLY B 1 167 ? 165.256 0.010   34.212 1.00 45.42 ? 219  GLY D N     1 
ATOM   3373  C CA    . GLY B 1 167 ? 163.854 0.339   34.068 1.00 44.39 ? 219  GLY D CA    1 
ATOM   3374  C C     . GLY B 1 167 ? 163.186 -0.968  33.694 1.00 43.59 ? 219  GLY D C     1 
ATOM   3375  O O     . GLY B 1 167 ? 163.817 -2.026  33.767 1.00 42.68 ? 219  GLY D O     1 
ATOM   3376  N N     . ASP B 1 168 ? 161.925 -0.910  33.286 1.00 42.90 ? 220  ASP D N     1 
ATOM   3377  C CA    . ASP B 1 168 ? 161.213 -2.119  32.909 1.00 41.83 ? 220  ASP D CA    1 
ATOM   3378  C C     . ASP B 1 168 ? 160.609 -2.039  31.507 1.00 40.36 ? 220  ASP D C     1 
ATOM   3379  O O     . ASP B 1 168 ? 159.535 -2.577  31.257 1.00 40.30 ? 220  ASP D O     1 
ATOM   3380  C CB    . ASP B 1 168 ? 160.115 -2.400  33.918 1.00 42.48 ? 220  ASP D CB    1 
ATOM   3381  C CG    . ASP B 1 168 ? 159.031 -1.357  33.884 1.00 44.77 ? 220  ASP D CG    1 
ATOM   3382  O OD1   . ASP B 1 168 ? 158.009 -1.557  34.578 1.00 46.19 ? 220  ASP D OD1   1 
ATOM   3383  O OD2   . ASP B 1 168 ? 159.201 -0.343  33.166 1.00 43.87 ? 220  ASP D OD2   1 
ATOM   3384  N N     . TYR B 1 169 ? 161.301 -1.365  30.596 1.00 38.67 ? 221  TYR D N     1 
ATOM   3385  C CA    . TYR B 1 169 ? 160.834 -1.240  29.222 1.00 37.91 ? 221  TYR D CA    1 
ATOM   3386  C C     . TYR B 1 169 ? 159.574 -0.387  29.050 1.00 37.94 ? 221  TYR D C     1 
ATOM   3387  O O     . TYR B 1 169 ? 159.141 -0.148  27.921 1.00 39.45 ? 221  TYR D O     1 
ATOM   3388  C CB    . TYR B 1 169 ? 160.576 -2.620  28.619 1.00 36.75 ? 221  TYR D CB    1 
ATOM   3389  C CG    . TYR B 1 169 ? 161.812 -3.449  28.381 1.00 36.67 ? 221  TYR D CG    1 
ATOM   3390  C CD1   . TYR B 1 169 ? 161.970 -4.691  29.008 1.00 36.07 ? 221  TYR D CD1   1 
ATOM   3391  C CD2   . TYR B 1 169 ? 162.816 -3.014  27.503 1.00 36.65 ? 221  TYR D CD2   1 
ATOM   3392  C CE1   . TYR B 1 169 ? 163.092 -5.487  28.768 1.00 34.91 ? 221  TYR D CE1   1 
ATOM   3393  C CE2   . TYR B 1 169 ? 163.951 -3.804  27.254 1.00 35.27 ? 221  TYR D CE2   1 
ATOM   3394  C CZ    . TYR B 1 169 ? 164.075 -5.040  27.893 1.00 35.59 ? 221  TYR D CZ    1 
ATOM   3395  O OH    . TYR B 1 169 ? 165.170 -5.829  27.657 1.00 34.85 ? 221  TYR D OH    1 
ATOM   3396  N N     . THR B 1 170 ? 158.975 0.061   30.149 1.00 36.62 ? 222  THR D N     1 
ATOM   3397  C CA    . THR B 1 170 ? 157.787 0.903   30.041 1.00 34.90 ? 222  THR D CA    1 
ATOM   3398  C C     . THR B 1 170 ? 158.161 2.385   30.000 1.00 34.85 ? 222  THR D C     1 
ATOM   3399  O O     . THR B 1 170 ? 159.128 2.831   30.620 1.00 33.57 ? 222  THR D O     1 
ATOM   3400  C CB    . THR B 1 170 ? 156.816 0.708   31.219 1.00 33.08 ? 222  THR D CB    1 
ATOM   3401  O OG1   . THR B 1 170 ? 157.360 1.323   32.392 1.00 35.03 ? 222  THR D OG1   1 
ATOM   3402  C CG2   . THR B 1 170 ? 156.596 -0.749  31.486 1.00 32.54 ? 222  THR D CG2   1 
ATOM   3403  N N     . TYR B 1 171 ? 157.378 3.143   29.251 1.00 35.55 ? 223  TYR D N     1 
ATOM   3404  C CA    . TYR B 1 171 ? 157.588 4.569   29.125 1.00 36.75 ? 223  TYR D CA    1 
ATOM   3405  C C     . TYR B 1 171 ? 157.750 5.193   30.503 1.00 37.73 ? 223  TYR D C     1 
ATOM   3406  O O     . TYR B 1 171 ? 158.502 6.141   30.669 1.00 38.44 ? 223  TYR D O     1 
ATOM   3407  C CB    . TYR B 1 171 ? 156.390 5.192   28.397 1.00 36.90 ? 223  TYR D CB    1 
ATOM   3408  C CG    . TYR B 1 171 ? 156.239 6.684   28.566 1.00 36.24 ? 223  TYR D CG    1 
ATOM   3409  C CD1   . TYR B 1 171 ? 157.084 7.582   27.908 1.00 35.64 ? 223  TYR D CD1   1 
ATOM   3410  C CD2   . TYR B 1 171 ? 155.244 7.201   29.384 1.00 35.18 ? 223  TYR D CD2   1 
ATOM   3411  C CE1   . TYR B 1 171 ? 156.932 8.959   28.065 1.00 33.30 ? 223  TYR D CE1   1 
ATOM   3412  C CE2   . TYR B 1 171 ? 155.091 8.570   29.543 1.00 34.40 ? 223  TYR D CE2   1 
ATOM   3413  C CZ    . TYR B 1 171 ? 155.935 9.438   28.883 1.00 32.49 ? 223  TYR D CZ    1 
ATOM   3414  O OH    . TYR B 1 171 ? 155.775 10.786  29.059 1.00 31.72 ? 223  TYR D OH    1 
ATOM   3415  N N     . ASP B 1 172 ? 157.051 4.657   31.493 1.00 39.33 ? 224  ASP D N     1 
ATOM   3416  C CA    . ASP B 1 172 ? 157.134 5.208   32.833 1.00 41.42 ? 224  ASP D CA    1 
ATOM   3417  C C     . ASP B 1 172 ? 158.465 5.063   33.550 1.00 42.41 ? 224  ASP D C     1 
ATOM   3418  O O     . ASP B 1 172 ? 158.934 6.024   34.163 1.00 41.87 ? 224  ASP D O     1 
ATOM   3419  C CB    . ASP B 1 172 ? 156.044 4.622   33.713 1.00 43.89 ? 224  ASP D CB    1 
ATOM   3420  C CG    . ASP B 1 172 ? 154.743 5.360   33.579 1.00 46.95 ? 224  ASP D CG    1 
ATOM   3421  O OD1   . ASP B 1 172 ? 154.762 6.611   33.654 1.00 47.61 ? 224  ASP D OD1   1 
ATOM   3422  O OD2   . ASP B 1 172 ? 153.699 4.691   33.407 1.00 50.75 ? 224  ASP D OD2   1 
ATOM   3423  N N     . SER B 1 173 ? 159.065 3.872   33.497 1.00 42.86 ? 225  SER D N     1 
ATOM   3424  C CA    . SER B 1 173 ? 160.345 3.645   34.172 1.00 42.20 ? 225  SER D CA    1 
ATOM   3425  C C     . SER B 1 173 ? 161.424 4.572   33.638 1.00 41.87 ? 225  SER D C     1 
ATOM   3426  O O     . SER B 1 173 ? 162.402 4.849   34.326 1.00 43.12 ? 225  SER D O     1 
ATOM   3427  C CB    . SER B 1 173 ? 160.803 2.189   34.023 1.00 40.51 ? 225  SER D CB    1 
ATOM   3428  O OG    . SER B 1 173 ? 161.144 1.890   32.689 1.00 40.21 ? 225  SER D OG    1 
ATOM   3429  N N     . GLY B 1 174 ? 161.235 5.046   32.411 1.00 41.77 ? 226  GLY D N     1 
ATOM   3430  C CA    . GLY B 1 174 ? 162.191 5.947   31.799 1.00 41.94 ? 226  GLY D CA    1 
ATOM   3431  C C     . GLY B 1 174 ? 162.083 7.325   32.412 1.00 42.64 ? 226  GLY D C     1 
ATOM   3432  O O     . GLY B 1 174 ? 163.061 8.073   32.447 1.00 41.22 ? 226  GLY D O     1 
ATOM   3433  N N     . ILE B 1 175 ? 160.881 7.661   32.875 1.00 43.85 ? 227  ILE D N     1 
ATOM   3434  C CA    . ILE B 1 175 ? 160.616 8.938   33.529 1.00 45.96 ? 227  ILE D CA    1 
ATOM   3435  C C     . ILE B 1 175 ? 161.331 8.838   34.868 1.00 47.68 ? 227  ILE D C     1 
ATOM   3436  O O     . ILE B 1 175 ? 162.155 9.682   35.234 1.00 48.82 ? 227  ILE D O     1 
ATOM   3437  C CB    . ILE B 1 175 ? 159.108 9.120   33.826 1.00 46.24 ? 227  ILE D CB    1 
ATOM   3438  C CG1   . ILE B 1 175 ? 158.325 9.329   32.537 1.00 46.49 ? 227  ILE D CG1   1 
ATOM   3439  C CG2   . ILE B 1 175 ? 158.895 10.308  34.746 1.00 46.29 ? 227  ILE D CG2   1 
ATOM   3440  C CD1   . ILE B 1 175 ? 158.474 10.717  31.981 1.00 45.77 ? 227  ILE D CD1   1 
ATOM   3441  N N     . GLU B 1 176 ? 161.000 7.775   35.589 1.00 48.28 ? 228  GLU D N     1 
ATOM   3442  C CA    . GLU B 1 176 ? 161.566 7.515   36.894 1.00 49.43 ? 228  GLU D CA    1 
ATOM   3443  C C     . GLU B 1 176 ? 163.095 7.517   36.820 1.00 48.69 ? 228  GLU D C     1 
ATOM   3444  O O     . GLU B 1 176 ? 163.767 8.192   37.601 1.00 50.37 ? 228  GLU D O     1 
ATOM   3445  C CB    . GLU B 1 176 ? 161.074 6.159   37.422 1.00 52.01 ? 228  GLU D CB    1 
ATOM   3446  C CG    . GLU B 1 176 ? 159.621 5.795   37.088 1.00 55.82 ? 228  GLU D CG    1 
ATOM   3447  C CD    . GLU B 1 176 ? 158.588 6.634   37.831 1.00 59.19 ? 228  GLU D CD    1 
ATOM   3448  O OE1   . GLU B 1 176 ? 157.368 6.442   37.585 1.00 61.57 ? 228  GLU D OE1   1 
ATOM   3449  O OE2   . GLU B 1 176 ? 158.988 7.480   38.660 1.00 60.43 ? 228  GLU D OE2   1 
ATOM   3450  N N     . ALA B 1 177 ? 163.648 6.764   35.884 1.00 46.86 ? 229  ALA D N     1 
ATOM   3451  C CA    . ALA B 1 177 ? 165.092 6.705   35.755 1.00 46.83 ? 229  ALA D CA    1 
ATOM   3452  C C     . ALA B 1 177 ? 165.755 8.083   35.615 1.00 47.82 ? 229  ALA D C     1 
ATOM   3453  O O     . ALA B 1 177 ? 166.874 8.285   36.092 1.00 47.39 ? 229  ALA D O     1 
ATOM   3454  C CB    . ALA B 1 177 ? 165.463 5.827   34.585 1.00 46.38 ? 229  ALA D CB    1 
ATOM   3455  N N     . VAL B 1 178 ? 165.083 9.036   34.972 1.00 48.97 ? 230  VAL D N     1 
ATOM   3456  C CA    . VAL B 1 178 ? 165.682 10.356  34.808 1.00 49.67 ? 230  VAL D CA    1 
ATOM   3457  C C     . VAL B 1 178 ? 165.742 11.025  36.150 1.00 50.13 ? 230  VAL D C     1 
ATOM   3458  O O     . VAL B 1 178 ? 166.799 11.496  36.569 1.00 49.31 ? 230  VAL D O     1 
ATOM   3459  C CB    . VAL B 1 178 ? 164.875 11.280  33.905 1.00 50.04 ? 230  VAL D CB    1 
ATOM   3460  C CG1   . VAL B 1 178 ? 165.767 12.411  33.435 1.00 51.26 ? 230  VAL D CG1   1 
ATOM   3461  C CG2   . VAL B 1 178 ? 164.311 10.522  32.743 1.00 50.95 ? 230  VAL D CG2   1 
ATOM   3462  N N     . GLU B 1 179 ? 164.591 11.074  36.816 1.00 51.60 ? 231  GLU D N     1 
ATOM   3463  C CA    . GLU B 1 179 ? 164.504 11.683  38.135 1.00 53.21 ? 231  GLU D CA    1 
ATOM   3464  C C     . GLU B 1 179 ? 165.638 11.145  38.982 1.00 52.73 ? 231  GLU D C     1 
ATOM   3465  O O     . GLU B 1 179 ? 166.374 11.910  39.596 1.00 51.80 ? 231  GLU D O     1 
ATOM   3466  C CB    . GLU B 1 179 ? 163.168 11.362  38.804 1.00 55.50 ? 231  GLU D CB    1 
ATOM   3467  C CG    . GLU B 1 179 ? 162.024 12.258  38.381 1.00 59.97 ? 231  GLU D CG    1 
ATOM   3468  C CD    . GLU B 1 179 ? 160.756 11.989  39.180 1.00 64.18 ? 231  GLU D CD    1 
ATOM   3469  O OE1   . GLU B 1 179 ? 160.216 10.858  39.086 1.00 65.63 ? 231  GLU D OE1   1 
ATOM   3470  O OE2   . GLU B 1 179 ? 160.305 12.909  39.904 1.00 65.86 ? 231  GLU D OE2   1 
ATOM   3471  N N     . LYS B 1 180 ? 165.783 9.825   38.998 1.00 53.78 ? 232  LYS D N     1 
ATOM   3472  C CA    . LYS B 1 180 ? 166.846 9.197   39.768 1.00 55.56 ? 232  LYS D CA    1 
ATOM   3473  C C     . LYS B 1 180 ? 168.216 9.717   39.335 1.00 55.71 ? 232  LYS D C     1 
ATOM   3474  O O     . LYS B 1 180 ? 169.028 10.120  40.166 1.00 55.44 ? 232  LYS D O     1 
ATOM   3475  C CB    . LYS B 1 180 ? 166.783 7.680   39.614 1.00 56.39 ? 232  LYS D CB    1 
ATOM   3476  C CG    . LYS B 1 180 ? 167.972 6.962   40.214 1.00 60.28 ? 232  LYS D CG    1 
ATOM   3477  C CD    . LYS B 1 180 ? 167.765 5.451   40.262 1.00 64.27 ? 232  LYS D CD    1 
ATOM   3478  C CE    . LYS B 1 180 ? 166.798 5.045   41.373 1.00 66.88 ? 232  LYS D CE    1 
ATOM   3479  N NZ    . LYS B 1 180 ? 167.295 5.443   42.732 1.00 68.67 ? 232  LYS D NZ    1 
ATOM   3480  N N     . LEU B 1 181 ? 168.471 9.716   38.033 1.00 56.61 ? 233  LEU D N     1 
ATOM   3481  C CA    . LEU B 1 181 ? 169.745 10.205  37.533 1.00 57.05 ? 233  LEU D CA    1 
ATOM   3482  C C     . LEU B 1 181 ? 169.938 11.671  37.924 1.00 57.37 ? 233  LEU D C     1 
ATOM   3483  O O     . LEU B 1 181 ? 171.055 12.118  38.161 1.00 57.66 ? 233  LEU D O     1 
ATOM   3484  C CB    . LEU B 1 181 ? 169.815 10.031  36.008 1.00 56.93 ? 233  LEU D CB    1 
ATOM   3485  C CG    . LEU B 1 181 ? 170.157 8.622   35.491 1.00 56.13 ? 233  LEU D CG    1 
ATOM   3486  C CD1   . LEU B 1 181 ? 169.828 8.497   34.015 1.00 54.62 ? 233  LEU D CD1   1 
ATOM   3487  C CD2   . LEU B 1 181 ? 171.632 8.338   35.723 1.00 55.05 ? 233  LEU D CD2   1 
ATOM   3488  N N     . LEU B 1 182 ? 168.847 12.419  38.010 1.00 58.03 ? 234  LEU D N     1 
ATOM   3489  C CA    . LEU B 1 182 ? 168.947 13.825  38.371 1.00 58.47 ? 234  LEU D CA    1 
ATOM   3490  C C     . LEU B 1 182 ? 169.171 14.002  39.860 1.00 58.81 ? 234  LEU D C     1 
ATOM   3491  O O     . LEU B 1 182 ? 169.530 15.087  40.314 1.00 59.86 ? 234  LEU D O     1 
ATOM   3492  C CB    . LEU B 1 182 ? 167.688 14.577  37.940 1.00 58.07 ? 234  LEU D CB    1 
ATOM   3493  C CG    . LEU B 1 182 ? 167.541 14.721  36.424 1.00 59.02 ? 234  LEU D CG    1 
ATOM   3494  C CD1   . LEU B 1 182 ? 166.162 15.276  36.097 1.00 59.73 ? 234  LEU D CD1   1 
ATOM   3495  C CD2   . LEU B 1 182 ? 168.645 15.624  35.874 1.00 58.44 ? 234  LEU D CD2   1 
ATOM   3496  N N     . GLU B 1 183 ? 168.956 12.939  40.623 1.00 58.48 ? 235  GLU D N     1 
ATOM   3497  C CA    . GLU B 1 183 ? 169.154 13.008  42.063 1.00 58.78 ? 235  GLU D CA    1 
ATOM   3498  C C     . GLU B 1 183 ? 170.613 12.696  42.354 1.00 58.16 ? 235  GLU D C     1 
ATOM   3499  O O     . GLU B 1 183 ? 171.070 12.792  43.489 1.00 58.58 ? 235  GLU D O     1 
ATOM   3500  C CB    . GLU B 1 183 ? 168.245 12.004  42.787 1.00 60.04 ? 235  GLU D CB    1 
ATOM   3501  C CG    . GLU B 1 183 ? 166.744 12.244  42.585 1.00 63.03 ? 235  GLU D CG    1 
ATOM   3502  C CD    . GLU B 1 183 ? 166.253 13.574  43.158 1.00 64.54 ? 235  GLU D CD    1 
ATOM   3503  O OE1   . GLU B 1 183 ? 165.126 14.004  42.805 1.00 63.93 ? 235  GLU D OE1   1 
ATOM   3504  O OE2   . GLU B 1 183 ? 166.986 14.182  43.968 1.00 66.00 ? 235  GLU D OE2   1 
ATOM   3505  N N     . GLU B 1 184 ? 171.343 12.328  41.311 1.00 57.62 ? 236  GLU D N     1 
ATOM   3506  C CA    . GLU B 1 184 ? 172.751 11.996  41.444 1.00 57.76 ? 236  GLU D CA    1 
ATOM   3507  C C     . GLU B 1 184 ? 173.563 13.258  41.777 1.00 57.75 ? 236  GLU D C     1 
ATOM   3508  O O     . GLU B 1 184 ? 173.219 14.361  41.340 1.00 57.75 ? 236  GLU D O     1 
ATOM   3509  C CB    . GLU B 1 184 ? 173.245 11.371  40.132 1.00 58.41 ? 236  GLU D CB    1 
ATOM   3510  C CG    . GLU B 1 184 ? 174.267 10.245  40.288 1.00 60.03 ? 236  GLU D CG    1 
ATOM   3511  C CD    . GLU B 1 184 ? 173.708 9.024   41.013 1.00 60.71 ? 236  GLU D CD    1 
ATOM   3512  O OE1   . GLU B 1 184 ? 172.660 8.492   40.585 1.00 61.23 ? 236  GLU D OE1   1 
ATOM   3513  O OE2   . GLU B 1 184 ? 174.324 8.592   42.010 1.00 60.81 ? 236  GLU D OE2   1 
ATOM   3514  N N     . ASP B 1 185 ? 174.626 13.094  42.564 1.00 57.54 ? 237  ASP D N     1 
ATOM   3515  C CA    . ASP B 1 185 ? 175.490 14.218  42.934 1.00 58.21 ? 237  ASP D CA    1 
ATOM   3516  C C     . ASP B 1 185 ? 176.157 14.741  41.678 1.00 57.43 ? 237  ASP D C     1 
ATOM   3517  O O     . ASP B 1 185 ? 176.268 15.948  41.470 1.00 59.09 ? 237  ASP D O     1 
ATOM   3518  C CB    . ASP B 1 185 ? 176.565 13.781  43.938 1.00 59.45 ? 237  ASP D CB    1 
ATOM   3519  C CG    . ASP B 1 185 ? 176.041 13.727  45.363 1.00 61.33 ? 237  ASP D CG    1 
ATOM   3520  O OD1   . ASP B 1 185 ? 175.549 14.774  45.842 1.00 61.88 ? 237  ASP D OD1   1 
ATOM   3521  O OD2   . ASP B 1 185 ? 176.116 12.650  46.002 1.00 60.99 ? 237  ASP D OD2   1 
ATOM   3522  N N     . GLU B 1 186 ? 176.615 13.811  40.854 1.00 55.26 ? 238  GLU D N     1 
ATOM   3523  C CA    . GLU B 1 186 ? 177.244 14.147  39.598 1.00 54.75 ? 238  GLU D CA    1 
ATOM   3524  C C     . GLU B 1 186 ? 176.193 13.895  38.521 1.00 53.80 ? 238  GLU D C     1 
ATOM   3525  O O     . GLU B 1 186 ? 175.888 12.747  38.201 1.00 56.48 ? 238  GLU D O     1 
ATOM   3526  C CB    . GLU B 1 186 ? 178.473 13.262  39.391 1.00 56.46 ? 238  GLU D CB    1 
ATOM   3527  C CG    . GLU B 1 186 ? 179.774 13.984  39.690 1.00 58.60 ? 238  GLU D CG    1 
ATOM   3528  C CD    . GLU B 1 186 ? 179.975 15.186  38.771 1.00 60.45 ? 238  GLU D CD    1 
ATOM   3529  O OE1   . GLU B 1 186 ? 180.662 15.048  37.732 1.00 59.68 ? 238  GLU D OE1   1 
ATOM   3530  O OE2   . GLU B 1 186 ? 179.426 16.269  39.080 1.00 61.44 ? 238  GLU D OE2   1 
ATOM   3531  N N     . LYS B 1 187 ? 175.626 14.957  37.964 1.00 50.74 ? 239  LYS D N     1 
ATOM   3532  C CA    . LYS B 1 187 ? 174.584 14.787  36.957 1.00 48.21 ? 239  LYS D CA    1 
ATOM   3533  C C     . LYS B 1 187 ? 175.103 14.443  35.564 1.00 44.99 ? 239  LYS D C     1 
ATOM   3534  O O     . LYS B 1 187 ? 176.033 15.070  35.072 1.00 44.00 ? 239  LYS D O     1 
ATOM   3535  C CB    . LYS B 1 187 ? 173.692 16.042  36.913 1.00 49.04 ? 239  LYS D CB    1 
ATOM   3536  C CG    . LYS B 1 187 ? 172.933 16.290  38.228 1.00 50.80 ? 239  LYS D CG    1 
ATOM   3537  C CD    . LYS B 1 187 ? 171.851 17.363  38.106 1.00 53.53 ? 239  LYS D CD    1 
ATOM   3538  C CE    . LYS B 1 187 ? 171.127 17.581  39.447 1.00 56.08 ? 239  LYS D CE    1 
ATOM   3539  N NZ    . LYS B 1 187 ? 170.078 18.659  39.435 1.00 56.00 ? 239  LYS D NZ    1 
ATOM   3540  N N     . PRO B 1 188 ? 174.507 13.425  34.913 1.00 43.27 ? 240  PRO D N     1 
ATOM   3541  C CA    . PRO B 1 188 ? 174.942 13.032  33.568 1.00 42.32 ? 240  PRO D CA    1 
ATOM   3542  C C     . PRO B 1 188 ? 174.742 14.164  32.574 1.00 42.65 ? 240  PRO D C     1 
ATOM   3543  O O     . PRO B 1 188 ? 173.759 14.907  32.638 1.00 41.99 ? 240  PRO D O     1 
ATOM   3544  C CB    . PRO B 1 188 ? 174.052 11.840  33.236 1.00 41.07 ? 240  PRO D CB    1 
ATOM   3545  C CG    . PRO B 1 188 ? 173.673 11.301  34.572 1.00 42.44 ? 240  PRO D CG    1 
ATOM   3546  C CD    . PRO B 1 188 ? 173.440 12.535  35.397 1.00 41.60 ? 240  PRO D CD    1 
ATOM   3547  N N     . THR B 1 189 ? 175.687 14.283  31.654 1.00 42.91 ? 241  THR D N     1 
ATOM   3548  C CA    . THR B 1 189 ? 175.648 15.306  30.632 1.00 42.81 ? 241  THR D CA    1 
ATOM   3549  C C     . THR B 1 189 ? 174.864 14.751  29.428 1.00 42.85 ? 241  THR D C     1 
ATOM   3550  O O     . THR B 1 189 ? 174.468 15.483  28.518 1.00 43.99 ? 241  THR D O     1 
ATOM   3551  C CB    . THR B 1 189 ? 177.105 15.721  30.280 1.00 43.30 ? 241  THR D CB    1 
ATOM   3552  O OG1   . THR B 1 189 ? 177.142 16.414  29.032 1.00 45.51 ? 241  THR D OG1   1 
ATOM   3553  C CG2   . THR B 1 189 ? 178.013 14.502  30.229 1.00 44.67 ? 241  THR D CG2   1 
ATOM   3554  N N     . ALA B 1 190 ? 174.610 13.447  29.461 1.00 42.84 ? 242  ALA D N     1 
ATOM   3555  C CA    . ALA B 1 190 ? 173.858 12.760  28.410 1.00 41.76 ? 242  ALA D CA    1 
ATOM   3556  C C     . ALA B 1 190 ? 173.386 11.387  28.901 1.00 40.71 ? 242  ALA D C     1 
ATOM   3557  O O     . ALA B 1 190 ? 173.887 10.870  29.907 1.00 40.13 ? 242  ALA D O     1 
ATOM   3558  C CB    . ALA B 1 190 ? 174.716 12.596  27.155 1.00 40.36 ? 242  ALA D CB    1 
ATOM   3559  N N     . ILE B 1 191 ? 172.421 10.805  28.186 1.00 39.21 ? 243  ILE D N     1 
ATOM   3560  C CA    . ILE B 1 191 ? 171.879 9.492   28.539 1.00 35.74 ? 243  ILE D CA    1 
ATOM   3561  C C     . ILE B 1 191 ? 171.578 8.587   27.332 1.00 34.78 ? 243  ILE D C     1 
ATOM   3562  O O     . ILE B 1 191 ? 170.901 8.988   26.388 1.00 35.39 ? 243  ILE D O     1 
ATOM   3563  C CB    . ILE B 1 191 ? 170.572 9.626   29.335 1.00 35.56 ? 243  ILE D CB    1 
ATOM   3564  C CG1   . ILE B 1 191 ? 170.759 10.569  30.524 1.00 32.55 ? 243  ILE D CG1   1 
ATOM   3565  C CG2   . ILE B 1 191 ? 170.112 8.246   29.800 1.00 35.35 ? 243  ILE D CG2   1 
ATOM   3566  C CD1   . ILE B 1 191 ? 169.464 10.866  31.260 1.00 37.69 ? 243  ILE D CD1   1 
ATOM   3567  N N     . PHE B 1 192 ? 172.085 7.360   27.375 1.00 32.95 ? 244  PHE D N     1 
ATOM   3568  C CA    . PHE B 1 192 ? 171.839 6.386   26.323 1.00 30.29 ? 244  PHE D CA    1 
ATOM   3569  C C     . PHE B 1 192 ? 170.704 5.545   26.887 1.00 30.38 ? 244  PHE D C     1 
ATOM   3570  O O     . PHE B 1 192 ? 170.786 5.111   28.034 1.00 33.30 ? 244  PHE D O     1 
ATOM   3571  C CB    . PHE B 1 192 ? 173.082 5.521   26.112 1.00 27.76 ? 244  PHE D CB    1 
ATOM   3572  C CG    . PHE B 1 192 ? 172.840 4.279   25.279 1.00 29.01 ? 244  PHE D CG    1 
ATOM   3573  C CD1   . PHE B 1 192 ? 172.460 4.372   23.933 1.00 29.36 ? 244  PHE D CD1   1 
ATOM   3574  C CD2   . PHE B 1 192 ? 172.997 3.016   25.837 1.00 27.17 ? 244  PHE D CD2   1 
ATOM   3575  C CE1   . PHE B 1 192 ? 172.240 3.222   23.165 1.00 27.05 ? 244  PHE D CE1   1 
ATOM   3576  C CE2   . PHE B 1 192 ? 172.781 1.869   25.080 1.00 27.30 ? 244  PHE D CE2   1 
ATOM   3577  C CZ    . PHE B 1 192 ? 172.401 1.972   23.740 1.00 28.29 ? 244  PHE D CZ    1 
ATOM   3578  N N     . VAL B 1 193 ? 169.640 5.330   26.116 1.00 28.43 ? 245  VAL D N     1 
ATOM   3579  C CA    . VAL B 1 193 ? 168.523 4.521   26.602 1.00 27.08 ? 245  VAL D CA    1 
ATOM   3580  C C     . VAL B 1 193 ? 168.340 3.229   25.787 1.00 27.41 ? 245  VAL D C     1 
ATOM   3581  O O     . VAL B 1 193 ? 168.456 3.230   24.560 1.00 27.01 ? 245  VAL D O     1 
ATOM   3582  C CB    . VAL B 1 193 ? 167.209 5.342   26.599 1.00 26.03 ? 245  VAL D CB    1 
ATOM   3583  C CG1   . VAL B 1 193 ? 166.056 4.502   27.106 1.00 24.96 ? 245  VAL D CG1   1 
ATOM   3584  C CG2   . VAL B 1 193 ? 167.372 6.571   27.458 1.00 23.30 ? 245  VAL D CG2   1 
ATOM   3585  N N     . GLY B 1 194 ? 168.051 2.134   26.487 1.00 28.27 ? 246  GLY D N     1 
ATOM   3586  C CA    . GLY B 1 194 ? 167.865 0.832   25.854 1.00 29.15 ? 246  GLY D CA    1 
ATOM   3587  C C     . GLY B 1 194 ? 166.765 0.661   24.810 1.00 30.41 ? 246  GLY D C     1 
ATOM   3588  O O     . GLY B 1 194 ? 166.967 -0.052  23.832 1.00 32.05 ? 246  GLY D O     1 
ATOM   3589  N N     . THR B 1 195 ? 165.597 1.269   25.018 1.00 31.17 ? 247  THR D N     1 
ATOM   3590  C CA    . THR B 1 195 ? 164.493 1.185   24.048 1.00 29.36 ? 247  THR D CA    1 
ATOM   3591  C C     . THR B 1 195 ? 163.981 2.594   23.755 1.00 29.95 ? 247  THR D C     1 
ATOM   3592  O O     . THR B 1 195 ? 164.296 3.535   24.481 1.00 30.24 ? 247  THR D O     1 
ATOM   3593  C CB    . THR B 1 195 ? 163.312 0.371   24.582 1.00 26.59 ? 247  THR D CB    1 
ATOM   3594  O OG1   . THR B 1 195 ? 162.720 1.057   25.695 1.00 24.00 ? 247  THR D OG1   1 
ATOM   3595  C CG2   . THR B 1 195 ? 163.767 -1.005  24.985 1.00 23.06 ? 247  THR D CG2   1 
ATOM   3596  N N     . ASP B 1 196 ? 163.201 2.747   22.695 1.00 30.26 ? 248  ASP D N     1 
ATOM   3597  C CA    . ASP B 1 196 ? 162.678 4.065   22.367 1.00 31.79 ? 248  ASP D CA    1 
ATOM   3598  C C     . ASP B 1 196 ? 161.615 4.443   23.383 1.00 33.48 ? 248  ASP D C     1 
ATOM   3599  O O     . ASP B 1 196 ? 161.563 5.588   23.833 1.00 34.87 ? 248  ASP D O     1 
ATOM   3600  C CB    . ASP B 1 196 ? 162.055 4.078   20.972 1.00 31.43 ? 248  ASP D CB    1 
ATOM   3601  C CG    . ASP B 1 196 ? 163.079 4.223   19.870 1.00 31.06 ? 248  ASP D CG    1 
ATOM   3602  O OD1   . ASP B 1 196 ? 162.682 4.063   18.699 1.00 29.36 ? 248  ASP D OD1   1 
ATOM   3603  O OD2   . ASP B 1 196 ? 164.263 4.503   20.168 1.00 30.44 ? 248  ASP D OD2   1 
ATOM   3604  N N     . GLU B 1 197 ? 160.767 3.482   23.748 1.00 33.58 ? 249  GLU D N     1 
ATOM   3605  C CA    . GLU B 1 197 ? 159.710 3.758   24.707 1.00 32.69 ? 249  GLU D CA    1 
ATOM   3606  C C     . GLU B 1 197 ? 160.258 4.369   25.978 1.00 31.39 ? 249  GLU D C     1 
ATOM   3607  O O     . GLU B 1 197 ? 159.688 5.313   26.505 1.00 32.15 ? 249  GLU D O     1 
ATOM   3608  C CB    . GLU B 1 197 ? 158.909 2.504   25.044 1.00 33.57 ? 249  GLU D CB    1 
ATOM   3609  C CG    . GLU B 1 197 ? 157.846 2.780   26.095 1.00 38.38 ? 249  GLU D CG    1 
ATOM   3610  C CD    . GLU B 1 197 ? 156.585 1.958   25.906 1.00 42.50 ? 249  GLU D CD    1 
ATOM   3611  O OE1   . GLU B 1 197 ? 155.640 2.099   26.731 1.00 42.66 ? 249  GLU D OE1   1 
ATOM   3612  O OE2   . GLU B 1 197 ? 156.539 1.178   24.926 1.00 45.74 ? 249  GLU D OE2   1 
ATOM   3613  N N     . MET B 1 198 ? 161.364 3.846   26.481 1.00 31.38 ? 250  MET D N     1 
ATOM   3614  C CA    . MET B 1 198 ? 161.936 4.414   27.694 1.00 31.38 ? 250  MET D CA    1 
ATOM   3615  C C     . MET B 1 198 ? 162.584 5.736   27.368 1.00 29.32 ? 250  MET D C     1 
ATOM   3616  O O     . MET B 1 198 ? 162.586 6.637   28.183 1.00 30.01 ? 250  MET D O     1 
ATOM   3617  C CB    . MET B 1 198 ? 162.985 3.496   28.296 1.00 34.47 ? 250  MET D CB    1 
ATOM   3618  C CG    . MET B 1 198 ? 162.499 2.117   28.652 1.00 36.62 ? 250  MET D CG    1 
ATOM   3619  S SD    . MET B 1 198 ? 163.889 1.197   29.316 1.00 39.82 ? 250  MET D SD    1 
ATOM   3620  C CE    . MET B 1 198 ? 163.728 1.656   31.023 1.00 39.69 ? 250  MET D CE    1 
ATOM   3621  N N     . ALA B 1 199 ? 163.141 5.852   26.172 1.00 28.25 ? 251  ALA D N     1 
ATOM   3622  C CA    . ALA B 1 199 ? 163.772 7.100   25.768 1.00 29.51 ? 251  ALA D CA    1 
ATOM   3623  C C     . ALA B 1 199 ? 162.755 8.236   25.829 1.00 29.51 ? 251  ALA D C     1 
ATOM   3624  O O     . ALA B 1 199 ? 163.045 9.311   26.341 1.00 31.01 ? 251  ALA D O     1 
ATOM   3625  C CB    . ALA B 1 199 ? 164.332 6.978   24.357 1.00 29.23 ? 251  ALA D CB    1 
ATOM   3626  N N     . LEU B 1 200 ? 161.561 8.002   25.299 1.00 28.59 ? 252  LEU D N     1 
ATOM   3627  C CA    . LEU B 1 200 ? 160.543 9.031   25.332 1.00 27.91 ? 252  LEU D CA    1 
ATOM   3628  C C     . LEU B 1 200 ? 160.309 9.427   26.777 1.00 28.55 ? 252  LEU D C     1 
ATOM   3629  O O     . LEU B 1 200 ? 160.188 10.609  27.104 1.00 30.05 ? 252  LEU D O     1 
ATOM   3630  C CB    . LEU B 1 200 ? 159.247 8.527   24.686 1.00 24.80 ? 252  LEU D CB    1 
ATOM   3631  C CG    . LEU B 1 200 ? 159.144 8.818   23.182 1.00 22.05 ? 252  LEU D CG    1 
ATOM   3632  C CD1   . LEU B 1 200 ? 160.381 8.300   22.447 1.00 19.42 ? 252  LEU D CD1   1 
ATOM   3633  C CD2   . LEU B 1 200 ? 157.876 8.187   22.628 1.00 21.92 ? 252  LEU D CD2   1 
ATOM   3634  N N     . GLY B 1 201 ? 160.275 8.429   27.649 1.00 30.07 ? 253  GLY D N     1 
ATOM   3635  C CA    . GLY B 1 201 ? 160.055 8.688   29.062 1.00 27.58 ? 253  GLY D CA    1 
ATOM   3636  C C     . GLY B 1 201 ? 161.146 9.557   29.635 1.00 25.67 ? 253  GLY D C     1 
ATOM   3637  O O     . GLY B 1 201 ? 160.885 10.420  30.482 1.00 26.12 ? 253  GLY D O     1 
ATOM   3638  N N     . VAL B 1 202 ? 162.370 9.338   29.159 1.00 23.77 ? 254  VAL D N     1 
ATOM   3639  C CA    . VAL B 1 202 ? 163.522 10.090  29.640 1.00 23.23 ? 254  VAL D CA    1 
ATOM   3640  C C     . VAL B 1 202 ? 163.470 11.547  29.235 1.00 24.45 ? 254  VAL D C     1 
ATOM   3641  O O     . VAL B 1 202 ? 163.706 12.434  30.055 1.00 24.10 ? 254  VAL D O     1 
ATOM   3642  C CB    . VAL B 1 202 ? 164.820 9.489   29.131 1.00 20.89 ? 254  VAL D CB    1 
ATOM   3643  C CG1   . VAL B 1 202 ? 165.978 10.333  29.598 1.00 19.66 ? 254  VAL D CG1   1 
ATOM   3644  C CG2   . VAL B 1 202 ? 164.949 8.057   29.627 1.00 19.77 ? 254  VAL D CG2   1 
ATOM   3645  N N     . ILE B 1 203 ? 163.159 11.782  27.964 1.00 25.70 ? 255  ILE D N     1 
ATOM   3646  C CA    . ILE B 1 203 ? 163.056 13.125  27.448 1.00 27.41 ? 255  ILE D CA    1 
ATOM   3647  C C     . ILE B 1 203 ? 162.006 13.889  28.240 1.00 28.91 ? 255  ILE D C     1 
ATOM   3648  O O     . ILE B 1 203 ? 162.280 14.995  28.714 1.00 29.30 ? 255  ILE D O     1 
ATOM   3649  C CB    . ILE B 1 203 ? 162.658 13.133  25.959 1.00 30.66 ? 255  ILE D CB    1 
ATOM   3650  C CG1   . ILE B 1 203 ? 163.773 12.500  25.110 1.00 29.30 ? 255  ILE D CG1   1 
ATOM   3651  C CG2   . ILE B 1 203 ? 162.352 14.571  25.517 1.00 27.64 ? 255  ILE D CG2   1 
ATOM   3652  C CD1   . ILE B 1 203 ? 163.444 12.383  23.639 1.00 36.32 ? 255  ILE D CD1   1 
ATOM   3653  N N     . HIS B 1 204 ? 160.816 13.302  28.399 1.00 29.78 ? 256  HIS D N     1 
ATOM   3654  C CA    . HIS B 1 204 ? 159.733 13.966  29.139 1.00 30.56 ? 256  HIS D CA    1 
ATOM   3655  C C     . HIS B 1 204 ? 160.086 14.238  30.590 1.00 32.30 ? 256  HIS D C     1 
ATOM   3656  O O     . HIS B 1 204 ? 159.960 15.372  31.045 1.00 32.97 ? 256  HIS D O     1 
ATOM   3657  C CB    . HIS B 1 204 ? 158.445 13.154  29.063 1.00 29.52 ? 256  HIS D CB    1 
ATOM   3658  C CG    . HIS B 1 204 ? 157.807 13.164  27.710 1.00 29.46 ? 256  HIS D CG    1 
ATOM   3659  N ND1   . HIS B 1 204 ? 158.206 14.016  26.702 1.00 29.63 ? 256  HIS D ND1   1 
ATOM   3660  C CD2   . HIS B 1 204 ? 156.815 12.408  27.187 1.00 28.26 ? 256  HIS D CD2   1 
ATOM   3661  C CE1   . HIS B 1 204 ? 157.493 13.779  25.618 1.00 27.36 ? 256  HIS D CE1   1 
ATOM   3662  N NE2   . HIS B 1 204 ? 156.642 12.807  25.886 1.00 26.96 ? 256  HIS D NE2   1 
ATOM   3663  N N     . GLY B 1 205 ? 160.520 13.206  31.317 1.00 33.60 ? 257  GLY D N     1 
ATOM   3664  C CA    . GLY B 1 205 ? 160.924 13.401  32.700 1.00 34.74 ? 257  GLY D CA    1 
ATOM   3665  C C     . GLY B 1 205 ? 161.826 14.626  32.800 1.00 35.06 ? 257  GLY D C     1 
ATOM   3666  O O     . GLY B 1 205 ? 161.566 15.539  33.577 1.00 33.89 ? 257  GLY D O     1 
ATOM   3667  N N     . ALA B 1 206 ? 162.876 14.648  31.986 1.00 35.20 ? 258  ALA D N     1 
ATOM   3668  C CA    . ALA B 1 206 ? 163.808 15.762  31.959 1.00 36.93 ? 258  ALA D CA    1 
ATOM   3669  C C     . ALA B 1 206 ? 163.100 17.095  31.695 1.00 39.02 ? 258  ALA D C     1 
ATOM   3670  O O     . ALA B 1 206 ? 163.203 18.046  32.476 1.00 40.54 ? 258  ALA D O     1 
ATOM   3671  C CB    . ALA B 1 206 ? 164.855 15.521  30.896 1.00 36.10 ? 258  ALA D CB    1 
ATOM   3672  N N     . GLN B 1 207 ? 162.389 17.178  30.582 1.00 39.59 ? 259  GLN D N     1 
ATOM   3673  C CA    . GLN B 1 207 ? 161.694 18.411  30.267 1.00 39.72 ? 259  GLN D CA    1 
ATOM   3674  C C     . GLN B 1 207 ? 160.802 18.802  31.440 1.00 41.19 ? 259  GLN D C     1 
ATOM   3675  O O     . GLN B 1 207 ? 160.774 19.966  31.829 1.00 41.03 ? 259  GLN D O     1 
ATOM   3676  C CB    . GLN B 1 207 ? 160.868 18.240  28.986 1.00 36.89 ? 259  GLN D CB    1 
ATOM   3677  C CG    . GLN B 1 207 ? 161.686 17.694  27.841 1.00 34.22 ? 259  GLN D CG    1 
ATOM   3678  C CD    . GLN B 1 207 ? 161.005 17.814  26.506 1.00 34.88 ? 259  GLN D CD    1 
ATOM   3679  O OE1   . GLN B 1 207 ? 159.931 17.259  26.283 1.00 36.26 ? 259  GLN D OE1   1 
ATOM   3680  N NE2   . GLN B 1 207 ? 161.633 18.540  25.597 1.00 34.96 ? 259  GLN D NE2   1 
ATOM   3681  N N     . ASP B 1 208 ? 160.104 17.825  32.022 1.00 43.36 ? 260  ASP D N     1 
ATOM   3682  C CA    . ASP B 1 208 ? 159.197 18.088  33.143 1.00 46.25 ? 260  ASP D CA    1 
ATOM   3683  C C     . ASP B 1 208 ? 159.885 18.662  34.384 1.00 48.04 ? 260  ASP D C     1 
ATOM   3684  O O     . ASP B 1 208 ? 159.213 19.241  35.248 1.00 48.65 ? 260  ASP D O     1 
ATOM   3685  C CB    . ASP B 1 208 ? 158.432 16.820  33.551 1.00 47.67 ? 260  ASP D CB    1 
ATOM   3686  C CG    . ASP B 1 208 ? 157.442 16.346  32.485 1.00 49.87 ? 260  ASP D CG    1 
ATOM   3687  O OD1   . ASP B 1 208 ? 156.676 17.175  31.938 1.00 49.51 ? 260  ASP D OD1   1 
ATOM   3688  O OD2   . ASP B 1 208 ? 157.420 15.126  32.207 1.00 51.45 ? 260  ASP D OD2   1 
ATOM   3689  N N     . ARG B 1 209 ? 161.204 18.483  34.491 1.00 47.79 ? 261  ARG D N     1 
ATOM   3690  C CA    . ARG B 1 209 ? 161.934 19.017  35.634 1.00 48.53 ? 261  ARG D CA    1 
ATOM   3691  C C     . ARG B 1 209 ? 162.511 20.343  35.198 1.00 47.33 ? 261  ARG D C     1 
ATOM   3692  O O     . ARG B 1 209 ? 163.271 20.973  35.928 1.00 46.69 ? 261  ARG D O     1 
ATOM   3693  C CB    . ARG B 1 209 ? 163.072 18.088  36.078 1.00 51.97 ? 261  ARG D CB    1 
ATOM   3694  C CG    . ARG B 1 209 ? 162.669 16.633  36.296 1.00 58.28 ? 261  ARG D CG    1 
ATOM   3695  C CD    . ARG B 1 209 ? 161.383 16.482  37.119 1.00 63.45 ? 261  ARG D CD    1 
ATOM   3696  N NE    . ARG B 1 209 ? 161.559 16.865  38.517 1.00 68.46 ? 261  ARG D NE    1 
ATOM   3697  C CZ    . ARG B 1 209 ? 162.430 16.293  39.346 1.00 71.04 ? 261  ARG D CZ    1 
ATOM   3698  N NH1   . ARG B 1 209 ? 163.214 15.308  38.923 1.00 72.18 ? 261  ARG D NH1   1 
ATOM   3699  N NH2   . ARG B 1 209 ? 162.512 16.703  40.604 1.00 72.64 ? 261  ARG D NH2   1 
ATOM   3700  N N     . GLY B 1 210 ? 162.154 20.746  33.986 1.00 46.81 ? 262  GLY D N     1 
ATOM   3701  C CA    . GLY B 1 210 ? 162.619 22.006  33.454 1.00 46.07 ? 262  GLY D CA    1 
ATOM   3702  C C     . GLY B 1 210 ? 163.828 21.976  32.541 1.00 45.47 ? 262  GLY D C     1 
ATOM   3703  O O     . GLY B 1 210 ? 164.285 23.038  32.127 1.00 46.23 ? 262  GLY D O     1 
ATOM   3704  N N     . LEU B 1 211 ? 164.345 20.797  32.204 1.00 45.23 ? 263  LEU D N     1 
ATOM   3705  C CA    . LEU B 1 211 ? 165.532 20.720  31.334 1.00 45.07 ? 263  LEU D CA    1 
ATOM   3706  C C     . LEU B 1 211 ? 165.291 20.663  29.829 1.00 41.57 ? 263  LEU D C     1 
ATOM   3707  O O     . LEU B 1 211 ? 164.245 20.208  29.381 1.00 44.96 ? 263  LEU D O     1 
ATOM   3708  C CB    . LEU B 1 211 ? 166.395 19.510  31.692 1.00 48.31 ? 263  LEU D CB    1 
ATOM   3709  C CG    . LEU B 1 211 ? 167.104 19.369  33.038 1.00 50.23 ? 263  LEU D CG    1 
ATOM   3710  C CD1   . LEU B 1 211 ? 166.096 19.022  34.143 1.00 50.23 ? 263  LEU D CD1   1 
ATOM   3711  C CD2   . LEU B 1 211 ? 168.163 18.263  32.906 1.00 50.99 ? 263  LEU D CD2   1 
ATOM   3712  N N     . ASN B 1 212 ? 166.307 21.047  29.061 1.00 37.59 ? 264  ASN D N     1 
ATOM   3713  C CA    . ASN B 1 212 ? 166.217 21.061  27.607 1.00 31.60 ? 264  ASN D CA    1 
ATOM   3714  C C     . ASN B 1 212 ? 167.034 19.975  26.919 1.00 30.62 ? 264  ASN D C     1 
ATOM   3715  O O     . ASN B 1 212 ? 168.210 19.738  27.226 1.00 29.01 ? 264  ASN D O     1 
ATOM   3716  C CB    . ASN B 1 212 ? 166.663 22.421  27.078 1.00 29.86 ? 264  ASN D CB    1 
ATOM   3717  C CG    . ASN B 1 212 ? 166.701 22.483  25.556 1.00 30.89 ? 264  ASN D CG    1 
ATOM   3718  O OD1   . ASN B 1 212 ? 167.546 21.864  24.896 1.00 33.11 ? 264  ASN D OD1   1 
ATOM   3719  N ND2   . ASN B 1 212 ? 165.781 23.239  24.991 1.00 31.00 ? 264  ASN D ND2   1 
ATOM   3720  N N     . VAL B 1 213 ? 166.400 19.313  25.964 1.00 30.11 ? 265  VAL D N     1 
ATOM   3721  C CA    . VAL B 1 213 ? 167.092 18.287  25.207 1.00 30.00 ? 265  VAL D CA    1 
ATOM   3722  C C     . VAL B 1 213 ? 167.187 18.957  23.844 1.00 30.44 ? 265  VAL D C     1 
ATOM   3723  O O     . VAL B 1 213 ? 166.193 19.491  23.349 1.00 31.40 ? 265  VAL D O     1 
ATOM   3724  C CB    . VAL B 1 213 ? 166.238 17.004  25.131 1.00 29.07 ? 265  VAL D CB    1 
ATOM   3725  C CG1   . VAL B 1 213 ? 167.112 15.810  24.808 1.00 30.04 ? 265  VAL D CG1   1 
ATOM   3726  C CG2   . VAL B 1 213 ? 165.509 16.784  26.450 1.00 27.70 ? 265  VAL D CG2   1 
ATOM   3727  N N     . PRO B 1 214 ? 168.374 18.965  23.221 1.00 30.05 ? 266  PRO D N     1 
ATOM   3728  C CA    . PRO B 1 214 ? 169.654 18.398  23.652 1.00 31.64 ? 266  PRO D CA    1 
ATOM   3729  C C     . PRO B 1 214 ? 170.591 19.374  24.352 1.00 34.19 ? 266  PRO D C     1 
ATOM   3730  O O     . PRO B 1 214 ? 171.731 19.024  24.702 1.00 38.12 ? 266  PRO D O     1 
ATOM   3731  C CB    . PRO B 1 214 ? 170.267 17.936  22.341 1.00 30.36 ? 266  PRO D CB    1 
ATOM   3732  C CG    . PRO B 1 214 ? 169.875 19.056  21.426 1.00 29.14 ? 266  PRO D CG    1 
ATOM   3733  C CD    . PRO B 1 214 ? 168.413 19.292  21.781 1.00 27.55 ? 266  PRO D CD    1 
ATOM   3734  N N     . ASN B 1 215 ? 170.144 20.599  24.544 1.00 34.39 ? 267  ASN D N     1 
ATOM   3735  C CA    . ASN B 1 215 ? 171.010 21.576  25.166 1.00 36.57 ? 267  ASN D CA    1 
ATOM   3736  C C     . ASN B 1 215 ? 171.425 21.312  26.625 1.00 39.01 ? 267  ASN D C     1 
ATOM   3737  O O     . ASN B 1 215 ? 172.537 21.670  27.004 1.00 39.14 ? 267  ASN D O     1 
ATOM   3738  C CB    . ASN B 1 215 ? 170.377 22.950  24.986 1.00 35.94 ? 267  ASN D CB    1 
ATOM   3739  C CG    . ASN B 1 215 ? 170.357 23.366  23.533 1.00 37.84 ? 267  ASN D CG    1 
ATOM   3740  O OD1   . ASN B 1 215 ? 171.407 23.643  22.943 1.00 41.41 ? 267  ASN D OD1   1 
ATOM   3741  N ND2   . ASN B 1 215 ? 169.171 23.382  22.934 1.00 40.07 ? 267  ASN D ND2   1 
ATOM   3742  N N     . ASP B 1 216 ? 170.555 20.695  27.429 1.00 42.64 ? 268  ASP D N     1 
ATOM   3743  C CA    . ASP B 1 216 ? 170.850 20.378  28.840 1.00 46.96 ? 268  ASP D CA    1 
ATOM   3744  C C     . ASP B 1 216 ? 171.099 18.888  29.031 1.00 49.03 ? 268  ASP D C     1 
ATOM   3745  O O     . ASP B 1 216 ? 171.628 18.454  30.062 1.00 50.36 ? 268  ASP D O     1 
ATOM   3746  C CB    . ASP B 1 216 ? 169.671 20.713  29.756 1.00 49.18 ? 268  ASP D CB    1 
ATOM   3747  C CG    . ASP B 1 216 ? 169.254 22.149  29.683 1.00 50.97 ? 268  ASP D CG    1 
ATOM   3748  O OD1   . ASP B 1 216 ? 168.293 22.486  30.406 1.00 50.96 ? 268  ASP D OD1   1 
ATOM   3749  O OD2   . ASP B 1 216 ? 169.869 22.931  28.924 1.00 51.59 ? 268  ASP D OD2   1 
ATOM   3750  N N     . LEU B 1 217 ? 170.684 18.099  28.049 1.00 49.26 ? 269  LEU D N     1 
ATOM   3751  C CA    . LEU B 1 217 ? 170.823 16.662  28.151 1.00 47.62 ? 269  LEU D CA    1 
ATOM   3752  C C     . LEU B 1 217 ? 170.625 16.038  26.794 1.00 47.01 ? 269  LEU D C     1 
ATOM   3753  O O     . LEU B 1 217 ? 169.575 16.205  26.178 1.00 48.78 ? 269  LEU D O     1 
ATOM   3754  C CB    . LEU B 1 217 ? 169.757 16.117  29.095 1.00 47.22 ? 269  LEU D CB    1 
ATOM   3755  C CG    . LEU B 1 217 ? 170.176 15.342  30.338 1.00 47.69 ? 269  LEU D CG    1 
ATOM   3756  C CD1   . LEU B 1 217 ? 168.936 14.757  30.988 1.00 46.22 ? 269  LEU D CD1   1 
ATOM   3757  C CD2   . LEU B 1 217 ? 171.149 14.239  29.957 1.00 46.58 ? 269  LEU D CD2   1 
ATOM   3758  N N     . GLU B 1 218 ? 171.633 15.330  26.315 1.00 45.05 ? 270  GLU D N     1 
ATOM   3759  C CA    . GLU B 1 218 ? 171.496 14.664  25.040 1.00 43.32 ? 270  GLU D CA    1 
ATOM   3760  C C     . GLU B 1 218 ? 170.966 13.263  25.362 1.00 40.78 ? 270  GLU D C     1 
ATOM   3761  O O     . GLU B 1 218 ? 171.315 12.675  26.391 1.00 39.53 ? 270  GLU D O     1 
ATOM   3762  C CB    . GLU B 1 218 ? 172.847 14.617  24.337 1.00 44.16 ? 270  GLU D CB    1 
ATOM   3763  C CG    . GLU B 1 218 ? 173.504 15.979  24.279 1.00 47.12 ? 270  GLU D CG    1 
ATOM   3764  C CD    . GLU B 1 218 ? 174.164 16.254  22.943 1.00 49.88 ? 270  GLU D CD    1 
ATOM   3765  O OE1   . GLU B 1 218 ? 175.190 16.972  22.919 1.00 51.08 ? 270  GLU D OE1   1 
ATOM   3766  O OE2   . GLU B 1 218 ? 173.653 15.762  21.913 1.00 50.19 ? 270  GLU D OE2   1 
ATOM   3767  N N     . ILE B 1 219 ? 170.100 12.741  24.501 1.00 38.40 ? 271  ILE D N     1 
ATOM   3768  C CA    . ILE B 1 219 ? 169.522 11.422  24.727 1.00 35.50 ? 271  ILE D CA    1 
ATOM   3769  C C     . ILE B 1 219 ? 169.547 10.610  23.445 1.00 33.00 ? 271  ILE D C     1 
ATOM   3770  O O     . ILE B 1 219 ? 169.107 11.087  22.401 1.00 33.05 ? 271  ILE D O     1 
ATOM   3771  C CB    . ILE B 1 219 ? 168.055 11.548  25.247 1.00 36.30 ? 271  ILE D CB    1 
ATOM   3772  C CG1   . ILE B 1 219 ? 167.990 12.600  26.357 1.00 36.46 ? 271  ILE D CG1   1 
ATOM   3773  C CG2   . ILE B 1 219 ? 167.572 10.232  25.850 1.00 34.35 ? 271  ILE D CG2   1 
ATOM   3774  C CD1   . ILE B 1 219 ? 166.605 12.830  26.892 1.00 40.57 ? 271  ILE D CD1   1 
ATOM   3775  N N     . ILE B 1 220 ? 170.100 9.402   23.516 1.00 31.22 ? 272  ILE D N     1 
ATOM   3776  C CA    . ILE B 1 220 ? 170.151 8.523   22.357 1.00 31.43 ? 272  ILE D CA    1 
ATOM   3777  C C     . ILE B 1 220 ? 169.368 7.275   22.684 1.00 31.68 ? 272  ILE D C     1 
ATOM   3778  O O     . ILE B 1 220 ? 169.654 6.604   23.680 1.00 31.85 ? 272  ILE D O     1 
ATOM   3779  C CB    . ILE B 1 220 ? 171.584 8.079   21.985 1.00 33.10 ? 272  ILE D CB    1 
ATOM   3780  C CG1   . ILE B 1 220 ? 172.306 9.156   21.178 1.00 32.87 ? 272  ILE D CG1   1 
ATOM   3781  C CG2   . ILE B 1 220 ? 171.522 6.821   21.134 1.00 34.16 ? 272  ILE D CG2   1 
ATOM   3782  C CD1   . ILE B 1 220 ? 172.579 10.397  21.952 1.00 40.02 ? 272  ILE D CD1   1 
ATOM   3783  N N     . GLY B 1 221 ? 168.381 6.973   21.841 1.00 31.95 ? 273  GLY D N     1 
ATOM   3784  C CA    . GLY B 1 221 ? 167.547 5.794   22.031 1.00 30.97 ? 273  GLY D CA    1 
ATOM   3785  C C     . GLY B 1 221 ? 168.053 4.592   21.256 1.00 29.92 ? 273  GLY D C     1 
ATOM   3786  O O     . GLY B 1 221 ? 169.137 4.633   20.679 1.00 29.91 ? 273  GLY D O     1 
ATOM   3787  N N     . PHE B 1 222 ? 167.267 3.524   21.224 1.00 29.64 ? 274  PHE D N     1 
ATOM   3788  C CA    . PHE B 1 222 ? 167.674 2.313   20.524 1.00 30.01 ? 274  PHE D CA    1 
ATOM   3789  C C     . PHE B 1 222 ? 166.446 1.594   20.004 1.00 29.49 ? 274  PHE D C     1 
ATOM   3790  O O     . PHE B 1 222 ? 165.536 1.326   20.775 1.00 28.39 ? 274  PHE D O     1 
ATOM   3791  C CB    . PHE B 1 222 ? 168.440 1.425   21.496 1.00 31.63 ? 274  PHE D CB    1 
ATOM   3792  C CG    . PHE B 1 222 ? 169.078 0.210   20.876 1.00 32.57 ? 274  PHE D CG    1 
ATOM   3793  C CD1   . PHE B 1 222 ? 168.303 -0.823  20.367 1.00 31.90 ? 274  PHE D CD1   1 
ATOM   3794  C CD2   . PHE B 1 222 ? 170.464 0.048   20.927 1.00 33.81 ? 274  PHE D CD2   1 
ATOM   3795  C CE1   . PHE B 1 222 ? 168.887 -2.008  19.932 1.00 33.47 ? 274  PHE D CE1   1 
ATOM   3796  C CE2   . PHE B 1 222 ? 171.061 -1.132  20.494 1.00 34.92 ? 274  PHE D CE2   1 
ATOM   3797  C CZ    . PHE B 1 222 ? 170.265 -2.169  19.996 1.00 34.97 ? 274  PHE D CZ    1 
ATOM   3798  N N     . ASP B 1 223 ? 166.452 1.310   18.697 1.00 29.78 ? 275  ASP D N     1 
ATOM   3799  C CA    . ASP B 1 223 ? 165.396 0.618   17.939 1.00 30.89 ? 275  ASP D CA    1 
ATOM   3800  C C     . ASP B 1 223 ? 164.964 1.412   16.701 1.00 31.49 ? 275  ASP D C     1 
ATOM   3801  O O     . ASP B 1 223 ? 164.766 0.855   15.617 1.00 32.56 ? 275  ASP D O     1 
ATOM   3802  C CB    . ASP B 1 223 ? 164.125 0.379   18.761 1.00 32.77 ? 275  ASP D CB    1 
ATOM   3803  C CG    . ASP B 1 223 ? 164.313 -0.624  19.868 1.00 33.84 ? 275  ASP D CG    1 
ATOM   3804  O OD1   . ASP B 1 223 ? 165.161 -1.535  19.721 1.00 34.24 ? 275  ASP D OD1   1 
ATOM   3805  O OD2   . ASP B 1 223 ? 163.585 -0.494  20.882 1.00 34.37 ? 275  ASP D OD2   1 
ATOM   3806  N N     . ASN B 1 224 ? 164.799 2.716   16.873 1.00 30.56 ? 276  ASN D N     1 
ATOM   3807  C CA    . ASN B 1 224 ? 164.349 3.577   15.790 1.00 29.51 ? 276  ASN D CA    1 
ATOM   3808  C C     . ASN B 1 224 ? 162.967 3.155   15.305 1.00 29.27 ? 276  ASN D C     1 
ATOM   3809  O O     . ASN B 1 224 ? 162.757 2.890   14.127 1.00 30.16 ? 276  ASN D O     1 
ATOM   3810  C CB    . ASN B 1 224 ? 165.325 3.568   14.611 1.00 27.94 ? 276  ASN D CB    1 
ATOM   3811  C CG    . ASN B 1 224 ? 164.921 4.553   13.522 1.00 27.52 ? 276  ASN D CG    1 
ATOM   3812  O OD1   . ASN B 1 224 ? 164.761 5.746   13.778 1.00 26.69 ? 276  ASN D OD1   1 
ATOM   3813  N ND2   . ASN B 1 224 ? 164.746 4.057   12.305 1.00 27.20 ? 276  ASN D ND2   1 
ATOM   3814  N N     . THR B 1 225 ? 162.027 3.066   16.232 1.00 29.89 ? 277  THR D N     1 
ATOM   3815  C CA    . THR B 1 225 ? 160.654 2.735   15.892 1.00 29.61 ? 277  THR D CA    1 
ATOM   3816  C C     . THR B 1 225 ? 160.030 4.065   15.441 1.00 29.91 ? 277  THR D C     1 
ATOM   3817  O O     . THR B 1 225 ? 160.726 5.080   15.365 1.00 29.41 ? 277  THR D O     1 
ATOM   3818  C CB    . THR B 1 225 ? 159.897 2.212   17.121 1.00 28.91 ? 277  THR D CB    1 
ATOM   3819  O OG1   . THR B 1 225 ? 159.888 3.221   18.134 1.00 29.73 ? 277  THR D OG1   1 
ATOM   3820  C CG2   . THR B 1 225 ? 160.566 0.976   17.668 1.00 28.01 ? 277  THR D CG2   1 
ATOM   3821  N N     . ARG B 1 226 ? 158.734 4.073   15.137 1.00 30.35 ? 278  ARG D N     1 
ATOM   3822  C CA    . ARG B 1 226 ? 158.094 5.316   14.719 1.00 30.45 ? 278  ARG D CA    1 
ATOM   3823  C C     . ARG B 1 226 ? 157.932 6.231   15.928 1.00 30.96 ? 278  ARG D C     1 
ATOM   3824  O O     . ARG B 1 226 ? 157.668 7.426   15.779 1.00 32.21 ? 278  ARG D O     1 
ATOM   3825  C CB    . ARG B 1 226 ? 156.738 5.049   14.072 1.00 29.46 ? 278  ARG D CB    1 
ATOM   3826  C CG    . ARG B 1 226 ? 155.861 4.094   14.846 1.00 28.75 ? 278  ARG D CG    1 
ATOM   3827  C CD    . ARG B 1 226 ? 154.425 4.061   14.310 1.00 25.59 ? 278  ARG D CD    1 
ATOM   3828  N NE    . ARG B 1 226 ? 153.830 2.736   14.489 1.00 24.92 ? 278  ARG D NE    1 
ATOM   3829  C CZ    . ARG B 1 226 ? 152.667 2.507   15.087 1.00 23.42 ? 278  ARG D CZ    1 
ATOM   3830  N NH1   . ARG B 1 226 ? 151.967 3.518   15.567 1.00 23.26 ? 278  ARG D NH1   1 
ATOM   3831  N NH2   . ARG B 1 226 ? 152.202 1.268   15.205 1.00 23.94 ? 278  ARG D NH2   1 
ATOM   3832  N N     . LEU B 1 227 ? 158.091 5.663   17.123 1.00 30.08 ? 279  LEU D N     1 
ATOM   3833  C CA    . LEU B 1 227 ? 158.008 6.431   18.363 1.00 30.06 ? 279  LEU D CA    1 
ATOM   3834  C C     . LEU B 1 227 ? 159.147 7.432   18.395 1.00 30.95 ? 279  LEU D C     1 
ATOM   3835  O O     . LEU B 1 227 ? 159.111 8.431   19.115 1.00 31.23 ? 279  LEU D O     1 
ATOM   3836  C CB    . LEU B 1 227 ? 158.172 5.528   19.580 1.00 27.75 ? 279  LEU D CB    1 
ATOM   3837  C CG    . LEU B 1 227 ? 156.960 4.894   20.232 1.00 26.06 ? 279  LEU D CG    1 
ATOM   3838  C CD1   . LEU B 1 227 ? 157.410 4.288   21.522 1.00 26.40 ? 279  LEU D CD1   1 
ATOM   3839  C CD2   . LEU B 1 227 ? 155.897 5.931   20.495 1.00 26.85 ? 279  LEU D CD2   1 
ATOM   3840  N N     . SER B 1 228 ? 160.177 7.128   17.619 1.00 32.22 ? 280  SER D N     1 
ATOM   3841  C CA    . SER B 1 228 ? 161.357 7.964   17.553 1.00 32.38 ? 280  SER D CA    1 
ATOM   3842  C C     . SER B 1 228 ? 161.017 9.321   16.960 1.00 31.23 ? 280  SER D C     1 
ATOM   3843  O O     . SER B 1 228 ? 161.651 10.320  17.287 1.00 31.60 ? 280  SER D O     1 
ATOM   3844  C CB    . SER B 1 228 ? 162.428 7.263   16.710 1.00 33.47 ? 280  SER D CB    1 
ATOM   3845  O OG    . SER B 1 228 ? 163.736 7.591   17.156 1.00 36.60 ? 280  SER D OG    1 
ATOM   3846  N N     . THR B 1 229 ? 160.008 9.348   16.094 1.00 30.92 ? 281  THR D N     1 
ATOM   3847  C CA    . THR B 1 229 ? 159.581 10.577  15.431 1.00 29.39 ? 281  THR D CA    1 
ATOM   3848  C C     . THR B 1 229 ? 158.319 11.166  16.051 1.00 29.34 ? 281  THR D C     1 
ATOM   3849  O O     . THR B 1 229 ? 157.809 12.182  15.580 1.00 30.81 ? 281  THR D O     1 
ATOM   3850  C CB    . THR B 1 229 ? 159.306 10.329  13.936 1.00 29.24 ? 281  THR D CB    1 
ATOM   3851  O OG1   . THR B 1 229 ? 158.241 9.380   13.800 1.00 26.82 ? 281  THR D OG1   1 
ATOM   3852  C CG2   . THR B 1 229 ? 160.556 9.790   13.246 1.00 27.63 ? 281  THR D CG2   1 
ATOM   3853  N N     . MET B 1 230 ? 157.823 10.528  17.105 1.00 28.56 ? 282  MET D N     1 
ATOM   3854  C CA    . MET B 1 230 ? 156.630 10.993  17.791 1.00 28.91 ? 282  MET D CA    1 
ATOM   3855  C C     . MET B 1 230 ? 156.960 11.702  19.104 1.00 28.89 ? 282  MET D C     1 
ATOM   3856  O O     . MET B 1 230 ? 156.220 11.611  20.074 1.00 29.46 ? 282  MET D O     1 
ATOM   3857  C CB    . MET B 1 230 ? 155.700 9.812   18.034 1.00 29.93 ? 282  MET D CB    1 
ATOM   3858  C CG    . MET B 1 230 ? 155.407 9.055   16.744 1.00 32.41 ? 282  MET D CG    1 
ATOM   3859  S SD    . MET B 1 230 ? 153.957 7.991   16.833 1.00 34.04 ? 282  MET D SD    1 
ATOM   3860  C CE    . MET B 1 230 ? 154.689 6.440   16.736 1.00 37.92 ? 282  MET D CE    1 
ATOM   3861  N N     . VAL B 1 231 ? 158.087 12.403  19.127 1.00 28.89 ? 283  VAL D N     1 
ATOM   3862  C CA    . VAL B 1 231 ? 158.510 13.147  20.306 1.00 28.81 ? 283  VAL D CA    1 
ATOM   3863  C C     . VAL B 1 231 ? 159.140 14.440  19.854 1.00 29.72 ? 283  VAL D C     1 
ATOM   3864  O O     . VAL B 1 231 ? 159.654 14.540  18.740 1.00 29.97 ? 283  VAL D O     1 
ATOM   3865  C CB    . VAL B 1 231 ? 159.599 12.437  21.111 1.00 28.80 ? 283  VAL D CB    1 
ATOM   3866  C CG1   . VAL B 1 231 ? 159.206 12.376  22.577 1.00 27.85 ? 283  VAL D CG1   1 
ATOM   3867  C CG2   . VAL B 1 231 ? 159.860 11.070  20.539 1.00 30.13 ? 283  VAL D CG2   1 
ATOM   3868  N N     . ARG B 1 232 ? 159.101 15.424  20.740 1.00 29.40 ? 284  ARG D N     1 
ATOM   3869  C CA    . ARG B 1 232 ? 159.691 16.724  20.499 1.00 28.23 ? 284  ARG D CA    1 
ATOM   3870  C C     . ARG B 1 232 ? 160.605 16.968  21.696 1.00 28.19 ? 284  ARG D C     1 
ATOM   3871  O O     . ARG B 1 232 ? 160.141 17.025  22.841 1.00 28.30 ? 284  ARG D O     1 
ATOM   3872  C CB    . ARG B 1 232 ? 158.612 17.803  20.443 1.00 26.67 ? 284  ARG D CB    1 
ATOM   3873  C CG    . ARG B 1 232 ? 157.699 17.716  19.241 1.00 30.39 ? 284  ARG D CG    1 
ATOM   3874  C CD    . ARG B 1 232 ? 158.457 17.881  17.922 1.00 31.62 ? 284  ARG D CD    1 
ATOM   3875  N NE    . ARG B 1 232 ? 158.482 16.632  17.170 1.00 34.87 ? 284  ARG D NE    1 
ATOM   3876  C CZ    . ARG B 1 232 ? 157.754 16.381  16.085 1.00 35.60 ? 284  ARG D CZ    1 
ATOM   3877  N NH1   . ARG B 1 232 ? 156.937 17.295  15.598 1.00 34.91 ? 284  ARG D NH1   1 
ATOM   3878  N NH2   . ARG B 1 232 ? 157.831 15.196  15.496 1.00 39.36 ? 284  ARG D NH2   1 
ATOM   3879  N N     . PRO B 1 233 ? 161.923 17.064  21.458 1.00 26.89 ? 285  PRO D N     1 
ATOM   3880  C CA    . PRO B 1 233 ? 162.605 16.963  20.167 1.00 27.20 ? 285  PRO D CA    1 
ATOM   3881  C C     . PRO B 1 233 ? 162.594 15.510  19.669 1.00 30.39 ? 285  PRO D C     1 
ATOM   3882  O O     . PRO B 1 233 ? 162.465 14.576  20.468 1.00 30.70 ? 285  PRO D O     1 
ATOM   3883  C CB    . PRO B 1 233 ? 164.001 17.447  20.502 1.00 25.87 ? 285  PRO D CB    1 
ATOM   3884  C CG    . PRO B 1 233 ? 164.196 16.873  21.863 1.00 24.71 ? 285  PRO D CG    1 
ATOM   3885  C CD    . PRO B 1 233 ? 162.899 17.200  22.551 1.00 24.31 ? 285  PRO D CD    1 
ATOM   3886  N N     . GLN B 1 234 ? 162.740 15.308  18.358 1.00 32.87 ? 286  GLN D N     1 
ATOM   3887  C CA    . GLN B 1 234 ? 162.726 13.948  17.810 1.00 32.40 ? 286  GLN D CA    1 
ATOM   3888  C C     . GLN B 1 234 ? 163.926 13.124  18.241 1.00 31.30 ? 286  GLN D C     1 
ATOM   3889  O O     . GLN B 1 234 ? 165.065 13.580  18.169 1.00 31.42 ? 286  GLN D O     1 
ATOM   3890  C CB    . GLN B 1 234 ? 162.589 13.981  16.287 1.00 33.90 ? 286  GLN D CB    1 
ATOM   3891  C CG    . GLN B 1 234 ? 161.130 14.100  15.864 1.00 37.13 ? 286  GLN D CG    1 
ATOM   3892  C CD    . GLN B 1 234 ? 160.923 14.083  14.361 1.00 39.66 ? 286  GLN D CD    1 
ATOM   3893  O OE1   . GLN B 1 234 ? 160.993 15.123  13.692 1.00 39.66 ? 286  GLN D OE1   1 
ATOM   3894  N NE2   . GLN B 1 234 ? 160.667 12.894  13.818 1.00 41.49 ? 286  GLN D NE2   1 
ATOM   3895  N N     . LEU B 1 235 ? 163.646 11.900  18.679 1.00 30.32 ? 287  LEU D N     1 
ATOM   3896  C CA    . LEU B 1 235 ? 164.651 10.986  19.199 1.00 29.77 ? 287  LEU D CA    1 
ATOM   3897  C C     . LEU B 1 235 ? 165.715 10.429  18.269 1.00 29.42 ? 287  LEU D C     1 
ATOM   3898  O O     . LEU B 1 235 ? 165.414 9.799   17.273 1.00 30.01 ? 287  LEU D O     1 
ATOM   3899  C CB    . LEU B 1 235 ? 163.963 9.812   19.895 1.00 30.07 ? 287  LEU D CB    1 
ATOM   3900  C CG    . LEU B 1 235 ? 164.898 8.765   20.522 1.00 29.99 ? 287  LEU D CG    1 
ATOM   3901  C CD1   . LEU B 1 235 ? 165.348 9.238   21.892 1.00 29.28 ? 287  LEU D CD1   1 
ATOM   3902  C CD2   . LEU B 1 235 ? 164.177 7.427   20.645 1.00 28.88 ? 287  LEU D CD2   1 
ATOM   3903  N N     . THR B 1 236 ? 166.968 10.670  18.634 1.00 30.37 ? 288  THR D N     1 
ATOM   3904  C CA    . THR B 1 236 ? 168.127 10.166  17.920 1.00 29.87 ? 288  THR D CA    1 
ATOM   3905  C C     . THR B 1 236 ? 168.158 8.752   18.471 1.00 30.88 ? 288  THR D C     1 
ATOM   3906  O O     . THR B 1 236 ? 168.219 8.561   19.687 1.00 31.32 ? 288  THR D O     1 
ATOM   3907  C CB    . THR B 1 236 ? 169.396 10.925  18.338 1.00 30.45 ? 288  THR D CB    1 
ATOM   3908  O OG1   . THR B 1 236 ? 169.322 12.276  17.855 1.00 30.21 ? 288  THR D OG1   1 
ATOM   3909  C CG2   . THR B 1 236 ? 170.643 10.246  17.783 1.00 30.10 ? 288  THR D CG2   1 
ATOM   3910  N N     . SER B 1 237 ? 168.115 7.765   17.583 1.00 30.98 ? 289  SER D N     1 
ATOM   3911  C CA    . SER B 1 237 ? 168.039 6.378   18.002 1.00 29.93 ? 289  SER D CA    1 
ATOM   3912  C C     . SER B 1 237 ? 168.865 5.423   17.157 1.00 30.58 ? 289  SER D C     1 
ATOM   3913  O O     . SER B 1 237 ? 169.123 5.667   15.984 1.00 31.41 ? 289  SER D O     1 
ATOM   3914  C CB    . SER B 1 237 ? 166.565 5.966   17.964 1.00 28.70 ? 289  SER D CB    1 
ATOM   3915  O OG    . SER B 1 237 ? 166.346 4.683   18.500 1.00 30.41 ? 289  SER D OG    1 
ATOM   3916  N N     . VAL B 1 238 ? 169.289 4.326   17.771 1.00 31.40 ? 290  VAL D N     1 
ATOM   3917  C CA    . VAL B 1 238 ? 170.058 3.317   17.054 1.00 31.56 ? 290  VAL D CA    1 
ATOM   3918  C C     . VAL B 1 238 ? 169.051 2.531   16.250 1.00 32.28 ? 290  VAL D C     1 
ATOM   3919  O O     . VAL B 1 238 ? 168.037 2.074   16.793 1.00 32.64 ? 290  VAL D O     1 
ATOM   3920  C CB    . VAL B 1 238 ? 170.752 2.322   18.000 1.00 31.04 ? 290  VAL D CB    1 
ATOM   3921  C CG1   . VAL B 1 238 ? 171.615 1.363   17.198 1.00 29.80 ? 290  VAL D CG1   1 
ATOM   3922  C CG2   . VAL B 1 238 ? 171.583 3.063   19.013 1.00 33.97 ? 290  VAL D CG2   1 
ATOM   3923  N N     . VAL B 1 239 ? 169.321 2.353   14.966 1.00 31.78 ? 291  VAL D N     1 
ATOM   3924  C CA    . VAL B 1 239 ? 168.402 1.606   14.123 1.00 30.45 ? 291  VAL D CA    1 
ATOM   3925  C C     . VAL B 1 239 ? 168.579 0.074   14.179 1.00 30.36 ? 291  VAL D C     1 
ATOM   3926  O O     . VAL B 1 239 ? 169.651 -0.429  13.872 1.00 30.29 ? 291  VAL D O     1 
ATOM   3927  C CB    . VAL B 1 239 ? 168.575 2.022   12.633 1.00 29.57 ? 291  VAL D CB    1 
ATOM   3928  C CG1   . VAL B 1 239 ? 167.706 1.143   11.764 1.00 29.27 ? 291  VAL D CG1   1 
ATOM   3929  C CG2   . VAL B 1 239 ? 168.234 3.489   12.435 1.00 27.75 ? 291  VAL D CG2   1 
ATOM   3930  N N     . GLN B 1 240 ? 167.568 -0.671  14.609 1.00 31.06 ? 292  GLN D N     1 
ATOM   3931  C CA    . GLN B 1 240 ? 167.658 -2.127  14.519 1.00 33.97 ? 292  GLN D CA    1 
ATOM   3932  C C     . GLN B 1 240 ? 166.373 -2.349  13.745 1.00 33.83 ? 292  GLN D C     1 
ATOM   3933  O O     . GLN B 1 240 ? 165.302 -2.452  14.317 1.00 36.48 ? 292  GLN D O     1 
ATOM   3934  C CB    . GLN B 1 240 ? 167.671 -2.814  15.901 1.00 34.14 ? 292  GLN D CB    1 
ATOM   3935  C CG    . GLN B 1 240 ? 166.407 -3.526  16.359 1.00 35.38 ? 292  GLN D CG    1 
ATOM   3936  C CD    . GLN B 1 240 ? 166.611 -4.469  17.529 1.00 36.44 ? 292  GLN D CD    1 
ATOM   3937  O OE1   . GLN B 1 240 ? 166.707 -5.687  17.357 1.00 38.82 ? 292  GLN D OE1   1 
ATOM   3938  N NE2   . GLN B 1 240 ? 166.651 -3.911  18.731 1.00 36.19 ? 292  GLN D NE2   1 
ATOM   3939  N N     . PRO B 1 241 ? 166.467 -2.383  12.405 1.00 34.36 ? 293  PRO D N     1 
ATOM   3940  C CA    . PRO B 1 241 ? 165.323 -2.566  11.502 1.00 35.81 ? 293  PRO D CA    1 
ATOM   3941  C C     . PRO B 1 241 ? 164.502 -3.806  11.765 1.00 34.47 ? 293  PRO D C     1 
ATOM   3942  O O     . PRO B 1 241 ? 164.681 -4.845  11.157 1.00 34.71 ? 293  PRO D O     1 
ATOM   3943  C CB    . PRO B 1 241 ? 165.968 -2.615  10.149 1.00 35.91 ? 293  PRO D CB    1 
ATOM   3944  C CG    . PRO B 1 241 ? 167.211 -3.387  10.448 1.00 33.95 ? 293  PRO D CG    1 
ATOM   3945  C CD    . PRO B 1 241 ? 167.714 -2.685  11.688 1.00 34.93 ? 293  PRO D CD    1 
ATOM   3946  N N     . MET B 1 242 ? 163.559 -3.658  12.675 1.00 33.73 ? 294  MET D N     1 
ATOM   3947  C CA    . MET B 1 242 ? 162.710 -4.746  13.085 1.00 33.82 ? 294  MET D CA    1 
ATOM   3948  C C     . MET B 1 242 ? 161.979 -5.365  11.901 1.00 34.26 ? 294  MET D C     1 
ATOM   3949  O O     . MET B 1 242 ? 161.936 -6.600  11.784 1.00 33.77 ? 294  MET D O     1 
ATOM   3950  C CB    . MET B 1 242 ? 161.780 -4.253  14.206 1.00 35.24 ? 294  MET D CB    1 
ATOM   3951  C CG    . MET B 1 242 ? 162.573 -3.825  15.457 1.00 36.48 ? 294  MET D CG    1 
ATOM   3952  S SD    . MET B 1 242 ? 163.334 -5.273  16.292 1.00 39.49 ? 294  MET D SD    1 
ATOM   3953  C CE    . MET B 1 242 ? 161.844 -6.175  16.764 1.00 37.72 ? 294  MET D CE    1 
ATOM   3954  N N     . TYR B 1 243 ? 161.473 -4.523  10.997 1.00 33.05 ? 295  TYR D N     1 
ATOM   3955  C CA    . TYR B 1 243 ? 160.760 -5.012  9.811  1.00 32.26 ? 295  TYR D CA    1 
ATOM   3956  C C     . TYR B 1 243 ? 161.630 -5.923  8.949  1.00 31.46 ? 295  TYR D C     1 
ATOM   3957  O O     . TYR B 1 243 ? 161.183 -6.967  8.486  1.00 31.71 ? 295  TYR D O     1 
ATOM   3958  C CB    . TYR B 1 243 ? 160.241 -3.844  8.958  1.00 31.92 ? 295  TYR D CB    1 
ATOM   3959  C CG    . TYR B 1 243 ? 159.518 -4.233  7.664  1.00 29.95 ? 295  TYR D CG    1 
ATOM   3960  C CD1   . TYR B 1 243 ? 160.223 -4.735  6.561  1.00 28.26 ? 295  TYR D CD1   1 
ATOM   3961  C CD2   . TYR B 1 243 ? 158.146 -4.017  7.518  1.00 28.22 ? 295  TYR D CD2   1 
ATOM   3962  C CE1   . TYR B 1 243 ? 159.579 -4.992  5.345  1.00 27.21 ? 295  TYR D CE1   1 
ATOM   3963  C CE2   . TYR B 1 243 ? 157.496 -4.279  6.307  1.00 27.92 ? 295  TYR D CE2   1 
ATOM   3964  C CZ    . TYR B 1 243 ? 158.221 -4.756  5.228  1.00 26.97 ? 295  TYR D CZ    1 
ATOM   3965  O OH    . TYR B 1 243 ? 157.597 -4.950  4.023  1.00 28.49 ? 295  TYR D OH    1 
ATOM   3966  N N     . ASP B 1 244 ? 162.868 -5.520  8.720  1.00 30.13 ? 296  ASP D N     1 
ATOM   3967  C CA    . ASP B 1 244 ? 163.761 -6.342  7.936  1.00 28.48 ? 296  ASP D CA    1 
ATOM   3968  C C     . ASP B 1 244 ? 164.018 -7.675  8.619  1.00 27.30 ? 296  ASP D C     1 
ATOM   3969  O O     . ASP B 1 244 ? 163.867 -8.739  8.001  1.00 25.92 ? 296  ASP D O     1 
ATOM   3970  C CB    . ASP B 1 244 ? 165.078 -5.613  7.720  1.00 31.34 ? 296  ASP D CB    1 
ATOM   3971  C CG    . ASP B 1 244 ? 164.974 -4.587  6.646  1.00 31.35 ? 296  ASP D CG    1 
ATOM   3972  O OD1   . ASP B 1 244 ? 164.434 -4.954  5.593  1.00 33.74 ? 296  ASP D OD1   1 
ATOM   3973  O OD2   . ASP B 1 244 ? 165.419 -3.442  6.839  1.00 32.51 ? 296  ASP D OD2   1 
ATOM   3974  N N     . ILE B 1 245 ? 164.415 -7.604  9.890  1.00 24.67 ? 297  ILE D N     1 
ATOM   3975  C CA    . ILE B 1 245 ? 164.697 -8.784  10.676 1.00 23.33 ? 297  ILE D CA    1 
ATOM   3976  C C     . ILE B 1 245 ? 163.585 -9.794  10.460 1.00 24.29 ? 297  ILE D C     1 
ATOM   3977  O O     . ILE B 1 245 ? 163.838 -10.942 10.097 1.00 22.15 ? 297  ILE D O     1 
ATOM   3978  C CB    . ILE B 1 245 ? 164.810 -8.420  12.166 1.00 25.11 ? 297  ILE D CB    1 
ATOM   3979  C CG1   . ILE B 1 245 ? 166.096 -7.628  12.386 1.00 24.88 ? 297  ILE D CG1   1 
ATOM   3980  C CG2   . ILE B 1 245 ? 164.807 -9.682  13.040 1.00 19.87 ? 297  ILE D CG2   1 
ATOM   3981  C CD1   . ILE B 1 245 ? 166.318 -7.189  13.805 1.00 35.91 ? 297  ILE D CD1   1 
ATOM   3982  N N     . GLY B 1 246 ? 162.350 -9.342  10.658 1.00 26.54 ? 298  GLY D N     1 
ATOM   3983  C CA    . GLY B 1 246 ? 161.185 -10.200 10.485 1.00 28.13 ? 298  GLY D CA    1 
ATOM   3984  C C     . GLY B 1 246 ? 160.965 -10.717 9.072  1.00 28.95 ? 298  GLY D C     1 
ATOM   3985  O O     . GLY B 1 246 ? 160.654 -11.892 8.862  1.00 30.03 ? 298  GLY D O     1 
ATOM   3986  N N     . ALA B 1 247 ? 161.100 -9.840  8.089  1.00 29.70 ? 299  ALA D N     1 
ATOM   3987  C CA    . ALA B 1 247 ? 160.930 -10.260 6.709  1.00 29.69 ? 299  ALA D CA    1 
ATOM   3988  C C     . ALA B 1 247 ? 161.971 -11.346 6.479  1.00 28.77 ? 299  ALA D C     1 
ATOM   3989  O O     . ALA B 1 247 ? 161.662 -12.427 5.994  1.00 28.79 ? 299  ALA D O     1 
ATOM   3990  C CB    . ALA B 1 247 ? 161.170 -9.094  5.777  1.00 29.64 ? 299  ALA D CB    1 
ATOM   3991  N N     . VAL B 1 248 ? 163.206 -11.047 6.860  1.00 27.67 ? 300  VAL D N     1 
ATOM   3992  C CA    . VAL B 1 248 ? 164.307 -11.983 6.704  1.00 27.96 ? 300  VAL D CA    1 
ATOM   3993  C C     . VAL B 1 248 ? 164.085 -13.277 7.468  1.00 27.97 ? 300  VAL D C     1 
ATOM   3994  O O     . VAL B 1 248 ? 164.351 -14.361 6.941  1.00 27.50 ? 300  VAL D O     1 
ATOM   3995  C CB    . VAL B 1 248 ? 165.624 -11.367 7.187  1.00 27.52 ? 300  VAL D CB    1 
ATOM   3996  C CG1   . VAL B 1 248 ? 166.730 -12.403 7.143  1.00 27.29 ? 300  VAL D CG1   1 
ATOM   3997  C CG2   . VAL B 1 248 ? 165.965 -10.185 6.336  1.00 26.36 ? 300  VAL D CG2   1 
ATOM   3998  N N     . ALA B 1 249 ? 163.607 -13.160 8.707  1.00 27.44 ? 301  ALA D N     1 
ATOM   3999  C CA    . ALA B 1 249 ? 163.368 -14.325 9.544  1.00 27.25 ? 301  ALA D CA    1 
ATOM   4000  C C     . ALA B 1 249 ? 162.370 -15.251 8.865  1.00 29.11 ? 301  ALA D C     1 
ATOM   4001  O O     . ALA B 1 249 ? 162.483 -16.478 8.945  1.00 30.49 ? 301  ALA D O     1 
ATOM   4002  C CB    . ALA B 1 249 ? 162.853 -13.895 10.889 1.00 26.10 ? 301  ALA D CB    1 
ATOM   4003  N N     . MET B 1 250 ? 161.395 -14.667 8.183  1.00 29.92 ? 302  MET D N     1 
ATOM   4004  C CA    . MET B 1 250 ? 160.396 -15.466 7.493  1.00 30.09 ? 302  MET D CA    1 
ATOM   4005  C C     . MET B 1 250 ? 161.016 -16.170 6.315  1.00 30.78 ? 302  MET D C     1 
ATOM   4006  O O     . MET B 1 250 ? 160.792 -17.354 6.098  1.00 32.85 ? 302  MET D O     1 
ATOM   4007  C CB    . MET B 1 250 ? 159.241 -14.591 7.010  1.00 29.67 ? 302  MET D CB    1 
ATOM   4008  C CG    . MET B 1 250 ? 158.000 -14.673 7.887  1.00 31.14 ? 302  MET D CG    1 
ATOM   4009  S SD    . MET B 1 250 ? 156.898 -16.070 7.503  1.00 31.20 ? 302  MET D SD    1 
ATOM   4010  C CE    . MET B 1 250 ? 157.770 -17.379 8.189  1.00 34.40 ? 302  MET D CE    1 
ATOM   4011  N N     . ARG B 1 251 ? 161.806 -15.451 5.540  1.00 31.59 ? 303  ARG D N     1 
ATOM   4012  C CA    . ARG B 1 251 ? 162.414 -16.077 4.378  1.00 32.65 ? 303  ARG D CA    1 
ATOM   4013  C C     . ARG B 1 251 ? 163.360 -17.223 4.761  1.00 31.99 ? 303  ARG D C     1 
ATOM   4014  O O     . ARG B 1 251 ? 163.449 -18.229 4.067  1.00 30.71 ? 303  ARG D O     1 
ATOM   4015  C CB    . ARG B 1 251 ? 163.109 -15.000 3.549  1.00 31.01 ? 303  ARG D CB    1 
ATOM   4016  C CG    . ARG B 1 251 ? 162.104 -14.039 2.943  1.00 29.50 ? 303  ARG D CG    1 
ATOM   4017  C CD    . ARG B 1 251 ? 162.780 -12.779 2.488  1.00 29.92 ? 303  ARG D CD    1 
ATOM   4018  N NE    . ARG B 1 251 ? 163.919 -13.066 1.623  1.00 31.45 ? 303  ARG D NE    1 
ATOM   4019  C CZ    . ARG B 1 251 ? 165.044 -12.360 1.634  1.00 32.85 ? 303  ARG D CZ    1 
ATOM   4020  N NH1   . ARG B 1 251 ? 165.173 -11.331 2.470  1.00 35.37 ? 303  ARG D NH1   1 
ATOM   4021  N NH2   . ARG B 1 251 ? 166.040 -12.682 0.826  1.00 32.16 ? 303  ARG D NH2   1 
ATOM   4022  N N     . LEU B 1 252 ? 164.041 -17.074 5.889  1.00 31.99 ? 304  LEU D N     1 
ATOM   4023  C CA    . LEU B 1 252 ? 164.952 -18.103 6.366  1.00 31.83 ? 304  LEU D CA    1 
ATOM   4024  C C     . LEU B 1 252 ? 164.144 -19.313 6.827  1.00 31.79 ? 304  LEU D C     1 
ATOM   4025  O O     . LEU B 1 252 ? 164.518 -20.460 6.573  1.00 29.99 ? 304  LEU D O     1 
ATOM   4026  C CB    . LEU B 1 252 ? 165.774 -17.555 7.525  1.00 31.47 ? 304  LEU D CB    1 
ATOM   4027  C CG    . LEU B 1 252 ? 166.720 -18.539 8.189  1.00 32.42 ? 304  LEU D CG    1 
ATOM   4028  C CD1   . LEU B 1 252 ? 167.724 -19.032 7.165  1.00 31.93 ? 304  LEU D CD1   1 
ATOM   4029  C CD2   . LEU B 1 252 ? 167.426 -17.843 9.353  1.00 34.55 ? 304  LEU D CD2   1 
ATOM   4030  N N     . LEU B 1 253 ? 163.035 -19.042 7.515  1.00 31.12 ? 305  LEU D N     1 
ATOM   4031  C CA    . LEU B 1 253 ? 162.170 -20.099 7.989  1.00 31.11 ? 305  LEU D CA    1 
ATOM   4032  C C     . LEU B 1 253 ? 161.618 -20.842 6.781  1.00 31.32 ? 305  LEU D C     1 
ATOM   4033  O O     . LEU B 1 253 ? 161.624 -22.066 6.746  1.00 31.13 ? 305  LEU D O     1 
ATOM   4034  C CB    . LEU B 1 253 ? 161.015 -19.521 8.809  1.00 32.34 ? 305  LEU D CB    1 
ATOM   4035  C CG    . LEU B 1 253 ? 160.047 -20.556 9.412  1.00 33.42 ? 305  LEU D CG    1 
ATOM   4036  C CD1   . LEU B 1 253 ? 160.794 -21.375 10.431 1.00 33.14 ? 305  LEU D CD1   1 
ATOM   4037  C CD2   . LEU B 1 253 ? 158.842 -19.880 10.066 1.00 31.97 ? 305  LEU D CD2   1 
ATOM   4038  N N     . THR B 1 254 ? 161.160 -20.094 5.782  1.00 31.91 ? 306  THR D N     1 
ATOM   4039  C CA    . THR B 1 254 ? 160.587 -20.694 4.584  1.00 32.54 ? 306  THR D CA    1 
ATOM   4040  C C     . THR B 1 254 ? 161.535 -21.689 3.943  1.00 33.52 ? 306  THR D C     1 
ATOM   4041  O O     . THR B 1 254 ? 161.125 -22.785 3.596  1.00 34.99 ? 306  THR D O     1 
ATOM   4042  C CB    . THR B 1 254 ? 160.182 -19.625 3.554  1.00 32.34 ? 306  THR D CB    1 
ATOM   4043  O OG1   . THR B 1 254 ? 159.292 -18.682 4.167  1.00 32.39 ? 306  THR D OG1   1 
ATOM   4044  C CG2   . THR B 1 254 ? 159.454 -20.259 2.401  1.00 30.98 ? 306  THR D CG2   1 
ATOM   4045  N N     . LYS B 1 255 ? 162.803 -21.329 3.795  1.00 35.69 ? 307  LYS D N     1 
ATOM   4046  C CA    . LYS B 1 255 ? 163.767 -22.255 3.209  1.00 37.00 ? 307  LYS D CA    1 
ATOM   4047  C C     . LYS B 1 255 ? 163.668 -23.574 3.964  1.00 37.74 ? 307  LYS D C     1 
ATOM   4048  O O     . LYS B 1 255 ? 163.414 -24.616 3.365  1.00 39.79 ? 307  LYS D O     1 
ATOM   4049  C CB    . LYS B 1 255 ? 165.197 -21.706 3.314  1.00 39.46 ? 307  LYS D CB    1 
ATOM   4050  C CG    . LYS B 1 255 ? 165.567 -20.576 2.326  1.00 43.62 ? 307  LYS D CG    1 
ATOM   4051  C CD    . LYS B 1 255 ? 165.851 -21.096 0.900  1.00 47.07 ? 307  LYS D CD    1 
ATOM   4052  C CE    . LYS B 1 255 ? 166.609 -20.070 0.029  1.00 47.90 ? 307  LYS D CE    1 
ATOM   4053  N NZ    . LYS B 1 255 ? 165.773 -18.975 -0.535 1.00 48.67 ? 307  LYS D NZ    1 
ATOM   4054  N N     . TYR B 1 256 ? 163.851 -23.532 5.280  1.00 38.13 ? 308  TYR D N     1 
ATOM   4055  C CA    . TYR B 1 256 ? 163.770 -24.746 6.086  1.00 38.92 ? 308  TYR D CA    1 
ATOM   4056  C C     . TYR B 1 256 ? 162.509 -25.541 5.796  1.00 40.17 ? 308  TYR D C     1 
ATOM   4057  O O     . TYR B 1 256 ? 162.584 -26.682 5.333  1.00 40.11 ? 308  TYR D O     1 
ATOM   4058  C CB    . TYR B 1 256 ? 163.814 -24.407 7.576  1.00 37.99 ? 308  TYR D CB    1 
ATOM   4059  C CG    . TYR B 1 256 ? 165.183 -24.008 8.038  1.00 37.16 ? 308  TYR D CG    1 
ATOM   4060  C CD1   . TYR B 1 256 ? 166.238 -24.913 7.971  1.00 37.25 ? 308  TYR D CD1   1 
ATOM   4061  C CD2   . TYR B 1 256 ? 165.444 -22.709 8.485  1.00 36.53 ? 308  TYR D CD2   1 
ATOM   4062  C CE1   . TYR B 1 256 ? 167.531 -24.543 8.329  1.00 38.26 ? 308  TYR D CE1   1 
ATOM   4063  C CE2   . TYR B 1 256 ? 166.728 -22.322 8.846  1.00 37.64 ? 308  TYR D CE2   1 
ATOM   4064  C CZ    . TYR B 1 256 ? 167.774 -23.246 8.761  1.00 38.81 ? 308  TYR D CZ    1 
ATOM   4065  O OH    . TYR B 1 256 ? 169.065 -22.870 9.068  1.00 39.19 ? 308  TYR D OH    1 
ATOM   4066  N N     . MET B 1 257 ? 161.358 -24.927 6.067  1.00 41.63 ? 309  MET D N     1 
ATOM   4067  C CA    . MET B 1 257 ? 160.058 -25.563 5.859  1.00 43.43 ? 309  MET D CA    1 
ATOM   4068  C C     . MET B 1 257 ? 159.975 -26.261 4.510  1.00 45.89 ? 309  MET D C     1 
ATOM   4069  O O     . MET B 1 257 ? 159.325 -27.301 4.378  1.00 46.29 ? 309  MET D O     1 
ATOM   4070  C CB    . MET B 1 257 ? 158.920 -24.538 5.939  1.00 41.38 ? 309  MET D CB    1 
ATOM   4071  C CG    . MET B 1 257 ? 158.903 -23.672 7.177  1.00 40.20 ? 309  MET D CG    1 
ATOM   4072  S SD    . MET B 1 257 ? 157.326 -22.818 7.386  1.00 40.09 ? 309  MET D SD    1 
ATOM   4073  C CE    . MET B 1 257 ? 157.268 -21.778 5.965  1.00 39.53 ? 309  MET D CE    1 
ATOM   4074  N N     . ASN B 1 258 ? 160.630 -25.682 3.510  1.00 47.98 ? 310  ASN D N     1 
ATOM   4075  C CA    . ASN B 1 258 ? 160.620 -26.243 2.175  1.00 51.39 ? 310  ASN D CA    1 
ATOM   4076  C C     . ASN B 1 258 ? 161.834 -27.121 1.912  1.00 53.68 ? 310  ASN D C     1 
ATOM   4077  O O     . ASN B 1 258 ? 162.112 -27.495 0.762  1.00 55.54 ? 310  ASN D O     1 
ATOM   4078  C CB    . ASN B 1 258 ? 160.520 -25.113 1.154  1.00 52.40 ? 310  ASN D CB    1 
ATOM   4079  C CG    . ASN B 1 258 ? 159.146 -24.479 1.138  1.00 54.84 ? 310  ASN D CG    1 
ATOM   4080  O OD1   . ASN B 1 258 ? 158.997 -23.311 0.790  1.00 56.49 ? 310  ASN D OD1   1 
ATOM   4081  N ND2   . ASN B 1 258 ? 158.126 -25.255 1.508  1.00 56.67 ? 310  ASN D ND2   1 
ATOM   4082  N N     . LYS B 1 259 ? 162.546 -27.452 2.982  1.00 54.35 ? 311  LYS D N     1 
ATOM   4083  C CA    . LYS B 1 259 ? 163.706 -28.316 2.880  1.00 56.89 ? 311  LYS D CA    1 
ATOM   4084  C C     . LYS B 1 259 ? 164.790 -27.866 1.924  1.00 57.73 ? 311  LYS D C     1 
ATOM   4085  O O     . LYS B 1 259 ? 165.391 -28.672 1.208  1.00 57.88 ? 311  LYS D O     1 
ATOM   4086  C CB    . LYS B 1 259 ? 163.241 -29.730 2.543  1.00 58.20 ? 311  LYS D CB    1 
ATOM   4087  C CG    . LYS B 1 259 ? 162.412 -30.366 3.644  1.00 59.44 ? 311  LYS D CG    1 
ATOM   4088  C CD    . LYS B 1 259 ? 162.179 -31.845 3.426  1.00 61.73 ? 311  LYS D CD    1 
ATOM   4089  C CE    . LYS B 1 259 ? 161.025 -32.109 2.467  1.00 64.13 ? 311  LYS D CE    1 
ATOM   4090  N NZ    . LYS B 1 259 ? 159.700 -31.771 3.069  1.00 64.06 ? 311  LYS D NZ    1 
ATOM   4091  N N     . GLU B 1 260 ? 165.012 -26.544 1.916  1.00 58.87 ? 312  GLU D N     1 
ATOM   4092  C CA    . GLU B 1 260 ? 166.038 -25.912 1.047  1.00 59.03 ? 312  GLU D CA    1 
ATOM   4093  C C     . GLU B 1 260 ? 167.302 -25.765 1.815  1.00 59.04 ? 312  GLU D C     1 
ATOM   4094  O O     . GLU B 1 260 ? 167.344 -26.132 3.015  1.00 58.87 ? 312  GLU D O     1 
ATOM   4095  C CB    . GLU B 1 260 ? 165.528 -24.595 0.468  1.00 59.41 ? 312  GLU D CB    1 
ATOM   4096  C CG    . GLU B 1 260 ? 164.480 -24.766 -0.632 1.00 61.57 ? 312  GLU D CG    1 
ATOM   4097  C CD    . GLU B 1 260 ? 163.550 -23.556 -0.850 1.00 62.69 ? 312  GLU D CD    1 
ATOM   4098  O OE1   . GLU B 1 260 ? 164.019 -22.406 -0.856 1.00 63.62 ? 312  GLU D OE1   1 
ATOM   4099  O OE2   . GLU B 1 260 ? 162.328 -23.756 -1.044 1.00 63.70 ? 312  GLU D OE2   1 
ATOM   4100  N N     . THR B 1 261 ? 168.320 -25.213 1.178  1.00 59.56 ? 313  THR D N     1 
ATOM   4101  C CA    . THR B 1 261 ? 169.563 -25.061 1.875  1.00 60.62 ? 313  THR D CA    1 
ATOM   4102  C C     . THR B 1 261 ? 169.766 -23.719 2.530  1.00 61.46 ? 313  THR D C     1 
ATOM   4103  O O     . THR B 1 261 ? 169.377 -22.707 1.957  1.00 61.49 ? 313  THR D O     1 
ATOM   4104  C CB    . THR B 1 261 ? 170.755 -25.296 0.985  1.00 61.10 ? 313  THR D CB    1 
ATOM   4105  O OG1   . THR B 1 261 ? 170.787 -24.321 -0.045 1.00 60.75 ? 313  THR D OG1   1 
ATOM   4106  C CG2   . THR B 1 261 ? 170.710 -26.655 0.388  1.00 63.13 ? 313  THR D CG2   1 
ATOM   4107  N N     . VAL B 1 262 ? 170.506 -23.714 3.642  1.00 61.96 ? 314  VAL D N     1 
ATOM   4108  C CA    . VAL B 1 262 ? 170.723 -22.510 4.390  1.00 62.66 ? 314  VAL D CA    1 
ATOM   4109  C C     . VAL B 1 262 ? 172.167 -22.541 4.767  1.00 64.82 ? 314  VAL D C     1 
ATOM   4110  O O     . VAL B 1 262 ? 172.551 -23.164 5.770  1.00 66.07 ? 314  VAL D O     1 
ATOM   4111  C CB    . VAL B 1 262 ? 169.815 -22.525 5.624  1.00 60.73 ? 314  VAL D CB    1 
ATOM   4112  C CG1   . VAL B 1 262 ? 170.091 -21.321 6.519  1.00 60.26 ? 314  VAL D CG1   1 
ATOM   4113  C CG2   . VAL B 1 262 ? 168.327 -22.533 5.233  1.00 59.53 ? 314  VAL D CG2   1 
ATOM   4114  N N     . ASP B 1 263 ? 172.954 -21.877 3.928  1.00 64.98 ? 315  ASP D N     1 
ATOM   4115  C CA    . ASP B 1 263 ? 174.368 -21.830 4.174  1.00 66.22 ? 315  ASP D CA    1 
ATOM   4116  C C     . ASP B 1 263 ? 174.666 -20.682 5.121  1.00 65.30 ? 315  ASP D C     1 
ATOM   4117  O O     . ASP B 1 263 ? 175.827 -20.366 5.399  1.00 66.55 ? 315  ASP D O     1 
ATOM   4118  C CB    . ASP B 1 263 ? 175.155 -21.700 2.857  1.00 67.80 ? 315  ASP D CB    1 
ATOM   4119  C CG    . ASP B 1 263 ? 175.013 -20.327 2.217  1.00 69.44 ? 315  ASP D CG    1 
ATOM   4120  O OD1   . ASP B 1 263 ? 173.900 -19.767 2.328  1.00 70.30 ? 315  ASP D OD1   1 
ATOM   4121  O OD2   . ASP B 1 263 ? 175.993 -19.815 1.613  1.00 69.22 ? 315  ASP D OD2   1 
ATOM   4122  N N     . SER B 1 264 ? 173.601 -20.055 5.603  1.00 62.90 ? 316  SER D N     1 
ATOM   4123  C CA    . SER B 1 264 ? 173.716 -18.946 6.533  1.00 60.31 ? 316  SER D CA    1 
ATOM   4124  C C     . SER B 1 264 ? 172.622 -19.121 7.577  1.00 57.50 ? 316  SER D C     1 
ATOM   4125  O O     . SER B 1 264 ? 171.618 -18.411 7.573  1.00 57.97 ? 316  SER D O     1 
ATOM   4126  C CB    . SER B 1 264 ? 173.547 -17.608 5.803  1.00 62.63 ? 316  SER D CB    1 
ATOM   4127  O OG    . SER B 1 264 ? 173.746 -16.502 6.678  1.00 64.05 ? 316  SER D OG    1 
ATOM   4128  N N     . SER B 1 265 ? 172.830 -20.092 8.460  1.00 54.51 ? 317  SER D N     1 
ATOM   4129  C CA    . SER B 1 265 ? 171.900 -20.426 9.540  1.00 50.12 ? 317  SER D CA    1 
ATOM   4130  C C     . SER B 1 265 ? 171.613 -19.253 10.483 1.00 46.61 ? 317  SER D C     1 
ATOM   4131  O O     . SER B 1 265 ? 170.476 -19.032 10.889 1.00 44.92 ? 317  SER D O     1 
ATOM   4132  C CB    . SER B 1 265 ? 172.461 -21.603 10.337 1.00 50.28 ? 317  SER D CB    1 
ATOM   4133  O OG    . SER B 1 265 ? 171.878 -21.658 11.622 1.00 52.69 ? 317  SER D OG    1 
ATOM   4134  N N     . ILE B 1 266 ? 172.645 -18.517 10.865 1.00 43.00 ? 318  ILE D N     1 
ATOM   4135  C CA    . ILE B 1 266 ? 172.417 -17.379 11.722 1.00 40.45 ? 318  ILE D CA    1 
ATOM   4136  C C     . ILE B 1 266 ? 172.805 -16.123 10.953 1.00 39.27 ? 318  ILE D C     1 
ATOM   4137  O O     . ILE B 1 266 ? 173.960 -15.917 10.573 1.00 39.07 ? 318  ILE D O     1 
ATOM   4138  C CB    . ILE B 1 266 ? 173.145 -17.519 13.124 1.00 40.47 ? 318  ILE D CB    1 
ATOM   4139  C CG1   . ILE B 1 266 ? 174.012 -16.290 13.414 1.00 40.30 ? 318  ILE D CG1   1 
ATOM   4140  C CG2   . ILE B 1 266 ? 173.880 -18.862 13.212 1.00 38.36 ? 318  ILE D CG2   1 
ATOM   4141  C CD1   . ILE B 1 266 ? 175.443 -16.408 12.955 1.00 44.13 ? 318  ILE D CD1   1 
ATOM   4142  N N     . VAL B 1 267 ? 171.782 -15.315 10.692 1.00 38.10 ? 319  VAL D N     1 
ATOM   4143  C CA    . VAL B 1 267 ? 171.904 -14.072 9.947  1.00 35.06 ? 319  VAL D CA    1 
ATOM   4144  C C     . VAL B 1 267 ? 172.035 -12.889 10.868 1.00 34.27 ? 319  VAL D C     1 
ATOM   4145  O O     . VAL B 1 267 ? 171.431 -12.839 11.939 1.00 33.79 ? 319  VAL D O     1 
ATOM   4146  C CB    . VAL B 1 267 ? 170.665 -13.826 9.075  1.00 33.50 ? 319  VAL D CB    1 
ATOM   4147  C CG1   . VAL B 1 267 ? 170.865 -12.594 8.196  1.00 30.09 ? 319  VAL D CG1   1 
ATOM   4148  C CG2   . VAL B 1 267 ? 170.368 -15.073 8.264  1.00 34.17 ? 319  VAL D CG2   1 
ATOM   4149  N N     . GLN B 1 268 ? 172.832 -11.932 10.431 1.00 33.50 ? 320  GLN D N     1 
ATOM   4150  C CA    . GLN B 1 268 ? 173.026 -10.724 11.188 1.00 33.44 ? 320  GLN D CA    1 
ATOM   4151  C C     . GLN B 1 268 ? 172.963 -9.535  10.248 1.00 33.40 ? 320  GLN D C     1 
ATOM   4152  O O     . GLN B 1 268 ? 173.813 -9.363  9.376  1.00 34.07 ? 320  GLN D O     1 
ATOM   4153  C CB    . GLN B 1 268 ? 174.360 -10.763 11.899 1.00 32.26 ? 320  GLN D CB    1 
ATOM   4154  C CG    . GLN B 1 268 ? 174.678 -9.474  12.571 1.00 31.48 ? 320  GLN D CG    1 
ATOM   4155  C CD    . GLN B 1 268 ? 175.980 -9.556  13.273 1.00 31.72 ? 320  GLN D CD    1 
ATOM   4156  O OE1   . GLN B 1 268 ? 176.050 -10.008 14.414 1.00 32.62 ? 320  GLN D OE1   1 
ATOM   4157  N NE2   . GLN B 1 268 ? 177.044 -9.142  12.594 1.00 32.72 ? 320  GLN D NE2   1 
ATOM   4158  N N     . LEU B 1 269 ? 171.931 -8.727  10.424 1.00 33.23 ? 321  LEU D N     1 
ATOM   4159  C CA    . LEU B 1 269 ? 171.738 -7.555  9.600  1.00 34.71 ? 321  LEU D CA    1 
ATOM   4160  C C     . LEU B 1 269 ? 172.585 -6.416  10.136 1.00 35.58 ? 321  LEU D C     1 
ATOM   4161  O O     . LEU B 1 269 ? 172.970 -6.401  11.302 1.00 37.11 ? 321  LEU D O     1 
ATOM   4162  C CB    . LEU B 1 269 ? 170.260 -7.155  9.603  1.00 34.10 ? 321  LEU D CB    1 
ATOM   4163  C CG    . LEU B 1 269 ? 169.255 -7.863  8.684  1.00 33.90 ? 321  LEU D CG    1 
ATOM   4164  C CD1   . LEU B 1 269 ? 169.446 -9.360  8.697  1.00 33.96 ? 321  LEU D CD1   1 
ATOM   4165  C CD2   . LEU B 1 269 ? 167.850 -7.491  9.121  1.00 33.83 ? 321  LEU D CD2   1 
ATOM   4166  N N     . PRO B 1 270 ? 172.904 -5.446  9.281  1.00 36.39 ? 322  PRO D N     1 
ATOM   4167  C CA    . PRO B 1 270 ? 173.713 -4.309  9.719  1.00 36.33 ? 322  PRO D CA    1 
ATOM   4168  C C     . PRO B 1 270 ? 172.881 -3.288  10.510 1.00 37.16 ? 322  PRO D C     1 
ATOM   4169  O O     . PRO B 1 270 ? 171.646 -3.351  10.514 1.00 36.96 ? 322  PRO D O     1 
ATOM   4170  C CB    . PRO B 1 270 ? 174.225 -3.745  8.403  1.00 36.94 ? 322  PRO D CB    1 
ATOM   4171  C CG    . PRO B 1 270 ? 173.073 -4.017  7.468  1.00 36.65 ? 322  PRO D CG    1 
ATOM   4172  C CD    . PRO B 1 270 ? 172.709 -5.431  7.819  1.00 35.76 ? 322  PRO D CD    1 
ATOM   4173  N N     . HIS B 1 271 ? 173.559 -2.351  11.179 1.00 36.75 ? 323  HIS D N     1 
ATOM   4174  C CA    . HIS B 1 271 ? 172.880 -1.309  11.957 1.00 34.25 ? 323  HIS D CA    1 
ATOM   4175  C C     . HIS B 1 271 ? 173.520 0.060   11.718 1.00 33.44 ? 323  HIS D C     1 
ATOM   4176  O O     . HIS B 1 271 ? 174.585 0.153   11.115 1.00 33.84 ? 323  HIS D O     1 
ATOM   4177  C CB    . HIS B 1 271 ? 172.954 -1.618  13.446 1.00 32.65 ? 323  HIS D CB    1 
ATOM   4178  C CG    . HIS B 1 271 ? 174.311 -1.404  14.029 1.00 33.32 ? 323  HIS D CG    1 
ATOM   4179  N ND1   . HIS B 1 271 ? 175.341 -2.308  13.873 1.00 34.53 ? 323  HIS D ND1   1 
ATOM   4180  C CD2   . HIS B 1 271 ? 174.818 -0.374  14.744 1.00 33.31 ? 323  HIS D CD2   1 
ATOM   4181  C CE1   . HIS B 1 271 ? 176.424 -1.844  14.469 1.00 34.22 ? 323  HIS D CE1   1 
ATOM   4182  N NE2   . HIS B 1 271 ? 176.134 -0.671  15.005 1.00 34.29 ? 323  HIS D NE2   1 
ATOM   4183  N N     . ARG B 1 272 ? 172.860 1.114   12.198 1.00 32.07 ? 324  ARG D N     1 
ATOM   4184  C CA    . ARG B 1 272 ? 173.354 2.486   12.076 1.00 29.86 ? 324  ARG D CA    1 
ATOM   4185  C C     . ARG B 1 272 ? 172.628 3.349   13.111 1.00 30.72 ? 324  ARG D C     1 
ATOM   4186  O O     . ARG B 1 272 ? 171.799 2.840   13.873 1.00 31.35 ? 324  ARG D O     1 
ATOM   4187  C CB    . ARG B 1 272 ? 173.103 3.029   10.669 1.00 27.88 ? 324  ARG D CB    1 
ATOM   4188  C CG    . ARG B 1 272 ? 171.652 3.186   10.306 1.00 28.21 ? 324  ARG D CG    1 
ATOM   4189  C CD    . ARG B 1 272 ? 171.479 3.717   8.897  1.00 30.26 ? 324  ARG D CD    1 
ATOM   4190  N NE    . ARG B 1 272 ? 170.257 3.174   8.301  1.00 37.76 ? 324  ARG D NE    1 
ATOM   4191  C CZ    . ARG B 1 272 ? 169.017 3.572   8.593  1.00 40.43 ? 324  ARG D CZ    1 
ATOM   4192  N NH1   . ARG B 1 272 ? 168.811 4.546   9.481  1.00 41.20 ? 324  ARG D NH1   1 
ATOM   4193  N NH2   . ARG B 1 272 ? 167.976 2.977   8.014  1.00 40.47 ? 324  ARG D NH2   1 
ATOM   4194  N N     . ILE B 1 273 ? 172.939 4.644   13.153 1.00 30.18 ? 325  ILE D N     1 
ATOM   4195  C CA    . ILE B 1 273 ? 172.287 5.552   14.096 1.00 29.52 ? 325  ILE D CA    1 
ATOM   4196  C C     . ILE B 1 273 ? 171.536 6.676   13.392 1.00 28.25 ? 325  ILE D C     1 
ATOM   4197  O O     . ILE B 1 273 ? 172.136 7.453   12.676 1.00 29.19 ? 325  ILE D O     1 
ATOM   4198  C CB    . ILE B 1 273 ? 173.303 6.229   15.016 1.00 30.97 ? 325  ILE D CB    1 
ATOM   4199  C CG1   . ILE B 1 273 ? 174.015 5.186   15.867 1.00 32.91 ? 325  ILE D CG1   1 
ATOM   4200  C CG2   . ILE B 1 273 ? 172.597 7.266   15.892 1.00 30.00 ? 325  ILE D CG2   1 
ATOM   4201  C CD1   . ILE B 1 273 ? 175.350 5.682   16.388 1.00 39.43 ? 325  ILE D CD1   1 
ATOM   4202  N N     . GLU B 1 274 ? 170.231 6.767   13.588 1.00 27.48 ? 326  GLU D N     1 
ATOM   4203  C CA    . GLU B 1 274 ? 169.481 7.857   12.988 1.00 27.74 ? 326  GLU D CA    1 
ATOM   4204  C C     . GLU B 1 274 ? 169.618 9.057   13.920 1.00 28.79 ? 326  GLU D C     1 
ATOM   4205  O O     . GLU B 1 274 ? 169.099 9.056   15.030 1.00 29.29 ? 326  GLU D O     1 
ATOM   4206  C CB    . GLU B 1 274 ? 168.009 7.501   12.851 1.00 26.72 ? 326  GLU D CB    1 
ATOM   4207  C CG    . GLU B 1 274 ? 167.652 6.751   11.595 1.00 29.04 ? 326  GLU D CG    1 
ATOM   4208  C CD    . GLU B 1 274 ? 167.804 7.602   10.351 1.00 29.52 ? 326  GLU D CD    1 
ATOM   4209  O OE1   . GLU B 1 274 ? 167.545 8.824   10.441 1.00 29.64 ? 326  GLU D OE1   1 
ATOM   4210  O OE2   . GLU B 1 274 ? 168.166 7.045   9.288  1.00 28.35 ? 326  GLU D OE2   1 
ATOM   4211  N N     . PHE B 1 275 ? 170.336 10.078  13.476 1.00 29.56 ? 327  PHE D N     1 
ATOM   4212  C CA    . PHE B 1 275 ? 170.519 11.269  14.285 1.00 29.17 ? 327  PHE D CA    1 
ATOM   4213  C C     . PHE B 1 275 ? 169.346 12.220  14.066 1.00 30.66 ? 327  PHE D C     1 
ATOM   4214  O O     . PHE B 1 275 ? 168.933 12.474  12.931 1.00 31.88 ? 327  PHE D O     1 
ATOM   4215  C CB    . PHE B 1 275 ? 171.852 11.946  13.935 1.00 28.20 ? 327  PHE D CB    1 
ATOM   4216  C CG    . PHE B 1 275 ? 173.066 11.159  14.379 1.00 27.49 ? 327  PHE D CG    1 
ATOM   4217  C CD1   . PHE B 1 275 ? 173.851 10.473  13.457 1.00 25.24 ? 327  PHE D CD1   1 
ATOM   4218  C CD2   . PHE B 1 275 ? 173.391 11.064  15.737 1.00 28.64 ? 327  PHE D CD2   1 
ATOM   4219  C CE1   . PHE B 1 275 ? 174.934 9.702   13.877 1.00 24.75 ? 327  PHE D CE1   1 
ATOM   4220  C CE2   . PHE B 1 275 ? 174.481 10.290  16.170 1.00 27.46 ? 327  PHE D CE2   1 
ATOM   4221  C CZ    . PHE B 1 275 ? 175.249 9.610   15.240 1.00 26.29 ? 327  PHE D CZ    1 
ATOM   4222  N N     . ARG B 1 276 ? 168.791 12.724  15.162 1.00 31.49 ? 328  ARG D N     1 
ATOM   4223  C CA    . ARG B 1 276 ? 167.662 13.634  15.087 1.00 31.48 ? 328  ARG D CA    1 
ATOM   4224  C C     . ARG B 1 276 ? 167.868 14.872  15.975 1.00 32.00 ? 328  ARG D C     1 
ATOM   4225  O O     . ARG B 1 276 ? 168.941 15.453  15.943 1.00 33.43 ? 328  ARG D O     1 
ATOM   4226  C CB    . ARG B 1 276 ? 166.380 12.864  15.417 1.00 30.59 ? 328  ARG D CB    1 
ATOM   4227  C CG    . ARG B 1 276 ? 166.067 11.759  14.373 1.00 26.47 ? 328  ARG D CG    1 
ATOM   4228  C CD    . ARG B 1 276 ? 164.593 11.295  14.406 1.00 24.00 ? 328  ARG D CD    1 
ATOM   4229  N NE    . ARG B 1 276 ? 164.278 10.258  13.418 1.00 21.45 ? 328  ARG D NE    1 
ATOM   4230  C CZ    . ARG B 1 276 ? 164.491 8.955   13.584 1.00 20.97 ? 328  ARG D CZ    1 
ATOM   4231  N NH1   . ARG B 1 276 ? 165.020 8.496   14.713 1.00 23.94 ? 328  ARG D NH1   1 
ATOM   4232  N NH2   . ARG B 1 276 ? 164.198 8.106   12.613 1.00 16.99 ? 328  ARG D NH2   1 
ATOM   4233  N N     . GLN B 1 277 ? 166.884 15.308  16.748 1.00 32.38 ? 329  GLN D N     1 
ATOM   4234  C CA    . GLN B 1 277 ? 167.124 16.497  17.559 1.00 34.20 ? 329  GLN D CA    1 
ATOM   4235  C C     . GLN B 1 277 ? 167.290 16.246  19.043 1.00 36.66 ? 329  GLN D C     1 
ATOM   4236  O O     . GLN B 1 277 ? 167.262 17.180  19.856 1.00 35.81 ? 329  GLN D O     1 
ATOM   4237  C CB    . GLN B 1 277 ? 166.036 17.526  17.343 1.00 33.47 ? 329  GLN D CB    1 
ATOM   4238  C CG    . GLN B 1 277 ? 166.025 18.029  15.941 1.00 34.44 ? 329  GLN D CG    1 
ATOM   4239  C CD    . GLN B 1 277 ? 165.479 17.001  15.015 1.00 35.57 ? 329  GLN D CD    1 
ATOM   4240  O OE1   . GLN B 1 277 ? 164.305 16.632  15.115 1.00 38.25 ? 329  GLN D OE1   1 
ATOM   4241  N NE2   . GLN B 1 277 ? 166.316 16.509  14.113 1.00 33.29 ? 329  GLN D NE2   1 
ATOM   4242  N N     . SER B 1 278 ? 167.472 14.974  19.377 1.00 38.58 ? 330  SER D N     1 
ATOM   4243  C CA    . SER B 1 278 ? 167.680 14.531  20.746 1.00 40.23 ? 330  SER D CA    1 
ATOM   4244  C C     . SER B 1 278 ? 169.184 14.687  21.025 1.00 42.35 ? 330  SER D C     1 
ATOM   4245  O O     . SER B 1 278 ? 169.628 14.678  22.172 1.00 41.02 ? 330  SER D O     1 
ATOM   4246  C CB    . SER B 1 278 ? 167.261 13.067  20.862 1.00 37.46 ? 330  SER D CB    1 
ATOM   4247  O OG    . SER B 1 278 ? 167.376 12.615  22.185 1.00 37.98 ? 330  SER D OG    1 
ATOM   4248  N N     . THR B 1 279 ? 169.950 14.835  19.946 1.00 45.57 ? 331  THR D N     1 
ATOM   4249  C CA    . THR B 1 279 ? 171.399 14.990  20.004 1.00 49.01 ? 331  THR D CA    1 
ATOM   4250  C C     . THR B 1 279 ? 171.809 16.326  19.395 1.00 51.08 ? 331  THR D C     1 
ATOM   4251  O O     . THR B 1 279 ? 171.672 16.537  18.190 1.00 51.96 ? 331  THR D O     1 
ATOM   4252  C CB    . THR B 1 279 ? 172.108 13.841  19.235 1.00 49.34 ? 331  THR D CB    1 
ATOM   4253  O OG1   . THR B 1 279 ? 172.069 12.646  20.025 1.00 48.48 ? 331  THR D OG1   1 
ATOM   4254  C CG2   . THR B 1 279 ? 173.561 14.196  18.929 1.00 51.87 ? 331  THR D CG2   1 
ATOM   4255  N N     . LYS B 1 280 ? 172.309 17.221  20.246 1.00 53.67 ? 332  LYS D N     1 
ATOM   4256  C CA    . LYS B 1 280 ? 172.759 18.553  19.843 1.00 53.99 ? 332  LYS D CA    1 
ATOM   4257  C C     . LYS B 1 280 ? 173.895 18.419  18.835 1.00 52.58 ? 332  LYS D C     1 
ATOM   4258  O O     . LYS B 1 280 ? 173.821 19.093  17.784 1.00 50.21 ? 332  LYS D O     1 
ATOM   4259  C CB    . LYS B 1 280 ? 173.211 19.339  21.086 1.00 57.14 ? 332  LYS D CB    1 
ATOM   4260  C CG    . LYS B 1 280 ? 173.663 20.773  20.838 1.00 60.89 ? 332  LYS D CG    1 
ATOM   4261  C CD    . LYS B 1 280 ? 173.446 21.672  22.074 1.00 64.08 ? 332  LYS D CD    1 
ATOM   4262  C CE    . LYS B 1 280 ? 174.107 21.126  23.343 1.00 65.98 ? 332  LYS D CE    1 
ATOM   4263  N NZ    . LYS B 1 280 ? 173.968 22.056  24.512 1.00 67.21 ? 332  LYS D NZ    1 
ATOM   4264  O OXT   . LYS B 1 280 ? 174.830 17.632  19.104 1.00 52.86 ? 332  LYS D OXT   1 
ATOM   4265  N N     . THR C 1 8   ? 36.353  37.844  5.616  1.00 32.79 ? 60   THR B N     1 
ATOM   4266  C CA    . THR C 1 8   ? 35.792  36.462  5.476  1.00 34.71 ? 60   THR B CA    1 
ATOM   4267  C C     . THR C 1 8   ? 34.477  36.340  6.240  1.00 36.81 ? 60   THR B C     1 
ATOM   4268  O O     . THR C 1 8   ? 34.363  36.792  7.384  1.00 35.95 ? 60   THR B O     1 
ATOM   4269  C CB    . THR C 1 8   ? 36.754  35.363  6.025  1.00 33.72 ? 60   THR B CB    1 
ATOM   4270  O OG1   . THR C 1 8   ? 38.094  35.579  5.535  1.00 32.70 ? 60   THR B OG1   1 
ATOM   4271  C CG2   . THR C 1 8   ? 36.259  33.968  5.585  1.00 30.27 ? 60   THR B CG2   1 
ATOM   4272  N N     . THR C 1 9   ? 33.499  35.709  5.600  1.00 39.21 ? 61   THR B N     1 
ATOM   4273  C CA    . THR C 1 9   ? 32.177  35.530  6.176  1.00 41.66 ? 61   THR B CA    1 
ATOM   4274  C C     . THR C 1 9   ? 32.228  34.539  7.320  1.00 41.57 ? 61   THR B C     1 
ATOM   4275  O O     . THR C 1 9   ? 33.008  33.592  7.285  1.00 42.23 ? 61   THR B O     1 
ATOM   4276  C CB    . THR C 1 9   ? 31.196  35.011  5.116  1.00 44.21 ? 61   THR B CB    1 
ATOM   4277  O OG1   . THR C 1 9   ? 31.537  35.571  3.839  1.00 43.05 ? 61   THR B OG1   1 
ATOM   4278  C CG2   . THR C 1 9   ? 29.764  35.401  5.472  1.00 43.68 ? 61   THR B CG2   1 
ATOM   4279  N N     . THR C 1 10  ? 31.394  34.773  8.332  1.00 40.55 ? 62   THR B N     1 
ATOM   4280  C CA    . THR C 1 10  ? 31.302  33.917  9.517  1.00 37.79 ? 62   THR B CA    1 
ATOM   4281  C C     . THR C 1 10  ? 29.836  33.755  9.933  1.00 36.73 ? 62   THR B C     1 
ATOM   4282  O O     . THR C 1 10  ? 29.198  34.729  10.309 1.00 36.12 ? 62   THR B O     1 
ATOM   4283  C CB    . THR C 1 10  ? 32.075  34.533  10.710 1.00 36.77 ? 62   THR B CB    1 
ATOM   4284  O OG1   . THR C 1 10  ? 33.483  34.496  10.447 1.00 35.65 ? 62   THR B OG1   1 
ATOM   4285  C CG2   . THR C 1 10  ? 31.779  33.776  11.993 1.00 35.30 ? 62   THR B CG2   1 
ATOM   4286  N N     . VAL C 1 11  ? 29.281  32.548  9.856  1.00 35.92 ? 63   VAL B N     1 
ATOM   4287  C CA    . VAL C 1 11  ? 27.891  32.407  10.278 1.00 36.61 ? 63   VAL B CA    1 
ATOM   4288  C C     . VAL C 1 11  ? 27.855  31.698  11.615 1.00 36.59 ? 63   VAL B C     1 
ATOM   4289  O O     . VAL C 1 11  ? 28.587  30.730  11.850 1.00 36.92 ? 63   VAL B O     1 
ATOM   4290  C CB    . VAL C 1 11  ? 26.983  31.650  9.245  1.00 35.82 ? 63   VAL B CB    1 
ATOM   4291  C CG1   . VAL C 1 11  ? 27.350  32.064  7.830  1.00 35.39 ? 63   VAL B CG1   1 
ATOM   4292  C CG2   . VAL C 1 11  ? 27.063  30.164  9.448  1.00 35.52 ? 63   VAL B CG2   1 
ATOM   4293  N N     . GLY C 1 12  ? 27.019  32.232  12.499 1.00 36.48 ? 64   GLY B N     1 
ATOM   4294  C CA    . GLY C 1 12  ? 26.873  31.694  13.829 1.00 34.01 ? 64   GLY B CA    1 
ATOM   4295  C C     . GLY C 1 12  ? 25.717  30.735  13.820 1.00 33.24 ? 64   GLY B C     1 
ATOM   4296  O O     . GLY C 1 12  ? 24.667  31.024  13.262 1.00 32.97 ? 64   GLY B O     1 
ATOM   4297  N N     . VAL C 1 13  ? 25.927  29.578  14.426 1.00 33.59 ? 65   VAL B N     1 
ATOM   4298  C CA    . VAL C 1 13  ? 24.903  28.565  14.502 1.00 33.82 ? 65   VAL B CA    1 
ATOM   4299  C C     . VAL C 1 13  ? 24.685  28.319  15.987 1.00 35.14 ? 65   VAL B C     1 
ATOM   4300  O O     . VAL C 1 13  ? 25.647  28.264  16.751 1.00 36.52 ? 65   VAL B O     1 
ATOM   4301  C CB    . VAL C 1 13  ? 25.366  27.240  13.832 1.00 31.83 ? 65   VAL B CB    1 
ATOM   4302  C CG1   . VAL C 1 13  ? 24.173  26.437  13.378 1.00 31.87 ? 65   VAL B CG1   1 
ATOM   4303  C CG2   . VAL C 1 13  ? 26.248  27.524  12.659 1.00 31.26 ? 65   VAL B CG2   1 
ATOM   4304  N N     . ILE C 1 14  ? 23.431  28.207  16.405 1.00 35.65 ? 66   ILE B N     1 
ATOM   4305  C CA    . ILE C 1 14  ? 23.149  27.916  17.797 1.00 37.34 ? 66   ILE B CA    1 
ATOM   4306  C C     . ILE C 1 14  ? 22.020  26.896  17.914 1.00 37.43 ? 66   ILE B C     1 
ATOM   4307  O O     . ILE C 1 14  ? 20.865  27.195  17.632 1.00 37.18 ? 66   ILE B O     1 
ATOM   4308  C CB    . ILE C 1 14  ? 22.834  29.209  18.578 1.00 39.28 ? 66   ILE B CB    1 
ATOM   4309  C CG1   . ILE C 1 14  ? 21.525  29.838  18.127 1.00 39.84 ? 66   ILE B CG1   1 
ATOM   4310  C CG2   . ILE C 1 14  ? 23.943  30.221  18.328 1.00 40.44 ? 66   ILE B CG2   1 
ATOM   4311  C CD1   . ILE C 1 14  ? 21.322  31.234  18.701 1.00 41.48 ? 66   ILE B CD1   1 
ATOM   4312  N N     . ILE C 1 15  ? 22.382  25.668  18.277 1.00 37.23 ? 67   ILE B N     1 
ATOM   4313  C CA    . ILE C 1 15  ? 21.412  24.593  18.446 1.00 38.05 ? 67   ILE B CA    1 
ATOM   4314  C C     . ILE C 1 15  ? 21.155  24.449  19.936 1.00 39.06 ? 67   ILE B C     1 
ATOM   4315  O O     . ILE C 1 15  ? 21.918  24.971  20.750 1.00 38.27 ? 67   ILE B O     1 
ATOM   4316  C CB    . ILE C 1 15  ? 21.943  23.239  17.921 1.00 38.79 ? 67   ILE B CB    1 
ATOM   4317  C CG1   . ILE C 1 15  ? 23.463  23.246  17.899 1.00 38.89 ? 67   ILE B CG1   1 
ATOM   4318  C CG2   . ILE C 1 15  ? 21.368  22.922  16.576 1.00 38.37 ? 67   ILE B CG2   1 
ATOM   4319  C CD1   . ILE C 1 15  ? 24.084  22.884  19.233 1.00 43.09 ? 67   ILE B CD1   1 
ATOM   4320  N N     . PRO C 1 16  ? 20.072  23.755  20.320 1.00 40.24 ? 68   PRO B N     1 
ATOM   4321  C CA    . PRO C 1 16  ? 19.819  23.609  21.756 1.00 42.96 ? 68   PRO B CA    1 
ATOM   4322  C C     . PRO C 1 16  ? 20.779  22.636  22.453 1.00 46.15 ? 68   PRO B C     1 
ATOM   4323  O O     . PRO C 1 16  ? 21.486  23.014  23.398 1.00 47.91 ? 68   PRO B O     1 
ATOM   4324  C CB    . PRO C 1 16  ? 18.368  23.141  21.807 1.00 40.93 ? 68   PRO B CB    1 
ATOM   4325  C CG    . PRO C 1 16  ? 18.212  22.388  20.539 1.00 40.28 ? 68   PRO B CG    1 
ATOM   4326  C CD    . PRO C 1 16  ? 18.929  23.258  19.535 1.00 39.62 ? 68   PRO B CD    1 
ATOM   4327  N N     . ASP C 1 17  ? 20.825  21.397  21.972 1.00 47.08 ? 69   ASP B N     1 
ATOM   4328  C CA    . ASP C 1 17  ? 21.679  20.386  22.578 1.00 47.77 ? 69   ASP B CA    1 
ATOM   4329  C C     . ASP C 1 17  ? 22.611  19.708  21.586 1.00 48.48 ? 69   ASP B C     1 
ATOM   4330  O O     . ASP C 1 17  ? 22.165  18.958  20.726 1.00 50.29 ? 69   ASP B O     1 
ATOM   4331  C CB    . ASP C 1 17  ? 20.813  19.316  23.234 1.00 48.60 ? 69   ASP B CB    1 
ATOM   4332  C CG    . ASP C 1 17  ? 21.500  18.644  24.402 1.00 49.16 ? 69   ASP B CG    1 
ATOM   4333  O OD1   . ASP C 1 17  ? 22.712  18.337  24.296 1.00 48.44 ? 69   ASP B OD1   1 
ATOM   4334  O OD2   . ASP C 1 17  ? 20.816  18.418  25.424 1.00 48.41 ? 69   ASP B OD2   1 
ATOM   4335  N N     . ILE C 1 18  ? 23.905  19.958  21.717 1.00 48.20 ? 70   ILE B N     1 
ATOM   4336  C CA    . ILE C 1 18  ? 24.888  19.347  20.838 1.00 47.38 ? 70   ILE B CA    1 
ATOM   4337  C C     . ILE C 1 18  ? 24.975  17.861  21.191 1.00 46.88 ? 70   ILE B C     1 
ATOM   4338  O O     . ILE C 1 18  ? 25.467  17.050  20.415 1.00 46.57 ? 70   ILE B O     1 
ATOM   4339  C CB    . ILE C 1 18  ? 26.257  20.016  21.036 1.00 48.13 ? 70   ILE B CB    1 
ATOM   4340  C CG1   . ILE C 1 18  ? 27.287  19.413  20.083 1.00 47.51 ? 70   ILE B CG1   1 
ATOM   4341  C CG2   . ILE C 1 18  ? 26.686  19.879  22.491 1.00 48.59 ? 70   ILE B CG2   1 
ATOM   4342  C CD1   . ILE C 1 18  ? 28.657  20.026  20.230 1.00 45.41 ? 70   ILE B CD1   1 
ATOM   4343  N N     . SER C 1 19  ? 24.484  17.507  22.371 1.00 47.00 ? 71   SER B N     1 
ATOM   4344  C CA    . SER C 1 19  ? 24.508  16.121  22.808 1.00 47.79 ? 71   SER B CA    1 
ATOM   4345  C C     . SER C 1 19  ? 23.227  15.350  22.497 1.00 48.20 ? 71   SER B C     1 
ATOM   4346  O O     . SER C 1 19  ? 22.703  14.590  23.320 1.00 48.06 ? 71   SER B O     1 
ATOM   4347  C CB    . SER C 1 19  ? 24.832  16.055  24.290 1.00 47.70 ? 71   SER B CB    1 
ATOM   4348  O OG    . SER C 1 19  ? 26.236  16.097  24.440 1.00 48.23 ? 71   SER B OG    1 
ATOM   4349  N N     . ASN C 1 20  ? 22.757  15.564  21.274 1.00 47.96 ? 72   ASN B N     1 
ATOM   4350  C CA    . ASN C 1 20  ? 21.568  14.940  20.711 1.00 46.22 ? 72   ASN B CA    1 
ATOM   4351  C C     . ASN C 1 20  ? 22.003  14.762  19.267 1.00 44.01 ? 72   ASN B C     1 
ATOM   4352  O O     . ASN C 1 20  ? 22.066  15.733  18.525 1.00 42.20 ? 72   ASN B O     1 
ATOM   4353  C CB    . ASN C 1 20  ? 20.392  15.909  20.791 1.00 47.78 ? 72   ASN B CB    1 
ATOM   4354  C CG    . ASN C 1 20  ? 19.148  15.369  20.129 1.00 49.03 ? 72   ASN B CG    1 
ATOM   4355  O OD1   . ASN C 1 20  ? 19.156  14.275  19.549 1.00 49.25 ? 72   ASN B OD1   1 
ATOM   4356  N ND2   . ASN C 1 20  ? 18.066  16.135  20.204 1.00 47.92 ? 72   ASN B ND2   1 
ATOM   4357  N N     . ILE C 1 21  ? 22.323  13.534  18.876 1.00 43.38 ? 73   ILE B N     1 
ATOM   4358  C CA    . ILE C 1 21  ? 22.809  13.295  17.521 1.00 42.66 ? 73   ILE B CA    1 
ATOM   4359  C C     . ILE C 1 21  ? 22.082  14.044  16.425 1.00 40.73 ? 73   ILE B C     1 
ATOM   4360  O O     . ILE C 1 21  ? 22.705  14.446  15.453 1.00 40.25 ? 73   ILE B O     1 
ATOM   4361  C CB    . ILE C 1 21  ? 22.828  11.793  17.131 1.00 44.42 ? 73   ILE B CB    1 
ATOM   4362  C CG1   . ILE C 1 21  ? 21.890  10.985  18.034 1.00 45.49 ? 73   ILE B CG1   1 
ATOM   4363  C CG2   . ILE C 1 21  ? 24.267  11.282  17.155 1.00 44.29 ? 73   ILE B CG2   1 
ATOM   4364  C CD1   . ILE C 1 21  ? 22.427  10.749  19.443 1.00 45.71 ? 73   ILE B CD1   1 
ATOM   4365  N N     . PHE C 1 22  ? 20.775  14.236  16.559 1.00 38.54 ? 74   PHE B N     1 
ATOM   4366  C CA    . PHE C 1 22  ? 20.050  14.960  15.525 1.00 36.07 ? 74   PHE B CA    1 
ATOM   4367  C C     . PHE C 1 22  ? 20.624  16.371  15.348 1.00 35.63 ? 74   PHE B C     1 
ATOM   4368  O O     . PHE C 1 22  ? 20.869  16.818  14.226 1.00 35.66 ? 74   PHE B O     1 
ATOM   4369  C CB    . PHE C 1 22  ? 18.561  15.048  15.855 1.00 33.09 ? 74   PHE B CB    1 
ATOM   4370  C CG    . PHE C 1 22  ? 17.800  15.893  14.899 1.00 30.81 ? 74   PHE B CG    1 
ATOM   4371  C CD1   . PHE C 1 22  ? 17.498  17.217  15.202 1.00 30.32 ? 74   PHE B CD1   1 
ATOM   4372  C CD2   . PHE C 1 22  ? 17.465  15.399  13.645 1.00 31.02 ? 74   PHE B CD2   1 
ATOM   4373  C CE1   . PHE C 1 22  ? 16.877  18.045  14.258 1.00 29.84 ? 74   PHE B CE1   1 
ATOM   4374  C CE2   . PHE C 1 22  ? 16.844  16.219  12.697 1.00 31.28 ? 74   PHE B CE2   1 
ATOM   4375  C CZ    . PHE C 1 22  ? 16.553  17.544  13.007 1.00 28.94 ? 74   PHE B CZ    1 
ATOM   4376  N N     . TYR C 1 23  ? 20.836  17.074  16.453 1.00 35.08 ? 75   TYR B N     1 
ATOM   4377  C CA    . TYR C 1 23  ? 21.388  18.414  16.384 1.00 35.06 ? 75   TYR B CA    1 
ATOM   4378  C C     . TYR C 1 23  ? 22.849  18.414  15.996 1.00 35.46 ? 75   TYR B C     1 
ATOM   4379  O O     . TYR C 1 23  ? 23.319  19.320  15.305 1.00 36.03 ? 75   TYR B O     1 
ATOM   4380  C CB    . TYR C 1 23  ? 21.225  19.119  17.716 1.00 34.84 ? 75   TYR B CB    1 
ATOM   4381  C CG    . TYR C 1 23  ? 19.810  19.489  17.954 1.00 35.41 ? 75   TYR B CG    1 
ATOM   4382  C CD1   . TYR C 1 23  ? 19.133  20.288  17.042 1.00 35.84 ? 75   TYR B CD1   1 
ATOM   4383  C CD2   . TYR C 1 23  ? 19.123  19.013  19.064 1.00 35.62 ? 75   TYR B CD2   1 
ATOM   4384  C CE1   . TYR C 1 23  ? 17.806  20.600  17.223 1.00 37.65 ? 75   TYR B CE1   1 
ATOM   4385  C CE2   . TYR C 1 23  ? 17.793  19.320  19.260 1.00 36.04 ? 75   TYR B CE2   1 
ATOM   4386  C CZ    . TYR C 1 23  ? 17.137  20.112  18.333 1.00 36.78 ? 75   TYR B CZ    1 
ATOM   4387  O OH    . TYR C 1 23  ? 15.803  20.397  18.492 1.00 38.62 ? 75   TYR B OH    1 
ATOM   4388  N N     . ALA C 1 24  ? 23.572  17.399  16.450 1.00 35.91 ? 76   ALA B N     1 
ATOM   4389  C CA    . ALA C 1 24  ? 24.988  17.289  16.148 1.00 36.43 ? 76   ALA B CA    1 
ATOM   4390  C C     . ALA C 1 24  ? 25.234  16.997  14.668 1.00 37.05 ? 76   ALA B C     1 
ATOM   4391  O O     . ALA C 1 24  ? 26.134  17.580  14.055 1.00 37.69 ? 76   ALA B O     1 
ATOM   4392  C CB    . ALA C 1 24  ? 25.611  16.214  17.011 1.00 36.27 ? 76   ALA B CB    1 
ATOM   4393  N N     . GLU C 1 25  ? 24.436  16.099  14.093 1.00 37.50 ? 77   GLU B N     1 
ATOM   4394  C CA    . GLU C 1 25  ? 24.580  15.752  12.689 1.00 37.68 ? 77   GLU B CA    1 
ATOM   4395  C C     . GLU C 1 25  ? 24.080  16.883  11.822 1.00 36.90 ? 77   GLU B C     1 
ATOM   4396  O O     . GLU C 1 25  ? 24.663  17.168  10.782 1.00 36.68 ? 77   GLU B O     1 
ATOM   4397  C CB    . GLU C 1 25  ? 23.853  14.445  12.393 1.00 40.06 ? 77   GLU B CB    1 
ATOM   4398  C CG    . GLU C 1 25  ? 24.459  13.310  13.205 1.00 44.45 ? 77   GLU B CG    1 
ATOM   4399  C CD    . GLU C 1 25  ? 24.177  11.935  12.640 1.00 47.19 ? 77   GLU B CD    1 
ATOM   4400  O OE1   . GLU C 1 25  ? 22.982  11.583  12.496 1.00 45.91 ? 77   GLU B OE1   1 
ATOM   4401  O OE2   . GLU C 1 25  ? 25.167  11.212  12.351 1.00 49.71 ? 77   GLU B OE2   1 
ATOM   4402  N N     . LEU C 1 26  ? 23.005  17.537  12.255 1.00 36.40 ? 78   LEU B N     1 
ATOM   4403  C CA    . LEU C 1 26  ? 22.486  18.689  11.526 1.00 35.51 ? 78   LEU B CA    1 
ATOM   4404  C C     . LEU C 1 26  ? 23.641  19.669  11.455 1.00 34.36 ? 78   LEU B C     1 
ATOM   4405  O O     . LEU C 1 26  ? 24.041  20.114  10.386 1.00 33.85 ? 78   LEU B O     1 
ATOM   4406  C CB    . LEU C 1 26  ? 21.352  19.360  12.295 1.00 34.83 ? 78   LEU B CB    1 
ATOM   4407  C CG    . LEU C 1 26  ? 19.918  19.264  11.779 1.00 35.60 ? 78   LEU B CG    1 
ATOM   4408  C CD1   . LEU C 1 26  ? 19.060  20.232  12.578 1.00 33.30 ? 78   LEU B CD1   1 
ATOM   4409  C CD2   . LEU C 1 26  ? 19.852  19.604  10.298 1.00 34.42 ? 78   LEU B CD2   1 
ATOM   4410  N N     . ALA C 1 27  ? 24.172  19.977  12.631 1.00 35.09 ? 79   ALA B N     1 
ATOM   4411  C CA    . ALA C 1 27  ? 25.276  20.908  12.801 1.00 36.79 ? 79   ALA B CA    1 
ATOM   4412  C C     . ALA C 1 27  ? 26.512  20.530  11.996 1.00 38.29 ? 79   ALA B C     1 
ATOM   4413  O O     . ALA C 1 27  ? 27.242  21.404  11.526 1.00 37.64 ? 79   ALA B O     1 
ATOM   4414  C CB    . ALA C 1 27  ? 25.632  21.009  14.276 1.00 34.38 ? 79   ALA B CB    1 
ATOM   4415  N N     . ARG C 1 28  ? 26.747  19.229  11.849 1.00 39.54 ? 80   ARG B N     1 
ATOM   4416  C CA    . ARG C 1 28  ? 27.899  18.759  11.107 1.00 40.98 ? 80   ARG B CA    1 
ATOM   4417  C C     . ARG C 1 28  ? 27.660  19.014  9.622  1.00 41.45 ? 80   ARG B C     1 
ATOM   4418  O O     . ARG C 1 28  ? 28.592  19.210  8.857  1.00 42.41 ? 80   ARG B O     1 
ATOM   4419  C CB    . ARG C 1 28  ? 28.128  17.270  11.382 1.00 42.52 ? 80   ARG B CB    1 
ATOM   4420  C CG    . ARG C 1 28  ? 29.477  16.726  10.887 1.00 45.80 ? 80   ARG B CG    1 
ATOM   4421  C CD    . ARG C 1 28  ? 30.661  17.465  11.546 1.00 49.39 ? 80   ARG B CD    1 
ATOM   4422  N NE    . ARG C 1 28  ? 31.958  16.788  11.382 1.00 52.61 ? 80   ARG B NE    1 
ATOM   4423  C CZ    . ARG C 1 28  ? 32.698  16.788  10.270 1.00 52.22 ? 80   ARG B CZ    1 
ATOM   4424  N NH1   . ARG C 1 28  ? 32.284  17.440  9.189  1.00 51.19 ? 80   ARG B NH1   1 
ATOM   4425  N NH2   . ARG C 1 28  ? 33.856  16.127  10.240 1.00 51.95 ? 80   ARG B NH2   1 
ATOM   4426  N N     . GLY C 1 29  ? 26.402  19.016  9.210  1.00 42.42 ? 81   GLY B N     1 
ATOM   4427  C CA    . GLY C 1 29  ? 26.107  19.278  7.818  1.00 41.96 ? 81   GLY B CA    1 
ATOM   4428  C C     . GLY C 1 29  ? 26.403  20.737  7.554  1.00 42.37 ? 81   GLY B C     1 
ATOM   4429  O O     . GLY C 1 29  ? 27.135  21.069  6.628  1.00 43.38 ? 81   GLY B O     1 
ATOM   4430  N N     . ILE C 1 30  ? 25.831  21.606  8.384  1.00 41.79 ? 82   ILE B N     1 
ATOM   4431  C CA    . ILE C 1 30  ? 26.022  23.049  8.279  1.00 41.66 ? 82   ILE B CA    1 
ATOM   4432  C C     . ILE C 1 30  ? 27.513  23.368  8.257  1.00 41.90 ? 82   ILE B C     1 
ATOM   4433  O O     . ILE C 1 30  ? 27.947  24.413  7.773  1.00 40.91 ? 82   ILE B O     1 
ATOM   4434  C CB    . ILE C 1 30  ? 25.382  23.761  9.491  1.00 40.65 ? 82   ILE B CB    1 
ATOM   4435  C CG1   . ILE C 1 30  ? 23.883  23.480  9.517  1.00 39.42 ? 82   ILE B CG1   1 
ATOM   4436  C CG2   . ILE C 1 30  ? 25.649  25.253  9.424  1.00 40.36 ? 82   ILE B CG2   1 
ATOM   4437  C CD1   . ILE C 1 30  ? 23.252  23.629  10.867 1.00 41.27 ? 82   ILE B CD1   1 
ATOM   4438  N N     . GLU C 1 31  ? 28.286  22.437  8.791  1.00 43.38 ? 83   GLU B N     1 
ATOM   4439  C CA    . GLU C 1 31  ? 29.728  22.570  8.887  1.00 44.55 ? 83   GLU B CA    1 
ATOM   4440  C C     . GLU C 1 31  ? 30.374  22.285  7.545  1.00 44.43 ? 83   GLU B C     1 
ATOM   4441  O O     . GLU C 1 31  ? 31.171  23.082  7.033  1.00 44.52 ? 83   GLU B O     1 
ATOM   4442  C CB    . GLU C 1 31  ? 30.245  21.585  9.932  1.00 46.32 ? 83   GLU B CB    1 
ATOM   4443  C CG    . GLU C 1 31  ? 31.634  21.868  10.391 1.00 50.05 ? 83   GLU B CG    1 
ATOM   4444  C CD    . GLU C 1 31  ? 31.753  23.258  10.947 1.00 51.40 ? 83   GLU B CD    1 
ATOM   4445  O OE1   . GLU C 1 31  ? 31.071  23.544  11.955 1.00 51.42 ? 83   GLU B OE1   1 
ATOM   4446  O OE2   . GLU C 1 31  ? 32.525  24.058  10.368 1.00 53.58 ? 83   GLU B OE2   1 
ATOM   4447  N N     . ASP C 1 32  ? 30.013  21.135  6.985  1.00 44.13 ? 84   ASP B N     1 
ATOM   4448  C CA    . ASP C 1 32  ? 30.532  20.681  5.705  1.00 42.72 ? 84   ASP B CA    1 
ATOM   4449  C C     . ASP C 1 32  ? 30.148  21.642  4.612  1.00 41.48 ? 84   ASP B C     1 
ATOM   4450  O O     . ASP C 1 32  ? 30.965  22.011  3.773  1.00 41.44 ? 84   ASP B O     1 
ATOM   4451  C CB    . ASP C 1 32  ? 29.995  19.288  5.398  1.00 41.23 ? 84   ASP B CB    1 
ATOM   4452  C CG    . ASP C 1 32  ? 30.436  18.269  6.423  1.00 41.51 ? 84   ASP B CG    1 
ATOM   4453  O OD1   . ASP C 1 32  ? 31.633  18.278  6.781  1.00 41.48 ? 84   ASP B OD1   1 
ATOM   4454  O OD2   . ASP C 1 32  ? 29.600  17.459  6.872  1.00 42.01 ? 84   ASP B OD2   1 
ATOM   4455  N N     . ILE C 1 33  ? 28.893  22.047  4.640  1.00 40.99 ? 85   ILE B N     1 
ATOM   4456  C CA    . ILE C 1 33  ? 28.371  22.971  3.657  1.00 41.20 ? 85   ILE B CA    1 
ATOM   4457  C C     . ILE C 1 33  ? 29.103  24.307  3.806  1.00 40.50 ? 85   ILE B C     1 
ATOM   4458  O O     . ILE C 1 33  ? 29.329  25.008  2.822  1.00 41.42 ? 85   ILE B O     1 
ATOM   4459  C CB    . ILE C 1 33  ? 26.830  23.134  3.848  1.00 41.83 ? 85   ILE B CB    1 
ATOM   4460  C CG1   . ILE C 1 33  ? 26.179  21.736  3.824  1.00 41.42 ? 85   ILE B CG1   1 
ATOM   4461  C CG2   . ILE C 1 33  ? 26.247  24.032  2.754  1.00 40.10 ? 85   ILE B CG2   1 
ATOM   4462  C CD1   . ILE C 1 33  ? 24.720  21.688  4.175  1.00 41.79 ? 85   ILE B CD1   1 
ATOM   4463  N N     . ALA C 1 34  ? 29.500  24.643  5.031  1.00 38.29 ? 86   ALA B N     1 
ATOM   4464  C CA    . ALA C 1 34  ? 30.212  25.894  5.268  1.00 36.04 ? 86   ALA B CA    1 
ATOM   4465  C C     . ALA C 1 34  ? 31.621  25.854  4.691  1.00 34.70 ? 86   ALA B C     1 
ATOM   4466  O O     . ALA C 1 34  ? 32.155  26.877  4.279  1.00 34.79 ? 86   ALA B O     1 
ATOM   4467  C CB    . ALA C 1 34  ? 30.272  26.191  6.754  1.00 36.97 ? 86   ALA B CB    1 
ATOM   4468  N N     . THR C 1 35  ? 32.242  24.683  4.681  1.00 32.84 ? 87   THR B N     1 
ATOM   4469  C CA    . THR C 1 35  ? 33.569  24.601  4.111  1.00 32.39 ? 87   THR B CA    1 
ATOM   4470  C C     . THR C 1 35  ? 33.448  24.917  2.628  1.00 33.89 ? 87   THR B C     1 
ATOM   4471  O O     . THR C 1 35  ? 34.314  25.565  2.045  1.00 35.73 ? 87   THR B O     1 
ATOM   4472  C CB    . THR C 1 35  ? 34.177  23.219  4.299  1.00 30.89 ? 87   THR B CB    1 
ATOM   4473  O OG1   . THR C 1 35  ? 34.650  23.093  5.645  1.00 32.14 ? 87   THR B OG1   1 
ATOM   4474  C CG2   . THR C 1 35  ? 35.334  23.016  3.351  1.00 29.19 ? 87   THR B CG2   1 
ATOM   4475  N N     . MET C 1 36  ? 32.358  24.468  2.022  1.00 33.74 ? 88   MET B N     1 
ATOM   4476  C CA    . MET C 1 36  ? 32.122  24.729  0.618  1.00 34.24 ? 88   MET B CA    1 
ATOM   4477  C C     . MET C 1 36  ? 31.943  26.220  0.375  1.00 32.86 ? 88   MET B C     1 
ATOM   4478  O O     . MET C 1 36  ? 32.629  26.819  -0.451 1.00 34.00 ? 88   MET B O     1 
ATOM   4479  C CB    . MET C 1 36  ? 30.882  23.977  0.143  1.00 37.38 ? 88   MET B CB    1 
ATOM   4480  C CG    . MET C 1 36  ? 31.198  22.758  -0.714 1.00 40.84 ? 88   MET B CG    1 
ATOM   4481  S SD    . MET C 1 36  ? 29.709  21.863  -1.181 1.00 45.34 ? 88   MET B SD    1 
ATOM   4482  C CE    . MET C 1 36  ? 28.645  23.274  -1.784 1.00 42.21 ? 88   MET B CE    1 
ATOM   4483  N N     . TYR C 1 37  ? 31.008  26.816  1.089  1.00 30.95 ? 89   TYR B N     1 
ATOM   4484  C CA    . TYR C 1 37  ? 30.756  28.232  0.953  1.00 31.56 ? 89   TYR B CA    1 
ATOM   4485  C C     . TYR C 1 37  ? 31.946  29.047  1.450  1.00 33.29 ? 89   TYR B C     1 
ATOM   4486  O O     . TYR C 1 37  ? 31.950  30.270  1.332  1.00 33.70 ? 89   TYR B O     1 
ATOM   4487  C CB    . TYR C 1 37  ? 29.525  28.605  1.762  1.00 31.22 ? 89   TYR B CB    1 
ATOM   4488  C CG    . TYR C 1 37  ? 28.204  28.462  1.038  1.00 32.38 ? 89   TYR B CG    1 
ATOM   4489  C CD1   . TYR C 1 37  ? 27.666  29.539  0.330  1.00 31.48 ? 89   TYR B CD1   1 
ATOM   4490  C CD2   . TYR C 1 37  ? 27.446  27.280  1.130  1.00 30.92 ? 89   TYR B CD2   1 
ATOM   4491  C CE1   . TYR C 1 37  ? 26.404  29.464  -0.257 1.00 30.70 ? 89   TYR B CE1   1 
ATOM   4492  C CE2   . TYR C 1 37  ? 26.179  27.193  0.542  1.00 31.54 ? 89   TYR B CE2   1 
ATOM   4493  C CZ    . TYR C 1 37  ? 25.664  28.298  -0.144 1.00 30.99 ? 89   TYR B CZ    1 
ATOM   4494  O OH    . TYR C 1 37  ? 24.391  28.263  -0.659 1.00 28.75 ? 89   TYR B OH    1 
ATOM   4495  N N     . LYS C 1 38  ? 32.950  28.378  2.013  1.00 35.19 ? 90   LYS B N     1 
ATOM   4496  C CA    . LYS C 1 38  ? 34.121  29.072  2.538  1.00 37.13 ? 90   LYS B CA    1 
ATOM   4497  C C     . LYS C 1 38  ? 33.709  30.060  3.625  1.00 37.46 ? 90   LYS B C     1 
ATOM   4498  O O     . LYS C 1 38  ? 33.990  31.252  3.550  1.00 37.33 ? 90   LYS B O     1 
ATOM   4499  C CB    . LYS C 1 38  ? 34.856  29.786  1.404  1.00 40.10 ? 90   LYS B CB    1 
ATOM   4500  C CG    . LYS C 1 38  ? 35.577  28.802  0.509  1.00 46.05 ? 90   LYS B CG    1 
ATOM   4501  C CD    . LYS C 1 38  ? 35.995  29.386  -0.817 1.00 49.51 ? 90   LYS B CD    1 
ATOM   4502  C CE    . LYS C 1 38  ? 36.784  28.357  -1.625 1.00 52.60 ? 90   LYS B CE    1 
ATOM   4503  N NZ    . LYS C 1 38  ? 35.960  27.703  -2.686 1.00 55.14 ? 90   LYS B NZ    1 
ATOM   4504  N N     . TYR C 1 39  ? 33.030  29.531  4.636  1.00 37.73 ? 91   TYR B N     1 
ATOM   4505  C CA    . TYR C 1 39  ? 32.549  30.305  5.770  1.00 37.87 ? 91   TYR B CA    1 
ATOM   4506  C C     . TYR C 1 39  ? 33.128  29.781  7.097  1.00 39.39 ? 91   TYR B C     1 
ATOM   4507  O O     . TYR C 1 39  ? 33.471  28.600  7.235  1.00 41.39 ? 91   TYR B O     1 
ATOM   4508  C CB    . TYR C 1 39  ? 31.033  30.190  5.891  1.00 36.06 ? 91   TYR B CB    1 
ATOM   4509  C CG    . TYR C 1 39  ? 30.170  30.845  4.843  1.00 35.61 ? 91   TYR B CG    1 
ATOM   4510  C CD1   . TYR C 1 39  ? 28.800  30.579  4.818  1.00 37.17 ? 91   TYR B CD1   1 
ATOM   4511  C CD2   . TYR C 1 39  ? 30.681  31.756  3.915  1.00 34.20 ? 91   TYR B CD2   1 
ATOM   4512  C CE1   . TYR C 1 39  ? 27.957  31.200  3.907  1.00 36.67 ? 91   TYR B CE1   1 
ATOM   4513  C CE2   . TYR C 1 39  ? 29.835  32.386  2.992  1.00 32.85 ? 91   TYR B CE2   1 
ATOM   4514  C CZ    . TYR C 1 39  ? 28.476  32.097  3.006  1.00 34.32 ? 91   TYR B CZ    1 
ATOM   4515  O OH    . TYR C 1 39  ? 27.603  32.696  2.143  1.00 34.93 ? 91   TYR B OH    1 
ATOM   4516  N N     . ASN C 1 40  ? 33.217  30.663  8.081  1.00 38.67 ? 92   ASN B N     1 
ATOM   4517  C CA    . ASN C 1 40  ? 33.668  30.266  9.395  1.00 38.47 ? 92   ASN B CA    1 
ATOM   4518  C C     . ASN C 1 40  ? 32.379  29.954  10.144 1.00 38.83 ? 92   ASN B C     1 
ATOM   4519  O O     . ASN C 1 40  ? 31.321  30.509  9.831  1.00 39.39 ? 92   ASN B O     1 
ATOM   4520  C CB    . ASN C 1 40  ? 34.391  31.419  10.064 1.00 39.34 ? 92   ASN B CB    1 
ATOM   4521  C CG    . ASN C 1 40  ? 35.722  31.706  9.427  1.00 41.34 ? 92   ASN B CG    1 
ATOM   4522  O OD1   . ASN C 1 40  ? 36.655  30.902  9.533  1.00 41.37 ? 92   ASN B OD1   1 
ATOM   4523  N ND2   . ASN C 1 40  ? 35.828  32.851  8.753  1.00 41.11 ? 92   ASN B ND2   1 
ATOM   4524  N N     . ILE C 1 41  ? 32.446  29.059  11.119 1.00 39.13 ? 93   ILE B N     1 
ATOM   4525  C CA    . ILE C 1 41  ? 31.257  28.722  11.889 1.00 39.15 ? 93   ILE B CA    1 
ATOM   4526  C C     . ILE C 1 41  ? 31.505  28.862  13.383 1.00 37.88 ? 93   ILE B C     1 
ATOM   4527  O O     . ILE C 1 41  ? 32.533  28.423  13.901 1.00 36.16 ? 93   ILE B O     1 
ATOM   4528  C CB    . ILE C 1 41  ? 30.748  27.266  11.575 1.00 39.99 ? 93   ILE B CB    1 
ATOM   4529  C CG1   . ILE C 1 41  ? 29.502  27.318  10.696 1.00 39.59 ? 93   ILE B CG1   1 
ATOM   4530  C CG2   . ILE C 1 41  ? 30.356  26.541  12.852 1.00 40.66 ? 93   ILE B CG2   1 
ATOM   4531  C CD1   . ILE C 1 41  ? 29.704  28.064  9.430  1.00 42.88 ? 93   ILE B CD1   1 
ATOM   4532  N N     . ILE C 1 42  ? 30.553  29.501  14.054 1.00 37.28 ? 94   ILE B N     1 
ATOM   4533  C CA    . ILE C 1 42  ? 30.599  29.686  15.496 1.00 37.91 ? 94   ILE B CA    1 
ATOM   4534  C C     . ILE C 1 42  ? 29.372  28.938  16.020 1.00 37.77 ? 94   ILE B C     1 
ATOM   4535  O O     . ILE C 1 42  ? 28.235  29.303  15.729 1.00 37.46 ? 94   ILE B O     1 
ATOM   4536  C CB    . ILE C 1 42  ? 30.525  31.184  15.868 1.00 39.42 ? 94   ILE B CB    1 
ATOM   4537  C CG1   . ILE C 1 42  ? 31.806  31.897  15.435 1.00 39.44 ? 94   ILE B CG1   1 
ATOM   4538  C CG2   . ILE C 1 42  ? 30.335  31.346  17.352 1.00 41.35 ? 94   ILE B CG2   1 
ATOM   4539  C CD1   . ILE C 1 42  ? 33.065  31.262  15.958 1.00 42.24 ? 94   ILE B CD1   1 
ATOM   4540  N N     . LEU C 1 43  ? 29.601  27.877  16.781 1.00 37.87 ? 95   LEU B N     1 
ATOM   4541  C CA    . LEU C 1 43  ? 28.499  27.071  17.292 1.00 38.85 ? 95   LEU B CA    1 
ATOM   4542  C C     . LEU C 1 43  ? 28.376  27.224  18.804 1.00 38.52 ? 95   LEU B C     1 
ATOM   4543  O O     . LEU C 1 43  ? 29.377  27.406  19.482 1.00 37.48 ? 95   LEU B O     1 
ATOM   4544  C CB    . LEU C 1 43  ? 28.757  25.602  16.931 1.00 39.65 ? 95   LEU B CB    1 
ATOM   4545  C CG    . LEU C 1 43  ? 27.625  24.573  16.799 1.00 41.21 ? 95   LEU B CG    1 
ATOM   4546  C CD1   . LEU C 1 43  ? 26.777  24.556  18.055 1.00 41.26 ? 95   LEU B CD1   1 
ATOM   4547  C CD2   . LEU C 1 43  ? 26.763  24.902  15.593 1.00 42.15 ? 95   LEU B CD2   1 
ATOM   4548  N N     . SER C 1 44  ? 27.151  27.169  19.325 1.00 39.95 ? 96   SER B N     1 
ATOM   4549  C CA    . SER C 1 44  ? 26.920  27.267  20.773 1.00 42.82 ? 96   SER B CA    1 
ATOM   4550  C C     . SER C 1 44  ? 25.550  26.688  21.164 1.00 43.43 ? 96   SER B C     1 
ATOM   4551  O O     . SER C 1 44  ? 24.610  26.727  20.371 1.00 44.54 ? 96   SER B O     1 
ATOM   4552  C CB    . SER C 1 44  ? 27.058  28.725  21.257 1.00 43.18 ? 96   SER B CB    1 
ATOM   4553  O OG    . SER C 1 44  ? 26.093  29.584  20.674 1.00 42.85 ? 96   SER B OG    1 
ATOM   4554  N N     . ASN C 1 45  ? 25.445  26.145  22.376 1.00 44.36 ? 97   ASN B N     1 
ATOM   4555  C CA    . ASN C 1 45  ? 24.199  25.531  22.839 1.00 46.17 ? 97   ASN B CA    1 
ATOM   4556  C C     . ASN C 1 45  ? 23.392  26.427  23.745 1.00 47.66 ? 97   ASN B C     1 
ATOM   4557  O O     . ASN C 1 45  ? 23.957  27.161  24.554 1.00 48.46 ? 97   ASN B O     1 
ATOM   4558  C CB    . ASN C 1 45  ? 24.482  24.244  23.612 1.00 47.13 ? 97   ASN B CB    1 
ATOM   4559  C CG    . ASN C 1 45  ? 25.395  23.295  22.864 1.00 48.96 ? 97   ASN B CG    1 
ATOM   4560  O OD1   . ASN C 1 45  ? 26.586  23.565  22.677 1.00 49.29 ? 97   ASN B OD1   1 
ATOM   4561  N ND2   . ASN C 1 45  ? 24.840  22.168  22.433 1.00 49.77 ? 97   ASN B ND2   1 
ATOM   4562  N N     . SER C 1 46  ? 22.067  26.343  23.624 1.00 49.12 ? 98   SER B N     1 
ATOM   4563  C CA    . SER C 1 46  ? 21.154  27.137  24.450 1.00 50.21 ? 98   SER B CA    1 
ATOM   4564  C C     . SER C 1 46  ? 20.546  26.212  25.484 1.00 51.94 ? 98   SER B C     1 
ATOM   4565  O O     . SER C 1 46  ? 19.817  26.647  26.376 1.00 52.11 ? 98   SER B O     1 
ATOM   4566  C CB    . SER C 1 46  ? 20.035  27.750  23.607 1.00 49.59 ? 98   SER B CB    1 
ATOM   4567  O OG    . SER C 1 46  ? 19.174  26.755  23.071 1.00 50.32 ? 98   SER B OG    1 
ATOM   4568  N N     . ASP C 1 47  ? 20.852  24.927  25.343 1.00 53.63 ? 99   ASP B N     1 
ATOM   4569  C CA    . ASP C 1 47  ? 20.363  23.900  26.251 1.00 55.31 ? 99   ASP B CA    1 
ATOM   4570  C C     . ASP C 1 47  ? 18.836  23.892  26.319 1.00 55.29 ? 99   ASP B C     1 
ATOM   4571  O O     . ASP C 1 47  ? 18.241  23.511  27.329 1.00 55.19 ? 99   ASP B O     1 
ATOM   4572  C CB    . ASP C 1 47  ? 20.958  24.119  27.643 1.00 56.51 ? 99   ASP B CB    1 
ATOM   4573  C CG    . ASP C 1 47  ? 20.886  22.879  28.502 1.00 58.38 ? 99   ASP B CG    1 
ATOM   4574  O OD1   . ASP C 1 47  ? 20.248  21.890  28.070 1.00 59.19 ? 99   ASP B OD1   1 
ATOM   4575  O OD2   . ASP C 1 47  ? 21.469  22.894  29.606 1.00 60.22 ? 99   ASP B OD2   1 
ATOM   4576  N N     . GLN C 1 48  ? 18.212  24.322  25.229 1.00 55.22 ? 100  GLN B N     1 
ATOM   4577  C CA    . GLN C 1 48  ? 16.760  24.371  25.131 1.00 55.97 ? 100  GLN B CA    1 
ATOM   4578  C C     . GLN C 1 48  ? 16.106  25.475  25.963 1.00 56.27 ? 100  GLN B C     1 
ATOM   4579  O O     . GLN C 1 48  ? 14.895  25.708  25.864 1.00 57.39 ? 100  GLN B O     1 
ATOM   4580  C CB    . GLN C 1 48  ? 16.163  23.007  25.499 1.00 55.03 ? 100  GLN B CB    1 
ATOM   4581  C CG    . GLN C 1 48  ? 16.477  21.920  24.479 1.00 54.91 ? 100  GLN B CG    1 
ATOM   4582  C CD    . GLN C 1 48  ? 15.544  20.727  24.575 1.00 55.58 ? 100  GLN B CD    1 
ATOM   4583  O OE1   . GLN C 1 48  ? 15.594  19.954  25.535 1.00 54.65 ? 100  GLN B OE1   1 
ATOM   4584  N NE2   . GLN C 1 48  ? 14.678  20.575  23.574 1.00 55.58 ? 100  GLN B NE2   1 
ATOM   4585  N N     . ASN C 1 49  ? 16.907  26.170  26.761 1.00 55.78 ? 101  ASN B N     1 
ATOM   4586  C CA    . ASN C 1 49  ? 16.394  27.239  27.608 1.00 54.79 ? 101  ASN B CA    1 
ATOM   4587  C C     . ASN C 1 49  ? 16.287  28.572  26.876 1.00 53.76 ? 101  ASN B C     1 
ATOM   4588  O O     . ASN C 1 49  ? 17.254  29.060  26.285 1.00 52.94 ? 101  ASN B O     1 
ATOM   4589  C CB    . ASN C 1 49  ? 17.277  27.398  28.846 1.00 55.66 ? 101  ASN B CB    1 
ATOM   4590  C CG    . ASN C 1 49  ? 16.803  28.501  29.745 1.00 55.92 ? 101  ASN B CG    1 
ATOM   4591  O OD1   . ASN C 1 49  ? 15.662  28.494  30.204 1.00 57.03 ? 101  ASN B OD1   1 
ATOM   4592  N ND2   . ASN C 1 49  ? 17.674  29.466  30.004 1.00 56.65 ? 101  ASN B ND2   1 
ATOM   4593  N N     . GLN C 1 50  ? 15.099  29.161  26.944 1.00 52.63 ? 102  GLN B N     1 
ATOM   4594  C CA    . GLN C 1 50  ? 14.803  30.431  26.289 1.00 51.86 ? 102  GLN B CA    1 
ATOM   4595  C C     . GLN C 1 50  ? 15.685  31.598  26.713 1.00 51.39 ? 102  GLN B C     1 
ATOM   4596  O O     . GLN C 1 50  ? 16.140  32.378  25.883 1.00 50.46 ? 102  GLN B O     1 
ATOM   4597  C CB    . GLN C 1 50  ? 13.346  30.802  26.530 1.00 50.46 ? 102  GLN B CB    1 
ATOM   4598  C CG    . GLN C 1 50  ? 12.893  32.004  25.754 1.00 49.53 ? 102  GLN B CG    1 
ATOM   4599  C CD    . GLN C 1 50  ? 11.470  32.359  26.070 1.00 50.97 ? 102  GLN B CD    1 
ATOM   4600  O OE1   . GLN C 1 50  ? 10.591  31.494  26.060 1.00 51.27 ? 102  GLN B OE1   1 
ATOM   4601  N NE2   . GLN C 1 50  ? 11.223  33.635  26.357 1.00 50.29 ? 102  GLN B NE2   1 
ATOM   4602  N N     . ASP C 1 51  ? 15.910  31.733  28.009 1.00 52.46 ? 103  ASP B N     1 
ATOM   4603  C CA    . ASP C 1 51  ? 16.740  32.821  28.498 1.00 53.88 ? 103  ASP B CA    1 
ATOM   4604  C C     . ASP C 1 51  ? 18.134  32.781  27.864 1.00 53.46 ? 103  ASP B C     1 
ATOM   4605  O O     . ASP C 1 51  ? 18.729  33.826  27.578 1.00 53.21 ? 103  ASP B O     1 
ATOM   4606  C CB    . ASP C 1 51  ? 16.842  32.753  30.027 1.00 54.95 ? 103  ASP B CB    1 
ATOM   4607  C CG    . ASP C 1 51  ? 15.567  33.227  30.726 1.00 56.42 ? 103  ASP B CG    1 
ATOM   4608  O OD1   . ASP C 1 51  ? 15.536  33.192  31.979 1.00 55.21 ? 103  ASP B OD1   1 
ATOM   4609  O OD2   . ASP C 1 51  ? 14.606  33.641  30.025 1.00 56.40 ? 103  ASP B OD2   1 
ATOM   4610  N N     . LYS C 1 52  ? 18.638  31.570  27.633 1.00 52.50 ? 104  LYS B N     1 
ATOM   4611  C CA    . LYS C 1 52  ? 19.955  31.389  27.044 1.00 51.77 ? 104  LYS B CA    1 
ATOM   4612  C C     . LYS C 1 52  ? 19.888  31.520  25.523 1.00 51.39 ? 104  LYS B C     1 
ATOM   4613  O O     . LYS C 1 52  ? 20.851  31.946  24.889 1.00 50.45 ? 104  LYS B O     1 
ATOM   4614  C CB    . LYS C 1 52  ? 20.521  30.024  27.445 1.00 52.33 ? 104  LYS B CB    1 
ATOM   4615  C CG    . LYS C 1 52  ? 22.017  29.884  27.223 1.00 53.89 ? 104  LYS B CG    1 
ATOM   4616  C CD    . LYS C 1 52  ? 22.546  28.570  27.788 1.00 55.11 ? 104  LYS B CD    1 
ATOM   4617  C CE    . LYS C 1 52  ? 24.056  28.429  27.586 1.00 55.44 ? 104  LYS B CE    1 
ATOM   4618  N NZ    . LYS C 1 52  ? 24.840  29.569  28.169 1.00 56.27 ? 104  LYS B NZ    1 
ATOM   4619  N N     . GLU C 1 53  ? 18.751  31.153  24.939 1.00 51.07 ? 105  GLU B N     1 
ATOM   4620  C CA    . GLU C 1 53  ? 18.592  31.275  23.498 1.00 50.91 ? 105  GLU B CA    1 
ATOM   4621  C C     . GLU C 1 53  ? 18.736  32.752  23.119 1.00 51.84 ? 105  GLU B C     1 
ATOM   4622  O O     . GLU C 1 53  ? 19.566  33.096  22.272 1.00 53.33 ? 105  GLU B O     1 
ATOM   4623  C CB    . GLU C 1 53  ? 17.232  30.721  23.040 1.00 50.27 ? 105  GLU B CB    1 
ATOM   4624  C CG    . GLU C 1 53  ? 17.085  29.222  23.288 1.00 52.60 ? 105  GLU B CG    1 
ATOM   4625  C CD    . GLU C 1 53  ? 15.984  28.546  22.466 1.00 53.95 ? 105  GLU B CD    1 
ATOM   4626  O OE1   . GLU C 1 53  ? 14.801  28.916  22.620 1.00 54.49 ? 105  GLU B OE1   1 
ATOM   4627  O OE2   . GLU C 1 53  ? 16.308  27.631  21.672 1.00 53.24 ? 105  GLU B OE2   1 
ATOM   4628  N N     . LEU C 1 54  ? 17.958  33.629  23.755 1.00 51.54 ? 106  LEU B N     1 
ATOM   4629  C CA    . LEU C 1 54  ? 18.037  35.061  23.460 1.00 51.33 ? 106  LEU B CA    1 
ATOM   4630  C C     . LEU C 1 54  ? 19.368  35.659  23.888 1.00 50.72 ? 106  LEU B C     1 
ATOM   4631  O O     . LEU C 1 54  ? 19.849  36.614  23.285 1.00 51.08 ? 106  LEU B O     1 
ATOM   4632  C CB    . LEU C 1 54  ? 16.910  35.822  24.151 1.00 53.02 ? 106  LEU B CB    1 
ATOM   4633  C CG    . LEU C 1 54  ? 15.490  35.524  23.673 1.00 55.24 ? 106  LEU B CG    1 
ATOM   4634  C CD1   . LEU C 1 54  ? 14.493  36.131  24.648 1.00 56.12 ? 106  LEU B CD1   1 
ATOM   4635  C CD2   . LEU C 1 54  ? 15.286  36.065  22.265 1.00 55.84 ? 106  LEU B CD2   1 
ATOM   4636  N N     . HIS C 1 55  ? 19.966  35.113  24.934 1.00 50.58 ? 107  HIS B N     1 
ATOM   4637  C CA    . HIS C 1 55  ? 21.243  35.633  25.380 1.00 51.69 ? 107  HIS B CA    1 
ATOM   4638  C C     . HIS C 1 55  ? 22.321  35.355  24.317 1.00 52.05 ? 107  HIS B C     1 
ATOM   4639  O O     . HIS C 1 55  ? 23.060  36.263  23.915 1.00 51.55 ? 107  HIS B O     1 
ATOM   4640  C CB    . HIS C 1 55  ? 21.627  35.002  26.719 1.00 52.03 ? 107  HIS B CB    1 
ATOM   4641  C CG    . HIS C 1 55  ? 22.992  35.386  27.191 1.00 54.55 ? 107  HIS B CG    1 
ATOM   4642  N ND1   . HIS C 1 55  ? 23.373  36.698  27.377 1.00 55.24 ? 107  HIS B ND1   1 
ATOM   4643  C CD2   . HIS C 1 55  ? 24.078  34.633  27.489 1.00 55.77 ? 107  HIS B CD2   1 
ATOM   4644  C CE1   . HIS C 1 55  ? 24.636  36.737  27.767 1.00 56.52 ? 107  HIS B CE1   1 
ATOM   4645  N NE2   . HIS C 1 55  ? 25.088  35.497  27.842 1.00 56.71 ? 107  HIS B NE2   1 
ATOM   4646  N N     . LEU C 1 56  ? 22.391  34.103  23.857 1.00 51.75 ? 108  LEU B N     1 
ATOM   4647  C CA    . LEU C 1 56  ? 23.368  33.687  22.844 1.00 50.56 ? 108  LEU B CA    1 
ATOM   4648  C C     . LEU C 1 56  ? 23.229  34.497  21.563 1.00 50.45 ? 108  LEU B C     1 
ATOM   4649  O O     . LEU C 1 56  ? 24.225  34.815  20.906 1.00 50.29 ? 108  LEU B O     1 
ATOM   4650  C CB    . LEU C 1 56  ? 23.207  32.196  22.524 1.00 49.67 ? 108  LEU B CB    1 
ATOM   4651  C CG    . LEU C 1 56  ? 23.566  31.212  23.638 1.00 48.11 ? 108  LEU B CG    1 
ATOM   4652  C CD1   . LEU C 1 56  ? 23.177  29.817  23.227 1.00 47.28 ? 108  LEU B CD1   1 
ATOM   4653  C CD2   . LEU C 1 56  ? 25.044  31.294  23.926 1.00 46.16 ? 108  LEU B CD2   1 
ATOM   4654  N N     . LEU C 1 57  ? 21.989  34.818  21.205 1.00 49.77 ? 109  LEU B N     1 
ATOM   4655  C CA    . LEU C 1 57  ? 21.721  35.612  20.011 1.00 49.12 ? 109  LEU B CA    1 
ATOM   4656  C C     . LEU C 1 57  ? 22.530  36.903  20.093 1.00 47.66 ? 109  LEU B C     1 
ATOM   4657  O O     . LEU C 1 57  ? 23.207  37.288  19.136 1.00 46.68 ? 109  LEU B O     1 
ATOM   4658  C CB    . LEU C 1 57  ? 20.227  35.915  19.927 1.00 50.31 ? 109  LEU B CB    1 
ATOM   4659  C CG    . LEU C 1 57  ? 19.688  36.801  18.806 1.00 53.40 ? 109  LEU B CG    1 
ATOM   4660  C CD1   . LEU C 1 57  ? 18.207  36.486  18.597 1.00 54.24 ? 109  LEU B CD1   1 
ATOM   4661  C CD2   . LEU C 1 57  ? 19.877  38.275  19.157 1.00 54.00 ? 109  LEU B CD2   1 
ATOM   4662  N N     . ASN C 1 58  ? 22.464  37.552  21.253 1.00 45.94 ? 110  ASN B N     1 
ATOM   4663  C CA    . ASN C 1 58  ? 23.185  38.796  21.496 1.00 45.47 ? 110  ASN B CA    1 
ATOM   4664  C C     . ASN C 1 58  ? 24.698  38.572  21.450 1.00 45.17 ? 110  ASN B C     1 
ATOM   4665  O O     . ASN C 1 58  ? 25.454  39.432  20.981 1.00 43.98 ? 110  ASN B O     1 
ATOM   4666  C CB    . ASN C 1 58  ? 22.790  39.373  22.860 1.00 45.73 ? 110  ASN B CB    1 
ATOM   4667  C CG    . ASN C 1 58  ? 21.333  39.798  22.920 1.00 44.36 ? 110  ASN B CG    1 
ATOM   4668  O OD1   . ASN C 1 58  ? 20.685  39.676  23.962 1.00 44.16 ? 110  ASN B OD1   1 
ATOM   4669  N ND2   . ASN C 1 58  ? 20.815  40.315  21.808 1.00 42.78 ? 110  ASN B ND2   1 
ATOM   4670  N N     . ASN C 1 59  ? 25.141  37.424  21.953 1.00 44.96 ? 111  ASN B N     1 
ATOM   4671  C CA    . ASN C 1 59  ? 26.562  37.110  21.938 1.00 45.39 ? 111  ASN B CA    1 
ATOM   4672  C C     . ASN C 1 59  ? 27.013  36.923  20.511 1.00 45.20 ? 111  ASN B C     1 
ATOM   4673  O O     . ASN C 1 59  ? 28.096  37.363  20.125 1.00 45.31 ? 111  ASN B O     1 
ATOM   4674  C CB    . ASN C 1 59  ? 26.848  35.828  22.704 1.00 47.34 ? 111  ASN B CB    1 
ATOM   4675  C CG    . ASN C 1 59  ? 27.056  36.069  24.164 1.00 47.96 ? 111  ASN B CG    1 
ATOM   4676  O OD1   . ASN C 1 59  ? 26.152  35.878  24.964 1.00 48.00 ? 111  ASN B OD1   1 
ATOM   4677  N ND2   . ASN C 1 59  ? 28.260  36.508  24.525 1.00 50.41 ? 111  ASN B ND2   1 
ATOM   4678  N N     . MET C 1 60  ? 26.170  36.250  19.736 1.00 44.66 ? 112  MET B N     1 
ATOM   4679  C CA    . MET C 1 60  ? 26.463  35.998  18.341 1.00 44.43 ? 112  MET B CA    1 
ATOM   4680  C C     . MET C 1 60  ? 26.671  37.320  17.606 1.00 45.09 ? 112  MET B C     1 
ATOM   4681  O O     . MET C 1 60  ? 27.745  37.566  17.065 1.00 45.82 ? 112  MET B O     1 
ATOM   4682  C CB    . MET C 1 60  ? 25.322  35.217  17.708 1.00 43.65 ? 112  MET B CB    1 
ATOM   4683  C CG    . MET C 1 60  ? 25.801  34.091  16.827 1.00 42.63 ? 112  MET B CG    1 
ATOM   4684  S SD    . MET C 1 60  ? 26.322  32.665  17.765 1.00 41.55 ? 112  MET B SD    1 
ATOM   4685  C CE    . MET C 1 60  ? 27.937  33.178  18.287 1.00 41.92 ? 112  MET B CE    1 
ATOM   4686  N N     . LEU C 1 61  ? 25.653  38.176  17.593 1.00 45.41 ? 113  LEU B N     1 
ATOM   4687  C CA    . LEU C 1 61  ? 25.781  39.469  16.927 1.00 45.77 ? 113  LEU B CA    1 
ATOM   4688  C C     . LEU C 1 61  ? 26.967  40.194  17.570 1.00 45.29 ? 113  LEU B C     1 
ATOM   4689  O O     . LEU C 1 61  ? 27.742  40.883  16.899 1.00 44.26 ? 113  LEU B O     1 
ATOM   4690  C CB    . LEU C 1 61  ? 24.513  40.310  17.115 1.00 45.92 ? 113  LEU B CB    1 
ATOM   4691  C CG    . LEU C 1 61  ? 23.131  39.656  17.065 1.00 46.83 ? 113  LEU B CG    1 
ATOM   4692  C CD1   . LEU C 1 61  ? 22.074  40.723  17.321 1.00 46.97 ? 113  LEU B CD1   1 
ATOM   4693  C CD2   . LEU C 1 61  ? 22.897  38.990  15.725 1.00 47.16 ? 113  LEU B CD2   1 
ATOM   4694  N N     . GLY C 1 62  ? 27.093  40.025  18.883 1.00 44.85 ? 114  GLY B N     1 
ATOM   4695  C CA    . GLY C 1 62  ? 28.173  40.656  19.617 1.00 45.36 ? 114  GLY B CA    1 
ATOM   4696  C C     . GLY C 1 62  ? 29.538  40.271  19.086 1.00 45.43 ? 114  GLY B C     1 
ATOM   4697  O O     . GLY C 1 62  ? 30.516  41.000  19.265 1.00 42.22 ? 114  GLY B O     1 
ATOM   4698  N N     . LYS C 1 63  ? 29.594  39.113  18.432 1.00 47.06 ? 115  LYS B N     1 
ATOM   4699  C CA    . LYS C 1 63  ? 30.831  38.606  17.848 1.00 47.95 ? 115  LYS B CA    1 
ATOM   4700  C C     . LYS C 1 63  ? 30.868  38.918  16.349 1.00 48.35 ? 115  LYS B C     1 
ATOM   4701  O O     . LYS C 1 63  ? 31.710  38.401  15.629 1.00 48.94 ? 115  LYS B O     1 
ATOM   4702  C CB    . LYS C 1 63  ? 30.937  37.093  18.070 1.00 47.77 ? 115  LYS B CB    1 
ATOM   4703  C CG    . LYS C 1 63  ? 31.114  36.657  19.525 1.00 47.83 ? 115  LYS B CG    1 
ATOM   4704  C CD    . LYS C 1 63  ? 32.522  36.948  20.030 1.00 49.55 ? 115  LYS B CD    1 
ATOM   4705  C CE    . LYS C 1 63  ? 32.756  36.401  21.436 1.00 49.77 ? 115  LYS B CE    1 
ATOM   4706  N NZ    . LYS C 1 63  ? 31.865  37.002  22.474 1.00 50.04 ? 115  LYS B NZ    1 
ATOM   4707  N N     . GLN C 1 64  ? 29.949  39.766  15.894 1.00 49.37 ? 116  GLN B N     1 
ATOM   4708  C CA    . GLN C 1 64  ? 29.849  40.172  14.488 1.00 50.78 ? 116  GLN B CA    1 
ATOM   4709  C C     . GLN C 1 64  ? 29.643  39.036  13.490 1.00 49.99 ? 116  GLN B C     1 
ATOM   4710  O O     . GLN C 1 64  ? 30.344  38.968  12.483 1.00 50.13 ? 116  GLN B O     1 
ATOM   4711  C CB    . GLN C 1 64  ? 31.086  40.967  14.048 1.00 53.30 ? 116  GLN B CB    1 
ATOM   4712  C CG    . GLN C 1 64  ? 31.403  42.215  14.857 1.00 58.17 ? 116  GLN B CG    1 
ATOM   4713  C CD    . GLN C 1 64  ? 32.283  41.924  16.076 1.00 62.28 ? 116  GLN B CD    1 
ATOM   4714  O OE1   . GLN C 1 64  ? 33.328  41.266  15.964 1.00 63.36 ? 116  GLN B OE1   1 
ATOM   4715  N NE2   . GLN C 1 64  ? 31.870  42.427  17.245 1.00 62.73 ? 116  GLN B NE2   1 
ATOM   4716  N N     . VAL C 1 65  ? 28.701  38.137  13.764 1.00 49.32 ? 117  VAL B N     1 
ATOM   4717  C CA    . VAL C 1 65  ? 28.423  37.039  12.837 1.00 47.09 ? 117  VAL B CA    1 
ATOM   4718  C C     . VAL C 1 65  ? 27.630  37.661  11.710 1.00 46.77 ? 117  VAL B C     1 
ATOM   4719  O O     . VAL C 1 65  ? 26.696  38.406  11.966 1.00 48.32 ? 117  VAL B O     1 
ATOM   4720  C CB    . VAL C 1 65  ? 27.575  35.917  13.485 1.00 44.89 ? 117  VAL B CB    1 
ATOM   4721  C CG1   . VAL C 1 65  ? 28.459  35.013  14.312 1.00 44.04 ? 117  VAL B CG1   1 
ATOM   4722  C CG2   . VAL C 1 65  ? 26.500  36.511  14.358 1.00 44.44 ? 117  VAL B CG2   1 
ATOM   4723  N N     . ASP C 1 66  ? 28.000  37.378  10.466 1.00 46.26 ? 118  ASP B N     1 
ATOM   4724  C CA    . ASP C 1 66  ? 27.289  37.952  9.327  1.00 44.86 ? 118  ASP B CA    1 
ATOM   4725  C C     . ASP C 1 66  ? 25.885  37.407  9.170  1.00 43.32 ? 118  ASP B C     1 
ATOM   4726  O O     . ASP C 1 66  ? 24.987  38.105  8.690  1.00 42.18 ? 118  ASP B O     1 
ATOM   4727  C CB    . ASP C 1 66  ? 28.074  37.719  8.048  1.00 44.09 ? 118  ASP B CB    1 
ATOM   4728  C CG    . ASP C 1 66  ? 29.431  38.320  8.115  1.00 44.16 ? 118  ASP B CG    1 
ATOM   4729  O OD1   . ASP C 1 66  ? 30.355  37.639  8.605  1.00 44.75 ? 118  ASP B OD1   1 
ATOM   4730  O OD2   . ASP C 1 66  ? 29.564  39.489  7.700  1.00 46.38 ? 118  ASP B OD2   1 
ATOM   4731  N N     . GLY C 1 67  ? 25.711  36.155  9.575  1.00 42.45 ? 119  GLY B N     1 
ATOM   4732  C CA    . GLY C 1 67  ? 24.414  35.512  9.501  1.00 42.52 ? 119  GLY B CA    1 
ATOM   4733  C C     . GLY C 1 67  ? 24.271  34.552  10.661 1.00 40.92 ? 119  GLY B C     1 
ATOM   4734  O O     . GLY C 1 67  ? 25.235  34.316  11.380 1.00 41.92 ? 119  GLY B O     1 
ATOM   4735  N N     . ILE C 1 68  ? 23.077  34.006  10.852 1.00 39.53 ? 120  ILE B N     1 
ATOM   4736  C CA    . ILE C 1 68  ? 22.847  33.062  11.932 1.00 37.79 ? 120  ILE B CA    1 
ATOM   4737  C C     . ILE C 1 68  ? 21.877  31.971  11.531 1.00 39.27 ? 120  ILE B C     1 
ATOM   4738  O O     . ILE C 1 68  ? 20.815  32.263  10.978 1.00 39.78 ? 120  ILE B O     1 
ATOM   4739  C CB    . ILE C 1 68  ? 22.230  33.735  13.176 1.00 36.48 ? 120  ILE B CB    1 
ATOM   4740  C CG1   . ILE C 1 68  ? 23.183  34.776  13.736 1.00 35.67 ? 120  ILE B CG1   1 
ATOM   4741  C CG2   . ILE C 1 68  ? 21.871  32.684  14.211 1.00 32.77 ? 120  ILE B CG2   1 
ATOM   4742  C CD1   . ILE C 1 68  ? 23.292  34.719  15.205 1.00 41.61 ? 120  ILE B CD1   1 
ATOM   4743  N N     . ILE C 1 69  ? 22.250  30.715  11.766 1.00 39.50 ? 121  ILE B N     1 
ATOM   4744  C CA    . ILE C 1 69  ? 21.316  29.628  11.524 1.00 40.75 ? 121  ILE B CA    1 
ATOM   4745  C C     . ILE C 1 69  ? 20.900  29.404  12.971 1.00 41.58 ? 121  ILE B C     1 
ATOM   4746  O O     . ILE C 1 69  ? 21.746  29.353  13.855 1.00 41.82 ? 121  ILE B O     1 
ATOM   4747  C CB    . ILE C 1 69  ? 21.968  28.324  10.984 1.00 42.30 ? 121  ILE B CB    1 
ATOM   4748  C CG1   . ILE C 1 69  ? 22.336  28.453  9.498  1.00 41.68 ? 121  ILE B CG1   1 
ATOM   4749  C CG2   . ILE C 1 69  ? 20.982  27.170  11.137 1.00 41.01 ? 121  ILE B CG2   1 
ATOM   4750  C CD1   . ILE C 1 69  ? 23.532  29.327  9.225  1.00 42.98 ? 121  ILE B CD1   1 
ATOM   4751  N N     . PHE C 1 70  ? 19.606  29.306  13.228 1.00 42.74 ? 122  PHE B N     1 
ATOM   4752  C CA    . PHE C 1 70  ? 19.124  29.121  14.587 1.00 43.04 ? 122  PHE B CA    1 
ATOM   4753  C C     . PHE C 1 70  ? 18.146  27.963  14.614 1.00 42.69 ? 122  PHE B C     1 
ATOM   4754  O O     . PHE C 1 70  ? 17.259  27.870  13.773 1.00 42.52 ? 122  PHE B O     1 
ATOM   4755  C CB    . PHE C 1 70  ? 18.457  30.423  15.067 1.00 44.30 ? 122  PHE B CB    1 
ATOM   4756  C CG    . PHE C 1 70  ? 17.689  30.299  16.365 1.00 46.67 ? 122  PHE B CG    1 
ATOM   4757  C CD1   . PHE C 1 70  ? 16.313  30.532  16.400 1.00 46.77 ? 122  PHE B CD1   1 
ATOM   4758  C CD2   . PHE C 1 70  ? 18.338  29.992  17.557 1.00 47.15 ? 122  PHE B CD2   1 
ATOM   4759  C CE1   . PHE C 1 70  ? 15.600  30.464  17.602 1.00 47.28 ? 122  PHE B CE1   1 
ATOM   4760  C CE2   . PHE C 1 70  ? 17.631  29.922  18.765 1.00 47.40 ? 122  PHE B CE2   1 
ATOM   4761  C CZ    . PHE C 1 70  ? 16.262  30.158  18.786 1.00 46.37 ? 122  PHE B CZ    1 
ATOM   4762  N N     . MET C 1 71  ? 18.329  27.071  15.577 1.00 42.53 ? 123  MET B N     1 
ATOM   4763  C CA    . MET C 1 71  ? 17.455  25.921  15.735 1.00 43.49 ? 123  MET B CA    1 
ATOM   4764  C C     . MET C 1 71  ? 16.904  25.936  17.164 1.00 44.44 ? 123  MET B C     1 
ATOM   4765  O O     . MET C 1 71  ? 17.667  26.094  18.113 1.00 45.30 ? 123  MET B O     1 
ATOM   4766  C CB    . MET C 1 71  ? 18.256  24.652  15.459 1.00 43.63 ? 123  MET B CB    1 
ATOM   4767  C CG    . MET C 1 71  ? 18.834  24.637  14.058 1.00 43.44 ? 123  MET B CG    1 
ATOM   4768  S SD    . MET C 1 71  ? 19.982  23.298  13.726 1.00 43.95 ? 123  MET B SD    1 
ATOM   4769  C CE    . MET C 1 71  ? 21.517  24.209  13.615 1.00 42.80 ? 123  MET B CE    1 
ATOM   4770  N N     . SER C 1 72  ? 15.587  25.789  17.321 1.00 44.99 ? 124  SER B N     1 
ATOM   4771  C CA    . SER C 1 72  ? 14.974  25.824  18.655 1.00 45.47 ? 124  SER B CA    1 
ATOM   4772  C C     . SER C 1 72  ? 13.687  25.034  18.786 1.00 45.22 ? 124  SER B C     1 
ATOM   4773  O O     . SER C 1 72  ? 12.849  25.036  17.882 1.00 44.52 ? 124  SER B O     1 
ATOM   4774  C CB    . SER C 1 72  ? 14.686  27.271  19.081 1.00 46.93 ? 124  SER B CB    1 
ATOM   4775  O OG    . SER C 1 72  ? 13.947  27.310  20.295 1.00 47.03 ? 124  SER B OG    1 
ATOM   4776  N N     . GLY C 1 73  ? 13.532  24.387  19.939 1.00 44.59 ? 125  GLY B N     1 
ATOM   4777  C CA    . GLY C 1 73  ? 12.350  23.589  20.197 1.00 46.03 ? 125  GLY B CA    1 
ATOM   4778  C C     . GLY C 1 73  ? 11.101  24.436  20.271 1.00 47.38 ? 125  GLY B C     1 
ATOM   4779  O O     . GLY C 1 73  ? 9.988   23.932  20.115 1.00 44.86 ? 125  GLY B O     1 
ATOM   4780  N N     . ASN C 1 74  ? 11.281  25.730  20.514 1.00 49.93 ? 126  ASN B N     1 
ATOM   4781  C CA    . ASN C 1 74  ? 10.136  26.624  20.597 1.00 53.22 ? 126  ASN B CA    1 
ATOM   4782  C C     . ASN C 1 74  ? 10.459  28.077  20.278 1.00 54.39 ? 126  ASN B C     1 
ATOM   4783  O O     . ASN C 1 74  ? 11.015  28.796  21.113 1.00 53.88 ? 126  ASN B O     1 
ATOM   4784  C CB    . ASN C 1 74  ? 9.503   26.548  21.987 1.00 53.83 ? 126  ASN B CB    1 
ATOM   4785  C CG    . ASN C 1 74  ? 8.118   27.169  22.026 1.00 54.33 ? 126  ASN B CG    1 
ATOM   4786  O OD1   . ASN C 1 74  ? 7.533   27.345  23.087 1.00 54.45 ? 126  ASN B OD1   1 
ATOM   4787  N ND2   . ASN C 1 74  ? 7.585   27.494  20.856 1.00 55.48 ? 126  ASN B ND2   1 
ATOM   4788  N N     . VAL C 1 75  ? 10.108  28.511  19.071 1.00 55.57 ? 127  VAL B N     1 
ATOM   4789  C CA    . VAL C 1 75  ? 10.358  29.895  18.681 1.00 57.42 ? 127  VAL B CA    1 
ATOM   4790  C C     . VAL C 1 75  ? 9.090   30.682  19.000 1.00 58.66 ? 127  VAL B C     1 
ATOM   4791  O O     . VAL C 1 75  ? 8.256   30.934  18.128 1.00 58.98 ? 127  VAL B O     1 
ATOM   4792  C CB    . VAL C 1 75  ? 10.678  30.024  17.173 1.00 56.48 ? 127  VAL B CB    1 
ATOM   4793  C CG1   . VAL C 1 75  ? 11.308  31.382  16.891 1.00 56.46 ? 127  VAL B CG1   1 
ATOM   4794  C CG2   . VAL C 1 75  ? 11.611  28.920  16.745 1.00 56.30 ? 127  VAL B CG2   1 
ATOM   4795  N N     . THR C 1 76  ? 8.958   31.055  20.270 1.00 59.66 ? 128  THR B N     1 
ATOM   4796  C CA    . THR C 1 76  ? 7.799   31.791  20.758 1.00 59.49 ? 128  THR B CA    1 
ATOM   4797  C C     . THR C 1 76  ? 7.707   33.189  20.195 1.00 60.80 ? 128  THR B C     1 
ATOM   4798  O O     . THR C 1 76  ? 8.678   33.724  19.643 1.00 60.58 ? 128  THR B O     1 
ATOM   4799  C CB    . THR C 1 76  ? 7.815   31.934  22.289 1.00 58.90 ? 128  THR B CB    1 
ATOM   4800  O OG1   . THR C 1 76  ? 9.036   32.570  22.694 1.00 57.83 ? 128  THR B OG1   1 
ATOM   4801  C CG2   . THR C 1 76  ? 7.694   30.574  22.958 1.00 58.34 ? 128  THR B CG2   1 
ATOM   4802  N N     . GLU C 1 77  ? 6.517   33.761  20.371 1.00 61.70 ? 129  GLU B N     1 
ATOM   4803  C CA    . GLU C 1 77  ? 6.171   35.108  19.939 1.00 62.67 ? 129  GLU B CA    1 
ATOM   4804  C C     . GLU C 1 77  ? 7.299   36.075  20.313 1.00 62.34 ? 129  GLU B C     1 
ATOM   4805  O O     . GLU C 1 77  ? 7.628   36.994  19.569 1.00 61.29 ? 129  GLU B O     1 
ATOM   4806  C CB    . GLU C 1 77  ? 4.874   35.528  20.643 1.00 64.79 ? 129  GLU B CB    1 
ATOM   4807  C CG    . GLU C 1 77  ? 4.077   36.595  19.931 1.00 68.36 ? 129  GLU B CG    1 
ATOM   4808  C CD    . GLU C 1 77  ? 3.473   36.084  18.641 1.00 70.57 ? 129  GLU B CD    1 
ATOM   4809  O OE1   . GLU C 1 77  ? 2.493   35.311  18.703 1.00 71.95 ? 129  GLU B OE1   1 
ATOM   4810  O OE2   . GLU C 1 77  ? 3.987   36.446  17.564 1.00 72.27 ? 129  GLU B OE2   1 
ATOM   4811  N N     . GLU C 1 78  ? 7.896   35.829  21.474 1.00 63.12 ? 130  GLU B N     1 
ATOM   4812  C CA    . GLU C 1 78  ? 8.969   36.656  22.020 1.00 63.99 ? 130  GLU B CA    1 
ATOM   4813  C C     . GLU C 1 78  ? 10.293  36.694  21.249 1.00 63.95 ? 130  GLU B C     1 
ATOM   4814  O O     . GLU C 1 78  ? 10.876  37.773  21.082 1.00 63.17 ? 130  GLU B O     1 
ATOM   4815  C CB    . GLU C 1 78  ? 9.229   36.227  23.461 1.00 64.41 ? 130  GLU B CB    1 
ATOM   4816  C CG    . GLU C 1 78  ? 10.229  37.082  24.191 1.00 65.90 ? 130  GLU B CG    1 
ATOM   4817  C CD    . GLU C 1 78  ? 10.415  36.613  25.605 1.00 67.20 ? 130  GLU B CD    1 
ATOM   4818  O OE1   . GLU C 1 78  ? 11.344  37.106  26.281 1.00 67.80 ? 130  GLU B OE1   1 
ATOM   4819  O OE2   . GLU C 1 78  ? 9.622   35.745  26.035 1.00 68.77 ? 130  GLU B OE2   1 
ATOM   4820  N N     . HIS C 1 79  ? 10.782  35.525  20.824 1.00 63.52 ? 131  HIS B N     1 
ATOM   4821  C CA    . HIS C 1 79  ? 12.025  35.459  20.062 1.00 62.30 ? 131  HIS B CA    1 
ATOM   4822  C C     . HIS C 1 79  ? 11.711  36.160  18.764 1.00 61.76 ? 131  HIS B C     1 
ATOM   4823  O O     . HIS C 1 79  ? 12.470  37.006  18.296 1.00 60.93 ? 131  HIS B O     1 
ATOM   4824  C CB    . HIS C 1 79  ? 12.425  34.018  19.727 1.00 62.99 ? 131  HIS B CB    1 
ATOM   4825  C CG    . HIS C 1 79  ? 12.642  33.140  20.920 1.00 63.58 ? 131  HIS B CG    1 
ATOM   4826  N ND1   . HIS C 1 79  ? 11.648  32.347  21.452 1.00 64.14 ? 131  HIS B ND1   1 
ATOM   4827  C CD2   . HIS C 1 79  ? 13.749  32.904  21.663 1.00 63.07 ? 131  HIS B CD2   1 
ATOM   4828  C CE1   . HIS C 1 79  ? 12.134  31.658  22.469 1.00 63.50 ? 131  HIS B CE1   1 
ATOM   4829  N NE2   . HIS C 1 79  ? 13.407  31.977  22.617 1.00 63.05 ? 131  HIS B NE2   1 
ATOM   4830  N N     . VAL C 1 80  ? 10.568  35.799  18.190 1.00 61.71 ? 132  VAL B N     1 
ATOM   4831  C CA    . VAL C 1 80  ? 10.143  36.384  16.933 1.00 63.17 ? 132  VAL B CA    1 
ATOM   4832  C C     . VAL C 1 80  ? 10.219  37.896  17.011 1.00 64.61 ? 132  VAL B C     1 
ATOM   4833  O O     . VAL C 1 80  ? 10.935  38.517  16.222 1.00 64.25 ? 132  VAL B O     1 
ATOM   4834  C CB    . VAL C 1 80  ? 8.722   35.992  16.579 1.00 62.75 ? 132  VAL B CB    1 
ATOM   4835  C CG1   . VAL C 1 80  ? 8.424   36.433  15.162 1.00 62.50 ? 132  VAL B CG1   1 
ATOM   4836  C CG2   . VAL C 1 80  ? 8.545   34.494  16.742 1.00 63.22 ? 132  VAL B CG2   1 
ATOM   4837  N N     . GLU C 1 81  ? 9.494   38.503  17.953 1.00 66.00 ? 133  GLU B N     1 
ATOM   4838  C CA    . GLU C 1 81  ? 9.577   39.952  18.050 1.00 67.14 ? 133  GLU B CA    1 
ATOM   4839  C C     . GLU C 1 81  ? 11.047  40.377  18.213 1.00 65.97 ? 133  GLU B C     1 
ATOM   4840  O O     . GLU C 1 81  ? 11.504  41.339  17.597 1.00 67.13 ? 133  GLU B O     1 
ATOM   4841  C CB    . GLU C 1 81  ? 8.616   40.553  19.151 1.00 69.15 ? 133  GLU B CB    1 
ATOM   4842  C CG    . GLU C 1 81  ? 8.286   39.745  20.446 1.00 73.09 ? 133  GLU B CG    1 
ATOM   4843  C CD    . GLU C 1 81  ? 6.931   40.155  21.137 1.00 74.53 ? 133  GLU B CD    1 
ATOM   4844  O OE1   . GLU C 1 81  ? 5.844   39.718  20.682 1.00 74.90 ? 133  GLU B OE1   1 
ATOM   4845  O OE2   . GLU C 1 81  ? 6.951   40.917  22.136 1.00 75.32 ? 133  GLU B OE2   1 
ATOM   4846  N N     . GLU C 1 82  ? 11.795  39.598  18.973 1.00 64.35 ? 134  GLU B N     1 
ATOM   4847  C CA    . GLU C 1 82  ? 13.195  39.869  19.222 1.00 63.14 ? 134  GLU B CA    1 
ATOM   4848  C C     . GLU C 1 82  ? 14.192  39.792  18.060 1.00 62.24 ? 134  GLU B C     1 
ATOM   4849  O O     . GLU C 1 82  ? 14.893  40.763  17.790 1.00 62.66 ? 134  GLU B O     1 
ATOM   4850  C CB    . GLU C 1 82  ? 13.669  38.941  20.333 1.00 62.11 ? 134  GLU B CB    1 
ATOM   4851  C CG    . GLU C 1 82  ? 14.964  39.389  20.990 1.00 60.27 ? 134  GLU B CG    1 
ATOM   4852  C CD    . GLU C 1 82  ? 14.808  40.715  21.729 1.00 59.67 ? 134  GLU B CD    1 
ATOM   4853  O OE1   . GLU C 1 82  ? 15.828  41.375  22.060 1.00 58.19 ? 134  GLU B OE1   1 
ATOM   4854  O OE2   . GLU C 1 82  ? 13.643  41.091  21.984 1.00 59.98 ? 134  GLU B OE2   1 
ATOM   4855  N N     . LEU C 1 83  ? 14.284  38.639  17.398 1.00 60.82 ? 135  LEU B N     1 
ATOM   4856  C CA    . LEU C 1 83  ? 15.249  38.466  16.308 1.00 59.68 ? 135  LEU B CA    1 
ATOM   4857  C C     . LEU C 1 83  ? 14.754  39.180  15.073 1.00 58.39 ? 135  LEU B C     1 
ATOM   4858  O O     . LEU C 1 83  ? 15.424  39.234  14.052 1.00 57.94 ? 135  LEU B O     1 
ATOM   4859  C CB    . LEU C 1 83  ? 15.484  36.972  16.026 1.00 58.62 ? 135  LEU B CB    1 
ATOM   4860  C CG    . LEU C 1 83  ? 14.537  36.116  15.184 1.00 57.57 ? 135  LEU B CG    1 
ATOM   4861  C CD1   . LEU C 1 83  ? 14.679  34.669  15.625 1.00 55.38 ? 135  LEU B CD1   1 
ATOM   4862  C CD2   . LEU C 1 83  ? 13.109  36.571  15.343 1.00 59.03 ? 135  LEU B CD2   1 
ATOM   4863  N N     . LYS C 1 84  ? 13.563  39.741  15.198 1.00 58.48 ? 136  LYS B N     1 
ATOM   4864  C CA    . LYS C 1 84  ? 12.947  40.491  14.124 1.00 58.13 ? 136  LYS B CA    1 
ATOM   4865  C C     . LYS C 1 84  ? 13.816  41.732  13.947 1.00 57.18 ? 136  LYS B C     1 
ATOM   4866  O O     . LYS C 1 84  ? 13.984  42.237  12.834 1.00 57.30 ? 136  LYS B O     1 
ATOM   4867  C CB    . LYS C 1 84  ? 11.528  40.905  14.526 1.00 59.27 ? 136  LYS B CB    1 
ATOM   4868  C CG    . LYS C 1 84  ? 10.543  41.028  13.370 1.00 60.39 ? 136  LYS B CG    1 
ATOM   4869  C CD    . LYS C 1 84  ? 10.071  39.669  12.893 1.00 61.79 ? 136  LYS B CD    1 
ATOM   4870  C CE    . LYS C 1 84  ? 9.198   39.802  11.658 1.00 62.97 ? 136  LYS B CE    1 
ATOM   4871  N NZ    . LYS C 1 84  ? 8.006   40.652  11.922 1.00 63.45 ? 136  LYS B NZ    1 
ATOM   4872  N N     . LYS C 1 85  ? 14.379  42.216  15.051 1.00 56.38 ? 137  LYS B N     1 
ATOM   4873  C CA    . LYS C 1 85  ? 15.230  43.400  14.992 1.00 56.44 ? 137  LYS B CA    1 
ATOM   4874  C C     . LYS C 1 85  ? 16.702  43.044  14.980 1.00 55.17 ? 137  LYS B C     1 
ATOM   4875  O O     . LYS C 1 85  ? 17.547  43.822  15.434 1.00 53.86 ? 137  LYS B O     1 
ATOM   4876  C CB    . LYS C 1 85  ? 14.932  44.352  16.158 1.00 58.86 ? 137  LYS B CB    1 
ATOM   4877  C CG    . LYS C 1 85  ? 15.207  43.807  17.548 1.00 61.15 ? 137  LYS B CG    1 
ATOM   4878  C CD    . LYS C 1 85  ? 14.642  44.751  18.607 1.00 63.19 ? 137  LYS B CD    1 
ATOM   4879  C CE    . LYS C 1 85  ? 13.151  44.975  18.393 1.00 63.47 ? 137  LYS B CE    1 
ATOM   4880  N NZ    . LYS C 1 85  ? 12.433  43.673  18.299 1.00 65.36 ? 137  LYS B NZ    1 
ATOM   4881  N N     . SER C 1 86  ? 16.996  41.862  14.447 1.00 54.31 ? 138  SER B N     1 
ATOM   4882  C CA    . SER C 1 86  ? 18.362  41.380  14.344 1.00 53.24 ? 138  SER B CA    1 
ATOM   4883  C C     . SER C 1 86  ? 19.103  42.131  13.255 1.00 53.09 ? 138  SER B C     1 
ATOM   4884  O O     . SER C 1 86  ? 18.730  42.090  12.082 1.00 53.42 ? 138  SER B O     1 
ATOM   4885  C CB    . SER C 1 86  ? 18.390  39.889  14.024 1.00 53.00 ? 138  SER B CB    1 
ATOM   4886  O OG    . SER C 1 86  ? 19.710  39.489  13.693 1.00 52.73 ? 138  SER B OG    1 
ATOM   4887  N N     . PRO C 1 87  ? 20.170  42.834  13.636 1.00 52.86 ? 139  PRO B N     1 
ATOM   4888  C CA    . PRO C 1 87  ? 20.989  43.609  12.707 1.00 52.56 ? 139  PRO B CA    1 
ATOM   4889  C C     . PRO C 1 87  ? 21.618  42.773  11.597 1.00 52.84 ? 139  PRO B C     1 
ATOM   4890  O O     . PRO C 1 87  ? 22.288  43.310  10.708 1.00 53.74 ? 139  PRO B O     1 
ATOM   4891  C CB    . PRO C 1 87  ? 22.023  44.238  13.626 1.00 52.80 ? 139  PRO B CB    1 
ATOM   4892  C CG    . PRO C 1 87  ? 21.219  44.463  14.900 1.00 52.96 ? 139  PRO B CG    1 
ATOM   4893  C CD    . PRO C 1 87  ? 20.525  43.142  15.034 1.00 53.04 ? 139  PRO B CD    1 
ATOM   4894  N N     . VAL C 1 88  ? 21.408  41.459  11.655 1.00 52.12 ? 140  VAL B N     1 
ATOM   4895  C CA    . VAL C 1 88  ? 21.952  40.541  10.650 1.00 50.60 ? 140  VAL B CA    1 
ATOM   4896  C C     . VAL C 1 88  ? 20.970  39.405  10.417 1.00 48.95 ? 140  VAL B C     1 
ATOM   4897  O O     . VAL C 1 88  ? 20.148  39.092  11.281 1.00 48.60 ? 140  VAL B O     1 
ATOM   4898  C CB    . VAL C 1 88  ? 23.304  39.935  11.090 1.00 51.41 ? 140  VAL B CB    1 
ATOM   4899  C CG1   . VAL C 1 88  ? 24.350  41.038  11.260 1.00 50.54 ? 140  VAL B CG1   1 
ATOM   4900  C CG2   . VAL C 1 88  ? 23.120  39.155  12.376 1.00 50.86 ? 140  VAL B CG2   1 
ATOM   4901  N N     . PRO C 1 89  ? 21.054  38.755  9.253  1.00 47.13 ? 141  PRO B N     1 
ATOM   4902  C CA    . PRO C 1 89  ? 20.125  37.662  8.971  1.00 46.62 ? 141  PRO B CA    1 
ATOM   4903  C C     . PRO C 1 89  ? 20.227  36.490  9.936  1.00 46.43 ? 141  PRO B C     1 
ATOM   4904  O O     . PRO C 1 89  ? 21.283  36.220  10.516 1.00 47.27 ? 141  PRO B O     1 
ATOM   4905  C CB    . PRO C 1 89  ? 20.480  37.258  7.539  1.00 46.69 ? 141  PRO B CB    1 
ATOM   4906  C CG    . PRO C 1 89  ? 21.136  38.470  6.976  1.00 47.56 ? 141  PRO B CG    1 
ATOM   4907  C CD    . PRO C 1 89  ? 21.971  38.962  8.125  1.00 47.48 ? 141  PRO B CD    1 
ATOM   4908  N N     . VAL C 1 90  ? 19.107  35.802  10.096 1.00 43.77 ? 142  VAL B N     1 
ATOM   4909  C CA    . VAL C 1 90  ? 19.026  34.642  10.952 1.00 43.50 ? 142  VAL B CA    1 
ATOM   4910  C C     . VAL C 1 90  ? 17.885  33.812  10.363 1.00 43.19 ? 142  VAL B C     1 
ATOM   4911  O O     . VAL C 1 90  ? 16.790  34.323  10.132 1.00 44.51 ? 142  VAL B O     1 
ATOM   4912  C CB    . VAL C 1 90  ? 18.746  35.059  12.432 1.00 43.88 ? 142  VAL B CB    1 
ATOM   4913  C CG1   . VAL C 1 90  ? 17.488  35.892  12.512 1.00 45.90 ? 142  VAL B CG1   1 
ATOM   4914  C CG2   . VAL C 1 90  ? 18.623  33.830  13.322 1.00 43.35 ? 142  VAL B CG2   1 
ATOM   4915  N N     . VAL C 1 91  ? 18.158  32.543  10.078 1.00 41.29 ? 143  VAL B N     1 
ATOM   4916  C CA    . VAL C 1 91  ? 17.159  31.660  9.489  1.00 40.05 ? 143  VAL B CA    1 
ATOM   4917  C C     . VAL C 1 91  ? 17.019  30.424  10.362 1.00 39.88 ? 143  VAL B C     1 
ATOM   4918  O O     . VAL C 1 91  ? 18.000  29.931  10.898 1.00 41.40 ? 143  VAL B O     1 
ATOM   4919  C CB    . VAL C 1 91  ? 17.576  31.260  8.041  1.00 37.94 ? 143  VAL B CB    1 
ATOM   4920  C CG1   . VAL C 1 91  ? 19.026  30.872  8.023  1.00 38.34 ? 143  VAL B CG1   1 
ATOM   4921  C CG2   . VAL C 1 91  ? 16.732  30.106  7.531  1.00 35.39 ? 143  VAL B CG2   1 
ATOM   4922  N N     . LEU C 1 92  ? 15.798  29.932  10.513 1.00 38.84 ? 144  LEU B N     1 
ATOM   4923  C CA    . LEU C 1 92  ? 15.553  28.761  11.337 1.00 39.43 ? 144  LEU B CA    1 
ATOM   4924  C C     . LEU C 1 92  ? 15.881  27.499  10.578 1.00 39.28 ? 144  LEU B C     1 
ATOM   4925  O O     . LEU C 1 92  ? 15.906  27.497  9.356  1.00 41.52 ? 144  LEU B O     1 
ATOM   4926  C CB    . LEU C 1 92  ? 14.088  28.721  11.780 1.00 41.31 ? 144  LEU B CB    1 
ATOM   4927  C CG    . LEU C 1 92  ? 13.584  29.875  12.657 1.00 41.50 ? 144  LEU B CG    1 
ATOM   4928  C CD1   . LEU C 1 92  ? 12.083  29.737  12.863 1.00 41.65 ? 144  LEU B CD1   1 
ATOM   4929  C CD2   . LEU C 1 92  ? 14.322  29.869  13.995 1.00 40.61 ? 144  LEU B CD2   1 
ATOM   4930  N N     . ALA C 1 93  ? 16.134  26.421  11.308 1.00 38.98 ? 145  ALA B N     1 
ATOM   4931  C CA    . ALA C 1 93  ? 16.454  25.149  10.686 1.00 38.26 ? 145  ALA B CA    1 
ATOM   4932  C C     . ALA C 1 93  ? 15.839  24.021  11.496 1.00 38.73 ? 145  ALA B C     1 
ATOM   4933  O O     . ALA C 1 93  ? 16.014  23.948  12.706 1.00 37.32 ? 145  ALA B O     1 
ATOM   4934  C CB    . ALA C 1 93  ? 17.952  24.974  10.599 1.00 37.77 ? 145  ALA B CB    1 
ATOM   4935  N N     . ALA C 1 94  ? 15.114  23.144  10.812 1.00 39.69 ? 146  ALA B N     1 
ATOM   4936  C CA    . ALA C 1 94  ? 14.453  22.018  11.451 1.00 41.37 ? 146  ALA B CA    1 
ATOM   4937  C C     . ALA C 1 94  ? 13.653  22.495  12.675 1.00 43.40 ? 146  ALA B C     1 
ATOM   4938  O O     . ALA C 1 94  ? 13.383  21.728  13.600 1.00 44.76 ? 146  ALA B O     1 
ATOM   4939  C CB    . ALA C 1 94  ? 15.486  20.968  11.843 1.00 36.78 ? 146  ALA B CB    1 
ATOM   4940  N N     . SER C 1 95  ? 13.273  23.768  12.672 1.00 44.72 ? 147  SER B N     1 
ATOM   4941  C CA    . SER C 1 95  ? 12.501  24.337  13.769 1.00 46.56 ? 147  SER B CA    1 
ATOM   4942  C C     . SER C 1 95  ? 11.292  25.060  13.196 1.00 48.28 ? 147  SER B C     1 
ATOM   4943  O O     . SER C 1 95  ? 11.282  25.401  12.014 1.00 50.00 ? 147  SER B O     1 
ATOM   4944  C CB    . SER C 1 95  ? 13.364  25.315  14.567 1.00 45.67 ? 147  SER B CB    1 
ATOM   4945  O OG    . SER C 1 95  ? 14.465  24.647  15.153 1.00 45.66 ? 147  SER B OG    1 
ATOM   4946  N N     . ILE C 1 96  ? 10.264  25.276  14.014 1.00 49.94 ? 148  ILE B N     1 
ATOM   4947  C CA    . ILE C 1 96  ? 9.076   25.990  13.552 1.00 51.71 ? 148  ILE B CA    1 
ATOM   4948  C C     . ILE C 1 96  ? 8.855   27.300  14.299 1.00 52.55 ? 148  ILE B C     1 
ATOM   4949  O O     . ILE C 1 96  ? 9.407   27.524  15.370 1.00 53.07 ? 148  ILE B O     1 
ATOM   4950  C CB    . ILE C 1 96  ? 7.801   25.143  13.680 1.00 51.16 ? 148  ILE B CB    1 
ATOM   4951  C CG1   . ILE C 1 96  ? 7.851   24.322  14.962 1.00 52.14 ? 148  ILE B CG1   1 
ATOM   4952  C CG2   . ILE C 1 96  ? 7.638   24.254  12.460 1.00 53.78 ? 148  ILE B CG2   1 
ATOM   4953  C CD1   . ILE C 1 96  ? 8.003   25.154  16.234 1.00 47.93 ? 148  ILE B CD1   1 
ATOM   4954  N N     . GLU C 1 97  ? 8.044   28.160  13.701 1.00 53.91 ? 149  GLU B N     1 
ATOM   4955  C CA    . GLU C 1 97  ? 7.696   29.459  14.243 1.00 55.15 ? 149  GLU B CA    1 
ATOM   4956  C C     . GLU C 1 97  ? 6.420   29.790  13.471 1.00 57.38 ? 149  GLU B C     1 
ATOM   4957  O O     . GLU C 1 97  ? 6.417   30.579  12.519 1.00 56.78 ? 149  GLU B O     1 
ATOM   4958  C CB    . GLU C 1 97  ? 8.815   30.460  13.951 1.00 54.62 ? 149  GLU B CB    1 
ATOM   4959  C CG    . GLU C 1 97  ? 8.689   31.806  14.648 1.00 55.10 ? 149  GLU B CG    1 
ATOM   4960  C CD    . GLU C 1 97  ? 7.817   32.795  13.898 1.00 55.23 ? 149  GLU B CD    1 
ATOM   4961  O OE1   . GLU C 1 97  ? 8.050   33.010  12.691 1.00 56.72 ? 149  GLU B OE1   1 
ATOM   4962  O OE2   . GLU C 1 97  ? 6.904   33.372  14.517 1.00 55.53 ? 149  GLU B OE2   1 
ATOM   4963  N N     . SER C 1 98  ? 5.351   29.117  13.890 1.00 59.75 ? 150  SER B N     1 
ATOM   4964  C CA    . SER C 1 98  ? 4.008   29.218  13.323 1.00 61.20 ? 150  SER B CA    1 
ATOM   4965  C C     . SER C 1 98  ? 3.520   30.491  12.662 1.00 62.22 ? 150  SER B C     1 
ATOM   4966  O O     . SER C 1 98  ? 2.641   30.430  11.820 1.00 62.96 ? 150  SER B O     1 
ATOM   4967  C CB    . SER C 1 98  ? 2.970   28.809  14.364 1.00 61.05 ? 150  SER B CB    1 
ATOM   4968  O OG    . SER C 1 98  ? 3.040   27.423  14.654 1.00 60.50 ? 150  SER B OG    1 
ATOM   4969  N N     . THR C 1 99  ? 4.050   31.638  13.076 1.00 63.12 ? 151  THR B N     1 
ATOM   4970  C CA    . THR C 1 99  ? 3.647   32.905  12.467 1.00 63.89 ? 151  THR B CA    1 
ATOM   4971  C C     . THR C 1 99  ? 4.195   33.064  11.051 1.00 64.30 ? 151  THR B C     1 
ATOM   4972  O O     . THR C 1 99  ? 3.696   33.872  10.270 1.00 65.76 ? 151  THR B O     1 
ATOM   4973  C CB    . THR C 1 99  ? 4.023   34.058  13.360 1.00 64.19 ? 151  THR B CB    1 
ATOM   4974  O OG1   . THR C 1 99  ? 3.632   33.771  14.714 1.00 64.46 ? 151  THR B OG1   1 
ATOM   4975  C CG2   . THR C 1 99  ? 3.315   35.319  12.922 1.00 66.45 ? 151  THR B CG2   1 
ATOM   4976  N N     . ASN C 1 100 ? 5.185   32.234  10.722 1.00 63.46 ? 152  ASN B N     1 
ATOM   4977  C CA    . ASN C 1 100 ? 5.863   32.270  9.433  1.00 61.98 ? 152  ASN B CA    1 
ATOM   4978  C C     . ASN C 1 100 ? 6.487   33.633  9.120  1.00 61.90 ? 152  ASN B C     1 
ATOM   4979  O O     . ASN C 1 100 ? 6.512   34.069  7.973  1.00 62.93 ? 152  ASN B O     1 
ATOM   4980  C CB    . ASN C 1 100 ? 4.904   31.887  8.295  1.00 61.23 ? 152  ASN B CB    1 
ATOM   4981  C CG    . ASN C 1 100 ? 4.712   30.411  8.183  1.00 62.53 ? 152  ASN B CG    1 
ATOM   4982  O OD1   . ASN C 1 100 ? 4.338   29.754  9.161  1.00 62.11 ? 152  ASN B OD1   1 
ATOM   4983  N ND2   . ASN C 1 100 ? 4.977   29.861  7.000  1.00 62.10 ? 152  ASN B ND2   1 
ATOM   4984  N N     . GLN C 1 101 ? 7.054   34.285  10.124 1.00 61.74 ? 153  GLN B N     1 
ATOM   4985  C CA    . GLN C 1 101 ? 7.660   35.602  9.909  1.00 61.70 ? 153  GLN B CA    1 
ATOM   4986  C C     . GLN C 1 101 ? 9.095   35.353  9.562  1.00 59.44 ? 153  GLN B C     1 
ATOM   4987  O O     . GLN C 1 101 ? 9.433   35.337  8.384  1.00 59.93 ? 153  GLN B O     1 
ATOM   4988  C CB    . GLN C 1 101 ? 7.566   36.474  11.161 1.00 65.04 ? 153  GLN B CB    1 
ATOM   4989  C CG    . GLN C 1 101 ? 6.145   36.793  11.600 1.00 69.31 ? 153  GLN B CG    1 
ATOM   4990  C CD    . GLN C 1 101 ? 6.138   37.572  12.895 1.00 71.75 ? 153  GLN B CD    1 
ATOM   4991  O OE1   . GLN C 1 101 ? 6.691   38.674  12.979 1.00 72.50 ? 153  GLN B OE1   1 
ATOM   4992  N NE2   . GLN C 1 101 ? 5.520   36.999  13.920 1.00 73.08 ? 153  GLN B NE2   1 
ATOM   4993  N N     . ILE C 1 102 ? 9.897   35.070  10.588 1.00 55.87 ? 154  ILE B N     1 
ATOM   4994  C CA    . ILE C 1 102 ? 11.320  34.759  10.448 1.00 51.60 ? 154  ILE B CA    1 
ATOM   4995  C C     . ILE C 1 102 ? 11.492  33.614  9.435  1.00 47.86 ? 154  ILE B C     1 
ATOM   4996  O O     . ILE C 1 102 ? 10.776  32.622  9.492  1.00 45.84 ? 154  ILE B O     1 
ATOM   4997  C CB    . ILE C 1 102 ? 11.907  34.356  11.837 1.00 51.02 ? 154  ILE B CB    1 
ATOM   4998  C CG1   . ILE C 1 102 ? 13.424  34.159  11.771 1.00 50.32 ? 154  ILE B CG1   1 
ATOM   4999  C CG2   . ILE C 1 102 ? 11.240  33.101  12.323 1.00 52.71 ? 154  ILE B CG2   1 
ATOM   5000  C CD1   . ILE C 1 102 ? 14.206  35.427  11.927 1.00 46.34 ? 154  ILE B CD1   1 
ATOM   5001  N N     . PRO C 1 103 ? 12.451  33.738  8.500  1.00 45.96 ? 155  PRO B N     1 
ATOM   5002  C CA    . PRO C 1 103 ? 12.686  32.700  7.480  1.00 45.82 ? 155  PRO B CA    1 
ATOM   5003  C C     . PRO C 1 103 ? 12.950  31.328  8.100  1.00 46.20 ? 155  PRO B C     1 
ATOM   5004  O O     . PRO C 1 103 ? 13.607  31.243  9.137  1.00 47.84 ? 155  PRO B O     1 
ATOM   5005  C CB    . PRO C 1 103 ? 13.912  33.216  6.724  1.00 45.45 ? 155  PRO B CB    1 
ATOM   5006  C CG    . PRO C 1 103 ? 13.941  34.689  7.028  1.00 44.94 ? 155  PRO B CG    1 
ATOM   5007  C CD    . PRO C 1 103 ? 13.518  34.750  8.462  1.00 45.42 ? 155  PRO B CD    1 
ATOM   5008  N N     . SER C 1 104 ? 12.465  30.255  7.473  1.00 44.52 ? 156  SER B N     1 
ATOM   5009  C CA    . SER C 1 104 ? 12.683  28.928  8.030  1.00 42.89 ? 156  SER B CA    1 
ATOM   5010  C C     . SER C 1 104 ? 12.602  27.796  7.019  1.00 43.46 ? 156  SER B C     1 
ATOM   5011  O O     . SER C 1 104 ? 11.755  27.808  6.123  1.00 43.16 ? 156  SER B O     1 
ATOM   5012  C CB    . SER C 1 104 ? 11.656  28.647  9.104  1.00 42.34 ? 156  SER B CB    1 
ATOM   5013  O OG    . SER C 1 104 ? 10.498  28.114  8.495  1.00 43.49 ? 156  SER B OG    1 
ATOM   5014  N N     . VAL C 1 105 ? 13.483  26.809  7.170  1.00 42.83 ? 157  VAL B N     1 
ATOM   5015  C CA    . VAL C 1 105 ? 13.466  25.651  6.281  1.00 42.64 ? 157  VAL B CA    1 
ATOM   5016  C C     . VAL C 1 105 ? 13.275  24.401  7.145  1.00 42.10 ? 157  VAL B C     1 
ATOM   5017  O O     . VAL C 1 105 ? 14.107  24.046  7.981  1.00 40.71 ? 157  VAL B O     1 
ATOM   5018  C CB    . VAL C 1 105 ? 14.751  25.602  5.364  1.00 42.36 ? 157  VAL B CB    1 
ATOM   5019  C CG1   . VAL C 1 105 ? 15.864  26.398  6.000  1.00 42.00 ? 157  VAL B CG1   1 
ATOM   5020  C CG2   . VAL C 1 105 ? 15.176  24.155  5.067  1.00 39.01 ? 157  VAL B CG2   1 
ATOM   5021  N N     . THR C 1 106 ? 12.129  23.763  6.939  1.00 42.03 ? 158  THR B N     1 
ATOM   5022  C CA    . THR C 1 106 ? 11.731  22.596  7.699  1.00 41.44 ? 158  THR B CA    1 
ATOM   5023  C C     . THR C 1 106 ? 11.274  21.472  6.779  1.00 42.13 ? 158  THR B C     1 
ATOM   5024  O O     . THR C 1 106 ? 11.622  21.421  5.609  1.00 42.50 ? 158  THR B O     1 
ATOM   5025  C CB    . THR C 1 106 ? 10.561  22.958  8.610  1.00 40.84 ? 158  THR B CB    1 
ATOM   5026  O OG1   . THR C 1 106 ? 9.394   23.160  7.802  1.00 41.77 ? 158  THR B OG1   1 
ATOM   5027  C CG2   . THR C 1 106 ? 10.853  24.248  9.371  1.00 38.77 ? 158  THR B CG2   1 
ATOM   5028  N N     . ILE C 1 107 ? 10.482  20.571  7.334  1.00 42.80 ? 159  ILE B N     1 
ATOM   5029  C CA    . ILE C 1 107 ? 9.928   19.442  6.613  1.00 43.66 ? 159  ILE B CA    1 
ATOM   5030  C C     . ILE C 1 107 ? 8.525   19.380  7.219  1.00 46.13 ? 159  ILE B C     1 
ATOM   5031  O O     . ILE C 1 107 ? 8.300   19.971  8.285  1.00 45.66 ? 159  ILE B O     1 
ATOM   5032  C CB    . ILE C 1 107 ? 10.762  18.174  6.912  1.00 43.27 ? 159  ILE B CB    1 
ATOM   5033  C CG1   . ILE C 1 107 ? 9.955   16.910  6.614  1.00 41.93 ? 159  ILE B CG1   1 
ATOM   5034  C CG2   . ILE C 1 107 ? 11.262  18.225  8.354  1.00 43.57 ? 159  ILE B CG2   1 
ATOM   5035  C CD1   . ILE C 1 107 ? 9.791   15.993  7.815  1.00 41.68 ? 159  ILE B CD1   1 
ATOM   5036  N N     . ASP C 1 108 ? 7.573   18.708  6.572  1.00 47.72 ? 160  ASP B N     1 
ATOM   5037  C CA    . ASP C 1 108 ? 6.224   18.678  7.148  1.00 49.46 ? 160  ASP B CA    1 
ATOM   5038  C C     . ASP C 1 108 ? 6.046   17.686  8.295  1.00 48.51 ? 160  ASP B C     1 
ATOM   5039  O O     . ASP C 1 108 ? 5.740   16.509  8.088  1.00 47.39 ? 160  ASP B O     1 
ATOM   5040  C CB    . ASP C 1 108 ? 5.168   18.404  6.078  1.00 52.70 ? 160  ASP B CB    1 
ATOM   5041  C CG    . ASP C 1 108 ? 3.779   18.796  6.541  1.00 54.00 ? 160  ASP B CG    1 
ATOM   5042  O OD1   . ASP C 1 108 ? 3.521   20.012  6.674  1.00 55.26 ? 160  ASP B OD1   1 
ATOM   5043  O OD2   . ASP C 1 108 ? 2.957   17.893  6.792  1.00 54.21 ? 160  ASP B OD2   1 
ATOM   5044  N N     . TYR C 1 109 ? 6.223   18.187  9.510  1.00 48.55 ? 161  TYR B N     1 
ATOM   5045  C CA    . TYR C 1 109 ? 6.109   17.371  10.711 1.00 49.64 ? 161  TYR B CA    1 
ATOM   5046  C C     . TYR C 1 109 ? 4.747   16.679  10.873 1.00 49.60 ? 161  TYR B C     1 
ATOM   5047  O O     . TYR C 1 109 ? 4.679   15.513  11.268 1.00 49.98 ? 161  TYR B O     1 
ATOM   5048  C CB    . TYR C 1 109 ? 6.451   18.236  11.929 1.00 49.80 ? 161  TYR B CB    1 
ATOM   5049  C CG    . TYR C 1 109 ? 7.830   18.874  11.816 1.00 50.71 ? 161  TYR B CG    1 
ATOM   5050  C CD1   . TYR C 1 109 ? 7.991   20.264  11.832 1.00 50.97 ? 161  TYR B CD1   1 
ATOM   5051  C CD2   . TYR C 1 109 ? 8.965   18.085  11.631 1.00 49.53 ? 161  TYR B CD2   1 
ATOM   5052  C CE1   . TYR C 1 109 ? 9.246   20.848  11.660 1.00 50.29 ? 161  TYR B CE1   1 
ATOM   5053  C CE2   . TYR C 1 109 ? 10.216  18.654  11.458 1.00 50.36 ? 161  TYR B CE2   1 
ATOM   5054  C CZ    . TYR C 1 109 ? 10.358  20.034  11.471 1.00 51.26 ? 161  TYR B CZ    1 
ATOM   5055  O OH    . TYR C 1 109 ? 11.618  20.585  11.285 1.00 50.87 ? 161  TYR B OH    1 
ATOM   5056  N N     . GLU C 1 110 ? 3.670   17.384  10.542 1.00 49.83 ? 162  GLU B N     1 
ATOM   5057  C CA    . GLU C 1 110 ? 2.323   16.822  10.648 1.00 49.19 ? 162  GLU B CA    1 
ATOM   5058  C C     . GLU C 1 110 ? 2.132   15.610  9.732  1.00 47.33 ? 162  GLU B C     1 
ATOM   5059  O O     . GLU C 1 110 ? 1.651   14.564  10.166 1.00 45.86 ? 162  GLU B O     1 
ATOM   5060  C CB    . GLU C 1 110 ? 1.284   17.924  10.343 1.00 51.87 ? 162  GLU B CB    1 
ATOM   5061  C CG    . GLU C 1 110 ? 0.199   17.601  9.297  1.00 55.06 ? 162  GLU B CG    1 
ATOM   5062  C CD    . GLU C 1 110 ? -0.838  16.599  9.780  1.00 56.54 ? 162  GLU B CD    1 
ATOM   5063  O OE1   . GLU C 1 110 ? -1.417  16.817  10.865 1.00 58.08 ? 162  GLU B OE1   1 
ATOM   5064  O OE2   . GLU C 1 110 ? -1.079  15.600  9.064  1.00 56.68 ? 162  GLU B OE2   1 
ATOM   5065  N N     . GLN C 1 111 ? 2.510   15.749  8.467  1.00 46.02 ? 163  GLN B N     1 
ATOM   5066  C CA    . GLN C 1 111 ? 2.364   14.651  7.529  1.00 45.56 ? 163  GLN B CA    1 
ATOM   5067  C C     . GLN C 1 111 ? 3.396   13.565  7.774  1.00 45.13 ? 163  GLN B C     1 
ATOM   5068  O O     . GLN C 1 111 ? 3.157   12.390  7.487  1.00 42.94 ? 163  GLN B O     1 
ATOM   5069  C CB    . GLN C 1 111 ? 2.459   15.162  6.093  1.00 47.50 ? 163  GLN B CB    1 
ATOM   5070  C CG    . GLN C 1 111 ? 1.101   15.487  5.486  1.00 47.57 ? 163  GLN B CG    1 
ATOM   5071  C CD    . GLN C 1 111 ? 0.286   14.238  5.236  1.00 47.56 ? 163  GLN B CD    1 
ATOM   5072  O OE1   . GLN C 1 111 ? -0.944  14.288  5.164  1.00 49.05 ? 163  GLN B OE1   1 
ATOM   5073  N NE2   . GLN C 1 111 ? 0.971   13.101  5.090  1.00 45.29 ? 163  GLN B NE2   1 
ATOM   5074  N N     . ALA C 1 112 ? 4.550   13.958  8.301  1.00 45.97 ? 164  ALA B N     1 
ATOM   5075  C CA    . ALA C 1 112 ? 5.594   12.991  8.604  1.00 45.65 ? 164  ALA B CA    1 
ATOM   5076  C C     . ALA C 1 112 ? 5.025   12.111  9.708  1.00 45.31 ? 164  ALA B C     1 
ATOM   5077  O O     . ALA C 1 112 ? 5.166   10.890  9.685  1.00 44.00 ? 164  ALA B O     1 
ATOM   5078  C CB    . ALA C 1 112 ? 6.839   13.703  9.083  1.00 45.00 ? 164  ALA B CB    1 
ATOM   5079  N N     . ALA C 1 113 ? 4.369   12.754  10.669 1.00 45.55 ? 165  ALA B N     1 
ATOM   5080  C CA    . ALA C 1 113 ? 3.752   12.043  11.777 1.00 47.63 ? 165  ALA B CA    1 
ATOM   5081  C C     . ALA C 1 113 ? 2.573   11.246  11.229 1.00 49.46 ? 165  ALA B C     1 
ATOM   5082  O O     . ALA C 1 113 ? 2.313   10.118  11.649 1.00 49.91 ? 165  ALA B O     1 
ATOM   5083  C CB    . ALA C 1 113 ? 3.281   13.031  12.823 1.00 46.33 ? 165  ALA B CB    1 
ATOM   5084  N N     . PHE C 1 114 ? 1.866   11.847  10.278 1.00 51.17 ? 166  PHE B N     1 
ATOM   5085  C CA    . PHE C 1 114 ? 0.720   11.210  9.652  1.00 52.16 ? 166  PHE B CA    1 
ATOM   5086  C C     . PHE C 1 114 ? 1.162   9.872   9.067  1.00 52.49 ? 166  PHE B C     1 
ATOM   5087  O O     . PHE C 1 114 ? 0.760   8.806   9.535  1.00 52.51 ? 166  PHE B O     1 
ATOM   5088  C CB    . PHE C 1 114 ? 0.168   12.108  8.527  1.00 53.43 ? 166  PHE B CB    1 
ATOM   5089  C CG    . PHE C 1 114 ? -1.235  11.758  8.096  1.00 54.28 ? 166  PHE B CG    1 
ATOM   5090  C CD1   . PHE C 1 114 ? -1.523  10.511  7.532  1.00 55.05 ? 166  PHE B CD1   1 
ATOM   5091  C CD2   . PHE C 1 114 ? -2.285  12.652  8.321  1.00 54.09 ? 166  PHE B CD2   1 
ATOM   5092  C CE1   . PHE C 1 114 ? -2.839  10.159  7.209  1.00 55.52 ? 166  PHE B CE1   1 
ATOM   5093  C CE2   . PHE C 1 114 ? -3.601  12.317  8.005  1.00 53.30 ? 166  PHE B CE2   1 
ATOM   5094  C CZ    . PHE C 1 114 ? -3.881  11.068  7.450  1.00 54.71 ? 166  PHE B CZ    1 
ATOM   5095  N N     . ASP C 1 115 ? 2.015   9.949   8.052  1.00 53.18 ? 167  ASP B N     1 
ATOM   5096  C CA    . ASP C 1 115 ? 2.509   8.771   7.344  1.00 53.23 ? 167  ASP B CA    1 
ATOM   5097  C C     . ASP C 1 115 ? 3.174   7.731   8.230  1.00 52.17 ? 167  ASP B C     1 
ATOM   5098  O O     . ASP C 1 115 ? 3.044   6.527   7.989  1.00 52.87 ? 167  ASP B O     1 
ATOM   5099  C CB    . ASP C 1 115 ? 3.462   9.208   6.230  1.00 55.07 ? 167  ASP B CB    1 
ATOM   5100  C CG    . ASP C 1 115 ? 2.889   10.348  5.387  1.00 57.81 ? 167  ASP B CG    1 
ATOM   5101  O OD1   . ASP C 1 115 ? 1.691   10.276  5.008  1.00 57.04 ? 167  ASP B OD1   1 
ATOM   5102  O OD2   . ASP C 1 115 ? 3.640   11.312  5.100  1.00 59.54 ? 167  ASP B OD2   1 
ATOM   5103  N N     . ALA C 1 116 ? 3.882   8.188   9.255  1.00 50.26 ? 168  ALA B N     1 
ATOM   5104  C CA    . ALA C 1 116 ? 4.553   7.276   10.165 1.00 48.73 ? 168  ALA B CA    1 
ATOM   5105  C C     . ALA C 1 116 ? 3.508   6.367   10.772 1.00 48.54 ? 168  ALA B C     1 
ATOM   5106  O O     . ALA C 1 116 ? 3.569   5.146   10.646 1.00 47.87 ? 168  ALA B O     1 
ATOM   5107  C CB    . ALA C 1 116 ? 5.250   8.054   11.250 1.00 48.67 ? 168  ALA B CB    1 
ATOM   5108  N N     . VAL C 1 117 ? 2.540   6.991   11.428 1.00 49.22 ? 169  VAL B N     1 
ATOM   5109  C CA    . VAL C 1 117 ? 1.456   6.278   12.078 1.00 51.41 ? 169  VAL B CA    1 
ATOM   5110  C C     . VAL C 1 117 ? 0.749   5.358   11.080 1.00 52.95 ? 169  VAL B C     1 
ATOM   5111  O O     . VAL C 1 117 ? 0.574   4.155   11.334 1.00 52.28 ? 169  VAL B O     1 
ATOM   5112  C CB    . VAL C 1 117 ? 0.445   7.284   12.661 1.00 51.44 ? 169  VAL B CB    1 
ATOM   5113  C CG1   . VAL C 1 117 ? -0.617  6.558   13.464 1.00 51.78 ? 169  VAL B CG1   1 
ATOM   5114  C CG2   . VAL C 1 117 ? 1.168   8.296   13.522 1.00 49.84 ? 169  VAL B CG2   1 
ATOM   5115  N N     . GLN C 1 118 ? 0.360   5.946   9.945  1.00 54.63 ? 170  GLN B N     1 
ATOM   5116  C CA    . GLN C 1 118 ? -0.333  5.245   8.864  1.00 54.90 ? 170  GLN B CA    1 
ATOM   5117  C C     . GLN C 1 118 ? 0.361   3.944   8.483  1.00 56.07 ? 170  GLN B C     1 
ATOM   5118  O O     . GLN C 1 118 ? -0.297  2.960   8.132  1.00 56.12 ? 170  GLN B O     1 
ATOM   5119  C CB    . GLN C 1 118 ? -0.414  6.136   7.632  1.00 54.74 ? 170  GLN B CB    1 
ATOM   5120  C CG    . GLN C 1 118 ? -1.214  5.530   6.496  1.00 54.72 ? 170  GLN B CG    1 
ATOM   5121  C CD    . GLN C 1 118 ? -2.699  5.630   6.735  1.00 55.34 ? 170  GLN B CD    1 
ATOM   5122  O OE1   . GLN C 1 118 ? -3.262  6.735   6.796  1.00 54.84 ? 170  GLN B OE1   1 
ATOM   5123  N NE2   . GLN C 1 118 ? -3.350  4.480   6.879  1.00 55.33 ? 170  GLN B NE2   1 
ATOM   5124  N N     . SER C 1 119 ? 1.692   3.948   8.538  1.00 56.83 ? 171  SER B N     1 
ATOM   5125  C CA    . SER C 1 119 ? 2.472   2.757   8.211  1.00 57.29 ? 171  SER B CA    1 
ATOM   5126  C C     . SER C 1 119 ? 2.065   1.575   9.080  1.00 57.31 ? 171  SER B C     1 
ATOM   5127  O O     . SER C 1 119 ? 2.061   0.428   8.637  1.00 57.29 ? 171  SER B O     1 
ATOM   5128  C CB    . SER C 1 119 ? 3.960   3.008   8.429  1.00 57.88 ? 171  SER B CB    1 
ATOM   5129  O OG    . SER C 1 119 ? 4.621   1.769   8.658  1.00 57.74 ? 171  SER B OG    1 
ATOM   5130  N N     . LEU C 1 120 ? 1.735   1.864   10.329 1.00 56.65 ? 172  LEU B N     1 
ATOM   5131  C CA    . LEU C 1 120 ? 1.353   0.824   11.257 1.00 56.45 ? 172  LEU B CA    1 
ATOM   5132  C C     . LEU C 1 120 ? -0.079  0.372   11.019 1.00 56.24 ? 172  LEU B C     1 
ATOM   5133  O O     . LEU C 1 120 ? -0.382  -0.822  11.119 1.00 54.78 ? 172  LEU B O     1 
ATOM   5134  C CB    . LEU C 1 120 ? 1.567   1.339   12.672 1.00 56.14 ? 172  LEU B CB    1 
ATOM   5135  C CG    . LEU C 1 120 ? 3.055   1.683   12.797 1.00 55.13 ? 172  LEU B CG    1 
ATOM   5136  C CD1   . LEU C 1 120 ? 3.288   2.621   13.965 1.00 54.22 ? 172  LEU B CD1   1 
ATOM   5137  C CD2   . LEU C 1 120 ? 3.862   0.384   12.917 1.00 54.22 ? 172  LEU B CD2   1 
ATOM   5138  N N     . ILE C 1 121 ? -0.954  1.323   10.694 1.00 56.09 ? 173  ILE B N     1 
ATOM   5139  C CA    . ILE C 1 121 ? -2.352  1.004   10.402 1.00 56.05 ? 173  ILE B CA    1 
ATOM   5140  C C     . ILE C 1 121 ? -2.346  -0.130  9.360  1.00 57.97 ? 173  ILE B C     1 
ATOM   5141  O O     . ILE C 1 121 ? -2.798  -1.253  9.616  1.00 56.60 ? 173  ILE B O     1 
ATOM   5142  C CB    . ILE C 1 121 ? -3.081  2.197   9.758  1.00 53.88 ? 173  ILE B CB    1 
ATOM   5143  C CG1   . ILE C 1 121 ? -2.765  3.492   10.510 1.00 51.49 ? 173  ILE B CG1   1 
ATOM   5144  C CG2   . ILE C 1 121 ? -4.575  1.909   9.708  1.00 53.81 ? 173  ILE B CG2   1 
ATOM   5145  C CD1   . ILE C 1 121 ? -3.425  3.616   11.847 1.00 46.96 ? 173  ILE B CD1   1 
ATOM   5146  N N     . ASP C 1 122 ? -1.813  0.201   8.185  1.00 59.19 ? 174  ASP B N     1 
ATOM   5147  C CA    . ASP C 1 122 ? -1.694  -0.711  7.055  1.00 61.06 ? 174  ASP B CA    1 
ATOM   5148  C C     . ASP C 1 122 ? -1.038  -2.039  7.443  1.00 62.26 ? 174  ASP B C     1 
ATOM   5149  O O     . ASP C 1 122 ? -1.214  -3.047  6.755  1.00 63.16 ? 174  ASP B O     1 
ATOM   5150  C CB    . ASP C 1 122 ? -0.864  -0.047  5.953  1.00 62.55 ? 174  ASP B CB    1 
ATOM   5151  C CG    . ASP C 1 122 ? -1.372  1.342   5.585  1.00 64.76 ? 174  ASP B CG    1 
ATOM   5152  O OD1   . ASP C 1 122 ? -2.004  2.005   6.447  1.00 64.30 ? 174  ASP B OD1   1 
ATOM   5153  O OD2   . ASP C 1 122 ? -1.119  1.773   4.432  1.00 64.79 ? 174  ASP B OD2   1 
ATOM   5154  N N     . SER C 1 123 ? -0.267  -2.041  8.528  1.00 63.15 ? 175  SER B N     1 
ATOM   5155  C CA    . SER C 1 123 ? 0.399   -3.259  8.981  1.00 63.98 ? 175  SER B CA    1 
ATOM   5156  C C     . SER C 1 123 ? -0.600  -4.125  9.736  1.00 64.56 ? 175  SER B C     1 
ATOM   5157  O O     . SER C 1 123 ? -0.411  -5.339  9.879  1.00 64.86 ? 175  SER B O     1 
ATOM   5158  C CB    . SER C 1 123 ? 1.558   -2.927  9.923  1.00 64.42 ? 175  SER B CB    1 
ATOM   5159  O OG    . SER C 1 123 ? 2.429   -1.955  9.376  1.00 65.06 ? 175  SER B OG    1 
ATOM   5160  N N     . GLY C 1 124 ? -1.661  -3.485  10.220 1.00 64.24 ? 176  GLY B N     1 
ATOM   5161  C CA    . GLY C 1 124 ? -2.678  -4.187  10.978 1.00 64.66 ? 176  GLY B CA    1 
ATOM   5162  C C     . GLY C 1 124 ? -2.503  -3.830  12.439 1.00 65.54 ? 176  GLY B C     1 
ATOM   5163  O O     . GLY C 1 124 ? -2.147  -4.676  13.265 1.00 65.57 ? 176  GLY B O     1 
ATOM   5164  N N     . HIS C 1 125 ? -2.744  -2.562  12.752 1.00 65.80 ? 177  HIS B N     1 
ATOM   5165  C CA    . HIS C 1 125 ? -2.599  -2.058  14.111 1.00 66.39 ? 177  HIS B CA    1 
ATOM   5166  C C     . HIS C 1 125 ? -3.677  -1.006  14.392 1.00 66.68 ? 177  HIS B C     1 
ATOM   5167  O O     . HIS C 1 125 ? -3.855  -0.078  13.606 1.00 65.61 ? 177  HIS B O     1 
ATOM   5168  C CB    . HIS C 1 125 ? -1.206  -1.409  14.300 1.00 67.82 ? 177  HIS B CB    1 
ATOM   5169  C CG    . HIS C 1 125 ? -0.075  -2.386  14.472 1.00 68.39 ? 177  HIS B CG    1 
ATOM   5170  N ND1   . HIS C 1 125 ? 0.279   -3.306  13.508 1.00 69.44 ? 177  HIS B ND1   1 
ATOM   5171  C CD2   . HIS C 1 125 ? 0.797   -2.565  15.494 1.00 67.97 ? 177  HIS B CD2   1 
ATOM   5172  C CE1   . HIS C 1 125 ? 1.317   -4.010  13.928 1.00 68.09 ? 177  HIS B CE1   1 
ATOM   5173  N NE2   . HIS C 1 125 ? 1.650   -3.579  15.131 1.00 68.10 ? 177  HIS B NE2   1 
ATOM   5174  N N     . LYS C 1 126 ? -4.390  -1.157  15.510 1.00 67.84 ? 178  LYS B N     1 
ATOM   5175  C CA    . LYS C 1 126 ? -5.432  -0.204  15.912 1.00 67.72 ? 178  LYS B CA    1 
ATOM   5176  C C     . LYS C 1 126 ? -4.939  0.567   17.127 1.00 67.01 ? 178  LYS B C     1 
ATOM   5177  O O     . LYS C 1 126 ? -5.114  1.783   17.230 1.00 66.75 ? 178  LYS B O     1 
ATOM   5178  C CB    . LYS C 1 126 ? -6.735  -0.942  16.255 1.00 69.29 ? 178  LYS B CB    1 
ATOM   5179  C CG    . LYS C 1 126 ? -7.742  -0.168  17.145 1.00 71.37 ? 178  LYS B CG    1 
ATOM   5180  C CD    . LYS C 1 126 ? -7.424  -0.290  18.655 1.00 71.93 ? 178  LYS B CD    1 
ATOM   5181  C CE    . LYS C 1 126 ? -8.572  0.185   19.560 1.00 71.46 ? 178  LYS B CE    1 
ATOM   5182  N NZ    . LYS C 1 126 ? -9.766  -0.718  19.545 1.00 70.65 ? 178  LYS B NZ    1 
ATOM   5183  N N     . ASN C 1 127 ? -4.324  -0.160  18.052 1.00 66.06 ? 179  ASN B N     1 
ATOM   5184  C CA    . ASN C 1 127 ? -3.785  0.435   19.274 1.00 65.13 ? 179  ASN B CA    1 
ATOM   5185  C C     . ASN C 1 127 ? -2.301  0.775   19.099 1.00 62.54 ? 179  ASN B C     1 
ATOM   5186  O O     . ASN C 1 127 ? -1.397  -0.055  19.302 1.00 60.93 ? 179  ASN B O     1 
ATOM   5187  C CB    . ASN C 1 127 ? -4.013  -0.511  20.461 1.00 66.52 ? 179  ASN B CB    1 
ATOM   5188  C CG    . ASN C 1 127 ? -4.215  -1.953  20.025 1.00 67.89 ? 179  ASN B CG    1 
ATOM   5189  O OD1   . ASN C 1 127 ? -4.866  -2.734  20.724 1.00 66.78 ? 179  ASN B OD1   1 
ATOM   5190  N ND2   . ASN C 1 127 ? -3.650  -2.317  18.865 1.00 67.68 ? 179  ASN B ND2   1 
ATOM   5191  N N     . ILE C 1 128 ? -2.097  2.027   18.700 1.00 59.24 ? 180  ILE B N     1 
ATOM   5192  C CA    . ILE C 1 128 ? -0.794  2.613   18.437 1.00 55.47 ? 180  ILE B CA    1 
ATOM   5193  C C     . ILE C 1 128 ? -0.654  3.804   19.375 1.00 53.07 ? 180  ILE B C     1 
ATOM   5194  O O     . ILE C 1 128 ? -1.418  4.769   19.281 1.00 51.02 ? 180  ILE B O     1 
ATOM   5195  C CB    . ILE C 1 128 ? -0.718  3.124   16.965 1.00 54.47 ? 180  ILE B CB    1 
ATOM   5196  C CG1   . ILE C 1 128 ? -0.911  1.956   15.991 1.00 52.25 ? 180  ILE B CG1   1 
ATOM   5197  C CG2   . ILE C 1 128 ? 0.600   3.838   16.718 1.00 54.19 ? 180  ILE B CG2   1 
ATOM   5198  C CD1   . ILE C 1 128 ? -1.343  2.382   14.601 1.00 47.25 ? 180  ILE B CD1   1 
ATOM   5199  N N     . ALA C 1 129 ? 0.310   3.734   20.283 1.00 51.08 ? 181  ALA B N     1 
ATOM   5200  C CA    . ALA C 1 129 ? 0.534   4.829   21.217 1.00 50.32 ? 181  ALA B CA    1 
ATOM   5201  C C     . ALA C 1 129 ? 1.486   5.862   20.611 1.00 50.30 ? 181  ALA B C     1 
ATOM   5202  O O     . ALA C 1 129 ? 1.955   5.705   19.484 1.00 50.87 ? 181  ALA B O     1 
ATOM   5203  C CB    . ALA C 1 129 ? 1.100   4.286   22.506 1.00 50.27 ? 181  ALA B CB    1 
ATOM   5204  N N     . PHE C 1 130 ? 1.780   6.916   21.361 1.00 50.34 ? 182  PHE B N     1 
ATOM   5205  C CA    . PHE C 1 130 ? 2.676   7.964   20.873 1.00 50.79 ? 182  PHE B CA    1 
ATOM   5206  C C     . PHE C 1 130 ? 3.641   8.486   21.945 1.00 49.81 ? 182  PHE B C     1 
ATOM   5207  O O     . PHE C 1 130 ? 3.247   9.265   22.818 1.00 49.87 ? 182  PHE B O     1 
ATOM   5208  C CB    . PHE C 1 130 ? 1.854   9.136   20.321 1.00 51.92 ? 182  PHE B CB    1 
ATOM   5209  C CG    . PHE C 1 130 ? 2.685   10.303  19.852 1.00 55.32 ? 182  PHE B CG    1 
ATOM   5210  C CD1   . PHE C 1 130 ? 2.210   11.609  19.992 1.00 56.99 ? 182  PHE B CD1   1 
ATOM   5211  C CD2   . PHE C 1 130 ? 3.925   10.105  19.246 1.00 56.23 ? 182  PHE B CD2   1 
ATOM   5212  C CE1   . PHE C 1 130 ? 2.958   12.702  19.533 1.00 57.25 ? 182  PHE B CE1   1 
ATOM   5213  C CE2   . PHE C 1 130 ? 4.681   11.191  18.784 1.00 57.17 ? 182  PHE B CE2   1 
ATOM   5214  C CZ    . PHE C 1 130 ? 4.196   12.491  18.928 1.00 56.95 ? 182  PHE B CZ    1 
ATOM   5215  N N     . VAL C 1 131 ? 4.900   8.048   21.881 1.00 48.13 ? 183  VAL B N     1 
ATOM   5216  C CA    . VAL C 1 131 ? 5.923   8.500   22.822 1.00 45.58 ? 183  VAL B CA    1 
ATOM   5217  C C     . VAL C 1 131 ? 6.450   9.809   22.249 1.00 44.98 ? 183  VAL B C     1 
ATOM   5218  O O     . VAL C 1 131 ? 7.341   9.812   21.409 1.00 45.51 ? 183  VAL B O     1 
ATOM   5219  C CB    . VAL C 1 131 ? 7.069   7.475   22.935 1.00 44.57 ? 183  VAL B CB    1 
ATOM   5220  C CG1   . VAL C 1 131 ? 8.238   8.076   23.690 1.00 45.13 ? 183  VAL B CG1   1 
ATOM   5221  C CG2   . VAL C 1 131 ? 6.583   6.239   23.658 1.00 44.08 ? 183  VAL B CG2   1 
ATOM   5222  N N     . SER C 1 132 ? 5.884   10.920  22.695 1.00 45.04 ? 184  SER B N     1 
ATOM   5223  C CA    . SER C 1 132 ? 6.266   12.225  22.184 1.00 46.44 ? 184  SER B CA    1 
ATOM   5224  C C     . SER C 1 132 ? 7.276   12.962  23.030 1.00 46.80 ? 184  SER B C     1 
ATOM   5225  O O     . SER C 1 132 ? 7.634   12.521  24.118 1.00 46.71 ? 184  SER B O     1 
ATOM   5226  C CB    . SER C 1 132 ? 5.027   13.106  22.037 1.00 48.18 ? 184  SER B CB    1 
ATOM   5227  O OG    . SER C 1 132 ? 5.389   14.451  21.766 1.00 51.80 ? 184  SER B OG    1 
ATOM   5228  N N     . GLY C 1 133 ? 7.733   14.095  22.504 1.00 46.57 ? 185  GLY B N     1 
ATOM   5229  C CA    . GLY C 1 133 ? 8.680   14.925  23.215 1.00 47.47 ? 185  GLY B CA    1 
ATOM   5230  C C     . GLY C 1 133 ? 7.849   15.888  24.033 1.00 49.19 ? 185  GLY B C     1 
ATOM   5231  O O     . GLY C 1 133 ? 6.621   15.870  23.933 1.00 48.52 ? 185  GLY B O     1 
ATOM   5232  N N     . THR C 1 134 ? 8.496   16.737  24.827 1.00 51.13 ? 186  THR B N     1 
ATOM   5233  C CA    . THR C 1 134 ? 7.761   17.671  25.673 1.00 53.28 ? 186  THR B CA    1 
ATOM   5234  C C     . THR C 1 134 ? 6.581   18.272  24.922 1.00 53.79 ? 186  THR B C     1 
ATOM   5235  O O     . THR C 1 134 ? 6.752   19.112  24.042 1.00 53.76 ? 186  THR B O     1 
ATOM   5236  C CB    . THR C 1 134 ? 8.685   18.789  26.218 1.00 53.70 ? 186  THR B CB    1 
ATOM   5237  O OG1   . THR C 1 134 ? 9.073   19.668  25.160 1.00 55.83 ? 186  THR B OG1   1 
ATOM   5238  C CG2   . THR C 1 134 ? 9.937   18.177  26.839 1.00 54.28 ? 186  THR B CG2   1 
ATOM   5239  N N     . LEU C 1 135 ? 5.381   17.818  25.269 1.00 54.66 ? 187  LEU B N     1 
ATOM   5240  C CA    . LEU C 1 135 ? 4.169   18.291  24.616 1.00 56.13 ? 187  LEU B CA    1 
ATOM   5241  C C     . LEU C 1 135 ? 4.013   19.802  24.633 1.00 56.70 ? 187  LEU B C     1 
ATOM   5242  O O     . LEU C 1 135 ? 3.251   20.361  23.842 1.00 57.02 ? 187  LEU B O     1 
ATOM   5243  C CB    . LEU C 1 135 ? 2.940   17.639  25.245 1.00 57.43 ? 187  LEU B CB    1 
ATOM   5244  C CG    . LEU C 1 135 ? 2.762   16.160  24.888 1.00 59.48 ? 187  LEU B CG    1 
ATOM   5245  C CD1   . LEU C 1 135 ? 1.520   15.613  25.588 1.00 60.12 ? 187  LEU B CD1   1 
ATOM   5246  C CD2   . LEU C 1 135 ? 2.639   16.002  23.374 1.00 59.15 ? 187  LEU B CD2   1 
ATOM   5247  N N     . GLU C 1 136 ? 4.738   20.465  25.525 1.00 57.40 ? 188  GLU B N     1 
ATOM   5248  C CA    . GLU C 1 136 ? 4.681   21.925  25.628 1.00 57.26 ? 188  GLU B CA    1 
ATOM   5249  C C     . GLU C 1 136 ? 5.326   22.575  24.407 1.00 55.67 ? 188  GLU B C     1 
ATOM   5250  O O     . GLU C 1 136 ? 5.323   23.798  24.272 1.00 55.12 ? 188  GLU B O     1 
ATOM   5251  C CB    . GLU C 1 136 ? 5.418   22.386  26.882 1.00 58.72 ? 188  GLU B CB    1 
ATOM   5252  C CG    . GLU C 1 136 ? 5.058   21.583  28.112 1.00 61.92 ? 188  GLU B CG    1 
ATOM   5253  C CD    . GLU C 1 136 ? 6.258   21.337  28.982 1.00 63.40 ? 188  GLU B CD    1 
ATOM   5254  O OE1   . GLU C 1 136 ? 6.825   22.328  29.499 1.00 64.73 ? 188  GLU B OE1   1 
ATOM   5255  O OE2   . GLU C 1 136 ? 6.632   20.152  29.134 1.00 64.01 ? 188  GLU B OE2   1 
ATOM   5256  N N     . GLU C 1 137 ? 5.883   21.752  23.523 1.00 54.11 ? 189  GLU B N     1 
ATOM   5257  C CA    . GLU C 1 137 ? 6.533   22.266  22.329 1.00 52.56 ? 189  GLU B CA    1 
ATOM   5258  C C     . GLU C 1 137 ? 5.715   22.134  21.045 1.00 51.76 ? 189  GLU B C     1 
ATOM   5259  O O     . GLU C 1 137 ? 5.202   21.053  20.702 1.00 52.05 ? 189  GLU B O     1 
ATOM   5260  C CB    . GLU C 1 137 ? 7.905   21.613  22.160 1.00 52.09 ? 189  GLU B CB    1 
ATOM   5261  C CG    . GLU C 1 137 ? 8.874   22.018  23.250 1.00 51.43 ? 189  GLU B CG    1 
ATOM   5262  C CD    . GLU C 1 137 ? 10.316  21.700  22.915 1.00 51.56 ? 189  GLU B CD    1 
ATOM   5263  O OE1   . GLU C 1 137 ? 11.207  22.276  23.578 1.00 51.29 ? 189  GLU B OE1   1 
ATOM   5264  O OE2   . GLU C 1 137 ? 10.559  20.882  22.002 1.00 48.60 ? 189  GLU B OE2   1 
ATOM   5265  N N     . PRO C 1 138 ? 5.581   23.252  20.318 1.00 49.97 ? 190  PRO B N     1 
ATOM   5266  C CA    . PRO C 1 138 ? 4.856   23.406  19.059 1.00 49.54 ? 190  PRO B CA    1 
ATOM   5267  C C     . PRO C 1 138 ? 4.990   22.232  18.077 1.00 49.85 ? 190  PRO B C     1 
ATOM   5268  O O     . PRO C 1 138 ? 3.983   21.689  17.615 1.00 49.13 ? 190  PRO B O     1 
ATOM   5269  C CB    . PRO C 1 138 ? 5.436   24.699  18.509 1.00 49.23 ? 190  PRO B CB    1 
ATOM   5270  C CG    . PRO C 1 138 ? 5.613   25.499  19.737 1.00 48.67 ? 190  PRO B CG    1 
ATOM   5271  C CD    . PRO C 1 138 ? 6.252   24.512  20.679 1.00 49.15 ? 190  PRO B CD    1 
ATOM   5272  N N     . ILE C 1 139 ? 6.224   21.843  17.756 1.00 49.65 ? 191  ILE B N     1 
ATOM   5273  C CA    . ILE C 1 139 ? 6.437   20.739  16.821 1.00 49.95 ? 191  ILE B CA    1 
ATOM   5274  C C     . ILE C 1 139 ? 5.693   19.520  17.314 1.00 49.38 ? 191  ILE B C     1 
ATOM   5275  O O     . ILE C 1 139 ? 5.234   18.704  16.528 1.00 47.85 ? 191  ILE B O     1 
ATOM   5276  C CB    . ILE C 1 139 ? 7.919   20.313  16.703 1.00 49.99 ? 191  ILE B CB    1 
ATOM   5277  C CG1   . ILE C 1 139 ? 8.823   21.534  16.702 1.00 51.50 ? 191  ILE B CG1   1 
ATOM   5278  C CG2   . ILE C 1 139 ? 8.131   19.487  15.435 1.00 51.05 ? 191  ILE B CG2   1 
ATOM   5279  C CD1   . ILE C 1 139 ? 8.966   22.167  18.083 1.00 48.87 ? 191  ILE B CD1   1 
ATOM   5280  N N     . ASN C 1 140 ? 5.576   19.399  18.628 1.00 50.69 ? 192  ASN B N     1 
ATOM   5281  C CA    . ASN C 1 140 ? 4.918   18.241  19.197 1.00 53.27 ? 192  ASN B CA    1 
ATOM   5282  C C     . ASN C 1 140 ? 3.401   18.274  19.187 1.00 54.27 ? 192  ASN B C     1 
ATOM   5283  O O     . ASN C 1 140 ? 2.756   17.511  18.449 1.00 53.39 ? 192  ASN B O     1 
ATOM   5284  C CB    . ASN C 1 140 ? 5.417   18.004  20.621 1.00 53.67 ? 192  ASN B CB    1 
ATOM   5285  C CG    . ASN C 1 140 ? 6.840   17.491  20.657 1.00 54.69 ? 192  ASN B CG    1 
ATOM   5286  O OD1   . ASN C 1 140 ? 7.161   16.453  20.064 1.00 54.19 ? 192  ASN B OD1   1 
ATOM   5287  N ND2   . ASN C 1 140 ? 7.704   18.214  21.356 1.00 54.17 ? 192  ASN B ND2   1 
ATOM   5288  N N     . HIS C 1 141 ? 2.825   19.154  19.998 1.00 54.68 ? 193  HIS B N     1 
ATOM   5289  C CA    . HIS C 1 141 ? 1.377   19.217  20.071 1.00 55.55 ? 193  HIS B CA    1 
ATOM   5290  C C     . HIS C 1 141 ? 0.710   19.634  18.763 1.00 55.12 ? 193  HIS B C     1 
ATOM   5291  O O     . HIS C 1 141 ? -0.163  18.927  18.261 1.00 55.06 ? 193  HIS B O     1 
ATOM   5292  C CB    . HIS C 1 141 ? 0.937   20.115  21.243 1.00 56.15 ? 193  HIS B CB    1 
ATOM   5293  C CG    . HIS C 1 141 ? 1.326   21.554  21.110 1.00 55.97 ? 193  HIS B CG    1 
ATOM   5294  N ND1   . HIS C 1 141 ? 0.715   22.411  20.221 1.00 55.75 ? 193  HIS B ND1   1 
ATOM   5295  C CD2   . HIS C 1 141 ? 2.217   22.303  21.801 1.00 56.14 ? 193  HIS B CD2   1 
ATOM   5296  C CE1   . HIS C 1 141 ? 1.209   23.626  20.376 1.00 56.63 ? 193  HIS B CE1   1 
ATOM   5297  N NE2   . HIS C 1 141 ? 2.122   23.588  21.329 1.00 56.01 ? 193  HIS B NE2   1 
ATOM   5298  N N     . ALA C 1 142 ? 1.138   20.754  18.195 1.00 55.78 ? 194  ALA B N     1 
ATOM   5299  C CA    . ALA C 1 142 ? 0.557   21.245  16.948 1.00 56.46 ? 194  ALA B CA    1 
ATOM   5300  C C     . ALA C 1 142 ? 0.789   20.348  15.731 1.00 56.37 ? 194  ALA B C     1 
ATOM   5301  O O     . ALA C 1 142 ? -0.161  19.983  15.038 1.00 56.35 ? 194  ALA B O     1 
ATOM   5302  C CB    . ALA C 1 142 ? 1.075   22.647  16.650 1.00 55.94 ? 194  ALA B CB    1 
ATOM   5303  N N     . LYS C 1 143 ? 2.045   19.987  15.478 1.00 56.32 ? 195  LYS B N     1 
ATOM   5304  C CA    . LYS C 1 143 ? 2.383   19.169  14.313 1.00 55.30 ? 195  LYS B CA    1 
ATOM   5305  C C     . LYS C 1 143 ? 2.322   17.644  14.480 1.00 55.84 ? 195  LYS B C     1 
ATOM   5306  O O     . LYS C 1 143 ? 1.457   16.990  13.897 1.00 56.35 ? 195  LYS B O     1 
ATOM   5307  C CB    . LYS C 1 143 ? 3.768   19.569  13.804 1.00 53.54 ? 195  LYS B CB    1 
ATOM   5308  C CG    . LYS C 1 143 ? 4.000   21.071  13.767 1.00 51.57 ? 195  LYS B CG    1 
ATOM   5309  C CD    . LYS C 1 143 ? 2.999   21.786  12.866 1.00 51.69 ? 195  LYS B CD    1 
ATOM   5310  C CE    . LYS C 1 143 ? 3.281   23.284  12.819 1.00 50.28 ? 195  LYS B CE    1 
ATOM   5311  N NZ    . LYS C 1 143 ? 2.344   23.998  11.926 1.00 48.84 ? 195  LYS B NZ    1 
ATOM   5312  N N     . LYS C 1 144 ? 3.238   17.080  15.265 1.00 56.70 ? 196  LYS B N     1 
ATOM   5313  C CA    . LYS C 1 144 ? 3.296   15.631  15.473 1.00 56.75 ? 196  LYS B CA    1 
ATOM   5314  C C     . LYS C 1 144 ? 2.058   15.001  16.108 1.00 56.52 ? 196  LYS B C     1 
ATOM   5315  O O     . LYS C 1 144 ? 1.353   14.223  15.454 1.00 55.54 ? 196  LYS B O     1 
ATOM   5316  C CB    . LYS C 1 144 ? 4.541   15.268  16.289 1.00 58.10 ? 196  LYS B CB    1 
ATOM   5317  C CG    . LYS C 1 144 ? 5.850   15.346  15.491 1.00 59.47 ? 196  LYS B CG    1 
ATOM   5318  C CD    . LYS C 1 144 ? 7.039   14.942  16.352 1.00 60.96 ? 196  LYS B CD    1 
ATOM   5319  C CE    . LYS C 1 144 ? 8.371   15.091  15.626 1.00 60.77 ? 196  LYS B CE    1 
ATOM   5320  N NZ    . LYS C 1 144 ? 9.525   14.887  16.563 1.00 60.34 ? 196  LYS B NZ    1 
ATOM   5321  N N     . VAL C 1 145 ? 1.806   15.313  17.379 1.00 56.46 ? 197  VAL B N     1 
ATOM   5322  C CA    . VAL C 1 145 ? 0.632   14.781  18.080 1.00 56.77 ? 197  VAL B CA    1 
ATOM   5323  C C     . VAL C 1 145 ? -0.538  14.759  17.103 1.00 56.82 ? 197  VAL B C     1 
ATOM   5324  O O     . VAL C 1 145 ? -1.061  13.699  16.742 1.00 55.26 ? 197  VAL B O     1 
ATOM   5325  C CB    . VAL C 1 145 ? 0.220   15.688  19.256 1.00 56.91 ? 197  VAL B CB    1 
ATOM   5326  C CG1   . VAL C 1 145 ? -1.098  15.227  19.824 1.00 57.12 ? 197  VAL B CG1   1 
ATOM   5327  C CG2   . VAL C 1 145 ? 1.282   15.673  20.328 1.00 58.56 ? 197  VAL B CG2   1 
ATOM   5328  N N     . LYS C 1 146 ? -0.915  15.966  16.684 1.00 56.46 ? 198  LYS B N     1 
ATOM   5329  C CA    . LYS C 1 146 ? -2.005  16.212  15.751 1.00 55.94 ? 198  LYS B CA    1 
ATOM   5330  C C     . LYS C 1 146 ? -1.895  15.320  14.514 1.00 55.17 ? 198  LYS B C     1 
ATOM   5331  O O     . LYS C 1 146 ? -2.862  14.646  14.133 1.00 55.54 ? 198  LYS B O     1 
ATOM   5332  C CB    . LYS C 1 146 ? -1.993  17.698  15.358 1.00 56.08 ? 198  LYS B CB    1 
ATOM   5333  C CG    . LYS C 1 146 ? -3.362  18.301  15.065 1.00 57.37 ? 198  LYS B CG    1 
ATOM   5334  C CD    . LYS C 1 146 ? -3.801  18.042  13.624 1.00 59.93 ? 198  LYS B CD    1 
ATOM   5335  C CE    . LYS C 1 146 ? -2.954  18.838  12.627 1.00 59.74 ? 198  LYS B CE    1 
ATOM   5336  N NZ    . LYS C 1 146 ? -3.387  18.627  11.218 1.00 59.58 ? 198  LYS B NZ    1 
ATOM   5337  N N     . GLY C 1 147 ? -0.712  15.312  13.902 1.00 54.06 ? 199  GLY B N     1 
ATOM   5338  C CA    . GLY C 1 147 ? -0.492  14.507  12.715 1.00 52.05 ? 199  GLY B CA    1 
ATOM   5339  C C     . GLY C 1 147 ? -0.742  13.036  12.971 1.00 51.09 ? 199  GLY B C     1 
ATOM   5340  O O     . GLY C 1 147 ? -1.067  12.283  12.046 1.00 51.23 ? 199  GLY B O     1 
ATOM   5341  N N     . TYR C 1 148 ? -0.597  12.628  14.230 1.00 49.78 ? 200  TYR B N     1 
ATOM   5342  C CA    . TYR C 1 148 ? -0.791  11.230  14.637 1.00 48.80 ? 200  TYR B CA    1 
ATOM   5343  C C     . TYR C 1 148 ? -2.256  10.913  14.942 1.00 47.81 ? 200  TYR B C     1 
ATOM   5344  O O     . TYR C 1 148 ? -2.711  9.786   14.761 1.00 46.85 ? 200  TYR B O     1 
ATOM   5345  C CB    . TYR C 1 148 ? 0.121   10.926  15.841 1.00 47.56 ? 200  TYR B CB    1 
ATOM   5346  C CG    . TYR C 1 148 ? -0.396  9.938   16.870 1.00 46.34 ? 200  TYR B CG    1 
ATOM   5347  C CD1   . TYR C 1 148 ? -1.051  10.379  18.020 1.00 45.28 ? 200  TYR B CD1   1 
ATOM   5348  C CD2   . TYR C 1 148 ? -0.165  8.570   16.728 1.00 46.90 ? 200  TYR B CD2   1 
ATOM   5349  C CE1   . TYR C 1 148 ? -1.454  9.486   19.006 1.00 45.06 ? 200  TYR B CE1   1 
ATOM   5350  C CE2   . TYR C 1 148 ? -0.562  7.664   17.704 1.00 46.54 ? 200  TYR B CE2   1 
ATOM   5351  C CZ    . TYR C 1 148 ? -1.203  8.127   18.846 1.00 47.64 ? 200  TYR B CZ    1 
ATOM   5352  O OH    . TYR C 1 148 ? -1.555  7.228   19.840 1.00 48.05 ? 200  TYR B OH    1 
ATOM   5353  N N     . LYS C 1 149 ? -2.988  11.918  15.409 1.00 47.89 ? 201  LYS B N     1 
ATOM   5354  C CA    . LYS C 1 149 ? -4.405  11.751  15.696 1.00 47.43 ? 201  LYS B CA    1 
ATOM   5355  C C     . LYS C 1 149 ? -5.031  11.429  14.339 1.00 48.23 ? 201  LYS B C     1 
ATOM   5356  O O     . LYS C 1 149 ? -5.542  10.329  14.109 1.00 44.82 ? 201  LYS B O     1 
ATOM   5357  C CB    . LYS C 1 149 ? -5.001  13.064  16.207 1.00 45.56 ? 201  LYS B CB    1 
ATOM   5358  C CG    . LYS C 1 149 ? -4.214  13.767  17.301 1.00 44.26 ? 201  LYS B CG    1 
ATOM   5359  C CD    . LYS C 1 149 ? -4.673  13.388  18.703 1.00 42.11 ? 201  LYS B CD    1 
ATOM   5360  C CE    . LYS C 1 149 ? -4.439  14.564  19.643 1.00 42.00 ? 201  LYS B CE    1 
ATOM   5361  N NZ    . LYS C 1 149 ? -4.956  14.367  21.024 1.00 41.37 ? 201  LYS B NZ    1 
ATOM   5362  N N     . ARG C 1 150 ? -4.952  12.420  13.446 1.00 50.47 ? 202  ARG B N     1 
ATOM   5363  C CA    . ARG C 1 150 ? -5.492  12.321  12.097 1.00 52.05 ? 202  ARG B CA    1 
ATOM   5364  C C     . ARG C 1 150 ? -5.288  10.916  11.563 1.00 53.56 ? 202  ARG B C     1 
ATOM   5365  O O     . ARG C 1 150 ? -6.166  10.358  10.908 1.00 54.02 ? 202  ARG B O     1 
ATOM   5366  C CB    . ARG C 1 150 ? -4.810  13.325  11.159 1.00 51.76 ? 202  ARG B CB    1 
ATOM   5367  C CG    . ARG C 1 150 ? -4.643  14.735  11.721 1.00 53.49 ? 202  ARG B CG    1 
ATOM   5368  C CD    . ARG C 1 150 ? -4.565  15.775  10.592 1.00 54.91 ? 202  ARG B CD    1 
ATOM   5369  N NE    . ARG C 1 150 ? -4.019  15.216  9.350  1.00 56.71 ? 202  ARG B NE    1 
ATOM   5370  C CZ    . ARG C 1 150 ? -3.749  15.919  8.248  1.00 56.69 ? 202  ARG B CZ    1 
ATOM   5371  N NH1   . ARG C 1 150 ? -3.968  17.233  8.208  1.00 55.21 ? 202  ARG B NH1   1 
ATOM   5372  N NH2   . ARG C 1 150 ? -3.255  15.301  7.180  1.00 55.94 ? 202  ARG B NH2   1 
ATOM   5373  N N     . ALA C 1 151 ? -4.128  10.340  11.845 1.00 54.63 ? 203  ALA B N     1 
ATOM   5374  C CA    . ALA C 1 151 ? -3.846  8.996   11.371 1.00 56.49 ? 203  ALA B CA    1 
ATOM   5375  C C     . ALA C 1 151 ? -4.916  8.045   11.888 1.00 56.66 ? 203  ALA B C     1 
ATOM   5376  O O     . ALA C 1 151 ? -5.811  7.645   11.147 1.00 56.72 ? 203  ALA B O     1 
ATOM   5377  C CB    . ALA C 1 151 ? -2.472  8.552   11.842 1.00 57.30 ? 203  ALA B CB    1 
ATOM   5378  N N     . LEU C 1 152 ? -4.818  7.702   13.168 1.00 57.40 ? 204  LEU B N     1 
ATOM   5379  C CA    . LEU C 1 152 ? -5.764  6.797   13.821 1.00 57.90 ? 204  LEU B CA    1 
ATOM   5380  C C     . LEU C 1 152 ? -7.221  7.090   13.441 1.00 58.22 ? 204  LEU B C     1 
ATOM   5381  O O     . LEU C 1 152 ? -7.948  6.190   13.014 1.00 57.87 ? 204  LEU B O     1 
ATOM   5382  C CB    . LEU C 1 152 ? -5.606  6.893   15.344 1.00 56.93 ? 204  LEU B CB    1 
ATOM   5383  C CG    . LEU C 1 152 ? -4.208  6.671   15.939 1.00 56.54 ? 204  LEU B CG    1 
ATOM   5384  C CD1   . LEU C 1 152 ? -4.178  7.272   17.334 1.00 54.46 ? 204  LEU B CD1   1 
ATOM   5385  C CD2   . LEU C 1 152 ? -3.841  5.178   15.954 1.00 54.65 ? 204  LEU B CD2   1 
ATOM   5386  N N     . THR C 1 153 ? -7.637  8.346   13.596 1.00 58.64 ? 205  THR B N     1 
ATOM   5387  C CA    . THR C 1 153 ? -9.001  8.757   13.276 1.00 59.35 ? 205  THR B CA    1 
ATOM   5388  C C     . THR C 1 153 ? -9.434  8.468   11.824 1.00 61.07 ? 205  THR B C     1 
ATOM   5389  O O     . THR C 1 153 ? -10.464 7.830   11.589 1.00 61.92 ? 205  THR B O     1 
ATOM   5390  C CB    . THR C 1 153 ? -9.215  10.268  13.595 1.00 58.16 ? 205  THR B CB    1 
ATOM   5391  O OG1   . THR C 1 153 ? -7.982  10.979  13.451 1.00 57.45 ? 205  THR B OG1   1 
ATOM   5392  C CG2   . THR C 1 153 ? -9.700  10.447  15.012 1.00 58.32 ? 205  THR B CG2   1 
ATOM   5393  N N     . GLU C 1 154 ? -8.651  8.925   10.853 1.00 62.06 ? 206  GLU B N     1 
ATOM   5394  C CA    . GLU C 1 154 ? -8.975  8.714   9.444  1.00 62.54 ? 206  GLU B CA    1 
ATOM   5395  C C     . GLU C 1 154 ? -9.092  7.253   9.018  1.00 62.10 ? 206  GLU B C     1 
ATOM   5396  O O     . GLU C 1 154 ? -9.313  6.976   7.841  1.00 63.21 ? 206  GLU B O     1 
ATOM   5397  C CB    . GLU C 1 154 ? -7.941  9.402   8.548  1.00 64.69 ? 206  GLU B CB    1 
ATOM   5398  C CG    . GLU C 1 154 ? -8.110  10.904  8.419  1.00 66.28 ? 206  GLU B CG    1 
ATOM   5399  C CD    . GLU C 1 154 ? -7.103  11.508  7.460  1.00 66.84 ? 206  GLU B CD    1 
ATOM   5400  O OE1   . GLU C 1 154 ? -6.690  10.796  6.519  1.00 66.51 ? 206  GLU B OE1   1 
ATOM   5401  O OE2   . GLU C 1 154 ? -6.738  12.691  7.640  1.00 67.76 ? 206  GLU B OE2   1 
ATOM   5402  N N     . SER C 1 155 ? -8.926  6.321   9.952  1.00 60.95 ? 207  SER B N     1 
ATOM   5403  C CA    . SER C 1 155 ? -9.048  4.895   9.633  1.00 59.93 ? 207  SER B CA    1 
ATOM   5404  C C     . SER C 1 155 ? -9.987  4.260   10.654 1.00 59.25 ? 207  SER B C     1 
ATOM   5405  O O     . SER C 1 155 ? -10.017 3.040   10.822 1.00 58.00 ? 207  SER B O     1 
ATOM   5406  C CB    . SER C 1 155 ? -7.679  4.200   9.680  1.00 59.81 ? 207  SER B CB    1 
ATOM   5407  O OG    . SER C 1 155 ? -6.791  4.716   8.699  1.00 59.55 ? 207  SER B OG    1 
ATOM   5408  N N     . GLY C 1 156 ? -10.742 5.115   11.340 1.00 59.03 ? 208  GLY B N     1 
ATOM   5409  C CA    . GLY C 1 156 ? -11.684 4.657   12.343 1.00 59.59 ? 208  GLY B CA    1 
ATOM   5410  C C     . GLY C 1 156 ? -11.036 4.049   13.570 1.00 60.15 ? 208  GLY B C     1 
ATOM   5411  O O     . GLY C 1 156 ? -11.335 2.905   13.925 1.00 60.46 ? 208  GLY B O     1 
ATOM   5412  N N     . LEU C 1 157 ? -10.161 4.807   14.230 1.00 60.27 ? 209  LEU B N     1 
ATOM   5413  C CA    . LEU C 1 157 ? -9.478  4.314   15.424 1.00 60.02 ? 209  LEU B CA    1 
ATOM   5414  C C     . LEU C 1 157 ? -9.551  5.279   16.610 1.00 60.01 ? 209  LEU B C     1 
ATOM   5415  O O     . LEU C 1 157 ? -9.645  6.496   16.427 1.00 59.97 ? 209  LEU B O     1 
ATOM   5416  C CB    . LEU C 1 157 ? -8.021  4.008   15.101 1.00 60.20 ? 209  LEU B CB    1 
ATOM   5417  C CG    . LEU C 1 157 ? -7.776  2.956   14.026 1.00 61.24 ? 209  LEU B CG    1 
ATOM   5418  C CD1   . LEU C 1 157 ? -6.290  2.647   13.979 1.00 63.36 ? 209  LEU B CD1   1 
ATOM   5419  C CD2   . LEU C 1 157 ? -8.557  1.692   14.336 1.00 62.29 ? 209  LEU B CD2   1 
ATOM   5420  N N     . PRO C 1 158 ? -9.501  4.735   17.846 1.00 59.65 ? 210  PRO B N     1 
ATOM   5421  C CA    . PRO C 1 158 ? -9.561  5.461   19.122 1.00 59.29 ? 210  PRO B CA    1 
ATOM   5422  C C     . PRO C 1 158 ? -8.408  6.408   19.414 1.00 59.02 ? 210  PRO B C     1 
ATOM   5423  O O     . PRO C 1 158 ? -7.246  6.026   19.325 1.00 59.14 ? 210  PRO B O     1 
ATOM   5424  C CB    . PRO C 1 158 ? -9.627  4.338   20.160 1.00 59.27 ? 210  PRO B CB    1 
ATOM   5425  C CG    . PRO C 1 158 ? -10.231 3.195   19.411 1.00 58.79 ? 210  PRO B CG    1 
ATOM   5426  C CD    . PRO C 1 158 ? -9.525  3.280   18.088 1.00 59.38 ? 210  PRO B CD    1 
ATOM   5427  N N     . VAL C 1 159 ? -8.740  7.638   19.783 1.00 59.36 ? 211  VAL B N     1 
ATOM   5428  C CA    . VAL C 1 159 ? -7.730  8.630   20.120 1.00 60.93 ? 211  VAL B CA    1 
ATOM   5429  C C     . VAL C 1 159 ? -7.598  8.695   21.641 1.00 63.27 ? 211  VAL B C     1 
ATOM   5430  O O     . VAL C 1 159 ? -7.955  9.698   22.279 1.00 63.79 ? 211  VAL B O     1 
ATOM   5431  C CB    . VAL C 1 159 ? -8.109  10.009  19.561 1.00 60.58 ? 211  VAL B CB    1 
ATOM   5432  C CG1   . VAL C 1 159 ? -7.112  11.065  20.017 1.00 58.99 ? 211  VAL B CG1   1 
ATOM   5433  C CG2   . VAL C 1 159 ? -8.145  9.938   18.041 1.00 60.73 ? 211  VAL B CG2   1 
ATOM   5434  N N     . ARG C 1 160 ? -7.089  7.596   22.205 1.00 64.30 ? 212  ARG B N     1 
ATOM   5435  C CA    . ARG C 1 160 ? -6.875  7.429   23.645 1.00 64.56 ? 212  ARG B CA    1 
ATOM   5436  C C     . ARG C 1 160 ? -5.743  8.331   24.152 1.00 63.70 ? 212  ARG B C     1 
ATOM   5437  O O     . ARG C 1 160 ? -4.602  8.186   23.728 1.00 63.56 ? 212  ARG B O     1 
ATOM   5438  C CB    . ARG C 1 160 ? -6.525  5.965   23.932 1.00 66.44 ? 212  ARG B CB    1 
ATOM   5439  C CG    . ARG C 1 160 ? -7.513  4.950   23.359 1.00 69.01 ? 212  ARG B CG    1 
ATOM   5440  C CD    . ARG C 1 160 ? -6.841  3.592   23.144 1.00 71.62 ? 212  ARG B CD    1 
ATOM   5441  N NE    . ARG C 1 160 ? -7.608  2.465   23.678 1.00 73.39 ? 212  ARG B NE    1 
ATOM   5442  C CZ    . ARG C 1 160 ? -7.829  2.250   24.976 1.00 75.07 ? 212  ARG B CZ    1 
ATOM   5443  N NH1   . ARG C 1 160 ? -7.345  3.089   25.889 1.00 75.22 ? 212  ARG B NH1   1 
ATOM   5444  N NH2   . ARG C 1 160 ? -8.524  1.185   25.366 1.00 75.20 ? 212  ARG B NH2   1 
ATOM   5445  N N     . ASP C 1 161 ? -6.056  9.245   25.066 1.00 63.22 ? 213  ASP B N     1 
ATOM   5446  C CA    . ASP C 1 161 ? -5.061  10.167  25.615 1.00 63.52 ? 213  ASP B CA    1 
ATOM   5447  C C     . ASP C 1 161 ? -3.937  9.470   26.405 1.00 63.59 ? 213  ASP B C     1 
ATOM   5448  O O     . ASP C 1 161 ? -2.772  9.881   26.338 1.00 63.28 ? 213  ASP B O     1 
ATOM   5449  C CB    . ASP C 1 161 ? -5.749  11.195  26.513 1.00 65.14 ? 213  ASP B CB    1 
ATOM   5450  C CG    . ASP C 1 161 ? -4.883  12.413  26.775 1.00 68.09 ? 213  ASP B CG    1 
ATOM   5451  O OD1   . ASP C 1 161 ? -3.696  12.242  27.138 1.00 69.45 ? 213  ASP B OD1   1 
ATOM   5452  O OD2   . ASP C 1 161 ? -5.392  13.548  26.624 1.00 69.90 ? 213  ASP B OD2   1 
ATOM   5453  N N     . SER C 1 162 ? -4.285  8.428   27.160 1.00 62.77 ? 214  SER B N     1 
ATOM   5454  C CA    . SER C 1 162 ? -3.300  7.685   27.950 1.00 62.01 ? 214  SER B CA    1 
ATOM   5455  C C     . SER C 1 162 ? -2.243  7.119   27.018 1.00 61.72 ? 214  SER B C     1 
ATOM   5456  O O     . SER C 1 162 ? -1.121  6.817   27.431 1.00 61.48 ? 214  SER B O     1 
ATOM   5457  C CB    . SER C 1 162 ? -3.953  6.509   28.661 1.00 62.02 ? 214  SER B CB    1 
ATOM   5458  O OG    . SER C 1 162 ? -4.041  5.399   27.781 1.00 62.99 ? 214  SER B OG    1 
ATOM   5459  N N     . TYR C 1 163 ? -2.636  6.956   25.761 1.00 61.21 ? 215  TYR B N     1 
ATOM   5460  C CA    . TYR C 1 163 ? -1.769  6.413   24.736 1.00 60.24 ? 215  TYR B CA    1 
ATOM   5461  C C     . TYR C 1 163 ? -0.682  7.371   24.242 1.00 60.38 ? 215  TYR B C     1 
ATOM   5462  O O     . TYR C 1 163 ? 0.119   6.999   23.387 1.00 62.71 ? 215  TYR B O     1 
ATOM   5463  C CB    . TYR C 1 163 ? -2.615  5.924   23.561 1.00 59.49 ? 215  TYR B CB    1 
ATOM   5464  C CG    . TYR C 1 163 ? -2.884  4.436   23.559 1.00 59.20 ? 215  TYR B CG    1 
ATOM   5465  C CD1   . TYR C 1 163 ? -3.392  3.789   24.680 1.00 60.18 ? 215  TYR B CD1   1 
ATOM   5466  C CD2   . TYR C 1 163 ? -2.640  3.675   22.420 1.00 59.65 ? 215  TYR B CD2   1 
ATOM   5467  C CE1   . TYR C 1 163 ? -3.649  2.409   24.659 1.00 60.61 ? 215  TYR B CE1   1 
ATOM   5468  C CE2   . TYR C 1 163 ? -2.893  2.307   22.387 1.00 59.28 ? 215  TYR B CE2   1 
ATOM   5469  C CZ    . TYR C 1 163 ? -3.394  1.675   23.503 1.00 59.57 ? 215  TYR B CZ    1 
ATOM   5470  O OH    . TYR C 1 163 ? -3.624  0.312   23.454 1.00 58.48 ? 215  TYR B OH    1 
ATOM   5471  N N     . ILE C 1 164 ? -0.644  8.601   24.746 1.00 57.96 ? 216  ILE B N     1 
ATOM   5472  C CA    . ILE C 1 164 ? 0.421   9.498   24.325 1.00 56.94 ? 216  ILE B CA    1 
ATOM   5473  C C     . ILE C 1 164 ? 1.200   9.992   25.537 1.00 57.28 ? 216  ILE B C     1 
ATOM   5474  O O     . ILE C 1 164 ? 0.884   11.030  26.132 1.00 57.29 ? 216  ILE B O     1 
ATOM   5475  C CB    . ILE C 1 164 ? -0.101  10.700  23.496 1.00 56.39 ? 216  ILE B CB    1 
ATOM   5476  C CG1   . ILE C 1 164 ? -0.957  11.641  24.354 1.00 56.53 ? 216  ILE B CG1   1 
ATOM   5477  C CG2   . ILE C 1 164 ? -0.878  10.178  22.307 1.00 57.47 ? 216  ILE B CG2   1 
ATOM   5478  C CD1   . ILE C 1 164 ? -1.187  13.020  23.731 1.00 49.44 ? 216  ILE B CD1   1 
ATOM   5479  N N     . VAL C 1 165 ? 2.222   9.223   25.906 1.00 56.49 ? 217  VAL B N     1 
ATOM   5480  C CA    . VAL C 1 165 ? 3.067   9.553   27.047 1.00 56.06 ? 217  VAL B CA    1 
ATOM   5481  C C     . VAL C 1 165 ? 4.139   10.532  26.590 1.00 55.41 ? 217  VAL B C     1 
ATOM   5482  O O     . VAL C 1 165 ? 4.564   10.482  25.438 1.00 55.56 ? 217  VAL B O     1 
ATOM   5483  C CB    . VAL C 1 165 ? 3.713   8.283   27.620 1.00 56.24 ? 217  VAL B CB    1 
ATOM   5484  C CG1   . VAL C 1 165 ? 2.630   7.317   28.081 1.00 56.38 ? 217  VAL B CG1   1 
ATOM   5485  C CG2   . VAL C 1 165 ? 4.569   7.620   26.573 1.00 57.30 ? 217  VAL B CG2   1 
ATOM   5486  N N     . GLU C 1 166 ? 4.568   11.425  27.480 1.00 54.69 ? 218  GLU B N     1 
ATOM   5487  C CA    . GLU C 1 166 ? 5.578   12.429  27.128 1.00 54.10 ? 218  GLU B CA    1 
ATOM   5488  C C     . GLU C 1 166 ? 6.985   12.208  27.700 1.00 52.91 ? 218  GLU B C     1 
ATOM   5489  O O     . GLU C 1 166 ? 7.186   12.195  28.915 1.00 53.07 ? 218  GLU B O     1 
ATOM   5490  C CB    . GLU C 1 166 ? 5.080   13.827  27.525 1.00 54.77 ? 218  GLU B CB    1 
ATOM   5491  C CG    . GLU C 1 166 ? 6.180   14.848  27.807 1.00 58.26 ? 218  GLU B CG    1 
ATOM   5492  C CD    . GLU C 1 166 ? 5.635   16.236  28.103 1.00 61.33 ? 218  GLU B CD    1 
ATOM   5493  O OE1   . GLU C 1 166 ? 6.401   17.100  28.587 1.00 63.43 ? 218  GLU B OE1   1 
ATOM   5494  O OE2   . GLU C 1 166 ? 4.438   16.473  27.843 1.00 63.37 ? 218  GLU B OE2   1 
ATOM   5495  N N     . GLY C 1 167 ? 7.955   12.035  26.806 1.00 50.60 ? 219  GLY B N     1 
ATOM   5496  C CA    . GLY C 1 167 ? 9.331   11.861  27.222 1.00 48.80 ? 219  GLY B CA    1 
ATOM   5497  C C     . GLY C 1 167 ? 10.001  13.225  27.145 1.00 48.03 ? 219  GLY B C     1 
ATOM   5498  O O     . GLY C 1 167 ? 9.335   14.221  26.846 1.00 46.95 ? 219  GLY B O     1 
ATOM   5499  N N     . ASP C 1 168 ? 11.306  13.285  27.404 1.00 46.49 ? 220  ASP B N     1 
ATOM   5500  C CA    . ASP C 1 168 ? 12.014  14.557  27.352 1.00 45.71 ? 220  ASP B CA    1 
ATOM   5501  C C     . ASP C 1 168 ? 13.193  14.524  26.386 1.00 45.11 ? 220  ASP B C     1 
ATOM   5502  O O     . ASP C 1 168 ? 14.236  15.117  26.658 1.00 44.71 ? 220  ASP B O     1 
ATOM   5503  C CB    . ASP C 1 168 ? 12.506  14.948  28.745 1.00 46.64 ? 220  ASP B CB    1 
ATOM   5504  C CG    . ASP C 1 168 ? 13.590  14.019  29.261 1.00 47.85 ? 220  ASP B CG    1 
ATOM   5505  O OD1   . ASP C 1 168 ? 13.708  12.910  28.706 1.00 48.47 ? 220  ASP B OD1   1 
ATOM   5506  O OD2   . ASP C 1 168 ? 14.314  14.387  30.220 1.00 48.47 ? 220  ASP B OD2   1 
ATOM   5507  N N     . TYR C 1 169 ? 13.025  13.828  25.262 1.00 42.95 ? 221  TYR B N     1 
ATOM   5508  C CA    . TYR C 1 169 ? 14.073  13.740  24.247 1.00 41.35 ? 221  TYR B CA    1 
ATOM   5509  C C     . TYR C 1 169 ? 15.284  12.920  24.688 1.00 39.63 ? 221  TYR B C     1 
ATOM   5510  O O     . TYR C 1 169 ? 16.287  12.831  23.974 1.00 38.22 ? 221  TYR B O     1 
ATOM   5511  C CB    . TYR C 1 169 ? 14.543  15.141  23.859 1.00 40.07 ? 221  TYR B CB    1 
ATOM   5512  C CG    . TYR C 1 169 ? 13.464  16.005  23.270 1.00 40.81 ? 221  TYR B CG    1 
ATOM   5513  C CD1   . TYR C 1 169 ? 12.750  15.590  22.145 1.00 40.60 ? 221  TYR B CD1   1 
ATOM   5514  C CD2   . TYR C 1 169 ? 13.166  17.252  23.824 1.00 40.73 ? 221  TYR B CD2   1 
ATOM   5515  C CE1   . TYR C 1 169 ? 11.769  16.396  21.585 1.00 41.82 ? 221  TYR B CE1   1 
ATOM   5516  C CE2   . TYR C 1 169 ? 12.188  18.065  23.273 1.00 41.37 ? 221  TYR B CE2   1 
ATOM   5517  C CZ    . TYR C 1 169 ? 11.493  17.634  22.153 1.00 42.42 ? 221  TYR B CZ    1 
ATOM   5518  O OH    . TYR C 1 169 ? 10.534  18.446  21.597 1.00 43.51 ? 221  TYR B OH    1 
ATOM   5519  N N     . THR C 1 170 ? 15.175  12.319  25.863 1.00 37.90 ? 222  THR B N     1 
ATOM   5520  C CA    . THR C 1 170 ? 16.249  11.523  26.428 1.00 36.33 ? 222  THR B CA    1 
ATOM   5521  C C     . THR C 1 170 ? 15.980  10.036  26.265 1.00 35.38 ? 222  THR B C     1 
ATOM   5522  O O     . THR C 1 170 ? 14.834  9.595   26.289 1.00 34.49 ? 222  THR B O     1 
ATOM   5523  C CB    . THR C 1 170 ? 16.444  11.891  27.929 1.00 36.37 ? 222  THR B CB    1 
ATOM   5524  O OG1   . THR C 1 170 ? 17.586  12.752  28.060 1.00 33.49 ? 222  THR B OG1   1 
ATOM   5525  C CG2   . THR C 1 170 ? 16.592  10.638  28.803 1.00 35.16 ? 222  THR B CG2   1 
ATOM   5526  N N     . TYR C 1 171 ? 17.048  9.267   26.093 1.00 36.44 ? 223  TYR B N     1 
ATOM   5527  C CA    . TYR C 1 171 ? 16.936  7.825   25.920 1.00 37.02 ? 223  TYR B CA    1 
ATOM   5528  C C     . TYR C 1 171 ? 16.312  7.170   27.151 1.00 37.59 ? 223  TYR B C     1 
ATOM   5529  O O     . TYR C 1 171 ? 15.569  6.194   27.037 1.00 35.54 ? 223  TYR B O     1 
ATOM   5530  C CB    . TYR C 1 171 ? 18.317  7.251   25.608 1.00 36.71 ? 223  TYR B CB    1 
ATOM   5531  C CG    . TYR C 1 171 ? 18.449  5.767   25.812 1.00 37.05 ? 223  TYR B CG    1 
ATOM   5532  C CD1   . TYR C 1 171 ? 18.900  5.257   27.029 1.00 36.65 ? 223  TYR B CD1   1 
ATOM   5533  C CD2   . TYR C 1 171 ? 18.132  4.870   24.794 1.00 37.22 ? 223  TYR B CD2   1 
ATOM   5534  C CE1   . TYR C 1 171 ? 19.037  3.900   27.232 1.00 36.61 ? 223  TYR B CE1   1 
ATOM   5535  C CE2   . TYR C 1 171 ? 18.262  3.498   24.988 1.00 38.45 ? 223  TYR B CE2   1 
ATOM   5536  C CZ    . TYR C 1 171 ? 18.719  3.027   26.213 1.00 38.62 ? 223  TYR B CZ    1 
ATOM   5537  O OH    . TYR C 1 171 ? 18.875  1.682   26.417 1.00 41.50 ? 223  TYR B OH    1 
ATOM   5538  N N     . ASP C 1 172 ? 16.601  7.727   28.324 1.00 39.81 ? 224  ASP B N     1 
ATOM   5539  C CA    . ASP C 1 172 ? 16.040  7.219   29.571 1.00 41.64 ? 224  ASP B CA    1 
ATOM   5540  C C     . ASP C 1 172 ? 14.536  7.481   29.578 1.00 41.17 ? 224  ASP B C     1 
ATOM   5541  O O     . ASP C 1 172 ? 13.743  6.603   29.929 1.00 41.30 ? 224  ASP B O     1 
ATOM   5542  C CB    . ASP C 1 172 ? 16.695  7.902   30.774 1.00 45.95 ? 224  ASP B CB    1 
ATOM   5543  C CG    . ASP C 1 172 ? 18.217  7.778   30.758 1.00 51.16 ? 224  ASP B CG    1 
ATOM   5544  O OD1   . ASP C 1 172 ? 18.837  7.781   31.850 1.00 52.90 ? 224  ASP B OD1   1 
ATOM   5545  O OD2   . ASP C 1 172 ? 18.794  7.688   29.646 1.00 54.61 ? 224  ASP B OD2   1 
ATOM   5546  N N     . SER C 1 173 ? 14.139  8.686   29.180 1.00 39.96 ? 225  SER B N     1 
ATOM   5547  C CA    . SER C 1 173 ? 12.720  9.006   29.130 1.00 40.19 ? 225  SER B CA    1 
ATOM   5548  C C     . SER C 1 173 ? 12.037  8.054   28.147 1.00 40.73 ? 225  SER B C     1 
ATOM   5549  O O     . SER C 1 173 ? 10.814  7.931   28.119 1.00 41.54 ? 225  SER B O     1 
ATOM   5550  C CB    . SER C 1 173 ? 12.505  10.454  28.683 1.00 38.69 ? 225  SER B CB    1 
ATOM   5551  O OG    . SER C 1 173 ? 12.337  10.554  27.281 1.00 37.90 ? 225  SER B OG    1 
ATOM   5552  N N     . GLY C 1 174 ? 12.836  7.380   27.335 1.00 41.24 ? 226  GLY B N     1 
ATOM   5553  C CA    . GLY C 1 174 ? 12.275  6.446   26.384 1.00 42.15 ? 226  GLY B CA    1 
ATOM   5554  C C     . GLY C 1 174 ? 11.890  5.168   27.088 1.00 42.19 ? 226  GLY B C     1 
ATOM   5555  O O     . GLY C 1 174 ? 10.801  4.642   26.876 1.00 41.41 ? 226  GLY B O     1 
ATOM   5556  N N     . ILE C 1 175 ? 12.791  4.663   27.925 1.00 43.20 ? 227  ILE B N     1 
ATOM   5557  C CA    . ILE C 1 175 ? 12.527  3.442   28.679 1.00 44.47 ? 227  ILE B CA    1 
ATOM   5558  C C     . ILE C 1 175 ? 11.275  3.629   29.546 1.00 45.90 ? 227  ILE B C     1 
ATOM   5559  O O     . ILE C 1 175 ? 10.426  2.740   29.625 1.00 45.57 ? 227  ILE B O     1 
ATOM   5560  C CB    . ILE C 1 175 ? 13.712  3.086   29.603 1.00 43.98 ? 227  ILE B CB    1 
ATOM   5561  C CG1   . ILE C 1 175 ? 14.967  2.816   28.777 1.00 42.52 ? 227  ILE B CG1   1 
ATOM   5562  C CG2   . ILE C 1 175 ? 13.362  1.878   30.454 1.00 42.91 ? 227  ILE B CG2   1 
ATOM   5563  C CD1   . ILE C 1 175 ? 16.198  2.597   29.620 1.00 42.91 ? 227  ILE B CD1   1 
ATOM   5564  N N     . GLU C 1 176 ? 11.166  4.788   30.190 1.00 47.50 ? 228  GLU B N     1 
ATOM   5565  C CA    . GLU C 1 176 ? 10.021  5.081   31.049 1.00 50.35 ? 228  GLU B CA    1 
ATOM   5566  C C     . GLU C 1 176 ? 8.698   5.189   30.289 1.00 51.06 ? 228  GLU B C     1 
ATOM   5567  O O     . GLU C 1 176 ? 7.627   4.857   30.815 1.00 51.08 ? 228  GLU B O     1 
ATOM   5568  C CB    . GLU C 1 176 ? 10.269  6.371   31.815 1.00 52.05 ? 228  GLU B CB    1 
ATOM   5569  C CG    . GLU C 1 176 ? 11.286  6.247   32.910 1.00 55.14 ? 228  GLU B CG    1 
ATOM   5570  C CD    . GLU C 1 176 ? 11.598  7.588   33.525 1.00 59.57 ? 228  GLU B CD    1 
ATOM   5571  O OE1   . GLU C 1 176 ? 12.234  8.430   32.842 1.00 60.17 ? 228  GLU B OE1   1 
ATOM   5572  O OE2   . GLU C 1 176 ? 11.191  7.808   34.688 1.00 62.77 ? 228  GLU B OE2   1 
ATOM   5573  N N     . ALA C 1 177 ? 8.775   5.663   29.054 1.00 51.30 ? 229  ALA B N     1 
ATOM   5574  C CA    . ALA C 1 177 ? 7.593   5.796   28.228 1.00 51.48 ? 229  ALA B CA    1 
ATOM   5575  C C     . ALA C 1 177 ? 6.987   4.425   27.932 1.00 52.14 ? 229  ALA B C     1 
ATOM   5576  O O     . ALA C 1 177 ? 5.766   4.282   27.887 1.00 52.03 ? 229  ALA B O     1 
ATOM   5577  C CB    . ALA C 1 177 ? 7.944   6.499   26.941 1.00 50.71 ? 229  ALA B CB    1 
ATOM   5578  N N     . VAL C 1 178 ? 7.830   3.415   27.730 1.00 53.44 ? 230  VAL B N     1 
ATOM   5579  C CA    . VAL C 1 178 ? 7.322   2.077   27.438 1.00 55.27 ? 230  VAL B CA    1 
ATOM   5580  C C     . VAL C 1 178 ? 6.972   1.254   28.657 1.00 55.31 ? 230  VAL B C     1 
ATOM   5581  O O     . VAL C 1 178 ? 6.035   0.465   28.599 1.00 55.62 ? 230  VAL B O     1 
ATOM   5582  C CB    . VAL C 1 178 ? 8.290   1.244   26.577 1.00 56.31 ? 230  VAL B CB    1 
ATOM   5583  C CG1   . VAL C 1 178 ? 8.138   1.637   25.132 1.00 56.24 ? 230  VAL B CG1   1 
ATOM   5584  C CG2   . VAL C 1 178 ? 9.723   1.435   27.053 1.00 56.98 ? 230  VAL B CG2   1 
ATOM   5585  N N     . GLU C 1 179 ? 7.720   1.406   29.750 1.00 55.71 ? 231  GLU B N     1 
ATOM   5586  C CA    . GLU C 1 179 ? 7.396   0.653   30.964 1.00 56.34 ? 231  GLU B CA    1 
ATOM   5587  C C     . GLU C 1 179 ? 5.965   1.087   31.306 1.00 55.81 ? 231  GLU B C     1 
ATOM   5588  O O     . GLU C 1 179 ? 5.114   0.270   31.665 1.00 54.90 ? 231  GLU B O     1 
ATOM   5589  C CB    . GLU C 1 179 ? 8.348   1.009   32.119 1.00 56.28 ? 231  GLU B CB    1 
ATOM   5590  C CG    . GLU C 1 179 ? 9.843   0.728   31.873 1.00 56.16 ? 231  GLU B CG    1 
ATOM   5591  C CD    . GLU C 1 179 ? 10.286  -0.687  32.256 1.00 56.49 ? 231  GLU B CD    1 
ATOM   5592  O OE1   . GLU C 1 179 ? 9.861   -1.180  33.329 1.00 56.49 ? 231  GLU B OE1   1 
ATOM   5593  O OE2   . GLU C 1 179 ? 11.080  -1.296  31.494 1.00 54.55 ? 231  GLU B OE2   1 
ATOM   5594  N N     . LYS C 1 180 ? 5.719   2.386   31.170 1.00 55.22 ? 232  LYS B N     1 
ATOM   5595  C CA    . LYS C 1 180 ? 4.407   2.967   31.416 1.00 55.61 ? 232  LYS B CA    1 
ATOM   5596  C C     . LYS C 1 180 ? 3.378   2.310   30.486 1.00 56.98 ? 232  LYS B C     1 
ATOM   5597  O O     . LYS C 1 180 ? 2.438   1.648   30.929 1.00 57.69 ? 232  LYS B O     1 
ATOM   5598  C CB    . LYS C 1 180 ? 4.464   4.474   31.145 1.00 54.08 ? 232  LYS B CB    1 
ATOM   5599  C CG    . LYS C 1 180 ? 3.113   5.137   31.034 1.00 52.88 ? 232  LYS B CG    1 
ATOM   5600  C CD    . LYS C 1 180 ? 2.450   5.286   32.389 1.00 52.89 ? 232  LYS B CD    1 
ATOM   5601  C CE    . LYS C 1 180 ? 3.015   6.481   33.148 1.00 52.08 ? 232  LYS B CE    1 
ATOM   5602  N NZ    . LYS C 1 180 ? 2.889   7.731   32.348 1.00 51.56 ? 232  LYS B NZ    1 
ATOM   5603  N N     . LEU C 1 181 ? 3.571   2.493   29.186 1.00 57.91 ? 233  LEU B N     1 
ATOM   5604  C CA    . LEU C 1 181 ? 2.666   1.935   28.196 1.00 59.15 ? 233  LEU B CA    1 
ATOM   5605  C C     . LEU C 1 181 ? 2.477   0.419   28.283 1.00 60.14 ? 233  LEU B C     1 
ATOM   5606  O O     . LEU C 1 181 ? 1.527   -0.118  27.714 1.00 60.70 ? 233  LEU B O     1 
ATOM   5607  C CB    . LEU C 1 181 ? 3.146   2.318   26.797 1.00 58.97 ? 233  LEU B CB    1 
ATOM   5608  C CG    . LEU C 1 181 ? 3.110   3.821   26.527 1.00 60.20 ? 233  LEU B CG    1 
ATOM   5609  C CD1   . LEU C 1 181 ? 3.779   4.111   25.196 1.00 59.81 ? 233  LEU B CD1   1 
ATOM   5610  C CD2   . LEU C 1 181 ? 1.662   4.316   26.541 1.00 59.92 ? 233  LEU B CD2   1 
ATOM   5611  N N     . LEU C 1 182 ? 3.375   -0.275  28.976 1.00 60.64 ? 234  LEU B N     1 
ATOM   5612  C CA    . LEU C 1 182 ? 3.253   -1.724  29.102 1.00 61.55 ? 234  LEU B CA    1 
ATOM   5613  C C     . LEU C 1 182 ? 2.401   -2.087  30.310 1.00 63.74 ? 234  LEU B C     1 
ATOM   5614  O O     . LEU C 1 182 ? 2.201   -3.268  30.626 1.00 63.22 ? 234  LEU B O     1 
ATOM   5615  C CB    . LEU C 1 182 ? 4.630   -2.375  29.222 1.00 60.81 ? 234  LEU B CB    1 
ATOM   5616  C CG    . LEU C 1 182 ? 5.505   -2.328  27.966 1.00 60.64 ? 234  LEU B CG    1 
ATOM   5617  C CD1   . LEU C 1 182 ? 6.776   -3.111  28.223 1.00 60.88 ? 234  LEU B CD1   1 
ATOM   5618  C CD2   . LEU C 1 182 ? 4.766   -2.915  26.774 1.00 60.03 ? 234  LEU B CD2   1 
ATOM   5619  N N     . GLU C 1 183 ? 1.907   -1.055  30.985 1.00 65.21 ? 235  GLU B N     1 
ATOM   5620  C CA    . GLU C 1 183 ? 1.056   -1.234  32.146 1.00 67.01 ? 235  GLU B CA    1 
ATOM   5621  C C     . GLU C 1 183 ? -0.390  -0.979  31.744 1.00 68.12 ? 235  GLU B C     1 
ATOM   5622  O O     . GLU C 1 183 ? -1.322  -1.330  32.467 1.00 69.47 ? 235  GLU B O     1 
ATOM   5623  C CB    . GLU C 1 183 ? 1.487   -0.290  33.260 1.00 67.30 ? 235  GLU B CB    1 
ATOM   5624  C CG    . GLU C 1 183 ? 2.596   -0.859  34.120 1.00 67.99 ? 235  GLU B CG    1 
ATOM   5625  C CD    . GLU C 1 183 ? 3.348   0.217   34.871 1.00 68.98 ? 235  GLU B CD    1 
ATOM   5626  O OE1   . GLU C 1 183 ? 2.708   1.216   35.275 1.00 69.10 ? 235  GLU B OE1   1 
ATOM   5627  O OE2   . GLU C 1 183 ? 4.575   0.056   35.062 1.00 69.27 ? 235  GLU B OE2   1 
ATOM   5628  N N     . GLU C 1 184 ? -0.568  -0.356  30.587 1.00 68.47 ? 236  GLU B N     1 
ATOM   5629  C CA    . GLU C 1 184 ? -1.899  -0.096  30.068 1.00 68.91 ? 236  GLU B CA    1 
ATOM   5630  C C     . GLU C 1 184 ? -2.508  -1.488  29.927 1.00 69.78 ? 236  GLU B C     1 
ATOM   5631  O O     . GLU C 1 184 ? -1.913  -2.362  29.294 1.00 70.33 ? 236  GLU B O     1 
ATOM   5632  C CB    . GLU C 1 184 ? -1.799  0.566   28.691 1.00 68.81 ? 236  GLU B CB    1 
ATOM   5633  C CG    . GLU C 1 184 ? -2.560  1.874   28.534 1.00 69.77 ? 236  GLU B CG    1 
ATOM   5634  C CD    . GLU C 1 184 ? -2.180  2.908   29.578 1.00 69.73 ? 236  GLU B CD    1 
ATOM   5635  O OE1   . GLU C 1 184 ? -1.068  2.804   30.139 1.00 70.81 ? 236  GLU B OE1   1 
ATOM   5636  O OE2   . GLU C 1 184 ? -2.990  3.829   29.828 1.00 69.07 ? 236  GLU B OE2   1 
ATOM   5637  N N     . ASP C 1 185 ? -3.672  -1.705  30.530 1.00 70.51 ? 237  ASP B N     1 
ATOM   5638  C CA    . ASP C 1 185 ? -4.339  -3.006  30.452 1.00 71.46 ? 237  ASP B CA    1 
ATOM   5639  C C     . ASP C 1 185 ? -4.403  -3.413  28.979 1.00 71.28 ? 237  ASP B C     1 
ATOM   5640  O O     . ASP C 1 185 ? -4.210  -4.575  28.615 1.00 70.93 ? 237  ASP B O     1 
ATOM   5641  C CB    . ASP C 1 185 ? -5.749  -2.892  31.034 1.00 72.19 ? 237  ASP B CB    1 
ATOM   5642  C CG    . ASP C 1 185 ? -5.767  -2.163  32.366 1.00 72.84 ? 237  ASP B CG    1 
ATOM   5643  O OD1   . ASP C 1 185 ? -5.340  -2.759  33.378 1.00 73.55 ? 237  ASP B OD1   1 
ATOM   5644  O OD2   . ASP C 1 185 ? -6.194  -0.986  32.395 1.00 72.77 ? 237  ASP B OD2   1 
ATOM   5645  N N     . GLU C 1 186 ? -4.670  -2.418  28.143 1.00 71.70 ? 238  GLU B N     1 
ATOM   5646  C CA    . GLU C 1 186 ? -4.752  -2.588  26.700 1.00 72.01 ? 238  GLU B CA    1 
ATOM   5647  C C     . GLU C 1 186 ? -3.420  -2.097  26.103 1.00 70.83 ? 238  GLU B C     1 
ATOM   5648  O O     . GLU C 1 186 ? -3.295  -0.947  25.667 1.00 70.55 ? 238  GLU B O     1 
ATOM   5649  C CB    . GLU C 1 186 ? -5.937  -1.775  26.148 1.00 72.72 ? 238  GLU B CB    1 
ATOM   5650  C CG    . GLU C 1 186 ? -5.910  -0.276  26.489 1.00 74.23 ? 238  GLU B CG    1 
ATOM   5651  C CD    . GLU C 1 186 ? -6.137  0.033   27.973 1.00 75.93 ? 238  GLU B CD    1 
ATOM   5652  O OE1   . GLU C 1 186 ? -6.004  1.219   28.355 1.00 77.04 ? 238  GLU B OE1   1 
ATOM   5653  O OE2   . GLU C 1 186 ? -6.455  -0.892  28.756 1.00 76.11 ? 238  GLU B OE2   1 
ATOM   5654  N N     . LYS C 1 187 ? -2.423  -2.979  26.111 1.00 68.37 ? 239  LYS B N     1 
ATOM   5655  C CA    . LYS C 1 187 ? -1.096  -2.657  25.593 1.00 65.41 ? 239  LYS B CA    1 
ATOM   5656  C C     . LYS C 1 187 ? -1.150  -2.430  24.093 1.00 62.56 ? 239  LYS B C     1 
ATOM   5657  O O     . LYS C 1 187 ? -1.834  -3.164  23.381 1.00 62.84 ? 239  LYS B O     1 
ATOM   5658  C CB    . LYS C 1 187 ? -0.123  -3.795  25.915 1.00 65.08 ? 239  LYS B CB    1 
ATOM   5659  C CG    . LYS C 1 187 ? -0.188  -4.234  27.371 1.00 64.72 ? 239  LYS B CG    1 
ATOM   5660  C CD    . LYS C 1 187 ? 1.140   -4.791  27.843 1.00 64.95 ? 239  LYS B CD    1 
ATOM   5661  C CE    . LYS C 1 187 ? 1.448   -6.149  27.229 1.00 64.40 ? 239  LYS B CE    1 
ATOM   5662  N NZ    . LYS C 1 187 ? 0.711   -7.246  27.917 1.00 64.46 ? 239  LYS B NZ    1 
ATOM   5663  N N     . PRO C 1 188 ? -0.447  -1.395  23.593 1.00 59.46 ? 240  PRO B N     1 
ATOM   5664  C CA    . PRO C 1 188 ? -0.441  -1.105  22.157 1.00 57.52 ? 240  PRO B CA    1 
ATOM   5665  C C     . PRO C 1 188 ? 0.470   -2.101  21.448 1.00 56.40 ? 240  PRO B C     1 
ATOM   5666  O O     . PRO C 1 188 ? 1.386   -2.648  22.069 1.00 55.36 ? 240  PRO B O     1 
ATOM   5667  C CB    . PRO C 1 188 ? 0.117   0.315   22.091 1.00 56.13 ? 240  PRO B CB    1 
ATOM   5668  C CG    . PRO C 1 188 ? -0.126  0.869   23.458 1.00 56.37 ? 240  PRO B CG    1 
ATOM   5669  C CD    . PRO C 1 188 ? 0.185   -0.297  24.336 1.00 57.49 ? 240  PRO B CD    1 
ATOM   5670  N N     . THR C 1 189 ? 0.217   -2.368  20.170 1.00 55.11 ? 241  THR B N     1 
ATOM   5671  C CA    . THR C 1 189 ? 1.099   -3.284  19.445 1.00 54.73 ? 241  THR B CA    1 
ATOM   5672  C C     . THR C 1 189 ? 2.221   -2.515  18.735 1.00 53.62 ? 241  THR B C     1 
ATOM   5673  O O     . THR C 1 189 ? 3.113   -3.120  18.141 1.00 51.91 ? 241  THR B O     1 
ATOM   5674  C CB    . THR C 1 189 ? 0.349   -4.140  18.401 1.00 54.51 ? 241  THR B CB    1 
ATOM   5675  O OG1   . THR C 1 189 ? -0.636  -3.337  17.747 1.00 56.74 ? 241  THR B OG1   1 
ATOM   5676  C CG2   . THR C 1 189 ? -0.297  -5.347  19.057 1.00 52.47 ? 241  THR B CG2   1 
ATOM   5677  N N     . ALA C 1 190 ? 2.178   -1.183  18.811 1.00 52.47 ? 242  ALA B N     1 
ATOM   5678  C CA    . ALA C 1 190 ? 3.202   -0.355  18.184 1.00 51.30 ? 242  ALA B CA    1 
ATOM   5679  C C     . ALA C 1 190 ? 3.199   1.094   18.660 1.00 50.69 ? 242  ALA B C     1 
ATOM   5680  O O     . ALA C 1 190 ? 2.141   1.709   18.824 1.00 50.22 ? 242  ALA B O     1 
ATOM   5681  C CB    . ALA C 1 190 ? 3.056   -0.401  16.679 1.00 51.68 ? 242  ALA B CB    1 
ATOM   5682  N N     . ILE C 1 191 ? 4.405   1.631   18.860 1.00 49.65 ? 243  ILE B N     1 
ATOM   5683  C CA    . ILE C 1 191 ? 4.604   3.005   19.323 1.00 47.38 ? 243  ILE B CA    1 
ATOM   5684  C C     . ILE C 1 191 ? 5.318   3.868   18.295 1.00 46.60 ? 243  ILE B C     1 
ATOM   5685  O O     . ILE C 1 191 ? 6.252   3.420   17.645 1.00 49.23 ? 243  ILE B O     1 
ATOM   5686  C CB    . ILE C 1 191 ? 5.472   3.048   20.577 1.00 45.88 ? 243  ILE B CB    1 
ATOM   5687  C CG1   . ILE C 1 191 ? 4.823   2.243   21.692 1.00 45.16 ? 243  ILE B CG1   1 
ATOM   5688  C CG2   . ILE C 1 191 ? 5.688   4.486   20.998 1.00 45.45 ? 243  ILE B CG2   1 
ATOM   5689  C CD1   . ILE C 1 191 ? 5.639   2.237   22.948 1.00 45.40 ? 243  ILE B CD1   1 
ATOM   5690  N N     . PHE C 1 192 ? 4.893   5.112   18.164 1.00 44.07 ? 244  PHE B N     1 
ATOM   5691  C CA    . PHE C 1 192 ? 5.526   6.026   17.235 1.00 41.97 ? 244  PHE B CA    1 
ATOM   5692  C C     . PHE C 1 192 ? 6.259   7.026   18.101 1.00 41.85 ? 244  PHE B C     1 
ATOM   5693  O O     . PHE C 1 192 ? 5.627   7.877   18.738 1.00 40.27 ? 244  PHE B O     1 
ATOM   5694  C CB    . PHE C 1 192 ? 4.472   6.740   16.387 1.00 42.27 ? 244  PHE B CB    1 
ATOM   5695  C CG    . PHE C 1 192 ? 4.956   8.024   15.746 1.00 41.21 ? 244  PHE B CG    1 
ATOM   5696  C CD1   . PHE C 1 192 ? 6.070   8.035   14.908 1.00 40.42 ? 244  PHE B CD1   1 
ATOM   5697  C CD2   . PHE C 1 192 ? 4.267   9.214   15.955 1.00 40.40 ? 244  PHE B CD2   1 
ATOM   5698  C CE1   . PHE C 1 192 ? 6.481   9.208   14.285 1.00 40.93 ? 244  PHE B CE1   1 
ATOM   5699  C CE2   . PHE C 1 192 ? 4.670   10.397  15.335 1.00 40.79 ? 244  PHE B CE2   1 
ATOM   5700  C CZ    . PHE C 1 192 ? 5.777   10.393  14.499 1.00 41.82 ? 244  PHE B CZ    1 
ATOM   5701  N N     . VAL C 1 193 ? 7.589   6.927   18.130 1.00 41.96 ? 245  VAL B N     1 
ATOM   5702  C CA    . VAL C 1 193 ? 8.396   7.832   18.952 1.00 41.11 ? 245  VAL B CA    1 
ATOM   5703  C C     . VAL C 1 193 ? 8.804   9.087   18.203 1.00 40.46 ? 245  VAL B C     1 
ATOM   5704  O O     . VAL C 1 193 ? 9.134   9.028   17.027 1.00 42.87 ? 245  VAL B O     1 
ATOM   5705  C CB    . VAL C 1 193 ? 9.654   7.127   19.463 1.00 40.06 ? 245  VAL B CB    1 
ATOM   5706  C CG1   . VAL C 1 193 ? 10.402  8.033   20.422 1.00 39.22 ? 245  VAL B CG1   1 
ATOM   5707  C CG2   . VAL C 1 193 ? 9.266   5.826   20.135 1.00 38.96 ? 245  VAL B CG2   1 
ATOM   5708  N N     . GLY C 1 194 ? 8.790   10.224  18.881 1.00 39.67 ? 246  GLY B N     1 
ATOM   5709  C CA    . GLY C 1 194 ? 9.156   11.465  18.216 1.00 40.81 ? 246  GLY B CA    1 
ATOM   5710  C C     . GLY C 1 194 ? 10.623  11.646  17.840 1.00 41.47 ? 246  GLY B C     1 
ATOM   5711  O O     . GLY C 1 194 ? 10.953  12.451  16.958 1.00 41.21 ? 246  GLY B O     1 
ATOM   5712  N N     . THR C 1 195 ? 11.511  10.911  18.503 1.00 41.29 ? 247  THR B N     1 
ATOM   5713  C CA    . THR C 1 195 ? 12.939  11.024  18.237 1.00 40.64 ? 247  THR B CA    1 
ATOM   5714  C C     . THR C 1 195 ? 13.598  9.664   18.310 1.00 41.05 ? 247  THR B C     1 
ATOM   5715  O O     . THR C 1 195 ? 13.102  8.773   19.001 1.00 43.26 ? 247  THR B O     1 
ATOM   5716  C CB    . THR C 1 195 ? 13.587  11.966  19.248 1.00 39.81 ? 247  THR B CB    1 
ATOM   5717  O OG1   . THR C 1 195 ? 12.993  13.262  19.116 1.00 39.61 ? 247  THR B OG1   1 
ATOM   5718  C CG2   . THR C 1 195 ? 15.076  12.084  18.996 1.00 42.41 ? 247  THR B CG2   1 
ATOM   5719  N N     . ASP C 1 196 ? 14.705  9.489   17.592 1.00 39.93 ? 248  ASP B N     1 
ATOM   5720  C CA    . ASP C 1 196 ? 15.403  8.206   17.600 1.00 39.19 ? 248  ASP B CA    1 
ATOM   5721  C C     . ASP C 1 196 ? 15.993  7.931   18.970 1.00 38.29 ? 248  ASP B C     1 
ATOM   5722  O O     . ASP C 1 196 ? 16.191  6.785   19.362 1.00 38.10 ? 248  ASP B O     1 
ATOM   5723  C CB    . ASP C 1 196 ? 16.516  8.197   16.558 1.00 38.88 ? 248  ASP B CB    1 
ATOM   5724  C CG    . ASP C 1 196 ? 15.989  8.085   15.142 1.00 39.66 ? 248  ASP B CG    1 
ATOM   5725  O OD1   . ASP C 1 196 ? 16.796  8.265   14.202 1.00 38.75 ? 248  ASP B OD1   1 
ATOM   5726  O OD2   . ASP C 1 196 ? 14.779  7.810   14.967 1.00 37.77 ? 248  ASP B OD2   1 
ATOM   5727  N N     . GLU C 1 197 ? 16.268  8.995   19.705 1.00 37.76 ? 249  GLU B N     1 
ATOM   5728  C CA    . GLU C 1 197 ? 16.846  8.843   21.021 1.00 37.69 ? 249  GLU B CA    1 
ATOM   5729  C C     . GLU C 1 197 ? 15.839  8.147   21.921 1.00 36.68 ? 249  GLU B C     1 
ATOM   5730  O O     . GLU C 1 197 ? 16.138  7.106   22.505 1.00 36.18 ? 249  GLU B O     1 
ATOM   5731  C CB    . GLU C 1 197 ? 17.204  10.209  21.594 1.00 39.69 ? 249  GLU B CB    1 
ATOM   5732  C CG    . GLU C 1 197 ? 18.406  10.203  22.521 1.00 41.44 ? 249  GLU B CG    1 
ATOM   5733  C CD    . GLU C 1 197 ? 19.710  10.377  21.764 1.00 43.34 ? 249  GLU B CD    1 
ATOM   5734  O OE1   . GLU C 1 197 ? 19.800  11.329  20.950 1.00 42.66 ? 249  GLU B OE1   1 
ATOM   5735  O OE2   . GLU C 1 197 ? 20.646  9.573   21.989 1.00 43.67 ? 249  GLU B OE2   1 
ATOM   5736  N N     . MET C 1 198 ? 14.640  8.716   22.016 1.00 35.36 ? 250  MET B N     1 
ATOM   5737  C CA    . MET C 1 198 ? 13.598  8.137   22.854 1.00 35.61 ? 250  MET B CA    1 
ATOM   5738  C C     . MET C 1 198 ? 13.087  6.824   22.264 1.00 35.00 ? 250  MET B C     1 
ATOM   5739  O O     . MET C 1 198 ? 12.382  6.058   22.926 1.00 34.80 ? 250  MET B O     1 
ATOM   5740  C CB    . MET C 1 198 ? 12.436  9.121   23.013 1.00 36.26 ? 250  MET B CB    1 
ATOM   5741  C CG    . MET C 1 198 ? 12.859  10.536  23.375 1.00 38.66 ? 250  MET B CG    1 
ATOM   5742  S SD    . MET C 1 198 ? 11.478  11.654  23.788 1.00 39.56 ? 250  MET B SD    1 
ATOM   5743  C CE    . MET C 1 198 ? 10.590  11.725  22.203 1.00 37.13 ? 250  MET B CE    1 
ATOM   5744  N N     . ALA C 1 199 ? 13.453  6.570   21.014 1.00 34.13 ? 251  ALA B N     1 
ATOM   5745  C CA    . ALA C 1 199 ? 13.038  5.358   20.330 1.00 34.29 ? 251  ALA B CA    1 
ATOM   5746  C C     . ALA C 1 199 ? 13.925  4.166   20.723 1.00 33.78 ? 251  ALA B C     1 
ATOM   5747  O O     . ALA C 1 199 ? 13.442  3.051   20.890 1.00 33.27 ? 251  ALA B O     1 
ATOM   5748  C CB    . ALA C 1 199 ? 13.063  5.588   18.814 1.00 35.30 ? 251  ALA B CB    1 
ATOM   5749  N N     . LEU C 1 200 ? 15.224  4.390   20.858 1.00 33.38 ? 252  LEU B N     1 
ATOM   5750  C CA    . LEU C 1 200 ? 16.102  3.308   21.278 1.00 33.73 ? 252  LEU B CA    1 
ATOM   5751  C C     . LEU C 1 200 ? 15.656  2.913   22.691 1.00 34.40 ? 252  LEU B C     1 
ATOM   5752  O O     . LEU C 1 200 ? 15.645  1.734   23.044 1.00 34.36 ? 252  LEU B O     1 
ATOM   5753  C CB    . LEU C 1 200 ? 17.563  3.772   21.305 1.00 33.12 ? 252  LEU B CB    1 
ATOM   5754  C CG    . LEU C 1 200 ? 18.456  3.459   20.100 1.00 31.74 ? 252  LEU B CG    1 
ATOM   5755  C CD1   . LEU C 1 200 ? 17.808  3.914   18.817 1.00 32.77 ? 252  LEU B CD1   1 
ATOM   5756  C CD2   . LEU C 1 200 ? 19.787  4.132   20.274 1.00 33.34 ? 252  LEU B CD2   1 
ATOM   5757  N N     . GLY C 1 201 ? 15.280  3.914   23.486 1.00 34.29 ? 253  GLY B N     1 
ATOM   5758  C CA    . GLY C 1 201 ? 14.827  3.675   24.843 1.00 33.99 ? 253  GLY B CA    1 
ATOM   5759  C C     . GLY C 1 201 ? 13.561  2.844   24.872 1.00 34.52 ? 253  GLY B C     1 
ATOM   5760  O O     . GLY C 1 201 ? 13.425  1.912   25.671 1.00 34.73 ? 253  GLY B O     1 
ATOM   5761  N N     . VAL C 1 202 ? 12.619  3.192   24.007 1.00 34.05 ? 254  VAL B N     1 
ATOM   5762  C CA    . VAL C 1 202 ? 11.370  2.452   23.910 1.00 34.02 ? 254  VAL B CA    1 
ATOM   5763  C C     . VAL C 1 202 ? 11.693  1.004   23.535 1.00 34.62 ? 254  VAL B C     1 
ATOM   5764  O O     . VAL C 1 202 ? 11.239  0.063   24.178 1.00 35.22 ? 254  VAL B O     1 
ATOM   5765  C CB    . VAL C 1 202 ? 10.446  3.100   22.844 1.00 33.52 ? 254  VAL B CB    1 
ATOM   5766  C CG1   . VAL C 1 202 ? 9.416   2.100   22.331 1.00 30.36 ? 254  VAL B CG1   1 
ATOM   5767  C CG2   . VAL C 1 202 ? 9.757   4.324   23.451 1.00 32.62 ? 254  VAL B CG2   1 
ATOM   5768  N N     . ILE C 1 203 ? 12.502  0.838   22.498 1.00 35.79 ? 255  ILE B N     1 
ATOM   5769  C CA    . ILE C 1 203 ? 12.900  -0.478  22.033 1.00 36.67 ? 255  ILE B CA    1 
ATOM   5770  C C     . ILE C 1 203 ? 13.574  -1.313  23.122 1.00 37.47 ? 255  ILE B C     1 
ATOM   5771  O O     . ILE C 1 203 ? 13.209  -2.468  23.332 1.00 36.76 ? 255  ILE B O     1 
ATOM   5772  C CB    . ILE C 1 203 ? 13.812  -0.337  20.813 1.00 37.12 ? 255  ILE B CB    1 
ATOM   5773  C CG1   . ILE C 1 203 ? 12.995  0.276   19.671 1.00 37.89 ? 255  ILE B CG1   1 
ATOM   5774  C CG2   . ILE C 1 203 ? 14.405  -1.687  20.428 1.00 35.35 ? 255  ILE B CG2   1 
ATOM   5775  C CD1   . ILE C 1 203 ? 13.791  0.639   18.462 1.00 41.94 ? 255  ILE B CD1   1 
ATOM   5776  N N     . HIS C 1 204 ? 14.554  -0.741  23.813 1.00 39.45 ? 256  HIS B N     1 
ATOM   5777  C CA    . HIS C 1 204 ? 15.227  -1.463  24.898 1.00 41.60 ? 256  HIS B CA    1 
ATOM   5778  C C     . HIS C 1 204 ? 14.288  -1.548  26.091 1.00 41.86 ? 256  HIS B C     1 
ATOM   5779  O O     . HIS C 1 204 ? 14.370  -2.476  26.901 1.00 41.25 ? 256  HIS B O     1 
ATOM   5780  C CB    . HIS C 1 204 ? 16.510  -0.747  25.314 1.00 42.14 ? 256  HIS B CB    1 
ATOM   5781  C CG    . HIS C 1 204 ? 17.627  -0.898  24.332 1.00 43.74 ? 256  HIS B CG    1 
ATOM   5782  N ND1   . HIS C 1 204 ? 18.811  -0.204  24.444 1.00 43.53 ? 256  HIS B ND1   1 
ATOM   5783  C CD2   . HIS C 1 204 ? 17.751  -1.682  23.236 1.00 43.40 ? 256  HIS B CD2   1 
ATOM   5784  C CE1   . HIS C 1 204 ? 19.617  -0.554  23.460 1.00 45.14 ? 256  HIS B CE1   1 
ATOM   5785  N NE2   . HIS C 1 204 ? 18.998  -1.450  22.713 1.00 45.00 ? 256  HIS B NE2   1 
ATOM   5786  N N     . GLY C 1 205 ? 13.402  -0.559  26.190 1.00 41.97 ? 257  GLY B N     1 
ATOM   5787  C CA    . GLY C 1 205 ? 12.435  -0.535  27.265 1.00 41.75 ? 257  GLY B CA    1 
ATOM   5788  C C     . GLY C 1 205 ? 11.684  -1.839  27.188 1.00 42.29 ? 257  GLY B C     1 
ATOM   5789  O O     . GLY C 1 205 ? 11.679  -2.614  28.140 1.00 41.68 ? 257  GLY B O     1 
ATOM   5790  N N     . ALA C 1 206 ? 11.070  -2.080  26.032 1.00 43.21 ? 258  ALA B N     1 
ATOM   5791  C CA    . ALA C 1 206 ? 10.310  -3.295  25.778 1.00 44.09 ? 258  ALA B CA    1 
ATOM   5792  C C     . ALA C 1 206 ? 11.193  -4.515  25.980 1.00 45.49 ? 258  ALA B C     1 
ATOM   5793  O O     . ALA C 1 206 ? 10.937  -5.347  26.852 1.00 44.91 ? 258  ALA B O     1 
ATOM   5794  C CB    . ALA C 1 206 ? 9.775   -3.280  24.355 1.00 44.93 ? 258  ALA B CB    1 
ATOM   5795  N N     . GLN C 1 207 ? 12.230  -4.618  25.155 1.00 47.54 ? 259  GLN B N     1 
ATOM   5796  C CA    . GLN C 1 207 ? 13.179  -5.731  25.222 1.00 49.76 ? 259  GLN B CA    1 
ATOM   5797  C C     . GLN C 1 207 ? 13.516  -6.178  26.650 1.00 50.29 ? 259  GLN B C     1 
ATOM   5798  O O     . GLN C 1 207 ? 13.463  -7.368  26.959 1.00 50.27 ? 259  GLN B O     1 
ATOM   5799  C CB    . GLN C 1 207 ? 14.470  -5.364  24.473 1.00 49.88 ? 259  GLN B CB    1 
ATOM   5800  C CG    . GLN C 1 207 ? 14.381  -5.490  22.961 1.00 49.79 ? 259  GLN B CG    1 
ATOM   5801  C CD    . GLN C 1 207 ? 15.579  -4.896  22.261 1.00 51.39 ? 259  GLN B CD    1 
ATOM   5802  O OE1   . GLN C 1 207 ? 15.781  -3.688  22.281 1.00 54.68 ? 259  GLN B OE1   1 
ATOM   5803  N NE2   . GLN C 1 207 ? 16.384  -5.741  21.642 1.00 51.99 ? 259  GLN B NE2   1 
ATOM   5804  N N     . ASP C 1 208 ? 13.869  -5.233  27.516 1.00 51.37 ? 260  ASP B N     1 
ATOM   5805  C CA    . ASP C 1 208 ? 14.196  -5.584  28.893 1.00 52.68 ? 260  ASP B CA    1 
ATOM   5806  C C     . ASP C 1 208 ? 13.085  -6.422  29.494 1.00 54.18 ? 260  ASP B C     1 
ATOM   5807  O O     . ASP C 1 208 ? 13.337  -7.473  30.080 1.00 55.07 ? 260  ASP B O     1 
ATOM   5808  C CB    . ASP C 1 208 ? 14.370  -4.341  29.762 1.00 51.47 ? 260  ASP B CB    1 
ATOM   5809  C CG    . ASP C 1 208 ? 15.563  -3.511  29.362 1.00 50.85 ? 260  ASP B CG    1 
ATOM   5810  O OD1   . ASP C 1 208 ? 16.555  -4.106  28.877 1.00 48.81 ? 260  ASP B OD1   1 
ATOM   5811  O OD2   . ASP C 1 208 ? 15.509  -2.268  29.554 1.00 50.73 ? 260  ASP B OD2   1 
ATOM   5812  N N     . ARG C 1 209 ? 11.856  -5.935  29.341 1.00 56.06 ? 261  ARG B N     1 
ATOM   5813  C CA    . ARG C 1 209 ? 10.661  -6.589  29.866 1.00 57.02 ? 261  ARG B CA    1 
ATOM   5814  C C     . ARG C 1 209 ? 10.438  -7.964  29.245 1.00 57.34 ? 261  ARG B C     1 
ATOM   5815  O O     . ARG C 1 209 ? 9.587   -8.721  29.708 1.00 57.69 ? 261  ARG B O     1 
ATOM   5816  C CB    . ARG C 1 209 ? 9.434   -5.706  29.617 1.00 57.44 ? 261  ARG B CB    1 
ATOM   5817  C CG    . ARG C 1 209 ? 9.617   -4.271  30.074 1.00 60.27 ? 261  ARG B CG    1 
ATOM   5818  C CD    . ARG C 1 209 ? 9.040   -4.011  31.455 1.00 64.17 ? 261  ARG B CD    1 
ATOM   5819  N NE    . ARG C 1 209 ? 7.590   -3.842  31.404 1.00 67.41 ? 261  ARG B NE    1 
ATOM   5820  C CZ    . ARG C 1 209 ? 6.874   -3.207  32.328 1.00 69.26 ? 261  ARG B CZ    1 
ATOM   5821  N NH1   . ARG C 1 209 ? 7.469   -2.674  33.394 1.00 69.86 ? 261  ARG B NH1   1 
ATOM   5822  N NH2   . ARG C 1 209 ? 5.560   -3.087  32.175 1.00 70.04 ? 261  ARG B NH2   1 
ATOM   5823  N N     . GLY C 1 210 ? 11.193  -8.278  28.196 1.00 57.30 ? 262  GLY B N     1 
ATOM   5824  C CA    . GLY C 1 210 ? 11.051  -9.570  27.551 1.00 57.29 ? 262  GLY B CA    1 
ATOM   5825  C C     . GLY C 1 210 ? 10.273  -9.562  26.247 1.00 56.85 ? 262  GLY B C     1 
ATOM   5826  O O     . GLY C 1 210 ? 10.123  -10.610 25.614 1.00 57.13 ? 262  GLY B O     1 
ATOM   5827  N N     . LEU C 1 211 ? 9.765   -8.395  25.852 1.00 54.97 ? 263  LEU B N     1 
ATOM   5828  C CA    . LEU C 1 211 ? 9.022   -8.274  24.604 1.00 52.41 ? 263  LEU B CA    1 
ATOM   5829  C C     . LEU C 1 211 ? 9.987   -8.365  23.452 1.00 48.69 ? 263  LEU B C     1 
ATOM   5830  O O     . LEU C 1 211 ? 11.186  -8.133  23.627 1.00 50.97 ? 263  LEU B O     1 
ATOM   5831  C CB    . LEU C 1 211 ? 8.313   -6.938  24.534 1.00 55.31 ? 263  LEU B CB    1 
ATOM   5832  C CG    . LEU C 1 211 ? 7.217   -6.811  25.575 1.00 56.98 ? 263  LEU B CG    1 
ATOM   5833  C CD1   . LEU C 1 211 ? 6.665   -5.404  25.556 1.00 57.90 ? 263  LEU B CD1   1 
ATOM   5834  C CD2   . LEU C 1 211 ? 6.132   -7.826  25.276 1.00 57.23 ? 263  LEU B CD2   1 
ATOM   5835  N N     . ASN C 1 212 ? 9.474   -8.702  22.273 1.00 42.71 ? 264  ASN B N     1 
ATOM   5836  C CA    . ASN C 1 212 ? 10.335  -8.814  21.100 1.00 35.92 ? 264  ASN B CA    1 
ATOM   5837  C C     . ASN C 1 212 ? 9.967   -7.851  19.998 1.00 33.92 ? 264  ASN B C     1 
ATOM   5838  O O     . ASN C 1 212 ? 8.799   -7.717  19.632 1.00 32.93 ? 264  ASN B O     1 
ATOM   5839  C CB    . ASN C 1 212 ? 10.315  -10.224 20.505 1.00 31.31 ? 264  ASN B CB    1 
ATOM   5840  C CG    . ASN C 1 212 ? 10.780  -10.238 19.051 1.00 32.90 ? 264  ASN B CG    1 
ATOM   5841  O OD1   . ASN C 1 212 ? 10.139  -9.628  18.177 1.00 31.25 ? 264  ASN B OD1   1 
ATOM   5842  N ND2   . ASN C 1 212 ? 11.905  -10.920 18.782 1.00 33.72 ? 264  ASN B ND2   1 
ATOM   5843  N N     . VAL C 1 213 ? 10.970  -7.181  19.450 1.00 32.05 ? 265  VAL B N     1 
ATOM   5844  C CA    . VAL C 1 213 ? 10.687  -6.284  18.356 1.00 30.78 ? 265  VAL B CA    1 
ATOM   5845  C C     . VAL C 1 213 ? 11.205  -6.985  17.105 1.00 30.73 ? 265  VAL B C     1 
ATOM   5846  O O     . VAL C 1 213 ? 12.347  -7.465  17.069 1.00 30.64 ? 265  VAL B O     1 
ATOM   5847  C CB    . VAL C 1 213 ? 11.386  -4.957  18.552 1.00 30.91 ? 265  VAL B CB    1 
ATOM   5848  C CG1   . VAL C 1 213 ? 10.897  -3.969  17.503 1.00 32.01 ? 265  VAL B CG1   1 
ATOM   5849  C CG2   . VAL C 1 213 ? 11.122  -4.442  19.969 1.00 28.77 ? 265  VAL B CG2   1 
ATOM   5850  N N     . PRO C 1 214 ? 10.378  -7.049  16.053 1.00 31.14 ? 266  PRO B N     1 
ATOM   5851  C CA    . PRO C 1 214 ? 9.013   -6.525  15.942 1.00 31.97 ? 266  PRO B CA    1 
ATOM   5852  C C     . PRO C 1 214 ? 7.915   -7.535  16.284 1.00 34.57 ? 266  PRO B C     1 
ATOM   5853  O O     . PRO C 1 214 ? 6.751   -7.149  16.473 1.00 35.46 ? 266  PRO B O     1 
ATOM   5854  C CB    . PRO C 1 214 ? 8.932   -6.147  14.473 1.00 30.08 ? 266  PRO B CB    1 
ATOM   5855  C CG    . PRO C 1 214 ? 9.602   -7.364  13.848 1.00 28.74 ? 266  PRO B CG    1 
ATOM   5856  C CD    . PRO C 1 214 ? 10.834  -7.571  14.746 1.00 30.00 ? 266  PRO B CD    1 
ATOM   5857  N N     . ASN C 1 215 ? 8.274   -8.819  16.332 1.00 36.81 ? 267  ASN B N     1 
ATOM   5858  C CA    . ASN C 1 215 ? 7.299   -9.883  16.602 1.00 39.85 ? 267  ASN B CA    1 
ATOM   5859  C C     . ASN C 1 215 ? 6.254   -9.609  17.711 1.00 44.25 ? 267  ASN B C     1 
ATOM   5860  O O     . ASN C 1 215 ? 5.191   -10.226 17.718 1.00 42.26 ? 267  ASN B O     1 
ATOM   5861  C CB    . ASN C 1 215 ? 8.041   -11.210 16.835 1.00 36.89 ? 267  ASN B CB    1 
ATOM   5862  C CG    . ASN C 1 215 ? 8.799   -11.681 15.579 1.00 38.64 ? 267  ASN B CG    1 
ATOM   5863  O OD1   . ASN C 1 215 ? 8.194   -12.084 14.584 1.00 41.00 ? 267  ASN B OD1   1 
ATOM   5864  N ND2   . ASN C 1 215 ? 10.125  -11.610 15.622 1.00 40.26 ? 267  ASN B ND2   1 
ATOM   5865  N N     . ASP C 1 216 ? 6.532   -8.683  18.627 1.00 50.44 ? 268  ASP B N     1 
ATOM   5866  C CA    . ASP C 1 216 ? 5.574   -8.339  19.683 1.00 58.17 ? 268  ASP B CA    1 
ATOM   5867  C C     . ASP C 1 216 ? 5.025   -6.960  19.397 1.00 60.69 ? 268  ASP B C     1 
ATOM   5868  O O     . ASP C 1 216 ? 3.908   -6.831  18.902 1.00 62.81 ? 268  ASP B O     1 
ATOM   5869  C CB    . ASP C 1 216 ? 6.237   -8.344  21.049 1.00 62.51 ? 268  ASP B CB    1 
ATOM   5870  C CG    . ASP C 1 216 ? 6.018   -9.629  21.776 1.00 64.71 ? 268  ASP B CG    1 
ATOM   5871  O OD1   . ASP C 1 216 ? 6.538   -10.678 21.334 1.00 65.17 ? 268  ASP B OD1   1 
ATOM   5872  O OD2   . ASP C 1 216 ? 5.306   -9.584  22.792 1.00 67.19 ? 268  ASP B OD2   1 
ATOM   5873  N N     . LEU C 1 217 ? 5.802   -5.930  19.723 1.00 61.42 ? 269  LEU B N     1 
ATOM   5874  C CA    . LEU C 1 217 ? 5.391   -4.567  19.429 1.00 60.83 ? 269  LEU B CA    1 
ATOM   5875  C C     . LEU C 1 217 ? 6.413   -3.969  18.477 1.00 60.38 ? 269  LEU B C     1 
ATOM   5876  O O     . LEU C 1 217 ? 7.609   -4.275  18.541 1.00 60.33 ? 269  LEU B O     1 
ATOM   5877  C CB    . LEU C 1 217 ? 5.287   -3.703  20.688 1.00 60.48 ? 269  LEU B CB    1 
ATOM   5878  C CG    . LEU C 1 217 ? 6.555   -3.116  21.304 1.00 59.89 ? 269  LEU B CG    1 
ATOM   5879  C CD1   . LEU C 1 217 ? 6.184   -1.917  22.166 1.00 58.51 ? 269  LEU B CD1   1 
ATOM   5880  C CD2   . LEU C 1 217 ? 7.280   -4.184  22.115 1.00 59.39 ? 269  LEU B CD2   1 
ATOM   5881  N N     . GLU C 1 218 ? 5.915   -3.131  17.578 1.00 59.70 ? 270  GLU B N     1 
ATOM   5882  C CA    . GLU C 1 218 ? 6.735   -2.470  16.578 1.00 58.08 ? 270  GLU B CA    1 
ATOM   5883  C C     . GLU C 1 218 ? 6.955   -1.011  16.945 1.00 56.41 ? 270  GLU B C     1 
ATOM   5884  O O     . GLU C 1 218 ? 6.081   -0.374  17.542 1.00 55.94 ? 270  GLU B O     1 
ATOM   5885  C CB    . GLU C 1 218 ? 6.054   -2.555  15.211 1.00 58.35 ? 270  GLU B CB    1 
ATOM   5886  C CG    . GLU C 1 218 ? 6.183   -3.895  14.524 1.00 59.24 ? 270  GLU B CG    1 
ATOM   5887  C CD    . GLU C 1 218 ? 5.449   -3.916  13.203 1.00 61.99 ? 270  GLU B CD    1 
ATOM   5888  O OE1   . GLU C 1 218 ? 5.335   -2.841  12.566 1.00 62.79 ? 270  GLU B OE1   1 
ATOM   5889  O OE2   . GLU C 1 218 ? 4.993   -5.008  12.796 1.00 63.23 ? 270  GLU B OE2   1 
ATOM   5890  N N     . ILE C 1 219 ? 8.123   -0.483  16.592 1.00 54.19 ? 271  ILE B N     1 
ATOM   5891  C CA    . ILE C 1 219 ? 8.424   0.911   16.889 1.00 51.96 ? 271  ILE B CA    1 
ATOM   5892  C C     . ILE C 1 219 ? 8.958   1.637   15.665 1.00 50.52 ? 271  ILE B C     1 
ATOM   5893  O O     . ILE C 1 219 ? 9.717   1.077   14.882 1.00 49.64 ? 271  ILE B O     1 
ATOM   5894  C CB    . ILE C 1 219 ? 9.474   1.059   18.026 1.00 50.55 ? 271  ILE B CB    1 
ATOM   5895  C CG1   . ILE C 1 219 ? 9.001   0.352   19.298 1.00 49.08 ? 271  ILE B CG1   1 
ATOM   5896  C CG2   . ILE C 1 219 ? 9.704   2.527   18.325 1.00 50.12 ? 271  ILE B CG2   1 
ATOM   5897  C CD1   . ILE C 1 219 ? 9.554   -1.050  19.456 1.00 46.22 ? 271  ILE B CD1   1 
ATOM   5898  N N     . ILE C 1 220 ? 8.539   2.883   15.501 1.00 49.66 ? 272  ILE B N     1 
ATOM   5899  C CA    . ILE C 1 220 ? 9.005   3.698   14.398 1.00 49.95 ? 272  ILE B CA    1 
ATOM   5900  C C     . ILE C 1 220 ? 9.509   5.031   14.940 1.00 50.47 ? 272  ILE B C     1 
ATOM   5901  O O     . ILE C 1 220 ? 8.802   5.762   15.655 1.00 49.61 ? 272  ILE B O     1 
ATOM   5902  C CB    . ILE C 1 220 ? 7.905   3.936   13.342 1.00 49.96 ? 272  ILE B CB    1 
ATOM   5903  C CG1   . ILE C 1 220 ? 8.533   4.525   12.086 1.00 49.80 ? 272  ILE B CG1   1 
ATOM   5904  C CG2   . ILE C 1 220 ? 6.860   4.914   13.853 1.00 52.09 ? 272  ILE B CG2   1 
ATOM   5905  C CD1   . ILE C 1 220 ? 7.666   4.379   10.882 1.00 47.14 ? 272  ILE B CD1   1 
ATOM   5906  N N     . GLY C 1 221 ? 10.754  5.332   14.604 1.00 50.29 ? 273  GLY B N     1 
ATOM   5907  C CA    . GLY C 1 221 ? 11.359  6.558   15.074 1.00 50.29 ? 273  GLY B CA    1 
ATOM   5908  C C     . GLY C 1 221 ? 11.103  7.758   14.196 1.00 49.71 ? 273  GLY B C     1 
ATOM   5909  O O     . GLY C 1 221 ? 10.194  7.766   13.360 1.00 49.51 ? 273  GLY B O     1 
ATOM   5910  N N     . PHE C 1 222 ? 11.941  8.771   14.389 1.00 49.83 ? 274  PHE B N     1 
ATOM   5911  C CA    . PHE C 1 222 ? 11.839  10.026  13.656 1.00 48.96 ? 274  PHE B CA    1 
ATOM   5912  C C     . PHE C 1 222 ? 13.236  10.656  13.559 1.00 47.13 ? 274  PHE B C     1 
ATOM   5913  O O     . PHE C 1 222 ? 14.038  10.544  14.483 1.00 45.20 ? 274  PHE B O     1 
ATOM   5914  C CB    . PHE C 1 222 ? 10.873  10.948  14.419 1.00 48.92 ? 274  PHE B CB    1 
ATOM   5915  C CG    . PHE C 1 222 ? 10.210  11.995  13.573 1.00 48.06 ? 274  PHE B CG    1 
ATOM   5916  C CD1   . PHE C 1 222 ? 10.910  13.119  13.150 1.00 48.89 ? 274  PHE B CD1   1 
ATOM   5917  C CD2   . PHE C 1 222 ? 8.872   11.873  13.231 1.00 48.55 ? 274  PHE B CD2   1 
ATOM   5918  C CE1   . PHE C 1 222 ? 10.286  14.111  12.401 1.00 49.38 ? 274  PHE B CE1   1 
ATOM   5919  C CE2   . PHE C 1 222 ? 8.237   12.855  12.483 1.00 49.96 ? 274  PHE B CE2   1 
ATOM   5920  C CZ    . PHE C 1 222 ? 8.943   13.980  12.066 1.00 49.51 ? 274  PHE B CZ    1 
ATOM   5921  N N     . ASP C 1 223 ? 13.508  11.298  12.425 1.00 47.26 ? 275  ASP B N     1 
ATOM   5922  C CA    . ASP C 1 223 ? 14.779  11.983  12.143 1.00 47.01 ? 275  ASP B CA    1 
ATOM   5923  C C     . ASP C 1 223 ? 15.730  11.164  11.268 1.00 44.34 ? 275  ASP B C     1 
ATOM   5924  O O     . ASP C 1 223 ? 16.469  11.710  10.455 1.00 44.27 ? 275  ASP B O     1 
ATOM   5925  C CB    . ASP C 1 223 ? 15.505  12.361  13.449 1.00 49.10 ? 275  ASP B CB    1 
ATOM   5926  C CG    . ASP C 1 223 ? 14.742  13.384  14.284 1.00 51.21 ? 275  ASP B CG    1 
ATOM   5927  O OD1   . ASP C 1 223 ? 14.967  13.428  15.515 1.00 52.87 ? 275  ASP B OD1   1 
ATOM   5928  O OD2   . ASP C 1 223 ? 13.936  14.155  13.718 1.00 52.72 ? 275  ASP B OD2   1 
ATOM   5929  N N     . ASN C 1 224 ? 15.693  9.850   11.419 1.00 42.93 ? 276  ASN B N     1 
ATOM   5930  C CA    . ASN C 1 224 ? 16.595  8.989   10.674 1.00 41.42 ? 276  ASN B CA    1 
ATOM   5931  C C     . ASN C 1 224 ? 17.986  9.523   10.967 1.00 40.31 ? 276  ASN B C     1 
ATOM   5932  O O     . ASN C 1 224 ? 18.594  10.242  10.178 1.00 40.00 ? 276  ASN B O     1 
ATOM   5933  C CB    . ASN C 1 224 ? 16.304  9.036   9.180  1.00 40.82 ? 276  ASN B CB    1 
ATOM   5934  C CG    . ASN C 1 224 ? 17.157  8.062   8.408  1.00 39.97 ? 276  ASN B CG    1 
ATOM   5935  O OD1   . ASN C 1 224 ? 17.332  6.910   8.814  1.00 39.57 ? 276  ASN B OD1   1 
ATOM   5936  N ND2   . ASN C 1 224 ? 17.695  8.514   7.286  1.00 40.23 ? 276  ASN B ND2   1 
ATOM   5937  N N     . THR C 1 225 ? 18.450  9.171   12.154 1.00 39.54 ? 277  THR B N     1 
ATOM   5938  C CA    . THR C 1 225 ? 19.735  9.573   12.677 1.00 37.39 ? 277  THR B CA    1 
ATOM   5939  C C     . THR C 1 225 ? 20.689  8.396   12.553 1.00 36.67 ? 277  THR B C     1 
ATOM   5940  O O     . THR C 1 225 ? 20.291  7.298   12.185 1.00 36.69 ? 277  THR B O     1 
ATOM   5941  C CB    . THR C 1 225 ? 19.549  9.993   14.159 1.00 36.72 ? 277  THR B CB    1 
ATOM   5942  O OG1   . THR C 1 225 ? 19.482  11.419  14.243 1.00 37.23 ? 277  THR B OG1   1 
ATOM   5943  C CG2   . THR C 1 225 ? 20.656  9.473   15.039 1.00 37.03 ? 277  THR B CG2   1 
ATOM   5944  N N     . ARG C 1 226 ? 21.958  8.632   12.832 1.00 35.68 ? 278  ARG B N     1 
ATOM   5945  C CA    . ARG C 1 226 ? 22.935  7.565   12.790 1.00 35.77 ? 278  ARG B CA    1 
ATOM   5946  C C     . ARG C 1 226 ? 22.475  6.477   13.781 1.00 34.50 ? 278  ARG B C     1 
ATOM   5947  O O     . ARG C 1 226 ? 22.658  5.285   13.556 1.00 34.50 ? 278  ARG B O     1 
ATOM   5948  C CB    . ARG C 1 226 ? 24.299  8.127   13.204 1.00 38.54 ? 278  ARG B CB    1 
ATOM   5949  C CG    . ARG C 1 226 ? 25.477  7.204   12.985 1.00 42.07 ? 278  ARG B CG    1 
ATOM   5950  C CD    . ARG C 1 226 ? 26.782  7.922   13.278 1.00 43.98 ? 278  ARG B CD    1 
ATOM   5951  N NE    . ARG C 1 226 ? 26.923  8.304   14.678 1.00 42.78 ? 278  ARG B NE    1 
ATOM   5952  C CZ    . ARG C 1 226 ? 27.335  9.502   15.079 1.00 43.70 ? 278  ARG B CZ    1 
ATOM   5953  N NH1   . ARG C 1 226 ? 27.635  10.435  14.188 1.00 42.01 ? 278  ARG B NH1   1 
ATOM   5954  N NH2   . ARG C 1 226 ? 27.465  9.761   16.371 1.00 45.26 ? 278  ARG B NH2   1 
ATOM   5955  N N     . LEU C 1 227 ? 21.865  6.902   14.878 1.00 33.54 ? 279  LEU B N     1 
ATOM   5956  C CA    . LEU C 1 227 ? 21.388  5.980   15.895 1.00 33.63 ? 279  LEU B CA    1 
ATOM   5957  C C     . LEU C 1 227 ? 20.393  4.930   15.425 1.00 33.77 ? 279  LEU B C     1 
ATOM   5958  O O     . LEU C 1 227 ? 20.304  3.867   16.016 1.00 32.09 ? 279  LEU B O     1 
ATOM   5959  C CB    . LEU C 1 227 ? 20.736  6.748   17.034 1.00 33.55 ? 279  LEU B CB    1 
ATOM   5960  C CG    . LEU C 1 227 ? 21.614  7.435   18.067 1.00 33.37 ? 279  LEU B CG    1 
ATOM   5961  C CD1   . LEU C 1 227 ? 20.727  7.793   19.221 1.00 34.64 ? 279  LEU B CD1   1 
ATOM   5962  C CD2   . LEU C 1 227 ? 22.735  6.526   18.534 1.00 32.66 ? 279  LEU B CD2   1 
ATOM   5963  N N     . SER C 1 228 ? 19.630  5.241   14.382 1.00 35.27 ? 280  SER B N     1 
ATOM   5964  C CA    . SER C 1 228 ? 18.618  4.322   13.872 1.00 35.29 ? 280  SER B CA    1 
ATOM   5965  C C     . SER C 1 228 ? 19.224  3.024   13.407 1.00 35.31 ? 280  SER B C     1 
ATOM   5966  O O     . SER C 1 228 ? 18.572  1.985   13.395 1.00 34.64 ? 280  SER B O     1 
ATOM   5967  C CB    . SER C 1 228 ? 17.874  4.960   12.714 1.00 35.26 ? 280  SER B CB    1 
ATOM   5968  O OG    . SER C 1 228 ? 17.452  6.262   13.070 1.00 38.63 ? 280  SER B OG    1 
ATOM   5969  N N     . THR C 1 229 ? 20.489  3.098   13.040 1.00 35.46 ? 281  THR B N     1 
ATOM   5970  C CA    . THR C 1 229 ? 21.207  1.951   12.536 1.00 36.49 ? 281  THR B CA    1 
ATOM   5971  C C     . THR C 1 229 ? 22.054  1.352   13.642 1.00 36.69 ? 281  THR B C     1 
ATOM   5972  O O     . THR C 1 229 ? 22.724  0.337   13.437 1.00 38.44 ? 281  THR B O     1 
ATOM   5973  C CB    . THR C 1 229 ? 22.119  2.390   11.392 1.00 36.77 ? 281  THR B CB    1 
ATOM   5974  O OG1   . THR C 1 229 ? 21.387  3.276   10.535 1.00 37.12 ? 281  THR B OG1   1 
ATOM   5975  C CG2   . THR C 1 229 ? 22.607  1.193   10.596 1.00 38.34 ? 281  THR B CG2   1 
ATOM   5976  N N     . MET C 1 230 ? 21.993  1.969   14.818 1.00 35.78 ? 282  MET B N     1 
ATOM   5977  C CA    . MET C 1 230 ? 22.791  1.541   15.965 1.00 34.93 ? 282  MET B CA    1 
ATOM   5978  C C     . MET C 1 230 ? 22.089  0.748   17.052 1.00 34.11 ? 282  MET B C     1 
ATOM   5979  O O     . MET C 1 230 ? 22.650  0.529   18.123 1.00 34.14 ? 282  MET B O     1 
ATOM   5980  C CB    . MET C 1 230 ? 23.491  2.765   16.565 1.00 34.61 ? 282  MET B CB    1 
ATOM   5981  C CG    . MET C 1 230 ? 24.481  3.365   15.566 1.00 35.18 ? 282  MET B CG    1 
ATOM   5982  S SD    . MET C 1 230 ? 25.127  4.946   16.007 1.00 32.07 ? 282  MET B SD    1 
ATOM   5983  C CE    . MET C 1 230 ? 26.076  4.508   17.452 1.00 31.40 ? 282  MET B CE    1 
ATOM   5984  N N     . VAL C 1 231 ? 20.865  0.323   16.772 1.00 34.10 ? 283  VAL B N     1 
ATOM   5985  C CA    . VAL C 1 231 ? 20.095  -0.491  17.701 1.00 35.15 ? 283  VAL B CA    1 
ATOM   5986  C C     . VAL C 1 231 ? 19.906  -1.827  17.029 1.00 35.90 ? 283  VAL B C     1 
ATOM   5987  O O     . VAL C 1 231 ? 20.313  -2.028  15.888 1.00 36.48 ? 283  VAL B O     1 
ATOM   5988  C CB    . VAL C 1 231 ? 18.672  0.034   17.921 1.00 35.72 ? 283  VAL B CB    1 
ATOM   5989  C CG1   . VAL C 1 231 ? 18.523  0.568   19.320 1.00 34.71 ? 283  VAL B CG1   1 
ATOM   5990  C CG2   . VAL C 1 231 ? 18.322  1.061   16.851 1.00 35.37 ? 283  VAL B CG2   1 
ATOM   5991  N N     . ARG C 1 232 ? 19.259  -2.739  17.732 1.00 36.89 ? 284  ARG B N     1 
ATOM   5992  C CA    . ARG C 1 232 ? 18.968  -4.030  17.146 1.00 37.64 ? 284  ARG B CA    1 
ATOM   5993  C C     . ARG C 1 232 ? 17.627  -4.443  17.730 1.00 38.52 ? 284  ARG B C     1 
ATOM   5994  O O     . ARG C 1 232 ? 17.460  -4.508  18.953 1.00 40.07 ? 284  ARG B O     1 
ATOM   5995  C CB    . ARG C 1 232 ? 20.052  -5.045  17.480 1.00 35.78 ? 284  ARG B CB    1 
ATOM   5996  C CG    . ARG C 1 232 ? 20.296  -6.032  16.366 1.00 37.95 ? 284  ARG B CG    1 
ATOM   5997  C CD    . ARG C 1 232 ? 21.482  -5.635  15.479 1.00 37.06 ? 284  ARG B CD    1 
ATOM   5998  N NE    . ARG C 1 232 ? 21.351  -4.300  14.904 1.00 35.63 ? 284  ARG B NE    1 
ATOM   5999  C CZ    . ARG C 1 232 ? 22.305  -3.681  14.210 1.00 34.88 ? 284  ARG B CZ    1 
ATOM   6000  N NH1   . ARG C 1 232 ? 23.476  -4.260  13.990 1.00 33.52 ? 284  ARG B NH1   1 
ATOM   6001  N NH2   . ARG C 1 232 ? 22.084  -2.466  13.738 1.00 37.31 ? 284  ARG B NH2   1 
ATOM   6002  N N     . PRO C 1 233 ? 16.624  -4.646  16.865 1.00 38.56 ? 285  PRO B N     1 
ATOM   6003  C CA    . PRO C 1 233 ? 16.695  -4.500  15.406 1.00 38.70 ? 285  PRO B CA    1 
ATOM   6004  C C     . PRO C 1 233 ? 16.806  -3.030  14.997 1.00 39.22 ? 285  PRO B C     1 
ATOM   6005  O O     . PRO C 1 233 ? 16.390  -2.133  15.739 1.00 38.84 ? 285  PRO B O     1 
ATOM   6006  C CB    . PRO C 1 233 ? 15.385  -5.112  14.944 1.00 38.76 ? 285  PRO B CB    1 
ATOM   6007  C CG    . PRO C 1 233 ? 14.446  -4.681  16.034 1.00 39.93 ? 285  PRO B CG    1 
ATOM   6008  C CD    . PRO C 1 233 ? 15.255  -4.986  17.288 1.00 38.66 ? 285  PRO B CD    1 
ATOM   6009  N N     . GLN C 1 234 ? 17.367  -2.786  13.817 1.00 38.73 ? 286  GLN B N     1 
ATOM   6010  C CA    . GLN C 1 234 ? 17.517  -1.423  13.333 1.00 37.34 ? 286  GLN B CA    1 
ATOM   6011  C C     . GLN C 1 234 ? 16.163  -0.730  13.297 1.00 36.50 ? 286  GLN B C     1 
ATOM   6012  O O     . GLN C 1 234 ? 15.172  -1.318  12.891 1.00 35.79 ? 286  GLN B O     1 
ATOM   6013  C CB    . GLN C 1 234 ? 18.163  -1.425  11.952 1.00 37.97 ? 286  GLN B CB    1 
ATOM   6014  C CG    . GLN C 1 234 ? 19.684  -1.577  11.993 1.00 37.13 ? 286  GLN B CG    1 
ATOM   6015  C CD    . GLN C 1 234 ? 20.203  -2.420  10.866 1.00 35.53 ? 286  GLN B CD    1 
ATOM   6016  O OE1   . GLN C 1 234 ? 20.021  -3.632  10.867 1.00 37.71 ? 286  GLN B OE1   1 
ATOM   6017  N NE2   . GLN C 1 234 ? 20.838  -1.791  9.890  1.00 33.88 ? 286  GLN B NE2   1 
ATOM   6018  N N     . LEU C 1 235 ? 16.147  0.523   13.736 1.00 36.32 ? 287  LEU B N     1 
ATOM   6019  C CA    . LEU C 1 235 ? 14.945  1.342   13.818 1.00 36.15 ? 287  LEU B CA    1 
ATOM   6020  C C     . LEU C 1 235 ? 14.478  1.930   12.492 1.00 38.01 ? 287  LEU B C     1 
ATOM   6021  O O     . LEU C 1 235 ? 15.249  2.605   11.807 1.00 39.79 ? 287  LEU B O     1 
ATOM   6022  C CB    . LEU C 1 235 ? 15.206  2.482   14.800 1.00 34.91 ? 287  LEU B CB    1 
ATOM   6023  C CG    . LEU C 1 235 ? 14.279  3.694   14.774 1.00 34.35 ? 287  LEU B CG    1 
ATOM   6024  C CD1   . LEU C 1 235 ? 12.980  3.336   15.451 1.00 33.33 ? 287  LEU B CD1   1 
ATOM   6025  C CD2   . LEU C 1 235 ? 14.937  4.876   15.480 1.00 33.99 ? 287  LEU B CD2   1 
ATOM   6026  N N     . THR C 1 236 ? 13.221  1.685   12.128 1.00 37.89 ? 288  THR B N     1 
ATOM   6027  C CA    . THR C 1 236 ? 12.686  2.255   10.902 1.00 38.48 ? 288  THR B CA    1 
ATOM   6028  C C     . THR C 1 236 ? 12.291  3.662   11.354 1.00 37.32 ? 288  THR B C     1 
ATOM   6029  O O     . THR C 1 236 ? 11.593  3.821   12.345 1.00 36.02 ? 288  THR B O     1 
ATOM   6030  C CB    . THR C 1 236 ? 11.467  1.454   10.375 1.00 40.20 ? 288  THR B CB    1 
ATOM   6031  O OG1   . THR C 1 236 ? 10.285  1.839   11.076 1.00 41.16 ? 288  THR B OG1   1 
ATOM   6032  C CG2   . THR C 1 236 ? 11.689  -0.044  10.573 1.00 43.22 ? 288  THR B CG2   1 
ATOM   6033  N N     . SER C 1 237 ? 12.750  4.681   10.636 1.00 37.47 ? 289  SER B N     1 
ATOM   6034  C CA    . SER C 1 237 ? 12.500  6.050   11.057 1.00 37.94 ? 289  SER B CA    1 
ATOM   6035  C C     . SER C 1 237 ? 12.115  7.059   9.984  1.00 37.39 ? 289  SER B C     1 
ATOM   6036  O O     . SER C 1 237 ? 12.478  6.929   8.825  1.00 35.87 ? 289  SER B O     1 
ATOM   6037  C CB    . SER C 1 237 ? 13.743  6.559   11.806 1.00 38.86 ? 289  SER B CB    1 
ATOM   6038  O OG    . SER C 1 237 ? 13.655  7.940   12.120 1.00 41.38 ? 289  SER B OG    1 
ATOM   6039  N N     . VAL C 1 238 ? 11.381  8.082   10.402 1.00 37.82 ? 290  VAL B N     1 
ATOM   6040  C CA    . VAL C 1 238 ? 10.959  9.140   9.499  1.00 39.24 ? 290  VAL B CA    1 
ATOM   6041  C C     . VAL C 1 238 ? 12.188  9.919   9.048  1.00 38.27 ? 290  VAL B C     1 
ATOM   6042  O O     . VAL C 1 238 ? 12.772  10.670  9.818  1.00 39.66 ? 290  VAL B O     1 
ATOM   6043  C CB    . VAL C 1 238 ? 9.988   10.127  10.202 1.00 40.36 ? 290  VAL B CB    1 
ATOM   6044  C CG1   . VAL C 1 238 ? 9.579   11.240  9.247  1.00 38.98 ? 290  VAL B CG1   1 
ATOM   6045  C CG2   . VAL C 1 238 ? 8.757   9.378   10.704 1.00 42.54 ? 290  VAL B CG2   1 
ATOM   6046  N N     . VAL C 1 239 ? 12.586  9.743   7.801  1.00 36.56 ? 291  VAL B N     1 
ATOM   6047  C CA    . VAL C 1 239 ? 13.744  10.460  7.308  1.00 35.19 ? 291  VAL B CA    1 
ATOM   6048  C C     . VAL C 1 239 ? 13.555  11.965  7.333  1.00 36.28 ? 291  VAL B C     1 
ATOM   6049  O O     . VAL C 1 239 ? 12.519  12.483  6.934  1.00 36.96 ? 291  VAL B O     1 
ATOM   6050  C CB    . VAL C 1 239 ? 14.079  10.063  5.857  1.00 34.00 ? 291  VAL B CB    1 
ATOM   6051  C CG1   . VAL C 1 239 ? 15.061  11.073  5.249  1.00 28.86 ? 291  VAL B CG1   1 
ATOM   6052  C CG2   . VAL C 1 239 ? 14.662  8.655   5.828  1.00 30.96 ? 291  VAL B CG2   1 
ATOM   6053  N N     . GLN C 1 240 ? 14.566  12.667  7.813  1.00 37.17 ? 292  GLN B N     1 
ATOM   6054  C CA    . GLN C 1 240 ? 14.536  14.113  7.823  1.00 37.71 ? 292  GLN B CA    1 
ATOM   6055  C C     . GLN C 1 240 ? 15.872  14.437  7.176  1.00 39.28 ? 292  GLN B C     1 
ATOM   6056  O O     . GLN C 1 240 ? 16.912  14.170  7.765  1.00 41.34 ? 292  GLN B O     1 
ATOM   6057  C CB    . GLN C 1 240 ? 14.469  14.640  9.251  1.00 37.72 ? 292  GLN B CB    1 
ATOM   6058  C CG    . GLN C 1 240 ? 14.262  16.145  9.317  1.00 39.31 ? 292  GLN B CG    1 
ATOM   6059  C CD    . GLN C 1 240 ? 13.801  16.651  10.682 1.00 37.74 ? 292  GLN B CD    1 
ATOM   6060  O OE1   . GLN C 1 240 ? 13.580  17.850  10.865 1.00 37.97 ? 292  GLN B OE1   1 
ATOM   6061  N NE2   . GLN C 1 240 ? 13.654  15.743  11.638 1.00 38.37 ? 292  GLN B NE2   1 
ATOM   6062  N N     . PRO C 1 241 ? 15.868  14.973  5.937  1.00 39.66 ? 293  PRO B N     1 
ATOM   6063  C CA    . PRO C 1 241 ? 17.097  15.320  5.211  1.00 39.55 ? 293  PRO B CA    1 
ATOM   6064  C C     . PRO C 1 241 ? 17.897  16.440  5.868  1.00 39.00 ? 293  PRO B C     1 
ATOM   6065  O O     . PRO C 1 241 ? 17.781  17.616  5.501  1.00 38.28 ? 293  PRO B O     1 
ATOM   6066  C CB    . PRO C 1 241 ? 16.575  15.705  3.831  1.00 40.73 ? 293  PRO B CB    1 
ATOM   6067  C CG    . PRO C 1 241 ? 15.262  16.344  4.146  1.00 39.17 ? 293  PRO B CG    1 
ATOM   6068  C CD    . PRO C 1 241 ? 14.686  15.357  5.144  1.00 40.65 ? 293  PRO B CD    1 
ATOM   6069  N N     . MET C 1 242 ? 18.723  16.051  6.832  1.00 37.98 ? 294  MET B N     1 
ATOM   6070  C CA    . MET C 1 242 ? 19.527  16.997  7.585  1.00 39.48 ? 294  MET B CA    1 
ATOM   6071  C C     . MET C 1 242 ? 20.461  17.811  6.717  1.00 37.99 ? 294  MET B C     1 
ATOM   6072  O O     . MET C 1 242 ? 20.545  19.029  6.856  1.00 36.28 ? 294  MET B O     1 
ATOM   6073  C CB    . MET C 1 242 ? 20.299  16.254  8.678  1.00 42.20 ? 294  MET B CB    1 
ATOM   6074  C CG    . MET C 1 242 ? 19.372  15.651  9.732  1.00 44.34 ? 294  MET B CG    1 
ATOM   6075  S SD    . MET C 1 242 ? 20.193  14.685  11.000 1.00 46.73 ? 294  MET B SD    1 
ATOM   6076  C CE    . MET C 1 242 ? 20.613  13.196  10.072 1.00 48.50 ? 294  MET B CE    1 
ATOM   6077  N N     . TYR C 1 243 ? 21.157  17.141  5.814  1.00 37.82 ? 295  TYR B N     1 
ATOM   6078  C CA    . TYR C 1 243 ? 22.055  17.848  4.924  1.00 38.96 ? 295  TYR B CA    1 
ATOM   6079  C C     . TYR C 1 243 ? 21.315  18.963  4.177  1.00 38.41 ? 295  TYR B C     1 
ATOM   6080  O O     . TYR C 1 243 ? 21.714  20.128  4.257  1.00 37.39 ? 295  TYR B O     1 
ATOM   6081  C CB    . TYR C 1 243 ? 22.667  16.893  3.895  1.00 41.16 ? 295  TYR B CB    1 
ATOM   6082  C CG    . TYR C 1 243 ? 23.715  17.544  3.017  1.00 41.35 ? 295  TYR B CG    1 
ATOM   6083  C CD1   . TYR C 1 243 ? 25.065  17.438  3.324  1.00 42.03 ? 295  TYR B CD1   1 
ATOM   6084  C CD2   . TYR C 1 243 ? 23.350  18.286  1.893  1.00 42.37 ? 295  TYR B CD2   1 
ATOM   6085  C CE1   . TYR C 1 243 ? 26.024  18.045  2.537  1.00 44.32 ? 295  TYR B CE1   1 
ATOM   6086  C CE2   . TYR C 1 243 ? 24.301  18.905  1.101  1.00 43.60 ? 295  TYR B CE2   1 
ATOM   6087  C CZ    . TYR C 1 243 ? 25.634  18.777  1.427  1.00 44.30 ? 295  TYR B CZ    1 
ATOM   6088  O OH    . TYR C 1 243 ? 26.585  19.363  0.637  1.00 45.37 ? 295  TYR B OH    1 
ATOM   6089  N N     . ASP C 1 244 ? 20.245  18.599  3.458  1.00 38.29 ? 296  ASP B N     1 
ATOM   6090  C CA    . ASP C 1 244 ? 19.471  19.562  2.662  1.00 37.61 ? 296  ASP B CA    1 
ATOM   6091  C C     . ASP C 1 244 ? 19.025  20.749  3.488  1.00 37.03 ? 296  ASP B C     1 
ATOM   6092  O O     . ASP C 1 244 ? 19.190  21.899  3.075  1.00 36.26 ? 296  ASP B O     1 
ATOM   6093  C CB    . ASP C 1 244 ? 18.225  18.922  2.037  1.00 38.80 ? 296  ASP B CB    1 
ATOM   6094  C CG    . ASP C 1 244 ? 18.538  17.699  1.201  1.00 39.34 ? 296  ASP B CG    1 
ATOM   6095  O OD1   . ASP C 1 244 ? 17.674  17.276  0.407  1.00 41.14 ? 296  ASP B OD1   1 
ATOM   6096  O OD2   . ASP C 1 244 ? 19.634  17.140  1.347  1.00 41.13 ? 296  ASP B OD2   1 
ATOM   6097  N N     . ILE C 1 245 ? 18.455  20.462  4.656  1.00 35.92 ? 297  ILE B N     1 
ATOM   6098  C CA    . ILE C 1 245 ? 17.979  21.512  5.542  1.00 34.80 ? 297  ILE B CA    1 
ATOM   6099  C C     . ILE C 1 245 ? 19.109  22.500  5.764  1.00 33.52 ? 297  ILE B C     1 
ATOM   6100  O O     . ILE C 1 245 ? 18.975  23.683  5.465  1.00 33.73 ? 297  ILE B O     1 
ATOM   6101  C CB    . ILE C 1 245 ? 17.514  20.922  6.891  1.00 36.54 ? 297  ILE B CB    1 
ATOM   6102  C CG1   . ILE C 1 245 ? 16.391  19.910  6.647  1.00 35.20 ? 297  ILE B CG1   1 
ATOM   6103  C CG2   . ILE C 1 245 ? 17.028  22.034  7.823  1.00 34.87 ? 297  ILE B CG2   1 
ATOM   6104  C CD1   . ILE C 1 245 ? 16.005  19.130  7.869  1.00 39.51 ? 297  ILE B CD1   1 
ATOM   6105  N N     . GLY C 1 246 ? 20.233  22.004  6.265  1.00 32.59 ? 298  GLY B N     1 
ATOM   6106  C CA    . GLY C 1 246 ? 21.370  22.869  6.500  1.00 31.31 ? 298  GLY B CA    1 
ATOM   6107  C C     . GLY C 1 246 ? 21.768  23.633  5.252  1.00 32.04 ? 298  GLY B C     1 
ATOM   6108  O O     . GLY C 1 246 ? 22.042  24.836  5.304  1.00 31.18 ? 298  GLY B O     1 
ATOM   6109  N N     . ALA C 1 247 ? 21.779  22.937  4.119  1.00 32.44 ? 299  ALA B N     1 
ATOM   6110  C CA    . ALA C 1 247 ? 22.170  23.538  2.853  1.00 32.33 ? 299  ALA B CA    1 
ATOM   6111  C C     . ALA C 1 247 ? 21.244  24.650  2.415  1.00 33.82 ? 299  ALA B C     1 
ATOM   6112  O O     . ALA C 1 247 ? 21.698  25.772  2.182  1.00 35.93 ? 299  ALA B O     1 
ATOM   6113  C CB    . ALA C 1 247 ? 22.247  22.481  1.775  1.00 32.06 ? 299  ALA B CB    1 
ATOM   6114  N N     . VAL C 1 248 ? 19.951  24.340  2.291  1.00 33.26 ? 300  VAL B N     1 
ATOM   6115  C CA    . VAL C 1 248 ? 18.960  25.329  1.868  1.00 30.00 ? 300  VAL B CA    1 
ATOM   6116  C C     . VAL C 1 248 ? 19.005  26.491  2.835  1.00 29.91 ? 300  VAL B C     1 
ATOM   6117  O O     . VAL C 1 248 ? 19.038  27.646  2.431  1.00 28.18 ? 300  VAL B O     1 
ATOM   6118  C CB    . VAL C 1 248 ? 17.549  24.748  1.878  1.00 28.25 ? 300  VAL B CB    1 
ATOM   6119  C CG1   . VAL C 1 248 ? 16.596  25.721  1.246  1.00 29.43 ? 300  VAL B CG1   1 
ATOM   6120  C CG2   . VAL C 1 248 ? 17.521  23.437  1.134  1.00 29.15 ? 300  VAL B CG2   1 
ATOM   6121  N N     . ALA C 1 249 ? 19.009  26.161  4.121  1.00 30.87 ? 301  ALA B N     1 
ATOM   6122  C CA    . ALA C 1 249 ? 19.075  27.154  5.180  1.00 32.10 ? 301  ALA B CA    1 
ATOM   6123  C C     . ALA C 1 249 ? 20.275  28.064  4.949  1.00 33.65 ? 301  ALA B C     1 
ATOM   6124  O O     . ALA C 1 249 ? 20.221  29.273  5.190  1.00 31.54 ? 301  ALA B O     1 
ATOM   6125  C CB    . ALA C 1 249 ? 19.210  26.457  6.520  1.00 31.04 ? 301  ALA B CB    1 
ATOM   6126  N N     . MET C 1 250 ? 21.364  27.464  4.479  1.00 36.52 ? 302  MET B N     1 
ATOM   6127  C CA    . MET C 1 250 ? 22.597  28.201  4.219  1.00 39.91 ? 302  MET B CA    1 
ATOM   6128  C C     . MET C 1 250 ? 22.519  29.129  2.988  1.00 40.21 ? 302  MET B C     1 
ATOM   6129  O O     . MET C 1 250 ? 22.890  30.299  3.077  1.00 40.64 ? 302  MET B O     1 
ATOM   6130  C CB    . MET C 1 250 ? 23.774  27.220  4.075  1.00 41.14 ? 302  MET B CB    1 
ATOM   6131  C CG    . MET C 1 250 ? 25.159  27.867  4.200  1.00 42.31 ? 302  MET B CG    1 
ATOM   6132  S SD    . MET C 1 250 ? 25.527  28.511  5.868  1.00 42.88 ? 302  MET B SD    1 
ATOM   6133  C CE    . MET C 1 250 ? 26.663  27.264  6.471  1.00 40.19 ? 302  MET B CE    1 
ATOM   6134  N N     . ARG C 1 251 ? 22.064  28.620  1.843  1.00 40.43 ? 303  ARG B N     1 
ATOM   6135  C CA    . ARG C 1 251 ? 21.945  29.463  0.655  1.00 40.39 ? 303  ARG B CA    1 
ATOM   6136  C C     . ARG C 1 251 ? 20.966  30.570  1.004  1.00 39.78 ? 303  ARG B C     1 
ATOM   6137  O O     . ARG C 1 251 ? 21.114  31.705  0.568  1.00 38.86 ? 303  ARG B O     1 
ATOM   6138  C CB    . ARG C 1 251 ? 21.408  28.662  -0.541 1.00 43.22 ? 303  ARG B CB    1 
ATOM   6139  C CG    . ARG C 1 251 ? 21.068  29.511  -1.798 1.00 46.50 ? 303  ARG B CG    1 
ATOM   6140  C CD    . ARG C 1 251 ? 22.067  29.397  -2.979 1.00 48.61 ? 303  ARG B CD    1 
ATOM   6141  N NE    . ARG C 1 251 ? 22.916  28.220  -2.895 1.00 48.49 ? 303  ARG B NE    1 
ATOM   6142  C CZ    . ARG C 1 251 ? 23.516  27.655  -3.934 1.00 49.88 ? 303  ARG B CZ    1 
ATOM   6143  N NH1   . ARG C 1 251 ? 23.347  28.157  -5.154 1.00 49.32 ? 303  ARG B NH1   1 
ATOM   6144  N NH2   . ARG C 1 251 ? 24.319  26.611  -3.744 1.00 49.64 ? 303  ARG B NH2   1 
ATOM   6145  N N     . LEU C 1 252 ? 19.964  30.219  1.802  1.00 40.89 ? 304  LEU B N     1 
ATOM   6146  C CA    . LEU C 1 252 ? 18.942  31.160  2.239  1.00 42.63 ? 304  LEU B CA    1 
ATOM   6147  C C     . LEU C 1 252 ? 19.636  32.291  2.985  1.00 43.70 ? 304  LEU B C     1 
ATOM   6148  O O     . LEU C 1 252 ? 19.511  33.466  2.635  1.00 44.12 ? 304  LEU B O     1 
ATOM   6149  C CB    . LEU C 1 252 ? 17.966  30.456  3.173  1.00 44.44 ? 304  LEU B CB    1 
ATOM   6150  C CG    . LEU C 1 252 ? 16.560  31.033  3.271  1.00 46.59 ? 304  LEU B CG    1 
ATOM   6151  C CD1   . LEU C 1 252 ? 15.913  30.986  1.903  1.00 46.93 ? 304  LEU B CD1   1 
ATOM   6152  C CD2   . LEU C 1 252 ? 15.742  30.224  4.270  1.00 48.22 ? 304  LEU B CD2   1 
ATOM   6153  N N     . LEU C 1 253 ? 20.377  31.913  4.020  1.00 44.58 ? 305  LEU B N     1 
ATOM   6154  C CA    . LEU C 1 253 ? 21.128  32.865  4.822  1.00 44.08 ? 305  LEU B CA    1 
ATOM   6155  C C     . LEU C 1 253 ? 22.036  33.683  3.902  1.00 43.76 ? 305  LEU B C     1 
ATOM   6156  O O     . LEU C 1 253 ? 22.174  34.899  4.069  1.00 43.84 ? 305  LEU B O     1 
ATOM   6157  C CB    . LEU C 1 253 ? 21.975  32.117  5.862  1.00 43.69 ? 305  LEU B CB    1 
ATOM   6158  C CG    . LEU C 1 253 ? 22.596  32.951  6.988  1.00 43.84 ? 305  LEU B CG    1 
ATOM   6159  C CD1   . LEU C 1 253 ? 21.544  33.238  8.040  1.00 42.67 ? 305  LEU B CD1   1 
ATOM   6160  C CD2   . LEU C 1 253 ? 23.761  32.208  7.610  1.00 44.20 ? 305  LEU B CD2   1 
ATOM   6161  N N     . THR C 1 254 ? 22.646  33.008  2.928  1.00 44.03 ? 306  THR B N     1 
ATOM   6162  C CA    . THR C 1 254 ? 23.554  33.654  1.978  1.00 44.22 ? 306  THR B CA    1 
ATOM   6163  C C     . THR C 1 254 ? 22.849  34.744  1.188  1.00 45.98 ? 306  THR B C     1 
ATOM   6164  O O     . THR C 1 254 ? 23.293  35.899  1.172  1.00 46.24 ? 306  THR B O     1 
ATOM   6165  C CB    . THR C 1 254 ? 24.154  32.639  0.984  1.00 41.80 ? 306  THR B CB    1 
ATOM   6166  O OG1   . THR C 1 254 ? 25.029  31.741  1.676  1.00 42.42 ? 306  THR B OG1   1 
ATOM   6167  C CG2   . THR C 1 254 ? 24.940  33.348  -0.067 1.00 39.73 ? 306  THR B CG2   1 
ATOM   6168  N N     . LYS C 1 255 ? 21.751  34.374  0.534  1.00 46.96 ? 307  LYS B N     1 
ATOM   6169  C CA    . LYS C 1 255 ? 20.983  35.326  -0.250 1.00 48.39 ? 307  LYS B CA    1 
ATOM   6170  C C     . LYS C 1 255 ? 20.661  36.533  0.607  1.00 49.57 ? 307  LYS B C     1 
ATOM   6171  O O     . LYS C 1 255 ? 20.906  37.662  0.199  1.00 50.20 ? 307  LYS B O     1 
ATOM   6172  C CB    . LYS C 1 255 ? 19.693  34.687  -0.761 1.00 50.30 ? 307  LYS B CB    1 
ATOM   6173  C CG    . LYS C 1 255 ? 19.863  33.844  -2.029 1.00 52.20 ? 307  LYS B CG    1 
ATOM   6174  C CD    . LYS C 1 255 ? 18.534  33.200  -2.415 1.00 55.34 ? 307  LYS B CD    1 
ATOM   6175  C CE    . LYS C 1 255 ? 18.655  32.286  -3.633 1.00 58.75 ? 307  LYS B CE    1 
ATOM   6176  N NZ    . LYS C 1 255 ? 17.424  31.438  -3.803 1.00 59.43 ? 307  LYS B NZ    1 
ATOM   6177  N N     . TYR C 1 256 ? 20.117  36.297  1.800  1.00 51.03 ? 308  TYR B N     1 
ATOM   6178  C CA    . TYR C 1 256 ? 19.797  37.396  2.707  1.00 51.63 ? 308  TYR B CA    1 
ATOM   6179  C C     . TYR C 1 256 ? 21.060  38.194  3.043  1.00 52.60 ? 308  TYR B C     1 
ATOM   6180  O O     . TYR C 1 256 ? 21.067  39.422  2.953  1.00 52.21 ? 308  TYR B O     1 
ATOM   6181  C CB    . TYR C 1 256 ? 19.151  36.877  4.002  1.00 51.60 ? 308  TYR B CB    1 
ATOM   6182  C CG    . TYR C 1 256 ? 17.749  36.353  3.816  1.00 51.17 ? 308  TYR B CG    1 
ATOM   6183  C CD1   . TYR C 1 256 ? 16.758  37.159  3.274  1.00 51.00 ? 308  TYR B CD1   1 
ATOM   6184  C CD2   . TYR C 1 256 ? 17.421  35.040  4.141  1.00 51.40 ? 308  TYR B CD2   1 
ATOM   6185  C CE1   . TYR C 1 256 ? 15.480  36.673  3.054  1.00 50.45 ? 308  TYR B CE1   1 
ATOM   6186  C CE2   . TYR C 1 256 ? 16.142  34.543  3.921  1.00 50.07 ? 308  TYR B CE2   1 
ATOM   6187  C CZ    . TYR C 1 256 ? 15.178  35.368  3.375  1.00 49.63 ? 308  TYR B CZ    1 
ATOM   6188  O OH    . TYR C 1 256 ? 13.913  34.889  3.125  1.00 50.52 ? 308  TYR B OH    1 
ATOM   6189  N N     . MET C 1 257 ? 22.130  37.498  3.421  1.00 53.28 ? 309  MET B N     1 
ATOM   6190  C CA    . MET C 1 257 ? 23.376  38.175  3.767  1.00 54.71 ? 309  MET B CA    1 
ATOM   6191  C C     . MET C 1 257 ? 23.926  38.930  2.569  1.00 55.94 ? 309  MET B C     1 
ATOM   6192  O O     . MET C 1 257 ? 24.881  39.699  2.687  1.00 56.17 ? 309  MET B O     1 
ATOM   6193  C CB    . MET C 1 257 ? 24.435  37.175  4.242  1.00 53.84 ? 309  MET B CB    1 
ATOM   6194  C CG    . MET C 1 257 ? 24.173  36.545  5.591  1.00 52.56 ? 309  MET B CG    1 
ATOM   6195  S SD    . MET C 1 257 ? 25.680  35.786  6.208  1.00 51.73 ? 309  MET B SD    1 
ATOM   6196  C CE    . MET C 1 257 ? 25.762  34.307  5.208  1.00 51.06 ? 309  MET B CE    1 
ATOM   6197  N N     . ASN C 1 258 ? 23.319  38.706  1.414  1.00 57.51 ? 310  ASN B N     1 
ATOM   6198  C CA    . ASN C 1 258 ? 23.774  39.349  0.200  1.00 60.02 ? 310  ASN B CA    1 
ATOM   6199  C C     . ASN C 1 258 ? 22.788  40.369  -0.352 1.00 61.80 ? 310  ASN B C     1 
ATOM   6200  O O     . ASN C 1 258 ? 23.079  41.035  -1.355 1.00 61.71 ? 310  ASN B O     1 
ATOM   6201  C CB    . ASN C 1 258 ? 24.060  38.283  -0.838 1.00 59.37 ? 310  ASN B CB    1 
ATOM   6202  C CG    . ASN C 1 258 ? 25.457  38.364  -1.361 1.00 59.37 ? 310  ASN B CG    1 
ATOM   6203  O OD1   . ASN C 1 258 ? 25.826  39.322  -2.055 1.00 59.80 ? 310  ASN B OD1   1 
ATOM   6204  N ND2   . ASN C 1 258 ? 26.260  37.360  -1.033 1.00 58.71 ? 310  ASN B ND2   1 
ATOM   6205  N N     . LYS C 1 259 ? 21.624  40.457  0.301  1.00 64.74 ? 311  LYS B N     1 
ATOM   6206  C CA    . LYS C 1 259 ? 20.539  41.385  -0.057 1.00 65.90 ? 311  LYS B CA    1 
ATOM   6207  C C     . LYS C 1 259 ? 19.734  40.969  -1.294 1.00 64.08 ? 311  LYS B C     1 
ATOM   6208  O O     . LYS C 1 259 ? 18.946  41.749  -1.844 1.00 66.74 ? 311  LYS B O     1 
ATOM   6209  C CB    . LYS C 1 259 ? 21.101  42.798  -0.234 1.00 68.91 ? 311  LYS B CB    1 
ATOM   6210  C CG    . LYS C 1 259 ? 21.532  43.489  1.072  1.00 70.41 ? 311  LYS B CG    1 
ATOM   6211  C CD    . LYS C 1 259 ? 20.316  43.701  2.017  1.00 73.65 ? 311  LYS B CD    1 
ATOM   6212  C CE    . LYS C 1 259 ? 20.688  44.213  3.428  1.00 74.49 ? 311  LYS B CE    1 
ATOM   6213  N NZ    . LYS C 1 259 ? 19.476  44.505  4.272  1.00 74.05 ? 311  LYS B NZ    1 
ATOM   6214  N N     . GLU C 1 260 ? 19.906  39.713  -1.702 1.00 64.60 ? 312  GLU B N     1 
ATOM   6215  C CA    . GLU C 1 260 ? 19.199  39.120  -2.848 1.00 60.50 ? 312  GLU B CA    1 
ATOM   6216  C C     . GLU C 1 260 ? 17.700  38.797  -2.545 1.00 59.42 ? 312  GLU B C     1 
ATOM   6217  O O     . GLU C 1 260 ? 17.295  38.606  -1.395 1.00 59.30 ? 312  GLU B O     1 
ATOM   6218  C CB    . GLU C 1 260 ? 19.907  37.830  -3.258 1.00 58.90 ? 312  GLU B CB    1 
ATOM   6219  C CG    . GLU C 1 260 ? 21.231  38.073  -3.961 1.00 60.99 ? 312  GLU B CG    1 
ATOM   6220  C CD    . GLU C 1 260 ? 22.193  36.878  -3.914 1.00 63.38 ? 312  GLU B CD    1 
ATOM   6221  O OE1   . GLU C 1 260 ? 21.771  35.729  -4.188 1.00 64.29 ? 312  GLU B OE1   1 
ATOM   6222  O OE2   . GLU C 1 260 ? 23.391  37.096  -3.615 1.00 64.44 ? 312  GLU B OE2   1 
ATOM   6223  N N     . THR C 1 261 ? 16.877  38.720  -3.586 1.00 60.25 ? 313  THR B N     1 
ATOM   6224  C CA    . THR C 1 261 ? 15.477  38.412  -3.377 1.00 60.63 ? 313  THR B CA    1 
ATOM   6225  C C     . THR C 1 261 ? 15.355  36.929  -3.078 1.00 61.21 ? 313  THR B C     1 
ATOM   6226  O O     . THR C 1 261 ? 16.091  36.103  -3.543 1.00 61.00 ? 313  THR B O     1 
ATOM   6227  C CB    . THR C 1 261 ? 14.589  38.727  -4.615 1.00 61.58 ? 313  THR B CB    1 
ATOM   6228  O OG1   . THR C 1 261 ? 15.119  38.055  -5.771 1.00 62.40 ? 313  THR B OG1   1 
ATOM   6229  C CG2   . THR C 1 261 ? 14.543  40.221  -4.860 1.00 62.03 ? 313  THR B CG2   1 
ATOM   6230  N N     . VAL C 1 262 ? 14.374  36.612  -2.270 1.00 62.20 ? 314  VAL B N     1 
ATOM   6231  C CA    . VAL C 1 262 ? 14.091  35.248  -1.859 1.00 63.01 ? 314  VAL B CA    1 
ATOM   6232  C C     . VAL C 1 262 ? 12.608  35.039  -2.099 1.00 64.28 ? 314  VAL B C     1 
ATOM   6233  O O     . VAL C 1 262 ? 11.766  35.388  -1.281 1.00 65.88 ? 314  VAL B O     1 
ATOM   6234  C CB    . VAL C 1 262 ? 14.472  35.061  -0.377 1.00 61.41 ? 314  VAL B CB    1 
ATOM   6235  C CG1   . VAL C 1 262 ? 13.991  33.706  0.137  1.00 60.17 ? 314  VAL B CG1   1 
ATOM   6236  C CG2   . VAL C 1 262 ? 16.022  35.176  -0.268 1.00 60.34 ? 314  VAL B CG2   1 
ATOM   6237  N N     . ASP C 1 263 ? 12.268  34.444  -3.231 1.00 64.82 ? 315  ASP B N     1 
ATOM   6238  C CA    . ASP C 1 263 ? 10.849  34.285  -3.497 1.00 65.91 ? 315  ASP B CA    1 
ATOM   6239  C C     . ASP C 1 263 ? 10.160  33.183  -2.711 1.00 65.03 ? 315  ASP B C     1 
ATOM   6240  O O     . ASP C 1 263 ? 9.240   32.566  -3.218 1.00 67.04 ? 315  ASP B O     1 
ATOM   6241  C CB    . ASP C 1 263 ? 10.579  34.171  -5.016 1.00 67.95 ? 315  ASP B CB    1 
ATOM   6242  C CG    . ASP C 1 263 ? 11.096  32.879  -5.629 1.00 69.92 ? 315  ASP B CG    1 
ATOM   6243  O OD1   . ASP C 1 263 ? 12.145  32.363  -5.142 1.00 70.57 ? 315  ASP B OD1   1 
ATOM   6244  O OD2   . ASP C 1 263 ? 10.439  32.421  -6.603 1.00 70.37 ? 315  ASP B OD2   1 
ATOM   6245  N N     . SER C 1 264 ? 10.592  32.945  -1.472 1.00 63.05 ? 316  SER B N     1 
ATOM   6246  C CA    . SER C 1 264 ? 10.037  31.941  -0.591 1.00 62.00 ? 316  SER B CA    1 
ATOM   6247  C C     . SER C 1 264 ? 10.945  31.819  0.640  1.00 61.51 ? 316  SER B C     1 
ATOM   6248  O O     . SER C 1 264 ? 11.908  31.031  0.754  1.00 59.24 ? 316  SER B O     1 
ATOM   6249  C CB    . SER C 1 264 ? 9.911   30.595  -1.246 1.00 61.92 ? 316  SER B CB    1 
ATOM   6250  O OG    . SER C 1 264 ? 9.039   29.802  -0.456 1.00 63.13 ? 316  SER B OG    1 
ATOM   6251  N N     . SER C 1 265 ? 10.562  32.586  1.643  1.00 59.44 ? 317  SER B N     1 
ATOM   6252  C CA    . SER C 1 265 ? 11.248  32.576  2.931  1.00 60.42 ? 317  SER B CA    1 
ATOM   6253  C C     . SER C 1 265 ? 10.859  31.421  3.857  1.00 60.57 ? 317  SER B C     1 
ATOM   6254  O O     . SER C 1 265 ? 11.430  31.314  4.940  1.00 60.89 ? 317  SER B O     1 
ATOM   6255  C CB    . SER C 1 265 ? 11.016  33.862  3.743  1.00 61.20 ? 317  SER B CB    1 
ATOM   6256  O OG    . SER C 1 265 ? 9.771   33.823  4.415  1.00 60.34 ? 317  SER B OG    1 
ATOM   6257  N N     . ILE C 1 266 ? 9.980   30.528  3.409  1.00 59.23 ? 318  ILE B N     1 
ATOM   6258  C CA    . ILE C 1 266 ? 9.543   29.388  4.206  1.00 57.82 ? 318  ILE B CA    1 
ATOM   6259  C C     . ILE C 1 266 ? 9.670   28.153  3.321  1.00 56.67 ? 318  ILE B C     1 
ATOM   6260  O O     . ILE C 1 266 ? 8.770   27.849  2.542  1.00 57.02 ? 318  ILE B O     1 
ATOM   6261  C CB    . ILE C 1 266 ? 8.068   29.594  4.637  1.00 58.04 ? 318  ILE B CB    1 
ATOM   6262  C CG1   . ILE C 1 266 ? 7.974   30.740  5.656  1.00 57.38 ? 318  ILE B CG1   1 
ATOM   6263  C CG2   . ILE C 1 266 ? 7.467   28.315  5.178  1.00 58.94 ? 318  ILE B CG2   1 
ATOM   6264  C CD1   . ILE C 1 266 ? 8.564   30.418  7.023  1.00 48.94 ? 318  ILE B CD1   1 
ATOM   6265  N N     . VAL C 1 267 ? 10.795  27.456  3.431  1.00 55.70 ? 319  VAL B N     1 
ATOM   6266  C CA    . VAL C 1 267 ? 11.015  26.261  2.633  1.00 54.13 ? 319  VAL B CA    1 
ATOM   6267  C C     . VAL C 1 267 ? 10.408  25.071  3.365  1.00 53.49 ? 319  VAL B C     1 
ATOM   6268  O O     . VAL C 1 267 ? 10.044  25.173  4.537  1.00 53.19 ? 319  VAL B O     1 
ATOM   6269  C CB    . VAL C 1 267 ? 12.525  26.013  2.402  1.00 53.23 ? 319  VAL B CB    1 
ATOM   6270  C CG1   . VAL C 1 267 ? 12.729  24.792  1.518  1.00 51.52 ? 319  VAL B CG1   1 
ATOM   6271  C CG2   . VAL C 1 267 ? 13.165  27.247  1.777  1.00 51.60 ? 319  VAL B CG2   1 
ATOM   6272  N N     . GLN C 1 268 ? 10.295  23.946  2.671  1.00 52.28 ? 320  GLN B N     1 
ATOM   6273  C CA    . GLN C 1 268 ? 9.733   22.758  3.275  1.00 52.37 ? 320  GLN B CA    1 
ATOM   6274  C C     . GLN C 1 268 ? 10.156  21.545  2.470  1.00 51.62 ? 320  GLN B C     1 
ATOM   6275  O O     . GLN C 1 268 ? 9.502   21.167  1.502  1.00 52.84 ? 320  GLN B O     1 
ATOM   6276  C CB    . GLN C 1 268 ? 8.215   22.858  3.310  1.00 54.16 ? 320  GLN B CB    1 
ATOM   6277  C CG    . GLN C 1 268 ? 7.585   22.174  4.501  1.00 57.10 ? 320  GLN B CG    1 
ATOM   6278  C CD    . GLN C 1 268 ? 6.092   21.989  4.338  1.00 59.05 ? 320  GLN B CD    1 
ATOM   6279  O OE1   . GLN C 1 268 ? 5.634   21.408  3.353  1.00 61.16 ? 320  GLN B OE1   1 
ATOM   6280  N NE2   . GLN C 1 268 ? 5.323   22.473  5.304  1.00 59.59 ? 320  GLN B NE2   1 
ATOM   6281  N N     . LEU C 1 269 ? 11.264  20.946  2.883  1.00 50.34 ? 321  LEU B N     1 
ATOM   6282  C CA    . LEU C 1 269 ? 11.824  19.776  2.224  1.00 48.41 ? 321  LEU B CA    1 
ATOM   6283  C C     . LEU C 1 269 ? 10.943  18.544  2.321  1.00 47.43 ? 321  LEU B C     1 
ATOM   6284  O O     . LEU C 1 269 ? 10.215  18.356  3.293  1.00 48.24 ? 321  LEU B O     1 
ATOM   6285  C CB    . LEU C 1 269 ? 13.196  19.456  2.818  1.00 47.79 ? 321  LEU B CB    1 
ATOM   6286  C CG    . LEU C 1 269 ? 14.418  20.160  2.224  1.00 47.12 ? 321  LEU B CG    1 
ATOM   6287  C CD1   . LEU C 1 269 ? 14.774  19.467  0.909  1.00 47.36 ? 321  LEU B CD1   1 
ATOM   6288  C CD2   . LEU C 1 269 ? 14.148  21.645  2.021  1.00 44.11 ? 321  LEU B CD2   1 
ATOM   6289  N N     . PRO C 1 270 ? 10.995  17.684  1.298  1.00 46.22 ? 322  PRO B N     1 
ATOM   6290  C CA    . PRO C 1 270 ? 10.183  16.474  1.322  1.00 44.87 ? 322  PRO B CA    1 
ATOM   6291  C C     . PRO C 1 270 ? 10.787  15.504  2.307  1.00 43.46 ? 322  PRO B C     1 
ATOM   6292  O O     . PRO C 1 270 ? 11.985  15.542  2.553  1.00 45.08 ? 322  PRO B O     1 
ATOM   6293  C CB    . PRO C 1 270 ? 10.280  15.973  -0.113 1.00 44.13 ? 322  PRO B CB    1 
ATOM   6294  C CG    . PRO C 1 270 ? 11.649  16.358  -0.492 1.00 44.50 ? 322  PRO B CG    1 
ATOM   6295  C CD    . PRO C 1 270 ? 11.755  17.772  0.039  1.00 45.79 ? 322  PRO B CD    1 
ATOM   6296  N N     . HIS C 1 271 ? 9.953   14.642  2.872  1.00 42.47 ? 323  HIS B N     1 
ATOM   6297  C CA    . HIS C 1 271 ? 10.404  13.642  3.825  1.00 41.22 ? 323  HIS B CA    1 
ATOM   6298  C C     . HIS C 1 271 ? 10.066  12.279  3.255  1.00 40.28 ? 323  HIS B C     1 
ATOM   6299  O O     . HIS C 1 271 ? 9.470   12.181  2.190  1.00 41.26 ? 323  HIS B O     1 
ATOM   6300  C CB    . HIS C 1 271 ? 9.688   13.815  5.171  1.00 42.07 ? 323  HIS B CB    1 
ATOM   6301  C CG    . HIS C 1 271 ? 8.198   13.659  5.096  1.00 42.52 ? 323  HIS B CG    1 
ATOM   6302  N ND1   . HIS C 1 271 ? 7.341   14.731  4.978  1.00 43.51 ? 323  HIS B ND1   1 
ATOM   6303  C CD2   . HIS C 1 271 ? 7.415   12.553  5.091  1.00 44.08 ? 323  HIS B CD2   1 
ATOM   6304  C CE1   . HIS C 1 271 ? 6.096   14.294  4.900  1.00 43.21 ? 323  HIS B CE1   1 
ATOM   6305  N NE2   . HIS C 1 271 ? 6.113   12.975  4.966  1.00 42.86 ? 323  HIS B NE2   1 
ATOM   6306  N N     . ARG C 1 272 ? 10.452  11.229  3.962  1.00 38.79 ? 324  ARG B N     1 
ATOM   6307  C CA    . ARG C 1 272 ? 10.134  9.875   3.538  1.00 38.75 ? 324  ARG B CA    1 
ATOM   6308  C C     . ARG C 1 272 ? 10.277  8.953   4.757  1.00 39.75 ? 324  ARG B C     1 
ATOM   6309  O O     . ARG C 1 272 ? 10.626  9.414   5.843  1.00 39.72 ? 324  ARG B O     1 
ATOM   6310  C CB    . ARG C 1 272 ? 11.048  9.428   2.385  1.00 36.22 ? 324  ARG B CB    1 
ATOM   6311  C CG    . ARG C 1 272 ? 12.527  9.317   2.726  1.00 35.64 ? 324  ARG B CG    1 
ATOM   6312  C CD    . ARG C 1 272 ? 13.238  8.409   1.724  1.00 36.59 ? 324  ARG B CD    1 
ATOM   6313  N NE    . ARG C 1 272 ? 14.596  8.059   2.129  1.00 37.68 ? 324  ARG B NE    1 
ATOM   6314  C CZ    . ARG C 1 272 ? 15.622  8.904   2.118  1.00 40.28 ? 324  ARG B CZ    1 
ATOM   6315  N NH1   . ARG C 1 272 ? 15.452  10.159  1.711  1.00 41.42 ? 324  ARG B NH1   1 
ATOM   6316  N NH2   . ARG C 1 272 ? 16.817  8.501   2.538  1.00 40.77 ? 324  ARG B NH2   1 
ATOM   6317  N N     . ILE C 1 273 ? 9.997   7.664   4.594  1.00 39.95 ? 325  ILE B N     1 
ATOM   6318  C CA    . ILE C 1 273 ? 10.110  6.744   5.718  1.00 40.92 ? 325  ILE B CA    1 
ATOM   6319  C C     . ILE C 1 273 ? 11.106  5.627   5.470  1.00 42.31 ? 325  ILE B C     1 
ATOM   6320  O O     . ILE C 1 273 ? 10.855  4.732   4.669  1.00 43.76 ? 325  ILE B O     1 
ATOM   6321  C CB    . ILE C 1 273 ? 8.764   6.079   6.046  1.00 39.95 ? 325  ILE B CB    1 
ATOM   6322  C CG1   . ILE C 1 273 ? 7.680   7.139   6.219  1.00 40.75 ? 325  ILE B CG1   1 
ATOM   6323  C CG2   . ILE C 1 273 ? 8.904   5.249   7.299  1.00 39.02 ? 325  ILE B CG2   1 
ATOM   6324  C CD1   . ILE C 1 273 ? 8.015   8.214   7.223  1.00 42.31 ? 325  ILE B CD1   1 
ATOM   6325  N N     . GLU C 1 274 ? 12.236  5.665   6.160  1.00 44.14 ? 326  GLU B N     1 
ATOM   6326  C CA    . GLU C 1 274 ? 13.232  4.613   5.999  1.00 46.25 ? 326  GLU B CA    1 
ATOM   6327  C C     . GLU C 1 274 ? 12.790  3.435   6.875  1.00 47.50 ? 326  GLU B C     1 
ATOM   6328  O O     . GLU C 1 274 ? 12.598  3.593   8.083  1.00 46.78 ? 326  GLU B O     1 
ATOM   6329  C CB    . GLU C 1 274 ? 14.613  5.122   6.423  1.00 44.95 ? 326  GLU B CB    1 
ATOM   6330  C CG    . GLU C 1 274 ? 15.763  4.184   6.094  1.00 47.41 ? 326  GLU B CG    1 
ATOM   6331  C CD    . GLU C 1 274 ? 16.030  4.056   4.603  1.00 49.40 ? 326  GLU B CD    1 
ATOM   6332  O OE1   . GLU C 1 274 ? 16.236  5.100   3.941  1.00 51.12 ? 326  GLU B OE1   1 
ATOM   6333  O OE2   . GLU C 1 274 ? 16.043  2.910   4.096  1.00 49.81 ? 326  GLU B OE2   1 
ATOM   6334  N N     . PHE C 1 275 ? 12.609  2.269   6.253  1.00 49.43 ? 327  PHE B N     1 
ATOM   6335  C CA    . PHE C 1 275 ? 12.181  1.055   6.951  1.00 51.53 ? 327  PHE B CA    1 
ATOM   6336  C C     . PHE C 1 275 ? 13.334  0.088   7.202  1.00 52.32 ? 327  PHE B C     1 
ATOM   6337  O O     . PHE C 1 275 ? 14.077  -0.258  6.284  1.00 52.69 ? 327  PHE B O     1 
ATOM   6338  C CB    . PHE C 1 275 ? 11.126  0.302   6.133  1.00 54.00 ? 327  PHE B CB    1 
ATOM   6339  C CG    . PHE C 1 275 ? 9.766   0.946   6.117  1.00 55.72 ? 327  PHE B CG    1 
ATOM   6340  C CD1   . PHE C 1 275 ? 9.554   2.167   5.474  1.00 56.65 ? 327  PHE B CD1   1 
ATOM   6341  C CD2   . PHE C 1 275 ? 8.686   0.307   6.712  1.00 55.79 ? 327  PHE B CD2   1 
ATOM   6342  C CE1   . PHE C 1 275 ? 8.283   2.741   5.421  1.00 55.85 ? 327  PHE B CE1   1 
ATOM   6343  C CE2   . PHE C 1 275 ? 7.415   0.870   6.666  1.00 56.56 ? 327  PHE B CE2   1 
ATOM   6344  C CZ    . PHE C 1 275 ? 7.216   2.093   6.017  1.00 56.41 ? 327  PHE B CZ    1 
ATOM   6345  N N     . ARG C 1 276 ? 13.470  -0.361  8.444  1.00 53.06 ? 328  ARG B N     1 
ATOM   6346  C CA    . ARG C 1 276 ? 14.516  -1.316  8.800  1.00 53.62 ? 328  ARG B CA    1 
ATOM   6347  C C     . ARG C 1 276 ? 13.809  -2.586  9.322  1.00 54.95 ? 328  ARG B C     1 
ATOM   6348  O O     . ARG C 1 276 ? 12.822  -3.035  8.725  1.00 55.03 ? 328  ARG B O     1 
ATOM   6349  C CB    . ARG C 1 276 ? 15.440  -0.752  9.895  1.00 51.48 ? 328  ARG B CB    1 
ATOM   6350  C CG    . ARG C 1 276 ? 15.839  0.722   9.780  1.00 48.38 ? 328  ARG B CG    1 
ATOM   6351  C CD    . ARG C 1 276 ? 16.712  1.003   8.579  1.00 47.60 ? 328  ARG B CD    1 
ATOM   6352  N NE    . ARG C 1 276 ? 17.609  2.163   8.718  1.00 45.39 ? 328  ARG B NE    1 
ATOM   6353  C CZ    . ARG C 1 276 ? 17.257  3.385   9.121  1.00 45.22 ? 328  ARG B CZ    1 
ATOM   6354  N NH1   . ARG C 1 276 ? 16.005  3.661   9.461  1.00 44.40 ? 328  ARG B NH1   1 
ATOM   6355  N NH2   . ARG C 1 276 ? 18.163  4.355   9.145  1.00 44.24 ? 328  ARG B NH2   1 
ATOM   6356  N N     . GLN C 1 277 ? 14.308  -3.138  10.435 1.00 55.36 ? 329  GLN B N     1 
ATOM   6357  C CA    . GLN C 1 277 ? 13.750  -4.346  11.055 1.00 55.57 ? 329  GLN B CA    1 
ATOM   6358  C C     . GLN C 1 277 ? 12.823  -4.112  12.240 1.00 55.09 ? 329  GLN B C     1 
ATOM   6359  O O     . GLN C 1 277 ? 12.101  -5.023  12.641 1.00 55.23 ? 329  GLN B O     1 
ATOM   6360  C CB    . GLN C 1 277 ? 14.862  -5.272  11.555 1.00 57.22 ? 329  GLN B CB    1 
ATOM   6361  C CG    . GLN C 1 277 ? 15.630  -5.993  10.491 1.00 58.71 ? 329  GLN B CG    1 
ATOM   6362  C CD    . GLN C 1 277 ? 16.265  -5.034  9.537  1.00 59.71 ? 329  GLN B CD    1 
ATOM   6363  O OE1   . GLN C 1 277 ? 15.639  -4.595  8.568  1.00 58.23 ? 329  GLN B OE1   1 
ATOM   6364  N NE2   . GLN C 1 277 ? 17.514  -4.675  9.813  1.00 60.40 ? 329  GLN B NE2   1 
ATOM   6365  N N     . SER C 1 278 ? 12.848  -2.919  12.821 1.00 54.87 ? 330  SER B N     1 
ATOM   6366  C CA    . SER C 1 278 ? 12.013  -2.665  13.984 1.00 54.22 ? 330  SER B CA    1 
ATOM   6367  C C     . SER C 1 278 ? 10.541  -2.836  13.668 1.00 55.53 ? 330  SER B C     1 
ATOM   6368  O O     . SER C 1 278 ? 9.728   -2.993  14.570 1.00 56.55 ? 330  SER B O     1 
ATOM   6369  C CB    . SER C 1 278 ? 12.273  -1.268  14.557 1.00 52.47 ? 330  SER B CB    1 
ATOM   6370  O OG    . SER C 1 278 ? 11.849  -0.257  13.673 1.00 49.34 ? 330  SER B OG    1 
ATOM   6371  N N     . THR C 1 279 ? 10.191  -2.814  12.388 1.00 56.95 ? 331  THR B N     1 
ATOM   6372  C CA    . THR C 1 279 ? 8.796   -2.987  12.008 1.00 57.39 ? 331  THR B CA    1 
ATOM   6373  C C     . THR C 1 279 ? 8.620   -4.135  11.024 1.00 57.92 ? 331  THR B C     1 
ATOM   6374  O O     . THR C 1 279 ? 9.597   -4.693  10.510 1.00 55.99 ? 331  THR B O     1 
ATOM   6375  C CB    . THR C 1 279 ? 8.218   -1.715  11.377 1.00 56.80 ? 331  THR B CB    1 
ATOM   6376  O OG1   . THR C 1 279 ? 9.009   -1.353  10.244 1.00 56.92 ? 331  THR B OG1   1 
ATOM   6377  C CG2   . THR C 1 279 ? 8.215   -0.575  12.374 1.00 57.00 ? 331  THR B CG2   1 
ATOM   6378  N N     . LYS C 1 280 ? 7.357   -4.480  10.781 1.00 59.09 ? 332  LYS B N     1 
ATOM   6379  C CA    . LYS C 1 280 ? 6.985   -5.554  9.863  1.00 59.30 ? 332  LYS B CA    1 
ATOM   6380  C C     . LYS C 1 280 ? 6.088   -5.013  8.743  1.00 59.01 ? 332  LYS B C     1 
ATOM   6381  O O     . LYS C 1 280 ? 6.400   -5.265  7.548  1.00 55.73 ? 332  LYS B O     1 
ATOM   6382  C CB    . LYS C 1 280 ? 6.264   -6.675  10.628 1.00 60.73 ? 332  LYS B CB    1 
ATOM   6383  C CG    . LYS C 1 280 ? 7.207   -7.570  11.433 1.00 63.40 ? 332  LYS B CG    1 
ATOM   6384  C CD    . LYS C 1 280 ? 6.479   -8.602  12.303 1.00 64.72 ? 332  LYS B CD    1 
ATOM   6385  C CE    . LYS C 1 280 ? 5.679   -7.931  13.426 1.00 66.27 ? 332  LYS B CE    1 
ATOM   6386  N NZ    . LYS C 1 280 ? 5.249   -8.886  14.496 1.00 65.42 ? 332  LYS B NZ    1 
ATOM   6387  O OXT   . LYS C 1 280 ? 5.085   -4.336  9.081  1.00 61.02 ? 332  LYS B OXT   1 
ATOM   6388  N N     . LYS D 1 6   ? 35.961  42.707  35.024 1.00 47.13 ? 58   LYS I N     1 
ATOM   6389  C CA    . LYS D 1 6   ? 34.472  42.752  34.922 1.00 47.97 ? 58   LYS I CA    1 
ATOM   6390  C C     . LYS D 1 6   ? 33.980  42.569  33.482 1.00 47.66 ? 58   LYS I C     1 
ATOM   6391  O O     . LYS D 1 6   ? 32.775  42.419  33.248 1.00 48.30 ? 58   LYS I O     1 
ATOM   6392  C CB    . LYS D 1 6   ? 33.944  44.076  35.490 1.00 48.70 ? 58   LYS I CB    1 
ATOM   6393  C CG    . LYS D 1 6   ? 32.429  44.226  35.444 1.00 48.65 ? 58   LYS I CG    1 
ATOM   6394  C CD    . LYS D 1 6   ? 31.958  45.156  36.556 1.00 50.31 ? 58   LYS I CD    1 
ATOM   6395  C CE    . LYS D 1 6   ? 30.468  45.440  36.449 1.00 51.12 ? 58   LYS I CE    1 
ATOM   6396  N NZ    . LYS D 1 6   ? 29.678  44.191  36.239 1.00 51.75 ? 58   LYS I NZ    1 
ATOM   6397  N N     . LYS D 1 7   ? 34.908  42.589  32.526 1.00 45.63 ? 59   LYS I N     1 
ATOM   6398  C CA    . LYS D 1 7   ? 34.562  42.396  31.117 1.00 44.21 ? 59   LYS I CA    1 
ATOM   6399  C C     . LYS D 1 7   ? 34.255  40.912  30.962 1.00 44.08 ? 59   LYS I C     1 
ATOM   6400  O O     . LYS D 1 7   ? 34.997  40.066  31.460 1.00 43.72 ? 59   LYS I O     1 
ATOM   6401  C CB    . LYS D 1 7   ? 35.741  42.795  30.215 1.00 43.03 ? 59   LYS I CB    1 
ATOM   6402  C CG    . LYS D 1 7   ? 35.430  42.889  28.719 1.00 40.30 ? 59   LYS I CG    1 
ATOM   6403  C CD    . LYS D 1 7   ? 35.498  41.541  28.009 1.00 40.68 ? 59   LYS I CD    1 
ATOM   6404  C CE    . LYS D 1 7   ? 36.929  41.057  27.770 1.00 39.48 ? 59   LYS I CE    1 
ATOM   6405  N NZ    . LYS D 1 7   ? 36.956  39.599  27.437 1.00 37.52 ? 59   LYS I NZ    1 
ATOM   6406  N N     . THR D 1 8   ? 33.162  40.592  30.283 1.00 43.85 ? 60   THR I N     1 
ATOM   6407  C CA    . THR D 1 8   ? 32.784  39.199  30.100 1.00 43.63 ? 60   THR I CA    1 
ATOM   6408  C C     . THR D 1 8   ? 33.900  38.374  29.468 1.00 43.53 ? 60   THR I C     1 
ATOM   6409  O O     . THR D 1 8   ? 34.629  38.851  28.602 1.00 43.55 ? 60   THR I O     1 
ATOM   6410  C CB    . THR D 1 8   ? 31.539  39.083  29.221 1.00 43.71 ? 60   THR I CB    1 
ATOM   6411  O OG1   . THR D 1 8   ? 30.505  39.921  29.753 1.00 44.66 ? 60   THR I OG1   1 
ATOM   6412  C CG2   . THR D 1 8   ? 31.051  37.650  29.188 1.00 43.22 ? 60   THR I CG2   1 
ATOM   6413  N N     . THR D 1 9   ? 34.058  37.138  29.925 1.00 43.89 ? 61   THR I N     1 
ATOM   6414  C CA    . THR D 1 9   ? 35.084  36.270  29.353 1.00 43.19 ? 61   THR I CA    1 
ATOM   6415  C C     . THR D 1 9   ? 34.389  35.212  28.505 1.00 41.55 ? 61   THR I C     1 
ATOM   6416  O O     . THR D 1 9   ? 33.302  34.723  28.827 1.00 41.47 ? 61   THR I O     1 
ATOM   6417  C CB    . THR D 1 9   ? 35.969  35.558  30.438 1.00 42.84 ? 61   THR I CB    1 
ATOM   6418  O OG1   . THR D 1 9   ? 36.676  36.531  31.221 1.00 41.36 ? 61   THR I OG1   1 
ATOM   6419  C CG2   . THR D 1 9   ? 36.996  34.660  29.766 1.00 44.02 ? 61   THR I CG2   1 
ATOM   6420  N N     . THR D 1 10  ? 35.011  34.886  27.389 1.00 40.41 ? 62   THR I N     1 
ATOM   6421  C CA    . THR D 1 10  ? 34.449  33.884  26.511 1.00 39.05 ? 62   THR I CA    1 
ATOM   6422  C C     . THR D 1 10  ? 35.594  32.991  26.090 1.00 36.58 ? 62   THR I C     1 
ATOM   6423  O O     . THR D 1 10  ? 36.632  33.468  25.634 1.00 36.14 ? 62   THR I O     1 
ATOM   6424  C CB    . THR D 1 10  ? 33.755  34.526  25.264 1.00 38.82 ? 62   THR I CB    1 
ATOM   6425  O OG1   . THR D 1 10  ? 34.170  33.839  24.078 1.00 39.16 ? 62   THR I OG1   1 
ATOM   6426  C CG2   . THR D 1 10  ? 34.084  36.018  25.149 1.00 40.36 ? 62   THR I CG2   1 
ATOM   6427  N N     . VAL D 1 11  ? 35.428  31.697  26.308 1.00 33.99 ? 63   VAL I N     1 
ATOM   6428  C CA    . VAL D 1 11  ? 36.454  30.750  25.917 1.00 33.00 ? 63   VAL I CA    1 
ATOM   6429  C C     . VAL D 1 11  ? 35.896  29.942  24.758 1.00 32.03 ? 63   VAL I C     1 
ATOM   6430  O O     . VAL D 1 11  ? 34.708  29.625  24.720 1.00 32.00 ? 63   VAL I O     1 
ATOM   6431  C CB    . VAL D 1 11  ? 36.860  29.819  27.101 1.00 31.05 ? 63   VAL I CB    1 
ATOM   6432  C CG1   . VAL D 1 11  ? 35.740  29.740  28.086 1.00 31.41 ? 63   VAL I CG1   1 
ATOM   6433  C CG2   . VAL D 1 11  ? 37.207  28.417  26.596 1.00 30.19 ? 63   VAL I CG2   1 
ATOM   6434  N N     . GLY D 1 12  ? 36.746  29.651  23.789 1.00 31.25 ? 64   GLY I N     1 
ATOM   6435  C CA    . GLY D 1 12  ? 36.290  28.866  22.667 1.00 32.29 ? 64   GLY I CA    1 
ATOM   6436  C C     . GLY D 1 12  ? 36.840  27.462  22.818 1.00 32.56 ? 64   GLY I C     1 
ATOM   6437  O O     . GLY D 1 12  ? 37.963  27.276  23.299 1.00 32.64 ? 64   GLY I O     1 
ATOM   6438  N N     . VAL D 1 13  ? 36.046  26.467  22.450 1.00 31.24 ? 65   VAL I N     1 
ATOM   6439  C CA    . VAL D 1 13  ? 36.519  25.103  22.527 1.00 32.95 ? 65   VAL I CA    1 
ATOM   6440  C C     . VAL D 1 13  ? 36.536  24.531  21.111 1.00 33.59 ? 65   VAL I C     1 
ATOM   6441  O O     . VAL D 1 13  ? 35.625  24.765  20.318 1.00 34.88 ? 65   VAL I O     1 
ATOM   6442  C CB    . VAL D 1 13  ? 35.637  24.255  23.458 1.00 32.41 ? 65   VAL I CB    1 
ATOM   6443  C CG1   . VAL D 1 13  ? 34.208  24.471  23.128 1.00 35.54 ? 65   VAL I CG1   1 
ATOM   6444  C CG2   . VAL D 1 13  ? 35.994  22.779  23.330 1.00 32.62 ? 65   VAL I CG2   1 
ATOM   6445  N N     . ILE D 1 14  ? 37.600  23.803  20.794 1.00 33.28 ? 66   ILE I N     1 
ATOM   6446  C CA    . ILE D 1 14  ? 37.763  23.211  19.481 1.00 31.52 ? 66   ILE I CA    1 
ATOM   6447  C C     . ILE D 1 14  ? 37.637  21.697  19.529 1.00 31.58 ? 66   ILE I C     1 
ATOM   6448  O O     . ILE D 1 14  ? 38.511  21.021  20.062 1.00 28.99 ? 66   ILE I O     1 
ATOM   6449  C CB    . ILE D 1 14  ? 39.146  23.563  18.902 1.00 31.72 ? 66   ILE I CB    1 
ATOM   6450  C CG1   . ILE D 1 14  ? 39.227  25.063  18.613 1.00 33.54 ? 66   ILE I CG1   1 
ATOM   6451  C CG2   . ILE D 1 14  ? 39.408  22.758  17.658 1.00 30.79 ? 66   ILE I CG2   1 
ATOM   6452  C CD1   . ILE D 1 14  ? 40.616  25.574  18.262 1.00 37.88 ? 66   ILE I CD1   1 
ATOM   6453  N N     . ILE D 1 15  ? 36.536  21.169  18.998 1.00 33.70 ? 67   ILE I N     1 
ATOM   6454  C CA    . ILE D 1 15  ? 36.363  19.721  18.940 1.00 36.28 ? 67   ILE I CA    1 
ATOM   6455  C C     . ILE D 1 15  ? 36.622  19.352  17.479 1.00 35.61 ? 67   ILE I C     1 
ATOM   6456  O O     . ILE D 1 15  ? 36.289  20.101  16.563 1.00 35.01 ? 67   ILE I O     1 
ATOM   6457  C CB    . ILE D 1 15  ? 34.937  19.234  19.405 1.00 38.51 ? 67   ILE I CB    1 
ATOM   6458  C CG1   . ILE D 1 15  ? 33.916  19.285  18.263 1.00 40.61 ? 67   ILE I CG1   1 
ATOM   6459  C CG2   . ILE D 1 15  ? 34.466  20.075  20.576 1.00 40.58 ? 67   ILE I CG2   1 
ATOM   6460  C CD1   . ILE D 1 15  ? 33.397  20.670  17.921 1.00 43.55 ? 67   ILE I CD1   1 
ATOM   6461  N N     . PRO D 1 16  ? 37.245  18.200  17.244 1.00 36.05 ? 68   PRO I N     1 
ATOM   6462  C CA    . PRO D 1 16  ? 37.539  17.787  15.872 1.00 36.98 ? 68   PRO I CA    1 
ATOM   6463  C C     . PRO D 1 16  ? 36.377  17.259  15.050 1.00 38.00 ? 68   PRO I C     1 
ATOM   6464  O O     . PRO D 1 16  ? 36.416  17.322  13.826 1.00 38.87 ? 68   PRO I O     1 
ATOM   6465  C CB    . PRO D 1 16  ? 38.617  16.739  16.065 1.00 35.75 ? 68   PRO I CB    1 
ATOM   6466  C CG    . PRO D 1 16  ? 38.180  16.083  17.318 1.00 36.33 ? 68   PRO I CG    1 
ATOM   6467  C CD    . PRO D 1 16  ? 37.785  17.234  18.211 1.00 34.55 ? 68   PRO I CD    1 
ATOM   6468  N N     . ASP D 1 17  ? 35.349  16.742  15.716 1.00 38.86 ? 69   ASP I N     1 
ATOM   6469  C CA    . ASP D 1 17  ? 34.196  16.178  15.020 1.00 38.95 ? 69   ASP I CA    1 
ATOM   6470  C C     . ASP D 1 17  ? 32.939  16.194  15.876 1.00 38.81 ? 69   ASP I C     1 
ATOM   6471  O O     . ASP D 1 17  ? 32.704  15.290  16.679 1.00 37.76 ? 69   ASP I O     1 
ATOM   6472  C CB    . ASP D 1 17  ? 34.509  14.745  14.587 1.00 40.40 ? 69   ASP I CB    1 
ATOM   6473  C CG    . ASP D 1 17  ? 33.297  14.025  14.014 1.00 42.32 ? 69   ASP I CG    1 
ATOM   6474  O OD1   . ASP D 1 17  ? 32.346  14.714  13.572 1.00 40.52 ? 69   ASP I OD1   1 
ATOM   6475  O OD2   . ASP D 1 17  ? 33.310  12.768  13.995 1.00 43.09 ? 69   ASP I OD2   1 
ATOM   6476  N N     . ILE D 1 18  ? 32.122  17.220  15.671 1.00 39.19 ? 70   ILE I N     1 
ATOM   6477  C CA    . ILE D 1 18  ? 30.887  17.400  16.418 1.00 39.10 ? 70   ILE I CA    1 
ATOM   6478  C C     . ILE D 1 18  ? 29.946  16.193  16.343 1.00 39.32 ? 70   ILE I C     1 
ATOM   6479  O O     . ILE D 1 18  ? 29.031  16.060  17.151 1.00 40.21 ? 70   ILE I O     1 
ATOM   6480  C CB    . ILE D 1 18  ? 30.159  18.680  15.929 1.00 40.28 ? 70   ILE I CB    1 
ATOM   6481  C CG1   . ILE D 1 18  ? 29.097  19.100  16.951 1.00 41.18 ? 70   ILE I CG1   1 
ATOM   6482  C CG2   . ILE D 1 18  ? 29.548  18.445  14.549 1.00 38.91 ? 70   ILE I CG2   1 
ATOM   6483  C CD1   . ILE D 1 18  ? 28.643  20.551  16.814 1.00 42.86 ? 70   ILE I CD1   1 
ATOM   6484  N N     . SER D 1 19  ? 30.175  15.308  15.382 1.00 40.14 ? 71   SER I N     1 
ATOM   6485  C CA    . SER D 1 19  ? 29.336  14.123  15.226 1.00 40.86 ? 71   SER I CA    1 
ATOM   6486  C C     . SER D 1 19  ? 29.742  13.018  16.187 1.00 40.90 ? 71   SER I C     1 
ATOM   6487  O O     . SER D 1 19  ? 28.950  12.115  16.457 1.00 42.30 ? 71   SER I O     1 
ATOM   6488  C CB    . SER D 1 19  ? 29.412  13.580  13.794 1.00 40.87 ? 71   SER I CB    1 
ATOM   6489  O OG    . SER D 1 19  ? 28.292  13.984  13.030 1.00 42.20 ? 71   SER I OG    1 
ATOM   6490  N N     . ASN D 1 20  ? 30.972  13.079  16.690 1.00 39.07 ? 72   ASN I N     1 
ATOM   6491  C CA    . ASN D 1 20  ? 31.458  12.064  17.622 1.00 38.40 ? 72   ASN I CA    1 
ATOM   6492  C C     . ASN D 1 20  ? 30.873  12.276  19.017 1.00 36.20 ? 72   ASN I C     1 
ATOM   6493  O O     . ASN D 1 20  ? 31.035  13.338  19.608 1.00 35.93 ? 72   ASN I O     1 
ATOM   6494  C CB    . ASN D 1 20  ? 32.981  12.108  17.690 1.00 39.79 ? 72   ASN I CB    1 
ATOM   6495  C CG    . ASN D 1 20  ? 33.538  11.240  18.790 1.00 40.79 ? 72   ASN I CG    1 
ATOM   6496  O OD1   . ASN D 1 20  ? 34.713  11.330  19.110 1.00 43.06 ? 72   ASN I OD1   1 
ATOM   6497  N ND2   . ASN D 1 20  ? 32.699  10.389  19.374 1.00 42.47 ? 72   ASN I ND2   1 
ATOM   6498  N N     . ILE D 1 21  ? 30.215  11.256  19.554 1.00 34.10 ? 73   ILE I N     1 
ATOM   6499  C CA    . ILE D 1 21  ? 29.596  11.381  20.864 1.00 32.99 ? 73   ILE I CA    1 
ATOM   6500  C C     . ILE D 1 21  ? 30.555  11.819  21.958 1.00 32.01 ? 73   ILE I C     1 
ATOM   6501  O O     . ILE D 1 21  ? 30.206  12.646  22.786 1.00 31.06 ? 73   ILE I O     1 
ATOM   6502  C CB    . ILE D 1 21  ? 28.914  10.063  21.308 1.00 33.32 ? 73   ILE I CB    1 
ATOM   6503  C CG1   . ILE D 1 21  ? 28.044  9.511   20.173 1.00 36.07 ? 73   ILE I CG1   1 
ATOM   6504  C CG2   . ILE D 1 21  ? 28.026  10.320  22.520 1.00 32.32 ? 73   ILE I CG2   1 
ATOM   6505  C CD1   . ILE D 1 21  ? 26.958  10.464  19.655 1.00 39.53 ? 73   ILE I CD1   1 
ATOM   6506  N N     . PHE D 1 22  ? 31.766  11.280  21.966 1.00 32.36 ? 74   PHE I N     1 
ATOM   6507  C CA    . PHE D 1 22  ? 32.712  11.644  23.006 1.00 33.06 ? 74   PHE I CA    1 
ATOM   6508  C C     . PHE D 1 22  ? 33.050  13.137  23.048 1.00 33.38 ? 74   PHE I C     1 
ATOM   6509  O O     . PHE D 1 22  ? 32.906  13.785  24.087 1.00 33.83 ? 74   PHE I O     1 
ATOM   6510  C CB    . PHE D 1 22  ? 33.998  10.824  22.884 1.00 32.82 ? 74   PHE I CB    1 
ATOM   6511  C CG    . PHE D 1 22  ? 34.986  11.128  23.955 1.00 32.39 ? 74   PHE I CG    1 
ATOM   6512  C CD1   . PHE D 1 22  ? 36.089  11.924  23.696 1.00 32.75 ? 74   PHE I CD1   1 
ATOM   6513  C CD2   . PHE D 1 22  ? 34.770  10.689  25.251 1.00 32.47 ? 74   PHE I CD2   1 
ATOM   6514  C CE1   . PHE D 1 22  ? 36.964  12.279  24.719 1.00 32.40 ? 74   PHE I CE1   1 
ATOM   6515  C CE2   . PHE D 1 22  ? 35.639  11.039  26.280 1.00 32.89 ? 74   PHE I CE2   1 
ATOM   6516  C CZ    . PHE D 1 22  ? 36.734  11.834  26.015 1.00 31.44 ? 74   PHE I CZ    1 
ATOM   6517  N N     . TYR D 1 23  ? 33.502  13.686  21.929 1.00 32.39 ? 75   TYR I N     1 
ATOM   6518  C CA    . TYR D 1 23  ? 33.841  15.099  21.891 1.00 31.95 ? 75   TYR I CA    1 
ATOM   6519  C C     . TYR D 1 23  ? 32.647  16.004  22.197 1.00 31.16 ? 75   TYR I C     1 
ATOM   6520  O O     . TYR D 1 23  ? 32.801  17.068  22.792 1.00 28.45 ? 75   TYR I O     1 
ATOM   6521  C CB    . TYR D 1 23  ? 34.441  15.450  20.533 1.00 32.74 ? 75   TYR I CB    1 
ATOM   6522  C CG    . TYR D 1 23  ? 35.741  14.734  20.269 1.00 31.85 ? 75   TYR I CG    1 
ATOM   6523  C CD1   . TYR D 1 23  ? 36.766  14.724  21.227 1.00 32.51 ? 75   TYR I CD1   1 
ATOM   6524  C CD2   . TYR D 1 23  ? 35.953  14.064  19.072 1.00 30.99 ? 75   TYR I CD2   1 
ATOM   6525  C CE1   . TYR D 1 23  ? 37.972  14.057  20.992 1.00 32.33 ? 75   TYR I CE1   1 
ATOM   6526  C CE2   . TYR D 1 23  ? 37.147  13.399  18.827 1.00 33.51 ? 75   TYR I CE2   1 
ATOM   6527  C CZ    . TYR D 1 23  ? 38.149  13.399  19.791 1.00 33.33 ? 75   TYR I CZ    1 
ATOM   6528  O OH    . TYR D 1 23  ? 39.318  12.724  19.539 1.00 37.42 ? 75   TYR I OH    1 
ATOM   6529  N N     . ALA D 1 24  ? 31.456  15.583  21.790 1.00 31.04 ? 76   ALA I N     1 
ATOM   6530  C CA    . ALA D 1 24  ? 30.264  16.372  22.056 1.00 31.29 ? 76   ALA I CA    1 
ATOM   6531  C C     . ALA D 1 24  ? 29.979  16.304  23.543 1.00 31.40 ? 76   ALA I C     1 
ATOM   6532  O O     . ALA D 1 24  ? 29.795  17.316  24.204 1.00 32.42 ? 76   ALA I O     1 
ATOM   6533  C CB    . ALA D 1 24  ? 29.101  15.830  21.283 1.00 30.66 ? 76   ALA I CB    1 
ATOM   6534  N N     . GLU D 1 25  ? 29.951  15.095  24.068 1.00 32.89 ? 77   GLU I N     1 
ATOM   6535  C CA    . GLU D 1 25  ? 29.710  14.899  25.484 1.00 35.14 ? 77   GLU I CA    1 
ATOM   6536  C C     . GLU D 1 25  ? 30.736  15.708  26.274 1.00 35.33 ? 77   GLU I C     1 
ATOM   6537  O O     . GLU D 1 25  ? 30.393  16.409  27.223 1.00 36.97 ? 77   GLU I O     1 
ATOM   6538  C CB    . GLU D 1 25  ? 29.824  13.412  25.834 1.00 35.66 ? 77   GLU I CB    1 
ATOM   6539  C CG    . GLU D 1 25  ? 29.225  13.053  27.164 1.00 37.61 ? 77   GLU I CG    1 
ATOM   6540  C CD    . GLU D 1 25  ? 28.288  11.870  27.067 1.00 40.57 ? 77   GLU I CD    1 
ATOM   6541  O OE1   . GLU D 1 25  ? 28.759  10.713  26.993 1.00 40.21 ? 77   GLU I OE1   1 
ATOM   6542  O OE2   . GLU D 1 25  ? 27.062  12.102  27.054 1.00 45.26 ? 77   GLU I OE2   1 
ATOM   6543  N N     . LEU D 1 26  ? 31.998  15.621  25.888 1.00 34.82 ? 78   LEU I N     1 
ATOM   6544  C CA    . LEU D 1 26  ? 33.001  16.380  26.597 1.00 35.19 ? 78   LEU I CA    1 
ATOM   6545  C C     . LEU D 1 26  ? 32.636  17.861  26.511 1.00 35.65 ? 78   LEU I C     1 
ATOM   6546  O O     . LEU D 1 26  ? 32.411  18.502  27.526 1.00 37.30 ? 78   LEU I O     1 
ATOM   6547  C CB    . LEU D 1 26  ? 34.375  16.134  25.991 1.00 35.72 ? 78   LEU I CB    1 
ATOM   6548  C CG    . LEU D 1 26  ? 35.489  15.922  27.014 1.00 37.13 ? 78   LEU I CG    1 
ATOM   6549  C CD1   . LEU D 1 26  ? 36.807  15.808  26.275 1.00 38.65 ? 78   LEU I CD1   1 
ATOM   6550  C CD2   . LEU D 1 26  ? 35.550  17.070  28.002 1.00 36.40 ? 78   LEU I CD2   1 
ATOM   6551  N N     . ALA D 1 27  ? 32.556  18.396  25.298 1.00 37.35 ? 79   ALA I N     1 
ATOM   6552  C CA    . ALA D 1 27  ? 32.210  19.806  25.083 1.00 37.49 ? 79   ALA I CA    1 
ATOM   6553  C C     . ALA D 1 27  ? 31.042  20.219  25.962 1.00 38.68 ? 79   ALA I C     1 
ATOM   6554  O O     . ALA D 1 27  ? 31.081  21.262  26.623 1.00 39.26 ? 79   ALA I O     1 
ATOM   6555  C CB    . ALA D 1 27  ? 31.859  20.039  23.627 1.00 36.19 ? 79   ALA I CB    1 
ATOM   6556  N N     . ARG D 1 28  ? 30.002  19.391  25.955 1.00 39.33 ? 80   ARG I N     1 
ATOM   6557  C CA    . ARG D 1 28  ? 28.809  19.622  26.750 1.00 39.77 ? 80   ARG I CA    1 
ATOM   6558  C C     . ARG D 1 28  ? 29.174  19.918  28.206 1.00 39.51 ? 80   ARG I C     1 
ATOM   6559  O O     . ARG D 1 28  ? 28.681  20.870  28.800 1.00 38.54 ? 80   ARG I O     1 
ATOM   6560  C CB    . ARG D 1 28  ? 27.916  18.392  26.694 1.00 42.22 ? 80   ARG I CB    1 
ATOM   6561  C CG    . ARG D 1 28  ? 26.538  18.633  27.237 1.00 46.79 ? 80   ARG I CG    1 
ATOM   6562  C CD    . ARG D 1 28  ? 25.855  19.680  26.388 1.00 51.54 ? 80   ARG I CD    1 
ATOM   6563  N NE    . ARG D 1 28  ? 24.591  20.112  26.963 1.00 55.19 ? 80   ARG I NE    1 
ATOM   6564  C CZ    . ARG D 1 28  ? 23.795  21.013  26.404 1.00 56.95 ? 80   ARG I CZ    1 
ATOM   6565  N NH1   . ARG D 1 28  ? 24.139  21.579  25.254 1.00 58.83 ? 80   ARG I NH1   1 
ATOM   6566  N NH2   . ARG D 1 28  ? 22.650  21.338  26.986 1.00 57.61 ? 80   ARG I NH2   1 
ATOM   6567  N N     . GLY D 1 29  ? 30.040  19.086  28.772 1.00 40.16 ? 81   GLY I N     1 
ATOM   6568  C CA    . GLY D 1 29  ? 30.469  19.280  30.144 1.00 41.39 ? 81   GLY I CA    1 
ATOM   6569  C C     . GLY D 1 29  ? 31.266  20.556  30.307 1.00 41.89 ? 81   GLY I C     1 
ATOM   6570  O O     . GLY D 1 29  ? 31.189  21.212  31.341 1.00 41.25 ? 81   GLY I O     1 
ATOM   6571  N N     . ILE D 1 30  ? 32.031  20.906  29.278 1.00 43.29 ? 82   ILE I N     1 
ATOM   6572  C CA    . ILE D 1 30  ? 32.839  22.121  29.293 1.00 45.48 ? 82   ILE I CA    1 
ATOM   6573  C C     . ILE D 1 30  ? 31.958  23.365  29.459 1.00 47.20 ? 82   ILE I C     1 
ATOM   6574  O O     . ILE D 1 30  ? 32.243  24.242  30.274 1.00 47.48 ? 82   ILE I O     1 
ATOM   6575  C CB    . ILE D 1 30  ? 33.637  22.285  27.983 1.00 44.04 ? 82   ILE I CB    1 
ATOM   6576  C CG1   . ILE D 1 30  ? 34.592  21.108  27.780 1.00 44.12 ? 82   ILE I CG1   1 
ATOM   6577  C CG2   . ILE D 1 30  ? 34.415  23.578  28.021 1.00 43.52 ? 82   ILE I CG2   1 
ATOM   6578  C CD1   . ILE D 1 30  ? 35.838  21.173  28.618 1.00 44.11 ? 82   ILE I CD1   1 
ATOM   6579  N N     . GLU D 1 31  ? 30.885  23.445  28.686 1.00 49.23 ? 83   GLU I N     1 
ATOM   6580  C CA    . GLU D 1 31  ? 30.011  24.606  28.770 1.00 52.11 ? 83   GLU I CA    1 
ATOM   6581  C C     . GLU D 1 31  ? 29.225  24.682  30.072 1.00 51.62 ? 83   GLU I C     1 
ATOM   6582  O O     . GLU D 1 31  ? 28.800  25.766  30.477 1.00 53.01 ? 83   GLU I O     1 
ATOM   6583  C CB    . GLU D 1 31  ? 29.068  24.641  27.570 1.00 54.64 ? 83   GLU I CB    1 
ATOM   6584  C CG    . GLU D 1 31  ? 28.457  23.312  27.256 1.00 58.52 ? 83   GLU I CG    1 
ATOM   6585  C CD    . GLU D 1 31  ? 27.639  23.357  25.995 1.00 60.76 ? 83   GLU I CD    1 
ATOM   6586  O OE1   . GLU D 1 31  ? 28.194  23.743  24.938 1.00 60.62 ? 83   GLU I OE1   1 
ATOM   6587  O OE2   . GLU D 1 31  ? 26.442  23.004  26.069 1.00 63.02 ? 83   GLU I OE2   1 
ATOM   6588  N N     . ASP D 1 32  ? 29.022  23.539  30.721 1.00 50.65 ? 84   ASP I N     1 
ATOM   6589  C CA    . ASP D 1 32  ? 28.322  23.518  32.000 1.00 48.87 ? 84   ASP I CA    1 
ATOM   6590  C C     . ASP D 1 32  ? 29.284  24.156  32.996 1.00 47.07 ? 84   ASP I C     1 
ATOM   6591  O O     . ASP D 1 32  ? 28.892  24.975  33.813 1.00 46.78 ? 84   ASP I O     1 
ATOM   6592  C CB    . ASP D 1 32  ? 27.993  22.080  32.415 1.00 50.71 ? 84   ASP I CB    1 
ATOM   6593  C CG    . ASP D 1 32  ? 26.768  21.519  31.689 1.00 52.68 ? 84   ASP I CG    1 
ATOM   6594  O OD1   . ASP D 1 32  ? 26.641  21.719  30.458 1.00 54.60 ? 84   ASP I OD1   1 
ATOM   6595  O OD2   . ASP D 1 32  ? 25.931  20.865  32.352 1.00 53.33 ? 84   ASP I OD2   1 
ATOM   6596  N N     . ILE D 1 33  ? 30.556  23.782  32.909 1.00 45.48 ? 85   ILE I N     1 
ATOM   6597  C CA    . ILE D 1 33  ? 31.572  24.351  33.781 1.00 44.91 ? 85   ILE I CA    1 
ATOM   6598  C C     . ILE D 1 33  ? 31.574  25.859  33.528 1.00 45.85 ? 85   ILE I C     1 
ATOM   6599  O O     . ILE D 1 33  ? 31.533  26.662  34.454 1.00 46.24 ? 85   ILE I O     1 
ATOM   6600  C CB    . ILE D 1 33  ? 32.991  23.819  33.436 1.00 45.00 ? 85   ILE I CB    1 
ATOM   6601  C CG1   . ILE D 1 33  ? 33.007  22.289  33.400 1.00 44.19 ? 85   ILE I CG1   1 
ATOM   6602  C CG2   . ILE D 1 33  ? 34.002  24.332  34.445 1.00 43.32 ? 85   ILE I CG2   1 
ATOM   6603  C CD1   . ILE D 1 33  ? 32.723  21.628  34.712 1.00 43.21 ? 85   ILE I CD1   1 
ATOM   6604  N N     . ALA D 1 34  ? 31.626  26.232  32.255 1.00 46.18 ? 86   ALA I N     1 
ATOM   6605  C CA    . ALA D 1 34  ? 31.651  27.629  31.849 1.00 46.51 ? 86   ALA I CA    1 
ATOM   6606  C C     . ALA D 1 34  ? 30.587  28.509  32.516 1.00 47.43 ? 86   ALA I C     1 
ATOM   6607  O O     . ALA D 1 34  ? 30.865  29.657  32.889 1.00 47.35 ? 86   ALA I O     1 
ATOM   6608  C CB    . ALA D 1 34  ? 31.526  27.719  30.338 1.00 46.08 ? 86   ALA I CB    1 
ATOM   6609  N N     . THR D 1 35  ? 29.373  27.997  32.670 1.00 46.84 ? 87   THR I N     1 
ATOM   6610  C CA    . THR D 1 35  ? 28.338  28.813  33.288 1.00 48.49 ? 87   THR I CA    1 
ATOM   6611  C C     . THR D 1 35  ? 28.570  28.979  34.791 1.00 48.97 ? 87   THR I C     1 
ATOM   6612  O O     . THR D 1 35  ? 28.158  29.972  35.389 1.00 48.54 ? 87   THR I O     1 
ATOM   6613  C CB    . THR D 1 35  ? 26.955  28.223  33.057 1.00 48.98 ? 87   THR I CB    1 
ATOM   6614  O OG1   . THR D 1 35  ? 26.787  27.069  33.885 1.00 51.64 ? 87   THR I OG1   1 
ATOM   6615  C CG2   . THR D 1 35  ? 26.792  27.834  31.598 1.00 49.36 ? 87   THR I CG2   1 
ATOM   6616  N N     . MET D 1 36  ? 29.218  27.996  35.405 1.00 49.37 ? 88   MET I N     1 
ATOM   6617  C CA    . MET D 1 36  ? 29.528  28.075  36.824 1.00 49.75 ? 88   MET I CA    1 
ATOM   6618  C C     . MET D 1 36  ? 30.609  29.158  36.984 1.00 49.41 ? 88   MET I C     1 
ATOM   6619  O O     . MET D 1 36  ? 30.766  29.760  38.051 1.00 48.35 ? 88   MET I O     1 
ATOM   6620  C CB    . MET D 1 36  ? 30.041  26.713  37.319 1.00 51.74 ? 88   MET I CB    1 
ATOM   6621  C CG    . MET D 1 36  ? 30.798  26.745  38.648 1.00 55.67 ? 88   MET I CG    1 
ATOM   6622  S SD    . MET D 1 36  ? 31.558  25.146  39.060 1.00 61.08 ? 88   MET I SD    1 
ATOM   6623  C CE    . MET D 1 36  ? 31.120  24.986  40.861 1.00 59.15 ? 88   MET I CE    1 
ATOM   6624  N N     . TYR D 1 37  ? 31.343  29.401  35.898 1.00 48.51 ? 89   TYR I N     1 
ATOM   6625  C CA    . TYR D 1 37  ? 32.415  30.391  35.869 1.00 46.68 ? 89   TYR I CA    1 
ATOM   6626  C C     . TYR D 1 37  ? 31.966  31.639  35.141 1.00 46.97 ? 89   TYR I C     1 
ATOM   6627  O O     . TYR D 1 37  ? 32.757  32.546  34.960 1.00 46.32 ? 89   TYR I O     1 
ATOM   6628  C CB    . TYR D 1 37  ? 33.625  29.854  35.113 1.00 44.81 ? 89   TYR I CB    1 
ATOM   6629  C CG    . TYR D 1 37  ? 34.560  28.935  35.855 1.00 43.23 ? 89   TYR I CG    1 
ATOM   6630  C CD1   . TYR D 1 37  ? 35.787  29.404  36.340 1.00 42.18 ? 89   TYR I CD1   1 
ATOM   6631  C CD2   . TYR D 1 37  ? 34.294  27.570  35.949 1.00 42.81 ? 89   TYR I CD2   1 
ATOM   6632  C CE1   . TYR D 1 37  ? 36.731  28.532  36.881 1.00 40.39 ? 89   TYR I CE1   1 
ATOM   6633  C CE2   . TYR D 1 37  ? 35.232  26.694  36.493 1.00 41.18 ? 89   TYR I CE2   1 
ATOM   6634  C CZ    . TYR D 1 37  ? 36.444  27.183  36.946 1.00 40.36 ? 89   TYR I CZ    1 
ATOM   6635  O OH    . TYR D 1 37  ? 37.382  26.305  37.410 1.00 41.37 ? 89   TYR I OH    1 
ATOM   6636  N N     . LYS D 1 38  ? 30.709  31.667  34.712 1.00 49.02 ? 90   LYS I N     1 
ATOM   6637  C CA    . LYS D 1 38  ? 30.131  32.787  33.962 1.00 51.56 ? 90   LYS I CA    1 
ATOM   6638  C C     . LYS D 1 38  ? 30.863  33.139  32.666 1.00 51.50 ? 90   LYS I C     1 
ATOM   6639  O O     . LYS D 1 38  ? 30.835  34.293  32.225 1.00 50.54 ? 90   LYS I O     1 
ATOM   6640  C CB    . LYS D 1 38  ? 29.969  34.057  34.834 1.00 54.47 ? 90   LYS I CB    1 
ATOM   6641  C CG    . LYS D 1 38  ? 31.232  34.661  35.500 1.00 58.54 ? 90   LYS I CG    1 
ATOM   6642  C CD    . LYS D 1 38  ? 32.359  35.068  34.528 1.00 60.89 ? 90   LYS I CD    1 
ATOM   6643  C CE    . LYS D 1 38  ? 32.061  36.311  33.698 1.00 63.76 ? 90   LYS I CE    1 
ATOM   6644  N NZ    . LYS D 1 38  ? 33.130  36.517  32.663 1.00 62.61 ? 90   LYS I NZ    1 
ATOM   6645  N N     . TYR D 1 39  ? 31.519  32.149  32.057 1.00 50.94 ? 91   TYR I N     1 
ATOM   6646  C CA    . TYR D 1 39  ? 32.210  32.381  30.788 1.00 49.84 ? 91   TYR I CA    1 
ATOM   6647  C C     . TYR D 1 39  ? 31.270  32.014  29.656 1.00 49.54 ? 91   TYR I C     1 
ATOM   6648  O O     . TYR D 1 39  ? 30.336  31.234  29.833 1.00 48.44 ? 91   TYR I O     1 
ATOM   6649  C CB    . TYR D 1 39  ? 33.428  31.492  30.594 1.00 48.49 ? 91   TYR I CB    1 
ATOM   6650  C CG    . TYR D 1 39  ? 34.519  31.586  31.601 1.00 47.92 ? 91   TYR I CG    1 
ATOM   6651  C CD1   . TYR D 1 39  ? 34.959  32.807  32.087 1.00 49.06 ? 91   TYR I CD1   1 
ATOM   6652  C CD2   . TYR D 1 39  ? 35.174  30.436  32.009 1.00 48.86 ? 91   TYR I CD2   1 
ATOM   6653  C CE1   . TYR D 1 39  ? 36.042  32.872  32.966 1.00 50.08 ? 91   TYR I CE1   1 
ATOM   6654  C CE2   . TYR D 1 39  ? 36.243  30.485  32.870 1.00 49.81 ? 91   TYR I CE2   1 
ATOM   6655  C CZ    . TYR D 1 39  ? 36.678  31.694  33.348 1.00 50.31 ? 91   TYR I CZ    1 
ATOM   6656  O OH    . TYR D 1 39  ? 37.749  31.693  34.208 1.00 51.33 ? 91   TYR I OH    1 
ATOM   6657  N N     . ASN D 1 40  ? 31.534  32.566  28.480 1.00 50.43 ? 92   ASN I N     1 
ATOM   6658  C CA    . ASN D 1 40  ? 30.729  32.251  27.312 1.00 49.05 ? 92   ASN I CA    1 
ATOM   6659  C C     . ASN D 1 40  ? 31.484  31.228  26.488 1.00 47.95 ? 92   ASN I C     1 
ATOM   6660  O O     . ASN D 1 40  ? 32.718  31.198  26.483 1.00 45.80 ? 92   ASN I O     1 
ATOM   6661  C CB    . ASN D 1 40  ? 30.440  33.515  26.512 1.00 49.21 ? 92   ASN I CB    1 
ATOM   6662  C CG    . ASN D 1 40  ? 29.313  34.318  27.119 1.00 49.21 ? 92   ASN I CG    1 
ATOM   6663  O OD1   . ASN D 1 40  ? 29.272  34.511  28.326 1.00 50.96 ? 92   ASN I OD1   1 
ATOM   6664  N ND2   . ASN D 1 40  ? 28.390  34.780  26.291 1.00 49.30 ? 92   ASN I ND2   1 
ATOM   6665  N N     . ILE D 1 41  ? 30.746  30.375  25.797 1.00 48.21 ? 93   ILE I N     1 
ATOM   6666  C CA    . ILE D 1 41  ? 31.406  29.349  25.021 1.00 49.46 ? 93   ILE I CA    1 
ATOM   6667  C C     . ILE D 1 41  ? 31.108  29.318  23.525 1.00 49.80 ? 93   ILE I C     1 
ATOM   6668  O O     . ILE D 1 41  ? 29.990  29.591  23.077 1.00 50.53 ? 93   ILE I O     1 
ATOM   6669  C CB    . ILE D 1 41  ? 31.131  27.974  25.640 1.00 48.65 ? 93   ILE I CB    1 
ATOM   6670  C CG1   . ILE D 1 41  ? 32.441  27.214  25.748 1.00 48.53 ? 93   ILE I CG1   1 
ATOM   6671  C CG2   . ILE D 1 41  ? 30.113  27.194  24.811 1.00 50.98 ? 93   ILE I CG2   1 
ATOM   6672  C CD1   . ILE D 1 41  ? 32.317  25.969  26.548 1.00 47.85 ? 93   ILE I CD1   1 
ATOM   6673  N N     . ILE D 1 42  ? 32.146  28.981  22.767 1.00 49.75 ? 94   ILE I N     1 
ATOM   6674  C CA    . ILE D 1 42  ? 32.091  28.889  21.321 1.00 48.19 ? 94   ILE I CA    1 
ATOM   6675  C C     . ILE D 1 42  ? 32.744  27.594  20.856 1.00 47.28 ? 94   ILE I C     1 
ATOM   6676  O O     . ILE D 1 42  ? 33.938  27.383  21.074 1.00 47.54 ? 94   ILE I O     1 
ATOM   6677  C CB    . ILE D 1 42  ? 32.858  30.039  20.663 1.00 48.40 ? 94   ILE I CB    1 
ATOM   6678  C CG1   . ILE D 1 42  ? 32.111  31.351  20.835 1.00 48.27 ? 94   ILE I CG1   1 
ATOM   6679  C CG2   . ILE D 1 42  ? 33.038  29.762  19.192 1.00 51.70 ? 94   ILE I CG2   1 
ATOM   6680  C CD1   . ILE D 1 42  ? 32.784  32.502  20.117 1.00 45.34 ? 94   ILE I CD1   1 
ATOM   6681  N N     . LEU D 1 43  ? 31.961  26.739  20.210 1.00 46.17 ? 95   LEU I N     1 
ATOM   6682  C CA    . LEU D 1 43  ? 32.458  25.479  19.670 1.00 44.69 ? 95   LEU I CA    1 
ATOM   6683  C C     . LEU D 1 43  ? 32.711  25.597  18.167 1.00 44.78 ? 95   LEU I C     1 
ATOM   6684  O O     . LEU D 1 43  ? 31.892  26.148  17.430 1.00 45.74 ? 95   LEU I O     1 
ATOM   6685  C CB    . LEU D 1 43  ? 31.445  24.364  19.882 1.00 43.99 ? 95   LEU I CB    1 
ATOM   6686  C CG    . LEU D 1 43  ? 31.483  23.597  21.189 1.00 44.52 ? 95   LEU I CG    1 
ATOM   6687  C CD1   . LEU D 1 43  ? 30.473  24.147  22.184 1.00 45.60 ? 95   LEU I CD1   1 
ATOM   6688  C CD2   . LEU D 1 43  ? 31.173  22.160  20.866 1.00 46.32 ? 95   LEU I CD2   1 
ATOM   6689  N N     . SER D 1 44  ? 33.839  25.080  17.704 1.00 43.33 ? 96   SER I N     1 
ATOM   6690  C CA    . SER D 1 44  ? 34.121  25.121  16.285 1.00 42.25 ? 96   SER I CA    1 
ATOM   6691  C C     . SER D 1 44  ? 34.644  23.759  15.850 1.00 42.54 ? 96   SER I C     1 
ATOM   6692  O O     . SER D 1 44  ? 35.330  23.070  16.606 1.00 40.87 ? 96   SER I O     1 
ATOM   6693  C CB    . SER D 1 44  ? 35.143  26.205  15.970 1.00 42.16 ? 96   SER I CB    1 
ATOM   6694  O OG    . SER D 1 44  ? 36.406  25.870  16.510 1.00 42.94 ? 96   SER I OG    1 
ATOM   6695  N N     . ASN D 1 45  ? 34.293  23.372  14.628 1.00 43.17 ? 97   ASN I N     1 
ATOM   6696  C CA    . ASN D 1 45  ? 34.722  22.101  14.058 1.00 43.20 ? 97   ASN I CA    1 
ATOM   6697  C C     . ASN D 1 45  ? 36.031  22.311  13.309 1.00 43.74 ? 97   ASN I C     1 
ATOM   6698  O O     . ASN D 1 45  ? 36.222  23.345  12.679 1.00 44.28 ? 97   ASN I O     1 
ATOM   6699  C CB    . ASN D 1 45  ? 33.672  21.601  13.077 1.00 43.43 ? 97   ASN I CB    1 
ATOM   6700  C CG    . ASN D 1 45  ? 33.201  20.211  13.391 1.00 44.28 ? 97   ASN I CG    1 
ATOM   6701  O OD1   . ASN D 1 45  ? 32.766  19.928  14.509 1.00 45.84 ? 97   ASN I OD1   1 
ATOM   6702  N ND2   . ASN D 1 45  ? 33.268  19.330  12.402 1.00 44.73 ? 97   ASN I ND2   1 
ATOM   6703  N N     . SER D 1 46  ? 36.928  21.335  13.377 1.00 44.70 ? 98   SER I N     1 
ATOM   6704  C CA    . SER D 1 46  ? 38.209  21.420  12.685 1.00 45.72 ? 98   SER I CA    1 
ATOM   6705  C C     . SER D 1 46  ? 38.329  20.261  11.691 1.00 46.59 ? 98   SER I C     1 
ATOM   6706  O O     . SER D 1 46  ? 39.250  20.221  10.868 1.00 45.77 ? 98   SER I O     1 
ATOM   6707  C CB    . SER D 1 46  ? 39.362  21.370  13.695 1.00 46.84 ? 98   SER I CB    1 
ATOM   6708  O OG    . SER D 1 46  ? 39.478  20.089  14.304 1.00 48.95 ? 98   SER I OG    1 
ATOM   6709  N N     . ASP D 1 47  ? 37.381  19.329  11.784 1.00 47.59 ? 99   ASP I N     1 
ATOM   6710  C CA    . ASP D 1 47  ? 37.310  18.145  10.929 1.00 49.15 ? 99   ASP I CA    1 
ATOM   6711  C C     . ASP D 1 47  ? 38.560  17.301  10.984 1.00 50.10 ? 99   ASP I C     1 
ATOM   6712  O O     . ASP D 1 47  ? 38.872  16.589  10.030 1.00 49.58 ? 99   ASP I O     1 
ATOM   6713  C CB    . ASP D 1 47  ? 37.035  18.536  9.482  1.00 49.43 ? 99   ASP I CB    1 
ATOM   6714  C CG    . ASP D 1 47  ? 35.730  19.273  9.323  1.00 51.61 ? 99   ASP I CG    1 
ATOM   6715  O OD1   . ASP D 1 47  ? 34.673  18.668  9.613  1.00 51.23 ? 99   ASP I OD1   1 
ATOM   6716  O OD2   . ASP D 1 47  ? 35.759  20.460  8.914  1.00 52.97 ? 99   ASP I OD2   1 
ATOM   6717  N N     . GLN D 1 48  ? 39.276  17.380  12.102 1.00 51.42 ? 100  GLN I N     1 
ATOM   6718  C CA    . GLN D 1 48  ? 40.497  16.598  12.266 1.00 53.12 ? 100  GLN I CA    1 
ATOM   6719  C C     . GLN D 1 48  ? 41.498  17.008  11.187 1.00 52.47 ? 100  GLN I C     1 
ATOM   6720  O O     . GLN D 1 48  ? 42.266  16.182  10.700 1.00 53.51 ? 100  GLN I O     1 
ATOM   6721  C CB    . GLN D 1 48  ? 40.159  15.108  12.136 1.00 54.38 ? 100  GLN I CB    1 
ATOM   6722  C CG    . GLN D 1 48  ? 38.897  14.725  12.912 1.00 58.87 ? 100  GLN I CG    1 
ATOM   6723  C CD    . GLN D 1 48  ? 38.191  13.482  12.375 1.00 61.20 ? 100  GLN I CD    1 
ATOM   6724  O OE1   . GLN D 1 48  ? 38.590  12.348  12.661 1.00 61.09 ? 100  GLN I OE1   1 
ATOM   6725  N NE2   . GLN D 1 48  ? 37.132  13.696  11.585 1.00 62.30 ? 100  GLN I NE2   1 
ATOM   6726  N N     . ASN D 1 49  ? 41.478  18.288  10.825 1.00 51.54 ? 101  ASN I N     1 
ATOM   6727  C CA    . ASN D 1 49  ? 42.355  18.834  9.794  1.00 51.49 ? 101  ASN I CA    1 
ATOM   6728  C C     . ASN D 1 49  ? 43.445  19.737  10.393 1.00 51.42 ? 101  ASN I C     1 
ATOM   6729  O O     . ASN D 1 49  ? 43.152  20.766  11.010 1.00 49.41 ? 101  ASN I O     1 
ATOM   6730  C CB    . ASN D 1 49  ? 41.512  19.630  8.791  1.00 52.87 ? 101  ASN I CB    1 
ATOM   6731  C CG    . ASN D 1 49  ? 42.281  19.998  7.524  1.00 53.61 ? 101  ASN I CG    1 
ATOM   6732  O OD1   . ASN D 1 49  ? 42.563  19.142  6.682  1.00 53.56 ? 101  ASN I OD1   1 
ATOM   6733  N ND2   . ASN D 1 49  ? 42.620  21.279  7.385  1.00 52.75 ? 101  ASN I ND2   1 
ATOM   6734  N N     . GLN D 1 50  ? 44.702  19.353  10.190 1.00 51.12 ? 102  GLN I N     1 
ATOM   6735  C CA    . GLN D 1 50  ? 45.833  20.111  10.717 1.00 51.65 ? 102  GLN I CA    1 
ATOM   6736  C C     . GLN D 1 50  ? 45.769  21.599  10.368 1.00 51.53 ? 102  GLN I C     1 
ATOM   6737  O O     . GLN D 1 50  ? 46.190  22.445  11.158 1.00 52.27 ? 102  GLN I O     1 
ATOM   6738  C CB    . GLN D 1 50  ? 47.151  19.491  10.219 1.00 52.34 ? 102  GLN I CB    1 
ATOM   6739  C CG    . GLN D 1 50  ? 48.427  20.304  10.503 1.00 54.57 ? 102  GLN I CG    1 
ATOM   6740  C CD    . GLN D 1 50  ? 49.496  19.525  11.287 1.00 56.91 ? 102  GLN I CD    1 
ATOM   6741  O OE1   . GLN D 1 50  ? 49.808  18.368  10.982 1.00 57.59 ? 102  GLN I OE1   1 
ATOM   6742  N NE2   . GLN D 1 50  ? 50.069  20.173  12.296 1.00 58.66 ? 102  GLN I NE2   1 
ATOM   6743  N N     . ASP D 1 51  ? 45.241  21.929  9.197  1.00 50.94 ? 103  ASP I N     1 
ATOM   6744  C CA    . ASP D 1 51  ? 45.145  23.330  8.807  1.00 50.23 ? 103  ASP I CA    1 
ATOM   6745  C C     . ASP D 1 51  ? 44.024  24.062  9.522  1.00 49.92 ? 103  ASP I C     1 
ATOM   6746  O O     . ASP D 1 51  ? 44.199  25.208  9.918  1.00 50.45 ? 103  ASP I O     1 
ATOM   6747  C CB    . ASP D 1 51  ? 44.937  23.455  7.304  1.00 50.61 ? 103  ASP I CB    1 
ATOM   6748  C CG    . ASP D 1 51  ? 46.181  23.143  6.529  1.00 50.59 ? 103  ASP I CG    1 
ATOM   6749  O OD1   . ASP D 1 51  ? 46.117  23.196  5.286  1.00 52.37 ? 103  ASP I OD1   1 
ATOM   6750  O OD2   . ASP D 1 51  ? 47.218  22.848  7.161  1.00 49.86 ? 103  ASP I OD2   1 
ATOM   6751  N N     . LYS D 1 52  ? 42.874  23.403  9.669  1.00 49.63 ? 104  LYS I N     1 
ATOM   6752  C CA    . LYS D 1 52  ? 41.702  23.986  10.339 1.00 48.93 ? 104  LYS I CA    1 
ATOM   6753  C C     . LYS D 1 52  ? 41.936  24.235  11.827 1.00 49.23 ? 104  LYS I C     1 
ATOM   6754  O O     . LYS D 1 52  ? 41.588  25.298  12.352 1.00 49.23 ? 104  LYS I O     1 
ATOM   6755  C CB    . LYS D 1 52  ? 40.486  23.066  10.177 1.00 47.88 ? 104  LYS I CB    1 
ATOM   6756  C CG    . LYS D 1 52  ? 39.597  23.417  9.018  1.00 45.19 ? 104  LYS I CG    1 
ATOM   6757  C CD    . LYS D 1 52  ? 38.717  24.600  9.346  1.00 44.43 ? 104  LYS I CD    1 
ATOM   6758  C CE    . LYS D 1 52  ? 37.537  24.166  10.184 1.00 44.58 ? 104  LYS I CE    1 
ATOM   6759  N NZ    . LYS D 1 52  ? 36.757  23.068  9.526  1.00 43.76 ? 104  LYS I NZ    1 
ATOM   6760  N N     . GLU D 1 53  ? 42.503  23.236  12.502 1.00 49.22 ? 105  GLU I N     1 
ATOM   6761  C CA    . GLU D 1 53  ? 42.799  23.326  13.929 1.00 48.79 ? 105  GLU I CA    1 
ATOM   6762  C C     . GLU D 1 53  ? 43.708  24.528  14.111 1.00 49.82 ? 105  GLU I C     1 
ATOM   6763  O O     . GLU D 1 53  ? 43.557  25.323  15.045 1.00 49.61 ? 105  GLU I O     1 
ATOM   6764  C CB    . GLU D 1 53  ? 43.534  22.064  14.402 1.00 47.06 ? 105  GLU I CB    1 
ATOM   6765  C CG    . GLU D 1 53  ? 42.817  20.762  14.086 1.00 45.26 ? 105  GLU I CG    1 
ATOM   6766  C CD    . GLU D 1 53  ? 43.487  19.554  14.706 1.00 44.13 ? 105  GLU I CD    1 
ATOM   6767  O OE1   . GLU D 1 53  ? 44.625  19.237  14.292 1.00 42.31 ? 105  GLU I OE1   1 
ATOM   6768  O OE2   . GLU D 1 53  ? 42.873  18.927  15.605 1.00 43.77 ? 105  GLU I OE2   1 
ATOM   6769  N N     . LEU D 1 54  ? 44.649  24.635  13.183 1.00 50.22 ? 106  LEU I N     1 
ATOM   6770  C CA    . LEU D 1 54  ? 45.639  25.688  13.156 1.00 52.13 ? 106  LEU I CA    1 
ATOM   6771  C C     . LEU D 1 54  ? 44.978  27.010  12.749 1.00 53.58 ? 106  LEU I C     1 
ATOM   6772  O O     . LEU D 1 54  ? 45.280  28.069  13.308 1.00 53.56 ? 106  LEU I O     1 
ATOM   6773  C CB    . LEU D 1 54  ? 46.730  25.284  12.164 1.00 52.54 ? 106  LEU I CB    1 
ATOM   6774  C CG    . LEU D 1 54  ? 48.145  25.828  12.315 1.00 53.77 ? 106  LEU I CG    1 
ATOM   6775  C CD1   . LEU D 1 54  ? 48.156  27.337  12.050 1.00 54.51 ? 106  LEU I CD1   1 
ATOM   6776  C CD2   . LEU D 1 54  ? 48.666  25.483  13.705 1.00 52.96 ? 106  LEU I CD2   1 
ATOM   6777  N N     . HIS D 1 55  ? 44.074  26.940  11.776 1.00 55.19 ? 107  HIS I N     1 
ATOM   6778  C CA    . HIS D 1 55  ? 43.365  28.122  11.302 1.00 56.98 ? 107  HIS I CA    1 
ATOM   6779  C C     . HIS D 1 55  ? 42.570  28.639  12.477 1.00 55.28 ? 107  HIS I C     1 
ATOM   6780  O O     . HIS D 1 55  ? 42.687  29.805  12.850 1.00 53.10 ? 107  HIS I O     1 
ATOM   6781  C CB    . HIS D 1 55  ? 42.419  27.748  10.153 1.00 63.09 ? 107  HIS I CB    1 
ATOM   6782  C CG    . HIS D 1 55  ? 41.473  28.844  9.748  1.00 69.51 ? 107  HIS I CG    1 
ATOM   6783  N ND1   . HIS D 1 55  ? 40.411  28.624  8.893  1.00 72.87 ? 107  HIS I ND1   1 
ATOM   6784  C CD2   . HIS D 1 55  ? 41.425  30.160  10.073 1.00 70.93 ? 107  HIS I CD2   1 
ATOM   6785  C CE1   . HIS D 1 55  ? 39.750  29.755  8.712  1.00 73.37 ? 107  HIS I CE1   1 
ATOM   6786  N NE2   . HIS D 1 55  ? 40.345  30.702  9.417  1.00 72.37 ? 107  HIS I NE2   1 
ATOM   6787  N N     . LEU D 1 56  ? 41.766  27.747  13.049 1.00 54.75 ? 108  LEU I N     1 
ATOM   6788  C CA    . LEU D 1 56  ? 40.922  28.057  14.195 1.00 55.00 ? 108  LEU I CA    1 
ATOM   6789  C C     . LEU D 1 56  ? 41.711  28.611  15.383 1.00 55.49 ? 108  LEU I C     1 
ATOM   6790  O O     . LEU D 1 56  ? 41.279  29.569  16.029 1.00 54.59 ? 108  LEU I O     1 
ATOM   6791  C CB    . LEU D 1 56  ? 40.144  26.806  14.620 1.00 54.17 ? 108  LEU I CB    1 
ATOM   6792  C CG    . LEU D 1 56  ? 39.067  26.306  13.654 1.00 54.05 ? 108  LEU I CG    1 
ATOM   6793  C CD1   . LEU D 1 56  ? 38.408  25.054  14.209 1.00 52.39 ? 108  LEU I CD1   1 
ATOM   6794  C CD2   . LEU D 1 56  ? 38.032  27.401  13.445 1.00 53.54 ? 108  LEU I CD2   1 
ATOM   6795  N N     . LEU D 1 57  ? 42.866  28.016  15.671 1.00 56.97 ? 109  LEU I N     1 
ATOM   6796  C CA    . LEU D 1 57  ? 43.690  28.470  16.790 1.00 59.07 ? 109  LEU I CA    1 
ATOM   6797  C C     . LEU D 1 57  ? 44.274  29.858  16.556 1.00 60.41 ? 109  LEU I C     1 
ATOM   6798  O O     . LEU D 1 57  ? 44.754  30.519  17.467 1.00 60.02 ? 109  LEU I O     1 
ATOM   6799  C CB    . LEU D 1 57  ? 44.797  27.460  17.063 1.00 60.63 ? 109  LEU I CB    1 
ATOM   6800  C CG    . LEU D 1 57  ? 45.716  27.778  18.241 1.00 63.30 ? 109  LEU I CG    1 
ATOM   6801  C CD1   . LEU D 1 57  ? 45.177  27.119  19.495 1.00 64.90 ? 109  LEU I CD1   1 
ATOM   6802  C CD2   . LEU D 1 57  ? 47.126  27.279  17.941 1.00 64.87 ? 109  LEU I CD2   1 
ATOM   6803  N N     . ASN D 1 58  ? 44.229  30.309  15.316 1.00 62.47 ? 110  ASN I N     1 
ATOM   6804  C CA    . ASN D 1 58  ? 44.717  31.640  15.019 1.00 63.42 ? 110  ASN I CA    1 
ATOM   6805  C C     . ASN D 1 58  ? 43.511  32.559  14.657 1.00 64.33 ? 110  ASN I C     1 
ATOM   6806  O O     . ASN D 1 58  ? 43.558  33.779  14.921 1.00 65.61 ? 110  ASN I O     1 
ATOM   6807  C CB    . ASN D 1 58  ? 45.785  31.540  13.912 1.00 63.29 ? 110  ASN I CB    1 
ATOM   6808  C CG    . ASN D 1 58  ? 47.122  30.984  14.448 1.00 63.96 ? 110  ASN I CG    1 
ATOM   6809  O OD1   . ASN D 1 58  ? 48.089  30.635  13.723 1.00 64.06 ? 110  ASN I OD1   1 
ATOM   6810  N ND2   . ASN D 1 58  ? 47.173  30.921  15.758 1.00 62.96 ? 110  ASN I ND2   1 
ATOM   6811  N N     . ASN D 1 59  ? 42.400  31.923  14.252 1.00 64.68 ? 111  ASN I N     1 
ATOM   6812  C CA    . ASN D 1 59  ? 41.208  32.653  13.823 1.00 65.20 ? 111  ASN I CA    1 
ATOM   6813  C C     . ASN D 1 59  ? 40.293  32.838  15.009 1.00 66.23 ? 111  ASN I C     1 
ATOM   6814  O O     . ASN D 1 59  ? 39.497  33.749  15.001 1.00 65.04 ? 111  ASN I O     1 
ATOM   6815  C CB    . ASN D 1 59  ? 40.427  31.942  12.679 1.00 65.61 ? 111  ASN I CB    1 
ATOM   6816  C CG    . ASN D 1 59  ? 39.004  31.698  13.084 1.00 65.82 ? 111  ASN I CG    1 
ATOM   6817  O OD1   . ASN D 1 59  ? 38.193  32.618  13.089 1.00 66.63 ? 111  ASN I OD1   1 
ATOM   6818  N ND2   . ASN D 1 59  ? 38.725  30.492  13.578 1.00 66.08 ? 111  ASN I ND2   1 
ATOM   6819  N N     . MET D 1 60  ? 40.457  32.017  16.055 1.00 67.98 ? 112  MET I N     1 
ATOM   6820  C CA    . MET D 1 60  ? 39.622  32.086  17.304 1.00 68.54 ? 112  MET I CA    1 
ATOM   6821  C C     . MET D 1 60  ? 39.847  33.319  18.200 1.00 69.21 ? 112  MET I C     1 
ATOM   6822  O O     . MET D 1 60  ? 38.911  34.042  18.607 1.00 69.01 ? 112  MET I O     1 
ATOM   6823  C CB    . MET D 1 60  ? 39.819  30.856  18.221 1.00 69.32 ? 112  MET I CB    1 
ATOM   6824  C CG    . MET D 1 60  ? 38.873  29.677  17.994 1.00 69.86 ? 112  MET I CG    1 
ATOM   6825  S SD    . MET D 1 60  ? 37.457  29.690  19.114 1.00 69.36 ? 112  MET I SD    1 
ATOM   6826  C CE    . MET D 1 60  ? 36.114  30.089  17.982 1.00 69.23 ? 112  MET I CE    1 
ATOM   6827  N N     . LEU D 1 61  ? 41.109  33.503  18.554 1.00 70.33 ? 113  LEU I N     1 
ATOM   6828  C CA    . LEU D 1 61  ? 41.567  34.639  19.333 1.00 71.73 ? 113  LEU I CA    1 
ATOM   6829  C C     . LEU D 1 61  ? 41.084  35.844  18.520 1.00 72.75 ? 113  LEU I C     1 
ATOM   6830  O O     . LEU D 1 61  ? 40.698  36.885  19.060 1.00 71.86 ? 113  LEU I O     1 
ATOM   6831  C CB    . LEU D 1 61  ? 43.087  34.606  19.364 1.00 72.66 ? 113  LEU I CB    1 
ATOM   6832  C CG    . LEU D 1 61  ? 43.602  33.508  18.422 1.00 73.91 ? 113  LEU I CG    1 
ATOM   6833  C CD1   . LEU D 1 61  ? 44.991  33.835  17.914 1.00 74.20 ? 113  LEU I CD1   1 
ATOM   6834  C CD2   . LEU D 1 61  ? 43.569  32.176  19.158 1.00 73.79 ? 113  LEU I CD2   1 
ATOM   6835  N N     . GLY D 1 62  ? 41.119  35.681  17.202 1.00 73.85 ? 114  GLY I N     1 
ATOM   6836  C CA    . GLY D 1 62  ? 40.649  36.725  16.319 1.00 75.06 ? 114  GLY I CA    1 
ATOM   6837  C C     . GLY D 1 62  ? 39.170  36.979  16.575 1.00 75.74 ? 114  GLY I C     1 
ATOM   6838  O O     . GLY D 1 62  ? 38.814  38.099  16.943 1.00 77.67 ? 114  GLY I O     1 
ATOM   6839  N N     . LYS D 1 63  ? 38.310  35.963  16.395 1.00 74.93 ? 115  LYS I N     1 
ATOM   6840  C CA    . LYS D 1 63  ? 36.862  36.126  16.623 1.00 72.29 ? 115  LYS I CA    1 
ATOM   6841  C C     . LYS D 1 63  ? 36.559  36.283  18.106 1.00 70.57 ? 115  LYS I C     1 
ATOM   6842  O O     . LYS D 1 63  ? 35.485  35.922  18.597 1.00 69.68 ? 115  LYS I O     1 
ATOM   6843  C CB    . LYS D 1 63  ? 36.038  34.973  16.008 1.00 70.83 ? 115  LYS I CB    1 
ATOM   6844  C CG    . LYS D 1 63  ? 36.242  33.595  16.608 1.00 69.84 ? 115  LYS I CG    1 
ATOM   6845  C CD    . LYS D 1 63  ? 36.697  32.569  15.551 1.00 67.97 ? 115  LYS I CD    1 
ATOM   6846  C CE    . LYS D 1 63  ? 35.719  32.454  14.374 1.00 66.67 ? 115  LYS I CE    1 
ATOM   6847  N NZ    . LYS D 1 63  ? 36.035  31.297  13.482 1.00 63.20 ? 115  LYS I NZ    1 
ATOM   6848  N N     . GLN D 1 64  ? 37.556  36.836  18.791 1.00 69.09 ? 116  GLN I N     1 
ATOM   6849  C CA    . GLN D 1 64  ? 37.523  37.176  20.206 1.00 68.15 ? 116  GLN I CA    1 
ATOM   6850  C C     . GLN D 1 64  ? 37.251  36.077  21.222 1.00 64.76 ? 116  GLN I C     1 
ATOM   6851  O O     . GLN D 1 64  ? 36.094  35.712  21.468 1.00 64.28 ? 116  GLN I O     1 
ATOM   6852  C CB    . GLN D 1 64  ? 36.513  38.322  20.457 1.00 71.72 ? 116  GLN I CB    1 
ATOM   6853  C CG    . GLN D 1 64  ? 36.449  39.457  19.390 1.00 74.48 ? 116  GLN I CG    1 
ATOM   6854  C CD    . GLN D 1 64  ? 37.733  40.306  19.275 1.00 76.08 ? 116  GLN I CD    1 
ATOM   6855  O OE1   . GLN D 1 64  ? 38.280  40.782  20.281 1.00 75.62 ? 116  GLN I OE1   1 
ATOM   6856  N NE2   . GLN D 1 64  ? 38.198  40.513  18.037 1.00 75.47 ? 116  GLN I NE2   1 
ATOM   6857  N N     . VAL D 1 65  ? 38.328  35.562  21.808 1.00 59.68 ? 117  VAL I N     1 
ATOM   6858  C CA    . VAL D 1 65  ? 38.239  34.571  22.869 1.00 54.74 ? 117  VAL I CA    1 
ATOM   6859  C C     . VAL D 1 65  ? 39.413  34.850  23.773 1.00 52.11 ? 117  VAL I C     1 
ATOM   6860  O O     . VAL D 1 65  ? 40.460  35.298  23.310 1.00 51.55 ? 117  VAL I O     1 
ATOM   6861  C CB    . VAL D 1 65  ? 38.301  33.101  22.375 1.00 53.52 ? 117  VAL I CB    1 
ATOM   6862  C CG1   . VAL D 1 65  ? 36.983  32.721  21.709 1.00 50.87 ? 117  VAL I CG1   1 
ATOM   6863  C CG2   . VAL D 1 65  ? 39.482  32.900  21.455 1.00 52.45 ? 117  VAL I CG2   1 
ATOM   6864  N N     . ASP D 1 66  ? 39.222  34.615  25.065 1.00 49.83 ? 118  ASP I N     1 
ATOM   6865  C CA    . ASP D 1 66  ? 40.272  34.846  26.044 1.00 47.71 ? 118  ASP I CA    1 
ATOM   6866  C C     . ASP D 1 66  ? 41.098  33.576  26.249 1.00 45.60 ? 118  ASP I C     1 
ATOM   6867  O O     . ASP D 1 66  ? 42.242  33.641  26.705 1.00 44.95 ? 118  ASP I O     1 
ATOM   6868  C CB    . ASP D 1 66  ? 39.663  35.293  27.377 1.00 48.61 ? 118  ASP I CB    1 
ATOM   6869  C CG    . ASP D 1 66  ? 38.798  36.540  27.241 1.00 49.86 ? 118  ASP I CG    1 
ATOM   6870  O OD1   . ASP D 1 66  ? 37.570  36.412  27.005 1.00 48.74 ? 118  ASP I OD1   1 
ATOM   6871  O OD2   . ASP D 1 66  ? 39.357  37.653  27.363 1.00 50.84 ? 118  ASP I OD2   1 
ATOM   6872  N N     . GLY D 1 67  ? 40.515  32.427  25.899 1.00 42.84 ? 119  GLY I N     1 
ATOM   6873  C CA    . GLY D 1 67  ? 41.205  31.155  26.059 1.00 40.22 ? 119  GLY I CA    1 
ATOM   6874  C C     . GLY D 1 67  ? 40.635  30.006  25.240 1.00 38.16 ? 119  GLY I C     1 
ATOM   6875  O O     . GLY D 1 67  ? 39.537  30.095  24.681 1.00 37.38 ? 119  GLY I O     1 
ATOM   6876  N N     . ILE D 1 68  ? 41.369  28.901  25.186 1.00 35.24 ? 120  ILE I N     1 
ATOM   6877  C CA    . ILE D 1 68  ? 40.915  27.774  24.394 1.00 32.72 ? 120  ILE I CA    1 
ATOM   6878  C C     . ILE D 1 68  ? 41.219  26.388  24.944 1.00 31.88 ? 120  ILE I C     1 
ATOM   6879  O O     . ILE D 1 68  ? 42.355  26.087  25.327 1.00 31.71 ? 120  ILE I O     1 
ATOM   6880  C CB    . ILE D 1 68  ? 41.518  27.854  22.961 1.00 32.50 ? 120  ILE I CB    1 
ATOM   6881  C CG1   . ILE D 1 68  ? 40.973  29.094  22.247 1.00 32.51 ? 120  ILE I CG1   1 
ATOM   6882  C CG2   . ILE D 1 68  ? 41.237  26.561  22.181 1.00 27.01 ? 120  ILE I CG2   1 
ATOM   6883  C CD1   . ILE D 1 68  ? 41.622  29.381  20.905 1.00 39.17 ? 120  ILE I CD1   1 
ATOM   6884  N N     . ILE D 1 69  ? 40.181  25.557  24.997 1.00 29.94 ? 121  ILE I N     1 
ATOM   6885  C CA    . ILE D 1 69  ? 40.338  24.167  25.390 1.00 29.03 ? 121  ILE I CA    1 
ATOM   6886  C C     . ILE D 1 69  ? 40.361  23.484  24.009 1.00 29.52 ? 121  ILE I C     1 
ATOM   6887  O O     . ILE D 1 69  ? 39.397  23.565  23.241 1.00 28.75 ? 121  ILE I O     1 
ATOM   6888  C CB    . ILE D 1 69  ? 39.159  23.647  26.222 1.00 28.41 ? 121  ILE I CB    1 
ATOM   6889  C CG1   . ILE D 1 69  ? 39.246  24.165  27.653 1.00 30.49 ? 121  ILE I CG1   1 
ATOM   6890  C CG2   . ILE D 1 69  ? 39.228  22.148  26.309 1.00 28.95 ? 121  ILE I CG2   1 
ATOM   6891  C CD1   . ILE D 1 69  ? 39.205  25.655  27.780 1.00 39.08 ? 121  ILE I CD1   1 
ATOM   6892  N N     . PHE D 1 70  ? 41.478  22.844  23.684 1.00 28.34 ? 122  PHE I N     1 
ATOM   6893  C CA    . PHE D 1 70  ? 41.648  22.210  22.392 1.00 29.29 ? 122  PHE I CA    1 
ATOM   6894  C C     . PHE D 1 70  ? 41.595  20.696  22.518 1.00 30.36 ? 122  PHE I C     1 
ATOM   6895  O O     . PHE D 1 70  ? 42.200  20.110  23.428 1.00 28.65 ? 122  PHE I O     1 
ATOM   6896  C CB    . PHE D 1 70  ? 43.000  22.661  21.811 1.00 30.46 ? 122  PHE I CB    1 
ATOM   6897  C CG    . PHE D 1 70  ? 43.347  22.077  20.465 1.00 29.49 ? 122  PHE I CG    1 
ATOM   6898  C CD1   . PHE D 1 70  ? 44.631  21.606  20.230 1.00 31.00 ? 122  PHE I CD1   1 
ATOM   6899  C CD2   . PHE D 1 70  ? 42.431  22.062  19.423 1.00 31.53 ? 122  PHE I CD2   1 
ATOM   6900  C CE1   . PHE D 1 70  ? 45.010  21.128  18.972 1.00 34.70 ? 122  PHE I CE1   1 
ATOM   6901  C CE2   . PHE D 1 70  ? 42.787  21.587  18.150 1.00 33.35 ? 122  PHE I CE2   1 
ATOM   6902  C CZ    . PHE D 1 70  ? 44.083  21.117  17.922 1.00 34.66 ? 122  PHE I CZ    1 
ATOM   6903  N N     . MET D 1 71  ? 40.861  20.075  21.600 1.00 31.26 ? 123  MET I N     1 
ATOM   6904  C CA    . MET D 1 71  ? 40.736  18.628  21.552 1.00 34.55 ? 123  MET I CA    1 
ATOM   6905  C C     . MET D 1 71  ? 41.124  18.257  20.128 1.00 36.55 ? 123  MET I C     1 
ATOM   6906  O O     . MET D 1 71  ? 40.624  18.847  19.182 1.00 38.90 ? 123  MET I O     1 
ATOM   6907  C CB    . MET D 1 71  ? 39.305  18.234  21.883 1.00 33.73 ? 123  MET I CB    1 
ATOM   6908  C CG    . MET D 1 71  ? 38.799  19.031  23.061 1.00 37.39 ? 123  MET I CG    1 
ATOM   6909  S SD    . MET D 1 71  ? 37.490  18.281  24.005 1.00 40.39 ? 123  MET I SD    1 
ATOM   6910  C CE    . MET D 1 71  ? 36.068  18.688  22.965 1.00 42.10 ? 123  MET I CE    1 
ATOM   6911  N N     . SER D 1 72  ? 42.029  17.302  19.959 1.00 38.66 ? 124  SER I N     1 
ATOM   6912  C CA    . SER D 1 72  ? 42.454  16.965  18.612 1.00 41.11 ? 124  SER I CA    1 
ATOM   6913  C C     . SER D 1 72  ? 42.409  15.507  18.174 1.00 42.97 ? 124  SER I C     1 
ATOM   6914  O O     . SER D 1 72  ? 41.621  15.139  17.299 1.00 45.41 ? 124  SER I O     1 
ATOM   6915  C CB    . SER D 1 72  ? 43.866  17.509  18.373 1.00 40.68 ? 124  SER I CB    1 
ATOM   6916  O OG    . SER D 1 72  ? 44.424  16.978  17.180 1.00 40.09 ? 124  SER I OG    1 
ATOM   6917  N N     . GLY D 1 73  ? 43.251  14.671  18.760 1.00 42.07 ? 125  GLY I N     1 
ATOM   6918  C CA    . GLY D 1 73  ? 43.271  13.291  18.318 1.00 42.69 ? 125  GLY I CA    1 
ATOM   6919  C C     . GLY D 1 73  ? 44.616  13.091  17.656 1.00 42.52 ? 125  GLY I C     1 
ATOM   6920  O O     . GLY D 1 73  ? 45.045  11.965  17.400 1.00 42.03 ? 125  GLY I O     1 
ATOM   6921  N N     . ASN D 1 74  ? 45.275  14.211  17.370 1.00 41.70 ? 126  ASN I N     1 
ATOM   6922  C CA    . ASN D 1 74  ? 46.611  14.185  16.803 1.00 43.05 ? 126  ASN I CA    1 
ATOM   6923  C C     . ASN D 1 74  ? 47.297  15.562  16.898 1.00 43.84 ? 126  ASN I C     1 
ATOM   6924  O O     . ASN D 1 74  ? 47.280  16.354  15.958 1.00 44.92 ? 126  ASN I O     1 
ATOM   6925  C CB    . ASN D 1 74  ? 46.567  13.708  15.360 1.00 44.25 ? 126  ASN I CB    1 
ATOM   6926  C CG    . ASN D 1 74  ? 47.908  13.186  14.886 1.00 45.71 ? 126  ASN I CG    1 
ATOM   6927  O OD1   . ASN D 1 74  ? 48.961  13.594  15.391 1.00 46.85 ? 126  ASN I OD1   1 
ATOM   6928  N ND2   . ASN D 1 74  ? 47.882  12.289  13.906 1.00 44.73 ? 126  ASN I ND2   1 
ATOM   6929  N N     . VAL D 1 75  ? 47.887  15.853  18.052 1.00 43.88 ? 127  VAL I N     1 
ATOM   6930  C CA    . VAL D 1 75  ? 48.565  17.124  18.253 1.00 43.41 ? 127  VAL I CA    1 
ATOM   6931  C C     . VAL D 1 75  ? 50.027  16.937  17.911 1.00 44.89 ? 127  VAL I C     1 
ATOM   6932  O O     . VAL D 1 75  ? 50.835  16.545  18.749 1.00 44.37 ? 127  VAL I O     1 
ATOM   6933  C CB    . VAL D 1 75  ? 48.449  17.621  19.711 1.00 42.70 ? 127  VAL I CB    1 
ATOM   6934  C CG1   . VAL D 1 75  ? 49.164  18.947  19.866 1.00 40.31 ? 127  VAL I CG1   1 
ATOM   6935  C CG2   . VAL D 1 75  ? 46.988  17.781  20.093 1.00 41.68 ? 127  VAL I CG2   1 
ATOM   6936  N N     . THR D 1 76  ? 50.350  17.231  16.661 1.00 46.61 ? 128  THR I N     1 
ATOM   6937  C CA    . THR D 1 76  ? 51.700  17.101  16.138 1.00 47.59 ? 128  THR I CA    1 
ATOM   6938  C C     . THR D 1 76  ? 52.714  18.145  16.614 1.00 50.11 ? 128  THR I C     1 
ATOM   6939  O O     . THR D 1 76  ? 52.366  19.138  17.267 1.00 48.80 ? 128  THR I O     1 
ATOM   6940  C CB    . THR D 1 76  ? 51.678  17.179  14.632 1.00 44.91 ? 128  THR I CB    1 
ATOM   6941  O OG1   . THR D 1 76  ? 51.527  18.551  14.244 1.00 42.57 ? 128  THR I OG1   1 
ATOM   6942  C CG2   . THR D 1 76  ? 50.528  16.344  14.087 1.00 43.64 ? 128  THR I CG2   1 
ATOM   6943  N N     . GLU D 1 77  ? 53.973  17.889  16.249 1.00 53.31 ? 129  GLU I N     1 
ATOM   6944  C CA    . GLU D 1 77  ? 55.117  18.748  16.560 1.00 56.29 ? 129  GLU I CA    1 
ATOM   6945  C C     . GLU D 1 77  ? 54.862  20.146  16.010 1.00 56.71 ? 129  GLU I C     1 
ATOM   6946  O O     . GLU D 1 77  ? 55.222  21.148  16.628 1.00 56.61 ? 129  GLU I O     1 
ATOM   6947  C CB    . GLU D 1 77  ? 56.393  18.177  15.922 1.00 58.92 ? 129  GLU I CB    1 
ATOM   6948  C CG    . GLU D 1 77  ? 56.495  18.364  14.394 1.00 63.37 ? 129  GLU I CG    1 
ATOM   6949  C CD    . GLU D 1 77  ? 55.337  17.723  13.615 1.00 65.92 ? 129  GLU I CD    1 
ATOM   6950  O OE1   . GLU D 1 77  ? 54.657  18.445  12.836 1.00 65.17 ? 129  GLU I OE1   1 
ATOM   6951  O OE2   . GLU D 1 77  ? 55.114  16.496  13.780 1.00 67.30 ? 129  GLU I OE2   1 
ATOM   6952  N N     . GLU D 1 78  ? 54.243  20.201  14.835 1.00 57.06 ? 130  GLU I N     1 
ATOM   6953  C CA    . GLU D 1 78  ? 53.934  21.466  14.208 1.00 57.73 ? 130  GLU I CA    1 
ATOM   6954  C C     . GLU D 1 78  ? 52.922  22.144  15.116 1.00 57.34 ? 130  GLU I C     1 
ATOM   6955  O O     . GLU D 1 78  ? 53.086  23.303  15.498 1.00 57.38 ? 130  GLU I O     1 
ATOM   6956  C CB    . GLU D 1 78  ? 53.336  21.228  12.822 1.00 59.82 ? 130  GLU I CB    1 
ATOM   6957  C CG    . GLU D 1 78  ? 53.414  22.439  11.906 1.00 63.06 ? 130  GLU I CG    1 
ATOM   6958  C CD    . GLU D 1 78  ? 52.801  22.186  10.536 1.00 65.39 ? 130  GLU I CD    1 
ATOM   6959  O OE1   . GLU D 1 78  ? 51.620  22.540  10.337 1.00 66.72 ? 130  GLU I OE1   1 
ATOM   6960  O OE2   . GLU D 1 78  ? 53.498  21.625  9.660  1.00 66.85 ? 130  GLU I OE2   1 
ATOM   6961  N N     . HIS D 1 79  ? 51.885  21.391  15.474 1.00 57.42 ? 131  HIS I N     1 
ATOM   6962  C CA    . HIS D 1 79  ? 50.825  21.877  16.349 1.00 57.09 ? 131  HIS I CA    1 
ATOM   6963  C C     . HIS D 1 79  ? 51.365  22.574  17.594 1.00 56.54 ? 131  HIS I C     1 
ATOM   6964  O O     . HIS D 1 79  ? 51.189  23.786  17.755 1.00 55.51 ? 131  HIS I O     1 
ATOM   6965  C CB    . HIS D 1 79  ? 49.918  20.715  16.773 1.00 57.15 ? 131  HIS I CB    1 
ATOM   6966  C CG    . HIS D 1 79  ? 48.933  20.303  15.724 1.00 57.78 ? 131  HIS I CG    1 
ATOM   6967  N ND1   . HIS D 1 79  ? 47.947  21.147  15.258 1.00 58.31 ? 131  HIS I ND1   1 
ATOM   6968  C CD2   . HIS D 1 79  ? 48.770  19.133  15.061 1.00 57.83 ? 131  HIS I CD2   1 
ATOM   6969  C CE1   . HIS D 1 79  ? 47.219  20.515  14.355 1.00 58.70 ? 131  HIS I CE1   1 
ATOM   6970  N NE2   . HIS D 1 79  ? 47.697  19.291  14.217 1.00 58.14 ? 131  HIS I NE2   1 
ATOM   6971  N N     . VAL D 1 80  ? 52.026  21.801  18.459 1.00 56.49 ? 132  VAL I N     1 
ATOM   6972  C CA    . VAL D 1 80  ? 52.592  22.312  19.715 1.00 57.78 ? 132  VAL I CA    1 
ATOM   6973  C C     . VAL D 1 80  ? 53.470  23.554  19.561 1.00 58.74 ? 132  VAL I C     1 
ATOM   6974  O O     . VAL D 1 80  ? 53.314  24.535  20.295 1.00 56.82 ? 132  VAL I O     1 
ATOM   6975  C CB    . VAL D 1 80  ? 53.387  21.195  20.471 1.00 56.49 ? 132  VAL I CB    1 
ATOM   6976  C CG1   . VAL D 1 80  ? 54.129  20.327  19.487 1.00 57.87 ? 132  VAL I CG1   1 
ATOM   6977  C CG2   . VAL D 1 80  ? 54.357  21.811  21.468 1.00 54.89 ? 132  VAL I CG2   1 
ATOM   6978  N N     . GLU D 1 81  ? 54.386  23.509  18.602 1.00 61.61 ? 133  GLU I N     1 
ATOM   6979  C CA    . GLU D 1 81  ? 55.272  24.637  18.355 1.00 65.48 ? 133  GLU I CA    1 
ATOM   6980  C C     . GLU D 1 81  ? 54.467  25.862  17.930 1.00 66.15 ? 133  GLU I C     1 
ATOM   6981  O O     . GLU D 1 81  ? 54.841  27.005  18.210 1.00 66.48 ? 133  GLU I O     1 
ATOM   6982  C CB    . GLU D 1 81  ? 56.303  24.265  17.286 1.00 67.73 ? 133  GLU I CB    1 
ATOM   6983  C CG    . GLU D 1 81  ? 57.651  23.838  17.866 1.00 71.09 ? 133  GLU I CG    1 
ATOM   6984  C CD    . GLU D 1 81  ? 58.392  25.003  18.498 1.00 72.82 ? 133  GLU I CD    1 
ATOM   6985  O OE1   . GLU D 1 81  ? 58.585  25.013  19.739 1.00 73.99 ? 133  GLU I OE1   1 
ATOM   6986  O OE2   . GLU D 1 81  ? 58.776  25.914  17.734 1.00 73.26 ? 133  GLU I OE2   1 
ATOM   6987  N N     . GLU D 1 82  ? 53.351  25.616  17.260 1.00 66.09 ? 134  GLU I N     1 
ATOM   6988  C CA    . GLU D 1 82  ? 52.489  26.697  16.821 1.00 66.89 ? 134  GLU I CA    1 
ATOM   6989  C C     . GLU D 1 82  ? 51.607  27.113  17.985 1.00 66.93 ? 134  GLU I C     1 
ATOM   6990  O O     . GLU D 1 82  ? 51.329  28.296  18.197 1.00 67.22 ? 134  GLU I O     1 
ATOM   6991  C CB    . GLU D 1 82  ? 51.626  26.219  15.668 1.00 67.45 ? 134  GLU I CB    1 
ATOM   6992  C CG    . GLU D 1 82  ? 52.400  26.050  14.385 1.00 69.20 ? 134  GLU I CG    1 
ATOM   6993  C CD    . GLU D 1 82  ? 52.416  27.316  13.562 1.00 69.85 ? 134  GLU I CD    1 
ATOM   6994  O OE1   . GLU D 1 82  ? 52.838  28.373  14.089 1.00 69.88 ? 134  GLU I OE1   1 
ATOM   6995  O OE2   . GLU D 1 82  ? 51.998  27.246  12.385 1.00 69.96 ? 134  GLU I OE2   1 
ATOM   6996  N N     . LEU D 1 83  ? 51.177  26.109  18.735 1.00 66.20 ? 135  LEU I N     1 
ATOM   6997  C CA    . LEU D 1 83  ? 50.318  26.291  19.893 1.00 65.64 ? 135  LEU I CA    1 
ATOM   6998  C C     . LEU D 1 83  ? 50.872  27.331  20.878 1.00 66.14 ? 135  LEU I C     1 
ATOM   6999  O O     . LEU D 1 83  ? 50.143  28.226  21.314 1.00 66.16 ? 135  LEU I O     1 
ATOM   7000  C CB    . LEU D 1 83  ? 50.142  24.937  20.583 1.00 64.27 ? 135  LEU I CB    1 
ATOM   7001  C CG    . LEU D 1 83  ? 48.745  24.398  20.906 1.00 62.86 ? 135  LEU I CG    1 
ATOM   7002  C CD1   . LEU D 1 83  ? 47.712  24.886  19.917 1.00 63.12 ? 135  LEU I CD1   1 
ATOM   7003  C CD2   . LEU D 1 83  ? 48.813  22.885  20.895 1.00 61.67 ? 135  LEU I CD2   1 
ATOM   7004  N N     . LYS D 1 84  ? 52.155  27.212  21.226 1.00 65.84 ? 136  LYS I N     1 
ATOM   7005  C CA    . LYS D 1 84  ? 52.795  28.150  22.156 1.00 64.53 ? 136  LYS I CA    1 
ATOM   7006  C C     . LYS D 1 84  ? 52.673  29.589  21.650 1.00 64.19 ? 136  LYS I C     1 
ATOM   7007  O O     . LYS D 1 84  ? 52.259  30.492  22.384 1.00 63.53 ? 136  LYS I O     1 
ATOM   7008  C CB    . LYS D 1 84  ? 54.282  27.828  22.311 1.00 64.38 ? 136  LYS I CB    1 
ATOM   7009  C CG    . LYS D 1 84  ? 54.626  26.374  22.559 1.00 64.59 ? 136  LYS I CG    1 
ATOM   7010  C CD    . LYS D 1 84  ? 56.137  26.218  22.564 1.00 65.20 ? 136  LYS I CD    1 
ATOM   7011  C CE    . LYS D 1 84  ? 56.573  24.772  22.679 1.00 65.51 ? 136  LYS I CE    1 
ATOM   7012  N NZ    . LYS D 1 84  ? 58.063  24.676  22.687 1.00 66.93 ? 136  LYS I NZ    1 
ATOM   7013  N N     . LYS D 1 85  ? 53.052  29.785  20.387 1.00 64.35 ? 137  LYS I N     1 
ATOM   7014  C CA    . LYS D 1 85  ? 53.019  31.096  19.734 1.00 63.45 ? 137  LYS I CA    1 
ATOM   7015  C C     . LYS D 1 85  ? 51.650  31.762  19.832 1.00 62.39 ? 137  LYS I C     1 
ATOM   7016  O O     . LYS D 1 85  ? 51.523  32.974  19.644 1.00 62.19 ? 137  LYS I O     1 
ATOM   7017  C CB    . LYS D 1 85  ? 53.382  30.968  18.247 1.00 64.29 ? 137  LYS I CB    1 
ATOM   7018  C CG    . LYS D 1 85  ? 54.652  30.172  17.930 1.00 63.80 ? 137  LYS I CG    1 
ATOM   7019  C CD    . LYS D 1 85  ? 54.902  30.175  16.420 1.00 62.33 ? 137  LYS I CD    1 
ATOM   7020  C CE    . LYS D 1 85  ? 55.979  29.194  16.025 1.00 61.23 ? 137  LYS I CE    1 
ATOM   7021  N NZ    . LYS D 1 85  ? 56.230  29.228  14.564 1.00 61.15 ? 137  LYS I NZ    1 
ATOM   7022  N N     . SER D 1 86  ? 50.621  30.972  20.115 1.00 61.21 ? 138  SER I N     1 
ATOM   7023  C CA    . SER D 1 86  ? 49.279  31.522  20.208 1.00 58.91 ? 138  SER I CA    1 
ATOM   7024  C C     . SER D 1 86  ? 49.181  32.568  21.291 1.00 56.67 ? 138  SER I C     1 
ATOM   7025  O O     . SER D 1 86  ? 49.780  32.431  22.357 1.00 54.95 ? 138  SER I O     1 
ATOM   7026  C CB    . SER D 1 86  ? 48.252  30.429  20.488 1.00 60.17 ? 138  SER I CB    1 
ATOM   7027  O OG    . SER D 1 86  ? 46.940  30.960  20.396 1.00 61.78 ? 138  SER I OG    1 
ATOM   7028  N N     . PRO D 1 87  ? 48.408  33.630  21.026 1.00 55.90 ? 139  PRO I N     1 
ATOM   7029  C CA    . PRO D 1 87  ? 48.171  34.757  21.933 1.00 55.44 ? 139  PRO I CA    1 
ATOM   7030  C C     . PRO D 1 87  ? 47.520  34.268  23.222 1.00 55.27 ? 139  PRO I C     1 
ATOM   7031  O O     . PRO D 1 87  ? 48.155  34.186  24.280 1.00 56.85 ? 139  PRO I O     1 
ATOM   7032  C CB    . PRO D 1 87  ? 47.210  35.646  21.142 1.00 55.86 ? 139  PRO I CB    1 
ATOM   7033  C CG    . PRO D 1 87  ? 47.461  35.285  19.721 1.00 55.64 ? 139  PRO I CG    1 
ATOM   7034  C CD    . PRO D 1 87  ? 47.644  33.799  19.779 1.00 55.52 ? 139  PRO I CD    1 
ATOM   7035  N N     . VAL D 1 88  ? 46.237  33.942  23.109 1.00 53.00 ? 140  VAL I N     1 
ATOM   7036  C CA    . VAL D 1 88  ? 45.447  33.470  24.231 1.00 50.90 ? 140  VAL I CA    1 
ATOM   7037  C C     . VAL D 1 88  ? 45.900  32.099  24.722 1.00 49.38 ? 140  VAL I C     1 
ATOM   7038  O O     . VAL D 1 88  ? 46.356  31.271  23.937 1.00 49.36 ? 140  VAL I O     1 
ATOM   7039  C CB    . VAL D 1 88  ? 43.974  33.386  23.830 1.00 51.30 ? 140  VAL I CB    1 
ATOM   7040  C CG1   . VAL D 1 88  ? 43.495  34.752  23.345 1.00 50.52 ? 140  VAL I CG1   1 
ATOM   7041  C CG2   . VAL D 1 88  ? 43.798  32.337  22.740 1.00 49.22 ? 140  VAL I CG2   1 
ATOM   7042  N N     . PRO D 1 89  ? 45.776  31.844  26.033 1.00 47.86 ? 141  PRO I N     1 
ATOM   7043  C CA    . PRO D 1 89  ? 46.184  30.550  26.586 1.00 47.41 ? 141  PRO I CA    1 
ATOM   7044  C C     . PRO D 1 89  ? 45.370  29.394  25.994 1.00 46.56 ? 141  PRO I C     1 
ATOM   7045  O O     . PRO D 1 89  ? 44.160  29.507  25.748 1.00 45.36 ? 141  PRO I O     1 
ATOM   7046  C CB    . PRO D 1 89  ? 45.940  30.712  28.091 1.00 47.21 ? 141  PRO I CB    1 
ATOM   7047  C CG    . PRO D 1 89  ? 46.026  32.183  28.310 1.00 48.08 ? 141  PRO I CG    1 
ATOM   7048  C CD    . PRO D 1 89  ? 45.309  32.741  27.102 1.00 48.06 ? 141  PRO I CD    1 
ATOM   7049  N N     . VAL D 1 90  ? 46.046  28.274  25.782 1.00 45.53 ? 142  VAL I N     1 
ATOM   7050  C CA    . VAL D 1 90  ? 45.411  27.095  25.219 1.00 43.10 ? 142  VAL I CA    1 
ATOM   7051  C C     . VAL D 1 90  ? 45.814  25.859  26.027 1.00 42.47 ? 142  VAL I C     1 
ATOM   7052  O O     . VAL D 1 90  ? 47.000  25.627  26.280 1.00 42.31 ? 142  VAL I O     1 
ATOM   7053  C CB    . VAL D 1 90  ? 45.849  26.902  23.748 1.00 41.93 ? 142  VAL I CB    1 
ATOM   7054  C CG1   . VAL D 1 90  ? 45.090  25.755  23.118 1.00 41.24 ? 142  VAL I CG1   1 
ATOM   7055  C CG2   . VAL D 1 90  ? 45.636  28.192  22.972 1.00 40.30 ? 142  VAL I CG2   1 
ATOM   7056  N N     . VAL D 1 91  ? 44.821  25.084  26.453 1.00 40.16 ? 143  VAL I N     1 
ATOM   7057  C CA    . VAL D 1 91  ? 45.080  23.855  27.191 1.00 37.09 ? 143  VAL I CA    1 
ATOM   7058  C C     . VAL D 1 91  ? 44.274  22.721  26.533 1.00 35.42 ? 143  VAL I C     1 
ATOM   7059  O O     . VAL D 1 91  ? 43.110  22.896  26.187 1.00 34.72 ? 143  VAL I O     1 
ATOM   7060  C CB    . VAL D 1 91  ? 44.729  24.033  28.703 1.00 36.19 ? 143  VAL I CB    1 
ATOM   7061  C CG1   . VAL D 1 91  ? 43.828  25.228  28.881 1.00 37.11 ? 143  VAL I CG1   1 
ATOM   7062  C CG2   . VAL D 1 91  ? 44.077  22.784  29.262 1.00 32.12 ? 143  VAL I CG2   1 
ATOM   7063  N N     . LEU D 1 92  ? 44.907  21.572  26.328 1.00 34.00 ? 144  LEU I N     1 
ATOM   7064  C CA    . LEU D 1 92  ? 44.240  20.434  25.700 1.00 33.90 ? 144  LEU I CA    1 
ATOM   7065  C C     . LEU D 1 92  ? 43.366  19.644  26.679 1.00 33.52 ? 144  LEU I C     1 
ATOM   7066  O O     . LEU D 1 92  ? 43.547  19.717  27.889 1.00 32.69 ? 144  LEU I O     1 
ATOM   7067  C CB    . LEU D 1 92  ? 45.276  19.486  25.110 1.00 33.05 ? 144  LEU I CB    1 
ATOM   7068  C CG    . LEU D 1 92  ? 46.489  20.098  24.431 1.00 31.72 ? 144  LEU I CG    1 
ATOM   7069  C CD1   . LEU D 1 92  ? 47.445  18.993  24.022 1.00 31.45 ? 144  LEU I CD1   1 
ATOM   7070  C CD2   . LEU D 1 92  ? 46.045  20.902  23.237 1.00 30.85 ? 144  LEU I CD2   1 
ATOM   7071  N N     . ALA D 1 93  ? 42.432  18.867  26.143 1.00 33.77 ? 145  ALA I N     1 
ATOM   7072  C CA    . ALA D 1 93  ? 41.546  18.072  26.981 1.00 33.94 ? 145  ALA I CA    1 
ATOM   7073  C C     . ALA D 1 93  ? 41.274  16.708  26.370 1.00 34.93 ? 145  ALA I C     1 
ATOM   7074  O O     . ALA D 1 93  ? 40.668  16.621  25.304 1.00 36.35 ? 145  ALA I O     1 
ATOM   7075  C CB    . ALA D 1 93  ? 40.249  18.801  27.176 1.00 33.03 ? 145  ALA I CB    1 
ATOM   7076  N N     . ALA D 1 94  ? 41.718  15.646  27.035 1.00 33.74 ? 146  ALA I N     1 
ATOM   7077  C CA    . ALA D 1 94  ? 41.480  14.294  26.539 1.00 34.64 ? 146  ALA I CA    1 
ATOM   7078  C C     . ALA D 1 94  ? 42.163  14.027  25.204 1.00 35.77 ? 146  ALA I C     1 
ATOM   7079  O O     . ALA D 1 94  ? 41.691  13.234  24.384 1.00 35.25 ? 146  ALA I O     1 
ATOM   7080  C CB    . ALA D 1 94  ? 39.994  14.050  26.416 1.00 34.35 ? 146  ALA I CB    1 
ATOM   7081  N N     . SER D 1 95  ? 43.284  14.705  24.999 1.00 37.43 ? 147  SER I N     1 
ATOM   7082  C CA    . SER D 1 95  ? 44.092  14.564  23.791 1.00 37.98 ? 147  SER I CA    1 
ATOM   7083  C C     . SER D 1 95  ? 45.538  14.782  24.230 1.00 37.96 ? 147  SER I C     1 
ATOM   7084  O O     . SER D 1 95  ? 45.826  15.688  25.000 1.00 37.48 ? 147  SER I O     1 
ATOM   7085  C CB    . SER D 1 95  ? 43.654  15.587  22.746 1.00 38.24 ? 147  SER I CB    1 
ATOM   7086  O OG    . SER D 1 95  ? 43.127  16.740  23.375 1.00 37.56 ? 147  SER I OG    1 
ATOM   7087  N N     . ILE D 1 96  ? 46.449  13.950  23.741 1.00 39.47 ? 148  ILE I N     1 
ATOM   7088  C CA    . ILE D 1 96  ? 47.848  14.030  24.163 1.00 40.16 ? 148  ILE I CA    1 
ATOM   7089  C C     . ILE D 1 96  ? 48.866  14.586  23.175 1.00 40.71 ? 148  ILE I C     1 
ATOM   7090  O O     . ILE D 1 96  ? 48.601  14.702  21.978 1.00 40.40 ? 148  ILE I O     1 
ATOM   7091  C CB    . ILE D 1 96  ? 48.336  12.650  24.586 1.00 39.39 ? 148  ILE I CB    1 
ATOM   7092  C CG1   . ILE D 1 96  ? 48.387  11.732  23.362 1.00 39.03 ? 148  ILE I CG1   1 
ATOM   7093  C CG2   . ILE D 1 96  ? 47.384  12.075  25.622 1.00 38.47 ? 148  ILE I CG2   1 
ATOM   7094  C CD1   . ILE D 1 96  ? 49.086  10.426  23.583 1.00 41.45 ? 148  ILE I CD1   1 
ATOM   7095  N N     . GLU D 1 97  ? 50.039  14.927  23.703 1.00 42.26 ? 149  GLU I N     1 
ATOM   7096  C CA    . GLU D 1 97  ? 51.133  15.445  22.887 1.00 45.81 ? 149  GLU I CA    1 
ATOM   7097  C C     . GLU D 1 97  ? 52.486  15.022  23.489 1.00 46.42 ? 149  GLU I C     1 
ATOM   7098  O O     . GLU D 1 97  ? 52.745  15.240  24.667 1.00 46.96 ? 149  GLU I O     1 
ATOM   7099  C CB    . GLU D 1 97  ? 51.018  16.972  22.744 1.00 46.62 ? 149  GLU I CB    1 
ATOM   7100  C CG    . GLU D 1 97  ? 51.467  17.805  23.925 1.00 48.83 ? 149  GLU I CG    1 
ATOM   7101  C CD    . GLU D 1 97  ? 52.868  18.343  23.739 1.00 50.70 ? 149  GLU I CD    1 
ATOM   7102  O OE1   . GLU D 1 97  ? 53.143  19.472  24.209 1.00 52.41 ? 149  GLU I OE1   1 
ATOM   7103  O OE2   . GLU D 1 97  ? 53.694  17.635  23.126 1.00 52.62 ? 149  GLU I OE2   1 
ATOM   7104  N N     . SER D 1 98  ? 53.337  14.413  22.664 1.00 46.91 ? 150  SER I N     1 
ATOM   7105  C CA    . SER D 1 98  ? 54.630  13.894  23.100 1.00 47.87 ? 150  SER I CA    1 
ATOM   7106  C C     . SER D 1 98  ? 55.556  14.803  23.907 1.00 47.46 ? 150  SER I C     1 
ATOM   7107  O O     . SER D 1 98  ? 56.036  14.406  24.959 1.00 47.66 ? 150  SER I O     1 
ATOM   7108  C CB    . SER D 1 98  ? 55.411  13.345  21.906 1.00 49.51 ? 150  SER I CB    1 
ATOM   7109  O OG    . SER D 1 98  ? 54.845  12.124  21.454 1.00 52.97 ? 150  SER I OG    1 
ATOM   7110  N N     . THR D 1 99  ? 55.804  16.009  23.420 1.00 47.63 ? 151  THR I N     1 
ATOM   7111  C CA    . THR D 1 99  ? 56.706  16.905  24.091 1.00 48.99 ? 151  THR I CA    1 
ATOM   7112  C C     . THR D 1 99  ? 56.217  17.326  25.483 1.00 50.60 ? 151  THR I C     1 
ATOM   7113  O O     . THR D 1 99  ? 57.012  17.787  26.307 1.00 49.62 ? 151  THR I O     1 
ATOM   7114  C CB    . THR D 1 99  ? 56.970  18.145  23.205 1.00 48.07 ? 151  THR I CB    1 
ATOM   7115  O OG1   . THR D 1 99  ? 55.886  19.068  23.337 1.00 47.27 ? 151  THR I OG1   1 
ATOM   7116  C CG2   . THR D 1 99  ? 57.070  17.705  21.761 1.00 45.56 ? 151  THR I CG2   1 
ATOM   7117  N N     . ASN D 1 100 ? 54.926  17.099  25.743 1.00 52.38 ? 152  ASN I N     1 
ATOM   7118  C CA    . ASN D 1 100 ? 54.221  17.469  26.981 1.00 54.65 ? 152  ASN I CA    1 
ATOM   7119  C C     . ASN D 1 100 ? 54.642  18.828  27.551 1.00 55.15 ? 152  ASN I C     1 
ATOM   7120  O O     . ASN D 1 100 ? 54.928  18.980  28.749 1.00 55.24 ? 152  ASN I O     1 
ATOM   7121  C CB    . ASN D 1 100 ? 54.284  16.365  28.085 1.00 55.13 ? 152  ASN I CB    1 
ATOM   7122  C CG    . ASN D 1 100 ? 55.675  15.825  28.340 1.00 55.80 ? 152  ASN I CG    1 
ATOM   7123  O OD1   . ASN D 1 100 ? 56.552  16.530  28.847 1.00 57.38 ? 152  ASN I OD1   1 
ATOM   7124  N ND2   . ASN D 1 100 ? 55.877  14.547  28.003 1.00 55.13 ? 152  ASN I ND2   1 
ATOM   7125  N N     . GLN D 1 101 ? 54.637  19.806  26.649 1.00 55.20 ? 153  GLN I N     1 
ATOM   7126  C CA    . GLN D 1 101 ? 54.993  21.180  26.926 1.00 55.37 ? 153  GLN I CA    1 
ATOM   7127  C C     . GLN D 1 101 ? 53.738  21.997  27.124 1.00 55.33 ? 153  GLN I C     1 
ATOM   7128  O O     . GLN D 1 101 ? 53.728  22.917  27.929 1.00 56.46 ? 153  GLN I O     1 
ATOM   7129  C CB    . GLN D 1 101 ? 55.801  21.763  25.768 1.00 55.09 ? 153  GLN I CB    1 
ATOM   7130  C CG    . GLN D 1 101 ? 57.115  21.074  25.535 1.00 55.56 ? 153  GLN I CG    1 
ATOM   7131  C CD    . GLN D 1 101 ? 57.918  21.766  24.478 1.00 57.00 ? 153  GLN I CD    1 
ATOM   7132  O OE1   . GLN D 1 101 ? 57.638  21.639  23.294 1.00 58.52 ? 153  GLN I OE1   1 
ATOM   7133  N NE2   . GLN D 1 101 ? 58.921  22.522  24.898 1.00 57.83 ? 153  GLN I NE2   1 
ATOM   7134  N N     . ILE D 1 102 ? 52.671  21.637  26.416 1.00 54.64 ? 154  ILE I N     1 
ATOM   7135  C CA    . ILE D 1 102 ? 51.408  22.368  26.511 1.00 53.39 ? 154  ILE I CA    1 
ATOM   7136  C C     . ILE D 1 102 ? 50.442  21.763  27.540 1.00 52.33 ? 154  ILE I C     1 
ATOM   7137  O O     . ILE D 1 102 ? 50.327  20.544  27.638 1.00 53.29 ? 154  ILE I O     1 
ATOM   7138  C CB    . ILE D 1 102 ? 50.757  22.437  25.130 1.00 52.13 ? 154  ILE I CB    1 
ATOM   7139  C CG1   . ILE D 1 102 ? 50.596  21.028  24.583 1.00 52.12 ? 154  ILE I CG1   1 
ATOM   7140  C CG2   . ILE D 1 102 ? 51.657  23.214  24.166 1.00 51.68 ? 154  ILE I CG2   1 
ATOM   7141  C CD1   . ILE D 1 102 ? 50.306  20.978  23.100 1.00 48.67 ? 154  ILE I CD1   1 
ATOM   7142  N N     . PRO D 1 103 ? 49.735  22.613  28.320 1.00 51.11 ? 155  PRO I N     1 
ATOM   7143  C CA    . PRO D 1 103 ? 48.776  22.210  29.361 1.00 50.08 ? 155  PRO I CA    1 
ATOM   7144  C C     . PRO D 1 103 ? 47.772  21.192  28.852 1.00 50.05 ? 155  PRO I C     1 
ATOM   7145  O O     . PRO D 1 103 ? 47.093  21.447  27.863 1.00 51.68 ? 155  PRO I O     1 
ATOM   7146  C CB    . PRO D 1 103 ? 48.095  23.524  29.732 1.00 49.46 ? 155  PRO I CB    1 
ATOM   7147  C CG    . PRO D 1 103 ? 49.107  24.542  29.421 1.00 48.76 ? 155  PRO I CG    1 
ATOM   7148  C CD    . PRO D 1 103 ? 49.652  24.066  28.105 1.00 50.25 ? 155  PRO I CD    1 
ATOM   7149  N N     . SER D 1 104 ? 47.657  20.050  29.521 1.00 48.94 ? 156  SER I N     1 
ATOM   7150  C CA    . SER D 1 104 ? 46.717  19.033  29.066 1.00 47.62 ? 156  SER I CA    1 
ATOM   7151  C C     . SER D 1 104 ? 46.192  18.136  30.168 1.00 47.31 ? 156  SER I C     1 
ATOM   7152  O O     . SER D 1 104 ? 46.963  17.413  30.802 1.00 48.82 ? 156  SER I O     1 
ATOM   7153  C CB    . SER D 1 104 ? 47.372  18.139  28.019 1.00 48.08 ? 156  SER I CB    1 
ATOM   7154  O OG    . SER D 1 104 ? 48.239  17.195  28.632 1.00 49.09 ? 156  SER I OG    1 
ATOM   7155  N N     . VAL D 1 105 ? 44.881  18.171  30.387 1.00 44.80 ? 157  VAL I N     1 
ATOM   7156  C CA    . VAL D 1 105 ? 44.269  17.315  31.384 1.00 41.83 ? 157  VAL I CA    1 
ATOM   7157  C C     . VAL D 1 105 ? 43.756  16.087  30.634 1.00 40.17 ? 157  VAL I C     1 
ATOM   7158  O O     . VAL D 1 105 ? 42.933  16.173  29.730 1.00 39.69 ? 157  VAL I O     1 
ATOM   7159  C CB    . VAL D 1 105 ? 43.164  18.065  32.176 1.00 40.88 ? 157  VAL I CB    1 
ATOM   7160  C CG1   . VAL D 1 105 ? 42.621  19.206  31.360 1.00 41.08 ? 157  VAL I CG1   1 
ATOM   7161  C CG2   . VAL D 1 105 ? 42.067  17.092  32.597 1.00 40.35 ? 157  VAL I CG2   1 
ATOM   7162  N N     . THR D 1 106 ? 44.280  14.941  31.040 1.00 40.30 ? 158  THR I N     1 
ATOM   7163  C CA    . THR D 1 106 ? 44.018  13.653  30.415 1.00 39.67 ? 158  THR I CA    1 
ATOM   7164  C C     . THR D 1 106 ? 43.960  12.556  31.486 1.00 38.37 ? 158  THR I C     1 
ATOM   7165  O O     . THR D 1 106 ? 43.868  12.843  32.673 1.00 37.64 ? 158  THR I O     1 
ATOM   7166  C CB    . THR D 1 106 ? 45.206  13.359  29.442 1.00 40.87 ? 158  THR I CB    1 
ATOM   7167  O OG1   . THR D 1 106 ? 45.138  12.023  28.945 1.00 43.52 ? 158  THR I OG1   1 
ATOM   7168  C CG2   . THR D 1 106 ? 46.544  13.539  30.178 1.00 41.47 ? 158  THR I CG2   1 
ATOM   7169  N N     . ILE D 1 107 ? 43.982  11.301  31.052 1.00 38.12 ? 159  ILE I N     1 
ATOM   7170  C CA    . ILE D 1 107 ? 44.033  10.163  31.963 1.00 38.06 ? 159  ILE I CA    1 
ATOM   7171  C C     . ILE D 1 107 ? 45.195  9.339   31.401 1.00 38.68 ? 159  ILE I C     1 
ATOM   7172  O O     . ILE D 1 107 ? 45.796  9.726   30.397 1.00 38.38 ? 159  ILE I O     1 
ATOM   7173  C CB    . ILE D 1 107 ? 42.746  9.282   31.957 1.00 38.05 ? 159  ILE I CB    1 
ATOM   7174  C CG1   . ILE D 1 107 ? 42.555  8.623   30.590 1.00 37.41 ? 159  ILE I CG1   1 
ATOM   7175  C CG2   . ILE D 1 107 ? 41.544  10.107  32.371 1.00 36.18 ? 159  ILE I CG2   1 
ATOM   7176  C CD1   . ILE D 1 107 ? 41.523  7.510   30.583 1.00 40.59 ? 159  ILE I CD1   1 
ATOM   7177  N N     . ASP D 1 108 ? 45.517  8.218   32.040 1.00 39.17 ? 160  ASP I N     1 
ATOM   7178  C CA    . ASP D 1 108 ? 46.613  7.366   31.578 1.00 37.57 ? 160  ASP I CA    1 
ATOM   7179  C C     . ASP D 1 108 ? 46.097  6.319   30.589 1.00 35.81 ? 160  ASP I C     1 
ATOM   7180  O O     . ASP D 1 108 ? 45.938  5.133   30.923 1.00 34.12 ? 160  ASP I O     1 
ATOM   7181  C CB    . ASP D 1 108 ? 47.273  6.668   32.768 1.00 39.50 ? 160  ASP I CB    1 
ATOM   7182  C CG    . ASP D 1 108 ? 48.569  6.014   32.402 1.00 39.69 ? 160  ASP I CG    1 
ATOM   7183  O OD1   . ASP D 1 108 ? 48.585  5.179   31.475 1.00 43.17 ? 160  ASP I OD1   1 
ATOM   7184  O OD2   . ASP D 1 108 ? 49.578  6.338   33.047 1.00 41.52 ? 160  ASP I OD2   1 
ATOM   7185  N N     . TYR D 1 109 ? 45.841  6.785   29.374 1.00 33.98 ? 161  TYR I N     1 
ATOM   7186  C CA    . TYR D 1 109 ? 45.342  5.964   28.283 1.00 34.59 ? 161  TYR I CA    1 
ATOM   7187  C C     . TYR D 1 109 ? 46.005  4.587   28.170 1.00 35.47 ? 161  TYR I C     1 
ATOM   7188  O O     . TYR D 1 109 ? 45.333  3.563   27.958 1.00 34.47 ? 161  TYR I O     1 
ATOM   7189  C CB    . TYR D 1 109 ? 45.495  6.749   26.981 1.00 34.37 ? 161  TYR I CB    1 
ATOM   7190  C CG    . TYR D 1 109 ? 44.590  7.954   26.934 1.00 32.23 ? 161  TYR I CG    1 
ATOM   7191  C CD1   . TYR D 1 109 ? 45.097  9.227   26.706 1.00 31.09 ? 161  TYR I CD1   1 
ATOM   7192  C CD2   . TYR D 1 109 ? 43.231  7.820   27.170 1.00 32.87 ? 161  TYR I CD2   1 
ATOM   7193  C CE1   . TYR D 1 109 ? 44.275  10.337  26.721 1.00 32.23 ? 161  TYR I CE1   1 
ATOM   7194  C CE2   . TYR D 1 109 ? 42.394  8.927   27.191 1.00 33.81 ? 161  TYR I CE2   1 
ATOM   7195  C CZ    . TYR D 1 109 ? 42.918  10.184  26.968 1.00 33.29 ? 161  TYR I CZ    1 
ATOM   7196  O OH    . TYR D 1 109 ? 42.078  11.281  27.013 1.00 32.40 ? 161  TYR I OH    1 
ATOM   7197  N N     . GLU D 1 110 ? 47.324  4.562   28.309 1.00 36.08 ? 162  GLU I N     1 
ATOM   7198  C CA    . GLU D 1 110 ? 48.058  3.311   28.242 1.00 36.22 ? 162  GLU I CA    1 
ATOM   7199  C C     . GLU D 1 110 ? 47.639  2.404   29.403 1.00 36.70 ? 162  GLU I C     1 
ATOM   7200  O O     . GLU D 1 110 ? 47.299  1.236   29.202 1.00 35.70 ? 162  GLU I O     1 
ATOM   7201  C CB    . GLU D 1 110 ? 49.555  3.593   28.291 1.00 35.93 ? 162  GLU I CB    1 
ATOM   7202  C CG    . GLU D 1 110 ? 50.431  2.405   27.963 1.00 37.44 ? 162  GLU I CG    1 
ATOM   7203  C CD    . GLU D 1 110 ? 50.693  1.508   29.167 1.00 39.54 ? 162  GLU I CD    1 
ATOM   7204  O OE1   . GLU D 1 110 ? 50.637  2.009   30.307 1.00 39.32 ? 162  GLU I OE1   1 
ATOM   7205  O OE2   . GLU D 1 110 ? 50.980  0.307   28.972 1.00 40.09 ? 162  GLU I OE2   1 
ATOM   7206  N N     . GLN D 1 111 ? 47.644  2.943   30.617 1.00 36.81 ? 163  GLN I N     1 
ATOM   7207  C CA    . GLN D 1 111 ? 47.265  2.143   31.774 1.00 37.92 ? 163  GLN I CA    1 
ATOM   7208  C C     . GLN D 1 111 ? 45.835  1.670   31.621 1.00 39.29 ? 163  GLN I C     1 
ATOM   7209  O O     . GLN D 1 111 ? 45.529  0.487   31.826 1.00 39.33 ? 163  GLN I O     1 
ATOM   7210  C CB    . GLN D 1 111 ? 47.376  2.952   33.062 1.00 37.91 ? 163  GLN I CB    1 
ATOM   7211  C CG    . GLN D 1 111 ? 47.264  2.104   34.317 1.00 36.02 ? 163  GLN I CG    1 
ATOM   7212  C CD    . GLN D 1 111 ? 48.322  1.019   34.359 1.00 36.92 ? 163  GLN I CD    1 
ATOM   7213  O OE1   . GLN D 1 111 ? 49.480  1.247   33.985 1.00 37.71 ? 163  GLN I OE1   1 
ATOM   7214  N NE2   . GLN D 1 111 ? 47.937  -0.169  34.823 1.00 35.92 ? 163  GLN I NE2   1 
ATOM   7215  N N     . ALA D 1 112 ? 44.956  2.608   31.274 1.00 39.03 ? 164  ALA I N     1 
ATOM   7216  C CA    . ALA D 1 112 ? 43.557  2.282   31.092 1.00 38.10 ? 164  ALA I CA    1 
ATOM   7217  C C     . ALA D 1 112 ? 43.489  1.106   30.125 1.00 38.56 ? 164  ALA I C     1 
ATOM   7218  O O     . ALA D 1 112 ? 42.974  0.044   30.472 1.00 38.58 ? 164  ALA I O     1 
ATOM   7219  C CB    . ALA D 1 112 ? 42.812  3.472   30.547 1.00 37.31 ? 164  ALA I CB    1 
ATOM   7220  N N     . ALA D 1 113 ? 44.035  1.281   28.925 1.00 39.27 ? 165  ALA I N     1 
ATOM   7221  C CA    . ALA D 1 113 ? 44.026  0.205   27.935 1.00 40.37 ? 165  ALA I CA    1 
ATOM   7222  C C     . ALA D 1 113 ? 44.490  -1.110  28.558 1.00 42.16 ? 165  ALA I C     1 
ATOM   7223  O O     . ALA D 1 113 ? 43.918  -2.172  28.288 1.00 42.17 ? 165  ALA I O     1 
ATOM   7224  C CB    . ALA D 1 113 ? 44.918  0.561   26.767 1.00 39.20 ? 165  ALA I CB    1 
ATOM   7225  N N     . PHE D 1 114 ? 45.520  -1.023  29.401 1.00 44.02 ? 166  PHE I N     1 
ATOM   7226  C CA    . PHE D 1 114 ? 46.098  -2.189  30.073 1.00 44.23 ? 166  PHE I CA    1 
ATOM   7227  C C     . PHE D 1 114 ? 45.137  -2.838  31.070 1.00 44.26 ? 166  PHE I C     1 
ATOM   7228  O O     . PHE D 1 114 ? 44.864  -4.045  30.998 1.00 44.11 ? 166  PHE I O     1 
ATOM   7229  C CB    . PHE D 1 114 ? 47.397  -1.788  30.794 1.00 44.46 ? 166  PHE I CB    1 
ATOM   7230  C CG    . PHE D 1 114 ? 48.054  -2.919  31.545 1.00 45.63 ? 166  PHE I CG    1 
ATOM   7231  C CD1   . PHE D 1 114 ? 47.511  -3.396  32.741 1.00 46.26 ? 166  PHE I CD1   1 
ATOM   7232  C CD2   . PHE D 1 114 ? 49.199  -3.534  31.041 1.00 46.45 ? 166  PHE I CD2   1 
ATOM   7233  C CE1   . PHE D 1 114 ? 48.098  -4.473  33.423 1.00 45.79 ? 166  PHE I CE1   1 
ATOM   7234  C CE2   . PHE D 1 114 ? 49.793  -4.614  31.716 1.00 45.80 ? 166  PHE I CE2   1 
ATOM   7235  C CZ    . PHE D 1 114 ? 49.239  -5.081  32.906 1.00 45.47 ? 166  PHE I CZ    1 
ATOM   7236  N N     . ASP D 1 115 ? 44.634  -2.041  32.006 1.00 42.62 ? 167  ASP I N     1 
ATOM   7237  C CA    . ASP D 1 115 ? 43.732  -2.566  33.015 1.00 41.40 ? 167  ASP I CA    1 
ATOM   7238  C C     . ASP D 1 115 ? 42.541  -3.254  32.361 1.00 40.28 ? 167  ASP I C     1 
ATOM   7239  O O     . ASP D 1 115 ? 42.071  -4.281  32.851 1.00 40.22 ? 167  ASP I O     1 
ATOM   7240  C CB    . ASP D 1 115 ? 43.275  -1.437  33.946 1.00 42.21 ? 167  ASP I CB    1 
ATOM   7241  C CG    . ASP D 1 115 ? 44.448  -0.683  34.563 1.00 43.27 ? 167  ASP I CG    1 
ATOM   7242  O OD1   . ASP D 1 115 ? 45.386  -1.353  35.039 1.00 44.87 ? 167  ASP I OD1   1 
ATOM   7243  O OD2   . ASP D 1 115 ? 44.446  0.567   34.582 1.00 41.44 ? 167  ASP I OD2   1 
ATOM   7244  N N     . ALA D 1 116 ? 42.072  -2.701  31.243 1.00 38.68 ? 168  ALA I N     1 
ATOM   7245  C CA    . ALA D 1 116 ? 40.932  -3.262  30.522 1.00 38.05 ? 168  ALA I CA    1 
ATOM   7246  C C     . ALA D 1 116 ? 41.186  -4.689  30.052 1.00 38.33 ? 168  ALA I C     1 
ATOM   7247  O O     . ALA D 1 116 ? 40.463  -5.614  30.418 1.00 37.86 ? 168  ALA I O     1 
ATOM   7248  C CB    . ALA D 1 116 ? 40.590  -2.391  29.341 1.00 38.68 ? 168  ALA I CB    1 
ATOM   7249  N N     . VAL D 1 117 ? 42.210  -4.868  29.227 1.00 38.98 ? 169  VAL I N     1 
ATOM   7250  C CA    . VAL D 1 117 ? 42.538  -6.198  28.737 1.00 40.06 ? 169  VAL I CA    1 
ATOM   7251  C C     . VAL D 1 117 ? 42.884  -7.131  29.904 1.00 39.56 ? 169  VAL I C     1 
ATOM   7252  O O     . VAL D 1 117 ? 42.496  -8.304  29.907 1.00 38.55 ? 169  VAL I O     1 
ATOM   7253  C CB    . VAL D 1 117 ? 43.689  -6.129  27.690 1.00 40.30 ? 169  VAL I CB    1 
ATOM   7254  C CG1   . VAL D 1 117 ? 44.576  -4.933  27.980 1.00 42.09 ? 169  VAL I CG1   1 
ATOM   7255  C CG2   . VAL D 1 117 ? 44.494  -7.430  27.682 1.00 38.19 ? 169  VAL I CG2   1 
ATOM   7256  N N     . GLN D 1 118 ? 43.595  -6.607  30.899 1.00 39.49 ? 170  GLN I N     1 
ATOM   7257  C CA    . GLN D 1 118 ? 43.954  -7.402  32.073 1.00 39.84 ? 170  GLN I CA    1 
ATOM   7258  C C     . GLN D 1 118 ? 42.664  -7.945  32.683 1.00 38.03 ? 170  GLN I C     1 
ATOM   7259  O O     . GLN D 1 118 ? 42.594  -9.091  33.122 1.00 35.41 ? 170  GLN I O     1 
ATOM   7260  C CB    . GLN D 1 118 ? 44.694  -6.527  33.088 1.00 41.95 ? 170  GLN I CB    1 
ATOM   7261  C CG    . GLN D 1 118 ? 45.313  -7.267  34.269 1.00 43.03 ? 170  GLN I CG    1 
ATOM   7262  C CD    . GLN D 1 118 ? 46.167  -8.442  33.843 1.00 45.30 ? 170  GLN I CD    1 
ATOM   7263  O OE1   . GLN D 1 118 ? 45.677  -9.567  33.744 1.00 48.38 ? 170  GLN I OE1   1 
ATOM   7264  N NE2   . GLN D 1 118 ? 47.445  -8.190  33.572 1.00 45.94 ? 170  GLN I NE2   1 
ATOM   7265  N N     . SER D 1 119 ? 41.644  -7.096  32.699 1.00 38.11 ? 171  SER I N     1 
ATOM   7266  C CA    . SER D 1 119 ? 40.344  -7.471  33.221 1.00 38.95 ? 171  SER I CA    1 
ATOM   7267  C C     . SER D 1 119 ? 39.861  -8.713  32.485 1.00 39.94 ? 171  SER I C     1 
ATOM   7268  O O     . SER D 1 119 ? 39.195  -9.571  33.048 1.00 39.01 ? 171  SER I O     1 
ATOM   7269  C CB    . SER D 1 119 ? 39.355  -6.331  33.007 1.00 38.61 ? 171  SER I CB    1 
ATOM   7270  O OG    . SER D 1 119 ? 38.023  -6.812  33.006 1.00 39.50 ? 171  SER I OG    1 
ATOM   7271  N N     . LEU D 1 120 ? 40.212  -8.801  31.214 1.00 41.87 ? 172  LEU I N     1 
ATOM   7272  C CA    . LEU D 1 120 ? 39.805  -9.932  30.404 1.00 44.52 ? 172  LEU I CA    1 
ATOM   7273  C C     . LEU D 1 120 ? 40.607  -11.193 30.724 1.00 45.45 ? 172  LEU I C     1 
ATOM   7274  O O     . LEU D 1 120 ? 40.051  -12.289 30.837 1.00 45.36 ? 172  LEU I O     1 
ATOM   7275  C CB    . LEU D 1 120 ? 39.959  -9.571  28.929 1.00 44.77 ? 172  LEU I CB    1 
ATOM   7276  C CG    . LEU D 1 120 ? 39.062  -8.415  28.485 1.00 43.92 ? 172  LEU I CG    1 
ATOM   7277  C CD1   . LEU D 1 120 ? 39.566  -7.890  27.152 1.00 42.51 ? 172  LEU I CD1   1 
ATOM   7278  C CD2   . LEU D 1 120 ? 37.599  -8.876  28.410 1.00 41.38 ? 172  LEU I CD2   1 
ATOM   7279  N N     . ILE D 1 121 ? 41.917  -11.029 30.866 1.00 45.61 ? 173  ILE I N     1 
ATOM   7280  C CA    . ILE D 1 121 ? 42.796  -12.145 31.166 1.00 45.86 ? 173  ILE I CA    1 
ATOM   7281  C C     . ILE D 1 121 ? 42.422  -12.782 32.500 1.00 46.85 ? 173  ILE I C     1 
ATOM   7282  O O     . ILE D 1 121 ? 42.326  -14.008 32.618 1.00 46.73 ? 173  ILE I O     1 
ATOM   7283  C CB    . ILE D 1 121 ? 44.259  -11.678 31.230 1.00 44.84 ? 173  ILE I CB    1 
ATOM   7284  C CG1   . ILE D 1 121 ? 44.615  -10.924 29.946 1.00 44.20 ? 173  ILE I CG1   1 
ATOM   7285  C CG2   . ILE D 1 121 ? 45.173  -12.883 31.396 1.00 45.92 ? 173  ILE I CG2   1 
ATOM   7286  C CD1   . ILE D 1 121 ? 45.977  -10.280 29.950 1.00 43.10 ? 173  ILE I CD1   1 
ATOM   7287  N N     . ASP D 1 122 ? 42.210  -11.933 33.501 1.00 47.39 ? 174  ASP I N     1 
ATOM   7288  C CA    . ASP D 1 122 ? 41.856  -12.386 34.838 1.00 46.79 ? 174  ASP I CA    1 
ATOM   7289  C C     . ASP D 1 122 ? 40.553  -13.157 34.838 1.00 46.68 ? 174  ASP I C     1 
ATOM   7290  O O     . ASP D 1 122 ? 40.237  -13.844 35.801 1.00 48.05 ? 174  ASP I O     1 
ATOM   7291  C CB    . ASP D 1 122 ? 41.729  -11.195 35.789 1.00 47.03 ? 174  ASP I CB    1 
ATOM   7292  C CG    . ASP D 1 122 ? 43.030  -10.439 35.953 1.00 48.46 ? 174  ASP I CG    1 
ATOM   7293  O OD1   . ASP D 1 122 ? 43.030  -9.415  36.675 1.00 47.90 ? 174  ASP I OD1   1 
ATOM   7294  O OD2   . ASP D 1 122 ? 44.049  -10.868 35.361 1.00 48.12 ? 174  ASP I OD2   1 
ATOM   7295  N N     . SER D 1 123 ? 39.790  -13.046 33.762 1.00 45.84 ? 175  SER I N     1 
ATOM   7296  C CA    . SER D 1 123 ? 38.519  -13.745 33.688 1.00 46.43 ? 175  SER I CA    1 
ATOM   7297  C C     . SER D 1 123 ? 38.645  -15.039 32.881 1.00 47.51 ? 175  SER I C     1 
ATOM   7298  O O     . SER D 1 123 ? 37.653  -15.723 32.623 1.00 47.65 ? 175  SER I O     1 
ATOM   7299  C CB    . SER D 1 123 ? 37.466  -12.828 33.060 1.00 45.86 ? 175  SER I CB    1 
ATOM   7300  O OG    . SER D 1 123 ? 36.203  -13.460 33.012 1.00 46.82 ? 175  SER I OG    1 
ATOM   7301  N N     . GLY D 1 124 ? 39.867  -15.366 32.474 1.00 47.32 ? 176  GLY I N     1 
ATOM   7302  C CA    . GLY D 1 124 ? 40.081  -16.577 31.706 1.00 48.32 ? 176  GLY I CA    1 
ATOM   7303  C C     . GLY D 1 124 ? 39.883  -16.458 30.202 1.00 49.60 ? 176  GLY I C     1 
ATOM   7304  O O     . GLY D 1 124 ? 39.089  -17.195 29.611 1.00 50.24 ? 176  GLY I O     1 
ATOM   7305  N N     . HIS D 1 125 ? 40.599  -15.527 29.581 1.00 49.71 ? 177  HIS I N     1 
ATOM   7306  C CA    . HIS D 1 125 ? 40.539  -15.323 28.134 1.00 49.34 ? 177  HIS I CA    1 
ATOM   7307  C C     . HIS D 1 125 ? 41.983  -15.379 27.649 1.00 52.04 ? 177  HIS I C     1 
ATOM   7308  O O     . HIS D 1 125 ? 42.886  -14.837 28.301 1.00 52.92 ? 177  HIS I O     1 
ATOM   7309  C CB    . HIS D 1 125 ? 39.915  -13.963 27.800 1.00 45.16 ? 177  HIS I CB    1 
ATOM   7310  C CG    . HIS D 1 125 ? 38.429  -13.924 27.963 1.00 41.38 ? 177  HIS I CG    1 
ATOM   7311  N ND1   . HIS D 1 125 ? 37.561  -14.248 26.944 1.00 40.25 ? 177  HIS I ND1   1 
ATOM   7312  C CD2   . HIS D 1 125 ? 37.656  -13.654 29.040 1.00 41.52 ? 177  HIS I CD2   1 
ATOM   7313  C CE1   . HIS D 1 125 ? 36.318  -14.185 27.385 1.00 40.34 ? 177  HIS I CE1   1 
ATOM   7314  N NE2   . HIS D 1 125 ? 36.348  -13.827 28.655 1.00 40.62 ? 177  HIS I NE2   1 
ATOM   7315  N N     . LYS D 1 126 ? 42.210  -16.044 26.520 1.00 53.94 ? 178  LYS I N     1 
ATOM   7316  C CA    . LYS D 1 126 ? 43.567  -16.169 25.982 1.00 55.40 ? 178  LYS I CA    1 
ATOM   7317  C C     . LYS D 1 126 ? 43.689  -15.400 24.671 1.00 54.51 ? 178  LYS I C     1 
ATOM   7318  O O     . LYS D 1 126 ? 44.692  -14.725 24.390 1.00 52.91 ? 178  LYS I O     1 
ATOM   7319  C CB    . LYS D 1 126 ? 43.884  -17.644 25.734 1.00 57.10 ? 178  LYS I CB    1 
ATOM   7320  C CG    . LYS D 1 126 ? 43.651  -18.552 26.937 1.00 59.38 ? 178  LYS I CG    1 
ATOM   7321  C CD    . LYS D 1 126 ? 44.729  -18.394 28.002 1.00 61.97 ? 178  LYS I CD    1 
ATOM   7322  C CE    . LYS D 1 126 ? 44.696  -19.563 28.996 1.00 63.46 ? 178  LYS I CE    1 
ATOM   7323  N NZ    . LYS D 1 126 ? 45.912  -19.641 29.865 1.00 65.19 ? 178  LYS I NZ    1 
ATOM   7324  N N     . ASN D 1 127 ? 42.639  -15.511 23.873 1.00 52.97 ? 179  ASN I N     1 
ATOM   7325  C CA    . ASN D 1 127 ? 42.605  -14.855 22.589 1.00 52.18 ? 179  ASN I CA    1 
ATOM   7326  C C     . ASN D 1 127 ? 41.848  -13.538 22.635 1.00 50.00 ? 179  ASN I C     1 
ATOM   7327  O O     . ASN D 1 127 ? 40.667  -13.485 22.295 1.00 50.14 ? 179  ASN I O     1 
ATOM   7328  C CB    . ASN D 1 127 ? 41.974  -15.798 21.559 1.00 54.12 ? 179  ASN I CB    1 
ATOM   7329  C CG    . ASN D 1 127 ? 42.789  -17.066 21.363 1.00 55.26 ? 179  ASN I CG    1 
ATOM   7330  O OD1   . ASN D 1 127 ? 42.403  -18.146 21.818 1.00 55.51 ? 179  ASN I OD1   1 
ATOM   7331  N ND2   . ASN D 1 127 ? 43.935  -16.935 20.696 1.00 54.78 ? 179  ASN I ND2   1 
ATOM   7332  N N     . ILE D 1 128 ? 42.523  -12.470 23.045 1.00 47.21 ? 180  ILE I N     1 
ATOM   7333  C CA    . ILE D 1 128 ? 41.854  -11.177 23.107 1.00 45.96 ? 180  ILE I CA    1 
ATOM   7334  C C     . ILE D 1 128 ? 42.314  -10.197 22.026 1.00 44.15 ? 180  ILE I C     1 
ATOM   7335  O O     . ILE D 1 128 ? 43.498  -9.879  21.904 1.00 43.01 ? 180  ILE I O     1 
ATOM   7336  C CB    . ILE D 1 128 ? 42.024  -10.510 24.488 1.00 46.84 ? 180  ILE I CB    1 
ATOM   7337  C CG1   . ILE D 1 128 ? 41.413  -11.394 25.582 1.00 46.56 ? 180  ILE I CG1   1 
ATOM   7338  C CG2   . ILE D 1 128 ? 41.323  -9.160  24.488 1.00 48.91 ? 180  ILE I CG2   1 
ATOM   7339  C CD1   . ILE D 1 128 ? 42.427  -12.037 26.500 1.00 45.20 ? 180  ILE I CD1   1 
ATOM   7340  N N     . ALA D 1 129 ? 41.351  -9.710  21.251 1.00 42.58 ? 181  ALA I N     1 
ATOM   7341  C CA    . ALA D 1 129 ? 41.631  -8.772  20.175 1.00 41.42 ? 181  ALA I CA    1 
ATOM   7342  C C     . ALA D 1 129 ? 41.550  -7.318  20.622 1.00 39.75 ? 181  ALA I C     1 
ATOM   7343  O O     . ALA D 1 129 ? 41.285  -7.024  21.789 1.00 40.33 ? 181  ALA I O     1 
ATOM   7344  C CB    . ALA D 1 129 ? 40.665  -9.011  19.033 1.00 41.48 ? 181  ALA I CB    1 
ATOM   7345  N N     . PHE D 1 130 ? 41.792  -6.413  19.680 1.00 38.34 ? 182  PHE I N     1 
ATOM   7346  C CA    . PHE D 1 130 ? 41.727  -4.975  19.937 1.00 38.18 ? 182  PHE I CA    1 
ATOM   7347  C C     . PHE D 1 130 ? 41.284  -4.173  18.715 1.00 37.37 ? 182  PHE I C     1 
ATOM   7348  O O     . PHE D 1 130 ? 41.983  -4.148  17.702 1.00 39.05 ? 182  PHE I O     1 
ATOM   7349  C CB    . PHE D 1 130 ? 43.084  -4.429  20.379 1.00 36.61 ? 182  PHE I CB    1 
ATOM   7350  C CG    . PHE D 1 130 ? 43.102  -2.943  20.544 1.00 35.75 ? 182  PHE I CG    1 
ATOM   7351  C CD1   . PHE D 1 130 ? 44.197  -2.203  20.130 1.00 38.35 ? 182  PHE I CD1   1 
ATOM   7352  C CD2   . PHE D 1 130 ? 42.018  -2.274  21.108 1.00 37.60 ? 182  PHE I CD2   1 
ATOM   7353  C CE1   . PHE D 1 130 ? 44.217  -0.805  20.271 1.00 39.40 ? 182  PHE I CE1   1 
ATOM   7354  C CE2   . PHE D 1 130 ? 42.022  -0.874  21.255 1.00 37.38 ? 182  PHE I CE2   1 
ATOM   7355  C CZ    . PHE D 1 130 ? 43.126  -0.141  20.835 1.00 37.04 ? 182  PHE I CZ    1 
ATOM   7356  N N     . VAL D 1 131 ? 40.127  -3.527  18.805 1.00 34.63 ? 183  VAL I N     1 
ATOM   7357  C CA    . VAL D 1 131 ? 39.663  -2.699  17.706 1.00 33.13 ? 183  VAL I CA    1 
ATOM   7358  C C     . VAL D 1 131 ? 40.033  -1.265  18.103 1.00 33.80 ? 183  VAL I C     1 
ATOM   7359  O O     . VAL D 1 131 ? 39.427  -0.673  18.997 1.00 32.88 ? 183  VAL I O     1 
ATOM   7360  C CB    . VAL D 1 131 ? 38.145  -2.832  17.502 1.00 33.07 ? 183  VAL I CB    1 
ATOM   7361  C CG1   . VAL D 1 131 ? 37.714  -2.037  16.273 1.00 30.38 ? 183  VAL I CG1   1 
ATOM   7362  C CG2   . VAL D 1 131 ? 37.773  -4.307  17.360 1.00 30.76 ? 183  VAL I CG2   1 
ATOM   7363  N N     . SER D 1 132 ? 41.047  -0.727  17.435 1.00 34.71 ? 184  SER I N     1 
ATOM   7364  C CA    . SER D 1 132 ? 41.561  0.606   17.710 1.00 37.10 ? 184  SER I CA    1 
ATOM   7365  C C     . SER D 1 132 ? 41.066  1.686   16.771 1.00 37.92 ? 184  SER I C     1 
ATOM   7366  O O     . SER D 1 132 ? 40.492  1.404   15.730 1.00 38.70 ? 184  SER I O     1 
ATOM   7367  C CB    . SER D 1 132 ? 43.090  0.575   17.647 1.00 37.24 ? 184  SER I CB    1 
ATOM   7368  O OG    . SER D 1 132 ? 43.635  1.881   17.688 1.00 40.31 ? 184  SER I OG    1 
ATOM   7369  N N     . GLY D 1 133 ? 41.300  2.935   17.151 1.00 39.06 ? 185  GLY I N     1 
ATOM   7370  C CA    . GLY D 1 133 ? 40.918  4.033   16.289 1.00 41.46 ? 185  GLY I CA    1 
ATOM   7371  C C     . GLY D 1 133 ? 42.031  4.088   15.270 1.00 43.20 ? 185  GLY I C     1 
ATOM   7372  O O     . GLY D 1 133 ? 42.872  3.203   15.276 1.00 44.76 ? 185  GLY I O     1 
ATOM   7373  N N     . THR D 1 134 ? 42.072  5.097   14.409 1.00 45.13 ? 186  THR I N     1 
ATOM   7374  C CA    . THR D 1 134 ? 43.134  5.154   13.410 1.00 47.00 ? 186  THR I CA    1 
ATOM   7375  C C     . THR D 1 134 ? 44.495  5.075   14.088 1.00 47.40 ? 186  THR I C     1 
ATOM   7376  O O     . THR D 1 134 ? 44.783  5.822   15.014 1.00 47.68 ? 186  THR I O     1 
ATOM   7377  C CB    . THR D 1 134 ? 43.041  6.432   12.567 1.00 46.96 ? 186  THR I CB    1 
ATOM   7378  O OG1   . THR D 1 134 ? 42.953  7.556   13.436 1.00 49.25 ? 186  THR I OG1   1 
ATOM   7379  C CG2   . THR D 1 134 ? 41.795  6.402   11.669 1.00 49.04 ? 186  THR I CG2   1 
ATOM   7380  N N     . LEU D 1 135 ? 45.329  4.157   13.615 1.00 48.51 ? 187  LEU I N     1 
ATOM   7381  C CA    . LEU D 1 135 ? 46.647  3.946   14.199 1.00 49.74 ? 187  LEU I CA    1 
ATOM   7382  C C     . LEU D 1 135 ? 47.688  5.047   14.055 1.00 50.16 ? 187  LEU I C     1 
ATOM   7383  O O     . LEU D 1 135 ? 48.723  4.991   14.712 1.00 49.46 ? 187  LEU I O     1 
ATOM   7384  C CB    . LEU D 1 135 ? 47.241  2.637   13.686 1.00 49.67 ? 187  LEU I CB    1 
ATOM   7385  C CG    . LEU D 1 135 ? 47.218  1.461   14.669 1.00 50.66 ? 187  LEU I CG    1 
ATOM   7386  C CD1   . LEU D 1 135 ? 45.800  1.138   15.128 1.00 49.28 ? 187  LEU I CD1   1 
ATOM   7387  C CD2   . LEU D 1 135 ? 47.837  0.260   13.986 1.00 51.96 ? 187  LEU I CD2   1 
ATOM   7388  N N     . GLU D 1 136 ? 47.447  6.042   13.209 1.00 50.65 ? 188  GLU I N     1 
ATOM   7389  C CA    . GLU D 1 136 ? 48.437  7.098   13.072 1.00 50.49 ? 188  GLU I CA    1 
ATOM   7390  C C     . GLU D 1 136 ? 48.281  8.139   14.165 1.00 48.80 ? 188  GLU I C     1 
ATOM   7391  O O     . GLU D 1 136 ? 49.113  9.035   14.293 1.00 48.21 ? 188  GLU I O     1 
ATOM   7392  C CB    . GLU D 1 136 ? 48.385  7.760   11.682 1.00 53.00 ? 188  GLU I CB    1 
ATOM   7393  C CG    . GLU D 1 136 ? 47.007  7.970   11.091 1.00 57.36 ? 188  GLU I CG    1 
ATOM   7394  C CD    . GLU D 1 136 ? 46.416  6.687   10.525 1.00 60.19 ? 188  GLU I CD    1 
ATOM   7395  O OE1   . GLU D 1 136 ? 45.304  6.741   9.945  1.00 61.92 ? 188  GLU I OE1   1 
ATOM   7396  O OE2   . GLU D 1 136 ? 47.065  5.624   10.660 1.00 61.41 ? 188  GLU I OE2   1 
ATOM   7397  N N     . GLU D 1 137 ? 47.220  8.018   14.959 1.00 47.65 ? 189  GLU I N     1 
ATOM   7398  C CA    . GLU D 1 137 ? 47.001  8.952   16.059 1.00 46.45 ? 189  GLU I CA    1 
ATOM   7399  C C     . GLU D 1 137 ? 47.863  8.511   17.230 1.00 45.73 ? 189  GLU I C     1 
ATOM   7400  O O     . GLU D 1 137 ? 47.740  7.385   17.701 1.00 45.67 ? 189  GLU I O     1 
ATOM   7401  C CB    . GLU D 1 137 ? 45.528  8.982   16.476 1.00 45.81 ? 189  GLU I CB    1 
ATOM   7402  C CG    . GLU D 1 137 ? 44.616  9.670   15.468 1.00 46.60 ? 189  GLU I CG    1 
ATOM   7403  C CD    . GLU D 1 137 ? 43.242  9.972   16.027 1.00 47.12 ? 189  GLU I CD    1 
ATOM   7404  O OE1   . GLU D 1 137 ? 42.372  10.437  15.257 1.00 47.50 ? 189  GLU I OE1   1 
ATOM   7405  O OE2   . GLU D 1 137 ? 43.035  9.752   17.238 1.00 47.70 ? 189  GLU I OE2   1 
ATOM   7406  N N     . PRO D 1 138 ? 48.749  9.398   17.718 1.00 45.57 ? 190  PRO I N     1 
ATOM   7407  C CA    . PRO D 1 138 ? 49.624  9.057   18.841 1.00 45.00 ? 190  PRO I CA    1 
ATOM   7408  C C     . PRO D 1 138 ? 48.903  8.301   19.947 1.00 44.92 ? 190  PRO I C     1 
ATOM   7409  O O     . PRO D 1 138 ? 49.415  7.300   20.439 1.00 46.23 ? 190  PRO I O     1 
ATOM   7410  C CB    . PRO D 1 138 ? 50.137  10.419  19.305 1.00 43.98 ? 190  PRO I CB    1 
ATOM   7411  C CG    . PRO D 1 138 ? 49.022  11.325  18.971 1.00 45.70 ? 190  PRO I CG    1 
ATOM   7412  C CD    . PRO D 1 138 ? 48.690  10.861  17.564 1.00 45.97 ? 190  PRO I CD    1 
ATOM   7413  N N     . ILE D 1 139 ? 47.717  8.779   20.329 1.00 43.75 ? 191  ILE I N     1 
ATOM   7414  C CA    . ILE D 1 139 ? 46.917  8.140   21.380 1.00 42.46 ? 191  ILE I CA    1 
ATOM   7415  C C     . ILE D 1 139 ? 46.737  6.629   21.173 1.00 41.93 ? 191  ILE I C     1 
ATOM   7416  O O     . ILE D 1 139 ? 46.831  5.844   22.118 1.00 39.81 ? 191  ILE I O     1 
ATOM   7417  C CB    . ILE D 1 139 ? 45.512  8.814   21.498 1.00 41.88 ? 191  ILE I CB    1 
ATOM   7418  C CG1   . ILE D 1 139 ? 44.634  8.062   22.492 1.00 41.75 ? 191  ILE I CG1   1 
ATOM   7419  C CG2   . ILE D 1 139 ? 44.807  8.801   20.162 1.00 41.37 ? 191  ILE I CG2   1 
ATOM   7420  C CD1   . ILE D 1 139 ? 45.242  7.901   23.827 1.00 43.39 ? 191  ILE I CD1   1 
ATOM   7421  N N     . ASN D 1 140 ? 46.488  6.235   19.927 1.00 42.75 ? 192  ASN I N     1 
ATOM   7422  C CA    . ASN D 1 140 ? 46.282  4.838   19.591 1.00 42.90 ? 192  ASN I CA    1 
ATOM   7423  C C     . ASN D 1 140 ? 47.597  4.073   19.492 1.00 44.29 ? 192  ASN I C     1 
ATOM   7424  O O     . ASN D 1 140 ? 47.844  3.185   20.303 1.00 45.49 ? 192  ASN I O     1 
ATOM   7425  C CB    . ASN D 1 140 ? 45.476  4.728   18.290 1.00 41.91 ? 192  ASN I CB    1 
ATOM   7426  C CG    . ASN D 1 140 ? 44.035  5.241   18.443 1.00 42.13 ? 192  ASN I CG    1 
ATOM   7427  O OD1   . ASN D 1 140 ? 43.437  5.737   17.485 1.00 40.89 ? 192  ASN I OD1   1 
ATOM   7428  N ND2   . ASN D 1 140 ? 43.475  5.107   19.643 1.00 38.91 ? 192  ASN I ND2   1 
ATOM   7429  N N     . HIS D 1 141 ? 48.461  4.410   18.537 1.00 45.39 ? 193  HIS I N     1 
ATOM   7430  C CA    . HIS D 1 141 ? 49.716  3.665   18.421 1.00 45.88 ? 193  HIS I CA    1 
ATOM   7431  C C     . HIS D 1 141 ? 50.680  3.821   19.593 1.00 45.23 ? 193  HIS I C     1 
ATOM   7432  O O     . HIS D 1 141 ? 51.369  2.872   19.950 1.00 46.70 ? 193  HIS I O     1 
ATOM   7433  C CB    . HIS D 1 141 ? 50.462  3.989   17.109 1.00 44.97 ? 193  HIS I CB    1 
ATOM   7434  C CG    . HIS D 1 141 ? 51.009  5.383   17.026 1.00 45.18 ? 193  HIS I CG    1 
ATOM   7435  N ND1   . HIS D 1 141 ? 50.365  6.400   16.354 1.00 46.10 ? 193  HIS I ND1   1 
ATOM   7436  C CD2   . HIS D 1 141 ? 52.167  5.914   17.482 1.00 45.81 ? 193  HIS I CD2   1 
ATOM   7437  C CE1   . HIS D 1 141 ? 51.103  7.494   16.392 1.00 44.20 ? 193  HIS I CE1   1 
ATOM   7438  N NE2   . HIS D 1 141 ? 52.202  7.227   17.070 1.00 45.78 ? 193  HIS I NE2   1 
ATOM   7439  N N     . ALA D 1 142 ? 50.724  4.995   20.205 1.00 43.81 ? 194  ALA I N     1 
ATOM   7440  C CA    . ALA D 1 142 ? 51.657  5.212   21.300 1.00 43.79 ? 194  ALA I CA    1 
ATOM   7441  C C     . ALA D 1 142 ? 51.149  4.866   22.686 1.00 44.01 ? 194  ALA I C     1 
ATOM   7442  O O     . ALA D 1 142 ? 51.951  4.622   23.586 1.00 45.93 ? 194  ALA I O     1 
ATOM   7443  C CB    . ALA D 1 142 ? 52.152  6.647   21.289 1.00 43.19 ? 194  ALA I CB    1 
ATOM   7444  N N     . LYS D 1 143 ? 49.837  4.829   22.883 1.00 41.88 ? 195  LYS I N     1 
ATOM   7445  C CA    . LYS D 1 143 ? 49.353  4.534   24.216 1.00 39.91 ? 195  LYS I CA    1 
ATOM   7446  C C     . LYS D 1 143 ? 48.407  3.352   24.332 1.00 39.81 ? 195  LYS I C     1 
ATOM   7447  O O     . LYS D 1 143 ? 48.697  2.390   25.047 1.00 40.76 ? 195  LYS I O     1 
ATOM   7448  C CB    . LYS D 1 143 ? 48.729  5.796   24.815 1.00 40.34 ? 195  LYS I CB    1 
ATOM   7449  C CG    . LYS D 1 143 ? 49.703  6.995   24.831 1.00 41.04 ? 195  LYS I CG    1 
ATOM   7450  C CD    . LYS D 1 143 ? 50.933  6.686   25.677 1.00 41.76 ? 195  LYS I CD    1 
ATOM   7451  C CE    . LYS D 1 143 ? 52.096  7.617   25.389 1.00 42.03 ? 195  LYS I CE    1 
ATOM   7452  N NZ    . LYS D 1 143 ? 51.839  9.028   25.778 1.00 44.96 ? 195  LYS I NZ    1 
ATOM   7453  N N     . LYS D 1 144 ? 47.284  3.397   23.632 1.00 38.75 ? 196  LYS I N     1 
ATOM   7454  C CA    . LYS D 1 144 ? 46.340  2.298   23.724 1.00 37.87 ? 196  LYS I CA    1 
ATOM   7455  C C     . LYS D 1 144 ? 46.885  0.946   23.264 1.00 38.08 ? 196  LYS I C     1 
ATOM   7456  O O     . LYS D 1 144 ? 46.927  0.012   24.052 1.00 40.05 ? 196  LYS I O     1 
ATOM   7457  C CB    . LYS D 1 144 ? 45.046  2.652   22.984 1.00 37.00 ? 196  LYS I CB    1 
ATOM   7458  C CG    . LYS D 1 144 ? 44.259  3.760   23.681 1.00 35.09 ? 196  LYS I CG    1 
ATOM   7459  C CD    . LYS D 1 144 ? 42.951  4.087   22.990 1.00 34.58 ? 196  LYS I CD    1 
ATOM   7460  C CE    . LYS D 1 144 ? 42.289  5.243   23.691 1.00 35.90 ? 196  LYS I CE    1 
ATOM   7461  N NZ    . LYS D 1 144 ? 41.080  5.745   23.000 1.00 37.22 ? 196  LYS I NZ    1 
ATOM   7462  N N     . VAL D 1 145 ? 47.310  0.818   22.014 1.00 37.28 ? 197  VAL I N     1 
ATOM   7463  C CA    . VAL D 1 145 ? 47.825  -0.469  21.572 1.00 38.35 ? 197  VAL I CA    1 
ATOM   7464  C C     . VAL D 1 145 ? 48.960  -0.943  22.472 1.00 38.57 ? 197  VAL I C     1 
ATOM   7465  O O     . VAL D 1 145 ? 49.006  -2.098  22.868 1.00 38.63 ? 197  VAL I O     1 
ATOM   7466  C CB    . VAL D 1 145 ? 48.315  -0.424  20.106 1.00 39.07 ? 197  VAL I CB    1 
ATOM   7467  C CG1   . VAL D 1 145 ? 49.324  0.687   19.917 1.00 39.67 ? 197  VAL I CG1   1 
ATOM   7468  C CG2   . VAL D 1 145 ? 48.935  -1.761  19.733 1.00 37.77 ? 197  VAL I CG2   1 
ATOM   7469  N N     . LYS D 1 146 ? 49.880  -0.045  22.791 1.00 40.84 ? 198  LYS I N     1 
ATOM   7470  C CA    . LYS D 1 146 ? 50.998  -0.370  23.670 1.00 42.72 ? 198  LYS I CA    1 
ATOM   7471  C C     . LYS D 1 146 ? 50.471  -0.881  25.021 1.00 42.88 ? 198  LYS I C     1 
ATOM   7472  O O     . LYS D 1 146 ? 51.102  -1.727  25.671 1.00 44.51 ? 198  LYS I O     1 
ATOM   7473  C CB    . LYS D 1 146 ? 51.856  0.873   23.907 1.00 44.00 ? 198  LYS I CB    1 
ATOM   7474  C CG    . LYS D 1 146 ? 53.255  0.817   23.328 1.00 46.93 ? 198  LYS I CG    1 
ATOM   7475  C CD    . LYS D 1 146 ? 53.262  1.042   21.831 1.00 50.09 ? 198  LYS I CD    1 
ATOM   7476  C CE    . LYS D 1 146 ? 54.609  1.616   21.376 1.00 52.87 ? 198  LYS I CE    1 
ATOM   7477  N NZ    . LYS D 1 146 ? 54.906  2.958   21.991 1.00 53.48 ? 198  LYS I NZ    1 
ATOM   7478  N N     . GLY D 1 147 ? 49.324  -0.355  25.443 1.00 40.90 ? 199  GLY I N     1 
ATOM   7479  C CA    . GLY D 1 147 ? 48.738  -0.775  26.699 1.00 40.44 ? 199  GLY I CA    1 
ATOM   7480  C C     . GLY D 1 147 ? 48.083  -2.130  26.549 1.00 40.53 ? 199  GLY I C     1 
ATOM   7481  O O     . GLY D 1 147 ? 47.952  -2.887  27.507 1.00 40.92 ? 199  GLY I O     1 
ATOM   7482  N N     . TYR D 1 148 ? 47.648  -2.428  25.334 1.00 41.17 ? 200  TYR I N     1 
ATOM   7483  C CA    . TYR D 1 148 ? 47.022  -3.706  25.041 1.00 41.93 ? 200  TYR I CA    1 
ATOM   7484  C C     . TYR D 1 148 ? 48.138  -4.736  24.935 1.00 43.42 ? 200  TYR I C     1 
ATOM   7485  O O     . TYR D 1 148 ? 48.075  -5.813  25.541 1.00 44.24 ? 200  TYR I O     1 
ATOM   7486  C CB    . TYR D 1 148 ? 46.237  -3.618  23.721 1.00 40.15 ? 200  TYR I CB    1 
ATOM   7487  C CG    . TYR D 1 148 ? 46.031  -4.938  22.985 1.00 38.70 ? 200  TYR I CG    1 
ATOM   7488  C CD1   . TYR D 1 148 ? 46.883  -5.322  21.951 1.00 37.61 ? 200  TYR I CD1   1 
ATOM   7489  C CD2   . TYR D 1 148 ? 44.965  -5.780  23.306 1.00 37.78 ? 200  TYR I CD2   1 
ATOM   7490  C CE1   . TYR D 1 148 ? 46.674  -6.505  21.249 1.00 39.14 ? 200  TYR I CE1   1 
ATOM   7491  C CE2   . TYR D 1 148 ? 44.746  -6.967  22.618 1.00 38.58 ? 200  TYR I CE2   1 
ATOM   7492  C CZ    . TYR D 1 148 ? 45.598  -7.329  21.585 1.00 40.17 ? 200  TYR I CZ    1 
ATOM   7493  O OH    . TYR D 1 148 ? 45.354  -8.501  20.878 1.00 39.07 ? 200  TYR I OH    1 
ATOM   7494  N N     . LYS D 1 149 ? 49.169  -4.391  24.169 1.00 43.63 ? 201  LYS I N     1 
ATOM   7495  C CA    . LYS D 1 149 ? 50.297  -5.288  23.977 1.00 44.20 ? 201  LYS I CA    1 
ATOM   7496  C C     . LYS D 1 149 ? 50.967  -5.633  25.311 1.00 44.76 ? 201  LYS I C     1 
ATOM   7497  O O     . LYS D 1 149 ? 51.329  -6.784  25.547 1.00 44.82 ? 201  LYS I O     1 
ATOM   7498  C CB    . LYS D 1 149 ? 51.290  -4.678  22.960 1.00 41.61 ? 201  LYS I CB    1 
ATOM   7499  C CG    . LYS D 1 149 ? 51.142  -5.276  21.536 1.00 38.46 ? 201  LYS I CG    1 
ATOM   7500  C CD    . LYS D 1 149 ? 51.408  -4.278  20.393 1.00 37.90 ? 201  LYS I CD    1 
ATOM   7501  C CE    . LYS D 1 149 ? 52.879  -3.835  20.275 1.00 36.75 ? 201  LYS I CE    1 
ATOM   7502  N NZ    . LYS D 1 149 ? 53.102  -2.709  19.288 1.00 31.97 ? 201  LYS I NZ    1 
ATOM   7503  N N     . ARG D 1 150 ? 51.104  -4.655  26.199 1.00 45.77 ? 202  ARG I N     1 
ATOM   7504  C CA    . ARG D 1 150 ? 51.709  -4.927  27.499 1.00 46.93 ? 202  ARG I CA    1 
ATOM   7505  C C     . ARG D 1 150 ? 50.881  -5.928  28.310 1.00 47.64 ? 202  ARG I C     1 
ATOM   7506  O O     . ARG D 1 150 ? 51.363  -6.990  28.669 1.00 48.59 ? 202  ARG I O     1 
ATOM   7507  C CB    . ARG D 1 150 ? 51.876  -3.635  28.298 1.00 46.28 ? 202  ARG I CB    1 
ATOM   7508  C CG    . ARG D 1 150 ? 52.631  -3.829  29.585 1.00 44.17 ? 202  ARG I CG    1 
ATOM   7509  C CD    . ARG D 1 150 ? 53.366  -2.560  29.969 1.00 47.35 ? 202  ARG I CD    1 
ATOM   7510  N NE    . ARG D 1 150 ? 52.469  -1.464  30.328 1.00 49.08 ? 202  ARG I NE    1 
ATOM   7511  C CZ    . ARG D 1 150 ? 51.683  -1.462  31.400 1.00 49.08 ? 202  ARG I CZ    1 
ATOM   7512  N NH1   . ARG D 1 150 ? 51.687  -2.498  32.220 1.00 49.12 ? 202  ARG I NH1   1 
ATOM   7513  N NH2   . ARG D 1 150 ? 50.888  -0.428  31.652 1.00 50.32 ? 202  ARG I NH2   1 
ATOM   7514  N N     . ALA D 1 151 ? 49.633  -5.594  28.598 1.00 48.62 ? 203  ALA I N     1 
ATOM   7515  C CA    . ALA D 1 151 ? 48.787  -6.487  29.371 1.00 50.67 ? 203  ALA I CA    1 
ATOM   7516  C C     . ALA D 1 151 ? 48.799  -7.892  28.798 1.00 52.05 ? 203  ALA I C     1 
ATOM   7517  O O     . ALA D 1 151 ? 48.730  -8.872  29.534 1.00 52.36 ? 203  ALA I O     1 
ATOM   7518  C CB    . ALA D 1 151 ? 47.358  -5.956  29.406 1.00 51.85 ? 203  ALA I CB    1 
ATOM   7519  N N     . LEU D 1 152 ? 48.893  -7.983  27.477 1.00 54.00 ? 204  LEU I N     1 
ATOM   7520  C CA    . LEU D 1 152 ? 48.883  -9.272  26.800 1.00 54.41 ? 204  LEU I CA    1 
ATOM   7521  C C     . LEU D 1 152 ? 50.192  -10.037 26.985 1.00 55.10 ? 204  LEU I C     1 
ATOM   7522  O O     . LEU D 1 152 ? 50.171  -11.191 27.408 1.00 56.32 ? 204  LEU I O     1 
ATOM   7523  C CB    . LEU D 1 152 ? 48.579  -9.071  25.308 1.00 53.88 ? 204  LEU I CB    1 
ATOM   7524  C CG    . LEU D 1 152 ? 47.621  -10.070 24.650 1.00 53.11 ? 204  LEU I CG    1 
ATOM   7525  C CD1   . LEU D 1 152 ? 46.311  -10.116 25.396 1.00 53.23 ? 204  LEU I CD1   1 
ATOM   7526  C CD2   . LEU D 1 152 ? 47.380  -9.659  23.219 1.00 52.82 ? 204  LEU I CD2   1 
ATOM   7527  N N     . THR D 1 153 ? 51.331  -9.410  26.699 1.00 55.02 ? 205  THR I N     1 
ATOM   7528  C CA    . THR D 1 153 ? 52.605  -10.112 26.849 1.00 55.64 ? 205  THR I CA    1 
ATOM   7529  C C     . THR D 1 153 ? 53.014  -10.439 28.289 1.00 56.49 ? 205  THR I C     1 
ATOM   7530  O O     . THR D 1 153 ? 53.517  -11.532 28.553 1.00 57.80 ? 205  THR I O     1 
ATOM   7531  C CB    . THR D 1 153 ? 53.780  -9.355  26.168 1.00 55.31 ? 205  THR I CB    1 
ATOM   7532  O OG1   . THR D 1 153 ? 53.897  -8.033  26.705 1.00 54.94 ? 205  THR I OG1   1 
ATOM   7533  C CG2   . THR D 1 153 ? 53.563  -9.283  24.667 1.00 55.13 ? 205  THR I CG2   1 
ATOM   7534  N N     . GLU D 1 154 ? 52.801  -9.514  29.221 1.00 56.19 ? 206  GLU I N     1 
ATOM   7535  C CA    . GLU D 1 154 ? 53.181  -9.755  30.609 1.00 55.15 ? 206  GLU I CA    1 
ATOM   7536  C C     . GLU D 1 154 ? 52.562  -11.042 31.139 1.00 55.68 ? 206  GLU I C     1 
ATOM   7537  O O     . GLU D 1 154 ? 53.175  -11.755 31.925 1.00 57.06 ? 206  GLU I O     1 
ATOM   7538  C CB    . GLU D 1 154 ? 52.795  -8.557  31.489 1.00 53.43 ? 206  GLU I CB    1 
ATOM   7539  C CG    . GLU D 1 154 ? 53.395  -7.240  30.992 1.00 52.95 ? 206  GLU I CG    1 
ATOM   7540  C CD    . GLU D 1 154 ? 53.587  -6.197  32.087 1.00 52.95 ? 206  GLU I CD    1 
ATOM   7541  O OE1   . GLU D 1 154 ? 52.749  -6.135  33.016 1.00 51.99 ? 206  GLU I OE1   1 
ATOM   7542  O OE2   . GLU D 1 154 ? 54.576  -5.427  32.004 1.00 51.05 ? 206  GLU I OE2   1 
ATOM   7543  N N     . SER D 1 155 ? 51.351  -11.347 30.694 1.00 56.49 ? 207  SER I N     1 
ATOM   7544  C CA    . SER D 1 155 ? 50.660  -12.560 31.116 1.00 57.03 ? 207  SER I CA    1 
ATOM   7545  C C     . SER D 1 155 ? 51.104  -13.710 30.204 1.00 57.46 ? 207  SER I C     1 
ATOM   7546  O O     . SER D 1 155 ? 50.410  -14.721 30.063 1.00 56.53 ? 207  SER I O     1 
ATOM   7547  C CB    . SER D 1 155 ? 49.141  -12.346 31.024 1.00 58.05 ? 207  SER I CB    1 
ATOM   7548  O OG    . SER D 1 155 ? 48.406  -13.484 31.442 1.00 59.44 ? 207  SER I OG    1 
ATOM   7549  N N     . GLY D 1 156 ? 52.264  -13.530 29.576 1.00 58.16 ? 208  GLY I N     1 
ATOM   7550  C CA    . GLY D 1 156 ? 52.819  -14.542 28.688 1.00 59.64 ? 208  GLY I CA    1 
ATOM   7551  C C     . GLY D 1 156 ? 52.174  -14.707 27.316 1.00 60.76 ? 208  GLY I C     1 
ATOM   7552  O O     . GLY D 1 156 ? 52.810  -15.206 26.375 1.00 61.44 ? 208  GLY I O     1 
ATOM   7553  N N     . LEU D 1 157 ? 50.916  -14.295 27.194 1.00 60.14 ? 209  LEU I N     1 
ATOM   7554  C CA    . LEU D 1 157 ? 50.193  -14.411 25.936 1.00 59.20 ? 209  LEU I CA    1 
ATOM   7555  C C     . LEU D 1 157 ? 50.977  -13.876 24.742 1.00 59.72 ? 209  LEU I C     1 
ATOM   7556  O O     . LEU D 1 157 ? 51.884  -13.052 24.891 1.00 59.20 ? 209  LEU I O     1 
ATOM   7557  C CB    . LEU D 1 157 ? 48.860  -13.688 26.055 1.00 58.66 ? 209  LEU I CB    1 
ATOM   7558  C CG    . LEU D 1 157 ? 47.997  -14.283 27.168 1.00 59.25 ? 209  LEU I CG    1 
ATOM   7559  C CD1   . LEU D 1 157 ? 47.472  -13.182 28.083 1.00 58.82 ? 209  LEU I CD1   1 
ATOM   7560  C CD2   . LEU D 1 157 ? 46.865  -15.087 26.540 1.00 58.70 ? 209  LEU I CD2   1 
ATOM   7561  N N     . PRO D 1 158 ? 50.647  -14.357 23.533 1.00 60.67 ? 210  PRO I N     1 
ATOM   7562  C CA    . PRO D 1 158 ? 51.334  -13.912 22.318 1.00 60.92 ? 210  PRO I CA    1 
ATOM   7563  C C     . PRO D 1 158 ? 50.546  -12.808 21.610 1.00 60.72 ? 210  PRO I C     1 
ATOM   7564  O O     . PRO D 1 158 ? 49.310  -12.848 21.553 1.00 60.27 ? 210  PRO I O     1 
ATOM   7565  C CB    . PRO D 1 158 ? 51.409  -15.187 21.465 1.00 61.58 ? 210  PRO I CB    1 
ATOM   7566  C CG    . PRO D 1 158 ? 50.713  -16.291 22.314 1.00 61.82 ? 210  PRO I CG    1 
ATOM   7567  C CD    . PRO D 1 158 ? 49.817  -15.535 23.241 1.00 60.74 ? 210  PRO I CD    1 
ATOM   7568  N N     . VAL D 1 159 ? 51.260  -11.830 21.067 1.00 59.49 ? 211  VAL I N     1 
ATOM   7569  C CA    . VAL D 1 159 ? 50.612  -10.734 20.368 1.00 59.42 ? 211  VAL I CA    1 
ATOM   7570  C C     . VAL D 1 159 ? 50.412  -11.051 18.886 1.00 60.23 ? 211  VAL I C     1 
ATOM   7571  O O     . VAL D 1 159 ? 51.363  -11.397 18.188 1.00 60.61 ? 211  VAL I O     1 
ATOM   7572  C CB    . VAL D 1 159 ? 51.438  -9.455  20.502 1.00 59.21 ? 211  VAL I CB    1 
ATOM   7573  C CG1   . VAL D 1 159 ? 50.857  -8.363  19.614 1.00 58.91 ? 211  VAL I CG1   1 
ATOM   7574  C CG2   . VAL D 1 159 ? 51.462  -9.019  21.958 1.00 58.75 ? 211  VAL I CG2   1 
ATOM   7575  N N     . ARG D 1 160 ? 49.171  -10.933 18.416 1.00 60.33 ? 212  ARG I N     1 
ATOM   7576  C CA    . ARG D 1 160 ? 48.836  -11.194 17.016 1.00 59.71 ? 212  ARG I CA    1 
ATOM   7577  C C     . ARG D 1 160 ? 48.397  -9.923  16.268 1.00 59.72 ? 212  ARG I C     1 
ATOM   7578  O O     . ARG D 1 160 ? 47.357  -9.343  16.587 1.00 59.01 ? 212  ARG I O     1 
ATOM   7579  C CB    . ARG D 1 160 ? 47.703  -12.221 16.916 1.00 60.64 ? 212  ARG I CB    1 
ATOM   7580  C CG    . ARG D 1 160 ? 48.034  -13.630 17.357 1.00 61.71 ? 212  ARG I CG    1 
ATOM   7581  C CD    . ARG D 1 160 ? 47.446  -13.927 18.723 1.00 65.30 ? 212  ARG I CD    1 
ATOM   7582  N NE    . ARG D 1 160 ? 47.030  -15.323 18.843 1.00 67.28 ? 212  ARG I NE    1 
ATOM   7583  C CZ    . ARG D 1 160 ? 47.846  -16.364 18.694 1.00 69.15 ? 212  ARG I CZ    1 
ATOM   7584  N NH1   . ARG D 1 160 ? 49.137  -16.172 18.421 1.00 68.68 ? 212  ARG I NH1   1 
ATOM   7585  N NH2   . ARG D 1 160 ? 47.365  -17.600 18.801 1.00 68.07 ? 212  ARG I NH2   1 
ATOM   7586  N N     . ASP D 1 161 ? 49.177  -9.509  15.267 1.00 59.83 ? 213  ASP I N     1 
ATOM   7587  C CA    . ASP D 1 161 ? 48.863  -8.324  14.462 1.00 58.91 ? 213  ASP I CA    1 
ATOM   7588  C C     . ASP D 1 161 ? 47.465  -8.469  13.885 1.00 58.45 ? 213  ASP I C     1 
ATOM   7589  O O     . ASP D 1 161 ? 46.733  -7.496  13.713 1.00 59.04 ? 213  ASP I O     1 
ATOM   7590  C CB    . ASP D 1 161 ? 49.842  -8.195  13.303 1.00 59.85 ? 213  ASP I CB    1 
ATOM   7591  C CG    . ASP D 1 161 ? 51.283  -8.289  13.746 1.00 62.88 ? 213  ASP I CG    1 
ATOM   7592  O OD1   . ASP D 1 161 ? 51.819  -7.274  14.250 1.00 63.61 ? 213  ASP I OD1   1 
ATOM   7593  O OD2   . ASP D 1 161 ? 51.874  -9.385  13.599 1.00 63.30 ? 213  ASP I OD2   1 
ATOM   7594  N N     . SER D 1 162 ? 47.109  -9.707  13.581 1.00 57.49 ? 214  SER I N     1 
ATOM   7595  C CA    . SER D 1 162 ? 45.810  -10.023 13.016 1.00 57.35 ? 214  SER I CA    1 
ATOM   7596  C C     . SER D 1 162 ? 44.688  -9.743  14.009 1.00 56.41 ? 214  SER I C     1 
ATOM   7597  O O     . SER D 1 162 ? 43.518  -9.671  13.628 1.00 55.49 ? 214  SER I O     1 
ATOM   7598  C CB    . SER D 1 162 ? 45.780  -11.496 12.618 1.00 58.73 ? 214  SER I CB    1 
ATOM   7599  O OG    . SER D 1 162 ? 46.957  -11.845 11.909 1.00 61.41 ? 214  SER I OG    1 
ATOM   7600  N N     . TYR D 1 163 ? 45.058  -9.590  15.278 1.00 55.75 ? 215  TYR I N     1 
ATOM   7601  C CA    . TYR D 1 163 ? 44.105  -9.337  16.355 1.00 54.93 ? 215  TYR I CA    1 
ATOM   7602  C C     . TYR D 1 163 ? 43.898  -7.856  16.597 1.00 53.68 ? 215  TYR I C     1 
ATOM   7603  O O     . TYR D 1 163 ? 42.995  -7.462  17.327 1.00 53.56 ? 215  TYR I O     1 
ATOM   7604  C CB    . TYR D 1 163 ? 44.586  -10.007 17.641 1.00 56.36 ? 215  TYR I CB    1 
ATOM   7605  C CG    . TYR D 1 163 ? 43.964  -11.354 17.891 1.00 57.32 ? 215  TYR I CG    1 
ATOM   7606  C CD1   . TYR D 1 163 ? 43.592  -12.181 16.831 1.00 58.42 ? 215  TYR I CD1   1 
ATOM   7607  C CD2   . TYR D 1 163 ? 43.738  -11.803 19.187 1.00 57.94 ? 215  TYR I CD2   1 
ATOM   7608  C CE1   . TYR D 1 163 ? 43.007  -13.420 17.058 1.00 59.30 ? 215  TYR I CE1   1 
ATOM   7609  C CE2   . TYR D 1 163 ? 43.156  -13.039 19.426 1.00 58.42 ? 215  TYR I CE2   1 
ATOM   7610  C CZ    . TYR D 1 163 ? 42.791  -13.842 18.360 1.00 59.18 ? 215  TYR I CZ    1 
ATOM   7611  O OH    . TYR D 1 163 ? 42.189  -15.057 18.596 1.00 61.11 ? 215  TYR I OH    1 
ATOM   7612  N N     . ILE D 1 164 ? 44.750  -7.045  15.983 1.00 52.07 ? 216  ILE I N     1 
ATOM   7613  C CA    . ILE D 1 164 ? 44.670  -5.595  16.093 1.00 50.66 ? 216  ILE I CA    1 
ATOM   7614  C C     . ILE D 1 164 ? 44.056  -5.051  14.799 1.00 51.00 ? 216  ILE I C     1 
ATOM   7615  O O     . ILE D 1 164 ? 44.762  -4.854  13.805 1.00 52.93 ? 216  ILE I O     1 
ATOM   7616  C CB    . ILE D 1 164 ? 46.075  -4.999  16.275 1.00 49.14 ? 216  ILE I CB    1 
ATOM   7617  C CG1   . ILE D 1 164 ? 46.680  -5.524  17.575 1.00 47.86 ? 216  ILE I CG1   1 
ATOM   7618  C CG2   . ILE D 1 164 ? 46.011  -3.486  16.282 1.00 47.68 ? 216  ILE I CG2   1 
ATOM   7619  C CD1   . ILE D 1 164 ? 48.174  -5.476  17.598 1.00 44.64 ? 216  ILE I CD1   1 
ATOM   7620  N N     . VAL D 1 165 ? 42.748  -4.818  14.807 1.00 48.49 ? 217  VAL I N     1 
ATOM   7621  C CA    . VAL D 1 165 ? 42.070  -4.304  13.628 1.00 48.08 ? 217  VAL I CA    1 
ATOM   7622  C C     . VAL D 1 165 ? 41.726  -2.822  13.789 1.00 47.64 ? 217  VAL I C     1 
ATOM   7623  O O     . VAL D 1 165 ? 41.269  -2.401  14.847 1.00 48.33 ? 217  VAL I O     1 
ATOM   7624  C CB    . VAL D 1 165 ? 40.791  -5.101  13.363 1.00 48.92 ? 217  VAL I CB    1 
ATOM   7625  C CG1   . VAL D 1 165 ? 40.127  -4.621  12.083 1.00 49.27 ? 217  VAL I CG1   1 
ATOM   7626  C CG2   . VAL D 1 165 ? 41.125  -6.576  13.283 1.00 47.99 ? 217  VAL I CG2   1 
ATOM   7627  N N     . GLU D 1 166 ? 41.942  -2.047  12.728 1.00 46.71 ? 218  GLU I N     1 
ATOM   7628  C CA    . GLU D 1 166 ? 41.690  -0.603  12.719 1.00 45.33 ? 218  GLU I CA    1 
ATOM   7629  C C     . GLU D 1 166 ? 40.315  -0.163  12.240 1.00 44.66 ? 218  GLU I C     1 
ATOM   7630  O O     . GLU D 1 166 ? 39.870  -0.542  11.158 1.00 44.48 ? 218  GLU I O     1 
ATOM   7631  C CB    . GLU D 1 166 ? 42.706  0.106   11.830 1.00 46.38 ? 218  GLU I CB    1 
ATOM   7632  C CG    . GLU D 1 166 ? 43.899  0.697   12.532 1.00 50.43 ? 218  GLU I CG    1 
ATOM   7633  C CD    . GLU D 1 166 ? 44.796  1.477   11.578 1.00 52.63 ? 218  GLU I CD    1 
ATOM   7634  O OE1   . GLU D 1 166 ? 44.311  2.454   10.954 1.00 53.44 ? 218  GLU I OE1   1 
ATOM   7635  O OE2   . GLU D 1 166 ? 45.987  1.108   11.455 1.00 53.18 ? 218  GLU I OE2   1 
ATOM   7636  N N     . GLY D 1 167 ? 39.665  0.671   13.044 1.00 44.00 ? 219  GLY I N     1 
ATOM   7637  C CA    . GLY D 1 167 ? 38.367  1.205   12.681 1.00 43.21 ? 219  GLY I CA    1 
ATOM   7638  C C     . GLY D 1 167 ? 38.611  2.666   12.358 1.00 43.05 ? 219  GLY I C     1 
ATOM   7639  O O     . GLY D 1 167 ? 39.765  3.085   12.246 1.00 44.01 ? 219  GLY I O     1 
ATOM   7640  N N     . ASP D 1 168 ? 37.552  3.447   12.184 1.00 41.97 ? 220  ASP I N     1 
ATOM   7641  C CA    . ASP D 1 168 ? 37.716  4.871   11.903 1.00 40.49 ? 220  ASP I CA    1 
ATOM   7642  C C     . ASP D 1 168 ? 36.782  5.629   12.842 1.00 38.15 ? 220  ASP I C     1 
ATOM   7643  O O     . ASP D 1 168 ? 36.242  6.676   12.503 1.00 37.85 ? 220  ASP I O     1 
ATOM   7644  C CB    . ASP D 1 168 ? 37.395  5.179   10.433 1.00 41.96 ? 220  ASP I CB    1 
ATOM   7645  C CG    . ASP D 1 168 ? 35.962  4.880   10.075 1.00 44.22 ? 220  ASP I CG    1 
ATOM   7646  O OD1   . ASP D 1 168 ? 35.612  4.933   8.877  1.00 46.23 ? 220  ASP I OD1   1 
ATOM   7647  O OD2   . ASP D 1 168 ? 35.179  4.593   10.998 1.00 45.79 ? 220  ASP I OD2   1 
ATOM   7648  N N     . TYR D 1 169 ? 36.610  5.056   14.030 1.00 35.16 ? 221  TYR I N     1 
ATOM   7649  C CA    . TYR D 1 169 ? 35.780  5.599   15.090 1.00 31.99 ? 221  TYR I CA    1 
ATOM   7650  C C     . TYR D 1 169 ? 34.300  5.524   14.810 1.00 31.33 ? 221  TYR I C     1 
ATOM   7651  O O     . TYR D 1 169 ? 33.491  5.989   15.624 1.00 32.09 ? 221  TYR I O     1 
ATOM   7652  C CB    . TYR D 1 169 ? 36.152  7.045   15.385 1.00 29.93 ? 221  TYR I CB    1 
ATOM   7653  C CG    . TYR D 1 169 ? 37.547  7.204   15.902 1.00 30.31 ? 221  TYR I CG    1 
ATOM   7654  C CD1   . TYR D 1 169 ? 38.460  8.005   15.231 1.00 30.67 ? 221  TYR I CD1   1 
ATOM   7655  C CD2   . TYR D 1 169 ? 37.968  6.549   17.060 1.00 30.55 ? 221  TYR I CD2   1 
ATOM   7656  C CE1   . TYR D 1 169 ? 39.755  8.155   15.686 1.00 30.04 ? 221  TYR I CE1   1 
ATOM   7657  C CE2   . TYR D 1 169 ? 39.267  6.696   17.531 1.00 28.54 ? 221  TYR I CE2   1 
ATOM   7658  C CZ    . TYR D 1 169 ? 40.154  7.505   16.834 1.00 29.47 ? 221  TYR I CZ    1 
ATOM   7659  O OH    . TYR D 1 169 ? 41.445  7.694   17.277 1.00 31.27 ? 221  TYR I OH    1 
ATOM   7660  N N     . THR D 1 170 ? 33.927  4.940   13.678 1.00 28.41 ? 222  THR I N     1 
ATOM   7661  C CA    . THR D 1 170 ? 32.507  4.838   13.357 1.00 25.97 ? 222  THR I CA    1 
ATOM   7662  C C     . THR D 1 170 ? 31.879  3.542   13.823 1.00 25.28 ? 222  THR I C     1 
ATOM   7663  O O     . THR D 1 170 ? 32.549  2.533   14.017 1.00 24.68 ? 222  THR I O     1 
ATOM   7664  C CB    . THR D 1 170 ? 32.229  4.940   11.850 1.00 24.78 ? 222  THR I CB    1 
ATOM   7665  O OG1   . THR D 1 170 ? 32.789  3.797   11.178 1.00 21.83 ? 222  THR I OG1   1 
ATOM   7666  C CG2   . THR D 1 170 ? 32.797  6.242   11.290 1.00 19.88 ? 222  THR I CG2   1 
ATOM   7667  N N     . TYR D 1 171 ? 30.573  3.597   14.008 1.00 26.42 ? 223  TYR I N     1 
ATOM   7668  C CA    . TYR D 1 171 ? 29.817  2.442   14.408 1.00 27.17 ? 223  TYR I CA    1 
ATOM   7669  C C     . TYR D 1 171 ? 30.051  1.381   13.349 1.00 29.02 ? 223  TYR I C     1 
ATOM   7670  O O     . TYR D 1 171 ? 30.364  0.242   13.672 1.00 29.95 ? 223  TYR I O     1 
ATOM   7671  C CB    . TYR D 1 171 ? 28.333  2.789   14.458 1.00 28.11 ? 223  TYR I CB    1 
ATOM   7672  C CG    . TYR D 1 171 ? 27.437  1.587   14.612 1.00 31.01 ? 223  TYR I CG    1 
ATOM   7673  C CD1   . TYR D 1 171 ? 27.384  0.879   15.817 1.00 31.74 ? 223  TYR I CD1   1 
ATOM   7674  C CD2   . TYR D 1 171 ? 26.649  1.146   13.553 1.00 32.43 ? 223  TYR I CD2   1 
ATOM   7675  C CE1   . TYR D 1 171 ? 26.569  -0.232  15.963 1.00 31.66 ? 223  TYR I CE1   1 
ATOM   7676  C CE2   . TYR D 1 171 ? 25.829  0.033   13.689 1.00 33.37 ? 223  TYR I CE2   1 
ATOM   7677  C CZ    . TYR D 1 171 ? 25.793  -0.648  14.897 1.00 33.05 ? 223  TYR I CZ    1 
ATOM   7678  O OH    . TYR D 1 171 ? 24.961  -1.737  15.043 1.00 35.15 ? 223  TYR I OH    1 
ATOM   7679  N N     . ASP D 1 172 ? 29.914  1.761   12.078 1.00 31.02 ? 224  ASP I N     1 
ATOM   7680  C CA    . ASP D 1 172 ? 30.091  0.807   10.986 1.00 32.52 ? 224  ASP I CA    1 
ATOM   7681  C C     . ASP D 1 172 ? 31.507  0.254   10.896 1.00 31.75 ? 224  ASP I C     1 
ATOM   7682  O O     . ASP D 1 172 ? 31.701  -0.915  10.587 1.00 32.46 ? 224  ASP I O     1 
ATOM   7683  C CB    . ASP D 1 172 ? 29.643  1.419   9.647  1.00 35.32 ? 224  ASP I CB    1 
ATOM   7684  C CG    . ASP D 1 172 ? 28.119  1.602   9.567  1.00 40.01 ? 224  ASP I CG    1 
ATOM   7685  O OD1   . ASP D 1 172 ? 27.377  0.673   9.971  1.00 42.50 ? 224  ASP I OD1   1 
ATOM   7686  O OD2   . ASP D 1 172 ? 27.651  2.666   9.099  1.00 41.74 ? 224  ASP I OD2   1 
ATOM   7687  N N     . SER D 1 173 ? 32.506  1.074   11.177 1.00 31.54 ? 225  SER I N     1 
ATOM   7688  C CA    . SER D 1 173 ? 33.868  0.564   11.146 1.00 31.42 ? 225  SER I CA    1 
ATOM   7689  C C     . SER D 1 173 ? 33.982  -0.511  12.227 1.00 32.02 ? 225  SER I C     1 
ATOM   7690  O O     . SER D 1 173 ? 34.952  -1.266  12.249 1.00 33.39 ? 225  SER I O     1 
ATOM   7691  C CB    . SER D 1 173 ? 34.881  1.672   11.441 1.00 30.42 ? 225  SER I CB    1 
ATOM   7692  O OG    . SER D 1 173 ? 34.981  1.919   12.828 1.00 29.19 ? 225  SER I OG    1 
ATOM   7693  N N     . GLY D 1 174 ? 32.989  -0.556  13.122 1.00 30.73 ? 226  GLY I N     1 
ATOM   7694  C CA    . GLY D 1 174 ? 32.962  -1.526  14.207 1.00 28.50 ? 226  GLY I CA    1 
ATOM   7695  C C     . GLY D 1 174 ? 32.412  -2.882  13.811 1.00 28.50 ? 226  GLY I C     1 
ATOM   7696  O O     . GLY D 1 174 ? 32.949  -3.907  14.203 1.00 25.28 ? 226  GLY I O     1 
ATOM   7697  N N     . ILE D 1 175 ? 31.318  -2.901  13.059 1.00 31.49 ? 227  ILE I N     1 
ATOM   7698  C CA    . ILE D 1 175 ? 30.785  -4.175  12.605 1.00 35.23 ? 227  ILE I CA    1 
ATOM   7699  C C     . ILE D 1 175 ? 31.893  -4.762  11.733 1.00 38.38 ? 227  ILE I C     1 
ATOM   7700  O O     . ILE D 1 175 ? 32.243  -5.934  11.858 1.00 40.87 ? 227  ILE I O     1 
ATOM   7701  C CB    . ILE D 1 175 ? 29.519  -4.019  11.725 1.00 35.01 ? 227  ILE I CB    1 
ATOM   7702  C CG1   . ILE D 1 175 ? 28.300  -3.679  12.578 1.00 35.61 ? 227  ILE I CG1   1 
ATOM   7703  C CG2   . ILE D 1 175 ? 29.243  -5.308  10.984 1.00 34.86 ? 227  ILE I CG2   1 
ATOM   7704  C CD1   . ILE D 1 175 ? 28.041  -2.209  12.713 1.00 41.49 ? 227  ILE I CD1   1 
ATOM   7705  N N     . GLU D 1 176 ? 32.459  -3.931  10.861 1.00 40.24 ? 228  GLU I N     1 
ATOM   7706  C CA    . GLU D 1 176 ? 33.517  -4.373  9.967  1.00 42.04 ? 228  GLU I CA    1 
ATOM   7707  C C     . GLU D 1 176 ? 34.763  -4.886  10.658 1.00 41.07 ? 228  GLU I C     1 
ATOM   7708  O O     . GLU D 1 176 ? 35.569  -5.580  10.054 1.00 41.18 ? 228  GLU I O     1 
ATOM   7709  C CB    . GLU D 1 176 ? 33.893  -3.253  8.985  1.00 45.98 ? 228  GLU I CB    1 
ATOM   7710  C CG    . GLU D 1 176 ? 32.855  -3.054  7.904  1.00 51.31 ? 228  GLU I CG    1 
ATOM   7711  C CD    . GLU D 1 176 ? 32.338  -4.391  7.379  1.00 57.45 ? 228  GLU I CD    1 
ATOM   7712  O OE1   . GLU D 1 176 ? 31.097  -4.530  7.236  1.00 59.48 ? 228  GLU I OE1   1 
ATOM   7713  O OE2   . GLU D 1 176 ? 33.171  -5.302  7.115  1.00 58.66 ? 228  GLU I OE2   1 
ATOM   7714  N N     . ALA D 1 177 ? 34.929  -4.552  11.926 1.00 41.62 ? 229  ALA I N     1 
ATOM   7715  C CA    . ALA D 1 177 ? 36.100  -5.008  12.652 1.00 42.33 ? 229  ALA I CA    1 
ATOM   7716  C C     . ALA D 1 177 ? 35.846  -6.395  13.250 1.00 43.50 ? 229  ALA I C     1 
ATOM   7717  O O     . ALA D 1 177 ? 36.764  -7.213  13.357 1.00 44.33 ? 229  ALA I O     1 
ATOM   7718  C CB    . ALA D 1 177 ? 36.463  -4.008  13.739 1.00 41.69 ? 229  ALA I CB    1 
ATOM   7719  N N     . VAL D 1 178 ? 34.607  -6.672  13.637 1.00 43.75 ? 230  VAL I N     1 
ATOM   7720  C CA    . VAL D 1 178 ? 34.311  -7.980  14.195 1.00 45.98 ? 230  VAL I CA    1 
ATOM   7721  C C     . VAL D 1 178 ? 34.139  -8.985  13.065 1.00 48.07 ? 230  VAL I C     1 
ATOM   7722  O O     . VAL D 1 178 ? 34.569  -10.131 13.194 1.00 48.39 ? 230  VAL I O     1 
ATOM   7723  C CB    . VAL D 1 178 ? 33.026  -7.989  15.053 1.00 44.76 ? 230  VAL I CB    1 
ATOM   7724  C CG1   . VAL D 1 178 ? 32.997  -9.229  15.907 1.00 42.30 ? 230  VAL I CG1   1 
ATOM   7725  C CG2   . VAL D 1 178 ? 32.966  -6.775  15.922 1.00 45.48 ? 230  VAL I CG2   1 
ATOM   7726  N N     . GLU D 1 179 ? 33.511  -8.562  11.963 1.00 50.29 ? 231  GLU I N     1 
ATOM   7727  C CA    . GLU D 1 179 ? 33.306  -9.457  10.822 1.00 52.99 ? 231  GLU I CA    1 
ATOM   7728  C C     . GLU D 1 179 ? 34.662  -9.994  10.378 1.00 52.74 ? 231  GLU I C     1 
ATOM   7729  O O     . GLU D 1 179 ? 34.789  -11.161 10.013 1.00 52.62 ? 231  GLU I O     1 
ATOM   7730  C CB    . GLU D 1 179 ? 32.630  -8.737  9.637  1.00 54.75 ? 231  GLU I CB    1 
ATOM   7731  C CG    . GLU D 1 179 ? 31.160  -8.291  9.839  1.00 57.86 ? 231  GLU I CG    1 
ATOM   7732  C CD    . GLU D 1 179 ? 30.161  -9.446  10.024 1.00 59.99 ? 231  GLU I CD    1 
ATOM   7733  O OE1   . GLU D 1 179 ? 30.248  -10.445 9.274  1.00 61.18 ? 231  GLU I OE1   1 
ATOM   7734  O OE2   . GLU D 1 179 ? 29.274  -9.346  10.909 1.00 59.34 ? 231  GLU I OE2   1 
ATOM   7735  N N     . LYS D 1 180 ? 35.675  -9.140  10.422 1.00 52.06 ? 232  LYS I N     1 
ATOM   7736  C CA    . LYS D 1 180 ? 37.009  -9.555  10.028 1.00 53.63 ? 232  LYS I CA    1 
ATOM   7737  C C     . LYS D 1 180 ? 37.688  -10.437 11.085 1.00 54.38 ? 232  LYS I C     1 
ATOM   7738  O O     . LYS D 1 180 ? 38.575  -11.237 10.769 1.00 54.52 ? 232  LYS I O     1 
ATOM   7739  C CB    . LYS D 1 180 ? 37.881  -8.332  9.742  1.00 53.31 ? 232  LYS I CB    1 
ATOM   7740  C CG    . LYS D 1 180 ? 39.225  -8.693  9.139  1.00 54.35 ? 232  LYS I CG    1 
ATOM   7741  C CD    . LYS D 1 180 ? 40.022  -7.461  8.758  1.00 56.66 ? 232  LYS I CD    1 
ATOM   7742  C CE    . LYS D 1 180 ? 41.089  -7.791  7.713  1.00 57.69 ? 232  LYS I CE    1 
ATOM   7743  N NZ    . LYS D 1 180 ? 40.494  -8.212  6.403  1.00 56.58 ? 232  LYS I NZ    1 
ATOM   7744  N N     . LEU D 1 181 ? 37.280  -10.292 12.340 1.00 54.58 ? 233  LEU I N     1 
ATOM   7745  C CA    . LEU D 1 181 ? 37.872  -11.086 13.407 1.00 55.28 ? 233  LEU I CA    1 
ATOM   7746  C C     . LEU D 1 181 ? 37.090  -12.382 13.609 1.00 56.35 ? 233  LEU I C     1 
ATOM   7747  O O     . LEU D 1 181 ? 37.640  -13.392 14.044 1.00 55.44 ? 233  LEU I O     1 
ATOM   7748  C CB    . LEU D 1 181 ? 37.917  -10.281 14.710 1.00 54.56 ? 233  LEU I CB    1 
ATOM   7749  C CG    . LEU D 1 181 ? 38.895  -9.104  14.833 1.00 53.52 ? 233  LEU I CG    1 
ATOM   7750  C CD1   . LEU D 1 181 ? 38.674  -8.419  16.173 1.00 51.69 ? 233  LEU I CD1   1 
ATOM   7751  C CD2   . LEU D 1 181 ? 40.332  -9.586  14.715 1.00 51.84 ? 233  LEU I CD2   1 
ATOM   7752  N N     . LEU D 1 182 ? 35.799  -12.351 13.297 1.00 58.36 ? 234  LEU I N     1 
ATOM   7753  C CA    . LEU D 1 182 ? 34.966  -13.541 13.425 1.00 60.51 ? 234  LEU I CA    1 
ATOM   7754  C C     . LEU D 1 182 ? 35.268  -14.458 12.250 1.00 63.22 ? 234  LEU I C     1 
ATOM   7755  O O     . LEU D 1 182 ? 34.450  -15.311 11.879 1.00 64.11 ? 234  LEU I O     1 
ATOM   7756  C CB    . LEU D 1 182 ? 33.478  -13.182 13.401 1.00 59.15 ? 234  LEU I CB    1 
ATOM   7757  C CG    . LEU D 1 182 ? 32.838  -12.612 14.666 1.00 58.40 ? 234  LEU I CG    1 
ATOM   7758  C CD1   . LEU D 1 182 ? 31.344  -12.423 14.435 1.00 56.97 ? 234  LEU I CD1   1 
ATOM   7759  C CD2   . LEU D 1 182 ? 33.076  -13.564 15.830 1.00 58.48 ? 234  LEU I CD2   1 
ATOM   7760  N N     . GLU D 1 183 ? 36.440  -14.261 11.653 1.00 65.29 ? 235  GLU I N     1 
ATOM   7761  C CA    . GLU D 1 183 ? 36.860  -15.064 10.520 1.00 66.68 ? 235  GLU I CA    1 
ATOM   7762  C C     . GLU D 1 183 ? 38.357  -15.301 10.525 1.00 67.02 ? 235  GLU I C     1 
ATOM   7763  O O     . GLU D 1 183 ? 38.949  -15.662 9.511  1.00 67.27 ? 235  GLU I O     1 
ATOM   7764  C CB    . GLU D 1 183 ? 36.415  -14.418 9.211  1.00 68.44 ? 235  GLU I CB    1 
ATOM   7765  C CG    . GLU D 1 183 ? 35.025  -14.859 8.771  1.00 70.51 ? 235  GLU I CG    1 
ATOM   7766  C CD    . GLU D 1 183 ? 34.589  -14.206 7.473  1.00 72.45 ? 235  GLU I CD    1 
ATOM   7767  O OE1   . GLU D 1 183 ? 33.620  -14.706 6.857  1.00 73.34 ? 235  GLU I OE1   1 
ATOM   7768  O OE2   . GLU D 1 183 ? 35.209  -13.191 7.075  1.00 72.65 ? 235  GLU I OE2   1 
ATOM   7769  N N     . GLU D 1 184 ? 38.967  -15.082 11.681 1.00 67.67 ? 236  GLU I N     1 
ATOM   7770  C CA    . GLU D 1 184 ? 40.386  -15.338 11.837 1.00 67.84 ? 236  GLU I CA    1 
ATOM   7771  C C     . GLU D 1 184 ? 40.383  -16.833 12.135 1.00 67.81 ? 236  GLU I C     1 
ATOM   7772  O O     . GLU D 1 184 ? 39.313  -17.421 12.331 1.00 67.12 ? 236  GLU I O     1 
ATOM   7773  C CB    . GLU D 1 184 ? 40.951  -14.587 13.038 1.00 68.48 ? 236  GLU I CB    1 
ATOM   7774  C CG    . GLU D 1 184 ? 42.456  -14.438 12.994 1.00 69.97 ? 236  GLU I CG    1 
ATOM   7775  C CD    . GLU D 1 184 ? 42.880  -13.296 12.097 1.00 70.64 ? 236  GLU I CD    1 
ATOM   7776  O OE1   . GLU D 1 184 ? 42.788  -12.135 12.537 1.00 72.40 ? 236  GLU I OE1   1 
ATOM   7777  O OE2   . GLU D 1 184 ? 43.291  -13.547 10.947 1.00 72.03 ? 236  GLU I OE2   1 
ATOM   7778  N N     . ASP D 1 185 ? 41.556  -17.458 12.177 1.00 67.81 ? 237  ASP I N     1 
ATOM   7779  C CA    . ASP D 1 185 ? 41.600  -18.890 12.457 1.00 67.48 ? 237  ASP I CA    1 
ATOM   7780  C C     . ASP D 1 185 ? 41.041  -19.142 13.847 1.00 67.16 ? 237  ASP I C     1 
ATOM   7781  O O     . ASP D 1 185 ? 40.093  -19.917 14.038 1.00 66.51 ? 237  ASP I O     1 
ATOM   7782  C CB    . ASP D 1 185 ? 43.027  -19.414 12.368 1.00 67.23 ? 237  ASP I CB    1 
ATOM   7783  C CG    . ASP D 1 185 ? 43.172  -20.495 11.322 1.00 67.32 ? 237  ASP I CG    1 
ATOM   7784  O OD1   . ASP D 1 185 ? 42.292  -21.386 11.272 1.00 66.53 ? 237  ASP I OD1   1 
ATOM   7785  O OD2   . ASP D 1 185 ? 44.163  -20.456 10.557 1.00 67.79 ? 237  ASP I OD2   1 
ATOM   7786  N N     . GLU D 1 186 ? 41.648  -18.474 14.817 1.00 66.83 ? 238  GLU I N     1 
ATOM   7787  C CA    . GLU D 1 186 ? 41.213  -18.566 16.195 1.00 65.80 ? 238  GLU I CA    1 
ATOM   7788  C C     . GLU D 1 186 ? 40.404  -17.303 16.492 1.00 64.11 ? 238  GLU I C     1 
ATOM   7789  O O     . GLU D 1 186 ? 40.957  -16.223 16.717 1.00 63.27 ? 238  GLU I O     1 
ATOM   7790  C CB    . GLU D 1 186 ? 42.428  -18.663 17.113 1.00 66.96 ? 238  GLU I CB    1 
ATOM   7791  C CG    . GLU D 1 186 ? 43.248  -19.905 16.868 1.00 69.78 ? 238  GLU I CG    1 
ATOM   7792  C CD    . GLU D 1 186 ? 44.623  -19.806 17.469 1.00 71.70 ? 238  GLU I CD    1 
ATOM   7793  O OE1   . GLU D 1 186 ? 45.456  -19.053 16.919 1.00 73.45 ? 238  GLU I OE1   1 
ATOM   7794  O OE2   . GLU D 1 186 ? 44.869  -20.473 18.496 1.00 72.39 ? 238  GLU I OE2   1 
ATOM   7795  N N     . LYS D 1 187 ? 39.086  -17.442 16.450 1.00 62.11 ? 239  LYS I N     1 
ATOM   7796  C CA    . LYS D 1 187 ? 38.207  -16.324 16.726 1.00 60.53 ? 239  LYS I CA    1 
ATOM   7797  C C     . LYS D 1 187 ? 38.437  -15.935 18.176 1.00 58.96 ? 239  LYS I C     1 
ATOM   7798  O O     . LYS D 1 187 ? 38.429  -16.790 19.060 1.00 58.98 ? 239  LYS I O     1 
ATOM   7799  C CB    . LYS D 1 187 ? 36.749  -16.734 16.518 1.00 61.77 ? 239  LYS I CB    1 
ATOM   7800  C CG    . LYS D 1 187 ? 36.516  -17.498 15.226 1.00 63.89 ? 239  LYS I CG    1 
ATOM   7801  C CD    . LYS D 1 187 ? 35.091  -17.334 14.740 1.00 66.19 ? 239  LYS I CD    1 
ATOM   7802  C CE    . LYS D 1 187 ? 34.848  -18.081 13.433 1.00 67.63 ? 239  LYS I CE    1 
ATOM   7803  N NZ    . LYS D 1 187 ? 33.531  -17.724 12.816 1.00 68.59 ? 239  LYS I NZ    1 
ATOM   7804  N N     . PRO D 1 188 ? 38.664  -14.639 18.440 1.00 57.51 ? 240  PRO I N     1 
ATOM   7805  C CA    . PRO D 1 188 ? 38.897  -14.158 19.806 1.00 55.07 ? 240  PRO I CA    1 
ATOM   7806  C C     . PRO D 1 188 ? 37.700  -14.385 20.704 1.00 52.16 ? 240  PRO I C     1 
ATOM   7807  O O     . PRO D 1 188 ? 36.559  -14.442 20.246 1.00 51.12 ? 240  PRO I O     1 
ATOM   7808  C CB    . PRO D 1 188 ? 39.164  -12.667 19.615 1.00 55.54 ? 240  PRO I CB    1 
ATOM   7809  C CG    . PRO D 1 188 ? 39.741  -12.593 18.242 1.00 57.24 ? 240  PRO I CG    1 
ATOM   7810  C CD    . PRO D 1 188 ? 38.854  -13.549 17.469 1.00 57.62 ? 240  PRO I CD    1 
ATOM   7811  N N     . THR D 1 189 ? 37.969  -14.517 21.992 1.00 50.16 ? 241  THR I N     1 
ATOM   7812  C CA    . THR D 1 189 ? 36.903  -14.706 22.954 1.00 47.98 ? 241  THR I CA    1 
ATOM   7813  C C     . THR D 1 189 ? 36.534  -13.346 23.547 1.00 45.68 ? 241  THR I C     1 
ATOM   7814  O O     . THR D 1 189 ? 35.469  -13.173 24.126 1.00 46.00 ? 241  THR I O     1 
ATOM   7815  C CB    . THR D 1 189 ? 37.332  -15.674 24.057 1.00 47.84 ? 241  THR I CB    1 
ATOM   7816  O OG1   . THR D 1 189 ? 38.730  -15.966 23.921 1.00 46.89 ? 241  THR I OG1   1 
ATOM   7817  C CG2   . THR D 1 189 ? 36.533  -16.966 23.949 1.00 48.63 ? 241  THR I CG2   1 
ATOM   7818  N N     . ALA D 1 190 ? 37.409  -12.367 23.376 1.00 43.22 ? 242  ALA I N     1 
ATOM   7819  C CA    . ALA D 1 190 ? 37.130  -11.044 23.897 1.00 41.33 ? 242  ALA I CA    1 
ATOM   7820  C C     . ALA D 1 190 ? 37.748  -9.942  23.053 1.00 39.81 ? 242  ALA I C     1 
ATOM   7821  O O     . ALA D 1 190 ? 38.867  -10.070 22.550 1.00 38.92 ? 242  ALA I O     1 
ATOM   7822  C CB    . ALA D 1 190 ? 37.620  -10.933 25.345 1.00 40.58 ? 242  ALA I CB    1 
ATOM   7823  N N     . ILE D 1 191 ? 37.000  -8.856  22.901 1.00 38.67 ? 243  ILE I N     1 
ATOM   7824  C CA    . ILE D 1 191 ? 37.480  -7.714  22.146 1.00 37.61 ? 243  ILE I CA    1 
ATOM   7825  C C     . ILE D 1 191 ? 37.569  -6.501  23.060 1.00 36.25 ? 243  ILE I C     1 
ATOM   7826  O O     . ILE D 1 191 ? 36.701  -6.275  23.902 1.00 36.08 ? 243  ILE I O     1 
ATOM   7827  C CB    . ILE D 1 191 ? 36.523  -7.314  21.002 1.00 38.97 ? 243  ILE I CB    1 
ATOM   7828  C CG1   . ILE D 1 191 ? 35.987  -8.548  20.269 1.00 38.17 ? 243  ILE I CG1   1 
ATOM   7829  C CG2   . ILE D 1 191 ? 37.250  -6.375  20.057 1.00 37.95 ? 243  ILE I CG2   1 
ATOM   7830  C CD1   . ILE D 1 191 ? 37.047  -9.362  19.605 1.00 41.60 ? 243  ILE I CD1   1 
ATOM   7831  N N     . PHE D 1 192 ? 38.638  -5.736  22.903 1.00 35.73 ? 244  PHE I N     1 
ATOM   7832  C CA    . PHE D 1 192 ? 38.818  -4.498  23.647 1.00 35.19 ? 244  PHE I CA    1 
ATOM   7833  C C     . PHE D 1 192 ? 38.719  -3.468  22.529 1.00 34.09 ? 244  PHE I C     1 
ATOM   7834  O O     . PHE D 1 192 ? 39.538  -3.454  21.608 1.00 33.35 ? 244  PHE I O     1 
ATOM   7835  C CB    . PHE D 1 192 ? 40.200  -4.417  24.314 1.00 35.59 ? 244  PHE I CB    1 
ATOM   7836  C CG    . PHE D 1 192 ? 40.582  -3.020  24.764 1.00 34.55 ? 244  PHE I CG    1 
ATOM   7837  C CD1   . PHE D 1 192 ? 39.750  -2.286  25.601 1.00 34.90 ? 244  PHE I CD1   1 
ATOM   7838  C CD2   . PHE D 1 192 ? 41.776  -2.444  24.350 1.00 33.98 ? 244  PHE I CD2   1 
ATOM   7839  C CE1   . PHE D 1 192 ? 40.108  -0.993  26.017 1.00 35.94 ? 244  PHE I CE1   1 
ATOM   7840  C CE2   . PHE D 1 192 ? 42.141  -1.156  24.758 1.00 33.48 ? 244  PHE I CE2   1 
ATOM   7841  C CZ    . PHE D 1 192 ? 41.305  -0.431  25.592 1.00 34.19 ? 244  PHE I CZ    1 
ATOM   7842  N N     . VAL D 1 193 ? 37.693  -2.637  22.601 1.00 32.02 ? 245  VAL I N     1 
ATOM   7843  C CA    . VAL D 1 193 ? 37.461  -1.619  21.598 1.00 30.17 ? 245  VAL I CA    1 
ATOM   7844  C C     . VAL D 1 193 ? 37.833  -0.269  22.179 1.00 29.56 ? 245  VAL I C     1 
ATOM   7845  O O     . VAL D 1 193 ? 37.383  0.088   23.262 1.00 30.04 ? 245  VAL I O     1 
ATOM   7846  C CB    . VAL D 1 193 ? 36.006  -1.635  21.201 1.00 29.87 ? 245  VAL I CB    1 
ATOM   7847  C CG1   . VAL D 1 193 ? 35.803  -0.839  19.940 1.00 31.12 ? 245  VAL I CG1   1 
ATOM   7848  C CG2   . VAL D 1 193 ? 35.556  -3.078  21.044 1.00 28.27 ? 245  VAL I CG2   1 
ATOM   7849  N N     . GLY D 1 194 ? 38.663  0.477   21.461 1.00 29.18 ? 246  GLY I N     1 
ATOM   7850  C CA    . GLY D 1 194 ? 39.111  1.773   21.944 1.00 27.76 ? 246  GLY I CA    1 
ATOM   7851  C C     . GLY D 1 194 ? 38.096  2.897   21.991 1.00 26.39 ? 246  GLY I C     1 
ATOM   7852  O O     . GLY D 1 194 ? 38.415  4.006   22.396 1.00 27.41 ? 246  GLY I O     1 
ATOM   7853  N N     . THR D 1 195 ? 36.865  2.624   21.598 1.00 27.08 ? 247  THR I N     1 
ATOM   7854  C CA    . THR D 1 195 ? 35.840  3.660   21.594 1.00 27.10 ? 247  THR I CA    1 
ATOM   7855  C C     . THR D 1 195 ? 34.457  3.059   21.728 1.00 27.22 ? 247  THR I C     1 
ATOM   7856  O O     . THR D 1 195 ? 34.146  2.052   21.102 1.00 28.22 ? 247  THR I O     1 
ATOM   7857  C CB    . THR D 1 195 ? 35.917  4.476   20.273 1.00 27.50 ? 247  THR I CB    1 
ATOM   7858  O OG1   . THR D 1 195 ? 36.559  5.730   20.519 1.00 27.34 ? 247  THR I OG1   1 
ATOM   7859  C CG2   . THR D 1 195 ? 34.551  4.702   19.674 1.00 27.68 ? 247  THR I CG2   1 
ATOM   7860  N N     . ASP D 1 196 ? 33.625  3.688   22.544 1.00 28.91 ? 248  ASP I N     1 
ATOM   7861  C CA    . ASP D 1 196 ? 32.251  3.232   22.733 1.00 29.80 ? 248  ASP I CA    1 
ATOM   7862  C C     . ASP D 1 196 ? 31.495  3.073   21.421 1.00 29.25 ? 248  ASP I C     1 
ATOM   7863  O O     . ASP D 1 196 ? 30.830  2.068   21.210 1.00 29.94 ? 248  ASP I O     1 
ATOM   7864  C CB    . ASP D 1 196 ? 31.466  4.221   23.588 1.00 31.12 ? 248  ASP I CB    1 
ATOM   7865  C CG    . ASP D 1 196 ? 31.716  4.054   25.052 1.00 31.30 ? 248  ASP I CG    1 
ATOM   7866  O OD1   . ASP D 1 196 ? 30.993  4.716   25.810 1.00 33.37 ? 248  ASP I OD1   1 
ATOM   7867  O OD2   . ASP D 1 196 ? 32.615  3.280   25.446 1.00 32.28 ? 248  ASP I OD2   1 
ATOM   7868  N N     . GLU D 1 197 ? 31.569  4.081   20.555 1.00 29.94 ? 249  GLU I N     1 
ATOM   7869  C CA    . GLU D 1 197 ? 30.856  4.020   19.291 1.00 31.21 ? 249  GLU I CA    1 
ATOM   7870  C C     . GLU D 1 197 ? 31.300  2.832   18.454 1.00 30.15 ? 249  GLU I C     1 
ATOM   7871  O O     . GLU D 1 197 ? 30.489  2.213   17.772 1.00 29.85 ? 249  GLU I O     1 
ATOM   7872  C CB    . GLU D 1 197 ? 31.023  5.316   18.507 1.00 32.72 ? 249  GLU I CB    1 
ATOM   7873  C CG    . GLU D 1 197 ? 29.747  5.701   17.793 1.00 37.81 ? 249  GLU I CG    1 
ATOM   7874  C CD    . GLU D 1 197 ? 29.782  7.096   17.229 1.00 41.96 ? 249  GLU I CD    1 
ATOM   7875  O OE1   . GLU D 1 197 ? 30.115  8.042   17.977 1.00 42.53 ? 249  GLU I OE1   1 
ATOM   7876  O OE2   . GLU D 1 197 ? 29.468  7.245   16.029 1.00 47.37 ? 249  GLU I OE2   1 
ATOM   7877  N N     . MET D 1 198 ? 32.582  2.501   18.511 1.00 28.76 ? 250  MET I N     1 
ATOM   7878  C CA    . MET D 1 198 ? 33.061  1.350   17.763 1.00 28.25 ? 250  MET I CA    1 
ATOM   7879  C C     . MET D 1 198 ? 32.658  0.067   18.487 1.00 26.81 ? 250  MET I C     1 
ATOM   7880  O O     . MET D 1 198 ? 32.265  -0.911  17.854 1.00 26.38 ? 250  MET I O     1 
ATOM   7881  C CB    . MET D 1 198 ? 34.573  1.412   17.594 1.00 29.38 ? 250  MET I CB    1 
ATOM   7882  C CG    . MET D 1 198 ? 35.018  2.454   16.600 1.00 30.51 ? 250  MET I CG    1 
ATOM   7883  S SD    . MET D 1 198 ? 36.704  2.155   16.130 1.00 32.26 ? 250  MET I SD    1 
ATOM   7884  C CE    . MET D 1 198 ? 37.564  3.107   17.298 1.00 35.36 ? 250  MET I CE    1 
ATOM   7885  N N     . ALA D 1 199 ? 32.754  0.087   19.815 1.00 24.70 ? 251  ALA I N     1 
ATOM   7886  C CA    . ALA D 1 199 ? 32.372  -1.049  20.647 1.00 22.09 ? 251  ALA I CA    1 
ATOM   7887  C C     . ALA D 1 199 ? 30.942  -1.501  20.365 1.00 20.89 ? 251  ALA I C     1 
ATOM   7888  O O     . ALA D 1 199 ? 30.665  -2.705  20.348 1.00 18.68 ? 251  ALA I O     1 
ATOM   7889  C CB    . ALA D 1 199 ? 32.513  -0.696  22.124 1.00 21.25 ? 251  ALA I CB    1 
ATOM   7890  N N     . LEU D 1 200 ? 30.027  -0.556  20.160 1.00 20.94 ? 252  LEU I N     1 
ATOM   7891  C CA    . LEU D 1 200 ? 28.648  -0.943  19.873 1.00 24.10 ? 252  LEU I CA    1 
ATOM   7892  C C     . LEU D 1 200 ? 28.616  -1.628  18.515 1.00 26.57 ? 252  LEU I C     1 
ATOM   7893  O O     . LEU D 1 200 ? 27.848  -2.561  18.303 1.00 27.11 ? 252  LEU I O     1 
ATOM   7894  C CB    . LEU D 1 200 ? 27.699  0.267   19.870 1.00 22.66 ? 252  LEU I CB    1 
ATOM   7895  C CG    . LEU D 1 200 ? 27.016  0.677   21.187 1.00 20.74 ? 252  LEU I CG    1 
ATOM   7896  C CD1   . LEU D 1 200 ? 28.093  1.156   22.188 1.00 18.74 ? 252  LEU I CD1   1 
ATOM   7897  C CD2   . LEU D 1 200 ? 25.963  1.769   20.928 1.00 15.42 ? 252  LEU I CD2   1 
ATOM   7898  N N     . GLY D 1 201 ? 29.456  -1.158  17.597 1.00 28.54 ? 253  GLY I N     1 
ATOM   7899  C CA    . GLY D 1 201 ? 29.517  -1.769  16.284 1.00 29.92 ? 253  GLY I CA    1 
ATOM   7900  C C     . GLY D 1 201 ? 30.081  -3.175  16.417 1.00 32.12 ? 253  GLY I C     1 
ATOM   7901  O O     . GLY D 1 201 ? 29.795  -4.067  15.616 1.00 33.43 ? 253  GLY I O     1 
ATOM   7902  N N     . VAL D 1 202 ? 30.899  -3.376  17.440 1.00 33.04 ? 254  VAL I N     1 
ATOM   7903  C CA    . VAL D 1 202 ? 31.491  -4.677  17.689 1.00 33.05 ? 254  VAL I CA    1 
ATOM   7904  C C     . VAL D 1 202 ? 30.458  -5.610  18.316 1.00 33.96 ? 254  VAL I C     1 
ATOM   7905  O O     . VAL D 1 202 ? 30.462  -6.813  18.053 1.00 33.83 ? 254  VAL I O     1 
ATOM   7906  C CB    . VAL D 1 202 ? 32.713  -4.550  18.620 1.00 32.70 ? 254  VAL I CB    1 
ATOM   7907  C CG1   . VAL D 1 202 ? 33.081  -5.892  19.183 1.00 32.64 ? 254  VAL I CG1   1 
ATOM   7908  C CG2   . VAL D 1 202 ? 33.885  -3.972  17.851 1.00 32.13 ? 254  VAL I CG2   1 
ATOM   7909  N N     . ILE D 1 203 ? 29.563  -5.050  19.130 1.00 34.56 ? 255  ILE I N     1 
ATOM   7910  C CA    . ILE D 1 203 ? 28.541  -5.857  19.784 1.00 35.56 ? 255  ILE I CA    1 
ATOM   7911  C C     . ILE D 1 203 ? 27.429  -6.270  18.830 1.00 36.76 ? 255  ILE I C     1 
ATOM   7912  O O     . ILE D 1 203 ? 26.963  -7.405  18.873 1.00 38.86 ? 255  ILE I O     1 
ATOM   7913  C CB    . ILE D 1 203 ? 27.928  -5.129  21.001 1.00 35.33 ? 255  ILE I CB    1 
ATOM   7914  C CG1   . ILE D 1 203 ? 28.953  -5.046  22.133 1.00 34.67 ? 255  ILE I CG1   1 
ATOM   7915  C CG2   . ILE D 1 203 ? 26.716  -5.884  21.504 1.00 35.25 ? 255  ILE I CG2   1 
ATOM   7916  C CD1   . ILE D 1 203 ? 28.396  -4.462  23.409 1.00 39.79 ? 255  ILE I CD1   1 
ATOM   7917  N N     . HIS D 1 204 ? 26.994  -5.360  17.971 1.00 37.21 ? 256  HIS I N     1 
ATOM   7918  C CA    . HIS D 1 204 ? 25.952  -5.707  17.026 1.00 37.46 ? 256  HIS I CA    1 
ATOM   7919  C C     . HIS D 1 204 ? 26.507  -6.616  15.941 1.00 38.14 ? 256  HIS I C     1 
ATOM   7920  O O     . HIS D 1 204 ? 25.900  -7.632  15.609 1.00 38.08 ? 256  HIS I O     1 
ATOM   7921  C CB    . HIS D 1 204 ? 25.370  -4.458  16.391 1.00 38.60 ? 256  HIS I CB    1 
ATOM   7922  C CG    . HIS D 1 204 ? 24.547  -3.637  17.328 1.00 38.95 ? 256  HIS I CG    1 
ATOM   7923  N ND1   . HIS D 1 204 ? 25.102  -2.869  18.326 1.00 39.52 ? 256  HIS I ND1   1 
ATOM   7924  C CD2   . HIS D 1 204 ? 23.209  -3.450  17.409 1.00 39.90 ? 256  HIS I CD2   1 
ATOM   7925  C CE1   . HIS D 1 204 ? 24.142  -2.239  18.978 1.00 41.18 ? 256  HIS I CE1   1 
ATOM   7926  N NE2   . HIS D 1 204 ? 22.983  -2.575  18.440 1.00 40.68 ? 256  HIS I NE2   1 
ATOM   7927  N N     . GLY D 1 205 ? 27.664  -6.250  15.393 1.00 38.74 ? 257  GLY I N     1 
ATOM   7928  C CA    . GLY D 1 205 ? 28.284  -7.057  14.355 1.00 39.81 ? 257  GLY I CA    1 
ATOM   7929  C C     . GLY D 1 205 ? 28.490  -8.488  14.819 1.00 41.16 ? 257  GLY I C     1 
ATOM   7930  O O     . GLY D 1 205 ? 28.254  -9.438  14.072 1.00 40.52 ? 257  GLY I O     1 
ATOM   7931  N N     . ALA D 1 206 ? 28.925  -8.631  16.069 1.00 42.35 ? 258  ALA I N     1 
ATOM   7932  C CA    . ALA D 1 206 ? 29.168  -9.934  16.674 1.00 42.06 ? 258  ALA I CA    1 
ATOM   7933  C C     . ALA D 1 206 ? 27.873  -10.719 16.877 1.00 42.99 ? 258  ALA I C     1 
ATOM   7934  O O     . ALA D 1 206 ? 27.806  -11.912 16.570 1.00 42.74 ? 258  ALA I O     1 
ATOM   7935  C CB    . ALA D 1 206 ? 29.882  -9.758  18.004 1.00 39.72 ? 258  ALA I CB    1 
ATOM   7936  N N     . GLN D 1 207 ? 26.841  -10.063 17.390 1.00 43.73 ? 259  GLN I N     1 
ATOM   7937  C CA    . GLN D 1 207 ? 25.599  -10.771 17.612 1.00 45.83 ? 259  GLN I CA    1 
ATOM   7938  C C     . GLN D 1 207 ? 24.794  -10.945 16.326 1.00 48.11 ? 259  GLN I C     1 
ATOM   7939  O O     . GLN D 1 207 ? 23.869  -11.772 16.275 1.00 49.09 ? 259  GLN I O     1 
ATOM   7940  C CB    . GLN D 1 207 ? 24.772  -10.071 18.693 1.00 45.60 ? 259  GLN I CB    1 
ATOM   7941  C CG    . GLN D 1 207 ? 24.263  -8.692  18.352 1.00 46.07 ? 259  GLN I CG    1 
ATOM   7942  C CD    . GLN D 1 207 ? 23.666  -7.987  19.560 1.00 46.19 ? 259  GLN I CD    1 
ATOM   7943  O OE1   . GLN D 1 207 ? 22.621  -7.346  19.457 1.00 47.28 ? 259  GLN I OE1   1 
ATOM   7944  N NE2   . GLN D 1 207 ? 24.335  -8.093  20.709 1.00 43.44 ? 259  GLN I NE2   1 
ATOM   7945  N N     . ASP D 1 208 ? 25.148  -10.184 15.285 1.00 48.06 ? 260  ASP I N     1 
ATOM   7946  C CA    . ASP D 1 208 ? 24.439  -10.297 14.007 1.00 47.76 ? 260  ASP I CA    1 
ATOM   7947  C C     . ASP D 1 208 ? 24.759  -11.676 13.443 1.00 48.57 ? 260  ASP I C     1 
ATOM   7948  O O     . ASP D 1 208 ? 23.963  -12.272 12.709 1.00 47.16 ? 260  ASP I O     1 
ATOM   7949  C CB    . ASP D 1 208 ? 24.894  -9.219  13.003 1.00 46.04 ? 260  ASP I CB    1 
ATOM   7950  C CG    . ASP D 1 208 ? 24.122  -7.899  13.138 1.00 45.01 ? 260  ASP I CG    1 
ATOM   7951  O OD1   . ASP D 1 208 ? 22.925  -7.928  13.492 1.00 45.10 ? 260  ASP I OD1   1 
ATOM   7952  O OD2   . ASP D 1 208 ? 24.708  -6.827  12.868 1.00 41.93 ? 260  ASP I OD2   1 
ATOM   7953  N N     . ARG D 1 209 ? 25.934  -12.172 13.815 1.00 49.29 ? 261  ARG I N     1 
ATOM   7954  C CA    . ARG D 1 209 ? 26.418  -13.462 13.363 1.00 50.84 ? 261  ARG I CA    1 
ATOM   7955  C C     . ARG D 1 209 ? 25.895  -14.580 14.251 1.00 51.05 ? 261  ARG I C     1 
ATOM   7956  O O     . ARG D 1 209 ? 26.334  -15.724 14.139 1.00 51.16 ? 261  ARG I O     1 
ATOM   7957  C CB    . ARG D 1 209 ? 27.942  -13.459 13.376 1.00 52.39 ? 261  ARG I CB    1 
ATOM   7958  C CG    . ARG D 1 209 ? 28.561  -12.425 12.463 1.00 56.02 ? 261  ARG I CG    1 
ATOM   7959  C CD    . ARG D 1 209 ? 28.475  -12.861 11.004 1.00 60.05 ? 261  ARG I CD    1 
ATOM   7960  N NE    . ARG D 1 209 ? 29.194  -14.115 10.773 1.00 62.90 ? 261  ARG I NE    1 
ATOM   7961  C CZ    . ARG D 1 209 ? 30.513  -14.259 10.887 1.00 64.50 ? 261  ARG I CZ    1 
ATOM   7962  N NH1   . ARG D 1 209 ? 31.271  -13.223 11.225 1.00 66.62 ? 261  ARG I NH1   1 
ATOM   7963  N NH2   . ARG D 1 209 ? 31.077  -15.441 10.677 1.00 65.34 ? 261  ARG I NH2   1 
ATOM   7964  N N     . GLY D 1 210 ? 24.961  -14.246 15.134 1.00 50.63 ? 262  GLY I N     1 
ATOM   7965  C CA    . GLY D 1 210 ? 24.401  -15.252 16.021 1.00 51.22 ? 262  GLY I CA    1 
ATOM   7966  C C     . GLY D 1 210 ? 25.106  -15.341 17.361 1.00 51.15 ? 262  GLY I C     1 
ATOM   7967  O O     . GLY D 1 210 ? 24.504  -15.702 18.368 1.00 50.53 ? 262  GLY I O     1 
ATOM   7968  N N     . LEU D 1 211 ? 26.393  -15.016 17.363 1.00 51.19 ? 263  LEU I N     1 
ATOM   7969  C CA    . LEU D 1 211 ? 27.208  -15.035 18.569 1.00 50.81 ? 263  LEU I CA    1 
ATOM   7970  C C     . LEU D 1 211 ? 26.532  -14.251 19.704 1.00 50.00 ? 263  LEU I C     1 
ATOM   7971  O O     . LEU D 1 211 ? 25.806  -13.286 19.459 1.00 50.40 ? 263  LEU I O     1 
ATOM   7972  C CB    . LEU D 1 211 ? 28.562  -14.420 18.239 1.00 51.69 ? 263  LEU I CB    1 
ATOM   7973  C CG    . LEU D 1 211 ? 29.706  -14.666 19.208 1.00 51.89 ? 263  LEU I CG    1 
ATOM   7974  C CD1   . LEU D 1 211 ? 29.970  -16.159 19.280 1.00 52.15 ? 263  LEU I CD1   1 
ATOM   7975  C CD2   . LEU D 1 211 ? 30.946  -13.913 18.733 1.00 51.46 ? 263  LEU I CD2   1 
ATOM   7976  N N     . ASN D 1 212 ? 26.775  -14.651 20.948 1.00 48.90 ? 264  ASN I N     1 
ATOM   7977  C CA    . ASN D 1 212 ? 26.161  -13.971 22.088 1.00 45.43 ? 264  ASN I CA    1 
ATOM   7978  C C     . ASN D 1 212 ? 27.139  -13.269 23.019 1.00 41.35 ? 264  ASN I C     1 
ATOM   7979  O O     . ASN D 1 212 ? 28.185  -13.813 23.363 1.00 40.34 ? 264  ASN I O     1 
ATOM   7980  C CB    . ASN D 1 212 ? 25.325  -14.969 22.894 1.00 47.61 ? 264  ASN I CB    1 
ATOM   7981  C CG    . ASN D 1 212 ? 24.954  -14.450 24.278 1.00 47.63 ? 264  ASN I CG    1 
ATOM   7982  O OD1   . ASN D 1 212 ? 25.816  -14.239 25.132 1.00 48.57 ? 264  ASN I OD1   1 
ATOM   7983  N ND2   . ASN D 1 212 ? 23.667  -14.254 24.506 1.00 46.66 ? 264  ASN I ND2   1 
ATOM   7984  N N     . VAL D 1 213 ? 26.782  -12.053 23.423 1.00 37.34 ? 265  VAL I N     1 
ATOM   7985  C CA    . VAL D 1 213 ? 27.605  -11.276 24.348 1.00 33.79 ? 265  VAL I CA    1 
ATOM   7986  C C     . VAL D 1 213 ? 26.880  -11.224 25.701 1.00 32.85 ? 265  VAL I C     1 
ATOM   7987  O O     . VAL D 1 213 ? 25.688  -10.911 25.763 1.00 31.74 ? 265  VAL I O     1 
ATOM   7988  C CB    . VAL D 1 213 ? 27.840  -9.828  23.836 1.00 32.07 ? 265  VAL I CB    1 
ATOM   7989  C CG1   . VAL D 1 213 ? 28.598  -9.002  24.894 1.00 29.58 ? 265  VAL I CG1   1 
ATOM   7990  C CG2   . VAL D 1 213 ? 28.632  -9.871  22.536 1.00 29.16 ? 265  VAL I CG2   1 
ATOM   7991  N N     . PRO D 1 214 ? 27.605  -11.465 26.808 1.00 31.56 ? 266  PRO I N     1 
ATOM   7992  C CA    . PRO D 1 214 ? 29.038  -11.769 26.899 1.00 32.04 ? 266  PRO I CA    1 
ATOM   7993  C C     . PRO D 1 214 ? 29.404  -13.238 26.986 1.00 36.56 ? 266  PRO I C     1 
ATOM   7994  O O     . PRO D 1 214 ? 30.586  -13.571 27.120 1.00 36.21 ? 266  PRO I O     1 
ATOM   7995  C CB    . PRO D 1 214 ? 29.433  -11.060 28.172 1.00 31.77 ? 266  PRO I CB    1 
ATOM   7996  C CG    . PRO D 1 214 ? 28.232  -11.420 29.081 1.00 29.41 ? 266  PRO I CG    1 
ATOM   7997  C CD    . PRO D 1 214 ? 27.007  -11.313 28.151 1.00 27.49 ? 266  PRO I CD    1 
ATOM   7998  N N     . ASN D 1 215 ? 28.414  -14.120 26.941 1.00 41.42 ? 267  ASN I N     1 
ATOM   7999  C CA    . ASN D 1 215 ? 28.717  -15.539 27.051 1.00 46.82 ? 267  ASN I CA    1 
ATOM   8000  C C     . ASN D 1 215 ? 29.669  -16.033 25.973 1.00 47.18 ? 267  ASN I C     1 
ATOM   8001  O O     . ASN D 1 215 ? 30.720  -16.581 26.279 1.00 49.74 ? 267  ASN I O     1 
ATOM   8002  C CB    . ASN D 1 215 ? 27.430  -16.362 27.062 1.00 49.86 ? 267  ASN I CB    1 
ATOM   8003  C CG    . ASN D 1 215 ? 26.578  -16.075 28.283 1.00 52.81 ? 267  ASN I CG    1 
ATOM   8004  O OD1   . ASN D 1 215 ? 27.092  -15.671 29.328 1.00 54.33 ? 267  ASN I OD1   1 
ATOM   8005  N ND2   . ASN D 1 215 ? 25.273  -16.296 28.166 1.00 53.08 ? 267  ASN I ND2   1 
ATOM   8006  N N     . ASP D 1 216 ? 29.328  -15.818 24.712 1.00 46.15 ? 268  ASP I N     1 
ATOM   8007  C CA    . ASP D 1 216 ? 30.191  -16.276 23.636 1.00 43.56 ? 268  ASP I CA    1 
ATOM   8008  C C     . ASP D 1 216 ? 31.305  -15.319 23.246 1.00 41.10 ? 268  ASP I C     1 
ATOM   8009  O O     . ASP D 1 216 ? 32.240  -15.717 22.565 1.00 42.08 ? 268  ASP I O     1 
ATOM   8010  C CB    . ASP D 1 216 ? 29.358  -16.612 22.400 1.00 44.48 ? 268  ASP I CB    1 
ATOM   8011  C CG    . ASP D 1 216 ? 28.610  -17.919 22.547 1.00 44.94 ? 268  ASP I CG    1 
ATOM   8012  O OD1   . ASP D 1 216 ? 27.352  -17.905 22.579 1.00 44.49 ? 268  ASP I OD1   1 
ATOM   8013  O OD2   . ASP D 1 216 ? 29.298  -18.960 22.638 1.00 44.60 ? 268  ASP I OD2   1 
ATOM   8014  N N     . LEU D 1 217 ? 31.222  -14.068 23.675 1.00 38.24 ? 269  LEU I N     1 
ATOM   8015  C CA    . LEU D 1 217 ? 32.244  -13.082 23.321 1.00 36.33 ? 269  LEU I CA    1 
ATOM   8016  C C     . LEU D 1 217 ? 32.110  -11.879 24.234 1.00 36.29 ? 269  LEU I C     1 
ATOM   8017  O O     . LEU D 1 217 ? 31.071  -11.218 24.246 1.00 37.25 ? 269  LEU I O     1 
ATOM   8018  C CB    . LEU D 1 217 ? 32.049  -12.650 21.870 1.00 34.79 ? 269  LEU I CB    1 
ATOM   8019  C CG    . LEU D 1 217 ? 33.149  -12.043 21.000 1.00 32.38 ? 269  LEU I CG    1 
ATOM   8020  C CD1   . LEU D 1 217 ? 32.620  -10.740 20.438 1.00 31.86 ? 269  LEU I CD1   1 
ATOM   8021  C CD2   . LEU D 1 217 ? 34.431  -11.839 21.778 1.00 31.46 ? 269  LEU I CD2   1 
ATOM   8022  N N     . GLU D 1 218 ? 33.156  -11.602 25.002 1.00 36.22 ? 270  GLU I N     1 
ATOM   8023  C CA    . GLU D 1 218 ? 33.134  -10.487 25.923 1.00 37.78 ? 270  GLU I CA    1 
ATOM   8024  C C     . GLU D 1 218 ? 33.823  -9.292  25.295 1.00 36.40 ? 270  GLU I C     1 
ATOM   8025  O O     . GLU D 1 218 ? 34.870  -9.399  24.689 1.00 36.89 ? 270  GLU I O     1 
ATOM   8026  C CB    . GLU D 1 218 ? 33.805  -10.870 27.247 1.00 41.10 ? 270  GLU I CB    1 
ATOM   8027  C CG    . GLU D 1 218 ? 33.054  -11.956 28.039 1.00 45.24 ? 270  GLU I CG    1 
ATOM   8028  C CD    . GLU D 1 218 ? 33.690  -12.269 29.396 1.00 48.43 ? 270  GLU I CD    1 
ATOM   8029  O OE1   . GLU D 1 218 ? 33.768  -13.471 29.748 1.00 50.61 ? 270  GLU I OE1   1 
ATOM   8030  O OE2   . GLU D 1 218 ? 34.102  -11.323 30.116 1.00 47.35 ? 270  GLU I OE2   1 
ATOM   8031  N N     . ILE D 1 219 ? 33.193  -8.140  25.451 1.00 35.81 ? 271  ILE I N     1 
ATOM   8032  C CA    . ILE D 1 219 ? 33.677  -6.874  24.910 1.00 34.73 ? 271  ILE I CA    1 
ATOM   8033  C C     . ILE D 1 219 ? 33.808  -5.750  25.965 1.00 33.61 ? 271  ILE I C     1 
ATOM   8034  O O     . ILE D 1 219 ? 32.981  -5.645  26.870 1.00 31.79 ? 271  ILE I O     1 
ATOM   8035  C CB    . ILE D 1 219 ? 32.722  -6.401  23.799 1.00 35.99 ? 271  ILE I CB    1 
ATOM   8036  C CG1   . ILE D 1 219 ? 33.200  -6.936  22.462 1.00 37.88 ? 271  ILE I CG1   1 
ATOM   8037  C CG2   . ILE D 1 219 ? 32.624  -4.895  23.790 1.00 35.62 ? 271  ILE I CG2   1 
ATOM   8038  C CD1   . ILE D 1 219 ? 32.234  -7.884  21.847 1.00 41.52 ? 271  ILE I CD1   1 
ATOM   8039  N N     . ILE D 1 220 ? 34.853  -4.928  25.861 1.00 32.23 ? 272  ILE I N     1 
ATOM   8040  C CA    . ILE D 1 220 ? 35.041  -3.800  26.774 1.00 31.44 ? 272  ILE I CA    1 
ATOM   8041  C C     . ILE D 1 220 ? 35.305  -2.546  25.962 1.00 30.89 ? 272  ILE I C     1 
ATOM   8042  O O     . ILE D 1 220 ? 36.203  -2.517  25.132 1.00 29.85 ? 272  ILE I O     1 
ATOM   8043  C CB    . ILE D 1 220 ? 36.226  -3.988  27.738 1.00 33.43 ? 272  ILE I CB    1 
ATOM   8044  C CG1   . ILE D 1 220 ? 35.941  -5.123  28.723 1.00 34.00 ? 272  ILE I CG1   1 
ATOM   8045  C CG2   . ILE D 1 220 ? 36.467  -2.691  28.512 1.00 32.98 ? 272  ILE I CG2   1 
ATOM   8046  C CD1   . ILE D 1 220 ? 37.042  -5.327  29.751 1.00 39.57 ? 272  ILE I CD1   1 
ATOM   8047  N N     . GLY D 1 221 ? 34.512  -1.513  26.210 1.00 32.14 ? 273  GLY I N     1 
ATOM   8048  C CA    . GLY D 1 221 ? 34.657  -0.264  25.479 1.00 33.60 ? 273  GLY I CA    1 
ATOM   8049  C C     . GLY D 1 221 ? 35.557  0.763   26.139 1.00 33.32 ? 273  GLY I C     1 
ATOM   8050  O O     . GLY D 1 221 ? 36.316  0.427   27.042 1.00 34.11 ? 273  GLY I O     1 
ATOM   8051  N N     . PHE D 1 222 ? 35.460  2.021   25.715 1.00 33.00 ? 274  PHE I N     1 
ATOM   8052  C CA    . PHE D 1 222 ? 36.312  3.062   26.272 1.00 33.26 ? 274  PHE I CA    1 
ATOM   8053  C C     . PHE D 1 222 ? 35.661  4.428   26.134 1.00 32.96 ? 274  PHE I C     1 
ATOM   8054  O O     . PHE D 1 222 ? 35.130  4.752   25.088 1.00 34.99 ? 274  PHE I O     1 
ATOM   8055  C CB    . PHE D 1 222 ? 37.645  3.035   25.540 1.00 34.22 ? 274  PHE I CB    1 
ATOM   8056  C CG    . PHE D 1 222 ? 38.766  3.701   26.271 1.00 35.69 ? 274  PHE I CG    1 
ATOM   8057  C CD1   . PHE D 1 222 ? 38.796  5.077   26.424 1.00 35.43 ? 274  PHE I CD1   1 
ATOM   8058  C CD2   . PHE D 1 222 ? 39.832  2.945   26.762 1.00 36.99 ? 274  PHE I CD2   1 
ATOM   8059  C CE1   . PHE D 1 222 ? 39.869  5.694   27.049 1.00 35.98 ? 274  PHE I CE1   1 
ATOM   8060  C CE2   . PHE D 1 222 ? 40.910  3.549   27.389 1.00 35.20 ? 274  PHE I CE2   1 
ATOM   8061  C CZ    . PHE D 1 222 ? 40.933  4.927   27.533 1.00 36.74 ? 274  PHE I CZ    1 
ATOM   8062  N N     . ASP D 1 223 ? 35.721  5.205   27.213 1.00 34.11 ? 275  ASP I N     1 
ATOM   8063  C CA    . ASP D 1 223 ? 35.167  6.569   27.351 1.00 33.38 ? 275  ASP I CA    1 
ATOM   8064  C C     . ASP D 1 223 ? 34.025  6.600   28.367 1.00 32.88 ? 275  ASP I C     1 
ATOM   8065  O O     . ASP D 1 223 ? 33.913  7.520   29.170 1.00 34.57 ? 275  ASP I O     1 
ATOM   8066  C CB    . ASP D 1 223 ? 34.618  7.125   26.037 1.00 33.56 ? 275  ASP I CB    1 
ATOM   8067  C CG    . ASP D 1 223 ? 35.700  7.518   25.066 1.00 35.00 ? 275  ASP I CG    1 
ATOM   8068  O OD1   . ASP D 1 223 ? 36.865  7.637   25.490 1.00 34.48 ? 275  ASP I OD1   1 
ATOM   8069  O OD2   . ASP D 1 223 ? 35.372  7.727   23.871 1.00 37.16 ? 275  ASP I OD2   1 
ATOM   8070  N N     . ASN D 1 224 ? 33.192  5.567   28.334 1.00 30.44 ? 276  ASN I N     1 
ATOM   8071  C CA    . ASN D 1 224 ? 32.022  5.473   29.191 1.00 27.27 ? 276  ASN I CA    1 
ATOM   8072  C C     . ASN D 1 224 ? 31.095  6.628   28.841 1.00 26.45 ? 276  ASN I C     1 
ATOM   8073  O O     . ASN D 1 224 ? 30.628  7.362   29.702 1.00 24.82 ? 276  ASN I O     1 
ATOM   8074  C CB    . ASN D 1 224 ? 32.386  5.512   30.670 1.00 26.74 ? 276  ASN I CB    1 
ATOM   8075  C CG    . ASN D 1 224 ? 31.205  5.181   31.543 1.00 27.72 ? 276  ASN I CG    1 
ATOM   8076  O OD1   . ASN D 1 224 ? 30.321  4.428   31.136 1.00 27.97 ? 276  ASN I OD1   1 
ATOM   8077  N ND2   . ASN D 1 224 ? 31.179  5.728   32.747 1.00 28.28 ? 276  ASN I ND2   1 
ATOM   8078  N N     . THR D 1 225 ? 30.852  6.786   27.545 1.00 26.32 ? 277  THR I N     1 
ATOM   8079  C CA    . THR D 1 225 ? 29.970  7.828   27.052 1.00 26.91 ? 277  THR I CA    1 
ATOM   8080  C C     . THR D 1 225 ? 28.570  7.410   27.452 1.00 26.56 ? 277  THR I C     1 
ATOM   8081  O O     . THR D 1 225 ? 28.383  6.372   28.071 1.00 25.53 ? 277  THR I O     1 
ATOM   8082  C CB    . THR D 1 225 ? 30.020  7.931   25.513 1.00 26.57 ? 277  THR I CB    1 
ATOM   8083  O OG1   . THR D 1 225 ? 29.408  6.768   24.932 1.00 28.03 ? 277  THR I OG1   1 
ATOM   8084  C CG2   . THR D 1 225 ? 31.450  8.017   25.041 1.00 26.15 ? 277  THR I CG2   1 
ATOM   8085  N N     . ARG D 1 226 ? 27.585  8.221   27.102 1.00 27.23 ? 278  ARG I N     1 
ATOM   8086  C CA    . ARG D 1 226 ? 26.220  7.883   27.415 1.00 27.22 ? 278  ARG I CA    1 
ATOM   8087  C C     . ARG D 1 226 ? 25.803  6.663   26.584 1.00 26.71 ? 278  ARG I C     1 
ATOM   8088  O O     . ARG D 1 226 ? 24.886  5.952   26.956 1.00 27.46 ? 278  ARG I O     1 
ATOM   8089  C CB    . ARG D 1 226 ? 25.332  9.083   27.122 1.00 28.88 ? 278  ARG I CB    1 
ATOM   8090  C CG    . ARG D 1 226 ? 25.373  9.521   25.685 1.00 34.11 ? 278  ARG I CG    1 
ATOM   8091  C CD    . ARG D 1 226 ? 24.908  10.952  25.549 1.00 37.54 ? 278  ARG I CD    1 
ATOM   8092  N NE    . ARG D 1 226 ? 24.696  11.326  24.152 1.00 39.59 ? 278  ARG I NE    1 
ATOM   8093  C CZ    . ARG D 1 226 ? 23.718  10.847  23.395 1.00 39.13 ? 278  ARG I CZ    1 
ATOM   8094  N NH1   . ARG D 1 226 ? 22.857  9.966   23.897 1.00 36.21 ? 278  ARG I NH1   1 
ATOM   8095  N NH2   . ARG D 1 226 ? 23.591  11.270  22.144 1.00 40.47 ? 278  ARG I NH2   1 
ATOM   8096  N N     . LEU D 1 227 ? 26.489  6.415   25.467 1.00 26.83 ? 279  LEU I N     1 
ATOM   8097  C CA    . LEU D 1 227 ? 26.179  5.271   24.598 1.00 27.75 ? 279  LEU I CA    1 
ATOM   8098  C C     . LEU D 1 227 ? 26.326  3.923   25.299 1.00 29.06 ? 279  LEU I C     1 
ATOM   8099  O O     . LEU D 1 227 ? 25.769  2.919   24.852 1.00 29.77 ? 279  LEU I O     1 
ATOM   8100  C CB    . LEU D 1 227 ? 27.098  5.232   23.378 1.00 26.57 ? 279  LEU I CB    1 
ATOM   8101  C CG    . LEU D 1 227 ? 27.026  6.233   22.236 1.00 25.09 ? 279  LEU I CG    1 
ATOM   8102  C CD1   . LEU D 1 227 ? 28.118  5.835   21.263 1.00 24.81 ? 279  LEU I CD1   1 
ATOM   8103  C CD2   . LEU D 1 227 ? 25.668  6.232   21.558 1.00 21.32 ? 279  LEU I CD2   1 
ATOM   8104  N N     . SER D 1 228 ? 27.099  3.905   26.380 1.00 30.40 ? 280  SER I N     1 
ATOM   8105  C CA    . SER D 1 228 ? 27.351  2.697   27.153 1.00 30.10 ? 280  SER I CA    1 
ATOM   8106  C C     . SER D 1 228 ? 26.109  2.088   27.772 1.00 29.63 ? 280  SER I C     1 
ATOM   8107  O O     . SER D 1 228 ? 26.075  0.883   28.005 1.00 31.51 ? 280  SER I O     1 
ATOM   8108  C CB    . SER D 1 228 ? 28.361  2.983   28.256 1.00 30.96 ? 280  SER I CB    1 
ATOM   8109  O OG    . SER D 1 228 ? 29.611  3.320   27.693 1.00 34.28 ? 280  SER I OG    1 
ATOM   8110  N N     . THR D 1 229 ? 25.104  2.904   28.064 1.00 27.20 ? 281  THR I N     1 
ATOM   8111  C CA    . THR D 1 229 ? 23.878  2.376   28.640 1.00 27.83 ? 281  THR I CA    1 
ATOM   8112  C C     . THR D 1 229 ? 22.812  2.355   27.561 1.00 29.25 ? 281  THR I C     1 
ATOM   8113  O O     . THR D 1 229 ? 21.630  2.101   27.825 1.00 28.66 ? 281  THR I O     1 
ATOM   8114  C CB    . THR D 1 229 ? 23.374  3.236   29.808 1.00 28.01 ? 281  THR I CB    1 
ATOM   8115  O OG1   . THR D 1 229 ? 23.127  4.568   29.345 1.00 28.63 ? 281  THR I OG1   1 
ATOM   8116  C CG2   . THR D 1 229 ? 24.390  3.262   30.930 1.00 24.96 ? 281  THR I CG2   1 
ATOM   8117  N N     . MET D 1 230 ? 23.251  2.618   26.335 1.00 30.89 ? 282  MET I N     1 
ATOM   8118  C CA    . MET D 1 230 ? 22.366  2.637   25.184 1.00 32.85 ? 282  MET I CA    1 
ATOM   8119  C C     . MET D 1 230 ? 22.521  1.424   24.269 1.00 34.51 ? 282  MET I C     1 
ATOM   8120  O O     . MET D 1 230 ? 22.235  1.493   23.074 1.00 35.68 ? 282  MET I O     1 
ATOM   8121  C CB    . MET D 1 230 ? 22.577  3.928   24.404 1.00 31.31 ? 282  MET I CB    1 
ATOM   8122  C CG    . MET D 1 230 ? 22.075  5.134   25.154 1.00 30.86 ? 282  MET I CG    1 
ATOM   8123  S SD    . MET D 1 230 ? 22.477  6.645   24.329 1.00 28.84 ? 282  MET I SD    1 
ATOM   8124  C CE    . MET D 1 230 ? 21.194  6.688   23.090 1.00 28.83 ? 282  MET I CE    1 
ATOM   8125  N N     . VAL D 1 231 ? 22.981  0.316   24.841 1.00 36.16 ? 283  VAL I N     1 
ATOM   8126  C CA    . VAL D 1 231 ? 23.139  -0.942  24.116 1.00 36.55 ? 283  VAL I CA    1 
ATOM   8127  C C     . VAL D 1 231 ? 22.634  -2.033  25.020 1.00 38.42 ? 283  VAL I C     1 
ATOM   8128  O O     . VAL D 1 231 ? 22.376  -1.804  26.213 1.00 39.68 ? 283  VAL I O     1 
ATOM   8129  C CB    . VAL D 1 231 ? 24.607  -1.319  23.809 1.00 35.64 ? 283  VAL I CB    1 
ATOM   8130  C CG1   . VAL D 1 231 ? 24.843  -1.300  22.319 1.00 35.00 ? 283  VAL I CG1   1 
ATOM   8131  C CG2   . VAL D 1 231 ? 25.553  -0.405  24.533 1.00 34.90 ? 283  VAL I CG2   1 
ATOM   8132  N N     . ARG D 1 232 ? 22.513  -3.221  24.434 1.00 39.83 ? 284  ARG I N     1 
ATOM   8133  C CA    . ARG D 1 232 ? 22.085  -4.425  25.131 1.00 38.38 ? 284  ARG I CA    1 
ATOM   8134  C C     . ARG D 1 232 ? 22.949  -5.540  24.557 1.00 38.63 ? 284  ARG I C     1 
ATOM   8135  O O     . ARG D 1 232 ? 22.899  -5.827  23.365 1.00 37.20 ? 284  ARG I O     1 
ATOM   8136  C CB    . ARG D 1 232 ? 20.604  -4.701  24.873 1.00 36.21 ? 284  ARG I CB    1 
ATOM   8137  C CG    . ARG D 1 232 ? 19.664  -3.651  25.464 1.00 35.95 ? 284  ARG I CG    1 
ATOM   8138  C CD    . ARG D 1 232 ? 19.769  -3.596  26.991 1.00 35.12 ? 284  ARG I CD    1 
ATOM   8139  N NE    . ARG D 1 232 ? 20.022  -2.241  27.471 1.00 35.24 ? 284  ARG I NE    1 
ATOM   8140  C CZ    . ARG D 1 232 ? 19.114  -1.474  28.061 1.00 34.36 ? 284  ARG I CZ    1 
ATOM   8141  N NH1   . ARG D 1 232 ? 17.893  -1.929  28.254 1.00 34.53 ? 284  ARG I NH1   1 
ATOM   8142  N NH2   . ARG D 1 232 ? 19.423  -0.245  28.445 1.00 37.01 ? 284  ARG I NH2   1 
ATOM   8143  N N     . PRO D 1 233 ? 23.813  -6.130  25.389 1.00 39.47 ? 285  PRO I N     1 
ATOM   8144  C CA    . PRO D 1 233 ? 24.028  -5.817  26.809 1.00 40.79 ? 285  PRO I CA    1 
ATOM   8145  C C     . PRO D 1 233 ? 24.682  -4.435  27.008 1.00 40.28 ? 285  PRO I C     1 
ATOM   8146  O O     . PRO D 1 233 ? 25.395  -3.960  26.121 1.00 41.02 ? 285  PRO I O     1 
ATOM   8147  C CB    . PRO D 1 233 ? 24.941  -6.952  27.265 1.00 40.44 ? 285  PRO I CB    1 
ATOM   8148  C CG    . PRO D 1 233 ? 25.775  -7.196  26.042 1.00 40.90 ? 285  PRO I CG    1 
ATOM   8149  C CD    . PRO D 1 233 ? 24.738  -7.182  24.939 1.00 40.20 ? 285  PRO I CD    1 
ATOM   8150  N N     . GLN D 1 234 ? 24.438  -3.793  28.153 1.00 38.50 ? 286  GLN I N     1 
ATOM   8151  C CA    . GLN D 1 234 ? 25.037  -2.485  28.397 1.00 37.39 ? 286  GLN I CA    1 
ATOM   8152  C C     . GLN D 1 234 ? 26.534  -2.707  28.410 1.00 35.25 ? 286  GLN I C     1 
ATOM   8153  O O     . GLN D 1 234 ? 27.023  -3.681  28.969 1.00 35.49 ? 286  GLN I O     1 
ATOM   8154  C CB    . GLN D 1 234 ? 24.565  -1.890  29.724 1.00 39.80 ? 286  GLN I CB    1 
ATOM   8155  C CG    . GLN D 1 234 ? 23.051  -1.808  29.852 1.00 43.33 ? 286  GLN I CG    1 
ATOM   8156  C CD    . GLN D 1 234 ? 22.605  -1.027  31.075 1.00 43.85 ? 286  GLN I CD    1 
ATOM   8157  O OE1   . GLN D 1 234 ? 22.556  0.199   31.057 1.00 44.85 ? 286  GLN I OE1   1 
ATOM   8158  N NE2   . GLN D 1 234 ? 22.291  -1.739  32.148 1.00 46.41 ? 286  GLN I NE2   1 
ATOM   8159  N N     . LEU D 1 235 ? 27.257  -1.790  27.792 1.00 33.38 ? 287  LEU I N     1 
ATOM   8160  C CA    . LEU D 1 235 ? 28.702  -1.904  27.652 1.00 32.68 ? 287  LEU I CA    1 
ATOM   8161  C C     . LEU D 1 235 ? 29.593  -1.625  28.869 1.00 31.65 ? 287  LEU I C     1 
ATOM   8162  O O     . LEU D 1 235 ? 29.366  -0.678  29.608 1.00 31.63 ? 287  LEU I O     1 
ATOM   8163  C CB    . LEU D 1 235 ? 29.145  -1.000  26.493 1.00 31.14 ? 287  LEU I CB    1 
ATOM   8164  C CG    . LEU D 1 235 ? 30.612  -1.016  26.087 1.00 29.64 ? 287  LEU I CG    1 
ATOM   8165  C CD1   . LEU D 1 235 ? 30.847  -2.232  25.230 1.00 29.59 ? 287  LEU I CD1   1 
ATOM   8166  C CD2   . LEU D 1 235 ? 30.977  0.257   25.333 1.00 29.10 ? 287  LEU I CD2   1 
ATOM   8167  N N     . THR D 1 236 ? 30.604  -2.469  29.069 1.00 31.47 ? 288  THR I N     1 
ATOM   8168  C CA    . THR D 1 236 ? 31.568  -2.257  30.138 1.00 32.18 ? 288  THR I CA    1 
ATOM   8169  C C     . THR D 1 236 ? 32.557  -1.357  29.434 1.00 31.26 ? 288  THR I C     1 
ATOM   8170  O O     . THR D 1 236 ? 33.172  -1.755  28.453 1.00 32.69 ? 288  THR I O     1 
ATOM   8171  C CB    . THR D 1 236 ? 32.325  -3.538  30.560 1.00 32.29 ? 288  THR I CB    1 
ATOM   8172  O OG1   . THR D 1 236 ? 31.420  -4.460  31.177 1.00 34.96 ? 288  THR I OG1   1 
ATOM   8173  C CG2   . THR D 1 236 ? 33.433  -3.190  31.557 1.00 31.09 ? 288  THR I CG2   1 
ATOM   8174  N N     . SER D 1 237 ? 32.704  -0.137  29.904 1.00 30.04 ? 289  SER I N     1 
ATOM   8175  C CA    . SER D 1 237 ? 33.615  0.759   29.242 1.00 29.59 ? 289  SER I CA    1 
ATOM   8176  C C     . SER D 1 237 ? 34.595  1.331   30.244 1.00 30.76 ? 289  SER I C     1 
ATOM   8177  O O     . SER D 1 237 ? 34.339  1.335   31.454 1.00 31.67 ? 289  SER I O     1 
ATOM   8178  C CB    . SER D 1 237 ? 32.813  1.875   28.560 1.00 28.37 ? 289  SER I CB    1 
ATOM   8179  O OG    . SER D 1 237 ? 33.663  2.884   28.041 1.00 29.03 ? 289  SER I OG    1 
ATOM   8180  N N     . VAL D 1 238 ? 35.731  1.788   29.738 1.00 30.21 ? 290  VAL I N     1 
ATOM   8181  C CA    . VAL D 1 238 ? 36.747  2.398   30.574 1.00 29.72 ? 290  VAL I CA    1 
ATOM   8182  C C     . VAL D 1 238 ? 36.304  3.835   30.797 1.00 30.23 ? 290  VAL I C     1 
ATOM   8183  O O     . VAL D 1 238 ? 36.070  4.566   29.846 1.00 31.34 ? 290  VAL I O     1 
ATOM   8184  C CB    . VAL D 1 238 ? 38.094  2.371   29.871 1.00 29.45 ? 290  VAL I CB    1 
ATOM   8185  C CG1   . VAL D 1 238 ? 39.093  3.242   30.601 1.00 26.67 ? 290  VAL I CG1   1 
ATOM   8186  C CG2   . VAL D 1 238 ? 38.570  0.940   29.791 1.00 29.07 ? 290  VAL I CG2   1 
ATOM   8187  N N     . VAL D 1 239 ? 36.181  4.222   32.061 1.00 30.57 ? 291  VAL I N     1 
ATOM   8188  C CA    . VAL D 1 239 ? 35.733  5.554   32.441 1.00 29.85 ? 291  VAL I CA    1 
ATOM   8189  C C     . VAL D 1 239 ? 36.746  6.667   32.243 1.00 31.26 ? 291  VAL I C     1 
ATOM   8190  O O     . VAL D 1 239 ? 37.875  6.606   32.720 1.00 31.72 ? 291  VAL I O     1 
ATOM   8191  C CB    . VAL D 1 239 ? 35.324  5.613   33.936 1.00 29.35 ? 291  VAL I CB    1 
ATOM   8192  C CG1   . VAL D 1 239 ? 34.976  7.039   34.309 1.00 27.95 ? 291  VAL I CG1   1 
ATOM   8193  C CG2   . VAL D 1 239 ? 34.160  4.683   34.222 1.00 27.39 ? 291  VAL I CG2   1 
ATOM   8194  N N     . GLN D 1 240 ? 36.329  7.697   31.533 1.00 32.70 ? 292  GLN I N     1 
ATOM   8195  C CA    . GLN D 1 240 ? 37.173  8.860   31.335 1.00 33.04 ? 292  GLN I CA    1 
ATOM   8196  C C     . GLN D 1 240 ? 36.239  9.877   31.952 1.00 33.38 ? 292  GLN I C     1 
ATOM   8197  O O     . GLN D 1 240 ? 35.146  10.115  31.434 1.00 33.00 ? 292  GLN I O     1 
ATOM   8198  C CB    . GLN D 1 240 ? 37.379  9.113   29.858 1.00 32.99 ? 292  GLN I CB    1 
ATOM   8199  C CG    . GLN D 1 240 ? 38.596  9.908   29.555 1.00 33.90 ? 292  GLN I CG    1 
ATOM   8200  C CD    . GLN D 1 240 ? 38.940  9.853   28.094 1.00 34.31 ? 292  GLN I CD    1 
ATOM   8201  O OE1   . GLN D 1 240 ? 39.766  10.615  27.615 1.00 38.14 ? 292  GLN I OE1   1 
ATOM   8202  N NE2   . GLN D 1 240 ? 38.313  8.940   27.377 1.00 34.37 ? 292  GLN I NE2   1 
ATOM   8203  N N     . PRO D 1 241 ? 36.622  10.434  33.112 1.00 34.18 ? 293  PRO I N     1 
ATOM   8204  C CA    . PRO D 1 241 ? 35.834  11.423  33.855 1.00 35.08 ? 293  PRO I CA    1 
ATOM   8205  C C     . PRO D 1 241 ? 35.696  12.747  33.127 1.00 35.37 ? 293  PRO I C     1 
ATOM   8206  O O     . PRO D 1 241 ? 36.297  13.743  33.521 1.00 36.53 ? 293  PRO I O     1 
ATOM   8207  C CB    . PRO D 1 241 ? 36.604  11.545  35.157 1.00 34.29 ? 293  PRO I CB    1 
ATOM   8208  C CG    . PRO D 1 241 ? 38.016  11.403  34.703 1.00 32.45 ? 293  PRO I CG    1 
ATOM   8209  C CD    . PRO D 1 241 ? 37.928  10.228  33.759 1.00 33.89 ? 293  PRO I CD    1 
ATOM   8210  N N     . MET D 1 242 ? 34.876  12.746  32.079 1.00 35.63 ? 294  MET I N     1 
ATOM   8211  C CA    . MET D 1 242 ? 34.662  13.918  31.245 1.00 35.56 ? 294  MET I CA    1 
ATOM   8212  C C     . MET D 1 242 ? 34.398  15.193  32.012 1.00 33.93 ? 294  MET I C     1 
ATOM   8213  O O     . MET D 1 242 ? 34.911  16.244  31.658 1.00 32.17 ? 294  MET I O     1 
ATOM   8214  C CB    . MET D 1 242 ? 33.553  13.635  30.231 1.00 38.23 ? 294  MET I CB    1 
ATOM   8215  C CG    . MET D 1 242 ? 33.995  12.586  29.196 1.00 42.49 ? 294  MET I CG    1 
ATOM   8216  S SD    . MET D 1 242 ? 32.720  11.915  28.087 1.00 47.88 ? 294  MET I SD    1 
ATOM   8217  C CE    . MET D 1 242 ? 31.887  10.726  29.149 1.00 46.29 ? 294  MET I CE    1 
ATOM   8218  N N     . TYR D 1 243 ? 33.633  15.108  33.086 1.00 34.54 ? 295  TYR I N     1 
ATOM   8219  C CA    . TYR D 1 243 ? 33.367  16.305  33.856 1.00 34.78 ? 295  TYR I CA    1 
ATOM   8220  C C     . TYR D 1 243 ? 34.619  16.797  34.567 1.00 34.38 ? 295  TYR I C     1 
ATOM   8221  O O     . TYR D 1 243 ? 34.962  17.978  34.473 1.00 33.93 ? 295  TYR I O     1 
ATOM   8222  C CB    . TYR D 1 243 ? 32.262  16.059  34.860 1.00 35.81 ? 295  TYR I CB    1 
ATOM   8223  C CG    . TYR D 1 243 ? 31.869  17.315  35.566 1.00 39.68 ? 295  TYR I CG    1 
ATOM   8224  C CD1   . TYR D 1 243 ? 32.425  17.644  36.807 1.00 41.73 ? 295  TYR I CD1   1 
ATOM   8225  C CD2   . TYR D 1 243 ? 30.947  18.197  34.992 1.00 41.44 ? 295  TYR I CD2   1 
ATOM   8226  C CE1   . TYR D 1 243 ? 32.069  18.824  37.465 1.00 44.26 ? 295  TYR I CE1   1 
ATOM   8227  C CE2   . TYR D 1 243 ? 30.582  19.379  35.635 1.00 43.79 ? 295  TYR I CE2   1 
ATOM   8228  C CZ    . TYR D 1 243 ? 31.146  19.688  36.873 1.00 44.45 ? 295  TYR I CZ    1 
ATOM   8229  O OH    . TYR D 1 243 ? 30.791  20.854  37.515 1.00 44.60 ? 295  TYR I OH    1 
ATOM   8230  N N     . ASP D 1 244 ? 35.307  15.901  35.272 1.00 34.32 ? 296  ASP I N     1 
ATOM   8231  C CA    . ASP D 1 244 ? 36.530  16.285  35.975 1.00 34.67 ? 296  ASP I CA    1 
ATOM   8232  C C     . ASP D 1 244 ? 37.516  16.933  34.988 1.00 34.04 ? 296  ASP I C     1 
ATOM   8233  O O     . ASP D 1 244 ? 38.169  17.931  35.316 1.00 33.24 ? 296  ASP I O     1 
ATOM   8234  C CB    . ASP D 1 244 ? 37.195  15.066  36.636 1.00 36.26 ? 296  ASP I CB    1 
ATOM   8235  C CG    . ASP D 1 244 ? 36.322  14.414  37.712 1.00 36.89 ? 296  ASP I CG    1 
ATOM   8236  O OD1   . ASP D 1 244 ? 36.817  13.498  38.404 1.00 35.61 ? 296  ASP I OD1   1 
ATOM   8237  O OD2   . ASP D 1 244 ? 35.148  14.802  37.867 1.00 36.70 ? 296  ASP I OD2   1 
ATOM   8238  N N     . ILE D 1 245 ? 37.612  16.365  33.781 1.00 32.27 ? 297  ILE I N     1 
ATOM   8239  C CA    . ILE D 1 245 ? 38.509  16.891  32.752 1.00 30.57 ? 297  ILE I CA    1 
ATOM   8240  C C     . ILE D 1 245 ? 38.160  18.315  32.335 1.00 30.57 ? 297  ILE I C     1 
ATOM   8241  O O     . ILE D 1 245 ? 39.039  19.162  32.250 1.00 30.18 ? 297  ILE I O     1 
ATOM   8242  C CB    . ILE D 1 245 ? 38.533  16.006  31.497 1.00 29.79 ? 297  ILE I CB    1 
ATOM   8243  C CG1   . ILE D 1 245 ? 39.130  14.640  31.836 1.00 29.80 ? 297  ILE I CG1   1 
ATOM   8244  C CG2   . ILE D 1 245 ? 39.393  16.665  30.437 1.00 27.32 ? 297  ILE I CG2   1 
ATOM   8245  C CD1   . ILE D 1 245 ? 39.309  13.735  30.659 1.00 36.87 ? 297  ILE I CD1   1 
ATOM   8246  N N     . GLY D 1 246 ? 36.888  18.582  32.059 1.00 30.47 ? 298  GLY I N     1 
ATOM   8247  C CA    . GLY D 1 246 ? 36.503  19.935  31.707 1.00 30.54 ? 298  GLY I CA    1 
ATOM   8248  C C     . GLY D 1 246 ? 36.829  20.823  32.903 1.00 31.66 ? 298  GLY I C     1 
ATOM   8249  O O     . GLY D 1 246 ? 37.492  21.862  32.770 1.00 31.72 ? 298  GLY I O     1 
ATOM   8250  N N     . ALA D 1 247 ? 36.373  20.393  34.082 1.00 29.91 ? 299  ALA I N     1 
ATOM   8251  C CA    . ALA D 1 247 ? 36.612  21.110  35.334 1.00 28.78 ? 299  ALA I CA    1 
ATOM   8252  C C     . ALA D 1 247 ? 38.068  21.530  35.507 1.00 28.15 ? 299  ALA I C     1 
ATOM   8253  O O     . ALA D 1 247 ? 38.374  22.704  35.719 1.00 28.72 ? 299  ALA I O     1 
ATOM   8254  C CB    . ALA D 1 247 ? 36.209  20.241  36.500 1.00 27.70 ? 299  ALA I CB    1 
ATOM   8255  N N     . VAL D 1 248 ? 38.961  20.557  35.420 1.00 27.53 ? 300  VAL I N     1 
ATOM   8256  C CA    . VAL D 1 248 ? 40.386  20.808  35.581 1.00 28.34 ? 300  VAL I CA    1 
ATOM   8257  C C     . VAL D 1 248 ? 40.993  21.620  34.433 1.00 29.53 ? 300  VAL I C     1 
ATOM   8258  O O     . VAL D 1 248 ? 41.938  22.383  34.633 1.00 29.69 ? 300  VAL I O     1 
ATOM   8259  C CB    . VAL D 1 248 ? 41.169  19.468  35.719 1.00 27.08 ? 300  VAL I CB    1 
ATOM   8260  C CG1   . VAL D 1 248 ? 42.663  19.746  35.798 1.00 25.47 ? 300  VAL I CG1   1 
ATOM   8261  C CG2   . VAL D 1 248 ? 40.694  18.701  36.956 1.00 23.63 ? 300  VAL I CG2   1 
ATOM   8262  N N     . ALA D 1 249 ? 40.467  21.453  33.229 1.00 30.07 ? 301  ALA I N     1 
ATOM   8263  C CA    . ALA D 1 249 ? 41.002  22.192  32.107 1.00 31.95 ? 301  ALA I CA    1 
ATOM   8264  C C     . ALA D 1 249 ? 40.618  23.670  32.233 1.00 34.16 ? 301  ALA I C     1 
ATOM   8265  O O     . ALA D 1 249 ? 41.425  24.551  31.930 1.00 33.78 ? 301  ALA I O     1 
ATOM   8266  C CB    . ALA D 1 249 ? 40.484  21.603  30.792 1.00 32.98 ? 301  ALA I CB    1 
ATOM   8267  N N     . MET D 1 250 ? 39.389  23.942  32.672 1.00 35.95 ? 302  MET I N     1 
ATOM   8268  C CA    . MET D 1 250 ? 38.945  25.323  32.840 1.00 38.98 ? 302  MET I CA    1 
ATOM   8269  C C     . MET D 1 250 ? 39.769  25.961  33.937 1.00 41.08 ? 302  MET I C     1 
ATOM   8270  O O     . MET D 1 250 ? 40.254  27.085  33.774 1.00 42.61 ? 302  MET I O     1 
ATOM   8271  C CB    . MET D 1 250 ? 37.467  25.400  33.234 1.00 40.45 ? 302  MET I CB    1 
ATOM   8272  C CG    . MET D 1 250 ? 36.473  25.330  32.078 1.00 41.89 ? 302  MET I CG    1 
ATOM   8273  S SD    . MET D 1 250 ? 36.199  26.897  31.260 1.00 36.61 ? 302  MET I SD    1 
ATOM   8274  C CE    . MET D 1 250 ? 37.587  26.988  30.309 1.00 42.17 ? 302  MET I CE    1 
ATOM   8275  N N     . ARG D 1 251 ? 39.912  25.242  35.053 1.00 41.66 ? 303  ARG I N     1 
ATOM   8276  C CA    . ARG D 1 251 ? 40.685  25.726  36.197 1.00 42.63 ? 303  ARG I CA    1 
ATOM   8277  C C     . ARG D 1 251 ? 42.059  26.091  35.663 1.00 40.99 ? 303  ARG I C     1 
ATOM   8278  O O     . ARG D 1 251 ? 42.550  27.206  35.864 1.00 41.96 ? 303  ARG I O     1 
ATOM   8279  C CB    . ARG D 1 251 ? 40.812  24.626  37.264 1.00 46.17 ? 303  ARG I CB    1 
ATOM   8280  C CG    . ARG D 1 251 ? 41.523  25.007  38.574 1.00 48.94 ? 303  ARG I CG    1 
ATOM   8281  C CD    . ARG D 1 251 ? 42.146  23.745  39.188 1.00 52.58 ? 303  ARG I CD    1 
ATOM   8282  N NE    . ARG D 1 251 ? 42.794  23.931  40.490 1.00 56.47 ? 303  ARG I NE    1 
ATOM   8283  C CZ    . ARG D 1 251 ? 43.745  24.826  40.744 1.00 57.30 ? 303  ARG I CZ    1 
ATOM   8284  N NH1   . ARG D 1 251 ? 44.160  25.635  39.784 1.00 60.40 ? 303  ARG I NH1   1 
ATOM   8285  N NH2   . ARG D 1 251 ? 44.301  24.899  41.949 1.00 56.54 ? 303  ARG I NH2   1 
ATOM   8286  N N     . LEU D 1 252 ? 42.668  25.148  34.960 1.00 37.82 ? 304  LEU I N     1 
ATOM   8287  C CA    . LEU D 1 252 ? 43.980  25.373  34.391 1.00 36.37 ? 304  LEU I CA    1 
ATOM   8288  C C     . LEU D 1 252 ? 43.945  26.617  33.488 1.00 36.57 ? 304  LEU I C     1 
ATOM   8289  O O     . LEU D 1 252 ? 44.792  27.503  33.612 1.00 37.27 ? 304  LEU I O     1 
ATOM   8290  C CB    . LEU D 1 252 ? 44.410  24.145  33.591 1.00 34.35 ? 304  LEU I CB    1 
ATOM   8291  C CG    . LEU D 1 252 ? 45.804  23.574  33.837 1.00 31.97 ? 304  LEU I CG    1 
ATOM   8292  C CD1   . LEU D 1 252 ? 45.908  22.962  35.201 1.00 28.64 ? 304  LEU I CD1   1 
ATOM   8293  C CD2   . LEU D 1 252 ? 46.075  22.528  32.791 1.00 31.32 ? 304  LEU I CD2   1 
ATOM   8294  N N     . LEU D 1 253 ? 42.958  26.692  32.597 1.00 35.01 ? 305  LEU I N     1 
ATOM   8295  C CA    . LEU D 1 253 ? 42.845  27.826  31.689 1.00 33.90 ? 305  LEU I CA    1 
ATOM   8296  C C     . LEU D 1 253 ? 42.642  29.149  32.417 1.00 34.68 ? 305  LEU I C     1 
ATOM   8297  O O     . LEU D 1 253 ? 43.216  30.180  32.042 1.00 33.56 ? 305  LEU I O     1 
ATOM   8298  C CB    . LEU D 1 253 ? 41.691  27.621  30.714 1.00 32.94 ? 305  LEU I CB    1 
ATOM   8299  C CG    . LEU D 1 253 ? 41.564  28.699  29.630 1.00 30.57 ? 305  LEU I CG    1 
ATOM   8300  C CD1   . LEU D 1 253 ? 42.765  28.617  28.704 1.00 28.58 ? 305  LEU I CD1   1 
ATOM   8301  C CD2   . LEU D 1 253 ? 40.281  28.506  28.845 1.00 27.87 ? 305  LEU I CD2   1 
ATOM   8302  N N     . THR D 1 254 ? 41.818  29.142  33.454 1.00 34.81 ? 306  THR I N     1 
ATOM   8303  C CA    . THR D 1 254 ? 41.600  30.382  34.175 1.00 34.05 ? 306  THR I CA    1 
ATOM   8304  C C     . THR D 1 254 ? 42.919  30.892  34.744 1.00 34.63 ? 306  THR I C     1 
ATOM   8305  O O     . THR D 1 254 ? 43.212  32.081  34.676 1.00 34.03 ? 306  THR I O     1 
ATOM   8306  C CB    . THR D 1 254 ? 40.584  30.209  35.301 1.00 32.46 ? 306  THR I CB    1 
ATOM   8307  O OG1   . THR D 1 254 ? 39.313  29.870  34.741 1.00 31.63 ? 306  THR I OG1   1 
ATOM   8308  C CG2   . THR D 1 254 ? 40.433  31.501  36.076 1.00 32.90 ? 306  THR I CG2   1 
ATOM   8309  N N     . LYS D 1 255 ? 43.733  30.000  35.287 1.00 35.50 ? 307  LYS I N     1 
ATOM   8310  C CA    . LYS D 1 255 ? 44.992  30.456  35.839 1.00 37.51 ? 307  LYS I CA    1 
ATOM   8311  C C     . LYS D 1 255 ? 45.837  31.138  34.770 1.00 37.96 ? 307  LYS I C     1 
ATOM   8312  O O     . LYS D 1 255 ? 46.416  32.185  35.024 1.00 37.87 ? 307  LYS I O     1 
ATOM   8313  C CB    . LYS D 1 255 ? 45.752  29.296  36.490 1.00 38.77 ? 307  LYS I CB    1 
ATOM   8314  C CG    . LYS D 1 255 ? 45.035  28.713  37.709 1.00 40.02 ? 307  LYS I CG    1 
ATOM   8315  C CD    . LYS D 1 255 ? 45.926  27.781  38.516 1.00 42.26 ? 307  LYS I CD    1 
ATOM   8316  C CE    . LYS D 1 255 ? 46.869  28.551  39.452 1.00 44.87 ? 307  LYS I CE    1 
ATOM   8317  N NZ    . LYS D 1 255 ? 47.741  27.653  40.297 1.00 44.81 ? 307  LYS I NZ    1 
ATOM   8318  N N     . TYR D 1 256 ? 45.887  30.568  33.569 1.00 40.38 ? 308  TYR I N     1 
ATOM   8319  C CA    . TYR D 1 256 ? 46.672  31.167  32.482 1.00 41.10 ? 308  TYR I CA    1 
ATOM   8320  C C     . TYR D 1 256 ? 46.073  32.468  31.974 1.00 42.42 ? 308  TYR I C     1 
ATOM   8321  O O     . TYR D 1 256 ? 46.798  33.374  31.560 1.00 43.49 ? 308  TYR I O     1 
ATOM   8322  C CB    . TYR D 1 256 ? 46.821  30.204  31.315 1.00 39.65 ? 308  TYR I CB    1 
ATOM   8323  C CG    . TYR D 1 256 ? 47.647  29.000  31.644 1.00 38.67 ? 308  TYR I CG    1 
ATOM   8324  C CD1   . TYR D 1 256 ? 47.050  27.761  31.839 1.00 38.99 ? 308  TYR I CD1   1 
ATOM   8325  C CD2   . TYR D 1 256 ? 49.031  29.094  31.757 1.00 38.61 ? 308  TYR I CD2   1 
ATOM   8326  C CE1   . TYR D 1 256 ? 47.810  26.634  32.138 1.00 40.26 ? 308  TYR I CE1   1 
ATOM   8327  C CE2   . TYR D 1 256 ? 49.808  27.968  32.058 1.00 39.01 ? 308  TYR I CE2   1 
ATOM   8328  C CZ    . TYR D 1 256 ? 49.187  26.744  32.245 1.00 38.76 ? 308  TYR I CZ    1 
ATOM   8329  O OH    . TYR D 1 256 ? 49.921  25.623  32.532 1.00 39.52 ? 308  TYR I OH    1 
ATOM   8330  N N     . MET D 1 257 ? 44.749  32.556  31.987 1.00 43.49 ? 309  MET I N     1 
ATOM   8331  C CA    . MET D 1 257 ? 44.092  33.776  31.562 1.00 44.32 ? 309  MET I CA    1 
ATOM   8332  C C     . MET D 1 257 ? 44.256  34.772  32.702 1.00 46.51 ? 309  MET I C     1 
ATOM   8333  O O     . MET D 1 257 ? 43.687  35.862  32.671 1.00 46.22 ? 309  MET I O     1 
ATOM   8334  C CB    . MET D 1 257 ? 42.605  33.541  31.336 1.00 43.66 ? 309  MET I CB    1 
ATOM   8335  C CG    . MET D 1 257 ? 42.262  32.608  30.209 1.00 43.78 ? 309  MET I CG    1 
ATOM   8336  S SD    . MET D 1 257 ? 40.509  32.759  29.846 1.00 42.51 ? 309  MET I SD    1 
ATOM   8337  C CE    . MET D 1 257 ? 39.839  31.509  30.894 1.00 46.09 ? 309  MET I CE    1 
ATOM   8338  N N     . ASN D 1 258 ? 45.029  34.392  33.716 1.00 48.69 ? 310  ASN I N     1 
ATOM   8339  C CA    . ASN D 1 258 ? 45.232  35.251  34.873 1.00 50.88 ? 310  ASN I CA    1 
ATOM   8340  C C     . ASN D 1 258 ? 46.666  35.354  35.340 1.00 52.17 ? 310  ASN I C     1 
ATOM   8341  O O     . ASN D 1 258 ? 46.936  35.792  36.455 1.00 52.76 ? 310  ASN I O     1 
ATOM   8342  C CB    . ASN D 1 258 ? 44.349  34.781  36.030 1.00 51.14 ? 310  ASN I CB    1 
ATOM   8343  C CG    . ASN D 1 258 ? 42.928  35.284  35.910 1.00 52.36 ? 310  ASN I CG    1 
ATOM   8344  O OD1   . ASN D 1 258 ? 41.999  34.718  36.485 1.00 54.21 ? 310  ASN I OD1   1 
ATOM   8345  N ND2   . ASN D 1 258 ? 42.753  36.367  35.169 1.00 52.83 ? 310  ASN I ND2   1 
ATOM   8346  N N     . LYS D 1 259 ? 47.593  34.943  34.496 1.00 54.37 ? 311  LYS I N     1 
ATOM   8347  C CA    . LYS D 1 259 ? 48.989  35.039  34.868 1.00 57.07 ? 311  LYS I CA    1 
ATOM   8348  C C     . LYS D 1 259 ? 49.267  34.523  36.282 1.00 58.08 ? 311  LYS I C     1 
ATOM   8349  O O     . LYS D 1 259 ? 50.050  35.114  37.025 1.00 57.93 ? 311  LYS I O     1 
ATOM   8350  C CB    . LYS D 1 259 ? 49.429  36.495  34.757 1.00 58.31 ? 311  LYS I CB    1 
ATOM   8351  C CG    . LYS D 1 259 ? 49.283  37.067  33.361 1.00 60.50 ? 311  LYS I CG    1 
ATOM   8352  C CD    . LYS D 1 259 ? 49.206  38.593  33.386 1.00 62.80 ? 311  LYS I CD    1 
ATOM   8353  C CE    . LYS D 1 259 ? 47.883  39.095  33.980 1.00 62.91 ? 311  LYS I CE    1 
ATOM   8354  N NZ    . LYS D 1 259 ? 46.693  38.660  33.190 1.00 61.33 ? 311  LYS I NZ    1 
ATOM   8355  N N     . GLU D 1 260 ? 48.604  33.437  36.662 1.00 59.08 ? 312  GLU I N     1 
ATOM   8356  C CA    . GLU D 1 260 ? 48.834  32.833  37.967 1.00 60.56 ? 312  GLU I CA    1 
ATOM   8357  C C     . GLU D 1 260 ? 49.684  31.599  37.685 1.00 60.93 ? 312  GLU I C     1 
ATOM   8358  O O     . GLU D 1 260 ? 49.375  30.834  36.781 1.00 61.41 ? 312  GLU I O     1 
ATOM   8359  C CB    . GLU D 1 260 ? 47.511  32.431  38.621 1.00 60.68 ? 312  GLU I CB    1 
ATOM   8360  C CG    . GLU D 1 260 ? 46.687  33.601  39.121 1.00 62.77 ? 312  GLU I CG    1 
ATOM   8361  C CD    . GLU D 1 260 ? 45.410  33.159  39.812 1.00 64.71 ? 312  GLU I CD    1 
ATOM   8362  O OE1   . GLU D 1 260 ? 45.490  32.338  40.752 1.00 65.47 ? 312  GLU I OE1   1 
ATOM   8363  O OE2   . GLU D 1 260 ? 44.323  33.635  39.416 1.00 66.71 ? 312  GLU I OE2   1 
ATOM   8364  N N     . THR D 1 261 ? 50.762  31.406  38.433 1.00 61.86 ? 313  THR I N     1 
ATOM   8365  C CA    . THR D 1 261 ? 51.618  30.252  38.192 1.00 63.05 ? 313  THR I CA    1 
ATOM   8366  C C     . THR D 1 261 ? 50.840  28.950  38.257 1.00 63.11 ? 313  THR I C     1 
ATOM   8367  O O     . THR D 1 261 ? 49.717  28.918  38.750 1.00 63.82 ? 313  THR I O     1 
ATOM   8368  C CB    . THR D 1 261 ? 52.790  30.197  39.188 1.00 63.83 ? 313  THR I CB    1 
ATOM   8369  O OG1   . THR D 1 261 ? 52.366  30.705  40.462 1.00 65.39 ? 313  THR I OG1   1 
ATOM   8370  C CG2   . THR D 1 261 ? 53.967  31.012  38.661 1.00 62.94 ? 313  THR I CG2   1 
ATOM   8371  N N     . VAL D 1 262 ? 51.447  27.877  37.760 1.00 63.38 ? 314  VAL I N     1 
ATOM   8372  C CA    . VAL D 1 262 ? 50.801  26.568  37.730 1.00 62.77 ? 314  VAL I CA    1 
ATOM   8373  C C     . VAL D 1 262 ? 51.760  25.411  38.021 1.00 63.13 ? 314  VAL I C     1 
ATOM   8374  O O     . VAL D 1 262 ? 52.491  24.959  37.135 1.00 62.05 ? 314  VAL I O     1 
ATOM   8375  C CB    . VAL D 1 262 ? 50.135  26.342  36.347 1.00 61.61 ? 314  VAL I CB    1 
ATOM   8376  C CG1   . VAL D 1 262 ? 49.750  24.890  36.164 1.00 61.22 ? 314  VAL I CG1   1 
ATOM   8377  C CG2   . VAL D 1 262 ? 48.917  27.221  36.222 1.00 60.29 ? 314  VAL I CG2   1 
ATOM   8378  N N     . ASP D 1 263 ? 51.760  24.926  39.260 1.00 64.63 ? 315  ASP I N     1 
ATOM   8379  C CA    . ASP D 1 263 ? 52.635  23.808  39.603 1.00 66.48 ? 315  ASP I CA    1 
ATOM   8380  C C     . ASP D 1 263 ? 51.993  22.460  39.249 1.00 66.92 ? 315  ASP I C     1 
ATOM   8381  O O     . ASP D 1 263 ? 51.985  21.529  40.059 1.00 69.11 ? 315  ASP I O     1 
ATOM   8382  C CB    . ASP D 1 263 ? 53.067  23.843  41.094 1.00 67.21 ? 315  ASP I CB    1 
ATOM   8383  C CG    . ASP D 1 263 ? 51.892  23.907  42.074 1.00 68.88 ? 315  ASP I CG    1 
ATOM   8384  O OD1   . ASP D 1 263 ? 51.222  24.960  42.134 1.00 70.04 ? 315  ASP I OD1   1 
ATOM   8385  O OD2   . ASP D 1 263 ? 51.645  22.910  42.798 1.00 68.28 ? 315  ASP I OD2   1 
ATOM   8386  N N     . SER D 1 264 ? 51.453  22.385  38.029 1.00 65.52 ? 316  SER I N     1 
ATOM   8387  C CA    . SER D 1 264 ? 50.813  21.190  37.456 1.00 63.16 ? 316  SER I CA    1 
ATOM   8388  C C     . SER D 1 264 ? 50.368  21.553  36.052 1.00 61.03 ? 316  SER I C     1 
ATOM   8389  O O     . SER D 1 264 ? 49.207  21.897  35.817 1.00 60.99 ? 316  SER I O     1 
ATOM   8390  C CB    . SER D 1 264 ? 49.581  20.727  38.246 1.00 65.08 ? 316  SER I CB    1 
ATOM   8391  O OG    . SER D 1 264 ? 49.917  20.128  39.489 1.00 66.10 ? 316  SER I OG    1 
ATOM   8392  N N     . SER D 1 265 ? 51.304  21.480  35.119 1.00 58.40 ? 317  SER I N     1 
ATOM   8393  C CA    . SER D 1 265 ? 51.020  21.810  33.737 1.00 55.04 ? 317  SER I CA    1 
ATOM   8394  C C     . SER D 1 265 ? 50.175  20.719  33.092 1.00 52.51 ? 317  SER I C     1 
ATOM   8395  O O     . SER D 1 265 ? 49.050  20.961  32.673 1.00 52.21 ? 317  SER I O     1 
ATOM   8396  C CB    . SER D 1 265 ? 52.330  21.978  32.972 1.00 56.31 ? 317  SER I CB    1 
ATOM   8397  O OG    . SER D 1 265 ? 52.101  22.516  31.681 1.00 57.65 ? 317  SER I OG    1 
ATOM   8398  N N     . ILE D 1 266 ? 50.718  19.513  33.015 1.00 49.19 ? 318  ILE I N     1 
ATOM   8399  C CA    . ILE D 1 266 ? 49.987  18.414  32.417 1.00 46.46 ? 318  ILE I CA    1 
ATOM   8400  C C     . ILE D 1 266 ? 49.482  17.462  33.509 1.00 45.30 ? 318  ILE I C     1 
ATOM   8401  O O     . ILE D 1 266 ? 50.268  16.889  34.261 1.00 44.92 ? 318  ILE I O     1 
ATOM   8402  C CB    . ILE D 1 266 ? 50.882  17.725  31.322 1.00 46.64 ? 318  ILE I CB    1 
ATOM   8403  C CG1   . ILE D 1 266 ? 50.510  16.251  31.133 1.00 46.79 ? 318  ILE I CG1   1 
ATOM   8404  C CG2   . ILE D 1 266 ? 52.344  17.959  31.631 1.00 46.45 ? 318  ILE I CG2   1 
ATOM   8405  C CD1   . ILE D 1 266 ? 51.178  15.286  32.102 1.00 45.87 ? 318  ILE I CD1   1 
ATOM   8406  N N     . VAL D 1 267 ? 48.152  17.326  33.585 1.00 43.68 ? 319  VAL I N     1 
ATOM   8407  C CA    . VAL D 1 267 ? 47.449  16.499  34.586 1.00 40.52 ? 319  VAL I CA    1 
ATOM   8408  C C     . VAL D 1 267 ? 46.861  15.167  34.100 1.00 39.56 ? 319  VAL I C     1 
ATOM   8409  O O     . VAL D 1 267 ? 46.278  15.099  33.025 1.00 39.83 ? 319  VAL I O     1 
ATOM   8410  C CB    . VAL D 1 267 ? 46.286  17.300  35.195 1.00 39.40 ? 319  VAL I CB    1 
ATOM   8411  C CG1   . VAL D 1 267 ? 45.540  16.461  36.207 1.00 38.37 ? 319  VAL I CG1   1 
ATOM   8412  C CG2   . VAL D 1 267 ? 46.816  18.573  35.827 1.00 40.08 ? 319  VAL I CG2   1 
ATOM   8413  N N     . GLN D 1 268 ? 46.992  14.118  34.908 1.00 38.21 ? 320  GLN I N     1 
ATOM   8414  C CA    . GLN D 1 268 ? 46.445  12.810  34.551 1.00 37.71 ? 320  GLN I CA    1 
ATOM   8415  C C     . GLN D 1 268 ? 45.446  12.311  35.586 1.00 36.99 ? 320  GLN I C     1 
ATOM   8416  O O     . GLN D 1 268 ? 45.826  11.692  36.576 1.00 37.06 ? 320  GLN I O     1 
ATOM   8417  C CB    . GLN D 1 268 ? 47.549  11.776  34.436 1.00 39.25 ? 320  GLN I CB    1 
ATOM   8418  C CG    . GLN D 1 268 ? 48.616  12.124  33.445 1.00 43.92 ? 320  GLN I CG    1 
ATOM   8419  C CD    . GLN D 1 268 ? 49.655  11.030  33.332 1.00 44.38 ? 320  GLN I CD    1 
ATOM   8420  O OE1   . GLN D 1 268 ? 49.321  9.889   33.002 1.00 42.84 ? 320  GLN I OE1   1 
ATOM   8421  N NE2   . GLN D 1 268 ? 50.924  11.370  33.610 1.00 44.70 ? 320  GLN I NE2   1 
ATOM   8422  N N     . LEU D 1 269 ? 44.165  12.556  35.346 1.00 35.33 ? 321  LEU I N     1 
ATOM   8423  C CA    . LEU D 1 269 ? 43.135  12.129  36.275 1.00 33.86 ? 321  LEU I CA    1 
ATOM   8424  C C     . LEU D 1 269 ? 42.965  10.617  36.328 1.00 33.56 ? 321  LEU I C     1 
ATOM   8425  O O     . LEU D 1 269 ? 43.242  9.904   35.367 1.00 34.69 ? 321  LEU I O     1 
ATOM   8426  C CB    . LEU D 1 269 ? 41.813  12.784  35.899 1.00 33.28 ? 321  LEU I CB    1 
ATOM   8427  C CG    . LEU D 1 269 ? 41.877  14.313  35.926 1.00 34.42 ? 321  LEU I CG    1 
ATOM   8428  C CD1   . LEU D 1 269 ? 40.698  14.907  35.174 1.00 33.65 ? 321  LEU I CD1   1 
ATOM   8429  C CD2   . LEU D 1 269 ? 41.917  14.789  37.383 1.00 34.72 ? 321  LEU I CD2   1 
ATOM   8430  N N     . PRO D 1 270 ? 42.527  10.109  37.478 1.00 32.83 ? 322  PRO I N     1 
ATOM   8431  C CA    . PRO D 1 270 ? 42.292  8.684   37.721 1.00 32.56 ? 322  PRO I CA    1 
ATOM   8432  C C     . PRO D 1 270 ? 41.232  8.146   36.783 1.00 32.37 ? 322  PRO I C     1 
ATOM   8433  O O     . PRO D 1 270 ? 40.310  8.857   36.402 1.00 32.56 ? 322  PRO I O     1 
ATOM   8434  C CB    . PRO D 1 270 ? 41.776  8.657   39.151 1.00 32.36 ? 322  PRO I CB    1 
ATOM   8435  C CG    . PRO D 1 270 ? 42.443  9.834   39.774 1.00 33.90 ? 322  PRO I CG    1 
ATOM   8436  C CD    . PRO D 1 270 ? 42.389  10.892  38.716 1.00 32.50 ? 322  PRO I CD    1 
ATOM   8437  N N     . HIS D 1 271 ? 41.353  6.882   36.421 1.00 32.85 ? 323  HIS I N     1 
ATOM   8438  C CA    . HIS D 1 271 ? 40.348  6.266   35.572 1.00 32.72 ? 323  HIS I CA    1 
ATOM   8439  C C     . HIS D 1 271 ? 39.835  5.046   36.305 1.00 32.05 ? 323  HIS I C     1 
ATOM   8440  O O     . HIS D 1 271 ? 40.349  4.677   37.354 1.00 31.19 ? 323  HIS I O     1 
ATOM   8441  C CB    . HIS D 1 271 ? 40.933  5.839   34.232 1.00 32.47 ? 323  HIS I CB    1 
ATOM   8442  C CG    . HIS D 1 271 ? 42.025  4.828   34.353 1.00 32.40 ? 323  HIS I CG    1 
ATOM   8443  N ND1   . HIS D 1 271 ? 43.337  5.176   34.589 1.00 33.27 ? 323  HIS I ND1   1 
ATOM   8444  C CD2   . HIS D 1 271 ? 41.995  3.477   34.292 1.00 31.22 ? 323  HIS I CD2   1 
ATOM   8445  C CE1   . HIS D 1 271 ? 44.070  4.080   34.664 1.00 32.31 ? 323  HIS I CE1   1 
ATOM   8446  N NE2   . HIS D 1 271 ? 43.279  3.037   34.488 1.00 31.78 ? 323  HIS I NE2   1 
ATOM   8447  N N     . ARG D 1 272 ? 38.827  4.411   35.740 1.00 32.85 ? 324  ARG I N     1 
ATOM   8448  C CA    . ARG D 1 272 ? 38.247  3.236   36.360 1.00 33.81 ? 324  ARG I CA    1 
ATOM   8449  C C     . ARG D 1 272 ? 37.475  2.485   35.290 1.00 33.84 ? 324  ARG I C     1 
ATOM   8450  O O     . ARG D 1 272 ? 37.163  3.037   34.238 1.00 34.61 ? 324  ARG I O     1 
ATOM   8451  C CB    . ARG D 1 272 ? 37.319  3.684   37.491 1.00 32.38 ? 324  ARG I CB    1 
ATOM   8452  C CG    . ARG D 1 272 ? 35.980  3.004   37.525 1.00 35.58 ? 324  ARG I CG    1 
ATOM   8453  C CD    . ARG D 1 272 ? 35.025  3.739   38.449 1.00 35.96 ? 324  ARG I CD    1 
ATOM   8454  N NE    . ARG D 1 272 ? 34.971  5.176   38.167 1.00 34.51 ? 324  ARG I NE    1 
ATOM   8455  C CZ    . ARG D 1 272 ? 33.868  5.824   37.796 1.00 33.59 ? 324  ARG I CZ    1 
ATOM   8456  N NH1   . ARG D 1 272 ? 32.722  5.166   37.657 1.00 30.45 ? 324  ARG I NH1   1 
ATOM   8457  N NH2   . ARG D 1 272 ? 33.914  7.130   37.569 1.00 32.28 ? 324  ARG I NH2   1 
ATOM   8458  N N     . ILE D 1 273 ? 37.202  1.213   35.517 1.00 33.33 ? 325  ILE I N     1 
ATOM   8459  C CA    . ILE D 1 273 ? 36.410  0.503   34.537 1.00 33.79 ? 325  ILE I CA    1 
ATOM   8460  C C     . ILE D 1 273 ? 35.022  0.402   35.159 1.00 34.59 ? 325  ILE I C     1 
ATOM   8461  O O     . ILE D 1 273 ? 34.863  -0.019  36.310 1.00 35.91 ? 325  ILE I O     1 
ATOM   8462  C CB    . ILE D 1 273 ? 36.926  -0.945  34.235 1.00 34.18 ? 325  ILE I CB    1 
ATOM   8463  C CG1   . ILE D 1 273 ? 38.242  -0.926  33.435 1.00 32.55 ? 325  ILE I CG1   1 
ATOM   8464  C CG2   . ILE D 1 273 ? 35.858  -1.703  33.445 1.00 33.38 ? 325  ILE I CG2   1 
ATOM   8465  C CD1   . ILE D 1 273 ? 39.483  -0.782  34.272 1.00 39.24 ? 325  ILE I CD1   1 
ATOM   8466  N N     . GLU D 1 274 ? 34.020  0.838   34.421 1.00 33.79 ? 326  GLU I N     1 
ATOM   8467  C CA    . GLU D 1 274 ? 32.657  0.740   34.898 1.00 33.96 ? 326  GLU I CA    1 
ATOM   8468  C C     . GLU D 1 274 ? 32.179  -0.580  34.261 1.00 34.44 ? 326  GLU I C     1 
ATOM   8469  O O     . GLU D 1 274 ? 32.048  -0.668  33.034 1.00 35.42 ? 326  GLU I O     1 
ATOM   8470  C CB    . GLU D 1 274 ? 31.864  1.949   34.385 1.00 35.83 ? 326  GLU I CB    1 
ATOM   8471  C CG    . GLU D 1 274 ? 30.398  1.980   34.754 1.00 40.16 ? 326  GLU I CG    1 
ATOM   8472  C CD    . GLU D 1 274 ? 30.147  2.168   36.247 1.00 45.08 ? 326  GLU I CD    1 
ATOM   8473  O OE1   . GLU D 1 274 ? 28.963  2.065   36.642 1.00 46.79 ? 326  GLU I OE1   1 
ATOM   8474  O OE2   . GLU D 1 274 ? 31.111  2.418   37.022 1.00 46.14 ? 326  GLU I OE2   1 
ATOM   8475  N N     . PHE D 1 275 ? 31.965  -1.620  35.071 1.00 33.04 ? 327  PHE I N     1 
ATOM   8476  C CA    . PHE D 1 275 ? 31.526  -2.912  34.539 1.00 30.73 ? 327  PHE I CA    1 
ATOM   8477  C C     . PHE D 1 275 ? 30.019  -3.041  34.444 1.00 33.11 ? 327  PHE I C     1 
ATOM   8478  O O     . PHE D 1 275 ? 29.291  -2.662  35.366 1.00 34.09 ? 327  PHE I O     1 
ATOM   8479  C CB    . PHE D 1 275 ? 32.058  -4.064  35.383 1.00 27.05 ? 327  PHE I CB    1 
ATOM   8480  C CG    . PHE D 1 275 ? 33.552  -4.177  35.375 1.00 26.87 ? 327  PHE I CG    1 
ATOM   8481  C CD1   . PHE D 1 275 ? 34.330  -3.417  36.246 1.00 23.96 ? 327  PHE I CD1   1 
ATOM   8482  C CD2   . PHE D 1 275 ? 34.192  -5.009  34.458 1.00 26.43 ? 327  PHE I CD2   1 
ATOM   8483  C CE1   . PHE D 1 275 ? 35.714  -3.481  36.200 1.00 21.94 ? 327  PHE I CE1   1 
ATOM   8484  C CE2   . PHE D 1 275 ? 35.577  -5.076  34.405 1.00 23.64 ? 327  PHE I CE2   1 
ATOM   8485  C CZ    . PHE D 1 275 ? 36.338  -4.308  35.280 1.00 22.68 ? 327  PHE I CZ    1 
ATOM   8486  N N     . ARG D 1 276 ? 29.555  -3.582  33.318 1.00 34.50 ? 328  ARG I N     1 
ATOM   8487  C CA    . ARG D 1 276 ? 28.130  -3.778  33.083 1.00 35.73 ? 328  ARG I CA    1 
ATOM   8488  C C     . ARG D 1 276 ? 27.849  -5.193  32.565 1.00 36.28 ? 328  ARG I C     1 
ATOM   8489  O O     . ARG D 1 276 ? 28.421  -6.159  33.074 1.00 37.00 ? 328  ARG I O     1 
ATOM   8490  C CB    . ARG D 1 276 ? 27.622  -2.710  32.107 1.00 36.12 ? 328  ARG I CB    1 
ATOM   8491  C CG    . ARG D 1 276 ? 27.924  -1.268  32.567 1.00 33.33 ? 328  ARG I CG    1 
ATOM   8492  C CD    . ARG D 1 276 ? 27.120  -0.264  31.763 1.00 35.13 ? 328  ARG I CD    1 
ATOM   8493  N NE    . ARG D 1 276 ? 27.173  1.088   32.313 1.00 37.03 ? 328  ARG I NE    1 
ATOM   8494  C CZ    . ARG D 1 276 ? 28.095  1.994   32.013 1.00 37.78 ? 328  ARG I CZ    1 
ATOM   8495  N NH1   . ARG D 1 276 ? 29.062  1.711   31.157 1.00 39.18 ? 328  ARG I NH1   1 
ATOM   8496  N NH2   . ARG D 1 276 ? 28.051  3.190   32.575 1.00 39.10 ? 328  ARG I NH2   1 
ATOM   8497  N N     . GLN D 1 277 ? 26.994  -5.340  31.560 1.00 36.70 ? 329  GLN I N     1 
ATOM   8498  C CA    . GLN D 1 277 ? 26.696  -6.685  31.071 1.00 39.18 ? 329  GLN I CA    1 
ATOM   8499  C C     . GLN D 1 277 ? 27.430  -7.179  29.822 1.00 39.43 ? 329  GLN I C     1 
ATOM   8500  O O     . GLN D 1 277 ? 27.331  -8.353  29.479 1.00 39.41 ? 329  GLN I O     1 
ATOM   8501  C CB    . GLN D 1 277 ? 25.187  -6.853  30.879 1.00 40.46 ? 329  GLN I CB    1 
ATOM   8502  C CG    . GLN D 1 277 ? 24.439  -6.996  32.194 1.00 45.41 ? 329  GLN I CG    1 
ATOM   8503  C CD    . GLN D 1 277 ? 24.622  -5.788  33.107 1.00 48.56 ? 329  GLN I CD    1 
ATOM   8504  O OE1   . GLN D 1 277 ? 24.080  -4.710  32.846 1.00 50.52 ? 329  GLN I OE1   1 
ATOM   8505  N NE2   . GLN D 1 277 ? 25.398  -5.961  34.177 1.00 49.29 ? 329  GLN I NE2   1 
ATOM   8506  N N     . SER D 1 278 ? 28.175  -6.308  29.151 1.00 39.52 ? 330  SER I N     1 
ATOM   8507  C CA    . SER D 1 278 ? 28.910  -6.722  27.958 1.00 40.85 ? 330  SER I CA    1 
ATOM   8508  C C     . SER D 1 278 ? 30.097  -7.578  28.393 1.00 42.68 ? 330  SER I C     1 
ATOM   8509  O O     . SER D 1 278 ? 30.872  -8.082  27.569 1.00 41.87 ? 330  SER I O     1 
ATOM   8510  C CB    . SER D 1 278 ? 29.445  -5.503  27.207 1.00 39.95 ? 330  SER I CB    1 
ATOM   8511  O OG    . SER D 1 278 ? 30.690  -5.074  27.760 1.00 40.13 ? 330  SER I OG    1 
ATOM   8512  N N     . THR D 1 279 ? 30.247  -7.728  29.700 1.00 44.89 ? 331  THR I N     1 
ATOM   8513  C CA    . THR D 1 279 ? 31.351  -8.498  30.228 1.00 47.79 ? 331  THR I CA    1 
ATOM   8514  C C     . THR D 1 279 ? 30.812  -9.555  31.183 1.00 49.73 ? 331  THR I C     1 
ATOM   8515  O O     . THR D 1 279 ? 29.692  -9.433  31.682 1.00 50.09 ? 331  THR I O     1 
ATOM   8516  C CB    . THR D 1 279 ? 32.384  -7.554  30.915 1.00 46.57 ? 331  THR I CB    1 
ATOM   8517  O OG1   . THR D 1 279 ? 33.644  -8.219  31.007 1.00 47.35 ? 331  THR I OG1   1 
ATOM   8518  C CG2   . THR D 1 279 ? 31.925  -7.141  32.304 1.00 46.67 ? 331  THR I CG2   1 
ATOM   8519  N N     . LYS D 1 280 ? 31.599  -10.605 31.402 1.00 53.08 ? 332  LYS I N     1 
ATOM   8520  C CA    . LYS D 1 280 ? 31.209  -11.711 32.283 1.00 55.22 ? 332  LYS I CA    1 
ATOM   8521  C C     . LYS D 1 280 ? 31.111  -11.216 33.733 1.00 54.93 ? 332  LYS I C     1 
ATOM   8522  O O     . LYS D 1 280 ? 30.102  -11.539 34.407 1.00 53.38 ? 332  LYS I O     1 
ATOM   8523  C CB    . LYS D 1 280 ? 32.234  -12.859 32.184 1.00 56.35 ? 332  LYS I CB    1 
ATOM   8524  C CG    . LYS D 1 280 ? 31.637  -14.257 32.297 1.00 56.49 ? 332  LYS I CG    1 
ATOM   8525  C CD    . LYS D 1 280 ? 30.877  -14.640 31.025 1.00 56.41 ? 332  LYS I CD    1 
ATOM   8526  C CE    . LYS D 1 280 ? 29.893  -15.810 31.240 1.00 57.11 ? 332  LYS I CE    1 
ATOM   8527  N NZ    . LYS D 1 280 ? 30.502  -17.091 31.731 1.00 56.18 ? 332  LYS I NZ    1 
ATOM   8528  O OXT   . LYS D 1 280 ? 32.051  -10.514 34.178 1.00 55.62 ? 332  LYS I OXT   1 
ATOM   8529  N N     . THR E 1 8   ? 282.504 9.467   30.300 1.00 63.63 ? 60   THR P N     1 
ATOM   8530  C CA    . THR E 1 8   ? 282.052 8.267   31.058 1.00 63.36 ? 60   THR P CA    1 
ATOM   8531  C C     . THR E 1 8   ? 283.164 7.821   32.004 1.00 63.14 ? 60   THR P C     1 
ATOM   8532  O O     . THR E 1 8   ? 283.113 6.723   32.566 1.00 64.07 ? 60   THR P O     1 
ATOM   8533  C CB    . THR E 1 8   ? 281.725 7.084   30.119 1.00 63.92 ? 60   THR P CB    1 
ATOM   8534  O OG1   . THR E 1 8   ? 281.225 7.574   28.865 1.00 64.87 ? 60   THR P OG1   1 
ATOM   8535  C CG2   . THR E 1 8   ? 280.674 6.183   30.767 1.00 63.73 ? 60   THR P CG2   1 
ATOM   8536  N N     . THR E 1 9   ? 284.179 8.668   32.161 1.00 61.87 ? 61   THR P N     1 
ATOM   8537  C CA    . THR E 1 9   ? 285.295 8.363   33.053 1.00 60.45 ? 61   THR P CA    1 
ATOM   8538  C C     . THR E 1 9   ? 284.918 8.856   34.458 1.00 59.98 ? 61   THR P C     1 
ATOM   8539  O O     . THR E 1 9   ? 284.628 10.039  34.655 1.00 60.67 ? 61   THR P O     1 
ATOM   8540  C CB    . THR E 1 9   ? 286.604 9.042   32.557 1.00 59.98 ? 61   THR P CB    1 
ATOM   8541  O OG1   . THR E 1 9   ? 286.402 10.455  32.420 1.00 58.27 ? 61   THR P OG1   1 
ATOM   8542  C CG2   . THR E 1 9   ? 287.023 8.461   31.201 1.00 58.34 ? 61   THR P CG2   1 
ATOM   8543  N N     . THR E 1 10  ? 284.895 7.947   35.430 1.00 57.96 ? 62   THR P N     1 
ATOM   8544  C CA    . THR E 1 10  ? 284.510 8.320   36.787 1.00 55.17 ? 62   THR P CA    1 
ATOM   8545  C C     . THR E 1 10  ? 285.714 8.449   37.717 1.00 54.67 ? 62   THR P C     1 
ATOM   8546  O O     . THR E 1 10  ? 286.470 7.491   37.909 1.00 56.24 ? 62   THR P O     1 
ATOM   8547  C CB    . THR E 1 10  ? 283.517 7.294   37.374 1.00 55.04 ? 62   THR P CB    1 
ATOM   8548  O OG1   . THR E 1 10  ? 284.143 6.570   38.437 1.00 54.67 ? 62   THR P OG1   1 
ATOM   8549  C CG2   . THR E 1 10  ? 283.067 6.302   36.297 1.00 53.62 ? 62   THR P CG2   1 
ATOM   8550  N N     . VAL E 1 11  ? 285.887 9.641   38.285 1.00 51.91 ? 63   VAL P N     1 
ATOM   8551  C CA    . VAL E 1 11  ? 286.995 9.927   39.195 1.00 48.30 ? 63   VAL P CA    1 
ATOM   8552  C C     . VAL E 1 11  ? 286.584 9.580   40.615 1.00 46.01 ? 63   VAL P C     1 
ATOM   8553  O O     . VAL E 1 11  ? 285.440 9.777   40.995 1.00 45.62 ? 63   VAL P O     1 
ATOM   8554  C CB    . VAL E 1 11  ? 287.387 11.421  39.138 1.00 47.41 ? 63   VAL P CB    1 
ATOM   8555  C CG1   . VAL E 1 11  ? 286.174 12.273  39.391 1.00 49.31 ? 63   VAL P CG1   1 
ATOM   8556  C CG2   . VAL E 1 11  ? 288.435 11.730  40.167 1.00 46.60 ? 63   VAL P CG2   1 
ATOM   8557  N N     . GLY E 1 12  ? 287.516 9.055   41.396 1.00 44.83 ? 64   GLY P N     1 
ATOM   8558  C CA    . GLY E 1 12  ? 287.198 8.698   42.765 1.00 43.43 ? 64   GLY P CA    1 
ATOM   8559  C C     . GLY E 1 12  ? 287.956 9.537   43.770 1.00 42.43 ? 64   GLY P C     1 
ATOM   8560  O O     . GLY E 1 12  ? 289.174 9.688   43.666 1.00 43.21 ? 64   GLY P O     1 
ATOM   8561  N N     . VAL E 1 13  ? 287.249 10.087  44.750 1.00 41.31 ? 65   VAL P N     1 
ATOM   8562  C CA    . VAL E 1 13  ? 287.909 10.906  45.752 1.00 40.29 ? 65   VAL P CA    1 
ATOM   8563  C C     . VAL E 1 13  ? 287.864 10.251  47.123 1.00 40.35 ? 65   VAL P C     1 
ATOM   8564  O O     . VAL E 1 13  ? 286.892 9.586   47.477 1.00 41.00 ? 65   VAL P O     1 
ATOM   8565  C CB    . VAL E 1 13  ? 287.285 12.328  45.819 1.00 38.70 ? 65   VAL P CB    1 
ATOM   8566  C CG1   . VAL E 1 13  ? 286.831 12.757  44.429 1.00 36.89 ? 65   VAL P CG1   1 
ATOM   8567  C CG2   . VAL E 1 13  ? 286.150 12.373  46.799 1.00 37.98 ? 65   VAL P CG2   1 
ATOM   8568  N N     . ILE E 1 14  ? 288.944 10.410  47.875 1.00 40.45 ? 66   ILE P N     1 
ATOM   8569  C CA    . ILE E 1 14  ? 289.027 9.859   49.221 1.00 40.92 ? 66   ILE P CA    1 
ATOM   8570  C C     . ILE E 1 14  ? 289.151 11.058  50.146 1.00 42.24 ? 66   ILE P C     1 
ATOM   8571  O O     . ILE E 1 14  ? 289.994 11.922  49.931 1.00 40.91 ? 66   ILE P O     1 
ATOM   8572  C CB    . ILE E 1 14  ? 290.275 8.971   49.415 1.00 40.24 ? 66   ILE P CB    1 
ATOM   8573  C CG1   . ILE E 1 14  ? 290.217 7.750   48.507 1.00 38.31 ? 66   ILE P CG1   1 
ATOM   8574  C CG2   . ILE E 1 14  ? 290.355 8.508   50.854 1.00 40.12 ? 66   ILE P CG2   1 
ATOM   8575  C CD1   . ILE E 1 14  ? 289.069 6.855   48.824 1.00 42.86 ? 66   ILE P CD1   1 
ATOM   8576  N N     . ILE E 1 15  ? 288.305 11.127  51.164 1.00 43.92 ? 67   ILE P N     1 
ATOM   8577  C CA    . ILE E 1 15  ? 288.373 12.243  52.082 1.00 45.80 ? 67   ILE P CA    1 
ATOM   8578  C C     . ILE E 1 15  ? 288.490 11.749  53.512 1.00 47.40 ? 67   ILE P C     1 
ATOM   8579  O O     . ILE E 1 15  ? 287.862 10.763  53.888 1.00 47.41 ? 67   ILE P O     1 
ATOM   8580  C CB    . ILE E 1 15  ? 287.133 13.184  51.919 1.00 46.97 ? 67   ILE P CB    1 
ATOM   8581  C CG1   . ILE E 1 15  ? 285.823 12.427  52.159 1.00 46.23 ? 67   ILE P CG1   1 
ATOM   8582  C CG2   . ILE E 1 15  ? 287.120 13.779  50.525 1.00 46.74 ? 67   ILE P CG2   1 
ATOM   8583  C CD1   . ILE E 1 15  ? 285.398 12.370  53.610 1.00 45.72 ? 67   ILE P CD1   1 
ATOM   8584  N N     . PRO E 1 16  ? 289.310 12.429  54.328 1.00 49.26 ? 68   PRO P N     1 
ATOM   8585  C CA    . PRO E 1 16  ? 289.540 12.092  55.737 1.00 50.67 ? 68   PRO P CA    1 
ATOM   8586  C C     . PRO E 1 16  ? 288.240 11.867  56.515 1.00 51.95 ? 68   PRO P C     1 
ATOM   8587  O O     . PRO E 1 16  ? 287.736 10.747  56.614 1.00 52.05 ? 68   PRO P O     1 
ATOM   8588  C CB    . PRO E 1 16  ? 290.299 13.309  56.259 1.00 50.72 ? 68   PRO P CB    1 
ATOM   8589  C CG    . PRO E 1 16  ? 291.047 13.779  55.062 1.00 51.25 ? 68   PRO P CG    1 
ATOM   8590  C CD    . PRO E 1 16  ? 290.015 13.673  53.970 1.00 49.86 ? 68   PRO P CD    1 
ATOM   8591  N N     . ASP E 1 17  ? 287.711 12.948  57.073 1.00 53.23 ? 69   ASP P N     1 
ATOM   8592  C CA    . ASP E 1 17  ? 286.483 12.883  57.842 1.00 55.90 ? 69   ASP P CA    1 
ATOM   8593  C C     . ASP E 1 17  ? 285.415 13.813  57.287 1.00 56.04 ? 69   ASP P C     1 
ATOM   8594  O O     . ASP E 1 17  ? 285.574 15.028  57.297 1.00 57.18 ? 69   ASP P O     1 
ATOM   8595  C CB    . ASP E 1 17  ? 286.756 13.232  59.304 1.00 57.72 ? 69   ASP P CB    1 
ATOM   8596  C CG    . ASP E 1 17  ? 285.485 13.271  60.134 1.00 61.27 ? 69   ASP P CG    1 
ATOM   8597  O OD1   . ASP E 1 17  ? 284.589 12.425  59.892 1.00 61.52 ? 69   ASP P OD1   1 
ATOM   8598  O OD2   . ASP E 1 17  ? 285.385 14.139  61.031 1.00 63.01 ? 69   ASP P OD2   1 
ATOM   8599  N N     . ILE E 1 18  ? 284.314 13.237  56.823 1.00 55.65 ? 70   ILE P N     1 
ATOM   8600  C CA    . ILE E 1 18  ? 283.226 14.016  56.256 1.00 54.95 ? 70   ILE P CA    1 
ATOM   8601  C C     . ILE E 1 18  ? 282.584 14.976  57.254 1.00 54.21 ? 70   ILE P C     1 
ATOM   8602  O O     . ILE E 1 18  ? 281.704 15.757  56.904 1.00 53.61 ? 70   ILE P O     1 
ATOM   8603  C CB    . ILE E 1 18  ? 282.143 13.087  55.688 1.00 55.12 ? 70   ILE P CB    1 
ATOM   8604  C CG1   . ILE E 1 18  ? 281.711 13.606  54.323 1.00 55.47 ? 70   ILE P CG1   1 
ATOM   8605  C CG2   . ILE E 1 18  ? 280.946 12.980  56.647 1.00 55.77 ? 70   ILE P CG2   1 
ATOM   8606  C CD1   . ILE E 1 18  ? 282.087 12.653  53.206 1.00 51.43 ? 70   ILE P CD1   1 
ATOM   8607  N N     . SER E 1 19  ? 283.024 14.914  58.499 1.00 54.00 ? 71   SER P N     1 
ATOM   8608  C CA    . SER E 1 19  ? 282.479 15.786  59.519 1.00 54.52 ? 71   SER P CA    1 
ATOM   8609  C C     . SER E 1 19  ? 283.259 17.112  59.510 1.00 54.31 ? 71   SER P C     1 
ATOM   8610  O O     . SER E 1 19  ? 282.884 18.080  60.179 1.00 54.55 ? 71   SER P O     1 
ATOM   8611  C CB    . SER E 1 19  ? 282.584 15.093  60.881 1.00 55.63 ? 71   SER P CB    1 
ATOM   8612  O OG    . SER E 1 19  ? 281.717 15.678  61.835 1.00 58.60 ? 71   SER P OG    1 
ATOM   8613  N N     . ASN E 1 20  ? 284.342 17.149  58.737 1.00 52.91 ? 72   ASN P N     1 
ATOM   8614  C CA    . ASN E 1 20  ? 285.176 18.344  58.629 1.00 51.65 ? 72   ASN P CA    1 
ATOM   8615  C C     . ASN E 1 20  ? 284.574 19.242  57.553 1.00 51.51 ? 72   ASN P C     1 
ATOM   8616  O O     . ASN E 1 20  ? 284.657 18.942  56.362 1.00 52.55 ? 72   ASN P O     1 
ATOM   8617  C CB    . ASN E 1 20  ? 286.610 17.941  58.267 1.00 50.51 ? 72   ASN P CB    1 
ATOM   8618  C CG    . ASN E 1 20  ? 287.550 19.124  58.169 1.00 50.56 ? 72   ASN P CG    1 
ATOM   8619  O OD1   . ASN E 1 20  ? 288.760 18.980  58.323 1.00 50.32 ? 72   ASN P OD1   1 
ATOM   8620  N ND2   . ASN E 1 20  ? 287.000 20.301  57.899 1.00 52.10 ? 72   ASN P ND2   1 
ATOM   8621  N N     . ILE E 1 21  ? 283.972 20.347  57.972 1.00 49.83 ? 73   ILE P N     1 
ATOM   8622  C CA    . ILE E 1 21  ? 283.340 21.241  57.024 1.00 49.02 ? 73   ILE P CA    1 
ATOM   8623  C C     . ILE E 1 21  ? 284.182 21.574  55.805 1.00 47.95 ? 73   ILE P C     1 
ATOM   8624  O O     . ILE E 1 21  ? 283.645 21.682  54.691 1.00 47.81 ? 73   ILE P O     1 
ATOM   8625  C CB    . ILE E 1 21  ? 282.873 22.543  57.699 1.00 49.59 ? 73   ILE P CB    1 
ATOM   8626  C CG1   . ILE E 1 21  ? 283.509 22.690  59.084 1.00 50.88 ? 73   ILE P CG1   1 
ATOM   8627  C CG2   . ILE E 1 21  ? 281.358 22.540  57.797 1.00 50.82 ? 73   ILE P CG2   1 
ATOM   8628  C CD1   . ILE E 1 21  ? 284.935 23.223  59.073 1.00 47.97 ? 73   ILE P CD1   1 
ATOM   8629  N N     . PHE E 1 22  ? 285.493 21.722  55.999 1.00 45.71 ? 74   PHE P N     1 
ATOM   8630  C CA    . PHE E 1 22  ? 286.381 22.041  54.882 1.00 42.16 ? 74   PHE P CA    1 
ATOM   8631  C C     . PHE E 1 22  ? 286.434 20.913  53.856 1.00 41.17 ? 74   PHE P C     1 
ATOM   8632  O O     . PHE E 1 22  ? 286.236 21.146  52.659 1.00 40.86 ? 74   PHE P O     1 
ATOM   8633  C CB    . PHE E 1 22  ? 287.794 22.350  55.379 1.00 39.95 ? 74   PHE P CB    1 
ATOM   8634  C CG    . PHE E 1 22  ? 288.780 22.585  54.270 1.00 37.85 ? 74   PHE P CG    1 
ATOM   8635  C CD1   . PHE E 1 22  ? 289.591 21.557  53.811 1.00 35.48 ? 74   PHE P CD1   1 
ATOM   8636  C CD2   . PHE E 1 22  ? 288.854 23.820  53.641 1.00 38.25 ? 74   PHE P CD2   1 
ATOM   8637  C CE1   . PHE E 1 22  ? 290.453 21.747  52.745 1.00 35.20 ? 74   PHE P CE1   1 
ATOM   8638  C CE2   . PHE E 1 22  ? 289.718 24.017  52.570 1.00 39.76 ? 74   PHE P CE2   1 
ATOM   8639  C CZ    . PHE E 1 22  ? 290.520 22.968  52.123 1.00 37.04 ? 74   PHE P CZ    1 
ATOM   8640  N N     . TYR E 1 23  ? 286.690 19.692  54.320 1.00 39.53 ? 75   TYR P N     1 
ATOM   8641  C CA    . TYR E 1 23  ? 286.764 18.553  53.412 1.00 39.18 ? 75   TYR P CA    1 
ATOM   8642  C C     . TYR E 1 23  ? 285.434 18.270  52.748 1.00 37.58 ? 75   TYR P C     1 
ATOM   8643  O O     . TYR E 1 23  ? 285.394 17.746  51.638 1.00 36.89 ? 75   TYR P O     1 
ATOM   8644  C CB    . TYR E 1 23  ? 287.305 17.296  54.130 1.00 40.25 ? 75   TYR P CB    1 
ATOM   8645  C CG    . TYR E 1 23  ? 288.796 17.376  54.311 1.00 40.90 ? 75   TYR P CG    1 
ATOM   8646  C CD1   . TYR E 1 23  ? 289.606 17.752  53.239 1.00 41.63 ? 75   TYR P CD1   1 
ATOM   8647  C CD2   . TYR E 1 23  ? 289.387 17.221  55.565 1.00 41.49 ? 75   TYR P CD2   1 
ATOM   8648  C CE1   . TYR E 1 23  ? 290.956 17.993  53.406 1.00 43.13 ? 75   TYR P CE1   1 
ATOM   8649  C CE2   . TYR E 1 23  ? 290.753 17.458  55.745 1.00 42.68 ? 75   TYR P CE2   1 
ATOM   8650  C CZ    . TYR E 1 23  ? 291.527 17.851  54.655 1.00 43.30 ? 75   TYR P CZ    1 
ATOM   8651  O OH    . TYR E 1 23  ? 292.866 18.139  54.790 1.00 44.04 ? 75   TYR P OH    1 
ATOM   8652  N N     . ALA E 1 24  ? 284.347 18.634  53.415 1.00 36.23 ? 76   ALA P N     1 
ATOM   8653  C CA    . ALA E 1 24  ? 283.031 18.421  52.840 1.00 36.57 ? 76   ALA P CA    1 
ATOM   8654  C C     . ALA E 1 24  ? 282.781 19.443  51.724 1.00 35.92 ? 76   ALA P C     1 
ATOM   8655  O O     . ALA E 1 24  ? 282.194 19.122  50.693 1.00 34.53 ? 76   ALA P O     1 
ATOM   8656  C CB    . ALA E 1 24  ? 281.957 18.539  53.919 1.00 36.94 ? 76   ALA P CB    1 
ATOM   8657  N N     . GLU E 1 25  ? 283.232 20.673  51.921 1.00 35.92 ? 77   GLU P N     1 
ATOM   8658  C CA    . GLU E 1 25  ? 283.013 21.682  50.898 1.00 36.79 ? 77   GLU P CA    1 
ATOM   8659  C C     . GLU E 1 25  ? 283.984 21.471  49.733 1.00 36.15 ? 77   GLU P C     1 
ATOM   8660  O O     . GLU E 1 25  ? 283.610 21.603  48.565 1.00 33.90 ? 77   GLU P O     1 
ATOM   8661  C CB    . GLU E 1 25  ? 283.169 23.093  51.490 1.00 37.48 ? 77   GLU P CB    1 
ATOM   8662  C CG    . GLU E 1 25  ? 282.336 23.341  52.735 1.00 40.71 ? 77   GLU P CG    1 
ATOM   8663  C CD    . GLU E 1 25  ? 282.253 24.814  53.128 1.00 44.69 ? 77   GLU P CD    1 
ATOM   8664  O OE1   . GLU E 1 25  ? 281.719 25.092  54.224 1.00 44.80 ? 77   GLU P OE1   1 
ATOM   8665  O OE2   . GLU E 1 25  ? 282.706 25.694  52.353 1.00 48.06 ? 77   GLU P OE2   1 
ATOM   8666  N N     . LEU E 1 26  ? 285.228 21.128  50.045 1.00 35.55 ? 78   LEU P N     1 
ATOM   8667  C CA    . LEU E 1 26  ? 286.190 20.933  48.980 1.00 36.08 ? 78   LEU P CA    1 
ATOM   8668  C C     . LEU E 1 26  ? 285.668 19.841  48.075 1.00 36.59 ? 78   LEU P C     1 
ATOM   8669  O O     . LEU E 1 26  ? 285.676 19.984  46.854 1.00 36.24 ? 78   LEU P O     1 
ATOM   8670  C CB    . LEU E 1 26  ? 287.563 20.546  49.531 1.00 37.32 ? 78   LEU P CB    1 
ATOM   8671  C CG    . LEU E 1 26  ? 288.623 20.275  48.454 1.00 37.05 ? 78   LEU P CG    1 
ATOM   8672  C CD1   . LEU E 1 26  ? 288.823 21.517  47.625 1.00 36.23 ? 78   LEU P CD1   1 
ATOM   8673  C CD2   . LEU E 1 26  ? 289.937 19.852  49.093 1.00 37.25 ? 78   LEU P CD2   1 
ATOM   8674  N N     . ALA E 1 27  ? 285.206 18.746  48.672 1.00 36.89 ? 79   ALA P N     1 
ATOM   8675  C CA    . ALA E 1 27  ? 284.670 17.646  47.886 1.00 36.95 ? 79   ALA P CA    1 
ATOM   8676  C C     . ALA E 1 27  ? 283.543 18.157  46.987 1.00 38.10 ? 79   ALA P C     1 
ATOM   8677  O O     . ALA E 1 27  ? 283.520 17.841  45.800 1.00 37.79 ? 79   ALA P O     1 
ATOM   8678  C CB    . ALA E 1 27  ? 284.161 16.555  48.794 1.00 35.60 ? 79   ALA P CB    1 
ATOM   8679  N N     . ARG E 1 28  ? 282.634 18.958  47.555 1.00 39.15 ? 80   ARG P N     1 
ATOM   8680  C CA    . ARG E 1 28  ? 281.501 19.529  46.824 1.00 39.97 ? 80   ARG P CA    1 
ATOM   8681  C C     . ARG E 1 28  ? 282.018 20.352  45.651 1.00 40.58 ? 80   ARG P C     1 
ATOM   8682  O O     . ARG E 1 28  ? 281.470 20.287  44.547 1.00 39.86 ? 80   ARG P O     1 
ATOM   8683  C CB    . ARG E 1 28  ? 280.660 20.416  47.748 1.00 43.06 ? 80   ARG P CB    1 
ATOM   8684  C CG    . ARG E 1 28  ? 279.151 20.376  47.490 1.00 47.16 ? 80   ARG P CG    1 
ATOM   8685  C CD    . ARG E 1 28  ? 278.751 21.074  46.198 1.00 52.81 ? 80   ARG P CD    1 
ATOM   8686  N NE    . ARG E 1 28  ? 277.343 20.841  45.850 1.00 57.44 ? 80   ARG P NE    1 
ATOM   8687  C CZ    . ARG E 1 28  ? 276.718 21.391  44.804 1.00 59.79 ? 80   ARG P CZ    1 
ATOM   8688  N NH1   . ARG E 1 28  ? 277.365 22.218  43.988 1.00 59.67 ? 80   ARG P NH1   1 
ATOM   8689  N NH2   . ARG E 1 28  ? 275.438 21.110  44.567 1.00 61.49 ? 80   ARG P NH2   1 
ATOM   8690  N N     . GLY E 1 29  ? 283.069 21.132  45.897 1.00 41.43 ? 81   GLY P N     1 
ATOM   8691  C CA    . GLY E 1 29  ? 283.670 21.927  44.836 1.00 42.18 ? 81   GLY P CA    1 
ATOM   8692  C C     . GLY E 1 29  ? 284.176 20.985  43.751 1.00 43.67 ? 81   GLY P C     1 
ATOM   8693  O O     . GLY E 1 29  ? 284.124 21.292  42.556 1.00 43.52 ? 81   GLY P O     1 
ATOM   8694  N N     . ILE E 1 30  ? 284.670 19.825  44.174 1.00 44.34 ? 82   ILE P N     1 
ATOM   8695  C CA    . ILE E 1 30  ? 285.153 18.828  43.240 1.00 46.13 ? 82   ILE P CA    1 
ATOM   8696  C C     . ILE E 1 30  ? 283.968 18.306  42.424 1.00 47.08 ? 82   ILE P C     1 
ATOM   8697  O O     . ILE E 1 30  ? 284.124 17.939  41.260 1.00 47.56 ? 82   ILE P O     1 
ATOM   8698  C CB    . ILE E 1 30  ? 285.810 17.644  43.969 1.00 46.88 ? 82   ILE P CB    1 
ATOM   8699  C CG1   . ILE E 1 30  ? 286.968 18.122  44.834 1.00 47.18 ? 82   ILE P CG1   1 
ATOM   8700  C CG2   . ILE E 1 30  ? 286.390 16.672  42.953 1.00 49.29 ? 82   ILE P CG2   1 
ATOM   8701  C CD1   . ILE E 1 30  ? 288.192 18.500  44.030 1.00 46.12 ? 82   ILE P CD1   1 
ATOM   8702  N N     . GLU E 1 31  ? 282.787 18.260  43.036 1.00 47.92 ? 83   GLU P N     1 
ATOM   8703  C CA    . GLU E 1 31  ? 281.590 17.804  42.328 1.00 48.91 ? 83   GLU P CA    1 
ATOM   8704  C C     . GLU E 1 31  ? 281.334 18.764  41.166 1.00 49.65 ? 83   GLU P C     1 
ATOM   8705  O O     . GLU E 1 31  ? 281.273 18.359  40.000 1.00 49.44 ? 83   GLU P O     1 
ATOM   8706  C CB    . GLU E 1 31  ? 280.342 17.840  43.227 1.00 49.36 ? 83   GLU P CB    1 
ATOM   8707  C CG    . GLU E 1 31  ? 280.328 16.918  44.429 1.00 51.42 ? 83   GLU P CG    1 
ATOM   8708  C CD    . GLU E 1 31  ? 280.537 15.467  44.062 1.00 53.30 ? 83   GLU P CD    1 
ATOM   8709  O OE1   . GLU E 1 31  ? 281.613 15.168  43.502 1.00 56.39 ? 83   GLU P OE1   1 
ATOM   8710  O OE2   . GLU E 1 31  ? 279.644 14.633  44.334 1.00 52.05 ? 83   GLU P OE2   1 
ATOM   8711  N N     . ASP E 1 32  ? 281.179 20.043  41.510 1.00 49.06 ? 84   ASP P N     1 
ATOM   8712  C CA    . ASP E 1 32  ? 280.895 21.075  40.530 1.00 49.08 ? 84   ASP P CA    1 
ATOM   8713  C C     . ASP E 1 32  ? 281.902 21.082  39.400 1.00 48.65 ? 84   ASP P C     1 
ATOM   8714  O O     . ASP E 1 32  ? 281.538 21.248  38.238 1.00 49.02 ? 84   ASP P O     1 
ATOM   8715  C CB    . ASP E 1 32  ? 280.842 22.453  41.200 1.00 50.59 ? 84   ASP P CB    1 
ATOM   8716  C CG    . ASP E 1 32  ? 279.628 22.621  42.109 1.00 52.26 ? 84   ASP P CG    1 
ATOM   8717  O OD1   . ASP E 1 32  ? 278.503 22.255  41.690 1.00 52.89 ? 84   ASP P OD1   1 
ATOM   8718  O OD2   . ASP E 1 32  ? 279.801 23.132  43.240 1.00 52.44 ? 84   ASP P OD2   1 
ATOM   8719  N N     . ILE E 1 33  ? 283.170 20.903  39.734 1.00 48.23 ? 85   ILE P N     1 
ATOM   8720  C CA    . ILE E 1 33  ? 284.198 20.887  38.709 1.00 48.40 ? 85   ILE P CA    1 
ATOM   8721  C C     . ILE E 1 33  ? 284.077 19.631  37.831 1.00 48.91 ? 85   ILE P C     1 
ATOM   8722  O O     . ILE E 1 33  ? 284.266 19.692  36.609 1.00 48.32 ? 85   ILE P O     1 
ATOM   8723  C CB    . ILE E 1 33  ? 285.608 20.990  39.354 1.00 46.79 ? 85   ILE P CB    1 
ATOM   8724  C CG1   . ILE E 1 33  ? 285.910 22.463  39.660 1.00 44.89 ? 85   ILE P CG1   1 
ATOM   8725  C CG2   . ILE E 1 33  ? 286.654 20.328  38.465 1.00 46.26 ? 85   ILE P CG2   1 
ATOM   8726  C CD1   . ILE E 1 33  ? 287.178 22.975  39.044 1.00 44.33 ? 85   ILE P CD1   1 
ATOM   8727  N N     . ALA E 1 34  ? 283.735 18.506  38.453 1.00 49.04 ? 86   ALA P N     1 
ATOM   8728  C CA    . ALA E 1 34  ? 283.591 17.250  37.731 1.00 50.25 ? 86   ALA P CA    1 
ATOM   8729  C C     . ALA E 1 34  ? 282.533 17.326  36.620 1.00 51.71 ? 86   ALA P C     1 
ATOM   8730  O O     . ALA E 1 34  ? 282.770 16.869  35.494 1.00 51.81 ? 86   ALA P O     1 
ATOM   8731  C CB    . ALA E 1 34  ? 283.254 16.127  38.703 1.00 48.98 ? 86   ALA P CB    1 
ATOM   8732  N N     . THR E 1 35  ? 281.369 17.900  36.922 1.00 52.26 ? 87   THR P N     1 
ATOM   8733  C CA    . THR E 1 35  ? 280.317 18.002  35.909 1.00 53.35 ? 87   THR P CA    1 
ATOM   8734  C C     . THR E 1 35  ? 280.823 18.779  34.694 1.00 53.31 ? 87   THR P C     1 
ATOM   8735  O O     . THR E 1 35  ? 280.557 18.403  33.552 1.00 52.71 ? 87   THR P O     1 
ATOM   8736  C CB    . THR E 1 35  ? 279.063 18.722  36.437 1.00 53.46 ? 87   THR P CB    1 
ATOM   8737  O OG1   . THR E 1 35  ? 279.383 20.091  36.695 1.00 55.72 ? 87   THR P OG1   1 
ATOM   8738  C CG2   . THR E 1 35  ? 278.560 18.071  37.716 1.00 53.50 ? 87   THR P CG2   1 
ATOM   8739  N N     . MET E 1 36  ? 281.550 19.864  34.952 1.00 53.69 ? 88   MET P N     1 
ATOM   8740  C CA    . MET E 1 36  ? 282.104 20.690  33.886 1.00 54.15 ? 88   MET P CA    1 
ATOM   8741  C C     . MET E 1 36  ? 283.093 19.892  33.050 1.00 54.19 ? 88   MET P C     1 
ATOM   8742  O O     . MET E 1 36  ? 283.381 20.242  31.906 1.00 54.42 ? 88   MET P O     1 
ATOM   8743  C CB    . MET E 1 36  ? 282.797 21.919  34.469 1.00 54.81 ? 88   MET P CB    1 
ATOM   8744  C CG    . MET E 1 36  ? 281.843 23.005  34.911 1.00 55.91 ? 88   MET P CG    1 
ATOM   8745  S SD    . MET E 1 36  ? 282.694 24.333  35.744 1.00 58.50 ? 88   MET P SD    1 
ATOM   8746  C CE    . MET E 1 36  ? 282.143 24.072  37.446 1.00 59.03 ? 88   MET P CE    1 
ATOM   8747  N N     . TYR E 1 37  ? 283.595 18.811  33.633 1.00 54.00 ? 89   TYR P N     1 
ATOM   8748  C CA    . TYR E 1 37  ? 284.545 17.935  32.970 1.00 53.52 ? 89   TYR P CA    1 
ATOM   8749  C C     . TYR E 1 37  ? 283.849 16.658  32.520 1.00 52.99 ? 89   TYR P C     1 
ATOM   8750  O O     . TYR E 1 37  ? 284.504 15.717  32.084 1.00 53.04 ? 89   TYR P O     1 
ATOM   8751  C CB    . TYR E 1 37  ? 285.664 17.563  33.938 1.00 56.56 ? 89   TYR P CB    1 
ATOM   8752  C CG    . TYR E 1 37  ? 286.842 18.519  34.007 1.00 59.49 ? 89   TYR P CG    1 
ATOM   8753  C CD1   . TYR E 1 37  ? 287.982 18.308  33.227 1.00 59.00 ? 89   TYR P CD1   1 
ATOM   8754  C CD2   . TYR E 1 37  ? 286.829 19.618  34.873 1.00 60.04 ? 89   TYR P CD2   1 
ATOM   8755  C CE1   . TYR E 1 37  ? 289.079 19.166  33.307 1.00 59.85 ? 89   TYR P CE1   1 
ATOM   8756  C CE2   . TYR E 1 37  ? 287.919 20.479  34.959 1.00 61.04 ? 89   TYR P CE2   1 
ATOM   8757  C CZ    . TYR E 1 37  ? 289.041 20.250  34.171 1.00 61.03 ? 89   TYR P CZ    1 
ATOM   8758  O OH    . TYR E 1 37  ? 290.111 21.119  34.242 1.00 61.23 ? 89   TYR P OH    1 
ATOM   8759  N N     . LYS E 1 38  ? 282.525 16.629  32.627 1.00 52.82 ? 90   LYS P N     1 
ATOM   8760  C CA    . LYS E 1 38  ? 281.727 15.453  32.261 1.00 53.15 ? 90   LYS P CA    1 
ATOM   8761  C C     . LYS E 1 38  ? 282.262 14.164  32.899 1.00 51.93 ? 90   LYS P C     1 
ATOM   8762  O O     . LYS E 1 38  ? 282.424 13.142  32.228 1.00 51.42 ? 90   LYS P O     1 
ATOM   8763  C CB    . LYS E 1 38  ? 281.623 15.284  30.729 1.00 55.06 ? 90   LYS P CB    1 
ATOM   8764  C CG    . LYS E 1 38  ? 282.819 14.608  30.036 1.00 59.27 ? 90   LYS P CG    1 
ATOM   8765  C CD    . LYS E 1 38  ? 282.656 14.554  28.507 1.00 61.95 ? 90   LYS P CD    1 
ATOM   8766  C CE    . LYS E 1 38  ? 281.621 13.540  28.046 1.00 62.87 ? 90   LYS P CE    1 
ATOM   8767  N NZ    . LYS E 1 38  ? 282.116 12.153  28.247 1.00 63.72 ? 90   LYS P NZ    1 
ATOM   8768  N N     . TYR E 1 39  ? 282.540 14.231  34.202 1.00 49.90 ? 91   TYR P N     1 
ATOM   8769  C CA    . TYR E 1 39  ? 283.016 13.077  34.963 1.00 48.43 ? 91   TYR P CA    1 
ATOM   8770  C C     . TYR E 1 39  ? 281.996 12.802  36.060 1.00 47.88 ? 91   TYR P C     1 
ATOM   8771  O O     . TYR E 1 39  ? 281.341 13.724  36.541 1.00 47.61 ? 91   TYR P O     1 
ATOM   8772  C CB    . TYR E 1 39  ? 284.360 13.352  35.658 1.00 48.65 ? 91   TYR P CB    1 
ATOM   8773  C CG    . TYR E 1 39  ? 285.494 13.778  34.763 1.00 48.60 ? 91   TYR P CG    1 
ATOM   8774  C CD1   . TYR E 1 39  ? 285.607 13.289  33.461 1.00 48.11 ? 91   TYR P CD1   1 
ATOM   8775  C CD2   . TYR E 1 39  ? 286.471 14.660  35.225 1.00 48.14 ? 91   TYR P CD2   1 
ATOM   8776  C CE1   . TYR E 1 39  ? 286.660 13.668  32.640 1.00 47.87 ? 91   TYR P CE1   1 
ATOM   8777  C CE2   . TYR E 1 39  ? 287.534 15.046  34.406 1.00 48.92 ? 91   TYR P CE2   1 
ATOM   8778  C CZ    . TYR E 1 39  ? 287.617 14.544  33.116 1.00 48.27 ? 91   TYR P CZ    1 
ATOM   8779  O OH    . TYR E 1 39  ? 288.651 14.919  32.299 1.00 49.03 ? 91   TYR P OH    1 
ATOM   8780  N N     . ASN E 1 40  ? 281.848 11.542  36.454 1.00 47.38 ? 92   ASN P N     1 
ATOM   8781  C CA    . ASN E 1 40  ? 280.930 11.223  37.539 1.00 47.02 ? 92   ASN P CA    1 
ATOM   8782  C C     . ASN E 1 40  ? 281.853 11.216  38.735 1.00 46.59 ? 92   ASN P C     1 
ATOM   8783  O O     . ASN E 1 40  ? 283.063 11.375  38.575 1.00 46.68 ? 92   ASN P O     1 
ATOM   8784  C CB    . ASN E 1 40  ? 280.309 9.837   37.386 1.00 47.70 ? 92   ASN P CB    1 
ATOM   8785  C CG    . ASN E 1 40  ? 280.316 9.354   35.968 1.00 47.79 ? 92   ASN P CG    1 
ATOM   8786  O OD1   . ASN E 1 40  ? 281.364 8.978   35.429 1.00 48.32 ? 92   ASN P OD1   1 
ATOM   8787  N ND2   . ASN E 1 40  ? 279.149 9.362   35.342 1.00 48.03 ? 92   ASN P ND2   1 
ATOM   8788  N N     . ILE E 1 41  ? 281.312 11.002  39.926 1.00 46.14 ? 93   ILE P N     1 
ATOM   8789  C CA    . ILE E 1 41  ? 282.166 11.019  41.096 1.00 46.91 ? 93   ILE P CA    1 
ATOM   8790  C C     . ILE E 1 41  ? 281.830 9.974   42.157 1.00 47.00 ? 93   ILE P C     1 
ATOM   8791  O O     . ILE E 1 41  ? 280.775 10.016  42.792 1.00 47.51 ? 93   ILE P O     1 
ATOM   8792  C CB    . ILE E 1 41  ? 282.161 12.448  41.706 1.00 47.46 ? 93   ILE P CB    1 
ATOM   8793  C CG1   . ILE E 1 41  ? 283.545 12.814  42.225 1.00 47.05 ? 93   ILE P CG1   1 
ATOM   8794  C CG2   . ILE E 1 41  ? 281.132 12.565  42.803 1.00 49.42 ? 93   ILE P CG2   1 
ATOM   8795  C CD1   . ILE E 1 41  ? 284.077 14.089  41.567 1.00 46.39 ? 93   ILE P CD1   1 
ATOM   8796  N N     . ILE E 1 42  ? 282.727 9.009   42.315 1.00 47.45 ? 94   ILE P N     1 
ATOM   8797  C CA    . ILE E 1 42  ? 282.567 7.962   43.317 1.00 47.17 ? 94   ILE P CA    1 
ATOM   8798  C C     . ILE E 1 42  ? 283.388 8.524   44.484 1.00 46.09 ? 94   ILE P C     1 
ATOM   8799  O O     . ILE E 1 42  ? 284.527 8.941   44.309 1.00 46.03 ? 94   ILE P O     1 
ATOM   8800  C CB    . ILE E 1 42  ? 283.110 6.587   42.775 1.00 47.03 ? 94   ILE P CB    1 
ATOM   8801  C CG1   . ILE E 1 42  ? 282.836 5.461   43.768 1.00 48.07 ? 94   ILE P CG1   1 
ATOM   8802  C CG2   . ILE E 1 42  ? 284.583 6.673   42.488 1.00 48.21 ? 94   ILE P CG2   1 
ATOM   8803  C CD1   . ILE E 1 42  ? 283.728 5.472   44.987 1.00 47.10 ? 94   ILE P CD1   1 
ATOM   8804  N N     . LEU E 1 43  ? 282.796 8.576   45.666 1.00 45.38 ? 95   LEU P N     1 
ATOM   8805  C CA    . LEU E 1 43  ? 283.482 9.148   46.812 1.00 44.50 ? 95   LEU P CA    1 
ATOM   8806  C C     . LEU E 1 43  ? 283.478 8.217   48.019 1.00 43.94 ? 95   LEU P C     1 
ATOM   8807  O O     . LEU E 1 43  ? 282.456 7.615   48.334 1.00 42.40 ? 95   LEU P O     1 
ATOM   8808  C CB    . LEU E 1 43  ? 282.817 10.489  47.138 1.00 45.63 ? 95   LEU P CB    1 
ATOM   8809  C CG    . LEU E 1 43  ? 283.290 11.420  48.254 1.00 46.52 ? 95   LEU P CG    1 
ATOM   8810  C CD1   . LEU E 1 43  ? 282.850 12.843  47.919 1.00 47.12 ? 95   LEU P CD1   1 
ATOM   8811  C CD2   . LEU E 1 43  ? 282.724 10.975  49.595 1.00 46.87 ? 95   LEU P CD2   1 
ATOM   8812  N N     . SER E 1 44  ? 284.634 8.097   48.674 1.00 44.84 ? 96   SER P N     1 
ATOM   8813  C CA    . SER E 1 44  ? 284.796 7.243   49.852 1.00 46.06 ? 96   SER P CA    1 
ATOM   8814  C C     . SER E 1 44  ? 285.435 7.978   51.041 1.00 47.87 ? 96   SER P C     1 
ATOM   8815  O O     . SER E 1 44  ? 286.384 8.755   50.873 1.00 45.89 ? 96   SER P O     1 
ATOM   8816  C CB    . SER E 1 44  ? 285.647 6.016   49.500 1.00 45.68 ? 96   SER P CB    1 
ATOM   8817  O OG    . SER E 1 44  ? 284.971 5.150   48.604 1.00 46.74 ? 96   SER P OG    1 
ATOM   8818  N N     . ASN E 1 45  ? 284.905 7.712   52.238 1.00 50.77 ? 97   ASN P N     1 
ATOM   8819  C CA    . ASN E 1 45  ? 285.376 8.316   53.486 1.00 53.58 ? 97   ASN P CA    1 
ATOM   8820  C C     . ASN E 1 45  ? 286.314 7.345   54.189 1.00 54.83 ? 97   ASN P C     1 
ATOM   8821  O O     . ASN E 1 45  ? 286.065 6.145   54.213 1.00 54.95 ? 97   ASN P O     1 
ATOM   8822  C CB    . ASN E 1 45  ? 284.173 8.646   54.386 1.00 56.54 ? 97   ASN P CB    1 
ATOM   8823  C CG    . ASN E 1 45  ? 284.578 9.131   55.780 1.00 60.01 ? 97   ASN P CG    1 
ATOM   8824  O OD1   . ASN E 1 45  ? 285.350 10.084  55.934 1.00 61.88 ? 97   ASN P OD1   1 
ATOM   8825  N ND2   . ASN E 1 45  ? 284.040 8.477   56.804 1.00 60.83 ? 97   ASN P ND2   1 
ATOM   8826  N N     . SER E 1 46  ? 287.392 7.865   54.761 1.00 57.06 ? 98   SER P N     1 
ATOM   8827  C CA    . SER E 1 46  ? 288.363 7.018   55.439 1.00 59.50 ? 98   SER P CA    1 
ATOM   8828  C C     . SER E 1 46  ? 288.383 7.160   56.961 1.00 63.33 ? 98   SER P C     1 
ATOM   8829  O O     . SER E 1 46  ? 289.157 6.474   57.628 1.00 63.87 ? 98   SER P O     1 
ATOM   8830  C CB    . SER E 1 46  ? 289.770 7.282   54.876 1.00 57.53 ? 98   SER P CB    1 
ATOM   8831  O OG    . SER E 1 46  ? 290.200 8.616   55.099 1.00 54.59 ? 98   SER P OG    1 
ATOM   8832  N N     . ASP E 1 47  ? 287.538 8.034   57.512 1.00 67.20 ? 99   ASP P N     1 
ATOM   8833  C CA    . ASP E 1 47  ? 287.486 8.247   58.966 1.00 70.96 ? 99   ASP P CA    1 
ATOM   8834  C C     . ASP E 1 47  ? 288.878 8.501   59.521 1.00 72.75 ? 99   ASP P C     1 
ATOM   8835  O O     . ASP E 1 47  ? 289.127 8.279   60.708 1.00 73.10 ? 99   ASP P O     1 
ATOM   8836  C CB    . ASP E 1 47  ? 286.921 7.023   59.697 1.00 72.40 ? 99   ASP P CB    1 
ATOM   8837  C CG    . ASP E 1 47  ? 285.471 6.753   59.365 1.00 74.18 ? 99   ASP P CG    1 
ATOM   8838  O OD1   . ASP E 1 47  ? 284.635 7.668   59.541 1.00 74.69 ? 99   ASP P OD1   1 
ATOM   8839  O OD2   . ASP E 1 47  ? 285.171 5.616   58.936 1.00 74.56 ? 99   ASP P OD2   1 
ATOM   8840  N N     . GLN E 1 48  ? 289.784 8.959   58.665 1.00 74.80 ? 100  GLN P N     1 
ATOM   8841  C CA    . GLN E 1 48  ? 291.153 9.211   59.083 1.00 76.60 ? 100  GLN P CA    1 
ATOM   8842  C C     . GLN E 1 48  ? 291.673 7.889   59.661 1.00 76.88 ? 100  GLN P C     1 
ATOM   8843  O O     . GLN E 1 48  ? 291.690 7.694   60.883 1.00 76.71 ? 100  GLN P O     1 
ATOM   8844  C CB    . GLN E 1 48  ? 291.187 10.322  60.146 1.00 78.54 ? 100  GLN P CB    1 
ATOM   8845  C CG    . GLN E 1 48  ? 292.572 10.954  60.374 1.00 81.22 ? 100  GLN P CG    1 
ATOM   8846  C CD    . GLN E 1 48  ? 293.086 11.755  59.169 1.00 82.11 ? 100  GLN P CD    1 
ATOM   8847  O OE1   . GLN E 1 48  ? 294.254 12.163  59.128 1.00 82.54 ? 100  GLN P OE1   1 
ATOM   8848  N NE2   . GLN E 1 48  ? 292.214 11.988  58.191 1.00 82.15 ? 100  GLN P NE2   1 
ATOM   8849  N N     . ASN E 1 49  ? 292.062 6.976   58.770 1.00 76.42 ? 101  ASN P N     1 
ATOM   8850  C CA    . ASN E 1 49  ? 292.575 5.667   59.170 1.00 75.83 ? 101  ASN P CA    1 
ATOM   8851  C C     . ASN E 1 49  ? 293.562 5.077   58.161 1.00 75.92 ? 101  ASN P C     1 
ATOM   8852  O O     . ASN E 1 49  ? 293.187 4.741   57.035 1.00 75.63 ? 101  ASN P O     1 
ATOM   8853  C CB    . ASN E 1 49  ? 291.426 4.680   59.370 1.00 75.47 ? 101  ASN P CB    1 
ATOM   8854  C CG    . ASN E 1 49  ? 291.904 3.320   59.846 1.00 75.54 ? 101  ASN P CG    1 
ATOM   8855  O OD1   . ASN E 1 49  ? 292.669 2.636   59.157 1.00 74.60 ? 101  ASN P OD1   1 
ATOM   8856  N ND2   . ASN E 1 49  ? 291.458 2.921   61.031 1.00 75.34 ? 101  ASN P ND2   1 
ATOM   8857  N N     . GLN E 1 50  ? 294.816 4.945   58.594 1.00 75.18 ? 102  GLN P N     1 
ATOM   8858  C CA    . GLN E 1 50  ? 295.910 4.398   57.790 1.00 74.86 ? 102  GLN P CA    1 
ATOM   8859  C C     . GLN E 1 50  ? 295.501 3.302   56.804 1.00 75.25 ? 102  GLN P C     1 
ATOM   8860  O O     . GLN E 1 50  ? 295.685 3.434   55.589 1.00 74.79 ? 102  GLN P O     1 
ATOM   8861  C CB    . GLN E 1 50  ? 297.000 3.846   58.721 1.00 74.58 ? 102  GLN P CB    1 
ATOM   8862  C CG    . GLN E 1 50  ? 298.046 4.861   59.172 1.00 73.19 ? 102  GLN P CG    1 
ATOM   8863  C CD    . GLN E 1 50  ? 299.281 4.863   58.283 1.00 72.03 ? 102  GLN P CD    1 
ATOM   8864  O OE1   . GLN E 1 50  ? 300.096 3.944   58.322 1.00 71.28 ? 102  GLN P OE1   1 
ATOM   8865  N NE2   . GLN E 1 50  ? 299.418 5.897   57.474 1.00 72.88 ? 102  GLN P NE2   1 
ATOM   8866  N N     . ASP E 1 51  ? 294.953 2.215   57.340 1.00 75.68 ? 103  ASP P N     1 
ATOM   8867  C CA    . ASP E 1 51  ? 294.537 1.076   56.524 1.00 75.87 ? 103  ASP P CA    1 
ATOM   8868  C C     . ASP E 1 51  ? 293.330 1.329   55.624 1.00 74.70 ? 103  ASP P C     1 
ATOM   8869  O O     . ASP E 1 51  ? 293.295 0.852   54.486 1.00 73.78 ? 103  ASP P O     1 
ATOM   8870  C CB    . ASP E 1 51  ? 294.275 -0.140  57.423 1.00 77.20 ? 103  ASP P CB    1 
ATOM   8871  C CG    . ASP E 1 51  ? 295.559 -0.856  57.823 1.00 79.23 ? 103  ASP P CG    1 
ATOM   8872  O OD1   . ASP E 1 51  ? 296.233 -1.413  56.924 1.00 80.52 ? 103  ASP P OD1   1 
ATOM   8873  O OD2   . ASP E 1 51  ? 295.896 -0.858  59.030 1.00 79.76 ? 103  ASP P OD2   1 
ATOM   8874  N N     . LYS E 1 52  ? 292.339 2.064   56.124 1.00 73.43 ? 104  LYS P N     1 
ATOM   8875  C CA    . LYS E 1 52  ? 291.161 2.347   55.311 1.00 71.25 ? 104  LYS P CA    1 
ATOM   8876  C C     . LYS E 1 52  ? 291.596 3.265   54.165 1.00 69.47 ? 104  LYS P C     1 
ATOM   8877  O O     . LYS E 1 52  ? 290.979 3.266   53.099 1.00 68.31 ? 104  LYS P O     1 
ATOM   8878  C CB    . LYS E 1 52  ? 290.045 3.003   56.151 1.00 70.81 ? 104  LYS P CB    1 
ATOM   8879  C CG    . LYS E 1 52  ? 288.665 3.000   55.460 1.00 70.70 ? 104  LYS P CG    1 
ATOM   8880  C CD    . LYS E 1 52  ? 287.558 3.649   56.303 1.00 70.65 ? 104  LYS P CD    1 
ATOM   8881  C CE    . LYS E 1 52  ? 287.115 2.771   57.477 1.00 70.44 ? 104  LYS P CE    1 
ATOM   8882  N NZ    . LYS E 1 52  ? 286.438 1.509   57.041 1.00 69.37 ? 104  LYS P NZ    1 
ATOM   8883  N N     . GLU E 1 53  ? 292.668 4.031   54.386 1.00 68.02 ? 105  GLU P N     1 
ATOM   8884  C CA    . GLU E 1 53  ? 293.183 4.930   53.356 1.00 66.82 ? 105  GLU P CA    1 
ATOM   8885  C C     . GLU E 1 53  ? 293.886 4.107   52.273 1.00 66.87 ? 105  GLU P C     1 
ATOM   8886  O O     . GLU E 1 53  ? 293.797 4.425   51.088 1.00 66.09 ? 105  GLU P O     1 
ATOM   8887  C CB    . GLU E 1 53  ? 294.144 5.982   53.950 1.00 65.62 ? 105  GLU P CB    1 
ATOM   8888  C CG    . GLU E 1 53  ? 293.470 7.019   54.878 1.00 65.25 ? 105  GLU P CG    1 
ATOM   8889  C CD    . GLU E 1 53  ? 294.326 8.268   55.164 1.00 64.31 ? 105  GLU P CD    1 
ATOM   8890  O OE1   . GLU E 1 53  ? 295.508 8.122   55.545 1.00 62.75 ? 105  GLU P OE1   1 
ATOM   8891  O OE2   . GLU E 1 53  ? 293.803 9.400   55.022 1.00 63.54 ? 105  GLU P OE2   1 
ATOM   8892  N N     . LEU E 1 54  ? 294.572 3.040   52.672 1.00 67.54 ? 106  LEU P N     1 
ATOM   8893  C CA    . LEU E 1 54  ? 295.253 2.190   51.696 1.00 67.72 ? 106  LEU P CA    1 
ATOM   8894  C C     . LEU E 1 54  ? 294.228 1.213   51.126 1.00 67.42 ? 106  LEU P C     1 
ATOM   8895  O O     . LEU E 1 54  ? 294.335 0.796   49.977 1.00 67.91 ? 106  LEU P O     1 
ATOM   8896  C CB    . LEU E 1 54  ? 296.409 1.423   52.354 1.00 68.92 ? 106  LEU P CB    1 
ATOM   8897  C CG    . LEU E 1 54  ? 297.549 0.828   51.502 1.00 69.79 ? 106  LEU P CG    1 
ATOM   8898  C CD1   . LEU E 1 54  ? 297.030 -0.243  50.545 1.00 69.67 ? 106  LEU P CD1   1 
ATOM   8899  C CD2   . LEU E 1 54  ? 298.239 1.944   50.732 1.00 70.05 ? 106  LEU P CD2   1 
ATOM   8900  N N     . HIS E 1 55  ? 293.235 0.855   51.940 1.00 67.63 ? 107  HIS P N     1 
ATOM   8901  C CA    . HIS E 1 55  ? 292.170 -0.057  51.520 1.00 67.48 ? 107  HIS P CA    1 
ATOM   8902  C C     . HIS E 1 55  ? 291.333 0.640   50.444 1.00 67.22 ? 107  HIS P C     1 
ATOM   8903  O O     . HIS E 1 55  ? 291.176 0.129   49.334 1.00 66.16 ? 107  HIS P O     1 
ATOM   8904  C CB    . HIS E 1 55  ? 291.275 -0.420  52.714 1.00 67.79 ? 107  HIS P CB    1 
ATOM   8905  C CG    . HIS E 1 55  ? 290.225 -1.446  52.400 1.00 67.99 ? 107  HIS P CG    1 
ATOM   8906  N ND1   . HIS E 1 55  ? 290.499 -2.796  52.329 1.00 67.68 ? 107  HIS P ND1   1 
ATOM   8907  C CD2   . HIS E 1 55  ? 288.906 -1.315  52.119 1.00 67.26 ? 107  HIS P CD2   1 
ATOM   8908  C CE1   . HIS E 1 55  ? 289.394 -3.452  52.017 1.00 67.54 ? 107  HIS P CE1   1 
ATOM   8909  N NE2   . HIS E 1 55  ? 288.414 -2.577  51.884 1.00 67.17 ? 107  HIS P NE2   1 
ATOM   8910  N N     . LEU E 1 56  ? 290.797 1.809   50.786 1.00 67.37 ? 108  LEU P N     1 
ATOM   8911  C CA    . LEU E 1 56  ? 289.997 2.586   49.849 1.00 68.40 ? 108  LEU P CA    1 
ATOM   8912  C C     . LEU E 1 56  ? 290.851 2.970   48.635 1.00 69.37 ? 108  LEU P C     1 
ATOM   8913  O O     . LEU E 1 56  ? 290.326 3.312   47.574 1.00 69.71 ? 108  LEU P O     1 
ATOM   8914  C CB    . LEU E 1 56  ? 289.463 3.855   50.522 1.00 67.28 ? 108  LEU P CB    1 
ATOM   8915  C CG    . LEU E 1 56  ? 288.515 3.718   51.716 1.00 66.96 ? 108  LEU P CG    1 
ATOM   8916  C CD1   . LEU E 1 56  ? 288.120 5.105   52.184 1.00 66.09 ? 108  LEU P CD1   1 
ATOM   8917  C CD2   . LEU E 1 56  ? 287.282 2.922   51.336 1.00 66.69 ? 108  LEU P CD2   1 
ATOM   8918  N N     . LEU E 1 57  ? 292.170 2.905   48.801 1.00 70.36 ? 109  LEU P N     1 
ATOM   8919  C CA    . LEU E 1 57  ? 293.118 3.241   47.738 1.00 70.26 ? 109  LEU P CA    1 
ATOM   8920  C C     . LEU E 1 57  ? 293.107 2.173   46.637 1.00 70.15 ? 109  LEU P C     1 
ATOM   8921  O O     . LEU E 1 57  ? 293.363 2.474   45.467 1.00 70.42 ? 109  LEU P O     1 
ATOM   8922  C CB    . LEU E 1 57  ? 294.530 3.374   48.330 1.00 69.89 ? 109  LEU P CB    1 
ATOM   8923  C CG    . LEU E 1 57  ? 295.398 4.598   48.009 1.00 69.08 ? 109  LEU P CG    1 
ATOM   8924  C CD1   . LEU E 1 57  ? 294.704 5.880   48.444 1.00 67.89 ? 109  LEU P CD1   1 
ATOM   8925  C CD2   . LEU E 1 57  ? 296.734 4.454   48.725 1.00 68.78 ? 109  LEU P CD2   1 
ATOM   8926  N N     . ASN E 1 58  ? 292.805 0.931   47.020 1.00 69.62 ? 110  ASN P N     1 
ATOM   8927  C CA    . ASN E 1 58  ? 292.752 -0.191  46.077 1.00 69.70 ? 110  ASN P CA    1 
ATOM   8928  C C     . ASN E 1 58  ? 291.317 -0.566  45.709 1.00 68.62 ? 110  ASN P C     1 
ATOM   8929  O O     . ASN E 1 58  ? 291.095 -1.328  44.770 1.00 66.96 ? 110  ASN P O     1 
ATOM   8930  C CB    . ASN E 1 58  ? 293.468 -1.421  46.657 1.00 71.25 ? 110  ASN P CB    1 
ATOM   8931  C CG    . ASN E 1 58  ? 294.968 -1.204  46.822 1.00 72.58 ? 110  ASN P CG    1 
ATOM   8932  O OD1   . ASN E 1 58  ? 295.668 -0.877  45.858 1.00 72.33 ? 110  ASN P OD1   1 
ATOM   8933  N ND2   . ASN E 1 58  ? 295.469 -1.388  48.046 1.00 72.04 ? 110  ASN P ND2   1 
ATOM   8934  N N     . ASN E 1 59  ? 290.356 -0.032  46.465 1.00 68.94 ? 111  ASN P N     1 
ATOM   8935  C CA    . ASN E 1 59  ? 288.925 -0.271  46.231 1.00 68.68 ? 111  ASN P CA    1 
ATOM   8936  C C     . ASN E 1 59  ? 288.452 0.561   45.047 1.00 67.92 ? 111  ASN P C     1 
ATOM   8937  O O     . ASN E 1 59  ? 287.462 0.228   44.393 1.00 66.78 ? 111  ASN P O     1 
ATOM   8938  C CB    . ASN E 1 59  ? 288.101 0.102   47.471 1.00 68.80 ? 111  ASN P CB    1 
ATOM   8939  C CG    . ASN E 1 59  ? 287.811 -1.093  48.367 1.00 70.28 ? 111  ASN P CG    1 
ATOM   8940  O OD1   . ASN E 1 59  ? 287.413 -0.932  49.522 1.00 70.24 ? 111  ASN P OD1   1 
ATOM   8941  N ND2   . ASN E 1 59  ? 287.998 -2.301  47.835 1.00 70.73 ? 111  ASN P ND2   1 
ATOM   8942  N N     . MET E 1 60  ? 289.171 1.650   44.791 1.00 68.58 ? 112  MET P N     1 
ATOM   8943  C CA    . MET E 1 60  ? 288.866 2.549   43.684 1.00 69.53 ? 112  MET P CA    1 
ATOM   8944  C C     . MET E 1 60  ? 289.314 1.928   42.357 1.00 69.81 ? 112  MET P C     1 
ATOM   8945  O O     . MET E 1 60  ? 288.699 2.157   41.313 1.00 68.76 ? 112  MET P O     1 
ATOM   8946  C CB    . MET E 1 60  ? 289.546 3.906   43.905 1.00 69.63 ? 112  MET P CB    1 
ATOM   8947  C CG    . MET E 1 60  ? 289.028 4.682   45.128 1.00 69.85 ? 112  MET P CG    1 
ATOM   8948  S SD    . MET E 1 60  ? 287.254 5.110   45.101 1.00 69.51 ? 112  MET P SD    1 
ATOM   8949  C CE    . MET E 1 60  ? 286.563 3.892   46.258 1.00 70.46 ? 112  MET P CE    1 
ATOM   8950  N N     . LEU E 1 61  ? 290.387 1.142   42.401 1.00 71.49 ? 113  LEU P N     1 
ATOM   8951  C CA    . LEU E 1 61  ? 290.867 0.467   41.201 1.00 72.90 ? 113  LEU P CA    1 
ATOM   8952  C C     . LEU E 1 61  ? 289.912 -0.685  40.902 1.00 72.60 ? 113  LEU P C     1 
ATOM   8953  O O     . LEU E 1 61  ? 289.601 -0.957  39.740 1.00 72.78 ? 113  LEU P O     1 
ATOM   8954  C CB    . LEU E 1 61  ? 292.291 -0.074  41.398 1.00 74.07 ? 113  LEU P CB    1 
ATOM   8955  C CG    . LEU E 1 61  ? 292.855 -1.027  40.324 1.00 75.93 ? 113  LEU P CG    1 
ATOM   8956  C CD1   . LEU E 1 61  ? 292.311 -2.442  40.542 1.00 76.57 ? 113  LEU P CD1   1 
ATOM   8957  C CD2   . LEU E 1 61  ? 292.531 -0.515  38.913 1.00 75.63 ? 113  LEU P CD2   1 
ATOM   8958  N N     . GLY E 1 62  ? 289.457 -1.361  41.955 1.00 72.12 ? 114  GLY P N     1 
ATOM   8959  C CA    . GLY E 1 62  ? 288.529 -2.462  41.776 1.00 72.23 ? 114  GLY P CA    1 
ATOM   8960  C C     . GLY E 1 62  ? 287.283 -1.937  41.090 1.00 72.66 ? 114  GLY P C     1 
ATOM   8961  O O     . GLY E 1 62  ? 286.615 -2.656  40.339 1.00 71.90 ? 114  GLY P O     1 
ATOM   8962  N N     . LYS E 1 63  ? 286.986 -0.664  41.351 1.00 73.04 ? 115  LYS P N     1 
ATOM   8963  C CA    . LYS E 1 63  ? 285.827 0.016   40.772 1.00 73.01 ? 115  LYS P CA    1 
ATOM   8964  C C     . LYS E 1 63  ? 286.170 0.746   39.473 1.00 72.75 ? 115  LYS P C     1 
ATOM   8965  O O     . LYS E 1 63  ? 285.544 1.747   39.130 1.00 73.82 ? 115  LYS P O     1 
ATOM   8966  C CB    . LYS E 1 63  ? 285.241 1.011   41.783 1.00 72.63 ? 115  LYS P CB    1 
ATOM   8967  C CG    . LYS E 1 63  ? 284.575 0.352   42.982 1.00 72.77 ? 115  LYS P CG    1 
ATOM   8968  C CD    . LYS E 1 63  ? 283.354 -0.454  42.552 1.00 72.69 ? 115  LYS P CD    1 
ATOM   8969  C CE    . LYS E 1 63  ? 282.798 -1.251  43.711 1.00 72.44 ? 115  LYS P CE    1 
ATOM   8970  N NZ    . LYS E 1 63  ? 282.533 -0.369  44.879 1.00 74.09 ? 115  LYS P NZ    1 
ATOM   8971  N N     . GLN E 1 64  ? 287.166 0.239   38.758 1.00 71.93 ? 116  GLN P N     1 
ATOM   8972  C CA    . GLN E 1 64  ? 287.590 0.830   37.498 1.00 71.28 ? 116  GLN P CA    1 
ATOM   8973  C C     . GLN E 1 64  ? 287.487 2.360   37.448 1.00 70.57 ? 116  GLN P C     1 
ATOM   8974  O O     . GLN E 1 64  ? 286.917 2.909   36.496 1.00 71.10 ? 116  GLN P O     1 
ATOM   8975  C CB    . GLN E 1 64  ? 286.773 0.243   36.337 1.00 72.33 ? 116  GLN P CB    1 
ATOM   8976  C CG    . GLN E 1 64  ? 287.007 -1.242  36.046 1.00 73.37 ? 116  GLN P CG    1 
ATOM   8977  C CD    . GLN E 1 64  ? 287.142 -1.535  34.543 1.00 74.35 ? 116  GLN P CD    1 
ATOM   8978  O OE1   . GLN E 1 64  ? 287.175 -2.698  34.119 1.00 73.70 ? 116  GLN P OE1   1 
ATOM   8979  N NE2   . GLN E 1 64  ? 287.235 -0.476  33.736 1.00 73.82 ? 116  GLN P NE2   1 
ATOM   8980  N N     . VAL E 1 65  ? 288.015 3.052   38.460 1.00 68.45 ? 117  VAL P N     1 
ATOM   8981  C CA    . VAL E 1 65  ? 287.978 4.518   38.450 1.00 66.10 ? 117  VAL P CA    1 
ATOM   8982  C C     . VAL E 1 65  ? 289.187 4.977   37.634 1.00 64.77 ? 117  VAL P C     1 
ATOM   8983  O O     . VAL E 1 65  ? 290.285 4.459   37.818 1.00 65.54 ? 117  VAL P O     1 
ATOM   8984  C CB    . VAL E 1 65  ? 288.044 5.105   39.878 1.00 65.55 ? 117  VAL P CB    1 
ATOM   8985  C CG1   . VAL E 1 65  ? 286.961 4.480   40.735 1.00 63.96 ? 117  VAL P CG1   1 
ATOM   8986  C CG2   . VAL E 1 65  ? 289.414 4.874   40.488 1.00 65.52 ? 117  VAL P CG2   1 
ATOM   8987  N N     . ASP E 1 66  ? 288.989 5.935   36.732 1.00 62.68 ? 118  ASP P N     1 
ATOM   8988  C CA    . ASP E 1 66  ? 290.067 6.409   35.860 1.00 61.45 ? 118  ASP P CA    1 
ATOM   8989  C C     . ASP E 1 66  ? 291.121 7.297   36.523 1.00 60.13 ? 118  ASP P C     1 
ATOM   8990  O O     . ASP E 1 66  ? 292.220 7.471   35.985 1.00 60.39 ? 118  ASP P O     1 
ATOM   8991  C CB    . ASP E 1 66  ? 289.478 7.144   34.648 1.00 62.75 ? 118  ASP P CB    1 
ATOM   8992  C CG    . ASP E 1 66  ? 288.416 6.323   33.917 1.00 63.24 ? 118  ASP P CG    1 
ATOM   8993  O OD1   . ASP E 1 66  ? 287.326 6.090   34.493 1.00 63.90 ? 118  ASP P OD1   1 
ATOM   8994  O OD2   . ASP E 1 66  ? 288.672 5.911   32.765 1.00 64.30 ? 118  ASP P OD2   1 
ATOM   8995  N N     . GLY E 1 67  ? 290.779 7.857   37.680 1.00 58.35 ? 119  GLY P N     1 
ATOM   8996  C CA    . GLY E 1 67  ? 291.697 8.716   38.409 1.00 54.46 ? 119  GLY P CA    1 
ATOM   8997  C C     . GLY E 1 67  ? 291.262 8.843   39.857 1.00 52.22 ? 119  GLY P C     1 
ATOM   8998  O O     . GLY E 1 67  ? 290.174 8.397   40.221 1.00 51.31 ? 119  GLY P O     1 
ATOM   8999  N N     . ILE E 1 68  ? 292.110 9.438   40.689 1.00 50.81 ? 120  ILE P N     1 
ATOM   9000  C CA    . ILE E 1 68  ? 291.786 9.620   42.103 1.00 48.01 ? 120  ILE P CA    1 
ATOM   9001  C C     . ILE E 1 68  ? 292.330 10.910  42.677 1.00 46.39 ? 120  ILE P C     1 
ATOM   9002  O O     . ILE E 1 68  ? 293.445 11.334  42.377 1.00 45.98 ? 120  ILE P O     1 
ATOM   9003  C CB    . ILE E 1 68  ? 292.340 8.479   42.990 1.00 47.57 ? 120  ILE P CB    1 
ATOM   9004  C CG1   . ILE E 1 68  ? 291.710 7.152   42.592 1.00 48.11 ? 120  ILE P CG1   1 
ATOM   9005  C CG2   . ILE E 1 68  ? 292.024 8.748   44.456 1.00 46.93 ? 120  ILE P CG2   1 
ATOM   9006  C CD1   . ILE E 1 68  ? 292.170 6.004   43.451 1.00 46.61 ? 120  ILE P CD1   1 
ATOM   9007  N N     . ILE E 1 69  ? 291.515 11.535  43.509 1.00 44.86 ? 121  ILE P N     1 
ATOM   9008  C CA    . ILE E 1 69  ? 291.908 12.751  44.187 1.00 42.83 ? 121  ILE P CA    1 
ATOM   9009  C C     . ILE E 1 69  ? 291.883 12.281  45.622 1.00 42.76 ? 121  ILE P C     1 
ATOM   9010  O O     . ILE E 1 69  ? 290.846 11.883  46.142 1.00 42.76 ? 121  ILE P O     1 
ATOM   9011  C CB    . ILE E 1 69  ? 290.913 13.881  43.910 1.00 40.87 ? 121  ILE P CB    1 
ATOM   9012  C CG1   . ILE E 1 69  ? 290.996 14.231  42.413 1.00 40.20 ? 121  ILE P CG1   1 
ATOM   9013  C CG2   . ILE E 1 69  ? 291.215 15.078  44.801 1.00 38.58 ? 121  ILE P CG2   1 
ATOM   9014  C CD1   . ILE E 1 69  ? 290.021 15.274  41.929 1.00 42.06 ? 121  ILE P CD1   1 
ATOM   9015  N N     . PHE E 1 70  ? 293.055 12.276  46.235 1.00 43.49 ? 122  PHE P N     1 
ATOM   9016  C CA    . PHE E 1 70  ? 293.213 11.798  47.592 1.00 44.84 ? 122  PHE P CA    1 
ATOM   9017  C C     . PHE E 1 70  ? 293.502 12.950  48.527 1.00 44.50 ? 122  PHE P C     1 
ATOM   9018  O O     . PHE E 1 70  ? 294.291 13.836  48.220 1.00 43.50 ? 122  PHE P O     1 
ATOM   9019  C CB    . PHE E 1 70  ? 294.353 10.767  47.620 1.00 47.30 ? 122  PHE P CB    1 
ATOM   9020  C CG    . PHE E 1 70  ? 294.609 10.150  48.968 1.00 50.48 ? 122  PHE P CG    1 
ATOM   9021  C CD1   . PHE E 1 70  ? 295.914 9.842   49.356 1.00 51.63 ? 122  PHE P CD1   1 
ATOM   9022  C CD2   . PHE E 1 70  ? 293.563 9.844   49.837 1.00 51.61 ? 122  PHE P CD2   1 
ATOM   9023  C CE1   . PHE E 1 70  ? 296.179 9.238   50.589 1.00 52.28 ? 122  PHE P CE1   1 
ATOM   9024  C CE2   . PHE E 1 70  ? 293.818 9.236   51.080 1.00 52.65 ? 122  PHE P CE2   1 
ATOM   9025  C CZ    . PHE E 1 70  ? 295.130 8.933   51.453 1.00 52.42 ? 122  PHE P CZ    1 
ATOM   9026  N N     . MET E 1 71  ? 292.818 12.935  49.661 1.00 46.47 ? 123  MET P N     1 
ATOM   9027  C CA    . MET E 1 71  ? 292.979 13.940  50.698 1.00 49.22 ? 123  MET P CA    1 
ATOM   9028  C C     . MET E 1 71  ? 293.363 13.189  51.965 1.00 50.48 ? 123  MET P C     1 
ATOM   9029  O O     . MET E 1 71  ? 292.804 12.143  52.280 1.00 51.26 ? 123  MET P O     1 
ATOM   9030  C CB    . MET E 1 71  ? 291.671 14.698  50.938 1.00 49.80 ? 123  MET P CB    1 
ATOM   9031  C CG    . MET E 1 71  ? 291.307 15.708  49.879 1.00 51.16 ? 123  MET P CG    1 
ATOM   9032  S SD    . MET E 1 71  ? 289.585 16.207  50.024 1.00 54.94 ? 123  MET P SD    1 
ATOM   9033  C CE    . MET E 1 71  ? 288.934 15.570  48.500 1.00 55.44 ? 123  MET P CE    1 
ATOM   9034  N N     . SER E 1 72  ? 294.320 13.719  52.699 1.00 52.51 ? 124  SER P N     1 
ATOM   9035  C CA    . SER E 1 72  ? 294.738 13.062  53.915 1.00 55.13 ? 124  SER P CA    1 
ATOM   9036  C C     . SER E 1 72  ? 295.328 14.142  54.813 1.00 57.06 ? 124  SER P C     1 
ATOM   9037  O O     . SER E 1 72  ? 295.946 15.101  54.335 1.00 57.47 ? 124  SER P O     1 
ATOM   9038  C CB    . SER E 1 72  ? 295.783 11.986  53.581 1.00 54.74 ? 124  SER P CB    1 
ATOM   9039  O OG    . SER E 1 72  ? 295.965 11.064  54.642 1.00 55.78 ? 124  SER P OG    1 
ATOM   9040  N N     . GLY E 1 73  ? 295.106 14.015  56.113 1.00 58.17 ? 125  GLY P N     1 
ATOM   9041  C CA    . GLY E 1 73  ? 295.668 14.996  57.016 1.00 59.25 ? 125  GLY P CA    1 
ATOM   9042  C C     . GLY E 1 73  ? 297.075 14.534  57.317 1.00 59.83 ? 125  GLY P C     1 
ATOM   9043  O O     . GLY E 1 73  ? 297.897 15.287  57.842 1.00 60.89 ? 125  GLY P O     1 
ATOM   9044  N N     . ASN E 1 74  ? 297.354 13.291  56.940 1.00 59.37 ? 126  ASN P N     1 
ATOM   9045  C CA    . ASN E 1 74  ? 298.646 12.693  57.200 1.00 59.82 ? 126  ASN P CA    1 
ATOM   9046  C C     . ASN E 1 74  ? 299.019 11.665  56.133 1.00 59.33 ? 126  ASN P C     1 
ATOM   9047  O O     . ASN E 1 74  ? 298.648 10.492  56.243 1.00 59.30 ? 126  ASN P O     1 
ATOM   9048  C CB    . ASN E 1 74  ? 298.591 12.010  58.568 1.00 62.17 ? 126  ASN P CB    1 
ATOM   9049  C CG    . ASN E 1 74  ? 299.970 11.760  59.167 1.00 64.56 ? 126  ASN P CG    1 
ATOM   9050  O OD1   . ASN E 1 74  ? 300.912 11.342  58.475 1.00 64.68 ? 126  ASN P OD1   1 
ATOM   9051  N ND2   . ASN E 1 74  ? 300.088 11.998  60.475 1.00 65.77 ? 126  ASN P ND2   1 
ATOM   9052  N N     . VAL E 1 75  ? 299.750 12.094  55.108 1.00 58.78 ? 127  VAL P N     1 
ATOM   9053  C CA    . VAL E 1 75  ? 300.177 11.176  54.054 1.00 58.85 ? 127  VAL P CA    1 
ATOM   9054  C C     . VAL E 1 75  ? 301.518 10.587  54.452 1.00 59.86 ? 127  VAL P C     1 
ATOM   9055  O O     . VAL E 1 75  ? 302.534 11.278  54.449 1.00 59.34 ? 127  VAL P O     1 
ATOM   9056  C CB    . VAL E 1 75  ? 300.342 11.874  52.693 1.00 57.43 ? 127  VAL P CB    1 
ATOM   9057  C CG1   . VAL E 1 75  ? 300.828 10.871  51.661 1.00 56.87 ? 127  VAL P CG1   1 
ATOM   9058  C CG2   . VAL E 1 75  ? 299.030 12.467  52.252 1.00 55.87 ? 127  VAL P CG2   1 
ATOM   9059  N N     . THR E 1 76  ? 301.515 9.303   54.788 1.00 61.94 ? 128  THR P N     1 
ATOM   9060  C CA    . THR E 1 76  ? 302.732 8.630   55.219 1.00 62.77 ? 128  THR P CA    1 
ATOM   9061  C C     . THR E 1 76  ? 303.548 8.042   54.078 1.00 64.48 ? 128  THR P C     1 
ATOM   9062  O O     . THR E 1 76  ? 303.058 7.873   52.955 1.00 64.39 ? 128  THR P O     1 
ATOM   9063  C CB    . THR E 1 76  ? 302.417 7.493   56.220 1.00 62.04 ? 128  THR P CB    1 
ATOM   9064  O OG1   . THR E 1 76  ? 301.895 6.358   55.513 1.00 61.13 ? 128  THR P OG1   1 
ATOM   9065  C CG2   . THR E 1 76  ? 301.402 7.971   57.257 1.00 59.42 ? 128  THR P CG2   1 
ATOM   9066  N N     . GLU E 1 77  ? 304.806 7.743   54.388 1.00 66.52 ? 129  GLU P N     1 
ATOM   9067  C CA    . GLU E 1 77  ? 305.734 7.154   53.433 1.00 68.28 ? 129  GLU P CA    1 
ATOM   9068  C C     . GLU E 1 77  ? 305.235 5.761   53.101 1.00 69.42 ? 129  GLU P C     1 
ATOM   9069  O O     . GLU E 1 77  ? 305.608 5.185   52.080 1.00 69.03 ? 129  GLU P O     1 
ATOM   9070  C CB    . GLU E 1 77  ? 307.143 7.089   54.025 1.00 69.29 ? 129  GLU P CB    1 
ATOM   9071  C CG    . GLU E 1 77  ? 307.220 6.522   55.442 1.00 72.06 ? 129  GLU P CG    1 
ATOM   9072  C CD    . GLU E 1 77  ? 306.486 7.379   56.474 1.00 73.26 ? 129  GLU P CD    1 
ATOM   9073  O OE1   . GLU E 1 77  ? 305.322 7.060   56.800 1.00 73.23 ? 129  GLU P OE1   1 
ATOM   9074  O OE2   . GLU E 1 77  ? 307.070 8.377   56.954 1.00 75.00 ? 129  GLU P OE2   1 
ATOM   9075  N N     . GLU E 1 78  ? 304.394 5.224   53.984 1.00 70.66 ? 130  GLU P N     1 
ATOM   9076  C CA    . GLU E 1 78  ? 303.801 3.912   53.779 1.00 71.49 ? 130  GLU P CA    1 
ATOM   9077  C C     . GLU E 1 78  ? 302.844 4.076   52.612 1.00 71.59 ? 130  GLU P C     1 
ATOM   9078  O O     . GLU E 1 78  ? 302.831 3.280   51.668 1.00 71.91 ? 130  GLU P O     1 
ATOM   9079  C CB    . GLU E 1 78  ? 303.018 3.480   55.016 1.00 72.75 ? 130  GLU P CB    1 
ATOM   9080  C CG    . GLU E 1 78  ? 303.877 2.982   56.157 1.00 75.36 ? 130  GLU P CG    1 
ATOM   9081  C CD    . GLU E 1 78  ? 303.056 2.290   57.234 1.00 76.85 ? 130  GLU P CD    1 
ATOM   9082  O OE1   . GLU E 1 78  ? 302.140 1.515   56.872 1.00 77.21 ? 130  GLU P OE1   1 
ATOM   9083  O OE2   . GLU E 1 78  ? 303.331 2.509   58.436 1.00 77.89 ? 130  GLU P OE2   1 
ATOM   9084  N N     . HIS E 1 79  ? 302.047 5.133   52.695 1.00 71.23 ? 131  HIS P N     1 
ATOM   9085  C CA    . HIS E 1 79  ? 301.079 5.452   51.663 1.00 71.14 ? 131  HIS P CA    1 
ATOM   9086  C C     . HIS E 1 79  ? 301.774 5.599   50.322 1.00 70.48 ? 131  HIS P C     1 
ATOM   9087  O O     . HIS E 1 79  ? 301.689 4.717   49.471 1.00 70.18 ? 131  HIS P O     1 
ATOM   9088  C CB    . HIS E 1 79  ? 300.356 6.755   52.012 1.00 71.87 ? 131  HIS P CB    1 
ATOM   9089  C CG    . HIS E 1 79  ? 299.423 6.633   53.177 1.00 72.27 ? 131  HIS P CG    1 
ATOM   9090  N ND1   . HIS E 1 79  ? 298.884 7.728   53.816 1.00 72.66 ? 131  HIS P ND1   1 
ATOM   9091  C CD2   . HIS E 1 79  ? 298.920 5.544   53.806 1.00 72.19 ? 131  HIS P CD2   1 
ATOM   9092  C CE1   . HIS E 1 79  ? 298.089 7.320   54.789 1.00 73.09 ? 131  HIS P CE1   1 
ATOM   9093  N NE2   . HIS E 1 79  ? 298.093 5.999   54.804 1.00 72.75 ? 131  HIS P NE2   1 
ATOM   9094  N N     . VAL E 1 80  ? 302.474 6.718   50.160 1.00 70.77 ? 132  VAL P N     1 
ATOM   9095  C CA    . VAL E 1 80  ? 303.191 7.047   48.930 1.00 70.88 ? 132  VAL P CA    1 
ATOM   9096  C C     . VAL E 1 80  ? 303.848 5.865   48.216 1.00 71.54 ? 132  VAL P C     1 
ATOM   9097  O O     . VAL E 1 80  ? 303.952 5.860   46.984 1.00 71.07 ? 132  VAL P O     1 
ATOM   9098  C CB    . VAL E 1 80  ? 304.258 8.142   49.196 1.00 69.87 ? 132  VAL P CB    1 
ATOM   9099  C CG1   . VAL E 1 80  ? 305.259 7.661   50.228 1.00 70.21 ? 132  VAL P CG1   1 
ATOM   9100  C CG2   . VAL E 1 80  ? 304.948 8.521   47.901 1.00 68.33 ? 132  VAL P CG2   1 
ATOM   9101  N N     . GLU E 1 81  ? 304.282 4.864   48.978 1.00 73.29 ? 133  GLU P N     1 
ATOM   9102  C CA    . GLU E 1 81  ? 304.921 3.692   48.383 1.00 74.60 ? 133  GLU P CA    1 
ATOM   9103  C C     . GLU E 1 81  ? 303.888 2.900   47.587 1.00 74.78 ? 133  GLU P C     1 
ATOM   9104  O O     . GLU E 1 81  ? 304.090 2.631   46.402 1.00 74.36 ? 133  GLU P O     1 
ATOM   9105  C CB    . GLU E 1 81  ? 305.533 2.802   49.465 1.00 75.28 ? 133  GLU P CB    1 
ATOM   9106  C CG    . GLU E 1 81  ? 306.638 1.877   48.966 1.00 76.37 ? 133  GLU P CG    1 
ATOM   9107  C CD    . GLU E 1 81  ? 306.968 0.789   49.975 1.00 77.73 ? 133  GLU P CD    1 
ATOM   9108  O OE1   . GLU E 1 81  ? 306.066 -0.027  50.264 1.00 78.79 ? 133  GLU P OE1   1 
ATOM   9109  O OE2   . GLU E 1 81  ? 308.115 0.748   50.483 1.00 77.83 ? 133  GLU P OE2   1 
ATOM   9110  N N     . GLU E 1 82  ? 302.784 2.528   48.236 1.00 75.12 ? 134  GLU P N     1 
ATOM   9111  C CA    . GLU E 1 82  ? 301.728 1.784   47.557 1.00 75.81 ? 134  GLU P CA    1 
ATOM   9112  C C     . GLU E 1 82  ? 300.873 2.737   46.740 1.00 75.42 ? 134  GLU P C     1 
ATOM   9113  O O     . GLU E 1 82  ? 300.119 2.325   45.859 1.00 75.28 ? 134  GLU P O     1 
ATOM   9114  C CB    . GLU E 1 82  ? 300.860 1.030   48.567 1.00 76.92 ? 134  GLU P CB    1 
ATOM   9115  C CG    . GLU E 1 82  ? 301.542 -0.216  49.113 1.00 79.55 ? 134  GLU P CG    1 
ATOM   9116  C CD    . GLU E 1 82  ? 300.635 -1.063  49.978 1.00 81.17 ? 134  GLU P CD    1 
ATOM   9117  O OE1   . GLU E 1 82  ? 299.602 -1.548  49.469 1.00 82.93 ? 134  GLU P OE1   1 
ATOM   9118  O OE2   . GLU E 1 82  ? 300.960 -1.247  51.168 1.00 81.88 ? 134  GLU P OE2   1 
ATOM   9119  N N     . LEU E 1 83  ? 301.027 4.022   47.034 1.00 75.25 ? 135  LEU P N     1 
ATOM   9120  C CA    . LEU E 1 83  ? 300.290 5.085   46.368 1.00 74.58 ? 135  LEU P CA    1 
ATOM   9121  C C     . LEU E 1 83  ? 301.049 5.551   45.138 1.00 73.83 ? 135  LEU P C     1 
ATOM   9122  O O     . LEU E 1 83  ? 300.677 6.540   44.514 1.00 74.12 ? 135  LEU P O     1 
ATOM   9123  C CB    . LEU E 1 83  ? 300.099 6.252   47.343 1.00 75.20 ? 135  LEU P CB    1 
ATOM   9124  C CG    . LEU E 1 83  ? 299.226 7.464   47.010 1.00 75.30 ? 135  LEU P CG    1 
ATOM   9125  C CD1   . LEU E 1 83  ? 297.789 7.034   46.750 1.00 75.11 ? 135  LEU P CD1   1 
ATOM   9126  C CD2   . LEU E 1 83  ? 299.283 8.437   48.187 1.00 75.77 ? 135  LEU P CD2   1 
ATOM   9127  N N     . LYS E 1 84  ? 302.123 4.840   44.805 1.00 73.21 ? 136  LYS P N     1 
ATOM   9128  C CA    . LYS E 1 84  ? 302.931 5.173   43.636 1.00 72.51 ? 136  LYS P CA    1 
ATOM   9129  C C     . LYS E 1 84  ? 303.014 3.949   42.730 1.00 71.50 ? 136  LYS P C     1 
ATOM   9130  O O     . LYS E 1 84  ? 303.599 3.989   41.650 1.00 70.49 ? 136  LYS P O     1 
ATOM   9131  C CB    . LYS E 1 84  ? 304.337 5.614   44.057 1.00 72.90 ? 136  LYS P CB    1 
ATOM   9132  C CG    . LYS E 1 84  ? 305.145 6.260   42.927 1.00 73.78 ? 136  LYS P CG    1 
ATOM   9133  C CD    . LYS E 1 84  ? 306.581 6.540   43.341 1.00 74.30 ? 136  LYS P CD    1 
ATOM   9134  C CE    . LYS E 1 84  ? 306.657 7.538   44.486 1.00 75.20 ? 136  LYS P CE    1 
ATOM   9135  N NZ    . LYS E 1 84  ? 308.005 7.545   45.138 1.00 75.75 ? 136  LYS P NZ    1 
ATOM   9136  N N     . LYS E 1 85  ? 302.426 2.856   43.199 1.00 71.70 ? 137  LYS P N     1 
ATOM   9137  C CA    . LYS E 1 85  ? 302.386 1.607   42.450 1.00 71.55 ? 137  LYS P CA    1 
ATOM   9138  C C     . LYS E 1 85  ? 300.965 1.465   41.909 1.00 70.63 ? 137  LYS P C     1 
ATOM   9139  O O     . LYS E 1 85  ? 300.616 0.472   41.261 1.00 69.96 ? 137  LYS P O     1 
ATOM   9140  C CB    . LYS E 1 85  ? 302.742 0.426   43.366 1.00 72.88 ? 137  LYS P CB    1 
ATOM   9141  C CG    . LYS E 1 85  ? 304.193 0.448   43.848 1.00 74.67 ? 137  LYS P CG    1 
ATOM   9142  C CD    . LYS E 1 85  ? 304.569 -0.785  44.670 1.00 76.61 ? 137  LYS P CD    1 
ATOM   9143  C CE    . LYS E 1 85  ? 306.042 -0.731  45.090 1.00 77.48 ? 137  LYS P CE    1 
ATOM   9144  N NZ    . LYS E 1 85  ? 306.499 -1.944  45.836 1.00 77.56 ? 137  LYS P NZ    1 
ATOM   9145  N N     . SER E 1 86  ? 300.152 2.484   42.184 1.00 69.73 ? 138  SER P N     1 
ATOM   9146  C CA    . SER E 1 86  ? 298.763 2.518   41.741 1.00 68.40 ? 138  SER P CA    1 
ATOM   9147  C C     . SER E 1 86  ? 298.677 2.271   40.240 1.00 67.92 ? 138  SER P C     1 
ATOM   9148  O O     . SER E 1 86  ? 299.572 2.653   39.480 1.00 67.81 ? 138  SER P O     1 
ATOM   9149  C CB    . SER E 1 86  ? 298.131 3.879   42.070 1.00 68.14 ? 138  SER P CB    1 
ATOM   9150  O OG    . SER E 1 86  ? 296.816 3.983   41.540 1.00 65.55 ? 138  SER P OG    1 
ATOM   9151  N N     . PRO E 1 87  ? 297.598 1.613   39.797 1.00 67.13 ? 139  PRO P N     1 
ATOM   9152  C CA    . PRO E 1 87  ? 297.369 1.303   38.383 1.00 66.01 ? 139  PRO P CA    1 
ATOM   9153  C C     . PRO E 1 87  ? 296.725 2.491   37.666 1.00 64.99 ? 139  PRO P C     1 
ATOM   9154  O O     . PRO E 1 87  ? 296.676 2.530   36.436 1.00 65.81 ? 139  PRO P O     1 
ATOM   9155  C CB    . PRO E 1 87  ? 296.437 0.109   38.454 1.00 66.52 ? 139  PRO P CB    1 
ATOM   9156  C CG    . PRO E 1 87  ? 295.573 0.479   39.623 1.00 66.67 ? 139  PRO P CG    1 
ATOM   9157  C CD    . PRO E 1 87  ? 296.582 0.962   40.644 1.00 66.67 ? 139  PRO P CD    1 
ATOM   9158  N N     . VAL E 1 88  ? 296.218 3.443   38.453 1.00 63.09 ? 140  VAL P N     1 
ATOM   9159  C CA    . VAL E 1 88  ? 295.581 4.656   37.934 1.00 60.19 ? 140  VAL P CA    1 
ATOM   9160  C C     . VAL E 1 88  ? 296.084 5.905   38.663 1.00 58.38 ? 140  VAL P C     1 
ATOM   9161  O O     . VAL E 1 88  ? 296.357 5.868   39.867 1.00 57.82 ? 140  VAL P O     1 
ATOM   9162  C CB    . VAL E 1 88  ? 294.045 4.598   38.077 1.00 60.01 ? 140  VAL P CB    1 
ATOM   9163  C CG1   . VAL E 1 88  ? 293.468 3.615   37.064 1.00 59.36 ? 140  VAL P CG1   1 
ATOM   9164  C CG2   . VAL E 1 88  ? 293.673 4.198   39.501 1.00 58.49 ? 140  VAL P CG2   1 
ATOM   9165  N N     . PRO E 1 89  ? 296.201 7.030   37.937 1.00 56.34 ? 141  PRO P N     1 
ATOM   9166  C CA    . PRO E 1 89  ? 296.670 8.304   38.487 1.00 55.35 ? 141  PRO P CA    1 
ATOM   9167  C C     . PRO E 1 89  ? 296.070 8.656   39.845 1.00 54.04 ? 141  PRO P C     1 
ATOM   9168  O O     . PRO E 1 89  ? 295.094 8.047   40.292 1.00 53.99 ? 141  PRO P O     1 
ATOM   9169  C CB    . PRO E 1 89  ? 296.276 9.312   37.410 1.00 55.66 ? 141  PRO P CB    1 
ATOM   9170  C CG    . PRO E 1 89  ? 296.410 8.522   36.163 1.00 56.16 ? 141  PRO P CG    1 
ATOM   9171  C CD    . PRO E 1 89  ? 295.775 7.199   36.537 1.00 56.24 ? 141  PRO P CD    1 
ATOM   9172  N N     . VAL E 1 90  ? 296.668 9.653   40.487 1.00 51.92 ? 142  VAL P N     1 
ATOM   9173  C CA    . VAL E 1 90  ? 296.234 10.116  41.793 1.00 49.17 ? 142  VAL P CA    1 
ATOM   9174  C C     . VAL E 1 90  ? 296.984 11.386  42.140 1.00 47.27 ? 142  VAL P C     1 
ATOM   9175  O O     . VAL E 1 90  ? 298.205 11.437  42.035 1.00 48.12 ? 142  VAL P O     1 
ATOM   9176  C CB    . VAL E 1 90  ? 296.509 9.056   42.890 1.00 48.68 ? 142  VAL P CB    1 
ATOM   9177  C CG1   . VAL E 1 90  ? 297.899 8.484   42.714 1.00 47.28 ? 142  VAL P CG1   1 
ATOM   9178  C CG2   . VAL E 1 90  ? 296.357 9.683   44.281 1.00 47.59 ? 142  VAL P CG2   1 
ATOM   9179  N N     . VAL E 1 91  ? 296.237 12.412  42.531 1.00 44.72 ? 143  VAL P N     1 
ATOM   9180  C CA    . VAL E 1 91  ? 296.807 13.695  42.918 1.00 40.90 ? 143  VAL P CA    1 
ATOM   9181  C C     . VAL E 1 91  ? 296.163 14.092  44.243 1.00 39.79 ? 143  VAL P C     1 
ATOM   9182  O O     . VAL E 1 91  ? 294.953 13.969  44.424 1.00 39.71 ? 143  VAL P O     1 
ATOM   9183  C CB    . VAL E 1 91  ? 296.568 14.798  41.823 1.00 39.59 ? 143  VAL P CB    1 
ATOM   9184  C CG1   . VAL E 1 91  ? 295.468 14.378  40.880 1.00 39.38 ? 143  VAL P CG1   1 
ATOM   9185  C CG2   . VAL E 1 91  ? 296.210 16.129  42.468 1.00 38.36 ? 143  VAL P CG2   1 
ATOM   9186  N N     . LEU E 1 92  ? 296.988 14.541  45.178 1.00 37.95 ? 144  LEU P N     1 
ATOM   9187  C CA    . LEU E 1 92  ? 296.514 14.947  46.487 1.00 36.55 ? 144  LEU P CA    1 
ATOM   9188  C C     . LEU E 1 92  ? 295.946 16.348  46.416 1.00 35.35 ? 144  LEU P C     1 
ATOM   9189  O O     . LEU E 1 92  ? 296.426 17.169  45.645 1.00 33.84 ? 144  LEU P O     1 
ATOM   9190  C CB    . LEU E 1 92  ? 297.673 14.928  47.478 1.00 37.11 ? 144  LEU P CB    1 
ATOM   9191  C CG    . LEU E 1 92  ? 298.587 13.710  47.348 1.00 37.91 ? 144  LEU P CG    1 
ATOM   9192  C CD1   . LEU E 1 92  ? 299.786 13.894  48.254 1.00 37.52 ? 144  LEU P CD1   1 
ATOM   9193  C CD2   . LEU E 1 92  ? 297.829 12.431  47.693 1.00 37.09 ? 144  LEU P CD2   1 
ATOM   9194  N N     . ALA E 1 93  ? 294.915 16.615  47.209 1.00 35.09 ? 145  ALA P N     1 
ATOM   9195  C CA    . ALA E 1 93  ? 294.316 17.940  47.249 1.00 35.66 ? 145  ALA P CA    1 
ATOM   9196  C C     . ALA E 1 93  ? 294.323 18.428  48.689 1.00 37.83 ? 145  ALA P C     1 
ATOM   9197  O O     . ALA E 1 93  ? 293.941 17.695  49.603 1.00 38.59 ? 145  ALA P O     1 
ATOM   9198  C CB    . ALA E 1 93  ? 292.915 17.890  46.730 1.00 36.70 ? 145  ALA P CB    1 
ATOM   9199  N N     . ALA E 1 94  ? 294.764 19.663  48.904 1.00 39.72 ? 146  ALA P N     1 
ATOM   9200  C CA    . ALA E 1 94  ? 294.815 20.212  50.258 1.00 41.46 ? 146  ALA P CA    1 
ATOM   9201  C C     . ALA E 1 94  ? 295.398 19.174  51.198 1.00 42.20 ? 146  ALA P C     1 
ATOM   9202  O O     . ALA E 1 94  ? 294.964 19.032  52.332 1.00 44.44 ? 146  ALA P O     1 
ATOM   9203  C CB    . ALA E 1 94  ? 293.418 20.611  50.733 1.00 40.41 ? 146  ALA P CB    1 
ATOM   9204  N N     . SER E 1 95  ? 296.366 18.422  50.710 1.00 43.14 ? 147  SER P N     1 
ATOM   9205  C CA    . SER E 1 95  ? 297.001 17.427  51.540 1.00 45.49 ? 147  SER P CA    1 
ATOM   9206  C C     . SER E 1 95  ? 298.489 17.655  51.506 1.00 47.25 ? 147  SER P C     1 
ATOM   9207  O O     . SER E 1 95  ? 299.022 18.167  50.527 1.00 50.59 ? 147  SER P O     1 
ATOM   9208  C CB    . SER E 1 95  ? 296.680 16.028  51.037 1.00 44.83 ? 147  SER P CB    1 
ATOM   9209  O OG    . SER E 1 95  ? 295.339 15.715  51.344 1.00 45.87 ? 147  SER P OG    1 
ATOM   9210  N N     . ILE E 1 96  ? 299.168 17.306  52.583 1.00 48.24 ? 148  ILE P N     1 
ATOM   9211  C CA    . ILE E 1 96  ? 300.600 17.474  52.596 1.00 49.77 ? 148  ILE P CA    1 
ATOM   9212  C C     . ILE E 1 96  ? 301.267 16.134  52.791 1.00 51.00 ? 148  ILE P C     1 
ATOM   9213  O O     . ILE E 1 96  ? 300.852 15.325  53.621 1.00 50.07 ? 148  ILE P O     1 
ATOM   9214  C CB    . ILE E 1 96  ? 301.073 18.490  53.688 1.00 50.20 ? 148  ILE P CB    1 
ATOM   9215  C CG1   . ILE E 1 96  ? 300.087 18.546  54.874 1.00 49.38 ? 148  ILE P CG1   1 
ATOM   9216  C CG2   . ILE E 1 96  ? 301.238 19.877  53.041 1.00 49.80 ? 148  ILE P CG2   1 
ATOM   9217  C CD1   . ILE E 1 96  ? 299.985 17.288  55.702 1.00 45.29 ? 148  ILE P CD1   1 
ATOM   9218  N N     . GLU E 1 97  ? 302.279 15.887  51.971 1.00 53.12 ? 149  GLU P N     1 
ATOM   9219  C CA    . GLU E 1 97  ? 303.036 14.659  52.055 1.00 54.55 ? 149  GLU P CA    1 
ATOM   9220  C C     . GLU E 1 97  ? 304.514 15.062  52.013 1.00 55.10 ? 149  GLU P C     1 
ATOM   9221  O O     . GLU E 1 97  ? 305.015 15.607  51.026 1.00 54.90 ? 149  GLU P O     1 
ATOM   9222  C CB    . GLU E 1 97  ? 302.645 13.712  50.912 1.00 55.67 ? 149  GLU P CB    1 
ATOM   9223  C CG    . GLU E 1 97  ? 303.296 13.988  49.585 1.00 58.64 ? 149  GLU P CG    1 
ATOM   9224  C CD    . GLU E 1 97  ? 304.377 12.972  49.261 1.00 60.61 ? 149  GLU P CD    1 
ATOM   9225  O OE1   . GLU E 1 97  ? 305.290 12.770  50.092 1.00 60.90 ? 149  GLU P OE1   1 
ATOM   9226  O OE2   . GLU E 1 97  ? 304.312 12.374  48.168 1.00 61.83 ? 149  GLU P OE2   1 
ATOM   9227  N N     . SER E 1 98  ? 305.173 14.825  53.144 1.00 55.43 ? 150  SER P N     1 
ATOM   9228  C CA    . SER E 1 98  ? 306.581 15.127  53.394 1.00 54.55 ? 150  SER P CA    1 
ATOM   9229  C C     . SER E 1 98  ? 307.557 15.148  52.206 1.00 53.49 ? 150  SER P C     1 
ATOM   9230  O O     . SER E 1 98  ? 308.383 16.054  52.104 1.00 52.40 ? 150  SER P O     1 
ATOM   9231  C CB    . SER E 1 98  ? 307.088 14.152  54.474 1.00 55.95 ? 150  SER P CB    1 
ATOM   9232  O OG    . SER E 1 98  ? 308.485 14.255  54.695 1.00 59.20 ? 150  SER P OG    1 
ATOM   9233  N N     . THR E 1 99  ? 307.455 14.165  51.311 1.00 52.80 ? 151  THR P N     1 
ATOM   9234  C CA    . THR E 1 99  ? 308.365 14.049  50.169 1.00 51.68 ? 151  THR P CA    1 
ATOM   9235  C C     . THR E 1 99  ? 308.149 14.973  48.971 1.00 51.13 ? 151  THR P C     1 
ATOM   9236  O O     . THR E 1 99  ? 309.062 15.168  48.170 1.00 49.62 ? 151  THR P O     1 
ATOM   9237  C CB    . THR E 1 99  ? 308.381 12.606  49.617 1.00 51.68 ? 151  THR P CB    1 
ATOM   9238  O OG1   . THR E 1 99  ? 308.500 11.675  50.697 1.00 50.72 ? 151  THR P OG1   1 
ATOM   9239  C CG2   . THR E 1 99  ? 309.569 12.416  48.679 1.00 53.04 ? 151  THR P CG2   1 
ATOM   9240  N N     . ASN E 1 100 ? 306.957 15.540  48.832 1.00 50.99 ? 152  ASN P N     1 
ATOM   9241  C CA    . ASN E 1 100 ? 306.688 16.408  47.690 1.00 50.85 ? 152  ASN P CA    1 
ATOM   9242  C C     . ASN E 1 100 ? 306.981 15.622  46.414 1.00 50.64 ? 152  ASN P C     1 
ATOM   9243  O O     . ASN E 1 100 ? 307.563 16.156  45.467 1.00 50.21 ? 152  ASN P O     1 
ATOM   9244  C CB    . ASN E 1 100 ? 307.588 17.650  47.701 1.00 50.77 ? 152  ASN P CB    1 
ATOM   9245  C CG    . ASN E 1 100 ? 307.452 18.466  48.965 1.00 51.24 ? 152  ASN P CG    1 
ATOM   9246  O OD1   . ASN E 1 100 ? 307.910 18.062  50.033 1.00 52.99 ? 152  ASN P OD1   1 
ATOM   9247  N ND2   . ASN E 1 100 ? 306.823 19.627  48.852 1.00 51.94 ? 152  ASN P ND2   1 
ATOM   9248  N N     . GLN E 1 101 ? 306.604 14.348  46.391 1.00 50.03 ? 153  GLN P N     1 
ATOM   9249  C CA    . GLN E 1 101 ? 306.849 13.549  45.201 1.00 50.56 ? 153  GLN P CA    1 
ATOM   9250  C C     . GLN E 1 101 ? 305.559 13.045  44.558 1.00 49.87 ? 153  GLN P C     1 
ATOM   9251  O O     . GLN E 1 101 ? 305.515 12.773  43.356 1.00 51.00 ? 153  GLN P O     1 
ATOM   9252  C CB    . GLN E 1 101 ? 307.813 12.396  45.511 1.00 52.02 ? 153  GLN P CB    1 
ATOM   9253  C CG    . GLN E 1 101 ? 307.343 11.372  46.510 1.00 52.24 ? 153  GLN P CG    1 
ATOM   9254  C CD    . GLN E 1 101 ? 308.394 10.302  46.721 1.00 52.27 ? 153  GLN P CD    1 
ATOM   9255  O OE1   . GLN E 1 101 ? 309.091 9.917   45.779 1.00 52.91 ? 153  GLN P OE1   1 
ATOM   9256  N NE2   . GLN E 1 101 ? 308.511 9.810   47.951 1.00 51.55 ? 153  GLN P NE2   1 
ATOM   9257  N N     . ILE E 1 102 ? 304.506 12.927  45.357 1.00 48.07 ? 154  ILE P N     1 
ATOM   9258  C CA    . ILE E 1 102 ? 303.211 12.524  44.834 1.00 44.93 ? 154  ILE P CA    1 
ATOM   9259  C C     . ILE E 1 102 ? 302.594 13.829  44.316 1.00 42.96 ? 154  ILE P C     1 
ATOM   9260  O O     . ILE E 1 102 ? 302.614 14.840  45.019 1.00 41.10 ? 154  ILE P O     1 
ATOM   9261  C CB    . ILE E 1 102 ? 302.332 11.910  45.953 1.00 44.11 ? 154  ILE P CB    1 
ATOM   9262  C CG1   . ILE E 1 102 ? 302.761 10.467  46.192 1.00 42.85 ? 154  ILE P CG1   1 
ATOM   9263  C CG2   . ILE E 1 102 ? 300.855 11.981  45.582 1.00 43.79 ? 154  ILE P CG2   1 
ATOM   9264  C CD1   . ILE E 1 102 ? 302.583 9.585   44.983 1.00 43.75 ? 154  ILE P CD1   1 
ATOM   9265  N N     . PRO E 1 103 ? 302.066 13.832  43.073 1.00 41.63 ? 155  PRO P N     1 
ATOM   9266  C CA    . PRO E 1 103 ? 301.473 15.065  42.549 1.00 40.69 ? 155  PRO P CA    1 
ATOM   9267  C C     . PRO E 1 103 ? 300.544 15.631  43.594 1.00 40.33 ? 155  PRO P C     1 
ATOM   9268  O O     . PRO E 1 103 ? 299.898 14.878  44.322 1.00 39.86 ? 155  PRO P O     1 
ATOM   9269  C CB    . PRO E 1 103 ? 300.728 14.593  41.307 1.00 40.53 ? 155  PRO P CB    1 
ATOM   9270  C CG    . PRO E 1 103 ? 301.563 13.455  40.836 1.00 40.63 ? 155  PRO P CG    1 
ATOM   9271  C CD    . PRO E 1 103 ? 301.874 12.722  42.122 1.00 41.05 ? 155  PRO P CD    1 
ATOM   9272  N N     . SER E 1 104 ? 300.482 16.952  43.684 1.00 39.72 ? 156  SER P N     1 
ATOM   9273  C CA    . SER E 1 104 ? 299.629 17.563  44.676 1.00 39.45 ? 156  SER P CA    1 
ATOM   9274  C C     . SER E 1 104 ? 299.375 19.035  44.431 1.00 40.16 ? 156  SER P C     1 
ATOM   9275  O O     . SER E 1 104 ? 300.222 19.752  43.896 1.00 41.52 ? 156  SER P O     1 
ATOM   9276  C CB    . SER E 1 104 ? 300.261 17.415  46.051 1.00 39.55 ? 156  SER P CB    1 
ATOM   9277  O OG    . SER E 1 104 ? 301.371 18.284  46.147 1.00 40.83 ? 156  SER P OG    1 
ATOM   9278  N N     . VAL E 1 105 ? 298.194 19.475  44.836 1.00 39.50 ? 157  VAL P N     1 
ATOM   9279  C CA    . VAL E 1 105 ? 297.814 20.863  44.723 1.00 39.75 ? 157  VAL P CA    1 
ATOM   9280  C C     . VAL E 1 105 ? 297.332 21.217  46.119 1.00 40.53 ? 157  VAL P C     1 
ATOM   9281  O O     . VAL E 1 105 ? 296.473 20.544  46.689 1.00 40.78 ? 157  VAL P O     1 
ATOM   9282  C CB    . VAL E 1 105 ? 296.711 21.070  43.653 1.00 39.46 ? 157  VAL P CB    1 
ATOM   9283  C CG1   . VAL E 1 105 ? 295.645 20.030  43.815 1.00 40.66 ? 157  VAL P CG1   1 
ATOM   9284  C CG2   . VAL E 1 105 ? 296.127 22.478  43.748 1.00 36.20 ? 157  VAL P CG2   1 
ATOM   9285  N N     . THR E 1 106 ? 297.938 22.254  46.683 1.00 41.90 ? 158  THR P N     1 
ATOM   9286  C CA    . THR E 1 106 ? 297.620 22.713  48.026 1.00 41.01 ? 158  THR P CA    1 
ATOM   9287  C C     . THR E 1 106 ? 298.298 24.049  48.230 1.00 40.70 ? 158  THR P C     1 
ATOM   9288  O O     . THR E 1 106 ? 299.270 24.355  47.550 1.00 40.12 ? 158  THR P O     1 
ATOM   9289  C CB    . THR E 1 106 ? 298.148 21.721  49.090 1.00 40.45 ? 158  THR P CB    1 
ATOM   9290  O OG1   . THR E 1 106 ? 298.339 22.410  50.328 1.00 41.63 ? 158  THR P OG1   1 
ATOM   9291  C CG2   . THR E 1 106 ? 299.470 21.104  48.653 1.00 40.28 ? 158  THR P CG2   1 
ATOM   9292  N N     . ILE E 1 107 ? 297.788 24.846  49.159 1.00 41.06 ? 159  ILE P N     1 
ATOM   9293  C CA    . ILE E 1 107 ? 298.392 26.142  49.442 1.00 40.80 ? 159  ILE P CA    1 
ATOM   9294  C C     . ILE E 1 107 ? 299.572 25.963  50.409 1.00 41.48 ? 159  ILE P C     1 
ATOM   9295  O O     . ILE E 1 107 ? 299.791 24.871  50.937 1.00 41.38 ? 159  ILE P O     1 
ATOM   9296  C CB    . ILE E 1 107 ? 297.362 27.090  50.069 1.00 39.55 ? 159  ILE P CB    1 
ATOM   9297  C CG1   . ILE E 1 107 ? 296.807 26.461  51.341 1.00 40.51 ? 159  ILE P CG1   1 
ATOM   9298  C CG2   . ILE E 1 107 ? 296.226 27.353  49.086 1.00 39.04 ? 159  ILE P CG2   1 
ATOM   9299  C CD1   . ILE E 1 107 ? 296.843 27.371  52.547 1.00 42.66 ? 159  ILE P CD1   1 
ATOM   9300  N N     . ASP E 1 108 ? 300.336 27.032  50.621 1.00 42.07 ? 160  ASP P N     1 
ATOM   9301  C CA    . ASP E 1 108 ? 301.482 27.023  51.542 1.00 43.66 ? 160  ASP P CA    1 
ATOM   9302  C C     . ASP E 1 108 ? 300.926 27.162  52.969 1.00 42.42 ? 160  ASP P C     1 
ATOM   9303  O O     . ASP E 1 108 ? 300.654 28.270  53.426 1.00 42.02 ? 160  ASP P O     1 
ATOM   9304  C CB    . ASP E 1 108 ? 302.392 28.224  51.242 1.00 47.35 ? 160  ASP P CB    1 
ATOM   9305  C CG    . ASP E 1 108 ? 303.779 28.088  51.849 1.00 49.26 ? 160  ASP P CG    1 
ATOM   9306  O OD1   . ASP E 1 108 ? 303.909 27.514  52.952 1.00 51.07 ? 160  ASP P OD1   1 
ATOM   9307  O OD2   . ASP E 1 108 ? 304.744 28.572  51.222 1.00 50.62 ? 160  ASP P OD2   1 
ATOM   9308  N N     . TYR E 1 109 ? 300.762 26.061  53.686 1.00 41.52 ? 161  TYR P N     1 
ATOM   9309  C CA    . TYR E 1 109 ? 300.196 26.185  55.015 1.00 42.90 ? 161  TYR P CA    1 
ATOM   9310  C C     . TYR E 1 109 ? 301.043 26.966  56.025 1.00 43.24 ? 161  TYR P C     1 
ATOM   9311  O O     . TYR E 1 109 ? 300.484 27.567  56.949 1.00 42.88 ? 161  TYR P O     1 
ATOM   9312  C CB    . TYR E 1 109 ? 299.833 24.810  55.584 1.00 44.34 ? 161  TYR P CB    1 
ATOM   9313  C CG    . TYR E 1 109 ? 298.707 24.099  54.849 1.00 46.97 ? 161  TYR P CG    1 
ATOM   9314  C CD1   . TYR E 1 109 ? 298.966 22.990  54.032 1.00 48.42 ? 161  TYR P CD1   1 
ATOM   9315  C CD2   . TYR E 1 109 ? 297.381 24.516  54.984 1.00 46.96 ? 161  TYR P CD2   1 
ATOM   9316  C CE1   . TYR E 1 109 ? 297.927 22.311  53.370 1.00 47.29 ? 161  TYR P CE1   1 
ATOM   9317  C CE2   . TYR E 1 109 ? 296.339 23.846  54.323 1.00 46.47 ? 161  TYR P CE2   1 
ATOM   9318  C CZ    . TYR E 1 109 ? 296.620 22.747  53.519 1.00 46.85 ? 161  TYR P CZ    1 
ATOM   9319  O OH    . TYR E 1 109 ? 295.603 22.097  52.849 1.00 46.16 ? 161  TYR P OH    1 
ATOM   9320  N N     . GLU E 1 110 ? 302.370 26.979  55.869 1.00 42.23 ? 162  GLU P N     1 
ATOM   9321  C CA    . GLU E 1 110 ? 303.200 27.727  56.819 1.00 41.45 ? 162  GLU P CA    1 
ATOM   9322  C C     . GLU E 1 110 ? 303.108 29.209  56.563 1.00 39.76 ? 162  GLU P C     1 
ATOM   9323  O O     . GLU E 1 110 ? 303.040 29.987  57.505 1.00 40.42 ? 162  GLU P O     1 
ATOM   9324  C CB    . GLU E 1 110 ? 304.677 27.293  56.777 1.00 42.98 ? 162  GLU P CB    1 
ATOM   9325  C CG    . GLU E 1 110 ? 305.673 28.317  56.178 1.00 43.06 ? 162  GLU P CG    1 
ATOM   9326  C CD    . GLU E 1 110 ? 306.212 29.364  57.173 1.00 42.14 ? 162  GLU P CD    1 
ATOM   9327  O OE1   . GLU E 1 110 ? 306.640 28.996  58.289 1.00 42.00 ? 162  GLU P OE1   1 
ATOM   9328  O OE2   . GLU E 1 110 ? 306.238 30.562  56.820 1.00 41.14 ? 162  GLU P OE2   1 
ATOM   9329  N N     . GLN E 1 111 ? 303.112 29.606  55.296 1.00 39.69 ? 163  GLN P N     1 
ATOM   9330  C CA    . GLN E 1 111 ? 303.021 31.028  54.964 1.00 40.12 ? 163  GLN P CA    1 
ATOM   9331  C C     . GLN E 1 111 ? 301.620 31.570  55.167 1.00 39.14 ? 163  GLN P C     1 
ATOM   9332  O O     . GLN E 1 111 ? 301.433 32.784  55.261 1.00 38.01 ? 163  GLN P O     1 
ATOM   9333  C CB    . GLN E 1 111 ? 303.473 31.284  53.526 1.00 40.94 ? 163  GLN P CB    1 
ATOM   9334  C CG    . GLN E 1 111 ? 304.926 31.719  53.434 1.00 43.86 ? 163  GLN P CG    1 
ATOM   9335  C CD    . GLN E 1 111 ? 305.145 33.106  54.005 1.00 45.87 ? 163  GLN P CD    1 
ATOM   9336  O OE1   . GLN E 1 111 ? 306.275 33.585  54.089 1.00 47.55 ? 163  GLN P OE1   1 
ATOM   9337  N NE2   . GLN E 1 111 ? 304.057 33.764  54.394 1.00 48.09 ? 163  GLN P NE2   1 
ATOM   9338  N N     . ALA E 1 112 ? 300.648 30.659  55.237 1.00 38.59 ? 164  ALA P N     1 
ATOM   9339  C CA    . ALA E 1 112 ? 299.248 31.013  55.447 1.00 39.21 ? 164  ALA P CA    1 
ATOM   9340  C C     . ALA E 1 112 ? 299.069 31.302  56.914 1.00 39.22 ? 164  ALA P C     1 
ATOM   9341  O O     . ALA E 1 112 ? 298.296 32.175  57.294 1.00 41.19 ? 164  ALA P O     1 
ATOM   9342  C CB    . ALA E 1 112 ? 298.338 29.866  55.038 1.00 39.97 ? 164  ALA P CB    1 
ATOM   9343  N N     . ALA E 1 113 ? 299.781 30.540  57.735 1.00 39.18 ? 165  ALA P N     1 
ATOM   9344  C CA    . ALA E 1 113 ? 299.740 30.719  59.178 1.00 39.37 ? 165  ALA P CA    1 
ATOM   9345  C C     . ALA E 1 113 ? 300.516 31.989  59.495 1.00 39.52 ? 165  ALA P C     1 
ATOM   9346  O O     . ALA E 1 113 ? 300.076 32.823  60.283 1.00 41.17 ? 165  ALA P O     1 
ATOM   9347  C CB    . ALA E 1 113 ? 300.385 29.531  59.871 1.00 38.83 ? 165  ALA P CB    1 
ATOM   9348  N N     . PHE E 1 114 ? 301.673 32.134  58.864 1.00 38.01 ? 166  PHE P N     1 
ATOM   9349  C CA    . PHE E 1 114 ? 302.515 33.290  59.088 1.00 37.69 ? 166  PHE P CA    1 
ATOM   9350  C C     . PHE E 1 114 ? 301.782 34.604  58.781 1.00 37.64 ? 166  PHE P C     1 
ATOM   9351  O O     . PHE E 1 114 ? 301.744 35.512  59.613 1.00 36.94 ? 166  PHE P O     1 
ATOM   9352  C CB    . PHE E 1 114 ? 303.804 33.153  58.251 1.00 37.41 ? 166  PHE P CB    1 
ATOM   9353  C CG    . PHE E 1 114 ? 304.783 34.288  58.432 1.00 35.21 ? 166  PHE P CG    1 
ATOM   9354  C CD1   . PHE E 1 114 ? 304.586 35.512  57.799 1.00 34.80 ? 166  PHE P CD1   1 
ATOM   9355  C CD2   . PHE E 1 114 ? 305.882 34.143  59.261 1.00 34.71 ? 166  PHE P CD2   1 
ATOM   9356  C CE1   . PHE E 1 114 ? 305.467 36.571  57.996 1.00 34.34 ? 166  PHE P CE1   1 
ATOM   9357  C CE2   . PHE E 1 114 ? 306.766 35.199  59.462 1.00 35.15 ? 166  PHE P CE2   1 
ATOM   9358  C CZ    . PHE E 1 114 ? 306.554 36.415  58.826 1.00 33.44 ? 166  PHE P CZ    1 
ATOM   9359  N N     . ASP E 1 115 ? 301.187 34.704  57.598 1.00 37.55 ? 167  ASP P N     1 
ATOM   9360  C CA    . ASP E 1 115 ? 300.490 35.926  57.227 1.00 36.50 ? 167  ASP P CA    1 
ATOM   9361  C C     . ASP E 1 115 ? 299.385 36.266  58.196 1.00 35.60 ? 167  ASP P C     1 
ATOM   9362  O O     . ASP E 1 115 ? 299.200 37.432  58.543 1.00 34.63 ? 167  ASP P O     1 
ATOM   9363  C CB    . ASP E 1 115 ? 299.903 35.811  55.826 1.00 36.82 ? 167  ASP P CB    1 
ATOM   9364  C CG    . ASP E 1 115 ? 300.961 35.685  54.772 1.00 38.92 ? 167  ASP P CG    1 
ATOM   9365  O OD1   . ASP E 1 115 ? 302.078 36.217  54.984 1.00 40.05 ? 167  ASP P OD1   1 
ATOM   9366  O OD2   . ASP E 1 115 ? 300.670 35.067  53.725 1.00 40.32 ? 167  ASP P OD2   1 
ATOM   9367  N N     . ALA E 1 116 ? 298.643 35.243  58.617 1.00 34.37 ? 168  ALA P N     1 
ATOM   9368  C CA    . ALA E 1 116 ? 297.536 35.429  59.553 1.00 33.15 ? 168  ALA P CA    1 
ATOM   9369  C C     . ALA E 1 116 ? 298.047 36.090  60.824 1.00 32.40 ? 168  ALA P C     1 
ATOM   9370  O O     . ALA E 1 116 ? 297.541 37.135  61.235 1.00 32.40 ? 168  ALA P O     1 
ATOM   9371  C CB    . ALA E 1 116 ? 296.888 34.085  59.882 1.00 30.53 ? 168  ALA P CB    1 
ATOM   9372  N N     . VAL E 1 117 ? 299.056 35.465  61.430 1.00 31.66 ? 169  VAL P N     1 
ATOM   9373  C CA    . VAL E 1 117 ? 299.680 35.953  62.645 1.00 30.56 ? 169  VAL P CA    1 
ATOM   9374  C C     . VAL E 1 117 ? 300.332 37.305  62.382 1.00 31.06 ? 169  VAL P C     1 
ATOM   9375  O O     . VAL E 1 117 ? 300.289 38.195  63.227 1.00 30.00 ? 169  VAL P O     1 
ATOM   9376  C CB    . VAL E 1 117 ? 300.770 34.968  63.126 1.00 31.77 ? 169  VAL P CB    1 
ATOM   9377  C CG1   . VAL E 1 117 ? 301.426 35.482  64.423 1.00 29.77 ? 169  VAL P CG1   1 
ATOM   9378  C CG2   . VAL E 1 117 ? 300.161 33.575  63.322 1.00 31.09 ? 169  VAL P CG2   1 
ATOM   9379  N N     . GLN E 1 118 ? 300.930 37.451  61.202 1.00 32.69 ? 170  GLN P N     1 
ATOM   9380  C CA    . GLN E 1 118 ? 301.609 38.683  60.830 1.00 33.76 ? 170  GLN P CA    1 
ATOM   9381  C C     . GLN E 1 118 ? 300.672 39.867  60.706 1.00 35.09 ? 170  GLN P C     1 
ATOM   9382  O O     . GLN E 1 118 ? 301.051 40.982  61.048 1.00 37.46 ? 170  GLN P O     1 
ATOM   9383  C CB    . GLN E 1 118 ? 302.379 38.496  59.518 1.00 35.74 ? 170  GLN P CB    1 
ATOM   9384  C CG    . GLN E 1 118 ? 303.152 39.749  59.026 1.00 36.60 ? 170  GLN P CG    1 
ATOM   9385  C CD    . GLN E 1 118 ? 304.126 40.322  60.059 1.00 36.69 ? 170  GLN P CD    1 
ATOM   9386  O OE1   . GLN E 1 118 ? 305.021 39.622  60.555 1.00 36.25 ? 170  GLN P OE1   1 
ATOM   9387  N NE2   . GLN E 1 118 ? 303.957 41.602  60.381 1.00 34.03 ? 170  GLN P NE2   1 
ATOM   9388  N N     . SER E 1 119 ? 299.455 39.640  60.219 1.00 36.61 ? 171  SER P N     1 
ATOM   9389  C CA    . SER E 1 119 ? 298.491 40.733  60.069 1.00 37.09 ? 171  SER P CA    1 
ATOM   9390  C C     . SER E 1 119 ? 298.059 41.213  61.445 1.00 38.26 ? 171  SER P C     1 
ATOM   9391  O O     . SER E 1 119 ? 297.724 42.395  61.619 1.00 40.44 ? 171  SER P O     1 
ATOM   9392  C CB    . SER E 1 119 ? 297.252 40.285  59.300 1.00 36.58 ? 171  SER P CB    1 
ATOM   9393  O OG    . SER E 1 119 ? 296.338 39.639  60.167 1.00 35.42 ? 171  SER P OG    1 
ATOM   9394  N N     . LEU E 1 120 ? 298.046 40.290  62.410 1.00 36.37 ? 172  LEU P N     1 
ATOM   9395  C CA    . LEU E 1 120 ? 297.675 40.614  63.783 1.00 35.55 ? 172  LEU P CA    1 
ATOM   9396  C C     . LEU E 1 120 ? 298.767 41.463  64.415 1.00 37.51 ? 172  LEU P C     1 
ATOM   9397  O O     . LEU E 1 120 ? 298.495 42.353  65.234 1.00 37.54 ? 172  LEU P O     1 
ATOM   9398  C CB    . LEU E 1 120 ? 297.499 39.346  64.603 1.00 32.75 ? 172  LEU P CB    1 
ATOM   9399  C CG    . LEU E 1 120 ? 296.206 38.597  64.331 1.00 32.87 ? 172  LEU P CG    1 
ATOM   9400  C CD1   . LEU E 1 120 ? 296.217 37.250  65.033 1.00 31.02 ? 172  LEU P CD1   1 
ATOM   9401  C CD2   . LEU E 1 120 ? 295.036 39.468  64.797 1.00 32.94 ? 172  LEU P CD2   1 
ATOM   9402  N N     . ILE E 1 121 ? 300.008 41.174  64.037 1.00 37.89 ? 173  ILE P N     1 
ATOM   9403  C CA    . ILE E 1 121 ? 301.131 41.919  64.564 1.00 39.79 ? 173  ILE P CA    1 
ATOM   9404  C C     . ILE E 1 121 ? 301.130 43.330  63.968 1.00 41.21 ? 173  ILE P C     1 
ATOM   9405  O O     . ILE E 1 121 ? 301.435 44.297  64.667 1.00 41.49 ? 173  ILE P O     1 
ATOM   9406  C CB    . ILE E 1 121 ? 302.471 41.231  64.243 1.00 40.20 ? 173  ILE P CB    1 
ATOM   9407  C CG1   . ILE E 1 121 ? 302.438 39.768  64.684 1.00 37.99 ? 173  ILE P CG1   1 
ATOM   9408  C CG2   . ILE E 1 121 ? 303.595 41.948  64.978 1.00 39.23 ? 173  ILE P CG2   1 
ATOM   9409  C CD1   . ILE E 1 121 ? 303.626 38.982  64.200 1.00 40.38 ? 173  ILE P CD1   1 
ATOM   9410  N N     . ASP E 1 122 ? 300.784 43.450  62.686 1.00 41.95 ? 174  ASP P N     1 
ATOM   9411  C CA    . ASP E 1 122 ? 300.741 44.764  62.050 1.00 43.07 ? 174  ASP P CA    1 
ATOM   9412  C C     . ASP E 1 122 ? 299.632 45.568  62.707 1.00 43.61 ? 174  ASP P C     1 
ATOM   9413  O O     . ASP E 1 122 ? 299.681 46.791  62.748 1.00 44.64 ? 174  ASP P O     1 
ATOM   9414  C CB    . ASP E 1 122 ? 300.445 44.660  60.548 1.00 43.91 ? 174  ASP P CB    1 
ATOM   9415  C CG    . ASP E 1 122 ? 301.390 43.722  59.819 1.00 45.39 ? 174  ASP P CG    1 
ATOM   9416  O OD1   . ASP E 1 122 ? 302.493 43.452  60.343 1.00 47.41 ? 174  ASP P OD1   1 
ATOM   9417  O OD2   . ASP E 1 122 ? 301.030 43.264  58.710 1.00 44.65 ? 174  ASP P OD2   1 
ATOM   9418  N N     . SER E 1 123 ? 298.625 44.860  63.206 1.00 45.45 ? 175  SER P N     1 
ATOM   9419  C CA    . SER E 1 123 ? 297.477 45.467  63.867 1.00 45.53 ? 175  SER P CA    1 
ATOM   9420  C C     . SER E 1 123 ? 297.906 45.962  65.250 1.00 46.10 ? 175  SER P C     1 
ATOM   9421  O O     . SER E 1 123 ? 297.185 46.708  65.910 1.00 46.45 ? 175  SER P O     1 
ATOM   9422  C CB    . SER E 1 123 ? 296.355 44.432  63.990 1.00 46.30 ? 175  SER P CB    1 
ATOM   9423  O OG    . SER E 1 123 ? 295.149 45.023  64.444 1.00 50.17 ? 175  SER P OG    1 
ATOM   9424  N N     . GLY E 1 124 ? 299.088 45.533  65.686 1.00 45.91 ? 176  GLY P N     1 
ATOM   9425  C CA    . GLY E 1 124 ? 299.600 45.966  66.971 1.00 44.90 ? 176  GLY P CA    1 
ATOM   9426  C C     . GLY E 1 124 ? 299.537 44.965  68.108 1.00 45.25 ? 176  GLY P C     1 
ATOM   9427  O O     . GLY E 1 124 ? 299.669 45.353  69.272 1.00 45.35 ? 176  GLY P O     1 
ATOM   9428  N N     . HIS E 1 125 ? 299.346 43.685  67.799 1.00 44.68 ? 177  HIS P N     1 
ATOM   9429  C CA    . HIS E 1 125 ? 299.275 42.677  68.857 1.00 43.11 ? 177  HIS P CA    1 
ATOM   9430  C C     . HIS E 1 125 ? 300.654 42.141  69.254 1.00 42.54 ? 177  HIS P C     1 
ATOM   9431  O O     . HIS E 1 125 ? 301.541 41.971  68.416 1.00 42.26 ? 177  HIS P O     1 
ATOM   9432  C CB    . HIS E 1 125 ? 298.341 41.534  68.438 1.00 41.73 ? 177  HIS P CB    1 
ATOM   9433  C CG    . HIS E 1 125 ? 296.894 41.924  68.397 1.00 40.65 ? 177  HIS P CG    1 
ATOM   9434  N ND1   . HIS E 1 125 ? 296.152 42.154  69.536 1.00 40.55 ? 177  HIS P ND1   1 
ATOM   9435  C CD2   . HIS E 1 125 ? 296.066 42.170  67.356 1.00 39.53 ? 177  HIS P CD2   1 
ATOM   9436  C CE1   . HIS E 1 125 ? 294.931 42.527  69.200 1.00 38.50 ? 177  HIS P CE1   1 
ATOM   9437  N NE2   . HIS E 1 125 ? 294.853 42.545  67.883 1.00 39.52 ? 177  HIS P NE2   1 
ATOM   9438  N N     . LYS E 1 126 ? 300.819 41.902  70.551 1.00 42.24 ? 178  LYS P N     1 
ATOM   9439  C CA    . LYS E 1 126 ? 302.065 41.399  71.122 1.00 42.82 ? 178  LYS P CA    1 
ATOM   9440  C C     . LYS E 1 126 ? 301.814 40.013  71.726 1.00 41.97 ? 178  LYS P C     1 
ATOM   9441  O O     . LYS E 1 126 ? 302.618 39.101  71.536 1.00 41.65 ? 178  LYS P O     1 
ATOM   9442  C CB    . LYS E 1 126 ? 302.588 42.411  72.173 1.00 44.21 ? 178  LYS P CB    1 
ATOM   9443  C CG    . LYS E 1 126 ? 303.103 41.849  73.524 1.00 47.95 ? 178  LYS P CG    1 
ATOM   9444  C CD    . LYS E 1 126 ? 303.318 42.999  74.568 1.00 50.13 ? 178  LYS P CD    1 
ATOM   9445  C CE    . LYS E 1 126 ? 303.658 42.516  76.008 1.00 49.50 ? 178  LYS P CE    1 
ATOM   9446  N NZ    . LYS E 1 126 ? 305.086 42.108  76.202 1.00 48.88 ? 178  LYS P NZ    1 
ATOM   9447  N N     . ASN E 1 127 ? 300.698 39.850  72.438 1.00 41.28 ? 179  ASN P N     1 
ATOM   9448  C CA    . ASN E 1 127 ? 300.358 38.555  73.027 1.00 41.64 ? 179  ASN P CA    1 
ATOM   9449  C C     . ASN E 1 127 ? 299.334 37.796  72.163 1.00 41.79 ? 179  ASN P C     1 
ATOM   9450  O O     . ASN E 1 127 ? 298.121 37.887  72.395 1.00 41.26 ? 179  ASN P O     1 
ATOM   9451  C CB    . ASN E 1 127 ? 299.812 38.725  74.451 1.00 42.28 ? 179  ASN P CB    1 
ATOM   9452  C CG    . ASN E 1 127 ? 300.816 39.374  75.390 1.00 42.19 ? 179  ASN P CG    1 
ATOM   9453  O OD1   . ASN E 1 127 ? 301.994 39.029  75.394 1.00 42.96 ? 179  ASN P OD1   1 
ATOM   9454  N ND2   . ASN E 1 127 ? 300.346 40.311  76.198 1.00 42.93 ? 179  ASN P ND2   1 
ATOM   9455  N N     . ILE E 1 128 ? 299.841 37.055  71.170 1.00 40.99 ? 180  ILE P N     1 
ATOM   9456  C CA    . ILE E 1 128 ? 299.026 36.269  70.245 1.00 39.35 ? 180  ILE P CA    1 
ATOM   9457  C C     . ILE E 1 128 ? 299.132 34.767  70.525 1.00 39.75 ? 180  ILE P C     1 
ATOM   9458  O O     . ILE E 1 128 ? 300.195 34.172  70.340 1.00 38.88 ? 180  ILE P O     1 
ATOM   9459  C CB    . ILE E 1 128 ? 299.457 36.495  68.775 1.00 39.27 ? 180  ILE P CB    1 
ATOM   9460  C CG1   . ILE E 1 128 ? 299.229 37.947  68.374 1.00 39.62 ? 180  ILE P CG1   1 
ATOM   9461  C CG2   . ILE E 1 128 ? 298.681 35.570  67.840 1.00 38.29 ? 180  ILE P CG2   1 
ATOM   9462  C CD1   . ILE E 1 128 ? 300.486 38.751  68.350 1.00 42.92 ? 180  ILE P CD1   1 
ATOM   9463  N N     . ALA E 1 129 ? 298.021 34.167  70.957 1.00 39.34 ? 181  ALA P N     1 
ATOM   9464  C CA    . ALA E 1 129 ? 297.951 32.738  71.245 1.00 38.75 ? 181  ALA P CA    1 
ATOM   9465  C C     . ALA E 1 129 ? 297.565 31.982  69.972 1.00 39.29 ? 181  ALA P C     1 
ATOM   9466  O O     . ALA E 1 129 ? 297.326 32.591  68.930 1.00 39.44 ? 181  ALA P O     1 
ATOM   9467  C CB    . ALA E 1 129 ? 296.924 32.482  72.330 1.00 39.61 ? 181  ALA P CB    1 
ATOM   9468  N N     . PHE E 1 130 ? 297.491 30.657  70.049 1.00 39.11 ? 182  PHE P N     1 
ATOM   9469  C CA    . PHE E 1 130 ? 297.139 29.865  68.875 1.00 38.82 ? 182  PHE P CA    1 
ATOM   9470  C C     . PHE E 1 130 ? 296.468 28.539  69.221 1.00 38.92 ? 182  PHE P C     1 
ATOM   9471  O O     . PHE E 1 130 ? 296.999 27.737  69.981 1.00 39.15 ? 182  PHE P O     1 
ATOM   9472  C CB    . PHE E 1 130 ? 298.405 29.649  68.031 1.00 40.17 ? 182  PHE P CB    1 
ATOM   9473  C CG    . PHE E 1 130 ? 298.332 28.490  67.062 1.00 41.96 ? 182  PHE P CG    1 
ATOM   9474  C CD1   . PHE E 1 130 ? 298.820 27.237  67.423 1.00 41.30 ? 182  PHE P CD1   1 
ATOM   9475  C CD2   . PHE E 1 130 ? 297.833 28.663  65.776 1.00 41.89 ? 182  PHE P CD2   1 
ATOM   9476  C CE1   . PHE E 1 130 ? 298.817 26.186  66.525 1.00 39.39 ? 182  PHE P CE1   1 
ATOM   9477  C CE2   . PHE E 1 130 ? 297.826 27.611  64.872 1.00 41.71 ? 182  PHE P CE2   1 
ATOM   9478  C CZ    . PHE E 1 130 ? 298.323 26.369  65.254 1.00 41.24 ? 182  PHE P CZ    1 
ATOM   9479  N N     . VAL E 1 131 ? 295.278 28.326  68.674 1.00 38.31 ? 183  VAL P N     1 
ATOM   9480  C CA    . VAL E 1 131 ? 294.541 27.098  68.914 1.00 37.05 ? 183  VAL P CA    1 
ATOM   9481  C C     . VAL E 1 131 ? 294.698 26.212  67.691 1.00 37.83 ? 183  VAL P C     1 
ATOM   9482  O O     . VAL E 1 131 ? 294.285 26.567  66.577 1.00 36.62 ? 183  VAL P O     1 
ATOM   9483  C CB    . VAL E 1 131 ? 293.057 27.387  69.182 1.00 36.46 ? 183  VAL P CB    1 
ATOM   9484  C CG1   . VAL E 1 131 ? 292.243 26.114  69.101 1.00 36.19 ? 183  VAL P CG1   1 
ATOM   9485  C CG2   . VAL E 1 131 ? 292.913 27.997  70.559 1.00 35.96 ? 183  VAL P CG2   1 
ATOM   9486  N N     . SER E 1 132 ? 295.316 25.059  67.920 1.00 37.54 ? 184  SER P N     1 
ATOM   9487  C CA    . SER E 1 132 ? 295.592 24.090  66.876 1.00 37.59 ? 184  SER P CA    1 
ATOM   9488  C C     . SER E 1 132 ? 294.773 22.823  67.000 1.00 38.57 ? 184  SER P C     1 
ATOM   9489  O O     . SER E 1 132 ? 294.179 22.547  68.040 1.00 37.71 ? 184  SER P O     1 
ATOM   9490  C CB    . SER E 1 132 ? 297.066 23.713  66.924 1.00 37.07 ? 184  SER P CB    1 
ATOM   9491  O OG    . SER E 1 132 ? 297.327 22.569  66.143 1.00 37.17 ? 184  SER P OG    1 
ATOM   9492  N N     . GLY E 1 133 ? 294.737 22.059  65.913 1.00 40.36 ? 185  GLY P N     1 
ATOM   9493  C CA    . GLY E 1 133 ? 294.044 20.788  65.929 1.00 41.96 ? 185  GLY P CA    1 
ATOM   9494  C C     . GLY E 1 133 ? 295.059 19.803  66.490 1.00 43.36 ? 185  GLY P C     1 
ATOM   9495  O O     . GLY E 1 133 ? 296.082 20.215  67.048 1.00 44.52 ? 185  GLY P O     1 
ATOM   9496  N N     . THR E 1 134 ? 294.804 18.510  66.359 1.00 44.02 ? 186  THR P N     1 
ATOM   9497  C CA    . THR E 1 134 ? 295.754 17.532  66.872 1.00 45.21 ? 186  THR P CA    1 
ATOM   9498  C C     . THR E 1 134 ? 297.148 17.817  66.323 1.00 45.63 ? 186  THR P C     1 
ATOM   9499  O O     . THR E 1 134 ? 297.351 17.872  65.114 1.00 43.19 ? 186  THR P O     1 
ATOM   9500  C CB    . THR E 1 134 ? 295.352 16.116  66.480 1.00 45.35 ? 186  THR P CB    1 
ATOM   9501  O OG1   . THR E 1 134 ? 294.049 15.830  67.008 1.00 43.73 ? 186  THR P OG1   1 
ATOM   9502  C CG2   . THR E 1 134 ? 296.373 15.123  67.010 1.00 45.15 ? 186  THR P CG2   1 
ATOM   9503  N N     . LEU E 1 135 ? 298.097 17.996  67.235 1.00 48.55 ? 187  LEU P N     1 
ATOM   9504  C CA    . LEU E 1 135 ? 299.485 18.296  66.894 1.00 52.02 ? 187  LEU P CA    1 
ATOM   9505  C C     . LEU E 1 135 ? 300.267 17.197  66.175 1.00 54.59 ? 187  LEU P C     1 
ATOM   9506  O O     . LEU E 1 135 ? 301.338 17.453  65.643 1.00 56.01 ? 187  LEU P O     1 
ATOM   9507  C CB    . LEU E 1 135 ? 300.265 18.679  68.159 1.00 51.56 ? 187  LEU P CB    1 
ATOM   9508  C CG    . LEU E 1 135 ? 300.194 20.103  68.725 1.00 51.12 ? 187  LEU P CG    1 
ATOM   9509  C CD1   . LEU E 1 135 ? 301.076 20.178  69.952 1.00 50.02 ? 187  LEU P CD1   1 
ATOM   9510  C CD2   . LEU E 1 135 ? 300.658 21.129  67.688 1.00 49.95 ? 187  LEU P CD2   1 
ATOM   9511  N N     . GLU E 1 136 ? 299.750 15.978  66.152 1.00 57.51 ? 188  GLU P N     1 
ATOM   9512  C CA    . GLU E 1 136 ? 300.472 14.891  65.510 1.00 59.44 ? 188  GLU P CA    1 
ATOM   9513  C C     . GLU E 1 136 ? 300.484 14.964  63.995 1.00 59.66 ? 188  GLU P C     1 
ATOM   9514  O O     . GLU E 1 136 ? 301.241 14.250  63.346 1.00 61.84 ? 188  GLU P O     1 
ATOM   9515  C CB    . GLU E 1 136 ? 299.889 13.558  65.958 1.00 62.13 ? 188  GLU P CB    1 
ATOM   9516  C CG    . GLU E 1 136 ? 299.757 13.465  67.462 1.00 66.76 ? 188  GLU P CG    1 
ATOM   9517  C CD    . GLU E 1 136 ? 299.276 12.108  67.919 1.00 69.04 ? 188  GLU P CD    1 
ATOM   9518  O OE1   . GLU E 1 136 ? 300.027 11.129  67.719 1.00 71.16 ? 188  GLU P OE1   1 
ATOM   9519  O OE2   . GLU E 1 136 ? 298.154 12.023  68.474 1.00 68.86 ? 188  GLU P OE2   1 
ATOM   9520  N N     . GLU E 1 137 ? 299.658 15.826  63.419 1.00 59.08 ? 189  GLU P N     1 
ATOM   9521  C CA    . GLU E 1 137 ? 299.609 15.937  61.967 1.00 57.60 ? 189  GLU P CA    1 
ATOM   9522  C C     . GLU E 1 137 ? 300.606 16.952  61.451 1.00 55.61 ? 189  GLU P C     1 
ATOM   9523  O O     . GLU E 1 137 ? 300.899 17.939  62.118 1.00 55.71 ? 189  GLU P O     1 
ATOM   9524  C CB    . GLU E 1 137 ? 298.218 16.364  61.500 1.00 58.46 ? 189  GLU P CB    1 
ATOM   9525  C CG    . GLU E 1 137 ? 297.077 15.501  61.998 1.00 60.06 ? 189  GLU P CG    1 
ATOM   9526  C CD    . GLU E 1 137 ? 295.738 15.985  61.473 1.00 61.00 ? 189  GLU P CD    1 
ATOM   9527  O OE1   . GLU E 1 137 ? 294.696 15.451  61.913 1.00 62.08 ? 189  GLU P OE1   1 
ATOM   9528  O OE2   . GLU E 1 137 ? 295.732 16.901  60.618 1.00 60.50 ? 189  GLU P OE2   1 
ATOM   9529  N N     . PRO E 1 138 ? 301.152 16.714  60.254 1.00 54.04 ? 190  PRO P N     1 
ATOM   9530  C CA    . PRO E 1 138 ? 302.118 17.642  59.654 1.00 52.59 ? 190  PRO P CA    1 
ATOM   9531  C C     . PRO E 1 138 ? 301.439 18.996  59.415 1.00 51.42 ? 190  PRO P C     1 
ATOM   9532  O O     . PRO E 1 138 ? 302.054 20.050  59.535 1.00 50.60 ? 190  PRO P O     1 
ATOM   9533  C CB    . PRO E 1 138 ? 302.487 16.952  58.346 1.00 52.34 ? 190  PRO P CB    1 
ATOM   9534  C CG    . PRO E 1 138 ? 302.369 15.494  58.692 1.00 53.13 ? 190  PRO P CG    1 
ATOM   9535  C CD    . PRO E 1 138 ? 301.105 15.439  59.516 1.00 53.48 ? 190  PRO P CD    1 
ATOM   9536  N N     . ILE E 1 139 ? 300.153 18.942  59.080 1.00 51.05 ? 191  ILE P N     1 
ATOM   9537  C CA    . ILE E 1 139 ? 299.360 20.135  58.813 1.00 49.89 ? 191  ILE P CA    1 
ATOM   9538  C C     . ILE E 1 139 ? 299.556 21.140  59.941 1.00 49.03 ? 191  ILE P C     1 
ATOM   9539  O O     . ILE E 1 139 ? 299.661 22.349  59.712 1.00 48.64 ? 191  ILE P O     1 
ATOM   9540  C CB    . ILE E 1 139 ? 297.838 19.779  58.692 1.00 49.67 ? 191  ILE P CB    1 
ATOM   9541  C CG1   . ILE E 1 139 ? 297.053 20.969  58.140 1.00 48.13 ? 191  ILE P CG1   1 
ATOM   9542  C CG2   . ILE E 1 139 ? 297.272 19.372  60.046 1.00 49.70 ? 191  ILE P CG2   1 
ATOM   9543  C CD1   . ILE E 1 139 ? 297.373 21.276  56.702 1.00 46.05 ? 191  ILE P CD1   1 
ATOM   9544  N N     . ASN E 1 140 ? 299.628 20.619  61.160 1.00 47.44 ? 192  ASN P N     1 
ATOM   9545  C CA    . ASN E 1 140 ? 299.784 21.440  62.346 1.00 45.22 ? 192  ASN P CA    1 
ATOM   9546  C C     . ASN E 1 140 ? 301.207 21.619  62.830 1.00 43.95 ? 192  ASN P C     1 
ATOM   9547  O O     . ASN E 1 140 ? 301.748 22.722  62.771 1.00 44.30 ? 192  ASN P O     1 
ATOM   9548  C CB    . ASN E 1 140 ? 298.959 20.847  63.468 1.00 45.46 ? 192  ASN P CB    1 
ATOM   9549  C CG    . ASN E 1 140 ? 297.484 21.017  63.244 1.00 46.29 ? 192  ASN P CG    1 
ATOM   9550  O OD1   . ASN E 1 140 ? 296.705 20.091  63.476 1.00 48.07 ? 192  ASN P OD1   1 
ATOM   9551  N ND2   . ASN E 1 140 ? 297.080 22.210  62.807 1.00 45.87 ? 192  ASN P ND2   1 
ATOM   9552  N N     . HIS E 1 141 ? 301.803 20.531  63.312 1.00 42.58 ? 193  HIS P N     1 
ATOM   9553  C CA    . HIS E 1 141 ? 303.165 20.564  63.842 1.00 40.91 ? 193  HIS P CA    1 
ATOM   9554  C C     . HIS E 1 141 ? 304.269 20.972  62.859 1.00 39.01 ? 193  HIS P C     1 
ATOM   9555  O O     . HIS E 1 141 ? 305.255 21.577  63.255 1.00 37.86 ? 193  HIS P O     1 
ATOM   9556  C CB    . HIS E 1 141 ? 303.515 19.210  64.484 1.00 40.48 ? 193  HIS P CB    1 
ATOM   9557  C CG    . HIS E 1 141 ? 303.808 18.106  63.505 1.00 42.29 ? 193  HIS P CG    1 
ATOM   9558  N ND1   . HIS E 1 141 ? 304.760 18.217  62.511 1.00 42.10 ? 193  HIS P ND1   1 
ATOM   9559  C CD2   . HIS E 1 141 ? 303.325 16.841  63.418 1.00 41.91 ? 193  HIS P CD2   1 
ATOM   9560  C CE1   . HIS E 1 141 ? 304.850 17.070  61.858 1.00 41.70 ? 193  HIS P CE1   1 
ATOM   9561  N NE2   . HIS E 1 141 ? 303.990 16.218  62.389 1.00 41.34 ? 193  HIS P NE2   1 
ATOM   9562  N N     . ALA E 1 142 ? 304.092 20.666  61.582 1.00 37.65 ? 194  ALA P N     1 
ATOM   9563  C CA    . ALA E 1 142 ? 305.105 20.983  60.590 1.00 37.38 ? 194  ALA P CA    1 
ATOM   9564  C C     . ALA E 1 142 ? 304.861 22.240  59.784 1.00 38.18 ? 194  ALA P C     1 
ATOM   9565  O O     . ALA E 1 142 ? 305.801 22.797  59.221 1.00 38.29 ? 194  ALA P O     1 
ATOM   9566  C CB    . ALA E 1 142 ? 305.273 19.814  59.644 1.00 37.36 ? 194  ALA P CB    1 
ATOM   9567  N N     . LYS E 1 143 ? 303.615 22.695  59.716 1.00 39.29 ? 195  LYS P N     1 
ATOM   9568  C CA    . LYS E 1 143 ? 303.323 23.875  58.922 1.00 39.28 ? 195  LYS P CA    1 
ATOM   9569  C C     . LYS E 1 143 ? 302.633 25.006  59.660 1.00 38.72 ? 195  LYS P C     1 
ATOM   9570  O O     . LYS E 1 143 ? 303.183 26.092  59.743 1.00 39.34 ? 195  LYS P O     1 
ATOM   9571  C CB    . LYS E 1 143 ? 302.504 23.479  57.685 1.00 39.60 ? 195  LYS P CB    1 
ATOM   9572  C CG    . LYS E 1 143 ? 303.194 22.484  56.757 1.00 38.62 ? 195  LYS P CG    1 
ATOM   9573  C CD    . LYS E 1 143 ? 304.509 23.044  56.242 1.00 41.84 ? 195  LYS P CD    1 
ATOM   9574  C CE    . LYS E 1 143 ? 305.234 22.105  55.268 1.00 42.81 ? 195  LYS P CE    1 
ATOM   9575  N NZ    . LYS E 1 143 ? 304.716 22.159  53.864 1.00 43.22 ? 195  LYS P NZ    1 
ATOM   9576  N N     . LYS E 1 144 ? 301.440 24.767  60.197 1.00 39.22 ? 196  LYS P N     1 
ATOM   9577  C CA    . LYS E 1 144 ? 300.715 25.832  60.897 1.00 40.93 ? 196  LYS P CA    1 
ATOM   9578  C C     . LYS E 1 144 ? 301.419 26.293  62.162 1.00 41.01 ? 196  LYS P C     1 
ATOM   9579  O O     . LYS E 1 144 ? 301.641 27.497  62.352 1.00 40.61 ? 196  LYS P O     1 
ATOM   9580  C CB    . LYS E 1 144 ? 299.268 25.412  61.239 1.00 41.81 ? 196  LYS P CB    1 
ATOM   9581  C CG    . LYS E 1 144 ? 298.261 25.537  60.077 1.00 40.52 ? 196  LYS P CG    1 
ATOM   9582  C CD    . LYS E 1 144 ? 296.924 24.881  60.408 1.00 40.54 ? 196  LYS P CD    1 
ATOM   9583  C CE    . LYS E 1 144 ? 296.068 24.684  59.162 1.00 40.55 ? 196  LYS P CE    1 
ATOM   9584  N NZ    . LYS E 1 144 ? 294.815 23.910  59.442 1.00 41.53 ? 196  LYS P NZ    1 
ATOM   9585  N N     . VAL E 1 145 ? 301.775 25.348  63.029 1.00 40.75 ? 197  VAL P N     1 
ATOM   9586  C CA    . VAL E 1 145 ? 302.451 25.722  64.260 1.00 40.68 ? 197  VAL P CA    1 
ATOM   9587  C C     . VAL E 1 145 ? 303.669 26.564  63.965 1.00 41.16 ? 197  VAL P C     1 
ATOM   9588  O O     . VAL E 1 145 ? 303.828 27.651  64.514 1.00 42.57 ? 197  VAL P O     1 
ATOM   9589  C CB    . VAL E 1 145 ? 302.957 24.528  65.079 1.00 38.75 ? 197  VAL P CB    1 
ATOM   9590  C CG1   . VAL E 1 145 ? 303.511 25.048  66.398 1.00 36.96 ? 197  VAL P CG1   1 
ATOM   9591  C CG2   . VAL E 1 145 ? 301.845 23.541  65.345 1.00 40.19 ? 197  VAL P CG2   1 
ATOM   9592  N N     . LYS E 1 146 ? 304.530 26.070  63.090 1.00 41.45 ? 198  LYS P N     1 
ATOM   9593  C CA    . LYS E 1 146 ? 305.741 26.808  62.803 1.00 43.47 ? 198  LYS P CA    1 
ATOM   9594  C C     . LYS E 1 146 ? 305.524 28.166  62.136 1.00 42.22 ? 198  LYS P C     1 
ATOM   9595  O O     . LYS E 1 146 ? 306.281 29.106  62.371 1.00 41.92 ? 198  LYS P O     1 
ATOM   9596  C CB    . LYS E 1 146 ? 306.706 25.941  61.989 1.00 46.70 ? 198  LYS P CB    1 
ATOM   9597  C CG    . LYS E 1 146 ? 308.165 26.345  62.202 1.00 52.01 ? 198  LYS P CG    1 
ATOM   9598  C CD    . LYS E 1 146 ? 308.541 26.302  63.686 1.00 54.82 ? 198  LYS P CD    1 
ATOM   9599  C CE    . LYS E 1 146 ? 309.642 27.306  63.994 1.00 57.64 ? 198  LYS P CE    1 
ATOM   9600  N NZ    . LYS E 1 146 ? 310.088 27.228  65.421 1.00 60.00 ? 198  LYS P NZ    1 
ATOM   9601  N N     . GLY E 1 147 ? 304.493 28.288  61.313 1.00 41.81 ? 199  GLY P N     1 
ATOM   9602  C CA    . GLY E 1 147 ? 304.255 29.571  60.678 1.00 40.76 ? 199  GLY P CA    1 
ATOM   9603  C C     . GLY E 1 147 ? 303.973 30.593  61.759 1.00 39.58 ? 199  GLY P C     1 
ATOM   9604  O O     . GLY E 1 147 ? 304.474 31.716  61.733 1.00 37.87 ? 199  GLY P O     1 
ATOM   9605  N N     . TYR E 1 148 ? 303.152 30.183  62.719 1.00 39.07 ? 200  TYR P N     1 
ATOM   9606  C CA    . TYR E 1 148 ? 302.780 31.034  63.836 1.00 38.73 ? 200  TYR P CA    1 
ATOM   9607  C C     . TYR E 1 148 ? 304.010 31.427  64.642 1.00 38.67 ? 200  TYR P C     1 
ATOM   9608  O O     . TYR E 1 148 ? 304.242 32.614  64.914 1.00 36.94 ? 200  TYR P O     1 
ATOM   9609  C CB    . TYR E 1 148 ? 301.767 30.304  64.716 1.00 38.04 ? 200  TYR P CB    1 
ATOM   9610  C CG    . TYR E 1 148 ? 301.713 30.765  66.156 1.00 36.69 ? 200  TYR P CG    1 
ATOM   9611  C CD1   . TYR E 1 148 ? 302.301 30.003  67.167 1.00 36.72 ? 200  TYR P CD1   1 
ATOM   9612  C CD2   . TYR E 1 148 ? 301.053 31.941  66.515 1.00 34.36 ? 200  TYR P CD2   1 
ATOM   9613  C CE1   . TYR E 1 148 ? 302.228 30.397  68.501 1.00 34.25 ? 200  TYR P CE1   1 
ATOM   9614  C CE2   . TYR E 1 148 ? 300.980 32.343  67.846 1.00 32.67 ? 200  TYR P CE2   1 
ATOM   9615  C CZ    . TYR E 1 148 ? 301.570 31.564  68.827 1.00 32.09 ? 200  TYR P CZ    1 
ATOM   9616  O OH    . TYR E 1 148 ? 301.507 31.943  70.133 1.00 28.51 ? 200  TYR P OH    1 
ATOM   9617  N N     . LYS E 1 149 ? 304.795 30.425  65.024 1.00 38.85 ? 201  LYS P N     1 
ATOM   9618  C CA    . LYS E 1 149 ? 306.011 30.671  65.781 1.00 39.04 ? 201  LYS P CA    1 
ATOM   9619  C C     . LYS E 1 149 ? 306.905 31.653  65.031 1.00 39.11 ? 201  LYS P C     1 
ATOM   9620  O O     . LYS E 1 149 ? 307.333 32.660  65.584 1.00 39.41 ? 201  LYS P O     1 
ATOM   9621  C CB    . LYS E 1 149 ? 306.768 29.367  66.016 1.00 39.59 ? 201  LYS P CB    1 
ATOM   9622  C CG    . LYS E 1 149 ? 306.241 28.499  67.164 1.00 41.18 ? 201  LYS P CG    1 
ATOM   9623  C CD    . LYS E 1 149 ? 307.115 27.247  67.320 1.00 44.43 ? 201  LYS P CD    1 
ATOM   9624  C CE    . LYS E 1 149 ? 306.732 26.362  68.517 1.00 47.16 ? 201  LYS P CE    1 
ATOM   9625  N NZ    . LYS E 1 149 ? 307.288 26.837  69.820 1.00 48.87 ? 201  LYS P NZ    1 
ATOM   9626  N N     . ARG E 1 150 ? 307.156 31.377  63.759 1.00 40.24 ? 202  ARG P N     1 
ATOM   9627  C CA    . ARG E 1 150 ? 308.022 32.237  62.958 1.00 40.78 ? 202  ARG P CA    1 
ATOM   9628  C C     . ARG E 1 150 ? 307.565 33.688  62.791 1.00 39.63 ? 202  ARG P C     1 
ATOM   9629  O O     . ARG E 1 150 ? 308.395 34.578  62.686 1.00 41.03 ? 202  ARG P O     1 
ATOM   9630  C CB    . ARG E 1 150 ? 308.252 31.618  61.580 1.00 42.17 ? 202  ARG P CB    1 
ATOM   9631  C CG    . ARG E 1 150 ? 309.521 32.095  60.910 1.00 43.69 ? 202  ARG P CG    1 
ATOM   9632  C CD    . ARG E 1 150 ? 309.534 31.706  59.461 1.00 44.89 ? 202  ARG P CD    1 
ATOM   9633  N NE    . ARG E 1 150 ? 308.695 32.599  58.683 1.00 47.62 ? 202  ARG P NE    1 
ATOM   9634  C CZ    . ARG E 1 150 ? 308.290 32.340  57.448 1.00 49.44 ? 202  ARG P CZ    1 
ATOM   9635  N NH1   . ARG E 1 150 ? 308.653 31.208  56.870 1.00 52.80 ? 202  ARG P NH1   1 
ATOM   9636  N NH2   . ARG E 1 150 ? 307.529 33.205  56.790 1.00 49.47 ? 202  ARG P NH2   1 
ATOM   9637  N N     . ALA E 1 151 ? 306.262 33.938  62.746 1.00 38.71 ? 203  ALA P N     1 
ATOM   9638  C CA    . ALA E 1 151 ? 305.784 35.312  62.605 1.00 36.49 ? 203  ALA P CA    1 
ATOM   9639  C C     . ALA E 1 151 ? 306.161 36.079  63.866 1.00 35.46 ? 203  ALA P C     1 
ATOM   9640  O O     . ALA E 1 151 ? 306.630 37.212  63.802 1.00 34.20 ? 203  ALA P O     1 
ATOM   9641  C CB    . ALA E 1 151 ? 304.277 35.329  62.410 1.00 36.14 ? 203  ALA P CB    1 
ATOM   9642  N N     . LEU E 1 152 ? 305.946 35.447  65.015 1.00 35.51 ? 204  LEU P N     1 
ATOM   9643  C CA    . LEU E 1 152 ? 306.279 36.049  66.297 1.00 36.31 ? 204  LEU P CA    1 
ATOM   9644  C C     . LEU E 1 152 ? 307.783 36.263  66.334 1.00 37.56 ? 204  LEU P C     1 
ATOM   9645  O O     . LEU E 1 152 ? 308.259 37.406  66.413 1.00 37.34 ? 204  LEU P O     1 
ATOM   9646  C CB    . LEU E 1 152 ? 305.864 35.125  67.444 1.00 36.39 ? 204  LEU P CB    1 
ATOM   9647  C CG    . LEU E 1 152 ? 304.378 35.085  67.803 1.00 35.24 ? 204  LEU P CG    1 
ATOM   9648  C CD1   . LEU E 1 152 ? 304.133 34.017  68.826 1.00 33.29 ? 204  LEU P CD1   1 
ATOM   9649  C CD2   . LEU E 1 152 ? 303.952 36.435  68.339 1.00 35.14 ? 204  LEU P CD2   1 
ATOM   9650  N N     . THR E 1 153 ? 308.520 35.154  66.263 1.00 37.73 ? 205  THR P N     1 
ATOM   9651  C CA    . THR E 1 153 ? 309.973 35.191  66.274 1.00 39.21 ? 205  THR P CA    1 
ATOM   9652  C C     . THR E 1 153 ? 310.418 36.410  65.480 1.00 40.50 ? 205  THR P C     1 
ATOM   9653  O O     . THR E 1 153 ? 311.039 37.319  66.021 1.00 41.00 ? 205  THR P O     1 
ATOM   9654  C CB    . THR E 1 153 ? 310.579 33.920  65.632 1.00 39.52 ? 205  THR P CB    1 
ATOM   9655  O OG1   . THR E 1 153 ? 310.098 32.751  66.313 1.00 39.22 ? 205  THR P OG1   1 
ATOM   9656  C CG2   . THR E 1 153 ? 312.098 33.948  65.734 1.00 39.04 ? 205  THR P CG2   1 
ATOM   9657  N N     . GLU E 1 154 ? 310.059 36.439  64.203 1.00 42.52 ? 206  GLU P N     1 
ATOM   9658  C CA    . GLU E 1 154 ? 310.415 37.549  63.322 1.00 43.52 ? 206  GLU P CA    1 
ATOM   9659  C C     . GLU E 1 154 ? 310.086 38.961  63.791 1.00 44.30 ? 206  GLU P C     1 
ATOM   9660  O O     . GLU E 1 154 ? 310.723 39.915  63.355 1.00 44.49 ? 206  GLU P O     1 
ATOM   9661  C CB    . GLU E 1 154 ? 309.791 37.359  61.945 1.00 43.35 ? 206  GLU P CB    1 
ATOM   9662  C CG    . GLU E 1 154 ? 310.654 36.563  61.006 1.00 45.03 ? 206  GLU P CG    1 
ATOM   9663  C CD    . GLU E 1 154 ? 310.190 36.677  59.571 1.00 46.43 ? 206  GLU P CD    1 
ATOM   9664  O OE1   . GLU E 1 154 ? 310.052 37.829  59.090 1.00 45.20 ? 206  GLU P OE1   1 
ATOM   9665  O OE2   . GLU E 1 154 ? 309.968 35.617  58.934 1.00 47.27 ? 206  GLU P OE2   1 
ATOM   9666  N N     . SER E 1 155 ? 309.099 39.124  64.660 1.00 45.57 ? 207  SER P N     1 
ATOM   9667  C CA    . SER E 1 155 ? 308.777 40.475  65.094 1.00 46.53 ? 207  SER P CA    1 
ATOM   9668  C C     . SER E 1 155 ? 309.464 40.861  66.410 1.00 46.69 ? 207  SER P C     1 
ATOM   9669  O O     . SER E 1 155 ? 309.306 41.983  66.907 1.00 45.77 ? 207  SER P O     1 
ATOM   9670  C CB    . SER E 1 155 ? 307.262 40.631  65.188 1.00 46.70 ? 207  SER P CB    1 
ATOM   9671  O OG    . SER E 1 155 ? 306.684 40.498  63.899 1.00 46.84 ? 207  SER P OG    1 
ATOM   9672  N N     . GLY E 1 156 ? 310.251 39.937  66.950 1.00 45.01 ? 208  GLY P N     1 
ATOM   9673  C CA    . GLY E 1 156 ? 310.935 40.214  68.190 1.00 46.36 ? 208  GLY P CA    1 
ATOM   9674  C C     . GLY E 1 156 ? 310.066 39.787  69.349 1.00 47.39 ? 208  GLY P C     1 
ATOM   9675  O O     . GLY E 1 156 ? 310.463 39.870  70.519 1.00 47.80 ? 208  GLY P O     1 
ATOM   9676  N N     . LEU E 1 157 ? 308.862 39.335  69.019 1.00 47.59 ? 209  LEU P N     1 
ATOM   9677  C CA    . LEU E 1 157 ? 307.929 38.871  70.029 1.00 47.48 ? 209  LEU P CA    1 
ATOM   9678  C C     . LEU E 1 157 ? 308.412 37.499  70.474 1.00 48.12 ? 209  LEU P C     1 
ATOM   9679  O O     . LEU E 1 157 ? 309.116 36.808  69.729 1.00 48.82 ? 209  LEU P O     1 
ATOM   9680  C CB    . LEU E 1 157 ? 306.516 38.800  69.451 1.00 47.20 ? 209  LEU P CB    1 
ATOM   9681  C CG    . LEU E 1 157 ? 305.915 40.169  69.115 1.00 45.43 ? 209  LEU P CG    1 
ATOM   9682  C CD1   . LEU E 1 157 ? 304.700 39.984  68.238 1.00 45.73 ? 209  LEU P CD1   1 
ATOM   9683  C CD2   . LEU E 1 157 ? 305.557 40.919  70.395 1.00 44.87 ? 209  LEU P CD2   1 
ATOM   9684  N N     . PRO E 1 158 ? 308.054 37.091  71.699 1.00 47.80 ? 210  PRO P N     1 
ATOM   9685  C CA    . PRO E 1 158 ? 308.474 35.796  72.229 1.00 47.11 ? 210  PRO P CA    1 
ATOM   9686  C C     . PRO E 1 158 ? 307.523 34.704  71.830 1.00 46.18 ? 210  PRO P C     1 
ATOM   9687  O O     . PRO E 1 158 ? 306.447 34.970  71.331 1.00 47.53 ? 210  PRO P O     1 
ATOM   9688  C CB    . PRO E 1 158 ? 308.454 36.007  73.743 1.00 47.26 ? 210  PRO P CB    1 
ATOM   9689  C CG    . PRO E 1 158 ? 308.015 37.472  73.943 1.00 48.20 ? 210  PRO P CG    1 
ATOM   9690  C CD    . PRO E 1 158 ? 307.265 37.816  72.702 1.00 47.90 ? 210  PRO P CD    1 
ATOM   9691  N N     . VAL E 1 159 ? 307.935 33.471  72.061 1.00 45.46 ? 211  VAL P N     1 
ATOM   9692  C CA    . VAL E 1 159 ? 307.106 32.332  71.763 1.00 44.82 ? 211  VAL P CA    1 
ATOM   9693  C C     . VAL E 1 159 ? 306.968 31.517  73.039 1.00 46.73 ? 211  VAL P C     1 
ATOM   9694  O O     . VAL E 1 159 ? 307.845 30.724  73.375 1.00 47.82 ? 211  VAL P O     1 
ATOM   9695  C CB    . VAL E 1 159 ? 307.725 31.471  70.666 1.00 42.47 ? 211  VAL P CB    1 
ATOM   9696  C CG1   . VAL E 1 159 ? 306.942 30.181  70.515 1.00 42.07 ? 211  VAL P CG1   1 
ATOM   9697  C CG2   . VAL E 1 159 ? 307.726 32.237  69.362 1.00 41.54 ? 211  VAL P CG2   1 
ATOM   9698  N N     . ARG E 1 160 ? 305.874 31.745  73.761 1.00 47.38 ? 212  ARG P N     1 
ATOM   9699  C CA    . ARG E 1 160 ? 305.590 31.027  74.999 1.00 46.95 ? 212  ARG P CA    1 
ATOM   9700  C C     . ARG E 1 160 ? 304.802 29.755  74.688 1.00 46.92 ? 212  ARG P C     1 
ATOM   9701  O O     . ARG E 1 160 ? 303.929 29.740  73.826 1.00 47.32 ? 212  ARG P O     1 
ATOM   9702  C CB    . ARG E 1 160 ? 304.802 31.925  75.953 1.00 46.79 ? 212  ARG P CB    1 
ATOM   9703  C CG    . ARG E 1 160 ? 303.621 32.604  75.314 1.00 47.81 ? 212  ARG P CG    1 
ATOM   9704  C CD    . ARG E 1 160 ? 303.768 34.112  75.315 1.00 49.24 ? 212  ARG P CD    1 
ATOM   9705  N NE    . ARG E 1 160 ? 303.819 34.642  76.675 1.00 49.12 ? 212  ARG P NE    1 
ATOM   9706  C CZ    . ARG E 1 160 ? 303.679 35.927  76.980 1.00 49.09 ? 212  ARG P CZ    1 
ATOM   9707  N NH1   . ARG E 1 160 ? 303.474 36.823  76.022 1.00 48.56 ? 212  ARG P NH1   1 
ATOM   9708  N NH2   . ARG E 1 160 ? 303.754 36.316  78.244 1.00 51.19 ? 212  ARG P NH2   1 
ATOM   9709  N N     . ASP E 1 161 ? 305.111 28.681  75.393 1.00 47.03 ? 213  ASP P N     1 
ATOM   9710  C CA    . ASP E 1 161 ? 304.445 27.414  75.148 1.00 46.34 ? 213  ASP P CA    1 
ATOM   9711  C C     . ASP E 1 161 ? 303.008 27.404  75.615 1.00 45.62 ? 213  ASP P C     1 
ATOM   9712  O O     . ASP E 1 161 ? 302.186 26.642  75.103 1.00 46.04 ? 213  ASP P O     1 
ATOM   9713  C CB    . ASP E 1 161 ? 305.209 26.303  75.849 1.00 48.52 ? 213  ASP P CB    1 
ATOM   9714  C CG    . ASP E 1 161 ? 306.696 26.403  75.621 1.00 50.54 ? 213  ASP P CG    1 
ATOM   9715  O OD1   . ASP E 1 161 ? 307.097 26.454  74.437 1.00 52.49 ? 213  ASP P OD1   1 
ATOM   9716  O OD2   . ASP E 1 161 ? 307.461 26.433  76.614 1.00 51.20 ? 213  ASP P OD2   1 
ATOM   9717  N N     . SER E 1 162 ? 302.708 28.245  76.596 1.00 44.63 ? 214  SER P N     1 
ATOM   9718  C CA    . SER E 1 162 ? 301.361 28.300  77.137 1.00 43.85 ? 214  SER P CA    1 
ATOM   9719  C C     . SER E 1 162 ? 300.382 28.827  76.085 1.00 43.44 ? 214  SER P C     1 
ATOM   9720  O O     . SER E 1 162 ? 299.191 28.505  76.119 1.00 43.69 ? 214  SER P O     1 
ATOM   9721  C CB    . SER E 1 162 ? 301.328 29.171  78.410 1.00 42.90 ? 214  SER P CB    1 
ATOM   9722  O OG    . SER E 1 162 ? 301.662 30.525  78.145 1.00 43.27 ? 214  SER P OG    1 
ATOM   9723  N N     . TYR E 1 163 ? 300.894 29.607  75.136 1.00 42.19 ? 215  TYR P N     1 
ATOM   9724  C CA    . TYR E 1 163 ? 300.070 30.190  74.076 1.00 40.77 ? 215  TYR P CA    1 
ATOM   9725  C C     . TYR E 1 163 ? 299.694 29.272  72.920 1.00 38.48 ? 215  TYR P C     1 
ATOM   9726  O O     . TYR E 1 163 ? 299.018 29.707  71.989 1.00 35.84 ? 215  TYR P O     1 
ATOM   9727  C CB    . TYR E 1 163 ? 300.734 31.455  73.524 1.00 41.41 ? 215  TYR P CB    1 
ATOM   9728  C CG    . TYR E 1 163 ? 300.395 32.716  74.283 1.00 42.23 ? 215  TYR P CG    1 
ATOM   9729  C CD1   . TYR E 1 163 ? 300.003 32.674  75.623 1.00 44.12 ? 215  TYR P CD1   1 
ATOM   9730  C CD2   . TYR E 1 163 ? 300.514 33.958  73.674 1.00 44.47 ? 215  TYR P CD2   1 
ATOM   9731  C CE1   . TYR E 1 163 ? 299.743 33.849  76.337 1.00 45.72 ? 215  TYR P CE1   1 
ATOM   9732  C CE2   . TYR E 1 163 ? 300.261 35.138  74.375 1.00 46.66 ? 215  TYR P CE2   1 
ATOM   9733  C CZ    . TYR E 1 163 ? 299.878 35.076  75.705 1.00 46.41 ? 215  TYR P CZ    1 
ATOM   9734  O OH    . TYR E 1 163 ? 299.654 36.242  76.389 1.00 46.46 ? 215  TYR P OH    1 
ATOM   9735  N N     . ILE E 1 164 ? 300.142 28.020  72.964 1.00 38.31 ? 216  ILE P N     1 
ATOM   9736  C CA    . ILE E 1 164 ? 299.780 27.051  71.925 1.00 39.11 ? 216  ILE P CA    1 
ATOM   9737  C C     . ILE E 1 164 ? 298.953 25.969  72.605 1.00 39.00 ? 216  ILE P C     1 
ATOM   9738  O O     . ILE E 1 164 ? 299.506 25.063  73.213 1.00 38.32 ? 216  ILE P O     1 
ATOM   9739  C CB    . ILE E 1 164 ? 301.007 26.340  71.241 1.00 39.16 ? 216  ILE P CB    1 
ATOM   9740  C CG1   . ILE E 1 164 ? 301.802 27.297  70.350 1.00 38.88 ? 216  ILE P CG1   1 
ATOM   9741  C CG2   . ILE E 1 164 ? 300.514 25.236  70.349 1.00 38.75 ? 216  ILE P CG2   1 
ATOM   9742  C CD1   . ILE E 1 164 ? 302.790 28.130  71.094 1.00 42.57 ? 216  ILE P CD1   1 
ATOM   9743  N N     . VAL E 1 165 ? 297.631 26.072  72.521 1.00 40.09 ? 217  VAL P N     1 
ATOM   9744  C CA    . VAL E 1 165 ? 296.770 25.071  73.133 1.00 42.20 ? 217  VAL P CA    1 
ATOM   9745  C C     . VAL E 1 165 ? 296.144 24.154  72.065 1.00 44.10 ? 217  VAL P C     1 
ATOM   9746  O O     . VAL E 1 165 ? 295.644 24.608  71.034 1.00 44.24 ? 217  VAL P O     1 
ATOM   9747  C CB    . VAL E 1 165 ? 295.696 25.739  74.015 1.00 41.26 ? 217  VAL P CB    1 
ATOM   9748  C CG1   . VAL E 1 165 ? 295.106 26.911  73.296 1.00 43.90 ? 217  VAL P CG1   1 
ATOM   9749  C CG2   . VAL E 1 165 ? 294.616 24.739  74.376 1.00 42.19 ? 217  VAL P CG2   1 
ATOM   9750  N N     . GLU E 1 166 ? 296.188 22.854  72.349 1.00 46.02 ? 218  GLU P N     1 
ATOM   9751  C CA    . GLU E 1 166 ? 295.732 21.793  71.460 1.00 47.01 ? 218  GLU P CA    1 
ATOM   9752  C C     . GLU E 1 166 ? 294.255 21.476  71.438 1.00 47.48 ? 218  GLU P C     1 
ATOM   9753  O O     . GLU E 1 166 ? 293.653 21.193  72.469 1.00 48.66 ? 218  GLU P O     1 
ATOM   9754  C CB    . GLU E 1 166 ? 296.484 20.517  71.818 1.00 49.97 ? 218  GLU P CB    1 
ATOM   9755  C CG    . GLU E 1 166 ? 296.792 19.576  70.667 1.00 53.61 ? 218  GLU P CG    1 
ATOM   9756  C CD    . GLU E 1 166 ? 297.664 18.403  71.118 1.00 56.76 ? 218  GLU P CD    1 
ATOM   9757  O OE1   . GLU E 1 166 ? 297.159 17.556  71.900 1.00 57.99 ? 218  GLU P OE1   1 
ATOM   9758  O OE2   . GLU E 1 166 ? 298.850 18.338  70.707 1.00 55.85 ? 218  GLU P OE2   1 
ATOM   9759  N N     . GLY E 1 167 ? 293.686 21.493  70.241 1.00 47.60 ? 219  GLY P N     1 
ATOM   9760  C CA    . GLY E 1 167 ? 292.285 21.162  70.078 1.00 48.41 ? 219  GLY P CA    1 
ATOM   9761  C C     . GLY E 1 167 ? 292.155 19.867  69.286 1.00 48.58 ? 219  GLY P C     1 
ATOM   9762  O O     . GLY E 1 167 ? 293.146 19.323  68.800 1.00 49.45 ? 219  GLY P O     1 
ATOM   9763  N N     . ASP E 1 168 ? 290.934 19.366  69.154 1.00 47.88 ? 220  ASP P N     1 
ATOM   9764  C CA    . ASP E 1 168 ? 290.699 18.142  68.411 1.00 47.06 ? 220  ASP P CA    1 
ATOM   9765  C C     . ASP E 1 168 ? 289.799 18.440  67.204 1.00 47.53 ? 220  ASP P C     1 
ATOM   9766  O O     . ASP E 1 168 ? 289.147 17.544  66.660 1.00 47.36 ? 220  ASP P O     1 
ATOM   9767  C CB    . ASP E 1 168 ? 290.056 17.106  69.338 1.00 47.78 ? 220  ASP P CB    1 
ATOM   9768  C CG    . ASP E 1 168 ? 288.705 17.551  69.867 1.00 48.85 ? 220  ASP P CG    1 
ATOM   9769  O OD1   . ASP E 1 168 ? 288.417 18.764  69.831 1.00 50.02 ? 220  ASP P OD1   1 
ATOM   9770  O OD2   . ASP E 1 168 ? 287.928 16.693  70.331 1.00 49.51 ? 220  ASP P OD2   1 
ATOM   9771  N N     . TYR E 1 169 ? 289.778 19.709  66.793 1.00 47.24 ? 221  TYR P N     1 
ATOM   9772  C CA    . TYR E 1 169 ? 288.971 20.180  65.665 1.00 45.89 ? 221  TYR P CA    1 
ATOM   9773  C C     . TYR E 1 169 ? 287.511 20.374  66.053 1.00 45.97 ? 221  TYR P C     1 
ATOM   9774  O O     . TYR E 1 169 ? 286.724 20.964  65.312 1.00 45.96 ? 221  TYR P O     1 
ATOM   9775  C CB    . TYR E 1 169 ? 289.081 19.205  64.492 1.00 45.41 ? 221  TYR P CB    1 
ATOM   9776  C CG    . TYR E 1 169 ? 290.462 19.187  63.898 1.00 45.01 ? 221  TYR P CG    1 
ATOM   9777  C CD1   . TYR E 1 169 ? 290.970 20.315  63.253 1.00 44.64 ? 221  TYR P CD1   1 
ATOM   9778  C CD2   . TYR E 1 169 ? 291.291 18.075  64.039 1.00 44.34 ? 221  TYR P CD2   1 
ATOM   9779  C CE1   . TYR E 1 169 ? 292.270 20.341  62.770 1.00 44.76 ? 221  TYR P CE1   1 
ATOM   9780  C CE2   . TYR E 1 169 ? 292.601 18.089  63.557 1.00 43.54 ? 221  TYR P CE2   1 
ATOM   9781  C CZ    . TYR E 1 169 ? 293.079 19.225  62.927 1.00 44.34 ? 221  TYR P CZ    1 
ATOM   9782  O OH    . TYR E 1 169 ? 294.368 19.263  62.457 1.00 45.36 ? 221  TYR P OH    1 
ATOM   9783  N N     . THR E 1 170 ? 287.159 19.890  67.234 1.00 45.62 ? 222  THR P N     1 
ATOM   9784  C CA    . THR E 1 170 ? 285.798 19.999  67.727 1.00 45.99 ? 222  THR P CA    1 
ATOM   9785  C C     . THR E 1 170 ? 285.489 21.423  68.176 1.00 44.26 ? 222  THR P C     1 
ATOM   9786  O O     . THR E 1 170 ? 286.360 22.118  68.701 1.00 44.01 ? 222  THR P O     1 
ATOM   9787  C CB    . THR E 1 170 ? 285.588 19.040  68.911 1.00 47.75 ? 222  THR P CB    1 
ATOM   9788  O OG1   . THR E 1 170 ? 285.987 17.720  68.524 1.00 49.75 ? 222  THR P OG1   1 
ATOM   9789  C CG2   . THR E 1 170 ? 284.128 19.005  69.325 1.00 50.91 ? 222  THR P CG2   1 
ATOM   9790  N N     . TYR E 1 171 ? 284.251 21.861  67.949 1.00 42.09 ? 223  TYR P N     1 
ATOM   9791  C CA    . TYR E 1 171 ? 283.832 23.191  68.368 1.00 39.48 ? 223  TYR P CA    1 
ATOM   9792  C C     . TYR E 1 171 ? 284.049 23.273  69.882 1.00 40.87 ? 223  TYR P C     1 
ATOM   9793  O O     . TYR E 1 171 ? 284.596 24.256  70.390 1.00 41.69 ? 223  TYR P O     1 
ATOM   9794  C CB    . TYR E 1 171 ? 282.364 23.409  67.992 1.00 34.44 ? 223  TYR P CB    1 
ATOM   9795  C CG    . TYR E 1 171 ? 281.646 24.549  68.696 1.00 31.26 ? 223  TYR P CG    1 
ATOM   9796  C CD1   . TYR E 1 171 ? 280.966 24.332  69.891 1.00 29.74 ? 223  TYR P CD1   1 
ATOM   9797  C CD2   . TYR E 1 171 ? 281.591 25.830  68.132 1.00 29.84 ? 223  TYR P CD2   1 
ATOM   9798  C CE1   . TYR E 1 171 ? 280.244 25.353  70.504 1.00 28.97 ? 223  TYR P CE1   1 
ATOM   9799  C CE2   . TYR E 1 171 ? 280.875 26.862  68.738 1.00 27.29 ? 223  TYR P CE2   1 
ATOM   9800  C CZ    . TYR E 1 171 ? 280.202 26.616  69.922 1.00 28.77 ? 223  TYR P CZ    1 
ATOM   9801  O OH    . TYR E 1 171 ? 279.483 27.622  70.533 1.00 27.50 ? 223  TYR P OH    1 
ATOM   9802  N N     . ASP E 1 172 ? 283.656 22.218  70.593 1.00 41.29 ? 224  ASP P N     1 
ATOM   9803  C CA    . ASP E 1 172 ? 283.820 22.159  72.049 1.00 40.96 ? 224  ASP P CA    1 
ATOM   9804  C C     . ASP E 1 172 ? 285.238 22.408  72.515 1.00 38.64 ? 224  ASP P C     1 
ATOM   9805  O O     . ASP E 1 172 ? 285.448 22.994  73.574 1.00 38.99 ? 224  ASP P O     1 
ATOM   9806  C CB    . ASP E 1 172 ? 283.402 20.798  72.596 1.00 43.81 ? 224  ASP P CB    1 
ATOM   9807  C CG    . ASP E 1 172 ? 281.916 20.648  72.703 1.00 45.24 ? 224  ASP P CG    1 
ATOM   9808  O OD1   . ASP E 1 172 ? 281.476 19.681  73.369 1.00 46.06 ? 224  ASP P OD1   1 
ATOM   9809  O OD2   . ASP E 1 172 ? 281.197 21.492  72.123 1.00 45.98 ? 224  ASP P OD2   1 
ATOM   9810  N N     . SER E 1 173 ? 286.209 21.926  71.745 1.00 36.46 ? 225  SER P N     1 
ATOM   9811  C CA    . SER E 1 173 ? 287.601 22.100  72.122 1.00 33.84 ? 225  SER P CA    1 
ATOM   9812  C C     . SER E 1 173 ? 287.965 23.543  71.923 1.00 32.77 ? 225  SER P C     1 
ATOM   9813  O O     . SER E 1 173 ? 288.876 24.044  72.571 1.00 33.60 ? 225  SER P O     1 
ATOM   9814  C CB    . SER E 1 173 ? 288.522 21.216  71.286 1.00 33.00 ? 225  SER P CB    1 
ATOM   9815  O OG    . SER E 1 173 ? 288.650 21.689  69.962 1.00 31.79 ? 225  SER P OG    1 
ATOM   9816  N N     . GLY E 1 174 ? 287.251 24.207  71.015 1.00 31.89 ? 226  GLY P N     1 
ATOM   9817  C CA    . GLY E 1 174 ? 287.499 25.617  70.769 1.00 28.15 ? 226  GLY P CA    1 
ATOM   9818  C C     . GLY E 1 174 ? 287.160 26.344  72.057 1.00 26.65 ? 226  GLY P C     1 
ATOM   9819  O O     . GLY E 1 174 ? 287.901 27.209  72.507 1.00 23.96 ? 226  GLY P O     1 
ATOM   9820  N N     . ILE E 1 175 ? 286.037 25.964  72.660 1.00 25.96 ? 227  ILE P N     1 
ATOM   9821  C CA    . ILE E 1 175 ? 285.598 26.560  73.905 1.00 28.74 ? 227  ILE P CA    1 
ATOM   9822  C C     . ILE E 1 175 ? 286.647 26.292  74.979 1.00 31.03 ? 227  ILE P C     1 
ATOM   9823  O O     . ILE E 1 175 ? 287.144 27.219  75.597 1.00 31.55 ? 227  ILE P O     1 
ATOM   9824  C CB    . ILE E 1 175 ? 284.186 26.009  74.307 1.00 29.33 ? 227  ILE P CB    1 
ATOM   9825  C CG1   . ILE E 1 175 ? 283.140 26.544  73.318 1.00 30.30 ? 227  ILE P CG1   1 
ATOM   9826  C CG2   . ILE E 1 175 ? 283.802 26.439  75.707 1.00 26.89 ? 227  ILE P CG2   1 
ATOM   9827  C CD1   . ILE E 1 175 ? 281.717 26.181  73.628 1.00 37.29 ? 227  ILE P CD1   1 
ATOM   9828  N N     . GLU E 1 176 ? 287.010 25.029  75.175 1.00 35.21 ? 228  GLU P N     1 
ATOM   9829  C CA    . GLU E 1 176 ? 288.014 24.661  76.173 1.00 37.40 ? 228  GLU P CA    1 
ATOM   9830  C C     . GLU E 1 176 ? 289.368 25.311  75.958 1.00 37.63 ? 228  GLU P C     1 
ATOM   9831  O O     . GLU E 1 176 ? 290.155 25.437  76.896 1.00 39.12 ? 228  GLU P O     1 
ATOM   9832  C CB    . GLU E 1 176 ? 288.248 23.163  76.175 1.00 40.02 ? 228  GLU P CB    1 
ATOM   9833  C CG    . GLU E 1 176 ? 287.184 22.322  76.799 1.00 44.70 ? 228  GLU P CG    1 
ATOM   9834  C CD    . GLU E 1 176 ? 287.642 20.885  76.888 1.00 48.42 ? 228  GLU P CD    1 
ATOM   9835  O OE1   . GLU E 1 176 ? 287.883 20.281  75.819 1.00 49.74 ? 228  GLU P OE1   1 
ATOM   9836  O OE2   . GLU E 1 176 ? 287.782 20.365  78.019 1.00 51.95 ? 228  GLU P OE2   1 
ATOM   9837  N N     . ALA E 1 177 ? 289.657 25.696  74.724 1.00 37.50 ? 229  ALA P N     1 
ATOM   9838  C CA    . ALA E 1 177 ? 290.940 26.311  74.427 1.00 39.19 ? 229  ALA P CA    1 
ATOM   9839  C C     . ALA E 1 177 ? 291.017 27.736  74.938 1.00 40.65 ? 229  ALA P C     1 
ATOM   9840  O O     . ALA E 1 177 ? 292.050 28.153  75.458 1.00 40.75 ? 229  ALA P O     1 
ATOM   9841  C CB    . ALA E 1 177 ? 291.203 26.285  72.932 1.00 39.07 ? 229  ALA P CB    1 
ATOM   9842  N N     . VAL E 1 178 ? 289.930 28.487  74.781 1.00 42.54 ? 230  VAL P N     1 
ATOM   9843  C CA    . VAL E 1 178 ? 289.907 29.871  75.241 1.00 43.43 ? 230  VAL P CA    1 
ATOM   9844  C C     . VAL E 1 178 ? 289.871 29.836  76.746 1.00 43.49 ? 230  VAL P C     1 
ATOM   9845  O O     . VAL E 1 178 ? 290.455 30.683  77.418 1.00 45.07 ? 230  VAL P O     1 
ATOM   9846  C CB    . VAL E 1 178 ? 288.659 30.647  74.765 1.00 43.03 ? 230  VAL P CB    1 
ATOM   9847  C CG1   . VAL E 1 178 ? 289.091 31.863  74.009 1.00 42.16 ? 230  VAL P CG1   1 
ATOM   9848  C CG2   . VAL E 1 178 ? 287.760 29.768  73.923 1.00 43.22 ? 230  VAL P CG2   1 
ATOM   9849  N N     . GLU E 1 179 ? 289.159 28.848  77.262 1.00 43.08 ? 231  GLU P N     1 
ATOM   9850  C CA    . GLU E 1 179 ? 289.026 28.663  78.690 1.00 44.88 ? 231  GLU P CA    1 
ATOM   9851  C C     . GLU E 1 179 ? 290.461 28.693  79.219 1.00 44.05 ? 231  GLU P C     1 
ATOM   9852  O O     . GLU E 1 179 ? 290.810 29.543  80.041 1.00 43.68 ? 231  GLU P O     1 
ATOM   9853  C CB    . GLU E 1 179 ? 288.350 27.310  78.947 1.00 49.20 ? 231  GLU P CB    1 
ATOM   9854  C CG    . GLU E 1 179 ? 287.809 27.064  80.348 1.00 53.85 ? 231  GLU P CG    1 
ATOM   9855  C CD    . GLU E 1 179 ? 287.036 25.739  80.451 1.00 57.78 ? 231  GLU P CD    1 
ATOM   9856  O OE1   . GLU E 1 179 ? 287.613 24.667  80.137 1.00 59.52 ? 231  GLU P OE1   1 
ATOM   9857  O OE2   . GLU E 1 179 ? 285.847 25.772  80.848 1.00 60.09 ? 231  GLU P OE2   1 
ATOM   9858  N N     . LYS E 1 180 ? 291.297 27.788  78.712 1.00 42.20 ? 232  LYS P N     1 
ATOM   9859  C CA    . LYS E 1 180 ? 292.694 27.715  79.129 1.00 40.65 ? 232  LYS P CA    1 
ATOM   9860  C C     . LYS E 1 180 ? 293.417 29.037  78.954 1.00 39.43 ? 232  LYS P C     1 
ATOM   9861  O O     . LYS E 1 180 ? 293.950 29.596  79.909 1.00 39.17 ? 232  LYS P O     1 
ATOM   9862  C CB    . LYS E 1 180 ? 293.439 26.640  78.333 1.00 41.41 ? 232  LYS P CB    1 
ATOM   9863  C CG    . LYS E 1 180 ? 293.488 25.301  79.018 1.00 42.23 ? 232  LYS P CG    1 
ATOM   9864  C CD    . LYS E 1 180 ? 294.206 25.414  80.346 1.00 42.68 ? 232  LYS P CD    1 
ATOM   9865  C CE    . LYS E 1 180 ? 295.701 25.596  80.161 1.00 42.23 ? 232  LYS P CE    1 
ATOM   9866  N NZ    . LYS E 1 180 ? 296.325 25.898  81.478 1.00 42.72 ? 232  LYS P NZ    1 
ATOM   9867  N N     . LEU E 1 181 ? 293.443 29.523  77.720 1.00 38.85 ? 233  LEU P N     1 
ATOM   9868  C CA    . LEU E 1 181 ? 294.115 30.773  77.400 1.00 37.66 ? 233  LEU P CA    1 
ATOM   9869  C C     . LEU E 1 181 ? 293.695 31.913  78.313 1.00 36.64 ? 233  LEU P C     1 
ATOM   9870  O O     . LEU E 1 181 ? 294.529 32.693  78.745 1.00 36.97 ? 233  LEU P O     1 
ATOM   9871  C CB    . LEU E 1 181 ? 293.852 31.161  75.942 1.00 37.25 ? 233  LEU P CB    1 
ATOM   9872  C CG    . LEU E 1 181 ? 294.395 30.250  74.837 1.00 37.07 ? 233  LEU P CG    1 
ATOM   9873  C CD1   . LEU E 1 181 ? 293.788 30.662  73.506 1.00 38.28 ? 233  LEU P CD1   1 
ATOM   9874  C CD2   . LEU E 1 181 ? 295.907 30.335  74.774 1.00 36.40 ? 233  LEU P CD2   1 
ATOM   9875  N N     . LEU E 1 182 ? 292.410 32.015  78.621 1.00 36.42 ? 234  LEU P N     1 
ATOM   9876  C CA    . LEU E 1 182 ? 291.960 33.107  79.474 1.00 37.04 ? 234  LEU P CA    1 
ATOM   9877  C C     . LEU E 1 182 ? 292.399 32.979  80.924 1.00 37.68 ? 234  LEU P C     1 
ATOM   9878  O O     . LEU E 1 182 ? 292.114 33.845  81.746 1.00 37.36 ? 234  LEU P O     1 
ATOM   9879  C CB    . LEU E 1 182 ? 290.439 33.267  79.390 1.00 34.75 ? 234  LEU P CB    1 
ATOM   9880  C CG    . LEU E 1 182 ? 289.929 33.683  78.006 1.00 32.59 ? 234  LEU P CG    1 
ATOM   9881  C CD1   . LEU E 1 182 ? 288.441 33.879  78.083 1.00 29.64 ? 234  LEU P CD1   1 
ATOM   9882  C CD2   . LEU E 1 182 ? 290.619 34.967  77.530 1.00 29.51 ? 234  LEU P CD2   1 
ATOM   9883  N N     . GLU E 1 183 ? 293.111 31.905  81.232 1.00 39.39 ? 235  GLU P N     1 
ATOM   9884  C CA    . GLU E 1 183 ? 293.602 31.693  82.586 1.00 40.94 ? 235  GLU P CA    1 
ATOM   9885  C C     . GLU E 1 183 ? 295.089 32.019  82.709 1.00 41.53 ? 235  GLU P C     1 
ATOM   9886  O O     . GLU E 1 183 ? 295.598 32.190  83.809 1.00 42.56 ? 235  GLU P O     1 
ATOM   9887  C CB    . GLU E 1 183 ? 293.366 30.250  83.013 1.00 40.45 ? 235  GLU P CB    1 
ATOM   9888  C CG    . GLU E 1 183 ? 291.907 29.852  83.018 1.00 42.97 ? 235  GLU P CG    1 
ATOM   9889  C CD    . GLU E 1 183 ? 291.710 28.427  83.489 1.00 44.33 ? 235  GLU P CD    1 
ATOM   9890  O OE1   . GLU E 1 183 ? 292.434 27.532  82.993 1.00 46.78 ? 235  GLU P OE1   1 
ATOM   9891  O OE2   . GLU E 1 183 ? 290.834 28.201  84.351 1.00 44.48 ? 235  GLU P OE2   1 
ATOM   9892  N N     . GLU E 1 184 ? 295.785 32.096  81.582 1.00 42.65 ? 236  GLU P N     1 
ATOM   9893  C CA    . GLU E 1 184 ? 297.205 32.394  81.599 1.00 44.49 ? 236  GLU P CA    1 
ATOM   9894  C C     . GLU E 1 184 ? 297.384 33.770  82.235 1.00 45.39 ? 236  GLU P C     1 
ATOM   9895  O O     . GLU E 1 184 ? 296.477 34.592  82.189 1.00 44.41 ? 236  GLU P O     1 
ATOM   9896  C CB    . GLU E 1 184 ? 297.770 32.338  80.167 1.00 45.32 ? 236  GLU P CB    1 
ATOM   9897  C CG    . GLU E 1 184 ? 298.740 31.153  79.911 1.00 49.40 ? 236  GLU P CG    1 
ATOM   9898  C CD    . GLU E 1 184 ? 298.092 29.747  79.995 1.00 53.05 ? 236  GLU P CD    1 
ATOM   9899  O OE1   . GLU E 1 184 ? 297.257 29.478  80.892 1.00 54.15 ? 236  GLU P OE1   1 
ATOM   9900  O OE2   . GLU E 1 184 ? 298.440 28.881  79.160 1.00 54.90 ? 236  GLU P OE2   1 
ATOM   9901  N N     . ASP E 1 185 ? 298.539 34.005  82.855 1.00 47.62 ? 237  ASP P N     1 
ATOM   9902  C CA    . ASP E 1 185 ? 298.825 35.287  83.519 1.00 49.32 ? 237  ASP P CA    1 
ATOM   9903  C C     . ASP E 1 185 ? 298.745 36.477  82.588 1.00 47.27 ? 237  ASP P C     1 
ATOM   9904  O O     . ASP E 1 185 ? 298.197 37.517  82.939 1.00 45.95 ? 237  ASP P O     1 
ATOM   9905  C CB    . ASP E 1 185 ? 300.215 35.267  84.159 1.00 53.34 ? 237  ASP P CB    1 
ATOM   9906  C CG    . ASP E 1 185 ? 300.236 34.550  85.497 1.00 56.94 ? 237  ASP P CG    1 
ATOM   9907  O OD1   . ASP E 1 185 ? 301.336 34.477  86.087 1.00 59.56 ? 237  ASP P OD1   1 
ATOM   9908  O OD2   . ASP E 1 185 ? 299.167 34.068  85.956 1.00 58.51 ? 237  ASP P OD2   1 
ATOM   9909  N N     . GLU E 1 186 ? 299.352 36.321  81.419 1.00 47.43 ? 238  GLU P N     1 
ATOM   9910  C CA    . GLU E 1 186 ? 299.342 37.343  80.385 1.00 46.26 ? 238  GLU P CA    1 
ATOM   9911  C C     . GLU E 1 186 ? 298.288 36.859  79.418 1.00 44.09 ? 238  GLU P C     1 
ATOM   9912  O O     . GLU E 1 186 ? 298.511 35.908  78.670 1.00 42.98 ? 238  GLU P O     1 
ATOM   9913  C CB    . GLU E 1 186 ? 300.687 37.408  79.685 1.00 49.45 ? 238  GLU P CB    1 
ATOM   9914  C CG    . GLU E 1 186 ? 301.610 38.461  80.236 1.00 54.50 ? 238  GLU P CG    1 
ATOM   9915  C CD    . GLU E 1 186 ? 301.108 39.859  79.937 1.00 58.26 ? 238  GLU P CD    1 
ATOM   9916  O OE1   . GLU E 1 186 ? 300.045 40.239  80.484 1.00 58.90 ? 238  GLU P OE1   1 
ATOM   9917  O OE2   . GLU E 1 186 ? 301.774 40.574  79.148 1.00 60.70 ? 238  GLU P OE2   1 
ATOM   9918  N N     . LYS E 1 187 ? 297.129 37.497  79.460 1.00 41.03 ? 239  LYS P N     1 
ATOM   9919  C CA    . LYS E 1 187 ? 296.039 37.105  78.604 1.00 39.84 ? 239  LYS P CA    1 
ATOM   9920  C C     . LYS E 1 187 ? 296.304 37.549  77.172 1.00 38.58 ? 239  LYS P C     1 
ATOM   9921  O O     . LYS E 1 187 ? 296.695 38.691  76.929 1.00 38.90 ? 239  LYS P O     1 
ATOM   9922  C CB    . LYS E 1 187 ? 294.745 37.738  79.101 1.00 40.80 ? 239  LYS P CB    1 
ATOM   9923  C CG    . LYS E 1 187 ? 294.565 37.742  80.614 1.00 41.01 ? 239  LYS P CG    1 
ATOM   9924  C CD    . LYS E 1 187 ? 294.139 36.396  81.157 1.00 41.44 ? 239  LYS P CD    1 
ATOM   9925  C CE    . LYS E 1 187 ? 293.690 36.519  82.619 1.00 41.65 ? 239  LYS P CE    1 
ATOM   9926  N NZ    . LYS E 1 187 ? 294.689 37.162  83.527 1.00 40.66 ? 239  LYS P NZ    1 
ATOM   9927  N N     . PRO E 1 188 ? 296.126 36.639  76.202 1.00 37.09 ? 240  PRO P N     1 
ATOM   9928  C CA    . PRO E 1 188 ? 296.365 37.059  74.824 1.00 36.40 ? 240  PRO P CA    1 
ATOM   9929  C C     . PRO E 1 188 ? 295.314 38.080  74.417 1.00 35.21 ? 240  PRO P C     1 
ATOM   9930  O O     . PRO E 1 188 ? 294.246 38.162  75.022 1.00 34.76 ? 240  PRO P O     1 
ATOM   9931  C CB    . PRO E 1 188 ? 296.245 35.754  74.034 1.00 36.33 ? 240  PRO P CB    1 
ATOM   9932  C CG    . PRO E 1 188 ? 295.342 34.909  74.884 1.00 35.74 ? 240  PRO P CG    1 
ATOM   9933  C CD    . PRO E 1 188 ? 295.848 35.194  76.267 1.00 36.17 ? 240  PRO P CD    1 
ATOM   9934  N N     . THR E 1 189 ? 295.629 38.878  73.410 1.00 33.67 ? 241  THR P N     1 
ATOM   9935  C CA    . THR E 1 189 ? 294.681 39.858  72.932 1.00 32.59 ? 241  THR P CA    1 
ATOM   9936  C C     . THR E 1 189 ? 294.166 39.410  71.551 1.00 32.80 ? 241  THR P C     1 
ATOM   9937  O O     . THR E 1 189 ? 293.161 39.911  71.041 1.00 32.99 ? 241  THR P O     1 
ATOM   9938  C CB    . THR E 1 189 ? 295.320 41.272  72.910 1.00 31.59 ? 241  THR P CB    1 
ATOM   9939  O OG1   . THR E 1 189 ? 296.647 41.204  72.388 1.00 28.20 ? 241  THR P OG1   1 
ATOM   9940  C CG2   . THR E 1 189 ? 295.356 41.850  74.328 1.00 29.69 ? 241  THR P CG2   1 
ATOM   9941  N N     . ALA E 1 190 ? 294.850 38.425  70.981 1.00 32.40 ? 242  ALA P N     1 
ATOM   9942  C CA    . ALA E 1 190 ? 294.482 37.847  69.696 1.00 31.70 ? 242  ALA P CA    1 
ATOM   9943  C C     . ALA E 1 190 ? 294.788 36.341  69.692 1.00 31.78 ? 242  ALA P C     1 
ATOM   9944  O O     . ALA E 1 190 ? 295.797 35.881  70.227 1.00 32.94 ? 242  ALA P O     1 
ATOM   9945  C CB    . ALA E 1 190 ? 295.234 38.541  68.568 1.00 30.68 ? 242  ALA P CB    1 
ATOM   9946  N N     . ILE E 1 191 ? 293.896 35.567  69.103 1.00 31.83 ? 243  ILE P N     1 
ATOM   9947  C CA    . ILE E 1 191 ? 294.087 34.131  69.028 1.00 32.17 ? 243  ILE P CA    1 
ATOM   9948  C C     . ILE E 1 191 ? 294.010 33.725  67.557 1.00 32.62 ? 243  ILE P C     1 
ATOM   9949  O O     . ILE E 1 191 ? 293.153 34.206  66.808 1.00 32.49 ? 243  ILE P O     1 
ATOM   9950  C CB    . ILE E 1 191 ? 292.986 33.375  69.824 1.00 32.51 ? 243  ILE P CB    1 
ATOM   9951  C CG1   . ILE E 1 191 ? 293.093 33.713  71.307 1.00 32.62 ? 243  ILE P CG1   1 
ATOM   9952  C CG2   . ILE E 1 191 ? 293.091 31.871  69.581 1.00 29.84 ? 243  ILE P CG2   1 
ATOM   9953  C CD1   . ILE E 1 191 ? 292.035 33.068  72.149 1.00 38.29 ? 243  ILE P CD1   1 
ATOM   9954  N N     . PHE E 1 192 ? 294.923 32.858  67.143 1.00 31.80 ? 244  PHE P N     1 
ATOM   9955  C CA    . PHE E 1 192 ? 294.922 32.380  65.781 1.00 30.68 ? 244  PHE P CA    1 
ATOM   9956  C C     . PHE E 1 192 ? 294.528 30.915  65.829 1.00 30.23 ? 244  PHE P C     1 
ATOM   9957  O O     . PHE E 1 192 ? 295.284 30.072  66.319 1.00 30.89 ? 244  PHE P O     1 
ATOM   9958  C CB    . PHE E 1 192 ? 296.299 32.531  65.148 1.00 30.59 ? 244  PHE P CB    1 
ATOM   9959  C CG    . PHE E 1 192 ? 296.405 31.878  63.821 1.00 32.36 ? 244  PHE P CG    1 
ATOM   9960  C CD1   . PHE E 1 192 ? 295.536 32.234  62.792 1.00 35.09 ? 244  PHE P CD1   1 
ATOM   9961  C CD2   . PHE E 1 192 ? 297.323 30.865  63.603 1.00 33.08 ? 244  PHE P CD2   1 
ATOM   9962  C CE1   . PHE E 1 192 ? 295.579 31.582  61.558 1.00 34.80 ? 244  PHE P CE1   1 
ATOM   9963  C CE2   . PHE E 1 192 ? 297.381 30.201  62.371 1.00 34.63 ? 244  PHE P CE2   1 
ATOM   9964  C CZ    . PHE E 1 192 ? 296.508 30.559  61.346 1.00 34.65 ? 244  PHE P CZ    1 
ATOM   9965  N N     . VAL E 1 193 ? 293.332 30.618  65.328 1.00 29.81 ? 245  VAL P N     1 
ATOM   9966  C CA    . VAL E 1 193 ? 292.804 29.253  65.308 1.00 28.57 ? 245  VAL P CA    1 
ATOM   9967  C C     . VAL E 1 193 ? 293.034 28.569  63.951 1.00 29.23 ? 245  VAL P C     1 
ATOM   9968  O O     . VAL E 1 193 ? 292.738 29.129  62.903 1.00 28.55 ? 245  VAL P O     1 
ATOM   9969  C CB    . VAL E 1 193 ? 291.315 29.268  65.663 1.00 24.76 ? 245  VAL P CB    1 
ATOM   9970  C CG1   . VAL E 1 193 ? 290.785 27.875  65.707 1.00 25.30 ? 245  VAL P CG1   1 
ATOM   9971  C CG2   . VAL E 1 193 ? 291.119 29.934  67.015 1.00 24.10 ? 245  VAL P CG2   1 
ATOM   9972  N N     . GLY E 1 194 ? 293.565 27.348  63.981 1.00 31.30 ? 246  GLY P N     1 
ATOM   9973  C CA    . GLY E 1 194 ? 293.871 26.641  62.742 1.00 32.65 ? 246  GLY P CA    1 
ATOM   9974  C C     . GLY E 1 194 ? 292.722 26.064  61.950 1.00 33.21 ? 246  GLY P C     1 
ATOM   9975  O O     . GLY E 1 194 ? 292.919 25.484  60.877 1.00 33.86 ? 246  GLY P O     1 
ATOM   9976  N N     . THR E 1 195 ? 291.512 26.244  62.463 1.00 33.98 ? 247  THR P N     1 
ATOM   9977  C CA    . THR E 1 195 ? 290.328 25.708  61.818 1.00 32.48 ? 247  THR P CA    1 
ATOM   9978  C C     . THR E 1 195 ? 289.083 26.517  62.157 1.00 33.38 ? 247  THR P C     1 
ATOM   9979  O O     . THR E 1 195 ? 288.830 26.829  63.319 1.00 34.58 ? 247  THR P O     1 
ATOM   9980  C CB    . THR E 1 195 ? 290.182 24.238  62.234 1.00 31.38 ? 247  THR P CB    1 
ATOM   9981  O OG1   . THR E 1 195 ? 290.625 23.415  61.153 1.00 30.50 ? 247  THR P OG1   1 
ATOM   9982  C CG2   . THR E 1 195 ? 288.766 23.891  62.645 1.00 30.76 ? 247  THR P CG2   1 
ATOM   9983  N N     . ASP E 1 196 ? 288.317 26.874  61.131 1.00 34.01 ? 248  ASP P N     1 
ATOM   9984  C CA    . ASP E 1 196 ? 287.092 27.641  61.323 1.00 32.92 ? 248  ASP P CA    1 
ATOM   9985  C C     . ASP E 1 196 ? 286.271 27.120  62.499 1.00 33.79 ? 248  ASP P C     1 
ATOM   9986  O O     . ASP E 1 196 ? 286.072 27.830  63.482 1.00 34.68 ? 248  ASP P O     1 
ATOM   9987  C CB    . ASP E 1 196 ? 286.217 27.594  60.068 1.00 32.01 ? 248  ASP P CB    1 
ATOM   9988  C CG    . ASP E 1 196 ? 286.576 28.651  59.066 1.00 31.83 ? 248  ASP P CG    1 
ATOM   9989  O OD1   . ASP E 1 196 ? 285.825 28.825  58.094 1.00 30.52 ? 248  ASP P OD1   1 
ATOM   9990  O OD2   . ASP E 1 196 ? 287.608 29.315  59.243 1.00 34.37 ? 248  ASP P OD2   1 
ATOM   9991  N N     . GLU E 1 197 ? 285.804 25.874  62.406 1.00 33.28 ? 249  GLU P N     1 
ATOM   9992  C CA    . GLU E 1 197 ? 284.976 25.323  63.461 1.00 32.46 ? 249  GLU P CA    1 
ATOM   9993  C C     . GLU E 1 197 ? 285.480 25.552  64.863 1.00 32.36 ? 249  GLU P C     1 
ATOM   9994  O O     . GLU E 1 197 ? 284.683 25.852  65.756 1.00 33.67 ? 249  GLU P O     1 
ATOM   9995  C CB    . GLU E 1 197 ? 284.725 23.835  63.285 1.00 34.30 ? 249  GLU P CB    1 
ATOM   9996  C CG    . GLU E 1 197 ? 283.790 23.336  64.376 1.00 36.33 ? 249  GLU P CG    1 
ATOM   9997  C CD    . GLU E 1 197 ? 283.064 22.073  64.012 1.00 38.40 ? 249  GLU P CD    1 
ATOM   9998  O OE1   . GLU E 1 197 ? 282.513 22.008  62.896 1.00 39.23 ? 249  GLU P OE1   1 
ATOM   9999  O OE2   . GLU E 1 197 ? 283.030 21.150  64.852 1.00 42.46 ? 249  GLU P OE2   1 
ATOM   10000 N N     . MET E 1 198 ? 286.779 25.401  65.085 1.00 30.41 ? 250  MET P N     1 
ATOM   10001 C CA    . MET E 1 198 ? 287.289 25.636  66.424 1.00 30.74 ? 250  MET P CA    1 
ATOM   10002 C C     . MET E 1 198 ? 287.259 27.129  66.725 1.00 29.60 ? 250  MET P C     1 
ATOM   10003 O O     . MET E 1 198 ? 287.051 27.537  67.874 1.00 27.76 ? 250  MET P O     1 
ATOM   10004 C CB    . MET E 1 198 ? 288.707 25.108  66.572 1.00 32.08 ? 250  MET P CB    1 
ATOM   10005 C CG    . MET E 1 198 ? 288.788 23.603  66.661 1.00 34.23 ? 250  MET P CG    1 
ATOM   10006 S SD    . MET E 1 198 ? 290.465 23.107  67.039 1.00 37.37 ? 250  MET P SD    1 
ATOM   10007 C CE    . MET E 1 198 ? 291.309 23.603  65.550 1.00 35.36 ? 250  MET P CE    1 
ATOM   10008 N N     . ALA E 1 199 ? 287.452 27.938  65.685 1.00 28.66 ? 251  ALA P N     1 
ATOM   10009 C CA    . ALA E 1 199 ? 287.447 29.384  65.851 1.00 28.57 ? 251  ALA P CA    1 
ATOM   10010 C C     . ALA E 1 199 ? 286.088 29.832  66.352 1.00 29.79 ? 251  ALA P C     1 
ATOM   10011 O O     . ALA E 1 199 ? 286.001 30.790  67.123 1.00 31.56 ? 251  ALA P O     1 
ATOM   10012 C CB    . ALA E 1 199 ? 287.784 30.076  64.556 1.00 27.04 ? 251  ALA P CB    1 
ATOM   10013 N N     . LEU E 1 200 ? 285.028 29.146  65.930 1.00 29.51 ? 252  LEU P N     1 
ATOM   10014 C CA    . LEU E 1 200 ? 283.695 29.504  66.401 1.00 29.70 ? 252  LEU P CA    1 
ATOM   10015 C C     . LEU E 1 200 ? 283.585 29.180  67.891 1.00 29.26 ? 252  LEU P C     1 
ATOM   10016 O O     . LEU E 1 200 ? 282.867 29.848  68.643 1.00 29.17 ? 252  LEU P O     1 
ATOM   10017 C CB    . LEU E 1 200 ? 282.618 28.762  65.599 1.00 29.08 ? 252  LEU P CB    1 
ATOM   10018 C CG    . LEU E 1 200 ? 282.201 29.462  64.293 1.00 28.24 ? 252  LEU P CG    1 
ATOM   10019 C CD1   . LEU E 1 200 ? 283.390 29.499  63.365 1.00 28.61 ? 252  LEU P CD1   1 
ATOM   10020 C CD2   . LEU E 1 200 ? 281.034 28.750  63.630 1.00 25.92 ? 252  LEU P CD2   1 
ATOM   10021 N N     . GLY E 1 201 ? 284.331 28.164  68.312 1.00 29.22 ? 253  GLY P N     1 
ATOM   10022 C CA    . GLY E 1 201 ? 284.322 27.761  69.705 1.00 28.21 ? 253  GLY P CA    1 
ATOM   10023 C C     . GLY E 1 201 ? 285.127 28.743  70.523 1.00 27.38 ? 253  GLY P C     1 
ATOM   10024 O O     . GLY E 1 201 ? 284.855 28.970  71.698 1.00 28.15 ? 253  GLY P O     1 
ATOM   10025 N N     . VAL E 1 202 ? 286.138 29.322  69.897 1.00 27.24 ? 254  VAL P N     1 
ATOM   10026 C CA    . VAL E 1 202 ? 286.973 30.308  70.562 1.00 25.92 ? 254  VAL P CA    1 
ATOM   10027 C C     . VAL E 1 202 ? 286.162 31.596  70.714 1.00 25.83 ? 254  VAL P C     1 
ATOM   10028 O O     . VAL E 1 202 ? 286.111 32.177  71.803 1.00 25.37 ? 254  VAL P O     1 
ATOM   10029 C CB    . VAL E 1 202 ? 288.263 30.566  69.756 1.00 25.38 ? 254  VAL P CB    1 
ATOM   10030 C CG1   . VAL E 1 202 ? 288.955 31.813  70.269 1.00 24.36 ? 254  VAL P CG1   1 
ATOM   10031 C CG2   . VAL E 1 202 ? 289.176 29.345  69.849 1.00 19.43 ? 254  VAL P CG2   1 
ATOM   10032 N N     . ILE E 1 203 ? 285.520 32.039  69.634 1.00 25.97 ? 255  ILE P N     1 
ATOM   10033 C CA    . ILE E 1 203 ? 284.689 33.245  69.710 1.00 26.31 ? 255  ILE P CA    1 
ATOM   10034 C C     . ILE E 1 203 ? 283.703 33.087  70.873 1.00 26.60 ? 255  ILE P C     1 
ATOM   10035 O O     . ILE E 1 203 ? 283.673 33.902  71.799 1.00 26.30 ? 255  ILE P O     1 
ATOM   10036 C CB    . ILE E 1 203 ? 283.801 33.461  68.461 1.00 26.84 ? 255  ILE P CB    1 
ATOM   10037 C CG1   . ILE E 1 203 ? 284.636 33.521  67.176 1.00 26.86 ? 255  ILE P CG1   1 
ATOM   10038 C CG2   . ILE E 1 203 ? 282.960 34.715  68.664 1.00 24.76 ? 255  ILE P CG2   1 
ATOM   10039 C CD1   . ILE E 1 203 ? 285.436 34.745  67.002 1.00 36.98 ? 255  ILE P CD1   1 
ATOM   10040 N N     . HIS E 1 204 ? 282.897 32.027  70.808 1.00 26.16 ? 256  HIS P N     1 
ATOM   10041 C CA    . HIS E 1 204 ? 281.876 31.776  71.818 1.00 26.44 ? 256  HIS P CA    1 
ATOM   10042 C C     . HIS E 1 204 ? 282.414 31.570  73.228 1.00 25.63 ? 256  HIS P C     1 
ATOM   10043 O O     . HIS E 1 204 ? 281.790 31.980  74.201 1.00 24.79 ? 256  HIS P O     1 
ATOM   10044 C CB    . HIS E 1 204 ? 281.009 30.598  71.381 1.00 27.07 ? 256  HIS P CB    1 
ATOM   10045 C CG    . HIS E 1 204 ? 280.131 30.914  70.210 1.00 30.06 ? 256  HIS P CG    1 
ATOM   10046 N ND1   . HIS E 1 204 ? 279.506 29.942  69.456 1.00 29.68 ? 256  HIS P ND1   1 
ATOM   10047 C CD2   . HIS E 1 204 ? 279.797 32.100  69.646 1.00 28.38 ? 256  HIS P CD2   1 
ATOM   10048 C CE1   . HIS E 1 204 ? 278.833 30.514  68.475 1.00 28.05 ? 256  HIS P CE1   1 
ATOM   10049 N NE2   . HIS E 1 204 ? 278.992 31.822  68.569 1.00 29.51 ? 256  HIS P NE2   1 
ATOM   10050 N N     . GLY E 1 205 ? 283.574 30.938  73.338 1.00 24.84 ? 257  GLY P N     1 
ATOM   10051 C CA    . GLY E 1 205 ? 284.162 30.727  74.642 1.00 22.84 ? 257  GLY P CA    1 
ATOM   10052 C C     . GLY E 1 205 ? 284.451 32.094  75.228 1.00 22.56 ? 257  GLY P C     1 
ATOM   10053 O O     . GLY E 1 205 ? 284.104 32.365  76.375 1.00 22.03 ? 257  GLY P O     1 
ATOM   10054 N N     . ALA E 1 206 ? 285.082 32.957  74.432 1.00 20.76 ? 258  ALA P N     1 
ATOM   10055 C CA    . ALA E 1 206 ? 285.398 34.304  74.870 1.00 19.16 ? 258  ALA P CA    1 
ATOM   10056 C C     . ALA E 1 206 ? 284.127 35.006  75.342 1.00 19.19 ? 258  ALA P C     1 
ATOM   10057 O O     . ALA E 1 206 ? 284.009 35.369  76.500 1.00 18.68 ? 258  ALA P O     1 
ATOM   10058 C CB    . ALA E 1 206 ? 286.035 35.088  73.732 1.00 17.13 ? 258  ALA P CB    1 
ATOM   10059 N N     . GLN E 1 207 ? 283.165 35.174  74.443 1.00 20.61 ? 259  GLN P N     1 
ATOM   10060 C CA    . GLN E 1 207 ? 281.919 35.852  74.776 1.00 21.62 ? 259  GLN P CA    1 
ATOM   10061 C C     . GLN E 1 207 ? 281.217 35.279  76.000 1.00 22.75 ? 259  GLN P C     1 
ATOM   10062 O O     . GLN E 1 207 ? 280.702 36.022  76.822 1.00 22.21 ? 259  GLN P O     1 
ATOM   10063 C CB    . GLN E 1 207 ? 280.974 35.807  73.589 1.00 19.88 ? 259  GLN P CB    1 
ATOM   10064 C CG    . GLN E 1 207 ? 281.534 36.440  72.349 1.00 18.40 ? 259  GLN P CG    1 
ATOM   10065 C CD    . GLN E 1 207 ? 280.718 36.083  71.129 1.00 18.71 ? 259  GLN P CD    1 
ATOM   10066 O OE1   . GLN E 1 207 ? 279.760 35.319  71.221 1.00 19.26 ? 259  GLN P OE1   1 
ATOM   10067 N NE2   . GLN E 1 207 ? 281.093 36.626  69.976 1.00 17.73 ? 259  GLN P NE2   1 
ATOM   10068 N N     . ASP E 1 208 ? 281.191 33.960  76.120 1.00 25.68 ? 260  ASP P N     1 
ATOM   10069 C CA    . ASP E 1 208 ? 280.541 33.322  77.260 1.00 27.73 ? 260  ASP P CA    1 
ATOM   10070 C C     . ASP E 1 208 ? 281.123 33.786  78.598 1.00 29.11 ? 260  ASP P C     1 
ATOM   10071 O O     . ASP E 1 208 ? 280.416 33.829  79.612 1.00 28.18 ? 260  ASP P O     1 
ATOM   10072 C CB    . ASP E 1 208 ? 280.648 31.796  77.152 1.00 27.06 ? 260  ASP P CB    1 
ATOM   10073 C CG    . ASP E 1 208 ? 279.754 31.220  76.060 1.00 26.33 ? 260  ASP P CG    1 
ATOM   10074 O OD1   . ASP E 1 208 ? 278.711 31.849  75.771 1.00 24.25 ? 260  ASP P OD1   1 
ATOM   10075 O OD2   . ASP E 1 208 ? 280.085 30.138  75.512 1.00 24.38 ? 260  ASP P OD2   1 
ATOM   10076 N N     . ARG E 1 209 ? 282.409 34.132  78.596 1.00 30.21 ? 261  ARG P N     1 
ATOM   10077 C CA    . ARG E 1 209 ? 283.064 34.596  79.810 1.00 30.47 ? 261  ARG P CA    1 
ATOM   10078 C C     . ARG E 1 209 ? 283.140 36.119  79.931 1.00 30.78 ? 261  ARG P C     1 
ATOM   10079 O O     . ARG E 1 209 ? 283.901 36.645  80.743 1.00 31.30 ? 261  ARG P O     1 
ATOM   10080 C CB    . ARG E 1 209 ? 284.459 33.991  79.929 1.00 31.49 ? 261  ARG P CB    1 
ATOM   10081 C CG    . ARG E 1 209 ? 284.450 32.497  80.222 1.00 35.40 ? 261  ARG P CG    1 
ATOM   10082 C CD    . ARG E 1 209 ? 284.831 31.715  78.982 1.00 39.55 ? 261  ARG P CD    1 
ATOM   10083 N NE    . ARG E 1 209 ? 284.338 30.334  78.988 1.00 43.73 ? 261  ARG P NE    1 
ATOM   10084 C CZ    . ARG E 1 209 ? 285.021 29.291  79.453 1.00 45.42 ? 261  ARG P CZ    1 
ATOM   10085 N NH1   . ARG E 1 209 ? 286.244 29.459  79.956 1.00 46.97 ? 261  ARG P NH1   1 
ATOM   10086 N NH2   . ARG E 1 209 ? 284.480 28.081  79.412 1.00 43.75 ? 261  ARG P NH2   1 
ATOM   10087 N N     . GLY E 1 210 ? 282.362 36.827  79.120 1.00 29.69 ? 262  GLY P N     1 
ATOM   10088 C CA    . GLY E 1 210 ? 282.335 38.270  79.221 1.00 30.48 ? 262  GLY P CA    1 
ATOM   10089 C C     . GLY E 1 210 ? 283.298 39.124  78.427 1.00 31.48 ? 262  GLY P C     1 
ATOM   10090 O O     . GLY E 1 210 ? 283.504 40.286  78.787 1.00 33.05 ? 262  GLY P O     1 
ATOM   10091 N N     . LEU E 1 211 ? 283.890 38.588  77.367 1.00 30.36 ? 263  LEU P N     1 
ATOM   10092 C CA    . LEU E 1 211 ? 284.801 39.382  76.556 1.00 29.36 ? 263  LEU P CA    1 
ATOM   10093 C C     . LEU E 1 211 ? 284.145 39.699  75.220 1.00 29.78 ? 263  LEU P C     1 
ATOM   10094 O O     . LEU E 1 211 ? 283.195 39.027  74.813 1.00 30.44 ? 263  LEU P O     1 
ATOM   10095 C CB    . LEU E 1 211 ? 286.098 38.626  76.310 1.00 28.46 ? 263  LEU P CB    1 
ATOM   10096 C CG    . LEU E 1 211 ? 287.014 38.294  77.489 1.00 27.68 ? 263  LEU P CG    1 
ATOM   10097 C CD1   . LEU E 1 211 ? 288.180 37.437  76.997 1.00 26.29 ? 263  LEU P CD1   1 
ATOM   10098 C CD2   . LEU E 1 211 ? 287.521 39.567  78.123 1.00 25.55 ? 263  LEU P CD2   1 
ATOM   10099 N N     . ASN E 1 212 ? 284.640 40.729  74.545 1.00 28.70 ? 264  ASN P N     1 
ATOM   10100 C CA    . ASN E 1 212 ? 284.109 41.097  73.251 1.00 28.48 ? 264  ASN P CA    1 
ATOM   10101 C C     . ASN E 1 212 ? 285.112 40.788  72.150 1.00 29.08 ? 264  ASN P C     1 
ATOM   10102 O O     . ASN E 1 212 ? 286.319 40.891  72.347 1.00 27.76 ? 264  ASN P O     1 
ATOM   10103 C CB    . ASN E 1 212 ? 283.768 42.584  73.217 1.00 29.56 ? 264  ASN P CB    1 
ATOM   10104 C CG    . ASN E 1 212 ? 283.272 43.042  71.852 1.00 29.42 ? 264  ASN P CG    1 
ATOM   10105 O OD1   . ASN E 1 212 ? 284.036 43.172  70.891 1.00 29.16 ? 264  ASN P OD1   1 
ATOM   10106 N ND2   . ASN E 1 212 ? 281.984 43.285  71.766 1.00 30.66 ? 264  ASN P ND2   1 
ATOM   10107 N N     . VAL E 1 213 ? 284.592 40.372  70.998 1.00 30.45 ? 265  VAL P N     1 
ATOM   10108 C CA    . VAL E 1 213 ? 285.402 40.099  69.810 1.00 30.51 ? 265  VAL P CA    1 
ATOM   10109 C C     . VAL E 1 213 ? 284.846 41.170  68.877 1.00 30.37 ? 265  VAL P C     1 
ATOM   10110 O O     . VAL E 1 213 ? 283.629 41.239  68.678 1.00 32.26 ? 265  VAL P O     1 
ATOM   10111 C CB    . VAL E 1 213 ? 285.126 38.678  69.212 1.00 29.98 ? 265  VAL P CB    1 
ATOM   10112 C CG1   . VAL E 1 213 ? 285.992 38.437  67.976 1.00 29.17 ? 265  VAL P CG1   1 
ATOM   10113 C CG2   . VAL E 1 213 ? 285.428 37.613  70.248 1.00 28.68 ? 265  VAL P CG2   1 
ATOM   10114 N N     . PRO E 1 214 ? 285.714 42.000  68.271 1.00 30.01 ? 266  PRO P N     1 
ATOM   10115 C CA    . PRO E 1 214 ? 287.179 42.050  68.348 1.00 30.56 ? 266  PRO P CA    1 
ATOM   10116 C C     . PRO E 1 214 ? 287.753 43.020  69.381 1.00 31.85 ? 266  PRO P C     1 
ATOM   10117 O O     . PRO E 1 214 ? 288.961 43.215  69.448 1.00 33.37 ? 266  PRO P O     1 
ATOM   10118 C CB    . PRO E 1 214 ? 287.545 42.487  66.948 1.00 28.85 ? 266  PRO P CB    1 
ATOM   10119 C CG    . PRO E 1 214 ? 286.516 43.571  66.724 1.00 27.46 ? 266  PRO P CG    1 
ATOM   10120 C CD    . PRO E 1 214 ? 285.223 42.999  67.301 1.00 26.87 ? 266  PRO P CD    1 
ATOM   10121 N N     . ASN E 1 215 ? 286.898 43.636  70.179 1.00 32.39 ? 267  ASN P N     1 
ATOM   10122 C CA    . ASN E 1 215 ? 287.382 44.604  71.140 1.00 32.93 ? 267  ASN P CA    1 
ATOM   10123 C C     . ASN E 1 215 ? 288.367 44.069  72.157 1.00 33.13 ? 267  ASN P C     1 
ATOM   10124 O O     . ASN E 1 215 ? 289.451 44.621  72.308 1.00 35.91 ? 267  ASN P O     1 
ATOM   10125 C CB    . ASN E 1 215 ? 286.203 45.269  71.849 1.00 35.05 ? 267  ASN P CB    1 
ATOM   10126 C CG    . ASN E 1 215 ? 285.484 46.270  70.961 1.00 34.71 ? 267  ASN P CG    1 
ATOM   10127 O OD1   . ASN E 1 215 ? 284.350 46.663  71.241 1.00 35.39 ? 267  ASN P OD1   1 
ATOM   10128 N ND2   . ASN E 1 215 ? 286.147 46.695  69.886 1.00 33.02 ? 267  ASN P ND2   1 
ATOM   10129 N N     . ASP E 1 216 ? 288.009 43.003  72.856 1.00 31.54 ? 268  ASP P N     1 
ATOM   10130 C CA    . ASP E 1 216 ? 288.901 42.447  73.863 1.00 30.67 ? 268  ASP P CA    1 
ATOM   10131 C C     . ASP E 1 216 ? 289.724 41.276  73.335 1.00 30.79 ? 268  ASP P C     1 
ATOM   10132 O O     . ASP E 1 216 ? 290.651 40.797  74.004 1.00 30.68 ? 268  ASP P O     1 
ATOM   10133 C CB    . ASP E 1 216 ? 288.105 41.972  75.077 1.00 29.98 ? 268  ASP P CB    1 
ATOM   10134 C CG    . ASP E 1 216 ? 287.174 43.020  75.602 1.00 30.03 ? 268  ASP P CG    1 
ATOM   10135 O OD1   . ASP E 1 216 ? 287.676 44.033  76.127 1.00 31.83 ? 268  ASP P OD1   1 
ATOM   10136 O OD2   . ASP E 1 216 ? 285.939 42.831  75.486 1.00 31.14 ? 268  ASP P OD2   1 
ATOM   10137 N N     . LEU E 1 217 ? 289.401 40.817  72.137 1.00 29.86 ? 269  LEU P N     1 
ATOM   10138 C CA    . LEU E 1 217 ? 290.121 39.682  71.613 1.00 30.80 ? 269  LEU P CA    1 
ATOM   10139 C C     . LEU E 1 217 ? 289.833 39.531  70.140 1.00 30.38 ? 269  LEU P C     1 
ATOM   10140 O O     . LEU E 1 217 ? 288.677 39.393  69.731 1.00 30.40 ? 269  LEU P O     1 
ATOM   10141 C CB    . LEU E 1 217 ? 289.683 38.427  72.382 1.00 32.22 ? 269  LEU P CB    1 
ATOM   10142 C CG    . LEU E 1 217 ? 290.403 37.077  72.300 1.00 33.17 ? 269  LEU P CG    1 
ATOM   10143 C CD1   . LEU E 1 217 ? 291.847 37.223  72.767 1.00 32.82 ? 269  LEU P CD1   1 
ATOM   10144 C CD2   . LEU E 1 217 ? 289.660 36.062  73.181 1.00 32.43 ? 269  LEU P CD2   1 
ATOM   10145 N N     . GLU E 1 218 ? 290.887 39.591  69.339 1.00 28.58 ? 270  GLU P N     1 
ATOM   10146 C CA    . GLU E 1 218 ? 290.729 39.422  67.912 1.00 28.44 ? 270  GLU P CA    1 
ATOM   10147 C C     . GLU E 1 218 ? 290.999 37.947  67.610 1.00 26.78 ? 270  GLU P C     1 
ATOM   10148 O O     . GLU E 1 218 ? 291.868 37.338  68.212 1.00 25.64 ? 270  GLU P O     1 
ATOM   10149 C CB    . GLU E 1 218 ? 291.670 40.370  67.143 1.00 29.94 ? 270  GLU P CB    1 
ATOM   10150 C CG    . GLU E 1 218 ? 291.121 41.808  67.019 1.00 31.63 ? 270  GLU P CG    1 
ATOM   10151 C CD    . GLU E 1 218 ? 292.063 42.795  66.311 1.00 35.10 ? 270  GLU P CD    1 
ATOM   10152 O OE1   . GLU E 1 218 ? 292.599 42.472  65.221 1.00 36.20 ? 270  GLU P OE1   1 
ATOM   10153 O OE2   . GLU E 1 218 ? 292.252 43.916  66.841 1.00 36.51 ? 270  GLU P OE2   1 
ATOM   10154 N N     . ILE E 1 219 ? 290.214 37.378  66.696 1.00 26.70 ? 271  ILE P N     1 
ATOM   10155 C CA    . ILE E 1 219 ? 290.308 35.967  66.316 1.00 25.46 ? 271  ILE P CA    1 
ATOM   10156 C C     . ILE E 1 219 ? 290.456 35.799  64.785 1.00 25.83 ? 271  ILE P C     1 
ATOM   10157 O O     . ILE E 1 219 ? 289.903 36.583  64.011 1.00 26.29 ? 271  ILE P O     1 
ATOM   10158 C CB    . ILE E 1 219 ? 289.019 35.211  66.763 1.00 24.45 ? 271  ILE P CB    1 
ATOM   10159 C CG1   . ILE E 1 219 ? 288.638 35.605  68.193 1.00 25.80 ? 271  ILE P CG1   1 
ATOM   10160 C CG2   . ILE E 1 219 ? 289.211 33.718  66.664 1.00 22.36 ? 271  ILE P CG2   1 
ATOM   10161 C CD1   . ILE E 1 219 ? 289.680 35.329  69.229 1.00 36.24 ? 271  ILE P CD1   1 
ATOM   10162 N N     . ILE E 1 220 ? 291.230 34.806  64.347 1.00 24.56 ? 272  ILE P N     1 
ATOM   10163 C CA    . ILE E 1 220 ? 291.352 34.536  62.922 1.00 24.31 ? 272  ILE P CA    1 
ATOM   10164 C C     . ILE E 1 220 ? 291.289 33.019  62.755 1.00 26.16 ? 272  ILE P C     1 
ATOM   10165 O O     . ILE E 1 220 ? 291.985 32.297  63.467 1.00 25.34 ? 272  ILE P O     1 
ATOM   10166 C CB    . ILE E 1 220 ? 292.679 35.065  62.277 1.00 25.10 ? 272  ILE P CB    1 
ATOM   10167 C CG1   . ILE E 1 220 ? 292.751 36.595  62.316 1.00 24.14 ? 272  ILE P CG1   1 
ATOM   10168 C CG2   . ILE E 1 220 ? 292.709 34.702  60.778 1.00 20.75 ? 272  ILE P CG2   1 
ATOM   10169 C CD1   . ILE E 1 220 ? 293.193 37.137  63.609 1.00 36.62 ? 272  ILE P CD1   1 
ATOM   10170 N N     . GLY E 1 221 ? 290.447 32.548  61.827 1.00 25.82 ? 273  GLY P N     1 
ATOM   10171 C CA    . GLY E 1 221 ? 290.308 31.124  61.582 1.00 25.11 ? 273  GLY P CA    1 
ATOM   10172 C C     . GLY E 1 221 ? 291.071 30.664  60.357 1.00 26.14 ? 273  GLY P C     1 
ATOM   10173 O O     . GLY E 1 221 ? 291.857 31.415  59.803 1.00 24.83 ? 273  GLY P O     1 
ATOM   10174 N N     . PHE E 1 222 ? 290.840 29.427  59.928 1.00 29.01 ? 274  PHE P N     1 
ATOM   10175 C CA    . PHE E 1 222 ? 291.534 28.884  58.764 1.00 32.22 ? 274  PHE P CA    1 
ATOM   10176 C C     . PHE E 1 222 ? 290.613 28.029  57.891 1.00 34.93 ? 274  PHE P C     1 
ATOM   10177 O O     . PHE E 1 222 ? 289.877 27.181  58.404 1.00 36.03 ? 274  PHE P O     1 
ATOM   10178 C CB    . PHE E 1 222 ? 292.740 28.041  59.214 1.00 32.09 ? 274  PHE P CB    1 
ATOM   10179 C CG    . PHE E 1 222 ? 293.841 27.952  58.185 1.00 32.94 ? 274  PHE P CG    1 
ATOM   10180 C CD1   . PHE E 1 222 ? 293.683 27.189  57.035 1.00 33.04 ? 274  PHE P CD1   1 
ATOM   10181 C CD2   . PHE E 1 222 ? 295.026 28.674  58.348 1.00 33.24 ? 274  PHE P CD2   1 
ATOM   10182 C CE1   . PHE E 1 222 ? 294.680 27.144  56.062 1.00 32.36 ? 274  PHE P CE1   1 
ATOM   10183 C CE2   . PHE E 1 222 ? 296.030 28.635  57.379 1.00 33.05 ? 274  PHE P CE2   1 
ATOM   10184 C CZ    . PHE E 1 222 ? 295.855 27.868  56.235 1.00 32.76 ? 274  PHE P CZ    1 
ATOM   10185 N N     . ASP E 1 223 ? 290.668 28.273  56.578 1.00 37.62 ? 275  ASP P N     1 
ATOM   10186 C CA    . ASP E 1 223 ? 289.893 27.553  55.558 1.00 40.39 ? 275  ASP P CA    1 
ATOM   10187 C C     . ASP E 1 223 ? 288.833 28.388  54.840 1.00 40.78 ? 275  ASP P C     1 
ATOM   10188 O O     . ASP E 1 223 ? 288.490 28.116  53.685 1.00 42.97 ? 275  ASP P O     1 
ATOM   10189 C CB    . ASP E 1 223 ? 289.213 26.317  56.157 1.00 43.02 ? 275  ASP P CB    1 
ATOM   10190 C CG    . ASP E 1 223 ? 290.195 25.232  56.521 1.00 43.54 ? 275  ASP P CG    1 
ATOM   10191 O OD1   . ASP E 1 223 ? 289.800 24.298  57.257 1.00 45.64 ? 275  ASP P OD1   1 
ATOM   10192 O OD2   . ASP E 1 223 ? 291.349 25.312  56.062 1.00 43.35 ? 275  ASP P OD2   1 
ATOM   10193 N N     . ASN E 1 224 ? 288.317 29.405  55.518 1.00 39.17 ? 276  ASN P N     1 
ATOM   10194 C CA    . ASN E 1 224 ? 287.274 30.250  54.945 1.00 36.89 ? 276  ASN P CA    1 
ATOM   10195 C C     . ASN E 1 224 ? 286.101 29.368  54.554 1.00 34.54 ? 276  ASN P C     1 
ATOM   10196 O O     . ASN E 1 224 ? 285.584 29.431  53.447 1.00 34.04 ? 276  ASN P O     1 
ATOM   10197 C CB    . ASN E 1 224 ? 287.779 31.025  53.721 1.00 35.09 ? 276  ASN P CB    1 
ATOM   10198 C CG    . ASN E 1 224 ? 286.774 32.065  53.244 1.00 34.16 ? 276  ASN P CG    1 
ATOM   10199 O OD1   . ASN E 1 224 ? 286.265 32.864  54.037 1.00 31.68 ? 276  ASN P OD1   1 
ATOM   10200 N ND2   . ASN E 1 224 ? 286.485 32.062  51.945 1.00 34.26 ? 276  ASN P ND2   1 
ATOM   10201 N N     . THR E 1 225 ? 285.690 28.550  55.504 1.00 33.76 ? 277  THR P N     1 
ATOM   10202 C CA    . THR E 1 225 ? 284.588 27.627  55.330 1.00 34.50 ? 277  THR P CA    1 
ATOM   10203 C C     . THR E 1 225 ? 283.262 28.393  55.408 1.00 34.15 ? 277  THR P C     1 
ATOM   10204 O O     . THR E 1 225 ? 283.242 29.597  55.643 1.00 34.48 ? 277  THR P O     1 
ATOM   10205 C CB    . THR E 1 225 ? 284.680 26.529  56.438 1.00 34.93 ? 277  THR P CB    1 
ATOM   10206 O OG1   . THR E 1 225 ? 284.383 25.252  55.873 1.00 36.12 ? 277  THR P OG1   1 
ATOM   10207 C CG2   . THR E 1 225 ? 283.728 26.823  57.605 1.00 34.66 ? 277  THR P CG2   1 
ATOM   10208 N N     . ARG E 1 226 ? 282.160 27.692  55.199 1.00 34.71 ? 278  ARG P N     1 
ATOM   10209 C CA    . ARG E 1 226 ? 280.821 28.286  55.268 1.00 34.92 ? 278  ARG P CA    1 
ATOM   10210 C C     . ARG E 1 226 ? 280.495 28.872  56.660 1.00 32.58 ? 278  ARG P C     1 
ATOM   10211 O O     . ARG E 1 226 ? 279.776 29.864  56.773 1.00 31.42 ? 278  ARG P O     1 
ATOM   10212 C CB    . ARG E 1 226 ? 279.785 27.211  54.871 1.00 37.12 ? 278  ARG P CB    1 
ATOM   10213 C CG    . ARG E 1 226 ? 278.327 27.547  55.129 1.00 41.32 ? 278  ARG P CG    1 
ATOM   10214 C CD    . ARG E 1 226 ? 277.352 26.539  54.453 1.00 44.89 ? 278  ARG P CD    1 
ATOM   10215 N NE    . ARG E 1 226 ? 277.036 25.341  55.240 1.00 45.92 ? 278  ARG P NE    1 
ATOM   10216 C CZ    . ARG E 1 226 ? 277.764 24.227  55.261 1.00 47.07 ? 278  ARG P CZ    1 
ATOM   10217 N NH1   . ARG E 1 226 ? 278.870 24.140  54.534 1.00 47.14 ? 278  ARG P NH1   1 
ATOM   10218 N NH2   . ARG E 1 226 ? 277.377 23.192  56.007 1.00 47.13 ? 278  ARG P NH2   1 
ATOM   10219 N N     . LEU E 1 227 ? 281.034 28.260  57.712 1.00 31.63 ? 279  LEU P N     1 
ATOM   10220 C CA    . LEU E 1 227 ? 280.781 28.712  59.084 1.00 30.54 ? 279  LEU P CA    1 
ATOM   10221 C C     . LEU E 1 227 ? 281.299 30.119  59.353 1.00 29.26 ? 279  LEU P C     1 
ATOM   10222 O O     . LEU E 1 227 ? 280.779 30.799  60.223 1.00 28.22 ? 279  LEU P O     1 
ATOM   10223 C CB    . LEU E 1 227 ? 281.413 27.750  60.101 1.00 30.50 ? 279  LEU P CB    1 
ATOM   10224 C CG    . LEU E 1 227 ? 280.992 26.279  60.084 1.00 29.55 ? 279  LEU P CG    1 
ATOM   10225 C CD1   . LEU E 1 227 ? 281.815 25.515  61.101 1.00 31.04 ? 279  LEU P CD1   1 
ATOM   10226 C CD2   . LEU E 1 227 ? 279.523 26.147  60.388 1.00 28.51 ? 279  LEU P CD2   1 
ATOM   10227 N N     . SER E 1 228 ? 282.333 30.538  58.620 1.00 28.72 ? 280  SER P N     1 
ATOM   10228 C CA    . SER E 1 228 ? 282.914 31.870  58.765 1.00 27.27 ? 280  SER P CA    1 
ATOM   10229 C C     . SER E 1 228 ? 281.867 32.953  58.843 1.00 27.82 ? 280  SER P C     1 
ATOM   10230 O O     . SER E 1 228 ? 282.034 33.930  59.556 1.00 29.88 ? 280  SER P O     1 
ATOM   10231 C CB    . SER E 1 228 ? 283.812 32.199  57.587 1.00 26.61 ? 280  SER P CB    1 
ATOM   10232 O OG    . SER E 1 228 ? 285.049 31.537  57.700 1.00 33.17 ? 280  SER P OG    1 
ATOM   10233 N N     . THR E 1 229 ? 280.781 32.783  58.102 1.00 28.99 ? 281  THR P N     1 
ATOM   10234 C CA    . THR E 1 229 ? 279.720 33.780  58.071 1.00 27.89 ? 281  THR P CA    1 
ATOM   10235 C C     . THR E 1 229 ? 278.452 33.413  58.807 1.00 27.32 ? 281  THR P C     1 
ATOM   10236 O O     . THR E 1 229 ? 277.452 34.104  58.679 1.00 29.17 ? 281  THR P O     1 
ATOM   10237 C CB    . THR E 1 229 ? 279.359 34.105  56.644 1.00 28.34 ? 281  THR P CB    1 
ATOM   10238 O OG1   . THR E 1 229 ? 279.249 32.885  55.908 1.00 29.55 ? 281  THR P OG1   1 
ATOM   10239 C CG2   . THR E 1 229 ? 280.435 34.975  56.017 1.00 30.27 ? 281  THR P CG2   1 
ATOM   10240 N N     . MET E 1 230 ? 278.493 32.327  59.572 1.00 27.27 ? 282  MET P N     1 
ATOM   10241 C CA    . MET E 1 230 ? 277.345 31.892  60.343 1.00 26.96 ? 282  MET P CA    1 
ATOM   10242 C C     . MET E 1 230 ? 277.585 32.144  61.825 1.00 27.41 ? 282  MET P C     1 
ATOM   10243 O O     . MET E 1 230 ? 276.907 31.577  62.670 1.00 28.96 ? 282  MET P O     1 
ATOM   10244 C CB    . MET E 1 230 ? 277.069 30.418  60.072 1.00 27.80 ? 282  MET P CB    1 
ATOM   10245 C CG    . MET E 1 230 ? 276.629 30.178  58.634 1.00 30.74 ? 282  MET P CG    1 
ATOM   10246 S SD    . MET E 1 230 ? 276.530 28.442  58.133 1.00 35.30 ? 282  MET P SD    1 
ATOM   10247 C CE    . MET E 1 230 ? 275.173 27.871  59.185 1.00 36.23 ? 282  MET P CE    1 
ATOM   10248 N N     . VAL E 1 231 ? 278.557 33.005  62.126 1.00 28.25 ? 283  VAL P N     1 
ATOM   10249 C CA    . VAL E 1 231 ? 278.897 33.390  63.500 1.00 29.50 ? 283  VAL P CA    1 
ATOM   10250 C C     . VAL E 1 231 ? 278.713 34.884  63.597 1.00 29.64 ? 283  VAL P C     1 
ATOM   10251 O O     . VAL E 1 231 ? 278.528 35.568  62.599 1.00 32.34 ? 283  VAL P O     1 
ATOM   10252 C CB    . VAL E 1 231 ? 280.393 33.191  63.875 1.00 30.58 ? 283  VAL P CB    1 
ATOM   10253 C CG1   . VAL E 1 231 ? 280.501 32.567  65.269 1.00 28.23 ? 283  VAL P CG1   1 
ATOM   10254 C CG2   . VAL E 1 231 ? 281.135 32.408  62.791 1.00 30.19 ? 283  VAL P CG2   1 
ATOM   10255 N N     . ARG E 1 232 ? 278.813 35.385  64.814 1.00 30.14 ? 284  ARG P N     1 
ATOM   10256 C CA    . ARG E 1 232 ? 278.709 36.810  65.076 1.00 29.94 ? 284  ARG P CA    1 
ATOM   10257 C C     . ARG E 1 232 ? 279.718 37.127  66.211 1.00 28.60 ? 284  ARG P C     1 
ATOM   10258 O O     . ARG E 1 232 ? 279.635 36.558  67.302 1.00 25.22 ? 284  ARG P O     1 
ATOM   10259 C CB    . ARG E 1 232 ? 277.266 37.155  65.477 1.00 30.18 ? 284  ARG P CB    1 
ATOM   10260 C CG    . ARG E 1 232 ? 276.535 38.082  64.500 1.00 34.53 ? 284  ARG P CG    1 
ATOM   10261 C CD    . ARG E 1 232 ? 276.437 37.507  63.097 1.00 36.03 ? 284  ARG P CD    1 
ATOM   10262 N NE    . ARG E 1 232 ? 276.018 38.490  62.101 1.00 39.82 ? 284  ARG P NE    1 
ATOM   10263 C CZ    . ARG E 1 232 ? 274.867 39.161  62.130 1.00 43.18 ? 284  ARG P CZ    1 
ATOM   10264 N NH1   . ARG E 1 232 ? 274.002 38.960  63.112 1.00 44.75 ? 284  ARG P NH1   1 
ATOM   10265 N NH2   . ARG E 1 232 ? 274.577 40.041  61.176 1.00 45.09 ? 284  ARG P NH2   1 
ATOM   10266 N N     . PRO E 1 233 ? 280.711 38.005  65.948 1.00 28.49 ? 285  PRO P N     1 
ATOM   10267 C CA    . PRO E 1 233 ? 280.957 38.713  64.690 1.00 27.81 ? 285  PRO P CA    1 
ATOM   10268 C C     . PRO E 1 233 ? 281.471 37.741  63.647 1.00 29.20 ? 285  PRO P C     1 
ATOM   10269 O O     . PRO E 1 233 ? 282.065 36.711  63.988 1.00 29.87 ? 285  PRO P O     1 
ATOM   10270 C CB    . PRO E 1 233 ? 282.006 39.746  65.083 1.00 26.77 ? 285  PRO P CB    1 
ATOM   10271 C CG    . PRO E 1 233 ? 282.822 39.009  66.082 1.00 27.17 ? 285  PRO P CG    1 
ATOM   10272 C CD    . PRO E 1 233 ? 281.777 38.308  66.926 1.00 29.33 ? 285  PRO P CD    1 
ATOM   10273 N N     . GLN E 1 234 ? 281.254 38.056  62.377 1.00 29.76 ? 286  GLN P N     1 
ATOM   10274 C CA    . GLN E 1 234 ? 281.719 37.160  61.332 1.00 30.06 ? 286  GLN P CA    1 
ATOM   10275 C C     . GLN E 1 234 ? 283.231 36.970  61.432 1.00 27.74 ? 286  GLN P C     1 
ATOM   10276 O O     . GLN E 1 234 ? 283.979 37.906  61.671 1.00 26.72 ? 286  GLN P O     1 
ATOM   10277 C CB    . GLN E 1 234 ? 281.331 37.681  59.939 1.00 33.39 ? 286  GLN P CB    1 
ATOM   10278 C CG    . GLN E 1 234 ? 279.837 37.995  59.760 1.00 36.67 ? 286  GLN P CG    1 
ATOM   10279 C CD    . GLN E 1 234 ? 279.406 37.980  58.302 1.00 38.09 ? 286  GLN P CD    1 
ATOM   10280 O OE1   . GLN E 1 234 ? 280.072 38.548  57.431 1.00 39.22 ? 286  GLN P OE1   1 
ATOM   10281 N NE2   . GLN E 1 234 ? 278.286 37.326  58.030 1.00 39.52 ? 286  GLN P NE2   1 
ATOM   10282 N N     . LEU E 1 235 ? 283.647 35.734  61.215 1.00 26.59 ? 287  LEU P N     1 
ATOM   10283 C CA    . LEU E 1 235 ? 285.025 35.293  61.288 1.00 26.61 ? 287  LEU P CA    1 
ATOM   10284 C C     . LEU E 1 235 ? 285.956 35.653  60.135 1.00 27.21 ? 287  LEU P C     1 
ATOM   10285 O O     . LEU E 1 235 ? 285.700 35.272  59.008 1.00 27.39 ? 287  LEU P O     1 
ATOM   10286 C CB    . LEU E 1 235 ? 285.017 33.775  61.444 1.00 25.95 ? 287  LEU P CB    1 
ATOM   10287 C CG    . LEU E 1 235 ? 286.321 33.020  61.674 1.00 26.81 ? 287  LEU P CG    1 
ATOM   10288 C CD1   . LEU E 1 235 ? 286.889 33.368  63.047 1.00 24.45 ? 287  LEU P CD1   1 
ATOM   10289 C CD2   . LEU E 1 235 ? 286.043 31.526  61.552 1.00 24.82 ? 287  LEU P CD2   1 
ATOM   10290 N N     . THR E 1 236 ? 287.043 36.376  60.412 1.00 28.56 ? 288  THR P N     1 
ATOM   10291 C CA    . THR E 1 236 ? 288.000 36.672  59.348 1.00 28.35 ? 288  THR P CA    1 
ATOM   10292 C C     . THR E 1 236 ? 288.813 35.386  59.326 1.00 28.34 ? 288  THR P C     1 
ATOM   10293 O O     . THR E 1 236 ? 289.278 34.903  60.357 1.00 27.65 ? 288  THR P O     1 
ATOM   10294 C CB    . THR E 1 236 ? 288.935 37.885  59.647 1.00 27.90 ? 288  THR P CB    1 
ATOM   10295 O OG1   . THR E 1 236 ? 290.158 37.422  60.217 1.00 25.91 ? 288  THR P OG1   1 
ATOM   10296 C CG2   . THR E 1 236 ? 288.270 38.871  60.590 1.00 27.84 ? 288  THR P CG2   1 
ATOM   10297 N N     . SER E 1 237 ? 288.991 34.823  58.147 1.00 29.43 ? 289  SER P N     1 
ATOM   10298 C CA    . SER E 1 237 ? 289.673 33.555  58.066 1.00 30.53 ? 289  SER P CA    1 
ATOM   10299 C C     . SER E 1 237 ? 290.540 33.437  56.841 1.00 30.58 ? 289  SER P C     1 
ATOM   10300 O O     . SER E 1 237 ? 290.278 34.069  55.830 1.00 30.13 ? 289  SER P O     1 
ATOM   10301 C CB    . SER E 1 237 ? 288.610 32.453  58.086 1.00 30.90 ? 289  SER P CB    1 
ATOM   10302 O OG    . SER E 1 237 ? 289.127 31.219  57.663 1.00 34.68 ? 289  SER P OG    1 
ATOM   10303 N N     . VAL E 1 238 ? 291.589 32.632  56.951 1.00 33.10 ? 290  VAL P N     1 
ATOM   10304 C CA    . VAL E 1 238 ? 292.504 32.405  55.846 1.00 35.72 ? 290  VAL P CA    1 
ATOM   10305 C C     . VAL E 1 238 ? 291.765 31.642  54.758 1.00 37.73 ? 290  VAL P C     1 
ATOM   10306 O O     . VAL E 1 238 ? 291.124 30.624  55.026 1.00 38.70 ? 290  VAL P O     1 
ATOM   10307 C CB    . VAL E 1 238 ? 293.718 31.571  56.290 1.00 36.27 ? 290  VAL P CB    1 
ATOM   10308 C CG1   . VAL E 1 238 ? 294.668 31.364  55.112 1.00 35.17 ? 290  VAL P CG1   1 
ATOM   10309 C CG2   . VAL E 1 238 ? 294.423 32.262  57.448 1.00 35.50 ? 290  VAL P CG2   1 
ATOM   10310 N N     . VAL E 1 239 ? 291.852 32.131  53.527 1.00 39.22 ? 291  VAL P N     1 
ATOM   10311 C CA    . VAL E 1 239 ? 291.171 31.463  52.440 1.00 40.12 ? 291  VAL P CA    1 
ATOM   10312 C C     . VAL E 1 239 ? 292.026 30.405  51.790 1.00 41.51 ? 291  VAL P C     1 
ATOM   10313 O O     . VAL E 1 239 ? 293.193 30.625  51.475 1.00 41.50 ? 291  VAL P O     1 
ATOM   10314 C CB    . VAL E 1 239 ? 290.710 32.450  51.334 1.00 39.41 ? 291  VAL P CB    1 
ATOM   10315 C CG1   . VAL E 1 239 ? 290.038 31.683  50.191 1.00 39.23 ? 291  VAL P CG1   1 
ATOM   10316 C CG2   . VAL E 1 239 ? 289.743 33.454  51.907 1.00 39.09 ? 291  VAL P CG2   1 
ATOM   10317 N N     . GLN E 1 240 ? 291.430 29.235  51.642 1.00 43.40 ? 292  GLN P N     1 
ATOM   10318 C CA    . GLN E 1 240 ? 292.060 28.132  50.960 1.00 45.97 ? 292  GLN P CA    1 
ATOM   10319 C C     . GLN E 1 240 ? 291.122 28.089  49.780 1.00 46.66 ? 292  GLN P C     1 
ATOM   10320 O O     . GLN E 1 240 ? 289.935 27.837  49.957 1.00 48.36 ? 292  GLN P O     1 
ATOM   10321 C CB    . GLN E 1 240 ? 291.928 26.829  51.745 1.00 47.26 ? 292  GLN P CB    1 
ATOM   10322 C CG    . GLN E 1 240 ? 293.167 26.411  52.505 1.00 48.29 ? 292  GLN P CG    1 
ATOM   10323 C CD    . GLN E 1 240 ? 293.180 24.922  52.789 1.00 49.47 ? 292  GLN P CD    1 
ATOM   10324 O OE1   . GLN E 1 240 ? 293.387 24.107  51.891 1.00 50.84 ? 292  GLN P OE1   1 
ATOM   10325 N NE2   . GLN E 1 240 ? 292.948 24.559  54.039 1.00 51.76 ? 292  GLN P NE2   1 
ATOM   10326 N N     . PRO E 1 241 ? 291.616 28.381  48.573 1.00 46.64 ? 293  PRO P N     1 
ATOM   10327 C CA    . PRO E 1 241 ? 290.750 28.354  47.389 1.00 47.23 ? 293  PRO P CA    1 
ATOM   10328 C C     . PRO E 1 241 ? 290.287 26.933  47.086 1.00 47.26 ? 293  PRO P C     1 
ATOM   10329 O O     . PRO E 1 241 ? 291.028 26.156  46.485 1.00 47.22 ? 293  PRO P O     1 
ATOM   10330 C CB    . PRO E 1 241 ? 291.651 28.901  46.286 1.00 47.40 ? 293  PRO P CB    1 
ATOM   10331 C CG    . PRO E 1 241 ? 292.615 29.765  47.027 1.00 48.19 ? 293  PRO P CG    1 
ATOM   10332 C CD    . PRO E 1 241 ? 292.936 28.931  48.241 1.00 47.04 ? 293  PRO P CD    1 
ATOM   10333 N N     . MET E 1 242 ? 289.069 26.592  47.504 1.00 47.04 ? 294  MET P N     1 
ATOM   10334 C CA    . MET E 1 242 ? 288.539 25.253  47.273 1.00 46.47 ? 294  MET P CA    1 
ATOM   10335 C C     . MET E 1 242 ? 288.264 25.049  45.794 1.00 45.87 ? 294  MET P C     1 
ATOM   10336 O O     . MET E 1 242 ? 288.535 23.988  45.243 1.00 43.99 ? 294  MET P O     1 
ATOM   10337 C CB    . MET E 1 242 ? 287.272 25.047  48.105 1.00 47.50 ? 294  MET P CB    1 
ATOM   10338 C CG    . MET E 1 242 ? 287.568 24.945  49.592 1.00 49.82 ? 294  MET P CG    1 
ATOM   10339 S SD    . MET E 1 242 ? 286.138 25.085  50.670 1.00 53.79 ? 294  MET P SD    1 
ATOM   10340 C CE    . MET E 1 242 ? 286.040 26.864  50.859 1.00 54.56 ? 294  MET P CE    1 
ATOM   10341 N N     . TYR E 1 243 ? 287.739 26.087  45.156 1.00 46.75 ? 295  TYR P N     1 
ATOM   10342 C CA    . TYR E 1 243 ? 287.441 26.051  43.730 1.00 47.67 ? 295  TYR P CA    1 
ATOM   10343 C C     . TYR E 1 243 ? 288.753 25.931  42.957 1.00 45.81 ? 295  TYR P C     1 
ATOM   10344 O O     . TYR E 1 243 ? 288.860 25.137  42.029 1.00 45.19 ? 295  TYR P O     1 
ATOM   10345 C CB    . TYR E 1 243 ? 286.687 27.323  43.339 1.00 51.42 ? 295  TYR P CB    1 
ATOM   10346 C CG    . TYR E 1 243 ? 287.287 28.563  43.969 1.00 56.36 ? 295  TYR P CG    1 
ATOM   10347 C CD1   . TYR E 1 243 ? 288.262 29.301  43.306 1.00 58.25 ? 295  TYR P CD1   1 
ATOM   10348 C CD2   . TYR E 1 243 ? 286.940 28.951  45.268 1.00 57.50 ? 295  TYR P CD2   1 
ATOM   10349 C CE1   . TYR E 1 243 ? 288.880 30.384  43.915 1.00 59.76 ? 295  TYR P CE1   1 
ATOM   10350 C CE2   . TYR E 1 243 ? 287.557 30.035  45.884 1.00 58.81 ? 295  TYR P CE2   1 
ATOM   10351 C CZ    . TYR E 1 243 ? 288.527 30.742  45.199 1.00 59.54 ? 295  TYR P CZ    1 
ATOM   10352 O OH    . TYR E 1 243 ? 289.169 31.800  45.798 1.00 63.54 ? 295  TYR P OH    1 
ATOM   10353 N N     . ASP E 1 244 ? 289.753 26.713  43.352 1.00 43.84 ? 296  ASP P N     1 
ATOM   10354 C CA    . ASP E 1 244 ? 291.053 26.667  42.699 1.00 42.66 ? 296  ASP P CA    1 
ATOM   10355 C C     . ASP E 1 244 ? 291.714 25.313  42.895 1.00 41.04 ? 296  ASP P C     1 
ATOM   10356 O O     . ASP E 1 244 ? 292.300 24.782  41.967 1.00 41.38 ? 296  ASP P O     1 
ATOM   10357 C CB    . ASP E 1 244 ? 291.967 27.757  43.248 1.00 45.75 ? 296  ASP P CB    1 
ATOM   10358 C CG    . ASP E 1 244 ? 291.639 29.131  42.699 1.00 46.87 ? 296  ASP P CG    1 
ATOM   10359 O OD1   . ASP E 1 244 ? 292.223 30.120  43.186 1.00 48.18 ? 296  ASP P OD1   1 
ATOM   10360 O OD2   . ASP E 1 244 ? 290.807 29.225  41.775 1.00 48.39 ? 296  ASP P OD2   1 
ATOM   10361 N N     . ILE E 1 245 ? 291.636 24.763  44.106 1.00 39.83 ? 297  ILE P N     1 
ATOM   10362 C CA    . ILE E 1 245 ? 292.213 23.449  44.381 1.00 38.37 ? 297  ILE P CA    1 
ATOM   10363 C C     . ILE E 1 245 ? 291.552 22.410  43.480 1.00 36.79 ? 297  ILE P C     1 
ATOM   10364 O O     . ILE E 1 245 ? 292.228 21.694  42.762 1.00 37.54 ? 297  ILE P O     1 
ATOM   10365 C CB    . ILE E 1 245 ? 292.024 22.997  45.877 1.00 39.14 ? 297  ILE P CB    1 
ATOM   10366 C CG1   . ILE E 1 245 ? 293.251 23.334  46.724 1.00 39.87 ? 297  ILE P CG1   1 
ATOM   10367 C CG2   . ILE E 1 245 ? 291.886 21.499  45.960 1.00 39.51 ? 297  ILE P CG2   1 
ATOM   10368 C CD1   . ILE E 1 245 ? 293.354 24.763  47.141 1.00 43.31 ? 297  ILE P CD1   1 
ATOM   10369 N N     . GLY E 1 246 ? 290.230 22.328  43.514 1.00 36.10 ? 298  GLY P N     1 
ATOM   10370 C CA    . GLY E 1 246 ? 289.546 21.345  42.690 1.00 35.63 ? 298  GLY P CA    1 
ATOM   10371 C C     . GLY E 1 246 ? 289.828 21.467  41.203 1.00 35.01 ? 298  GLY P C     1 
ATOM   10372 O O     . GLY E 1 246 ? 289.973 20.464  40.492 1.00 34.28 ? 298  GLY P O     1 
ATOM   10373 N N     . ALA E 1 247 ? 289.904 22.710  40.736 1.00 34.42 ? 299  ALA P N     1 
ATOM   10374 C CA    . ALA E 1 247 ? 290.154 23.012  39.332 1.00 34.11 ? 299  ALA P CA    1 
ATOM   10375 C C     . ALA E 1 247 ? 291.465 22.423  38.845 1.00 34.17 ? 299  ALA P C     1 
ATOM   10376 O O     . ALA E 1 247 ? 291.496 21.609  37.907 1.00 34.40 ? 299  ALA P O     1 
ATOM   10377 C CB    . ALA E 1 247 ? 290.150 24.529  39.123 1.00 33.54 ? 299  ALA P CB    1 
ATOM   10378 N N     . VAL E 1 248 ? 292.542 22.846  39.498 1.00 32.87 ? 300  VAL P N     1 
ATOM   10379 C CA    . VAL E 1 248 ? 293.889 22.401  39.174 1.00 32.06 ? 300  VAL P CA    1 
ATOM   10380 C C     . VAL E 1 248 ? 294.113 20.920  39.457 1.00 33.54 ? 300  VAL P C     1 
ATOM   10381 O O     . VAL E 1 248 ? 294.864 20.261  38.748 1.00 34.85 ? 300  VAL P O     1 
ATOM   10382 C CB    . VAL E 1 248 ? 294.932 23.219  39.955 1.00 30.26 ? 300  VAL P CB    1 
ATOM   10383 C CG1   . VAL E 1 248 ? 296.322 22.821  39.526 1.00 27.03 ? 300  VAL P CG1   1 
ATOM   10384 C CG2   . VAL E 1 248 ? 294.698 24.714  39.733 1.00 26.39 ? 300  VAL P CG2   1 
ATOM   10385 N N     . ALA E 1 249 ? 293.469 20.401  40.496 1.00 34.52 ? 301  ALA P N     1 
ATOM   10386 C CA    . ALA E 1 249 ? 293.610 18.995  40.847 1.00 36.36 ? 301  ALA P CA    1 
ATOM   10387 C C     . ALA E 1 249 ? 292.969 18.186  39.743 1.00 38.28 ? 301  ALA P C     1 
ATOM   10388 O O     . ALA E 1 249 ? 293.350 17.044  39.496 1.00 38.01 ? 301  ALA P O     1 
ATOM   10389 C CB    . ALA E 1 249 ? 292.915 18.702  42.185 1.00 35.08 ? 301  ALA P CB    1 
ATOM   10390 N N     . MET E 1 250 ? 291.988 18.791  39.083 1.00 41.25 ? 302  MET P N     1 
ATOM   10391 C CA    . MET E 1 250 ? 291.276 18.127  38.004 1.00 44.27 ? 302  MET P CA    1 
ATOM   10392 C C     . MET E 1 250 ? 292.062 18.277  36.701 1.00 45.79 ? 302  MET P C     1 
ATOM   10393 O O     . MET E 1 250 ? 292.335 17.290  36.021 1.00 44.49 ? 302  MET P O     1 
ATOM   10394 C CB    . MET E 1 250 ? 289.871 18.714  37.870 1.00 44.36 ? 302  MET P CB    1 
ATOM   10395 C CG    . MET E 1 250 ? 288.884 17.770  37.216 1.00 44.50 ? 302  MET P CG    1 
ATOM   10396 S SD    . MET E 1 250 ? 288.816 16.136  38.030 1.00 46.84 ? 302  MET P SD    1 
ATOM   10397 C CE    . MET E 1 250 ? 287.597 16.415  39.343 1.00 44.48 ? 302  MET P CE    1 
ATOM   10398 N N     . ARG E 1 251 ? 292.428 19.509  36.361 1.00 48.45 ? 303  ARG P N     1 
ATOM   10399 C CA    . ARG E 1 251 ? 293.214 19.758  35.153 1.00 51.88 ? 303  ARG P CA    1 
ATOM   10400 C C     . ARG E 1 251 ? 294.399 18.793  35.182 1.00 52.17 ? 303  ARG P C     1 
ATOM   10401 O O     . ARG E 1 251 ? 294.696 18.099  34.204 1.00 52.36 ? 303  ARG P O     1 
ATOM   10402 C CB    . ARG E 1 251 ? 293.753 21.193  35.156 1.00 56.16 ? 303  ARG P CB    1 
ATOM   10403 C CG    . ARG E 1 251 ? 293.005 22.211  34.291 1.00 60.93 ? 303  ARG P CG    1 
ATOM   10404 C CD    . ARG E 1 251 ? 293.708 22.433  32.949 1.00 62.83 ? 303  ARG P CD    1 
ATOM   10405 N NE    . ARG E 1 251 ? 293.515 21.318  32.028 1.00 64.76 ? 303  ARG P NE    1 
ATOM   10406 C CZ    . ARG E 1 251 ? 292.334 20.957  31.535 1.00 66.44 ? 303  ARG P CZ    1 
ATOM   10407 N NH1   . ARG E 1 251 ? 291.236 21.625  31.872 1.00 67.29 ? 303  ARG P NH1   1 
ATOM   10408 N NH2   . ARG E 1 251 ? 292.247 19.923  30.710 1.00 67.75 ? 303  ARG P NH2   1 
ATOM   10409 N N     . LEU E 1 252 ? 295.064 18.770  36.334 1.00 51.82 ? 304  LEU P N     1 
ATOM   10410 C CA    . LEU E 1 252 ? 296.226 17.926  36.574 1.00 50.21 ? 304  LEU P CA    1 
ATOM   10411 C C     . LEU E 1 252 ? 295.874 16.454  36.387 1.00 49.00 ? 304  LEU P C     1 
ATOM   10412 O O     . LEU E 1 252 ? 296.475 15.767  35.567 1.00 47.84 ? 304  LEU P O     1 
ATOM   10413 C CB    . LEU E 1 252 ? 296.749 18.165  37.999 1.00 50.16 ? 304  LEU P CB    1 
ATOM   10414 C CG    . LEU E 1 252 ? 298.109 17.588  38.410 1.00 51.45 ? 304  LEU P CG    1 
ATOM   10415 C CD1   . LEU E 1 252 ? 299.196 18.202  37.546 1.00 50.36 ? 304  LEU P CD1   1 
ATOM   10416 C CD2   . LEU E 1 252 ? 298.387 17.881  39.886 1.00 51.70 ? 304  LEU P CD2   1 
ATOM   10417 N N     . LEU E 1 253 ? 294.892 15.978  37.145 1.00 48.14 ? 305  LEU P N     1 
ATOM   10418 C CA    . LEU E 1 253 ? 294.479 14.584  37.065 1.00 47.04 ? 305  LEU P CA    1 
ATOM   10419 C C     . LEU E 1 253 ? 294.138 14.180  35.639 1.00 48.38 ? 305  LEU P C     1 
ATOM   10420 O O     . LEU E 1 253 ? 294.528 13.101  35.185 1.00 48.24 ? 305  LEU P O     1 
ATOM   10421 C CB    . LEU E 1 253 ? 293.265 14.337  37.953 1.00 43.26 ? 305  LEU P CB    1 
ATOM   10422 C CG    . LEU E 1 253 ? 292.749 12.903  37.946 1.00 40.48 ? 305  LEU P CG    1 
ATOM   10423 C CD1   . LEU E 1 253 ? 293.770 11.967  38.583 1.00 39.83 ? 305  LEU P CD1   1 
ATOM   10424 C CD2   . LEU E 1 253 ? 291.450 12.853  38.695 1.00 39.17 ? 305  LEU P CD2   1 
ATOM   10425 N N     . THR E 1 254 ? 293.417 15.050  34.937 1.00 49.06 ? 306  THR P N     1 
ATOM   10426 C CA    . THR E 1 254 ? 293.005 14.768  33.566 1.00 50.49 ? 306  THR P CA    1 
ATOM   10427 C C     . THR E 1 254 ? 294.176 14.496  32.641 1.00 50.97 ? 306  THR P C     1 
ATOM   10428 O O     . THR E 1 254 ? 294.082 13.653  31.756 1.00 51.51 ? 306  THR P O     1 
ATOM   10429 C CB    . THR E 1 254 ? 292.139 15.915  32.985 1.00 51.09 ? 306  THR P CB    1 
ATOM   10430 O OG1   . THR E 1 254 ? 290.826 15.845  33.553 1.00 52.31 ? 306  THR P OG1   1 
ATOM   10431 C CG2   . THR E 1 254 ? 292.021 15.801  31.473 1.00 50.75 ? 306  THR P CG2   1 
ATOM   10432 N N     . LYS E 1 255 ? 295.280 15.202  32.832 1.00 51.49 ? 307  LYS P N     1 
ATOM   10433 C CA    . LYS E 1 255 ? 296.433 14.960  31.986 1.00 52.37 ? 307  LYS P CA    1 
ATOM   10434 C C     . LYS E 1 255 ? 296.973 13.567  32.307 1.00 53.88 ? 307  LYS P C     1 
ATOM   10435 O O     . LYS E 1 255 ? 297.203 12.762  31.405 1.00 55.13 ? 307  LYS P O     1 
ATOM   10436 C CB    . LYS E 1 255 ? 297.510 16.016  32.231 1.00 51.78 ? 307  LYS P CB    1 
ATOM   10437 C CG    . LYS E 1 255 ? 296.966 17.442  32.213 1.00 52.82 ? 307  LYS P CG    1 
ATOM   10438 C CD    . LYS E 1 255 ? 298.071 18.487  32.140 1.00 52.03 ? 307  LYS P CD    1 
ATOM   10439 C CE    . LYS E 1 255 ? 298.174 19.092  30.737 1.00 54.37 ? 307  LYS P CE    1 
ATOM   10440 N NZ    . LYS E 1 255 ? 298.555 18.109  29.665 1.00 53.61 ? 307  LYS P NZ    1 
ATOM   10441 N N     . TYR E 1 256 ? 297.152 13.277  33.594 1.00 55.37 ? 308  TYR P N     1 
ATOM   10442 C CA    . TYR E 1 256 ? 297.675 11.980  34.031 1.00 56.90 ? 308  TYR P CA    1 
ATOM   10443 C C     . TYR E 1 256 ? 296.840 10.799  33.538 1.00 58.20 ? 308  TYR P C     1 
ATOM   10444 O O     . TYR E 1 256 ? 297.375 9.708   33.302 1.00 58.10 ? 308  TYR P O     1 
ATOM   10445 C CB    . TYR E 1 256 ? 297.779 11.936  35.562 1.00 57.12 ? 308  TYR P CB    1 
ATOM   10446 C CG    . TYR E 1 256 ? 298.951 12.715  36.130 1.00 58.02 ? 308  TYR P CG    1 
ATOM   10447 C CD1   . TYR E 1 256 ? 300.261 12.300  35.912 1.00 58.45 ? 308  TYR P CD1   1 
ATOM   10448 C CD2   . TYR E 1 256 ? 298.747 13.863  36.894 1.00 58.81 ? 308  TYR P CD2   1 
ATOM   10449 C CE1   . TYR E 1 256 ? 301.338 13.002  36.440 1.00 58.79 ? 308  TYR P CE1   1 
ATOM   10450 C CE2   . TYR E 1 256 ? 299.821 14.576  37.427 1.00 59.38 ? 308  TYR P CE2   1 
ATOM   10451 C CZ    . TYR E 1 256 ? 301.113 14.140  37.198 1.00 59.91 ? 308  TYR P CZ    1 
ATOM   10452 O OH    . TYR E 1 256 ? 302.176 14.836  37.739 1.00 60.18 ? 308  TYR P OH    1 
ATOM   10453 N N     . MET E 1 257 ? 295.532 11.016  33.388 1.00 59.20 ? 309  MET P N     1 
ATOM   10454 C CA    . MET E 1 257 ? 294.629 9.969   32.910 1.00 59.52 ? 309  MET P CA    1 
ATOM   10455 C C     . MET E 1 257 ? 294.847 9.736   31.408 1.00 60.87 ? 309  MET P C     1 
ATOM   10456 O O     . MET E 1 257 ? 294.911 8.588   30.951 1.00 60.96 ? 309  MET P O     1 
ATOM   10457 C CB    . MET E 1 257 ? 293.171 10.353  33.187 1.00 57.12 ? 309  MET P CB    1 
ATOM   10458 C CG    . MET E 1 257 ? 292.843 10.500  34.664 1.00 54.70 ? 309  MET P CG    1 
ATOM   10459 S SD    . MET E 1 257 ? 291.071 10.644  34.973 1.00 51.36 ? 309  MET P SD    1 
ATOM   10460 C CE    . MET E 1 257 ? 290.767 12.338  34.407 1.00 49.00 ? 309  MET P CE    1 
ATOM   10461 N N     . ASN E 1 258 ? 294.966 10.827  30.651 1.00 61.84 ? 310  ASN P N     1 
ATOM   10462 C CA    . ASN E 1 258 ? 295.216 10.752  29.212 1.00 63.51 ? 310  ASN P CA    1 
ATOM   10463 C C     . ASN E 1 258 ? 296.697 10.423  28.976 1.00 64.66 ? 310  ASN P C     1 
ATOM   10464 O O     . ASN E 1 258 ? 297.132 10.283  27.829 1.00 64.09 ? 310  ASN P O     1 
ATOM   10465 C CB    . ASN E 1 258 ? 294.928 12.100  28.526 1.00 63.76 ? 310  ASN P CB    1 
ATOM   10466 C CG    . ASN E 1 258 ? 293.460 12.476  28.533 1.00 64.23 ? 310  ASN P CG    1 
ATOM   10467 O OD1   . ASN E 1 258 ? 292.593 11.647  28.261 1.00 64.67 ? 310  ASN P OD1   1 
ATOM   10468 N ND2   . ASN E 1 258 ? 293.176 13.746  28.816 1.00 63.79 ? 310  ASN P ND2   1 
ATOM   10469 N N     . LYS E 1 259 ? 297.459 10.297  30.063 1.00 66.15 ? 311  LYS P N     1 
ATOM   10470 C CA    . LYS E 1 259 ? 298.901 10.045  29.988 1.00 67.98 ? 311  LYS P CA    1 
ATOM   10471 C C     . LYS E 1 259 ? 299.470 11.219  29.200 1.00 69.24 ? 311  LYS P C     1 
ATOM   10472 O O     . LYS E 1 259 ? 299.783 11.079  28.018 1.00 70.61 ? 311  LYS P O     1 
ATOM   10473 C CB    . LYS E 1 259 ? 299.220 8.730   29.253 1.00 66.61 ? 311  LYS P CB    1 
ATOM   10474 C CG    . LYS E 1 259 ? 299.093 7.467   30.090 1.00 67.11 ? 311  LYS P CG    1 
ATOM   10475 C CD    . LYS E 1 259 ? 297.821 6.717   29.759 1.00 68.74 ? 311  LYS P CD    1 
ATOM   10476 C CE    . LYS E 1 259 ? 297.768 5.367   30.460 1.00 70.42 ? 311  LYS P CE    1 
ATOM   10477 N NZ    . LYS E 1 259 ? 296.560 4.600   30.027 1.00 71.35 ? 311  LYS P NZ    1 
ATOM   10478 N N     . GLU E 1 260 ? 299.590 12.379  29.843 1.00 70.40 ? 312  GLU P N     1 
ATOM   10479 C CA    . GLU E 1 260 ? 300.095 13.569  29.157 1.00 71.89 ? 312  GLU P CA    1 
ATOM   10480 C C     . GLU E 1 260 ? 301.434 14.155  29.634 1.00 72.76 ? 312  GLU P C     1 
ATOM   10481 O O     . GLU E 1 260 ? 301.743 15.314  29.344 1.00 73.15 ? 312  GLU P O     1 
ATOM   10482 C CB    . GLU E 1 260 ? 299.014 14.653  29.145 1.00 71.78 ? 312  GLU P CB    1 
ATOM   10483 C CG    . GLU E 1 260 ? 297.788 14.265  28.320 1.00 72.74 ? 312  GLU P CG    1 
ATOM   10484 C CD    . GLU E 1 260 ? 296.767 15.384  28.217 1.00 74.17 ? 312  GLU P CD    1 
ATOM   10485 O OE1   . GLU E 1 260 ? 297.151 16.489  27.784 1.00 73.96 ? 312  GLU P OE1   1 
ATOM   10486 O OE2   . GLU E 1 260 ? 295.583 15.162  28.563 1.00 75.17 ? 312  GLU P OE2   1 
ATOM   10487 N N     . THR E 1 261 ? 302.205 13.345  30.364 1.00 73.30 ? 313  THR P N     1 
ATOM   10488 C CA    . THR E 1 261 ? 303.559 13.670  30.855 1.00 73.85 ? 313  THR P CA    1 
ATOM   10489 C C     . THR E 1 261 ? 303.927 15.044  31.455 1.00 73.70 ? 313  THR P C     1 
ATOM   10490 O O     . THR E 1 261 ? 305.045 15.214  31.949 1.00 72.85 ? 313  THR P O     1 
ATOM   10491 C CB    . THR E 1 261 ? 304.612 13.371  29.724 1.00 74.66 ? 313  THR P CB    1 
ATOM   10492 O OG1   . THR E 1 261 ? 305.935 13.370  30.277 1.00 75.31 ? 313  THR P OG1   1 
ATOM   10493 C CG2   . THR E 1 261 ? 304.544 14.436  28.612 1.00 73.04 ? 313  THR P CG2   1 
ATOM   10494 N N     . VAL E 1 262 ? 303.013 16.010  31.433 1.00 73.91 ? 314  VAL P N     1 
ATOM   10495 C CA    . VAL E 1 262 ? 303.308 17.357  31.936 1.00 73.25 ? 314  VAL P CA    1 
ATOM   10496 C C     . VAL E 1 262 ? 304.060 17.507  33.265 1.00 73.17 ? 314  VAL P C     1 
ATOM   10497 O O     . VAL E 1 262 ? 303.608 17.039  34.318 1.00 73.16 ? 314  VAL P O     1 
ATOM   10498 C CB    . VAL E 1 262 ? 302.032 18.210  32.012 1.00 72.75 ? 314  VAL P CB    1 
ATOM   10499 C CG1   . VAL E 1 262 ? 302.359 19.589  32.584 1.00 72.29 ? 314  VAL P CG1   1 
ATOM   10500 C CG2   . VAL E 1 262 ? 301.426 18.339  30.623 1.00 72.42 ? 314  VAL P CG2   1 
ATOM   10501 N N     . ASP E 1 263 ? 305.207 18.189  33.174 1.00 72.31 ? 315  ASP P N     1 
ATOM   10502 C CA    . ASP E 1 263 ? 306.092 18.489  34.301 1.00 70.80 ? 315  ASP P CA    1 
ATOM   10503 C C     . ASP E 1 263 ? 305.371 19.476  35.232 1.00 69.50 ? 315  ASP P C     1 
ATOM   10504 O O     . ASP E 1 263 ? 304.231 19.868  34.958 1.00 69.59 ? 315  ASP P O     1 
ATOM   10505 C CB    . ASP E 1 263 ? 307.410 19.118  33.797 1.00 72.71 ? 315  ASP P CB    1 
ATOM   10506 C CG    . ASP E 1 263 ? 308.297 18.131  33.007 1.00 73.70 ? 315  ASP P CG    1 
ATOM   10507 O OD1   . ASP E 1 263 ? 309.318 18.578  32.428 1.00 71.92 ? 315  ASP P OD1   1 
ATOM   10508 O OD2   . ASP E 1 263 ? 307.985 16.916  32.969 1.00 74.61 ? 315  ASP P OD2   1 
ATOM   10509 N N     . SER E 1 264 ? 306.043 19.886  36.312 1.00 66.79 ? 316  SER P N     1 
ATOM   10510 C CA    . SER E 1 264 ? 305.463 20.796  37.310 1.00 63.48 ? 316  SER P CA    1 
ATOM   10511 C C     . SER E 1 264 ? 304.386 19.990  38.052 1.00 60.71 ? 316  SER P C     1 
ATOM   10512 O O     . SER E 1 264 ? 303.184 20.184  37.877 1.00 58.78 ? 316  SER P O     1 
ATOM   10513 C CB    . SER E 1 264 ? 304.868 22.032  36.626 1.00 63.93 ? 316  SER P CB    1 
ATOM   10514 O OG    . SER E 1 264 ? 304.845 23.141  37.510 1.00 64.34 ? 316  SER P OG    1 
ATOM   10515 N N     . SER E 1 265 ? 304.867 19.083  38.895 1.00 59.06 ? 317  SER P N     1 
ATOM   10516 C CA    . SER E 1 265 ? 304.052 18.141  39.662 1.00 56.58 ? 317  SER P CA    1 
ATOM   10517 C C     . SER E 1 265 ? 303.349 18.618  40.949 1.00 54.18 ? 317  SER P C     1 
ATOM   10518 O O     . SER E 1 265 ? 302.186 18.272  41.183 1.00 53.76 ? 317  SER P O     1 
ATOM   10519 C CB    . SER E 1 265 ? 304.925 16.922  39.973 1.00 56.66 ? 317  SER P CB    1 
ATOM   10520 O OG    . SER E 1 265 ? 304.143 15.781  40.237 1.00 59.52 ? 317  SER P OG    1 
ATOM   10521 N N     . ILE E 1 266 ? 304.042 19.377  41.795 1.00 50.44 ? 318  ILE P N     1 
ATOM   10522 C CA    . ILE E 1 266 ? 303.427 19.858  43.026 1.00 47.15 ? 318  ILE P CA    1 
ATOM   10523 C C     . ILE E 1 266 ? 303.039 21.317  42.891 1.00 45.49 ? 318  ILE P C     1 
ATOM   10524 O O     . ILE E 1 266 ? 303.875 22.213  43.014 1.00 45.85 ? 318  ILE P O     1 
ATOM   10525 C CB    . ILE E 1 266 ? 304.362 19.729  44.254 1.00 46.78 ? 318  ILE P CB    1 
ATOM   10526 C CG1   . ILE E 1 266 ? 304.775 18.269  44.479 1.00 45.95 ? 318  ILE P CG1   1 
ATOM   10527 C CG2   . ILE E 1 266 ? 303.628 20.218  45.498 1.00 46.70 ? 318  ILE P CG2   1 
ATOM   10528 C CD1   . ILE E 1 266 ? 305.761 17.751  43.502 1.00 44.47 ? 318  ILE P CD1   1 
ATOM   10529 N N     . VAL E 1 267 ? 301.760 21.561  42.648 1.00 43.51 ? 319  VAL P N     1 
ATOM   10530 C CA    . VAL E 1 267 ? 301.289 22.929  42.490 1.00 41.11 ? 319  VAL P CA    1 
ATOM   10531 C C     . VAL E 1 267 ? 300.979 23.562  43.840 1.00 40.38 ? 319  VAL P C     1 
ATOM   10532 O O     . VAL E 1 267 ? 300.304 22.968  44.681 1.00 39.85 ? 319  VAL P O     1 
ATOM   10533 C CB    . VAL E 1 267 ? 300.014 22.991  41.621 1.00 38.63 ? 319  VAL P CB    1 
ATOM   10534 C CG1   . VAL E 1 267 ? 299.770 24.412  41.184 1.00 37.09 ? 319  VAL P CG1   1 
ATOM   10535 C CG2   . VAL E 1 267 ? 300.139 22.072  40.434 1.00 36.05 ? 319  VAL P CG2   1 
ATOM   10536 N N     . GLN E 1 268 ? 301.485 24.766  44.050 1.00 39.32 ? 320  GLN P N     1 
ATOM   10537 C CA    . GLN E 1 268 ? 301.216 25.456  45.293 1.00 39.71 ? 320  GLN P CA    1 
ATOM   10538 C C     . GLN E 1 268 ? 300.382 26.693  44.983 1.00 40.16 ? 320  GLN P C     1 
ATOM   10539 O O     . GLN E 1 268 ? 300.870 27.668  44.410 1.00 40.17 ? 320  GLN P O     1 
ATOM   10540 C CB    . GLN E 1 268 ? 302.508 25.852  45.982 1.00 39.38 ? 320  GLN P CB    1 
ATOM   10541 C CG    . GLN E 1 268 ? 302.276 26.366  47.370 1.00 43.92 ? 320  GLN P CG    1 
ATOM   10542 C CD    . GLN E 1 268 ? 303.495 27.039  47.960 1.00 47.15 ? 320  GLN P CD    1 
ATOM   10543 O OE1   . GLN E 1 268 ? 303.915 28.105  47.496 1.00 47.89 ? 320  GLN P OE1   1 
ATOM   10544 N NE2   . GLN E 1 268 ? 304.075 26.420  48.991 1.00 48.58 ? 320  GLN P NE2   1 
ATOM   10545 N N     . LEU E 1 269 ? 299.110 26.645  45.362 1.00 40.55 ? 321  LEU P N     1 
ATOM   10546 C CA    . LEU E 1 269 ? 298.200 27.748  45.104 1.00 40.37 ? 321  LEU P CA    1 
ATOM   10547 C C     . LEU E 1 269 ? 298.328 28.913  46.073 1.00 40.92 ? 321  LEU P C     1 
ATOM   10548 O O     . LEU E 1 269 ? 298.677 28.739  47.242 1.00 42.14 ? 321  LEU P O     1 
ATOM   10549 C CB    . LEU E 1 269 ? 296.769 27.240  45.121 1.00 38.95 ? 321  LEU P CB    1 
ATOM   10550 C CG    . LEU E 1 269 ? 296.462 26.173  44.083 1.00 38.28 ? 321  LEU P CG    1 
ATOM   10551 C CD1   . LEU E 1 269 ? 295.000 25.825  44.220 1.00 40.92 ? 321  LEU P CD1   1 
ATOM   10552 C CD2   . LEU E 1 269 ? 296.761 26.671  42.670 1.00 37.05 ? 321  LEU P CD2   1 
ATOM   10553 N N     . PRO E 1 270 ? 298.049 30.128  45.589 1.00 40.50 ? 322  PRO P N     1 
ATOM   10554 C CA    . PRO E 1 270 ? 298.132 31.327  46.426 1.00 40.58 ? 322  PRO P CA    1 
ATOM   10555 C C     . PRO E 1 270 ? 296.962 31.446  47.397 1.00 40.32 ? 322  PRO P C     1 
ATOM   10556 O O     . PRO E 1 270 ? 295.803 31.360  46.996 1.00 42.07 ? 322  PRO P O     1 
ATOM   10557 C CB    . PRO E 1 270 ? 298.151 32.460  45.404 1.00 40.42 ? 322  PRO P CB    1 
ATOM   10558 C CG    . PRO E 1 270 ? 297.350 31.906  44.262 1.00 40.62 ? 322  PRO P CG    1 
ATOM   10559 C CD    . PRO E 1 270 ? 297.825 30.478  44.173 1.00 40.43 ? 322  PRO P CD    1 
ATOM   10560 N N     . HIS E 1 271 ? 297.266 31.645  48.674 1.00 38.86 ? 323  HIS P N     1 
ATOM   10561 C CA    . HIS E 1 271 ? 296.229 31.787  49.689 1.00 37.35 ? 323  HIS P CA    1 
ATOM   10562 C C     . HIS E 1 271 ? 295.968 33.272  49.893 1.00 36.22 ? 323  HIS P C     1 
ATOM   10563 O O     . HIS E 1 271 ? 296.542 34.108  49.206 1.00 36.38 ? 323  HIS P O     1 
ATOM   10564 C CB    . HIS E 1 271 ? 296.681 31.188  51.021 1.00 37.68 ? 323  HIS P CB    1 
ATOM   10565 C CG    . HIS E 1 271 ? 297.818 31.935  51.651 1.00 37.05 ? 323  HIS P CG    1 
ATOM   10566 N ND1   . HIS E 1 271 ? 299.131 31.752  51.273 1.00 36.60 ? 323  HIS P ND1   1 
ATOM   10567 C CD2   . HIS E 1 271 ? 297.828 32.926  52.574 1.00 35.86 ? 323  HIS P CD2   1 
ATOM   10568 C CE1   . HIS E 1 271 ? 299.900 32.600  51.933 1.00 35.49 ? 323  HIS P CE1   1 
ATOM   10569 N NE2   . HIS E 1 271 ? 299.134 33.324  52.728 1.00 35.10 ? 323  HIS P NE2   1 
ATOM   10570 N N     . ARG E 1 272 ? 295.126 33.588  50.869 1.00 35.79 ? 324  ARG P N     1 
ATOM   10571 C CA    . ARG E 1 272 ? 294.758 34.970  51.176 1.00 35.50 ? 324  ARG P CA    1 
ATOM   10572 C C     . ARG E 1 272 ? 293.931 34.981  52.458 1.00 34.55 ? 324  ARG P C     1 
ATOM   10573 O O     . ARG E 1 272 ? 293.620 33.925  53.000 1.00 32.93 ? 324  ARG P O     1 
ATOM   10574 C CB    . ARG E 1 272 ? 293.922 35.554  50.024 1.00 34.91 ? 324  ARG P CB    1 
ATOM   10575 C CG    . ARG E 1 272 ? 292.928 34.557  49.421 1.00 37.01 ? 324  ARG P CG    1 
ATOM   10576 C CD    . ARG E 1 272 ? 291.979 35.187  48.402 1.00 38.67 ? 324  ARG P CD    1 
ATOM   10577 N NE    . ARG E 1 272 ? 290.917 35.975  49.032 1.00 41.21 ? 324  ARG P NE    1 
ATOM   10578 C CZ    . ARG E 1 272 ? 289.633 35.624  49.069 1.00 39.74 ? 324  ARG P CZ    1 
ATOM   10579 N NH1   . ARG E 1 272 ? 289.235 34.487  48.512 1.00 40.28 ? 324  ARG P NH1   1 
ATOM   10580 N NH2   . ARG E 1 272 ? 288.748 36.417  49.657 1.00 37.40 ? 324  ARG P NH2   1 
ATOM   10581 N N     . ILE E 1 273 ? 293.591 36.167  52.951 1.00 35.10 ? 325  ILE P N     1 
ATOM   10582 C CA    . ILE E 1 273 ? 292.746 36.255  54.138 1.00 36.79 ? 325  ILE P CA    1 
ATOM   10583 C C     . ILE E 1 273 ? 291.483 37.116  53.924 1.00 37.02 ? 325  ILE P C     1 
ATOM   10584 O O     . ILE E 1 273 ? 291.549 38.288  53.521 1.00 35.35 ? 325  ILE P O     1 
ATOM   10585 C CB    . ILE E 1 273 ? 293.500 36.800  55.369 1.00 36.87 ? 325  ILE P CB    1 
ATOM   10586 C CG1   . ILE E 1 273 ? 294.482 35.759  55.901 1.00 39.86 ? 325  ILE P CG1   1 
ATOM   10587 C CG2   . ILE E 1 273 ? 292.520 37.095  56.483 1.00 36.93 ? 325  ILE P CG2   1 
ATOM   10588 C CD1   . ILE E 1 273 ? 295.845 35.799  55.270 1.00 42.84 ? 325  ILE P CD1   1 
ATOM   10589 N N     . GLU E 1 274 ? 290.328 36.514  54.189 1.00 36.76 ? 326  GLU P N     1 
ATOM   10590 C CA    . GLU E 1 274 ? 289.062 37.218  54.064 1.00 37.60 ? 326  GLU P CA    1 
ATOM   10591 C C     . GLU E 1 274 ? 288.871 37.944  55.382 1.00 35.68 ? 326  GLU P C     1 
ATOM   10592 O O     . GLU E 1 274 ? 288.622 37.313  56.404 1.00 35.30 ? 326  GLU P O     1 
ATOM   10593 C CB    . GLU E 1 274 ? 287.916 36.230  53.850 1.00 39.47 ? 326  GLU P CB    1 
ATOM   10594 C CG    . GLU E 1 274 ? 286.588 36.891  53.548 1.00 43.28 ? 326  GLU P CG    1 
ATOM   10595 C CD    . GLU E 1 274 ? 286.630 37.743  52.295 1.00 45.27 ? 326  GLU P CD    1 
ATOM   10596 O OE1   . GLU E 1 274 ? 287.078 37.237  51.249 1.00 47.12 ? 326  GLU P OE1   1 
ATOM   10597 O OE2   . GLU E 1 274 ? 286.207 38.916  52.352 1.00 47.76 ? 326  GLU P OE2   1 
ATOM   10598 N N     . PHE E 1 275 ? 288.998 39.266  55.369 1.00 34.37 ? 327  PHE P N     1 
ATOM   10599 C CA    . PHE E 1 275 ? 288.848 40.018  56.603 1.00 32.58 ? 327  PHE P CA    1 
ATOM   10600 C C     . PHE E 1 275 ? 287.416 40.386  56.942 1.00 31.96 ? 327  PHE P C     1 
ATOM   10601 O O     . PHE E 1 275 ? 286.699 40.962  56.133 1.00 32.36 ? 327  PHE P O     1 
ATOM   10602 C CB    . PHE E 1 275 ? 289.742 41.257  56.568 1.00 33.08 ? 327  PHE P CB    1 
ATOM   10603 C CG    . PHE E 1 275 ? 291.204 40.931  56.715 1.00 34.26 ? 327  PHE P CG    1 
ATOM   10604 C CD1   . PHE E 1 275 ? 291.994 40.696  55.598 1.00 32.31 ? 327  PHE P CD1   1 
ATOM   10605 C CD2   . PHE E 1 275 ? 291.768 40.769  57.984 1.00 35.26 ? 327  PHE P CD2   1 
ATOM   10606 C CE1   . PHE E 1 275 ? 293.306 40.304  55.730 1.00 32.49 ? 327  PHE P CE1   1 
ATOM   10607 C CE2   . PHE E 1 275 ? 293.083 40.375  58.127 1.00 34.73 ? 327  PHE P CE2   1 
ATOM   10608 C CZ    . PHE E 1 275 ? 293.854 40.140  56.996 1.00 35.20 ? 327  PHE P CZ    1 
ATOM   10609 N N     . ARG E 1 276 ? 286.998 40.038  58.152 1.00 30.84 ? 328  ARG P N     1 
ATOM   10610 C CA    . ARG E 1 276 ? 285.642 40.323  58.580 1.00 30.16 ? 328  ARG P CA    1 
ATOM   10611 C C     . ARG E 1 276 ? 285.567 41.088  59.907 1.00 30.47 ? 328  ARG P C     1 
ATOM   10612 O O     . ARG E 1 276 ? 286.346 42.008  60.135 1.00 30.92 ? 328  ARG P O     1 
ATOM   10613 C CB    . ARG E 1 276 ? 284.857 39.013  58.660 1.00 30.46 ? 328  ARG P CB    1 
ATOM   10614 C CG    . ARG E 1 276 ? 284.950 38.198  57.386 1.00 28.61 ? 328  ARG P CG    1 
ATOM   10615 C CD    . ARG E 1 276 ? 283.807 37.218  57.249 1.00 28.20 ? 328  ARG P CD    1 
ATOM   10616 N NE    . ARG E 1 276 ? 283.806 36.607  55.922 1.00 28.60 ? 328  ARG P NE    1 
ATOM   10617 C CZ    . ARG E 1 276 ? 284.451 35.488  55.600 1.00 29.52 ? 328  ARG P CZ    1 
ATOM   10618 N NH1   . ARG E 1 276 ? 285.161 34.822  56.501 1.00 30.34 ? 328  ARG P NH1   1 
ATOM   10619 N NH2   . ARG E 1 276 ? 284.391 35.030  54.362 1.00 29.57 ? 328  ARG P NH2   1 
ATOM   10620 N N     . GLN E 1 277 ? 284.634 40.704  60.774 1.00 31.48 ? 329  GLN P N     1 
ATOM   10621 C CA    . GLN E 1 277 ? 284.438 41.371  62.065 1.00 33.80 ? 329  GLN P CA    1 
ATOM   10622 C C     . GLN E 1 277 ? 285.264 40.867  63.260 1.00 34.49 ? 329  GLN P C     1 
ATOM   10623 O O     . GLN E 1 277 ? 285.320 41.547  64.280 1.00 34.07 ? 329  GLN P O     1 
ATOM   10624 C CB    . GLN E 1 277 ? 282.948 41.330  62.446 1.00 34.73 ? 329  GLN P CB    1 
ATOM   10625 C CG    . GLN E 1 277 ? 281.998 42.128  61.527 1.00 37.23 ? 329  GLN P CG    1 
ATOM   10626 C CD    . GLN E 1 277 ? 282.070 41.720  60.052 1.00 38.49 ? 329  GLN P CD    1 
ATOM   10627 O OE1   . GLN E 1 277 ? 282.682 42.404  59.229 1.00 37.58 ? 329  GLN P OE1   1 
ATOM   10628 N NE2   . GLN E 1 277 ? 281.443 40.598  59.719 1.00 40.94 ? 329  GLN P NE2   1 
ATOM   10629 N N     . SER E 1 278 ? 285.883 39.688  63.140 1.00 35.78 ? 330  SER P N     1 
ATOM   10630 C CA    . SER E 1 278 ? 286.699 39.099  64.219 1.00 37.46 ? 330  SER P CA    1 
ATOM   10631 C C     . SER E 1 278 ? 287.927 39.949  64.520 1.00 38.21 ? 330  SER P C     1 
ATOM   10632 O O     . SER E 1 278 ? 288.455 39.928  65.624 1.00 37.96 ? 330  SER P O     1 
ATOM   10633 C CB    . SER E 1 278 ? 287.213 37.710  63.833 1.00 37.47 ? 330  SER P CB    1 
ATOM   10634 O OG    . SER E 1 278 ? 286.205 36.903  63.290 1.00 39.99 ? 330  SER P OG    1 
ATOM   10635 N N     . THR E 1 279 ? 288.398 40.659  63.504 1.00 39.33 ? 331  THR P N     1 
ATOM   10636 C CA    . THR E 1 279 ? 289.560 41.514  63.626 1.00 39.02 ? 331  THR P CA    1 
ATOM   10637 C C     . THR E 1 279 ? 289.115 42.983  63.538 1.00 40.35 ? 331  THR P C     1 
ATOM   10638 O O     . THR E 1 279 ? 288.015 43.281  63.069 1.00 39.83 ? 331  THR P O     1 
ATOM   10639 C CB    . THR E 1 279 ? 290.566 41.163  62.517 1.00 37.96 ? 331  THR P CB    1 
ATOM   10640 O OG1   . THR E 1 279 ? 289.937 41.281  61.237 1.00 38.25 ? 331  THR P OG1   1 
ATOM   10641 C CG2   . THR E 1 279 ? 291.038 39.728  62.680 1.00 35.56 ? 331  THR P CG2   1 
ATOM   10642 N N     . LYS E 1 280 ? 289.951 43.894  64.028 1.00 42.17 ? 332  LYS P N     1 
ATOM   10643 C CA    . LYS E 1 280 ? 289.647 45.326  63.996 1.00 42.71 ? 332  LYS P CA    1 
ATOM   10644 C C     . LYS E 1 280 ? 290.234 45.997  62.751 1.00 43.47 ? 332  LYS P C     1 
ATOM   10645 O O     . LYS E 1 280 ? 289.565 46.885  62.183 1.00 44.08 ? 332  LYS P O     1 
ATOM   10646 C CB    . LYS E 1 280 ? 290.187 46.018  65.243 1.00 42.41 ? 332  LYS P CB    1 
ATOM   10647 C CG    . LYS E 1 280 ? 289.242 46.054  66.427 1.00 44.14 ? 332  LYS P CG    1 
ATOM   10648 C CD    . LYS E 1 280 ? 289.889 46.837  67.566 1.00 46.00 ? 332  LYS P CD    1 
ATOM   10649 C CE    . LYS E 1 280 ? 288.984 46.983  68.782 1.00 47.60 ? 332  LYS P CE    1 
ATOM   10650 N NZ    . LYS E 1 280 ? 289.707 47.618  69.930 1.00 48.28 ? 332  LYS P NZ    1 
ATOM   10651 O OXT   . LYS E 1 280 ? 291.364 45.638  62.357 1.00 44.92 ? 332  LYS P OXT   1 
ATOM   10652 N N     . THR F 1 8   ? 281.825 -7.964  52.834 1.00 71.95 ? 60   THR F N     1 
ATOM   10653 C CA    . THR F 1 8   ? 282.873 -8.448  51.880 1.00 71.26 ? 60   THR F CA    1 
ATOM   10654 C C     . THR F 1 8   ? 282.674 -7.703  50.562 1.00 69.87 ? 60   THR F C     1 
ATOM   10655 O O     . THR F 1 8   ? 283.458 -7.843  49.614 1.00 69.61 ? 60   THR F O     1 
ATOM   10656 C CB    . THR F 1 8   ? 282.725 -9.972  51.610 1.00 71.79 ? 60   THR F CB    1 
ATOM   10657 O OG1   . THR F 1 8   ? 282.583 -10.676 52.853 1.00 71.67 ? 60   THR F OG1   1 
ATOM   10658 C CG2   . THR F 1 8   ? 283.951 -10.500 50.870 1.00 72.73 ? 60   THR F CG2   1 
ATOM   10659 N N     . THR F 1 9   ? 281.617 -6.898  50.528 1.00 67.54 ? 61   THR F N     1 
ATOM   10660 C CA    . THR F 1 9   ? 281.257 -6.152  49.337 1.00 66.14 ? 61   THR F CA    1 
ATOM   10661 C C     . THR F 1 9   ? 281.011 -4.667  49.593 1.00 63.70 ? 61   THR F C     1 
ATOM   10662 O O     . THR F 1 9   ? 281.061 -4.200  50.729 1.00 63.22 ? 61   THR F O     1 
ATOM   10663 C CB    . THR F 1 9   ? 279.988 -6.738  48.729 1.00 67.83 ? 61   THR F CB    1 
ATOM   10664 O OG1   . THR F 1 9   ? 278.897 -6.529  49.636 1.00 69.26 ? 61   THR F OG1   1 
ATOM   10665 C CG2   . THR F 1 9   ? 280.154 -8.238  48.492 1.00 69.22 ? 61   THR F CG2   1 
ATOM   10666 N N     . THR F 1 10  ? 280.726 -3.933  48.522 1.00 60.80 ? 62   THR F N     1 
ATOM   10667 C CA    . THR F 1 10  ? 280.472 -2.504  48.629 1.00 57.71 ? 62   THR F CA    1 
ATOM   10668 C C     . THR F 1 10  ? 278.979 -2.187  48.477 1.00 54.79 ? 62   THR F C     1 
ATOM   10669 O O     . THR F 1 10  ? 278.246 -2.911  47.799 1.00 54.28 ? 62   THR F O     1 
ATOM   10670 C CB    . THR F 1 10  ? 281.258 -1.715  47.558 1.00 58.15 ? 62   THR F CB    1 
ATOM   10671 O OG1   . THR F 1 10  ? 280.551 -1.771  46.314 1.00 61.01 ? 62   THR F OG1   1 
ATOM   10672 C CG2   . THR F 1 10  ? 282.658 -2.306  47.375 1.00 56.09 ? 62   THR F CG2   1 
ATOM   10673 N N     . VAL F 1 11  ? 278.543 -1.113  49.137 1.00 51.52 ? 63   VAL F N     1 
ATOM   10674 C CA    . VAL F 1 11  ? 277.153 -0.647  49.096 1.00 47.27 ? 63   VAL F CA    1 
ATOM   10675 C C     . VAL F 1 11  ? 277.168 0.851   48.803 1.00 44.13 ? 63   VAL F C     1 
ATOM   10676 O O     . VAL F 1 11  ? 277.972 1.594   49.366 1.00 43.05 ? 63   VAL F O     1 
ATOM   10677 C CB    . VAL F 1 11  ? 276.403 -0.911  50.436 1.00 46.24 ? 63   VAL F CB    1 
ATOM   10678 C CG1   . VAL F 1 11  ? 277.349 -0.842  51.591 1.00 47.44 ? 63   VAL F CG1   1 
ATOM   10679 C CG2   . VAL F 1 11  ? 275.318 0.125   50.634 1.00 46.30 ? 63   VAL F CG2   1 
ATOM   10680 N N     . GLY F 1 12  ? 276.283 1.288   47.913 1.00 40.76 ? 64   GLY F N     1 
ATOM   10681 C CA    . GLY F 1 12  ? 276.246 2.689   47.552 1.00 37.44 ? 64   GLY F CA    1 
ATOM   10682 C C     . GLY F 1 12  ? 275.260 3.532   48.325 1.00 36.33 ? 64   GLY F C     1 
ATOM   10683 O O     . GLY F 1 12  ? 274.245 3.027   48.812 1.00 35.06 ? 64   GLY F O     1 
ATOM   10684 N N     . VAL F 1 13  ? 275.568 4.824   48.426 1.00 34.81 ? 65   VAL F N     1 
ATOM   10685 C CA    . VAL F 1 13  ? 274.722 5.787   49.119 1.00 34.81 ? 65   VAL F CA    1 
ATOM   10686 C C     . VAL F 1 13  ? 274.507 7.013   48.222 1.00 35.65 ? 65   VAL F C     1 
ATOM   10687 O O     . VAL F 1 13  ? 275.471 7.612   47.732 1.00 36.60 ? 65   VAL F O     1 
ATOM   10688 C CB    . VAL F 1 13  ? 275.363 6.230   50.446 1.00 33.30 ? 65   VAL F CB    1 
ATOM   10689 C CG1   . VAL F 1 13  ? 274.389 7.091   51.216 1.00 32.83 ? 65   VAL F CG1   1 
ATOM   10690 C CG2   . VAL F 1 13  ? 275.744 5.015   51.266 1.00 32.49 ? 65   VAL F CG2   1 
ATOM   10691 N N     . ILE F 1 14  ? 273.252 7.383   47.989 1.00 34.04 ? 66   ILE F N     1 
ATOM   10692 C CA    . ILE F 1 14  ? 272.991 8.528   47.138 1.00 34.80 ? 66   ILE F CA    1 
ATOM   10693 C C     . ILE F 1 14  ? 272.383 9.640   47.956 1.00 36.19 ? 66   ILE F C     1 
ATOM   10694 O O     . ILE F 1 14  ? 271.185 9.641   48.195 1.00 38.94 ? 66   ILE F O     1 
ATOM   10695 C CB    . ILE F 1 14  ? 271.996 8.203   45.972 1.00 35.91 ? 66   ILE F CB    1 
ATOM   10696 C CG1   . ILE F 1 14  ? 272.503 7.035   45.116 1.00 34.64 ? 66   ILE F CG1   1 
ATOM   10697 C CG2   . ILE F 1 14  ? 271.825 9.435   45.067 1.00 34.48 ? 66   ILE F CG2   1 
ATOM   10698 C CD1   . ILE F 1 14  ? 271.628 6.747   43.890 1.00 39.66 ? 66   ILE F CD1   1 
ATOM   10699 N N     . ILE F 1 15  ? 273.191 10.586  48.410 1.00 37.68 ? 67   ILE F N     1 
ATOM   10700 C CA    . ILE F 1 15  ? 272.627 11.697  49.167 1.00 39.07 ? 67   ILE F CA    1 
ATOM   10701 C C     . ILE F 1 15  ? 272.761 12.950  48.314 1.00 39.08 ? 67   ILE F C     1 
ATOM   10702 O O     . ILE F 1 15  ? 273.647 13.048  47.466 1.00 39.28 ? 67   ILE F O     1 
ATOM   10703 C CB    . ILE F 1 15  ? 273.316 11.917  50.571 1.00 40.71 ? 67   ILE F CB    1 
ATOM   10704 C CG1   . ILE F 1 15  ? 274.716 12.537  50.421 1.00 39.54 ? 67   ILE F CG1   1 
ATOM   10705 C CG2   . ILE F 1 15  ? 273.355 10.595  51.342 1.00 39.33 ? 67   ILE F CG2   1 
ATOM   10706 C CD1   . ILE F 1 15  ? 275.727 11.651  49.768 1.00 41.65 ? 67   ILE F CD1   1 
ATOM   10707 N N     . PRO F 1 16  ? 271.882 13.928  48.531 1.00 38.70 ? 68   PRO F N     1 
ATOM   10708 C CA    . PRO F 1 16  ? 271.919 15.169  47.759 1.00 39.65 ? 68   PRO F CA    1 
ATOM   10709 C C     . PRO F 1 16  ? 273.116 16.085  47.952 1.00 41.11 ? 68   PRO F C     1 
ATOM   10710 O O     . PRO F 1 16  ? 273.556 16.719  46.999 1.00 42.36 ? 68   PRO F O     1 
ATOM   10711 C CB    . PRO F 1 16  ? 270.625 15.850  48.157 1.00 39.60 ? 68   PRO F CB    1 
ATOM   10712 C CG    . PRO F 1 16  ? 270.478 15.424  49.575 1.00 38.85 ? 68   PRO F CG    1 
ATOM   10713 C CD    . PRO F 1 16  ? 270.813 13.966  49.540 1.00 36.73 ? 68   PRO F CD    1 
ATOM   10714 N N     . ASP F 1 17  ? 273.644 16.180  49.167 1.00 42.51 ? 69   ASP F N     1 
ATOM   10715 C CA    . ASP F 1 17  ? 274.779 17.073  49.390 1.00 44.48 ? 69   ASP F CA    1 
ATOM   10716 C C     . ASP F 1 17  ? 275.595 16.740  50.622 1.00 44.92 ? 69   ASP F C     1 
ATOM   10717 O O     . ASP F 1 17  ? 275.211 17.047  51.747 1.00 46.53 ? 69   ASP F O     1 
ATOM   10718 C CB    . ASP F 1 17  ? 274.289 18.519  49.454 1.00 44.64 ? 69   ASP F CB    1 
ATOM   10719 C CG    . ASP F 1 17  ? 275.353 19.472  49.908 1.00 45.21 ? 69   ASP F CG    1 
ATOM   10720 O OD1   . ASP F 1 17  ? 276.553 19.139  49.793 1.00 44.78 ? 69   ASP F OD1   1 
ATOM   10721 O OD2   . ASP F 1 17  ? 274.978 20.566  50.376 1.00 47.63 ? 69   ASP F OD2   1 
ATOM   10722 N N     . ILE F 1 18  ? 276.745 16.130  50.382 1.00 45.04 ? 70   ILE F N     1 
ATOM   10723 C CA    . ILE F 1 18  ? 277.639 15.703  51.442 1.00 45.88 ? 70   ILE F CA    1 
ATOM   10724 C C     . ILE F 1 18  ? 278.142 16.828  52.329 1.00 45.76 ? 70   ILE F C     1 
ATOM   10725 O O     . ILE F 1 18  ? 278.405 16.605  53.507 1.00 45.99 ? 70   ILE F O     1 
ATOM   10726 C CB    . ILE F 1 18  ? 278.864 14.964  50.856 1.00 46.74 ? 70   ILE F CB    1 
ATOM   10727 C CG1   . ILE F 1 18  ? 279.509 14.098  51.926 1.00 46.27 ? 70   ILE F CG1   1 
ATOM   10728 C CG2   . ILE F 1 18  ? 279.883 15.960  50.329 1.00 47.14 ? 70   ILE F CG2   1 
ATOM   10729 C CD1   . ILE F 1 18  ? 278.637 12.963  52.362 1.00 47.07 ? 70   ILE F CD1   1 
ATOM   10730 N N     . SER F 1 19  ? 278.275 18.029  51.769 1.00 45.77 ? 71   SER F N     1 
ATOM   10731 C CA    . SER F 1 19  ? 278.778 19.173  52.527 1.00 45.00 ? 71   SER F CA    1 
ATOM   10732 C C     . SER F 1 19  ? 277.779 19.706  53.544 1.00 46.33 ? 71   SER F C     1 
ATOM   10733 O O     . SER F 1 19  ? 278.104 20.602  54.328 1.00 46.99 ? 71   SER F O     1 
ATOM   10734 C CB    . SER F 1 19  ? 279.166 20.299  51.584 1.00 43.90 ? 71   SER F CB    1 
ATOM   10735 O OG    . SER F 1 19  ? 278.020 20.810  50.936 1.00 40.93 ? 71   SER F OG    1 
ATOM   10736 N N     . ASN F 1 20  ? 276.564 19.167  53.515 1.00 46.19 ? 72   ASN F N     1 
ATOM   10737 C CA    . ASN F 1 20  ? 275.513 19.564  54.440 1.00 46.79 ? 72   ASN F CA    1 
ATOM   10738 C C     . ASN F 1 20  ? 275.786 18.814  55.742 1.00 47.66 ? 72   ASN F C     1 
ATOM   10739 O O     . ASN F 1 20  ? 275.927 17.601  55.714 1.00 48.95 ? 72   ASN F O     1 
ATOM   10740 C CB    . ASN F 1 20  ? 274.162 19.162  53.843 1.00 47.06 ? 72   ASN F CB    1 
ATOM   10741 C CG    . ASN F 1 20  ? 272.976 19.541  54.725 1.00 48.33 ? 72   ASN F CG    1 
ATOM   10742 O OD1   . ASN F 1 20  ? 271.831 19.597  54.253 1.00 47.04 ? 72   ASN F OD1   1 
ATOM   10743 N ND2   . ASN F 1 20  ? 273.236 19.786  56.008 1.00 50.02 ? 72   ASN F ND2   1 
ATOM   10744 N N     . ILE F 1 21  ? 275.880 19.519  56.873 1.00 48.97 ? 73   ILE F N     1 
ATOM   10745 C CA    . ILE F 1 21  ? 276.154 18.849  58.157 1.00 49.68 ? 73   ILE F CA    1 
ATOM   10746 C C     . ILE F 1 21  ? 275.084 17.824  58.454 1.00 49.88 ? 73   ILE F C     1 
ATOM   10747 O O     . ILE F 1 21  ? 275.363 16.772  59.029 1.00 48.99 ? 73   ILE F O     1 
ATOM   10748 C CB    . ILE F 1 21  ? 276.198 19.819  59.393 1.00 49.82 ? 73   ILE F CB    1 
ATOM   10749 C CG1   . ILE F 1 21  ? 274.832 20.494  59.596 1.00 49.39 ? 73   ILE F CG1   1 
ATOM   10750 C CG2   . ILE F 1 21  ? 277.340 20.811  59.253 1.00 50.52 ? 73   ILE F CG2   1 
ATOM   10751 C CD1   . ILE F 1 21  ? 274.318 21.303  58.412 1.00 45.98 ? 73   ILE F CD1   1 
ATOM   10752 N N     . PHE F 1 22  ? 273.851 18.139  58.071 1.00 50.91 ? 74   PHE F N     1 
ATOM   10753 C CA    . PHE F 1 22  ? 272.765 17.215  58.312 1.00 50.99 ? 74   PHE F CA    1 
ATOM   10754 C C     . PHE F 1 22  ? 273.089 15.837  57.765 1.00 50.90 ? 74   PHE F C     1 
ATOM   10755 O O     . PHE F 1 22  ? 272.879 14.849  58.453 1.00 51.57 ? 74   PHE F O     1 
ATOM   10756 C CB    . PHE F 1 22  ? 271.447 17.699  57.701 1.00 52.22 ? 74   PHE F CB    1 
ATOM   10757 C CG    . PHE F 1 22  ? 270.318 16.727  57.906 1.00 53.69 ? 74   PHE F CG    1 
ATOM   10758 C CD1   . PHE F 1 22  ? 269.964 15.826  56.907 1.00 54.43 ? 74   PHE F CD1   1 
ATOM   10759 C CD2   . PHE F 1 22  ? 269.704 16.617  59.155 1.00 54.00 ? 74   PHE F CD2   1 
ATOM   10760 C CE1   . PHE F 1 22  ? 269.031 14.826  57.155 1.00 55.12 ? 74   PHE F CE1   1 
ATOM   10761 C CE2   . PHE F 1 22  ? 268.770 15.618  59.414 1.00 54.07 ? 74   PHE F CE2   1 
ATOM   10762 C CZ    . PHE F 1 22  ? 268.433 14.720  58.418 1.00 54.45 ? 74   PHE F CZ    1 
ATOM   10763 N N     . TYR F 1 23  ? 273.610 15.766  56.541 1.00 51.34 ? 75   TYR F N     1 
ATOM   10764 C CA    . TYR F 1 23  ? 273.937 14.474  55.932 1.00 51.31 ? 75   TYR F CA    1 
ATOM   10765 C C     . TYR F 1 23  ? 275.263 13.868  56.373 1.00 50.11 ? 75   TYR F C     1 
ATOM   10766 O O     . TYR F 1 23  ? 275.570 12.738  56.015 1.00 51.16 ? 75   TYR F O     1 
ATOM   10767 C CB    . TYR F 1 23  ? 273.889 14.568  54.398 1.00 52.40 ? 75   TYR F CB    1 
ATOM   10768 C CG    . TYR F 1 23  ? 272.502 14.870  53.844 1.00 54.01 ? 75   TYR F CG    1 
ATOM   10769 C CD1   . TYR F 1 23  ? 271.442 13.962  54.001 1.00 54.02 ? 75   TYR F CD1   1 
ATOM   10770 C CD2   . TYR F 1 23  ? 272.246 16.078  53.193 1.00 54.41 ? 75   TYR F CD2   1 
ATOM   10771 C CE1   . TYR F 1 23  ? 270.167 14.257  53.527 1.00 54.78 ? 75   TYR F CE1   1 
ATOM   10772 C CE2   . TYR F 1 23  ? 270.979 16.386  52.718 1.00 55.06 ? 75   TYR F CE2   1 
ATOM   10773 C CZ    . TYR F 1 23  ? 269.945 15.476  52.887 1.00 55.71 ? 75   TYR F CZ    1 
ATOM   10774 O OH    . TYR F 1 23  ? 268.695 15.806  52.411 1.00 55.09 ? 75   TYR F OH    1 
ATOM   10775 N N