data_1T7P
# 
_entry.id   1T7P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1T7P         
RCSB  PDE0135      
WWPDB D_1000176573 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1T7P 
_pdbx_database_status.recvd_initial_deposition_date   1997-09-24 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doublie, S.'      1 
'Tabor, S.'        2 
'Long, A.M.'       3 
'Richardson, C.C.' 4 
'Ellenberger, T.'  5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of a bacteriophage T7 DNA replication complex at 2.2 A resolution.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            391 
_citation.page_first                251 
_citation.page_last                 258 
_citation.year                      1998 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9440688 
_citation.pdbx_database_id_DOI      10.1038/34593 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Doublie, S.'      1 
primary 'Tabor, S.'        2 
primary 'Long, A.M.'       3 
primary 'Richardson, C.C.' 4 
primary 'Ellenberger, T.'  5 
# 
_cell.entry_id           1T7P 
_cell.length_a           106.600 
_cell.length_b           216.300 
_cell.length_c           52.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1T7P 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(P*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*2DA)-3')
;
3327.200  1   ?                ?              ? ? 
2 polymer     syn 
;DNA (5'-D(P*CP*CP*TP*TP*GP*GP*CP*AP*CP*TP*GP*GP*C)-3')
;
3943.559  1   ?                ?              ? ? 
3 polymer     man 'DNA-directed DNA polymerase'                            79089.789 1   2.7.7.7,3.1.11.- 'DEL(118-123)' ? ? 
4 polymer     man 'Thioredoxin 1'                                          11687.388 1   ?                ?              ? ? 
5 non-polymer syn "2'-3'-DIDEOXYGUANOSINE-5'-TRIPHOSPHATE"                 491.182   1   ?                ?              ? ? 
6 non-polymer syn 'MAGNESIUM ION'                                          24.305    3   ?                ?              ? ? 
7 water       nat water                                                    18.015    503 ?                ?              ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'Gene product 5,Gp5' 
4 Trx-1                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)(DA)(2DA)' GCCAGTGCCAA P ? 
2 polydeoxyribonucleotide no no  '(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)' CCTTGGCACTGGC T ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DC  n 
1 4   DA  n 
1 5   DG  n 
1 6   DT  n 
1 7   DG  n 
1 8   DC  n 
1 9   DC  n 
1 10  DA  n 
1 11  2DA n 
2 1   DC  n 
2 2   DC  n 
2 3   DT  n 
2 4   DT  n 
2 5   DG  n 
2 6   DG  n 
2 7   DC  n 
2 8   DA  n 
2 9   DC  n 
2 10  DT  n 
2 11  DG  n 
2 12  DG  n 
2 13  DC  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample 'Biological sequence' 1 698 'Bacteriophage T7' 'T7-like viruses' ?                      ? ? ? ? ? ? 
'Enterobacteria phage T7'  10760 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 108 ?                  Escherichia       'trxA, Z5291, ECs4714' ? ? ? ? ? ? 
'Escherichia coli O157:H7' 83334 ? ? ? ? ? ? ? ? ?                  ?   ?           ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 11 ? ? ? ? 
2 1 sample 1 13 ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 1T7P       1T7P   ? 1 ? 1 
2 PDB 1T7P       1T7P   ? 2 ? 1 
3 UNP DPOL_BPT7  P00581 ? 3 
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEW
WNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIE
ELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREY
VAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSA
EGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLE
LRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTP
AIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKH
GWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
1 
4 UNP THIO_ECO57 P0AA27 ? 4 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
2 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1T7P P 1 ? 11  ? 1T7P   12 ? 22  ? 12 22  
2 2 1T7P T 1 ? 13  ? 1T7P   3  ? 15  ? 3  15  
3 3 1T7P A 1 ? 698 ? P00581 1  ? 704 ? 1  704 
4 4 1T7P B 1 ? 108 ? P0AA27 2  ? 109 ? 1  108 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1T7P ? A ? ? UNP P00581 LYS 118 deletion ? 1 
3 1T7P ? A ? ? UNP P00581 ARG 119 deletion ? 2 
3 1T7P ? A ? ? UNP P00581 PHE 120 deletion ? 3 
3 1T7P ? A ? ? UNP P00581 GLY 121 deletion ? 4 
3 1T7P ? A ? ? UNP P00581 SER 122 deletion ? 5 
3 1T7P ? A ? ? UNP P00581 HIS 123 deletion ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DA 'DNA linking'       n "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O5 P'   315.222 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O7 P'   347.221 
DG3 non-polymer         . "2'-3'-DIDEOXYGUANOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O12 P3' 491.182 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                           ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1T7P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.70 
_exptl_crystal.density_Matthews      3.05 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1T7P 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40. 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   162012 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0540000 
_reflns.pdbx_netI_over_sigmaI        20.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.3 
_reflns_shell.percent_possible_all   86.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1500000 
_reflns_shell.meanI_over_sigI_obs    6.5 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1T7P 
_refine.ls_number_reflns_obs                     60190 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20. 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2400000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2400000 
_refine.ls_R_factor_R_free                       0.2790000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               23.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6068 
_refine_hist.pdbx_number_atoms_nucleic_acid   488 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             503 
_refine_hist.number_atoms_total               7092 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        20. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.19  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.86 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.09  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.3 
_refine_ls_shell.number_reflns_R_work             5447 
_refine_ls_shell.R_factor_R_work                  0.3020000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3330000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10. 
_refine_ls_shell.number_reflns_R_free             593 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARNDBX.DNA  TOPNDBX.DNA  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1T7P 
_struct.title                     
'T7 DNA POLYMERASE COMPLEXED TO DNA PRIMER/TEMPLATE,A NUCLEOSIDE TRIPHOSPHATE, AND ITS PROCESSIVITY FACTOR THIOREDOXIN' 
_struct.pdbx_descriptor           
;DNA POLYMERASE, THIOREDOXIN/DNA COMPLEX, 2'-3'DIDEOXYGUANOSINE-5'-TRIPHOSPHATE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1T7P 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;T7 DNA POLYMERASE, DNA REPLICATION, NUCLEOTIDYL TRANSFERASE, THIOREDOXIN, PROCESSIVITY FACTOR, COMPLEX (HYDROLASE-ELECTRON TRANSPORT-DNA), TRANSFERASE-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 12  ? SER C 14  ? LEU A 12  SER A 14  5 ? 3  
HELX_P HELX_P2  2  PRO C 36  ? ALA C 51  ? PRO A 36  ALA A 51  5 ? 16 
HELX_P HELX_P3  3  ASP C 65  ? GLN C 76  ? ASP A 65  GLN A 76  1 ? 12 
HELX_P HELX_P4  4  ARG C 85  ? ASN C 87  ? ARG A 85  ASN A 87  5 ? 3  
HELX_P HELX_P5  5  THR C 91  ? ILE C 98  ? THR A 91  ILE A 98  1 ? 8  
HELX_P HELX_P6  6  ALA C 121 ? GLU C 143 ? ALA A 127 GLU A 149 1 ? 23 
HELX_P HELX_P7  7  MET C 152 ? TRP C 154 ? MET A 158 TRP A 160 5 ? 3  
HELX_P HELX_P8  8  GLU C 159 ? LEU C 180 ? GLU A 165 LEU A 186 1 ? 22 
HELX_P HELX_P9  9  TYR C 197 ? GLU C 203 ? TYR A 203 GLU A 209 1 ? 7  
HELX_P HELX_P10 10 GLU C 206 ? ASN C 224 ? GLU A 212 ASN A 230 1 ? 19 
HELX_P HELX_P11 11 THR C 230 ? THR C 254 ? THR A 236 THR A 260 1 ? 25 
HELX_P HELX_P12 12 ASP C 334 ? GLN C 341 ? ASP A 340 GLN A 347 1 ? 8  
HELX_P HELX_P13 13 ASP C 360 ? GLY C 365 ? ASP A 366 GLY A 371 1 ? 6  
HELX_P HELX_P14 14 PRO C 371 ? SER C 393 ? PRO A 377 SER A 399 1 ? 23 
HELX_P HELX_P15 15 TRP C 400 ? TYR C 403 ? TRP A 406 TYR A 409 1 ? 4  
HELX_P HELX_P16 16 GLY C 442 ? ALA C 448 ? GLY A 448 ALA A 454 1 ? 7  
HELX_P HELX_P17 17 ALA C 451 ? HIS C 453 ? ALA A 457 HIS A 459 5 ? 3  
HELX_P HELX_P18 18 LEU C 473 ? ASP C 486 ? LEU A 479 ASP A 492 1 ? 14 
HELX_P HELX_P19 19 GLU C 489 ? GLU C 493 ? GLU A 495 GLU A 499 1 ? 5  
HELX_P HELX_P20 20 ILE C 499 ? ALA C 507 ? ILE A 505 ALA A 513 1 ? 9  
HELX_P HELX_P21 21 ARG C 512 ? LEU C 523 ? ARG A 518 LEU A 529 1 ? 12 
HELX_P HELX_P22 22 ASP C 528 ? VAL C 535 ? ASP A 534 VAL A 541 1 ? 8  
HELX_P HELX_P23 23 LYS C 539 ? ASN C 552 ? LYS A 545 ASN A 558 1 ? 14 
HELX_P HELX_P24 24 ALA C 555 ? LEU C 567 ? ALA A 561 LEU A 573 1 ? 13 
HELX_P HELX_P25 25 PRO C 600 ? LYS C 630 ? PRO A 606 LYS A 636 5 ? 31 
HELX_P HELX_P26 26 GLU C 657 ? HIS C 677 ? GLU A 663 HIS A 683 1 ? 21 
HELX_P HELX_P27 27 ASP D 9   ? ASP D 15  ? ASP B 9   ASP B 15  1 ? 7  
HELX_P HELX_P28 28 GLY D 33  ? GLU D 48  ? GLY B 33  GLU B 48  1 ? 16 
HELX_P HELX_P29 29 PRO D 68  ? TYR D 70  ? PRO B 68  TYR B 70  5 ? 3  
HELX_P HELX_P30 30 LYS D 96  ? ALA D 105 ? LYS B 96  ALA B 105 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G MG  .  MG    ? ? ? 1_555 C ASP 648 OD1 ? ? A MG  4002 A ASP 654  1_555 ? ? ? ? ? ? ?            2.301 ? 
metalc2  metalc ? ? F MG  .  MG    ? ? ? 1_555 E DG3 .   O1G ? ? A MG  4001 P DG3 23   1_555 ? ? ? ? ? ? ?            2.192 ? 
metalc3  metalc ? ? F MG  .  MG    ? ? ? 1_555 E DG3 .   O2B ? ? A MG  4001 P DG3 23   1_555 ? ? ? ? ? ? ?            2.208 ? 
metalc4  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ALA 470 O   ? ? A MG  4001 A ALA 476  1_555 ? ? ? ? ? ? ?            2.185 ? 
metalc5  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 648 OD2 ? ? A MG  4001 A ASP 654  1_555 ? ? ? ? ? ? ?            2.354 ? 
metalc6  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 469 OD1 ? ? A MG  4001 A ASP 475  1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc7  metalc ? ? F MG  .  MG    ? ? ? 1_555 E DG3 .   O2A ? ? A MG  4001 P DG3 23   1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc8  metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4002 A HOH 3195 1_555 ? ? ? ? ? ? ?            2.395 ? 
metalc9  metalc ? ? G MG  .  MG    ? ? ? 1_555 C ASP 469 OD2 ? ? A MG  4002 A ASP 475  1_555 ? ? ? ? ? ? ?            2.539 ? 
metalc10 metalc ? ? G MG  .  MG    ? ? ? 1_555 E DG3 .   O2A ? ? A MG  4002 P DG3 23   1_555 ? ? ? ? ? ? ?            2.384 ? 
metalc11 metalc ? ? G MG  .  MG    ? ? ? 1_555 I HOH .   O   ? ? A MG  4002 P HOH 3180 1_555 ? ? ? ? ? ? ?            2.365 ? 
metalc12 metalc ? ? H MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 3534 1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc13 metalc ? ? H MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 3533 1_555 ? ? ? ? ? ? ?            2.468 ? 
metalc14 metalc ? ? H MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 3535 1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc15 metalc ? ? H MG  .  MG    ? ? ? 1_555 C ASP 5   OD1 ? ? A MG  4003 A ASP 5    1_555 ? ? ? ? ? ? ?            2.475 ? 
metalc16 metalc ? ? H MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 3532 1_555 ? ? ? ? ? ? ?            2.329 ? 
covale1  covale ? ? A DA  10 "O3'" ? ? ? 1_555 A 2DA 11  P   ? ? P DA  21   P 2DA 22   1_555 ? ? ? ? ? ? ?            1.603 ? 
hydrog1  hydrog ? ? A DC  2  N3    ? ? ? 1_555 B DG  12  N1  ? ? P DC  13   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  2  N4    ? ? ? 1_555 B DG  12  O6  ? ? P DC  13   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  2  O2    ? ? ? 1_555 B DG  12  N2  ? ? P DC  13   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC  3  N3    ? ? ? 1_555 B DG  11  N1  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC  3  N4    ? ? ? 1_555 B DG  11  O6  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC  3  O2    ? ? ? 1_555 B DG  11  N2  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA  4  N1    ? ? ? 1_555 B DT  10  N3  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  4  N6    ? ? ? 1_555 B DT  10  O4  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG  5  N1    ? ? ? 1_555 B DC  9   N3  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG  5  N2    ? ? ? 1_555 B DC  9   O2  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  5  O6    ? ? ? 1_555 B DC  9   N4  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT  6  N3    ? ? ? 1_555 B DA  8   N1  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  6  O4    ? ? ? 1_555 B DA  8   N6  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG  7  N1    ? ? ? 1_555 B DC  7   N3  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  7  N2    ? ? ? 1_555 B DC  7   O2  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  7  O6    ? ? ? 1_555 B DC  7   N4  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  8  N3    ? ? ? 1_555 B DG  6   N1  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  8  N4    ? ? ? 1_555 B DG  6   O6  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  8  O2    ? ? ? 1_555 B DG  6   N2  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  9  N3    ? ? ? 1_555 B DG  5   N1  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  9  N4    ? ? ? 1_555 B DG  5   O6  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DC  9  O2    ? ? ? 1_555 B DG  5   N2  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA  10 N1    ? ? ? 1_555 B DT  4   N3  ? ? P DA  21   T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DA  10 N6    ? ? ? 1_555 B DT  4   O4  ? ? P DA  21   T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A 2DA 11 N1    ? ? ? 1_555 B DT  3   N3  ? ? P 2DA 22   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A 2DA 11 N6    ? ? ? 1_555 B DT  3   O4  ? ? P 2DA 22   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 C . ? PHE 434 A PRO 429 C ? PRO 435 A 1 -0.64 
2 ILE 75  D . ? ILE 75  B PRO 76  D ? PRO 76  B 1 -0.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 30  ? TYR C 34  ? GLU A 30  TYR A 34  
A 2 PHE C 18  ? ASP C 25  ? PHE A 18  ASP A 25  
A 3 ILE C 2   ? ALA C 8   ? ILE A 2   ALA A 8   
B 1 ILE C 56  ? PHE C 58  ? ILE A 56  PHE A 58  
B 2 CYS C 88  ? ASP C 90  ? CYS A 88  ASP A 90  
C 1 TRP C 258 ? PRO C 261 ? TRP A 264 PRO A 267 
C 2 VAL C 323 ? VAL C 326 ? VAL A 329 VAL A 332 
D 1 SER C 413 ? ASN C 415 ? SER A 419 ASN A 421 
D 2 THR C 425 ? ALA C 427 ? THR A 431 ALA A 433 
E 1 THR C 686 ? GLY C 691 ? THR A 692 GLY A 697 
E 2 VAL C 464 ? ALA C 470 ? VAL A 470 ALA A 476 
E 3 GLU C 649 ? CYS C 654 ? GLU A 655 CYS A 660 
E 4 PHE C 640 ? TRP C 645 ? PHE A 646 TRP A 651 
F 1 TRP C 586 ? LYS C 588 ? TRP A 592 LYS A 594 
F 2 LYS C 594 ? HIS C 596 ? LYS A 600 HIS A 602 
G 1 THR D 54  ? ASN D 59  ? THR B 54  ASN B 59  
G 2 ALA D 22  ? TRP D 28  ? ALA B 22  TRP B 28  
G 3 THR D 77  ? LYS D 82  ? THR B 77  LYS B 82  
G 4 GLU D 85  ? VAL D 91  ? GLU B 85  VAL B 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU C 30  ? O GLU A 30  N ASP C 25  ? N ASP A 25  
A 2 3 O HIS C 19  ? O HIS A 19  N GLU C 7   ? N GLU A 7   
B 1 2 O ILE C 56  ? O ILE A 56  N ILE C 89  ? N ILE A 89  
C 1 2 O TRP C 258 ? O TRP A 264 N VAL C 326 ? N VAL A 332 
D 1 2 O SER C 413 ? O SER A 419 N ALA C 427 ? N ALA A 433 
E 1 2 O GLU C 687 ? O GLU A 693 N ASP C 469 ? N ASP A 475 
E 2 3 O VAL C 464 ? O VAL A 470 N CYS C 654 ? N CYS A 660 
E 3 4 O GLN C 651 ? O GLN A 657 N ALA C 644 ? N ALA A 650 
F 1 2 O ILE C 587 ? O ILE A 593 N VAL C 595 ? N VAL A 601 
G 1 2 O THR D 54  ? O THR B 54  N LEU D 24  ? N LEU B 24  
G 2 3 O ILE D 23  ? O ILE B 23  N PHE D 81  ? N PHE B 81  
G 3 4 O LEU D 78  ? O LEU B 78  N LYS D 90  ? N LYS B 90  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 4001' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 4002' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 4003' 
AC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE DG3 P 23'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP C 469 ? ASP A 475  . ? 1_555 ? 
2  AC1 4  ALA C 470 ? ALA A 476  . ? 1_555 ? 
3  AC1 4  ASP C 648 ? ASP A 654  . ? 1_555 ? 
4  AC1 4  DG3 E .   ? DG3 P 23   . ? 1_555 ? 
5  AC2 6  ASP C 469 ? ASP A 475  . ? 1_555 ? 
6  AC2 6  ASP C 648 ? ASP A 654  . ? 1_555 ? 
7  AC2 6  HOH K .   ? HOH A 3195 . ? 1_555 ? 
8  AC2 6  2DA A 11  ? 2DA P 22   . ? 1_555 ? 
9  AC2 6  DG3 E .   ? DG3 P 23   . ? 1_555 ? 
10 AC2 6  HOH I .   ? HOH P 3180 . ? 1_555 ? 
11 AC3 5  ASP C 5   ? ASP A 5    . ? 1_555 ? 
12 AC3 5  HOH K .   ? HOH A 3532 . ? 1_555 ? 
13 AC3 5  HOH K .   ? HOH A 3533 . ? 1_555 ? 
14 AC3 5  HOH K .   ? HOH A 3534 . ? 1_555 ? 
15 AC3 5  HOH K .   ? HOH A 3535 . ? 1_555 ? 
16 AC4 21 ARG C 423 ? ARG A 429  . ? 1_555 ? 
17 AC4 21 ASP C 469 ? ASP A 475  . ? 1_555 ? 
18 AC4 21 ALA C 470 ? ALA A 476  . ? 1_555 ? 
19 AC4 21 SER C 471 ? SER A 477  . ? 1_555 ? 
20 AC4 21 GLY C 472 ? GLY A 478  . ? 1_555 ? 
21 AC4 21 LEU C 473 ? LEU A 479  . ? 1_555 ? 
22 AC4 21 GLU C 474 ? GLU A 480  . ? 1_555 ? 
23 AC4 21 HIS C 500 ? HIS A 506  . ? 1_555 ? 
24 AC4 21 ARG C 512 ? ARG A 518  . ? 1_555 ? 
25 AC4 21 LYS C 516 ? LYS A 522  . ? 1_555 ? 
26 AC4 21 TYR C 520 ? TYR A 526  . ? 1_555 ? 
27 AC4 21 TYR C 524 ? TYR A 530  . ? 1_555 ? 
28 AC4 21 ASP C 648 ? ASP A 654  . ? 1_555 ? 
29 AC4 21 HOH K .   ? HOH A 3486 . ? 1_555 ? 
30 AC4 21 MG  F .   ? MG  A 4001 . ? 1_555 ? 
31 AC4 21 MG  G .   ? MG  A 4002 . ? 1_555 ? 
32 AC4 21 2DA A 11  ? 2DA P 22   . ? 1_555 ? 
33 AC4 21 HOH I .   ? HOH P 3107 . ? 1_555 ? 
34 AC4 21 HOH I .   ? HOH P 3405 . ? 1_555 ? 
35 AC4 21 DC  B 2   ? DC  T 4    . ? 1_555 ? 
36 AC4 21 DT  B 3   ? DT  T 5    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1T7P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1T7P 
_atom_sites.fract_transf_matrix[1][1]   0.009381 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004623 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019194 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DG  A 1 1   ? 69.973 48.808  11.377  1.00 51.75  ? 12   DG  P P     1 
ATOM   2    O  OP1   . DG  A 1 1   ? 70.140 50.253  11.717  1.00 34.37  ? 12   DG  P OP1   1 
ATOM   3    O  OP2   . DG  A 1 1   ? 68.929 48.401  10.395  1.00 38.74  ? 12   DG  P OP2   1 
ATOM   4    O  "O5'" . DG  A 1 1   ? 69.716 47.976  12.714  1.00 42.95  ? 12   DG  P "O5'" 1 
ATOM   5    C  "C5'" . DG  A 1 1   ? 70.813 47.481  13.513  1.00 34.86  ? 12   DG  P "C5'" 1 
ATOM   6    C  "C4'" . DG  A 1 1   ? 70.284 46.712  14.704  1.00 31.82  ? 12   DG  P "C4'" 1 
ATOM   7    O  "O4'" . DG  A 1 1   ? 69.507 47.606  15.548  1.00 35.87  ? 12   DG  P "O4'" 1 
ATOM   8    C  "C3'" . DG  A 1 1   ? 69.345 45.561  14.345  1.00 31.57  ? 12   DG  P "C3'" 1 
ATOM   9    O  "O3'" . DG  A 1 1   ? 69.532 44.469  15.249  1.00 34.45  ? 12   DG  P "O3'" 1 
ATOM   10   C  "C2'" . DG  A 1 1   ? 67.961 46.161  14.511  1.00 31.22  ? 12   DG  P "C2'" 1 
ATOM   11   C  "C1'" . DG  A 1 1   ? 68.149 47.167  15.636  1.00 31.94  ? 12   DG  P "C1'" 1 
ATOM   12   N  N9    . DG  A 1 1   ? 67.292 48.340  15.471  1.00 35.09  ? 12   DG  P N9    1 
ATOM   13   C  C8    . DG  A 1 1   ? 66.888 48.894  14.278  1.00 31.02  ? 12   DG  P C8    1 
ATOM   14   N  N7    . DG  A 1 1   ? 66.138 49.953  14.431  1.00 34.75  ? 12   DG  P N7    1 
ATOM   15   C  C5    . DG  A 1 1   ? 66.032 50.106  15.809  1.00 32.01  ? 12   DG  P C5    1 
ATOM   16   C  C6    . DG  A 1 1   ? 65.342 51.090  16.575  1.00 30.88  ? 12   DG  P C6    1 
ATOM   17   O  O6    . DG  A 1 1   ? 64.671 52.053  16.172  1.00 29.68  ? 12   DG  P O6    1 
ATOM   18   N  N1    . DG  A 1 1   ? 65.492 50.869  17.942  1.00 30.69  ? 12   DG  P N1    1 
ATOM   19   C  C2    . DG  A 1 1   ? 66.213 49.839  18.500  1.00 32.45  ? 12   DG  P C2    1 
ATOM   20   N  N2    . DG  A 1 1   ? 66.234 49.790  19.842  1.00 34.83  ? 12   DG  P N2    1 
ATOM   21   N  N3    . DG  A 1 1   ? 66.865 48.920  17.797  1.00 35.32  ? 12   DG  P N3    1 
ATOM   22   C  C4    . DG  A 1 1   ? 66.732 49.114  16.467  1.00 31.48  ? 12   DG  P C4    1 
ATOM   23   P  P     . DC  A 1 2   ? 68.378 43.359  15.405  1.00 50.57  ? 13   DC  P P     1 
ATOM   24   O  OP1   . DC  A 1 2   ? 69.002 42.126  15.962  1.00 39.20  ? 13   DC  P OP1   1 
ATOM   25   O  OP2   . DC  A 1 2   ? 67.622 43.288  14.123  1.00 44.16  ? 13   DC  P OP2   1 
ATOM   26   O  "O5'" . DC  A 1 2   ? 67.413 43.990  16.507  1.00 33.71  ? 13   DC  P "O5'" 1 
ATOM   27   C  "C5'" . DC  A 1 2   ? 67.887 44.215  17.844  1.00 28.88  ? 13   DC  P "C5'" 1 
ATOM   28   C  "C4'" . DC  A 1 2   ? 66.725 44.294  18.807  1.00 26.09  ? 13   DC  P "C4'" 1 
ATOM   29   O  "O4'" . DC  A 1 2   ? 66.042 45.565  18.680  1.00 29.59  ? 13   DC  P "O4'" 1 
ATOM   30   C  "C3'" . DC  A 1 2   ? 65.659 43.217  18.609  1.00 25.98  ? 13   DC  P "C3'" 1 
ATOM   31   O  "O3'" . DC  A 1 2   ? 65.224 42.730  19.888  1.00 34.54  ? 13   DC  P "O3'" 1 
ATOM   32   C  "C2'" . DC  A 1 2   ? 64.544 43.958  17.889  1.00 21.71  ? 13   DC  P "C2'" 1 
ATOM   33   C  "C1'" . DC  A 1 2   ? 64.652 45.342  18.504  1.00 22.43  ? 13   DC  P "C1'" 1 
ATOM   34   N  N1    . DC  A 1 2   ? 64.112 46.442  17.681  1.00 32.92  ? 13   DC  P N1    1 
ATOM   35   C  C2    . DC  A 1 2   ? 63.360 47.462  18.309  1.00 33.41  ? 13   DC  P C2    1 
ATOM   36   O  O2    . DC  A 1 2   ? 63.180 47.414  19.541  1.00 45.16  ? 13   DC  P O2    1 
ATOM   37   N  N3    . DC  A 1 2   ? 62.850 48.470  17.554  1.00 36.82  ? 13   DC  P N3    1 
ATOM   38   C  C4    . DC  A 1 2   ? 63.065 48.489  16.234  1.00 30.82  ? 13   DC  P C4    1 
ATOM   39   N  N4    . DC  A 1 2   ? 62.533 49.498  15.526  1.00 24.37  ? 13   DC  P N4    1 
ATOM   40   C  C5    . DC  A 1 2   ? 63.832 47.476  15.575  1.00 35.16  ? 13   DC  P C5    1 
ATOM   41   C  C6    . DC  A 1 2   ? 64.332 46.481  16.332  1.00 30.64  ? 13   DC  P C6    1 
ATOM   42   P  P     . DC  A 1 3   ? 63.897 41.823  19.993  1.00 47.24  ? 14   DC  P P     1 
ATOM   43   O  OP1   . DC  A 1 3   ? 63.889 41.166  21.335  1.00 36.53  ? 14   DC  P OP1   1 
ATOM   44   O  OP2   . DC  A 1 3   ? 63.776 40.981  18.760  1.00 34.98  ? 14   DC  P OP2   1 
ATOM   45   O  "O5'" . DC  A 1 3   ? 62.743 42.919  19.960  1.00 33.78  ? 14   DC  P "O5'" 1 
ATOM   46   C  "C5'" . DC  A 1 3   ? 62.615 43.870  21.031  1.00 32.30  ? 14   DC  P "C5'" 1 
ATOM   47   C  "C4'" . DC  A 1 3   ? 61.187 44.348  21.120  1.00 26.67  ? 14   DC  P "C4'" 1 
ATOM   48   O  "O4'" . DC  A 1 3   ? 60.925 45.406  20.167  1.00 27.19  ? 14   DC  P "O4'" 1 
ATOM   49   C  "C3'" . DC  A 1 3   ? 60.192 43.236  20.805  1.00 31.15  ? 14   DC  P "C3'" 1 
ATOM   50   O  "O3'" . DC  A 1 3   ? 59.061 43.334  21.657  1.00 34.02  ? 14   DC  P "O3'" 1 
ATOM   51   C  "C2'" . DC  A 1 3   ? 59.778 43.532  19.375  1.00 23.77  ? 14   DC  P "C2'" 1 
ATOM   52   C  "C1'" . DC  A 1 3   ? 59.806 45.049  19.373  1.00 22.80  ? 14   DC  P "C1'" 1 
ATOM   53   N  N1    . DC  A 1 3   ? 59.979 45.653  18.047  1.00 23.89  ? 14   DC  P N1    1 
ATOM   54   C  C2    . DC  A 1 3   ? 59.322 46.853  17.765  1.00 21.13  ? 14   DC  P C2    1 
ATOM   55   O  O2    . DC  A 1 3   ? 58.615 47.372  18.645  1.00 23.08  ? 14   DC  P O2    1 
ATOM   56   N  N3    . DC  A 1 3   ? 59.472 47.414  16.547  1.00 19.21  ? 14   DC  P N3    1 
ATOM   57   C  C4    . DC  A 1 3   ? 60.237 46.821  15.629  1.00 22.47  ? 14   DC  P C4    1 
ATOM   58   N  N4    . DC  A 1 3   ? 60.359 47.409  14.437  1.00 23.00  ? 14   DC  P N4    1 
ATOM   59   C  C5    . DC  A 1 3   ? 60.917 45.598  15.893  1.00 23.11  ? 14   DC  P C5    1 
ATOM   60   C  C6    . DC  A 1 3   ? 60.763 45.054  17.101  1.00 19.15  ? 14   DC  P C6    1 
ATOM   61   P  P     . DA  A 1 4   ? 58.023 42.118  21.728  1.00 42.50  ? 15   DA  P P     1 
ATOM   62   O  OP1   . DA  A 1 4   ? 58.288 41.373  22.988  1.00 39.22  ? 15   DA  P OP1   1 
ATOM   63   O  OP2   . DA  A 1 4   ? 58.048 41.403  20.419  1.00 33.83  ? 15   DA  P OP2   1 
ATOM   64   O  "O5'" . DA  A 1 4   ? 56.631 42.861  21.854  1.00 31.12  ? 15   DA  P "O5'" 1 
ATOM   65   C  "C5'" . DA  A 1 4   ? 56.519 44.063  22.628  1.00 25.92  ? 15   DA  P "C5'" 1 
ATOM   66   C  "C4'" . DA  A 1 4   ? 55.319 44.847  22.163  1.00 28.08  ? 15   DA  P "C4'" 1 
ATOM   67   O  "O4'" . DA  A 1 4   ? 55.616 45.589  20.952  1.00 29.70  ? 15   DA  P "O4'" 1 
ATOM   68   C  "C3'" . DA  A 1 4   ? 54.153 43.926  21.825  1.00 27.84  ? 15   DA  P "C3'" 1 
ATOM   69   O  "O3'" . DA  A 1 4   ? 52.948 44.452  22.357  1.00 28.76  ? 15   DA  P "O3'" 1 
ATOM   70   C  "C2'" . DA  A 1 4   ? 54.149 43.877  20.303  1.00 26.96  ? 15   DA  P "C2'" 1 
ATOM   71   C  "C1'" . DA  A 1 4   ? 54.705 45.238  19.916  1.00 23.42  ? 15   DA  P "C1'" 1 
ATOM   72   N  N9    . DA  A 1 4   ? 55.434 45.298  18.641  1.00 25.14  ? 15   DA  P N9    1 
ATOM   73   C  C8    . DA  A 1 4   ? 56.430 44.460  18.194  1.00 22.42  ? 15   DA  P C8    1 
ATOM   74   N  N7    . DA  A 1 4   ? 56.928 44.800  17.027  1.00 17.66  ? 15   DA  P N7    1 
ATOM   75   C  C5    . DA  A 1 4   ? 56.207 45.934  16.674  1.00 18.06  ? 15   DA  P C5    1 
ATOM   76   C  C6    . DA  A 1 4   ? 56.263 46.779  15.545  1.00 19.68  ? 15   DA  P C6    1 
ATOM   77   N  N6    . DA  A 1 4   ? 57.130 46.620  14.534  1.00 14.50  ? 15   DA  P N6    1 
ATOM   78   N  N1    . DA  A 1 4   ? 55.392 47.812  15.494  1.00 18.67  ? 15   DA  P N1    1 
ATOM   79   C  C2    . DA  A 1 4   ? 54.539 47.987  16.515  1.00 14.91  ? 15   DA  P C2    1 
ATOM   80   N  N3    . DA  A 1 4   ? 54.400 47.273  17.631  1.00 23.15  ? 15   DA  P N3    1 
ATOM   81   C  C4    . DA  A 1 4   ? 55.273 46.246  17.650  1.00 25.04  ? 15   DA  P C4    1 
ATOM   82   P  P     . DG  A 1 5   ? 51.569 43.702  22.058  1.00 42.54  ? 16   DG  P P     1 
ATOM   83   O  OP1   . DG  A 1 5   ? 50.640 43.917  23.206  1.00 34.56  ? 16   DG  P OP1   1 
ATOM   84   O  OP2   . DG  A 1 5   ? 51.900 42.313  21.624  1.00 27.38  ? 16   DG  P OP2   1 
ATOM   85   O  "O5'" . DG  A 1 5   ? 51.034 44.525  20.808  1.00 35.51  ? 16   DG  P "O5'" 1 
ATOM   86   C  "C5'" . DG  A 1 5   ? 50.985 45.955  20.875  1.00 31.31  ? 16   DG  P "C5'" 1 
ATOM   87   C  "C4'" . DG  A 1 5   ? 50.309 46.516  19.651  1.00 23.42  ? 16   DG  P "C4'" 1 
ATOM   88   O  "O4'" . DG  A 1 5   ? 51.220 46.516  18.526  1.00 27.06  ? 16   DG  P "O4'" 1 
ATOM   89   C  "C3'" . DG  A 1 5   ? 49.053 45.770  19.203  1.00 17.87  ? 16   DG  P "C3'" 1 
ATOM   90   O  "O3'" . DG  A 1 5   ? 48.044 46.746  18.910  1.00 21.67  ? 16   DG  P "O3'" 1 
ATOM   91   C  "C2'" . DG  A 1 5   ? 49.522 45.014  17.963  1.00 16.54  ? 16   DG  P "C2'" 1 
ATOM   92   C  "C1'" . DG  A 1 5   ? 50.587 45.943  17.394  1.00 16.15  ? 16   DG  P "C1'" 1 
ATOM   93   N  N9    . DG  A 1 5   ? 51.632 45.344  16.565  1.00 15.94  ? 16   DG  P N9    1 
ATOM   94   C  C8    . DG  A 1 5   ? 52.352 44.202  16.830  1.00 18.01  ? 16   DG  P C8    1 
ATOM   95   N  N7    . DG  A 1 5   ? 53.244 43.932  15.913  1.00 14.67  ? 16   DG  P N7    1 
ATOM   96   C  C5    . DG  A 1 5   ? 53.104 44.949  14.981  1.00 14.64  ? 16   DG  P C5    1 
ATOM   97   C  C6    . DG  A 1 5   ? 53.810 45.192  13.766  1.00 18.51  ? 16   DG  P C6    1 
ATOM   98   O  O6    . DG  A 1 5   ? 54.720 44.531  13.259  1.00 20.37  ? 16   DG  P O6    1 
ATOM   99   N  N1    . DG  A 1 5   ? 53.357 46.342  13.130  1.00 16.33  ? 16   DG  P N1    1 
ATOM   100  C  C2    . DG  A 1 5   ? 52.352 47.156  13.597  1.00 20.23  ? 16   DG  P C2    1 
ATOM   101  N  N2    . DG  A 1 5   ? 52.063 48.222  12.837  1.00 19.44  ? 16   DG  P N2    1 
ATOM   102  N  N3    . DG  A 1 5   ? 51.682 46.941  14.723  1.00 20.04  ? 16   DG  P N3    1 
ATOM   103  C  C4    . DG  A 1 5   ? 52.110 45.829  15.362  1.00 16.51  ? 16   DG  P C4    1 
ATOM   104  P  P     . DT  A 1 6   ? 46.498 46.316  18.801  1.00 31.51  ? 17   DT  P P     1 
ATOM   105  O  OP1   . DT  A 1 6   ? 45.690 47.345  19.501  1.00 30.49  ? 17   DT  P OP1   1 
ATOM   106  O  OP2   . DT  A 1 6   ? 46.326 44.873  19.146  1.00 23.79  ? 17   DT  P OP2   1 
ATOM   107  O  "O5'" . DT  A 1 6   ? 46.249 46.457  17.241  1.00 33.38  ? 17   DT  P "O5'" 1 
ATOM   108  C  "C5'" . DT  A 1 6   ? 47.338 46.211  16.348  1.00 30.97  ? 17   DT  P "C5'" 1 
ATOM   109  C  "C4'" . DT  A 1 6   ? 47.025 46.739  14.973  1.00 22.00  ? 17   DT  P "C4'" 1 
ATOM   110  O  "O4'" . DT  A 1 6   ? 48.182 46.490  14.152  1.00 20.53  ? 17   DT  P "O4'" 1 
ATOM   111  C  "C3'" . DT  A 1 6   ? 45.866 46.023  14.295  1.00 23.43  ? 17   DT  P "C3'" 1 
ATOM   112  O  "O3'" . DT  A 1 6   ? 45.187 46.968  13.458  1.00 18.66  ? 17   DT  P "O3'" 1 
ATOM   113  C  "C2'" . DT  A 1 6   ? 46.558 44.909  13.526  1.00 11.15  ? 17   DT  P "C2'" 1 
ATOM   114  C  "C1'" . DT  A 1 6   ? 47.889 45.541  13.144  1.00 17.10  ? 17   DT  P "C1'" 1 
ATOM   115  N  N1    . DT  A 1 6   ? 49.034 44.613  13.080  1.00 20.42  ? 17   DT  P N1    1 
ATOM   116  C  C2    . DT  A 1 6   ? 49.956 44.785  12.073  1.00 13.76  ? 17   DT  P C2    1 
ATOM   117  O  O2    . DT  A 1 6   ? 49.873 45.668  11.236  1.00 15.14  ? 17   DT  P O2    1 
ATOM   118  N  N3    . DT  A 1 6   ? 50.991 43.882  12.085  1.00 23.20  ? 17   DT  P N3    1 
ATOM   119  C  C4    . DT  A 1 6   ? 51.191 42.845  12.984  1.00 20.79  ? 17   DT  P C4    1 
ATOM   120  O  O4    . DT  A 1 6   ? 52.172 42.108  12.864  1.00 15.73  ? 17   DT  P O4    1 
ATOM   121  C  C5    . DT  A 1 6   ? 50.184 42.726  14.017  1.00 21.06  ? 17   DT  P C5    1 
ATOM   122  C  C7    . DT  A 1 6   ? 50.316 41.643  15.044  1.00 19.85  ? 17   DT  P C7    1 
ATOM   123  C  C6    . DT  A 1 6   ? 49.169 43.602  14.011  1.00 20.48  ? 17   DT  P C6    1 
ATOM   124  P  P     . DG  A 1 7   ? 43.708 46.657  12.922  1.00 18.22  ? 18   DG  P P     1 
ATOM   125  O  OP1   . DG  A 1 7   ? 42.951 47.929  12.896  1.00 23.66  ? 18   DG  P OP1   1 
ATOM   126  O  OP2   . DG  A 1 7   ? 43.165 45.490  13.663  1.00 23.89  ? 18   DG  P OP2   1 
ATOM   127  O  "O5'" . DG  A 1 7   ? 43.981 46.208  11.424  1.00 18.75  ? 18   DG  P "O5'" 1 
ATOM   128  C  "C5'" . DG  A 1 7   ? 45.243 45.634  11.094  1.00 16.68  ? 18   DG  P "C5'" 1 
ATOM   129  C  "C4'" . DG  A 1 7   ? 45.478 45.690  9.608   1.00 20.58  ? 18   DG  P "C4'" 1 
ATOM   130  O  "O4'" . DG  A 1 7   ? 46.810 45.182  9.394   1.00 24.70  ? 18   DG  P "O4'" 1 
ATOM   131  C  "C3'" . DG  A 1 7   ? 44.546 44.768  8.833   1.00 26.92  ? 18   DG  P "C3'" 1 
ATOM   132  O  "O3'" . DG  A 1 7   ? 44.255 45.287  7.539   1.00 26.80  ? 18   DG  P "O3'" 1 
ATOM   133  C  "C2'" . DG  A 1 7   ? 45.331 43.480  8.728   1.00 24.99  ? 18   DG  P "C2'" 1 
ATOM   134  C  "C1'" . DG  A 1 7   ? 46.771 43.947  8.705   1.00 21.13  ? 18   DG  P "C1'" 1 
ATOM   135  N  N9    . DG  A 1 7   ? 47.648 43.024  9.414   1.00 21.59  ? 18   DG  P N9    1 
ATOM   136  C  C8    . DG  A 1 7   ? 47.367 42.345  10.576  1.00 16.88  ? 18   DG  P C8    1 
ATOM   137  N  N7    . DG  A 1 7   ? 48.340 41.562  10.959  1.00 19.16  ? 18   DG  P N7    1 
ATOM   138  C  C5    . DG  A 1 7   ? 49.323 41.742  9.991   1.00 21.45  ? 18   DG  P C5    1 
ATOM   139  C  C6    . DG  A 1 7   ? 50.603 41.154  9.867   1.00 24.74  ? 18   DG  P C6    1 
ATOM   140  O  O6    . DG  A 1 7   ? 51.141 40.323  10.606  1.00 30.13  ? 18   DG  P O6    1 
ATOM   141  N  N1    . DG  A 1 7   ? 51.275 41.621  8.739   1.00 19.82  ? 18   DG  P N1    1 
ATOM   142  C  C2    . DG  A 1 7   ? 50.773 42.534  7.843   1.00 16.65  ? 18   DG  P C2    1 
ATOM   143  N  N2    . DG  A 1 7   ? 51.567 42.857  6.816   1.00 24.52  ? 18   DG  P N2    1 
ATOM   144  N  N3    . DG  A 1 7   ? 49.579 43.088  7.946   1.00 23.38  ? 18   DG  P N3    1 
ATOM   145  C  C4    . DG  A 1 7   ? 48.912 42.648  9.037   1.00 23.16  ? 18   DG  P C4    1 
ATOM   146  P  P     . DC  A 1 8   ? 43.328 44.437  6.539   1.00 22.94  ? 19   DC  P P     1 
ATOM   147  O  OP1   . DC  A 1 8   ? 42.337 45.358  5.931   1.00 22.16  ? 19   DC  P OP1   1 
ATOM   148  O  OP2   . DC  A 1 8   ? 42.859 43.227  7.263   1.00 21.40  ? 19   DC  P OP2   1 
ATOM   149  O  "O5'" . DC  A 1 8   ? 44.354 43.957  5.416   1.00 22.66  ? 19   DC  P "O5'" 1 
ATOM   150  C  "C5'" . DC  A 1 8   ? 45.181 44.910  4.732   1.00 11.94  ? 19   DC  P "C5'" 1 
ATOM   151  C  "C4'" . DC  A 1 8   ? 46.161 44.209  3.820   1.00 11.67  ? 19   DC  P "C4'" 1 
ATOM   152  O  "O4'" . DC  A 1 8   ? 47.123 43.472  4.609   1.00 12.54  ? 19   DC  P "O4'" 1 
ATOM   153  C  "C3'" . DC  A 1 8   ? 45.568 43.209  2.823   1.00 22.21  ? 19   DC  P "C3'" 1 
ATOM   154  O  "O3'" . DC  A 1 8   ? 46.264 43.347  1.576   1.00 29.01  ? 19   DC  P "O3'" 1 
ATOM   155  C  "C2'" . DC  A 1 8   ? 45.853 41.863  3.467   1.00 18.21  ? 19   DC  P "C2'" 1 
ATOM   156  C  "C1'" . DC  A 1 8   ? 47.176 42.124  4.160   1.00 22.68  ? 19   DC  P "C1'" 1 
ATOM   157  N  N1    . DC  A 1 8   ? 47.475 41.264  5.320   1.00 16.26  ? 19   DC  P N1    1 
ATOM   158  C  C2    . DC  A 1 8   ? 48.702 40.593  5.358   1.00 13.04  ? 19   DC  P C2    1 
ATOM   159  O  O2    . DC  A 1 8   ? 49.503 40.746  4.427   1.00 18.16  ? 19   DC  P O2    1 
ATOM   160  N  N3    . DC  A 1 8   ? 48.990 39.801  6.411   1.00 14.74  ? 19   DC  P N3    1 
ATOM   161  C  C4    . DC  A 1 8   ? 48.114 39.670  7.404   1.00 17.55  ? 19   DC  P C4    1 
ATOM   162  N  N4    . DC  A 1 8   ? 48.454 38.879  8.430   1.00 16.43  ? 19   DC  P N4    1 
ATOM   163  C  C5    . DC  A 1 8   ? 46.852 40.341  7.394   1.00 16.54  ? 19   DC  P C5    1 
ATOM   164  C  C6    . DC  A 1 8   ? 46.577 41.119  6.340   1.00 15.43  ? 19   DC  P C6    1 
ATOM   165  P  P     . DC  A 1 9   ? 45.899 42.396  0.328   1.00 30.59  ? 20   DC  P P     1 
ATOM   166  O  OP1   . DC  A 1 9   ? 46.064 43.229  -0.893  1.00 30.75  ? 20   DC  P OP1   1 
ATOM   167  O  OP2   . DC  A 1 9   ? 44.614 41.678  0.567   1.00 16.65  ? 20   DC  P OP2   1 
ATOM   168  O  "O5'" . DC  A 1 9   ? 47.060 41.313  0.367   1.00 25.49  ? 20   DC  P "O5'" 1 
ATOM   169  C  "C5'" . DC  A 1 9   ? 48.281 41.505  -0.364  1.00 20.41  ? 20   DC  P "C5'" 1 
ATOM   170  C  "C4'" . DC  A 1 9   ? 48.832 40.161  -0.761  1.00 17.39  ? 20   DC  P "C4'" 1 
ATOM   171  O  "O4'" . DC  A 1 9   ? 49.452 39.546  0.400   1.00 18.39  ? 20   DC  P "O4'" 1 
ATOM   172  C  "C3'" . DC  A 1 9   ? 47.665 39.259  -1.154  1.00 18.91  ? 20   DC  P "C3'" 1 
ATOM   173  O  "O3'" . DC  A 1 9   ? 47.825 38.487  -2.312  1.00 14.60  ? 20   DC  P "O3'" 1 
ATOM   174  C  "C2'" . DC  A 1 9   ? 47.547 38.279  -0.019  1.00 26.69  ? 20   DC  P "C2'" 1 
ATOM   175  C  "C1'" . DC  A 1 9   ? 48.925 38.247  0.588   1.00 22.60  ? 20   DC  P "C1'" 1 
ATOM   176  N  N1    . DC  A 1 9   ? 48.692 38.020  2.016   1.00 23.33  ? 20   DC  P N1    1 
ATOM   177  C  C2    . DC  A 1 9   ? 49.517 37.153  2.724   1.00 12.78  ? 20   DC  P C2    1 
ATOM   178  O  O2    . DC  A 1 9   ? 50.530 36.698  2.172   1.00 12.94  ? 20   DC  P O2    1 
ATOM   179  N  N3    . DC  A 1 9   ? 49.185 36.831  3.995   1.00 15.53  ? 20   DC  P N3    1 
ATOM   180  C  C4    . DC  A 1 9   ? 48.097 37.374  4.557   1.00 15.79  ? 20   DC  P C4    1 
ATOM   181  N  N4    . DC  A 1 9   ? 47.769 36.997  5.789   1.00 17.62  ? 20   DC  P N4    1 
ATOM   182  C  C5    . DC  A 1 9   ? 47.291 38.319  3.877   1.00 21.32  ? 20   DC  P C5    1 
ATOM   183  C  C6    . DC  A 1 9   ? 47.625 38.620  2.629   1.00 18.59  ? 20   DC  P C6    1 
ATOM   184  P  P     . DA  A 1 10  ? 46.677 37.433  -2.678  1.00 19.73  ? 21   DA  P P     1 
ATOM   185  O  OP1   . DA  A 1 10  ? 46.326 37.590  -4.105  1.00 25.09  ? 21   DA  P OP1   1 
ATOM   186  O  OP2   . DA  A 1 10  ? 45.602 37.533  -1.656  1.00 14.98  ? 21   DA  P OP2   1 
ATOM   187  O  "O5'" . DA  A 1 10  ? 47.420 36.050  -2.442  1.00 15.81  ? 21   DA  P "O5'" 1 
ATOM   188  C  "C5'" . DA  A 1 10  ? 48.789 35.894  -2.827  1.00 11.90  ? 21   DA  P "C5'" 1 
ATOM   189  C  "C4'" . DA  A 1 10  ? 49.230 34.481  -2.557  1.00 14.82  ? 21   DA  P "C4'" 1 
ATOM   190  O  "O4'" . DA  A 1 10  ? 49.489 34.319  -1.135  1.00 12.01  ? 21   DA  P "O4'" 1 
ATOM   191  C  "C3'" . DA  A 1 10  ? 48.114 33.506  -2.921  1.00 13.16  ? 21   DA  P "C3'" 1 
ATOM   192  O  "O3'" . DA  A 1 10  ? 48.524 32.428  -3.736  1.00 13.80  ? 21   DA  P "O3'" 1 
ATOM   193  C  "C2'" . DA  A 1 10  ? 47.628 32.979  -1.590  1.00 23.94  ? 21   DA  P "C2'" 1 
ATOM   194  C  "C1'" . DA  A 1 10  ? 48.797 33.187  -0.647  1.00 18.39  ? 21   DA  P "C1'" 1 
ATOM   195  N  N9    . DA  A 1 10  ? 48.250 33.508  0.667   1.00 18.30  ? 21   DA  P N9    1 
ATOM   196  C  C8    . DA  A 1 10  ? 47.453 34.575  0.990   1.00 14.00  ? 21   DA  P C8    1 
ATOM   197  N  N7    . DA  A 1 10  ? 47.016 34.550  2.220   1.00 13.49  ? 21   DA  P N7    1 
ATOM   198  C  C5    . DA  A 1 10  ? 47.581 33.401  2.752   1.00 11.30  ? 21   DA  P C5    1 
ATOM   199  C  C6    . DA  A 1 10  ? 47.488 32.801  4.019   1.00 16.86  ? 21   DA  P C6    1 
ATOM   200  N  N6    . DA  A 1 10  ? 46.744 33.283  5.014   1.00 11.98  ? 21   DA  P N6    1 
ATOM   201  N  N1    . DA  A 1 10  ? 48.185 31.668  4.229   1.00 17.49  ? 21   DA  P N1    1 
ATOM   202  C  C2    . DA  A 1 10  ? 48.914 31.172  3.226   1.00 22.95  ? 21   DA  P C2    1 
ATOM   203  N  N3    . DA  A 1 10  ? 49.071 31.636  1.989   1.00 23.02  ? 21   DA  P N3    1 
ATOM   204  C  C4    . DA  A 1 10  ? 48.367 32.766  1.816   1.00 13.94  ? 21   DA  P C4    1 
HETATM 205  P  P     . 2DA A 1 11  ? 47.402 31.519  -4.431  1.00 17.33  ? 22   2DA P P     1 
HETATM 206  O  OP1   . 2DA A 1 11  ? 47.813 31.275  -5.835  1.00 21.95  ? 22   2DA P OP1   1 
HETATM 207  O  OP2   . 2DA A 1 11  ? 46.075 32.121  -4.149  1.00 11.06  ? 22   2DA P OP2   1 
HETATM 208  O  "O5'" . 2DA A 1 11  ? 47.487 30.159  -3.609  1.00 16.78  ? 22   2DA P "O5'" 1 
HETATM 209  C  "C5'" . 2DA A 1 11  ? 48.709 29.410  -3.563  1.00 14.20  ? 22   2DA P "C5'" 1 
HETATM 210  C  "C4'" . 2DA A 1 11  ? 48.666 28.394  -2.449  1.00 9.01   ? 22   2DA P "C4'" 1 
HETATM 211  O  "O4'" . 2DA A 1 11  ? 48.709 29.069  -1.167  1.00 13.99  ? 22   2DA P "O4'" 1 
HETATM 212  C  "C3'" . 2DA A 1 11  ? 47.418 27.534  -2.379  1.00 11.06  ? 22   2DA P "C3'" 1 
HETATM 213  C  "C2'" . 2DA A 1 11  ? 47.416 27.082  -0.920  1.00 16.75  ? 22   2DA P "C2'" 1 
HETATM 214  C  "C1'" . 2DA A 1 11  ? 48.001 28.302  -0.207  1.00 12.45  ? 22   2DA P "C1'" 1 
HETATM 215  N  N9    . 2DA A 1 11  ? 47.015 29.161  0.453   1.00 18.15  ? 22   2DA P N9    1 
HETATM 216  C  C8    . 2DA A 1 11  ? 46.264 30.179  -0.079  1.00 13.91  ? 22   2DA P C8    1 
HETATM 217  N  N7    . 2DA A 1 11  ? 45.469 30.762  0.788   1.00 18.17  ? 22   2DA P N7    1 
HETATM 218  C  C5    . 2DA A 1 11  ? 45.713 30.078  1.975   1.00 20.60  ? 22   2DA P C5    1 
HETATM 219  C  C6    . 2DA A 1 11  ? 45.186 30.214  3.278   1.00 17.98  ? 22   2DA P C6    1 
HETATM 220  N  N6    . 2DA A 1 11  ? 44.270 31.121  3.627   1.00 6.66   ? 22   2DA P N6    1 
HETATM 221  N  N1    . 2DA A 1 11  ? 45.639 29.368  4.225   1.00 12.97  ? 22   2DA P N1    1 
HETATM 222  C  C2    . 2DA A 1 11  ? 46.559 28.456  3.886   1.00 18.22  ? 22   2DA P C2    1 
HETATM 223  N  N3    . 2DA A 1 11  ? 47.132 28.234  2.706   1.00 24.85  ? 22   2DA P N3    1 
HETATM 224  C  C4    . 2DA A 1 11  ? 46.659 29.088  1.781   1.00 19.48  ? 22   2DA P C4    1 
ATOM   225  P  P     . DC  B 2 1   ? 33.415 27.694  17.293  1.00 50.58  ? 3    DC  T P     1 
ATOM   226  O  OP1   . DC  B 2 1   ? 32.224 28.593  17.189  1.00 34.29  ? 3    DC  T OP1   1 
ATOM   227  O  OP2   . DC  B 2 1   ? 33.416 26.569  18.275  1.00 40.28  ? 3    DC  T OP2   1 
ATOM   228  O  "O5'" . DC  B 2 1   ? 34.687 28.609  17.580  1.00 36.43  ? 3    DC  T "O5'" 1 
ATOM   229  C  "C5'" . DC  B 2 1   ? 34.545 30.032  17.738  1.00 37.31  ? 3    DC  T "C5'" 1 
ATOM   230  C  "C4'" . DC  B 2 1   ? 35.872 30.715  17.505  1.00 29.23  ? 3    DC  T "C4'" 1 
ATOM   231  O  "O4'" . DC  B 2 1   ? 36.799 30.280  18.525  1.00 28.64  ? 3    DC  T "O4'" 1 
ATOM   232  C  "C3'" . DC  B 2 1   ? 36.534 30.392  16.165  1.00 28.72  ? 3    DC  T "C3'" 1 
ATOM   233  O  "O3'" . DC  B 2 1   ? 37.201 31.565  15.664  1.00 28.99  ? 3    DC  T "O3'" 1 
ATOM   234  C  "C2'" . DC  B 2 1   ? 37.518 29.288  16.519  1.00 21.31  ? 3    DC  T "C2'" 1 
ATOM   235  C  "C1'" . DC  B 2 1   ? 37.919 29.628  17.946  1.00 23.84  ? 3    DC  T "C1'" 1 
ATOM   236  N  N1    . DC  B 2 1   ? 38.234 28.457  18.788  1.00 21.03  ? 3    DC  T N1    1 
ATOM   237  C  C2    . DC  B 2 1   ? 39.503 28.367  19.386  1.00 23.66  ? 3    DC  T C2    1 
ATOM   238  O  O2    . DC  B 2 1   ? 40.319 29.296  19.215  1.00 29.75  ? 3    DC  T O2    1 
ATOM   239  N  N3    . DC  B 2 1   ? 39.806 27.272  20.135  1.00 25.57  ? 3    DC  T N3    1 
ATOM   240  C  C4    . DC  B 2 1   ? 38.896 26.300  20.296  1.00 29.97  ? 3    DC  T C4    1 
ATOM   241  N  N4    . DC  B 2 1   ? 39.245 25.217  21.012  1.00 35.16  ? 3    DC  T N4    1 
ATOM   242  C  C5    . DC  B 2 1   ? 37.592 26.384  19.721  1.00 26.69  ? 3    DC  T C5    1 
ATOM   243  C  C6    . DC  B 2 1   ? 37.307 27.467  18.983  1.00 21.89  ? 3    DC  T C6    1 
ATOM   244  P  P     . DC  B 2 2   ? 36.858 32.116  14.189  1.00 25.31  ? 4    DC  T P     1 
ATOM   245  O  OP1   . DC  B 2 2   ? 37.134 33.574  14.152  1.00 22.67  ? 4    DC  T OP1   1 
ATOM   246  O  OP2   . DC  B 2 2   ? 35.518 31.625  13.810  1.00 23.50  ? 4    DC  T OP2   1 
ATOM   247  O  "O5'" . DC  B 2 2   ? 37.975 31.426  13.295  1.00 27.94  ? 4    DC  T "O5'" 1 
ATOM   248  C  "C5'" . DC  B 2 2   ? 37.658 30.673  12.125  1.00 24.12  ? 4    DC  T "C5'" 1 
ATOM   249  C  "C4'" . DC  B 2 2   ? 38.536 29.446  12.081  1.00 18.94  ? 4    DC  T "C4'" 1 
ATOM   250  O  "O4'" . DC  B 2 2   ? 38.436 28.904  10.741  1.00 20.71  ? 4    DC  T "O4'" 1 
ATOM   251  C  "C3'" . DC  B 2 2   ? 40.011 29.797  12.303  1.00 24.66  ? 4    DC  T "C3'" 1 
ATOM   252  O  "O3'" . DC  B 2 2   ? 40.713 28.913  13.178  1.00 24.75  ? 4    DC  T "O3'" 1 
ATOM   253  C  "C2'" . DC  B 2 2   ? 40.629 29.734  10.928  1.00 27.22  ? 4    DC  T "C2'" 1 
ATOM   254  C  "C1'" . DC  B 2 2   ? 39.712 28.834  10.129  1.00 19.97  ? 4    DC  T "C1'" 1 
ATOM   255  N  N1    . DC  B 2 2   ? 39.622 29.440  8.800   1.00 23.96  ? 4    DC  T N1    1 
ATOM   256  C  C2    . DC  B 2 2   ? 40.202 28.781  7.731   1.00 18.77  ? 4    DC  T C2    1 
ATOM   257  O  O2    . DC  B 2 2   ? 40.670 27.645  7.914   1.00 16.10  ? 4    DC  T O2    1 
ATOM   258  N  N3    . DC  B 2 2   ? 40.246 29.396  6.525   1.00 25.96  ? 4    DC  T N3    1 
ATOM   259  C  C4    . DC  B 2 2   ? 39.705 30.609  6.371   1.00 23.43  ? 4    DC  T C4    1 
ATOM   260  N  N4    . DC  B 2 2   ? 39.818 31.200  5.179   1.00 21.66  ? 4    DC  T N4    1 
ATOM   261  C  C5    . DC  B 2 2   ? 39.042 31.274  7.438   1.00 24.78  ? 4    DC  T C5    1 
ATOM   262  C  C6    . DC  B 2 2   ? 39.017 30.657  8.624   1.00 20.60  ? 4    DC  T C6    1 
ATOM   263  P  P     . DT  B 2 3   ? 42.251 29.234  13.540  1.00 18.11  ? 5    DT  T P     1 
ATOM   264  O  OP1   . DT  B 2 3   ? 42.557 28.803  14.927  1.00 21.33  ? 5    DT  T OP1   1 
ATOM   265  O  OP2   . DT  B 2 3   ? 42.546 30.634  13.127  1.00 15.56  ? 5    DT  T OP2   1 
ATOM   266  O  "O5'" . DT  B 2 3   ? 43.053 28.304  12.531  1.00 22.94  ? 5    DT  T "O5'" 1 
ATOM   267  C  "C5'" . DT  B 2 3   ? 42.925 26.871  12.574  1.00 13.52  ? 5    DT  T "C5'" 1 
ATOM   268  C  "C4'" . DT  B 2 3   ? 44.113 26.247  11.884  1.00 17.41  ? 5    DT  T "C4'" 1 
ATOM   269  O  "O4'" . DT  B 2 3   ? 43.950 26.391  10.446  1.00 17.59  ? 5    DT  T "O4'" 1 
ATOM   270  C  "C3'" . DT  B 2 3   ? 45.378 27.013  12.266  1.00 18.02  ? 5    DT  T "C3'" 1 
ATOM   271  O  "O3'" . DT  B 2 3   ? 46.483 26.207  12.638  1.00 11.88  ? 5    DT  T "O3'" 1 
ATOM   272  C  "C2'" . DT  B 2 3   ? 45.714 27.827  11.033  1.00 22.96  ? 5    DT  T "C2'" 1 
ATOM   273  C  "C1'" . DT  B 2 3   ? 45.046 27.099  9.881   1.00 17.80  ? 5    DT  T "C1'" 1 
ATOM   274  N  N1    . DT  B 2 3   ? 44.524 28.124  8.935   1.00 21.36  ? 5    DT  T N1    1 
ATOM   275  C  C2    . DT  B 2 3   ? 44.923 28.094  7.611   1.00 13.76  ? 5    DT  T C2    1 
ATOM   276  O  O2    . DT  B 2 3   ? 45.599 27.202  7.131   1.00 11.49  ? 5    DT  T O2    1 
ATOM   277  N  N3    . DT  B 2 3   ? 44.494 29.164  6.866   1.00 17.02  ? 5    DT  T N3    1 
ATOM   278  C  C4    . DT  B 2 3   ? 43.712 30.223  7.289   1.00 13.89  ? 5    DT  T C4    1 
ATOM   279  O  O4    . DT  B 2 3   ? 43.445 31.133  6.512   1.00 13.53  ? 5    DT  T O4    1 
ATOM   280  C  C5    . DT  B 2 3   ? 43.277 30.157  8.661   1.00 13.34  ? 5    DT  T C5    1 
ATOM   281  C  C7    . DT  B 2 3   ? 42.394 31.240  9.194   1.00 18.96  ? 5    DT  T C7    1 
ATOM   282  C  C6    . DT  B 2 3   ? 43.692 29.124  9.403   1.00 15.02  ? 5    DT  T C6    1 
ATOM   283  P  P     . DT  B 2 4   ? 47.895 26.920  12.922  1.00 31.83  ? 6    DT  T P     1 
ATOM   284  O  OP1   . DT  B 2 4   ? 48.678 26.119  13.886  1.00 14.68  ? 6    DT  T OP1   1 
ATOM   285  O  OP2   . DT  B 2 4   ? 47.673 28.356  13.181  1.00 11.10  ? 6    DT  T OP2   1 
ATOM   286  O  "O5'" . DT  B 2 4   ? 48.604 26.824  11.505  1.00 14.29  ? 6    DT  T "O5'" 1 
ATOM   287  C  "C5'" . DT  B 2 4   ? 48.730 25.559  10.830  1.00 12.32  ? 6    DT  T "C5'" 1 
ATOM   288  C  "C4'" . DT  B 2 4   ? 49.730 25.685  9.711   1.00 19.43  ? 6    DT  T "C4'" 1 
ATOM   289  O  "O4'" . DT  B 2 4   ? 49.099 26.341  8.570   1.00 13.74  ? 6    DT  T "O4'" 1 
ATOM   290  C  "C3'" . DT  B 2 4   ? 50.866 26.596  10.171  1.00 21.72  ? 6    DT  T "C3'" 1 
ATOM   291  O  "O3'" . DT  B 2 4   ? 52.190 26.104  10.046  1.00 15.17  ? 6    DT  T "O3'" 1 
ATOM   292  C  "C2'" . DT  B 2 4   ? 50.695 27.864  9.369   1.00 28.38  ? 6    DT  T "C2'" 1 
ATOM   293  C  "C1'" . DT  B 2 4   ? 49.855 27.474  8.167   1.00 19.18  ? 6    DT  T "C1'" 1 
ATOM   294  N  N1    . DT  B 2 4   ? 48.933 28.605  7.924   1.00 18.47  ? 6    DT  T N1    1 
ATOM   295  C  C2    . DT  B 2 4   ? 48.856 29.176  6.670   1.00 13.00  ? 6    DT  T C2    1 
ATOM   296  O  O2    . DT  B 2 4   ? 49.450 28.752  5.697   1.00 14.31  ? 6    DT  T O2    1 
ATOM   297  N  N3    . DT  B 2 4   ? 48.052 30.282  6.600   1.00 14.21  ? 6    DT  T N3    1 
ATOM   298  C  C4    . DT  B 2 4   ? 47.331 30.862  7.625   1.00 11.30  ? 6    DT  T C4    1 
ATOM   299  O  O4    . DT  B 2 4   ? 46.680 31.878  7.409   1.00 10.87  ? 6    DT  T O4    1 
ATOM   300  C  C5    . DT  B 2 4   ? 47.425 30.191  8.903   1.00 16.53  ? 6    DT  T C5    1 
ATOM   301  C  C7    . DT  B 2 4   ? 46.670 30.737  10.076  1.00 14.08  ? 6    DT  T C7    1 
ATOM   302  C  C6    . DT  B 2 4   ? 48.200 29.107  8.982   1.00 8.87   ? 6    DT  T C6    1 
ATOM   303  P  P     . DG  B 2 5   ? 53.349 26.832  10.892  1.00 21.56  ? 7    DG  T P     1 
ATOM   304  O  OP1   . DG  B 2 5   ? 54.321 25.844  11.428  1.00 12.57  ? 7    DG  T OP1   1 
ATOM   305  O  OP2   . DG  B 2 5   ? 52.627 27.733  11.828  1.00 13.72  ? 7    DG  T OP2   1 
ATOM   306  O  "O5'" . DG  B 2 5   ? 54.073 27.776  9.829   1.00 15.37  ? 7    DG  T "O5'" 1 
ATOM   307  C  "C5'" . DG  B 2 5   ? 53.288 28.689  9.057   1.00 24.48  ? 7    DG  T "C5'" 1 
ATOM   308  C  "C4'" . DG  B 2 5   ? 54.095 29.336  7.963   1.00 23.59  ? 7    DG  T "C4'" 1 
ATOM   309  O  "O4'" . DG  B 2 5   ? 53.099 29.897  7.079   1.00 24.78  ? 7    DG  T "O4'" 1 
ATOM   310  C  "C3'" . DG  B 2 5   ? 54.980 30.502  8.415   1.00 21.20  ? 7    DG  T "C3'" 1 
ATOM   311  O  "O3'" . DG  B 2 5   ? 56.189 30.650  7.677   1.00 9.69   ? 7    DG  T "O3'" 1 
ATOM   312  C  "C2'" . DG  B 2 5   ? 54.140 31.721  8.126   1.00 27.69  ? 7    DG  T "C2'" 1 
ATOM   313  C  "C1'" . DG  B 2 5   ? 53.258 31.293  6.971   1.00 22.29  ? 7    DG  T "C1'" 1 
ATOM   314  N  N9    . DG  B 2 5   ? 51.962 31.916  7.174   1.00 14.57  ? 7    DG  T N9    1 
ATOM   315  C  C8    . DG  B 2 5   ? 51.149 31.798  8.275   1.00 9.53   ? 7    DG  T C8    1 
ATOM   316  N  N7    . DG  B 2 5   ? 50.132 32.609  8.240   1.00 13.54  ? 7    DG  T N7    1 
ATOM   317  C  C5    . DG  B 2 5   ? 50.269 33.272  7.029   1.00 14.09  ? 7    DG  T C5    1 
ATOM   318  C  C6    . DG  B 2 5   ? 49.496 34.291  6.462   1.00 14.07  ? 7    DG  T C6    1 
ATOM   319  O  O6    . DG  B 2 5   ? 48.524 34.859  6.946   1.00 16.03  ? 7    DG  T O6    1 
ATOM   320  N  N1    . DG  B 2 5   ? 49.969 34.659  5.206   1.00 11.14  ? 7    DG  T N1    1 
ATOM   321  C  C2    . DG  B 2 5   ? 51.070 34.119  4.589   1.00 18.12  ? 7    DG  T C2    1 
ATOM   322  N  N2    . DG  B 2 5   ? 51.370 34.584  3.374   1.00 18.13  ? 7    DG  T N2    1 
ATOM   323  N  N3    . DG  B 2 5   ? 51.821 33.185  5.128   1.00 20.41  ? 7    DG  T N3    1 
ATOM   324  C  C4    . DG  B 2 5   ? 51.365 32.813  6.341   1.00 19.46  ? 7    DG  T C4    1 
ATOM   325  P  P     . DG  B 2 6   ? 57.176 31.884  8.024   1.00 9.95   ? 8    DG  T P     1 
ATOM   326  O  OP1   . DG  B 2 6   ? 58.582 31.425  7.948   1.00 8.22   ? 8    DG  T OP1   1 
ATOM   327  O  OP2   . DG  B 2 6   ? 56.688 32.531  9.267   1.00 11.55  ? 8    DG  T OP2   1 
ATOM   328  O  "O5'" . DG  B 2 6   ? 56.918 32.951  6.866   1.00 14.16  ? 8    DG  T "O5'" 1 
ATOM   329  C  "C5'" . DG  B 2 6   ? 57.288 32.684  5.498   1.00 12.16  ? 8    DG  T "C5'" 1 
ATOM   330  C  "C4'" . DG  B 2 6   ? 57.287 33.968  4.696   1.00 11.76  ? 8    DG  T "C4'" 1 
ATOM   331  O  "O4'" . DG  B 2 6   ? 55.969 34.558  4.757   1.00 14.76  ? 8    DG  T "O4'" 1 
ATOM   332  C  "C3'" . DG  B 2 6   ? 58.250 35.064  5.150   1.00 13.62  ? 8    DG  T "C3'" 1 
ATOM   333  O  "O3'" . DG  B 2 6   ? 58.746 35.736  3.985   1.00 11.82  ? 8    DG  T "O3'" 1 
ATOM   334  C  "C2'" . DG  B 2 6   ? 57.374 35.973  5.997   1.00 18.52  ? 8    DG  T "C2'" 1 
ATOM   335  C  "C1'" . DG  B 2 6   ? 56.014 35.858  5.331   1.00 11.87  ? 8    DG  T "C1'" 1 
ATOM   336  N  N9    . DG  B 2 6   ? 54.877 35.975  6.240   1.00 16.61  ? 8    DG  T N9    1 
ATOM   337  C  C8    . DG  B 2 6   ? 54.670 35.264  7.397   1.00 13.67  ? 8    DG  T C8    1 
ATOM   338  N  N7    . DG  B 2 6   ? 53.550 35.569  7.993   1.00 16.27  ? 8    DG  T N7    1 
ATOM   339  C  C5    . DG  B 2 6   ? 52.984 36.549  7.188   1.00 15.24  ? 8    DG  T C5    1 
ATOM   340  C  C6    . DG  B 2 6   ? 51.764 37.275  7.329   1.00 16.33  ? 8    DG  T C6    1 
ATOM   341  O  O6    . DG  B 2 6   ? 50.915 37.199  8.230   1.00 14.07  ? 8    DG  T O6    1 
ATOM   342  N  N1    . DG  B 2 6   ? 51.578 38.169  6.280   1.00 17.14  ? 8    DG  T N1    1 
ATOM   343  C  C2    . DG  B 2 6   ? 52.455 38.351  5.239   1.00 12.39  ? 8    DG  T C2    1 
ATOM   344  N  N2    . DG  B 2 6   ? 52.107 39.261  4.324   1.00 18.57  ? 8    DG  T N2    1 
ATOM   345  N  N3    . DG  B 2 6   ? 53.590 37.692  5.102   1.00 15.73  ? 8    DG  T N3    1 
ATOM   346  C  C4    . DG  B 2 6   ? 53.790 36.813  6.102   1.00 18.61  ? 8    DG  T C4    1 
ATOM   347  P  P     . DC  B 2 7   ? 59.882 36.862  4.117   1.00 9.43   ? 9    DC  T P     1 
ATOM   348  O  OP1   . DC  B 2 7   ? 60.546 36.949  2.795   1.00 16.95  ? 9    DC  T OP1   1 
ATOM   349  O  OP2   . DC  B 2 7   ? 60.698 36.631  5.324   1.00 13.74  ? 9    DC  T OP2   1 
ATOM   350  O  "O5'" . DC  B 2 7   ? 59.035 38.191  4.333   1.00 13.70  ? 9    DC  T "O5'" 1 
ATOM   351  C  "C5'" . DC  B 2 7   ? 58.072 38.593  3.349   1.00 8.94   ? 9    DC  T "C5'" 1 
ATOM   352  C  "C4'" . DC  B 2 7   ? 57.362 39.852  3.785   1.00 14.80  ? 9    DC  T "C4'" 1 
ATOM   353  O  "O4'" . DC  B 2 7   ? 56.255 39.588  4.686   1.00 12.63  ? 9    DC  T "O4'" 1 
ATOM   354  C  "C3'" . DC  B 2 7   ? 58.254 40.875  4.485   1.00 13.32  ? 9    DC  T "C3'" 1 
ATOM   355  O  "O3'" . DC  B 2 7   ? 57.915 42.158  4.002   1.00 17.30  ? 9    DC  T "O3'" 1 
ATOM   356  C  "C2'" . DC  B 2 7   ? 57.804 40.789  5.932   1.00 18.35  ? 9    DC  T "C2'" 1 
ATOM   357  C  "C1'" . DC  B 2 7   ? 56.321 40.531  5.743   1.00 16.20  ? 9    DC  T "C1'" 1 
ATOM   358  N  N1    . DC  B 2 7   ? 55.596 39.985  6.907   1.00 15.74  ? 9    DC  T N1    1 
ATOM   359  C  C2    . DC  B 2 7   ? 54.260 40.365  7.106   1.00 13.88  ? 9    DC  T C2    1 
ATOM   360  O  O2    . DC  B 2 7   ? 53.727 41.144  6.303   1.00 15.52  ? 9    DC  T O2    1 
ATOM   361  N  N3    . DC  B 2 7   ? 53.585 39.879  8.170   1.00 17.34  ? 9    DC  T N3    1 
ATOM   362  C  C4    . DC  B 2 7   ? 54.188 39.045  9.020   1.00 17.58  ? 9    DC  T C4    1 
ATOM   363  N  N4    . DC  B 2 7   ? 53.474 38.588  10.056  1.00 10.81  ? 9    DC  T N4    1 
ATOM   364  C  C5    . DC  B 2 7   ? 55.547 38.642  8.845   1.00 13.71  ? 9    DC  T C5    1 
ATOM   365  C  C6    . DC  B 2 7   ? 56.206 39.129  7.784   1.00 16.08  ? 9    DC  T C6    1 
ATOM   366  P  P     . DA  B 2 8   ? 59.044 43.279  3.850   1.00 14.70  ? 10   DA  T P     1 
ATOM   367  O  OP1   . DA  B 2 8   ? 59.727 43.059  2.555   1.00 26.67  ? 10   DA  T OP1   1 
ATOM   368  O  OP2   . DA  B 2 8   ? 59.838 43.358  5.095   1.00 23.28  ? 10   DA  T OP2   1 
ATOM   369  O  "O5'" . DA  B 2 8   ? 58.150 44.579  3.723   1.00 23.34  ? 10   DA  T "O5'" 1 
ATOM   370  C  "C5'" . DA  B 2 8   ? 57.029 44.581  2.826   1.00 23.97  ? 10   DA  T "C5'" 1 
ATOM   371  C  "C4'" . DA  B 2 8   ? 55.958 45.511  3.335   1.00 23.28  ? 10   DA  T "C4'" 1 
ATOM   372  O  "O4'" . DA  B 2 8   ? 55.201 44.923  4.417   1.00 23.62  ? 10   DA  T "O4'" 1 
ATOM   373  C  "C3'" . DA  B 2 8   ? 56.513 46.822  3.870   1.00 22.16  ? 10   DA  T "C3'" 1 
ATOM   374  O  "O3'" . DA  B 2 8   ? 55.636 47.863  3.471   1.00 28.02  ? 10   DA  T "O3'" 1 
ATOM   375  C  "C2'" . DA  B 2 8   ? 56.491 46.623  5.376   1.00 20.89  ? 10   DA  T "C2'" 1 
ATOM   376  C  "C1'" . DA  B 2 8   ? 55.263 45.751  5.566   1.00 21.43  ? 10   DA  T "C1'" 1 
ATOM   377  N  N9    . DA  B 2 8   ? 55.305 44.877  6.737   1.00 18.45  ? 10   DA  T N9    1 
ATOM   378  C  C8    . DA  B 2 8   ? 56.263 43.944  7.061   1.00 15.56  ? 10   DA  T C8    1 
ATOM   379  N  N7    . DA  B 2 8   ? 56.011 43.291  8.169   1.00 18.17  ? 10   DA  T N7    1 
ATOM   380  C  C5    . DA  B 2 8   ? 54.808 43.830  8.606   1.00 14.69  ? 10   DA  T C5    1 
ATOM   381  C  C6    . DA  B 2 8   ? 54.005 43.558  9.727   1.00 17.47  ? 10   DA  T C6    1 
ATOM   382  N  N6    . DA  B 2 8   ? 54.294 42.615  10.628  1.00 14.41  ? 10   DA  T N6    1 
ATOM   383  N  N1    . DA  B 2 8   ? 52.879 44.290  9.887   1.00 13.68  ? 10   DA  T N1    1 
ATOM   384  C  C2    . DA  B 2 8   ? 52.584 45.218  8.963   1.00 22.59  ? 10   DA  T C2    1 
ATOM   385  N  N3    . DA  B 2 8   ? 53.253 45.554  7.860   1.00 15.17  ? 10   DA  T N3    1 
ATOM   386  C  C4    . DA  B 2 8   ? 54.368 44.815  7.740   1.00 15.07  ? 10   DA  T C4    1 
ATOM   387  P  P     . DC  B 2 9   ? 56.203 49.340  3.286   1.00 26.73  ? 11   DC  T P     1 
ATOM   388  O  OP1   . DC  B 2 9   ? 55.534 49.864  2.080   1.00 38.98  ? 11   DC  T OP1   1 
ATOM   389  O  OP2   . DC  B 2 9   ? 57.688 49.299  3.348   1.00 23.17  ? 11   DC  T OP2   1 
ATOM   390  O  "O5'" . DC  B 2 9   ? 55.634 50.086  4.571   1.00 26.44  ? 11   DC  T "O5'" 1 
ATOM   391  C  "C5'" . DC  B 2 9   ? 54.213 50.213  4.759   1.00 22.40  ? 11   DC  T "C5'" 1 
ATOM   392  C  "C4'" . DC  B 2 9   ? 53.899 50.688  6.158   1.00 16.81  ? 11   DC  T "C4'" 1 
ATOM   393  O  "O4'" . DC  B 2 9   ? 53.849 49.579  7.096   1.00 15.62  ? 11   DC  T "O4'" 1 
ATOM   394  C  "C3'" . DC  B 2 9   ? 54.884 51.715  6.726   1.00 18.33  ? 11   DC  T "C3'" 1 
ATOM   395  O  "O3'" . DC  B 2 9   ? 54.187 52.846  7.253   1.00 22.55  ? 11   DC  T "O3'" 1 
ATOM   396  C  "C2'" . DC  B 2 9   ? 55.564 50.958  7.851   1.00 18.67  ? 11   DC  T "C2'" 1 
ATOM   397  C  "C1'" . DC  B 2 9   ? 54.485 49.979  8.295   1.00 18.05  ? 11   DC  T "C1'" 1 
ATOM   398  N  N1    . DC  B 2 9   ? 55.030 48.782  8.974   1.00 13.71  ? 11   DC  T N1    1 
ATOM   399  C  C2    . DC  B 2 9   ? 54.292 48.169  9.998   1.00 13.39  ? 11   DC  T C2    1 
ATOM   400  O  O2    . DC  B 2 9   ? 53.159 48.595  10.270  1.00 15.90  ? 11   DC  T O2    1 
ATOM   401  N  N3    . DC  B 2 9   ? 54.835 47.121  10.670  1.00 15.60  ? 11   DC  T N3    1 
ATOM   402  C  C4    . DC  B 2 9   ? 56.053 46.680  10.346  1.00 17.41  ? 11   DC  T C4    1 
ATOM   403  N  N4    . DC  B 2 9   ? 56.568 45.665  11.049  1.00 17.39  ? 11   DC  T N4    1 
ATOM   404  C  C5    . DC  B 2 9   ? 56.807 47.264  9.286   1.00 20.28  ? 11   DC  T C5    1 
ATOM   405  C  C6    . DC  B 2 9   ? 56.262 48.297  8.632   1.00 18.53  ? 11   DC  T C6    1 
ATOM   406  P  P     . DT  B 2 10  ? 55.003 54.150  7.754   1.00 17.17  ? 12   DT  T P     1 
ATOM   407  O  OP1   . DT  B 2 10  ? 54.605 55.309  6.922   1.00 20.95  ? 12   DT  T OP1   1 
ATOM   408  O  OP2   . DT  B 2 10  ? 56.441 53.839  7.928   1.00 17.55  ? 12   DT  T OP2   1 
ATOM   409  O  "O5'" . DT  B 2 10  ? 54.350 54.373  9.184   1.00 23.57  ? 12   DT  T "O5'" 1 
ATOM   410  C  "C5'" . DT  B 2 10  ? 52.931 54.217  9.337   1.00 14.48  ? 12   DT  T "C5'" 1 
ATOM   411  C  "C4'" . DT  B 2 10  ? 52.560 54.039  10.788  1.00 17.43  ? 12   DT  T "C4'" 1 
ATOM   412  O  "O4'" . DT  B 2 10  ? 52.991 52.749  11.282  1.00 16.62  ? 12   DT  T "O4'" 1 
ATOM   413  C  "C3'" . DT  B 2 10  ? 53.148 55.085  11.730  1.00 15.97  ? 12   DT  T "C3'" 1 
ATOM   414  O  "O3'" . DT  B 2 10  ? 52.129 55.504  12.634  1.00 25.94  ? 12   DT  T "O3'" 1 
ATOM   415  C  "C2'" . DT  B 2 10  ? 54.259 54.334  12.445  1.00 19.47  ? 12   DT  T "C2'" 1 
ATOM   416  C  "C1'" . DT  B 2 10  ? 53.721 52.915  12.485  1.00 18.07  ? 12   DT  T "C1'" 1 
ATOM   417  N  N1    . DT  B 2 10  ? 54.743 51.852  12.535  1.00 18.42  ? 12   DT  T N1    1 
ATOM   418  C  C2    . DT  B 2 10  ? 54.606 50.854  13.483  1.00 24.41  ? 12   DT  T C2    1 
ATOM   419  O  O2    . DT  B 2 10  ? 53.695 50.820  14.297  1.00 18.84  ? 12   DT  T O2    1 
ATOM   420  N  N3    . DT  B 2 10  ? 55.585 49.887  13.440  1.00 15.41  ? 12   DT  T N3    1 
ATOM   421  C  C4    . DT  B 2 10  ? 56.658 49.822  12.570  1.00 19.98  ? 12   DT  T C4    1 
ATOM   422  O  O4    . DT  B 2 10  ? 57.449 48.884  12.644  1.00 27.45  ? 12   DT  T O4    1 
ATOM   423  C  C5    . DT  B 2 10  ? 56.746 50.908  11.615  1.00 16.93  ? 12   DT  T C5    1 
ATOM   424  C  C7    . DT  B 2 10  ? 57.880 50.928  10.641  1.00 12.78  ? 12   DT  T C7    1 
ATOM   425  C  C6    . DT  B 2 10  ? 55.799 51.854  11.647  1.00 18.62  ? 12   DT  T C6    1 
ATOM   426  P  P     . DG  B 2 11  ? 52.312 56.861  13.469  1.00 25.70  ? 13   DG  T P     1 
ATOM   427  O  OP1   . DG  B 2 11  ? 50.958 57.391  13.771  1.00 17.76  ? 13   DG  T OP1   1 
ATOM   428  O  OP2   . DG  B 2 11  ? 53.301 57.726  12.792  1.00 15.65  ? 13   DG  T OP2   1 
ATOM   429  O  "O5'" . DG  B 2 11  ? 52.971 56.339  14.817  1.00 23.16  ? 13   DG  T "O5'" 1 
ATOM   430  C  "C5'" . DG  B 2 11  ? 52.220 55.514  15.715  1.00 16.59  ? 13   DG  T "C5'" 1 
ATOM   431  C  "C4'" . DG  B 2 11  ? 53.109 55.025  16.830  1.00 17.99  ? 13   DG  T "C4'" 1 
ATOM   432  O  "O4'" . DG  B 2 11  ? 53.983 53.969  16.375  1.00 19.05  ? 13   DG  T "O4'" 1 
ATOM   433  C  "C3'" . DG  B 2 11  ? 54.026 56.090  17.433  1.00 23.24  ? 13   DG  T "C3'" 1 
ATOM   434  O  "O3'" . DG  B 2 11  ? 54.137 55.816  18.823  1.00 31.06  ? 13   DG  T "O3'" 1 
ATOM   435  C  "C2'" . DG  B 2 11  ? 55.365 55.788  16.787  1.00 20.35  ? 13   DG  T "C2'" 1 
ATOM   436  C  "C1'" . DG  B 2 11  ? 55.289 54.281  16.809  1.00 21.71  ? 13   DG  T "C1'" 1 
ATOM   437  N  N9    . DG  B 2 11  ? 56.235 53.537  15.993  1.00 17.93  ? 13   DG  T N9    1 
ATOM   438  C  C8    . DG  B 2 11  ? 56.826 53.916  14.813  1.00 22.26  ? 13   DG  T C8    1 
ATOM   439  N  N7    . DG  B 2 11  ? 57.656 53.020  14.349  1.00 22.64  ? 13   DG  T N7    1 
ATOM   440  C  C5    . DG  B 2 11  ? 57.599 51.986  15.277  1.00 20.56  ? 13   DG  T C5    1 
ATOM   441  C  C6    . DG  B 2 11  ? 58.284 50.732  15.320  1.00 24.55  ? 13   DG  T C6    1 
ATOM   442  O  O6    . DG  B 2 11  ? 59.102 50.269  14.511  1.00 18.91  ? 13   DG  T O6    1 
ATOM   443  N  N1    . DG  B 2 11  ? 57.930 49.994  16.448  1.00 22.94  ? 13   DG  T N1    1 
ATOM   444  C  C2    . DG  B 2 11  ? 57.030 50.401  17.408  1.00 18.04  ? 13   DG  T C2    1 
ATOM   445  N  N2    . DG  B 2 11  ? 56.814 49.553  18.424  1.00 14.57  ? 13   DG  T N2    1 
ATOM   446  N  N3    . DG  B 2 11  ? 56.388 51.555  17.375  1.00 20.79  ? 13   DG  T N3    1 
ATOM   447  C  C4    . DG  B 2 11  ? 56.723 52.291  16.293  1.00 19.29  ? 13   DG  T C4    1 
ATOM   448  P  P     . DG  B 2 12  ? 54.629 56.955  19.829  1.00 33.13  ? 14   DG  T P     1 
ATOM   449  O  OP1   . DG  B 2 12  ? 53.400 57.601  20.355  1.00 26.73  ? 14   DG  T OP1   1 
ATOM   450  O  OP2   . DG  B 2 12  ? 55.693 57.782  19.197  1.00 28.15  ? 14   DG  T OP2   1 
ATOM   451  O  "O5'" . DG  B 2 12  ? 55.337 56.121  20.984  1.00 31.96  ? 14   DG  T "O5'" 1 
ATOM   452  C  "C5'" . DG  B 2 12  ? 54.652 55.046  21.652  1.00 28.14  ? 14   DG  T "C5'" 1 
ATOM   453  C  "C4'" . DG  B 2 12  ? 55.651 54.178  22.380  1.00 26.53  ? 14   DG  T "C4'" 1 
ATOM   454  O  "O4'" . DG  B 2 12  ? 56.348 53.327  21.432  1.00 29.36  ? 14   DG  T "O4'" 1 
ATOM   455  C  "C3'" . DG  B 2 12  ? 56.731 54.984  23.109  1.00 27.74  ? 14   DG  T "C3'" 1 
ATOM   456  O  "O3'" . DG  B 2 12  ? 57.039 54.403  24.383  1.00 41.09  ? 14   DG  T "O3'" 1 
ATOM   457  C  "C2'" . DG  B 2 12  ? 57.932 54.876  22.187  1.00 27.89  ? 14   DG  T "C2'" 1 
ATOM   458  C  "C1'" . DG  B 2 12  ? 57.751 53.490  21.589  1.00 23.51  ? 14   DG  T "C1'" 1 
ATOM   459  N  N9    . DG  B 2 12  ? 58.380 53.354  20.280  1.00 23.05  ? 14   DG  T N9    1 
ATOM   460  C  C8    . DG  B 2 12  ? 58.299 54.237  19.231  1.00 19.04  ? 14   DG  T C8    1 
ATOM   461  N  N7    . DG  B 2 12  ? 59.009 53.875  18.200  1.00 25.55  ? 14   DG  T N7    1 
ATOM   462  C  C5    . DG  B 2 12  ? 59.589 52.672  18.582  1.00 23.43  ? 14   DG  T C5    1 
ATOM   463  C  C6    . DG  B 2 12  ? 60.474 51.805  17.876  1.00 24.81  ? 14   DG  T C6    1 
ATOM   464  O  O6    . DG  B 2 12  ? 60.942 51.942  16.736  1.00 34.16  ? 14   DG  T O6    1 
ATOM   465  N  N1    . DG  B 2 12  ? 60.815 50.687  18.633  1.00 21.66  ? 14   DG  T N1    1 
ATOM   466  C  C2    . DG  B 2 12  ? 60.366 50.434  19.909  1.00 24.53  ? 14   DG  T C2    1 
ATOM   467  N  N2    . DG  B 2 12  ? 60.815 49.300  20.480  1.00 26.22  ? 14   DG  T N2    1 
ATOM   468  N  N3    . DG  B 2 12  ? 59.543 51.233  20.580  1.00 23.53  ? 14   DG  T N3    1 
ATOM   469  C  C4    . DG  B 2 12  ? 59.200 52.327  19.861  1.00 26.49  ? 14   DG  T C4    1 
ATOM   470  P  P     . DC  B 2 13  ? 58.213 55.038  25.291  1.00 44.30  ? 15   DC  T P     1 
ATOM   471  O  OP1   . DC  B 2 13  ? 57.764 54.897  26.704  1.00 44.03  ? 15   DC  T OP1   1 
ATOM   472  O  OP2   . DC  B 2 13  ? 58.588 56.384  24.768  1.00 35.89  ? 15   DC  T OP2   1 
ATOM   473  O  "O5'" . DC  B 2 13  ? 59.455 54.070  25.035  1.00 29.71  ? 15   DC  T "O5'" 1 
ATOM   474  C  "C5'" . DC  B 2 13  ? 59.470 52.736  25.588  1.00 30.86  ? 15   DC  T "C5'" 1 
ATOM   475  C  "C4'" . DC  B 2 13  ? 60.876 52.181  25.574  1.00 31.11  ? 15   DC  T "C4'" 1 
ATOM   476  O  "O4'" . DC  B 2 13  ? 61.263 51.995  24.192  1.00 37.13  ? 15   DC  T "O4'" 1 
ATOM   477  C  "C3'" . DC  B 2 13  ? 61.934 53.098  26.201  1.00 33.47  ? 15   DC  T "C3'" 1 
ATOM   478  O  "O3'" . DC  B 2 13  ? 62.931 52.349  26.912  1.00 36.71  ? 15   DC  T "O3'" 1 
ATOM   479  C  "C2'" . DC  B 2 13  ? 62.565 53.776  25.000  1.00 32.48  ? 15   DC  T "C2'" 1 
ATOM   480  C  "C1'" . DC  B 2 13  ? 62.467 52.699  23.930  1.00 36.55  ? 15   DC  T "C1'" 1 
ATOM   481  N  N1    . DC  B 2 13  ? 62.399 53.220  22.553  1.00 28.42  ? 15   DC  T N1    1 
ATOM   482  C  C2    . DC  B 2 13  ? 63.074 52.530  21.531  1.00 28.56  ? 15   DC  T C2    1 
ATOM   483  O  O2    . DC  B 2 13  ? 63.679 51.475  21.806  1.00 30.83  ? 15   DC  T O2    1 
ATOM   484  N  N3    . DC  B 2 13  ? 63.051 53.027  20.271  1.00 28.07  ? 15   DC  T N3    1 
ATOM   485  C  C4    . DC  B 2 13  ? 62.385 54.155  20.013  1.00 31.82  ? 15   DC  T C4    1 
ATOM   486  N  N4    . DC  B 2 13  ? 62.408 54.620  18.756  1.00 27.59  ? 15   DC  T N4    1 
ATOM   487  C  C5    . DC  B 2 13  ? 61.672 54.864  21.030  1.00 31.25  ? 15   DC  T C5    1 
ATOM   488  C  C6    . DC  B 2 13  ? 61.705 54.364  22.271  1.00 25.47  ? 15   DC  T C6    1 
ATOM   489  N  N     . MET C 3 1   ? 80.280 5.615   7.397   1.00 10.60  ? 1    MET A N     1 
ATOM   490  C  CA    . MET C 3 1   ? 79.687 6.921   7.645   1.00 11.85  ? 1    MET A CA    1 
ATOM   491  C  C     . MET C 3 1   ? 80.709 7.942   8.137   1.00 12.21  ? 1    MET A C     1 
ATOM   492  O  O     . MET C 3 1   ? 81.549 7.644   8.988   1.00 14.36  ? 1    MET A O     1 
ATOM   493  C  CB    . MET C 3 1   ? 78.544 6.808   8.671   1.00 13.00  ? 1    MET A CB    1 
ATOM   494  C  CG    . MET C 3 1   ? 77.810 8.138   8.945   1.00 20.28  ? 1    MET A CG    1 
ATOM   495  S  SD    . MET C 3 1   ? 76.466 8.162   10.183  1.00 29.57  ? 1    MET A SD    1 
ATOM   496  C  CE    . MET C 3 1   ? 75.039 7.898   9.179   1.00 11.50  ? 1    MET A CE    1 
ATOM   497  N  N     . ILE C 3 2   ? 80.634 9.148   7.580   1.00 11.25  ? 2    ILE A N     1 
ATOM   498  C  CA    . ILE C 3 2   ? 81.515 10.245  7.973   1.00 9.13   ? 2    ILE A CA    1 
ATOM   499  C  C     . ILE C 3 2   ? 80.665 11.493  8.201   1.00 10.24  ? 2    ILE A C     1 
ATOM   500  O  O     . ILE C 3 2   ? 79.578 11.621  7.643   1.00 10.80  ? 2    ILE A O     1 
ATOM   501  C  CB    . ILE C 3 2   ? 82.608 10.562  6.901   1.00 13.97  ? 2    ILE A CB    1 
ATOM   502  C  CG1   . ILE C 3 2   ? 81.979 11.067  5.597   1.00 6.69   ? 2    ILE A CG1   1 
ATOM   503  C  CG2   . ILE C 3 2   ? 83.484 9.325   6.647   1.00 7.14   ? 2    ILE A CG2   1 
ATOM   504  C  CD1   . ILE C 3 2   ? 83.013 11.411  4.533   1.00 3.87   ? 2    ILE A CD1   1 
ATOM   505  N  N     . VAL C 3 3   ? 81.131 12.376  9.074   1.00 15.77  ? 3    VAL A N     1 
ATOM   506  C  CA    . VAL C 3 3   ? 80.427 13.624  9.364   1.00 11.74  ? 3    VAL A CA    1 
ATOM   507  C  C     . VAL C 3 3   ? 81.420 14.696  8.907   1.00 13.90  ? 3    VAL A C     1 
ATOM   508  O  O     . VAL C 3 3   ? 82.596 14.644  9.248   1.00 6.27   ? 3    VAL A O     1 
ATOM   509  C  CB    . VAL C 3 3   ? 80.104 13.756  10.871  1.00 14.70  ? 3    VAL A CB    1 
ATOM   510  C  CG1   . VAL C 3 3   ? 79.210 14.963  11.121  1.00 2.23   ? 3    VAL A CG1   1 
ATOM   511  C  CG2   . VAL C 3 3   ? 79.419 12.490  11.366  1.00 5.60   ? 3    VAL A CG2   1 
ATOM   512  N  N     . SER C 3 4   ? 80.954 15.673  8.137   1.00 13.48  ? 4    SER A N     1 
ATOM   513  C  CA    . SER C 3 4   ? 81.859 16.693  7.625   1.00 14.84  ? 4    SER A CA    1 
ATOM   514  C  C     . SER C 3 4   ? 81.272 18.104  7.549   1.00 10.09  ? 4    SER A C     1 
ATOM   515  O  O     . SER C 3 4   ? 80.066 18.310  7.704   1.00 4.02   ? 4    SER A O     1 
ATOM   516  C  CB    . SER C 3 4   ? 82.365 16.232  6.246   1.00 9.11   ? 4    SER A CB    1 
ATOM   517  O  OG    . SER C 3 4   ? 83.330 17.109  5.704   1.00 7.45   ? 4    SER A OG    1 
ATOM   518  N  N     . ASP C 3 5   ? 82.149 19.071  7.296   1.00 11.08  ? 5    ASP A N     1 
ATOM   519  C  CA    . ASP C 3 5   ? 81.765 20.474  7.191   1.00 11.25  ? 5    ASP A CA    1 
ATOM   520  C  C     . ASP C 3 5   ? 82.881 21.273  6.522   1.00 10.71  ? 5    ASP A C     1 
ATOM   521  O  O     . ASP C 3 5   ? 84.056 20.964  6.687   1.00 9.05   ? 5    ASP A O     1 
ATOM   522  C  CB    . ASP C 3 5   ? 81.493 21.041  8.587   1.00 14.80  ? 5    ASP A CB    1 
ATOM   523  C  CG    . ASP C 3 5   ? 81.054 22.489  8.556   1.00 18.47  ? 5    ASP A CG    1 
ATOM   524  O  OD1   . ASP C 3 5   ? 80.032 22.788  7.902   1.00 15.49  ? 5    ASP A OD1   1 
ATOM   525  O  OD2   . ASP C 3 5   ? 81.738 23.328  9.184   1.00 17.27  ? 5    ASP A OD2   1 
ATOM   526  N  N     . ILE C 3 6   ? 82.515 22.303  5.766   1.00 11.87  ? 6    ILE A N     1 
ATOM   527  C  CA    . ILE C 3 6   ? 83.529 23.122  5.108   1.00 11.81  ? 6    ILE A CA    1 
ATOM   528  C  C     . ILE C 3 6   ? 83.393 24.587  5.490   1.00 12.66  ? 6    ILE A C     1 
ATOM   529  O  O     . ILE C 3 6   ? 82.355 25.023  5.991   1.00 14.01  ? 6    ILE A O     1 
ATOM   530  C  CB    . ILE C 3 6   ? 83.469 23.042  3.538   1.00 11.26  ? 6    ILE A CB    1 
ATOM   531  C  CG1   . ILE C 3 6   ? 82.291 23.858  2.995   1.00 8.25   ? 6    ILE A CG1   1 
ATOM   532  C  CG2   . ILE C 3 6   ? 83.372 21.601  3.083   1.00 9.43   ? 6    ILE A CG2   1 
ATOM   533  C  CD1   . ILE C 3 6   ? 82.262 23.980  1.493   1.00 9.66   ? 6    ILE A CD1   1 
ATOM   534  N  N     . GLU C 3 7   ? 84.459 25.335  5.245   1.00 12.04  ? 7    GLU A N     1 
ATOM   535  C  CA    . GLU C 3 7   ? 84.492 26.764  5.494   1.00 12.89  ? 7    GLU A CA    1 
ATOM   536  C  C     . GLU C 3 7   ? 84.973 27.315  4.151   1.00 13.16  ? 7    GLU A C     1 
ATOM   537  O  O     . GLU C 3 7   ? 85.955 26.820  3.588   1.00 12.84  ? 7    GLU A O     1 
ATOM   538  C  CB    . GLU C 3 7   ? 85.502 27.118  6.590   1.00 20.71  ? 7    GLU A CB    1 
ATOM   539  C  CG    . GLU C 3 7   ? 85.255 26.476  7.957   1.00 25.12  ? 7    GLU A CG    1 
ATOM   540  C  CD    . GLU C 3 7   ? 84.063 27.044  8.719   1.00 20.50  ? 7    GLU A CD    1 
ATOM   541  O  OE1   . GLU C 3 7   ? 83.357 27.933  8.199   1.00 18.93  ? 7    GLU A OE1   1 
ATOM   542  O  OE2   . GLU C 3 7   ? 83.836 26.597  9.862   1.00 25.85  ? 7    GLU A OE2   1 
ATOM   543  N  N     . ALA C 3 8   ? 84.250 28.291  3.614   1.00 14.61  ? 8    ALA A N     1 
ATOM   544  C  CA    . ALA C 3 8   ? 84.607 28.899  2.337   1.00 16.53  ? 8    ALA A CA    1 
ATOM   545  C  C     . ALA C 3 8   ? 84.467 30.424  2.436   1.00 18.00  ? 8    ALA A C     1 
ATOM   546  O  O     . ALA C 3 8   ? 83.903 30.936  3.413   1.00 13.37  ? 8    ALA A O     1 
ATOM   547  C  CB    . ALA C 3 8   ? 83.731 28.329  1.215   1.00 11.28  ? 8    ALA A CB    1 
ATOM   548  N  N     . ASN C 3 9   ? 84.941 31.139  1.414   1.00 15.24  ? 9    ASN A N     1 
ATOM   549  C  CA    . ASN C 3 9   ? 84.908 32.605  1.410   1.00 15.16  ? 9    ASN A CA    1 
ATOM   550  C  C     . ASN C 3 9   ? 83.601 33.375  1.204   1.00 13.15  ? 9    ASN A C     1 
ATOM   551  O  O     . ASN C 3 9   ? 83.587 34.597  1.339   1.00 17.31  ? 9    ASN A O     1 
ATOM   552  C  CB    . ASN C 3 9   ? 85.983 33.155  0.465   1.00 11.97  ? 9    ASN A CB    1 
ATOM   553  C  CG    . ASN C 3 9   ? 85.660 32.934  -1.000  1.00 8.58   ? 9    ASN A CG    1 
ATOM   554  O  OD1   . ASN C 3 9   ? 84.798 32.136  -1.355  1.00 16.24  ? 9    ASN A OD1   1 
ATOM   555  N  ND2   . ASN C 3 9   ? 86.365 33.647  -1.860  1.00 7.69   ? 9    ASN A ND2   1 
ATOM   556  N  N     . ALA C 3 10  ? 82.508 32.687  0.888   1.00 13.33  ? 10   ALA A N     1 
ATOM   557  C  CA    . ALA C 3 10  ? 81.233 33.379  0.689   1.00 10.28  ? 10   ALA A CA    1 
ATOM   558  C  C     . ALA C 3 10  ? 80.063 32.427  0.560   1.00 8.83   ? 10   ALA A C     1 
ATOM   559  O  O     . ALA C 3 10  ? 80.235 31.212  0.595   1.00 14.24  ? 10   ALA A O     1 
ATOM   560  C  CB    . ALA C 3 10  ? 81.309 34.268  -0.553  1.00 13.83  ? 10   ALA A CB    1 
ATOM   561  N  N     . LEU C 3 11  ? 78.867 32.991  0.415   1.00 7.94   ? 11   LEU A N     1 
ATOM   562  C  CA    . LEU C 3 11  ? 77.657 32.196  0.239   1.00 12.57  ? 11   LEU A CA    1 
ATOM   563  C  C     . LEU C 3 11  ? 77.777 31.520  -1.130  1.00 17.60  ? 11   LEU A C     1 
ATOM   564  O  O     . LEU C 3 11  ? 78.599 31.934  -1.955  1.00 18.61  ? 11   LEU A O     1 
ATOM   565  C  CB    . LEU C 3 11  ? 76.418 33.090  0.279   1.00 16.66  ? 11   LEU A CB    1 
ATOM   566  C  CG    . LEU C 3 11  ? 76.129 33.824  1.595   1.00 24.83  ? 11   LEU A CG    1 
ATOM   567  C  CD1   . LEU C 3 11  ? 74.951 34.772  1.409   1.00 23.37  ? 11   LEU A CD1   1 
ATOM   568  C  CD2   . LEU C 3 11  ? 75.849 32.814  2.705   1.00 27.55  ? 11   LEU A CD2   1 
ATOM   569  N  N     . LEU C 3 12  ? 76.952 30.505  -1.378  1.00 19.19  ? 12   LEU A N     1 
ATOM   570  C  CA    . LEU C 3 12  ? 76.988 29.759  -2.642  1.00 20.33  ? 12   LEU A CA    1 
ATOM   571  C  C     . LEU C 3 12  ? 76.993 30.597  -3.926  1.00 20.58  ? 12   LEU A C     1 
ATOM   572  O  O     . LEU C 3 12  ? 77.756 30.311  -4.853  1.00 15.86  ? 12   LEU A O     1 
ATOM   573  C  CB    . LEU C 3 12  ? 75.826 28.761  -2.690  1.00 10.66  ? 12   LEU A CB    1 
ATOM   574  C  CG    . LEU C 3 12  ? 75.720 27.860  -3.925  1.00 15.43  ? 12   LEU A CG    1 
ATOM   575  C  CD1   . LEU C 3 12  ? 76.981 27.018  -4.076  1.00 5.73   ? 12   LEU A CD1   1 
ATOM   576  C  CD2   . LEU C 3 12  ? 74.491 26.972  -3.800  1.00 12.32  ? 12   LEU A CD2   1 
ATOM   577  N  N     . GLU C 3 13  ? 76.161 31.636  -3.954  1.00 22.32  ? 13   GLU A N     1 
ATOM   578  C  CA    . GLU C 3 13  ? 76.021 32.525  -5.110  1.00 26.56  ? 13   GLU A CA    1 
ATOM   579  C  C     . GLU C 3 13  ? 77.333 33.103  -5.623  1.00 26.16  ? 13   GLU A C     1 
ATOM   580  O  O     . GLU C 3 13  ? 77.518 33.252  -6.831  1.00 26.23  ? 13   GLU A O     1 
ATOM   581  C  CB    . GLU C 3 13  ? 75.074 33.697  -4.797  1.00 33.39  ? 13   GLU A CB    1 
ATOM   582  C  CG    . GLU C 3 13  ? 73.689 33.319  -4.249  1.00 50.56  ? 13   GLU A CG    1 
ATOM   583  C  CD    . GLU C 3 13  ? 73.678 33.035  -2.742  1.00 60.53  ? 13   GLU A CD    1 
ATOM   584  O  OE1   . GLU C 3 13  ? 73.693 34.007  -1.951  1.00 60.62  ? 13   GLU A OE1   1 
ATOM   585  O  OE2   . GLU C 3 13  ? 73.644 31.845  -2.351  1.00 50.53  ? 13   GLU A OE2   1 
ATOM   586  N  N     . SER C 3 14  ? 78.251 33.405  -4.709  1.00 26.45  ? 14   SER A N     1 
ATOM   587  C  CA    . SER C 3 14  ? 79.524 33.991  -5.093  1.00 27.14  ? 14   SER A CA    1 
ATOM   588  C  C     . SER C 3 14  ? 80.767 33.370  -4.469  1.00 25.32  ? 14   SER A C     1 
ATOM   589  O  O     . SER C 3 14  ? 81.832 33.992  -4.464  1.00 28.54  ? 14   SER A O     1 
ATOM   590  C  CB    . SER C 3 14  ? 79.494 35.499  -4.819  1.00 30.75  ? 14   SER A CB    1 
ATOM   591  O  OG    . SER C 3 14  ? 79.130 35.770  -3.478  1.00 32.53  ? 14   SER A OG    1 
ATOM   592  N  N     . VAL C 3 15  ? 80.651 32.143  -3.970  1.00 18.07  ? 15   VAL A N     1 
ATOM   593  C  CA    . VAL C 3 15  ? 81.802 31.471  -3.364  1.00 17.41  ? 15   VAL A CA    1 
ATOM   594  C  C     . VAL C 3 15  ? 82.871 31.151  -4.442  1.00 15.21  ? 15   VAL A C     1 
ATOM   595  O  O     . VAL C 3 15  ? 82.537 30.704  -5.536  1.00 17.91  ? 15   VAL A O     1 
ATOM   596  C  CB    . VAL C 3 15  ? 81.350 30.185  -2.565  1.00 13.23  ? 15   VAL A CB    1 
ATOM   597  C  CG1   . VAL C 3 15  ? 80.926 29.043  -3.509  1.00 12.40  ? 15   VAL A CG1   1 
ATOM   598  C  CG2   . VAL C 3 15  ? 82.439 29.747  -1.610  1.00 7.78   ? 15   VAL A CG2   1 
ATOM   599  N  N     . THR C 3 16  ? 84.138 31.447  -4.148  1.00 17.19  ? 16   THR A N     1 
ATOM   600  C  CA    . THR C 3 16  ? 85.245 31.201  -5.084  1.00 14.55  ? 16   THR A CA    1 
ATOM   601  C  C     . THR C 3 16  ? 86.477 30.561  -4.429  1.00 16.36  ? 16   THR A C     1 
ATOM   602  O  O     . THR C 3 16  ? 87.471 30.284  -5.111  1.00 12.19  ? 16   THR A O     1 
ATOM   603  C  CB    . THR C 3 16  ? 85.713 32.509  -5.802  1.00 11.84  ? 16   THR A CB    1 
ATOM   604  O  OG1   . THR C 3 16  ? 86.236 33.431  -4.841  1.00 16.81  ? 16   THR A OG1   1 
ATOM   605  C  CG2   . THR C 3 16  ? 84.561 33.176  -6.543  1.00 2.80   ? 16   THR A CG2   1 
ATOM   606  N  N     . LYS C 3 17  ? 86.410 30.332  -3.116  1.00 13.81  ? 17   LYS A N     1 
ATOM   607  C  CA    . LYS C 3 17  ? 87.521 29.730  -2.380  1.00 15.49  ? 17   LYS A CA    1 
ATOM   608  C  C     . LYS C 3 17  ? 87.153 28.847  -1.197  1.00 12.16  ? 17   LYS A C     1 
ATOM   609  O  O     . LYS C 3 17  ? 86.408 29.247  -0.306  1.00 8.18   ? 17   LYS A O     1 
ATOM   610  C  CB    . LYS C 3 17  ? 88.497 30.799  -1.869  1.00 20.28  ? 17   LYS A CB    1 
ATOM   611  C  CG    . LYS C 3 17  ? 89.664 31.126  -2.783  1.00 29.32  ? 17   LYS A CG    1 
ATOM   612  C  CD    . LYS C 3 17  ? 90.675 32.010  -2.050  1.00 34.44  ? 17   LYS A CD    1 
ATOM   613  C  CE    . LYS C 3 17  ? 91.950 32.206  -2.860  1.00 38.77  ? 17   LYS A CE    1 
ATOM   614  N  NZ    . LYS C 3 17  ? 92.635 30.909  -3.167  1.00 40.20  ? 17   LYS A NZ    1 
ATOM   615  N  N     . PHE C 3 18  ? 87.716 27.643  -1.209  1.00 13.38  ? 18   PHE A N     1 
ATOM   616  C  CA    . PHE C 3 18  ? 87.546 26.659  -0.152  1.00 9.42   ? 18   PHE A CA    1 
ATOM   617  C  C     . PHE C 3 18  ? 88.660 27.023  0.826   1.00 10.17  ? 18   PHE A C     1 
ATOM   618  O  O     . PHE C 3 18  ? 89.825 27.159  0.432   1.00 6.43   ? 18   PHE A O     1 
ATOM   619  C  CB    . PHE C 3 18  ? 87.760 25.252  -0.723  1.00 11.01  ? 18   PHE A CB    1 
ATOM   620  C  CG    . PHE C 3 18  ? 87.982 24.175  0.318   1.00 9.64   ? 18   PHE A CG    1 
ATOM   621  C  CD1   . PHE C 3 18  ? 86.909 23.499  0.886   1.00 11.46  ? 18   PHE A CD1   1 
ATOM   622  C  CD2   . PHE C 3 18  ? 89.274 23.799  0.688   1.00 10.65  ? 18   PHE A CD2   1 
ATOM   623  C  CE1   . PHE C 3 18  ? 87.116 22.460  1.801   1.00 8.20   ? 18   PHE A CE1   1 
ATOM   624  C  CE2   . PHE C 3 18  ? 89.488 22.758  1.605   1.00 6.83   ? 18   PHE A CE2   1 
ATOM   625  C  CZ    . PHE C 3 18  ? 88.411 22.091  2.156   1.00 5.34   ? 18   PHE A CZ    1 
ATOM   626  N  N     . HIS C 3 19  ? 88.291 27.249  2.081   1.00 10.55  ? 19   HIS A N     1 
ATOM   627  C  CA    . HIS C 3 19  ? 89.265 27.600  3.105   1.00 6.55   ? 19   HIS A CA    1 
ATOM   628  C  C     . HIS C 3 19  ? 89.720 26.380  3.876   1.00 6.67   ? 19   HIS A C     1 
ATOM   629  O  O     . HIS C 3 19  ? 90.910 26.150  4.019   1.00 10.62  ? 19   HIS A O     1 
ATOM   630  C  CB    . HIS C 3 19  ? 88.698 28.653  4.067   1.00 11.83  ? 19   HIS A CB    1 
ATOM   631  C  CG    . HIS C 3 19  ? 88.627 30.031  3.482   1.00 13.99  ? 19   HIS A CG    1 
ATOM   632  N  ND1   . HIS C 3 19  ? 89.586 30.520  2.621   1.00 19.33  ? 19   HIS A ND1   1 
ATOM   633  C  CD2   . HIS C 3 19  ? 87.720 31.022  3.634   1.00 14.06  ? 19   HIS A CD2   1 
ATOM   634  C  CE1   . HIS C 3 19  ? 89.274 31.751  2.265   1.00 15.89  ? 19   HIS A CE1   1 
ATOM   635  N  NE2   . HIS C 3 19  ? 88.144 32.081  2.867   1.00 16.88  ? 19   HIS A NE2   1 
ATOM   636  N  N     . CYS C 3 20  ? 88.770 25.593  4.364   1.00 11.01  ? 20   CYS A N     1 
ATOM   637  C  CA    . CYS C 3 20  ? 89.101 24.396  5.122   1.00 15.02  ? 20   CYS A CA    1 
ATOM   638  C  C     . CYS C 3 20  ? 87.906 23.462  5.270   1.00 13.63  ? 20   CYS A C     1 
ATOM   639  O  O     . CYS C 3 20  ? 86.771 23.833  4.977   1.00 8.57   ? 20   CYS A O     1 
ATOM   640  C  CB    . CYS C 3 20  ? 89.648 24.775  6.507   1.00 11.15  ? 20   CYS A CB    1 
ATOM   641  S  SG    . CYS C 3 20  ? 88.500 25.689  7.526   1.00 11.16  ? 20   CYS A SG    1 
ATOM   642  N  N     . GLY C 3 21  ? 88.180 22.239  5.712   1.00 12.15  ? 21   GLY A N     1 
ATOM   643  C  CA    . GLY C 3 21  ? 87.133 21.255  5.899   1.00 7.17   ? 21   GLY A CA    1 
ATOM   644  C  C     . GLY C 3 21  ? 87.560 20.269  6.961   1.00 10.36  ? 21   GLY A C     1 
ATOM   645  O  O     . GLY C 3 21  ? 88.741 20.149  7.261   1.00 12.22  ? 21   GLY A O     1 
ATOM   646  N  N     . VAL C 3 22  ? 86.598 19.579  7.555   1.00 13.44  ? 22   VAL A N     1 
ATOM   647  C  CA    . VAL C 3 22  ? 86.898 18.601  8.592   1.00 14.24  ? 22   VAL A CA    1 
ATOM   648  C  C     . VAL C 3 22  ? 86.048 17.380  8.341   1.00 11.84  ? 22   VAL A C     1 
ATOM   649  O  O     . VAL C 3 22  ? 84.901 17.495  7.921   1.00 8.08   ? 22   VAL A O     1 
ATOM   650  C  CB    . VAL C 3 22  ? 86.576 19.137  10.015  1.00 10.73  ? 22   VAL A CB    1 
ATOM   651  C  CG1   . VAL C 3 22  ? 86.673 18.016  11.049  1.00 6.63   ? 22   VAL A CG1   1 
ATOM   652  C  CG2   . VAL C 3 22  ? 87.534 20.252  10.377  1.00 10.77  ? 22   VAL A CG2   1 
ATOM   653  N  N     . ILE C 3 23  ? 86.627 16.212  8.598   1.00 18.74  ? 23   ILE A N     1 
ATOM   654  C  CA    . ILE C 3 23  ? 85.933 14.951  8.420   1.00 16.91  ? 23   ILE A CA    1 
ATOM   655  C  C     . ILE C 3 23  ? 86.123 14.067  9.642   1.00 18.98  ? 23   ILE A C     1 
ATOM   656  O  O     . ILE C 3 23  ? 87.243 13.893  10.130  1.00 11.75  ? 23   ILE A O     1 
ATOM   657  C  CB    . ILE C 3 23  ? 86.459 14.153  7.184   1.00 14.70  ? 23   ILE A CB    1 
ATOM   658  C  CG1   . ILE C 3 23  ? 86.283 14.963  5.898   1.00 5.51   ? 23   ILE A CG1   1 
ATOM   659  C  CG2   . ILE C 3 23  ? 85.708 12.819  7.055   1.00 11.13  ? 23   ILE A CG2   1 
ATOM   660  C  CD1   . ILE C 3 23  ? 86.735 14.233  4.651   1.00 11.80  ? 23   ILE A CD1   1 
ATOM   661  N  N     . TYR C 3 24  ? 85.011 13.538  10.142  1.00 21.88  ? 24   TYR A N     1 
ATOM   662  C  CA    . TYR C 3 24  ? 85.022 12.616  11.268  1.00 20.02  ? 24   TYR A CA    1 
ATOM   663  C  C     . TYR C 3 24  ? 84.604 11.283  10.646  1.00 16.70  ? 24   TYR A C     1 
ATOM   664  O  O     . TYR C 3 24  ? 83.554 11.191  10.029  1.00 10.88  ? 24   TYR A O     1 
ATOM   665  C  CB    . TYR C 3 24  ? 84.023 13.008  12.366  1.00 15.60  ? 24   TYR A CB    1 
ATOM   666  C  CG    . TYR C 3 24  ? 83.907 11.925  13.417  1.00 10.16  ? 24   TYR A CG    1 
ATOM   667  C  CD1   . TYR C 3 24  ? 84.891 11.771  14.393  1.00 15.51  ? 24   TYR A CD1   1 
ATOM   668  C  CD2   . TYR C 3 24  ? 82.855 11.002  13.391  1.00 18.08  ? 24   TYR A CD2   1 
ATOM   669  C  CE1   . TYR C 3 24  ? 84.842 10.727  15.316  1.00 8.55   ? 24   TYR A CE1   1 
ATOM   670  C  CE2   . TYR C 3 24  ? 82.798 9.943   14.311  1.00 16.11  ? 24   TYR A CE2   1 
ATOM   671  C  CZ    . TYR C 3 24  ? 83.801 9.817   15.270  1.00 15.45  ? 24   TYR A CZ    1 
ATOM   672  O  OH    . TYR C 3 24  ? 83.776 8.775   16.175  1.00 24.50  ? 24   TYR A OH    1 
ATOM   673  N  N     . ASP C 3 25  ? 85.434 10.260  10.796  1.00 20.13  ? 25   ASP A N     1 
ATOM   674  C  CA    . ASP C 3 25  ? 85.129 8.952   10.233  1.00 21.47  ? 25   ASP A CA    1 
ATOM   675  C  C     . ASP C 3 25  ? 84.771 7.976   11.349  1.00 22.50  ? 25   ASP A C     1 
ATOM   676  O  O     . ASP C 3 25  ? 85.573 7.737   12.252  1.00 19.53  ? 25   ASP A O     1 
ATOM   677  C  CB    . ASP C 3 25  ? 86.346 8.436   9.451   1.00 20.79  ? 25   ASP A CB    1 
ATOM   678  C  CG    . ASP C 3 25  ? 86.003 7.313   8.479   1.00 15.45  ? 25   ASP A CG    1 
ATOM   679  O  OD1   . ASP C 3 25  ? 84.962 6.649   8.640   1.00 16.00  ? 25   ASP A OD1   1 
ATOM   680  O  OD2   . ASP C 3 25  ? 86.794 7.097   7.539   1.00 18.18  ? 25   ASP A OD2   1 
ATOM   681  N  N     . TYR C 3 26  ? 83.566 7.414   11.283  1.00 19.87  ? 26   TYR A N     1 
ATOM   682  C  CA    . TYR C 3 26  ? 83.115 6.455   12.289  1.00 21.39  ? 26   TYR A CA    1 
ATOM   683  C  C     . TYR C 3 26  ? 83.920 5.159   12.323  1.00 16.82  ? 26   TYR A C     1 
ATOM   684  O  O     . TYR C 3 26  ? 83.989 4.512   13.364  1.00 18.92  ? 26   TYR A O     1 
ATOM   685  C  CB    . TYR C 3 26  ? 81.637 6.117   12.092  1.00 19.70  ? 26   TYR A CB    1 
ATOM   686  C  CG    . TYR C 3 26  ? 80.693 7.087   12.753  1.00 22.25  ? 26   TYR A CG    1 
ATOM   687  C  CD1   . TYR C 3 26  ? 80.403 6.986   14.120  1.00 12.05  ? 26   TYR A CD1   1 
ATOM   688  C  CD2   . TYR C 3 26  ? 80.064 8.092   12.015  1.00 17.22  ? 26   TYR A CD2   1 
ATOM   689  C  CE1   . TYR C 3 26  ? 79.505 7.864   14.733  1.00 17.71  ? 26   TYR A CE1   1 
ATOM   690  C  CE2   . TYR C 3 26  ? 79.168 8.971   12.619  1.00 20.13  ? 26   TYR A CE2   1 
ATOM   691  C  CZ    . TYR C 3 26  ? 78.893 8.854   13.976  1.00 20.44  ? 26   TYR A CZ    1 
ATOM   692  O  OH    . TYR C 3 26  ? 78.014 9.737   14.556  1.00 17.80  ? 26   TYR A OH    1 
ATOM   693  N  N     . SER C 3 27  ? 84.530 4.795   11.194  1.00 18.81  ? 27   SER A N     1 
ATOM   694  C  CA    . SER C 3 27  ? 85.322 3.570   11.098  1.00 22.26  ? 27   SER A CA    1 
ATOM   695  C  C     . SER C 3 27  ? 86.699 3.664   11.785  1.00 22.99  ? 27   SER A C     1 
ATOM   696  O  O     . SER C 3 27  ? 87.265 2.643   12.182  1.00 26.20  ? 27   SER A O     1 
ATOM   697  C  CB    . SER C 3 27  ? 85.493 3.164   9.631   1.00 22.14  ? 27   SER A CB    1 
ATOM   698  O  OG    . SER C 3 27  ? 86.357 4.060   8.957   1.00 29.34  ? 27   SER A OG    1 
ATOM   699  N  N     . THR C 3 28  ? 87.233 4.877   11.916  1.00 15.85  ? 28   THR A N     1 
ATOM   700  C  CA    . THR C 3 28  ? 88.531 5.091   12.567  1.00 17.68  ? 28   THR A CA    1 
ATOM   701  C  C     . THR C 3 28  ? 88.362 5.855   13.896  1.00 19.25  ? 28   THR A C     1 
ATOM   702  O  O     . THR C 3 28  ? 89.260 5.861   14.739  1.00 17.31  ? 28   THR A O     1 
ATOM   703  C  CB    . THR C 3 28  ? 89.509 5.906   11.663  1.00 19.77  ? 28   THR A CB    1 
ATOM   704  O  OG1   . THR C 3 28  ? 88.928 7.180   11.349  1.00 28.92  ? 28   THR A OG1   1 
ATOM   705  C  CG2   . THR C 3 28  ? 89.816 5.159   10.365  1.00 16.06  ? 28   THR A CG2   1 
ATOM   706  N  N     . ALA C 3 29  ? 87.206 6.502   14.057  1.00 22.11  ? 29   ALA A N     1 
ATOM   707  C  CA    . ALA C 3 29  ? 86.856 7.304   15.234  1.00 22.11  ? 29   ALA A CA    1 
ATOM   708  C  C     . ALA C 3 29  ? 87.810 8.493   15.432  1.00 26.18  ? 29   ALA A C     1 
ATOM   709  O  O     . ALA C 3 29  ? 88.118 8.877   16.568  1.00 28.55  ? 29   ALA A O     1 
ATOM   710  C  CB    . ALA C 3 29  ? 86.798 6.428   16.498  1.00 33.61  ? 29   ALA A CB    1 
ATOM   711  N  N     . GLU C 3 30  ? 88.267 9.074   14.321  1.00 24.60  ? 30   GLU A N     1 
ATOM   712  C  CA    . GLU C 3 30  ? 89.179 10.218  14.359  1.00 23.87  ? 30   GLU A CA    1 
ATOM   713  C  C     . GLU C 3 30  ? 88.758 11.393  13.474  1.00 22.83  ? 30   GLU A C     1 
ATOM   714  O  O     . GLU C 3 30  ? 88.002 11.238  12.509  1.00 19.77  ? 30   GLU A O     1 
ATOM   715  C  CB    . GLU C 3 30  ? 90.603 9.792   13.971  1.00 31.84  ? 30   GLU A CB    1 
ATOM   716  C  CG    . GLU C 3 30  ? 91.353 8.990   15.039  1.00 37.14  ? 30   GLU A CG    1 
ATOM   717  C  CD    . GLU C 3 30  ? 92.802 8.694   14.667  1.00 47.73  ? 30   GLU A CD    1 
ATOM   718  O  OE1   . GLU C 3 30  ? 93.291 9.240   13.654  1.00 49.91  ? 30   GLU A OE1   1 
ATOM   719  O  OE2   . GLU C 3 30  ? 93.462 7.915   15.393  1.00 45.24  ? 30   GLU A OE2   1 
ATOM   720  N  N     . TYR C 3 31  ? 89.251 12.573  13.831  1.00 22.53  ? 31   TYR A N     1 
ATOM   721  C  CA    . TYR C 3 31  ? 88.981 13.798  13.091  1.00 13.42  ? 31   TYR A CA    1 
ATOM   722  C  C     . TYR C 3 31  ? 90.203 14.108  12.250  1.00 17.24  ? 31   TYR A C     1 
ATOM   723  O  O     . TYR C 3 31  ? 91.334 13.932  12.706  1.00 15.32  ? 31   TYR A O     1 
ATOM   724  C  CB    . TYR C 3 31  ? 88.746 14.967  14.041  1.00 18.23  ? 31   TYR A CB    1 
ATOM   725  C  CG    . TYR C 3 31  ? 87.458 14.894  14.816  1.00 16.45  ? 31   TYR A CG    1 
ATOM   726  C  CD1   . TYR C 3 31  ? 87.363 14.121  15.972  1.00 15.82  ? 31   TYR A CD1   1 
ATOM   727  C  CD2   . TYR C 3 31  ? 86.333 15.616  14.406  1.00 13.45  ? 31   TYR A CD2   1 
ATOM   728  C  CE1   . TYR C 3 31  ? 86.185 14.072  16.704  1.00 13.46  ? 31   TYR A CE1   1 
ATOM   729  C  CE2   . TYR C 3 31  ? 85.148 15.574  15.134  1.00 14.23  ? 31   TYR A CE2   1 
ATOM   730  C  CZ    . TYR C 3 31  ? 85.082 14.798  16.282  1.00 12.85  ? 31   TYR A CZ    1 
ATOM   731  O  OH    . TYR C 3 31  ? 83.923 14.750  17.014  1.00 17.14  ? 31   TYR A OH    1 
ATOM   732  N  N     . VAL C 3 32  ? 89.966 14.556  11.020  1.00 20.34  ? 32   VAL A N     1 
ATOM   733  C  CA    . VAL C 3 32  ? 91.033 14.918  10.087  1.00 14.96  ? 32   VAL A CA    1 
ATOM   734  C  C     . VAL C 3 32  ? 90.709 16.302  9.538   1.00 16.08  ? 32   VAL A C     1 
ATOM   735  O  O     . VAL C 3 32  ? 89.598 16.545  9.064   1.00 11.91  ? 32   VAL A O     1 
ATOM   736  C  CB    . VAL C 3 32  ? 91.146 13.912  8.901   1.00 19.05  ? 32   VAL A CB    1 
ATOM   737  C  CG1   . VAL C 3 32  ? 92.215 14.366  7.913   1.00 10.38  ? 32   VAL A CG1   1 
ATOM   738  C  CG2   . VAL C 3 32  ? 91.498 12.529  9.419   1.00 17.20  ? 32   VAL A CG2   1 
ATOM   739  N  N     . SER C 3 33  ? 91.673 17.212  9.650   1.00 18.35  ? 33   SER A N     1 
ATOM   740  C  CA    . SER C 3 33  ? 91.511 18.574  9.162   1.00 13.64  ? 33   SER A CA    1 
ATOM   741  C  C     . SER C 3 33  ? 92.155 18.734  7.799   1.00 10.84  ? 33   SER A C     1 
ATOM   742  O  O     . SER C 3 33  ? 93.149 18.084  7.484   1.00 10.89  ? 33   SER A O     1 
ATOM   743  C  CB    . SER C 3 33  ? 92.133 19.578  10.132  1.00 18.26  ? 33   SER A CB    1 
ATOM   744  O  OG    . SER C 3 33  ? 91.432 19.612  11.358  1.00 17.53  ? 33   SER A OG    1 
ATOM   745  N  N     . TYR C 3 34  ? 91.561 19.602  6.990   1.00 13.39  ? 34   TYR A N     1 
ATOM   746  C  CA    . TYR C 3 34  ? 92.048 19.893  5.651   1.00 12.72  ? 34   TYR A CA    1 
ATOM   747  C  C     . TYR C 3 34  ? 92.110 21.407  5.501   1.00 8.82   ? 34   TYR A C     1 
ATOM   748  O  O     . TYR C 3 34  ? 91.097 22.098  5.642   1.00 7.86   ? 34   TYR A O     1 
ATOM   749  C  CB    . TYR C 3 34  ? 91.108 19.315  4.593   1.00 10.07  ? 34   TYR A CB    1 
ATOM   750  C  CG    . TYR C 3 34  ? 90.897 17.831  4.710   1.00 13.99  ? 34   TYR A CG    1 
ATOM   751  C  CD1   . TYR C 3 34  ? 89.915 17.311  5.559   1.00 14.42  ? 34   TYR A CD1   1 
ATOM   752  C  CD2   . TYR C 3 34  ? 91.682 16.941  3.985   1.00 11.98  ? 34   TYR A CD2   1 
ATOM   753  C  CE1   . TYR C 3 34  ? 89.724 15.938  5.678   1.00 9.75   ? 34   TYR A CE1   1 
ATOM   754  C  CE2   . TYR C 3 34  ? 91.497 15.565  4.098   1.00 10.47  ? 34   TYR A CE2   1 
ATOM   755  C  CZ    . TYR C 3 34  ? 90.516 15.075  4.946   1.00 5.25   ? 34   TYR A CZ    1 
ATOM   756  O  OH    . TYR C 3 34  ? 90.337 13.717  5.038   1.00 13.28  ? 34   TYR A OH    1 
ATOM   757  N  N     . ARG C 3 35  ? 93.313 21.910  5.243   1.00 12.17  ? 35   ARG A N     1 
ATOM   758  C  CA    . ARG C 3 35  ? 93.549 23.339  5.062   1.00 15.85  ? 35   ARG A CA    1 
ATOM   759  C  C     . ARG C 3 35  ? 93.384 23.714  3.581   1.00 17.94  ? 35   ARG A C     1 
ATOM   760  O  O     . ARG C 3 35  ? 93.143 22.830  2.760   1.00 22.67  ? 35   ARG A O     1 
ATOM   761  C  CB    . ARG C 3 35  ? 94.908 23.693  5.660   1.00 17.29  ? 35   ARG A CB    1 
ATOM   762  C  CG    . ARG C 3 35  ? 94.824 23.664  7.174   1.00 14.96  ? 35   ARG A CG    1 
ATOM   763  C  CD    . ARG C 3 35  ? 96.136 23.913  7.876   1.00 26.19  ? 35   ARG A CD    1 
ATOM   764  N  NE    . ARG C 3 35  ? 95.921 24.094  9.313   1.00 26.18  ? 35   ARG A NE    1 
ATOM   765  C  CZ    . ARG C 3 35  ? 95.587 23.118  10.156  1.00 30.36  ? 35   ARG A CZ    1 
ATOM   766  N  NH1   . ARG C 3 35  ? 95.431 21.872  9.722   1.00 29.92  ? 35   ARG A NH1   1 
ATOM   767  N  NH2   . ARG C 3 35  ? 95.390 23.390  11.437  1.00 31.33  ? 35   ARG A NH2   1 
ATOM   768  N  N     . PRO C 3 36  ? 93.490 25.012  3.217   1.00 19.71  ? 36   PRO A N     1 
ATOM   769  C  CA    . PRO C 3 36  ? 93.319 25.372  1.802   1.00 17.55  ? 36   PRO A CA    1 
ATOM   770  C  C     . PRO C 3 36  ? 94.058 24.575  0.724   1.00 16.42  ? 36   PRO A C     1 
ATOM   771  O  O     . PRO C 3 36  ? 93.490 24.301  -0.329  1.00 22.00  ? 36   PRO A O     1 
ATOM   772  C  CB    . PRO C 3 36  ? 93.609 26.884  1.784   1.00 14.26  ? 36   PRO A CB    1 
ATOM   773  C  CG    . PRO C 3 36  ? 94.437 27.105  2.991   1.00 20.34  ? 36   PRO A CG    1 
ATOM   774  C  CD    . PRO C 3 36  ? 93.786 26.218  4.011   1.00 20.33  ? 36   PRO A CD    1 
ATOM   775  N  N     . SER C 3 37  ? 95.290 24.161  0.986   1.00 16.80  ? 37   SER A N     1 
ATOM   776  C  CA    . SER C 3 37  ? 96.034 23.380  0.000   1.00 14.81  ? 37   SER A CA    1 
ATOM   777  C  C     . SER C 3 37  ? 95.683 21.878  0.036   1.00 19.01  ? 37   SER A C     1 
ATOM   778  O  O     . SER C 3 37  ? 96.224 21.092  -0.744  1.00 16.90  ? 37   SER A O     1 
ATOM   779  C  CB    . SER C 3 37  ? 97.535 23.591  0.184   1.00 9.77   ? 37   SER A CB    1 
ATOM   780  O  OG    . SER C 3 37  ? 97.918 23.325  1.520   1.00 28.59  ? 37   SER A OG    1 
ATOM   781  N  N     . ASP C 3 38  ? 94.779 21.494  0.941   1.00 19.69  ? 38   ASP A N     1 
ATOM   782  C  CA    . ASP C 3 38  ? 94.334 20.101  1.085   1.00 19.71  ? 38   ASP A CA    1 
ATOM   783  C  C     . ASP C 3 38  ? 92.934 19.872  0.500   1.00 21.14  ? 38   ASP A C     1 
ATOM   784  O  O     . ASP C 3 38  ? 92.284 18.868  0.808   1.00 20.11  ? 38   ASP A O     1 
ATOM   785  C  CB    . ASP C 3 38  ? 94.311 19.669  2.562   1.00 21.68  ? 38   ASP A CB    1 
ATOM   786  C  CG    . ASP C 3 38  ? 95.689 19.651  3.210   1.00 22.78  ? 38   ASP A CG    1 
ATOM   787  O  OD1   . ASP C 3 38  ? 96.636 19.076  2.630   1.00 24.37  ? 38   ASP A OD1   1 
ATOM   788  O  OD2   . ASP C 3 38  ? 95.812 20.198  4.326   1.00 28.60  ? 38   ASP A OD2   1 
ATOM   789  N  N     . PHE C 3 39  ? 92.480 20.800  -0.343  1.00 15.88  ? 39   PHE A N     1 
ATOM   790  C  CA    . PHE C 3 39  ? 91.166 20.720  -0.975  1.00 14.16  ? 39   PHE A CA    1 
ATOM   791  C  C     . PHE C 3 39  ? 91.014 19.422  -1.766  1.00 13.60  ? 39   PHE A C     1 
ATOM   792  O  O     . PHE C 3 39  ? 90.038 18.694  -1.590  1.00 18.14  ? 39   PHE A O     1 
ATOM   793  C  CB    . PHE C 3 39  ? 90.955 21.939  -1.888  1.00 11.94  ? 39   PHE A CB    1 
ATOM   794  C  CG    . PHE C 3 39  ? 89.560 22.050  -2.460  1.00 10.46  ? 39   PHE A CG    1 
ATOM   795  C  CD1   . PHE C 3 39  ? 88.457 21.495  -1.795  1.00 13.68  ? 39   PHE A CD1   1 
ATOM   796  C  CD2   . PHE C 3 39  ? 89.346 22.730  -3.661  1.00 9.59   ? 39   PHE A CD2   1 
ATOM   797  C  CE1   . PHE C 3 39  ? 87.167 21.608  -2.322  1.00 10.22  ? 39   PHE A CE1   1 
ATOM   798  C  CE2   . PHE C 3 39  ? 88.064 22.849  -4.197  1.00 6.56   ? 39   PHE A CE2   1 
ATOM   799  C  CZ    . PHE C 3 39  ? 86.970 22.290  -3.523  1.00 9.48   ? 39   PHE A CZ    1 
ATOM   800  N  N     . GLY C 3 40  ? 91.993 19.132  -2.619  1.00 11.67  ? 40   GLY A N     1 
ATOM   801  C  CA    . GLY C 3 40  ? 91.962 17.920  -3.415  1.00 11.79  ? 40   GLY A CA    1 
ATOM   802  C  C     . GLY C 3 40  ? 91.879 16.676  -2.553  1.00 12.91  ? 40   GLY A C     1 
ATOM   803  O  O     . GLY C 3 40  ? 91.123 15.757  -2.866  1.00 17.03  ? 40   GLY A O     1 
ATOM   804  N  N     . ALA C 3 41  ? 92.654 16.656  -1.469  1.00 13.10  ? 41   ALA A N     1 
ATOM   805  C  CA    . ALA C 3 41  ? 92.679 15.533  -0.533  1.00 11.43  ? 41   ALA A CA    1 
ATOM   806  C  C     . ALA C 3 41  ? 91.323 15.391  0.149   1.00 12.79  ? 41   ALA A C     1 
ATOM   807  O  O     . ALA C 3 41  ? 90.847 14.280  0.364   1.00 18.68  ? 41   ALA A O     1 
ATOM   808  C  CB    . ALA C 3 41  ? 93.777 15.745  0.516   1.00 10.40  ? 41   ALA A CB    1 
ATOM   809  N  N     . TYR C 3 42  ? 90.706 16.526  0.478   1.00 17.00  ? 42   TYR A N     1 
ATOM   810  C  CA    . TYR C 3 42  ? 89.398 16.551  1.133   1.00 13.47  ? 42   TYR A CA    1 
ATOM   811  C  C     . TYR C 3 42  ? 88.355 15.912  0.230   1.00 13.02  ? 42   TYR A C     1 
ATOM   812  O  O     . TYR C 3 42  ? 87.601 15.044  0.657   1.00 13.39  ? 42   TYR A O     1 
ATOM   813  C  CB    . TYR C 3 42  ? 88.988 17.992  1.459   1.00 11.86  ? 42   TYR A CB    1 
ATOM   814  C  CG    . TYR C 3 42  ? 87.578 18.116  1.992   1.00 11.42  ? 42   TYR A CG    1 
ATOM   815  C  CD1   . TYR C 3 42  ? 87.262 17.710  3.291   1.00 11.32  ? 42   TYR A CD1   1 
ATOM   816  C  CD2   . TYR C 3 42  ? 86.547 18.600  1.184   1.00 7.12   ? 42   TYR A CD2   1 
ATOM   817  C  CE1   . TYR C 3 42  ? 85.946 17.778  3.772   1.00 4.57   ? 42   TYR A CE1   1 
ATOM   818  C  CE2   . TYR C 3 42  ? 85.236 18.669  1.653   1.00 9.49   ? 42   TYR A CE2   1 
ATOM   819  C  CZ    . TYR C 3 42  ? 84.939 18.256  2.948   1.00 7.29   ? 42   TYR A CZ    1 
ATOM   820  O  OH    . TYR C 3 42  ? 83.635 18.321  3.405   1.00 11.60  ? 42   TYR A OH    1 
ATOM   821  N  N     . LEU C 3 43  ? 88.332 16.356  -1.022  1.00 15.22  ? 43   LEU A N     1 
ATOM   822  C  CA    . LEU C 3 43  ? 87.406 15.852  -2.023  1.00 10.34  ? 43   LEU A CA    1 
ATOM   823  C  C     . LEU C 3 43  ? 87.580 14.354  -2.226  1.00 11.84  ? 43   LEU A C     1 
ATOM   824  O  O     . LEU C 3 43  ? 86.598 13.626  -2.368  1.00 9.57   ? 43   LEU A O     1 
ATOM   825  C  CB    . LEU C 3 43  ? 87.627 16.574  -3.352  1.00 10.68  ? 43   LEU A CB    1 
ATOM   826  C  CG    . LEU C 3 43  ? 87.233 18.045  -3.431  1.00 8.90   ? 43   LEU A CG    1 
ATOM   827  C  CD1   . LEU C 3 43  ? 87.583 18.597  -4.799  1.00 3.62   ? 43   LEU A CD1   1 
ATOM   828  C  CD2   . LEU C 3 43  ? 85.751 18.190  -3.159  1.00 2.00   ? 43   LEU A CD2   1 
ATOM   829  N  N     . ASP C 3 44  ? 88.834 13.907  -2.251  1.00 9.98   ? 44   ASP A N     1 
ATOM   830  C  CA    . ASP C 3 44  ? 89.153 12.493  -2.432  1.00 14.20  ? 44   ASP A CA    1 
ATOM   831  C  C     . ASP C 3 44  ? 88.527 11.681  -1.314  1.00 9.92   ? 44   ASP A C     1 
ATOM   832  O  O     . ASP C 3 44  ? 87.914 10.648  -1.563  1.00 15.57  ? 44   ASP A O     1 
ATOM   833  C  CB    . ASP C 3 44  ? 90.674 12.263  -2.434  1.00 11.81  ? 44   ASP A CB    1 
ATOM   834  C  CG    . ASP C 3 44  ? 91.368 12.833  -3.673  1.00 25.24  ? 44   ASP A CG    1 
ATOM   835  O  OD1   . ASP C 3 44  ? 90.689 13.144  -4.673  1.00 20.65  ? 44   ASP A OD1   1 
ATOM   836  O  OD2   . ASP C 3 44  ? 92.609 12.965  -3.646  1.00 18.17  ? 44   ASP A OD2   1 
ATOM   837  N  N     . ALA C 3 45  ? 88.663 12.178  -0.089  1.00 14.87  ? 45   ALA A N     1 
ATOM   838  C  CA    . ALA C 3 45  ? 88.119 11.506  1.087   1.00 12.98  ? 45   ALA A CA    1 
ATOM   839  C  C     . ALA C 3 45  ? 86.609 11.323  1.002   1.00 9.46   ? 45   ALA A C     1 
ATOM   840  O  O     . ALA C 3 45  ? 86.084 10.285  1.409   1.00 13.49  ? 45   ALA A O     1 
ATOM   841  C  CB    . ALA C 3 45  ? 88.483 12.273  2.338   1.00 17.76  ? 45   ALA A CB    1 
ATOM   842  N  N     . LEU C 3 46  ? 85.914 12.316  0.453   1.00 10.03  ? 46   LEU A N     1 
ATOM   843  C  CA    . LEU C 3 46  ? 84.458 12.235  0.326   1.00 8.17   ? 46   LEU A CA    1 
ATOM   844  C  C     . LEU C 3 46  ? 84.051 11.204  -0.721  1.00 7.26   ? 46   LEU A C     1 
ATOM   845  O  O     . LEU C 3 46  ? 83.106 10.448  -0.516  1.00 14.52  ? 46   LEU A O     1 
ATOM   846  C  CB    . LEU C 3 46  ? 83.847 13.605  -0.003  1.00 6.74   ? 46   LEU A CB    1 
ATOM   847  C  CG    . LEU C 3 46  ? 84.029 14.751  0.998   1.00 10.73  ? 46   LEU A CG    1 
ATOM   848  C  CD1   . LEU C 3 46  ? 83.160 15.907  0.554   1.00 13.74  ? 46   LEU A CD1   1 
ATOM   849  C  CD2   . LEU C 3 46  ? 83.649 14.335  2.416   1.00 2.00   ? 46   LEU A CD2   1 
ATOM   850  N  N     . GLU C 3 47  ? 84.770 11.171  -1.841  1.00 9.18   ? 47   GLU A N     1 
ATOM   851  C  CA    . GLU C 3 47  ? 84.481 10.213  -2.899  1.00 11.39  ? 47   GLU A CA    1 
ATOM   852  C  C     . GLU C 3 47  ? 84.811 8.795   -2.462  1.00 12.86  ? 47   GLU A C     1 
ATOM   853  O  O     . GLU C 3 47  ? 84.160 7.850   -2.903  1.00 17.79  ? 47   GLU A O     1 
ATOM   854  C  CB    . GLU C 3 47  ? 85.250 10.557  -4.174  1.00 16.71  ? 47   GLU A CB    1 
ATOM   855  C  CG    . GLU C 3 47  ? 84.730 11.801  -4.861  1.00 19.81  ? 47   GLU A CG    1 
ATOM   856  C  CD    . GLU C 3 47  ? 85.518 12.203  -6.087  1.00 16.93  ? 47   GLU A CD    1 
ATOM   857  O  OE1   . GLU C 3 47  ? 86.745 11.944  -6.154  1.00 18.01  ? 47   GLU A OE1   1 
ATOM   858  O  OE2   . GLU C 3 47  ? 84.889 12.800  -6.982  1.00 17.67  ? 47   GLU A OE2   1 
ATOM   859  N  N     . ALA C 3 48  ? 85.814 8.649   -1.596  1.00 9.08   ? 48   ALA A N     1 
ATOM   860  C  CA    . ALA C 3 48  ? 86.219 7.333   -1.099  1.00 13.32  ? 48   ALA A CA    1 
ATOM   861  C  C     . ALA C 3 48  ? 85.067 6.722   -0.305  1.00 16.16  ? 48   ALA A C     1 
ATOM   862  O  O     . ALA C 3 48  ? 84.808 5.519   -0.401  1.00 17.73  ? 48   ALA A O     1 
ATOM   863  C  CB    . ALA C 3 48  ? 87.455 7.455   -0.231  1.00 11.44  ? 48   ALA A CB    1 
ATOM   864  N  N     . GLU C 3 49  ? 84.362 7.575   0.442   1.00 13.10  ? 49   GLU A N     1 
ATOM   865  C  CA    . GLU C 3 49  ? 83.215 7.169   1.249   1.00 13.50  ? 49   GLU A CA    1 
ATOM   866  C  C     . GLU C 3 49  ? 82.072 6.749   0.324   1.00 15.33  ? 49   GLU A C     1 
ATOM   867  O  O     . GLU C 3 49  ? 81.367 5.773   0.603   1.00 14.46  ? 49   GLU A O     1 
ATOM   868  C  CB    . GLU C 3 49  ? 82.779 8.321   2.165   1.00 4.47   ? 49   GLU A CB    1 
ATOM   869  C  CG    . GLU C 3 49  ? 81.553 8.043   3.030   1.00 4.80   ? 49   GLU A CG    1 
ATOM   870  C  CD    . GLU C 3 49  ? 81.754 6.915   4.039   1.00 11.87  ? 49   GLU A CD    1 
ATOM   871  O  OE1   . GLU C 3 49  ? 82.884 6.722   4.523   1.00 14.03  ? 49   GLU A OE1   1 
ATOM   872  O  OE2   . GLU C 3 49  ? 80.770 6.228   4.375   1.00 11.22  ? 49   GLU A OE2   1 
ATOM   873  N  N     . VAL C 3 50  ? 81.894 7.493   -0.769  1.00 13.32  ? 50   VAL A N     1 
ATOM   874  C  CA    . VAL C 3 50  ? 80.853 7.189   -1.753  1.00 10.43  ? 50   VAL A CA    1 
ATOM   875  C  C     . VAL C 3 50  ? 81.170 5.857   -2.442  1.00 13.18  ? 50   VAL A C     1 
ATOM   876  O  O     . VAL C 3 50  ? 80.271 5.050   -2.699  1.00 8.27   ? 50   VAL A O     1 
ATOM   877  C  CB    . VAL C 3 50  ? 80.754 8.279   -2.846  1.00 13.15  ? 50   VAL A CB    1 
ATOM   878  C  CG1   . VAL C 3 50  ? 79.739 7.864   -3.901  1.00 14.13  ? 50   VAL A CG1   1 
ATOM   879  C  CG2   . VAL C 3 50  ? 80.343 9.605   -2.233  1.00 9.45   ? 50   VAL A CG2   1 
ATOM   880  N  N     . ALA C 3 51  ? 82.459 5.629   -2.699  1.00 11.31  ? 51   ALA A N     1 
ATOM   881  C  CA    . ALA C 3 51  ? 82.943 4.413   -3.357  1.00 20.17  ? 51   ALA A CA    1 
ATOM   882  C  C     . ALA C 3 51  ? 82.661 3.141   -2.553  1.00 14.64  ? 51   ALA A C     1 
ATOM   883  O  O     . ALA C 3 51  ? 82.545 2.065   -3.127  1.00 23.26  ? 51   ALA A O     1 
ATOM   884  C  CB    . ALA C 3 51  ? 84.439 4.540   -3.663  1.00 14.09  ? 51   ALA A CB    1 
ATOM   885  N  N     . ARG C 3 52  ? 82.552 3.277   -1.232  1.00 20.53  ? 52   ARG A N     1 
ATOM   886  C  CA    . ARG C 3 52  ? 82.255 2.145   -0.348  1.00 20.58  ? 52   ARG A CA    1 
ATOM   887  C  C     . ARG C 3 52  ? 80.757 1.957   -0.202  1.00 17.93  ? 52   ARG A C     1 
ATOM   888  O  O     . ARG C 3 52  ? 80.317 1.071   0.523   1.00 18.01  ? 52   ARG A O     1 
ATOM   889  C  CB    . ARG C 3 52  ? 82.803 2.377   1.053   1.00 22.13  ? 52   ARG A CB    1 
ATOM   890  C  CG    . ARG C 3 52  ? 84.283 2.494   1.131   1.00 28.83  ? 52   ARG A CG    1 
ATOM   891  C  CD    . ARG C 3 52  ? 84.717 2.696   2.559   1.00 25.94  ? 52   ARG A CD    1 
ATOM   892  N  NE    . ARG C 3 52  ? 85.870 3.584   2.586   1.00 38.51  ? 52   ARG A NE    1 
ATOM   893  C  CZ    . ARG C 3 52  ? 85.868 4.789   3.142   1.00 36.50  ? 52   ARG A CZ    1 
ATOM   894  N  NH1   . ARG C 3 52  ? 84.782 5.250   3.731   1.00 39.11  ? 52   ARG A NH1   1 
ATOM   895  N  NH2   . ARG C 3 52  ? 86.931 5.562   3.048   1.00 36.00  ? 52   ARG A NH2   1 
ATOM   896  N  N     . GLY C 3 53  ? 79.976 2.806   -0.867  1.00 19.53  ? 53   GLY A N     1 
ATOM   897  C  CA    . GLY C 3 53  ? 78.530 2.720   -0.761  1.00 14.87  ? 53   GLY A CA    1 
ATOM   898  C  C     . GLY C 3 53  ? 78.148 3.211   0.624   1.00 11.77  ? 53   GLY A C     1 
ATOM   899  O  O     . GLY C 3 53  ? 77.166 2.751   1.198   1.00 19.77  ? 53   GLY A O     1 
ATOM   900  N  N     . GLY C 3 54  ? 78.955 4.130   1.160   1.00 11.29  ? 54   GLY A N     1 
ATOM   901  C  CA    . GLY C 3 54  ? 78.734 4.685   2.483   1.00 10.67  ? 54   GLY A CA    1 
ATOM   902  C  C     . GLY C 3 54  ? 77.904 5.955   2.533   1.00 13.39  ? 54   GLY A C     1 
ATOM   903  O  O     . GLY C 3 54  ? 77.209 6.281   1.576   1.00 14.52  ? 54   GLY A O     1 
ATOM   904  N  N     . LEU C 3 55  ? 78.014 6.690   3.641   1.00 11.00  ? 55   LEU A N     1 
ATOM   905  C  CA    . LEU C 3 55  ? 77.253 7.918   3.846   1.00 6.15   ? 55   LEU A CA    1 
ATOM   906  C  C     . LEU C 3 55  ? 78.073 9.119   4.331   1.00 9.25   ? 55   LEU A C     1 
ATOM   907  O  O     . LEU C 3 55  ? 79.025 8.968   5.091   1.00 12.14  ? 55   LEU A O     1 
ATOM   908  C  CB    . LEU C 3 55  ? 76.123 7.633   4.843   1.00 6.38   ? 55   LEU A CB    1 
ATOM   909  C  CG    . LEU C 3 55  ? 74.986 6.706   4.390   1.00 9.63   ? 55   LEU A CG    1 
ATOM   910  C  CD1   . LEU C 3 55  ? 74.298 6.097   5.582   1.00 7.56   ? 55   LEU A CD1   1 
ATOM   911  C  CD2   . LEU C 3 55  ? 74.003 7.481   3.523   1.00 5.14   ? 55   LEU A CD2   1 
ATOM   912  N  N     . ILE C 3 56  ? 77.668 10.313  3.898   1.00 14.29  ? 56   ILE A N     1 
ATOM   913  C  CA    . ILE C 3 56  ? 78.325 11.569  4.264   1.00 10.61  ? 56   ILE A CA    1 
ATOM   914  C  C     . ILE C 3 56  ? 77.275 12.450  4.945   1.00 13.39  ? 56   ILE A C     1 
ATOM   915  O  O     . ILE C 3 56  ? 76.210 12.702  4.381   1.00 15.35  ? 56   ILE A O     1 
ATOM   916  C  CB    . ILE C 3 56  ? 78.874 12.309  3.009   1.00 10.23  ? 56   ILE A CB    1 
ATOM   917  C  CG1   . ILE C 3 56  ? 79.825 11.386  2.222   1.00 7.16   ? 56   ILE A CG1   1 
ATOM   918  C  CG2   . ILE C 3 56  ? 79.570 13.614  3.431   1.00 5.30   ? 56   ILE A CG2   1 
ATOM   919  C  CD1   . ILE C 3 56  ? 80.363 11.971  0.951   1.00 2.90   ? 56   ILE A CD1   1 
ATOM   920  N  N     . VAL C 3 57  ? 77.580 12.922  6.152   1.00 13.54  ? 57   VAL A N     1 
ATOM   921  C  CA    . VAL C 3 57  ? 76.641 13.759  6.908   1.00 7.53   ? 57   VAL A CA    1 
ATOM   922  C  C     . VAL C 3 57  ? 77.110 15.210  7.023   1.00 8.71   ? 57   VAL A C     1 
ATOM   923  O  O     . VAL C 3 57  ? 78.251 15.481  7.400   1.00 9.61   ? 57   VAL A O     1 
ATOM   924  C  CB    . VAL C 3 57  ? 76.408 13.205  8.352   1.00 9.09   ? 57   VAL A CB    1 
ATOM   925  C  CG1   . VAL C 3 57  ? 75.292 13.971  9.043   1.00 8.86   ? 57   VAL A CG1   1 
ATOM   926  C  CG2   . VAL C 3 57  ? 76.085 11.720  8.315   1.00 2.36   ? 57   VAL A CG2   1 
ATOM   927  N  N     . PHE C 3 58  ? 76.216 16.136  6.691   1.00 8.54   ? 58   PHE A N     1 
ATOM   928  C  CA    . PHE C 3 58  ? 76.490 17.573  6.776   1.00 8.79   ? 58   PHE A CA    1 
ATOM   929  C  C     . PHE C 3 58  ? 75.306 18.188  7.510   1.00 7.16   ? 58   PHE A C     1 
ATOM   930  O  O     . PHE C 3 58  ? 74.277 17.538  7.681   1.00 7.90   ? 58   PHE A O     1 
ATOM   931  C  CB    . PHE C 3 58  ? 76.516 18.236  5.389   1.00 7.58   ? 58   PHE A CB    1 
ATOM   932  C  CG    . PHE C 3 58  ? 77.734 17.931  4.553   1.00 10.84  ? 58   PHE A CG    1 
ATOM   933  C  CD1   . PHE C 3 58  ? 78.973 18.488  4.862   1.00 6.52   ? 58   PHE A CD1   1 
ATOM   934  C  CD2   . PHE C 3 58  ? 77.623 17.131  3.413   1.00 11.84  ? 58   PHE A CD2   1 
ATOM   935  C  CE1   . PHE C 3 58  ? 80.086 18.267  4.044   1.00 10.84  ? 58   PHE A CE1   1 
ATOM   936  C  CE2   . PHE C 3 58  ? 78.725 16.900  2.583   1.00 15.27  ? 58   PHE A CE2   1 
ATOM   937  C  CZ    . PHE C 3 58  ? 79.965 17.469  2.901   1.00 9.12   ? 58   PHE A CZ    1 
ATOM   938  N  N     . HIS C 3 59  ? 75.473 19.427  7.972   1.00 10.69  ? 59   HIS A N     1 
ATOM   939  C  CA    . HIS C 3 59  ? 74.396 20.169  8.621   1.00 10.27  ? 59   HIS A CA    1 
ATOM   940  C  C     . HIS C 3 59  ? 74.213 21.312  7.623   1.00 13.34  ? 59   HIS A C     1 
ATOM   941  O  O     . HIS C 3 59  ? 75.045 22.217  7.526   1.00 12.91  ? 59   HIS A O     1 
ATOM   942  C  CB    . HIS C 3 59  ? 74.784 20.705  10.004  1.00 5.56   ? 59   HIS A CB    1 
ATOM   943  C  CG    . HIS C 3 59  ? 73.684 21.474  10.674  1.00 9.66   ? 59   HIS A CG    1 
ATOM   944  N  ND1   . HIS C 3 59  ? 72.605 20.868  11.286  1.00 6.35   ? 59   HIS A ND1   1 
ATOM   945  C  CD2   . HIS C 3 59  ? 73.486 22.807  10.799  1.00 11.65  ? 59   HIS A CD2   1 
ATOM   946  C  CE1   . HIS C 3 59  ? 71.789 21.796  11.756  1.00 9.23   ? 59   HIS A CE1   1 
ATOM   947  N  NE2   . HIS C 3 59  ? 72.302 22.981  11.472  1.00 12.07  ? 59   HIS A NE2   1 
ATOM   948  N  N     . ASN C 3 60  ? 73.152 21.195  6.834   1.00 14.98  ? 60   ASN A N     1 
ATOM   949  C  CA    . ASN C 3 60  ? 72.780 22.132  5.779   1.00 14.64  ? 60   ASN A CA    1 
ATOM   950  C  C     . ASN C 3 60  ? 73.667 21.904  4.547   1.00 13.79  ? 60   ASN A C     1 
ATOM   951  O  O     . ASN C 3 60  ? 73.965 22.825  3.794   1.00 15.78  ? 60   ASN A O     1 
ATOM   952  C  CB    . ASN C 3 60  ? 72.849 23.586  6.248   1.00 11.99  ? 60   ASN A CB    1 
ATOM   953  C  CG    . ASN C 3 60  ? 72.164 24.540  5.285   1.00 10.29  ? 60   ASN A CG    1 
ATOM   954  O  OD1   . ASN C 3 60  ? 71.068 24.269  4.802   1.00 9.52   ? 60   ASN A OD1   1 
ATOM   955  N  ND2   . ASN C 3 60  ? 72.813 25.662  4.999   1.00 8.49   ? 60   ASN A ND2   1 
ATOM   956  N  N     . GLY C 3 61  ? 74.068 20.655  4.343   1.00 11.27  ? 61   GLY A N     1 
ATOM   957  C  CA    . GLY C 3 61  ? 74.898 20.320  3.202   1.00 10.67  ? 61   GLY A CA    1 
ATOM   958  C  C     . GLY C 3 61  ? 74.137 20.318  1.883   1.00 11.19  ? 61   GLY A C     1 
ATOM   959  O  O     . GLY C 3 61  ? 74.693 20.682  0.853   1.00 11.24  ? 61   GLY A O     1 
ATOM   960  N  N     . HIS C 3 62  ? 72.868 19.917  1.910   1.00 7.07   ? 62   HIS A N     1 
ATOM   961  C  CA    . HIS C 3 62  ? 72.058 19.876  0.692   1.00 7.93   ? 62   HIS A CA    1 
ATOM   962  C  C     . HIS C 3 62  ? 71.970 21.222  -0.002  1.00 7.32   ? 62   HIS A C     1 
ATOM   963  O  O     . HIS C 3 62  ? 72.105 21.295  -1.218  1.00 7.59   ? 62   HIS A O     1 
ATOM   964  C  CB    . HIS C 3 62  ? 70.657 19.336  0.987   1.00 5.82   ? 62   HIS A CB    1 
ATOM   965  C  CG    . HIS C 3 62  ? 70.606 17.846  1.152   1.00 6.24   ? 62   HIS A CG    1 
ATOM   966  N  ND1   . HIS C 3 62  ? 71.693 17.102  1.559   1.00 9.40   ? 62   HIS A ND1   1 
ATOM   967  C  CD2   . HIS C 3 62  ? 69.602 16.960  0.943   1.00 6.37   ? 62   HIS A CD2   1 
ATOM   968  C  CE1   . HIS C 3 62  ? 71.364 15.824  1.593   1.00 5.46   ? 62   HIS A CE1   1 
ATOM   969  N  NE2   . HIS C 3 62  ? 70.101 15.710  1.224   1.00 9.53   ? 62   HIS A NE2   1 
ATOM   970  N  N     . LYS C 3 63  ? 71.784 22.283  0.785   1.00 6.43   ? 63   LYS A N     1 
ATOM   971  C  CA    . LYS C 3 63  ? 71.684 23.640  0.258   1.00 10.14  ? 63   LYS A CA    1 
ATOM   972  C  C     . LYS C 3 63  ? 73.023 24.354  0.119   1.00 9.55   ? 63   LYS A C     1 
ATOM   973  O  O     . LYS C 3 63  ? 73.184 25.191  -0.772  1.00 9.98   ? 63   LYS A O     1 
ATOM   974  C  CB    . LYS C 3 63  ? 70.748 24.492  1.115   1.00 12.50  ? 63   LYS A CB    1 
ATOM   975  C  CG    . LYS C 3 63  ? 69.281 24.197  0.908   1.00 10.60  ? 63   LYS A CG    1 
ATOM   976  C  CD    . LYS C 3 63  ? 68.382 25.059  1.793   1.00 7.37   ? 63   LYS A CD    1 
ATOM   977  C  CE    . LYS C 3 63  ? 68.510 26.538  1.474   1.00 12.75  ? 63   LYS A CE    1 
ATOM   978  N  NZ    . LYS C 3 63  ? 67.391 27.334  2.054   1.00 7.03   ? 63   LYS A NZ    1 
ATOM   979  N  N     . TYR C 3 64  ? 73.995 24.018  0.962   1.00 11.58  ? 64   TYR A N     1 
ATOM   980  C  CA    . TYR C 3 64  ? 75.283 24.697  0.866   1.00 13.43  ? 64   TYR A CA    1 
ATOM   981  C  C     . TYR C 3 64  ? 76.531 23.881  0.530   1.00 14.96  ? 64   TYR A C     1 
ATOM   982  O  O     . TYR C 3 64  ? 77.073 24.026  -0.566  1.00 11.05  ? 64   TYR A O     1 
ATOM   983  C  CB    . TYR C 3 64  ? 75.550 25.543  2.118   1.00 5.21   ? 64   TYR A CB    1 
ATOM   984  C  CG    . TYR C 3 64  ? 76.810 26.360  1.993   1.00 3.44   ? 64   TYR A CG    1 
ATOM   985  C  CD1   . TYR C 3 64  ? 76.839 27.512  1.198   1.00 2.40   ? 64   TYR A CD1   1 
ATOM   986  C  CD2   . TYR C 3 64  ? 77.989 25.956  2.618   1.00 5.21   ? 64   TYR A CD2   1 
ATOM   987  C  CE1   . TYR C 3 64  ? 78.010 28.238  1.032   1.00 6.82   ? 64   TYR A CE1   1 
ATOM   988  C  CE2   . TYR C 3 64  ? 79.169 26.678  2.461   1.00 6.57   ? 64   TYR A CE2   1 
ATOM   989  C  CZ    . TYR C 3 64  ? 79.172 27.814  1.663   1.00 2.82   ? 64   TYR A CZ    1 
ATOM   990  O  OH    . TYR C 3 64  ? 80.341 28.520  1.504   1.00 12.63  ? 64   TYR A OH    1 
ATOM   991  N  N     . ASP C 3 65  ? 76.993 23.055  1.471   1.00 9.35   ? 65   ASP A N     1 
ATOM   992  C  CA    . ASP C 3 65  ? 78.207 22.246  1.293   1.00 9.13   ? 65   ASP A CA    1 
ATOM   993  C  C     . ASP C 3 65  ? 78.331 21.434  0.011   1.00 7.56   ? 65   ASP A C     1 
ATOM   994  O  O     . ASP C 3 65  ? 79.326 21.554  -0.694  1.00 11.46  ? 65   ASP A O     1 
ATOM   995  C  CB    . ASP C 3 65  ? 78.434 21.320  2.497   1.00 9.93   ? 65   ASP A CB    1 
ATOM   996  C  CG    . ASP C 3 65  ? 78.567 22.079  3.811   1.00 7.26   ? 65   ASP A CG    1 
ATOM   997  O  OD1   . ASP C 3 65  ? 77.577 22.696  4.232   1.00 18.45  ? 65   ASP A OD1   1 
ATOM   998  O  OD2   . ASP C 3 65  ? 79.651 22.064  4.424   1.00 6.58   ? 65   ASP A OD2   1 
ATOM   999  N  N     . VAL C 3 66  ? 77.337 20.602  -0.285  1.00 6.90   ? 66   VAL A N     1 
ATOM   1000 C  CA    . VAL C 3 66  ? 77.375 19.775  -1.491  1.00 8.74   ? 66   VAL A CA    1 
ATOM   1001 C  C     . VAL C 3 66  ? 77.518 20.616  -2.779  1.00 7.65   ? 66   VAL A C     1 
ATOM   1002 O  O     . VAL C 3 66  ? 78.488 20.438  -3.518  1.00 8.26   ? 66   VAL A O     1 
ATOM   1003 C  CB    . VAL C 3 66  ? 76.149 18.797  -1.558  1.00 7.69   ? 66   VAL A CB    1 
ATOM   1004 C  CG1   . VAL C 3 66  ? 76.218 17.935  -2.811  1.00 9.49   ? 66   VAL A CG1   1 
ATOM   1005 C  CG2   . VAL C 3 66  ? 76.131 17.894  -0.332  1.00 5.00   ? 66   VAL A CG2   1 
ATOM   1006 N  N     . PRO C 3 67  ? 76.587 21.562  -3.044  1.00 5.92   ? 67   PRO A N     1 
ATOM   1007 C  CA    . PRO C 3 67  ? 76.692 22.386  -4.262  1.00 3.84   ? 67   PRO A CA    1 
ATOM   1008 C  C     . PRO C 3 67  ? 77.954 23.264  -4.270  1.00 9.74   ? 67   PRO A C     1 
ATOM   1009 O  O     . PRO C 3 67  ? 78.571 23.481  -5.317  1.00 11.36  ? 67   PRO A O     1 
ATOM   1010 C  CB    . PRO C 3 67  ? 75.425 23.235  -4.210  1.00 2.62   ? 67   PRO A CB    1 
ATOM   1011 C  CG    . PRO C 3 67  ? 74.481 22.407  -3.404  1.00 9.89   ? 67   PRO A CG    1 
ATOM   1012 C  CD    . PRO C 3 67  ? 75.359 21.909  -2.306  1.00 2.42   ? 67   PRO A CD    1 
ATOM   1013 N  N     . ALA C 3 68  ? 78.349 23.740  -3.092  1.00 10.17  ? 68   ALA A N     1 
ATOM   1014 C  CA    . ALA C 3 68  ? 79.529 24.584  -2.960  1.00 7.07   ? 68   ALA A CA    1 
ATOM   1015 C  C     . ALA C 3 68  ? 80.774 23.840  -3.412  1.00 13.14  ? 68   ALA A C     1 
ATOM   1016 O  O     . ALA C 3 68  ? 81.601 24.390  -4.135  1.00 13.39  ? 68   ALA A O     1 
ATOM   1017 C  CB    . ALA C 3 68  ? 79.697 25.045  -1.517  1.00 8.89   ? 68   ALA A CB    1 
ATOM   1018 N  N     . LEU C 3 69  ? 80.889 22.582  -2.994  1.00 14.48  ? 69   LEU A N     1 
ATOM   1019 C  CA    . LEU C 3 69  ? 82.038 21.746  -3.341  1.00 10.94  ? 69   LEU A CA    1 
ATOM   1020 C  C     . LEU C 3 69  ? 82.134 21.468  -4.840  1.00 8.00   ? 69   LEU A C     1 
ATOM   1021 O  O     . LEU C 3 69  ? 83.231 21.404  -5.387  1.00 5.48   ? 69   LEU A O     1 
ATOM   1022 C  CB    . LEU C 3 69  ? 82.003 20.451  -2.528  1.00 13.40  ? 69   LEU A CB    1 
ATOM   1023 C  CG    . LEU C 3 69  ? 82.251 20.682  -1.028  1.00 6.31   ? 69   LEU A CG    1 
ATOM   1024 C  CD1   . LEU C 3 69  ? 81.890 19.437  -0.223  1.00 6.72   ? 69   LEU A CD1   1 
ATOM   1025 C  CD2   . LEU C 3 69  ? 83.712 21.098  -0.821  1.00 4.16   ? 69   LEU A CD2   1 
ATOM   1026 N  N     . THR C 3 70  ? 80.979 21.335  -5.491  1.00 10.53  ? 70   THR A N     1 
ATOM   1027 C  CA    . THR C 3 70  ? 80.907 21.099  -6.932  1.00 13.94  ? 70   THR A CA    1 
ATOM   1028 C  C     . THR C 3 70  ? 81.401 22.352  -7.664  1.00 15.90  ? 70   THR A C     1 
ATOM   1029 O  O     . THR C 3 70  ? 82.187 22.263  -8.613  1.00 18.04  ? 70   THR A O     1 
ATOM   1030 C  CB    . THR C 3 70  ? 79.455 20.796  -7.381  1.00 12.60  ? 70   THR A CB    1 
ATOM   1031 O  OG1   . THR C 3 70  ? 79.041 19.531  -6.853  1.00 15.34  ? 70   THR A OG1   1 
ATOM   1032 C  CG2   . THR C 3 70  ? 79.350 20.763  -8.897  1.00 14.73  ? 70   THR A CG2   1 
ATOM   1033 N  N     . LYS C 3 71  ? 80.944 23.514  -7.201  1.00 10.66  ? 71   LYS A N     1 
ATOM   1034 C  CA    . LYS C 3 71  ? 81.320 24.797  -7.786  1.00 9.74   ? 71   LYS A CA    1 
ATOM   1035 C  C     . LYS C 3 71  ? 82.820 25.056  -7.622  1.00 9.67   ? 71   LYS A C     1 
ATOM   1036 O  O     . LYS C 3 71  ? 83.518 25.339  -8.596  1.00 11.04  ? 71   LYS A O     1 
ATOM   1037 C  CB    . LYS C 3 71  ? 80.504 25.922  -7.136  1.00 8.73   ? 71   LYS A CB    1 
ATOM   1038 C  CG    . LYS C 3 71  ? 80.851 27.324  -7.622  1.00 15.72  ? 71   LYS A CG    1 
ATOM   1039 C  CD    . LYS C 3 71  ? 79.880 28.364  -7.110  1.00 12.22  ? 71   LYS A CD    1 
ATOM   1040 C  CE    . LYS C 3 71  ? 80.277 29.745  -7.587  1.00 18.66  ? 71   LYS A CE    1 
ATOM   1041 N  NZ    . LYS C 3 71  ? 79.304 30.772  -7.140  1.00 21.62  ? 71   LYS A NZ    1 
ATOM   1042 N  N     . LEU C 3 72  ? 83.306 24.908  -6.390  1.00 10.11  ? 72   LEU A N     1 
ATOM   1043 C  CA    . LEU C 3 72  ? 84.707 25.118  -6.043  1.00 11.96  ? 72   LEU A CA    1 
ATOM   1044 C  C     . LEU C 3 72  ? 85.683 24.120  -6.664  1.00 11.96  ? 72   LEU A C     1 
ATOM   1045 O  O     . LEU C 3 72  ? 86.822 24.476  -6.974  1.00 14.74  ? 72   LEU A O     1 
ATOM   1046 C  CB    . LEU C 3 72  ? 84.878 25.112  -4.519  1.00 13.78  ? 72   LEU A CB    1 
ATOM   1047 C  CG    . LEU C 3 72  ? 84.196 26.252  -3.767  1.00 16.06  ? 72   LEU A CG    1 
ATOM   1048 C  CD1   . LEU C 3 72  ? 84.316 26.042  -2.263  1.00 11.33  ? 72   LEU A CD1   1 
ATOM   1049 C  CD2   . LEU C 3 72  ? 84.820 27.569  -4.188  1.00 13.10  ? 72   LEU A CD2   1 
ATOM   1050 N  N     . ALA C 3 73  ? 85.255 22.868  -6.812  1.00 10.36  ? 73   ALA A N     1 
ATOM   1051 C  CA    . ALA C 3 73  ? 86.111 21.842  -7.400  1.00 12.28  ? 73   ALA A CA    1 
ATOM   1052 C  C     . ALA C 3 73  ? 86.432 22.203  -8.850  1.00 13.80  ? 73   ALA A C     1 
ATOM   1053 O  O     . ALA C 3 73  ? 87.557 22.025  -9.304  1.00 19.03  ? 73   ALA A O     1 
ATOM   1054 C  CB    . ALA C 3 73  ? 85.430 20.497  -7.338  1.00 8.49   ? 73   ALA A CB    1 
ATOM   1055 N  N     . LYS C 3 74  ? 85.437 22.727  -9.562  1.00 17.25  ? 74   LYS A N     1 
ATOM   1056 C  CA    . LYS C 3 74  ? 85.598 23.123  -10.956 1.00 20.89  ? 74   LYS A CA    1 
ATOM   1057 C  C     . LYS C 3 74  ? 86.418 24.403  -11.107 1.00 18.37  ? 74   LYS A C     1 
ATOM   1058 O  O     . LYS C 3 74  ? 87.257 24.507  -12.001 1.00 20.74  ? 74   LYS A O     1 
ATOM   1059 C  CB    . LYS C 3 74  ? 84.224 23.325  -11.600 1.00 23.03  ? 74   LYS A CB    1 
ATOM   1060 C  CG    . LYS C 3 74  ? 84.257 23.852  -13.034 1.00 36.15  ? 74   LYS A CG    1 
ATOM   1061 C  CD    . LYS C 3 74  ? 84.664 22.804  -14.064 1.00 41.24  ? 74   LYS A CD    1 
ATOM   1062 C  CE    . LYS C 3 74  ? 84.721 23.442  -15.450 1.00 44.06  ? 74   LYS A CE    1 
ATOM   1063 N  NZ    . LYS C 3 74  ? 84.487 22.496  -16.582 1.00 47.79  ? 74   LYS A NZ    1 
ATOM   1064 N  N     . LEU C 3 75  ? 86.162 25.373  -10.234 1.00 20.31  ? 75   LEU A N     1 
ATOM   1065 C  CA    . LEU C 3 75  ? 86.854 26.659  -10.279 1.00 19.18  ? 75   LEU A CA    1 
ATOM   1066 C  C     . LEU C 3 75  ? 88.312 26.609  -9.873  1.00 18.18  ? 75   LEU A C     1 
ATOM   1067 O  O     . LEU C 3 75  ? 89.180 27.140  -10.566 1.00 18.18  ? 75   LEU A O     1 
ATOM   1068 C  CB    . LEU C 3 75  ? 86.144 27.677  -9.383  1.00 21.42  ? 75   LEU A CB    1 
ATOM   1069 C  CG    . LEU C 3 75  ? 84.688 28.033  -9.677  1.00 30.64  ? 75   LEU A CG    1 
ATOM   1070 C  CD1   . LEU C 3 75  ? 84.194 28.994  -8.601  1.00 36.60  ? 75   LEU A CD1   1 
ATOM   1071 C  CD2   . LEU C 3 75  ? 84.559 28.653  -11.059 1.00 34.82  ? 75   LEU A CD2   1 
ATOM   1072 N  N     . GLN C 3 76  ? 88.573 25.975  -8.735  1.00 19.36  ? 76   GLN A N     1 
ATOM   1073 C  CA    . GLN C 3 76  ? 89.925 25.877  -8.202  1.00 16.21  ? 76   GLN A CA    1 
ATOM   1074 C  C     . GLN C 3 76  ? 90.784 24.728  -8.716  1.00 12.07  ? 76   GLN A C     1 
ATOM   1075 O  O     . GLN C 3 76  ? 91.988 24.893  -8.890  1.00 9.14   ? 76   GLN A O     1 
ATOM   1076 C  CB    . GLN C 3 76  ? 89.876 25.791  -6.676  1.00 18.83  ? 76   GLN A CB    1 
ATOM   1077 C  CG    . GLN C 3 76  ? 89.193 26.955  -5.977  1.00 16.94  ? 76   GLN A CG    1 
ATOM   1078 C  CD    . GLN C 3 76  ? 89.153 26.764  -4.467  1.00 17.48  ? 76   GLN A CD    1 
ATOM   1079 O  OE1   . GLN C 3 76  ? 88.090 26.564  -3.884  1.00 9.95   ? 76   GLN A OE1   1 
ATOM   1080 N  NE2   . GLN C 3 76  ? 90.318 26.799  -3.834  1.00 15.49  ? 76   GLN A NE2   1 
ATOM   1081 N  N     . LEU C 3 77  ? 90.172 23.568  -8.939  1.00 14.43  ? 77   LEU A N     1 
ATOM   1082 C  CA    . LEU C 3 77  ? 90.910 22.391  -9.392  1.00 11.11  ? 77   LEU A CA    1 
ATOM   1083 C  C     . LEU C 3 77  ? 90.590 21.919  -10.804 1.00 12.51  ? 77   LEU A C     1 
ATOM   1084 O  O     . LEU C 3 77  ? 91.295 21.064  -11.343 1.00 13.11  ? 77   LEU A O     1 
ATOM   1085 C  CB    . LEU C 3 77  ? 90.674 21.226  -8.420  1.00 10.62  ? 77   LEU A CB    1 
ATOM   1086 C  CG    . LEU C 3 77  ? 91.010 21.392  -6.934  1.00 12.89  ? 77   LEU A CG    1 
ATOM   1087 C  CD1   . LEU C 3 77  ? 90.625 20.131  -6.165  1.00 11.22  ? 77   LEU A CD1   1 
ATOM   1088 C  CD2   . LEU C 3 77  ? 92.490 21.678  -6.764  1.00 20.96  ? 77   LEU A CD2   1 
ATOM   1089 N  N     . ASN C 3 78  ? 89.528 22.463  -11.392 1.00 14.47  ? 78   ASN A N     1 
ATOM   1090 C  CA    . ASN C 3 78  ? 89.099 22.082  -12.736 1.00 17.93  ? 78   ASN A CA    1 
ATOM   1091 C  C     . ASN C 3 78  ? 88.736 20.594  -12.672 1.00 19.05  ? 78   ASN A C     1 
ATOM   1092 O  O     . ASN C 3 78  ? 89.194 19.775  -13.478 1.00 22.06  ? 78   ASN A O     1 
ATOM   1093 C  CB    . ASN C 3 78  ? 90.224 22.341  -13.744 1.00 25.27  ? 78   ASN A CB    1 
ATOM   1094 C  CG    . ASN C 3 78  ? 89.717 22.502  -15.154 1.00 38.37  ? 78   ASN A CG    1 
ATOM   1095 O  OD1   . ASN C 3 78  ? 88.534 22.771  -15.381 1.00 39.30  ? 78   ASN A OD1   1 
ATOM   1096 N  ND2   . ASN C 3 78  ? 90.613 22.345  -16.117 1.00 44.68  ? 78   ASN A ND2   1 
ATOM   1097 N  N     . ARG C 3 79  ? 87.900 20.273  -11.688 1.00 17.98  ? 79   ARG A N     1 
ATOM   1098 C  CA    . ARG C 3 79  ? 87.449 18.911  -11.423 1.00 14.43  ? 79   ARG A CA    1 
ATOM   1099 C  C     . ARG C 3 79  ? 85.923 18.814  -11.355 1.00 15.79  ? 79   ARG A C     1 
ATOM   1100 O  O     . ARG C 3 79  ? 85.245 19.755  -10.930 1.00 10.64  ? 79   ARG A O     1 
ATOM   1101 C  CB    . ARG C 3 79  ? 88.033 18.431  -10.075 1.00 16.56  ? 79   ARG A CB    1 
ATOM   1102 C  CG    . ARG C 3 79  ? 87.715 16.978  -9.733  1.00 20.96  ? 79   ARG A CG    1 
ATOM   1103 C  CD    . ARG C 3 79  ? 87.658 16.679  -8.232  1.00 24.94  ? 79   ARG A CD    1 
ATOM   1104 N  NE    . ARG C 3 79  ? 88.953 16.545  -7.566  1.00 22.46  ? 79   ARG A NE    1 
ATOM   1105 C  CZ    . ARG C 3 79  ? 89.249 15.596  -6.673  1.00 22.90  ? 79   ARG A CZ    1 
ATOM   1106 N  NH1   . ARG C 3 79  ? 88.356 14.672  -6.337  1.00 19.12  ? 79   ARG A NH1   1 
ATOM   1107 N  NH2   . ARG C 3 79  ? 90.429 15.604  -6.060  1.00 9.96   ? 79   ARG A NH2   1 
ATOM   1108 N  N     . GLU C 3 80  ? 85.393 17.671  -11.788 1.00 17.37  ? 80   GLU A N     1 
ATOM   1109 C  CA    . GLU C 3 80  ? 83.961 17.406  -11.746 1.00 17.50  ? 80   GLU A CA    1 
ATOM   1110 C  C     . GLU C 3 80  ? 83.708 16.625  -10.458 1.00 17.56  ? 80   GLU A C     1 
ATOM   1111 O  O     . GLU C 3 80  ? 84.109 15.467  -10.337 1.00 12.06  ? 80   GLU A O     1 
ATOM   1112 C  CB    . GLU C 3 80  ? 83.507 16.562  -12.945 1.00 12.01  ? 80   GLU A CB    1 
ATOM   1113 C  CG    . GLU C 3 80  ? 83.632 17.236  -14.302 1.00 17.33  ? 80   GLU A CG    1 
ATOM   1114 C  CD    . GLU C 3 80  ? 82.813 18.512  -14.429 1.00 19.41  ? 80   GLU A CD    1 
ATOM   1115 O  OE1   . GLU C 3 80  ? 81.694 18.589  -13.876 1.00 19.76  ? 80   GLU A OE1   1 
ATOM   1116 O  OE2   . GLU C 3 80  ? 83.298 19.450  -15.097 1.00 29.21  ? 80   GLU A OE2   1 
ATOM   1117 N  N     . PHE C 3 81  ? 83.067 17.277  -9.493  1.00 15.41  ? 81   PHE A N     1 
ATOM   1118 C  CA    . PHE C 3 81  ? 82.754 16.658  -8.212  1.00 9.18   ? 81   PHE A CA    1 
ATOM   1119 C  C     . PHE C 3 81  ? 81.242 16.690  -8.079  1.00 13.08  ? 81   PHE A C     1 
ATOM   1120 O  O     . PHE C 3 81  ? 80.639 17.767  -8.106  1.00 13.82  ? 81   PHE A O     1 
ATOM   1121 C  CB    . PHE C 3 81  ? 83.405 17.449  -7.078  1.00 11.85  ? 81   PHE A CB    1 
ATOM   1122 C  CG    . PHE C 3 81  ? 83.198 16.843  -5.718  1.00 16.44  ? 81   PHE A CG    1 
ATOM   1123 C  CD1   . PHE C 3 81  ? 83.925 15.715  -5.327  1.00 9.47   ? 81   PHE A CD1   1 
ATOM   1124 C  CD2   . PHE C 3 81  ? 82.294 17.409  -4.818  1.00 13.02  ? 81   PHE A CD2   1 
ATOM   1125 C  CE1   . PHE C 3 81  ? 83.758 15.160  -4.067  1.00 14.94  ? 81   PHE A CE1   1 
ATOM   1126 C  CE2   . PHE C 3 81  ? 82.114 16.863  -3.548  1.00 13.82  ? 81   PHE A CE2   1 
ATOM   1127 C  CZ    . PHE C 3 81  ? 82.853 15.733  -3.170  1.00 13.42  ? 81   PHE A CZ    1 
ATOM   1128 N  N     . HIS C 3 82  ? 80.623 15.517  -7.955  1.00 11.30  ? 82   HIS A N     1 
ATOM   1129 C  CA    . HIS C 3 82  ? 79.166 15.438  -7.842  1.00 11.67  ? 82   HIS A CA    1 
ATOM   1130 C  C     . HIS C 3 82  ? 78.733 14.312  -6.910  1.00 15.55  ? 82   HIS A C     1 
ATOM   1131 O  O     . HIS C 3 82  ? 78.591 13.164  -7.334  1.00 16.68  ? 82   HIS A O     1 
ATOM   1132 C  CB    . HIS C 3 82  ? 78.519 15.232  -9.232  1.00 10.72  ? 82   HIS A CB    1 
ATOM   1133 C  CG    . HIS C 3 82  ? 78.880 16.287  -10.238 1.00 14.11  ? 82   HIS A CG    1 
ATOM   1134 N  ND1   . HIS C 3 82  ? 78.252 17.512  -10.294 1.00 15.12  ? 82   HIS A ND1   1 
ATOM   1135 C  CD2   . HIS C 3 82  ? 79.824 16.312  -11.209 1.00 10.99  ? 82   HIS A CD2   1 
ATOM   1136 C  CE1   . HIS C 3 82  ? 78.790 18.247  -11.248 1.00 10.75  ? 82   HIS A CE1   1 
ATOM   1137 N  NE2   . HIS C 3 82  ? 79.747 17.541  -11.820 1.00 14.12  ? 82   HIS A NE2   1 
ATOM   1138 N  N     . LEU C 3 83  ? 78.563 14.634  -5.630  1.00 15.04  ? 83   LEU A N     1 
ATOM   1139 C  CA    . LEU C 3 83  ? 78.130 13.646  -4.650  1.00 12.12  ? 83   LEU A CA    1 
ATOM   1140 C  C     . LEU C 3 83  ? 76.708 13.217  -4.965  1.00 6.13   ? 83   LEU A C     1 
ATOM   1141 O  O     . LEU C 3 83  ? 75.850 14.059  -5.220  1.00 11.44  ? 83   LEU A O     1 
ATOM   1142 C  CB    . LEU C 3 83  ? 78.166 14.223  -3.231  1.00 7.69   ? 83   LEU A CB    1 
ATOM   1143 C  CG    . LEU C 3 83  ? 79.493 14.583  -2.576  1.00 6.82   ? 83   LEU A CG    1 
ATOM   1144 C  CD1   . LEU C 3 83  ? 79.201 15.103  -1.179  1.00 13.00  ? 83   LEU A CD1   1 
ATOM   1145 C  CD2   . LEU C 3 83  ? 80.410 13.373  -2.511  1.00 10.25  ? 83   LEU A CD2   1 
ATOM   1146 N  N     . PRO C 3 84  ? 76.451 11.897  -5.002  1.00 2.00   ? 84   PRO A N     1 
ATOM   1147 C  CA    . PRO C 3 84  ? 75.109 11.398  -5.293  1.00 8.95   ? 84   PRO A CA    1 
ATOM   1148 C  C     . PRO C 3 84  ? 74.171 11.716  -4.133  1.00 10.35  ? 84   PRO A C     1 
ATOM   1149 O  O     . PRO C 3 84  ? 74.565 11.661  -2.965  1.00 14.77  ? 84   PRO A O     1 
ATOM   1150 C  CB    . PRO C 3 84  ? 75.328 9.886   -5.432  1.00 6.56   ? 84   PRO A CB    1 
ATOM   1151 C  CG    . PRO C 3 84  ? 76.735 9.791   -5.891  1.00 5.07   ? 84   PRO A CG    1 
ATOM   1152 C  CD    . PRO C 3 84  ? 77.407 10.781  -4.977  1.00 7.02   ? 84   PRO A CD    1 
ATOM   1153 N  N     . ARG C 3 85  ? 72.925 12.019  -4.470  1.00 4.20   ? 85   ARG A N     1 
ATOM   1154 C  CA    . ARG C 3 85  ? 71.901 12.343  -3.487  1.00 3.85   ? 85   ARG A CA    1 
ATOM   1155 C  C     . ARG C 3 85  ? 71.759 11.253  -2.419  1.00 12.51  ? 85   ARG A C     1 
ATOM   1156 O  O     . ARG C 3 85  ? 71.660 11.552  -1.224  1.00 15.54  ? 85   ARG A O     1 
ATOM   1157 C  CB    . ARG C 3 85  ? 70.559 12.504  -4.197  1.00 3.75   ? 85   ARG A CB    1 
ATOM   1158 C  CG    . ARG C 3 85  ? 69.423 12.888  -3.282  1.00 8.22   ? 85   ARG A CG    1 
ATOM   1159 C  CD    . ARG C 3 85  ? 68.190 12.088  -3.600  1.00 18.45  ? 85   ARG A CD    1 
ATOM   1160 N  NE    . ARG C 3 85  ? 68.133 10.863  -2.814  1.00 17.44  ? 85   ARG A NE    1 
ATOM   1161 C  CZ    . ARG C 3 85  ? 68.115 9.631   -3.312  1.00 21.63  ? 85   ARG A CZ    1 
ATOM   1162 N  NH1   . ARG C 3 85  ? 68.153 9.413   -4.624  1.00 17.33  ? 85   ARG A NH1   1 
ATOM   1163 N  NH2   . ARG C 3 85  ? 68.044 8.606   -2.477  1.00 22.04  ? 85   ARG A NH2   1 
ATOM   1164 N  N     . GLU C 3 86  ? 71.774 9.997   -2.866  1.00 10.97  ? 86   GLU A N     1 
ATOM   1165 C  CA    . GLU C 3 86  ? 71.619 8.835   -1.986  1.00 12.69  ? 86   GLU A CA    1 
ATOM   1166 C  C     . GLU C 3 86  ? 72.718 8.588   -0.957  1.00 11.19  ? 86   GLU A C     1 
ATOM   1167 O  O     . GLU C 3 86  ? 72.524 7.809   -0.031  1.00 11.39  ? 86   GLU A O     1 
ATOM   1168 C  CB    . GLU C 3 86  ? 71.386 7.557   -2.801  1.00 8.45   ? 86   GLU A CB    1 
ATOM   1169 C  CG    . GLU C 3 86  ? 72.565 7.088   -3.648  1.00 14.57  ? 86   GLU A CG    1 
ATOM   1170 C  CD    . GLU C 3 86  ? 72.495 7.544   -5.092  1.00 23.66  ? 86   GLU A CD    1 
ATOM   1171 O  OE1   . GLU C 3 86  ? 71.976 8.652   -5.371  1.00 19.44  ? 86   GLU A OE1   1 
ATOM   1172 O  OE2   . GLU C 3 86  ? 72.970 6.781   -5.959  1.00 33.04  ? 86   GLU A OE2   1 
ATOM   1173 N  N     . ASN C 3 87  ? 73.872 9.226   -1.125  1.00 11.67  ? 87   ASN A N     1 
ATOM   1174 C  CA    . ASN C 3 87  ? 74.972 9.060   -0.174  1.00 11.94  ? 87   ASN A CA    1 
ATOM   1175 C  C     . ASN C 3 87  ? 75.030 10.222  0.828   1.00 9.90   ? 87   ASN A C     1 
ATOM   1176 O  O     . ASN C 3 87  ? 75.904 10.246  1.699   1.00 5.22   ? 87   ASN A O     1 
ATOM   1177 C  CB    . ASN C 3 87  ? 76.316 8.996   -0.906  1.00 6.33   ? 87   ASN A CB    1 
ATOM   1178 C  CG    . ASN C 3 87  ? 76.432 7.802   -1.816  1.00 13.89  ? 87   ASN A CG    1 
ATOM   1179 O  OD1   . ASN C 3 87  ? 76.226 7.910   -3.023  1.00 16.57  ? 87   ASN A OD1   1 
ATOM   1180 N  ND2   . ASN C 3 87  ? 76.786 6.655   -1.247  1.00 7.41   ? 87   ASN A ND2   1 
ATOM   1181 N  N     . CYS C 3 88  ? 74.102 11.171  0.712   1.00 6.58   ? 88   CYS A N     1 
ATOM   1182 C  CA    . CYS C 3 88  ? 74.098 12.340  1.588   1.00 7.46   ? 88   CYS A CA    1 
ATOM   1183 C  C     . CYS C 3 88  ? 72.998 12.418  2.637   1.00 9.73   ? 88   CYS A C     1 
ATOM   1184 O  O     . CYS C 3 88  ? 71.837 12.074  2.386   1.00 11.80  ? 88   CYS A O     1 
ATOM   1185 C  CB    . CYS C 3 88  ? 74.090 13.619  0.744   1.00 6.93   ? 88   CYS A CB    1 
ATOM   1186 S  SG    . CYS C 3 88  ? 75.523 13.790  -0.330  1.00 7.90   ? 88   CYS A SG    1 
ATOM   1187 N  N     . ILE C 3 89  ? 73.385 12.913  3.809   1.00 10.81  ? 89   ILE A N     1 
ATOM   1188 C  CA    . ILE C 3 89  ? 72.484 13.077  4.942   1.00 4.61   ? 89   ILE A CA    1 
ATOM   1189 C  C     . ILE C 3 89  ? 72.627 14.516  5.445   1.00 2.00   ? 89   ILE A C     1 
ATOM   1190 O  O     . ILE C 3 89  ? 73.724 15.072  5.457   1.00 2.78   ? 89   ILE A O     1 
ATOM   1191 C  CB    . ILE C 3 89  ? 72.832 12.059  6.074   1.00 6.44   ? 89   ILE A CB    1 
ATOM   1192 C  CG1   . ILE C 3 89  ? 72.516 10.639  5.609   1.00 2.00   ? 89   ILE A CG1   1 
ATOM   1193 C  CG2   . ILE C 3 89  ? 72.047 12.358  7.357   1.00 3.80   ? 89   ILE A CG2   1 
ATOM   1194 C  CD1   . ILE C 3 89  ? 72.937 9.589   6.595   1.00 10.46  ? 89   ILE A CD1   1 
ATOM   1195 N  N     . ASP C 3 90  ? 71.510 15.121  5.829   1.00 7.40   ? 90   ASP A N     1 
ATOM   1196 C  CA    . ASP C 3 90  ? 71.507 16.490  6.331   1.00 9.98   ? 90   ASP A CA    1 
ATOM   1197 C  C     . ASP C 3 90  ? 70.821 16.544  7.707   1.00 6.88   ? 90   ASP A C     1 
ATOM   1198 O  O     . ASP C 3 90  ? 69.616 16.306  7.817   1.00 2.55   ? 90   ASP A O     1 
ATOM   1199 C  CB    . ASP C 3 90  ? 70.784 17.393  5.319   1.00 12.86  ? 90   ASP A CB    1 
ATOM   1200 C  CG    . ASP C 3 90  ? 71.031 18.879  5.553   1.00 11.39  ? 90   ASP A CG    1 
ATOM   1201 O  OD1   . ASP C 3 90  ? 70.970 19.344  6.706   1.00 12.94  ? 90   ASP A OD1   1 
ATOM   1202 O  OD2   . ASP C 3 90  ? 71.267 19.597  4.565   1.00 7.83   ? 90   ASP A OD2   1 
ATOM   1203 N  N     . THR C 3 91  ? 71.591 16.863  8.749   1.00 8.17   ? 91   THR A N     1 
ATOM   1204 C  CA    . THR C 3 91  ? 71.044 16.953  10.107  1.00 6.58   ? 91   THR A CA    1 
ATOM   1205 C  C     . THR C 3 91  ? 70.021 18.079  10.275  1.00 5.80   ? 91   THR A C     1 
ATOM   1206 O  O     . THR C 3 91  ? 69.153 17.998  11.140  1.00 3.06   ? 91   THR A O     1 
ATOM   1207 C  CB    . THR C 3 91  ? 72.150 17.062  11.189  1.00 4.28   ? 91   THR A CB    1 
ATOM   1208 O  OG1   . THR C 3 91  ? 73.118 18.044  10.807  1.00 9.06   ? 91   THR A OG1   1 
ATOM   1209 C  CG2   . THR C 3 91  ? 72.851 15.721  11.387  1.00 2.00   ? 91   THR A CG2   1 
ATOM   1210 N  N     . LEU C 3 92  ? 70.111 19.120  9.448   1.00 7.91   ? 92   LEU A N     1 
ATOM   1211 C  CA    . LEU C 3 92  ? 69.152 20.225  9.517   1.00 7.19   ? 92   LEU A CA    1 
ATOM   1212 C  C     . LEU C 3 92  ? 67.811 19.719  8.982   1.00 7.10   ? 92   LEU A C     1 
ATOM   1213 O  O     . LEU C 3 92  ? 66.751 20.033  9.533   1.00 7.52   ? 92   LEU A O     1 
ATOM   1214 C  CB    . LEU C 3 92  ? 69.627 21.430  8.695   1.00 11.43  ? 92   LEU A CB    1 
ATOM   1215 C  CG    . LEU C 3 92  ? 68.722 22.667  8.759   1.00 3.86   ? 92   LEU A CG    1 
ATOM   1216 C  CD1   . LEU C 3 92  ? 68.564 23.108  10.204  1.00 5.82   ? 92   LEU A CD1   1 
ATOM   1217 C  CD2   . LEU C 3 92  ? 69.307 23.783  7.922   1.00 5.67   ? 92   LEU A CD2   1 
ATOM   1218 N  N     . VAL C 3 93  ? 67.872 18.943  7.898   1.00 6.66   ? 93   VAL A N     1 
ATOM   1219 C  CA    . VAL C 3 93  ? 66.675 18.358  7.302   1.00 7.25   ? 93   VAL A CA    1 
ATOM   1220 C  C     . VAL C 3 93  ? 66.077 17.388  8.326   1.00 9.13   ? 93   VAL A C     1 
ATOM   1221 O  O     . VAL C 3 93  ? 64.874 17.398  8.559   1.00 11.38  ? 93   VAL A O     1 
ATOM   1222 C  CB    . VAL C 3 93  ? 66.989 17.574  5.987   1.00 10.91  ? 93   VAL A CB    1 
ATOM   1223 C  CG1   . VAL C 3 93  ? 65.735 16.854  5.474   1.00 2.54   ? 93   VAL A CG1   1 
ATOM   1224 C  CG2   . VAL C 3 93  ? 67.492 18.524  4.919   1.00 2.00   ? 93   VAL A CG2   1 
ATOM   1225 N  N     . LEU C 3 94  ? 66.929 16.572  8.946   1.00 9.04   ? 94   LEU A N     1 
ATOM   1226 C  CA    . LEU C 3 94  ? 66.477 15.606  9.952   1.00 11.26  ? 94   LEU A CA    1 
ATOM   1227 C  C     . LEU C 3 94  ? 65.859 16.283  11.164  1.00 9.55   ? 94   LEU A C     1 
ATOM   1228 O  O     . LEU C 3 94  ? 64.864 15.808  11.694  1.00 13.27  ? 94   LEU A O     1 
ATOM   1229 C  CB    . LEU C 3 94  ? 67.634 14.726  10.436  1.00 18.91  ? 94   LEU A CB    1 
ATOM   1230 C  CG    . LEU C 3 94  ? 67.839 13.343  9.827   1.00 22.77  ? 94   LEU A CG    1 
ATOM   1231 C  CD1   . LEU C 3 94  ? 69.041 12.698  10.482  1.00 27.27  ? 94   LEU A CD1   1 
ATOM   1232 C  CD2   . LEU C 3 94  ? 66.599 12.483  10.032  1.00 17.42  ? 94   LEU A CD2   1 
ATOM   1233 N  N     . SER C 3 95  ? 66.465 17.386  11.602  1.00 13.89  ? 95   SER A N     1 
ATOM   1234 C  CA    . SER C 3 95  ? 65.979 18.129  12.755  1.00 12.56  ? 95   SER A CA    1 
ATOM   1235 C  C     . SER C 3 95  ? 64.646 18.759  12.456  1.00 8.60   ? 95   SER A C     1 
ATOM   1236 O  O     . SER C 3 95  ? 63.784 18.810  13.323  1.00 14.84  ? 95   SER A O     1 
ATOM   1237 C  CB    . SER C 3 95  ? 66.946 19.246  13.140  1.00 14.29  ? 95   SER A CB    1 
ATOM   1238 O  OG    . SER C 3 95  ? 68.246 18.751  13.378  1.00 25.21  ? 95   SER A OG    1 
ATOM   1239 N  N     . ARG C 3 96  ? 64.481 19.261  11.233  1.00 9.45   ? 96   ARG A N     1 
ATOM   1240 C  CA    . ARG C 3 96  ? 63.227 19.906  10.850  1.00 6.13   ? 96   ARG A CA    1 
ATOM   1241 C  C     . ARG C 3 96  ? 62.071 18.923  10.731  1.00 6.60   ? 96   ARG A C     1 
ATOM   1242 O  O     . ARG C 3 96  ? 60.904 19.311  10.812  1.00 9.42   ? 96   ARG A O     1 
ATOM   1243 C  CB    . ARG C 3 96  ? 63.417 20.727  9.575   1.00 9.99   ? 96   ARG A CB    1 
ATOM   1244 C  CG    . ARG C 3 96  ? 64.260 21.974  9.806   1.00 7.13   ? 96   ARG A CG    1 
ATOM   1245 C  CD    . ARG C 3 96  ? 64.600 22.692  8.506   1.00 15.24  ? 96   ARG A CD    1 
ATOM   1246 N  NE    . ARG C 3 96  ? 65.224 23.992  8.758   1.00 12.66  ? 96   ARG A NE    1 
ATOM   1247 C  CZ    . ARG C 3 96  ? 65.713 24.799  7.818   1.00 14.48  ? 96   ARG A CZ    1 
ATOM   1248 N  NH1   . ARG C 3 96  ? 65.671 24.455  6.530   1.00 13.73  ? 96   ARG A NH1   1 
ATOM   1249 N  NH2   . ARG C 3 96  ? 66.209 25.980  8.166   1.00 8.98   ? 96   ARG A NH2   1 
ATOM   1250 N  N     . LEU C 3 97  ? 62.404 17.653  10.528  1.00 5.21   ? 97   LEU A N     1 
ATOM   1251 C  CA    . LEU C 3 97  ? 61.400 16.596  10.439  1.00 9.72   ? 97   LEU A CA    1 
ATOM   1252 C  C     . LEU C 3 97  ? 61.041 16.123  11.856  1.00 5.09   ? 97   LEU A C     1 
ATOM   1253 O  O     . LEU C 3 97  ? 59.885 16.163  12.251  1.00 16.37  ? 97   LEU A O     1 
ATOM   1254 C  CB    . LEU C 3 97  ? 61.934 15.409  9.617   1.00 10.02  ? 97   LEU A CB    1 
ATOM   1255 C  CG    . LEU C 3 97  ? 61.145 14.087  9.695   1.00 14.59  ? 97   LEU A CG    1 
ATOM   1256 C  CD1   . LEU C 3 97  ? 59.713 14.268  9.174   1.00 2.99   ? 97   LEU A CD1   1 
ATOM   1257 C  CD2   . LEU C 3 97  ? 61.879 13.008  8.912   1.00 11.57  ? 97   LEU A CD2   1 
ATOM   1258 N  N     . ILE C 3 98  ? 62.046 15.688  12.611  1.00 7.82   ? 98   ILE A N     1 
ATOM   1259 C  CA    . ILE C 3 98  ? 61.859 15.186  13.972  1.00 15.27  ? 98   ILE A CA    1 
ATOM   1260 C  C     . ILE C 3 98  ? 61.349 16.248  14.952  1.00 21.07  ? 98   ILE A C     1 
ATOM   1261 O  O     . ILE C 3 98  ? 60.435 15.989  15.735  1.00 20.85  ? 98   ILE A O     1 
ATOM   1262 C  CB    . ILE C 3 98  ? 63.169 14.523  14.479  1.00 13.46  ? 98   ILE A CB    1 
ATOM   1263 C  CG1   . ILE C 3 98  ? 63.468 13.283  13.624  1.00 15.21  ? 98   ILE A CG1   1 
ATOM   1264 C  CG2   . ILE C 3 98  ? 63.048 14.109  15.942  1.00 16.21  ? 98   ILE A CG2   1 
ATOM   1265 C  CD1   . ILE C 3 98  ? 64.766 12.583  13.954  1.00 12.74  ? 98   ILE A CD1   1 
ATOM   1266 N  N     . HIS C 3 99  ? 61.932 17.443  14.892  1.00 23.55  ? 99   HIS A N     1 
ATOM   1267 C  CA    . HIS C 3 99  ? 61.538 18.555  15.758  1.00 21.56  ? 99   HIS A CA    1 
ATOM   1268 C  C     . HIS C 3 99  ? 60.710 19.545  14.931  1.00 19.99  ? 99   HIS A C     1 
ATOM   1269 O  O     . HIS C 3 99  ? 60.963 20.748  14.939  1.00 17.62  ? 99   HIS A O     1 
ATOM   1270 C  CB    . HIS C 3 99  ? 62.781 19.245  16.349  1.00 19.93  ? 99   HIS A CB    1 
ATOM   1271 C  CG    . HIS C 3 99  ? 63.651 18.336  17.167  1.00 24.14  ? 99   HIS A CG    1 
ATOM   1272 N  ND1   . HIS C 3 99  ? 63.236 17.781  18.359  1.00 28.54  ? 99   HIS A ND1   1 
ATOM   1273 C  CD2   . HIS C 3 99  ? 64.912 17.886  16.965  1.00 22.05  ? 99   HIS A CD2   1 
ATOM   1274 C  CE1   . HIS C 3 99  ? 64.202 17.028  18.856  1.00 26.23  ? 99   HIS A CE1   1 
ATOM   1275 N  NE2   . HIS C 3 99  ? 65.230 17.075  18.028  1.00 26.90  ? 99   HIS A NE2   1 
ATOM   1276 N  N     . SER C 3 100 ? 59.725 19.007  14.215  1.00 22.46  ? 100  SER A N     1 
ATOM   1277 C  CA    . SER C 3 100 ? 58.829 19.787  13.357  1.00 27.97  ? 100  SER A CA    1 
ATOM   1278 C  C     . SER C 3 100 ? 57.991 20.827  14.101  1.00 26.75  ? 100  SER A C     1 
ATOM   1279 O  O     . SER C 3 100 ? 57.503 21.785  13.499  1.00 22.62  ? 100  SER A O     1 
ATOM   1280 C  CB    . SER C 3 100 ? 57.894 18.848  12.584  1.00 26.03  ? 100  SER A CB    1 
ATOM   1281 O  OG    . SER C 3 100 ? 57.085 18.073  13.459  1.00 25.35  ? 100  SER A OG    1 
ATOM   1282 N  N     . ASN C 3 101 ? 57.810 20.612  15.401  1.00 23.09  ? 101  ASN A N     1 
ATOM   1283 C  CA    . ASN C 3 101 ? 57.037 21.515  16.251  1.00 21.68  ? 101  ASN A CA    1 
ATOM   1284 C  C     . ASN C 3 101 ? 57.815 22.771  16.648  1.00 19.61  ? 101  ASN A C     1 
ATOM   1285 O  O     . ASN C 3 101 ? 57.225 23.763  17.077  1.00 21.83  ? 101  ASN A O     1 
ATOM   1286 C  CB    . ASN C 3 101 ? 56.558 20.776  17.511  1.00 26.17  ? 101  ASN A CB    1 
ATOM   1287 C  CG    . ASN C 3 101 ? 57.707 20.218  18.352  1.00 31.13  ? 101  ASN A CG    1 
ATOM   1288 O  OD1   . ASN C 3 101 ? 58.612 19.561  17.839  1.00 33.08  ? 101  ASN A OD1   1 
ATOM   1289 N  ND2   . ASN C 3 101 ? 57.673 20.492  19.650  1.00 29.42  ? 101  ASN A ND2   1 
ATOM   1290 N  N     . LEU C 3 102 ? 59.136 22.723  16.491  1.00 15.28  ? 102  LEU A N     1 
ATOM   1291 C  CA    . LEU C 3 102 ? 60.001 23.843  16.837  1.00 13.36  ? 102  LEU A CA    1 
ATOM   1292 C  C     . LEU C 3 102 ? 60.501 24.689  15.655  1.00 14.00  ? 102  LEU A C     1 
ATOM   1293 O  O     . LEU C 3 102 ? 60.601 24.225  14.512  1.00 15.83  ? 102  LEU A O     1 
ATOM   1294 C  CB    . LEU C 3 102 ? 61.218 23.332  17.620  1.00 13.25  ? 102  LEU A CB    1 
ATOM   1295 C  CG    . LEU C 3 102 ? 61.026 22.520  18.903  1.00 9.62   ? 102  LEU A CG    1 
ATOM   1296 C  CD1   . LEU C 3 102 ? 62.392 22.163  19.465  1.00 12.65  ? 102  LEU A CD1   1 
ATOM   1297 C  CD2   . LEU C 3 102 ? 60.233 23.313  19.930  1.00 9.02   ? 102  LEU A CD2   1 
ATOM   1298 N  N     . LYS C 3 103 ? 60.834 25.937  15.958  1.00 11.94  ? 103  LYS A N     1 
ATOM   1299 C  CA    . LYS C 3 103 ? 61.357 26.870  14.972  1.00 7.75   ? 103  LYS A CA    1 
ATOM   1300 C  C     . LYS C 3 103 ? 62.873 26.699  14.946  1.00 8.68   ? 103  LYS A C     1 
ATOM   1301 O  O     . LYS C 3 103 ? 63.433 25.896  15.699  1.00 9.69   ? 103  LYS A O     1 
ATOM   1302 C  CB    . LYS C 3 103 ? 61.063 28.315  15.398  1.00 11.18  ? 103  LYS A CB    1 
ATOM   1303 C  CG    . LYS C 3 103 ? 59.609 28.710  15.453  1.00 12.07  ? 103  LYS A CG    1 
ATOM   1304 C  CD    . LYS C 3 103 ? 59.033 28.820  14.055  1.00 16.76  ? 103  LYS A CD    1 
ATOM   1305 C  CE    . LYS C 3 103 ? 57.562 29.174  14.098  1.00 19.08  ? 103  LYS A CE    1 
ATOM   1306 N  NZ    . LYS C 3 103 ? 57.019 29.456  12.744  1.00 14.52  ? 103  LYS A NZ    1 
ATOM   1307 N  N     . ASP C 3 104 ? 63.523 27.449  14.060  1.00 10.05  ? 104  ASP A N     1 
ATOM   1308 C  CA    . ASP C 3 104 ? 64.981 27.479  13.942  1.00 6.53   ? 104  ASP A CA    1 
ATOM   1309 C  C     . ASP C 3 104 ? 65.359 28.800  13.248  1.00 12.94  ? 104  ASP A C     1 
ATOM   1310 O  O     . ASP C 3 104 ? 64.513 29.444  12.621  1.00 14.46  ? 104  ASP A O     1 
ATOM   1311 C  CB    . ASP C 3 104 ? 65.585 26.203  13.285  1.00 13.43  ? 104  ASP A CB    1 
ATOM   1312 C  CG    . ASP C 3 104 ? 65.327 26.092  11.789  1.00 16.24  ? 104  ASP A CG    1 
ATOM   1313 O  OD1   . ASP C 3 104 ? 66.028 26.755  11.007  1.00 23.00  ? 104  ASP A OD1   1 
ATOM   1314 O  OD2   . ASP C 3 104 ? 64.462 25.299  11.389  1.00 19.88  ? 104  ASP A OD2   1 
ATOM   1315 N  N     . THR C 3 105 ? 66.607 29.231  13.397  1.00 18.04  ? 105  THR A N     1 
ATOM   1316 C  CA    . THR C 3 105 ? 67.055 30.498  12.814  1.00 20.63  ? 105  THR A CA    1 
ATOM   1317 C  C     . THR C 3 105 ? 67.414 30.488  11.326  1.00 24.23  ? 105  THR A C     1 
ATOM   1318 O  O     . THR C 3 105 ? 67.961 31.468  10.819  1.00 19.82  ? 105  THR A O     1 
ATOM   1319 C  CB    . THR C 3 105 ? 68.263 31.050  13.582  1.00 17.53  ? 105  THR A CB    1 
ATOM   1320 O  OG1   . THR C 3 105 ? 69.346 30.126  13.469  1.00 15.47  ? 105  THR A OG1   1 
ATOM   1321 C  CG2   . THR C 3 105 ? 67.924 31.245  15.055  1.00 16.78  ? 105  THR A CG2   1 
ATOM   1322 N  N     . ASP C 3 106 ? 67.090 29.396  10.633  1.00 24.26  ? 106  ASP A N     1 
ATOM   1323 C  CA    . ASP C 3 106 ? 67.391 29.224  9.206   1.00 24.69  ? 106  ASP A CA    1 
ATOM   1324 C  C     . ASP C 3 106 ? 68.853 29.574  8.956   1.00 22.11  ? 106  ASP A C     1 
ATOM   1325 O  O     . ASP C 3 106 ? 69.180 30.432  8.137   1.00 18.27  ? 106  ASP A O     1 
ATOM   1326 C  CB    . ASP C 3 106 ? 66.465 30.071  8.329   1.00 24.04  ? 106  ASP A CB    1 
ATOM   1327 C  CG    . ASP C 3 106 ? 66.469 29.626  6.867   1.00 29.83  ? 106  ASP A CG    1 
ATOM   1328 O  OD1   . ASP C 3 106 ? 67.031 28.549  6.564   1.00 34.35  ? 106  ASP A OD1   1 
ATOM   1329 O  OD2   . ASP C 3 106 ? 65.906 30.354  6.014   1.00 30.51  ? 106  ASP A OD2   1 
ATOM   1330 N  N     . MET C 3 107 ? 69.709 28.909  9.730   1.00 21.06  ? 107  MET A N     1 
ATOM   1331 C  CA    . MET C 3 107 ? 71.157 29.065  9.704   1.00 21.14  ? 107  MET A CA    1 
ATOM   1332 C  C     . MET C 3 107 ? 71.629 30.497  9.951   1.00 21.29  ? 107  MET A C     1 
ATOM   1333 O  O     . MET C 3 107 ? 72.464 31.023  9.211   1.00 22.33  ? 107  MET A O     1 
ATOM   1334 C  CB    . MET C 3 107 ? 71.748 28.480  8.414   1.00 20.51  ? 107  MET A CB    1 
ATOM   1335 C  CG    . MET C 3 107 ? 71.691 26.952  8.361   1.00 23.84  ? 107  MET A CG    1 
ATOM   1336 S  SD    . MET C 3 107 ? 72.590 26.141  9.737   1.00 32.99  ? 107  MET A SD    1 
ATOM   1337 C  CE    . MET C 3 107 ? 74.312 26.272  9.146   1.00 19.97  ? 107  MET A CE    1 
ATOM   1338 N  N     . GLY C 3 108 ? 71.079 31.109  11.003  1.00 17.98  ? 108  GLY A N     1 
ATOM   1339 C  CA    . GLY C 3 108 ? 71.439 32.468  11.388  1.00 19.31  ? 108  GLY A CA    1 
ATOM   1340 C  C     . GLY C 3 108 ? 70.846 33.622  10.593  1.00 20.36  ? 108  GLY A C     1 
ATOM   1341 O  O     . GLY C 3 108 ? 71.178 34.783  10.844  1.00 23.87  ? 108  GLY A O     1 
ATOM   1342 N  N     . LEU C 3 109 ? 69.978 33.315  9.635   1.00 21.13  ? 109  LEU A N     1 
ATOM   1343 C  CA    . LEU C 3 109 ? 69.352 34.351  8.823   1.00 17.75  ? 109  LEU A CA    1 
ATOM   1344 C  C     . LEU C 3 109 ? 68.234 35.055  9.572   1.00 17.76  ? 109  LEU A C     1 
ATOM   1345 O  O     . LEU C 3 109 ? 67.958 36.233  9.319   1.00 22.96  ? 109  LEU A O     1 
ATOM   1346 C  CB    . LEU C 3 109 ? 68.814 33.764  7.518   1.00 11.90  ? 109  LEU A CB    1 
ATOM   1347 C  CG    . LEU C 3 109 ? 69.883 33.325  6.523   1.00 10.94  ? 109  LEU A CG    1 
ATOM   1348 C  CD1   . LEU C 3 109 ? 69.215 32.699  5.317   1.00 20.21  ? 109  LEU A CD1   1 
ATOM   1349 C  CD2   . LEU C 3 109 ? 70.731 34.515  6.101   1.00 18.95  ? 109  LEU A CD2   1 
ATOM   1350 N  N     . LEU C 3 110 ? 67.596 34.338  10.496  1.00 14.29  ? 110  LEU A N     1 
ATOM   1351 C  CA    . LEU C 3 110 ? 66.500 34.903  11.276  1.00 18.67  ? 110  LEU A CA    1 
ATOM   1352 C  C     . LEU C 3 110 ? 66.914 35.315  12.682  1.00 27.01  ? 110  LEU A C     1 
ATOM   1353 O  O     . LEU C 3 110 ? 67.770 34.680  13.305  1.00 25.83  ? 110  LEU A O     1 
ATOM   1354 C  CB    . LEU C 3 110 ? 65.336 33.920  11.359  1.00 16.15  ? 110  LEU A CB    1 
ATOM   1355 C  CG    . LEU C 3 110 ? 64.748 33.406  10.046  1.00 22.20  ? 110  LEU A CG    1 
ATOM   1356 C  CD1   . LEU C 3 110 ? 63.644 32.425  10.371  1.00 24.01  ? 110  LEU A CD1   1 
ATOM   1357 C  CD2   . LEU C 3 110 ? 64.212 34.552  9.203   1.00 13.25  ? 110  LEU A CD2   1 
ATOM   1358 N  N     . ARG C 3 111 ? 66.312 36.408  13.154  1.00 40.47  ? 111  ARG A N     1 
ATOM   1359 C  CA    . ARG C 3 111 ? 66.564 36.945  14.488  1.00 49.02  ? 111  ARG A CA    1 
ATOM   1360 C  C     . ARG C 3 111 ? 66.120 35.897  15.506  1.00 44.03  ? 111  ARG A C     1 
ATOM   1361 O  O     . ARG C 3 111 ? 64.950 35.508  15.531  1.00 56.40  ? 111  ARG A O     1 
ATOM   1362 C  CB    . ARG C 3 111 ? 65.769 38.243  14.690  1.00 63.24  ? 111  ARG A CB    1 
ATOM   1363 C  CG    . ARG C 3 111 ? 66.348 39.466  13.986  1.00 75.41  ? 111  ARG A CG    1 
ATOM   1364 C  CD    . ARG C 3 111 ? 65.345 40.621  13.913  1.00 73.70  ? 111  ARG A CD    1 
ATOM   1365 N  NE    . ARG C 3 111 ? 64.436 40.491  12.772  1.00 77.14  ? 111  ARG A NE    1 
ATOM   1366 C  CZ    . ARG C 3 111 ? 63.392 41.285  12.534  1.00 72.46  ? 111  ARG A CZ    1 
ATOM   1367 N  NH1   . ARG C 3 111 ? 63.098 42.283  13.358  1.00 78.74  ? 111  ARG A NH1   1 
ATOM   1368 N  NH2   . ARG C 3 111 ? 62.647 41.089  11.450  1.00 72.93  ? 111  ARG A NH2   1 
ATOM   1369 N  N     . SER C 3 112 ? 67.059 35.445  16.334  1.00 34.17  ? 112  SER A N     1 
ATOM   1370 C  CA    . SER C 3 112 ? 66.788 34.427  17.356  1.00 31.09  ? 112  SER A CA    1 
ATOM   1371 C  C     . SER C 3 112 ? 65.677 34.799  18.346  1.00 31.56  ? 112  SER A C     1 
ATOM   1372 O  O     . SER C 3 112 ? 64.921 33.932  18.779  1.00 35.04  ? 112  SER A O     1 
ATOM   1373 C  CB    . SER C 3 112 ? 68.063 34.112  18.140  1.00 33.78  ? 112  SER A CB    1 
ATOM   1374 O  OG    . SER C 3 112 ? 69.146 33.850  17.270  1.00 44.47  ? 112  SER A OG    1 
ATOM   1375 N  N     . GLY C 3 113 ? 65.567 36.087  18.674  1.00 32.07  ? 113  GLY A N     1 
ATOM   1376 C  CA    . GLY C 3 113 ? 64.562 36.545  19.619  1.00 30.56  ? 113  GLY A CA    1 
ATOM   1377 C  C     . GLY C 3 113 ? 63.149 36.755  19.097  1.00 33.88  ? 113  GLY A C     1 
ATOM   1378 O  O     . GLY C 3 113 ? 62.201 36.797  19.887  1.00 36.15  ? 113  GLY A O     1 
ATOM   1379 N  N     . LYS C 3 114 ? 63.001 36.916  17.783  1.00 34.44  ? 114  LYS A N     1 
ATOM   1380 C  CA    . LYS C 3 114 ? 61.684 37.119  17.179  1.00 38.71  ? 114  LYS A CA    1 
ATOM   1381 C  C     . LYS C 3 114 ? 60.959 35.780  17.001  1.00 38.75  ? 114  LYS A C     1 
ATOM   1382 O  O     . LYS C 3 114 ? 59.764 35.748  16.687  1.00 41.37  ? 114  LYS A O     1 
ATOM   1383 C  CB    . LYS C 3 114 ? 61.824 37.826  15.821  1.00 50.79  ? 114  LYS A CB    1 
ATOM   1384 C  CG    . LYS C 3 114 ? 60.504 38.320  15.218  1.00 63.92  ? 114  LYS A CG    1 
ATOM   1385 C  CD    . LYS C 3 114 ? 60.713 38.958  13.848  1.00 65.23  ? 114  LYS A CD    1 
ATOM   1386 C  CE    . LYS C 3 114 ? 59.410 39.499  13.258  1.00 68.30  ? 114  LYS A CE    1 
ATOM   1387 N  NZ    . LYS C 3 114 ? 58.379 38.444  13.019  1.00 72.46  ? 114  LYS A NZ    1 
ATOM   1388 N  N     . LEU C 3 115 ? 61.684 34.683  17.215  1.00 29.43  ? 115  LEU A N     1 
ATOM   1389 C  CA    . LEU C 3 115 ? 61.121 33.343  17.069  1.00 29.09  ? 115  LEU A CA    1 
ATOM   1390 C  C     . LEU C 3 115 ? 60.426 32.842  18.331  1.00 29.14  ? 115  LEU A C     1 
ATOM   1391 O  O     . LEU C 3 115 ? 60.968 32.965  19.431  1.00 28.76  ? 115  LEU A O     1 
ATOM   1392 C  CB    . LEU C 3 115 ? 62.220 32.351  16.676  1.00 22.22  ? 115  LEU A CB    1 
ATOM   1393 C  CG    . LEU C 3 115 ? 62.942 32.587  15.348  1.00 18.71  ? 115  LEU A CG    1 
ATOM   1394 C  CD1   . LEU C 3 115 ? 64.161 31.695  15.264  1.00 17.35  ? 115  LEU A CD1   1 
ATOM   1395 C  CD2   . LEU C 3 115 ? 61.992 32.336  14.187  1.00 18.95  ? 115  LEU A CD2   1 
ATOM   1396 N  N     . PRO C 3 116 ? 59.200 32.297  18.188  1.00 26.31  ? 116  PRO A N     1 
ATOM   1397 C  CA    . PRO C 3 116 ? 58.426 31.771  19.318  1.00 21.04  ? 116  PRO A CA    1 
ATOM   1398 C  C     . PRO C 3 116 ? 58.929 30.397  19.773  1.00 19.32  ? 116  PRO A C     1 
ATOM   1399 O  O     . PRO C 3 116 ? 59.606 29.691  19.016  1.00 20.26  ? 116  PRO A O     1 
ATOM   1400 C  CB    . PRO C 3 116 ? 57.011 31.697  18.746  1.00 28.14  ? 116  PRO A CB    1 
ATOM   1401 C  CG    . PRO C 3 116 ? 57.264 31.340  17.313  1.00 27.87  ? 116  PRO A CG    1 
ATOM   1402 C  CD    . PRO C 3 116 ? 58.375 32.306  16.963  1.00 25.19  ? 116  PRO A CD    1 
ATOM   1403 N  N     . GLY C 3 117 ? 58.624 30.047  21.021  1.00 16.30  ? 117  GLY A N     1 
ATOM   1404 C  CA    . GLY C 3 117 ? 59.027 28.761  21.576  1.00 12.58  ? 117  GLY A CA    1 
ATOM   1405 C  C     . GLY C 3 117 ? 60.509 28.550  21.832  1.00 10.63  ? 117  GLY A C     1 
ATOM   1406 O  O     . GLY C 3 117 ? 61.296 29.490  21.861  1.00 18.81  ? 117  GLY A O     1 
ATOM   1407 N  N     . ALA C 3 118 ? 60.885 27.288  22.018  1.00 14.66  ? 124  ALA A N     1 
ATOM   1408 C  CA    . ALA C 3 118 ? 62.276 26.913  22.278  1.00 13.96  ? 124  ALA A CA    1 
ATOM   1409 C  C     . ALA C 3 118 ? 63.028 26.532  21.002  1.00 14.96  ? 124  ALA A C     1 
ATOM   1410 O  O     . ALA C 3 118 ? 62.422 26.293  19.953  1.00 16.11  ? 124  ALA A O     1 
ATOM   1411 C  CB    . ALA C 3 118 ? 62.317 25.750  23.259  1.00 11.69  ? 124  ALA A CB    1 
ATOM   1412 N  N     . LEU C 3 119 ? 64.350 26.462  21.103  1.00 7.36   ? 125  LEU A N     1 
ATOM   1413 C  CA    . LEU C 3 119 ? 65.177 26.099  19.970  1.00 15.13  ? 125  LEU A CA    1 
ATOM   1414 C  C     . LEU C 3 119 ? 66.103 24.956  20.376  1.00 12.45  ? 125  LEU A C     1 
ATOM   1415 O  O     . LEU C 3 119 ? 66.726 25.004  21.438  1.00 15.26  ? 125  LEU A O     1 
ATOM   1416 C  CB    . LEU C 3 119 ? 66.007 27.303  19.520  1.00 14.79  ? 125  LEU A CB    1 
ATOM   1417 C  CG    . LEU C 3 119 ? 65.262 28.616  19.241  1.00 23.80  ? 125  LEU A CG    1 
ATOM   1418 C  CD1   . LEU C 3 119 ? 66.255 29.701  18.833  1.00 17.92  ? 125  LEU A CD1   1 
ATOM   1419 C  CD2   . LEU C 3 119 ? 64.205 28.416  18.152  1.00 21.50  ? 125  LEU A CD2   1 
ATOM   1420 N  N     . GLU C 3 120 ? 66.197 23.935  19.527  1.00 14.12  ? 126  GLU A N     1 
ATOM   1421 C  CA    . GLU C 3 120 ? 67.058 22.778  19.789  1.00 11.92  ? 126  GLU A CA    1 
ATOM   1422 C  C     . GLU C 3 120 ? 68.488 23.316  19.938  1.00 14.39  ? 126  GLU A C     1 
ATOM   1423 O  O     . GLU C 3 120 ? 68.961 24.088  19.101  1.00 22.63  ? 126  GLU A O     1 
ATOM   1424 C  CB    . GLU C 3 120 ? 66.923 21.767  18.637  1.00 17.11  ? 126  GLU A CB    1 
ATOM   1425 C  CG    . GLU C 3 120 ? 67.451 20.362  18.924  1.00 20.56  ? 126  GLU A CG    1 
ATOM   1426 C  CD    . GLU C 3 120 ? 68.962 20.298  18.937  1.00 21.05  ? 126  GLU A CD    1 
ATOM   1427 O  OE1   . GLU C 3 120 ? 69.575 20.730  17.944  1.00 19.26  ? 126  GLU A OE1   1 
ATOM   1428 O  OE2   . GLU C 3 120 ? 69.540 19.834  19.937  1.00 22.97  ? 126  GLU A OE2   1 
ATOM   1429 N  N     . ALA C 3 121 ? 69.152 22.921  21.019  1.00 13.74  ? 127  ALA A N     1 
ATOM   1430 C  CA    . ALA C 3 121 ? 70.502 23.374  21.349  1.00 8.31   ? 127  ALA A CA    1 
ATOM   1431 C  C     . ALA C 3 121 ? 71.647 23.232  20.349  1.00 15.19  ? 127  ALA A C     1 
ATOM   1432 O  O     . ALA C 3 121 ? 72.315 24.224  20.037  1.00 15.22  ? 127  ALA A O     1 
ATOM   1433 C  CB    . ALA C 3 121 ? 70.921 22.785  22.697  1.00 16.41  ? 127  ALA A CB    1 
ATOM   1434 N  N     . TRP C 3 122 ? 71.911 22.009  19.892  1.00 17.64  ? 128  TRP A N     1 
ATOM   1435 C  CA    . TRP C 3 122 ? 72.998 21.756  18.945  1.00 12.14  ? 128  TRP A CA    1 
ATOM   1436 C  C     . TRP C 3 122 ? 72.800 22.496  17.619  1.00 16.11  ? 128  TRP A C     1 
ATOM   1437 O  O     . TRP C 3 122 ? 73.743 23.070  17.072  1.00 12.40  ? 128  TRP A O     1 
ATOM   1438 C  CB    . TRP C 3 122 ? 73.149 20.255  18.699  1.00 16.27  ? 128  TRP A CB    1 
ATOM   1439 C  CG    . TRP C 3 122 ? 73.455 19.431  19.938  1.00 22.09  ? 128  TRP A CG    1 
ATOM   1440 C  CD1   . TRP C 3 122 ? 72.784 18.323  20.364  1.00 18.24  ? 128  TRP A CD1   1 
ATOM   1441 C  CD2   . TRP C 3 122 ? 74.528 19.632  20.879  1.00 25.70  ? 128  TRP A CD2   1 
ATOM   1442 N  NE1   . TRP C 3 122 ? 73.368 17.817  21.502  1.00 25.63  ? 128  TRP A NE1   1 
ATOM   1443 C  CE2   . TRP C 3 122 ? 74.439 18.598  21.841  1.00 25.42  ? 128  TRP A CE2   1 
ATOM   1444 C  CE3   . TRP C 3 122 ? 75.554 20.583  21.002  1.00 26.23  ? 128  TRP A CE3   1 
ATOM   1445 C  CZ2   . TRP C 3 122 ? 75.337 18.485  22.912  1.00 24.60  ? 128  TRP A CZ2   1 
ATOM   1446 C  CZ3   . TRP C 3 122 ? 76.451 20.471  22.071  1.00 27.60  ? 128  TRP A CZ3   1 
ATOM   1447 C  CH2   . TRP C 3 122 ? 76.334 19.427  23.010  1.00 24.01  ? 128  TRP A CH2   1 
ATOM   1448 N  N     . GLY C 3 123 ? 71.563 22.501  17.136  1.00 12.73  ? 129  GLY A N     1 
ATOM   1449 C  CA    . GLY C 3 123 ? 71.227 23.178  15.900  1.00 9.77   ? 129  GLY A CA    1 
ATOM   1450 C  C     . GLY C 3 123 ? 71.343 24.674  16.111  1.00 14.43  ? 129  GLY A C     1 
ATOM   1451 O  O     . GLY C 3 123 ? 71.770 25.397  15.209  1.00 13.88  ? 129  GLY A O     1 
ATOM   1452 N  N     . TYR C 3 124 ? 70.971 25.146  17.301  1.00 13.42  ? 130  TYR A N     1 
ATOM   1453 C  CA    . TYR C 3 124 ? 71.074 26.570  17.601  1.00 16.31  ? 130  TYR A CA    1 
ATOM   1454 C  C     . TYR C 3 124 ? 72.541 26.988  17.482  1.00 10.20  ? 130  TYR A C     1 
ATOM   1455 O  O     . TYR C 3 124 ? 72.847 27.974  16.822  1.00 11.42  ? 130  TYR A O     1 
ATOM   1456 C  CB    . TYR C 3 124 ? 70.567 26.905  19.017  1.00 15.67  ? 130  TYR A CB    1 
ATOM   1457 C  CG    . TYR C 3 124 ? 70.788 28.365  19.373  1.00 11.71  ? 130  TYR A CG    1 
ATOM   1458 C  CD1   . TYR C 3 124 ? 69.892 29.342  18.956  1.00 12.11  ? 130  TYR A CD1   1 
ATOM   1459 C  CD2   . TYR C 3 124 ? 71.932 28.773  20.066  1.00 16.19  ? 130  TYR A CD2   1 
ATOM   1460 C  CE1   . TYR C 3 124 ? 70.127 30.700  19.211  1.00 14.62  ? 130  TYR A CE1   1 
ATOM   1461 C  CE2   . TYR C 3 124 ? 72.180 30.129  20.325  1.00 21.95  ? 130  TYR A CE2   1 
ATOM   1462 C  CZ    . TYR C 3 124 ? 71.273 31.087  19.894  1.00 14.41  ? 130  TYR A CZ    1 
ATOM   1463 O  OH    . TYR C 3 124 ? 71.524 32.429  20.127  1.00 21.18  ? 130  TYR A OH    1 
ATOM   1464 N  N     . ARG C 3 125 ? 73.436 26.239  18.131  1.00 13.20  ? 131  ARG A N     1 
ATOM   1465 C  CA    . ARG C 3 125 ? 74.868 26.536  18.099  1.00 15.03  ? 131  ARG A CA    1 
ATOM   1466 C  C     . ARG C 3 125 ? 75.425 26.543  16.679  1.00 16.70  ? 131  ARG A C     1 
ATOM   1467 O  O     . ARG C 3 125 ? 76.197 27.429  16.321  1.00 22.20  ? 131  ARG A O     1 
ATOM   1468 C  CB    . ARG C 3 125 ? 75.654 25.548  18.972  1.00 20.12  ? 131  ARG A CB    1 
ATOM   1469 C  CG    . ARG C 3 125 ? 75.799 25.970  20.433  1.00 36.60  ? 131  ARG A CG    1 
ATOM   1470 C  CD    . ARG C 3 125 ? 76.792 27.136  20.586  1.00 42.85  ? 131  ARG A CD    1 
ATOM   1471 N  NE    . ARG C 3 125 ? 76.752 27.733  21.921  1.00 39.69  ? 131  ARG A NE    1 
ATOM   1472 C  CZ    . ARG C 3 125 ? 76.262 28.942  22.190  1.00 45.81  ? 131  ARG A CZ    1 
ATOM   1473 N  NH1   . ARG C 3 125 ? 75.774 29.701  21.211  1.00 43.29  ? 131  ARG A NH1   1 
ATOM   1474 N  NH2   . ARG C 3 125 ? 76.229 29.385  23.446  1.00 41.13  ? 131  ARG A NH2   1 
ATOM   1475 N  N     . LEU C 3 126 ? 75.008 25.576  15.865  1.00 14.18  ? 132  LEU A N     1 
ATOM   1476 C  CA    . LEU C 3 126 ? 75.469 25.482  14.482  1.00 11.09  ? 132  LEU A CA    1 
ATOM   1477 C  C     . LEU C 3 126 ? 75.014 26.704  13.680  1.00 7.82   ? 132  LEU A C     1 
ATOM   1478 O  O     . LEU C 3 126 ? 75.779 27.250  12.892  1.00 14.99  ? 132  LEU A O     1 
ATOM   1479 C  CB    . LEU C 3 126 ? 74.983 24.169  13.850  1.00 9.62   ? 132  LEU A CB    1 
ATOM   1480 C  CG    . LEU C 3 126 ? 75.684 22.931  14.425  1.00 7.78   ? 132  LEU A CG    1 
ATOM   1481 C  CD1   . LEU C 3 126 ? 75.000 21.629  14.029  1.00 5.81   ? 132  LEU A CD1   1 
ATOM   1482 C  CD2   . LEU C 3 126 ? 77.130 22.940  13.979  1.00 10.96  ? 132  LEU A CD2   1 
ATOM   1483 N  N     . GLY C 3 127 ? 73.792 27.163  13.933  1.00 4.66   ? 133  GLY A N     1 
ATOM   1484 C  CA    . GLY C 3 127 ? 73.276 28.330  13.239  1.00 3.85   ? 133  GLY A CA    1 
ATOM   1485 C  C     . GLY C 3 127 ? 73.903 29.645  13.683  1.00 14.40  ? 133  GLY A C     1 
ATOM   1486 O  O     . GLY C 3 127 ? 73.803 30.651  12.977  1.00 19.39  ? 133  GLY A O     1 
ATOM   1487 N  N     . GLU C 3 128 ? 74.577 29.638  14.831  1.00 15.97  ? 134  GLU A N     1 
ATOM   1488 C  CA    . GLU C 3 128 ? 75.208 30.844  15.370  1.00 15.11  ? 134  GLU A CA    1 
ATOM   1489 C  C     . GLU C 3 128 ? 76.713 30.925  15.161  1.00 16.00  ? 134  GLU A C     1 
ATOM   1490 O  O     . GLU C 3 128 ? 77.308 31.975  15.404  1.00 14.73  ? 134  GLU A O     1 
ATOM   1491 C  CB    . GLU C 3 128 ? 74.929 30.959  16.875  1.00 21.50  ? 134  GLU A CB    1 
ATOM   1492 C  CG    . GLU C 3 128 ? 73.471 31.143  17.239  1.00 22.31  ? 134  GLU A CG    1 
ATOM   1493 C  CD    . GLU C 3 128 ? 72.877 32.410  16.657  1.00 28.09  ? 134  GLU A CD    1 
ATOM   1494 O  OE1   . GLU C 3 128 ? 73.427 33.500  16.931  1.00 31.73  ? 134  GLU A OE1   1 
ATOM   1495 O  OE2   . GLU C 3 128 ? 71.860 32.315  15.932  1.00 27.80  ? 134  GLU A OE2   1 
ATOM   1496 N  N     . MET C 3 129 ? 77.323 29.837  14.696  1.00 15.44  ? 135  MET A N     1 
ATOM   1497 C  CA    . MET C 3 129 ? 78.766 29.789  14.490  1.00 18.81  ? 135  MET A CA    1 
ATOM   1498 C  C     . MET C 3 129 ? 79.378 30.912  13.663  1.00 17.38  ? 135  MET A C     1 
ATOM   1499 O  O     . MET C 3 129 ? 80.467 31.386  13.977  1.00 22.89  ? 135  MET A O     1 
ATOM   1500 C  CB    . MET C 3 129 ? 79.176 28.431  13.913  1.00 35.79  ? 135  MET A CB    1 
ATOM   1501 C  CG    . MET C 3 129 ? 79.024 27.257  14.885  1.00 56.53  ? 135  MET A CG    1 
ATOM   1502 S  SD    . MET C 3 129 ? 80.113 27.287  16.349  1.00 63.72  ? 135  MET A SD    1 
ATOM   1503 C  CE    . MET C 3 129 ? 79.023 28.007  17.577  1.00 61.88  ? 135  MET A CE    1 
ATOM   1504 N  N     . LYS C 3 130 ? 78.684 31.346  12.618  1.00 20.25  ? 136  LYS A N     1 
ATOM   1505 C  CA    . LYS C 3 130 ? 79.212 32.415  11.776  1.00 23.07  ? 136  LYS A CA    1 
ATOM   1506 C  C     . LYS C 3 130 ? 79.247 33.763  12.477  1.00 17.25  ? 136  LYS A C     1 
ATOM   1507 O  O     . LYS C 3 130 ? 80.263 34.447  12.426  1.00 15.73  ? 136  LYS A O     1 
ATOM   1508 C  CB    . LYS C 3 130 ? 78.446 32.493  10.457  1.00 21.12  ? 136  LYS A CB    1 
ATOM   1509 C  CG    . LYS C 3 130 ? 78.756 31.319  9.530   1.00 23.66  ? 136  LYS A CG    1 
ATOM   1510 C  CD    . LYS C 3 130 ? 77.937 31.368  8.261   1.00 23.18  ? 136  LYS A CD    1 
ATOM   1511 C  CE    . LYS C 3 130 ? 78.194 32.634  7.483   1.00 19.47  ? 136  LYS A CE    1 
ATOM   1512 N  NZ    . LYS C 3 130 ? 77.209 32.737  6.384   1.00 18.76  ? 136  LYS A NZ    1 
ATOM   1513 N  N     . GLY C 3 131 ? 78.158 34.124  13.156  1.00 14.59  ? 137  GLY A N     1 
ATOM   1514 C  CA    . GLY C 3 131 ? 78.110 35.394  13.868  1.00 17.10  ? 137  GLY A CA    1 
ATOM   1515 C  C     . GLY C 3 131 ? 79.077 35.394  15.043  1.00 18.79  ? 137  GLY A C     1 
ATOM   1516 O  O     . GLY C 3 131 ? 79.718 36.403  15.357  1.00 20.96  ? 137  GLY A O     1 
ATOM   1517 N  N     . GLU C 3 132 ? 79.198 34.225  15.661  1.00 15.84  ? 138  GLU A N     1 
ATOM   1518 C  CA    . GLU C 3 132 ? 80.067 33.997  16.802  1.00 19.38  ? 138  GLU A CA    1 
ATOM   1519 C  C     . GLU C 3 132 ? 81.527 34.072  16.373  1.00 23.06  ? 138  GLU A C     1 
ATOM   1520 O  O     . GLU C 3 132 ? 82.385 34.503  17.143  1.00 25.11  ? 138  GLU A O     1 
ATOM   1521 C  CB    . GLU C 3 132 ? 79.761 32.625  17.373  1.00 26.71  ? 138  GLU A CB    1 
ATOM   1522 C  CG    . GLU C 3 132 ? 80.013 32.487  18.834  1.00 37.44  ? 138  GLU A CG    1 
ATOM   1523 C  CD    . GLU C 3 132 ? 79.267 31.312  19.399  1.00 45.08  ? 138  GLU A CD    1 
ATOM   1524 O  OE1   . GLU C 3 132 ? 78.072 31.472  19.734  1.00 50.37  ? 138  GLU A OE1   1 
ATOM   1525 O  OE2   . GLU C 3 132 ? 79.868 30.226  19.492  1.00 45.42  ? 138  GLU A OE2   1 
ATOM   1526 N  N     . TYR C 3 133 ? 81.798 33.633  15.144  1.00 23.07  ? 139  TYR A N     1 
ATOM   1527 C  CA    . TYR C 3 133 ? 83.146 33.665  14.586  1.00 21.75  ? 139  TYR A CA    1 
ATOM   1528 C  C     . TYR C 3 133 ? 83.504 35.115  14.258  1.00 19.97  ? 139  TYR A C     1 
ATOM   1529 O  O     . TYR C 3 133 ? 84.649 35.536  14.435  1.00 20.35  ? 139  TYR A O     1 
ATOM   1530 C  CB    . TYR C 3 133 ? 83.237 32.789  13.326  1.00 22.13  ? 139  TYR A CB    1 
ATOM   1531 C  CG    . TYR C 3 133 ? 84.486 33.041  12.512  1.00 21.92  ? 139  TYR A CG    1 
ATOM   1532 C  CD1   . TYR C 3 133 ? 85.753 32.779  13.037  1.00 20.26  ? 139  TYR A CD1   1 
ATOM   1533 C  CD2   . TYR C 3 133 ? 84.403 33.598  11.236  1.00 22.22  ? 139  TYR A CD2   1 
ATOM   1534 C  CE1   . TYR C 3 133 ? 86.906 33.072  12.311  1.00 24.64  ? 139  TYR A CE1   1 
ATOM   1535 C  CE2   . TYR C 3 133 ? 85.551 33.894  10.500  1.00 24.50  ? 139  TYR A CE2   1 
ATOM   1536 C  CZ    . TYR C 3 133 ? 86.797 33.632  11.044  1.00 21.97  ? 139  TYR A CZ    1 
ATOM   1537 O  OH    . TYR C 3 133 ? 87.932 33.937  10.331  1.00 22.68  ? 139  TYR A OH    1 
ATOM   1538 N  N     . LYS C 3 134 ? 82.514 35.863  13.774  1.00 20.52  ? 140  LYS A N     1 
ATOM   1539 C  CA    . LYS C 3 134 ? 82.687 37.270  13.430  1.00 24.75  ? 140  LYS A CA    1 
ATOM   1540 C  C     . LYS C 3 134 ? 83.010 38.061  14.700  1.00 25.00  ? 140  LYS A C     1 
ATOM   1541 O  O     . LYS C 3 134 ? 83.800 39.000  14.657  1.00 29.91  ? 140  LYS A O     1 
ATOM   1542 C  CB    . LYS C 3 134 ? 81.420 37.820  12.767  1.00 25.86  ? 140  LYS A CB    1 
ATOM   1543 C  CG    . LYS C 3 134 ? 81.496 39.295  12.412  1.00 28.53  ? 140  LYS A CG    1 
ATOM   1544 C  CD    . LYS C 3 134 ? 80.171 39.820  11.904  1.00 28.19  ? 140  LYS A CD    1 
ATOM   1545 C  CE    . LYS C 3 134 ? 80.237 41.324  11.708  1.00 32.31  ? 140  LYS A CE    1 
ATOM   1546 N  NZ    . LYS C 3 134 ? 78.936 41.878  11.251  1.00 33.02  ? 140  LYS A NZ    1 
ATOM   1547 N  N     . ASP C 3 135 ? 82.408 37.671  15.824  1.00 24.58  ? 141  ASP A N     1 
ATOM   1548 C  CA    . ASP C 3 135 ? 82.661 38.340  17.105  1.00 26.97  ? 141  ASP A CA    1 
ATOM   1549 C  C     . ASP C 3 135 ? 84.100 38.082  17.573  1.00 24.90  ? 141  ASP A C     1 
ATOM   1550 O  O     . ASP C 3 135 ? 84.763 38.994  18.066  1.00 30.18  ? 141  ASP A O     1 
ATOM   1551 C  CB    . ASP C 3 135 ? 81.681 37.857  18.189  1.00 26.76  ? 141  ASP A CB    1 
ATOM   1552 C  CG    . ASP C 3 135 ? 80.246 38.299  17.939  1.00 25.25  ? 141  ASP A CG    1 
ATOM   1553 O  OD1   . ASP C 3 135 ? 80.032 39.323  17.256  1.00 30.77  ? 141  ASP A OD1   1 
ATOM   1554 O  OD2   . ASP C 3 135 ? 79.325 37.617  18.438  1.00 27.21  ? 141  ASP A OD2   1 
ATOM   1555 N  N     . ASP C 3 136 ? 84.569 36.844  17.414  1.00 25.68  ? 142  ASP A N     1 
ATOM   1556 C  CA    . ASP C 3 136 ? 85.924 36.467  17.811  1.00 28.12  ? 142  ASP A CA    1 
ATOM   1557 C  C     . ASP C 3 136 ? 86.966 37.123  16.928  1.00 28.88  ? 142  ASP A C     1 
ATOM   1558 O  O     . ASP C 3 136 ? 88.026 37.533  17.406  1.00 29.73  ? 142  ASP A O     1 
ATOM   1559 C  CB    . ASP C 3 136 ? 86.105 34.952  17.758  1.00 42.44  ? 142  ASP A CB    1 
ATOM   1560 C  CG    . ASP C 3 136 ? 85.504 34.255  18.952  1.00 49.45  ? 142  ASP A CG    1 
ATOM   1561 O  OD1   . ASP C 3 136 ? 84.268 34.288  19.105  1.00 59.68  ? 142  ASP A OD1   1 
ATOM   1562 O  OD2   . ASP C 3 136 ? 86.269 33.675  19.746  1.00 59.79  ? 142  ASP A OD2   1 
ATOM   1563 N  N     . PHE C 3 137 ? 86.655 37.221  15.638  1.00 27.02  ? 143  PHE A N     1 
ATOM   1564 C  CA    . PHE C 3 137 ? 87.553 37.828  14.663  1.00 24.05  ? 143  PHE A CA    1 
ATOM   1565 C  C     . PHE C 3 137 ? 87.667 39.334  14.918  1.00 25.00  ? 143  PHE A C     1 
ATOM   1566 O  O     . PHE C 3 137 ? 88.770 39.881  14.927  1.00 22.22  ? 143  PHE A O     1 
ATOM   1567 C  CB    . PHE C 3 137 ? 87.036 37.559  13.242  1.00 21.18  ? 143  PHE A CB    1 
ATOM   1568 C  CG    . PHE C 3 137 ? 87.993 37.969  12.153  1.00 16.36  ? 143  PHE A CG    1 
ATOM   1569 C  CD1   . PHE C 3 137 ? 88.943 37.073  11.674  1.00 11.05  ? 143  PHE A CD1   1 
ATOM   1570 C  CD2   . PHE C 3 137 ? 87.940 39.248  11.601  1.00 13.57  ? 143  PHE A CD2   1 
ATOM   1571 C  CE1   . PHE C 3 137 ? 89.824 37.440  10.662  1.00 17.60  ? 143  PHE A CE1   1 
ATOM   1572 C  CE2   . PHE C 3 137 ? 88.817 39.626  10.588  1.00 11.84  ? 143  PHE A CE2   1 
ATOM   1573 C  CZ    . PHE C 3 137 ? 89.761 38.722  10.117  1.00 11.12  ? 143  PHE A CZ    1 
ATOM   1574 N  N     . LYS C 3 138 ? 86.524 39.985  15.143  1.00 29.05  ? 144  LYS A N     1 
ATOM   1575 C  CA    . LYS C 3 138 ? 86.478 41.425  15.404  1.00 30.90  ? 144  LYS A CA    1 
ATOM   1576 C  C     . LYS C 3 138 ? 87.250 41.872  16.635  1.00 34.94  ? 144  LYS A C     1 
ATOM   1577 O  O     . LYS C 3 138 ? 87.943 42.890  16.582  1.00 31.30  ? 144  LYS A O     1 
ATOM   1578 C  CB    . LYS C 3 138 ? 85.038 41.923  15.517  1.00 28.44  ? 144  LYS A CB    1 
ATOM   1579 C  CG    . LYS C 3 138 ? 84.315 42.008  14.198  1.00 28.65  ? 144  LYS A CG    1 
ATOM   1580 C  CD    . LYS C 3 138 ? 82.936 42.622  14.348  1.00 30.62  ? 144  LYS A CD    1 
ATOM   1581 C  CE    . LYS C 3 138 ? 83.024 44.071  14.778  1.00 35.40  ? 144  LYS A CE    1 
ATOM   1582 N  NZ    . LYS C 3 138 ? 81.682 44.710  14.776  1.00 41.19  ? 144  LYS A NZ    1 
ATOM   1583 N  N     . ARG C 3 139 ? 87.125 41.137  17.742  1.00 30.94  ? 145  ARG A N     1 
ATOM   1584 C  CA    . ARG C 3 139 ? 87.847 41.509  18.952  1.00 38.36  ? 145  ARG A CA    1 
ATOM   1585 C  C     . ARG C 3 139 ? 89.337 41.196  18.875  1.00 37.34  ? 145  ARG A C     1 
ATOM   1586 O  O     . ARG C 3 139 ? 90.144 41.937  19.434  1.00 42.59  ? 145  ARG A O     1 
ATOM   1587 C  CB    . ARG C 3 139 ? 87.219 40.907  20.216  1.00 49.46  ? 145  ARG A CB    1 
ATOM   1588 C  CG    . ARG C 3 139 ? 87.218 39.397  20.333  1.00 59.84  ? 145  ARG A CG    1 
ATOM   1589 C  CD    . ARG C 3 139 ? 86.658 39.008  21.695  1.00 65.31  ? 145  ARG A CD    1 
ATOM   1590 N  NE    . ARG C 3 139 ? 86.417 37.575  21.838  1.00 60.35  ? 145  ARG A NE    1 
ATOM   1591 C  CZ    . ARG C 3 139 ? 85.264 36.971  21.558  1.00 58.53  ? 145  ARG A CZ    1 
ATOM   1592 N  NH1   . ARG C 3 139 ? 84.222 37.662  21.107  1.00 59.22  ? 145  ARG A NH1   1 
ATOM   1593 N  NH2   . ARG C 3 139 ? 85.144 35.666  21.756  1.00 70.48  ? 145  ARG A NH2   1 
ATOM   1594 N  N     . MET C 3 140 ? 89.707 40.120  18.176  1.00 42.84  ? 146  MET A N     1 
ATOM   1595 C  CA    . MET C 3 140 ? 91.123 39.768  18.023  1.00 56.03  ? 146  MET A CA    1 
ATOM   1596 C  C     . MET C 3 140 ? 91.846 40.878  17.256  1.00 56.10  ? 146  MET A C     1 
ATOM   1597 O  O     . MET C 3 140 ? 93.006 41.179  17.540  1.00 64.39  ? 146  MET A O     1 
ATOM   1598 C  CB    . MET C 3 140 ? 91.303 38.430  17.288  1.00 69.33  ? 146  MET A CB    1 
ATOM   1599 C  CG    . MET C 3 140 ? 91.183 37.192  18.175  1.00 92.84  ? 146  MET A CG    1 
ATOM   1600 S  SD    . MET C 3 140 ? 91.460 35.631  17.283  1.00 100.00 ? 146  MET A SD    1 
ATOM   1601 C  CE    . MET C 3 140 ? 93.140 35.237  17.736  1.00 99.22  ? 146  MET A CE    1 
ATOM   1602 N  N     . LEU C 3 141 ? 91.145 41.496  16.304  1.00 56.91  ? 147  LEU A N     1 
ATOM   1603 C  CA    . LEU C 3 141 ? 91.713 42.579  15.507  1.00 53.49  ? 147  LEU A CA    1 
ATOM   1604 C  C     . LEU C 3 141 ? 91.760 43.901  16.257  1.00 54.23  ? 147  LEU A C     1 
ATOM   1605 O  O     . LEU C 3 141 ? 92.684 44.693  16.061  1.00 57.16  ? 147  LEU A O     1 
ATOM   1606 C  CB    . LEU C 3 141 ? 90.955 42.773  14.193  1.00 47.10  ? 147  LEU A CB    1 
ATOM   1607 C  CG    . LEU C 3 141 ? 91.243 41.808  13.043  1.00 44.14  ? 147  LEU A CG    1 
ATOM   1608 C  CD1   . LEU C 3 141 ? 90.694 42.431  11.771  1.00 49.08  ? 147  LEU A CD1   1 
ATOM   1609 C  CD2   . LEU C 3 141 ? 92.744 41.567  12.888  1.00 41.66  ? 147  LEU A CD2   1 
ATOM   1610 N  N     . GLU C 3 142 ? 90.766 44.148  17.106  1.00 52.91  ? 148  GLU A N     1 
ATOM   1611 C  CA    . GLU C 3 142 ? 90.737 45.390  17.874  1.00 61.56  ? 148  GLU A CA    1 
ATOM   1612 C  C     . GLU C 3 142 ? 91.740 45.367  19.022  1.00 60.39  ? 148  GLU A C     1 
ATOM   1613 O  O     . GLU C 3 142 ? 92.031 46.405  19.620  1.00 74.38  ? 148  GLU A O     1 
ATOM   1614 C  CB    . GLU C 3 142 ? 89.327 45.702  18.370  1.00 74.49  ? 148  GLU A CB    1 
ATOM   1615 C  CG    . GLU C 3 142 ? 88.387 46.116  17.243  1.00 94.63  ? 148  GLU A CG    1 
ATOM   1616 C  CD    . GLU C 3 142 ? 87.037 46.595  17.739  1.00 99.35  ? 148  GLU A CD    1 
ATOM   1617 O  OE1   . GLU C 3 142 ? 86.987 47.645  18.417  1.00 98.66  ? 148  GLU A OE1   1 
ATOM   1618 O  OE2   . GLU C 3 142 ? 86.024 45.925  17.440  1.00 99.93  ? 148  GLU A OE2   1 
ATOM   1619 N  N     . GLU C 3 143 ? 92.261 44.178  19.325  1.00 56.58  ? 149  GLU A N     1 
ATOM   1620 C  CA    . GLU C 3 143 ? 93.264 44.018  20.373  1.00 54.92  ? 149  GLU A CA    1 
ATOM   1621 C  C     . GLU C 3 143 ? 94.600 44.411  19.757  1.00 55.17  ? 149  GLU A C     1 
ATOM   1622 O  O     . GLU C 3 143 ? 95.435 45.037  20.413  1.00 62.87  ? 149  GLU A O     1 
ATOM   1623 C  CB    . GLU C 3 143 ? 93.348 42.566  20.853  1.00 57.23  ? 149  GLU A CB    1 
ATOM   1624 C  CG    . GLU C 3 143 ? 92.181 42.087  21.704  1.00 64.26  ? 149  GLU A CG    1 
ATOM   1625 C  CD    . GLU C 3 143 ? 92.317 40.628  22.127  1.00 68.03  ? 149  GLU A CD    1 
ATOM   1626 O  OE1   . GLU C 3 143 ? 92.914 39.823  21.376  1.00 71.16  ? 149  GLU A OE1   1 
ATOM   1627 O  OE2   . GLU C 3 143 ? 91.819 40.281  23.216  1.00 70.96  ? 149  GLU A OE2   1 
ATOM   1628 N  N     . GLN C 3 144 ? 94.791 44.031  18.493  1.00 57.30  ? 150  GLN A N     1 
ATOM   1629 C  CA    . GLN C 3 144 ? 96.019 44.336  17.759  1.00 59.39  ? 150  GLN A CA    1 
ATOM   1630 C  C     . GLN C 3 144 ? 96.008 45.729  17.129  1.00 58.52  ? 150  GLN A C     1 
ATOM   1631 O  O     . GLN C 3 144 ? 96.958 46.106  16.438  1.00 60.11  ? 150  GLN A O     1 
ATOM   1632 C  CB    . GLN C 3 144 ? 96.278 43.276  16.685  1.00 60.62  ? 150  GLN A CB    1 
ATOM   1633 C  CG    . GLN C 3 144 ? 96.290 41.848  17.212  1.00 69.63  ? 150  GLN A CG    1 
ATOM   1634 C  CD    . GLN C 3 144 ? 97.170 41.671  18.438  1.00 69.33  ? 150  GLN A CD    1 
ATOM   1635 O  OE1   . GLN C 3 144 ? 98.355 42.015  18.428  1.00 75.94  ? 150  GLN A OE1   1 
ATOM   1636 N  NE2   . GLN C 3 144 ? 96.594 41.115  19.500  1.00 66.88  ? 150  GLN A NE2   1 
ATOM   1637 N  N     . GLY C 3 145 ? 94.928 46.477  17.363  1.00 53.55  ? 151  GLY A N     1 
ATOM   1638 C  CA    . GLY C 3 145 ? 94.799 47.827  16.838  1.00 48.89  ? 151  GLY A CA    1 
ATOM   1639 C  C     . GLY C 3 145 ? 94.312 47.956  15.406  1.00 48.73  ? 151  GLY A C     1 
ATOM   1640 O  O     . GLY C 3 145 ? 94.000 49.062  14.953  1.00 51.42  ? 151  GLY A O     1 
ATOM   1641 N  N     . GLU C 3 146 ? 94.248 46.834  14.694  1.00 49.46  ? 152  GLU A N     1 
ATOM   1642 C  CA    . GLU C 3 146 ? 93.801 46.819  13.304  1.00 49.57  ? 152  GLU A CA    1 
ATOM   1643 C  C     . GLU C 3 146 ? 92.288 47.033  13.193  1.00 43.15  ? 152  GLU A C     1 
ATOM   1644 O  O     . GLU C 3 146 ? 91.532 46.677  14.096  1.00 52.44  ? 152  GLU A O     1 
ATOM   1645 C  CB    . GLU C 3 146 ? 94.236 45.512  12.636  1.00 59.28  ? 152  GLU A CB    1 
ATOM   1646 C  CG    . GLU C 3 146 ? 95.756 45.344  12.590  1.00 68.58  ? 152  GLU A CG    1 
ATOM   1647 C  CD    . GLU C 3 146 ? 96.194 43.983  12.083  1.00 77.43  ? 152  GLU A CD    1 
ATOM   1648 O  OE1   . GLU C 3 146 ? 96.225 43.032  12.896  1.00 75.69  ? 152  GLU A OE1   1 
ATOM   1649 O  OE2   . GLU C 3 146 ? 96.517 43.867  10.878  1.00 74.66  ? 152  GLU A OE2   1 
ATOM   1650 N  N     . GLU C 3 147 ? 91.859 47.631  12.086  1.00 34.41  ? 153  GLU A N     1 
ATOM   1651 C  CA    . GLU C 3 147 ? 90.446 47.917  11.868  1.00 36.38  ? 153  GLU A CA    1 
ATOM   1652 C  C     . GLU C 3 147 ? 89.670 46.846  11.121  1.00 34.00  ? 153  GLU A C     1 
ATOM   1653 O  O     . GLU C 3 147 ? 90.179 46.227  10.186  1.00 39.24  ? 153  GLU A O     1 
ATOM   1654 C  CB    . GLU C 3 147 ? 90.279 49.251  11.139  1.00 47.41  ? 153  GLU A CB    1 
ATOM   1655 C  CG    . GLU C 3 147 ? 90.787 50.457  11.910  1.00 59.72  ? 153  GLU A CG    1 
ATOM   1656 C  CD    . GLU C 3 147 ? 90.463 51.769  11.218  1.00 67.21  ? 153  GLU A CD    1 
ATOM   1657 O  OE1   . GLU C 3 147 ? 90.787 51.910  10.019  1.00 68.79  ? 153  GLU A OE1   1 
ATOM   1658 O  OE2   . GLU C 3 147 ? 89.883 52.660  11.875  1.00 74.89  ? 153  GLU A OE2   1 
ATOM   1659 N  N     . TYR C 3 148 ? 88.425 46.645  11.547  1.00 33.77  ? 154  TYR A N     1 
ATOM   1660 C  CA    . TYR C 3 148 ? 87.537 45.667  10.932  1.00 30.75  ? 154  TYR A CA    1 
ATOM   1661 C  C     . TYR C 3 148 ? 86.776 46.320  9.788   1.00 30.68  ? 154  TYR A C     1 
ATOM   1662 O  O     . TYR C 3 148 ? 86.277 47.440  9.924   1.00 26.93  ? 154  TYR A O     1 
ATOM   1663 C  CB    . TYR C 3 148 ? 86.547 45.104  11.958  1.00 29.05  ? 154  TYR A CB    1 
ATOM   1664 C  CG    . TYR C 3 148 ? 85.481 44.209  11.349  1.00 28.82  ? 154  TYR A CG    1 
ATOM   1665 C  CD1   . TYR C 3 148 ? 85.772 42.886  10.989  1.00 17.68  ? 154  TYR A CD1   1 
ATOM   1666 C  CD2   . TYR C 3 148 ? 84.187 44.691  11.111  1.00 23.34  ? 154  TYR A CD2   1 
ATOM   1667 C  CE1   . TYR C 3 148 ? 84.803 42.070  10.412  1.00 19.92  ? 154  TYR A CE1   1 
ATOM   1668 C  CE2   . TYR C 3 148 ? 83.211 43.881  10.531  1.00 19.33  ? 154  TYR A CE2   1 
ATOM   1669 C  CZ    . TYR C 3 148 ? 83.526 42.575  10.184  1.00 17.93  ? 154  TYR A CZ    1 
ATOM   1670 O  OH    . TYR C 3 148 ? 82.567 41.777  9.606   1.00 17.40  ? 154  TYR A OH    1 
ATOM   1671 N  N     . VAL C 3 149 ? 86.671 45.594  8.677   1.00 34.42  ? 155  VAL A N     1 
ATOM   1672 C  CA    . VAL C 3 149 ? 85.983 46.067  7.477   1.00 31.15  ? 155  VAL A CA    1 
ATOM   1673 C  C     . VAL C 3 149 ? 84.886 45.101  7.038   1.00 34.73  ? 155  VAL A C     1 
ATOM   1674 O  O     . VAL C 3 149 ? 85.028 43.887  7.186   1.00 29.86  ? 155  VAL A O     1 
ATOM   1675 C  CB    . VAL C 3 149 ? 86.986 46.226  6.302   1.00 29.63  ? 155  VAL A CB    1 
ATOM   1676 C  CG1   . VAL C 3 149 ? 86.277 46.704  5.040   1.00 22.91  ? 155  VAL A CG1   1 
ATOM   1677 C  CG2   . VAL C 3 149 ? 88.098 47.191  6.687   1.00 27.57  ? 155  VAL A CG2   1 
ATOM   1678 N  N     . ASP C 3 150 ? 83.802 45.674  6.513   1.00 42.74  ? 156  ASP A N     1 
ATOM   1679 C  CA    . ASP C 3 150 ? 82.626 44.965  5.991   1.00 54.68  ? 156  ASP A CA    1 
ATOM   1680 C  C     . ASP C 3 150 ? 82.390 43.549  6.509   1.00 49.06  ? 156  ASP A C     1 
ATOM   1681 O  O     . ASP C 3 150 ? 81.591 43.340  7.420   1.00 66.07  ? 156  ASP A O     1 
ATOM   1682 C  CB    . ASP C 3 150 ? 82.674 44.939  4.450   1.00 76.71  ? 156  ASP A CB    1 
ATOM   1683 C  CG    . ASP C 3 150 ? 82.516 46.323  3.817   1.00 88.63  ? 156  ASP A CG    1 
ATOM   1684 O  OD1   . ASP C 3 150 ? 83.120 47.305  4.301   1.00 91.07  ? 156  ASP A OD1   1 
ATOM   1685 O  OD2   . ASP C 3 150 ? 81.787 46.421  2.809   1.00 91.98  ? 156  ASP A OD2   1 
ATOM   1686 N  N     . GLY C 3 151 ? 83.089 42.586  5.910   1.00 37.89  ? 157  GLY A N     1 
ATOM   1687 C  CA    . GLY C 3 151 ? 82.969 41.192  6.298   1.00 22.27  ? 157  GLY A CA    1 
ATOM   1688 C  C     . GLY C 3 151 ? 84.277 40.493  5.980   1.00 20.51  ? 157  GLY A C     1 
ATOM   1689 O  O     . GLY C 3 151 ? 84.293 39.411  5.388   1.00 19.87  ? 157  GLY A O     1 
ATOM   1690 N  N     . MET C 3 152 ? 85.376 41.098  6.424   1.00 12.44  ? 158  MET A N     1 
ATOM   1691 C  CA    . MET C 3 152 ? 86.702 40.564  6.172   1.00 14.06  ? 158  MET A CA    1 
ATOM   1692 C  C     . MET C 3 152 ? 87.073 39.243  6.840   1.00 16.12  ? 158  MET A C     1 
ATOM   1693 O  O     . MET C 3 152 ? 88.103 38.654  6.505   1.00 15.64  ? 158  MET A O     1 
ATOM   1694 C  CB    . MET C 3 152 ? 87.766 41.621  6.469   1.00 16.10  ? 158  MET A CB    1 
ATOM   1695 C  CG    . MET C 3 152 ? 88.031 41.909  7.928   1.00 32.14  ? 158  MET A CG    1 
ATOM   1696 S  SD    . MET C 3 152 ? 89.365 43.132  8.123   1.00 48.75  ? 158  MET A SD    1 
ATOM   1697 C  CE    . MET C 3 152 ? 90.855 42.123  7.989   1.00 25.85  ? 158  MET A CE    1 
ATOM   1698 N  N     . GLU C 3 153 ? 86.249 38.772  7.773   1.00 14.90  ? 159  GLU A N     1 
ATOM   1699 C  CA    . GLU C 3 153 ? 86.531 37.510  8.460   1.00 14.00  ? 159  GLU A CA    1 
ATOM   1700 C  C     . GLU C 3 153 ? 86.464 36.305  7.525   1.00 13.45  ? 159  GLU A C     1 
ATOM   1701 O  O     . GLU C 3 153 ? 86.960 35.233  7.860   1.00 11.36  ? 159  GLU A O     1 
ATOM   1702 C  CB    . GLU C 3 153 ? 85.586 37.285  9.657   1.00 18.28  ? 159  GLU A CB    1 
ATOM   1703 C  CG    . GLU C 3 153 ? 84.117 36.969  9.334   1.00 15.83  ? 159  GLU A CG    1 
ATOM   1704 C  CD    . GLU C 3 153 ? 83.249 38.202  9.130   1.00 20.74  ? 159  GLU A CD    1 
ATOM   1705 O  OE1   . GLU C 3 153 ? 83.790 39.299  8.888   1.00 22.76  ? 159  GLU A OE1   1 
ATOM   1706 O  OE2   . GLU C 3 153 ? 82.011 38.074  9.222   1.00 20.02  ? 159  GLU A OE2   1 
ATOM   1707 N  N     . TRP C 3 154 ? 85.865 36.491  6.353   1.00 9.72   ? 160  TRP A N     1 
ATOM   1708 C  CA    . TRP C 3 154 ? 85.742 35.411  5.383   1.00 8.91   ? 160  TRP A CA    1 
ATOM   1709 C  C     . TRP C 3 154 ? 86.660 35.517  4.167   1.00 16.33  ? 160  TRP A C     1 
ATOM   1710 O  O     . TRP C 3 154 ? 86.690 34.596  3.354   1.00 21.01  ? 160  TRP A O     1 
ATOM   1711 C  CB    . TRP C 3 154 ? 84.290 35.280  4.910   1.00 11.38  ? 160  TRP A CB    1 
ATOM   1712 C  CG    . TRP C 3 154 ? 83.346 34.851  5.991   1.00 19.22  ? 160  TRP A CG    1 
ATOM   1713 C  CD1   . TRP C 3 154 ? 82.285 35.555  6.477   1.00 16.09  ? 160  TRP A CD1   1 
ATOM   1714 C  CD2   . TRP C 3 154 ? 83.394 33.627  6.738   1.00 19.33  ? 160  TRP A CD2   1 
ATOM   1715 N  NE1   . TRP C 3 154 ? 81.672 34.851  7.479   1.00 19.72  ? 160  TRP A NE1   1 
ATOM   1716 C  CE2   . TRP C 3 154 ? 82.329 33.664  7.663   1.00 19.90  ? 160  TRP A CE2   1 
ATOM   1717 C  CE3   . TRP C 3 154 ? 84.234 32.503  6.718   1.00 22.47  ? 160  TRP A CE3   1 
ATOM   1718 C  CZ2   . TRP C 3 154 ? 82.078 32.621  8.565   1.00 19.39  ? 160  TRP A CZ2   1 
ATOM   1719 C  CZ3   . TRP C 3 154 ? 83.985 31.461  7.617   1.00 24.29  ? 160  TRP A CZ3   1 
ATOM   1720 C  CH2   . TRP C 3 154 ? 82.916 31.532  8.527   1.00 22.73  ? 160  TRP A CH2   1 
ATOM   1721 N  N     . TRP C 3 155 ? 87.419 36.609  4.041   1.00 19.33  ? 161  TRP A N     1 
ATOM   1722 C  CA    . TRP C 3 155 ? 88.315 36.782  2.892   1.00 10.97  ? 161  TRP A CA    1 
ATOM   1723 C  C     . TRP C 3 155 ? 89.449 35.764  2.848   1.00 14.56  ? 161  TRP A C     1 
ATOM   1724 O  O     . TRP C 3 155 ? 89.770 35.230  1.785   1.00 21.20  ? 161  TRP A O     1 
ATOM   1725 C  CB    . TRP C 3 155 ? 88.920 38.189  2.869   1.00 14.93  ? 161  TRP A CB    1 
ATOM   1726 C  CG    . TRP C 3 155 ? 87.932 39.318  2.729   1.00 16.69  ? 161  TRP A CG    1 
ATOM   1727 C  CD1   . TRP C 3 155 ? 86.603 39.223  2.417   1.00 16.33  ? 161  TRP A CD1   1 
ATOM   1728 C  CD2   . TRP C 3 155 ? 88.194 40.712  2.944   1.00 14.78  ? 161  TRP A CD2   1 
ATOM   1729 N  NE1   . TRP C 3 155 ? 86.022 40.468  2.435   1.00 13.45  ? 161  TRP A NE1   1 
ATOM   1730 C  CE2   . TRP C 3 155 ? 86.972 41.401  2.755   1.00 13.46  ? 161  TRP A CE2   1 
ATOM   1731 C  CE3   . TRP C 3 155 ? 89.342 41.446  3.286   1.00 9.53   ? 161  TRP A CE3   1 
ATOM   1732 C  CZ2   . TRP C 3 155 ? 86.863 42.793  2.898   1.00 14.45  ? 161  TRP A CZ2   1 
ATOM   1733 C  CZ3   . TRP C 3 155 ? 89.233 42.830  3.428   1.00 11.58  ? 161  TRP A CZ3   1 
ATOM   1734 C  CH2   . TRP C 3 155 ? 87.998 43.487  3.234   1.00 11.60  ? 161  TRP A CH2   1 
ATOM   1735 N  N     . ASN C 3 156 ? 90.037 35.483  4.007   1.00 16.70  ? 162  ASN A N     1 
ATOM   1736 C  CA    . ASN C 3 156 ? 91.149 34.543  4.103   1.00 14.62  ? 162  ASN A CA    1 
ATOM   1737 C  C     . ASN C 3 156 ? 90.998 33.499  5.205   1.00 16.67  ? 162  ASN A C     1 
ATOM   1738 O  O     . ASN C 3 156 ? 90.240 33.681  6.160   1.00 25.93  ? 162  ASN A O     1 
ATOM   1739 C  CB    . ASN C 3 156 ? 92.461 35.304  4.338   1.00 18.79  ? 162  ASN A CB    1 
ATOM   1740 C  CG    . ASN C 3 156 ? 92.831 36.216  3.182   1.00 24.74  ? 162  ASN A CG    1 
ATOM   1741 O  OD1   . ASN C 3 156 ? 93.258 35.753  2.119   1.00 27.03  ? 162  ASN A OD1   1 
ATOM   1742 N  ND2   . ASN C 3 156 ? 92.676 37.521  3.385   1.00 25.61  ? 162  ASN A ND2   1 
ATOM   1743 N  N     . PHE C 3 157 ? 91.748 32.408  5.062   1.00 18.08  ? 163  PHE A N     1 
ATOM   1744 C  CA    . PHE C 3 157 ? 91.759 31.314  6.025   1.00 18.27  ? 163  PHE A CA    1 
ATOM   1745 C  C     . PHE C 3 157 ? 92.692 31.642  7.201   1.00 21.15  ? 163  PHE A C     1 
ATOM   1746 O  O     . PHE C 3 157 ? 93.706 32.329  7.044   1.00 16.96  ? 163  PHE A O     1 
ATOM   1747 C  CB    . PHE C 3 157 ? 92.225 30.015  5.333   1.00 17.36  ? 163  PHE A CB    1 
ATOM   1748 C  CG    . PHE C 3 157 ? 92.728 28.948  6.285   1.00 16.26  ? 163  PHE A CG    1 
ATOM   1749 C  CD1   . PHE C 3 157 ? 91.841 28.128  6.976   1.00 16.56  ? 163  PHE A CD1   1 
ATOM   1750 C  CD2   . PHE C 3 157 ? 94.099 28.781  6.502   1.00 22.20  ? 163  PHE A CD2   1 
ATOM   1751 C  CE1   . PHE C 3 157 ? 92.310 27.158  7.875   1.00 9.89   ? 163  PHE A CE1   1 
ATOM   1752 C  CE2   . PHE C 3 157 ? 94.575 27.816  7.397   1.00 11.23  ? 163  PHE A CE2   1 
ATOM   1753 C  CZ    . PHE C 3 157 ? 93.677 27.006  8.082   1.00 15.19  ? 163  PHE A CZ    1 
ATOM   1754 N  N     . ASN C 3 158 ? 92.332 31.150  8.379   1.00 19.62  ? 164  ASN A N     1 
ATOM   1755 C  CA    . ASN C 3 158 ? 93.138 31.343  9.576   1.00 20.27  ? 164  ASN A CA    1 
ATOM   1756 C  C     . ASN C 3 158 ? 92.815 30.216  10.552  1.00 20.96  ? 164  ASN A C     1 
ATOM   1757 O  O     . ASN C 3 158 ? 91.797 29.537  10.396  1.00 20.54  ? 164  ASN A O     1 
ATOM   1758 C  CB    . ASN C 3 158 ? 92.904 32.728  10.195  1.00 13.82  ? 164  ASN A CB    1 
ATOM   1759 C  CG    . ASN C 3 158 ? 91.460 32.989  10.531  1.00 13.76  ? 164  ASN A CG    1 
ATOM   1760 O  OD1   . ASN C 3 158 ? 90.937 32.473  11.514  1.00 20.42  ? 164  ASN A OD1   1 
ATOM   1761 N  ND2   . ASN C 3 158 ? 90.807 33.806  9.717   1.00 11.59  ? 164  ASN A ND2   1 
ATOM   1762 N  N     . GLU C 3 159 ? 93.689 29.994  11.534  1.00 20.23  ? 165  GLU A N     1 
ATOM   1763 C  CA    . GLU C 3 159 ? 93.482 28.925  12.514  1.00 17.98  ? 165  GLU A CA    1 
ATOM   1764 C  C     . GLU C 3 159 ? 92.250 29.058  13.409  1.00 13.65  ? 165  GLU A C     1 
ATOM   1765 O  O     . GLU C 3 159 ? 91.797 28.067  13.979  1.00 19.17  ? 165  GLU A O     1 
ATOM   1766 C  CB    . GLU C 3 159 ? 94.745 28.691  13.354  1.00 19.26  ? 165  GLU A CB    1 
ATOM   1767 C  CG    . GLU C 3 159 ? 95.988 28.260  12.537  1.00 25.09  ? 165  GLU A CG    1 
ATOM   1768 C  CD    . GLU C 3 159 ? 95.799 26.970  11.715  1.00 34.66  ? 165  GLU A CD    1 
ATOM   1769 O  OE1   . GLU C 3 159 ? 95.028 26.076  12.122  1.00 28.98  ? 165  GLU A OE1   1 
ATOM   1770 O  OE2   . GLU C 3 159 ? 96.446 26.843  10.654  1.00 39.01  ? 165  GLU A OE2   1 
ATOM   1771 N  N     . GLU C 3 160 ? 91.700 30.266  13.514  1.00 17.59  ? 166  GLU A N     1 
ATOM   1772 C  CA    . GLU C 3 160 ? 90.496 30.506  14.319  1.00 20.48  ? 166  GLU A CA    1 
ATOM   1773 C  C     . GLU C 3 160 ? 89.295 29.936  13.553  1.00 18.41  ? 166  GLU A C     1 
ATOM   1774 O  O     . GLU C 3 160 ? 88.379 29.369  14.148  1.00 18.31  ? 166  GLU A O     1 
ATOM   1775 C  CB    . GLU C 3 160 ? 90.306 32.000  14.575  1.00 20.76  ? 166  GLU A CB    1 
ATOM   1776 N  N     . MET C 3 161 ? 89.318 30.099  12.230  1.00 20.50  ? 167  MET A N     1 
ATOM   1777 C  CA    . MET C 3 161 ? 88.268 29.592  11.343  1.00 17.76  ? 167  MET A CA    1 
ATOM   1778 C  C     . MET C 3 161 ? 88.319 28.056  11.354  1.00 12.39  ? 167  MET A C     1 
ATOM   1779 O  O     . MET C 3 161 ? 87.284 27.389  11.351  1.00 17.98  ? 167  MET A O     1 
ATOM   1780 C  CB    . MET C 3 161 ? 88.514 30.096  9.919   1.00 23.93  ? 167  MET A CB    1 
ATOM   1781 C  CG    . MET C 3 161 ? 87.467 29.667  8.894   1.00 27.46  ? 167  MET A CG    1 
ATOM   1782 S  SD    . MET C 3 161 ? 87.932 30.086  7.185   1.00 31.86  ? 167  MET A SD    1 
ATOM   1783 C  CE    . MET C 3 161 ? 87.675 31.872  7.195   1.00 29.51  ? 167  MET A CE    1 
ATOM   1784 N  N     . MET C 3 162 ? 89.540 27.519  11.356  1.00 14.12  ? 168  MET A N     1 
ATOM   1785 C  CA    . MET C 3 162 ? 89.792 26.077  11.371  1.00 14.69  ? 168  MET A CA    1 
ATOM   1786 C  C     . MET C 3 162 ? 89.197 25.456  12.637  1.00 17.49  ? 168  MET A C     1 
ATOM   1787 O  O     . MET C 3 162 ? 88.607 24.376  12.582  1.00 17.78  ? 168  MET A O     1 
ATOM   1788 C  CB    . MET C 3 162 ? 91.305 25.813  11.310  1.00 15.99  ? 168  MET A CB    1 
ATOM   1789 C  CG    . MET C 3 162 ? 91.736 24.336  11.225  1.00 26.67  ? 168  MET A CG    1 
ATOM   1790 S  SD    . MET C 3 162 ? 91.652 23.527  9.577   1.00 37.85  ? 168  MET A SD    1 
ATOM   1791 C  CE    . MET C 3 162 ? 90.127 22.677  9.689   1.00 23.28  ? 168  MET A CE    1 
ATOM   1792 N  N     . ASP C 3 163 ? 89.349 26.154  13.767  1.00 17.41  ? 169  ASP A N     1 
ATOM   1793 C  CA    . ASP C 3 163 ? 88.831 25.702  15.059  1.00 11.33  ? 169  ASP A CA    1 
ATOM   1794 C  C     . ASP C 3 163 ? 87.319 25.611  15.042  1.00 9.60   ? 169  ASP A C     1 
ATOM   1795 O  O     . ASP C 3 163 ? 86.742 24.652  15.555  1.00 13.22  ? 169  ASP A O     1 
ATOM   1796 C  CB    . ASP C 3 163 ? 89.266 26.646  16.188  1.00 23.61  ? 169  ASP A CB    1 
ATOM   1797 C  CG    . ASP C 3 163 ? 90.733 26.485  16.566  1.00 25.76  ? 169  ASP A CG    1 
ATOM   1798 O  OD1   . ASP C 3 163 ? 91.308 25.405  16.317  1.00 18.39  ? 169  ASP A OD1   1 
ATOM   1799 O  OD2   . ASP C 3 163 ? 91.309 27.442  17.132  1.00 30.38  ? 169  ASP A OD2   1 
ATOM   1800 N  N     . TYR C 3 164 ? 86.674 26.625  14.477  1.00 6.76   ? 170  TYR A N     1 
ATOM   1801 C  CA    . TYR C 3 164 ? 85.222 26.631  14.386  1.00 9.37   ? 170  TYR A CA    1 
ATOM   1802 C  C     . TYR C 3 164 ? 84.733 25.531  13.446  1.00 11.36  ? 170  TYR A C     1 
ATOM   1803 O  O     . TYR C 3 164 ? 83.605 25.060  13.569  1.00 15.25  ? 170  TYR A O     1 
ATOM   1804 C  CB    . TYR C 3 164 ? 84.717 27.995  13.918  1.00 9.71   ? 170  TYR A CB    1 
ATOM   1805 C  CG    . TYR C 3 164 ? 84.410 28.956  15.046  1.00 16.90  ? 170  TYR A CG    1 
ATOM   1806 C  CD1   . TYR C 3 164 ? 83.150 28.960  15.646  1.00 20.99  ? 170  TYR A CD1   1 
ATOM   1807 C  CD2   . TYR C 3 164 ? 85.361 29.883  15.497  1.00 22.11  ? 170  TYR A CD2   1 
ATOM   1808 C  CE1   . TYR C 3 164 ? 82.831 29.857  16.664  1.00 26.46  ? 170  TYR A CE1   1 
ATOM   1809 C  CE2   . TYR C 3 164 ? 85.050 30.792  16.524  1.00 21.71  ? 170  TYR A CE2   1 
ATOM   1810 C  CZ    . TYR C 3 164 ? 83.778 30.767  17.098  1.00 20.74  ? 170  TYR A CZ    1 
ATOM   1811 O  OH    . TYR C 3 164 ? 83.421 31.638  18.099  1.00 24.42  ? 170  TYR A OH    1 
ATOM   1812 N  N     . ASN C 3 165 ? 85.591 25.131  12.510  1.00 16.38  ? 171  ASN A N     1 
ATOM   1813 C  CA    . ASN C 3 165 ? 85.266 24.075  11.556  1.00 15.33  ? 171  ASN A CA    1 
ATOM   1814 C  C     . ASN C 3 165 ? 85.228 22.736  12.301  1.00 11.47  ? 171  ASN A C     1 
ATOM   1815 O  O     . ASN C 3 165 ? 84.316 21.939  12.088  1.00 14.08  ? 171  ASN A O     1 
ATOM   1816 C  CB    . ASN C 3 165 ? 86.313 24.041  10.435  1.00 13.20  ? 171  ASN A CB    1 
ATOM   1817 C  CG    . ASN C 3 165 ? 85.866 23.243  9.208   1.00 16.03  ? 171  ASN A CG    1 
ATOM   1818 O  OD1   . ASN C 3 165 ? 86.659 23.029  8.299   1.00 16.83  ? 171  ASN A OD1   1 
ATOM   1819 N  ND2   . ASN C 3 165 ? 84.603 22.815  9.171   1.00 14.86  ? 171  ASN A ND2   1 
ATOM   1820 N  N     . VAL C 3 166 ? 86.207 22.507  13.182  1.00 14.63  ? 172  VAL A N     1 
ATOM   1821 C  CA    . VAL C 3 166 ? 86.283 21.271  13.975  1.00 8.87   ? 172  VAL A CA    1 
ATOM   1822 C  C     . VAL C 3 166 ? 85.103 21.225  14.943  1.00 10.16  ? 172  VAL A C     1 
ATOM   1823 O  O     . VAL C 3 166 ? 84.496 20.174  15.142  1.00 14.46  ? 172  VAL A O     1 
ATOM   1824 C  CB    . VAL C 3 166 ? 87.607 21.163  14.783  1.00 8.45   ? 172  VAL A CB    1 
ATOM   1825 C  CG1   . VAL C 3 166 ? 87.631 19.871  15.592  1.00 12.53  ? 172  VAL A CG1   1 
ATOM   1826 C  CG2   . VAL C 3 166 ? 88.802 21.186  13.853  1.00 2.00   ? 172  VAL A CG2   1 
ATOM   1827 N  N     . GLN C 3 167 ? 84.773 22.369  15.534  1.00 10.64  ? 173  GLN A N     1 
ATOM   1828 C  CA    . GLN C 3 167 ? 83.646 22.433  16.457  1.00 17.41  ? 173  GLN A CA    1 
ATOM   1829 C  C     . GLN C 3 167 ? 82.325 22.139  15.759  1.00 14.70  ? 173  GLN A C     1 
ATOM   1830 O  O     . GLN C 3 167 ? 81.427 21.557  16.358  1.00 17.24  ? 173  GLN A O     1 
ATOM   1831 C  CB    . GLN C 3 167 ? 83.580 23.787  17.168  1.00 24.56  ? 173  GLN A CB    1 
ATOM   1832 C  CG    . GLN C 3 167 ? 84.398 23.826  18.447  1.00 36.72  ? 173  GLN A CG    1 
ATOM   1833 C  CD    . GLN C 3 167 ? 83.982 22.740  19.431  1.00 42.96  ? 173  GLN A CD    1 
ATOM   1834 O  OE1   . GLN C 3 167 ? 84.754 21.822  19.725  1.00 44.37  ? 173  GLN A OE1   1 
ATOM   1835 N  NE2   . GLN C 3 167 ? 82.752 22.832  19.933  1.00 45.37  ? 173  GLN A NE2   1 
ATOM   1836 N  N     . ASP C 3 168 ? 82.201 22.553  14.499  1.00 16.32  ? 174  ASP A N     1 
ATOM   1837 C  CA    . ASP C 3 168 ? 80.985 22.297  13.733  1.00 12.31  ? 174  ASP A CA    1 
ATOM   1838 C  C     . ASP C 3 168 ? 80.743 20.798  13.595  1.00 7.88   ? 174  ASP A C     1 
ATOM   1839 O  O     . ASP C 3 168 ? 79.640 20.325  13.829  1.00 10.89  ? 174  ASP A O     1 
ATOM   1840 C  CB    . ASP C 3 168 ? 81.068 22.925  12.335  1.00 19.46  ? 174  ASP A CB    1 
ATOM   1841 C  CG    . ASP C 3 168 ? 80.730 24.406  12.328  1.00 26.85  ? 174  ASP A CG    1 
ATOM   1842 O  OD1   . ASP C 3 168 ? 79.901 24.835  13.151  1.00 31.69  ? 174  ASP A OD1   1 
ATOM   1843 O  OD2   . ASP C 3 168 ? 81.286 25.143  11.489  1.00 33.17  ? 174  ASP A OD2   1 
ATOM   1844 N  N     . VAL C 3 169 ? 81.778 20.051  13.230  1.00 6.00   ? 175  VAL A N     1 
ATOM   1845 C  CA    . VAL C 3 169 ? 81.640 18.612  13.065  1.00 6.35   ? 175  VAL A CA    1 
ATOM   1846 C  C     . VAL C 3 169 ? 81.402 17.887  14.390  1.00 12.14  ? 175  VAL A C     1 
ATOM   1847 O  O     . VAL C 3 169 ? 80.662 16.908  14.418  1.00 12.01  ? 175  VAL A O     1 
ATOM   1848 C  CB    . VAL C 3 169 ? 82.846 17.999  12.304  1.00 11.80  ? 175  VAL A CB    1 
ATOM   1849 C  CG1   . VAL C 3 169 ? 82.713 16.475  12.211  1.00 9.07   ? 175  VAL A CG1   1 
ATOM   1850 C  CG2   . VAL C 3 169 ? 82.919 18.581  10.895  1.00 12.26  ? 175  VAL A CG2   1 
ATOM   1851 N  N     . VAL C 3 170 ? 82.001 18.356  15.487  1.00 11.35  ? 176  VAL A N     1 
ATOM   1852 C  CA    . VAL C 3 170 ? 81.770 17.692  16.773  1.00 13.75  ? 176  VAL A CA    1 
ATOM   1853 C  C     . VAL C 3 170 ? 80.306 17.910  17.183  1.00 11.74  ? 176  VAL A C     1 
ATOM   1854 O  O     . VAL C 3 170 ? 79.646 16.986  17.648  1.00 18.56  ? 176  VAL A O     1 
ATOM   1855 C  CB    . VAL C 3 170 ? 82.739 18.174  17.918  1.00 19.26  ? 176  VAL A CB    1 
ATOM   1856 C  CG1   . VAL C 3 170 ? 84.187 18.067  17.486  1.00 22.07  ? 176  VAL A CG1   1 
ATOM   1857 C  CG2   . VAL C 3 170 ? 82.414 19.567  18.361  1.00 27.65  ? 176  VAL A CG2   1 
ATOM   1858 N  N     . VAL C 3 171 ? 79.795 19.118  16.950  1.00 13.48  ? 177  VAL A N     1 
ATOM   1859 C  CA    . VAL C 3 171 ? 78.415 19.455  17.282  1.00 10.96  ? 177  VAL A CA    1 
ATOM   1860 C  C     . VAL C 3 171 ? 77.455 18.754  16.321  1.00 14.48  ? 177  VAL A C     1 
ATOM   1861 O  O     . VAL C 3 171 ? 76.378 18.314  16.728  1.00 13.27  ? 177  VAL A O     1 
ATOM   1862 C  CB    . VAL C 3 171 ? 78.177 20.997  17.248  1.00 12.30  ? 177  VAL A CB    1 
ATOM   1863 C  CG1   . VAL C 3 171 ? 76.715 21.323  17.522  1.00 8.97   ? 177  VAL A CG1   1 
ATOM   1864 C  CG2   . VAL C 3 171 ? 79.055 21.686  18.284  1.00 13.71  ? 177  VAL A CG2   1 
ATOM   1865 N  N     . THR C 3 172 ? 77.852 18.633  15.054  1.00 12.40  ? 178  THR A N     1 
ATOM   1866 C  CA    . THR C 3 172 ? 77.014 17.969  14.054  1.00 10.76  ? 178  THR A CA    1 
ATOM   1867 C  C     . THR C 3 172 ? 76.928 16.475  14.376  1.00 10.96  ? 178  THR A C     1 
ATOM   1868 O  O     . THR C 3 172 ? 75.863 15.869  14.229  1.00 14.22  ? 178  THR A O     1 
ATOM   1869 C  CB    . THR C 3 172 ? 77.561 18.199  12.631  1.00 8.49   ? 178  THR A CB    1 
ATOM   1870 O  OG1   . THR C 3 172 ? 77.488 19.594  12.334  1.00 10.01  ? 178  THR A OG1   1 
ATOM   1871 C  CG2   . THR C 3 172 ? 76.751 17.434  11.581  1.00 3.96   ? 178  THR A CG2   1 
ATOM   1872 N  N     . LYS C 3 173 ? 78.041 15.904  14.844  1.00 9.62   ? 179  LYS A N     1 
ATOM   1873 C  CA    . LYS C 3 173 ? 78.099 14.492  15.218  1.00 11.32  ? 179  LYS A CA    1 
ATOM   1874 C  C     . LYS C 3 173 ? 77.150 14.270  16.401  1.00 15.91  ? 179  LYS A C     1 
ATOM   1875 O  O     . LYS C 3 173 ? 76.377 13.306  16.430  1.00 14.35  ? 179  LYS A O     1 
ATOM   1876 C  CB    . LYS C 3 173 ? 79.517 14.096  15.624  1.00 10.26  ? 179  LYS A CB    1 
ATOM   1877 C  CG    . LYS C 3 173 ? 79.636 12.651  16.100  1.00 8.55   ? 179  LYS A CG    1 
ATOM   1878 C  CD    . LYS C 3 173 ? 81.033 12.353  16.593  1.00 13.52  ? 179  LYS A CD    1 
ATOM   1879 C  CE    . LYS C 3 173 ? 81.137 10.942  17.148  1.00 20.07  ? 179  LYS A CE    1 
ATOM   1880 N  NZ    . LYS C 3 173 ? 80.335 10.745  18.382  1.00 19.13  ? 179  LYS A NZ    1 
ATOM   1881 N  N     . ALA C 3 174 ? 77.194 15.194  17.357  1.00 13.11  ? 180  ALA A N     1 
ATOM   1882 C  CA    . ALA C 3 174 ? 76.343 15.127  18.538  1.00 14.00  ? 180  ALA A CA    1 
ATOM   1883 C  C     . ALA C 3 174 ? 74.858 15.240  18.166  1.00 13.34  ? 180  ALA A C     1 
ATOM   1884 O  O     . ALA C 3 174 ? 74.022 14.513  18.706  1.00 16.51  ? 180  ALA A O     1 
ATOM   1885 C  CB    . ALA C 3 174 ? 76.736 16.228  19.534  1.00 10.89  ? 180  ALA A CB    1 
ATOM   1886 N  N     . LEU C 3 175 ? 74.535 16.144  17.243  1.00 8.38   ? 181  LEU A N     1 
ATOM   1887 C  CA    . LEU C 3 175 ? 73.150 16.332  16.815  1.00 8.26   ? 181  LEU A CA    1 
ATOM   1888 C  C     . LEU C 3 175 ? 72.677 15.071  16.081  1.00 9.66   ? 181  LEU A C     1 
ATOM   1889 O  O     . LEU C 3 175 ? 71.562 14.596  16.300  1.00 7.76   ? 181  LEU A O     1 
ATOM   1890 C  CB    . LEU C 3 175 ? 73.037 17.528  15.871  1.00 12.24  ? 181  LEU A CB    1 
ATOM   1891 C  CG    . LEU C 3 175 ? 71.794 18.428  15.860  1.00 19.80  ? 181  LEU A CG    1 
ATOM   1892 C  CD1   . LEU C 3 175 ? 71.709 19.080  14.495  1.00 10.67  ? 181  LEU A CD1   1 
ATOM   1893 C  CD2   . LEU C 3 175 ? 70.513 17.682  16.154  1.00 16.27  ? 181  LEU A CD2   1 
ATOM   1894 N  N     . LEU C 3 176 ? 73.531 14.536  15.210  1.00 8.85   ? 182  LEU A N     1 
ATOM   1895 C  CA    . LEU C 3 176 ? 73.202 13.336  14.442  1.00 11.77  ? 182  LEU A CA    1 
ATOM   1896 C  C     . LEU C 3 176 ? 72.806 12.159  15.332  1.00 10.69  ? 182  LEU A C     1 
ATOM   1897 O  O     . LEU C 3 176 ? 71.790 11.511  15.102  1.00 16.36  ? 182  LEU A O     1 
ATOM   1898 C  CB    . LEU C 3 176 ? 74.388 12.918  13.568  1.00 9.75   ? 182  LEU A CB    1 
ATOM   1899 C  CG    . LEU C 3 176 ? 74.257 11.558  12.866  1.00 9.81   ? 182  LEU A CG    1 
ATOM   1900 C  CD1   . LEU C 3 176 ? 73.174 11.591  11.803  1.00 8.80   ? 182  LEU A CD1   1 
ATOM   1901 C  CD2   . LEU C 3 176 ? 75.586 11.183  12.256  1.00 12.51  ? 182  LEU A CD2   1 
ATOM   1902 N  N     . GLU C 3 177 ? 73.623 11.885  16.341  1.00 12.59  ? 183  GLU A N     1 
ATOM   1903 C  CA    . GLU C 3 177 ? 73.365 10.782  17.255  1.00 16.15  ? 183  GLU A CA    1 
ATOM   1904 C  C     . GLU C 3 177 ? 72.120 11.011  18.103  1.00 16.38  ? 183  GLU A C     1 
ATOM   1905 O  O     . GLU C 3 177 ? 71.456 10.059  18.508  1.00 11.83  ? 183  GLU A O     1 
ATOM   1906 C  CB    . GLU C 3 177 ? 74.597 10.540  18.118  1.00 23.75  ? 183  GLU A CB    1 
ATOM   1907 C  CG    . GLU C 3 177 ? 75.835 10.250  17.271  1.00 22.00  ? 183  GLU A CG    1 
ATOM   1908 C  CD    . GLU C 3 177 ? 77.055 9.879   18.083  1.00 24.39  ? 183  GLU A CD    1 
ATOM   1909 O  OE1   . GLU C 3 177 ? 77.040 10.059  19.318  1.00 31.57  ? 183  GLU A OE1   1 
ATOM   1910 O  OE2   . GLU C 3 177 ? 78.037 9.398   17.483  1.00 19.84  ? 183  GLU A OE2   1 
ATOM   1911 N  N     . LYS C 3 178 ? 71.796 12.280  18.348  1.00 14.45  ? 184  LYS A N     1 
ATOM   1912 C  CA    . LYS C 3 178 ? 70.616 12.640  19.123  1.00 10.75  ? 184  LYS A CA    1 
ATOM   1913 C  C     . LYS C 3 178 ? 69.363 12.379  18.275  1.00 15.92  ? 184  LYS A C     1 
ATOM   1914 O  O     . LYS C 3 178 ? 68.315 11.990  18.797  1.00 19.80  ? 184  LYS A O     1 
ATOM   1915 C  CB    . LYS C 3 178 ? 70.681 14.116  19.534  1.00 15.06  ? 184  LYS A CB    1 
ATOM   1916 C  CG    . LYS C 3 178 ? 69.475 14.584  20.329  1.00 20.80  ? 184  LYS A CG    1 
ATOM   1917 C  CD    . LYS C 3 178 ? 69.506 16.073  20.635  1.00 26.47  ? 184  LYS A CD    1 
ATOM   1918 C  CE    . LYS C 3 178 ? 68.240 16.491  21.378  1.00 31.72  ? 184  LYS A CE    1 
ATOM   1919 N  NZ    . LYS C 3 178 ? 68.205 17.942  21.686  1.00 25.04  ? 184  LYS A NZ    1 
ATOM   1920 N  N     . LEU C 3 179 ? 69.487 12.589  16.965  1.00 18.94  ? 185  LEU A N     1 
ATOM   1921 C  CA    . LEU C 3 179 ? 68.386 12.380  16.020  1.00 14.93  ? 185  LEU A CA    1 
ATOM   1922 C  C     . LEU C 3 179 ? 68.140 10.894  15.756  1.00 3.92   ? 185  LEU A C     1 
ATOM   1923 O  O     . LEU C 3 179 ? 66.995 10.446  15.717  1.00 10.51  ? 185  LEU A O     1 
ATOM   1924 C  CB    . LEU C 3 179 ? 68.688 13.096  14.702  1.00 11.78  ? 185  LEU A CB    1 
ATOM   1925 C  CG    . LEU C 3 179 ? 68.813 14.618  14.818  1.00 8.83   ? 185  LEU A CG    1 
ATOM   1926 C  CD1   . LEU C 3 179 ? 69.300 15.199  13.506  1.00 9.26   ? 185  LEU A CD1   1 
ATOM   1927 C  CD2   . LEU C 3 179 ? 67.468 15.219  15.218  1.00 9.36   ? 185  LEU A CD2   1 
ATOM   1928 N  N     . LEU C 3 180 ? 69.223 10.140  15.595  1.00 3.82   ? 186  LEU A N     1 
ATOM   1929 C  CA    . LEU C 3 180 ? 69.151 8.702   15.343  1.00 10.77  ? 186  LEU A CA    1 
ATOM   1930 C  C     . LEU C 3 180 ? 68.622 7.924   16.542  1.00 15.62  ? 186  LEU A C     1 
ATOM   1931 O  O     . LEU C 3 180 ? 68.167 6.791   16.388  1.00 13.75  ? 186  LEU A O     1 
ATOM   1932 C  CB    . LEU C 3 180 ? 70.529 8.144   14.978  1.00 5.83   ? 186  LEU A CB    1 
ATOM   1933 C  CG    . LEU C 3 180 ? 71.224 8.614   13.702  1.00 5.14   ? 186  LEU A CG    1 
ATOM   1934 C  CD1   . LEU C 3 180 ? 72.581 7.954   13.605  1.00 2.00   ? 186  LEU A CD1   1 
ATOM   1935 C  CD2   . LEU C 3 180 ? 70.374 8.281   12.496  1.00 5.54   ? 186  LEU A CD2   1 
ATOM   1936 N  N     . SER C 3 181 ? 68.694 8.527   17.730  1.00 13.34  ? 187  SER A N     1 
ATOM   1937 C  CA    . SER C 3 181 ? 68.222 7.872   18.942  1.00 18.72  ? 187  SER A CA    1 
ATOM   1938 C  C     . SER C 3 181 ? 66.707 7.936   19.078  1.00 17.99  ? 187  SER A C     1 
ATOM   1939 O  O     . SER C 3 181 ? 66.164 7.442   20.062  1.00 20.96  ? 187  SER A O     1 
ATOM   1940 C  CB    . SER C 3 181 ? 68.882 8.463   20.195  1.00 24.67  ? 187  SER A CB    1 
ATOM   1941 O  OG    . SER C 3 181 ? 68.330 9.726   20.525  1.00 26.52  ? 187  SER A OG    1 
ATOM   1942 N  N     . ASP C 3 182 ? 66.030 8.562   18.111  1.00 18.35  ? 188  ASP A N     1 
ATOM   1943 C  CA    . ASP C 3 182 ? 64.567 8.661   18.134  1.00 13.86  ? 188  ASP A CA    1 
ATOM   1944 C  C     . ASP C 3 182 ? 64.051 7.335   17.584  1.00 16.51  ? 188  ASP A C     1 
ATOM   1945 O  O     . ASP C 3 182 ? 64.206 7.055   16.396  1.00 19.09  ? 188  ASP A O     1 
ATOM   1946 C  CB    . ASP C 3 182 ? 64.087 9.826   17.256  1.00 11.60  ? 188  ASP A CB    1 
ATOM   1947 C  CG    . ASP C 3 182 ? 62.623 10.175  17.484  1.00 5.33   ? 188  ASP A CG    1 
ATOM   1948 O  OD1   . ASP C 3 182 ? 61.760 9.283   17.375  1.00 16.02  ? 188  ASP A OD1   1 
ATOM   1949 O  OD2   . ASP C 3 182 ? 62.325 11.348  17.773  1.00 15.49  ? 188  ASP A OD2   1 
ATOM   1950 N  N     . LYS C 3 183 ? 63.454 6.522   18.455  1.00 13.65  ? 189  LYS A N     1 
ATOM   1951 C  CA    . LYS C 3 183 ? 62.933 5.209   18.073  1.00 17.32  ? 189  LYS A CA    1 
ATOM   1952 C  C     . LYS C 3 183 ? 61.777 5.234   17.077  1.00 15.48  ? 189  LYS A C     1 
ATOM   1953 O  O     . LYS C 3 183 ? 61.501 4.233   16.420  1.00 16.06  ? 189  LYS A O     1 
ATOM   1954 C  CB    . LYS C 3 183 ? 62.541 4.411   19.321  1.00 21.68  ? 189  LYS A CB    1 
ATOM   1955 N  N     . HIS C 3 184 ? 61.101 6.373   16.967  1.00 9.95   ? 190  HIS A N     1 
ATOM   1956 C  CA    . HIS C 3 184 ? 59.987 6.499   16.040  1.00 11.18  ? 190  HIS A CA    1 
ATOM   1957 C  C     . HIS C 3 184 ? 60.460 6.544   14.582  1.00 11.40  ? 190  HIS A C     1 
ATOM   1958 O  O     . HIS C 3 184 ? 59.791 6.025   13.692  1.00 13.85  ? 190  HIS A O     1 
ATOM   1959 C  CB    . HIS C 3 184 ? 59.166 7.749   16.372  1.00 9.06   ? 190  HIS A CB    1 
ATOM   1960 C  CG    . HIS C 3 184 ? 57.945 7.912   15.523  1.00 8.56   ? 190  HIS A CG    1 
ATOM   1961 N  ND1   . HIS C 3 184 ? 56.711 7.425   15.893  1.00 16.73  ? 190  HIS A ND1   1 
ATOM   1962 C  CD2   . HIS C 3 184 ? 57.770 8.500   14.316  1.00 12.21  ? 190  HIS A CD2   1 
ATOM   1963 C  CE1   . HIS C 3 184 ? 55.828 7.703   14.951  1.00 13.75  ? 190  HIS A CE1   1 
ATOM   1964 N  NE2   . HIS C 3 184 ? 56.446 8.357   13.983  1.00 15.56  ? 190  HIS A NE2   1 
ATOM   1965 N  N     . TYR C 3 185 ? 61.623 7.145   14.351  1.00 11.24  ? 191  TYR A N     1 
ATOM   1966 C  CA    . TYR C 3 185 ? 62.172 7.270   13.008  1.00 7.45   ? 191  TYR A CA    1 
ATOM   1967 C  C     . TYR C 3 185 ? 63.232 6.235   12.693  1.00 13.37  ? 191  TYR A C     1 
ATOM   1968 O  O     . TYR C 3 185 ? 63.330 5.767   11.553  1.00 11.07  ? 191  TYR A O     1 
ATOM   1969 C  CB    . TYR C 3 185 ? 62.737 8.680   12.808  1.00 5.53   ? 191  TYR A CB    1 
ATOM   1970 C  CG    . TYR C 3 185 ? 61.672 9.736   12.915  1.00 14.41  ? 191  TYR A CG    1 
ATOM   1971 C  CD1   . TYR C 3 185 ? 61.309 10.267  14.157  1.00 14.06  ? 191  TYR A CD1   1 
ATOM   1972 C  CD2   . TYR C 3 185 ? 60.968 10.159  11.784  1.00 14.35  ? 191  TYR A CD2   1 
ATOM   1973 C  CE1   . TYR C 3 185 ? 60.264 11.187  14.271  1.00 9.95   ? 191  TYR A CE1   1 
ATOM   1974 C  CE2   . TYR C 3 185 ? 59.920 11.079  11.885  1.00 10.93  ? 191  TYR A CE2   1 
ATOM   1975 C  CZ    . TYR C 3 185 ? 59.573 11.585  13.130  1.00 11.27  ? 191  TYR A CZ    1 
ATOM   1976 O  OH    . TYR C 3 185 ? 58.529 12.476  13.236  1.00 9.12   ? 191  TYR A OH    1 
ATOM   1977 N  N     . PHE C 3 186 ? 64.008 5.859   13.710  1.00 11.19  ? 192  PHE A N     1 
ATOM   1978 C  CA    . PHE C 3 186 ? 65.076 4.883   13.543  1.00 10.76  ? 192  PHE A CA    1 
ATOM   1979 C  C     . PHE C 3 186 ? 64.975 3.713   14.517  1.00 16.74  ? 192  PHE A C     1 
ATOM   1980 O  O     . PHE C 3 186 ? 65.083 3.895   15.728  1.00 13.65  ? 192  PHE A O     1 
ATOM   1981 C  CB    . PHE C 3 186 ? 66.433 5.571   13.707  1.00 8.00   ? 192  PHE A CB    1 
ATOM   1982 C  CG    . PHE C 3 186 ? 66.649 6.704   12.749  1.00 11.32  ? 192  PHE A CG    1 
ATOM   1983 C  CD1   . PHE C 3 186 ? 67.142 6.462   11.468  1.00 14.42  ? 192  PHE A CD1   1 
ATOM   1984 C  CD2   . PHE C 3 186 ? 66.333 8.015   13.114  1.00 3.53   ? 192  PHE A CD2   1 
ATOM   1985 C  CE1   . PHE C 3 186 ? 67.321 7.505   10.560  1.00 17.10  ? 192  PHE A CE1   1 
ATOM   1986 C  CE2   . PHE C 3 186 ? 66.507 9.065   12.214  1.00 6.86   ? 192  PHE A CE2   1 
ATOM   1987 C  CZ    . PHE C 3 186 ? 67.000 8.809   10.933  1.00 12.33  ? 192  PHE A CZ    1 
ATOM   1988 N  N     . PRO C 3 187 ? 64.757 2.492   13.994  1.00 25.52  ? 193  PRO A N     1 
ATOM   1989 C  CA    . PRO C 3 187 ? 64.639 1.270   14.796  1.00 27.83  ? 193  PRO A CA    1 
ATOM   1990 C  C     . PRO C 3 187 ? 65.880 1.023   15.664  1.00 25.79  ? 193  PRO A C     1 
ATOM   1991 O  O     . PRO C 3 187 ? 67.011 1.079   15.179  1.00 19.78  ? 193  PRO A O     1 
ATOM   1992 C  CB    . PRO C 3 187 ? 64.475 0.188   13.729  1.00 30.25  ? 193  PRO A CB    1 
ATOM   1993 C  CG    . PRO C 3 187 ? 63.699 0.900   12.679  1.00 32.05  ? 193  PRO A CG    1 
ATOM   1994 C  CD    . PRO C 3 187 ? 64.477 2.193   12.578  1.00 31.01  ? 193  PRO A CD    1 
ATOM   1995 N  N     . PRO C 3 188 ? 65.675 0.761   16.967  1.00 26.71  ? 194  PRO A N     1 
ATOM   1996 C  CA    . PRO C 3 188 ? 66.747 0.503   17.938  1.00 23.77  ? 194  PRO A CA    1 
ATOM   1997 C  C     . PRO C 3 188 ? 67.616 -0.709  17.601  1.00 20.68  ? 194  PRO A C     1 
ATOM   1998 O  O     . PRO C 3 188 ? 68.773 -0.773  18.010  1.00 25.39  ? 194  PRO A O     1 
ATOM   1999 C  CB    . PRO C 3 188 ? 65.973 0.283   19.238  1.00 25.58  ? 194  PRO A CB    1 
ATOM   2000 C  CG    . PRO C 3 188 ? 64.771 1.155   19.057  1.00 27.76  ? 194  PRO A CG    1 
ATOM   2001 C  CD    . PRO C 3 188 ? 64.370 0.793   17.649  1.00 27.54  ? 194  PRO A CD    1 
ATOM   2002 N  N     . GLU C 3 189 ? 67.062 -1.653  16.841  1.00 21.04  ? 195  GLU A N     1 
ATOM   2003 C  CA    . GLU C 3 189 ? 67.781 -2.874  16.451  1.00 26.68  ? 195  GLU A CA    1 
ATOM   2004 C  C     . GLU C 3 189 ? 68.978 -2.602  15.550  1.00 24.38  ? 195  GLU A C     1 
ATOM   2005 O  O     . GLU C 3 189 ? 69.917 -3.399  15.498  1.00 25.90  ? 195  GLU A O     1 
ATOM   2006 C  CB    . GLU C 3 189 ? 66.852 -3.849  15.711  1.00 27.22  ? 195  GLU A CB    1 
ATOM   2007 C  CG    . GLU C 3 189 ? 65.684 -4.400  16.518  1.00 40.98  ? 195  GLU A CG    1 
ATOM   2008 C  CD    . GLU C 3 189 ? 64.647 -3.345  16.877  1.00 44.81  ? 195  GLU A CD    1 
ATOM   2009 O  OE1   . GLU C 3 189 ? 64.218 -2.591  15.972  1.00 42.95  ? 195  GLU A OE1   1 
ATOM   2010 O  OE2   . GLU C 3 189 ? 64.264 -3.270  18.067  1.00 44.37  ? 195  GLU A OE2   1 
ATOM   2011 N  N     . ILE C 3 190 ? 68.929 -1.473  14.848  1.00 23.41  ? 196  ILE A N     1 
ATOM   2012 C  CA    . ILE C 3 190 ? 69.973 -1.080  13.908  1.00 18.70  ? 196  ILE A CA    1 
ATOM   2013 C  C     . ILE C 3 190 ? 70.851 0.092   14.334  1.00 16.84  ? 196  ILE A C     1 
ATOM   2014 O  O     . ILE C 3 190 ? 70.357 1.108   14.822  1.00 21.98  ? 196  ILE A O     1 
ATOM   2015 C  CB    . ILE C 3 190 ? 69.322 -0.717  12.546  1.00 16.14  ? 196  ILE A CB    1 
ATOM   2016 C  CG1   . ILE C 3 190 ? 68.507 -1.904  12.033  1.00 19.24  ? 196  ILE A CG1   1 
ATOM   2017 C  CG2   . ILE C 3 190 ? 70.380 -0.315  11.528  1.00 16.68  ? 196  ILE A CG2   1 
ATOM   2018 C  CD1   . ILE C 3 190 ? 67.397 -1.527  11.098  1.00 23.47  ? 196  ILE A CD1   1 
ATOM   2019 N  N     . ASP C 3 191 ? 72.160 -0.067  14.156  1.00 13.27  ? 197  ASP A N     1 
ATOM   2020 C  CA    . ASP C 3 191 ? 73.113 0.993   14.461  1.00 11.33  ? 197  ASP A CA    1 
ATOM   2021 C  C     . ASP C 3 191 ? 73.278 1.722   13.124  1.00 12.28  ? 197  ASP A C     1 
ATOM   2022 O  O     . ASP C 3 191 ? 74.034 1.288   12.248  1.00 15.29  ? 197  ASP A O     1 
ATOM   2023 C  CB    . ASP C 3 191 ? 74.458 0.414   14.918  1.00 15.89  ? 197  ASP A CB    1 
ATOM   2024 C  CG    . ASP C 3 191 ? 75.517 1.493   15.177  1.00 23.11  ? 197  ASP A CG    1 
ATOM   2025 O  OD1   . ASP C 3 191 ? 75.184 2.701   15.225  1.00 23.81  ? 197  ASP A OD1   1 
ATOM   2026 O  OD2   . ASP C 3 191 ? 76.697 1.124   15.336  1.00 19.48  ? 197  ASP A OD2   1 
ATOM   2027 N  N     . PHE C 3 192 ? 72.535 2.811   12.962  1.00 10.88  ? 198  PHE A N     1 
ATOM   2028 C  CA    . PHE C 3 192 ? 72.571 3.597   11.735  1.00 10.20  ? 198  PHE A CA    1 
ATOM   2029 C  C     . PHE C 3 192 ? 73.875 4.304   11.415  1.00 8.25   ? 198  PHE A C     1 
ATOM   2030 O  O     . PHE C 3 192 ? 73.991 4.924   10.364  1.00 4.94   ? 198  PHE A O     1 
ATOM   2031 C  CB    . PHE C 3 192 ? 71.397 4.579   11.699  1.00 7.46   ? 198  PHE A CB    1 
ATOM   2032 C  CG    . PHE C 3 192 ? 70.070 3.915   11.463  1.00 12.28  ? 198  PHE A CG    1 
ATOM   2033 C  CD1   . PHE C 3 192 ? 69.341 3.386   12.522  1.00 11.31  ? 198  PHE A CD1   1 
ATOM   2034 C  CD2   . PHE C 3 192 ? 69.563 3.789   10.171  1.00 15.20  ? 198  PHE A CD2   1 
ATOM   2035 C  CE1   . PHE C 3 192 ? 68.117 2.742   12.302  1.00 8.09   ? 198  PHE A CE1   1 
ATOM   2036 C  CE2   . PHE C 3 192 ? 68.345 3.151   9.937   1.00 12.98  ? 198  PHE A CE2   1 
ATOM   2037 C  CZ    . PHE C 3 192 ? 67.619 2.624   11.008  1.00 10.69  ? 198  PHE A CZ    1 
ATOM   2038 N  N     . THR C 3 193 ? 74.839 4.242   12.329  1.00 9.75   ? 199  THR A N     1 
ATOM   2039 C  CA    . THR C 3 193 ? 76.138 4.860   12.090  1.00 12.16  ? 199  THR A CA    1 
ATOM   2040 C  C     . THR C 3 193 ? 77.092 3.785   11.553  1.00 15.01  ? 199  THR A C     1 
ATOM   2041 O  O     . THR C 3 193 ? 78.258 4.061   11.260  1.00 11.53  ? 199  THR A O     1 
ATOM   2042 C  CB    . THR C 3 193 ? 76.747 5.496   13.384  1.00 10.93  ? 199  THR A CB    1 
ATOM   2043 O  OG1   . THR C 3 193 ? 77.122 4.473   14.311  1.00 19.99  ? 199  THR A OG1   1 
ATOM   2044 C  CG2   . THR C 3 193 ? 75.750 6.431   14.046  1.00 9.35   ? 199  THR A CG2   1 
ATOM   2045 N  N     . ASP C 3 194 ? 76.568 2.569   11.396  1.00 16.19  ? 200  ASP A N     1 
ATOM   2046 C  CA    . ASP C 3 194 ? 77.341 1.432   10.911  1.00 16.84  ? 200  ASP A CA    1 
ATOM   2047 C  C     . ASP C 3 194 ? 76.637 0.670   9.771   1.00 15.68  ? 200  ASP A C     1 
ATOM   2048 O  O     . ASP C 3 194 ? 76.702 -0.558  9.700   1.00 16.69  ? 200  ASP A O     1 
ATOM   2049 C  CB    . ASP C 3 194 ? 77.621 0.494   12.098  1.00 11.78  ? 200  ASP A CB    1 
ATOM   2050 C  CG    . ASP C 3 194 ? 78.701 -0.520  11.806  1.00 18.99  ? 200  ASP A CG    1 
ATOM   2051 O  OD1   . ASP C 3 194 ? 79.760 -0.130  11.266  1.00 19.87  ? 200  ASP A OD1   1 
ATOM   2052 O  OD2   . ASP C 3 194 ? 78.489 -1.708  12.122  1.00 16.19  ? 200  ASP A OD2   1 
ATOM   2053 N  N     . VAL C 3 195 ? 75.958 1.395   8.888   1.00 14.05  ? 201  VAL A N     1 
ATOM   2054 C  CA    . VAL C 3 195 ? 75.266 0.766   7.760   1.00 15.66  ? 201  VAL A CA    1 
ATOM   2055 C  C     . VAL C 3 195 ? 75.558 1.491   6.445   1.00 16.08  ? 201  VAL A C     1 
ATOM   2056 O  O     . VAL C 3 195 ? 76.005 2.641   6.447   1.00 19.53  ? 201  VAL A O     1 
ATOM   2057 C  CB    . VAL C 3 195 ? 73.714 0.712   7.967   1.00 18.60  ? 201  VAL A CB    1 
ATOM   2058 C  CG1   . VAL C 3 195 ? 73.360 -0.146  9.179   1.00 13.22  ? 201  VAL A CG1   1 
ATOM   2059 C  CG2   . VAL C 3 195 ? 73.133 2.122   8.108   1.00 17.48  ? 201  VAL A CG2   1 
ATOM   2060 N  N     . GLY C 3 196 ? 75.346 0.802   5.326   1.00 13.02  ? 202  GLY A N     1 
ATOM   2061 C  CA    . GLY C 3 196 ? 75.564 1.413   4.024   1.00 9.43   ? 202  GLY A CA    1 
ATOM   2062 C  C     . GLY C 3 196 ? 74.384 2.318   3.703   1.00 10.37  ? 202  GLY A C     1 
ATOM   2063 O  O     . GLY C 3 196 ? 73.347 2.242   4.370   1.00 6.39   ? 202  GLY A O     1 
ATOM   2064 N  N     . TYR C 3 197 ? 74.506 3.142   2.666   1.00 10.61  ? 203  TYR A N     1 
ATOM   2065 C  CA    . TYR C 3 197 ? 73.423 4.060   2.315   1.00 9.79   ? 203  TYR A CA    1 
ATOM   2066 C  C     . TYR C 3 197 ? 72.087 3.386   2.036   1.00 9.08   ? 203  TYR A C     1 
ATOM   2067 O  O     . TYR C 3 197 ? 71.030 3.848   2.493   1.00 6.31   ? 203  TYR A O     1 
ATOM   2068 C  CB    . TYR C 3 197 ? 73.824 4.963   1.133   1.00 14.45  ? 203  TYR A CB    1 
ATOM   2069 C  CG    . TYR C 3 197 ? 73.745 4.354   -0.252  1.00 9.61   ? 203  TYR A CG    1 
ATOM   2070 C  CD1   . TYR C 3 197 ? 72.554 4.395   -0.982  1.00 11.20  ? 203  TYR A CD1   1 
ATOM   2071 C  CD2   . TYR C 3 197 ? 74.864 3.776   -0.850  1.00 13.88  ? 203  TYR A CD2   1 
ATOM   2072 C  CE1   . TYR C 3 197 ? 72.480 3.881   -2.275  1.00 11.84  ? 203  TYR A CE1   1 
ATOM   2073 C  CE2   . TYR C 3 197 ? 74.805 3.258   -2.149  1.00 12.79  ? 203  TYR A CE2   1 
ATOM   2074 C  CZ    . TYR C 3 197 ? 73.611 3.316   -2.854  1.00 14.61  ? 203  TYR A CZ    1 
ATOM   2075 O  OH    . TYR C 3 197 ? 73.545 2.833   -4.147  1.00 16.95  ? 203  TYR A OH    1 
ATOM   2076 N  N     . THR C 3 198 ? 72.148 2.275   1.309   1.00 8.08   ? 204  THR A N     1 
ATOM   2077 C  CA    . THR C 3 198 ? 70.963 1.529   0.935   1.00 9.61   ? 204  THR A CA    1 
ATOM   2078 C  C     . THR C 3 198 ? 70.180 1.034   2.159   1.00 11.06  ? 204  THR A C     1 
ATOM   2079 O  O     . THR C 3 198 ? 68.948 1.047   2.161   1.00 14.91  ? 204  THR A O     1 
ATOM   2080 C  CB    . THR C 3 198 ? 71.341 0.375   -0.031  1.00 17.36  ? 204  THR A CB    1 
ATOM   2081 O  OG1   . THR C 3 198 ? 70.149 -0.206  -0.570  1.00 34.95  ? 204  THR A OG1   1 
ATOM   2082 C  CG2   . THR C 3 198 ? 72.188 -0.699  0.677   1.00 29.86  ? 204  THR A CG2   1 
ATOM   2083 N  N     . THR C 3 199 ? 70.899 0.646   3.209   1.00 15.09  ? 205  THR A N     1 
ATOM   2084 C  CA    . THR C 3 199 ? 70.279 0.166   4.444   1.00 14.66  ? 205  THR A CA    1 
ATOM   2085 C  C     . THR C 3 199 ? 69.719 1.357   5.224   1.00 16.71  ? 205  THR A C     1 
ATOM   2086 O  O     . THR C 3 199 ? 68.658 1.260   5.837   1.00 15.12  ? 205  THR A O     1 
ATOM   2087 C  CB    . THR C 3 199 ? 71.299 -0.599  5.324   1.00 18.97  ? 205  THR A CB    1 
ATOM   2088 O  OG1   . THR C 3 199 ? 71.743 -1.771  4.634   1.00 16.06  ? 205  THR A OG1   1 
ATOM   2089 C  CG2   . THR C 3 199 ? 70.682 -1.007  6.650   1.00 14.72  ? 205  THR A CG2   1 
ATOM   2090 N  N     . PHE C 3 200 ? 70.414 2.490   5.170   1.00 15.87  ? 206  PHE A N     1 
ATOM   2091 C  CA    . PHE C 3 200 ? 69.962 3.684   5.877   1.00 11.60  ? 206  PHE A CA    1 
ATOM   2092 C  C     . PHE C 3 200 ? 68.571 4.127   5.439   1.00 10.63  ? 206  PHE A C     1 
ATOM   2093 O  O     . PHE C 3 200 ? 67.745 4.471   6.278   1.00 17.20  ? 206  PHE A O     1 
ATOM   2094 C  CB    . PHE C 3 200 ? 70.949 4.848   5.688   1.00 12.92  ? 206  PHE A CB    1 
ATOM   2095 C  CG    . PHE C 3 200 ? 70.654 6.042   6.559   1.00 13.66  ? 206  PHE A CG    1 
ATOM   2096 C  CD1   . PHE C 3 200 ? 69.795 7.054   6.118   1.00 15.00  ? 206  PHE A CD1   1 
ATOM   2097 C  CD2   . PHE C 3 200 ? 71.221 6.149   7.831   1.00 11.51  ? 206  PHE A CD2   1 
ATOM   2098 C  CE1   . PHE C 3 200 ? 69.502 8.158   6.931   1.00 17.27  ? 206  PHE A CE1   1 
ATOM   2099 C  CE2   . PHE C 3 200 ? 70.937 7.248   8.655   1.00 12.30  ? 206  PHE A CE2   1 
ATOM   2100 C  CZ    . PHE C 3 200 ? 70.075 8.254   8.205   1.00 16.41  ? 206  PHE A CZ    1 
ATOM   2101 N  N     . TRP C 3 201 ? 68.317 4.119   4.134   1.00 11.24  ? 207  TRP A N     1 
ATOM   2102 C  CA    . TRP C 3 201 ? 67.020 4.538   3.600   1.00 9.40   ? 207  TRP A CA    1 
ATOM   2103 C  C     . TRP C 3 201 ? 65.941 3.470   3.733   1.00 11.49  ? 207  TRP A C     1 
ATOM   2104 O  O     . TRP C 3 201 ? 64.789 3.785   4.039   1.00 9.72   ? 207  TRP A O     1 
ATOM   2105 C  CB    . TRP C 3 201 ? 67.146 4.957   2.127   1.00 12.41  ? 207  TRP A CB    1 
ATOM   2106 C  CG    . TRP C 3 201 ? 68.217 5.986   1.871   1.00 11.74  ? 207  TRP A CG    1 
ATOM   2107 C  CD1   . TRP C 3 201 ? 69.313 5.837   1.074   1.00 5.51   ? 207  TRP A CD1   1 
ATOM   2108 C  CD2   . TRP C 3 201 ? 68.308 7.305   2.439   1.00 9.75   ? 207  TRP A CD2   1 
ATOM   2109 N  NE1   . TRP C 3 201 ? 70.082 6.973   1.111   1.00 10.26  ? 207  TRP A NE1   1 
ATOM   2110 C  CE2   . TRP C 3 201 ? 69.491 7.892   1.938   1.00 14.29  ? 207  TRP A CE2   1 
ATOM   2111 C  CE3   . TRP C 3 201 ? 67.503 8.047   3.321   1.00 6.66   ? 207  TRP A CE3   1 
ATOM   2112 C  CZ2   . TRP C 3 201 ? 69.897 9.193   2.294   1.00 16.56  ? 207  TRP A CZ2   1 
ATOM   2113 C  CZ3   . TRP C 3 201 ? 67.898 9.333   3.672   1.00 12.47  ? 207  TRP A CZ3   1 
ATOM   2114 C  CH2   . TRP C 3 201 ? 69.089 9.894   3.160   1.00 14.52  ? 207  TRP A CH2   1 
ATOM   2115 N  N     . SER C 3 202 ? 66.308 2.206   3.527   1.00 17.20  ? 208  SER A N     1 
ATOM   2116 C  CA    . SER C 3 202 ? 65.328 1.124   3.627   1.00 15.73  ? 208  SER A CA    1 
ATOM   2117 C  C     . SER C 3 202 ? 64.840 0.837   5.048   1.00 15.13  ? 208  SER A C     1 
ATOM   2118 O  O     . SER C 3 202 ? 63.644 0.617   5.249   1.00 17.26  ? 208  SER A O     1 
ATOM   2119 C  CB    . SER C 3 202 ? 65.854 -0.163  2.965   1.00 11.85  ? 208  SER A CB    1 
ATOM   2120 O  OG    . SER C 3 202 ? 67.038 -0.628  3.585   1.00 27.57  ? 208  SER A OG    1 
ATOM   2121 N  N     . GLU C 3 203 ? 65.743 0.899   6.030   1.00 16.79  ? 209  GLU A N     1 
ATOM   2122 C  CA    . GLU C 3 203 ? 65.389 0.621   7.431   1.00 17.86  ? 209  GLU A CA    1 
ATOM   2123 C  C     . GLU C 3 203 ? 64.755 1.766   8.229   1.00 12.88  ? 209  GLU A C     1 
ATOM   2124 O  O     . GLU C 3 203 ? 64.045 1.524   9.208   1.00 10.69  ? 209  GLU A O     1 
ATOM   2125 C  CB    . GLU C 3 203 ? 66.606 0.105   8.199   1.00 20.51  ? 209  GLU A CB    1 
ATOM   2126 C  CG    . GLU C 3 203 ? 67.340 -1.074  7.556   1.00 27.11  ? 209  GLU A CG    1 
ATOM   2127 C  CD    . GLU C 3 203 ? 66.477 -2.300  7.293   1.00 29.67  ? 209  GLU A CD    1 
ATOM   2128 O  OE1   . GLU C 3 203 ? 65.635 -2.661  8.145   1.00 28.58  ? 209  GLU A OE1   1 
ATOM   2129 O  OE2   . GLU C 3 203 ? 66.666 -2.916  6.223   1.00 30.54  ? 209  GLU A OE2   1 
ATOM   2130 N  N     . SER C 3 204 ? 65.040 3.005   7.838   1.00 13.87  ? 210  SER A N     1 
ATOM   2131 C  CA    . SER C 3 204 ? 64.486 4.168   8.526   1.00 6.87   ? 210  SER A CA    1 
ATOM   2132 C  C     . SER C 3 204 ? 63.070 4.471   8.054   1.00 10.53  ? 210  SER A C     1 
ATOM   2133 O  O     . SER C 3 204 ? 62.635 3.979   7.016   1.00 15.41  ? 210  SER A O     1 
ATOM   2134 C  CB    . SER C 3 204 ? 65.374 5.387   8.314   1.00 10.90  ? 210  SER A CB    1 
ATOM   2135 O  OG    . SER C 3 204 ? 65.491 5.686   6.940   1.00 15.05  ? 210  SER A OG    1 
ATOM   2136 N  N     . LEU C 3 205 ? 62.361 5.295   8.816   1.00 9.24   ? 211  LEU A N     1 
ATOM   2137 C  CA    . LEU C 3 205 ? 60.984 5.662   8.492   1.00 9.02   ? 211  LEU A CA    1 
ATOM   2138 C  C     . LEU C 3 205 ? 60.924 6.321   7.112   1.00 11.42  ? 211  LEU A C     1 
ATOM   2139 O  O     . LEU C 3 205 ? 61.817 7.092   6.743   1.00 11.86  ? 211  LEU A O     1 
ATOM   2140 C  CB    . LEU C 3 205 ? 60.426 6.609   9.556   1.00 7.76   ? 211  LEU A CB    1 
ATOM   2141 C  CG    . LEU C 3 205 ? 58.908 6.696   9.653   1.00 8.54   ? 211  LEU A CG    1 
ATOM   2142 C  CD1   . LEU C 3 205 ? 58.364 5.382   10.181  1.00 6.21   ? 211  LEU A CD1   1 
ATOM   2143 C  CD2   . LEU C 3 205 ? 58.529 7.823   10.581  1.00 10.32  ? 211  LEU A CD2   1 
ATOM   2144 N  N     . GLU C 3 206 ? 59.868 6.021   6.359   1.00 9.60   ? 212  GLU A N     1 
ATOM   2145 C  CA    . GLU C 3 206 ? 59.703 6.570   5.015   1.00 10.91  ? 212  GLU A CA    1 
ATOM   2146 C  C     . GLU C 3 206 ? 59.907 8.081   4.956   1.00 14.09  ? 212  GLU A C     1 
ATOM   2147 O  O     . GLU C 3 206 ? 60.463 8.586   3.985   1.00 12.76  ? 212  GLU A O     1 
ATOM   2148 C  CB    . GLU C 3 206 ? 58.325 6.226   4.447   1.00 10.25  ? 212  GLU A CB    1 
ATOM   2149 C  CG    . GLU C 3 206 ? 58.179 6.596   2.969   1.00 8.07   ? 212  GLU A CG    1 
ATOM   2150 C  CD    . GLU C 3 206 ? 56.758 6.468   2.442   1.00 14.35  ? 212  GLU A CD    1 
ATOM   2151 O  OE1   . GLU C 3 206 ? 55.874 5.957   3.164   1.00 19.98  ? 212  GLU A OE1   1 
ATOM   2152 O  OE2   . GLU C 3 206 ? 56.520 6.888   1.292   1.00 14.92  ? 212  GLU A OE2   1 
ATOM   2153 N  N     . ALA C 3 207 ? 59.497 8.779   6.019   1.00 11.39  ? 213  ALA A N     1 
ATOM   2154 C  CA    . ALA C 3 207 ? 59.612 10.237  6.108   1.00 7.48   ? 213  ALA A CA    1 
ATOM   2155 C  C     . ALA C 3 207 ? 61.044 10.739  5.963   1.00 7.81   ? 213  ALA A C     1 
ATOM   2156 O  O     . ALA C 3 207 ? 61.281 11.813  5.407   1.00 10.08  ? 213  ALA A O     1 
ATOM   2157 C  CB    . ALA C 3 207 ? 59.010 10.737  7.421   1.00 6.22   ? 213  ALA A CB    1 
ATOM   2158 N  N     . VAL C 3 208 ? 61.993 9.958   6.464   1.00 9.28   ? 214  VAL A N     1 
ATOM   2159 C  CA    . VAL C 3 208 ? 63.401 10.321  6.385   1.00 10.47  ? 214  VAL A CA    1 
ATOM   2160 C  C     . VAL C 3 208 ? 63.849 10.376  4.916   1.00 12.85  ? 214  VAL A C     1 
ATOM   2161 O  O     . VAL C 3 208 ? 64.567 11.290  4.520   1.00 9.78   ? 214  VAL A O     1 
ATOM   2162 C  CB    . VAL C 3 208 ? 64.284 9.324   7.205   1.00 14.41  ? 214  VAL A CB    1 
ATOM   2163 C  CG1   . VAL C 3 208 ? 65.770 9.710   7.110   1.00 9.22   ? 214  VAL A CG1   1 
ATOM   2164 C  CG2   . VAL C 3 208 ? 63.838 9.313   8.679   1.00 9.57   ? 214  VAL A CG2   1 
ATOM   2165 N  N     . ASP C 3 209 ? 63.388 9.420   4.114   1.00 16.39  ? 215  ASP A N     1 
ATOM   2166 C  CA    . ASP C 3 209 ? 63.736 9.367   2.693   1.00 19.86  ? 215  ASP A CA    1 
ATOM   2167 C  C     . ASP C 3 209 ? 63.101 10.538  1.936   1.00 15.33  ? 215  ASP A C     1 
ATOM   2168 O  O     . ASP C 3 209 ? 63.785 11.246  1.205   1.00 14.27  ? 215  ASP A O     1 
ATOM   2169 C  CB    . ASP C 3 209 ? 63.284 8.026   2.086   1.00 19.12  ? 215  ASP A CB    1 
ATOM   2170 C  CG    . ASP C 3 209 ? 63.809 7.796   0.661   1.00 17.92  ? 215  ASP A CG    1 
ATOM   2171 O  OD1   . ASP C 3 209 ? 64.818 8.415   0.253   1.00 15.44  ? 215  ASP A OD1   1 
ATOM   2172 O  OD2   . ASP C 3 209 ? 63.210 6.969   -0.051  1.00 20.36  ? 215  ASP A OD2   1 
ATOM   2173 N  N     . ILE C 3 210 ? 61.805 10.754  2.149   1.00 11.30  ? 216  ILE A N     1 
ATOM   2174 C  CA    . ILE C 3 210 ? 61.066 11.839  1.490   1.00 17.34  ? 216  ILE A CA    1 
ATOM   2175 C  C     . ILE C 3 210 ? 61.624 13.244  1.778   1.00 13.63  ? 216  ILE A C     1 
ATOM   2176 O  O     . ILE C 3 210 ? 61.677 14.086  0.874   1.00 12.57  ? 216  ILE A O     1 
ATOM   2177 C  CB    . ILE C 3 210 ? 59.549 11.794  1.865   1.00 17.89  ? 216  ILE A CB    1 
ATOM   2178 C  CG1   . ILE C 3 210 ? 58.918 10.518  1.313   1.00 13.92  ? 216  ILE A CG1   1 
ATOM   2179 C  CG2   . ILE C 3 210 ? 58.806 13.021  1.327   1.00 15.70  ? 216  ILE A CG2   1 
ATOM   2180 C  CD1   . ILE C 3 210 ? 57.434 10.408  1.579   1.00 12.70  ? 216  ILE A CD1   1 
ATOM   2181 N  N     . GLU C 3 211 ? 62.042 13.485  3.024   1.00 10.66  ? 217  GLU A N     1 
ATOM   2182 C  CA    . GLU C 3 211 ? 62.583 14.784  3.411   1.00 6.59   ? 217  GLU A CA    1 
ATOM   2183 C  C     . GLU C 3 211 ? 63.924 15.103  2.761   1.00 6.36   ? 217  GLU A C     1 
ATOM   2184 O  O     . GLU C 3 211 ? 64.158 16.237  2.343   1.00 6.35   ? 217  GLU A O     1 
ATOM   2185 C  CB    . GLU C 3 211 ? 62.668 14.911  4.934   1.00 8.64   ? 217  GLU A CB    1 
ATOM   2186 C  CG    . GLU C 3 211 ? 61.303 15.011  5.628   1.00 9.65   ? 217  GLU A CG    1 
ATOM   2187 C  CD    . GLU C 3 211 ? 60.455 16.199  5.163   1.00 14.54  ? 217  GLU A CD    1 
ATOM   2188 O  OE1   . GLU C 3 211 ? 60.980 17.329  5.058   1.00 13.38  ? 217  GLU A OE1   1 
ATOM   2189 O  OE2   . GLU C 3 211 ? 59.250 16.004  4.902   1.00 10.25  ? 217  GLU A OE2   1 
ATOM   2190 N  N     . HIS C 3 212 ? 64.805 14.113  2.666   1.00 5.01   ? 218  HIS A N     1 
ATOM   2191 C  CA    . HIS C 3 212 ? 66.098 14.342  2.033   1.00 8.54   ? 218  HIS A CA    1 
ATOM   2192 C  C     . HIS C 3 212 ? 65.938 14.544  0.535   1.00 5.55   ? 218  HIS A C     1 
ATOM   2193 O  O     . HIS C 3 212 ? 66.630 15.368  -0.052  1.00 9.24   ? 218  HIS A O     1 
ATOM   2194 C  CB    . HIS C 3 212 ? 67.065 13.195  2.318   1.00 2.00   ? 218  HIS A CB    1 
ATOM   2195 C  CG    . HIS C 3 212 ? 67.672 13.255  3.683   1.00 7.91   ? 218  HIS A CG    1 
ATOM   2196 N  ND1   . HIS C 3 212 ? 67.009 12.831  4.813   1.00 8.01   ? 218  HIS A ND1   1 
ATOM   2197 C  CD2   . HIS C 3 212 ? 68.876 13.712  4.102   1.00 7.48   ? 218  HIS A CD2   1 
ATOM   2198 C  CE1   . HIS C 3 212 ? 67.776 13.024  5.870   1.00 9.75   ? 218  HIS A CE1   1 
ATOM   2199 N  NE2   . HIS C 3 212 ? 68.914 13.558  5.465   1.00 8.61   ? 218  HIS A NE2   1 
ATOM   2200 N  N     . ARG C 3 213 ? 65.018 13.803  -0.075  1.00 8.89   ? 219  ARG A N     1 
ATOM   2201 C  CA    . ARG C 3 213 ? 64.770 13.921  -1.508  1.00 7.88   ? 219  ARG A CA    1 
ATOM   2202 C  C     . ARG C 3 213 ? 64.127 15.266  -1.812  1.00 10.26  ? 219  ARG A C     1 
ATOM   2203 O  O     . ARG C 3 213 ? 64.452 15.904  -2.814  1.00 9.54   ? 219  ARG A O     1 
ATOM   2204 C  CB    . ARG C 3 213 ? 63.878 12.782  -2.004  1.00 6.50   ? 219  ARG A CB    1 
ATOM   2205 C  CG    . ARG C 3 213 ? 64.570 11.426  -2.079  1.00 8.70   ? 219  ARG A CG    1 
ATOM   2206 C  CD    . ARG C 3 213 ? 63.582 10.356  -2.516  1.00 2.00   ? 219  ARG A CD    1 
ATOM   2207 N  NE    . ARG C 3 213 ? 64.192 9.039   -2.691  1.00 8.59   ? 219  ARG A NE    1 
ATOM   2208 C  CZ    . ARG C 3 213 ? 64.536 8.516   -3.868  1.00 13.85  ? 219  ARG A CZ    1 
ATOM   2209 N  NH1   . ARG C 3 213 ? 64.342 9.201   -4.987  1.00 19.02  ? 219  ARG A NH1   1 
ATOM   2210 N  NH2   . ARG C 3 213 ? 65.043 7.290   -3.931  1.00 8.20   ? 219  ARG A NH2   1 
ATOM   2211 N  N     . ALA C 3 214 ? 63.221 15.702  -0.939  1.00 7.78   ? 220  ALA A N     1 
ATOM   2212 C  CA    . ALA C 3 214 ? 62.559 16.987  -1.117  1.00 7.67   ? 220  ALA A CA    1 
ATOM   2213 C  C     . ALA C 3 214 ? 63.572 18.125  -0.966  1.00 9.66   ? 220  ALA A C     1 
ATOM   2214 O  O     . ALA C 3 214 ? 63.599 19.043  -1.776  1.00 15.06  ? 220  ALA A O     1 
ATOM   2215 C  CB    . ALA C 3 214 ? 61.433 17.145  -0.111  1.00 6.04   ? 220  ALA A CB    1 
ATOM   2216 N  N     . ALA C 3 215 ? 64.438 18.032  0.039   1.00 5.67   ? 221  ALA A N     1 
ATOM   2217 C  CA    . ALA C 3 215 ? 65.442 19.062  0.283   1.00 3.50   ? 221  ALA A CA    1 
ATOM   2218 C  C     . ALA C 3 215 ? 66.476 19.128  -0.831  1.00 7.33   ? 221  ALA A C     1 
ATOM   2219 O  O     . ALA C 3 215 ? 67.012 20.196  -1.129  1.00 3.40   ? 221  ALA A O     1 
ATOM   2220 C  CB    . ALA C 3 215 ? 66.129 18.810  1.595   1.00 2.00   ? 221  ALA A CB    1 
ATOM   2221 N  N     . TRP C 3 216 ? 66.781 17.979  -1.422  1.00 4.26   ? 222  TRP A N     1 
ATOM   2222 C  CA    . TRP C 3 216 ? 67.760 17.922  -2.498  1.00 5.97   ? 222  TRP A CA    1 
ATOM   2223 C  C     . TRP C 3 216 ? 67.168 18.542  -3.758  1.00 5.12   ? 222  TRP A C     1 
ATOM   2224 O  O     . TRP C 3 216 ? 67.855 19.260  -4.476  1.00 9.90   ? 222  TRP A O     1 
ATOM   2225 C  CB    . TRP C 3 216 ? 68.176 16.477  -2.755  1.00 5.91   ? 222  TRP A CB    1 
ATOM   2226 C  CG    . TRP C 3 216 ? 69.318 16.320  -3.720  1.00 14.56  ? 222  TRP A CG    1 
ATOM   2227 C  CD1   . TRP C 3 216 ? 69.236 16.243  -5.086  1.00 10.33  ? 222  TRP A CD1   1 
ATOM   2228 C  CD2   . TRP C 3 216 ? 70.711 16.159  -3.391  1.00 13.62  ? 222  TRP A CD2   1 
ATOM   2229 N  NE1   . TRP C 3 216 ? 70.486 16.031  -5.622  1.00 12.17  ? 222  TRP A NE1   1 
ATOM   2230 C  CE2   . TRP C 3 216 ? 71.409 15.975  -4.610  1.00 15.10  ? 222  TRP A CE2   1 
ATOM   2231 C  CE3   . TRP C 3 216 ? 71.433 16.142  -2.188  1.00 14.35  ? 222  TRP A CE3   1 
ATOM   2232 C  CZ2   . TRP C 3 216 ? 72.801 15.776  -4.658  1.00 10.13  ? 222  TRP A CZ2   1 
ATOM   2233 C  CZ3   . TRP C 3 216 ? 72.813 15.944  -2.233  1.00 11.35  ? 222  TRP A CZ3   1 
ATOM   2234 C  CH2   . TRP C 3 216 ? 73.483 15.763  -3.463  1.00 11.73  ? 222  TRP A CH2   1 
ATOM   2235 N  N     . LEU C 3 217 ? 65.885 18.283  -3.999  1.00 4.62   ? 223  LEU A N     1 
ATOM   2236 C  CA    . LEU C 3 217 ? 65.201 18.823  -5.172  1.00 8.83   ? 223  LEU A CA    1 
ATOM   2237 C  C     . LEU C 3 217 ? 64.992 20.333  -5.054  1.00 14.05  ? 223  LEU A C     1 
ATOM   2238 O  O     . LEU C 3 217 ? 65.252 21.081  -6.001  1.00 12.58  ? 223  LEU A O     1 
ATOM   2239 C  CB    . LEU C 3 217 ? 63.851 18.122  -5.366  1.00 10.58  ? 223  LEU A CB    1 
ATOM   2240 C  CG    . LEU C 3 217 ? 62.878 18.666  -6.415  1.00 7.40   ? 223  LEU A CG    1 
ATOM   2241 C  CD1   . LEU C 3 217 ? 63.537 18.735  -7.787  1.00 8.28   ? 223  LEU A CD1   1 
ATOM   2242 C  CD2   . LEU C 3 217 ? 61.653 17.798  -6.449  1.00 2.00   ? 223  LEU A CD2   1 
ATOM   2243 N  N     . LEU C 3 218 ? 64.555 20.768  -3.875  1.00 7.70   ? 224  LEU A N     1 
ATOM   2244 C  CA    . LEU C 3 218 ? 64.290 22.175  -3.609  1.00 3.60   ? 224  LEU A CA    1 
ATOM   2245 C  C     . LEU C 3 218 ? 65.548 23.039  -3.570  1.00 3.81   ? 224  LEU A C     1 
ATOM   2246 O  O     . LEU C 3 218 ? 65.487 24.240  -3.812  1.00 10.10  ? 224  LEU A O     1 
ATOM   2247 C  CB    . LEU C 3 218 ? 63.472 22.308  -2.320  1.00 8.86   ? 224  LEU A CB    1 
ATOM   2248 C  CG    . LEU C 3 218 ? 62.071 21.698  -2.451  1.00 6.80   ? 224  LEU A CG    1 
ATOM   2249 C  CD1   . LEU C 3 218 ? 61.366 21.709  -1.114  1.00 8.74   ? 224  LEU A CD1   1 
ATOM   2250 C  CD2   . LEU C 3 218 ? 61.268 22.474  -3.500  1.00 6.99   ? 224  LEU A CD2   1 
ATOM   2251 N  N     . ALA C 3 219 ? 66.686 22.425  -3.270  1.00 5.12   ? 225  ALA A N     1 
ATOM   2252 C  CA    . ALA C 3 219 ? 67.951 23.143  -3.236  1.00 10.73  ? 225  ALA A CA    1 
ATOM   2253 C  C     . ALA C 3 219 ? 68.282 23.484  -4.688  1.00 13.08  ? 225  ALA A C     1 
ATOM   2254 O  O     . ALA C 3 219 ? 68.800 24.565  -4.985  1.00 14.61  ? 225  ALA A O     1 
ATOM   2255 C  CB    . ALA C 3 219 ? 69.038 22.274  -2.627  1.00 9.15   ? 225  ALA A CB    1 
ATOM   2256 N  N     . LYS C 3 220 ? 67.958 22.551  -5.582  1.00 5.56   ? 226  LYS A N     1 
ATOM   2257 C  CA    . LYS C 3 220 ? 68.174 22.716  -7.019  1.00 13.62  ? 226  LYS A CA    1 
ATOM   2258 C  C     . LYS C 3 220 ? 67.258 23.832  -7.539  1.00 14.51  ? 226  LYS A C     1 
ATOM   2259 O  O     . LYS C 3 220 ? 67.687 24.668  -8.333  1.00 13.35  ? 226  LYS A O     1 
ATOM   2260 C  CB    . LYS C 3 220 ? 67.867 21.406  -7.751  1.00 13.72  ? 226  LYS A CB    1 
ATOM   2261 C  CG    . LYS C 3 220 ? 67.863 21.502  -9.272  1.00 8.04   ? 226  LYS A CG    1 
ATOM   2262 C  CD    . LYS C 3 220 ? 69.217 21.840  -9.836  1.00 5.41   ? 226  LYS A CD    1 
ATOM   2263 C  CE    . LYS C 3 220 ? 69.226 21.619  -11.336 1.00 8.87   ? 226  LYS A CE    1 
ATOM   2264 N  NZ    . LYS C 3 220 ? 70.606 21.688  -11.872 1.00 20.81  ? 226  LYS A NZ    1 
ATOM   2265 N  N     . GLN C 3 221 ? 66.006 23.835  -7.074  1.00 5.42   ? 227  GLN A N     1 
ATOM   2266 C  CA    . GLN C 3 221 ? 65.028 24.842  -7.466  1.00 2.00   ? 227  GLN A CA    1 
ATOM   2267 C  C     . GLN C 3 221 ? 65.494 26.250  -7.086  1.00 10.42  ? 227  GLN A C     1 
ATOM   2268 O  O     . GLN C 3 221 ? 65.250 27.211  -7.823  1.00 17.39  ? 227  GLN A O     1 
ATOM   2269 C  CB    . GLN C 3 221 ? 63.692 24.565  -6.800  1.00 2.00   ? 227  GLN A CB    1 
ATOM   2270 C  CG    . GLN C 3 221 ? 62.645 25.615  -7.119  1.00 7.31   ? 227  GLN A CG    1 
ATOM   2271 C  CD    . GLN C 3 221 ? 61.323 25.356  -6.452  1.00 4.65   ? 227  GLN A CD    1 
ATOM   2272 O  OE1   . GLN C 3 221 ? 60.532 24.527  -6.905  1.00 5.82   ? 227  GLN A OE1   1 
ATOM   2273 N  NE2   . GLN C 3 221 ? 61.063 26.078  -5.366  1.00 14.17  ? 227  GLN A NE2   1 
ATOM   2274 N  N     . GLU C 3 222 ? 66.138 26.367  -5.924  1.00 9.54   ? 228  GLU A N     1 
ATOM   2275 C  CA    . GLU C 3 222 ? 66.642 27.652  -5.446  1.00 8.09   ? 228  GLU A CA    1 
ATOM   2276 C  C     . GLU C 3 222 ? 67.756 28.129  -6.353  1.00 10.35  ? 228  GLU A C     1 
ATOM   2277 O  O     . GLU C 3 222 ? 67.789 29.295  -6.739  1.00 8.16   ? 228  GLU A O     1 
ATOM   2278 C  CB    . GLU C 3 222 ? 67.162 27.542  -4.019  1.00 3.21   ? 228  GLU A CB    1 
ATOM   2279 C  CG    . GLU C 3 222 ? 66.072 27.255  -2.999  1.00 11.31  ? 228  GLU A CG    1 
ATOM   2280 C  CD    . GLU C 3 222 ? 66.521 27.499  -1.571  1.00 15.86  ? 228  GLU A CD    1 
ATOM   2281 O  OE1   . GLU C 3 222 ? 67.578 28.134  -1.360  1.00 13.15  ? 228  GLU A OE1   1 
ATOM   2282 O  OE2   . GLU C 3 222 ? 65.801 27.069  -0.653  1.00 10.65  ? 228  GLU A OE2   1 
ATOM   2283 N  N     . ARG C 3 223 ? 68.658 27.209  -6.689  1.00 8.58   ? 229  ARG A N     1 
ATOM   2284 C  CA    . ARG C 3 223 ? 69.782 27.497  -7.565  1.00 7.90   ? 229  ARG A CA    1 
ATOM   2285 C  C     . ARG C 3 223 ? 69.297 27.875  -8.968  1.00 5.25   ? 229  ARG A C     1 
ATOM   2286 O  O     . ARG C 3 223 ? 69.930 28.679  -9.642  1.00 7.92   ? 229  ARG A O     1 
ATOM   2287 C  CB    . ARG C 3 223 ? 70.722 26.293  -7.632  1.00 9.07   ? 229  ARG A CB    1 
ATOM   2288 C  CG    . ARG C 3 223 ? 71.753 26.235  -6.512  1.00 12.04  ? 229  ARG A CG    1 
ATOM   2289 C  CD    . ARG C 3 223 ? 72.599 24.971  -6.614  1.00 7.21   ? 229  ARG A CD    1 
ATOM   2290 N  NE    . ARG C 3 223 ? 72.051 23.930  -5.755  1.00 26.92  ? 229  ARG A NE    1 
ATOM   2291 C  CZ    . ARG C 3 223 ? 71.764 22.684  -6.113  1.00 12.85  ? 229  ARG A CZ    1 
ATOM   2292 N  NH1   . ARG C 3 223 ? 71.967 22.241  -7.342  1.00 20.42  ? 229  ARG A NH1   1 
ATOM   2293 N  NH2   . ARG C 3 223 ? 71.221 21.886  -5.220  1.00 27.58  ? 229  ARG A NH2   1 
ATOM   2294 N  N     . ASN C 3 224 ? 68.176 27.293  -9.395  1.00 8.14   ? 230  ASN A N     1 
ATOM   2295 C  CA    . ASN C 3 224 ? 67.598 27.581  -10.704 1.00 3.10   ? 230  ASN A CA    1 
ATOM   2296 C  C     . ASN C 3 224 ? 67.119 29.021  -10.685 1.00 5.93   ? 230  ASN A C     1 
ATOM   2297 O  O     . ASN C 3 224 ? 67.541 29.837  -11.497 1.00 8.88   ? 230  ASN A O     1 
ATOM   2298 C  CB    . ASN C 3 224 ? 66.389 26.674  -11.004 1.00 2.00   ? 230  ASN A CB    1 
ATOM   2299 C  CG    . ASN C 3 224 ? 66.775 25.244  -11.345 1.00 2.15   ? 230  ASN A CG    1 
ATOM   2300 O  OD1   . ASN C 3 224 ? 67.909 24.955  -11.702 1.00 4.77   ? 230  ASN A OD1   1 
ATOM   2301 N  ND2   . ASN C 3 224 ? 65.811 24.344  -11.253 1.00 4.04   ? 230  ASN A ND2   1 
ATOM   2302 N  N     . GLY C 3 225 ? 66.254 29.324  -9.722  1.00 8.54   ? 231  GLY A N     1 
ATOM   2303 C  CA    . GLY C 3 225 ? 65.704 30.660  -9.598  1.00 5.77   ? 231  GLY A CA    1 
ATOM   2304 C  C     . GLY C 3 225 ? 64.449 30.782  -10.432 1.00 5.88   ? 231  GLY A C     1 
ATOM   2305 O  O     . GLY C 3 225 ? 64.096 29.869  -11.174 1.00 7.92   ? 231  GLY A O     1 
ATOM   2306 N  N     . PHE C 3 226 ? 63.770 31.911  -10.310 1.00 6.20   ? 232  PHE A N     1 
ATOM   2307 C  CA    . PHE C 3 226 ? 62.548 32.157  -11.061 1.00 9.32   ? 232  PHE A CA    1 
ATOM   2308 C  C     . PHE C 3 226 ? 62.821 33.383  -11.929 1.00 11.53  ? 232  PHE A C     1 
ATOM   2309 O  O     . PHE C 3 226 ? 63.019 34.481  -11.404 1.00 6.84   ? 232  PHE A O     1 
ATOM   2310 C  CB    . PHE C 3 226 ? 61.381 32.440  -10.099 1.00 5.74   ? 232  PHE A CB    1 
ATOM   2311 C  CG    . PHE C 3 226 ? 60.018 32.155  -10.679 1.00 6.93   ? 232  PHE A CG    1 
ATOM   2312 C  CD1   . PHE C 3 226 ? 59.757 32.335  -12.040 1.00 2.00   ? 232  PHE A CD1   1 
ATOM   2313 C  CD2   . PHE C 3 226 ? 58.997 31.681  -9.863  1.00 7.22   ? 232  PHE A CD2   1 
ATOM   2314 C  CE1   . PHE C 3 226 ? 58.498 32.047  -12.575 1.00 4.07   ? 232  PHE A CE1   1 
ATOM   2315 C  CE2   . PHE C 3 226 ? 57.736 31.389  -10.387 1.00 5.30   ? 232  PHE A CE2   1 
ATOM   2316 C  CZ    . PHE C 3 226 ? 57.487 31.572  -11.750 1.00 7.32   ? 232  PHE A CZ    1 
ATOM   2317 N  N     . PRO C 3 227 ? 62.908 33.195  -13.266 1.00 13.50  ? 233  PRO A N     1 
ATOM   2318 C  CA    . PRO C 3 227 ? 63.164 34.288  -14.216 1.00 11.62  ? 233  PRO A CA    1 
ATOM   2319 C  C     . PRO C 3 227 ? 62.192 35.433  -13.960 1.00 14.29  ? 233  PRO A C     1 
ATOM   2320 O  O     . PRO C 3 227 ? 60.970 35.264  -14.003 1.00 10.39  ? 233  PRO A O     1 
ATOM   2321 C  CB    . PRO C 3 227 ? 62.962 33.605  -15.561 1.00 9.61   ? 233  PRO A CB    1 
ATOM   2322 C  CG    . PRO C 3 227 ? 63.546 32.250  -15.283 1.00 7.67   ? 233  PRO A CG    1 
ATOM   2323 C  CD    . PRO C 3 227 ? 62.849 31.908  -13.983 1.00 7.41   ? 233  PRO A CD    1 
ATOM   2324 N  N     . PHE C 3 228 ? 62.770 36.590  -13.663 1.00 14.18  ? 234  PHE A N     1 
ATOM   2325 C  CA    . PHE C 3 228 ? 62.019 37.785  -13.328 1.00 16.37  ? 234  PHE A CA    1 
ATOM   2326 C  C     . PHE C 3 228 ? 62.218 38.950  -14.308 1.00 16.55  ? 234  PHE A C     1 
ATOM   2327 O  O     . PHE C 3 228 ? 63.328 39.217  -14.765 1.00 15.05  ? 234  PHE A O     1 
ATOM   2328 C  CB    . PHE C 3 228 ? 62.435 38.181  -11.905 1.00 9.49   ? 234  PHE A CB    1 
ATOM   2329 C  CG    . PHE C 3 228 ? 61.692 39.351  -11.336 1.00 6.99   ? 234  PHE A CG    1 
ATOM   2330 C  CD1   . PHE C 3 228 ? 60.369 39.226  -10.932 1.00 7.02   ? 234  PHE A CD1   1 
ATOM   2331 C  CD2   . PHE C 3 228 ? 62.336 40.568  -11.151 1.00 5.33   ? 234  PHE A CD2   1 
ATOM   2332 C  CE1   . PHE C 3 228 ? 59.703 40.294  -10.343 1.00 2.92   ? 234  PHE A CE1   1 
ATOM   2333 C  CE2   . PHE C 3 228 ? 61.678 41.635  -10.564 1.00 6.32   ? 234  PHE A CE2   1 
ATOM   2334 C  CZ    . PHE C 3 228 ? 60.361 41.495  -10.160 1.00 2.00   ? 234  PHE A CZ    1 
ATOM   2335 N  N     . ASP C 3 229 ? 61.127 39.657  -14.594 1.00 18.89  ? 235  ASP A N     1 
ATOM   2336 C  CA    . ASP C 3 229 ? 61.145 40.797  -15.504 1.00 18.42  ? 235  ASP A CA    1 
ATOM   2337 C  C     . ASP C 3 229 ? 61.371 42.077  -14.681 1.00 14.95  ? 235  ASP A C     1 
ATOM   2338 O  O     . ASP C 3 229 ? 60.421 42.700  -14.204 1.00 9.03   ? 235  ASP A O     1 
ATOM   2339 C  CB    . ASP C 3 229 ? 59.810 40.871  -16.260 1.00 19.74  ? 235  ASP A CB    1 
ATOM   2340 C  CG    . ASP C 3 229 ? 59.856 41.792  -17.479 1.00 12.14  ? 235  ASP A CG    1 
ATOM   2341 O  OD1   . ASP C 3 229 ? 60.831 42.561  -17.657 1.00 7.38   ? 235  ASP A OD1   1 
ATOM   2342 O  OD2   . ASP C 3 229 ? 58.892 41.738  -18.268 1.00 13.49  ? 235  ASP A OD2   1 
ATOM   2343 N  N     . THR C 3 230 ? 62.638 42.450  -14.524 1.00 9.91   ? 236  THR A N     1 
ATOM   2344 C  CA    . THR C 3 230 ? 63.015 43.633  -13.768 1.00 13.24  ? 236  THR A CA    1 
ATOM   2345 C  C     . THR C 3 230 ? 62.435 44.913  -14.367 1.00 17.45  ? 236  THR A C     1 
ATOM   2346 O  O     . THR C 3 230 ? 61.854 45.719  -13.644 1.00 19.97  ? 236  THR A O     1 
ATOM   2347 C  CB    . THR C 3 230 ? 64.547 43.756  -13.668 1.00 18.08  ? 236  THR A CB    1 
ATOM   2348 O  OG1   . THR C 3 230 ? 65.088 42.518  -13.193 1.00 19.21  ? 236  THR A OG1   1 
ATOM   2349 C  CG2   . THR C 3 230 ? 64.943 44.860  -12.697 1.00 15.16  ? 236  THR A CG2   1 
ATOM   2350 N  N     . LYS C 3 231 ? 62.563 45.086  -15.683 1.00 15.88  ? 237  LYS A N     1 
ATOM   2351 C  CA    . LYS C 3 231 ? 62.042 46.281  -16.340 1.00 13.92  ? 237  LYS A CA    1 
ATOM   2352 C  C     . LYS C 3 231 ? 60.554 46.492  -16.128 1.00 6.77   ? 237  LYS A C     1 
ATOM   2353 O  O     . LYS C 3 231 ? 60.138 47.590  -15.778 1.00 15.18  ? 237  LYS A O     1 
ATOM   2354 C  CB    . LYS C 3 231 ? 62.363 46.276  -17.839 1.00 27.18  ? 237  LYS A CB    1 
ATOM   2355 C  CG    . LYS C 3 231 ? 63.297 47.416  -18.278 1.00 47.25  ? 237  LYS A CG    1 
ATOM   2356 C  CD    . LYS C 3 231 ? 62.675 48.806  -18.033 1.00 55.89  ? 237  LYS A CD    1 
ATOM   2357 C  CE    . LYS C 3 231 ? 63.627 49.962  -18.378 1.00 50.87  ? 237  LYS A CE    1 
ATOM   2358 N  NZ    . LYS C 3 231 ? 64.824 50.042  -17.481 1.00 55.82  ? 237  LYS A NZ    1 
ATOM   2359 N  N     . ALA C 3 232 ? 59.754 45.447  -16.322 1.00 10.75  ? 238  ALA A N     1 
ATOM   2360 C  CA    . ALA C 3 232 ? 58.303 45.551  -16.145 1.00 9.68   ? 238  ALA A CA    1 
ATOM   2361 C  C     . ALA C 3 232 ? 57.911 45.978  -14.733 1.00 12.38  ? 238  ALA A C     1 
ATOM   2362 O  O     . ALA C 3 232 ? 56.994 46.777  -14.553 1.00 12.43  ? 238  ALA A O     1 
ATOM   2363 C  CB    . ALA C 3 232 ? 57.629 44.238  -16.491 1.00 3.57   ? 238  ALA A CB    1 
ATOM   2364 N  N     . ILE C 3 233 ? 58.626 45.462  -13.736 1.00 18.38  ? 239  ILE A N     1 
ATOM   2365 C  CA    . ILE C 3 233 ? 58.345 45.790  -12.338 1.00 16.13  ? 239  ILE A CA    1 
ATOM   2366 C  C     . ILE C 3 233 ? 58.840 47.179  -11.956 1.00 15.32  ? 239  ILE A C     1 
ATOM   2367 O  O     . ILE C 3 233 ? 58.246 47.835  -11.096 1.00 17.17  ? 239  ILE A O     1 
ATOM   2368 C  CB    . ILE C 3 233 ? 58.908 44.718  -11.392 1.00 12.00  ? 239  ILE A CB    1 
ATOM   2369 C  CG1   . ILE C 3 233 ? 58.263 43.371  -11.735 1.00 12.03  ? 239  ILE A CG1   1 
ATOM   2370 C  CG2   . ILE C 3 233 ? 58.604 45.068  -9.933  1.00 8.72   ? 239  ILE A CG2   1 
ATOM   2371 C  CD1   . ILE C 3 233 ? 56.744 43.357  -11.617 1.00 10.96  ? 239  ILE A CD1   1 
ATOM   2372 N  N     . GLU C 3 234 ? 59.920 47.624  -12.602 1.00 15.53  ? 240  GLU A N     1 
ATOM   2373 C  CA    . GLU C 3 234 ? 60.472 48.952  -12.359 1.00 15.25  ? 240  GLU A CA    1 
ATOM   2374 C  C     . GLU C 3 234 ? 59.497 49.972  -12.938 1.00 17.87  ? 240  GLU A C     1 
ATOM   2375 O  O     . GLU C 3 234 ? 59.316 51.046  -12.369 1.00 20.61  ? 240  GLU A O     1 
ATOM   2376 C  CB    . GLU C 3 234 ? 61.847 49.111  -13.008 1.00 16.67  ? 240  GLU A CB    1 
ATOM   2377 C  CG    . GLU C 3 234 ? 62.935 48.309  -12.327 1.00 23.40  ? 240  GLU A CG    1 
ATOM   2378 C  CD    . GLU C 3 234 ? 64.310 48.524  -12.933 1.00 28.24  ? 240  GLU A CD    1 
ATOM   2379 O  OE1   . GLU C 3 234 ? 64.428 48.640  -14.176 1.00 27.42  ? 240  GLU A OE1   1 
ATOM   2380 O  OE2   . GLU C 3 234 ? 65.281 48.564  -12.148 1.00 26.47  ? 240  GLU A OE2   1 
ATOM   2381 N  N     . GLU C 3 235 ? 58.859 49.622  -14.060 1.00 13.85  ? 241  GLU A N     1 
ATOM   2382 C  CA    . GLU C 3 235 ? 57.879 50.501  -14.701 1.00 18.06  ? 241  GLU A CA    1 
ATOM   2383 C  C     . GLU C 3 235 ? 56.608 50.521  -13.860 1.00 19.09  ? 241  GLU A C     1 
ATOM   2384 O  O     . GLU C 3 235 ? 55.936 51.551  -13.763 1.00 21.85  ? 241  GLU A O     1 
ATOM   2385 C  CB    . GLU C 3 235 ? 57.563 50.027  -16.122 1.00 21.45  ? 241  GLU A CB    1 
ATOM   2386 C  CG    . GLU C 3 235 ? 58.765 50.105  -17.060 1.00 29.39  ? 241  GLU A CG    1 
ATOM   2387 C  CD    . GLU C 3 235 ? 58.532 49.464  -18.428 1.00 34.10  ? 241  GLU A CD    1 
ATOM   2388 O  OE1   . GLU C 3 235 ? 57.519 48.736  -18.614 1.00 29.44  ? 241  GLU A OE1   1 
ATOM   2389 O  OE2   . GLU C 3 235 ? 59.387 49.690  -19.320 1.00 25.22  ? 241  GLU A OE2   1 
ATOM   2390 N  N     . LEU C 3 236 ? 56.289 49.379  -13.249 1.00 19.68  ? 242  LEU A N     1 
ATOM   2391 C  CA    . LEU C 3 236 ? 55.111 49.267  -12.393 1.00 14.60  ? 242  LEU A CA    1 
ATOM   2392 C  C     . LEU C 3 236 ? 55.316 50.124  -11.148 1.00 12.15  ? 242  LEU A C     1 
ATOM   2393 O  O     . LEU C 3 236 ? 54.372 50.720  -10.649 1.00 13.92  ? 242  LEU A O     1 
ATOM   2394 C  CB    . LEU C 3 236 ? 54.881 47.814  -11.981 1.00 15.95  ? 242  LEU A CB    1 
ATOM   2395 C  CG    . LEU C 3 236 ? 53.774 47.553  -10.949 1.00 21.20  ? 242  LEU A CG    1 
ATOM   2396 C  CD1   . LEU C 3 236 ? 52.424 48.025  -11.484 1.00 21.19  ? 242  LEU A CD1   1 
ATOM   2397 C  CD2   . LEU C 3 236 ? 53.730 46.067  -10.601 1.00 17.57  ? 242  LEU A CD2   1 
ATOM   2398 N  N     . TYR C 3 237 ? 56.560 50.191  -10.676 1.00 9.16   ? 243  TYR A N     1 
ATOM   2399 C  CA    . TYR C 3 237 ? 56.932 50.968  -9.495  1.00 13.58  ? 243  TYR A CA    1 
ATOM   2400 C  C     . TYR C 3 237 ? 56.735 52.473  -9.747  1.00 15.95  ? 243  TYR A C     1 
ATOM   2401 O  O     . TYR C 3 237 ? 56.271 53.212  -8.872  1.00 13.33  ? 243  TYR A O     1 
ATOM   2402 C  CB    . TYR C 3 237 ? 58.391 50.656  -9.124  1.00 11.91  ? 243  TYR A CB    1 
ATOM   2403 C  CG    . TYR C 3 237 ? 58.936 51.394  -7.913  1.00 16.52  ? 243  TYR A CG    1 
ATOM   2404 C  CD1   . TYR C 3 237 ? 58.118 51.703  -6.817  1.00 18.43  ? 243  TYR A CD1   1 
ATOM   2405 C  CD2   . TYR C 3 237 ? 60.277 51.782  -7.859  1.00 11.09  ? 243  TYR A CD2   1 
ATOM   2406 C  CE1   . TYR C 3 237 ? 58.628 52.381  -5.700  1.00 15.71  ? 243  TYR A CE1   1 
ATOM   2407 C  CE2   . TYR C 3 237 ? 60.793 52.455  -6.751  1.00 12.41  ? 243  TYR A CE2   1 
ATOM   2408 C  CZ    . TYR C 3 237 ? 59.965 52.752  -5.677  1.00 14.32  ? 243  TYR A CZ    1 
ATOM   2409 O  OH    . TYR C 3 237 ? 60.473 53.425  -4.590  1.00 15.89  ? 243  TYR A OH    1 
ATOM   2410 N  N     . VAL C 3 238 ? 57.076 52.911  -10.956 1.00 15.16  ? 244  VAL A N     1 
ATOM   2411 C  CA    . VAL C 3 238 ? 56.931 54.308  -11.348 1.00 18.87  ? 244  VAL A CA    1 
ATOM   2412 C  C     . VAL C 3 238 ? 55.449 54.680  -11.407 1.00 15.89  ? 244  VAL A C     1 
ATOM   2413 O  O     . VAL C 3 238 ? 55.065 55.773  -10.994 1.00 20.88  ? 244  VAL A O     1 
ATOM   2414 C  CB    . VAL C 3 238 ? 57.601 54.574  -12.726 1.00 23.59  ? 244  VAL A CB    1 
ATOM   2415 C  CG1   . VAL C 3 238 ? 57.248 55.975  -13.238 1.00 22.67  ? 244  VAL A CG1   1 
ATOM   2416 C  CG2   . VAL C 3 238 ? 59.115 54.431  -12.600 1.00 21.10  ? 244  VAL A CG2   1 
ATOM   2417 N  N     . GLU C 3 239 ? 54.630 53.764  -11.926 1.00 16.97  ? 245  GLU A N     1 
ATOM   2418 C  CA    . GLU C 3 239 ? 53.184 53.961  -12.041 1.00 21.53  ? 245  GLU A CA    1 
ATOM   2419 C  C     . GLU C 3 239 ? 52.528 54.022  -10.661 1.00 20.73  ? 245  GLU A C     1 
ATOM   2420 O  O     . GLU C 3 239 ? 51.685 54.880  -10.408 1.00 25.70  ? 245  GLU A O     1 
ATOM   2421 C  CB    . GLU C 3 239 ? 52.551 52.816  -12.843 1.00 24.03  ? 245  GLU A CB    1 
ATOM   2422 C  CG    . GLU C 3 239 ? 51.026 52.902  -12.989 1.00 33.34  ? 245  GLU A CG    1 
ATOM   2423 C  CD    . GLU C 3 239 ? 50.394 51.638  -13.579 1.00 35.57  ? 245  GLU A CD    1 
ATOM   2424 O  OE1   . GLU C 3 239 ? 51.123 50.674  -13.910 1.00 38.83  ? 245  GLU A OE1   1 
ATOM   2425 O  OE2   . GLU C 3 239 ? 49.151 51.612  -13.707 1.00 33.86  ? 245  GLU A OE2   1 
ATOM   2426 N  N     . LEU C 3 240 ? 52.912 53.095  -9.784  1.00 26.26  ? 246  LEU A N     1 
ATOM   2427 C  CA    . LEU C 3 240 ? 52.376 53.027  -8.419  1.00 24.29  ? 246  LEU A CA    1 
ATOM   2428 C  C     . LEU C 3 240 ? 52.791 54.244  -7.590  1.00 19.03  ? 246  LEU A C     1 
ATOM   2429 O  O     . LEU C 3 240 ? 51.969 54.834  -6.889  1.00 17.50  ? 246  LEU A O     1 
ATOM   2430 C  CB    . LEU C 3 240 ? 52.848 51.744  -7.720  1.00 14.17  ? 246  LEU A CB    1 
ATOM   2431 C  CG    . LEU C 3 240 ? 52.363 50.406  -8.273  1.00 11.98  ? 246  LEU A CG    1 
ATOM   2432 C  CD1   . LEU C 3 240 ? 53.104 49.276  -7.583  1.00 18.81  ? 246  LEU A CD1   1 
ATOM   2433 C  CD2   . LEU C 3 240 ? 50.866 50.266  -8.080  1.00 8.63   ? 246  LEU A CD2   1 
ATOM   2434 N  N     . ALA C 3 241 ? 54.061 54.621  -7.700  1.00 12.65  ? 247  ALA A N     1 
ATOM   2435 C  CA    . ALA C 3 241 ? 54.602 55.764  -6.975  1.00 22.11  ? 247  ALA A CA    1 
ATOM   2436 C  C     . ALA C 3 241 ? 53.928 57.067  -7.410  1.00 20.76  ? 247  ALA A C     1 
ATOM   2437 O  O     . ALA C 3 241 ? 53.722 57.964  -6.593  1.00 27.02  ? 247  ALA A O     1 
ATOM   2438 C  CB    . ALA C 3 241 ? 56.108 55.846  -7.180  1.00 24.89  ? 247  ALA A CB    1 
ATOM   2439 N  N     . ALA C 3 242 ? 53.587 57.160  -8.697  1.00 18.34  ? 248  ALA A N     1 
ATOM   2440 C  CA    . ALA C 3 242 ? 52.922 58.341  -9.253  1.00 17.31  ? 248  ALA A CA    1 
ATOM   2441 C  C     . ALA C 3 242 ? 51.518 58.447  -8.683  1.00 14.58  ? 248  ALA A C     1 
ATOM   2442 O  O     . ALA C 3 242 ? 51.042 59.538  -8.377  1.00 21.59  ? 248  ALA A O     1 
ATOM   2443 C  CB    . ALA C 3 242 ? 52.858 58.250  -10.775 1.00 9.48   ? 248  ALA A CB    1 
ATOM   2444 N  N     . ARG C 3 243 ? 50.852 57.301  -8.564  1.00 16.07  ? 249  ARG A N     1 
ATOM   2445 C  CA    . ARG C 3 243 ? 49.506 57.256  -8.020  1.00 17.54  ? 249  ARG A CA    1 
ATOM   2446 C  C     . ARG C 3 243 ? 49.547 57.528  -6.516  1.00 21.19  ? 249  ARG A C     1 
ATOM   2447 O  O     . ARG C 3 243 ? 48.629 58.133  -5.966  1.00 19.85  ? 249  ARG A O     1 
ATOM   2448 C  CB    . ARG C 3 243 ? 48.868 55.898  -8.299  1.00 18.65  ? 249  ARG A CB    1 
ATOM   2449 C  CG    . ARG C 3 243 ? 47.419 55.794  -7.867  1.00 21.87  ? 249  ARG A CG    1 
ATOM   2450 C  CD    . ARG C 3 243 ? 46.601 56.904  -8.490  1.00 21.82  ? 249  ARG A CD    1 
ATOM   2451 N  NE    . ARG C 3 243 ? 45.199 56.842  -8.101  1.00 23.58  ? 249  ARG A NE    1 
ATOM   2452 C  CZ    . ARG C 3 243 ? 44.389 57.895  -8.034  1.00 29.98  ? 249  ARG A CZ    1 
ATOM   2453 N  NH1   . ARG C 3 243 ? 44.840 59.112  -8.324  1.00 36.07  ? 249  ARG A NH1   1 
ATOM   2454 N  NH2   . ARG C 3 243 ? 43.116 57.728  -7.693  1.00 24.31  ? 249  ARG A NH2   1 
ATOM   2455 N  N     . ARG C 3 244 ? 50.624 57.097  -5.862  1.00 21.60  ? 250  ARG A N     1 
ATOM   2456 C  CA    . ARG C 3 244 ? 50.782 57.308  -4.427  1.00 21.76  ? 250  ARG A CA    1 
ATOM   2457 C  C     . ARG C 3 244 ? 50.971 58.795  -4.155  1.00 19.26  ? 250  ARG A C     1 
ATOM   2458 O  O     . ARG C 3 244 ? 50.353 59.337  -3.240  1.00 14.85  ? 250  ARG A O     1 
ATOM   2459 C  CB    . ARG C 3 244 ? 51.976 56.521  -3.882  1.00 22.60  ? 250  ARG A CB    1 
ATOM   2460 C  CG    . ARG C 3 244 ? 52.203 56.704  -2.378  1.00 19.18  ? 250  ARG A CG    1 
ATOM   2461 C  CD    . ARG C 3 244 ? 53.307 55.793  -1.866  1.00 16.46  ? 250  ARG A CD    1 
ATOM   2462 N  NE    . ARG C 3 244 ? 54.588 56.057  -2.511  1.00 14.22  ? 250  ARG A NE    1 
ATOM   2463 C  CZ    . ARG C 3 244 ? 55.685 55.327  -2.339  1.00 16.63  ? 250  ARG A CZ    1 
ATOM   2464 N  NH1   . ARG C 3 244 ? 55.668 54.271  -1.538  1.00 14.76  ? 250  ARG A NH1   1 
ATOM   2465 N  NH2   . ARG C 3 244 ? 56.805 55.655  -2.967  1.00 14.14  ? 250  ARG A NH2   1 
ATOM   2466 N  N     . SER C 3 245 ? 51.816 59.442  -4.959  1.00 14.76  ? 251  SER A N     1 
ATOM   2467 C  CA    . SER C 3 245 ? 52.086 60.874  -4.822  1.00 18.38  ? 251  SER A CA    1 
ATOM   2468 C  C     . SER C 3 245 ? 50.813 61.689  -4.963  1.00 15.65  ? 251  SER A C     1 
ATOM   2469 O  O     . SER C 3 245 ? 50.610 62.659  -4.241  1.00 24.26  ? 251  SER A O     1 
ATOM   2470 C  CB    . SER C 3 245 ? 53.078 61.348  -5.881  1.00 21.49  ? 251  SER A CB    1 
ATOM   2471 O  OG    . SER C 3 245 ? 54.375 60.856  -5.617  1.00 33.53  ? 251  SER A OG    1 
ATOM   2472 N  N     . GLU C 3 246 ? 49.960 61.284  -5.898  1.00 17.43  ? 252  GLU A N     1 
ATOM   2473 C  CA    . GLU C 3 246 ? 48.702 61.975  -6.145  1.00 18.00  ? 252  GLU A CA    1 
ATOM   2474 C  C     . GLU C 3 246 ? 47.697 61.754  -5.018  1.00 17.31  ? 252  GLU A C     1 
ATOM   2475 O  O     . GLU C 3 246 ? 47.007 62.689  -4.600  1.00 16.07  ? 252  GLU A O     1 
ATOM   2476 C  CB    . GLU C 3 246 ? 48.122 61.533  -7.494  1.00 17.65  ? 252  GLU A CB    1 
ATOM   2477 C  CG    . GLU C 3 246 ? 46.829 62.247  -7.907  1.00 26.99  ? 252  GLU A CG    1 
ATOM   2478 C  CD    . GLU C 3 246 ? 46.935 63.778  -7.959  1.00 25.45  ? 252  GLU A CD    1 
ATOM   2479 O  OE1   . GLU C 3 246 ? 48.056 64.330  -8.053  1.00 14.92  ? 252  GLU A OE1   1 
ATOM   2480 O  OE2   . GLU C 3 246 ? 45.869 64.428  -7.903  1.00 23.36  ? 252  GLU A OE2   1 
ATOM   2481 N  N     . LEU C 3 247 ? 47.622 60.520  -4.530  1.00 16.69  ? 253  LEU A N     1 
ATOM   2482 C  CA    . LEU C 3 247 ? 46.712 60.187  -3.438  1.00 20.16  ? 253  LEU A CA    1 
ATOM   2483 C  C     . LEU C 3 247 ? 47.122 60.959  -2.191  1.00 16.39  ? 253  LEU A C     1 
ATOM   2484 O  O     . LEU C 3 247 ? 46.276 61.512  -1.494  1.00 16.19  ? 253  LEU A O     1 
ATOM   2485 C  CB    . LEU C 3 247 ? 46.734 58.683  -3.157  1.00 16.32  ? 253  LEU A CB    1 
ATOM   2486 C  CG    . LEU C 3 247 ? 46.078 57.801  -4.219  1.00 16.04  ? 253  LEU A CG    1 
ATOM   2487 C  CD1   . LEU C 3 247 ? 46.337 56.340  -3.909  1.00 12.34  ? 253  LEU A CD1   1 
ATOM   2488 C  CD2   . LEU C 3 247 ? 44.584 58.088  -4.278  1.00 13.16  ? 253  LEU A CD2   1 
ATOM   2489 N  N     . LEU C 3 248 ? 48.431 61.032  -1.959  1.00 13.16  ? 254  LEU A N     1 
ATOM   2490 C  CA    . LEU C 3 248 ? 48.999 61.737  -0.817  1.00 16.74  ? 254  LEU A CA    1 
ATOM   2491 C  C     . LEU C 3 248 ? 48.723 63.246  -0.913  1.00 14.92  ? 254  LEU A C     1 
ATOM   2492 O  O     . LEU C 3 248 ? 48.432 63.889  0.093   1.00 19.79  ? 254  LEU A O     1 
ATOM   2493 C  CB    . LEU C 3 248 ? 50.506 61.470  -0.745  1.00 14.49  ? 254  LEU A CB    1 
ATOM   2494 C  CG    . LEU C 3 248 ? 51.281 62.020  0.456   1.00 22.49  ? 254  LEU A CG    1 
ATOM   2495 C  CD1   . LEU C 3 248 ? 50.745 61.429  1.743   1.00 20.60  ? 254  LEU A CD1   1 
ATOM   2496 C  CD2   . LEU C 3 248 ? 52.749 61.689  0.301   1.00 23.96  ? 254  LEU A CD2   1 
ATOM   2497 N  N     . ARG C 3 249 ? 48.799 63.791  -2.128  1.00 14.90  ? 255  ARG A N     1 
ATOM   2498 C  CA    . ARG C 3 249 ? 48.553 65.214  -2.380  1.00 17.07  ? 255  ARG A CA    1 
ATOM   2499 C  C     . ARG C 3 249 ? 47.106 65.591  -2.041  1.00 12.08  ? 255  ARG A C     1 
ATOM   2500 O  O     . ARG C 3 249 ? 46.858 66.583  -1.358  1.00 16.83  ? 255  ARG A O     1 
ATOM   2501 C  CB    . ARG C 3 249 ? 48.827 65.538  -3.851  1.00 21.67  ? 255  ARG A CB    1 
ATOM   2502 C  CG    . ARG C 3 249 ? 48.794 67.023  -4.175  1.00 26.42  ? 255  ARG A CG    1 
ATOM   2503 C  CD    . ARG C 3 249 ? 48.725 67.267  -5.668  1.00 23.37  ? 255  ARG A CD    1 
ATOM   2504 N  NE    . ARG C 3 249 ? 47.469 66.787  -6.245  1.00 22.94  ? 255  ARG A NE    1 
ATOM   2505 C  CZ    . ARG C 3 249 ? 46.329 67.476  -6.249  1.00 24.36  ? 255  ARG A CZ    1 
ATOM   2506 N  NH1   . ARG C 3 249 ? 46.280 68.686  -5.705  1.00 20.84  ? 255  ARG A NH1   1 
ATOM   2507 N  NH2   . ARG C 3 249 ? 45.232 66.960  -6.799  1.00 15.26  ? 255  ARG A NH2   1 
ATOM   2508 N  N     . LYS C 3 250 ? 46.160 64.803  -2.549  1.00 17.14  ? 256  LYS A N     1 
ATOM   2509 C  CA    . LYS C 3 250 ? 44.740 65.024  -2.307  1.00 18.84  ? 256  LYS A CA    1 
ATOM   2510 C  C     . LYS C 3 250 ? 44.365 64.788  -0.846  1.00 21.53  ? 256  LYS A C     1 
ATOM   2511 O  O     . LYS C 3 250 ? 43.558 65.525  -0.276  1.00 26.59  ? 256  LYS A O     1 
ATOM   2512 C  CB    . LYS C 3 250 ? 43.896 64.111  -3.202  1.00 25.36  ? 256  LYS A CB    1 
ATOM   2513 C  CG    . LYS C 3 250 ? 43.831 64.549  -4.654  1.00 31.85  ? 256  LYS A CG    1 
ATOM   2514 C  CD    . LYS C 3 250 ? 42.801 63.741  -5.432  1.00 33.55  ? 256  LYS A CD    1 
ATOM   2515 C  CE    . LYS C 3 250 ? 42.482 64.398  -6.769  1.00 41.27  ? 256  LYS A CE    1 
ATOM   2516 N  NZ    . LYS C 3 250 ? 41.859 65.752  -6.609  1.00 46.45  ? 256  LYS A NZ    1 
ATOM   2517 N  N     . LEU C 3 251 ? 44.955 63.757  -0.247  1.00 24.48  ? 257  LEU A N     1 
ATOM   2518 C  CA    . LEU C 3 251 ? 44.686 63.422  1.146   1.00 23.47  ? 257  LEU A CA    1 
ATOM   2519 C  C     . LEU C 3 251 ? 45.212 64.473  2.115   1.00 22.39  ? 257  LEU A C     1 
ATOM   2520 O  O     . LEU C 3 251 ? 44.556 64.778  3.105   1.00 21.82  ? 257  LEU A O     1 
ATOM   2521 C  CB    . LEU C 3 251 ? 45.259 62.040  1.490   1.00 19.62  ? 257  LEU A CB    1 
ATOM   2522 C  CG    . LEU C 3 251 ? 44.421 60.868  0.972   1.00 20.69  ? 257  LEU A CG    1 
ATOM   2523 C  CD1   . LEU C 3 251 ? 45.138 59.554  1.202   1.00 15.23  ? 257  LEU A CD1   1 
ATOM   2524 C  CD2   . LEU C 3 251 ? 43.070 60.873  1.669   1.00 17.17  ? 257  LEU A CD2   1 
ATOM   2525 N  N     . THR C 3 252 ? 46.383 65.036  1.829   1.00 16.76  ? 258  THR A N     1 
ATOM   2526 C  CA    . THR C 3 252 ? 46.948 66.052  2.705   1.00 19.30  ? 258  THR A CA    1 
ATOM   2527 C  C     . THR C 3 252 ? 46.184 67.358  2.502   1.00 24.09  ? 258  THR A C     1 
ATOM   2528 O  O     . THR C 3 252 ? 46.147 68.207  3.391   1.00 30.52  ? 258  THR A O     1 
ATOM   2529 C  CB    . THR C 3 252 ? 48.468 66.242  2.479   1.00 22.45  ? 258  THR A CB    1 
ATOM   2530 O  OG1   . THR C 3 252 ? 48.730 66.480  1.094   1.00 31.93  ? 258  THR A OG1   1 
ATOM   2531 C  CG2   . THR C 3 252 ? 49.234 65.011  2.941   1.00 13.13  ? 258  THR A CG2   1 
ATOM   2532 N  N     . GLU C 3 253 ? 45.551 67.485  1.337   1.00 25.88  ? 259  GLU A N     1 
ATOM   2533 C  CA    . GLU C 3 253 ? 44.746 68.653  0.984   1.00 31.22  ? 259  GLU A CA    1 
ATOM   2534 C  C     . GLU C 3 253 ? 43.488 68.638  1.863   1.00 26.47  ? 259  GLU A C     1 
ATOM   2535 O  O     . GLU C 3 253 ? 43.112 69.653  2.440   1.00 32.05  ? 259  GLU A O     1 
ATOM   2536 C  CB    . GLU C 3 253 ? 44.355 68.558  -0.496  1.00 46.56  ? 259  GLU A CB    1 
ATOM   2537 C  CG    . GLU C 3 253 ? 43.139 69.372  -0.929  1.00 63.02  ? 259  GLU A CG    1 
ATOM   2538 C  CD    . GLU C 3 253 ? 42.287 68.643  -1.970  1.00 68.40  ? 259  GLU A CD    1 
ATOM   2539 O  OE1   . GLU C 3 253 ? 42.806 68.319  -3.064  1.00 61.09  ? 259  GLU A OE1   1 
ATOM   2540 O  OE2   . GLU C 3 253 ? 41.093 68.390  -1.688  1.00 66.81  ? 259  GLU A OE2   1 
ATOM   2541 N  N     . THR C 3 254 ? 42.875 67.460  1.979   1.00 18.25  ? 260  THR A N     1 
ATOM   2542 C  CA    . THR C 3 254 ? 41.661 67.252  2.765   1.00 17.12  ? 260  THR A CA    1 
ATOM   2543 C  C     . THR C 3 254 ? 41.908 67.187  4.280   1.00 18.19  ? 260  THR A C     1 
ATOM   2544 O  O     . THR C 3 254 ? 41.160 67.766  5.071   1.00 18.68  ? 260  THR A O     1 
ATOM   2545 C  CB    . THR C 3 254 ? 40.948 65.959  2.289   1.00 20.03  ? 260  THR A CB    1 
ATOM   2546 O  OG1   . THR C 3 254 ? 40.538 66.123  0.926   1.00 17.60  ? 260  THR A OG1   1 
ATOM   2547 C  CG2   . THR C 3 254 ? 39.727 65.645  3.140   1.00 15.27  ? 260  THR A CG2   1 
ATOM   2548 N  N     . PHE C 3 255 ? 42.954 66.472  4.672   1.00 19.31  ? 261  PHE A N     1 
ATOM   2549 C  CA    . PHE C 3 255 ? 43.305 66.323  6.077   1.00 19.54  ? 261  PHE A CA    1 
ATOM   2550 C  C     . PHE C 3 255 ? 44.590 67.086  6.349   1.00 21.39  ? 261  PHE A C     1 
ATOM   2551 O  O     . PHE C 3 255 ? 45.684 66.650  5.977   1.00 22.43  ? 261  PHE A O     1 
ATOM   2552 C  CB    . PHE C 3 255 ? 43.473 64.844  6.424   1.00 15.50  ? 261  PHE A CB    1 
ATOM   2553 C  CG    . PHE C 3 255 ? 42.234 64.031  6.190   1.00 19.15  ? 261  PHE A CG    1 
ATOM   2554 C  CD1   . PHE C 3 255 ? 41.071 64.284  6.921   1.00 16.65  ? 261  PHE A CD1   1 
ATOM   2555 C  CD2   . PHE C 3 255 ? 42.219 63.012  5.242   1.00 11.77  ? 261  PHE A CD2   1 
ATOM   2556 C  CE1   . PHE C 3 255 ? 39.907 63.532  6.710   1.00 8.99   ? 261  PHE A CE1   1 
ATOM   2557 C  CE2   . PHE C 3 255 ? 41.060 62.255  5.025   1.00 9.01   ? 261  PHE A CE2   1 
ATOM   2558 C  CZ    . PHE C 3 255 ? 39.905 62.516  5.761   1.00 15.37  ? 261  PHE A CZ    1 
ATOM   2559 N  N     . GLY C 3 256 ? 44.444 68.238  6.993   1.00 18.41  ? 262  GLY A N     1 
ATOM   2560 C  CA    . GLY C 3 256 ? 45.587 69.071  7.297   1.00 18.63  ? 262  GLY A CA    1 
ATOM   2561 C  C     . GLY C 3 256 ? 46.460 68.580  8.429   1.00 24.95  ? 262  GLY A C     1 
ATOM   2562 O  O     . GLY C 3 256 ? 46.076 67.700  9.205   1.00 33.54  ? 262  GLY A O     1 
ATOM   2563 N  N     . SER C 3 257 ? 47.645 69.178  8.511   1.00 27.06  ? 263  SER A N     1 
ATOM   2564 C  CA    . SER C 3 257 ? 48.637 68.867  9.530   1.00 26.94  ? 263  SER A CA    1 
ATOM   2565 C  C     . SER C 3 257 ? 48.233 69.406  10.905  1.00 28.86  ? 263  SER A C     1 
ATOM   2566 O  O     . SER C 3 257 ? 47.312 70.221  11.025  1.00 30.76  ? 263  SER A O     1 
ATOM   2567 C  CB    . SER C 3 257 ? 49.984 69.453  9.116   1.00 31.87  ? 263  SER A CB    1 
ATOM   2568 O  OG    . SER C 3 257 ? 49.889 70.856  8.934   1.00 37.83  ? 263  SER A OG    1 
ATOM   2569 N  N     . TRP C 3 258 ? 48.931 68.947  11.938  1.00 21.66  ? 264  TRP A N     1 
ATOM   2570 C  CA    . TRP C 3 258 ? 48.644 69.373  13.299  1.00 22.43  ? 264  TRP A CA    1 
ATOM   2571 C  C     . TRP C 3 258 ? 49.873 69.217  14.184  1.00 25.74  ? 264  TRP A C     1 
ATOM   2572 O  O     . TRP C 3 258 ? 50.870 68.625  13.779  1.00 26.63  ? 264  TRP A O     1 
ATOM   2573 C  CB    . TRP C 3 258 ? 47.477 68.552  13.872  1.00 24.28  ? 264  TRP A CB    1 
ATOM   2574 C  CG    . TRP C 3 258 ? 47.764 67.071  14.025  1.00 27.20  ? 264  TRP A CG    1 
ATOM   2575 C  CD1   . TRP C 3 258 ? 48.225 66.438  15.147  1.00 21.06  ? 264  TRP A CD1   1 
ATOM   2576 C  CD2   . TRP C 3 258 ? 47.621 66.055  13.022  1.00 23.33  ? 264  TRP A CD2   1 
ATOM   2577 N  NE1   . TRP C 3 258 ? 48.380 65.094  14.901  1.00 24.74  ? 264  TRP A NE1   1 
ATOM   2578 C  CE2   . TRP C 3 258 ? 48.017 64.830  13.608  1.00 22.55  ? 264  TRP A CE2   1 
ATOM   2579 C  CE3   . TRP C 3 258 ? 47.198 66.060  11.685  1.00 24.51  ? 264  TRP A CE3   1 
ATOM   2580 C  CZ2   . TRP C 3 258 ? 48.004 63.620  12.903  1.00 25.66  ? 264  TRP A CZ2   1 
ATOM   2581 C  CZ3   . TRP C 3 258 ? 47.184 64.852  10.980  1.00 22.91  ? 264  TRP A CZ3   1 
ATOM   2582 C  CH2   . TRP C 3 258 ? 47.587 63.651  11.593  1.00 25.80  ? 264  TRP A CH2   1 
ATOM   2583 N  N     . TYR C 3 259 ? 49.796 69.760  15.393  1.00 29.27  ? 265  TYR A N     1 
ATOM   2584 C  CA    . TYR C 3 259 ? 50.891 69.669  16.348  1.00 25.52  ? 265  TYR A CA    1 
ATOM   2585 C  C     . TYR C 3 259 ? 50.578 68.686  17.471  1.00 23.82  ? 265  TYR A C     1 
ATOM   2586 O  O     . TYR C 3 259 ? 49.423 68.516  17.862  1.00 20.13  ? 265  TYR A O     1 
ATOM   2587 C  CB    . TYR C 3 259 ? 51.201 71.043  16.926  1.00 23.96  ? 265  TYR A CB    1 
ATOM   2588 C  CG    . TYR C 3 259 ? 51.950 71.930  15.970  1.00 22.17  ? 265  TYR A CG    1 
ATOM   2589 C  CD1   . TYR C 3 259 ? 51.272 72.724  15.047  1.00 15.61  ? 265  TYR A CD1   1 
ATOM   2590 C  CD2   . TYR C 3 259 ? 53.346 71.979  15.990  1.00 22.53  ? 265  TYR A CD2   1 
ATOM   2591 C  CE1   . TYR C 3 259 ? 51.966 73.544  14.165  1.00 15.41  ? 265  TYR A CE1   1 
ATOM   2592 C  CE2   . TYR C 3 259 ? 54.051 72.796  15.113  1.00 22.70  ? 265  TYR A CE2   1 
ATOM   2593 C  CZ    . TYR C 3 259 ? 53.355 73.579  14.204  1.00 22.16  ? 265  TYR A CZ    1 
ATOM   2594 O  OH    . TYR C 3 259 ? 54.050 74.393  13.340  1.00 19.89  ? 265  TYR A OH    1 
ATOM   2595 N  N     . GLN C 3 260 ? 51.619 68.031  17.972  1.00 20.41  ? 266  GLN A N     1 
ATOM   2596 C  CA    . GLN C 3 260 ? 51.491 67.059  19.057  1.00 25.32  ? 266  GLN A CA    1 
ATOM   2597 C  C     . GLN C 3 260 ? 52.690 67.213  19.972  1.00 21.99  ? 266  GLN A C     1 
ATOM   2598 O  O     . GLN C 3 260 ? 53.778 67.548  19.514  1.00 22.62  ? 266  GLN A O     1 
ATOM   2599 C  CB    . GLN C 3 260 ? 51.514 65.615  18.527  1.00 32.14  ? 266  GLN A CB    1 
ATOM   2600 C  CG    . GLN C 3 260 ? 50.323 65.172  17.699  1.00 37.83  ? 266  GLN A CG    1 
ATOM   2601 C  CD    . GLN C 3 260 ? 50.439 63.727  17.218  1.00 38.24  ? 266  GLN A CD    1 
ATOM   2602 O  OE1   . GLN C 3 260 ? 49.437 63.101  16.885  1.00 38.87  ? 266  GLN A OE1   1 
ATOM   2603 N  NE2   . GLN C 3 260 ? 51.660 63.198  17.171  1.00 33.09  ? 266  GLN A NE2   1 
ATOM   2604 N  N     . PRO C 3 261 ? 52.513 66.961  21.278  1.00 27.10  ? 267  PRO A N     1 
ATOM   2605 C  CA    . PRO C 3 261 ? 53.641 67.086  22.207  1.00 27.90  ? 267  PRO A CA    1 
ATOM   2606 C  C     . PRO C 3 261 ? 54.683 65.998  21.939  1.00 24.28  ? 267  PRO A C     1 
ATOM   2607 O  O     . PRO C 3 261 ? 54.337 64.855  21.640  1.00 24.34  ? 267  PRO A O     1 
ATOM   2608 C  CB    . PRO C 3 261 ? 52.973 66.928  23.571  1.00 28.63  ? 267  PRO A CB    1 
ATOM   2609 C  CG    . PRO C 3 261 ? 51.822 66.008  23.270  1.00 31.38  ? 267  PRO A CG    1 
ATOM   2610 C  CD    . PRO C 3 261 ? 51.276 66.615  22.002  1.00 30.76  ? 267  PRO A CD    1 
ATOM   2611 N  N     . LYS C 3 262 ? 55.953 66.379  21.996  1.00 26.47  ? 268  LYS A N     1 
ATOM   2612 C  CA    . LYS C 3 262 ? 57.058 65.455  21.768  1.00 29.04  ? 268  LYS A CA    1 
ATOM   2613 C  C     . LYS C 3 262 ? 58.344 66.064  22.304  1.00 30.90  ? 268  LYS A C     1 
ATOM   2614 O  O     . LYS C 3 262 ? 58.702 67.189  21.952  1.00 34.83  ? 268  LYS A O     1 
ATOM   2615 C  CB    . LYS C 3 262 ? 57.210 65.140  20.270  1.00 40.71  ? 268  LYS A CB    1 
ATOM   2616 C  CG    . LYS C 3 262 ? 58.436 64.289  19.915  1.00 46.58  ? 268  LYS A CG    1 
ATOM   2617 C  CD    . LYS C 3 262 ? 58.408 62.916  20.585  1.00 52.46  ? 268  LYS A CD    1 
ATOM   2618 C  CE    . LYS C 3 262 ? 57.651 61.898  19.756  1.00 50.74  ? 268  LYS A CE    1 
ATOM   2619 N  NZ    . LYS C 3 262 ? 58.456 61.509  18.567  1.00 42.90  ? 268  LYS A NZ    1 
ATOM   2620 N  N     . GLY C 3 263 ? 59.035 65.309  23.152  1.00 35.92  ? 269  GLY A N     1 
ATOM   2621 C  CA    . GLY C 3 263 ? 60.282 65.787  23.723  1.00 40.70  ? 269  GLY A CA    1 
ATOM   2622 C  C     . GLY C 3 263 ? 60.171 66.212  25.173  1.00 40.87  ? 269  GLY A C     1 
ATOM   2623 O  O     . GLY C 3 263 ? 61.188 66.435  25.834  1.00 52.19  ? 269  GLY A O     1 
ATOM   2624 N  N     . GLY C 3 264 ? 58.939 66.339  25.663  1.00 39.32  ? 270  GLY A N     1 
ATOM   2625 C  CA    . GLY C 3 264 ? 58.721 66.738  27.044  1.00 39.05  ? 270  GLY A CA    1 
ATOM   2626 C  C     . GLY C 3 264 ? 59.195 65.693  28.040  1.00 34.70  ? 270  GLY A C     1 
ATOM   2627 O  O     . GLY C 3 264 ? 58.784 64.534  27.981  1.00 45.15  ? 270  GLY A O     1 
ATOM   2628 N  N     . THR C 3 265 ? 60.066 66.103  28.953  1.00 33.87  ? 271  THR A N     1 
ATOM   2629 C  CA    . THR C 3 265 ? 60.609 65.204  29.971  1.00 40.61  ? 271  THR A CA    1 
ATOM   2630 C  C     . THR C 3 265 ? 59.959 65.399  31.344  1.00 40.71  ? 271  THR A C     1 
ATOM   2631 O  O     . THR C 3 265 ? 59.588 64.437  32.021  1.00 42.63  ? 271  THR A O     1 
ATOM   2632 C  CB    . THR C 3 265 ? 62.135 65.410  30.116  1.00 47.15  ? 271  THR A CB    1 
ATOM   2633 O  OG1   . THR C 3 265 ? 62.420 66.812  30.248  1.00 47.82  ? 271  THR A OG1   1 
ATOM   2634 C  CG2   . THR C 3 265 ? 62.863 64.859  28.905  1.00 53.46  ? 271  THR A CG2   1 
ATOM   2635 N  N     . GLU C 3 266 ? 59.821 66.665  31.721  1.00 43.60  ? 272  GLU A N     1 
ATOM   2636 C  CA    . GLU C 3 266 ? 59.248 67.095  32.991  1.00 41.01  ? 272  GLU A CA    1 
ATOM   2637 C  C     . GLU C 3 266 ? 57.734 66.910  33.135  1.00 40.96  ? 272  GLU A C     1 
ATOM   2638 O  O     . GLU C 3 266 ? 56.981 67.018  32.170  1.00 44.27  ? 272  GLU A O     1 
ATOM   2639 C  CB    . GLU C 3 266 ? 59.591 68.566  33.172  1.00 43.57  ? 272  GLU A CB    1 
ATOM   2640 C  CG    . GLU C 3 266 ? 59.996 68.988  34.555  1.00 44.95  ? 272  GLU A CG    1 
ATOM   2641 C  CD    . GLU C 3 266 ? 60.560 70.396  34.560  1.00 50.38  ? 272  GLU A CD    1 
ATOM   2642 O  OE1   . GLU C 3 266 ? 61.336 70.729  33.634  1.00 50.53  ? 272  GLU A OE1   1 
ATOM   2643 O  OE2   . GLU C 3 266 ? 60.219 71.168  35.482  1.00 54.56  ? 272  GLU A OE2   1 
ATOM   2644 N  N     . MET C 3 267 ? 57.307 66.651  34.366  1.00 37.35  ? 273  MET A N     1 
ATOM   2645 C  CA    . MET C 3 267 ? 55.898 66.461  34.703  1.00 37.78  ? 273  MET A CA    1 
ATOM   2646 C  C     . MET C 3 267 ? 55.267 67.838  34.910  1.00 35.30  ? 273  MET A C     1 
ATOM   2647 O  O     . MET C 3 267 ? 55.867 68.706  35.548  1.00 45.25  ? 273  MET A O     1 
ATOM   2648 C  CB    . MET C 3 267 ? 55.796 65.650  36.003  1.00 49.31  ? 273  MET A CB    1 
ATOM   2649 C  CG    . MET C 3 267 ? 54.411 65.582  36.658  1.00 66.20  ? 273  MET A CG    1 
ATOM   2650 S  SD    . MET C 3 267 ? 53.201 64.490  35.865  1.00 70.93  ? 273  MET A SD    1 
ATOM   2651 C  CE    . MET C 3 267 ? 53.657 62.913  36.604  1.00 64.22  ? 273  MET A CE    1 
ATOM   2652 N  N     . PHE C 3 268 ? 54.077 68.050  34.350  1.00 37.64  ? 274  PHE A N     1 
ATOM   2653 C  CA    . PHE C 3 268 ? 53.385 69.325  34.521  1.00 35.52  ? 274  PHE A CA    1 
ATOM   2654 C  C     . PHE C 3 268 ? 52.571 69.253  35.808  1.00 35.68  ? 274  PHE A C     1 
ATOM   2655 O  O     . PHE C 3 268 ? 51.787 68.325  36.007  1.00 24.94  ? 274  PHE A O     1 
ATOM   2656 C  CB    . PHE C 3 268 ? 52.464 69.661  33.337  1.00 27.90  ? 274  PHE A CB    1 
ATOM   2657 C  CG    . PHE C 3 268 ? 51.725 70.966  33.509  1.00 23.44  ? 274  PHE A CG    1 
ATOM   2658 C  CD1   . PHE C 3 268 ? 52.421 72.177  33.547  1.00 24.56  ? 274  PHE A CD1   1 
ATOM   2659 C  CD2   . PHE C 3 268 ? 50.343 70.983  33.704  1.00 21.46  ? 274  PHE A CD2   1 
ATOM   2660 C  CE1   . PHE C 3 268 ? 51.753 73.388  33.780  1.00 24.33  ? 274  PHE A CE1   1 
ATOM   2661 C  CE2   . PHE C 3 268 ? 49.664 72.190  33.938  1.00 21.73  ? 274  PHE A CE2   1 
ATOM   2662 C  CZ    . PHE C 3 268 ? 50.375 73.394  33.977  1.00 17.90  ? 274  PHE A CZ    1 
ATOM   2663 N  N     . CYS C 3 269 ? 52.769 70.237  36.679  1.00 32.97  ? 275  CYS A N     1 
ATOM   2664 C  CA    . CYS C 3 269 ? 52.066 70.278  37.950  1.00 36.63  ? 275  CYS A CA    1 
ATOM   2665 C  C     . CYS C 3 269 ? 51.154 71.486  38.084  1.00 34.90  ? 275  CYS A C     1 
ATOM   2666 O  O     . CYS C 3 269 ? 51.462 72.573  37.589  1.00 37.30  ? 275  CYS A O     1 
ATOM   2667 C  CB    . CYS C 3 269 ? 53.073 70.252  39.107  1.00 32.71  ? 275  CYS A CB    1 
ATOM   2668 S  SG    . CYS C 3 269 ? 54.123 68.765  39.160  1.00 38.47  ? 275  CYS A SG    1 
ATOM   2669 N  N     . HIS C 3 270 ? 50.035 71.275  38.772  1.00 35.27  ? 276  HIS A N     1 
ATOM   2670 C  CA    . HIS C 3 270 ? 49.038 72.310  39.019  1.00 36.50  ? 276  HIS A CA    1 
ATOM   2671 C  C     . HIS C 3 270 ? 49.686 73.459  39.801  1.00 39.84  ? 276  HIS A C     1 
ATOM   2672 O  O     . HIS C 3 270 ? 50.257 73.248  40.874  1.00 34.15  ? 276  HIS A O     1 
ATOM   2673 C  CB    . HIS C 3 270 ? 47.869 71.716  39.821  1.00 36.32  ? 276  HIS A CB    1 
ATOM   2674 C  CG    . HIS C 3 270 ? 46.590 72.492  39.715  1.00 39.66  ? 276  HIS A CG    1 
ATOM   2675 N  ND1   . HIS C 3 270 ? 45.351 71.892  39.811  1.00 43.47  ? 276  HIS A ND1   1 
ATOM   2676 C  CD2   . HIS C 3 270 ? 46.352 73.812  39.516  1.00 40.80  ? 276  HIS A CD2   1 
ATOM   2677 C  CE1   . HIS C 3 270 ? 44.409 72.806  39.673  1.00 37.42  ? 276  HIS A CE1   1 
ATOM   2678 N  NE2   . HIS C 3 270 ? 44.989 73.978  39.494  1.00 44.12  ? 276  HIS A NE2   1 
ATOM   2679 N  N     . PRO C 3 271 ? 49.656 74.682  39.234  1.00 46.28  ? 277  PRO A N     1 
ATOM   2680 C  CA    . PRO C 3 271 ? 50.219 75.907  39.825  1.00 52.57  ? 277  PRO A CA    1 
ATOM   2681 C  C     . PRO C 3 271 ? 49.505 76.312  41.124  1.00 58.19  ? 277  PRO A C     1 
ATOM   2682 O  O     . PRO C 3 271 ? 50.149 76.618  42.125  1.00 55.59  ? 277  PRO A O     1 
ATOM   2683 C  CB    . PRO C 3 271 ? 49.997 76.953  38.728  1.00 50.57  ? 277  PRO A CB    1 
ATOM   2684 C  CG    . PRO C 3 271 ? 49.987 76.150  37.477  1.00 50.91  ? 277  PRO A CG    1 
ATOM   2685 C  CD    . PRO C 3 271 ? 49.181 74.943  37.864  1.00 50.80  ? 277  PRO A CD    1 
ATOM   2686 N  N     . ARG C 3 272 ? 48.172 76.299  41.081  1.00 65.25  ? 278  ARG A N     1 
ATOM   2687 C  CA    . ARG C 3 272 ? 47.296 76.644  42.208  1.00 66.05  ? 278  ARG A CA    1 
ATOM   2688 C  C     . ARG C 3 272 ? 47.548 75.643  43.330  1.00 66.01  ? 278  ARG A C     1 
ATOM   2689 O  O     . ARG C 3 272 ? 48.095 75.985  44.377  1.00 60.05  ? 278  ARG A O     1 
ATOM   2690 C  CB    . ARG C 3 272 ? 45.839 76.535  41.738  1.00 60.03  ? 278  ARG A CB    1 
ATOM   2691 C  CG    . ARG C 3 272 ? 44.740 76.918  42.719  1.00 52.83  ? 278  ARG A CG    1 
ATOM   2692 C  CD    . ARG C 3 272 ? 43.402 76.468  42.128  1.00 49.52  ? 278  ARG A CD    1 
ATOM   2693 N  NE    . ARG C 3 272 ? 43.277 76.841  40.712  1.00 54.60  ? 278  ARG A NE    1 
ATOM   2694 C  CZ    . ARG C 3 272 ? 42.647 76.119  39.783  1.00 54.64  ? 278  ARG A CZ    1 
ATOM   2695 N  NH1   . ARG C 3 272 ? 42.063 74.974  40.096  1.00 52.57  ? 278  ARG A NH1   1 
ATOM   2696 N  NH2   . ARG C 3 272 ? 42.616 76.536  38.525  1.00 51.36  ? 278  ARG A NH2   1 
ATOM   2697 N  N     . THR C 3 273 ? 47.174 74.394  43.068  1.00 69.97  ? 279  THR A N     1 
ATOM   2698 C  CA    . THR C 3 273 ? 47.339 73.299  44.012  1.00 70.85  ? 279  THR A CA    1 
ATOM   2699 C  C     . THR C 3 273 ? 48.809 72.852  43.978  1.00 67.82  ? 279  THR A C     1 
ATOM   2700 O  O     . THR C 3 273 ? 49.662 73.496  44.592  1.00 73.73  ? 279  THR A O     1 
ATOM   2701 C  CB    . THR C 3 273 ? 46.389 72.126  43.644  1.00 76.35  ? 279  THR A CB    1 
ATOM   2702 O  OG1   . THR C 3 273 ? 45.041 72.605  43.558  1.00 85.15  ? 279  THR A OG1   1 
ATOM   2703 C  CG2   . THR C 3 273 ? 46.451 71.046  44.689  1.00 79.85  ? 279  THR A CG2   1 
ATOM   2704 N  N     . GLY C 3 274 ? 49.110 71.775  43.256  1.00 62.63  ? 280  GLY A N     1 
ATOM   2705 C  CA    . GLY C 3 274 ? 50.476 71.300  43.176  1.00 50.11  ? 280  GLY A CA    1 
ATOM   2706 C  C     . GLY C 3 274 ? 50.562 69.852  42.738  1.00 45.87  ? 280  GLY A C     1 
ATOM   2707 O  O     . GLY C 3 274 ? 51.657 69.357  42.442  1.00 36.86  ? 280  GLY A O     1 
ATOM   2708 N  N     . LYS C 3 275 ? 49.411 69.178  42.671  1.00 37.21  ? 281  LYS A N     1 
ATOM   2709 C  CA    . LYS C 3 275 ? 49.373 67.781  42.278  1.00 43.46  ? 281  LYS A CA    1 
ATOM   2710 C  C     . LYS C 3 275 ? 49.847 67.585  40.849  1.00 44.85  ? 281  LYS A C     1 
ATOM   2711 O  O     . LYS C 3 275 ? 49.598 68.422  39.976  1.00 43.73  ? 281  LYS A O     1 
ATOM   2712 C  CB    . LYS C 3 275 ? 47.962 67.190  42.447  1.00 43.95  ? 281  LYS A CB    1 
ATOM   2713 C  CG    . LYS C 3 275 ? 46.926 67.672  41.448  1.00 47.44  ? 281  LYS A CG    1 
ATOM   2714 C  CD    . LYS C 3 275 ? 45.567 67.030  41.677  1.00 45.77  ? 281  LYS A CD    1 
ATOM   2715 C  CE    . LYS C 3 275 ? 44.537 67.652  40.756  1.00 45.32  ? 281  LYS A CE    1 
ATOM   2716 N  NZ    . LYS C 3 275 ? 43.146 67.270  41.111  1.00 46.75  ? 281  LYS A NZ    1 
ATOM   2717 N  N     . PRO C 3 276 ? 50.609 66.510  40.609  1.00 46.62  ? 282  PRO A N     1 
ATOM   2718 C  CA    . PRO C 3 276 ? 51.114 66.235  39.268  1.00 46.65  ? 282  PRO A CA    1 
ATOM   2719 C  C     . PRO C 3 276 ? 49.917 65.912  38.377  1.00 44.64  ? 282  PRO A C     1 
ATOM   2720 O  O     . PRO C 3 276 ? 48.987 65.223  38.802  1.00 45.82  ? 282  PRO A O     1 
ATOM   2721 C  CB    . PRO C 3 276 ? 52.005 65.014  39.495  1.00 50.16  ? 282  PRO A CB    1 
ATOM   2722 C  CG    . PRO C 3 276 ? 52.508 65.234  40.887  1.00 49.65  ? 282  PRO A CG    1 
ATOM   2723 C  CD    . PRO C 3 276 ? 51.212 65.576  41.577  1.00 47.33  ? 282  PRO A CD    1 
ATOM   2724 N  N     . LEU C 3 277 ? 49.920 66.482  37.176  1.00 37.33  ? 283  LEU A N     1 
ATOM   2725 C  CA    . LEU C 3 277 ? 48.856 66.275  36.201  1.00 37.74  ? 283  LEU A CA    1 
ATOM   2726 C  C     . LEU C 3 277 ? 49.390 65.365  35.088  1.00 43.55  ? 283  LEU A C     1 
ATOM   2727 O  O     . LEU C 3 277 ? 49.925 65.840  34.084  1.00 41.17  ? 283  LEU A O     1 
ATOM   2728 C  CB    . LEU C 3 277 ? 48.400 67.628  35.641  1.00 35.91  ? 283  LEU A CB    1 
ATOM   2729 C  CG    . LEU C 3 277 ? 47.790 68.622  36.643  1.00 40.45  ? 283  LEU A CG    1 
ATOM   2730 C  CD1   . LEU C 3 277 ? 47.525 69.975  35.980  1.00 32.52  ? 283  LEU A CD1   1 
ATOM   2731 C  CD2   . LEU C 3 277 ? 46.495 68.040  37.201  1.00 40.53  ? 283  LEU A CD2   1 
ATOM   2732 N  N     . PRO C 3 278 ? 49.258 64.035  35.270  1.00 53.15  ? 284  PRO A N     1 
ATOM   2733 C  CA    . PRO C 3 278 ? 49.694 62.973  34.357  1.00 56.90  ? 284  PRO A CA    1 
ATOM   2734 C  C     . PRO C 3 278 ? 49.035 62.943  32.986  1.00 56.26  ? 284  PRO A C     1 
ATOM   2735 O  O     . PRO C 3 278 ? 49.580 62.357  32.050  1.00 52.84  ? 284  PRO A O     1 
ATOM   2736 C  CB    . PRO C 3 278 ? 49.382 61.707  35.155  1.00 54.67  ? 284  PRO A CB    1 
ATOM   2737 C  CG    . PRO C 3 278 ? 49.545 62.175  36.565  1.00 51.36  ? 284  PRO A CG    1 
ATOM   2738 C  CD    . PRO C 3 278 ? 48.715 63.417  36.487  1.00 55.81  ? 284  PRO A CD    1 
ATOM   2739 N  N     . LYS C 3 279 ? 47.869 63.574  32.874  1.00 46.96  ? 285  LYS A N     1 
ATOM   2740 C  CA    . LYS C 3 279 ? 47.138 63.612  31.618  1.00 43.66  ? 285  LYS A CA    1 
ATOM   2741 C  C     . LYS C 3 279 ? 47.617 64.716  30.669  1.00 38.67  ? 285  LYS A C     1 
ATOM   2742 O  O     . LYS C 3 279 ? 47.505 64.576  29.452  1.00 41.66  ? 285  LYS A O     1 
ATOM   2743 C  CB    . LYS C 3 279 ? 45.659 63.743  31.893  1.00 46.50  ? 285  LYS A CB    1 
ATOM   2744 N  N     . TYR C 3 280 ? 48.135 65.809  31.231  1.00 36.35  ? 286  TYR A N     1 
ATOM   2745 C  CA    . TYR C 3 280 ? 48.655 66.938  30.451  1.00 35.51  ? 286  TYR A CA    1 
ATOM   2746 C  C     . TYR C 3 280 ? 50.002 66.533  29.843  1.00 35.44  ? 286  TYR A C     1 
ATOM   2747 O  O     . TYR C 3 280 ? 50.701 65.685  30.401  1.00 39.67  ? 286  TYR A O     1 
ATOM   2748 C  CB    . TYR C 3 280 ? 48.874 68.160  31.364  1.00 33.00  ? 286  TYR A CB    1 
ATOM   2749 C  CG    . TYR C 3 280 ? 47.710 69.123  31.452  1.00 38.97  ? 286  TYR A CG    1 
ATOM   2750 C  CD1   . TYR C 3 280 ? 47.594 70.182  30.548  1.00 39.72  ? 286  TYR A CD1   1 
ATOM   2751 C  CD2   . TYR C 3 280 ? 46.730 68.989  32.441  1.00 42.76  ? 286  TYR A CD2   1 
ATOM   2752 C  CE1   . TYR C 3 280 ? 46.535 71.088  30.624  1.00 46.11  ? 286  TYR A CE1   1 
ATOM   2753 C  CE2   . TYR C 3 280 ? 45.661 69.892  32.528  1.00 45.12  ? 286  TYR A CE2   1 
ATOM   2754 C  CZ    . TYR C 3 280 ? 45.572 70.937  31.615  1.00 48.41  ? 286  TYR A CZ    1 
ATOM   2755 O  OH    . TYR C 3 280 ? 44.518 71.822  31.688  1.00 46.97  ? 286  TYR A OH    1 
ATOM   2756 N  N     . PRO C 3 281 ? 50.374 67.112  28.686  1.00 35.22  ? 287  PRO A N     1 
ATOM   2757 C  CA    . PRO C 3 281 ? 51.646 66.790  28.033  1.00 33.14  ? 287  PRO A CA    1 
ATOM   2758 C  C     . PRO C 3 281 ? 52.819 67.176  28.920  1.00 29.89  ? 287  PRO A C     1 
ATOM   2759 O  O     . PRO C 3 281 ? 52.708 68.104  29.721  1.00 27.87  ? 287  PRO A O     1 
ATOM   2760 C  CB    . PRO C 3 281 ? 51.597 67.653  26.777  1.00 33.22  ? 287  PRO A CB    1 
ATOM   2761 C  CG    . PRO C 3 281 ? 50.150 67.619  26.443  1.00 30.46  ? 287  PRO A CG    1 
ATOM   2762 C  CD    . PRO C 3 281 ? 49.571 67.966  27.795  1.00 34.35  ? 287  PRO A CD    1 
ATOM   2763 N  N     . ARG C 3 282 ? 53.923 66.445  28.797  1.00 31.34  ? 288  ARG A N     1 
ATOM   2764 C  CA    . ARG C 3 282 ? 55.119 66.733  29.583  1.00 33.86  ? 288  ARG A CA    1 
ATOM   2765 C  C     . ARG C 3 282 ? 55.691 68.089  29.139  1.00 32.98  ? 288  ARG A C     1 
ATOM   2766 O  O     . ARG C 3 282 ? 55.706 68.405  27.945  1.00 34.57  ? 288  ARG A O     1 
ATOM   2767 C  CB    . ARG C 3 282 ? 56.175 65.646  29.376  1.00 42.23  ? 288  ARG A CB    1 
ATOM   2768 C  CG    . ARG C 3 282 ? 55.821 64.235  29.846  1.00 51.64  ? 288  ARG A CG    1 
ATOM   2769 C  CD    . ARG C 3 282 ? 55.729 64.104  31.366  1.00 58.68  ? 288  ARG A CD    1 
ATOM   2770 N  NE    . ARG C 3 282 ? 54.345 64.124  31.838  1.00 62.35  ? 288  ARG A NE    1 
ATOM   2771 C  CZ    . ARG C 3 282 ? 53.599 63.037  32.038  1.00 61.20  ? 288  ARG A CZ    1 
ATOM   2772 N  NH1   . ARG C 3 282 ? 54.091 61.827  31.813  1.00 57.87  ? 288  ARG A NH1   1 
ATOM   2773 N  NH2   . ARG C 3 282 ? 52.349 63.160  32.456  1.00 57.14  ? 288  ARG A NH2   1 
ATOM   2774 N  N     . ILE C 3 283 ? 56.162 68.880  30.100  1.00 32.94  ? 289  ILE A N     1 
ATOM   2775 C  CA    . ILE C 3 283 ? 56.721 70.201  29.815  1.00 31.85  ? 289  ILE A CA    1 
ATOM   2776 C  C     . ILE C 3 283 ? 58.254 70.229  29.803  1.00 35.09  ? 289  ILE A C     1 
ATOM   2777 O  O     . ILE C 3 283 ? 58.911 69.188  29.792  1.00 33.00  ? 289  ILE A O     1 
ATOM   2778 C  CB    . ILE C 3 283 ? 56.208 71.255  30.836  1.00 27.55  ? 289  ILE A CB    1 
ATOM   2779 C  CG1   . ILE C 3 283 ? 56.709 70.916  32.244  1.00 18.54  ? 289  ILE A CG1   1 
ATOM   2780 C  CG2   . ILE C 3 283 ? 54.687 71.300  30.806  1.00 27.66  ? 289  ILE A CG2   1 
ATOM   2781 C  CD1   . ILE C 3 283 ? 56.562 72.025  33.247  1.00 18.28  ? 289  ILE A CD1   1 
ATOM   2782 N  N     . LYS C 3 284 ? 58.810 71.434  29.802  1.00 38.14  ? 290  LYS A N     1 
ATOM   2783 C  CA    . LYS C 3 284 ? 60.249 71.622  29.799  1.00 36.28  ? 290  LYS A CA    1 
ATOM   2784 C  C     . LYS C 3 284 ? 60.452 73.011  30.386  1.00 34.63  ? 290  LYS A C     1 
ATOM   2785 O  O     . LYS C 3 284 ? 59.922 73.990  29.862  1.00 32.61  ? 290  LYS A O     1 
ATOM   2786 C  CB    . LYS C 3 284 ? 60.776 71.554  28.360  1.00 31.30  ? 290  LYS A CB    1 
ATOM   2787 C  CG    . LYS C 3 284 ? 62.247 71.180  28.196  1.00 35.41  ? 290  LYS A CG    1 
ATOM   2788 C  CD    . LYS C 3 284 ? 63.210 72.293  28.593  1.00 29.90  ? 290  LYS A CD    1 
ATOM   2789 C  CE    . LYS C 3 284 ? 64.653 71.852  28.376  1.00 37.15  ? 290  LYS A CE    1 
ATOM   2790 N  NZ    . LYS C 3 284 ? 65.655 72.857  28.839  1.00 32.65  ? 290  LYS A NZ    1 
ATOM   2791 N  N     . THR C 3 285 ? 61.143 73.072  31.522  1.00 31.31  ? 291  THR A N     1 
ATOM   2792 C  CA    . THR C 3 285 ? 61.430 74.336  32.194  1.00 30.46  ? 291  THR A CA    1 
ATOM   2793 C  C     . THR C 3 285 ? 62.900 74.624  31.911  1.00 33.55  ? 291  THR A C     1 
ATOM   2794 O  O     . THR C 3 285 ? 63.779 73.960  32.454  1.00 32.78  ? 291  THR A O     1 
ATOM   2795 C  CB    . THR C 3 285 ? 61.195 74.233  33.715  1.00 30.63  ? 291  THR A CB    1 
ATOM   2796 O  OG1   . THR C 3 285 ? 59.847 73.818  33.963  1.00 34.41  ? 291  THR A OG1   1 
ATOM   2797 C  CG2   . THR C 3 285 ? 61.432 75.580  34.387  1.00 38.32  ? 291  THR A CG2   1 
ATOM   2798 N  N     . PRO C 3 286 ? 63.181 75.611  31.041  1.00 42.11  ? 292  PRO A N     1 
ATOM   2799 C  CA    . PRO C 3 286 ? 64.540 76.011  30.653  1.00 45.79  ? 292  PRO A CA    1 
ATOM   2800 C  C     . PRO C 3 286 ? 65.459 76.614  31.719  1.00 52.43  ? 292  PRO A C     1 
ATOM   2801 O  O     . PRO C 3 286 ? 65.028 76.954  32.827  1.00 45.13  ? 292  PRO A O     1 
ATOM   2802 C  CB    . PRO C 3 286 ? 64.284 76.978  29.494  1.00 38.85  ? 292  PRO A CB    1 
ATOM   2803 C  CG    . PRO C 3 286 ? 62.993 77.618  29.888  1.00 35.93  ? 292  PRO A CG    1 
ATOM   2804 C  CD    . PRO C 3 286 ? 62.184 76.418  30.311  1.00 34.51  ? 292  PRO A CD    1 
ATOM   2805 N  N     . LYS C 3 287 ? 66.735 76.733  31.349  1.00 55.51  ? 293  LYS A N     1 
ATOM   2806 C  CA    . LYS C 3 287 ? 67.783 77.285  32.206  1.00 59.10  ? 293  LYS A CA    1 
ATOM   2807 C  C     . LYS C 3 287 ? 67.795 78.817  32.201  1.00 62.54  ? 293  LYS A C     1 
ATOM   2808 O  O     . LYS C 3 287 ? 68.250 79.458  31.247  1.00 61.19  ? 293  LYS A O     1 
ATOM   2809 C  CB    . LYS C 3 287 ? 69.139 76.748  31.769  1.00 63.60  ? 293  LYS A CB    1 
ATOM   2810 N  N     . GLU C 3 313 ? 65.657 82.665  23.230  1.00 40.94  ? 319  GLU A N     1 
ATOM   2811 C  CA    . GLU C 3 313 ? 64.207 82.829  23.163  1.00 44.34  ? 319  GLU A CA    1 
ATOM   2812 C  C     . GLU C 3 313 ? 63.455 82.255  24.372  1.00 40.92  ? 319  GLU A C     1 
ATOM   2813 O  O     . GLU C 3 313 ? 62.226 82.292  24.416  1.00 40.48  ? 319  GLU A O     1 
ATOM   2814 C  CB    . GLU C 3 313 ? 63.659 82.201  21.880  1.00 48.96  ? 319  GLU A CB    1 
ATOM   2815 C  CG    . GLU C 3 313 ? 63.759 80.680  21.820  1.00 53.67  ? 319  GLU A CG    1 
ATOM   2816 C  CD    . GLU C 3 313 ? 63.143 80.089  20.557  1.00 57.84  ? 319  GLU A CD    1 
ATOM   2817 O  OE1   . GLU C 3 313 ? 62.287 80.749  19.923  1.00 52.40  ? 319  GLU A OE1   1 
ATOM   2818 O  OE2   . GLU C 3 313 ? 63.517 78.951  20.198  1.00 62.34  ? 319  GLU A OE2   1 
ATOM   2819 N  N     . TYR C 3 314 ? 64.187 81.719  25.343  1.00 37.52  ? 320  TYR A N     1 
ATOM   2820 C  CA    . TYR C 3 314 ? 63.573 81.154  26.541  1.00 44.59  ? 320  TYR A CA    1 
ATOM   2821 C  C     . TYR C 3 314 ? 63.856 82.010  27.770  1.00 45.67  ? 320  TYR A C     1 
ATOM   2822 O  O     . TYR C 3 314 ? 64.696 82.913  27.737  1.00 46.14  ? 320  TYR A O     1 
ATOM   2823 C  CB    . TYR C 3 314 ? 64.074 79.726  26.787  1.00 46.84  ? 320  TYR A CB    1 
ATOM   2824 C  CG    . TYR C 3 314 ? 63.644 78.737  25.731  1.00 52.11  ? 320  TYR A CG    1 
ATOM   2825 C  CD1   . TYR C 3 314 ? 62.322 78.300  25.663  1.00 49.38  ? 320  TYR A CD1   1 
ATOM   2826 C  CD2   . TYR C 3 314 ? 64.549 78.255  24.784  1.00 52.85  ? 320  TYR A CD2   1 
ATOM   2827 C  CE1   . TYR C 3 314 ? 61.908 77.408  24.679  1.00 46.39  ? 320  TYR A CE1   1 
ATOM   2828 C  CE2   . TYR C 3 314 ? 64.144 77.357  23.792  1.00 48.62  ? 320  TYR A CE2   1 
ATOM   2829 C  CZ    . TYR C 3 314 ? 62.818 76.941  23.746  1.00 47.66  ? 320  TYR A CZ    1 
ATOM   2830 O  OH    . TYR C 3 314 ? 62.397 76.062  22.773  1.00 51.95  ? 320  TYR A OH    1 
ATOM   2831 N  N     . VAL C 3 315 ? 63.128 81.734  28.845  1.00 51.80  ? 321  VAL A N     1 
ATOM   2832 C  CA    . VAL C 3 315 ? 63.293 82.454  30.102  1.00 48.99  ? 321  VAL A CA    1 
ATOM   2833 C  C     . VAL C 3 315 ? 63.334 81.405  31.204  1.00 52.07  ? 321  VAL A C     1 
ATOM   2834 O  O     . VAL C 3 315 ? 62.445 80.553  31.286  1.00 39.35  ? 321  VAL A O     1 
ATOM   2835 C  CB    . VAL C 3 315 ? 62.118 83.446  30.361  1.00 39.67  ? 321  VAL A CB    1 
ATOM   2836 C  CG1   . VAL C 3 315 ? 62.234 84.058  31.741  1.00 32.12  ? 321  VAL A CG1   1 
ATOM   2837 C  CG2   . VAL C 3 315 ? 62.127 84.553  29.324  1.00 30.96  ? 321  VAL A CG2   1 
ATOM   2838 N  N     . ALA C 3 316 ? 64.384 81.457  32.023  1.00 51.82  ? 322  ALA A N     1 
ATOM   2839 C  CA    . ALA C 3 316 ? 64.565 80.521  33.129  1.00 51.55  ? 322  ALA A CA    1 
ATOM   2840 C  C     . ALA C 3 316 ? 63.340 80.499  34.042  1.00 47.58  ? 322  ALA A C     1 
ATOM   2841 O  O     . ALA C 3 316 ? 62.952 81.527  34.601  1.00 42.04  ? 322  ALA A O     1 
ATOM   2842 C  CB    . ALA C 3 316 ? 65.810 80.893  33.928  1.00 49.49  ? 322  ALA A CB    1 
ATOM   2843 N  N     . GLY C 3 317 ? 62.727 79.325  34.173  1.00 42.38  ? 323  GLY A N     1 
ATOM   2844 C  CA    . GLY C 3 317 ? 61.550 79.192  35.013  1.00 36.54  ? 323  GLY A CA    1 
ATOM   2845 C  C     . GLY C 3 317 ? 60.241 79.143  34.246  1.00 40.10  ? 323  GLY A C     1 
ATOM   2846 O  O     . GLY C 3 317 ? 59.260 78.578  34.739  1.00 33.78  ? 323  GLY A O     1 
ATOM   2847 N  N     . ALA C 3 318 ? 60.220 79.731  33.049  1.00 40.15  ? 324  ALA A N     1 
ATOM   2848 C  CA    . ALA C 3 318 ? 59.022 79.761  32.203  1.00 42.12  ? 324  ALA A CA    1 
ATOM   2849 C  C     . ALA C 3 318 ? 58.802 78.436  31.460  1.00 37.90  ? 324  ALA A C     1 
ATOM   2850 O  O     . ALA C 3 318 ? 59.455 78.160  30.449  1.00 34.30  ? 324  ALA A O     1 
ATOM   2851 C  CB    . ALA C 3 318 ? 59.112 80.916  31.216  1.00 35.42  ? 324  ALA A CB    1 
ATOM   2852 N  N     . PRO C 3 319 ? 57.842 77.619  31.934  1.00 30.04  ? 325  PRO A N     1 
ATOM   2853 C  CA    . PRO C 3 319 ? 57.505 76.316  31.349  1.00 28.61  ? 325  PRO A CA    1 
ATOM   2854 C  C     . PRO C 3 319 ? 56.870 76.358  29.958  1.00 31.78  ? 325  PRO A C     1 
ATOM   2855 O  O     . PRO C 3 319 ? 56.212 77.329  29.594  1.00 32.78  ? 325  PRO A O     1 
ATOM   2856 C  CB    . PRO C 3 319 ? 56.547 75.731  32.384  1.00 27.61  ? 325  PRO A CB    1 
ATOM   2857 C  CG    . PRO C 3 319 ? 55.807 76.948  32.846  1.00 25.94  ? 325  PRO A CG    1 
ATOM   2858 C  CD    . PRO C 3 319 ? 56.937 77.926  33.059  1.00 28.48  ? 325  PRO A CD    1 
ATOM   2859 N  N     . TYR C 3 320 ? 57.057 75.281  29.197  1.00 31.66  ? 326  TYR A N     1 
ATOM   2860 C  CA    . TYR C 3 320 ? 56.494 75.180  27.854  1.00 26.41  ? 326  TYR A CA    1 
ATOM   2861 C  C     . TYR C 3 320 ? 56.412 73.728  27.391  1.00 26.55  ? 326  TYR A C     1 
ATOM   2862 O  O     . TYR C 3 320 ? 57.232 72.887  27.763  1.00 29.79  ? 326  TYR A O     1 
ATOM   2863 C  CB    . TYR C 3 320 ? 57.313 76.006  26.851  1.00 24.34  ? 326  TYR A CB    1 
ATOM   2864 C  CG    . TYR C 3 320 ? 58.630 75.383  26.445  1.00 25.54  ? 326  TYR A CG    1 
ATOM   2865 C  CD1   . TYR C 3 320 ? 59.788 75.608  27.189  1.00 24.80  ? 326  TYR A CD1   1 
ATOM   2866 C  CD2   . TYR C 3 320 ? 58.717 74.557  25.314  1.00 27.40  ? 326  TYR A CD2   1 
ATOM   2867 C  CE1   . TYR C 3 320 ? 61.004 75.025  26.823  1.00 28.13  ? 326  TYR A CE1   1 
ATOM   2868 C  CE2   . TYR C 3 320 ? 59.926 73.970  24.937  1.00 30.19  ? 326  TYR A CE2   1 
ATOM   2869 C  CZ    . TYR C 3 320 ? 61.067 74.207  25.696  1.00 30.15  ? 326  TYR A CZ    1 
ATOM   2870 O  OH    . TYR C 3 320 ? 62.269 73.633  25.334  1.00 26.60  ? 326  TYR A OH    1 
ATOM   2871 N  N     . THR C 3 321 ? 55.408 73.445  26.572  1.00 27.46  ? 327  THR A N     1 
ATOM   2872 C  CA    . THR C 3 321 ? 55.196 72.113  26.038  1.00 26.45  ? 327  THR A CA    1 
ATOM   2873 C  C     . THR C 3 321 ? 55.925 71.984  24.701  1.00 27.88  ? 327  THR A C     1 
ATOM   2874 O  O     . THR C 3 321 ? 55.613 72.696  23.746  1.00 25.66  ? 327  THR A O     1 
ATOM   2875 C  CB    . THR C 3 321 ? 53.680 71.842  25.836  1.00 23.73  ? 327  THR A CB    1 
ATOM   2876 O  OG1   . THR C 3 321 ? 53.001 71.928  27.097  1.00 24.38  ? 327  THR A OG1   1 
ATOM   2877 C  CG2   . THR C 3 321 ? 53.448 70.470  25.234  1.00 22.49  ? 327  THR A CG2   1 
ATOM   2878 N  N     . PRO C 3 322 ? 56.955 71.120  24.635  1.00 30.27  ? 328  PRO A N     1 
ATOM   2879 C  CA    . PRO C 3 322 ? 57.691 70.941  23.378  1.00 31.02  ? 328  PRO A CA    1 
ATOM   2880 C  C     . PRO C 3 322 ? 56.738 70.230  22.419  1.00 30.48  ? 328  PRO A C     1 
ATOM   2881 O  O     . PRO C 3 322 ? 56.063 69.273  22.810  1.00 28.90  ? 328  PRO A O     1 
ATOM   2882 C  CB    . PRO C 3 322 ? 58.850 70.025  23.787  1.00 29.16  ? 328  PRO A CB    1 
ATOM   2883 C  CG    . PRO C 3 322 ? 59.013 70.298  25.259  1.00 27.93  ? 328  PRO A CG    1 
ATOM   2884 C  CD    . PRO C 3 322 ? 57.577 70.329  25.710  1.00 26.96  ? 328  PRO A CD    1 
ATOM   2885 N  N     . VAL C 3 323 ? 56.631 70.728  21.192  1.00 31.28  ? 329  VAL A N     1 
ATOM   2886 C  CA    . VAL C 3 323 ? 55.739 70.110  20.214  1.00 26.75  ? 329  VAL A CA    1 
ATOM   2887 C  C     . VAL C 3 323 ? 56.383 69.832  18.872  1.00 25.64  ? 329  VAL A C     1 
ATOM   2888 O  O     . VAL C 3 323 ? 57.386 70.445  18.500  1.00 28.03  ? 329  VAL A O     1 
ATOM   2889 C  CB    . VAL C 3 323 ? 54.446 70.941  19.966  1.00 25.81  ? 329  VAL A CB    1 
ATOM   2890 C  CG1   . VAL C 3 323 ? 53.578 70.947  21.201  1.00 28.28  ? 329  VAL A CG1   1 
ATOM   2891 C  CG2   . VAL C 3 323 ? 54.791 72.358  19.546  1.00 27.58  ? 329  VAL A CG2   1 
ATOM   2892 N  N     . GLU C 3 324 ? 55.781 68.894  18.149  1.00 24.36  ? 330  GLU A N     1 
ATOM   2893 C  CA    . GLU C 3 324 ? 56.250 68.505  16.832  1.00 27.13  ? 330  GLU A CA    1 
ATOM   2894 C  C     . GLU C 3 324 ? 55.112 68.729  15.850  1.00 24.72  ? 330  GLU A C     1 
ATOM   2895 O  O     . GLU C 3 324 ? 53.936 68.647  16.212  1.00 33.19  ? 330  GLU A O     1 
ATOM   2896 C  CB    . GLU C 3 324 ? 56.640 67.021  16.810  1.00 38.02  ? 330  GLU A CB    1 
ATOM   2897 C  CG    . GLU C 3 324 ? 55.467 66.059  17.007  1.00 44.24  ? 330  GLU A CG    1 
ATOM   2898 C  CD    . GLU C 3 324 ? 55.843 64.591  16.870  1.00 60.17  ? 330  GLU A CD    1 
ATOM   2899 O  OE1   . GLU C 3 324 ? 56.924 64.280  16.319  1.00 57.87  ? 330  GLU A OE1   1 
ATOM   2900 O  OE2   . GLU C 3 324 ? 55.040 63.742  17.317  1.00 58.79  ? 330  GLU A OE2   1 
ATOM   2901 N  N     . HIS C 3 325 ? 55.465 69.057  14.618  1.00 20.85  ? 331  HIS A N     1 
ATOM   2902 C  CA    . HIS C 3 325 ? 54.464 69.253  13.590  1.00 22.71  ? 331  HIS A CA    1 
ATOM   2903 C  C     . HIS C 3 325 ? 54.368 67.913  12.866  1.00 21.00  ? 331  HIS A C     1 
ATOM   2904 O  O     . HIS C 3 325 ? 55.382 67.335  12.470  1.00 24.95  ? 331  HIS A O     1 
ATOM   2905 C  CB    . HIS C 3 325 ? 54.884 70.364  12.627  1.00 28.26  ? 331  HIS A CB    1 
ATOM   2906 C  CG    . HIS C 3 325 ? 53.830 70.726  11.628  1.00 32.96  ? 331  HIS A CG    1 
ATOM   2907 N  ND1   . HIS C 3 325 ? 54.049 70.676  10.269  1.00 31.35  ? 331  HIS A ND1   1 
ATOM   2908 C  CD2   . HIS C 3 325 ? 52.556 71.155  11.788  1.00 26.96  ? 331  HIS A CD2   1 
ATOM   2909 C  CE1   . HIS C 3 325 ? 52.957 71.060  9.633   1.00 35.40  ? 331  HIS A CE1   1 
ATOM   2910 N  NE2   . HIS C 3 325 ? 52.036 71.356  10.533  1.00 32.92  ? 331  HIS A NE2   1 
ATOM   2911 N  N     . VAL C 3 326 ? 53.150 67.402  12.741  1.00 26.68  ? 332  VAL A N     1 
ATOM   2912 C  CA    . VAL C 3 326 ? 52.919 66.121  12.080  1.00 33.81  ? 332  VAL A CA    1 
ATOM   2913 C  C     . VAL C 3 326 ? 51.975 66.206  10.878  1.00 30.74  ? 332  VAL A C     1 
ATOM   2914 O  O     . VAL C 3 326 ? 50.868 66.740  10.963  1.00 29.80  ? 332  VAL A O     1 
ATOM   2915 C  CB    . VAL C 3 326 ? 52.451 65.023  13.107  1.00 37.58  ? 332  VAL A CB    1 
ATOM   2916 C  CG1   . VAL C 3 326 ? 51.518 65.613  14.132  1.00 38.47  ? 332  VAL A CG1   1 
ATOM   2917 C  CG2   . VAL C 3 326 ? 51.773 63.854  12.396  1.00 34.77  ? 332  VAL A CG2   1 
ATOM   2918 N  N     . VAL C 3 327 ? 52.455 65.692  9.750   1.00 21.23  ? 333  VAL A N     1 
ATOM   2919 C  CA    . VAL C 3 327 ? 51.701 65.678  8.507   1.00 18.08  ? 333  VAL A CA    1 
ATOM   2920 C  C     . VAL C 3 327 ? 50.895 64.392  8.410   1.00 18.44  ? 333  VAL A C     1 
ATOM   2921 O  O     . VAL C 3 327 ? 51.352 63.331  8.834   1.00 22.86  ? 333  VAL A O     1 
ATOM   2922 C  CB    . VAL C 3 327 ? 52.649 65.783  7.280   1.00 21.33  ? 333  VAL A CB    1 
ATOM   2923 C  CG1   . VAL C 3 327 ? 51.860 65.678  5.979   1.00 25.91  ? 333  VAL A CG1   1 
ATOM   2924 C  CG2   . VAL C 3 327 ? 53.408 67.105  7.322   1.00 21.68  ? 333  VAL A CG2   1 
ATOM   2925 N  N     . PHE C 3 328 ? 49.695 64.494  7.851   1.00 17.09  ? 334  PHE A N     1 
ATOM   2926 C  CA    . PHE C 3 328 ? 48.825 63.336  7.689   1.00 20.76  ? 334  PHE A CA    1 
ATOM   2927 C  C     . PHE C 3 328 ? 49.562 62.216  6.948   1.00 25.43  ? 334  PHE A C     1 
ATOM   2928 O  O     . PHE C 3 328 ? 50.246 62.461  5.950   1.00 30.32  ? 334  PHE A O     1 
ATOM   2929 C  CB    . PHE C 3 328 ? 47.557 63.731  6.925   1.00 13.57  ? 334  PHE A CB    1 
ATOM   2930 C  CG    . PHE C 3 328 ? 46.576 62.605  6.753   1.00 17.44  ? 334  PHE A CG    1 
ATOM   2931 C  CD1   . PHE C 3 328 ? 45.958 62.027  7.860   1.00 10.17  ? 334  PHE A CD1   1 
ATOM   2932 C  CD2   . PHE C 3 328 ? 46.281 62.107  5.483   1.00 12.01  ? 334  PHE A CD2   1 
ATOM   2933 C  CE1   . PHE C 3 328 ? 45.058 60.968  7.704   1.00 17.35  ? 334  PHE A CE1   1 
ATOM   2934 C  CE2   . PHE C 3 328 ? 45.382 61.047  5.318   1.00 8.63   ? 334  PHE A CE2   1 
ATOM   2935 C  CZ    . PHE C 3 328 ? 44.771 60.475  6.426   1.00 11.68  ? 334  PHE A CZ    1 
ATOM   2936 N  N     . ASN C 3 329 ? 49.435 60.995  7.463   1.00 22.17  ? 335  ASN A N     1 
ATOM   2937 C  CA    . ASN C 3 329 ? 50.072 59.814  6.878   1.00 14.75  ? 335  ASN A CA    1 
ATOM   2938 C  C     . ASN C 3 329 ? 48.983 58.749  6.739   1.00 13.01  ? 335  ASN A C     1 
ATOM   2939 O  O     . ASN C 3 329 ? 48.519 58.203  7.735   1.00 12.05  ? 335  ASN A O     1 
ATOM   2940 C  CB    . ASN C 3 329 ? 51.187 59.316  7.795   1.00 13.82  ? 335  ASN A CB    1 
ATOM   2941 C  CG    . ASN C 3 329 ? 51.994 58.178  7.181   1.00 11.45  ? 335  ASN A CG    1 
ATOM   2942 O  OD1   . ASN C 3 329 ? 51.584 57.559  6.204   1.00 18.89  ? 335  ASN A OD1   1 
ATOM   2943 N  ND2   . ASN C 3 329 ? 53.163 57.920  7.743   1.00 14.29  ? 335  ASN A ND2   1 
ATOM   2944 N  N     . PRO C 3 330 ? 48.562 58.449  5.495   1.00 9.90   ? 336  PRO A N     1 
ATOM   2945 C  CA    . PRO C 3 330 ? 47.523 57.457  5.202   1.00 13.64  ? 336  PRO A CA    1 
ATOM   2946 C  C     . PRO C 3 330 ? 47.941 56.029  5.544   1.00 14.62  ? 336  PRO A C     1 
ATOM   2947 O  O     . PRO C 3 330 ? 47.102 55.133  5.634   1.00 14.39  ? 336  PRO A O     1 
ATOM   2948 C  CB    . PRO C 3 330 ? 47.288 57.636  3.701   1.00 10.23  ? 336  PRO A CB    1 
ATOM   2949 C  CG    . PRO C 3 330 ? 47.805 59.019  3.424   1.00 11.94  ? 336  PRO A CG    1 
ATOM   2950 C  CD    . PRO C 3 330 ? 49.041 59.053  4.247   1.00 8.80   ? 336  PRO A CD    1 
ATOM   2951 N  N     . SER C 3 331 ? 49.249 55.816  5.686   1.00 19.51  ? 337  SER A N     1 
ATOM   2952 C  CA    . SER C 3 331 ? 49.802 54.505  6.035   1.00 21.62  ? 337  SER A CA    1 
ATOM   2953 C  C     . SER C 3 331 ? 49.698 54.232  7.538   1.00 22.30  ? 337  SER A C     1 
ATOM   2954 O  O     . SER C 3 331 ? 49.896 53.124  7.997   1.00 19.59  ? 337  SER A O     1 
ATOM   2955 C  CB    . SER C 3 331 ? 51.263 54.371  5.591   1.00 16.74  ? 337  SER A CB    1 
ATOM   2956 O  OG    . SER C 3 331 ? 51.349 54.002  4.232   1.00 18.25  ? 337  SER A OG    1 
ATOM   2957 N  N     . SER C 3 332 ? 49.391 55.270  8.302   1.00 22.32  ? 338  SER A N     1 
ATOM   2958 C  CA    . SER C 3 332 ? 49.237 55.135  9.754   1.00 31.19  ? 338  SER A CA    1 
ATOM   2959 C  C     . SER C 3 332 ? 47.775 54.742  9.957   1.00 31.91  ? 338  SER A C     1 
ATOM   2960 O  O     . SER C 3 332 ? 46.952 55.060  9.113   1.00 46.08  ? 338  SER A O     1 
ATOM   2961 C  CB    . SER C 3 332 ? 49.552 56.465  10.421  1.00 24.00  ? 338  SER A CB    1 
ATOM   2962 O  OG    . SER C 3 332 ? 49.207 56.472  11.793  1.00 31.38  ? 338  SER A OG    1 
ATOM   2963 N  N     . ARG C 3 333 ? 47.443 54.074  11.056  1.00 25.09  ? 339  ARG A N     1 
ATOM   2964 C  CA    . ARG C 3 333 ? 46.055 53.701  11.313  1.00 22.52  ? 339  ARG A CA    1 
ATOM   2965 C  C     . ARG C 3 333 ? 45.547 54.631  12.419  1.00 20.85  ? 339  ARG A C     1 
ATOM   2966 O  O     . ARG C 3 333 ? 44.355 54.700  12.698  1.00 25.24  ? 339  ARG A O     1 
ATOM   2967 C  CB    . ARG C 3 333 ? 45.956 52.207  11.747  1.00 29.90  ? 339  ARG A CB    1 
ATOM   2968 C  CG    . ARG C 3 333 ? 46.506 51.226  10.711  1.00 41.54  ? 339  ARG A CG    1 
ATOM   2969 C  CD    . ARG C 3 333 ? 45.719 51.220  9.385   1.00 50.09  ? 339  ARG A CD    1 
ATOM   2970 N  NE    . ARG C 3 333 ? 46.325 50.326  8.388   1.00 57.21  ? 339  ARG A NE    1 
ATOM   2971 C  CZ    . ARG C 3 333 ? 45.661 49.446  7.635   1.00 46.26  ? 339  ARG A CZ    1 
ATOM   2972 N  NH1   . ARG C 3 333 ? 44.343 49.324  7.731   1.00 44.72  ? 339  ARG A NH1   1 
ATOM   2973 N  NH2   . ARG C 3 333 ? 46.323 48.674  6.780   1.00 44.38  ? 339  ARG A NH2   1 
ATOM   2974 N  N     . ASP C 3 334 ? 46.472 55.389  13.003  1.00 24.24  ? 340  ASP A N     1 
ATOM   2975 C  CA    . ASP C 3 334 ? 46.196 56.356  14.065  1.00 25.14  ? 340  ASP A CA    1 
ATOM   2976 C  C     . ASP C 3 334 ? 45.688 57.671  13.486  1.00 21.02  ? 340  ASP A C     1 
ATOM   2977 O  O     . ASP C 3 334 ? 44.705 58.226  13.973  1.00 31.69  ? 340  ASP A O     1 
ATOM   2978 C  CB    . ASP C 3 334 ? 47.467 56.614  14.869  1.00 40.30  ? 340  ASP A CB    1 
ATOM   2979 C  CG    . ASP C 3 334 ? 47.302 56.234  16.316  1.00 58.12  ? 340  ASP A CG    1 
ATOM   2980 O  OD1   . ASP C 3 334 ? 47.454 55.033  16.640  1.00 62.62  ? 340  ASP A OD1   1 
ATOM   2981 O  OD2   . ASP C 3 334 ? 47.031 57.137  17.133  1.00 59.01  ? 340  ASP A OD2   1 
ATOM   2982 N  N     . HIS C 3 335 ? 46.401 58.189  12.484  1.00 18.80  ? 341  HIS A N     1 
ATOM   2983 C  CA    . HIS C 3 335 ? 46.034 59.433  11.799  1.00 16.04  ? 341  HIS A CA    1 
ATOM   2984 C  C     . HIS C 3 335 ? 44.642 59.335  11.168  1.00 16.25  ? 341  HIS A C     1 
ATOM   2985 O  O     . HIS C 3 335 ? 43.860 60.259  11.288  1.00 21.81  ? 341  HIS A O     1 
ATOM   2986 C  CB    . HIS C 3 335 ? 47.068 59.770  10.724  1.00 10.86  ? 341  HIS A CB    1 
ATOM   2987 C  CG    . HIS C 3 335 ? 48.387 60.204  11.270  1.00 5.81   ? 341  HIS A CG    1 
ATOM   2988 N  ND1   . HIS C 3 335 ? 49.405 60.675  10.471  1.00 12.03  ? 341  HIS A ND1   1 
ATOM   2989 C  CD2   . HIS C 3 335 ? 48.864 60.230  12.537  1.00 11.12  ? 341  HIS A CD2   1 
ATOM   2990 C  CE1   . HIS C 3 335 ? 50.452 60.969  11.217  1.00 8.85   ? 341  HIS A CE1   1 
ATOM   2991 N  NE2   . HIS C 3 335 ? 50.151 60.709  12.475  1.00 10.29  ? 341  HIS A NE2   1 
ATOM   2992 N  N     . ILE C 3 336 ? 44.347 58.229  10.485  1.00 15.33  ? 342  ILE A N     1 
ATOM   2993 C  CA    . ILE C 3 336 ? 43.050 57.973  9.845   1.00 18.17  ? 342  ILE A CA    1 
ATOM   2994 C  C     . ILE C 3 336 ? 41.937 57.957  10.908  1.00 15.45  ? 342  ILE A C     1 
ATOM   2995 O  O     . ILE C 3 336 ? 40.849 58.494  10.706  1.00 20.38  ? 342  ILE A O     1 
ATOM   2996 C  CB    . ILE C 3 336 ? 43.086 56.591  9.140   1.00 18.05  ? 342  ILE A CB    1 
ATOM   2997 C  CG1   . ILE C 3 336 ? 44.163 56.575  8.047   1.00 26.25  ? 342  ILE A CG1   1 
ATOM   2998 C  CG2   . ILE C 3 336 ? 41.723 56.223  8.591   1.00 19.92  ? 342  ILE A CG2   1 
ATOM   2999 C  CD1   . ILE C 3 336 ? 44.396 55.194  7.473   1.00 28.73  ? 342  ILE A CD1   1 
ATOM   3000 N  N     . GLN C 3 337 ? 42.234 57.304  12.026  1.00 17.06  ? 343  GLN A N     1 
ATOM   3001 C  CA    . GLN C 3 337 ? 41.320 57.180  13.159  1.00 19.40  ? 343  GLN A CA    1 
ATOM   3002 C  C     . GLN C 3 337 ? 41.046 58.558  13.763  1.00 14.29  ? 343  GLN A C     1 
ATOM   3003 O  O     . GLN C 3 337 ? 39.896 58.909  14.036  1.00 18.01  ? 343  GLN A O     1 
ATOM   3004 C  CB    . GLN C 3 337 ? 41.949 56.213  14.179  1.00 32.38  ? 343  GLN A CB    1 
ATOM   3005 C  CG    . GLN C 3 337 ? 41.384 56.223  15.585  1.00 33.44  ? 343  GLN A CG    1 
ATOM   3006 C  CD    . GLN C 3 337 ? 42.024 57.274  16.472  1.00 34.51  ? 343  GLN A CD    1 
ATOM   3007 O  OE1   . GLN C 3 337 ? 41.330 58.069  17.096  1.00 43.24  ? 343  GLN A OE1   1 
ATOM   3008 N  NE2   . GLN C 3 337 ? 43.353 57.285  16.529  1.00 36.89  ? 343  GLN A NE2   1 
ATOM   3009 N  N     . LYS C 3 338 ? 42.109 59.341  13.922  1.00 14.95  ? 344  LYS A N     1 
ATOM   3010 C  CA    . LYS C 3 338 ? 42.032 60.688  14.472  1.00 18.71  ? 344  LYS A CA    1 
ATOM   3011 C  C     . LYS C 3 338 ? 41.124 61.542  13.585  1.00 20.00  ? 344  LYS A C     1 
ATOM   3012 O  O     . LYS C 3 338 ? 40.082 62.022  14.028  1.00 26.09  ? 344  LYS A O     1 
ATOM   3013 C  CB    . LYS C 3 338 ? 43.438 61.295  14.512  1.00 25.75  ? 344  LYS A CB    1 
ATOM   3014 C  CG    . LYS C 3 338 ? 43.522 62.696  15.100  1.00 34.05  ? 344  LYS A CG    1 
ATOM   3015 C  CD    . LYS C 3 338 ? 44.897 63.296  14.868  1.00 36.26  ? 344  LYS A CD    1 
ATOM   3016 C  CE    . LYS C 3 338 ? 45.051 64.619  15.591  1.00 41.56  ? 344  LYS A CE    1 
ATOM   3017 N  NZ    . LYS C 3 338 ? 45.104 64.454  17.075  1.00 42.91  ? 344  LYS A NZ    1 
ATOM   3018 N  N     . LYS C 3 339 ? 41.515 61.676  12.320  1.00 18.09  ? 345  LYS A N     1 
ATOM   3019 C  CA    . LYS C 3 339 ? 40.784 62.463  11.331  1.00 15.99  ? 345  LYS A CA    1 
ATOM   3020 C  C     . LYS C 3 339 ? 39.340 62.039  11.092  1.00 14.09  ? 345  LYS A C     1 
ATOM   3021 O  O     . LYS C 3 339 ? 38.461 62.888  10.951  1.00 25.22  ? 345  LYS A O     1 
ATOM   3022 C  CB    . LYS C 3 339 ? 41.554 62.480  10.010  1.00 16.09  ? 345  LYS A CB    1 
ATOM   3023 C  CG    . LYS C 3 339 ? 42.861 63.270  10.071  1.00 22.39  ? 345  LYS A CG    1 
ATOM   3024 C  CD    . LYS C 3 339 ? 42.591 64.721  10.443  1.00 21.80  ? 345  LYS A CD    1 
ATOM   3025 C  CE    . LYS C 3 339 ? 43.851 65.564  10.402  1.00 26.49  ? 345  LYS A CE    1 
ATOM   3026 N  NZ    . LYS C 3 339 ? 43.554 67.016  10.600  1.00 25.18  ? 345  LYS A NZ    1 
ATOM   3027 N  N     . LEU C 3 340 ? 39.084 60.736  11.053  1.00 15.42  ? 346  LEU A N     1 
ATOM   3028 C  CA    . LEU C 3 340 ? 37.726 60.270  10.832  1.00 15.24  ? 346  LEU A CA    1 
ATOM   3029 C  C     . LEU C 3 340 ? 36.829 60.503  12.035  1.00 18.62  ? 346  LEU A C     1 
ATOM   3030 O  O     . LEU C 3 340 ? 35.634 60.748  11.867  1.00 21.05  ? 346  LEU A O     1 
ATOM   3031 C  CB    . LEU C 3 340 ? 37.697 58.805  10.399  1.00 12.34  ? 346  LEU A CB    1 
ATOM   3032 C  CG    . LEU C 3 340 ? 38.276 58.547  9.002   1.00 21.72  ? 346  LEU A CG    1 
ATOM   3033 C  CD1   . LEU C 3 340 ? 38.105 57.079  8.638   1.00 13.32  ? 346  LEU A CD1   1 
ATOM   3034 C  CD2   . LEU C 3 340 ? 37.587 59.436  7.967   1.00 17.81  ? 346  LEU A CD2   1 
ATOM   3035 N  N     . GLN C 3 341 ? 37.391 60.438  13.243  1.00 22.03  ? 347  GLN A N     1 
ATOM   3036 C  CA    . GLN C 3 341 ? 36.593 60.675  14.448  1.00 26.55  ? 347  GLN A CA    1 
ATOM   3037 C  C     . GLN C 3 341 ? 36.341 62.162  14.621  1.00 25.68  ? 347  GLN A C     1 
ATOM   3038 O  O     . GLN C 3 341 ? 35.317 62.562  15.170  1.00 22.53  ? 347  GLN A O     1 
ATOM   3039 C  CB    . GLN C 3 341 ? 37.248 60.089  15.699  1.00 27.59  ? 347  GLN A CB    1 
ATOM   3040 C  CG    . GLN C 3 341 ? 37.112 58.580  15.784  1.00 26.03  ? 347  GLN A CG    1 
ATOM   3041 C  CD    . GLN C 3 341 ? 37.446 58.031  17.154  1.00 27.04  ? 347  GLN A CD    1 
ATOM   3042 O  OE1   . GLN C 3 341 ? 36.641 58.120  18.081  1.00 28.08  ? 347  GLN A OE1   1 
ATOM   3043 N  NE2   . GLN C 3 341 ? 38.629 57.441  17.284  1.00 23.94  ? 347  GLN A NE2   1 
ATOM   3044 N  N     . GLU C 3 342 ? 37.279 62.977  14.136  1.00 32.21  ? 348  GLU A N     1 
ATOM   3045 C  CA    . GLU C 3 342 ? 37.141 64.431  14.203  1.00 31.24  ? 348  GLU A CA    1 
ATOM   3046 C  C     . GLU C 3 342 ? 36.084 64.857  13.181  1.00 33.85  ? 348  GLU A C     1 
ATOM   3047 O  O     . GLU C 3 342 ? 35.644 66.006  13.175  1.00 33.96  ? 348  GLU A O     1 
ATOM   3048 C  CB    . GLU C 3 342 ? 38.479 65.121  13.911  1.00 25.45  ? 348  GLU A CB    1 
ATOM   3049 C  CG    . GLU C 3 342 ? 39.533 64.885  14.992  1.00 28.07  ? 348  GLU A CG    1 
ATOM   3050 C  CD    . GLU C 3 342 ? 40.892 65.517  14.693  1.00 25.63  ? 348  GLU A CD    1 
ATOM   3051 O  OE1   . GLU C 3 342 ? 41.117 66.009  13.565  1.00 29.18  ? 348  GLU A OE1   1 
ATOM   3052 O  OE2   . GLU C 3 342 ? 41.748 65.513  15.603  1.00 30.10  ? 348  GLU A OE2   1 
ATOM   3053 N  N     . ALA C 3 343 ? 35.682 63.913  12.326  1.00 32.39  ? 349  ALA A N     1 
ATOM   3054 C  CA    . ALA C 3 343 ? 34.676 64.140  11.293  1.00 26.94  ? 349  ALA A CA    1 
ATOM   3055 C  C     . ALA C 3 343 ? 33.331 63.497  11.647  1.00 27.97  ? 349  ALA A C     1 
ATOM   3056 O  O     . ALA C 3 343 ? 32.407 63.491  10.831  1.00 30.95  ? 349  ALA A O     1 
ATOM   3057 C  CB    . ALA C 3 343 ? 35.173 63.615  9.951   1.00 30.14  ? 349  ALA A CB    1 
ATOM   3058 N  N     . GLY C 3 344 ? 33.240 62.913  12.842  1.00 28.02  ? 350  GLY A N     1 
ATOM   3059 C  CA    . GLY C 3 344 ? 31.991 62.303  13.275  1.00 25.30  ? 350  GLY A CA    1 
ATOM   3060 C  C     . GLY C 3 344 ? 31.891 60.792  13.387  1.00 29.23  ? 350  GLY A C     1 
ATOM   3061 O  O     . GLY C 3 344 ? 30.918 60.295  13.943  1.00 29.65  ? 350  GLY A O     1 
ATOM   3062 N  N     . TRP C 3 345 ? 32.867 60.060  12.858  1.00 31.62  ? 351  TRP A N     1 
ATOM   3063 C  CA    . TRP C 3 345 ? 32.850 58.599  12.923  1.00 30.56  ? 351  TRP A CA    1 
ATOM   3064 C  C     . TRP C 3 345 ? 32.905 58.086  14.360  1.00 29.00  ? 351  TRP A C     1 
ATOM   3065 O  O     . TRP C 3 345 ? 33.715 58.547  15.168  1.00 28.62  ? 351  TRP A O     1 
ATOM   3066 C  CB    . TRP C 3 345 ? 34.018 58.009  12.112  1.00 28.25  ? 351  TRP A CB    1 
ATOM   3067 C  CG    . TRP C 3 345 ? 34.221 56.503  12.262  1.00 21.80  ? 351  TRP A CG    1 
ATOM   3068 C  CD1   . TRP C 3 345 ? 33.275 55.517  12.107  1.00 18.21  ? 351  TRP A CD1   1 
ATOM   3069 C  CD2   . TRP C 3 345 ? 35.452 55.825  12.581  1.00 16.51  ? 351  TRP A CD2   1 
ATOM   3070 N  NE1   . TRP C 3 345 ? 33.843 54.280  12.308  1.00 14.48  ? 351  TRP A NE1   1 
ATOM   3071 C  CE2   . TRP C 3 345 ? 35.174 54.436  12.596  1.00 14.46  ? 351  TRP A CE2   1 
ATOM   3072 C  CE3   . TRP C 3 345 ? 36.764 56.259  12.850  1.00 15.53  ? 351  TRP A CE3   1 
ATOM   3073 C  CZ2   . TRP C 3 345 ? 36.160 53.473  12.870  1.00 17.12  ? 351  TRP A CZ2   1 
ATOM   3074 C  CZ3   . TRP C 3 345 ? 37.748 55.301  13.123  1.00 16.57  ? 351  TRP A CZ3   1 
ATOM   3075 C  CH2   . TRP C 3 345 ? 37.437 53.921  13.130  1.00 15.43  ? 351  TRP A CH2   1 
ATOM   3076 N  N     . VAL C 3 346 ? 32.014 57.142  14.659  1.00 29.67  ? 352  VAL A N     1 
ATOM   3077 C  CA    . VAL C 3 346 ? 31.928 56.509  15.974  1.00 30.15  ? 352  VAL A CA    1 
ATOM   3078 C  C     . VAL C 3 346 ? 32.313 55.032  15.780  1.00 26.47  ? 352  VAL A C     1 
ATOM   3079 O  O     . VAL C 3 346 ? 31.527 54.242  15.248  1.00 21.17  ? 352  VAL A O     1 
ATOM   3080 C  CB    . VAL C 3 346 ? 30.488 56.585  16.571  1.00 30.88  ? 352  VAL A CB    1 
ATOM   3081 C  CG1   . VAL C 3 346 ? 30.470 55.976  17.969  1.00 24.02  ? 352  VAL A CG1   1 
ATOM   3082 C  CG2   . VAL C 3 346 ? 30.002 58.028  16.620  1.00 27.62  ? 352  VAL A CG2   1 
ATOM   3083 N  N     . PRO C 3 347 ? 33.537 54.650  16.190  1.00 23.44  ? 353  PRO A N     1 
ATOM   3084 C  CA    . PRO C 3 347 ? 34.032 53.276  16.062  1.00 27.71  ? 353  PRO A CA    1 
ATOM   3085 C  C     . PRO C 3 347 ? 33.154 52.248  16.766  1.00 33.55  ? 353  PRO A C     1 
ATOM   3086 O  O     . PRO C 3 347 ? 32.696 52.474  17.885  1.00 31.21  ? 353  PRO A O     1 
ATOM   3087 C  CB    . PRO C 3 347 ? 35.414 53.356  16.700  1.00 23.87  ? 353  PRO A CB    1 
ATOM   3088 C  CG    . PRO C 3 347 ? 35.828 54.757  16.428  1.00 19.93  ? 353  PRO A CG    1 
ATOM   3089 C  CD    . PRO C 3 347 ? 34.578 55.510  16.780  1.00 19.78  ? 353  PRO A CD    1 
ATOM   3090 N  N     . THR C 3 348 ? 32.916 51.130  16.086  1.00 41.53  ? 354  THR A N     1 
ATOM   3091 C  CA    . THR C 3 348 ? 32.101 50.046  16.623  1.00 45.50  ? 354  THR A CA    1 
ATOM   3092 C  C     . THR C 3 348 ? 33.018 49.003  17.244  1.00 44.91  ? 354  THR A C     1 
ATOM   3093 O  O     . THR C 3 348 ? 32.923 48.712  18.437  1.00 52.14  ? 354  THR A O     1 
ATOM   3094 C  CB    . THR C 3 348 ? 31.261 49.363  15.517  1.00 54.35  ? 354  THR A CB    1 
ATOM   3095 O  OG1   . THR C 3 348 ? 30.421 50.332  14.881  1.00 58.67  ? 354  THR A OG1   1 
ATOM   3096 C  CG2   . THR C 3 348 ? 30.389 48.262  16.105  1.00 57.55  ? 354  THR A CG2   1 
ATOM   3097 N  N     . LYS C 3 349 ? 33.915 48.455  16.426  1.00 39.72  ? 355  LYS A N     1 
ATOM   3098 C  CA    . LYS C 3 349 ? 34.853 47.435  16.882  1.00 42.00  ? 355  LYS A CA    1 
ATOM   3099 C  C     . LYS C 3 349 ? 36.229 47.991  17.241  1.00 38.18  ? 355  LYS A C     1 
ATOM   3100 O  O     . LYS C 3 349 ? 36.748 48.890  16.578  1.00 48.14  ? 355  LYS A O     1 
ATOM   3101 C  CB    . LYS C 3 349 ? 34.962 46.304  15.848  1.00 52.64  ? 355  LYS A CB    1 
ATOM   3102 C  CG    . LYS C 3 349 ? 35.310 46.748  14.437  1.00 65.88  ? 355  LYS A CG    1 
ATOM   3103 C  CD    . LYS C 3 349 ? 35.389 45.566  13.469  1.00 70.61  ? 355  LYS A CD    1 
ATOM   3104 C  CE    . LYS C 3 349 ? 36.409 44.529  13.923  1.00 72.22  ? 355  LYS A CE    1 
ATOM   3105 N  NZ    . LYS C 3 349 ? 36.768 43.577  12.834  1.00 73.42  ? 355  LYS A NZ    1 
ATOM   3106 N  N     . TYR C 3 350 ? 36.794 47.460  18.324  1.00 39.06  ? 356  TYR A N     1 
ATOM   3107 C  CA    . TYR C 3 350 ? 38.102 47.875  18.830  1.00 38.07  ? 356  TYR A CA    1 
ATOM   3108 C  C     . TYR C 3 350 ? 39.053 46.678  18.964  1.00 39.88  ? 356  TYR A C     1 
ATOM   3109 O  O     . TYR C 3 350 ? 38.649 45.526  18.776  1.00 38.32  ? 356  TYR A O     1 
ATOM   3110 C  CB    . TYR C 3 350 ? 37.942 48.577  20.192  1.00 35.27  ? 356  TYR A CB    1 
ATOM   3111 C  CG    . TYR C 3 350 ? 37.099 49.837  20.140  1.00 32.18  ? 356  TYR A CG    1 
ATOM   3112 C  CD1   . TYR C 3 350 ? 35.713 49.767  19.981  1.00 33.46  ? 356  TYR A CD1   1 
ATOM   3113 C  CD2   . TYR C 3 350 ? 37.690 51.103  20.219  1.00 37.49  ? 356  TYR A CD2   1 
ATOM   3114 C  CE1   . TYR C 3 350 ? 34.934 50.923  19.896  1.00 37.39  ? 356  TYR A CE1   1 
ATOM   3115 C  CE2   . TYR C 3 350 ? 36.918 52.270  20.136  1.00 37.78  ? 356  TYR A CE2   1 
ATOM   3116 C  CZ    . TYR C 3 350 ? 35.540 52.170  19.972  1.00 39.01  ? 356  TYR A CZ    1 
ATOM   3117 O  OH    . TYR C 3 350 ? 34.773 53.314  19.872  1.00 42.10  ? 356  TYR A OH    1 
ATOM   3118 N  N     . THR C 3 351 ? 40.318 46.961  19.266  1.00 40.90  ? 357  THR A N     1 
ATOM   3119 C  CA    . THR C 3 351 ? 41.333 45.918  19.431  1.00 41.91  ? 357  THR A CA    1 
ATOM   3120 C  C     . THR C 3 351 ? 41.626 45.729  20.910  1.00 44.24  ? 357  THR A C     1 
ATOM   3121 O  O     . THR C 3 351 ? 41.486 46.661  21.702  1.00 48.34  ? 357  THR A O     1 
ATOM   3122 C  CB    . THR C 3 351 ? 42.672 46.276  18.743  1.00 33.00  ? 357  THR A CB    1 
ATOM   3123 O  OG1   . THR C 3 351 ? 43.198 47.476  19.318  1.00 36.34  ? 357  THR A OG1   1 
ATOM   3124 C  CG2   . THR C 3 351 ? 42.490 46.461  17.244  1.00 37.84  ? 357  THR A CG2   1 
ATOM   3125 N  N     . ASP C 3 352 ? 42.038 44.520  21.275  1.00 49.39  ? 358  ASP A N     1 
ATOM   3126 C  CA    . ASP C 3 352 ? 42.361 44.217  22.660  1.00 56.36  ? 358  ASP A CA    1 
ATOM   3127 C  C     . ASP C 3 352 ? 43.681 44.854  23.073  1.00 54.68  ? 358  ASP A C     1 
ATOM   3128 O  O     . ASP C 3 352 ? 44.731 44.205  23.081  1.00 61.33  ? 358  ASP A O     1 
ATOM   3129 C  CB    . ASP C 3 352 ? 42.396 42.705  22.888  1.00 70.23  ? 358  ASP A CB    1 
ATOM   3130 C  CG    . ASP C 3 352 ? 41.037 42.067  22.724  1.00 86.05  ? 358  ASP A CG    1 
ATOM   3131 O  OD1   . ASP C 3 352 ? 40.156 42.320  23.576  1.00 85.66  ? 358  ASP A OD1   1 
ATOM   3132 O  OD2   . ASP C 3 352 ? 40.845 41.322  21.739  1.00 84.36  ? 358  ASP A OD2   1 
ATOM   3133 N  N     . LYS C 3 353 ? 43.608 46.145  23.383  1.00 46.36  ? 359  LYS A N     1 
ATOM   3134 C  CA    . LYS C 3 353 ? 44.751 46.934  23.819  1.00 51.59  ? 359  LYS A CA    1 
ATOM   3135 C  C     . LYS C 3 353 ? 44.241 48.336  24.111  1.00 54.44  ? 359  LYS A C     1 
ATOM   3136 O  O     . LYS C 3 353 ? 44.448 48.874  25.203  1.00 62.51  ? 359  LYS A O     1 
ATOM   3137 C  CB    . LYS C 3 353 ? 45.840 47.003  22.743  1.00 57.92  ? 359  LYS A CB    1 
ATOM   3138 C  CG    . LYS C 3 353 ? 47.106 47.695  23.227  1.00 67.66  ? 359  LYS A CG    1 
ATOM   3139 C  CD    . LYS C 3 353 ? 48.084 47.945  22.102  1.00 65.47  ? 359  LYS A CD    1 
ATOM   3140 C  CE    . LYS C 3 353 ? 49.315 48.683  22.604  1.00 66.31  ? 359  LYS A CE    1 
ATOM   3141 N  NZ    . LYS C 3 353 ? 50.239 49.026  21.488  1.00 64.82  ? 359  LYS A NZ    1 
ATOM   3142 N  N     . GLY C 3 354 ? 43.567 48.918  23.125  1.00 59.87  ? 360  GLY A N     1 
ATOM   3143 C  CA    . GLY C 3 354 ? 43.029 50.253  23.281  1.00 63.13  ? 360  GLY A CA    1 
ATOM   3144 C  C     . GLY C 3 354 ? 43.195 51.030  21.998  1.00 61.26  ? 360  GLY A C     1 
ATOM   3145 O  O     . GLY C 3 354 ? 43.852 52.076  21.978  1.00 65.93  ? 360  GLY A O     1 
ATOM   3146 N  N     . ALA C 3 355 ? 42.608 50.504  20.924  1.00 48.58  ? 361  ALA A N     1 
ATOM   3147 C  CA    . ALA C 3 355 ? 42.680 51.136  19.609  1.00 38.99  ? 361  ALA A CA    1 
ATOM   3148 C  C     . ALA C 3 355 ? 41.573 50.621  18.703  1.00 31.78  ? 361  ALA A C     1 
ATOM   3149 O  O     . ALA C 3 355 ? 41.388 49.413  18.574  1.00 28.53  ? 361  ALA A O     1 
ATOM   3150 C  CB    . ALA C 3 355 ? 44.039 50.864  18.969  1.00 34.00  ? 361  ALA A CB    1 
ATOM   3151 N  N     . PRO C 3 356 ? 40.804 51.530  18.075  1.00 30.16  ? 362  PRO A N     1 
ATOM   3152 C  CA    . PRO C 3 356 ? 39.728 51.076  17.188  1.00 30.29  ? 362  PRO A CA    1 
ATOM   3153 C  C     . PRO C 3 356 ? 40.294 50.334  15.975  1.00 29.83  ? 362  PRO A C     1 
ATOM   3154 O  O     . PRO C 3 356 ? 41.404 50.625  15.510  1.00 21.57  ? 362  PRO A O     1 
ATOM   3155 C  CB    . PRO C 3 356 ? 39.029 52.383  16.803  1.00 26.65  ? 362  PRO A CB    1 
ATOM   3156 C  CG    . PRO C 3 356 ? 40.129 53.373  16.843  1.00 20.04  ? 362  PRO A CG    1 
ATOM   3157 C  CD    . PRO C 3 356 ? 40.845 53.004  18.122  1.00 26.86  ? 362  PRO A CD    1 
ATOM   3158 N  N     . VAL C 3 357 ? 39.555 49.336  15.506  1.00 27.14  ? 363  VAL A N     1 
ATOM   3159 C  CA    . VAL C 3 357 ? 39.984 48.558  14.353  1.00 28.74  ? 363  VAL A CA    1 
ATOM   3160 C  C     . VAL C 3 357 ? 39.846 49.416  13.098  1.00 30.59  ? 363  VAL A C     1 
ATOM   3161 O  O     . VAL C 3 357 ? 38.752 49.879  12.774  1.00 33.40  ? 363  VAL A O     1 
ATOM   3162 C  CB    . VAL C 3 357 ? 39.145 47.267  14.203  1.00 26.74  ? 363  VAL A CB    1 
ATOM   3163 C  CG1   . VAL C 3 357 ? 39.471 46.573  12.886  1.00 29.12  ? 363  VAL A CG1   1 
ATOM   3164 C  CG2   . VAL C 3 357 ? 39.428 46.328  15.367  1.00 26.84  ? 363  VAL A CG2   1 
ATOM   3165 N  N     . VAL C 3 358 ? 40.973 49.688  12.447  1.00 26.06  ? 364  VAL A N     1 
ATOM   3166 C  CA    . VAL C 3 358 ? 40.985 50.483  11.226  1.00 24.24  ? 364  VAL A CA    1 
ATOM   3167 C  C     . VAL C 3 358 ? 41.526 49.637  10.070  1.00 27.01  ? 364  VAL A C     1 
ATOM   3168 O  O     . VAL C 3 358 ? 42.691 49.753  9.695   1.00 26.61  ? 364  VAL A O     1 
ATOM   3169 C  CB    . VAL C 3 358 ? 41.852 51.771  11.377  1.00 18.18  ? 364  VAL A CB    1 
ATOM   3170 C  CG1   . VAL C 3 358 ? 41.695 52.660  10.145  1.00 23.71  ? 364  VAL A CG1   1 
ATOM   3171 C  CG2   . VAL C 3 358 ? 41.464 52.534  12.630  1.00 14.09  ? 364  VAL A CG2   1 
ATOM   3172 N  N     . ASP C 3 359 ? 40.688 48.746  9.547   1.00 26.72  ? 365  ASP A N     1 
ATOM   3173 C  CA    . ASP C 3 359 ? 41.072 47.897  8.422   1.00 26.34  ? 365  ASP A CA    1 
ATOM   3174 C  C     . ASP C 3 359 ? 40.123 48.168  7.258   1.00 28.17  ? 365  ASP A C     1 
ATOM   3175 O  O     . ASP C 3 359 ? 39.213 48.984  7.394   1.00 31.53  ? 365  ASP A O     1 
ATOM   3176 C  CB    . ASP C 3 359 ? 41.105 46.401  8.812   1.00 26.02  ? 365  ASP A CB    1 
ATOM   3177 C  CG    . ASP C 3 359 ? 39.786 45.879  9.382   1.00 23.49  ? 365  ASP A CG    1 
ATOM   3178 O  OD1   . ASP C 3 359 ? 38.704 46.437  9.107   1.00 27.47  ? 365  ASP A OD1   1 
ATOM   3179 O  OD2   . ASP C 3 359 ? 39.840 44.868  10.113  1.00 30.82  ? 365  ASP A OD2   1 
ATOM   3180 N  N     . ASP C 3 360 ? 40.310 47.481  6.130   1.00 29.14  ? 366  ASP A N     1 
ATOM   3181 C  CA    . ASP C 3 360 ? 39.458 47.697  4.957   1.00 29.64  ? 366  ASP A CA    1 
ATOM   3182 C  C     . ASP C 3 360 ? 37.964 47.436  5.204   1.00 24.91  ? 366  ASP A C     1 
ATOM   3183 O  O     . ASP C 3 360 ? 37.112 48.054  4.563   1.00 27.02  ? 366  ASP A O     1 
ATOM   3184 C  CB    . ASP C 3 360 ? 39.963 46.873  3.761   1.00 31.89  ? 366  ASP A CB    1 
ATOM   3185 C  CG    . ASP C 3 360 ? 39.682 47.552  2.417   1.00 37.23  ? 366  ASP A CG    1 
ATOM   3186 O  OD1   . ASP C 3 360 ? 40.466 48.446  2.021   1.00 35.37  ? 366  ASP A OD1   1 
ATOM   3187 O  OD2   . ASP C 3 360 ? 38.679 47.198  1.760   1.00 39.51  ? 366  ASP A OD2   1 
ATOM   3188 N  N     . GLU C 3 361 ? 37.654 46.540  6.142   1.00 31.40  ? 367  GLU A N     1 
ATOM   3189 C  CA    . GLU C 3 361 ? 36.265 46.221  6.481   1.00 34.30  ? 367  GLU A CA    1 
ATOM   3190 C  C     . GLU C 3 361 ? 35.548 47.421  7.080   1.00 29.78  ? 367  GLU A C     1 
ATOM   3191 O  O     . GLU C 3 361 ? 34.454 47.774  6.641   1.00 43.12  ? 367  GLU A O     1 
ATOM   3192 C  CB    . GLU C 3 361 ? 36.189 45.102  7.508   1.00 50.52  ? 367  GLU A CB    1 
ATOM   3193 C  CG    . GLU C 3 361 ? 36.720 43.774  7.075   1.00 62.40  ? 367  GLU A CG    1 
ATOM   3194 C  CD    . GLU C 3 361 ? 36.648 42.770  8.201   1.00 72.49  ? 367  GLU A CD    1 
ATOM   3195 O  OE1   . GLU C 3 361 ? 35.532 42.552  8.731   1.00 76.64  ? 367  GLU A OE1   1 
ATOM   3196 O  OE2   . GLU C 3 361 ? 37.708 42.215  8.564   1.00 75.44  ? 367  GLU A OE2   1 
ATOM   3197 N  N     . VAL C 3 362 ? 36.160 48.029  8.099   1.00 28.75  ? 368  VAL A N     1 
ATOM   3198 C  CA    . VAL C 3 362 ? 35.558 49.183  8.759   1.00 28.74  ? 368  VAL A CA    1 
ATOM   3199 C  C     . VAL C 3 362 ? 35.541 50.406  7.854   1.00 27.48  ? 368  VAL A C     1 
ATOM   3200 O  O     . VAL C 3 362 ? 34.541 51.112  7.807   1.00 33.60  ? 368  VAL A O     1 
ATOM   3201 C  CB    . VAL C 3 362 ? 36.240 49.535  10.122  1.00 29.39  ? 368  VAL A CB    1 
ATOM   3202 C  CG1   . VAL C 3 362 ? 36.354 48.294  10.988  1.00 29.41  ? 368  VAL A CG1   1 
ATOM   3203 C  CG2   . VAL C 3 362 ? 37.590 50.178  9.913   1.00 34.95  ? 368  VAL A CG2   1 
ATOM   3204 N  N     . LEU C 3 363 ? 36.624 50.624  7.109   1.00 26.67  ? 369  LEU A N     1 
ATOM   3205 C  CA    . LEU C 3 363 ? 36.726 51.765  6.198   1.00 27.69  ? 369  LEU A CA    1 
ATOM   3206 C  C     . LEU C 3 363 ? 35.609 51.755  5.166   1.00 28.98  ? 369  LEU A C     1 
ATOM   3207 O  O     . LEU C 3 363 ? 35.027 52.796  4.852   1.00 30.86  ? 369  LEU A O     1 
ATOM   3208 C  CB    . LEU C 3 363 ? 38.087 51.781  5.492   1.00 23.55  ? 369  LEU A CB    1 
ATOM   3209 C  CG    . LEU C 3 363 ? 39.280 52.149  6.376   1.00 21.77  ? 369  LEU A CG    1 
ATOM   3210 C  CD1   . LEU C 3 363 ? 40.571 52.076  5.581   1.00 21.55  ? 369  LEU A CD1   1 
ATOM   3211 C  CD2   . LEU C 3 363 ? 39.079 53.540  6.940   1.00 20.20  ? 369  LEU A CD2   1 
ATOM   3212 N  N     . GLU C 3 364 ? 35.295 50.567  4.667   1.00 30.60  ? 370  GLU A N     1 
ATOM   3213 C  CA    . GLU C 3 364 ? 34.241 50.403  3.676   1.00 34.99  ? 370  GLU A CA    1 
ATOM   3214 C  C     . GLU C 3 364 ? 32.869 50.739  4.273   1.00 32.61  ? 370  GLU A C     1 
ATOM   3215 O  O     . GLU C 3 364 ? 31.952 51.146  3.553   1.00 34.66  ? 370  GLU A O     1 
ATOM   3216 C  CB    . GLU C 3 364 ? 34.270 48.968  3.128   1.00 43.72  ? 370  GLU A CB    1 
ATOM   3217 C  CG    . GLU C 3 364 ? 33.215 48.636  2.070   1.00 52.39  ? 370  GLU A CG    1 
ATOM   3218 C  CD    . GLU C 3 364 ? 33.244 49.565  0.861   1.00 57.74  ? 370  GLU A CD    1 
ATOM   3219 O  OE1   . GLU C 3 364 ? 34.345 49.950  0.410   1.00 56.57  ? 370  GLU A OE1   1 
ATOM   3220 O  OE2   . GLU C 3 364 ? 32.151 49.903  0.357   1.00 57.41  ? 370  GLU A OE2   1 
ATOM   3221 N  N     . GLY C 3 365 ? 32.752 50.607  5.594   1.00 29.84  ? 371  GLY A N     1 
ATOM   3222 C  CA    . GLY C 3 365 ? 31.495 50.894  6.267   1.00 28.53  ? 371  GLY A CA    1 
ATOM   3223 C  C     . GLY C 3 365 ? 31.401 52.223  6.998   1.00 30.13  ? 371  GLY A C     1 
ATOM   3224 O  O     . GLY C 3 365 ? 30.326 52.585  7.477   1.00 30.06  ? 371  GLY A O     1 
ATOM   3225 N  N     . VAL C 3 366 ? 32.519 52.939  7.105   1.00 34.40  ? 372  VAL A N     1 
ATOM   3226 C  CA    . VAL C 3 366 ? 32.555 54.236  7.784   1.00 30.86  ? 372  VAL A CA    1 
ATOM   3227 C  C     . VAL C 3 366 ? 31.713 55.274  7.033   1.00 33.74  ? 372  VAL A C     1 
ATOM   3228 O  O     . VAL C 3 366 ? 31.806 55.394  5.809   1.00 27.05  ? 372  VAL A O     1 
ATOM   3229 C  CB    . VAL C 3 366 ? 34.019 54.752  7.929   1.00 25.60  ? 372  VAL A CB    1 
ATOM   3230 C  CG1   . VAL C 3 366 ? 34.043 56.160  8.490   1.00 16.81  ? 372  VAL A CG1   1 
ATOM   3231 C  CG2   . VAL C 3 366 ? 34.807 53.840  8.849   1.00 22.61  ? 372  VAL A CG2   1 
ATOM   3232 N  N     . ARG C 3 367 ? 30.874 55.994  7.774   1.00 29.84  ? 373  ARG A N     1 
ATOM   3233 C  CA    . ARG C 3 367 ? 30.016 57.027  7.199   1.00 33.65  ? 373  ARG A CA    1 
ATOM   3234 C  C     . ARG C 3 367 ? 30.116 58.346  7.976   1.00 35.04  ? 373  ARG A C     1 
ATOM   3235 O  O     . ARG C 3 367 ? 29.873 58.393  9.190   1.00 40.08  ? 373  ARG A O     1 
ATOM   3236 C  CB    . ARG C 3 367 ? 28.555 56.559  7.171   1.00 40.03  ? 373  ARG A CB    1 
ATOM   3237 C  CG    . ARG C 3 367 ? 28.270 55.372  6.267   1.00 45.91  ? 373  ARG A CG    1 
ATOM   3238 C  CD    . ARG C 3 367 ? 28.436 55.728  4.799   1.00 48.31  ? 373  ARG A CD    1 
ATOM   3239 N  NE    . ARG C 3 367 ? 28.203 54.569  3.941   1.00 52.30  ? 373  ARG A NE    1 
ATOM   3240 C  CZ    . ARG C 3 367 ? 29.141 53.696  3.579   1.00 52.48  ? 373  ARG A CZ    1 
ATOM   3241 N  NH1   . ARG C 3 367 ? 30.394 53.843  3.993   1.00 53.80  ? 373  ARG A NH1   1 
ATOM   3242 N  NH2   . ARG C 3 367 ? 28.823 52.671  2.800   1.00 54.08  ? 373  ARG A NH2   1 
ATOM   3243 N  N     . VAL C 3 368 ? 30.514 59.406  7.277   1.00 29.32  ? 374  VAL A N     1 
ATOM   3244 C  CA    . VAL C 3 368 ? 30.629 60.731  7.880   1.00 35.49  ? 374  VAL A CA    1 
ATOM   3245 C  C     . VAL C 3 368 ? 29.577 61.630  7.216   1.00 35.99  ? 374  VAL A C     1 
ATOM   3246 O  O     . VAL C 3 368 ? 28.612 61.120  6.638   1.00 48.98  ? 374  VAL A O     1 
ATOM   3247 C  CB    . VAL C 3 368 ? 32.069 61.324  7.729   1.00 46.11  ? 374  VAL A CB    1 
ATOM   3248 C  CG1   . VAL C 3 368 ? 33.058 60.523  8.567   1.00 46.68  ? 374  VAL A CG1   1 
ATOM   3249 C  CG2   . VAL C 3 368 ? 32.503 61.330  6.272   1.00 52.67  ? 374  VAL A CG2   1 
ATOM   3250 N  N     . ASP C 3 369 ? 29.738 62.947  7.301   1.00 35.43  ? 375  ASP A N     1 
ATOM   3251 C  CA    . ASP C 3 369 ? 28.773 63.862  6.697   1.00 33.21  ? 375  ASP A CA    1 
ATOM   3252 C  C     . ASP C 3 369 ? 29.368 64.618  5.529   1.00 29.42  ? 375  ASP A C     1 
ATOM   3253 O  O     . ASP C 3 369 ? 28.767 64.685  4.459   1.00 36.54  ? 375  ASP A O     1 
ATOM   3254 C  CB    . ASP C 3 369 ? 28.245 64.850  7.734   1.00 42.74  ? 375  ASP A CB    1 
ATOM   3255 C  CG    . ASP C 3 369 ? 27.317 64.197  8.731   1.00 49.97  ? 375  ASP A CG    1 
ATOM   3256 O  OD1   . ASP C 3 369 ? 26.120 64.044  8.409   1.00 58.37  ? 375  ASP A OD1   1 
ATOM   3257 O  OD2   . ASP C 3 369 ? 27.783 63.832  9.829   1.00 52.39  ? 375  ASP A OD2   1 
ATOM   3258 N  N     . ASP C 3 370 ? 30.552 65.189  5.748   1.00 29.99  ? 376  ASP A N     1 
ATOM   3259 C  CA    . ASP C 3 370 ? 31.253 65.947  4.721   1.00 29.12  ? 376  ASP A CA    1 
ATOM   3260 C  C     . ASP C 3 370 ? 31.539 65.055  3.519   1.00 29.17  ? 376  ASP A C     1 
ATOM   3261 O  O     . ASP C 3 370 ? 32.221 64.037  3.640   1.00 36.41  ? 376  ASP A O     1 
ATOM   3262 C  CB    . ASP C 3 370 ? 32.562 66.510  5.281   1.00 30.12  ? 376  ASP A CB    1 
ATOM   3263 C  CG    . ASP C 3 370 ? 33.294 67.388  4.282   1.00 32.48  ? 376  ASP A CG    1 
ATOM   3264 O  OD1   . ASP C 3 370 ? 32.640 68.223  3.623   1.00 46.55  ? 376  ASP A OD1   1 
ATOM   3265 O  OD2   . ASP C 3 370 ? 34.525 67.244  4.149   1.00 35.47  ? 376  ASP A OD2   1 
ATOM   3266 N  N     . PRO C 3 371 ? 31.004 65.422  2.343   1.00 30.91  ? 377  PRO A N     1 
ATOM   3267 C  CA    . PRO C 3 371 ? 31.210 64.642  1.119   1.00 29.58  ? 377  PRO A CA    1 
ATOM   3268 C  C     . PRO C 3 371 ? 32.676 64.483  0.701   1.00 28.45  ? 377  PRO A C     1 
ATOM   3269 O  O     . PRO C 3 371 ? 33.059 63.435  0.172   1.00 29.19  ? 377  PRO A O     1 
ATOM   3270 C  CB    . PRO C 3 371 ? 30.381 65.411  0.085   1.00 34.42  ? 377  PRO A CB    1 
ATOM   3271 C  CG    . PRO C 3 371 ? 30.432 66.824  0.594   1.00 42.09  ? 377  PRO A CG    1 
ATOM   3272 C  CD    . PRO C 3 371 ? 30.172 66.606  2.065   1.00 33.55  ? 377  PRO A CD    1 
ATOM   3273 N  N     . GLU C 3 372 ? 33.494 65.508  0.941   1.00 20.40  ? 378  GLU A N     1 
ATOM   3274 C  CA    . GLU C 3 372 ? 34.904 65.439  0.578   1.00 18.43  ? 378  GLU A CA    1 
ATOM   3275 C  C     . GLU C 3 372 ? 35.660 64.421  1.427   1.00 19.13  ? 378  GLU A C     1 
ATOM   3276 O  O     . GLU C 3 372 ? 36.491 63.671  0.906   1.00 20.43  ? 378  GLU A O     1 
ATOM   3277 C  CB    . GLU C 3 372 ? 35.579 66.811  0.684   1.00 15.85  ? 378  GLU A CB    1 
ATOM   3278 C  CG    . GLU C 3 372 ? 37.048 66.807  0.226   1.00 14.49  ? 378  GLU A CG    1 
ATOM   3279 C  CD    . GLU C 3 372 ? 37.695 68.182  0.240   1.00 18.96  ? 378  GLU A CD    1 
ATOM   3280 O  OE1   . GLU C 3 372 ? 36.996 69.185  -0.014  1.00 16.81  ? 378  GLU A OE1   1 
ATOM   3281 O  OE2   . GLU C 3 372 ? 38.915 68.259  0.496   1.00 27.07  ? 378  GLU A OE2   1 
ATOM   3282 N  N     . LYS C 3 373 ? 35.379 64.409  2.730   1.00 19.37  ? 379  LYS A N     1 
ATOM   3283 C  CA    . LYS C 3 373 ? 36.033 63.475  3.643   1.00 19.99  ? 379  LYS A CA    1 
ATOM   3284 C  C     . LYS C 3 373 ? 35.551 62.038  3.416   1.00 17.53  ? 379  LYS A C     1 
ATOM   3285 O  O     . LYS C 3 373 ? 36.327 61.093  3.529   1.00 17.62  ? 379  LYS A O     1 
ATOM   3286 C  CB    . LYS C 3 373 ? 35.842 63.918  5.100   1.00 17.92  ? 379  LYS A CB    1 
ATOM   3287 C  CG    . LYS C 3 373 ? 36.598 65.209  5.442   1.00 19.60  ? 379  LYS A CG    1 
ATOM   3288 C  CD    . LYS C 3 373 ? 36.541 65.538  6.930   1.00 22.31  ? 379  LYS A CD    1 
ATOM   3289 C  CE    . LYS C 3 373 ? 37.061 66.944  7.239   1.00 17.05  ? 379  LYS A CE    1 
ATOM   3290 N  NZ    . LYS C 3 373 ? 38.448 67.211  6.742   1.00 36.39  ? 379  LYS A NZ    1 
ATOM   3291 N  N     . GLN C 3 374 ? 34.279 61.892  3.057   1.00 15.48  ? 380  GLN A N     1 
ATOM   3292 C  CA    . GLN C 3 374 ? 33.682 60.588  2.777   1.00 21.06  ? 380  GLN A CA    1 
ATOM   3293 C  C     . GLN C 3 374 ? 34.361 59.999  1.530   1.00 21.65  ? 380  GLN A C     1 
ATOM   3294 O  O     . GLN C 3 374 ? 34.598 58.794  1.444   1.00 21.40  ? 380  GLN A O     1 
ATOM   3295 C  CB    . GLN C 3 374 ? 32.174 60.757  2.536   1.00 25.25  ? 380  GLN A CB    1 
ATOM   3296 C  CG    . GLN C 3 374 ? 31.422 59.485  2.164   1.00 24.10  ? 380  GLN A CG    1 
ATOM   3297 C  CD    . GLN C 3 374 ? 31.417 58.459  3.275   1.00 30.32  ? 380  GLN A CD    1 
ATOM   3298 O  OE1   . GLN C 3 374 ? 30.971 58.736  4.385   1.00 32.71  ? 380  GLN A OE1   1 
ATOM   3299 N  NE2   . GLN C 3 374 ? 31.913 57.264  2.980   1.00 23.92  ? 380  GLN A NE2   1 
ATOM   3300 N  N     . ALA C 3 375 ? 34.681 60.875  0.578   1.00 24.46  ? 381  ALA A N     1 
ATOM   3301 C  CA    . ALA C 3 375 ? 35.339 60.491  -0.664  1.00 19.16  ? 381  ALA A CA    1 
ATOM   3302 C  C     . ALA C 3 375 ? 36.811 60.192  -0.411  1.00 20.65  ? 381  ALA A C     1 
ATOM   3303 O  O     . ALA C 3 375 ? 37.409 59.363  -1.095  1.00 18.82  ? 381  ALA A O     1 
ATOM   3304 C  CB    . ALA C 3 375 ? 35.206 61.601  -1.684  1.00 22.07  ? 381  ALA A CB    1 
ATOM   3305 N  N     . ALA C 3 376 ? 37.387 60.867  0.582   1.00 18.67  ? 382  ALA A N     1 
ATOM   3306 C  CA    . ALA C 3 376 ? 38.787 60.669  0.932   1.00 14.74  ? 382  ALA A CA    1 
ATOM   3307 C  C     . ALA C 3 376 ? 39.031 59.268  1.490   1.00 16.87  ? 382  ALA A C     1 
ATOM   3308 O  O     . ALA C 3 376 ? 40.140 58.744  1.386   1.00 21.79  ? 382  ALA A O     1 
ATOM   3309 C  CB    . ALA C 3 376 ? 39.231 61.715  1.931   1.00 14.00  ? 382  ALA A CB    1 
ATOM   3310 N  N     . ILE C 3 377 ? 37.993 58.666  2.070   1.00 16.94  ? 383  ILE A N     1 
ATOM   3311 C  CA    . ILE C 3 377 ? 38.090 57.324  2.641   1.00 16.50  ? 383  ILE A CA    1 
ATOM   3312 C  C     . ILE C 3 377 ? 38.431 56.303  1.553   1.00 19.17  ? 383  ILE A C     1 
ATOM   3313 O  O     . ILE C 3 377 ? 39.128 55.321  1.809   1.00 20.70  ? 383  ILE A O     1 
ATOM   3314 C  CB    . ILE C 3 377 ? 36.775 56.909  3.353   1.00 13.42  ? 383  ILE A CB    1 
ATOM   3315 C  CG1   . ILE C 3 377 ? 36.492 57.854  4.519   1.00 9.44   ? 383  ILE A CG1   1 
ATOM   3316 C  CG2   . ILE C 3 377 ? 36.879 55.477  3.887   1.00 10.70  ? 383  ILE A CG2   1 
ATOM   3317 C  CD1   . ILE C 3 377 ? 35.151 57.629  5.165   1.00 13.29  ? 383  ILE A CD1   1 
ATOM   3318 N  N     . ASP C 3 378 ? 37.937 56.536  0.343   1.00 14.14  ? 384  ASP A N     1 
ATOM   3319 C  CA    . ASP C 3 378 ? 38.217 55.635  -0.766  1.00 19.92  ? 384  ASP A CA    1 
ATOM   3320 C  C     . ASP C 3 378 ? 39.650 55.825  -1.250  1.00 18.58  ? 384  ASP A C     1 
ATOM   3321 O  O     . ASP C 3 378 ? 40.290 54.877  -1.702  1.00 15.39  ? 384  ASP A O     1 
ATOM   3322 C  CB    . ASP C 3 378 ? 37.225 55.865  -1.897  1.00 23.73  ? 384  ASP A CB    1 
ATOM   3323 C  CG    . ASP C 3 378 ? 35.819 55.482  -1.509  1.00 31.89  ? 384  ASP A CG    1 
ATOM   3324 O  OD1   . ASP C 3 378 ? 35.481 54.286  -1.641  1.00 35.64  ? 384  ASP A OD1   1 
ATOM   3325 O  OD2   . ASP C 3 378 ? 35.059 56.368  -1.057  1.00 43.48  ? 384  ASP A OD2   1 
ATOM   3326 N  N     . LEU C 3 379 ? 40.158 57.050  -1.128  1.00 19.34  ? 385  LEU A N     1 
ATOM   3327 C  CA    . LEU C 3 379 ? 41.527 57.351  -1.533  1.00 18.73  ? 385  LEU A CA    1 
ATOM   3328 C  C     . LEU C 3 379 ? 42.472 56.655  -0.549  1.00 17.89  ? 385  LEU A C     1 
ATOM   3329 O  O     . LEU C 3 379 ? 43.556 56.204  -0.926  1.00 18.87  ? 385  LEU A O     1 
ATOM   3330 C  CB    . LEU C 3 379 ? 41.784 58.864  -1.522  1.00 15.34  ? 385  LEU A CB    1 
ATOM   3331 C  CG    . LEU C 3 379 ? 40.852 59.787  -2.310  1.00 15.38  ? 385  LEU A CG    1 
ATOM   3332 C  CD1   . LEU C 3 379 ? 41.441 61.193  -2.318  1.00 14.25  ? 385  LEU A CD1   1 
ATOM   3333 C  CD2   . LEU C 3 379 ? 40.671 59.285  -3.726  1.00 18.10  ? 385  LEU A CD2   1 
ATOM   3334 N  N     . ILE C 3 380 ? 42.046 56.581  0.711   1.00 17.47  ? 386  ILE A N     1 
ATOM   3335 C  CA    . ILE C 3 380 ? 42.818 55.935  1.773   1.00 22.40  ? 386  ILE A CA    1 
ATOM   3336 C  C     . ILE C 3 380 ? 42.885 54.429  1.512   1.00 20.87  ? 386  ILE A C     1 
ATOM   3337 O  O     . ILE C 3 380 ? 43.956 53.834  1.604   1.00 23.11  ? 386  ILE A O     1 
ATOM   3338 C  CB    . ILE C 3 380 ? 42.193 56.197  3.176   1.00 26.71  ? 386  ILE A CB    1 
ATOM   3339 C  CG1   . ILE C 3 380 ? 42.245 57.695  3.500   1.00 21.97  ? 386  ILE A CG1   1 
ATOM   3340 C  CG2   . ILE C 3 380 ? 42.950 55.421  4.251   1.00 17.10  ? 386  ILE A CG2   1 
ATOM   3341 C  CD1   . ILE C 3 380 ? 41.438 58.096  4.715   1.00 23.59  ? 386  ILE A CD1   1 
ATOM   3342 N  N     . LYS C 3 381 ? 41.742 53.826  1.177   1.00 20.29  ? 387  LYS A N     1 
ATOM   3343 C  CA    . LYS C 3 381 ? 41.682 52.394  0.888   1.00 18.58  ? 387  LYS A CA    1 
ATOM   3344 C  C     . LYS C 3 381 ? 42.546 52.043  -0.321  1.00 20.77  ? 387  LYS A C     1 
ATOM   3345 O  O     . LYS C 3 381 ? 43.200 50.995  -0.344  1.00 25.65  ? 387  LYS A O     1 
ATOM   3346 C  CB    . LYS C 3 381 ? 40.245 51.939  0.635   1.00 24.09  ? 387  LYS A CB    1 
ATOM   3347 C  CG    . LYS C 3 381 ? 39.349 51.971  1.855   1.00 32.55  ? 387  LYS A CG    1 
ATOM   3348 C  CD    . LYS C 3 381 ? 38.186 50.995  1.708   1.00 43.49  ? 387  LYS A CD    1 
ATOM   3349 C  CE    . LYS C 3 381 ? 37.293 51.321  0.524   1.00 42.50  ? 387  LYS A CE    1 
ATOM   3350 N  NZ    . LYS C 3 381 ? 36.533 52.572  0.754   1.00 41.99  ? 387  LYS A NZ    1 
ATOM   3351 N  N     . GLU C 3 382 ? 42.552 52.927  -1.317  1.00 18.23  ? 388  GLU A N     1 
ATOM   3352 C  CA    . GLU C 3 382 ? 43.351 52.716  -2.520  1.00 17.45  ? 388  GLU A CA    1 
ATOM   3353 C  C     . GLU C 3 382 ? 44.832 52.870  -2.198  1.00 15.77  ? 388  GLU A C     1 
ATOM   3354 O  O     . GLU C 3 382 ? 45.656 52.074  -2.637  1.00 19.77  ? 388  GLU A O     1 
ATOM   3355 C  CB    . GLU C 3 382 ? 42.959 53.709  -3.615  1.00 22.30  ? 388  GLU A CB    1 
ATOM   3356 C  CG    . GLU C 3 382 ? 43.737 53.509  -4.904  1.00 23.60  ? 388  GLU A CG    1 
ATOM   3357 C  CD    . GLU C 3 382 ? 43.312 54.433  -6.029  1.00 25.35  ? 388  GLU A CD    1 
ATOM   3358 O  OE1   . GLU C 3 382 ? 42.307 55.165  -5.884  1.00 32.57  ? 388  GLU A OE1   1 
ATOM   3359 O  OE2   . GLU C 3 382 ? 43.994 54.419  -7.073  1.00 22.91  ? 388  GLU A OE2   1 
ATOM   3360 N  N     . TYR C 3 383 ? 45.153 53.883  -1.402  1.00 13.92  ? 389  TYR A N     1 
ATOM   3361 C  CA    . TYR C 3 383 ? 46.529 54.162  -1.003  1.00 18.21  ? 389  TYR A CA    1 
ATOM   3362 C  C     . TYR C 3 383 ? 47.143 52.983  -0.253  1.00 18.27  ? 389  TYR A C     1 
ATOM   3363 O  O     . TYR C 3 383 ? 48.287 52.617  -0.501  1.00 15.50  ? 389  TYR A O     1 
ATOM   3364 C  CB    . TYR C 3 383 ? 46.568 55.426  -0.131  1.00 17.49  ? 389  TYR A CB    1 
ATOM   3365 C  CG    . TYR C 3 383 ? 47.947 55.852  0.324   1.00 12.75  ? 389  TYR A CG    1 
ATOM   3366 C  CD1   . TYR C 3 383 ? 48.574 55.222  1.402   1.00 13.33  ? 389  TYR A CD1   1 
ATOM   3367 C  CD2   . TYR C 3 383 ? 48.612 56.901  -0.301  1.00 6.78   ? 389  TYR A CD2   1 
ATOM   3368 C  CE1   . TYR C 3 383 ? 49.827 55.623  1.840   1.00 12.97  ? 389  TYR A CE1   1 
ATOM   3369 C  CE2   . TYR C 3 383 ? 49.869 57.315  0.133   1.00 16.55  ? 389  TYR A CE2   1 
ATOM   3370 C  CZ    . TYR C 3 383 ? 50.469 56.669  1.208   1.00 14.03  ? 389  TYR A CZ    1 
ATOM   3371 O  OH    . TYR C 3 383 ? 51.710 57.065  1.659   1.00 20.20  ? 389  TYR A OH    1 
ATOM   3372 N  N     . LEU C 3 384 ? 46.379 52.399  0.665   1.00 17.12  ? 390  LEU A N     1 
ATOM   3373 C  CA    . LEU C 3 384 ? 46.856 51.267  1.449   1.00 17.29  ? 390  LEU A CA    1 
ATOM   3374 C  C     . LEU C 3 384 ? 47.225 50.102  0.544   1.00 14.61  ? 390  LEU A C     1 
ATOM   3375 O  O     . LEU C 3 384 ? 48.245 49.464  0.751   1.00 15.63  ? 390  LEU A O     1 
ATOM   3376 C  CB    . LEU C 3 384 ? 45.807 50.852  2.487   1.00 13.69  ? 390  LEU A CB    1 
ATOM   3377 C  CG    . LEU C 3 384 ? 45.588 51.891  3.601   1.00 16.79  ? 390  LEU A CG    1 
ATOM   3378 C  CD1   . LEU C 3 384 ? 44.386 51.514  4.435   1.00 12.57  ? 390  LEU A CD1   1 
ATOM   3379 C  CD2   . LEU C 3 384 ? 46.848 52.031  4.463   1.00 10.85  ? 390  LEU A CD2   1 
ATOM   3380 N  N     . MET C 3 385 ? 46.420 49.851  -0.482  1.00 20.71  ? 391  MET A N     1 
ATOM   3381 C  CA    . MET C 3 385 ? 46.725 48.768  -1.409  1.00 23.44  ? 391  MET A CA    1 
ATOM   3382 C  C     . MET C 3 385 ? 47.937 49.165  -2.252  1.00 23.50  ? 391  MET A C     1 
ATOM   3383 O  O     . MET C 3 385 ? 48.815 48.341  -2.503  1.00 25.88  ? 391  MET A O     1 
ATOM   3384 C  CB    . MET C 3 385 ? 45.527 48.454  -2.310  1.00 24.22  ? 391  MET A CB    1 
ATOM   3385 C  CG    . MET C 3 385 ? 45.838 47.442  -3.420  1.00 29.22  ? 391  MET A CG    1 
ATOM   3386 S  SD    . MET C 3 385 ? 45.944 48.178  -5.096  1.00 27.70  ? 391  MET A SD    1 
ATOM   3387 C  CE    . MET C 3 385 ? 47.621 48.509  -5.319  1.00 35.21  ? 391  MET A CE    1 
ATOM   3388 N  N     . ILE C 3 386 ? 47.983 50.426  -2.684  1.00 18.24  ? 392  ILE A N     1 
ATOM   3389 C  CA    . ILE C 3 386 ? 49.093 50.922  -3.490  1.00 16.71  ? 392  ILE A CA    1 
ATOM   3390 C  C     . ILE C 3 386 ? 50.384 50.661  -2.726  1.00 13.61  ? 392  ILE A C     1 
ATOM   3391 O  O     . ILE C 3 386 ? 51.346 50.136  -3.286  1.00 16.48  ? 392  ILE A O     1 
ATOM   3392 C  CB    . ILE C 3 386 ? 48.932 52.453  -3.824  1.00 26.31  ? 392  ILE A CB    1 
ATOM   3393 C  CG1   . ILE C 3 386 ? 47.749 52.673  -4.779  1.00 21.80  ? 392  ILE A CG1   1 
ATOM   3394 C  CG2   . ILE C 3 386 ? 50.203 53.029  -4.455  1.00 21.30  ? 392  ILE A CG2   1 
ATOM   3395 C  CD1   . ILE C 3 386 ? 47.888 52.014  -6.134  1.00 21.26  ? 392  ILE A CD1   1 
ATOM   3396 N  N     . GLN C 3 387 ? 50.378 50.971  -1.432  1.00 15.13  ? 393  GLN A N     1 
ATOM   3397 C  CA    . GLN C 3 387 ? 51.554 50.761  -0.590  1.00 14.81  ? 393  GLN A CA    1 
ATOM   3398 C  C     . GLN C 3 387 ? 51.910 49.293  -0.427  1.00 16.92  ? 393  GLN A C     1 
ATOM   3399 O  O     . GLN C 3 387 ? 53.089 48.937  -0.346  1.00 14.45  ? 393  GLN A O     1 
ATOM   3400 C  CB    . GLN C 3 387 ? 51.358 51.376  0.792   1.00 18.95  ? 393  GLN A CB    1 
ATOM   3401 C  CG    . GLN C 3 387 ? 52.010 52.719  0.953   1.00 25.79  ? 393  GLN A CG    1 
ATOM   3402 C  CD    . GLN C 3 387 ? 53.517 52.700  0.727   1.00 26.62  ? 393  GLN A CD    1 
ATOM   3403 O  OE1   . GLN C 3 387 ? 54.122 53.748  0.554   1.00 35.36  ? 393  GLN A OE1   1 
ATOM   3404 N  NE2   . GLN C 3 387 ? 54.125 51.519  0.737   1.00 30.55  ? 393  GLN A NE2   1 
ATOM   3405 N  N     . LYS C 3 388 ? 50.878 48.456  -0.364  1.00 18.45  ? 394  LYS A N     1 
ATOM   3406 C  CA    . LYS C 3 388 ? 51.051 47.022  -0.218  1.00 16.79  ? 394  LYS A CA    1 
ATOM   3407 C  C     . LYS C 3 388 ? 51.834 46.466  -1.414  1.00 16.40  ? 394  LYS A C     1 
ATOM   3408 O  O     . LYS C 3 388 ? 52.766 45.672  -1.239  1.00 22.08  ? 394  LYS A O     1 
ATOM   3409 C  CB    . LYS C 3 388 ? 49.688 46.345  -0.100  1.00 25.50  ? 394  LYS A CB    1 
ATOM   3410 C  CG    . LYS C 3 388 ? 49.773 44.869  0.189   1.00 39.08  ? 394  LYS A CG    1 
ATOM   3411 C  CD    . LYS C 3 388 ? 50.548 44.614  1.476   1.00 43.94  ? 394  LYS A CD    1 
ATOM   3412 C  CE    . LYS C 3 388 ? 49.654 44.032  2.544   1.00 45.47  ? 394  LYS A CE    1 
ATOM   3413 N  NZ    . LYS C 3 388 ? 49.051 42.770  2.049   1.00 47.50  ? 394  LYS A NZ    1 
ATOM   3414 N  N     . ARG C 3 389 ? 51.474 46.920  -2.617  1.00 15.97  ? 395  ARG A N     1 
ATOM   3415 C  CA    . ARG C 3 389 ? 52.134 46.493  -3.855  1.00 7.80   ? 395  ARG A CA    1 
ATOM   3416 C  C     . ARG C 3 389 ? 53.531 47.079  -3.969  1.00 5.47   ? 395  ARG A C     1 
ATOM   3417 O  O     . ARG C 3 389 ? 54.461 46.400  -4.389  1.00 9.24   ? 395  ARG A O     1 
ATOM   3418 C  CB    . ARG C 3 389 ? 51.313 46.917  -5.069  1.00 9.95   ? 395  ARG A CB    1 
ATOM   3419 C  CG    . ARG C 3 389 ? 49.925 46.312  -5.126  1.00 6.47   ? 395  ARG A CG    1 
ATOM   3420 C  CD    . ARG C 3 389 ? 49.920 44.819  -5.381  1.00 9.27   ? 395  ARG A CD    1 
ATOM   3421 N  NE    . ARG C 3 389 ? 48.549 44.325  -5.448  1.00 12.96  ? 395  ARG A NE    1 
ATOM   3422 C  CZ    . ARG C 3 389 ? 47.787 44.068  -4.389  1.00 10.56  ? 395  ARG A CZ    1 
ATOM   3423 N  NH1   . ARG C 3 389 ? 48.260 44.240  -3.160  1.00 15.54  ? 395  ARG A NH1   1 
ATOM   3424 N  NH2   . ARG C 3 389 ? 46.527 43.705  -4.561  1.00 6.04   ? 395  ARG A NH2   1 
ATOM   3425 N  N     . ILE C 3 390 ? 53.678 48.339  -3.578  1.00 7.02   ? 396  ILE A N     1 
ATOM   3426 C  CA    . ILE C 3 390 ? 54.975 49.003  -3.635  1.00 11.72  ? 396  ILE A CA    1 
ATOM   3427 C  C     . ILE C 3 390 ? 55.968 48.345  -2.681  1.00 6.30   ? 396  ILE A C     1 
ATOM   3428 O  O     . ILE C 3 390 ? 57.117 48.122  -3.040  1.00 10.78  ? 396  ILE A O     1 
ATOM   3429 C  CB    . ILE C 3 390 ? 54.844 50.508  -3.300  1.00 11.41  ? 396  ILE A CB    1 
ATOM   3430 C  CG1   . ILE C 3 390 ? 54.004 51.196  -4.378  1.00 5.81   ? 396  ILE A CG1   1 
ATOM   3431 C  CG2   . ILE C 3 390 ? 56.211 51.148  -3.173  1.00 2.00   ? 396  ILE A CG2   1 
ATOM   3432 C  CD1   . ILE C 3 390 ? 53.814 52.674  -4.172  1.00 4.73   ? 396  ILE A CD1   1 
ATOM   3433 N  N     . GLY C 3 391 ? 55.509 48.022  -1.474  1.00 5.49   ? 397  GLY A N     1 
ATOM   3434 C  CA    . GLY C 3 391 ? 56.369 47.390  -0.485  1.00 3.94   ? 397  GLY A CA    1 
ATOM   3435 C  C     . GLY C 3 391 ? 56.842 45.999  -0.885  1.00 5.10   ? 397  GLY A C     1 
ATOM   3436 O  O     . GLY C 3 391 ? 58.006 45.655  -0.683  1.00 8.83   ? 397  GLY A O     1 
ATOM   3437 N  N     . GLN C 3 392 ? 55.942 45.198  -1.452  1.00 6.59   ? 398  GLN A N     1 
ATOM   3438 C  CA    . GLN C 3 392 ? 56.289 43.841  -1.872  1.00 12.75  ? 398  GLN A CA    1 
ATOM   3439 C  C     . GLN C 3 392 ? 57.161 43.793  -3.128  1.00 9.76   ? 398  GLN A C     1 
ATOM   3440 O  O     . GLN C 3 392 ? 58.112 43.013  -3.210  1.00 10.93  ? 398  GLN A O     1 
ATOM   3441 C  CB    . GLN C 3 392 ? 55.018 43.010  -2.088  1.00 8.84   ? 398  GLN A CB    1 
ATOM   3442 C  CG    . GLN C 3 392 ? 55.292 41.560  -2.463  1.00 12.70  ? 398  GLN A CG    1 
ATOM   3443 C  CD    . GLN C 3 392 ? 54.055 40.674  -2.419  1.00 12.51  ? 398  GLN A CD    1 
ATOM   3444 O  OE1   . GLN C 3 392 ? 52.928 41.151  -2.284  1.00 11.50  ? 398  GLN A OE1   1 
ATOM   3445 N  NE2   . GLN C 3 392 ? 54.269 39.370  -2.538  1.00 11.04  ? 398  GLN A NE2   1 
ATOM   3446 N  N     . SER C 3 393 ? 56.854 44.660  -4.086  1.00 12.71  ? 399  SER A N     1 
ATOM   3447 C  CA    . SER C 3 393 ? 57.590 44.707  -5.344  1.00 13.52  ? 399  SER A CA    1 
ATOM   3448 C  C     . SER C 3 393 ? 58.899 45.483  -5.346  1.00 12.03  ? 399  SER A C     1 
ATOM   3449 O  O     . SER C 3 393 ? 59.879 45.015  -5.914  1.00 14.03  ? 399  SER A O     1 
ATOM   3450 C  CB    . SER C 3 393 ? 56.695 45.257  -6.466  1.00 13.14  ? 399  SER A CB    1 
ATOM   3451 O  OG    . SER C 3 393 ? 56.475 46.658  -6.347  1.00 7.24   ? 399  SER A OG    1 
ATOM   3452 N  N     . ALA C 3 394 ? 58.928 46.651  -4.697  1.00 16.85  ? 400  ALA A N     1 
ATOM   3453 C  CA    . ALA C 3 394 ? 60.132 47.480  -4.709  1.00 16.72  ? 400  ALA A CA    1 
ATOM   3454 C  C     . ALA C 3 394 ? 60.751 48.071  -3.441  1.00 18.24  ? 400  ALA A C     1 
ATOM   3455 O  O     . ALA C 3 394 ? 61.974 48.045  -3.297  1.00 19.22  ? 400  ALA A O     1 
ATOM   3456 C  CB    . ALA C 3 394 ? 59.937 48.599  -5.717  1.00 11.74  ? 400  ALA A CB    1 
ATOM   3457 N  N     . GLU C 3 395 ? 59.937 48.625  -2.545  1.00 10.52  ? 401  GLU A N     1 
ATOM   3458 C  CA    . GLU C 3 395 ? 60.470 49.264  -1.340  1.00 13.80  ? 401  GLU A CA    1 
ATOM   3459 C  C     . GLU C 3 395 ? 60.758 48.470  -0.079  1.00 11.73  ? 401  GLU A C     1 
ATOM   3460 O  O     . GLU C 3 395 ? 61.669 48.825  0.665   1.00 14.07  ? 401  GLU A O     1 
ATOM   3461 C  CB    . GLU C 3 395 ? 59.630 50.491  -0.987  1.00 13.39  ? 401  GLU A CB    1 
ATOM   3462 C  CG    . GLU C 3 395 ? 59.824 51.639  -1.966  1.00 24.00  ? 401  GLU A CG    1 
ATOM   3463 C  CD    . GLU C 3 395 ? 59.004 52.882  -1.633  1.00 23.87  ? 401  GLU A CD    1 
ATOM   3464 O  OE1   . GLU C 3 395 ? 58.147 52.841  -0.722  1.00 27.93  ? 401  GLU A OE1   1 
ATOM   3465 O  OE2   . GLU C 3 395 ? 59.217 53.912  -2.300  1.00 27.44  ? 401  GLU A OE2   1 
ATOM   3466 N  N     . GLY C 3 396 ? 59.981 47.423  0.179   1.00 19.34  ? 402  GLY A N     1 
ATOM   3467 C  CA    . GLY C 3 396 ? 60.194 46.608  1.365   1.00 16.41  ? 402  GLY A CA    1 
ATOM   3468 C  C     . GLY C 3 396 ? 61.580 45.988  1.424   1.00 15.41  ? 402  GLY A C     1 
ATOM   3469 O  O     . GLY C 3 396 ? 62.271 45.914  0.410   1.00 14.00  ? 402  GLY A O     1 
ATOM   3470 N  N     . ASP C 3 397 ? 61.984 45.551  2.617   1.00 21.47  ? 403  ASP A N     1 
ATOM   3471 C  CA    . ASP C 3 397 ? 63.294 44.925  2.841   1.00 24.22  ? 403  ASP A CA    1 
ATOM   3472 C  C     . ASP C 3 397 ? 63.504 43.646  2.029   1.00 21.81  ? 403  ASP A C     1 
ATOM   3473 O  O     . ASP C 3 397 ? 64.634 43.301  1.680   1.00 16.15  ? 403  ASP A O     1 
ATOM   3474 C  CB    . ASP C 3 397 ? 63.475 44.600  4.328   1.00 32.62  ? 403  ASP A CB    1 
ATOM   3475 C  CG    . ASP C 3 397 ? 63.530 45.837  5.195   1.00 39.06  ? 403  ASP A CG    1 
ATOM   3476 O  OD1   . ASP C 3 397 ? 62.564 46.628  5.180   1.00 46.08  ? 403  ASP A OD1   1 
ATOM   3477 O  OD2   . ASP C 3 397 ? 64.546 46.023  5.893   1.00 44.92  ? 403  ASP A OD2   1 
ATOM   3478 N  N     . LYS C 3 398 ? 62.407 42.947  1.746   1.00 15.10  ? 404  LYS A N     1 
ATOM   3479 C  CA    . LYS C 3 398 ? 62.433 41.700  0.987   1.00 17.23  ? 404  LYS A CA    1 
ATOM   3480 C  C     . LYS C 3 398 ? 61.794 41.894  -0.393  1.00 14.19  ? 404  LYS A C     1 
ATOM   3481 O  O     . LYS C 3 398 ? 61.325 40.937  -1.012  1.00 11.19  ? 404  LYS A O     1 
ATOM   3482 C  CB    . LYS C 3 398 ? 61.669 40.616  1.756   1.00 15.27  ? 404  LYS A CB    1 
ATOM   3483 C  CG    . LYS C 3 398 ? 62.072 40.455  3.222   1.00 16.33  ? 404  LYS A CG    1 
ATOM   3484 C  CD    . LYS C 3 398 ? 63.449 39.825  3.393   1.00 19.73  ? 404  LYS A CD    1 
ATOM   3485 C  CE    . LYS C 3 398 ? 63.840 39.736  4.867   1.00 21.37  ? 404  LYS A CE    1 
ATOM   3486 N  NZ    . LYS C 3 398 ? 62.829 39.001  5.705   1.00 20.63  ? 404  LYS A NZ    1 
ATOM   3487 N  N     . ALA C 3 399 ? 61.780 43.135  -0.869  1.00 9.45   ? 405  ALA A N     1 
ATOM   3488 C  CA    . ALA C 3 399 ? 61.189 43.450  -2.167  1.00 14.40  ? 405  ALA A CA    1 
ATOM   3489 C  C     . ALA C 3 399 ? 61.863 42.730  -3.325  1.00 8.10   ? 405  ALA A C     1 
ATOM   3490 O  O     . ALA C 3 399 ? 63.077 42.540  -3.324  1.00 10.84  ? 405  ALA A O     1 
ATOM   3491 C  CB    . ALA C 3 399 ? 61.215 44.941  -2.402  1.00 13.17  ? 405  ALA A CB    1 
ATOM   3492 N  N     . TRP C 3 400 ? 61.051 42.345  -4.308  1.00 10.01  ? 406  TRP A N     1 
ATOM   3493 C  CA    . TRP C 3 400 ? 61.510 41.639  -5.507  1.00 9.71   ? 406  TRP A CA    1 
ATOM   3494 C  C     . TRP C 3 400 ? 62.685 42.333  -6.176  1.00 13.02  ? 406  TRP A C     1 
ATOM   3495 O  O     . TRP C 3 400 ? 63.676 41.692  -6.512  1.00 13.16  ? 406  TRP A O     1 
ATOM   3496 C  CB    . TRP C 3 400 ? 60.380 41.537  -6.527  1.00 5.93   ? 406  TRP A CB    1 
ATOM   3497 C  CG    . TRP C 3 400 ? 59.141 40.903  -6.014  1.00 7.52   ? 406  TRP A CG    1 
ATOM   3498 C  CD1   . TRP C 3 400 ? 59.032 40.017  -4.977  1.00 6.75   ? 406  TRP A CD1   1 
ATOM   3499 C  CD2   . TRP C 3 400 ? 57.816 41.123  -6.498  1.00 6.56   ? 406  TRP A CD2   1 
ATOM   3500 N  NE1   . TRP C 3 400 ? 57.718 39.679  -4.788  1.00 6.39   ? 406  TRP A NE1   1 
ATOM   3501 C  CE2   . TRP C 3 400 ? 56.949 40.339  -5.708  1.00 5.51   ? 406  TRP A CE2   1 
ATOM   3502 C  CE3   . TRP C 3 400 ? 57.275 41.903  -7.528  1.00 6.66   ? 406  TRP A CE3   1 
ATOM   3503 C  CZ2   . TRP C 3 400 ? 55.560 40.320  -5.910  1.00 9.46   ? 406  TRP A CZ2   1 
ATOM   3504 C  CZ3   . TRP C 3 400 ? 55.899 41.885  -7.728  1.00 5.41   ? 406  TRP A CZ3   1 
ATOM   3505 C  CH2   . TRP C 3 400 ? 55.058 41.095  -6.924  1.00 12.64  ? 406  TRP A CH2   1 
ATOM   3506 N  N     . LEU C 3 401 ? 62.575 43.648  -6.355  1.00 16.29  ? 407  LEU A N     1 
ATOM   3507 C  CA    . LEU C 3 401 ? 63.639 44.420  -6.995  1.00 18.81  ? 407  LEU A CA    1 
ATOM   3508 C  C     . LEU C 3 401 ? 64.964 44.400  -6.230  1.00 16.14  ? 407  LEU A C     1 
ATOM   3509 O  O     . LEU C 3 401 ? 66.022 44.615  -6.818  1.00 14.80  ? 407  LEU A O     1 
ATOM   3510 C  CB    . LEU C 3 401 ? 63.182 45.861  -7.258  1.00 15.80  ? 407  LEU A CB    1 
ATOM   3511 C  CG    . LEU C 3 401 ? 62.113 46.056  -8.339  1.00 11.78  ? 407  LEU A CG    1 
ATOM   3512 C  CD1   . LEU C 3 401 ? 61.754 47.528  -8.436  1.00 7.83   ? 407  LEU A CD1   1 
ATOM   3513 C  CD2   . LEU C 3 401 ? 62.620 45.541  -9.691  1.00 10.75  ? 407  LEU A CD2   1 
ATOM   3514 N  N     . ARG C 3 402 ? 64.906 44.137  -4.927  1.00 17.13  ? 408  ARG A N     1 
ATOM   3515 C  CA    . ARG C 3 402 ? 66.114 44.067  -4.102  1.00 12.78  ? 408  ARG A CA    1 
ATOM   3516 C  C     . ARG C 3 402 ? 66.696 42.655  -4.122  1.00 13.48  ? 408  ARG A C     1 
ATOM   3517 O  O     . ARG C 3 402 ? 67.852 42.451  -3.756  1.00 18.34  ? 408  ARG A O     1 
ATOM   3518 C  CB    . ARG C 3 402 ? 65.812 44.450  -2.650  1.00 15.15  ? 408  ARG A CB    1 
ATOM   3519 C  CG    . ARG C 3 402 ? 65.285 45.857  -2.466  1.00 20.84  ? 408  ARG A CG    1 
ATOM   3520 C  CD    . ARG C 3 402 ? 65.061 46.166  -0.997  1.00 23.02  ? 408  ARG A CD    1 
ATOM   3521 N  NE    . ARG C 3 402 ? 64.353 47.434  -0.813  1.00 24.55  ? 408  ARG A NE    1 
ATOM   3522 C  CZ    . ARG C 3 402 ? 64.937 48.626  -0.730  1.00 22.23  ? 408  ARG A CZ    1 
ATOM   3523 N  NH1   . ARG C 3 402 ? 66.254 48.735  -0.818  1.00 19.28  ? 408  ARG A NH1   1 
ATOM   3524 N  NH2   . ARG C 3 402 ? 64.199 49.712  -0.535  1.00 20.93  ? 408  ARG A NH2   1 
ATOM   3525 N  N     . TYR C 3 403 ? 65.893 41.689  -4.559  1.00 14.05  ? 409  TYR A N     1 
ATOM   3526 C  CA    . TYR C 3 403 ? 66.316 40.296  -4.610  1.00 16.09  ? 409  TYR A CA    1 
ATOM   3527 C  C     . TYR C 3 403 ? 66.719 39.679  -5.946  1.00 21.68  ? 409  TYR A C     1 
ATOM   3528 O  O     . TYR C 3 403 ? 67.037 38.489  -5.991  1.00 25.72  ? 409  TYR A O     1 
ATOM   3529 C  CB    . TYR C 3 403 ? 65.264 39.414  -3.926  1.00 15.06  ? 409  TYR A CB    1 
ATOM   3530 C  CG    . TYR C 3 403 ? 65.511 39.285  -2.446  1.00 21.11  ? 409  TYR A CG    1 
ATOM   3531 C  CD1   . TYR C 3 403 ? 66.376 38.312  -1.957  1.00 20.33  ? 409  TYR A CD1   1 
ATOM   3532 C  CD2   . TYR C 3 403 ? 64.921 40.160  -1.537  1.00 22.44  ? 409  TYR A CD2   1 
ATOM   3533 C  CE1   . TYR C 3 403 ? 66.654 38.210  -0.599  1.00 23.31  ? 409  TYR A CE1   1 
ATOM   3534 C  CE2   . TYR C 3 403 ? 65.192 40.069  -0.171  1.00 26.88  ? 409  TYR A CE2   1 
ATOM   3535 C  CZ    . TYR C 3 403 ? 66.062 39.091  0.290   1.00 26.60  ? 409  TYR A CZ    1 
ATOM   3536 O  OH    . TYR C 3 403 ? 66.347 38.996  1.634   1.00 24.77  ? 409  TYR A OH    1 
ATOM   3537 N  N     . VAL C 3 404 ? 66.715 40.458  -7.030  1.00 24.12  ? 410  VAL A N     1 
ATOM   3538 C  CA    . VAL C 3 404 ? 67.103 39.912  -8.335  1.00 20.67  ? 410  VAL A CA    1 
ATOM   3539 C  C     . VAL C 3 404 ? 68.608 39.798  -8.494  1.00 18.08  ? 410  VAL A C     1 
ATOM   3540 O  O     . VAL C 3 404 ? 69.333 40.778  -8.350  1.00 20.73  ? 410  VAL A O     1 
ATOM   3541 C  CB    . VAL C 3 404 ? 66.527 40.719  -9.535  1.00 21.57  ? 410  VAL A CB    1 
ATOM   3542 C  CG1   . VAL C 3 404 ? 65.052 40.575  -9.570  1.00 25.04  ? 410  VAL A CG1   1 
ATOM   3543 C  CG2   . VAL C 3 404 ? 66.906 42.189  -9.458  1.00 22.90  ? 410  VAL A CG2   1 
ATOM   3544 N  N     . ALA C 3 405 ? 69.065 38.582  -8.786  1.00 20.28  ? 411  ALA A N     1 
ATOM   3545 C  CA    . ALA C 3 405 ? 70.486 38.297  -8.977  1.00 12.83  ? 411  ALA A CA    1 
ATOM   3546 C  C     . ALA C 3 405 ? 70.939 38.717  -10.381 1.00 15.39  ? 411  ALA A C     1 
ATOM   3547 O  O     . ALA C 3 405 ? 70.119 39.134  -11.203 1.00 16.89  ? 411  ALA A O     1 
ATOM   3548 C  CB    . ALA C 3 405 ? 70.745 36.818  -8.749  1.00 13.58  ? 411  ALA A CB    1 
ATOM   3549 N  N     . GLU C 3 406 ? 72.241 38.615  -10.648 1.00 23.60  ? 412  GLU A N     1 
ATOM   3550 C  CA    . GLU C 3 406 ? 72.800 38.994  -11.948 1.00 37.53  ? 412  GLU A CA    1 
ATOM   3551 C  C     . GLU C 3 406 ? 72.259 38.174  -13.110 1.00 36.56  ? 412  GLU A C     1 
ATOM   3552 O  O     . GLU C 3 406 ? 72.225 38.644  -14.248 1.00 49.53  ? 412  GLU A O     1 
ATOM   3553 C  CB    . GLU C 3 406 ? 74.329 38.907  -11.927 1.00 58.90  ? 412  GLU A CB    1 
ATOM   3554 C  CG    . GLU C 3 406 ? 75.007 39.942  -11.034 1.00 77.04  ? 412  GLU A CG    1 
ATOM   3555 C  CD    . GLU C 3 406 ? 74.715 41.371  -11.461 1.00 80.25  ? 412  GLU A CD    1 
ATOM   3556 O  OE1   . GLU C 3 406 ? 75.305 41.826  -12.466 1.00 84.14  ? 412  GLU A OE1   1 
ATOM   3557 O  OE2   . GLU C 3 406 ? 73.894 42.036  -10.792 1.00 82.28  ? 412  GLU A OE2   1 
ATOM   3558 N  N     . ASP C 3 407 ? 71.829 36.950  -12.818 1.00 29.98  ? 413  ASP A N     1 
ATOM   3559 C  CA    . ASP C 3 407 ? 71.281 36.068  -13.840 1.00 17.92  ? 413  ASP A CA    1 
ATOM   3560 C  C     . ASP C 3 407 ? 69.836 36.416  -14.213 1.00 15.82  ? 413  ASP A C     1 
ATOM   3561 O  O     . ASP C 3 407 ? 69.186 35.670  -14.954 1.00 20.20  ? 413  ASP A O     1 
ATOM   3562 C  CB    . ASP C 3 407 ? 71.393 34.600  -13.391 1.00 21.35  ? 413  ASP A CB    1 
ATOM   3563 C  CG    . ASP C 3 407 ? 70.804 34.347  -11.996 1.00 20.70  ? 413  ASP A CG    1 
ATOM   3564 O  OD1   . ASP C 3 407 ? 69.898 35.079  -11.556 1.00 25.80  ? 413  ASP A OD1   1 
ATOM   3565 O  OD2   . ASP C 3 407 ? 71.255 33.396  -11.333 1.00 24.33  ? 413  ASP A OD2   1 
ATOM   3566 N  N     . GLY C 3 408 ? 69.347 37.546  -13.698 1.00 12.91  ? 414  GLY A N     1 
ATOM   3567 C  CA    . GLY C 3 408 ? 67.990 37.989  -13.968 1.00 9.87   ? 414  GLY A CA    1 
ATOM   3568 C  C     . GLY C 3 408 ? 66.928 37.089  -13.351 1.00 16.32  ? 414  GLY A C     1 
ATOM   3569 O  O     . GLY C 3 408 ? 65.825 36.965  -13.896 1.00 17.38  ? 414  GLY A O     1 
ATOM   3570 N  N     . LYS C 3 409 ? 67.252 36.470  -12.215 1.00 16.31  ? 415  LYS A N     1 
ATOM   3571 C  CA    . LYS C 3 409 ? 66.323 35.564  -11.526 1.00 19.94  ? 415  LYS A CA    1 
ATOM   3572 C  C     . LYS C 3 409 ? 66.278 35.802  -10.022 1.00 12.88  ? 415  LYS A C     1 
ATOM   3573 O  O     . LYS C 3 409 ? 67.255 36.263  -9.431  1.00 11.55  ? 415  LYS A O     1 
ATOM   3574 C  CB    . LYS C 3 409 ? 66.731 34.099  -11.767 1.00 19.72  ? 415  LYS A CB    1 
ATOM   3575 C  CG    . LYS C 3 409 ? 66.659 33.664  -13.210 1.00 19.24  ? 415  LYS A CG    1 
ATOM   3576 C  CD    . LYS C 3 409 ? 67.674 32.588  -13.516 1.00 24.62  ? 415  LYS A CD    1 
ATOM   3577 C  CE    . LYS C 3 409 ? 67.808 32.404  -15.019 1.00 28.28  ? 415  LYS A CE    1 
ATOM   3578 N  NZ    . LYS C 3 409 ? 69.046 31.659  -15.354 1.00 35.93  ? 415  LYS A NZ    1 
ATOM   3579 N  N     . ILE C 3 410 ? 65.131 35.485  -9.422  1.00 8.71   ? 416  ILE A N     1 
ATOM   3580 C  CA    . ILE C 3 410 ? 64.931 35.613  -7.983  1.00 10.10  ? 416  ILE A CA    1 
ATOM   3581 C  C     . ILE C 3 410 ? 65.025 34.199  -7.405  1.00 11.26  ? 416  ILE A C     1 
ATOM   3582 O  O     . ILE C 3 410 ? 64.213 33.324  -7.713  1.00 15.29  ? 416  ILE A O     1 
ATOM   3583 C  CB    . ILE C 3 410 ? 63.555 36.233  -7.637  1.00 12.52  ? 416  ILE A CB    1 
ATOM   3584 C  CG1   . ILE C 3 410 ? 63.518 37.699  -8.075  1.00 10.87  ? 416  ILE A CG1   1 
ATOM   3585 C  CG2   . ILE C 3 410 ? 63.284 36.121  -6.142  1.00 7.46   ? 416  ILE A CG2   1 
ATOM   3586 C  CD1   . ILE C 3 410 ? 62.259 38.421  -7.699  1.00 7.01   ? 416  ILE A CD1   1 
ATOM   3587 N  N     . HIS C 3 411 ? 66.048 33.983  -6.589  1.00 8.78   ? 417  HIS A N     1 
ATOM   3588 C  CA    . HIS C 3 411 ? 66.287 32.694  -5.964  1.00 15.51  ? 417  HIS A CA    1 
ATOM   3589 C  C     . HIS C 3 411 ? 65.690 32.653  -4.559  1.00 12.97  ? 417  HIS A C     1 
ATOM   3590 O  O     . HIS C 3 411 ? 66.411 32.716  -3.564  1.00 18.52  ? 417  HIS A O     1 
ATOM   3591 C  CB    . HIS C 3 411 ? 67.794 32.416  -5.929  1.00 15.18  ? 417  HIS A CB    1 
ATOM   3592 C  CG    . HIS C 3 411 ? 68.464 32.583  -7.257  1.00 15.07  ? 417  HIS A CG    1 
ATOM   3593 N  ND1   . HIS C 3 411 ? 68.869 31.516  -8.030  1.00 13.29  ? 417  HIS A ND1   1 
ATOM   3594 C  CD2   . HIS C 3 411 ? 68.785 33.695  -7.956  1.00 13.08  ? 417  HIS A CD2   1 
ATOM   3595 C  CE1   . HIS C 3 411 ? 69.410 31.962  -9.148  1.00 13.43  ? 417  HIS A CE1   1 
ATOM   3596 N  NE2   . HIS C 3 411 ? 69.372 33.283  -9.127  1.00 16.54  ? 417  HIS A NE2   1 
ATOM   3597 N  N     . GLY C 3 412 ? 64.366 32.566  -4.494  1.00 12.46  ? 418  GLY A N     1 
ATOM   3598 C  CA    . GLY C 3 412 ? 63.680 32.516  -3.215  1.00 13.93  ? 418  GLY A CA    1 
ATOM   3599 C  C     . GLY C 3 412 ? 64.047 31.280  -2.403  1.00 14.74  ? 418  GLY A C     1 
ATOM   3600 O  O     . GLY C 3 412 ? 64.295 30.209  -2.968  1.00 11.95  ? 418  GLY A O     1 
ATOM   3601 N  N     . SER C 3 413 ? 64.129 31.449  -1.083  1.00 10.04  ? 419  SER A N     1 
ATOM   3602 C  CA    . SER C 3 413 ? 64.457 30.355  -0.174  1.00 12.17  ? 419  SER A CA    1 
ATOM   3603 C  C     . SER C 3 413 ? 63.232 29.544  0.161   1.00 2.00   ? 419  SER A C     1 
ATOM   3604 O  O     . SER C 3 413 ? 62.120 30.055  0.153   1.00 7.84   ? 419  SER A O     1 
ATOM   3605 C  CB    . SER C 3 413 ? 65.064 30.870  1.130   1.00 11.64  ? 419  SER A CB    1 
ATOM   3606 O  OG    . SER C 3 413 ? 66.459 31.056  1.002   1.00 28.30  ? 419  SER A OG    1 
ATOM   3607 N  N     . VAL C 3 414 ? 63.453 28.272  0.463   1.00 7.70   ? 420  VAL A N     1 
ATOM   3608 C  CA    . VAL C 3 414 ? 62.375 27.357  0.825   1.00 9.49   ? 420  VAL A CA    1 
ATOM   3609 C  C     . VAL C 3 414 ? 62.843 26.449  1.957   1.00 11.94  ? 420  VAL A C     1 
ATOM   3610 O  O     . VAL C 3 414 ? 63.926 25.869  1.888   1.00 10.26  ? 420  VAL A O     1 
ATOM   3611 C  CB    . VAL C 3 414 ? 61.939 26.440  -0.370  1.00 9.18   ? 420  VAL A CB    1 
ATOM   3612 C  CG1   . VAL C 3 414 ? 60.867 25.451  0.084   1.00 8.64   ? 420  VAL A CG1   1 
ATOM   3613 C  CG2   . VAL C 3 414 ? 61.408 27.276  -1.535  1.00 2.09   ? 420  VAL A CG2   1 
ATOM   3614 N  N     . ASN C 3 415 ? 62.067 26.417  3.037   1.00 12.00  ? 421  ASN A N     1 
ATOM   3615 C  CA    . ASN C 3 415 ? 62.344 25.544  4.172   1.00 7.53   ? 421  ASN A CA    1 
ATOM   3616 C  C     . ASN C 3 415 ? 61.356 24.418  3.852   1.00 6.03   ? 421  ASN A C     1 
ATOM   3617 O  O     . ASN C 3 415 ? 60.160 24.536  4.130   1.00 11.76  ? 421  ASN A O     1 
ATOM   3618 C  CB    . ASN C 3 415 ? 61.981 26.221  5.495   1.00 3.08   ? 421  ASN A CB    1 
ATOM   3619 C  CG    . ASN C 3 415 ? 62.225 25.322  6.695   1.00 10.16  ? 421  ASN A CG    1 
ATOM   3620 O  OD1   . ASN C 3 415 ? 62.054 24.103  6.621   1.00 9.95   ? 421  ASN A OD1   1 
ATOM   3621 N  ND2   . ASN C 3 415 ? 62.624 25.918  7.807   1.00 4.26   ? 421  ASN A ND2   1 
ATOM   3622 N  N     . PRO C 3 416 ? 61.851 23.307  3.277   1.00 4.81   ? 422  PRO A N     1 
ATOM   3623 C  CA    . PRO C 3 416 ? 61.069 22.127  2.878   1.00 4.61   ? 422  PRO A CA    1 
ATOM   3624 C  C     . PRO C 3 416 ? 60.077 21.566  3.898   1.00 12.47  ? 422  PRO A C     1 
ATOM   3625 O  O     . PRO C 3 416 ? 59.078 20.948  3.524   1.00 9.56   ? 422  PRO A O     1 
ATOM   3626 C  CB    . PRO C 3 416 ? 62.150 21.110  2.513   1.00 6.07   ? 422  PRO A CB    1 
ATOM   3627 C  CG    . PRO C 3 416 ? 63.297 21.988  2.062   1.00 7.32   ? 422  PRO A CG    1 
ATOM   3628 C  CD    . PRO C 3 416 ? 63.293 23.018  3.154   1.00 4.03   ? 422  PRO A CD    1 
ATOM   3629 N  N     . ASN C 3 417 ? 60.354 21.769  5.182   1.00 16.18  ? 423  ASN A N     1 
ATOM   3630 C  CA    . ASN C 3 417 ? 59.460 21.273  6.214   1.00 15.62  ? 423  ASN A CA    1 
ATOM   3631 C  C     . ASN C 3 417 ? 59.329 22.329  7.304   1.00 18.98  ? 423  ASN A C     1 
ATOM   3632 O  O     . ASN C 3 417 ? 59.407 22.028  8.492   1.00 19.44  ? 423  ASN A O     1 
ATOM   3633 C  CB    . ASN C 3 417 ? 59.998 19.959  6.781   1.00 8.27   ? 423  ASN A CB    1 
ATOM   3634 C  CG    . ASN C 3 417 ? 58.921 19.128  7.446   1.00 11.03  ? 423  ASN A CG    1 
ATOM   3635 O  OD1   . ASN C 3 417 ? 57.864 18.878  6.867   1.00 9.82   ? 423  ASN A OD1   1 
ATOM   3636 N  ND2   . ASN C 3 417 ? 59.178 18.708  8.673   1.00 12.35  ? 423  ASN A ND2   1 
ATOM   3637 N  N     . GLY C 3 418 ? 59.108 23.569  6.873   1.00 14.42  ? 424  GLY A N     1 
ATOM   3638 C  CA    . GLY C 3 418 ? 58.970 24.682  7.795   1.00 9.45   ? 424  GLY A CA    1 
ATOM   3639 C  C     . GLY C 3 418 ? 57.706 24.715  8.630   1.00 11.30  ? 424  GLY A C     1 
ATOM   3640 O  O     . GLY C 3 418 ? 57.744 25.200  9.758   1.00 12.90  ? 424  GLY A O     1 
ATOM   3641 N  N     . ALA C 3 419 ? 56.588 24.250  8.072   1.00 12.13  ? 425  ALA A N     1 
ATOM   3642 C  CA    . ALA C 3 419 ? 55.312 24.236  8.791   1.00 10.42  ? 425  ALA A CA    1 
ATOM   3643 C  C     . ALA C 3 419 ? 55.183 22.980  9.635   1.00 11.42  ? 425  ALA A C     1 
ATOM   3644 O  O     . ALA C 3 419 ? 55.697 21.925  9.261   1.00 11.20  ? 425  ALA A O     1 
ATOM   3645 C  CB    . ALA C 3 419 ? 54.141 24.334  7.813   1.00 10.00  ? 425  ALA A CB    1 
ATOM   3646 N  N     . VAL C 3 420 ? 54.486 23.092  10.767  1.00 12.06  ? 426  VAL A N     1 
ATOM   3647 C  CA    . VAL C 3 420 ? 54.292 21.951  11.670  1.00 14.68  ? 426  VAL A CA    1 
ATOM   3648 C  C     . VAL C 3 420 ? 53.587 20.774  11.004  1.00 11.53  ? 426  VAL A C     1 
ATOM   3649 O  O     . VAL C 3 420 ? 53.856 19.621  11.328  1.00 13.52  ? 426  VAL A O     1 
ATOM   3650 C  CB    . VAL C 3 420 ? 53.509 22.343  12.962  1.00 11.65  ? 426  VAL A CB    1 
ATOM   3651 C  CG1   . VAL C 3 420 ? 54.385 23.187  13.848  1.00 25.35  ? 426  VAL A CG1   1 
ATOM   3652 C  CG2   . VAL C 3 420 ? 52.226 23.102  12.621  1.00 10.64  ? 426  VAL A CG2   1 
ATOM   3653 N  N     . THR C 3 421 ? 52.705 21.085  10.057  1.00 15.23  ? 427  THR A N     1 
ATOM   3654 C  CA    . THR C 3 421 ? 51.932 20.087  9.324   1.00 12.05  ? 427  THR A CA    1 
ATOM   3655 C  C     . THR C 3 421 ? 52.732 19.329  8.263   1.00 5.66   ? 427  THR A C     1 
ATOM   3656 O  O     . THR C 3 421 ? 52.280 18.306  7.746   1.00 10.89  ? 427  THR A O     1 
ATOM   3657 C  CB    . THR C 3 421 ? 50.721 20.738  8.644   1.00 10.14  ? 427  THR A CB    1 
ATOM   3658 O  OG1   . THR C 3 421 ? 51.170 21.789  7.777   1.00 5.31   ? 427  THR A OG1   1 
ATOM   3659 C  CG2   . THR C 3 421 ? 49.761 21.312  9.689   1.00 7.08   ? 427  THR A CG2   1 
ATOM   3660 N  N     . GLY C 3 422 ? 53.935 19.800  7.970   1.00 4.65   ? 428  GLY A N     1 
ATOM   3661 C  CA    . GLY C 3 422 ? 54.733 19.146  6.955   1.00 5.99   ? 428  GLY A CA    1 
ATOM   3662 C  C     . GLY C 3 422 ? 54.803 19.989  5.691   1.00 12.95  ? 428  GLY A C     1 
ATOM   3663 O  O     . GLY C 3 422 ? 55.439 19.585  4.717   1.00 15.82  ? 428  GLY A O     1 
ATOM   3664 N  N     . ARG C 3 423 ? 54.113 21.130  5.681   1.00 9.98   ? 429  ARG A N     1 
ATOM   3665 C  CA    . ARG C 3 423 ? 54.151 22.041  4.536   1.00 8.12   ? 429  ARG A CA    1 
ATOM   3666 C  C     . ARG C 3 423 ? 55.508 22.733  4.571   1.00 8.02   ? 429  ARG A C     1 
ATOM   3667 O  O     . ARG C 3 423 ? 56.233 22.667  5.572   1.00 4.09   ? 429  ARG A O     1 
ATOM   3668 C  CB    . ARG C 3 423 ? 53.080 23.144  4.636   1.00 7.94   ? 429  ARG A CB    1 
ATOM   3669 C  CG    . ARG C 3 423 ? 51.733 22.854  4.006   1.00 9.70   ? 429  ARG A CG    1 
ATOM   3670 C  CD    . ARG C 3 423 ? 50.876 24.126  3.985   1.00 9.00   ? 429  ARG A CD    1 
ATOM   3671 N  NE    . ARG C 3 423 ? 49.614 23.950  3.260   1.00 5.84   ? 429  ARG A NE    1 
ATOM   3672 C  CZ    . ARG C 3 423 ? 48.799 24.941  2.897   1.00 9.27   ? 429  ARG A CZ    1 
ATOM   3673 N  NH1   . ARG C 3 423 ? 49.092 26.207  3.180   1.00 5.60   ? 429  ARG A NH1   1 
ATOM   3674 N  NH2   . ARG C 3 423 ? 47.672 24.664  2.256   1.00 9.88   ? 429  ARG A NH2   1 
ATOM   3675 N  N     . ALA C 3 424 ? 55.841 23.415  3.483   1.00 11.06  ? 430  ALA A N     1 
ATOM   3676 C  CA    . ALA C 3 424 ? 57.093 24.147  3.405   1.00 7.25   ? 430  ALA A CA    1 
ATOM   3677 C  C     . ALA C 3 424 ? 56.797 25.609  3.684   1.00 7.07   ? 430  ALA A C     1 
ATOM   3678 O  O     . ALA C 3 424 ? 55.641 26.024  3.693   1.00 5.23   ? 430  ALA A O     1 
ATOM   3679 C  CB    . ALA C 3 424 ? 57.706 24.002  2.008   1.00 2.53   ? 430  ALA A CB    1 
ATOM   3680 N  N     . THR C 3 425 ? 57.841 26.374  3.978   1.00 5.65   ? 431  THR A N     1 
ATOM   3681 C  CA    . THR C 3 425 ? 57.696 27.806  4.201   1.00 8.57   ? 431  THR A CA    1 
ATOM   3682 C  C     . THR C 3 425 ? 58.595 28.397  3.131   1.00 7.43   ? 431  THR A C     1 
ATOM   3683 O  O     . THR C 3 425 ? 59.538 27.742  2.675   1.00 3.60   ? 431  THR A O     1 
ATOM   3684 C  CB    . THR C 3 425 ? 58.144 28.254  5.598   1.00 7.37   ? 431  THR A CB    1 
ATOM   3685 O  OG1   . THR C 3 425 ? 59.518 27.910  5.804   1.00 3.34   ? 431  THR A OG1   1 
ATOM   3686 C  CG2   . THR C 3 425 ? 57.260 27.612  6.663   1.00 9.15   ? 431  THR A CG2   1 
ATOM   3687 N  N     . HIS C 3 426 ? 58.291 29.618  2.709   1.00 11.44  ? 432  HIS A N     1 
ATOM   3688 C  CA    . HIS C 3 426 ? 59.055 30.281  1.654   1.00 7.35   ? 432  HIS A CA    1 
ATOM   3689 C  C     . HIS C 3 426 ? 59.401 31.697  2.100   1.00 10.95  ? 432  HIS A C     1 
ATOM   3690 O  O     . HIS C 3 426 ? 58.564 32.387  2.683   1.00 8.81   ? 432  HIS A O     1 
ATOM   3691 C  CB    . HIS C 3 426 ? 58.210 30.297  0.376   1.00 6.99   ? 432  HIS A CB    1 
ATOM   3692 C  CG    . HIS C 3 426 ? 57.524 28.990  0.091   1.00 6.64   ? 432  HIS A CG    1 
ATOM   3693 N  ND1   . HIS C 3 426 ? 56.344 28.621  0.701   1.00 9.17   ? 432  HIS A ND1   1 
ATOM   3694 C  CD2   . HIS C 3 426 ? 57.850 27.969  -0.738  1.00 13.07  ? 432  HIS A CD2   1 
ATOM   3695 C  CE1   . HIS C 3 426 ? 55.972 27.431  0.263   1.00 6.06   ? 432  HIS A CE1   1 
ATOM   3696 N  NE2   . HIS C 3 426 ? 56.868 27.013  -0.612  1.00 8.22   ? 432  HIS A NE2   1 
ATOM   3697 N  N     . ALA C 3 427 ? 60.637 32.123  1.849   1.00 8.21   ? 433  ALA A N     1 
ATOM   3698 C  CA    . ALA C 3 427 ? 61.074 33.457  2.247   1.00 13.01  ? 433  ALA A CA    1 
ATOM   3699 C  C     . ALA C 3 427 ? 62.280 33.977  1.461   1.00 10.68  ? 433  ALA A C     1 
ATOM   3700 O  O     . ALA C 3 427 ? 62.936 33.235  0.733   1.00 14.66  ? 433  ALA A O     1 
ATOM   3701 C  CB    . ALA C 3 427 ? 61.385 33.477  3.761   1.00 8.53   ? 433  ALA A CB    1 
ATOM   3702 N  N     . PHE C 3 428 ? 62.542 35.273  1.621   1.00 7.70   ? 434  PHE A N     1 
ATOM   3703 C  CA    . PHE C 3 428 ? 63.650 35.976  0.983   1.00 12.24  ? 434  PHE A CA    1 
ATOM   3704 C  C     . PHE C 3 428 ? 63.723 35.966  -0.554  1.00 13.64  ? 434  PHE A C     1 
ATOM   3705 O  O     . PHE C 3 428 ? 64.738 35.562  -1.120  1.00 15.01  ? 434  PHE A O     1 
ATOM   3706 C  CB    . PHE C 3 428 ? 64.985 35.459  1.541   1.00 11.14  ? 434  PHE A CB    1 
ATOM   3707 C  CG    . PHE C 3 428 ? 64.977 35.220  3.021   1.00 16.18  ? 434  PHE A CG    1 
ATOM   3708 C  CD1   . PHE C 3 428 ? 64.580 36.217  3.907   1.00 19.46  ? 434  PHE A CD1   1 
ATOM   3709 C  CD2   . PHE C 3 428 ? 65.382 33.985  3.532   1.00 15.93  ? 434  PHE A CD2   1 
ATOM   3710 C  CE1   . PHE C 3 428 ? 64.572 35.981  5.288   1.00 16.97  ? 434  PHE A CE1   1 
ATOM   3711 C  CE2   . PHE C 3 428 ? 65.377 33.737  4.905   1.00 12.74  ? 434  PHE A CE2   1 
ATOM   3712 C  CZ    . PHE C 3 428 ? 64.981 34.739  5.783   1.00 15.86  ? 434  PHE A CZ    1 
ATOM   3713 N  N     . PRO C 3 429 ? 62.635 36.348  -1.254  1.00 13.76  ? 435  PRO A N     1 
ATOM   3714 C  CA    . PRO C 3 429 ? 61.339 36.776  -0.729  1.00 9.14   ? 435  PRO A CA    1 
ATOM   3715 C  C     . PRO C 3 429 ? 60.399 35.570  -0.752  1.00 9.82   ? 435  PRO A C     1 
ATOM   3716 O  O     . PRO C 3 429 ? 60.755 34.507  -1.269  1.00 9.35   ? 435  PRO A O     1 
ATOM   3717 C  CB    . PRO C 3 429 ? 60.915 37.838  -1.737  1.00 15.02  ? 435  PRO A CB    1 
ATOM   3718 C  CG    . PRO C 3 429 ? 61.363 37.230  -3.028  1.00 12.48  ? 435  PRO A CG    1 
ATOM   3719 C  CD    . PRO C 3 429 ? 62.749 36.700  -2.685  1.00 12.20  ? 435  PRO A CD    1 
ATOM   3720 N  N     . ASN C 3 430 ? 59.208 35.729  -0.185  1.00 3.00   ? 436  ASN A N     1 
ATOM   3721 C  CA    . ASN C 3 430 ? 58.234 34.650  -0.163  1.00 8.77   ? 436  ASN A CA    1 
ATOM   3722 C  C     . ASN C 3 430 ? 57.555 34.556  -1.544  1.00 14.07  ? 436  ASN A C     1 
ATOM   3723 O  O     . ASN C 3 430 ? 56.689 35.379  -1.888  1.00 8.45   ? 436  ASN A O     1 
ATOM   3724 C  CB    . ASN C 3 430 ? 57.215 34.906  0.955   1.00 4.82   ? 436  ASN A CB    1 
ATOM   3725 C  CG    . ASN C 3 430 ? 56.167 33.825  1.056   1.00 9.26   ? 436  ASN A CG    1 
ATOM   3726 O  OD1   . ASN C 3 430 ? 56.246 32.798  0.384   1.00 14.34  ? 436  ASN A OD1   1 
ATOM   3727 N  ND2   . ASN C 3 430 ? 55.164 34.053  1.897   1.00 12.11  ? 436  ASN A ND2   1 
ATOM   3728 N  N     . LEU C 3 431 ? 57.984 33.574  -2.345  1.00 8.67   ? 437  LEU A N     1 
ATOM   3729 C  CA    . LEU C 3 431 ? 57.413 33.373  -3.678  1.00 9.37   ? 437  LEU A CA    1 
ATOM   3730 C  C     . LEU C 3 431 ? 56.032 32.702  -3.641  1.00 12.27  ? 437  LEU A C     1 
ATOM   3731 O  O     . LEU C 3 431 ? 55.374 32.540  -4.674  1.00 6.54   ? 437  LEU A O     1 
ATOM   3732 C  CB    . LEU C 3 431 ? 58.385 32.606  -4.587  1.00 11.02  ? 437  LEU A CB    1 
ATOM   3733 C  CG    . LEU C 3 431 ? 59.713 33.327  -4.887  1.00 11.80  ? 437  LEU A CG    1 
ATOM   3734 C  CD1   . LEU C 3 431 ? 60.496 32.573  -5.961  1.00 15.11  ? 437  LEU A CD1   1 
ATOM   3735 C  CD2   . LEU C 3 431 ? 59.449 34.760  -5.354  1.00 9.94   ? 437  LEU A CD2   1 
ATOM   3736 N  N     . ALA C 3 432 ? 55.590 32.348  -2.431  1.00 13.01  ? 438  ALA A N     1 
ATOM   3737 C  CA    . ALA C 3 432 ? 54.287 31.725  -2.217  1.00 6.48   ? 438  ALA A CA    1 
ATOM   3738 C  C     . ALA C 3 432 ? 53.204 32.752  -1.803  1.00 10.27  ? 438  ALA A C     1 
ATOM   3739 O  O     . ALA C 3 432 ? 52.092 32.373  -1.432  1.00 14.79  ? 438  ALA A O     1 
ATOM   3740 C  CB    . ALA C 3 432 ? 54.405 30.602  -1.183  1.00 4.28   ? 438  ALA A CB    1 
ATOM   3741 N  N     . GLN C 3 433 ? 53.526 34.045  -1.856  1.00 9.89   ? 439  GLN A N     1 
ATOM   3742 C  CA    . GLN C 3 433 ? 52.548 35.077  -1.512  1.00 14.18  ? 439  GLN A CA    1 
ATOM   3743 C  C     . GLN C 3 433 ? 52.454 36.164  -2.600  1.00 17.46  ? 439  GLN A C     1 
ATOM   3744 O  O     . GLN C 3 433 ? 52.100 37.308  -2.315  1.00 13.59  ? 439  GLN A O     1 
ATOM   3745 C  CB    . GLN C 3 433 ? 52.847 35.710  -0.152  1.00 7.56   ? 439  GLN A CB    1 
ATOM   3746 C  CG    . GLN C 3 433 ? 54.065 36.628  -0.123  1.00 8.25   ? 439  GLN A CG    1 
ATOM   3747 C  CD    . GLN C 3 433 ? 54.384 37.163  1.263   1.00 8.79   ? 439  GLN A CD    1 
ATOM   3748 O  OE1   . GLN C 3 433 ? 55.511 37.569  1.523   1.00 15.31  ? 439  GLN A OE1   1 
ATOM   3749 N  NE2   . GLN C 3 433 ? 53.396 37.170  2.155   1.00 10.04  ? 439  GLN A NE2   1 
ATOM   3750 N  N     . ILE C 3 434 ? 52.776 35.802  -3.843  1.00 13.47  ? 440  ILE A N     1 
ATOM   3751 C  CA    . ILE C 3 434 ? 52.701 36.749  -4.963  1.00 13.71  ? 440  ILE A CA    1 
ATOM   3752 C  C     . ILE C 3 434 ? 51.213 37.053  -5.169  1.00 5.95   ? 440  ILE A C     1 
ATOM   3753 O  O     . ILE C 3 434 ? 50.383 36.146  -5.097  1.00 11.23  ? 440  ILE A O     1 
ATOM   3754 C  CB    . ILE C 3 434 ? 53.288 36.134  -6.275  1.00 13.11  ? 440  ILE A CB    1 
ATOM   3755 C  CG1   . ILE C 3 434 ? 54.725 35.654  -6.047  1.00 7.92   ? 440  ILE A CG1   1 
ATOM   3756 C  CG2   . ILE C 3 434 ? 53.260 37.155  -7.413  1.00 17.36  ? 440  ILE A CG2   1 
ATOM   3757 C  CD1   . ILE C 3 434 ? 55.684 36.728  -5.647  1.00 5.09   ? 440  ILE A CD1   1 
ATOM   3758 N  N     . PRO C 3 435 ? 50.849 38.331  -5.398  1.00 12.20  ? 441  PRO A N     1 
ATOM   3759 C  CA    . PRO C 3 435 ? 49.433 38.673  -5.600  1.00 10.01  ? 441  PRO A CA    1 
ATOM   3760 C  C     . PRO C 3 435 ? 48.784 37.915  -6.766  1.00 10.57  ? 441  PRO A C     1 
ATOM   3761 O  O     . PRO C 3 435 ? 49.375 37.778  -7.839  1.00 14.19  ? 441  PRO A O     1 
ATOM   3762 C  CB    . PRO C 3 435 ? 49.480 40.179  -5.860  1.00 11.05  ? 441  PRO A CB    1 
ATOM   3763 C  CG    . PRO C 3 435 ? 50.678 40.619  -5.076  1.00 11.35  ? 441  PRO A CG    1 
ATOM   3764 C  CD    . PRO C 3 435 ? 51.686 39.548  -5.426  1.00 7.86   ? 441  PRO A CD    1 
ATOM   3765 N  N     . GLY C 3 436 ? 47.572 37.419  -6.535  1.00 10.82  ? 442  GLY A N     1 
ATOM   3766 C  CA    . GLY C 3 436 ? 46.837 36.678  -7.551  1.00 8.59   ? 442  GLY A CA    1 
ATOM   3767 C  C     . GLY C 3 436 ? 46.423 37.543  -8.725  1.00 11.07  ? 442  GLY A C     1 
ATOM   3768 O  O     . GLY C 3 436 ? 46.125 38.718  -8.541  1.00 12.87  ? 442  GLY A O     1 
ATOM   3769 N  N     . VAL C 3 437 ? 46.381 36.961  -9.922  1.00 14.15  ? 443  VAL A N     1 
ATOM   3770 C  CA    . VAL C 3 437 ? 46.009 37.688  -11.142 1.00 19.71  ? 443  VAL A CA    1 
ATOM   3771 C  C     . VAL C 3 437 ? 44.679 38.425  -11.108 1.00 18.83  ? 443  VAL A C     1 
ATOM   3772 O  O     . VAL C 3 437 ? 44.482 39.383  -11.852 1.00 26.78  ? 443  VAL A O     1 
ATOM   3773 C  CB    . VAL C 3 437 ? 45.993 36.766  -12.392 1.00 19.28  ? 443  VAL A CB    1 
ATOM   3774 C  CG1   . VAL C 3 437 ? 47.387 36.291  -12.694 1.00 29.76  ? 443  VAL A CG1   1 
ATOM   3775 C  CG2   . VAL C 3 437 ? 45.048 35.579  -12.185 1.00 23.31  ? 443  VAL A CG2   1 
ATOM   3776 N  N     . ARG C 3 438 ? 43.771 37.993  -10.240 1.00 18.90  ? 444  ARG A N     1 
ATOM   3777 C  CA    . ARG C 3 438 ? 42.463 38.625  -10.155 1.00 25.80  ? 444  ARG A CA    1 
ATOM   3778 C  C     . ARG C 3 438 ? 42.358 39.733  -9.110  1.00 23.93  ? 444  ARG A C     1 
ATOM   3779 O  O     . ARG C 3 438 ? 41.257 40.196  -8.811  1.00 28.32  ? 444  ARG A O     1 
ATOM   3780 C  CB    . ARG C 3 438 ? 41.391 37.560  -9.934  1.00 31.14  ? 444  ARG A CB    1 
ATOM   3781 C  CG    . ARG C 3 438 ? 41.444 36.436  -10.957 1.00 36.04  ? 444  ARG A CG    1 
ATOM   3782 C  CD    . ARG C 3 438 ? 40.455 35.353  -10.610 1.00 40.54  ? 444  ARG A CD    1 
ATOM   3783 N  NE    . ARG C 3 438 ? 40.766 34.076  -11.242 1.00 32.79  ? 444  ARG A NE    1 
ATOM   3784 C  CZ    . ARG C 3 438 ? 41.691 33.230  -10.801 1.00 30.61  ? 444  ARG A CZ    1 
ATOM   3785 N  NH1   . ARG C 3 438 ? 42.406 33.522  -9.726  1.00 34.60  ? 444  ARG A NH1   1 
ATOM   3786 N  NH2   . ARG C 3 438 ? 41.886 32.075  -11.418 1.00 39.26  ? 444  ARG A NH2   1 
ATOM   3787 N  N     . SER C 3 439 ? 43.496 40.145  -8.550  1.00 19.75  ? 445  SER A N     1 
ATOM   3788 C  CA    . SER C 3 439 ? 43.523 41.223  -7.556  1.00 16.71  ? 445  SER A CA    1 
ATOM   3789 C  C     . SER C 3 439 ? 44.157 42.432  -8.258  1.00 13.67  ? 445  SER A C     1 
ATOM   3790 O  O     . SER C 3 439 ? 44.769 42.276  -9.313  1.00 16.38  ? 445  SER A O     1 
ATOM   3791 C  CB    . SER C 3 439 ? 44.340 40.814  -6.320  1.00 8.72   ? 445  SER A CB    1 
ATOM   3792 O  OG    . SER C 3 439 ? 45.729 40.816  -6.580  1.00 9.20   ? 445  SER A OG    1 
ATOM   3793 N  N     . PRO C 3 440 ? 44.004 43.648  -7.698  1.00 21.17  ? 446  PRO A N     1 
ATOM   3794 C  CA    . PRO C 3 440 ? 44.587 44.844  -8.323  1.00 15.78  ? 446  PRO A CA    1 
ATOM   3795 C  C     . PRO C 3 440 ? 46.078 44.689  -8.601  1.00 14.20  ? 446  PRO A C     1 
ATOM   3796 O  O     . PRO C 3 440 ? 46.840 44.300  -7.715  1.00 13.88  ? 446  PRO A O     1 
ATOM   3797 C  CB    . PRO C 3 440 ? 44.306 45.934  -7.290  1.00 16.91  ? 446  PRO A CB    1 
ATOM   3798 C  CG    . PRO C 3 440 ? 42.983 45.514  -6.744  1.00 18.56  ? 446  PRO A CG    1 
ATOM   3799 C  CD    . PRO C 3 440 ? 43.215 44.027  -6.509  1.00 19.19  ? 446  PRO A CD    1 
ATOM   3800 N  N     . TYR C 3 441 ? 46.468 44.965  -9.846  1.00 13.40  ? 447  TYR A N     1 
ATOM   3801 C  CA    . TYR C 3 441 ? 47.859 44.868  -10.304 1.00 16.42  ? 447  TYR A CA    1 
ATOM   3802 C  C     . TYR C 3 441 ? 48.433 43.451  -10.207 1.00 14.33  ? 447  TYR A C     1 
ATOM   3803 O  O     . TYR C 3 441 ? 49.641 43.250  -10.344 1.00 14.95  ? 447  TYR A O     1 
ATOM   3804 C  CB    . TYR C 3 441 ? 48.748 45.844  -9.524  1.00 18.26  ? 447  TYR A CB    1 
ATOM   3805 C  CG    . TYR C 3 441 ? 48.366 47.300  -9.690  1.00 28.10  ? 447  TYR A CG    1 
ATOM   3806 C  CD1   . TYR C 3 441 ? 48.894 48.064  -10.732 1.00 31.76  ? 447  TYR A CD1   1 
ATOM   3807 C  CD2   . TYR C 3 441 ? 47.492 47.919  -8.797  1.00 18.60  ? 447  TYR A CD2   1 
ATOM   3808 C  CE1   . TYR C 3 441 ? 48.568 49.408  -10.877 1.00 25.07  ? 447  TYR A CE1   1 
ATOM   3809 C  CE2   . TYR C 3 441 ? 47.160 49.262  -8.933  1.00 27.23  ? 447  TYR A CE2   1 
ATOM   3810 C  CZ    . TYR C 3 441 ? 47.702 50.001  -9.976  1.00 23.54  ? 447  TYR A CZ    1 
ATOM   3811 O  OH    . TYR C 3 441 ? 47.385 51.338  -10.109 1.00 38.53  ? 447  TYR A OH    1 
ATOM   3812 N  N     . GLY C 3 442 ? 47.554 42.472  -9.996  1.00 18.78  ? 448  GLY A N     1 
ATOM   3813 C  CA    . GLY C 3 442 ? 47.981 41.091  -9.876  1.00 3.87   ? 448  GLY A CA    1 
ATOM   3814 C  C     . GLY C 3 442 ? 48.494 40.491  -11.166 1.00 7.38   ? 448  GLY A C     1 
ATOM   3815 O  O     . GLY C 3 442 ? 49.411 39.679  -11.138 1.00 14.76  ? 448  GLY A O     1 
ATOM   3816 N  N     . GLU C 3 443 ? 47.911 40.877  -12.299 1.00 12.16  ? 449  GLU A N     1 
ATOM   3817 C  CA    . GLU C 3 443 ? 48.341 40.342  -13.586 1.00 17.77  ? 449  GLU A CA    1 
ATOM   3818 C  C     . GLU C 3 443 ? 49.739 40.814  -13.934 1.00 20.76  ? 449  GLU A C     1 
ATOM   3819 O  O     . GLU C 3 443 ? 50.546 40.038  -14.445 1.00 29.27  ? 449  GLU A O     1 
ATOM   3820 C  CB    . GLU C 3 443 ? 47.345 40.696  -14.696 1.00 35.75  ? 449  GLU A CB    1 
ATOM   3821 C  CG    . GLU C 3 443 ? 45.963 40.106  -14.433 1.00 58.14  ? 449  GLU A CG    1 
ATOM   3822 C  CD    . GLU C 3 443 ? 45.029 40.111  -15.634 1.00 71.00  ? 449  GLU A CD    1 
ATOM   3823 O  OE1   . GLU C 3 443 ? 45.154 40.997  -16.508 1.00 69.62  ? 449  GLU A OE1   1 
ATOM   3824 O  OE2   . GLU C 3 443 ? 44.153 39.216  -15.692 1.00 64.23  ? 449  GLU A OE2   1 
ATOM   3825 N  N     . GLN C 3 444 ? 50.037 42.075  -13.625 1.00 14.79  ? 450  GLN A N     1 
ATOM   3826 C  CA    . GLN C 3 444 ? 51.359 42.633  -13.893 1.00 12.47  ? 450  GLN A CA    1 
ATOM   3827 C  C     . GLN C 3 444 ? 52.407 41.982  -13.001 1.00 8.73   ? 450  GLN A C     1 
ATOM   3828 O  O     . GLN C 3 444 ? 53.496 41.654  -13.461 1.00 13.74  ? 450  GLN A O     1 
ATOM   3829 C  CB    . GLN C 3 444 ? 51.357 44.155  -13.696 1.00 22.91  ? 450  GLN A CB    1 
ATOM   3830 C  CG    . GLN C 3 444 ? 50.780 44.931  -14.876 1.00 28.29  ? 450  GLN A CG    1 
ATOM   3831 C  CD    . GLN C 3 444 ? 50.377 46.339  -14.502 1.00 31.13  ? 450  GLN A CD    1 
ATOM   3832 O  OE1   . GLN C 3 444 ? 49.277 46.556  -14.001 1.00 27.54  ? 450  GLN A OE1   1 
ATOM   3833 N  NE2   . GLN C 3 444 ? 51.263 47.302  -14.735 1.00 28.01  ? 450  GLN A NE2   1 
ATOM   3834 N  N     . CYS C 3 445 ? 52.065 41.770  -11.732 1.00 9.02   ? 451  CYS A N     1 
ATOM   3835 C  CA    . CYS C 3 445 ? 52.984 41.148  -10.774 1.00 8.69   ? 451  CYS A CA    1 
ATOM   3836 C  C     . CYS C 3 445 ? 53.319 39.718  -11.178 1.00 9.31   ? 451  CYS A C     1 
ATOM   3837 O  O     . CYS C 3 445 ? 54.482 39.321  -11.238 1.00 15.58  ? 451  CYS A O     1 
ATOM   3838 C  CB    . CYS C 3 445 ? 52.351 41.105  -9.381  1.00 16.41  ? 451  CYS A CB    1 
ATOM   3839 S  SG    . CYS C 3 445 ? 52.023 42.702  -8.624  1.00 14.49  ? 451  CYS A SG    1 
ATOM   3840 N  N     . ARG C 3 446 ? 52.269 38.965  -11.477 1.00 7.56   ? 452  ARG A N     1 
ATOM   3841 C  CA    . ARG C 3 446 ? 52.359 37.570  -11.856 1.00 6.76   ? 452  ARG A CA    1 
ATOM   3842 C  C     . ARG C 3 446 ? 53.052 37.348  -13.209 1.00 12.99  ? 452  ARG A C     1 
ATOM   3843 O  O     . ARG C 3 446 ? 53.789 36.371  -13.375 1.00 14.83  ? 452  ARG A O     1 
ATOM   3844 C  CB    . ARG C 3 446 ? 50.943 36.996  -11.873 1.00 9.56   ? 452  ARG A CB    1 
ATOM   3845 C  CG    . ARG C 3 446 ? 50.788 35.613  -11.290 1.00 22.17  ? 452  ARG A CG    1 
ATOM   3846 C  CD    . ARG C 3 446 ? 50.738 35.562  -9.763  1.00 10.94  ? 452  ARG A CD    1 
ATOM   3847 N  NE    . ARG C 3 446 ? 50.554 34.168  -9.373  1.00 22.54  ? 452  ARG A NE    1 
ATOM   3848 C  CZ    . ARG C 3 446 ? 50.217 33.719  -8.171  1.00 13.33  ? 452  ARG A CZ    1 
ATOM   3849 N  NH1   . ARG C 3 446 ? 50.015 34.535  -7.155  1.00 21.09  ? 452  ARG A NH1   1 
ATOM   3850 N  NH2   . ARG C 3 446 ? 50.050 32.427  -8.008  1.00 17.65  ? 452  ARG A NH2   1 
ATOM   3851 N  N     . ALA C 3 447 ? 52.832 38.257  -14.163 1.00 13.34  ? 453  ALA A N     1 
ATOM   3852 C  CA    . ALA C 3 447 ? 53.434 38.155  -15.498 1.00 12.49  ? 453  ALA A CA    1 
ATOM   3853 C  C     . ALA C 3 447 ? 54.950 38.340  -15.467 1.00 13.53  ? 453  ALA A C     1 
ATOM   3854 O  O     . ALA C 3 447 ? 55.659 37.812  -16.329 1.00 14.27  ? 453  ALA A O     1 
ATOM   3855 C  CB    . ALA C 3 447 ? 52.798 39.165  -16.455 1.00 13.44  ? 453  ALA A CB    1 
ATOM   3856 N  N     . ALA C 3 448 ? 55.432 39.080  -14.465 1.00 9.87   ? 454  ALA A N     1 
ATOM   3857 C  CA    . ALA C 3 448 ? 56.862 39.348  -14.276 1.00 10.56  ? 454  ALA A CA    1 
ATOM   3858 C  C     . ALA C 3 448 ? 57.668 38.106  -13.903 1.00 7.38   ? 454  ALA A C     1 
ATOM   3859 O  O     . ALA C 3 448 ? 58.892 38.106  -14.000 1.00 8.42   ? 454  ALA A O     1 
ATOM   3860 C  CB    . ALA C 3 448 ? 57.056 40.420  -13.218 1.00 11.53  ? 454  ALA A CB    1 
ATOM   3861 N  N     . PHE C 3 449 ? 56.976 37.082  -13.406 1.00 7.78   ? 455  PHE A N     1 
ATOM   3862 C  CA    . PHE C 3 449 ? 57.592 35.812  -13.026 1.00 8.14   ? 455  PHE A CA    1 
ATOM   3863 C  C     . PHE C 3 449 ? 57.227 34.847  -14.145 1.00 8.39   ? 455  PHE A C     1 
ATOM   3864 O  O     . PHE C 3 449 ? 56.077 34.422  -14.245 1.00 11.56  ? 455  PHE A O     1 
ATOM   3865 C  CB    . PHE C 3 449 ? 57.010 35.295  -11.701 1.00 11.85  ? 455  PHE A CB    1 
ATOM   3866 C  CG    . PHE C 3 449 ? 57.432 36.087  -10.501 1.00 8.26   ? 455  PHE A CG    1 
ATOM   3867 C  CD1   . PHE C 3 449 ? 56.733 37.234  -10.126 1.00 10.81  ? 455  PHE A CD1   1 
ATOM   3868 C  CD2   . PHE C 3 449 ? 58.550 35.704  -9.760  1.00 5.19   ? 455  PHE A CD2   1 
ATOM   3869 C  CE1   . PHE C 3 449 ? 57.147 37.997  -9.029  1.00 11.78  ? 455  PHE A CE1   1 
ATOM   3870 C  CE2   . PHE C 3 449 ? 58.974 36.456  -8.663  1.00 10.78  ? 455  PHE A CE2   1 
ATOM   3871 C  CZ    . PHE C 3 449 ? 58.268 37.610  -8.297  1.00 7.58   ? 455  PHE A CZ    1 
ATOM   3872 N  N     . GLY C 3 450 ? 58.186 34.517  -15.001 1.00 9.73   ? 456  GLY A N     1 
ATOM   3873 C  CA    . GLY C 3 450 ? 57.866 33.613  -16.086 1.00 9.40   ? 456  GLY A CA    1 
ATOM   3874 C  C     . GLY C 3 450 ? 59.052 33.034  -16.808 1.00 9.31   ? 456  GLY A C     1 
ATOM   3875 O  O     . GLY C 3 450 ? 60.123 33.641  -16.855 1.00 5.59   ? 456  GLY A O     1 
ATOM   3876 N  N     . ALA C 3 451 ? 58.846 31.847  -17.372 1.00 13.82  ? 457  ALA A N     1 
ATOM   3877 C  CA    . ALA C 3 451 ? 59.891 31.150  -18.112 1.00 10.80  ? 457  ALA A CA    1 
ATOM   3878 C  C     . ALA C 3 451 ? 60.289 31.952  -19.345 1.00 10.17  ? 457  ALA A C     1 
ATOM   3879 O  O     . ALA C 3 451 ? 61.432 31.881  -19.788 1.00 18.17  ? 457  ALA A O     1 
ATOM   3880 C  CB    . ALA C 3 451 ? 59.421 29.764  -18.510 1.00 7.19   ? 457  ALA A CB    1 
ATOM   3881 N  N     . GLU C 3 452 ? 59.347 32.734  -19.871 1.00 9.21   ? 458  GLU A N     1 
ATOM   3882 C  CA    . GLU C 3 452 ? 59.583 33.566  -21.051 1.00 13.70  ? 458  GLU A CA    1 
ATOM   3883 C  C     . GLU C 3 452 ? 60.708 34.572  -20.797 1.00 15.88  ? 458  GLU A C     1 
ATOM   3884 O  O     . GLU C 3 452 ? 61.401 34.981  -21.731 1.00 16.58  ? 458  GLU A O     1 
ATOM   3885 C  CB    . GLU C 3 452 ? 58.308 34.318  -21.447 1.00 13.23  ? 458  GLU A CB    1 
ATOM   3886 C  CG    . GLU C 3 452 ? 57.841 35.320  -20.398 1.00 16.04  ? 458  GLU A CG    1 
ATOM   3887 C  CD    . GLU C 3 452 ? 56.730 36.229  -20.871 1.00 16.08  ? 458  GLU A CD    1 
ATOM   3888 O  OE1   . GLU C 3 452 ? 56.468 36.290  -22.089 1.00 24.37  ? 458  GLU A OE1   1 
ATOM   3889 O  OE2   . GLU C 3 452 ? 56.120 36.898  -20.014 1.00 9.98   ? 458  GLU A OE2   1 
ATOM   3890 N  N     . HIS C 3 453 ? 60.894 34.940  -19.527 1.00 13.68  ? 459  HIS A N     1 
ATOM   3891 C  CA    . HIS C 3 453 ? 61.924 35.890  -19.108 1.00 5.31   ? 459  HIS A CA    1 
ATOM   3892 C  C     . HIS C 3 453 ? 63.324 35.291  -19.071 1.00 7.01   ? 459  HIS A C     1 
ATOM   3893 O  O     . HIS C 3 453 ? 64.292 35.972  -18.731 1.00 12.93  ? 459  HIS A O     1 
ATOM   3894 C  CB    . HIS C 3 453 ? 61.538 36.509  -17.767 1.00 8.83   ? 459  HIS A CB    1 
ATOM   3895 C  CG    . HIS C 3 453 ? 60.203 37.187  -17.803 1.00 10.05  ? 459  HIS A CG    1 
ATOM   3896 N  ND1   . HIS C 3 453 ? 59.892 38.150  -18.737 1.00 15.40  ? 459  HIS A ND1   1 
ATOM   3897 C  CD2   . HIS C 3 453 ? 59.085 37.004  -17.065 1.00 9.53   ? 459  HIS A CD2   1 
ATOM   3898 C  CE1   . HIS C 3 453 ? 58.638 38.528  -18.581 1.00 17.71  ? 459  HIS A CE1   1 
ATOM   3899 N  NE2   . HIS C 3 453 ? 58.124 37.846  -17.572 1.00 16.90  ? 459  HIS A NE2   1 
ATOM   3900 N  N     . HIS C 3 454 ? 63.422 34.012  -19.425 1.00 7.05   ? 460  HIS A N     1 
ATOM   3901 C  CA    . HIS C 3 454 ? 64.704 33.313  -19.489 1.00 7.41   ? 460  HIS A CA    1 
ATOM   3902 C  C     . HIS C 3 454 ? 64.950 32.957  -20.958 1.00 6.93   ? 460  HIS A C     1 
ATOM   3903 O  O     . HIS C 3 454 ? 64.125 32.299  -21.600 1.00 9.23   ? 460  HIS A O     1 
ATOM   3904 C  CB    . HIS C 3 454 ? 64.703 32.022  -18.653 1.00 11.63  ? 460  HIS A CB    1 
ATOM   3905 C  CG    . HIS C 3 454 ? 65.902 31.151  -18.891 1.00 8.18   ? 460  HIS A CG    1 
ATOM   3906 N  ND1   . HIS C 3 454 ? 67.167 31.479  -18.449 1.00 9.31   ? 460  HIS A ND1   1 
ATOM   3907 C  CD2   . HIS C 3 454 ? 66.033 29.978  -19.557 1.00 7.96   ? 460  HIS A CD2   1 
ATOM   3908 C  CE1   . HIS C 3 454 ? 68.024 30.548  -18.833 1.00 8.04   ? 460  HIS A CE1   1 
ATOM   3909 N  NE2   . HIS C 3 454 ? 67.361 29.626  -19.508 1.00 11.86  ? 460  HIS A NE2   1 
ATOM   3910 N  N     . LEU C 3 455 ? 66.084 33.406  -21.482 1.00 6.66   ? 461  LEU A N     1 
ATOM   3911 C  CA    . LEU C 3 455 ? 66.454 33.143  -22.857 1.00 10.18  ? 461  LEU A CA    1 
ATOM   3912 C  C     . LEU C 3 455 ? 67.457 31.999  -22.834 1.00 7.57   ? 461  LEU A C     1 
ATOM   3913 O  O     . LEU C 3 455 ? 68.422 32.025  -22.068 1.00 10.97  ? 461  LEU A O     1 
ATOM   3914 C  CB    . LEU C 3 455 ? 67.072 34.399  -23.490 1.00 11.55  ? 461  LEU A CB    1 
ATOM   3915 C  CG    . LEU C 3 455 ? 66.257 35.703  -23.403 1.00 16.22  ? 461  LEU A CG    1 
ATOM   3916 C  CD1   . LEU C 3 455 ? 67.063 36.834  -24.009 1.00 18.39  ? 461  LEU A CD1   1 
ATOM   3917 C  CD2   . LEU C 3 455 ? 64.899 35.573  -24.089 1.00 8.46   ? 461  LEU A CD2   1 
ATOM   3918 N  N     . ASP C 3 456 ? 67.216 30.990  -23.666 1.00 7.82   ? 462  ASP A N     1 
ATOM   3919 C  CA    . ASP C 3 456 ? 68.079 29.813  -23.752 1.00 10.09  ? 462  ASP A CA    1 
ATOM   3920 C  C     . ASP C 3 456 ? 69.546 30.187  -23.946 1.00 7.90   ? 462  ASP A C     1 
ATOM   3921 O  O     . ASP C 3 456 ? 69.866 31.085  -24.726 1.00 16.04  ? 462  ASP A O     1 
ATOM   3922 C  CB    . ASP C 3 456 ? 67.603 28.914  -24.895 1.00 4.96   ? 462  ASP A CB    1 
ATOM   3923 C  CG    . ASP C 3 456 ? 68.239 27.552  -24.864 1.00 8.19   ? 462  ASP A CG    1 
ATOM   3924 O  OD1   . ASP C 3 456 ? 67.778 26.712  -24.075 1.00 12.36  ? 462  ASP A OD1   1 
ATOM   3925 O  OD2   . ASP C 3 456 ? 69.203 27.320  -25.617 1.00 14.30  ? 462  ASP A OD2   1 
ATOM   3926 N  N     . GLY C 3 457 ? 70.431 29.480  -23.244 1.00 11.39  ? 463  GLY A N     1 
ATOM   3927 C  CA    . GLY C 3 457 ? 71.857 29.752  -23.321 1.00 9.88   ? 463  GLY A CA    1 
ATOM   3928 C  C     . GLY C 3 457 ? 72.500 29.523  -24.674 1.00 14.58  ? 463  GLY A C     1 
ATOM   3929 O  O     . GLY C 3 457 ? 73.535 30.117  -24.975 1.00 18.74  ? 463  GLY A O     1 
ATOM   3930 N  N     . ILE C 3 458 ? 71.901 28.653  -25.482 1.00 12.25  ? 464  ILE A N     1 
ATOM   3931 C  CA    . ILE C 3 458 ? 72.426 28.352  -26.812 1.00 16.50  ? 464  ILE A CA    1 
ATOM   3932 C  C     . ILE C 3 458 ? 71.694 29.133  -27.911 1.00 12.51  ? 464  ILE A C     1 
ATOM   3933 O  O     . ILE C 3 458 ? 72.311 29.915  -28.633 1.00 12.74  ? 464  ILE A O     1 
ATOM   3934 C  CB    . ILE C 3 458 ? 72.319 26.833  -27.143 1.00 19.44  ? 464  ILE A CB    1 
ATOM   3935 C  CG1   . ILE C 3 458 ? 72.974 25.985  -26.043 1.00 12.94  ? 464  ILE A CG1   1 
ATOM   3936 C  CG2   . ILE C 3 458 ? 72.944 26.547  -28.511 1.00 13.62  ? 464  ILE A CG2   1 
ATOM   3937 C  CD1   . ILE C 3 458 ? 74.448 26.253  -25.841 1.00 23.92  ? 464  ILE A CD1   1 
ATOM   3938 N  N     . THR C 3 459 ? 70.379 28.934  -28.010 1.00 11.50  ? 465  THR A N     1 
ATOM   3939 C  CA    . THR C 3 459 ? 69.561 29.587  -29.036 1.00 6.08   ? 465  THR A CA    1 
ATOM   3940 C  C     . THR C 3 459 ? 69.047 30.988  -28.751 1.00 11.05  ? 465  THR A C     1 
ATOM   3941 O  O     . THR C 3 459 ? 68.646 31.698  -29.673 1.00 8.67   ? 465  THR A O     1 
ATOM   3942 C  CB    . THR C 3 459 ? 68.352 28.736  -29.391 1.00 6.87   ? 465  THR A CB    1 
ATOM   3943 O  OG1   . THR C 3 459 ? 67.451 28.721  -28.281 1.00 10.23  ? 465  THR A OG1   1 
ATOM   3944 C  CG2   . THR C 3 459 ? 68.781 27.311  -29.717 1.00 7.81   ? 465  THR A CG2   1 
ATOM   3945 N  N     . GLY C 3 460 ? 69.008 31.363  -27.477 1.00 14.23  ? 466  GLY A N     1 
ATOM   3946 C  CA    . GLY C 3 460 ? 68.530 32.683  -27.107 1.00 13.36  ? 466  GLY A CA    1 
ATOM   3947 C  C     . GLY C 3 460 ? 67.022 32.818  -27.161 1.00 13.92  ? 466  GLY A C     1 
ATOM   3948 O  O     . GLY C 3 460 ? 66.500 33.925  -27.024 1.00 22.20  ? 466  GLY A O     1 
ATOM   3949 N  N     . LYS C 3 461 ? 66.317 31.704  -27.362 1.00 11.14  ? 467  LYS A N     1 
ATOM   3950 C  CA    . LYS C 3 461 ? 64.853 31.730  -27.428 1.00 8.00   ? 467  LYS A CA    1 
ATOM   3951 C  C     . LYS C 3 461 ? 64.245 31.568  -26.039 1.00 10.93  ? 467  LYS A C     1 
ATOM   3952 O  O     . LYS C 3 461 ? 64.708 30.751  -25.241 1.00 14.24  ? 467  LYS A O     1 
ATOM   3953 C  CB    . LYS C 3 461 ? 64.321 30.633  -28.365 1.00 11.76  ? 467  LYS A CB    1 
ATOM   3954 C  CG    . LYS C 3 461 ? 64.847 30.714  -29.798 1.00 16.65  ? 467  LYS A CG    1 
ATOM   3955 C  CD    . LYS C 3 461 ? 64.759 32.130  -30.381 1.00 20.90  ? 467  LYS A CD    1 
ATOM   3956 C  CE    . LYS C 3 461 ? 63.415 32.463  -31.019 1.00 23.60  ? 467  LYS A CE    1 
ATOM   3957 N  NZ    . LYS C 3 461 ? 62.243 32.413  -30.120 1.00 31.49  ? 467  LYS A NZ    1 
ATOM   3958 N  N     . PRO C 3 462 ? 63.202 32.354  -25.726 1.00 12.02  ? 468  PRO A N     1 
ATOM   3959 C  CA    . PRO C 3 462 ? 62.554 32.267  -24.413 1.00 12.32  ? 468  PRO A CA    1 
ATOM   3960 C  C     . PRO C 3 462 ? 61.999 30.889  -24.083 1.00 15.13  ? 468  PRO A C     1 
ATOM   3961 O  O     . PRO C 3 462 ? 61.548 30.164  -24.968 1.00 18.68  ? 468  PRO A O     1 
ATOM   3962 C  CB    . PRO C 3 462 ? 61.457 33.338  -24.495 1.00 10.11  ? 468  PRO A CB    1 
ATOM   3963 C  CG    . PRO C 3 462 ? 61.209 33.492  -25.956 1.00 15.14  ? 468  PRO A CG    1 
ATOM   3964 C  CD    . PRO C 3 462 ? 62.593 33.427  -26.533 1.00 6.01   ? 468  PRO A CD    1 
ATOM   3965 N  N     . TRP C 3 463 ? 62.093 30.500  -22.816 1.00 14.97  ? 469  TRP A N     1 
ATOM   3966 C  CA    . TRP C 3 463 ? 61.573 29.203  -22.397 1.00 7.78   ? 469  TRP A CA    1 
ATOM   3967 C  C     . TRP C 3 463 ? 60.060 29.288  -22.234 1.00 4.63   ? 469  TRP A C     1 
ATOM   3968 O  O     . TRP C 3 463 ? 59.487 30.377  -22.241 1.00 10.15  ? 469  TRP A O     1 
ATOM   3969 C  CB    . TRP C 3 463 ? 62.257 28.716  -21.105 1.00 2.96   ? 469  TRP A CB    1 
ATOM   3970 C  CG    . TRP C 3 463 ? 63.597 28.052  -21.348 1.00 8.73   ? 469  TRP A CG    1 
ATOM   3971 C  CD1   . TRP C 3 463 ? 64.505 28.372  -22.323 1.00 5.98   ? 469  TRP A CD1   1 
ATOM   3972 C  CD2   . TRP C 3 463 ? 64.174 26.951  -20.613 1.00 8.20   ? 469  TRP A CD2   1 
ATOM   3973 N  NE1   . TRP C 3 463 ? 65.604 27.543  -22.240 1.00 9.04   ? 469  TRP A NE1   1 
ATOM   3974 C  CE2   . TRP C 3 463 ? 65.429 26.663  -21.206 1.00 4.66   ? 469  TRP A CE2   1 
ATOM   3975 C  CE3   . TRP C 3 463 ? 63.751 26.181  -19.516 1.00 7.19   ? 469  TRP A CE3   1 
ATOM   3976 C  CZ2   . TRP C 3 463 ? 66.269 25.636  -20.737 1.00 11.48  ? 469  TRP A CZ2   1 
ATOM   3977 C  CZ3   . TRP C 3 463 ? 64.589 25.157  -19.049 1.00 4.26   ? 469  TRP A CZ3   1 
ATOM   3978 C  CH2   . TRP C 3 463 ? 65.832 24.898  -19.662 1.00 11.22  ? 469  TRP A CH2   1 
ATOM   3979 N  N     . VAL C 3 464 ? 59.418 28.128  -22.148 1.00 2.00   ? 470  VAL A N     1 
ATOM   3980 C  CA    . VAL C 3 464 ? 57.976 28.014  -21.993 1.00 7.80   ? 470  VAL A CA    1 
ATOM   3981 C  C     . VAL C 3 464 ? 57.704 27.543  -20.568 1.00 13.18  ? 470  VAL A C     1 
ATOM   3982 O  O     . VAL C 3 464 ? 58.510 26.829  -19.983 1.00 15.79  ? 470  VAL A O     1 
ATOM   3983 C  CB    . VAL C 3 464 ? 57.403 26.984  -23.001 1.00 14.97  ? 470  VAL A CB    1 
ATOM   3984 C  CG1   . VAL C 3 464 ? 55.903 26.848  -22.830 1.00 22.43  ? 470  VAL A CG1   1 
ATOM   3985 C  CG2   . VAL C 3 464 ? 57.746 27.406  -24.430 1.00 25.17  ? 470  VAL A CG2   1 
ATOM   3986 N  N     . GLN C 3 465 ? 56.560 27.921  -20.016 1.00 14.28  ? 471  GLN A N     1 
ATOM   3987 C  CA    . GLN C 3 465 ? 56.217 27.551  -18.646 1.00 14.09  ? 471  GLN A CA    1 
ATOM   3988 C  C     . GLN C 3 465 ? 55.115 26.503  -18.530 1.00 12.66  ? 471  GLN A C     1 
ATOM   3989 O  O     . GLN C 3 465 ? 54.166 26.485  -19.316 1.00 11.46  ? 471  GLN A O     1 
ATOM   3990 C  CB    . GLN C 3 465 ? 55.833 28.823  -17.879 1.00 11.99  ? 471  GLN A CB    1 
ATOM   3991 C  CG    . GLN C 3 465 ? 55.531 28.659  -16.405 1.00 5.93   ? 471  GLN A CG    1 
ATOM   3992 C  CD    . GLN C 3 465 ? 55.627 29.978  -15.671 1.00 6.63   ? 471  GLN A CD    1 
ATOM   3993 O  OE1   . GLN C 3 465 ? 56.550 30.756  -15.905 1.00 10.62  ? 471  GLN A OE1   1 
ATOM   3994 N  NE2   . GLN C 3 465 ? 54.682 30.237  -14.780 1.00 3.33   ? 471  GLN A NE2   1 
ATOM   3995 N  N     . ALA C 3 466 ? 55.245 25.642  -17.527 1.00 12.56  ? 472  ALA A N     1 
ATOM   3996 C  CA    . ALA C 3 466 ? 54.266 24.591  -17.266 1.00 11.35  ? 472  ALA A CA    1 
ATOM   3997 C  C     . ALA C 3 466 ? 53.871 24.669  -15.789 1.00 11.07  ? 472  ALA A C     1 
ATOM   3998 O  O     . ALA C 3 466 ? 54.677 24.403  -14.899 1.00 11.74  ? 472  ALA A O     1 
ATOM   3999 C  CB    . ALA C 3 466 ? 54.855 23.208  -17.600 1.00 12.06  ? 472  ALA A CB    1 
ATOM   4000 N  N     . GLY C 3 467 ? 52.641 25.093  -15.538 1.00 7.23   ? 473  GLY A N     1 
ATOM   4001 C  CA    . GLY C 3 467 ? 52.164 25.196  -14.178 1.00 13.72  ? 473  GLY A CA    1 
ATOM   4002 C  C     . GLY C 3 467 ? 51.160 24.104  -13.919 1.00 16.04  ? 473  GLY A C     1 
ATOM   4003 O  O     . GLY C 3 467 ? 50.213 23.942  -14.689 1.00 16.33  ? 473  GLY A O     1 
ATOM   4004 N  N     . ILE C 3 468 ? 51.386 23.330  -12.862 1.00 12.51  ? 474  ILE A N     1 
ATOM   4005 C  CA    . ILE C 3 468 ? 50.485 22.238  -12.507 1.00 12.32  ? 474  ILE A CA    1 
ATOM   4006 C  C     . ILE C 3 468 ? 50.026 22.409  -11.061 1.00 10.99  ? 474  ILE A C     1 
ATOM   4007 O  O     . ILE C 3 468 ? 50.826 22.666  -10.171 1.00 5.64   ? 474  ILE A O     1 
ATOM   4008 C  CB    . ILE C 3 468 ? 51.156 20.856  -12.701 1.00 10.99  ? 474  ILE A CB    1 
ATOM   4009 C  CG1   . ILE C 3 468 ? 51.680 20.721  -14.135 1.00 5.94   ? 474  ILE A CG1   1 
ATOM   4010 C  CG2   . ILE C 3 468 ? 50.143 19.734  -12.439 1.00 4.83   ? 474  ILE A CG2   1 
ATOM   4011 C  CD1   . ILE C 3 468 ? 53.163 20.936  -14.278 1.00 4.90   ? 474  ILE A CD1   1 
ATOM   4012 N  N     . ASP C 3 469 ? 48.730 22.246  -10.833 1.00 11.87  ? 475  ASP A N     1 
ATOM   4013 C  CA    . ASP C 3 469 ? 48.161 22.419  -9.507  1.00 14.29  ? 475  ASP A CA    1 
ATOM   4014 C  C     . ASP C 3 469 ? 47.241 21.246  -9.158  1.00 17.07  ? 475  ASP A C     1 
ATOM   4015 O  O     . ASP C 3 469 ? 46.445 20.803  -9.985  1.00 21.34  ? 475  ASP A O     1 
ATOM   4016 C  CB    . ASP C 3 469 ? 47.379 23.739  -9.495  1.00 19.74  ? 475  ASP A CB    1 
ATOM   4017 C  CG    . ASP C 3 469 ? 47.031 24.211  -8.102  1.00 26.81  ? 475  ASP A CG    1 
ATOM   4018 O  OD1   . ASP C 3 469 ? 46.072 23.677  -7.516  1.00 32.67  ? 475  ASP A OD1   1 
ATOM   4019 O  OD2   . ASP C 3 469 ? 47.703 25.136  -7.602  1.00 34.47  ? 475  ASP A OD2   1 
ATOM   4020 N  N     . ALA C 3 470 ? 47.356 20.747  -7.932  1.00 10.87  ? 476  ALA A N     1 
ATOM   4021 C  CA    . ALA C 3 470 ? 46.531 19.634  -7.469  1.00 14.43  ? 476  ALA A CA    1 
ATOM   4022 C  C     . ALA C 3 470 ? 45.068 20.057  -7.352  1.00 13.62  ? 476  ALA A C     1 
ATOM   4023 O  O     . ALA C 3 470 ? 44.749 21.053  -6.713  1.00 14.68  ? 476  ALA A O     1 
ATOM   4024 C  CB    . ALA C 3 470 ? 47.043 19.128  -6.131  1.00 13.22  ? 476  ALA A CB    1 
ATOM   4025 N  N     . SER C 3 471 ? 44.179 19.295  -7.976  1.00 14.25  ? 477  SER A N     1 
ATOM   4026 C  CA    . SER C 3 471 ? 42.748 19.595  -7.952  1.00 16.76  ? 477  SER A CA    1 
ATOM   4027 C  C     . SER C 3 471 ? 42.053 19.301  -6.618  1.00 13.30  ? 477  SER A C     1 
ATOM   4028 O  O     . SER C 3 471 ? 42.042 18.157  -6.166  1.00 15.01  ? 477  SER A O     1 
ATOM   4029 C  CB    . SER C 3 471 ? 42.042 18.828  -9.074  1.00 15.59  ? 477  SER A CB    1 
ATOM   4030 O  OG    . SER C 3 471 ? 42.512 19.245  -10.340 1.00 16.69  ? 477  SER A OG    1 
ATOM   4031 N  N     . GLY C 3 472 ? 41.486 20.350  -6.010  1.00 15.47  ? 478  GLY A N     1 
ATOM   4032 C  CA    . GLY C 3 472 ? 40.762 20.256  -4.739  1.00 11.20  ? 478  GLY A CA    1 
ATOM   4033 C  C     . GLY C 3 472 ? 41.409 19.413  -3.656  1.00 14.88  ? 478  GLY A C     1 
ATOM   4034 O  O     . GLY C 3 472 ? 40.732 18.686  -2.938  1.00 12.76  ? 478  GLY A O     1 
ATOM   4035 N  N     . LEU C 3 473 ? 42.721 19.558  -3.535  1.00 19.91  ? 479  LEU A N     1 
ATOM   4036 C  CA    . LEU C 3 473 ? 43.557 18.826  -2.595  1.00 20.95  ? 479  LEU A CA    1 
ATOM   4037 C  C     . LEU C 3 473 ? 42.987 18.412  -1.234  1.00 23.28  ? 479  LEU A C     1 
ATOM   4038 O  O     . LEU C 3 473 ? 42.653 17.243  -1.035  1.00 20.91  ? 479  LEU A O     1 
ATOM   4039 C  CB    . LEU C 3 473 ? 44.867 19.587  -2.393  1.00 21.68  ? 479  LEU A CB    1 
ATOM   4040 C  CG    . LEU C 3 473 ? 45.938 18.852  -1.589  1.00 22.24  ? 479  LEU A CG    1 
ATOM   4041 C  CD1   . LEU C 3 473 ? 46.375 17.588  -2.333  1.00 17.94  ? 479  LEU A CD1   1 
ATOM   4042 C  CD2   . LEU C 3 473 ? 47.110 19.792  -1.345  1.00 25.36  ? 479  LEU A CD2   1 
ATOM   4043 N  N     . GLU C 3 474 ? 42.878 19.359  -0.306  1.00 16.76  ? 480  GLU A N     1 
ATOM   4044 C  CA    . GLU C 3 474 ? 42.382 19.050  1.030   1.00 13.90  ? 480  GLU A CA    1 
ATOM   4045 C  C     . GLU C 3 474 ? 40.972 18.496  1.140   1.00 14.31  ? 480  GLU A C     1 
ATOM   4046 O  O     . GLU C 3 474 ? 40.685 17.747  2.073   1.00 15.27  ? 480  GLU A O     1 
ATOM   4047 C  CB    . GLU C 3 474 ? 42.622 20.228  1.972   1.00 11.04  ? 480  GLU A CB    1 
ATOM   4048 C  CG    . GLU C 3 474 ? 44.101 20.340  2.317   1.00 4.77   ? 480  GLU A CG    1 
ATOM   4049 C  CD    . GLU C 3 474 ? 44.452 21.572  3.126   1.00 12.91  ? 480  GLU A CD    1 
ATOM   4050 O  OE1   . GLU C 3 474 ? 43.622 22.020  3.951   1.00 8.11   ? 480  GLU A OE1   1 
ATOM   4051 O  OE2   . GLU C 3 474 ? 45.574 22.088  2.929   1.00 13.58  ? 480  GLU A OE2   1 
ATOM   4052 N  N     . LEU C 3 475 ? 40.098 18.842  0.197   1.00 9.13   ? 481  LEU A N     1 
ATOM   4053 C  CA    . LEU C 3 475 ? 38.742 18.304  0.218   1.00 9.80   ? 481  LEU A CA    1 
ATOM   4054 C  C     . LEU C 3 475 ? 38.790 16.813  -0.161  1.00 11.31  ? 481  LEU A C     1 
ATOM   4055 O  O     . LEU C 3 475 ? 37.965 16.019  0.300   1.00 11.51  ? 481  LEU A O     1 
ATOM   4056 C  CB    . LEU C 3 475 ? 37.810 19.083  -0.717  1.00 10.45  ? 481  LEU A CB    1 
ATOM   4057 C  CG    . LEU C 3 475 ? 37.296 20.438  -0.212  1.00 13.56  ? 481  LEU A CG    1 
ATOM   4058 C  CD1   . LEU C 3 475 ? 36.265 20.988  -1.190  1.00 8.83   ? 481  LEU A CD1   1 
ATOM   4059 C  CD2   . LEU C 3 475 ? 36.655 20.283  1.170   1.00 12.53  ? 481  LEU A CD2   1 
ATOM   4060 N  N     . ARG C 3 476 ? 39.770 16.441  -0.987  1.00 8.47   ? 482  ARG A N     1 
ATOM   4061 C  CA    . ARG C 3 476 ? 39.950 15.052  -1.400  1.00 3.82   ? 482  ARG A CA    1 
ATOM   4062 C  C     . ARG C 3 476 ? 40.594 14.273  -0.254  1.00 7.16   ? 482  ARG A C     1 
ATOM   4063 O  O     . ARG C 3 476 ? 40.393 13.064  -0.122  1.00 9.76   ? 482  ARG A O     1 
ATOM   4064 C  CB    . ARG C 3 476 ? 40.783 14.967  -2.684  1.00 9.14   ? 482  ARG A CB    1 
ATOM   4065 C  CG    . ARG C 3 476 ? 40.056 15.551  -3.903  1.00 8.10   ? 482  ARG A CG    1 
ATOM   4066 C  CD    . ARG C 3 476 ? 40.752 15.208  -5.209  1.00 11.08  ? 482  ARG A CD    1 
ATOM   4067 N  NE    . ARG C 3 476 ? 40.120 15.862  -6.358  1.00 15.68  ? 482  ARG A NE    1 
ATOM   4068 C  CZ    . ARG C 3 476 ? 40.183 15.414  -7.614  1.00 14.86  ? 482  ARG A CZ    1 
ATOM   4069 N  NH1   . ARG C 3 476 ? 40.846 14.304  -7.895  1.00 9.81   ? 482  ARG A NH1   1 
ATOM   4070 N  NH2   . ARG C 3 476 ? 39.605 16.092  -8.598  1.00 7.12   ? 482  ARG A NH2   1 
ATOM   4071 N  N     . CYS C 3 477 ? 41.377 14.975  0.568   1.00 6.75   ? 483  CYS A N     1 
ATOM   4072 C  CA    . CYS C 3 477 ? 42.007 14.373  1.736   1.00 9.33   ? 483  CYS A CA    1 
ATOM   4073 C  C     . CYS C 3 477 ? 40.894 14.088  2.757   1.00 10.98  ? 483  CYS A C     1 
ATOM   4074 O  O     . CYS C 3 477 ? 40.933 13.073  3.455   1.00 10.31  ? 483  CYS A O     1 
ATOM   4075 C  CB    . CYS C 3 477 ? 43.071 15.301  2.329   1.00 5.63   ? 483  CYS A CB    1 
ATOM   4076 S  SG    . CYS C 3 477 ? 44.561 15.431  1.310   1.00 22.73  ? 483  CYS A SG    1 
ATOM   4077 N  N     . LEU C 3 478 ? 39.893 14.975  2.803   1.00 13.29  ? 484  LEU A N     1 
ATOM   4078 C  CA    . LEU C 3 478 ? 38.736 14.831  3.698   1.00 11.53  ? 484  LEU A CA    1 
ATOM   4079 C  C     . LEU C 3 478 ? 37.937 13.619  3.241   1.00 13.15  ? 484  LEU A C     1 
ATOM   4080 O  O     . LEU C 3 478 ? 37.531 12.802  4.056   1.00 11.51  ? 484  LEU A O     1 
ATOM   4081 C  CB    . LEU C 3 478 ? 37.832 16.070  3.627   1.00 15.33  ? 484  LEU A CB    1 
ATOM   4082 C  CG    . LEU C 3 478 ? 36.442 16.028  4.295   1.00 15.79  ? 484  LEU A CG    1 
ATOM   4083 C  CD1   . LEU C 3 478 ? 36.581 15.924  5.810   1.00 14.23  ? 484  LEU A CD1   1 
ATOM   4084 C  CD2   . LEU C 3 478 ? 35.646 17.276  3.934   1.00 7.55   ? 484  LEU A CD2   1 
ATOM   4085 N  N     . ALA C 3 479 ? 37.737 13.511  1.926   1.00 15.20  ? 485  ALA A N     1 
ATOM   4086 C  CA    . ALA C 3 479 ? 36.990 12.409  1.322   1.00 14.74  ? 485  ALA A CA    1 
ATOM   4087 C  C     . ALA C 3 479 ? 37.630 11.071  1.672   1.00 13.86  ? 485  ALA A C     1 
ATOM   4088 O  O     . ALA C 3 479 ? 36.937 10.082  1.909   1.00 17.51  ? 485  ALA A O     1 
ATOM   4089 C  CB    . ALA C 3 479 ? 36.934 12.588  -0.188  1.00 9.97   ? 485  ALA A CB    1 
ATOM   4090 N  N     . HIS C 3 480 ? 38.958 11.061  1.711   1.00 8.85   ? 486  HIS A N     1 
ATOM   4091 C  CA    . HIS C 3 480 ? 39.734 9.871   2.045   1.00 12.55  ? 486  HIS A CA    1 
ATOM   4092 C  C     . HIS C 3 480 ? 39.478 9.432   3.482   1.00 12.85  ? 486  HIS A C     1 
ATOM   4093 O  O     . HIS C 3 480 ? 39.038 8.306   3.727   1.00 14.64  ? 486  HIS A O     1 
ATOM   4094 C  CB    . HIS C 3 480 ? 41.225 10.165  1.844   1.00 11.60  ? 486  HIS A CB    1 
ATOM   4095 C  CG    . HIS C 3 480 ? 42.142 9.179   2.501   1.00 12.78  ? 486  HIS A CG    1 
ATOM   4096 N  ND1   . HIS C 3 480 ? 42.292 7.884   2.056   1.00 15.26  ? 486  HIS A ND1   1 
ATOM   4097 C  CD2   . HIS C 3 480 ? 42.972 9.308   3.564   1.00 5.88   ? 486  HIS A CD2   1 
ATOM   4098 C  CE1   . HIS C 3 480 ? 43.178 7.258   2.810   1.00 11.43  ? 486  HIS A CE1   1 
ATOM   4099 N  NE2   . HIS C 3 480 ? 43.605 8.101   3.733   1.00 6.94   ? 486  HIS A NE2   1 
ATOM   4100 N  N     . PHE C 3 481 ? 39.741 10.337  4.423   1.00 16.21  ? 487  PHE A N     1 
ATOM   4101 C  CA    . PHE C 3 481 ? 39.558 10.053  5.841   1.00 13.74  ? 487  PHE A CA    1 
ATOM   4102 C  C     . PHE C 3 481 ? 38.128 9.766   6.299   1.00 14.81  ? 487  PHE A C     1 
ATOM   4103 O  O     . PHE C 3 481 ? 37.936 8.998   7.245   1.00 17.72  ? 487  PHE A O     1 
ATOM   4104 C  CB    . PHE C 3 481 ? 40.208 11.150  6.695   1.00 9.74   ? 487  PHE A CB    1 
ATOM   4105 C  CG    . PHE C 3 481 ? 41.719 11.120  6.667   1.00 6.89   ? 487  PHE A CG    1 
ATOM   4106 C  CD1   . PHE C 3 481 ? 42.419 10.062  7.246   1.00 6.64   ? 487  PHE A CD1   1 
ATOM   4107 C  CD2   . PHE C 3 481 ? 42.440 12.137  6.047   1.00 9.00   ? 487  PHE A CD2   1 
ATOM   4108 C  CE1   . PHE C 3 481 ? 43.813 10.017  7.207   1.00 5.23   ? 487  PHE A CE1   1 
ATOM   4109 C  CE2   . PHE C 3 481 ? 43.838 12.103  6.002   1.00 8.71   ? 487  PHE A CE2   1 
ATOM   4110 C  CZ    . PHE C 3 481 ? 44.523 11.041  6.583   1.00 2.00   ? 487  PHE A CZ    1 
ATOM   4111 N  N     . MET C 3 482 ? 37.127 10.366  5.655   1.00 15.75  ? 488  MET A N     1 
ATOM   4112 C  CA    . MET C 3 482 ? 35.756 10.078  6.068   1.00 19.25  ? 488  MET A CA    1 
ATOM   4113 C  C     . MET C 3 482 ? 35.112 8.930   5.293   1.00 17.18  ? 488  MET A C     1 
ATOM   4114 O  O     . MET C 3 482 ? 33.937 8.625   5.484   1.00 10.95  ? 488  MET A O     1 
ATOM   4115 C  CB    . MET C 3 482 ? 34.860 11.335  6.119   1.00 27.02  ? 488  MET A CB    1 
ATOM   4116 C  CG    . MET C 3 482 ? 34.629 12.112  4.848   1.00 34.82  ? 488  MET A CG    1 
ATOM   4117 S  SD    . MET C 3 482 ? 33.498 13.521  5.177   1.00 39.44  ? 488  MET A SD    1 
ATOM   4118 C  CE    . MET C 3 482 ? 32.143 13.117  4.105   1.00 36.60  ? 488  MET A CE    1 
ATOM   4119 N  N     . ALA C 3 483 ? 35.922 8.256   4.475   1.00 15.16  ? 489  ALA A N     1 
ATOM   4120 C  CA    . ALA C 3 483 ? 35.476 7.119   3.678   1.00 16.60  ? 489  ALA A CA    1 
ATOM   4121 C  C     . ALA C 3 483 ? 35.082 5.926   4.562   1.00 13.64  ? 489  ALA A C     1 
ATOM   4122 O  O     . ALA C 3 483 ? 34.276 5.092   4.160   1.00 13.57  ? 489  ALA A O     1 
ATOM   4123 C  CB    . ALA C 3 483 ? 36.562 6.710   2.694   1.00 16.43  ? 489  ALA A CB    1 
ATOM   4124 N  N     . ARG C 3 484 ? 35.674 5.825   5.751   1.00 15.51  ? 490  ARG A N     1 
ATOM   4125 C  CA    . ARG C 3 484 ? 35.335 4.734   6.664   1.00 19.47  ? 490  ARG A CA    1 
ATOM   4126 C  C     . ARG C 3 484 ? 33.953 4.961   7.262   1.00 18.24  ? 490  ARG A C     1 
ATOM   4127 O  O     . ARG C 3 484 ? 33.305 4.018   7.717   1.00 23.43  ? 490  ARG A O     1 
ATOM   4128 C  CB    . ARG C 3 484 ? 36.377 4.581   7.779   1.00 23.39  ? 490  ARG A CB    1 
ATOM   4129 C  CG    . ARG C 3 484 ? 36.851 5.876   8.391   1.00 33.01  ? 490  ARG A CG    1 
ATOM   4130 C  CD    . ARG C 3 484 ? 37.740 5.623   9.594   1.00 37.19  ? 490  ARG A CD    1 
ATOM   4131 N  NE    . ARG C 3 484 ? 36.957 5.418   10.806  1.00 36.19  ? 490  ARG A NE    1 
ATOM   4132 C  CZ    . ARG C 3 484 ? 37.419 5.613   12.038  1.00 39.53  ? 490  ARG A CZ    1 
ATOM   4133 N  NH1   . ARG C 3 484 ? 38.670 6.014   12.231  1.00 40.75  ? 490  ARG A NH1   1 
ATOM   4134 N  NH2   . ARG C 3 484 ? 36.613 5.446   13.080  1.00 39.39  ? 490  ARG A NH2   1 
ATOM   4135 N  N     . PHE C 3 485 ? 33.502 6.214   7.224   1.00 18.70  ? 491  PHE A N     1 
ATOM   4136 C  CA    . PHE C 3 485 ? 32.198 6.605   7.748   1.00 13.54  ? 491  PHE A CA    1 
ATOM   4137 C  C     . PHE C 3 485 ? 31.079 6.629   6.699   1.00 18.13  ? 491  PHE A C     1 
ATOM   4138 O  O     . PHE C 3 485 ? 29.945 6.267   7.007   1.00 18.40  ? 491  PHE A O     1 
ATOM   4139 C  CB    . PHE C 3 485 ? 32.297 7.975   8.408   1.00 11.95  ? 491  PHE A CB    1 
ATOM   4140 C  CG    . PHE C 3 485 ? 33.313 8.042   9.500   1.00 11.45  ? 491  PHE A CG    1 
ATOM   4141 C  CD1   . PHE C 3 485 ? 33.040 7.504   10.755  1.00 17.28  ? 491  PHE A CD1   1 
ATOM   4142 C  CD2   . PHE C 3 485 ? 34.542 8.651   9.282   1.00 13.82  ? 491  PHE A CD2   1 
ATOM   4143 C  CE1   . PHE C 3 485 ? 33.977 7.579   11.780  1.00 14.80  ? 491  PHE A CE1   1 
ATOM   4144 C  CE2   . PHE C 3 485 ? 35.490 8.734   10.294  1.00 13.40  ? 491  PHE A CE2   1 
ATOM   4145 C  CZ    . PHE C 3 485 ? 35.211 8.197   11.547  1.00 15.59  ? 491  PHE A CZ    1 
ATOM   4146 N  N     . ASP C 3 486 ? 31.382 7.055   5.472   1.00 12.53  ? 492  ASP A N     1 
ATOM   4147 C  CA    . ASP C 3 486 ? 30.351 7.108   4.434   1.00 16.19  ? 492  ASP A CA    1 
ATOM   4148 C  C     . ASP C 3 486 ? 30.561 6.150   3.260   1.00 16.35  ? 492  ASP A C     1 
ATOM   4149 O  O     . ASP C 3 486 ? 29.835 6.213   2.270   1.00 17.95  ? 492  ASP A O     1 
ATOM   4150 C  CB    . ASP C 3 486 ? 30.156 8.556   3.932   1.00 11.05  ? 492  ASP A CB    1 
ATOM   4151 C  CG    . ASP C 3 486 ? 31.296 9.059   3.044   1.00 13.74  ? 492  ASP A CG    1 
ATOM   4152 O  OD1   . ASP C 3 486 ? 32.372 8.432   2.960   1.00 10.69  ? 492  ASP A OD1   1 
ATOM   4153 O  OD2   . ASP C 3 486 ? 31.109 10.112  2.409   1.00 12.05  ? 492  ASP A OD2   1 
ATOM   4154 N  N     . ASN C 3 487 ? 31.553 5.271   3.389   1.00 21.06  ? 493  ASN A N     1 
ATOM   4155 C  CA    . ASN C 3 487 ? 31.901 4.279   2.366   1.00 22.71  ? 493  ASN A CA    1 
ATOM   4156 C  C     . ASN C 3 487 ? 32.337 4.838   1.012   1.00 24.30  ? 493  ASN A C     1 
ATOM   4157 O  O     . ASN C 3 487 ? 32.021 4.263   -0.035  1.00 22.66  ? 493  ASN A O     1 
ATOM   4158 C  CB    . ASN C 3 487 ? 30.770 3.264   2.182   1.00 22.44  ? 493  ASN A CB    1 
ATOM   4159 C  CG    . ASN C 3 487 ? 30.557 2.413   3.409   1.00 24.37  ? 493  ASN A CG    1 
ATOM   4160 O  OD1   . ASN C 3 487 ? 31.513 1.906   4.009   1.00 28.73  ? 493  ASN A OD1   1 
ATOM   4161 N  ND2   . ASN C 3 487 ? 29.300 2.257   3.801   1.00 27.05  ? 493  ASN A ND2   1 
ATOM   4162 N  N     . GLY C 3 488 ? 33.082 5.944   1.048   1.00 18.92  ? 494  GLY A N     1 
ATOM   4163 C  CA    . GLY C 3 488 ? 33.578 6.574   -0.167  1.00 16.47  ? 494  GLY A CA    1 
ATOM   4164 C  C     . GLY C 3 488 ? 32.546 7.321   -0.985  1.00 19.22  ? 494  GLY A C     1 
ATOM   4165 O  O     . GLY C 3 488 ? 32.746 7.575   -2.173  1.00 27.14  ? 494  GLY A O     1 
ATOM   4166 N  N     . GLU C 3 489 ? 31.448 7.687   -0.335  1.00 19.20  ? 495  GLU A N     1 
ATOM   4167 C  CA    . GLU C 3 489 ? 30.351 8.414   -0.968  1.00 18.91  ? 495  GLU A CA    1 
ATOM   4168 C  C     . GLU C 3 489 ? 30.798 9.819   -1.384  1.00 20.36  ? 495  GLU A C     1 
ATOM   4169 O  O     . GLU C 3 489 ? 30.565 10.234  -2.516  1.00 17.54  ? 495  GLU A O     1 
ATOM   4170 C  CB    . GLU C 3 489 ? 29.182 8.474   0.012   1.00 23.16  ? 495  GLU A CB    1 
ATOM   4171 C  CG    . GLU C 3 489 ? 27.925 9.168   -0.453  1.00 33.45  ? 495  GLU A CG    1 
ATOM   4172 C  CD    . GLU C 3 489 ? 26.897 9.231   0.665   1.00 41.61  ? 495  GLU A CD    1 
ATOM   4173 O  OE1   . GLU C 3 489 ? 26.492 8.150   1.156   1.00 41.82  ? 495  GLU A OE1   1 
ATOM   4174 O  OE2   . GLU C 3 489 ? 26.518 10.356  1.068   1.00 35.53  ? 495  GLU A OE2   1 
ATOM   4175 N  N     . TYR C 3 490 ? 31.459 10.537  -0.479  1.00 20.95  ? 496  TYR A N     1 
ATOM   4176 C  CA    . TYR C 3 490 ? 31.933 11.883  -0.790  1.00 19.83  ? 496  TYR A CA    1 
ATOM   4177 C  C     . TYR C 3 490 ? 33.040 11.836  -1.844  1.00 19.02  ? 496  TYR A C     1 
ATOM   4178 O  O     . TYR C 3 490 ? 33.120 12.718  -2.689  1.00 19.95  ? 496  TYR A O     1 
ATOM   4179 C  CB    . TYR C 3 490 ? 32.454 12.592  0.469   1.00 13.45  ? 496  TYR A CB    1 
ATOM   4180 C  CG    . TYR C 3 490 ? 32.880 14.033  0.236   1.00 16.02  ? 496  TYR A CG    1 
ATOM   4181 C  CD1   . TYR C 3 490 ? 32.032 14.949  -0.405  1.00 17.82  ? 496  TYR A CD1   1 
ATOM   4182 C  CD2   . TYR C 3 490 ? 34.137 14.477  0.640   1.00 12.11  ? 496  TYR A CD2   1 
ATOM   4183 C  CE1   . TYR C 3 490 ? 32.434 16.272  -0.640  1.00 22.05  ? 496  TYR A CE1   1 
ATOM   4184 C  CE2   . TYR C 3 490 ? 34.549 15.792  0.415   1.00 16.88  ? 496  TYR A CE2   1 
ATOM   4185 C  CZ    . TYR C 3 490 ? 33.699 16.682  -0.226  1.00 17.12  ? 496  TYR A CZ    1 
ATOM   4186 O  OH    . TYR C 3 490 ? 34.132 17.963  -0.452  1.00 14.34  ? 496  TYR A OH    1 
ATOM   4187 N  N     . ALA C 3 491 ? 33.872 10.797  -1.793  1.00 19.14  ? 497  ALA A N     1 
ATOM   4188 C  CA    . ALA C 3 491 ? 34.984 10.620  -2.731  1.00 15.53  ? 497  ALA A CA    1 
ATOM   4189 C  C     . ALA C 3 491 ? 34.495 10.462  -4.170  1.00 17.88  ? 497  ALA A C     1 
ATOM   4190 O  O     . ALA C 3 491 ? 35.222 10.776  -5.115  1.00 18.37  ? 497  ALA A O     1 
ATOM   4191 C  CB    . ALA C 3 491 ? 35.832 9.418   -2.326  1.00 12.71  ? 497  ALA A CB    1 
ATOM   4192 N  N     . HIS C 3 492 ? 33.261 9.986   -4.320  1.00 17.60  ? 498  HIS A N     1 
ATOM   4193 C  CA    . HIS C 3 492 ? 32.657 9.797   -5.627  1.00 16.92  ? 498  HIS A CA    1 
ATOM   4194 C  C     . HIS C 3 492 ? 31.957 11.080  -6.051  1.00 19.44  ? 498  HIS A C     1 
ATOM   4195 O  O     . HIS C 3 492 ? 32.052 11.492  -7.210  1.00 29.18  ? 498  HIS A O     1 
ATOM   4196 C  CB    . HIS C 3 492 ? 31.652 8.645   -5.587  1.00 21.60  ? 498  HIS A CB    1 
ATOM   4197 C  CG    . HIS C 3 492 ? 31.015 8.357   -6.912  1.00 32.08  ? 498  HIS A CG    1 
ATOM   4198 N  ND1   . HIS C 3 492 ? 31.684 7.721   -7.935  1.00 30.90  ? 498  HIS A ND1   1 
ATOM   4199 C  CD2   . HIS C 3 492 ? 29.778 8.633   -7.386  1.00 29.95  ? 498  HIS A CD2   1 
ATOM   4200 C  CE1   . HIS C 3 492 ? 30.888 7.617   -8.983  1.00 29.09  ? 498  HIS A CE1   1 
ATOM   4201 N  NE2   . HIS C 3 492 ? 29.724 8.164   -8.676  1.00 30.77  ? 498  HIS A NE2   1 
ATOM   4202 N  N     . GLU C 3 493 ? 31.249 11.700  -5.106  1.00 23.77  ? 499  GLU A N     1 
ATOM   4203 C  CA    . GLU C 3 493 ? 30.516 12.946  -5.351  1.00 24.78  ? 499  GLU A CA    1 
ATOM   4204 C  C     . GLU C 3 493 ? 31.456 14.111  -5.662  1.00 23.23  ? 499  GLU A C     1 
ATOM   4205 O  O     . GLU C 3 493 ? 31.137 14.965  -6.486  1.00 27.58  ? 499  GLU A O     1 
ATOM   4206 C  CB    . GLU C 3 493 ? 29.680 13.318  -4.118  1.00 37.06  ? 499  GLU A CB    1 
ATOM   4207 C  CG    . GLU C 3 493 ? 28.955 14.674  -4.213  1.00 50.42  ? 499  GLU A CG    1 
ATOM   4208 C  CD    . GLU C 3 493 ? 28.802 15.384  -2.858  1.00 54.50  ? 499  GLU A CD    1 
ATOM   4209 O  OE1   . GLU C 3 493 ? 28.185 14.803  -1.932  1.00 51.46  ? 499  GLU A OE1   1 
ATOM   4210 O  OE2   . GLU C 3 493 ? 29.300 16.532  -2.726  1.00 54.05  ? 499  GLU A OE2   1 
ATOM   4211 N  N     . ILE C 3 494 ? 32.622 14.119  -5.017  1.00 20.94  ? 500  ILE A N     1 
ATOM   4212 C  CA    . ILE C 3 494 ? 33.598 15.190  -5.182  1.00 22.36  ? 500  ILE A CA    1 
ATOM   4213 C  C     . ILE C 3 494 ? 34.097 15.385  -6.609  1.00 29.33  ? 500  ILE A C     1 
ATOM   4214 O  O     . ILE C 3 494 ? 34.410 16.508  -7.009  1.00 29.48  ? 500  ILE A O     1 
ATOM   4215 C  CB    . ILE C 3 494 ? 34.799 15.033  -4.192  1.00 19.59  ? 500  ILE A CB    1 
ATOM   4216 C  CG1   . ILE C 3 494 ? 35.483 16.387  -3.984  1.00 21.17  ? 500  ILE A CG1   1 
ATOM   4217 C  CG2   . ILE C 3 494 ? 35.811 14.009  -4.711  1.00 21.98  ? 500  ILE A CG2   1 
ATOM   4218 C  CD1   . ILE C 3 494 ? 36.533 16.390  -2.910  1.00 19.43  ? 500  ILE A CD1   1 
ATOM   4219 N  N     . LEU C 3 495 ? 34.155 14.304  -7.382  1.00 33.53  ? 501  LEU A N     1 
ATOM   4220 C  CA    . LEU C 3 495 ? 34.615 14.415  -8.760  1.00 36.90  ? 501  LEU A CA    1 
ATOM   4221 C  C     . LEU C 3 495 ? 33.497 14.507  -9.805  1.00 33.62  ? 501  LEU A C     1 
ATOM   4222 O  O     . LEU C 3 495 ? 33.704 14.254  -10.991 1.00 25.63  ? 501  LEU A O     1 
ATOM   4223 C  CB    . LEU C 3 495 ? 35.658 13.330  -9.084  1.00 36.35  ? 501  LEU A CB    1 
ATOM   4224 C  CG    . LEU C 3 495 ? 35.598 11.914  -8.511  1.00 32.71  ? 501  LEU A CG    1 
ATOM   4225 C  CD1   . LEU C 3 495 ? 34.561 11.070  -9.237  1.00 35.99  ? 501  LEU A CD1   1 
ATOM   4226 C  CD2   . LEU C 3 495 ? 36.971 11.295  -8.669  1.00 28.40  ? 501  LEU A CD2   1 
ATOM   4227 N  N     . ASN C 3 496 ? 32.315 14.903  -9.341  1.00 26.59  ? 502  ASN A N     1 
ATOM   4228 C  CA    . ASN C 3 496 ? 31.150 15.085  -10.200 1.00 34.26  ? 502  ASN A CA    1 
ATOM   4229 C  C     . ASN C 3 496 ? 31.252 16.560  -10.575 1.00 31.09  ? 502  ASN A C     1 
ATOM   4230 O  O     . ASN C 3 496 ? 30.566 17.417  -10.002 1.00 33.98  ? 502  ASN A O     1 
ATOM   4231 C  CB    . ASN C 3 496 ? 29.861 14.814  -9.412  1.00 37.48  ? 502  ASN A CB    1 
ATOM   4232 C  CG    . ASN C 3 496 ? 28.607 14.987  -10.254 1.00 42.36  ? 502  ASN A CG    1 
ATOM   4233 O  OD1   . ASN C 3 496 ? 28.650 14.920  -11.485 1.00 48.07  ? 502  ASN A OD1   1 
ATOM   4234 N  ND2   . ASN C 3 496 ? 27.481 15.205  -9.589  1.00 45.25  ? 502  ASN A ND2   1 
ATOM   4235 N  N     . GLY C 3 497 ? 32.143 16.840  -11.525 1.00 34.31  ? 503  GLY A N     1 
ATOM   4236 C  CA    . GLY C 3 497 ? 32.387 18.206  -11.957 1.00 35.00  ? 503  GLY A CA    1 
ATOM   4237 C  C     . GLY C 3 497 ? 33.365 18.805  -10.955 1.00 35.50  ? 503  GLY A C     1 
ATOM   4238 O  O     . GLY C 3 497 ? 33.937 18.074  -10.138 1.00 38.67  ? 503  GLY A O     1 
ATOM   4239 N  N     . ASP C 3 498 ? 33.593 20.112  -11.015 1.00 33.56  ? 504  ASP A N     1 
ATOM   4240 C  CA    . ASP C 3 498 ? 34.506 20.744  -10.065 1.00 31.00  ? 504  ASP A CA    1 
ATOM   4241 C  C     . ASP C 3 498 ? 33.760 20.967  -8.753  1.00 30.33  ? 504  ASP A C     1 
ATOM   4242 O  O     . ASP C 3 498 ? 32.634 21.469  -8.752  1.00 29.52  ? 504  ASP A O     1 
ATOM   4243 C  CB    . ASP C 3 498 ? 35.034 22.073  -10.598 1.00 27.45  ? 504  ASP A CB    1 
ATOM   4244 C  CG    . ASP C 3 498 ? 36.040 22.710  -9.660  1.00 23.93  ? 504  ASP A CG    1 
ATOM   4245 O  OD1   . ASP C 3 498 ? 37.179 22.210  -9.574  1.00 27.74  ? 504  ASP A OD1   1 
ATOM   4246 O  OD2   . ASP C 3 498 ? 35.688 23.703  -8.998  1.00 30.78  ? 504  ASP A OD2   1 
ATOM   4247 N  N     . ILE C 3 499 ? 34.392 20.596  -7.643  1.00 28.86  ? 505  ILE A N     1 
ATOM   4248 C  CA    . ILE C 3 499 ? 33.783 20.739  -6.323  1.00 23.28  ? 505  ILE A CA    1 
ATOM   4249 C  C     . ILE C 3 499 ? 33.566 22.203  -5.925  1.00 23.00  ? 505  ILE A C     1 
ATOM   4250 O  O     . ILE C 3 499 ? 32.515 22.563  -5.391  1.00 14.96  ? 505  ILE A O     1 
ATOM   4251 C  CB    . ILE C 3 499 ? 34.627 19.978  -5.236  1.00 22.70  ? 505  ILE A CB    1 
ATOM   4252 C  CG1   . ILE C 3 499 ? 33.907 19.971  -3.878  1.00 18.79  ? 505  ILE A CG1   1 
ATOM   4253 C  CG2   . ILE C 3 499 ? 36.027 20.575  -5.120  1.00 13.69  ? 505  ILE A CG2   1 
ATOM   4254 C  CD1   . ILE C 3 499 ? 32.620 19.178  -3.847  1.00 9.36   ? 505  ILE A CD1   1 
ATOM   4255 N  N     . HIS C 3 500 ? 34.541 23.052  -6.228  1.00 24.19  ? 506  HIS A N     1 
ATOM   4256 C  CA    . HIS C 3 500 ? 34.437 24.461  -5.879  1.00 23.13  ? 506  HIS A CA    1 
ATOM   4257 C  C     . HIS C 3 500 ? 33.411 25.224  -6.680  1.00 25.05  ? 506  HIS A C     1 
ATOM   4258 O  O     . HIS C 3 500 ? 32.786 26.140  -6.152  1.00 34.26  ? 506  HIS A O     1 
ATOM   4259 C  CB    . HIS C 3 500 ? 35.804 25.118  -5.948  1.00 19.29  ? 506  HIS A CB    1 
ATOM   4260 C  CG    . HIS C 3 500 ? 36.753 24.579  -4.929  1.00 21.95  ? 506  HIS A CG    1 
ATOM   4261 N  ND1   . HIS C 3 500 ? 36.476 24.611  -3.581  1.00 21.60  ? 506  HIS A ND1   1 
ATOM   4262 C  CD2   . HIS C 3 500 ? 37.951 23.962  -5.054  1.00 21.55  ? 506  HIS A CD2   1 
ATOM   4263 C  CE1   . HIS C 3 500 ? 37.458 24.028  -2.919  1.00 24.49  ? 506  HIS A CE1   1 
ATOM   4264 N  NE2   . HIS C 3 500 ? 38.365 23.628  -3.790  1.00 22.33  ? 506  HIS A NE2   1 
ATOM   4265 N  N     . THR C 3 501 ? 33.218 24.838  -7.939  1.00 25.87  ? 507  THR A N     1 
ATOM   4266 C  CA    . THR C 3 501 ? 32.231 25.495  -8.788  1.00 24.66  ? 507  THR A CA    1 
ATOM   4267 C  C     . THR C 3 501 ? 30.851 24.971  -8.389  1.00 25.81  ? 507  THR A C     1 
ATOM   4268 O  O     . THR C 3 501 ? 29.866 25.697  -8.467  1.00 25.01  ? 507  THR A O     1 
ATOM   4269 C  CB    . THR C 3 501 ? 32.473 25.217  -10.288 1.00 27.67  ? 507  THR A CB    1 
ATOM   4270 O  OG1   . THR C 3 501 ? 33.824 25.548  -10.632 1.00 29.60  ? 507  THR A OG1   1 
ATOM   4271 C  CG2   . THR C 3 501 ? 31.539 26.065  -11.132 1.00 22.83  ? 507  THR A CG2   1 
ATOM   4272 N  N     . LYS C 3 502 ? 30.794 23.713  -7.945  1.00 26.53  ? 508  LYS A N     1 
ATOM   4273 C  CA    . LYS C 3 502 ? 29.535 23.091  -7.521  1.00 26.77  ? 508  LYS A CA    1 
ATOM   4274 C  C     . LYS C 3 502 ? 29.080 23.681  -6.177  1.00 25.85  ? 508  LYS A C     1 
ATOM   4275 O  O     . LYS C 3 502 ? 27.883 23.863  -5.943  1.00 27.59  ? 508  LYS A O     1 
ATOM   4276 C  CB    . LYS C 3 502 ? 29.695 21.564  -7.423  1.00 24.76  ? 508  LYS A CB    1 
ATOM   4277 C  CG    . LYS C 3 502 ? 28.387 20.798  -7.305  1.00 27.68  ? 508  LYS A CG    1 
ATOM   4278 C  CD    . LYS C 3 502 ? 28.571 19.284  -7.491  1.00 34.12  ? 508  LYS A CD    1 
ATOM   4279 C  CE    . LYS C 3 502 ? 28.617 18.499  -6.178  1.00 33.92  ? 508  LYS A CE    1 
ATOM   4280 N  NZ    . LYS C 3 502 ? 29.790 18.802  -5.319  1.00 36.21  ? 508  LYS A NZ    1 
ATOM   4281 N  N     . ASN C 3 503 ? 30.044 23.985  -5.306  1.00 25.94  ? 509  ASN A N     1 
ATOM   4282 C  CA    . ASN C 3 503 ? 29.764 24.575  -3.995  1.00 23.65  ? 509  ASN A CA    1 
ATOM   4283 C  C     . ASN C 3 503 ? 29.423 26.056  -4.124  1.00 20.23  ? 509  ASN A C     1 
ATOM   4284 O  O     . ASN C 3 503 ? 28.561 26.563  -3.410  1.00 23.61  ? 509  ASN A O     1 
ATOM   4285 C  CB    . ASN C 3 503 ? 30.963 24.426  -3.056  1.00 21.49  ? 509  ASN A CB    1 
ATOM   4286 C  CG    . ASN C 3 503 ? 31.113 23.020  -2.508  1.00 21.69  ? 509  ASN A CG    1 
ATOM   4287 O  OD1   . ASN C 3 503 ? 30.168 22.232  -2.500  1.00 17.06  ? 509  ASN A OD1   1 
ATOM   4288 N  ND2   . ASN C 3 503 ? 32.303 22.711  -2.019  1.00 20.53  ? 509  ASN A ND2   1 
ATOM   4289 N  N     . GLN C 3 504 ? 30.128 26.742  -5.023  1.00 19.68  ? 510  GLN A N     1 
ATOM   4290 C  CA    . GLN C 3 504 ? 29.919 28.166  -5.276  1.00 18.76  ? 510  GLN A CA    1 
ATOM   4291 C  C     . GLN C 3 504 ? 28.448 28.433  -5.574  1.00 20.66  ? 510  GLN A C     1 
ATOM   4292 O  O     . GLN C 3 504 ? 27.809 29.236  -4.904  1.00 28.35  ? 510  GLN A O     1 
ATOM   4293 C  CB    . GLN C 3 504 ? 30.772 28.615  -6.470  1.00 26.31  ? 510  GLN A CB    1 
ATOM   4294 C  CG    . GLN C 3 504 ? 30.507 30.046  -6.950  1.00 29.75  ? 510  GLN A CG    1 
ATOM   4295 C  CD    . GLN C 3 504 ? 31.214 30.386  -8.256  1.00 27.70  ? 510  GLN A CD    1 
ATOM   4296 O  OE1   . GLN C 3 504 ? 31.889 29.548  -8.852  1.00 29.37  ? 510  GLN A OE1   1 
ATOM   4297 N  NE2   . GLN C 3 504 ? 31.064 31.628  -8.701  1.00 30.12  ? 510  GLN A NE2   1 
ATOM   4298 N  N     . ILE C 3 505 ? 27.922 27.721  -6.569  1.00 23.17  ? 511  ILE A N     1 
ATOM   4299 C  CA    . ILE C 3 505 ? 26.531 27.840  -7.010  1.00 24.92  ? 511  ILE A CA    1 
ATOM   4300 C  C     . ILE C 3 505 ? 25.554 27.484  -5.887  1.00 26.67  ? 511  ILE A C     1 
ATOM   4301 O  O     . ILE C 3 505 ? 24.624 28.241  -5.596  1.00 26.36  ? 511  ILE A O     1 
ATOM   4302 C  CB    . ILE C 3 505 ? 26.293 26.934  -8.260  1.00 25.91  ? 511  ILE A CB    1 
ATOM   4303 C  CG1   . ILE C 3 505 ? 27.217 27.395  -9.402  1.00 21.39  ? 511  ILE A CG1   1 
ATOM   4304 C  CG2   . ILE C 3 505 ? 24.821 26.965  -8.682  1.00 20.39  ? 511  ILE A CG2   1 
ATOM   4305 C  CD1   . ILE C 3 505 ? 27.265 26.471  -10.612 1.00 24.38  ? 511  ILE A CD1   1 
ATOM   4306 N  N     . ALA C 3 506 ? 25.801 26.346  -5.244  1.00 26.13  ? 512  ALA A N     1 
ATOM   4307 C  CA    . ALA C 3 506 ? 24.973 25.857  -4.148  1.00 25.94  ? 512  ALA A CA    1 
ATOM   4308 C  C     . ALA C 3 506 ? 24.864 26.858  -3.002  1.00 28.16  ? 512  ALA A C     1 
ATOM   4309 O  O     . ALA C 3 506 ? 23.789 27.037  -2.425  1.00 24.74  ? 512  ALA A O     1 
ATOM   4310 C  CB    . ALA C 3 506 ? 25.539 24.539  -3.627  1.00 29.52  ? 512  ALA A CB    1 
ATOM   4311 N  N     . ALA C 3 507 ? 25.980 27.515  -2.693  1.00 30.28  ? 513  ALA A N     1 
ATOM   4312 C  CA    . ALA C 3 507 ? 26.042 28.492  -1.612  1.00 29.48  ? 513  ALA A CA    1 
ATOM   4313 C  C     . ALA C 3 507 ? 25.687 29.898  -2.068  1.00 30.04  ? 513  ALA A C     1 
ATOM   4314 O  O     . ALA C 3 507 ? 25.573 30.804  -1.241  1.00 31.85  ? 513  ALA A O     1 
ATOM   4315 C  CB    . ALA C 3 507 ? 27.428 28.477  -0.973  1.00 29.44  ? 513  ALA A CB    1 
ATOM   4316 N  N     . GLU C 3 508 ? 25.511 30.067  -3.381  1.00 41.00  ? 514  GLU A N     1 
ATOM   4317 C  CA    . GLU C 3 508 ? 25.164 31.354  -3.993  1.00 48.88  ? 514  GLU A CA    1 
ATOM   4318 C  C     . GLU C 3 508 ? 26.278 32.391  -3.794  1.00 47.08  ? 514  GLU A C     1 
ATOM   4319 O  O     . GLU C 3 508 ? 26.041 33.519  -3.354  1.00 53.49  ? 514  GLU A O     1 
ATOM   4320 C  CB    . GLU C 3 508 ? 23.818 31.855  -3.437  1.00 53.83  ? 514  GLU A CB    1 
ATOM   4321 C  CG    . GLU C 3 508 ? 22.662 30.879  -3.673  1.00 60.23  ? 514  GLU A CG    1 
ATOM   4322 C  CD    . GLU C 3 508 ? 21.420 31.214  -2.868  1.00 61.80  ? 514  GLU A CD    1 
ATOM   4323 O  OE1   . GLU C 3 508 ? 20.580 31.987  -3.367  1.00 62.64  ? 514  GLU A OE1   1 
ATOM   4324 O  OE2   . GLU C 3 508 ? 21.277 30.694  -1.741  1.00 52.92  ? 514  GLU A OE2   1 
ATOM   4325 N  N     . LEU C 3 509 ? 27.498 31.985  -4.130  1.00 35.93  ? 515  LEU A N     1 
ATOM   4326 C  CA    . LEU C 3 509 ? 28.678 32.833  -4.006  1.00 31.21  ? 515  LEU A CA    1 
ATOM   4327 C  C     . LEU C 3 509 ? 29.094 33.442  -5.349  1.00 31.91  ? 515  LEU A C     1 
ATOM   4328 O  O     . LEU C 3 509 ? 28.916 32.826  -6.405  1.00 27.74  ? 515  LEU A O     1 
ATOM   4329 C  CB    . LEU C 3 509 ? 29.827 32.025  -3.395  1.00 26.94  ? 515  LEU A CB    1 
ATOM   4330 C  CG    . LEU C 3 509 ? 29.518 31.506  -1.988  1.00 22.67  ? 515  LEU A CG    1 
ATOM   4331 C  CD1   . LEU C 3 509 ? 30.682 30.697  -1.462  1.00 20.37  ? 515  LEU A CD1   1 
ATOM   4332 C  CD2   . LEU C 3 509 ? 29.223 32.679  -1.065  1.00 16.79  ? 515  LEU A CD2   1 
ATOM   4333 N  N     . PRO C 3 510 ? 29.652 34.668  -5.321  1.00 30.70  ? 516  PRO A N     1 
ATOM   4334 C  CA    . PRO C 3 510 ? 30.099 35.391  -6.517  1.00 31.50  ? 516  PRO A CA    1 
ATOM   4335 C  C     . PRO C 3 510 ? 31.244 34.771  -7.320  1.00 36.54  ? 516  PRO A C     1 
ATOM   4336 O  O     . PRO C 3 510 ? 31.206 34.772  -8.555  1.00 32.52  ? 516  PRO A O     1 
ATOM   4337 C  CB    . PRO C 3 510 ? 30.464 36.769  -5.957  1.00 26.46  ? 516  PRO A CB    1 
ATOM   4338 C  CG    . PRO C 3 510 ? 30.941 36.447  -4.573  1.00 30.46  ? 516  PRO A CG    1 
ATOM   4339 C  CD    . PRO C 3 510 ? 29.874 35.488  -4.115  1.00 26.63  ? 516  PRO A CD    1 
ATOM   4340 N  N     . THR C 3 511 ? 32.258 34.253  -6.628  1.00 38.48  ? 517  THR A N     1 
ATOM   4341 C  CA    . THR C 3 511 ? 33.407 33.644  -7.294  1.00 34.60  ? 517  THR A CA    1 
ATOM   4342 C  C     . THR C 3 511 ? 33.723 32.232  -6.806  1.00 36.17  ? 517  THR A C     1 
ATOM   4343 O  O     . THR C 3 511 ? 33.185 31.768  -5.798  1.00 30.72  ? 517  THR A O     1 
ATOM   4344 C  CB    . THR C 3 511 ? 34.679 34.500  -7.132  1.00 26.22  ? 517  THR A CB    1 
ATOM   4345 O  OG1   . THR C 3 511 ? 34.955 34.691  -5.740  1.00 29.83  ? 517  THR A OG1   1 
ATOM   4346 C  CG2   . THR C 3 511 ? 34.511 35.848  -7.807  1.00 24.79  ? 517  THR A CG2   1 
ATOM   4347 N  N     . ARG C 3 512 ? 34.607 31.562  -7.540  1.00 29.49  ? 518  ARG A N     1 
ATOM   4348 C  CA    . ARG C 3 512 ? 35.026 30.208  -7.216  1.00 22.67  ? 518  ARG A CA    1 
ATOM   4349 C  C     . ARG C 3 512 ? 36.076 30.281  -6.120  1.00 26.99  ? 518  ARG A C     1 
ATOM   4350 O  O     . ARG C 3 512 ? 36.246 29.333  -5.355  1.00 24.05  ? 518  ARG A O     1 
ATOM   4351 C  CB    . ARG C 3 512 ? 35.602 29.527  -8.456  1.00 25.54  ? 518  ARG A CB    1 
ATOM   4352 C  CG    . ARG C 3 512 ? 36.091 28.116  -8.214  1.00 22.49  ? 518  ARG A CG    1 
ATOM   4353 C  CD    . ARG C 3 512 ? 36.652 27.502  -9.483  1.00 23.43  ? 518  ARG A CD    1 
ATOM   4354 N  NE    . ARG C 3 512 ? 37.153 26.155  -9.234  1.00 26.10  ? 518  ARG A NE    1 
ATOM   4355 C  CZ    . ARG C 3 512 ? 38.330 25.882  -8.677  1.00 27.98  ? 518  ARG A CZ    1 
ATOM   4356 N  NH1   . ARG C 3 512 ? 39.143 26.870  -8.314  1.00 21.38  ? 518  ARG A NH1   1 
ATOM   4357 N  NH2   . ARG C 3 512 ? 38.684 24.622  -8.455  1.00 21.11  ? 518  ARG A NH2   1 
ATOM   4358 N  N     . ASP C 3 513 ? 36.793 31.404  -6.071  1.00 28.63  ? 519  ASP A N     1 
ATOM   4359 C  CA    . ASP C 3 513 ? 37.818 31.628  -5.061  1.00 28.34  ? 519  ASP A CA    1 
ATOM   4360 C  C     . ASP C 3 513 ? 37.119 31.822  -3.720  1.00 23.24  ? 519  ASP A C     1 
ATOM   4361 O  O     . ASP C 3 513 ? 37.602 31.362  -2.692  1.00 18.87  ? 519  ASP A O     1 
ATOM   4362 C  CB    . ASP C 3 513 ? 38.667 32.865  -5.405  1.00 28.92  ? 519  ASP A CB    1 
ATOM   4363 C  CG    . ASP C 3 513 ? 39.733 32.587  -6.472  1.00 34.85  ? 519  ASP A CG    1 
ATOM   4364 O  OD1   . ASP C 3 513 ? 39.942 31.414  -6.865  1.00 27.53  ? 519  ASP A OD1   1 
ATOM   4365 O  OD2   . ASP C 3 513 ? 40.380 33.561  -6.913  1.00 34.98  ? 519  ASP A OD2   1 
ATOM   4366 N  N     . ASN C 3 514 ? 35.963 32.480  -3.752  1.00 21.07  ? 520  ASN A N     1 
ATOM   4367 C  CA    . ASN C 3 514 ? 35.175 32.736  -2.552  1.00 24.13  ? 520  ASN A CA    1 
ATOM   4368 C  C     . ASN C 3 514 ? 34.567 31.427  -2.023  1.00 24.31  ? 520  ASN A C     1 
ATOM   4369 O  O     . ASN C 3 514 ? 34.312 31.294  -0.823  1.00 33.03  ? 520  ASN A O     1 
ATOM   4370 C  CB    . ASN C 3 514 ? 34.075 33.771  -2.851  1.00 29.70  ? 520  ASN A CB    1 
ATOM   4371 C  CG    . ASN C 3 514 ? 33.322 34.224  -1.599  1.00 34.58  ? 520  ASN A CG    1 
ATOM   4372 O  OD1   . ASN C 3 514 ? 32.094 34.331  -1.601  1.00 37.31  ? 520  ASN A OD1   1 
ATOM   4373 N  ND2   . ASN C 3 514 ? 34.059 34.500  -0.530  1.00 36.50  ? 520  ASN A ND2   1 
ATOM   4374 N  N     . ALA C 3 515 ? 34.342 30.466  -2.921  1.00 26.25  ? 521  ALA A N     1 
ATOM   4375 C  CA    . ALA C 3 515 ? 33.776 29.169  -2.536  1.00 22.92  ? 521  ALA A CA    1 
ATOM   4376 C  C     . ALA C 3 515 ? 34.840 28.354  -1.830  1.00 20.34  ? 521  ALA A C     1 
ATOM   4377 O  O     . ALA C 3 515 ? 34.535 27.602  -0.912  1.00 21.17  ? 521  ALA A O     1 
ATOM   4378 C  CB    . ALA C 3 515 ? 33.263 28.416  -3.759  1.00 16.82  ? 521  ALA A CB    1 
ATOM   4379 N  N     . LYS C 3 516 ? 36.088 28.526  -2.267  1.00 21.79  ? 522  LYS A N     1 
ATOM   4380 C  CA    . LYS C 3 516 ? 37.236 27.827  -1.695  1.00 24.57  ? 522  LYS A CA    1 
ATOM   4381 C  C     . LYS C 3 516 ? 37.477 28.298  -0.270  1.00 25.17  ? 522  LYS A C     1 
ATOM   4382 O  O     . LYS C 3 516 ? 37.576 27.481  0.649   1.00 25.91  ? 522  LYS A O     1 
ATOM   4383 C  CB    . LYS C 3 516 ? 38.488 28.052  -2.559  1.00 20.47  ? 522  LYS A CB    1 
ATOM   4384 C  CG    . LYS C 3 516 ? 38.406 27.381  -3.927  1.00 21.56  ? 522  LYS A CG    1 
ATOM   4385 C  CD    . LYS C 3 516 ? 39.461 27.868  -4.899  1.00 16.24  ? 522  LYS A CD    1 
ATOM   4386 C  CE    . LYS C 3 516 ? 40.860 27.535  -4.461  1.00 19.75  ? 522  LYS A CE    1 
ATOM   4387 N  NZ    . LYS C 3 516 ? 41.848 28.121  -5.416  1.00 17.99  ? 522  LYS A NZ    1 
ATOM   4388 N  N     . THR C 3 517 ? 37.557 29.615  -0.088  1.00 23.56  ? 523  THR A N     1 
ATOM   4389 C  CA    . THR C 3 517 ? 37.774 30.197  1.232   1.00 25.62  ? 523  THR A CA    1 
ATOM   4390 C  C     . THR C 3 517 ? 36.588 29.872  2.156   1.00 26.99  ? 523  THR A C     1 
ATOM   4391 O  O     . THR C 3 517 ? 36.758 29.725  3.378   1.00 27.31  ? 523  THR A O     1 
ATOM   4392 C  CB    . THR C 3 517 ? 38.032 31.735  1.148   1.00 28.06  ? 523  THR A CB    1 
ATOM   4393 O  OG1   . THR C 3 517 ? 38.124 32.284  2.466   1.00 38.88  ? 523  THR A OG1   1 
ATOM   4394 C  CG2   . THR C 3 517 ? 36.925 32.444  0.415   1.00 47.55  ? 523  THR A CG2   1 
ATOM   4395 N  N     . PHE C 3 518 ? 35.400 29.732  1.563   1.00 18.16  ? 524  PHE A N     1 
ATOM   4396 C  CA    . PHE C 3 518 ? 34.201 29.401  2.324   1.00 13.73  ? 524  PHE A CA    1 
ATOM   4397 C  C     . PHE C 3 518 ? 34.216 27.960  2.818   1.00 17.64  ? 524  PHE A C     1 
ATOM   4398 O  O     . PHE C 3 518 ? 33.961 27.697  3.991   1.00 21.99  ? 524  PHE A O     1 
ATOM   4399 C  CB    . PHE C 3 518 ? 32.923 29.588  1.495   1.00 13.92  ? 524  PHE A CB    1 
ATOM   4400 C  CG    . PHE C 3 518 ? 31.743 28.828  2.050   1.00 22.38  ? 524  PHE A CG    1 
ATOM   4401 C  CD1   . PHE C 3 518 ? 31.132 29.228  3.244   1.00 25.52  ? 524  PHE A CD1   1 
ATOM   4402 C  CD2   . PHE C 3 518 ? 31.295 27.661  1.429   1.00 25.84  ? 524  PHE A CD2   1 
ATOM   4403 C  CE1   . PHE C 3 518 ? 30.096 28.473  3.812   1.00 21.52  ? 524  PHE A CE1   1 
ATOM   4404 C  CE2   . PHE C 3 518 ? 30.260 26.901  1.990   1.00 21.51  ? 524  PHE A CE2   1 
ATOM   4405 C  CZ    . PHE C 3 518 ? 29.663 27.309  3.184   1.00 23.35  ? 524  PHE A CZ    1 
ATOM   4406 N  N     . ILE C 3 519 ? 34.464 27.032  1.899   1.00 17.62  ? 525  ILE A N     1 
ATOM   4407 C  CA    . ILE C 3 519 ? 34.468 25.613  2.222   1.00 16.78  ? 525  ILE A CA    1 
ATOM   4408 C  C     . ILE C 3 519 ? 35.553 25.218  3.225   1.00 16.15  ? 525  ILE A C     1 
ATOM   4409 O  O     . ILE C 3 519 ? 35.313 24.387  4.096   1.00 19.38  ? 525  ILE A O     1 
ATOM   4410 C  CB    . ILE C 3 519 ? 34.515 24.757  0.925   1.00 11.61  ? 525  ILE A CB    1 
ATOM   4411 C  CG1   . ILE C 3 519 ? 33.931 23.373  1.199   1.00 21.07  ? 525  ILE A CG1   1 
ATOM   4412 C  CG2   . ILE C 3 519 ? 35.926 24.690  0.357   1.00 7.78   ? 525  ILE A CG2   1 
ATOM   4413 C  CD1   . ILE C 3 519 ? 32.461 23.405  1.589   1.00 11.23  ? 525  ILE A CD1   1 
ATOM   4414 N  N     . TYR C 3 520 ? 36.725 25.843  3.134   1.00 17.91  ? 526  TYR A N     1 
ATOM   4415 C  CA    . TYR C 3 520 ? 37.816 25.543  4.057   1.00 17.32  ? 526  TYR A CA    1 
ATOM   4416 C  C     . TYR C 3 520 ? 37.609 26.256  5.384   1.00 16.38  ? 526  TYR A C     1 
ATOM   4417 O  O     . TYR C 3 520 ? 37.993 25.742  6.431   1.00 20.88  ? 526  TYR A O     1 
ATOM   4418 C  CB    . TYR C 3 520 ? 39.184 25.874  3.434   1.00 14.15  ? 526  TYR A CB    1 
ATOM   4419 C  CG    . TYR C 3 520 ? 39.579 24.873  2.362   1.00 15.55  ? 526  TYR A CG    1 
ATOM   4420 C  CD1   . TYR C 3 520 ? 39.624 23.510  2.651   1.00 9.88   ? 526  TYR A CD1   1 
ATOM   4421 C  CD2   . TYR C 3 520 ? 39.833 25.279  1.046   1.00 16.73  ? 526  TYR A CD2   1 
ATOM   4422 C  CE1   . TYR C 3 520 ? 39.900 22.568  1.663   1.00 13.13  ? 526  TYR A CE1   1 
ATOM   4423 C  CE2   . TYR C 3 520 ? 40.113 24.346  0.044   1.00 11.02  ? 526  TYR A CE2   1 
ATOM   4424 C  CZ    . TYR C 3 520 ? 40.142 22.990  0.363   1.00 18.03  ? 526  TYR A CZ    1 
ATOM   4425 O  OH    . TYR C 3 520 ? 40.399 22.049  -0.606  1.00 15.85  ? 526  TYR A OH    1 
ATOM   4426 N  N     . GLY C 3 521 ? 36.985 27.430  5.337   1.00 17.60  ? 527  GLY A N     1 
ATOM   4427 C  CA    . GLY C 3 521 ? 36.710 28.172  6.554   1.00 9.32   ? 527  GLY A CA    1 
ATOM   4428 C  C     . GLY C 3 521 ? 35.744 27.343  7.381   1.00 12.38  ? 527  GLY A C     1 
ATOM   4429 O  O     . GLY C 3 521 ? 35.968 27.105  8.568   1.00 12.48  ? 527  GLY A O     1 
ATOM   4430 N  N     . PHE C 3 522 ? 34.696 26.864  6.712   1.00 13.08  ? 528  PHE A N     1 
ATOM   4431 C  CA    . PHE C 3 522 ? 33.650 26.034  7.305   1.00 17.50  ? 528  PHE A CA    1 
ATOM   4432 C  C     . PHE C 3 522 ? 34.209 24.714  7.840   1.00 18.90  ? 528  PHE A C     1 
ATOM   4433 O  O     . PHE C 3 522 ? 34.080 24.408  9.024   1.00 19.00  ? 528  PHE A O     1 
ATOM   4434 C  CB    . PHE C 3 522 ? 32.553 25.772  6.251   1.00 17.41  ? 528  PHE A CB    1 
ATOM   4435 C  CG    . PHE C 3 522 ? 31.783 24.493  6.461   1.00 16.99  ? 528  PHE A CG    1 
ATOM   4436 C  CD1   . PHE C 3 522 ? 30.808 24.400  7.453   1.00 14.71  ? 528  PHE A CD1   1 
ATOM   4437 C  CD2   . PHE C 3 522 ? 32.049 23.374  5.671   1.00 12.55  ? 528  PHE A CD2   1 
ATOM   4438 C  CE1   . PHE C 3 522 ? 30.105 23.207  7.658   1.00 13.18  ? 528  PHE A CE1   1 
ATOM   4439 C  CE2   . PHE C 3 522 ? 31.354 22.179  5.865   1.00 17.33  ? 528  PHE A CE2   1 
ATOM   4440 C  CZ    . PHE C 3 522 ? 30.378 22.094  6.865   1.00 13.77  ? 528  PHE A CZ    1 
ATOM   4441 N  N     . LEU C 3 523 ? 34.827 23.943  6.952   1.00 19.74  ? 529  LEU A N     1 
ATOM   4442 C  CA    . LEU C 3 523 ? 35.402 22.653  7.304   1.00 19.79  ? 529  LEU A CA    1 
ATOM   4443 C  C     . LEU C 3 523 ? 36.291 22.712  8.549   1.00 23.37  ? 529  LEU A C     1 
ATOM   4444 O  O     . LEU C 3 523 ? 36.236 21.822  9.397   1.00 22.05  ? 529  LEU A O     1 
ATOM   4445 C  CB    . LEU C 3 523 ? 36.197 22.105  6.114   1.00 16.76  ? 529  LEU A CB    1 
ATOM   4446 C  CG    . LEU C 3 523 ? 36.919 20.772  6.303   1.00 13.53  ? 529  LEU A CG    1 
ATOM   4447 C  CD1   . LEU C 3 523 ? 35.923 19.699  6.714   1.00 19.54  ? 529  LEU A CD1   1 
ATOM   4448 C  CD2   . LEU C 3 523 ? 37.624 20.383  5.013   1.00 16.22  ? 529  LEU A CD2   1 
ATOM   4449 N  N     . TYR C 3 524 ? 37.064 23.786  8.681   1.00 25.00  ? 530  TYR A N     1 
ATOM   4450 C  CA    . TYR C 3 524 ? 37.971 23.939  9.810   1.00 23.37  ? 530  TYR A CA    1 
ATOM   4451 C  C     . TYR C 3 524 ? 37.474 24.706  11.035  1.00 23.82  ? 530  TYR A C     1 
ATOM   4452 O  O     . TYR C 3 524 ? 38.262 25.344  11.733  1.00 23.50  ? 530  TYR A O     1 
ATOM   4453 C  CB    . TYR C 3 524 ? 39.304 24.487  9.313   1.00 15.01  ? 530  TYR A CB    1 
ATOM   4454 C  CG    . TYR C 3 524 ? 39.925 23.580  8.288   1.00 15.09  ? 530  TYR A CG    1 
ATOM   4455 C  CD1   . TYR C 3 524 ? 39.999 22.198  8.505   1.00 16.26  ? 530  TYR A CD1   1 
ATOM   4456 C  CD2   . TYR C 3 524 ? 40.435 24.089  7.099   1.00 14.07  ? 530  TYR A CD2   1 
ATOM   4457 C  CE1   . TYR C 3 524 ? 40.568 21.347  7.562   1.00 9.55   ? 530  TYR A CE1   1 
ATOM   4458 C  CE2   . TYR C 3 524 ? 41.007 23.249  6.144   1.00 20.53  ? 530  TYR A CE2   1 
ATOM   4459 C  CZ    . TYR C 3 524 ? 41.072 21.876  6.382   1.00 21.23  ? 530  TYR A CZ    1 
ATOM   4460 O  OH    . TYR C 3 524 ? 41.643 21.049  5.438   1.00 15.56  ? 530  TYR A OH    1 
ATOM   4461 N  N     . GLY C 3 525 ? 36.163 24.643  11.273  1.00 22.98  ? 531  GLY A N     1 
ATOM   4462 C  CA    . GLY C 3 525 ? 35.552 25.275  12.431  1.00 21.64  ? 531  GLY A CA    1 
ATOM   4463 C  C     . GLY C 3 525 ? 35.328 26.769  12.562  1.00 27.05  ? 531  GLY A C     1 
ATOM   4464 O  O     . GLY C 3 525 ? 35.372 27.291  13.676  1.00 21.45  ? 531  GLY A O     1 
ATOM   4465 N  N     . ALA C 3 526 ? 35.072 27.464  11.459  1.00 34.02  ? 532  ALA A N     1 
ATOM   4466 C  CA    . ALA C 3 526 ? 34.824 28.901  11.536  1.00 31.35  ? 532  ALA A CA    1 
ATOM   4467 C  C     . ALA C 3 526 ? 33.455 29.135  12.169  1.00 29.00  ? 532  ALA A C     1 
ATOM   4468 O  O     . ALA C 3 526 ? 32.521 28.366  11.943  1.00 24.49  ? 532  ALA A O     1 
ATOM   4469 C  CB    . ALA C 3 526 ? 34.877 29.530  10.155  1.00 17.67  ? 532  ALA A CB    1 
ATOM   4470 N  N     . GLY C 3 527 ? 33.351 30.189  12.975  1.00 28.73  ? 533  GLY A N     1 
ATOM   4471 C  CA    . GLY C 3 527 ? 32.099 30.521  13.632  1.00 25.56  ? 533  GLY A CA    1 
ATOM   4472 C  C     . GLY C 3 527 ? 31.113 31.067  12.619  1.00 28.57  ? 533  GLY A C     1 
ATOM   4473 O  O     . GLY C 3 527 ? 31.476 31.296  11.464  1.00 30.44  ? 533  GLY A O     1 
ATOM   4474 N  N     . ASP C 3 528 ? 29.873 31.288  13.044  1.00 27.97  ? 534  ASP A N     1 
ATOM   4475 C  CA    . ASP C 3 528 ? 28.840 31.808  12.148  1.00 27.26  ? 534  ASP A CA    1 
ATOM   4476 C  C     . ASP C 3 528 ? 29.213 33.167  11.567  1.00 23.87  ? 534  ASP A C     1 
ATOM   4477 O  O     . ASP C 3 528 ? 29.087 33.393  10.361  1.00 22.52  ? 534  ASP A O     1 
ATOM   4478 C  CB    . ASP C 3 528 ? 27.499 31.917  12.880  1.00 26.91  ? 534  ASP A CB    1 
ATOM   4479 C  CG    . ASP C 3 528 ? 27.010 30.585  13.413  1.00 29.91  ? 534  ASP A CG    1 
ATOM   4480 O  OD1   . ASP C 3 528 ? 27.210 29.553  12.738  1.00 33.55  ? 534  ASP A OD1   1 
ATOM   4481 O  OD2   . ASP C 3 528 ? 26.411 30.574  14.510  1.00 37.17  ? 534  ASP A OD2   1 
ATOM   4482 N  N     . GLU C 3 529 ? 29.693 34.059  12.431  1.00 25.29  ? 535  GLU A N     1 
ATOM   4483 C  CA    . GLU C 3 529 ? 30.085 35.398  12.018  1.00 30.15  ? 535  GLU A CA    1 
ATOM   4484 C  C     . GLU C 3 529 ? 31.276 35.369  11.066  1.00 27.73  ? 535  GLU A C     1 
ATOM   4485 O  O     . GLU C 3 529 ? 31.329 36.156  10.119  1.00 33.94  ? 535  GLU A O     1 
ATOM   4486 C  CB    . GLU C 3 529 ? 30.406 36.263  13.239  1.00 40.81  ? 535  GLU A CB    1 
ATOM   4487 C  CG    . GLU C 3 529 ? 30.647 37.735  12.905  1.00 58.54  ? 535  GLU A CG    1 
ATOM   4488 C  CD    . GLU C 3 529 ? 30.899 38.589  14.133  1.00 59.95  ? 535  GLU A CD    1 
ATOM   4489 O  OE1   . GLU C 3 529 ? 30.006 38.660  15.003  1.00 65.80  ? 535  GLU A OE1   1 
ATOM   4490 O  OE2   . GLU C 3 529 ? 31.987 39.197  14.226  1.00 63.67  ? 535  GLU A OE2   1 
ATOM   4491 N  N     . LYS C 3 530 ? 32.218 34.456  11.312  1.00 27.26  ? 536  LYS A N     1 
ATOM   4492 C  CA    . LYS C 3 530 ? 33.407 34.330  10.472  1.00 25.86  ? 536  LYS A CA    1 
ATOM   4493 C  C     . LYS C 3 530 ? 32.990 33.891  9.070   1.00 27.36  ? 536  LYS A C     1 
ATOM   4494 O  O     . LYS C 3 530 ? 33.455 34.458  8.080   1.00 27.44  ? 536  LYS A O     1 
ATOM   4495 C  CB    . LYS C 3 530 ? 34.400 33.336  11.074  1.00 31.18  ? 536  LYS A CB    1 
ATOM   4496 C  CG    . LYS C 3 530 ? 35.823 33.503  10.556  1.00 41.22  ? 536  LYS A CG    1 
ATOM   4497 C  CD    . LYS C 3 530 ? 36.380 34.865  10.954  1.00 42.58  ? 536  LYS A CD    1 
ATOM   4498 C  CE    . LYS C 3 530 ? 37.821 35.041  10.515  1.00 43.46  ? 536  LYS A CE    1 
ATOM   4499 N  NZ    . LYS C 3 530 ? 38.394 36.347  10.973  1.00 40.27  ? 536  LYS A NZ    1 
ATOM   4500 N  N     . ILE C 3 531 ? 32.087 32.909  8.999   1.00 25.94  ? 537  ILE A N     1 
ATOM   4501 C  CA    . ILE C 3 531 ? 31.573 32.403  7.723   1.00 28.71  ? 537  ILE A CA    1 
ATOM   4502 C  C     . ILE C 3 531 ? 30.781 33.515  7.029   1.00 30.88  ? 537  ILE A C     1 
ATOM   4503 O  O     . ILE C 3 531 ? 30.715 33.573  5.800   1.00 27.81  ? 537  ILE A O     1 
ATOM   4504 C  CB    . ILE C 3 531 ? 30.667 31.159  7.929   1.00 31.58  ? 537  ILE A CB    1 
ATOM   4505 C  CG1   . ILE C 3 531 ? 31.511 29.965  8.381   1.00 27.77  ? 537  ILE A CG1   1 
ATOM   4506 C  CG2   . ILE C 3 531 ? 29.916 30.814  6.648   1.00 31.38  ? 537  ILE A CG2   1 
ATOM   4507 C  CD1   . ILE C 3 531 ? 32.588 29.565  7.391   1.00 39.43  ? 537  ILE A CD1   1 
ATOM   4508 N  N     . GLY C 3 532 ? 30.198 34.404  7.829   1.00 33.50  ? 538  GLY A N     1 
ATOM   4509 C  CA    . GLY C 3 532 ? 29.441 35.513  7.282   1.00 34.63  ? 538  GLY A CA    1 
ATOM   4510 C  C     . GLY C 3 532 ? 30.389 36.497  6.622   1.00 35.81  ? 538  GLY A C     1 
ATOM   4511 O  O     . GLY C 3 532 ? 30.154 36.935  5.500   1.00 26.99  ? 538  GLY A O     1 
ATOM   4512 N  N     . GLN C 3 533 ? 31.490 36.804  7.304   1.00 36.22  ? 539  GLN A N     1 
ATOM   4513 C  CA    . GLN C 3 533 ? 32.487 37.737  6.790   1.00 39.13  ? 539  GLN A CA    1 
ATOM   4514 C  C     . GLN C 3 533 ? 33.046 37.266  5.449   1.00 40.55  ? 539  GLN A C     1 
ATOM   4515 O  O     . GLN C 3 533 ? 33.182 38.065  4.520   1.00 38.66  ? 539  GLN A O     1 
ATOM   4516 C  CB    . GLN C 3 533 ? 33.633 37.903  7.795   1.00 39.16  ? 539  GLN A CB    1 
ATOM   4517 C  CG    . GLN C 3 533 ? 34.657 38.952  7.384   1.00 44.57  ? 539  GLN A CG    1 
ATOM   4518 C  CD    . GLN C 3 533 ? 35.982 38.804  8.108   1.00 47.35  ? 539  GLN A CD    1 
ATOM   4519 O  OE1   . GLN C 3 533 ? 36.171 39.335  9.204   1.00 45.39  ? 539  GLN A OE1   1 
ATOM   4520 N  NE2   . GLN C 3 533 ? 36.915 38.085  7.490   1.00 45.78  ? 539  GLN A NE2   1 
ATOM   4521 N  N     . ILE C 3 534 ? 33.373 35.972  5.364   1.00 43.27  ? 540  ILE A N     1 
ATOM   4522 C  CA    . ILE C 3 534 ? 33.916 35.369  4.143   1.00 37.44  ? 540  ILE A CA    1 
ATOM   4523 C  C     . ILE C 3 534 ? 32.985 35.579  2.945   1.00 35.46  ? 540  ILE A C     1 
ATOM   4524 O  O     . ILE C 3 534 ? 33.429 35.998  1.880   1.00 25.08  ? 540  ILE A O     1 
ATOM   4525 C  CB    . ILE C 3 534 ? 34.188 33.822  4.317   1.00 32.90  ? 540  ILE A CB    1 
ATOM   4526 C  CG1   . ILE C 3 534 ? 35.596 33.561  4.862   1.00 29.57  ? 540  ILE A CG1   1 
ATOM   4527 C  CG2   . ILE C 3 534 ? 34.064 33.082  2.988   1.00 35.84  ? 540  ILE A CG2   1 
ATOM   4528 C  CD1   . ILE C 3 534 ? 35.786 33.886  6.309   1.00 29.72  ? 540  ILE A CD1   1 
ATOM   4529 N  N     . VAL C 3 535 ? 31.692 35.321  3.148   1.00 30.56  ? 541  VAL A N     1 
ATOM   4530 C  CA    . VAL C 3 535 ? 30.692 35.447  2.090   1.00 29.82  ? 541  VAL A CA    1 
ATOM   4531 C  C     . VAL C 3 535 ? 30.050 36.823  1.897   1.00 36.36  ? 541  VAL A C     1 
ATOM   4532 O  O     . VAL C 3 535 ? 29.309 37.032  0.933   1.00 35.08  ? 541  VAL A O     1 
ATOM   4533 C  CB    . VAL C 3 535 ? 29.577 34.381  2.267   1.00 27.64  ? 541  VAL A CB    1 
ATOM   4534 C  CG1   . VAL C 3 535 ? 30.192 32.983  2.268   1.00 27.40  ? 541  VAL A CG1   1 
ATOM   4535 C  CG2   . VAL C 3 535 ? 28.789 34.621  3.557   1.00 27.97  ? 541  VAL A CG2   1 
ATOM   4536 N  N     . GLY C 3 536 ? 30.345 37.756  2.800   1.00 48.27  ? 542  GLY A N     1 
ATOM   4537 C  CA    . GLY C 3 536 ? 29.784 39.095  2.712   1.00 52.48  ? 542  GLY A CA    1 
ATOM   4538 C  C     . GLY C 3 536 ? 28.352 39.167  3.217   1.00 51.69  ? 542  GLY A C     1 
ATOM   4539 O  O     . GLY C 3 536 ? 27.491 39.760  2.566   1.00 60.59  ? 542  GLY A O     1 
ATOM   4540 N  N     . ALA C 3 537 ? 28.105 38.557  4.376   1.00 42.53  ? 543  ALA A N     1 
ATOM   4541 C  CA    . ALA C 3 537 ? 26.788 38.521  5.015   1.00 32.09  ? 543  ALA A CA    1 
ATOM   4542 C  C     . ALA C 3 537 ? 26.957 38.507  6.543   1.00 29.14  ? 543  ALA A C     1 
ATOM   4543 O  O     . ALA C 3 537 ? 28.030 38.841  7.048   1.00 25.69  ? 543  ALA A O     1 
ATOM   4544 C  CB    . ALA C 3 537 ? 26.010 37.292  4.547   1.00 23.36  ? 543  ALA A CB    1 
ATOM   4545 N  N     . GLY C 3 538 ? 25.915 38.114  7.277   1.00 34.53  ? 544  GLY A N     1 
ATOM   4546 C  CA    . GLY C 3 538 ? 26.005 38.090  8.732   1.00 40.46  ? 544  GLY A CA    1 
ATOM   4547 C  C     . GLY C 3 538 ? 26.040 36.720  9.388   1.00 41.90  ? 544  GLY A C     1 
ATOM   4548 O  O     . GLY C 3 538 ? 26.200 35.702  8.712   1.00 53.92  ? 544  GLY A O     1 
ATOM   4549 N  N     . LYS C 3 539 ? 25.896 36.704  10.714  1.00 35.89  ? 545  LYS A N     1 
ATOM   4550 C  CA    . LYS C 3 539 ? 25.905 35.465  11.494  1.00 35.39  ? 545  LYS A CA    1 
ATOM   4551 C  C     . LYS C 3 539 ? 24.711 34.577  11.146  1.00 36.94  ? 545  LYS A C     1 
ATOM   4552 O  O     . LYS C 3 539 ? 24.765 33.358  11.314  1.00 42.07  ? 545  LYS A O     1 
ATOM   4553 C  CB    . LYS C 3 539 ? 25.884 35.773  12.999  1.00 44.91  ? 545  LYS A CB    1 
ATOM   4554 C  CG    . LYS C 3 539 ? 24.648 36.534  13.463  1.00 54.45  ? 545  LYS A CG    1 
ATOM   4555 C  CD    . LYS C 3 539 ? 24.542 36.612  14.979  1.00 63.44  ? 545  LYS A CD    1 
ATOM   4556 C  CE    . LYS C 3 539 ? 23.240 37.297  15.409  1.00 61.61  ? 545  LYS A CE    1 
ATOM   4557 N  NZ    . LYS C 3 539 ? 22.011 36.612  14.884  1.00 65.95  ? 545  LYS A NZ    1 
ATOM   4558 N  N     . GLU C 3 540 ? 23.641 35.202  10.656  1.00 42.06  ? 546  GLU A N     1 
ATOM   4559 C  CA    . GLU C 3 540 ? 22.413 34.496  10.282  1.00 47.92  ? 546  GLU A CA    1 
ATOM   4560 C  C     . GLU C 3 540 ? 22.689 33.591  9.084   1.00 44.37  ? 546  GLU A C     1 
ATOM   4561 O  O     . GLU C 3 540 ? 22.379 32.395  9.104   1.00 48.68  ? 546  GLU A O     1 
ATOM   4562 C  CB    . GLU C 3 540 ? 21.294 35.484  9.912   1.00 66.92  ? 546  GLU A CB    1 
ATOM   4563 C  CG    . GLU C 3 540 ? 21.305 36.832  10.645  1.00 69.25  ? 546  GLU A CG    1 
ATOM   4564 C  CD    . GLU C 3 540 ? 22.296 37.839  10.052  1.00 81.70  ? 546  GLU A CD    1 
ATOM   4565 O  OE1   . GLU C 3 540 ? 22.619 37.736  8.846   1.00 81.10  ? 546  GLU A OE1   1 
ATOM   4566 O  OE2   . GLU C 3 540 ? 22.752 38.737  10.795  1.00 79.18  ? 546  GLU A OE2   1 
ATOM   4567 N  N     . ARG C 3 541 ? 23.283 34.181  8.048   1.00 36.68  ? 547  ARG A N     1 
ATOM   4568 C  CA    . ARG C 3 541 ? 23.626 33.466  6.824   1.00 33.33  ? 547  ARG A CA    1 
ATOM   4569 C  C     . ARG C 3 541 ? 24.706 32.447  7.157   1.00 32.62  ? 547  ARG A C     1 
ATOM   4570 O  O     . ARG C 3 541 ? 24.774 31.384  6.542   1.00 32.67  ? 547  ARG A O     1 
ATOM   4571 C  CB    . ARG C 3 541 ? 24.132 34.451  5.762   1.00 35.79  ? 547  ARG A CB    1 
ATOM   4572 C  CG    . ARG C 3 541 ? 24.447 33.828  4.404   1.00 42.99  ? 547  ARG A CG    1 
ATOM   4573 C  CD    . ARG C 3 541 ? 23.225 33.143  3.816   1.00 44.27  ? 547  ARG A CD    1 
ATOM   4574 N  NE    . ARG C 3 541 ? 23.515 32.454  2.561   1.00 51.67  ? 547  ARG A NE    1 
ATOM   4575 C  CZ    . ARG C 3 541 ? 22.648 31.673  1.923   1.00 48.47  ? 547  ARG A CZ    1 
ATOM   4576 N  NH1   . ARG C 3 541 ? 21.430 31.475  2.419   1.00 49.51  ? 547  ARG A NH1   1 
ATOM   4577 N  NH2   . ARG C 3 541 ? 22.995 31.090  0.784   1.00 50.66  ? 547  ARG A NH2   1 
ATOM   4578 N  N     . GLY C 3 542 ? 25.532 32.785  8.150   1.00 42.31  ? 548  GLY A N     1 
ATOM   4579 C  CA    . GLY C 3 542 ? 26.606 31.910  8.591   1.00 42.43  ? 548  GLY A CA    1 
ATOM   4580 C  C     . GLY C 3 542 ? 26.064 30.582  9.082   1.00 45.47  ? 548  GLY A C     1 
ATOM   4581 O  O     . GLY C 3 542 ? 26.530 29.533  8.634   1.00 34.59  ? 548  GLY A O     1 
ATOM   4582 N  N     . LYS C 3 543 ? 25.071 30.626  9.977   1.00 45.79  ? 549  LYS A N     1 
ATOM   4583 C  CA    . LYS C 3 543 ? 24.450 29.412  10.521  1.00 50.72  ? 549  LYS A CA    1 
ATOM   4584 C  C     . LYS C 3 543 ? 23.808 28.581  9.419   1.00 47.05  ? 549  LYS A C     1 
ATOM   4585 O  O     . LYS C 3 543 ? 23.928 27.357  9.409   1.00 49.96  ? 549  LYS A O     1 
ATOM   4586 C  CB    . LYS C 3 543 ? 23.360 29.741  11.547  1.00 56.17  ? 549  LYS A CB    1 
ATOM   4587 C  CG    . LYS C 3 543 ? 23.816 30.493  12.770  1.00 64.40  ? 549  LYS A CG    1 
ATOM   4588 C  CD    . LYS C 3 543 ? 22.829 30.341  13.916  1.00 66.75  ? 549  LYS A CD    1 
ATOM   4589 C  CE    . LYS C 3 543 ? 22.670 28.878  14.314  1.00 65.73  ? 549  LYS A CE    1 
ATOM   4590 N  NZ    . LYS C 3 543 ? 21.825 28.713  15.529  1.00 70.49  ? 549  LYS A NZ    1 
ATOM   4591 N  N     . GLU C 3 544 ? 23.104 29.261  8.513   1.00 39.39  ? 550  GLU A N     1 
ATOM   4592 C  CA    . GLU C 3 544 ? 22.427 28.607  7.395   1.00 39.41  ? 550  GLU A CA    1 
ATOM   4593 C  C     . GLU C 3 544 ? 23.404 27.789  6.559   1.00 33.10  ? 550  GLU A C     1 
ATOM   4594 O  O     . GLU C 3 544 ? 23.182 26.605  6.324   1.00 37.31  ? 550  GLU A O     1 
ATOM   4595 C  CB    . GLU C 3 544 ? 21.749 29.642  6.491   1.00 47.78  ? 550  GLU A CB    1 
ATOM   4596 C  CG    . GLU C 3 544 ? 20.574 30.385  7.110   1.00 58.15  ? 550  GLU A CG    1 
ATOM   4597 C  CD    . GLU C 3 544 ? 19.951 31.392  6.149   1.00 65.23  ? 550  GLU A CD    1 
ATOM   4598 O  OE1   . GLU C 3 544 ? 19.760 31.047  4.962   1.00 60.26  ? 550  GLU A OE1   1 
ATOM   4599 O  OE2   . GLU C 3 544 ? 19.653 32.529  6.581   1.00 67.25  ? 550  GLU A OE2   1 
ATOM   4600 N  N     . LEU C 3 545 ? 24.491 28.432  6.140   1.00 23.85  ? 551  LEU A N     1 
ATOM   4601 C  CA    . LEU C 3 545 ? 25.525 27.804  5.325   1.00 27.44  ? 551  LEU A CA    1 
ATOM   4602 C  C     . LEU C 3 545 ? 26.258 26.663  6.038   1.00 27.88  ? 551  LEU A C     1 
ATOM   4603 O  O     . LEU C 3 545 ? 26.578 25.643  5.423   1.00 28.39  ? 551  LEU A O     1 
ATOM   4604 C  CB    . LEU C 3 545 ? 26.521 28.871  4.858   1.00 24.62  ? 551  LEU A CB    1 
ATOM   4605 C  CG    . LEU C 3 545 ? 26.474 29.339  3.401   1.00 26.96  ? 551  LEU A CG    1 
ATOM   4606 C  CD1   . LEU C 3 545 ? 25.076 29.282  2.835   1.00 25.03  ? 551  LEU A CD1   1 
ATOM   4607 C  CD2   . LEU C 3 545 ? 27.056 30.739  3.322   1.00 21.80  ? 551  LEU A CD2   1 
ATOM   4608 N  N     . LYS C 3 546 ? 26.506 26.839  7.334   1.00 28.76  ? 552  LYS A N     1 
ATOM   4609 C  CA    . LYS C 3 546 ? 27.193 25.837  8.140   1.00 30.22  ? 552  LYS A CA    1 
ATOM   4610 C  C     . LYS C 3 546 ? 26.390 24.544  8.243   1.00 34.05  ? 552  LYS A C     1 
ATOM   4611 O  O     . LYS C 3 546 ? 26.912 23.465  7.967   1.00 32.29  ? 552  LYS A O     1 
ATOM   4612 C  CB    . LYS C 3 546 ? 27.460 26.383  9.546   1.00 34.33  ? 552  LYS A CB    1 
ATOM   4613 C  CG    . LYS C 3 546 ? 28.533 27.463  9.631   1.00 36.97  ? 552  LYS A CG    1 
ATOM   4614 C  CD    . LYS C 3 546 ? 29.790 26.923  10.277  1.00 42.40  ? 552  LYS A CD    1 
ATOM   4615 C  CE    . LYS C 3 546 ? 29.592 26.601  11.758  1.00 33.38  ? 552  LYS A CE    1 
ATOM   4616 N  NZ    . LYS C 3 546 ? 29.549 27.829  12.608  1.00 37.51  ? 552  LYS A NZ    1 
ATOM   4617 N  N     . LYS C 3 547 ? 25.119 24.661  8.625   1.00 40.65  ? 553  LYS A N     1 
ATOM   4618 C  CA    . LYS C 3 547 ? 24.249 23.495  8.775   1.00 46.08  ? 553  LYS A CA    1 
ATOM   4619 C  C     . LYS C 3 547 ? 23.817 22.894  7.439   1.00 43.70  ? 553  LYS A C     1 
ATOM   4620 O  O     . LYS C 3 547 ? 23.492 21.710  7.363   1.00 40.51  ? 553  LYS A O     1 
ATOM   4621 C  CB    . LYS C 3 547 ? 23.017 23.841  9.625   1.00 50.37  ? 553  LYS A CB    1 
ATOM   4622 C  CG    . LYS C 3 547 ? 22.061 24.856  9.004   1.00 61.28  ? 553  LYS A CG    1 
ATOM   4623 C  CD    . LYS C 3 547 ? 20.838 25.125  9.886   1.00 55.24  ? 553  LYS A CD    1 
ATOM   4624 C  CE    . LYS C 3 547 ? 19.845 23.958  9.910   1.00 53.40  ? 553  LYS A CE    1 
ATOM   4625 N  NZ    . LYS C 3 547 ? 20.367 22.718  10.549  1.00 57.04  ? 553  LYS A NZ    1 
ATOM   4626 N  N     . LYS C 3 548 ? 23.823 23.720  6.394   1.00 38.74  ? 554  LYS A N     1 
ATOM   4627 C  CA    . LYS C 3 548 ? 23.442 23.301  5.050   1.00 37.23  ? 554  LYS A CA    1 
ATOM   4628 C  C     . LYS C 3 548 ? 24.499 22.320  4.514   1.00 34.63  ? 554  LYS A C     1 
ATOM   4629 O  O     . LYS C 3 548 ? 24.162 21.251  3.996   1.00 38.58  ? 554  LYS A O     1 
ATOM   4630 C  CB    . LYS C 3 548 ? 23.306 24.552  4.155   1.00 53.72  ? 554  LYS A CB    1 
ATOM   4631 C  CG    . LYS C 3 548 ? 22.687 24.368  2.761   1.00 62.58  ? 554  LYS A CG    1 
ATOM   4632 C  CD    . LYS C 3 548 ? 23.712 23.888  1.741   1.00 72.57  ? 554  LYS A CD    1 
ATOM   4633 C  CE    . LYS C 3 548 ? 23.121 23.708  0.352   1.00 71.62  ? 554  LYS A CE    1 
ATOM   4634 N  NZ    . LYS C 3 548 ? 24.126 23.057  -0.541  1.00 67.68  ? 554  LYS A NZ    1 
ATOM   4635 N  N     . PHE C 3 549 ? 25.774 22.678  4.675   1.00 29.85  ? 555  PHE A N     1 
ATOM   4636 C  CA    . PHE C 3 549 ? 26.880 21.843  4.211   1.00 26.33  ? 555  PHE A CA    1 
ATOM   4637 C  C     . PHE C 3 549 ? 27.236 20.682  5.140   1.00 30.15  ? 555  PHE A C     1 
ATOM   4638 O  O     . PHE C 3 549 ? 27.708 19.634  4.682   1.00 24.98  ? 555  PHE A O     1 
ATOM   4639 C  CB    . PHE C 3 549 ? 28.117 22.707  3.920   1.00 18.39  ? 555  PHE A CB    1 
ATOM   4640 C  CG    . PHE C 3 549 ? 28.074 23.389  2.573   1.00 23.26  ? 555  PHE A CG    1 
ATOM   4641 C  CD1   . PHE C 3 549 ? 27.382 24.590  2.395   1.00 21.87  ? 555  PHE A CD1   1 
ATOM   4642 C  CD2   . PHE C 3 549 ? 28.726 22.824  1.474   1.00 23.59  ? 555  PHE A CD2   1 
ATOM   4643 C  CE1   . PHE C 3 549 ? 27.325 25.213  1.135   1.00 23.92  ? 555  PHE A CE1   1 
ATOM   4644 C  CE2   . PHE C 3 549 ? 28.675 23.437  0.212   1.00 25.91  ? 555  PHE A CE2   1 
ATOM   4645 C  CZ    . PHE C 3 549 ? 27.979 24.638  0.046   1.00 16.62  ? 555  PHE A CZ    1 
ATOM   4646 N  N     . LEU C 3 550 ? 26.997 20.860  6.438   1.00 37.64  ? 556  LEU A N     1 
ATOM   4647 C  CA    . LEU C 3 550 ? 27.291 19.817  7.417   1.00 40.89  ? 556  LEU A CA    1 
ATOM   4648 C  C     . LEU C 3 550 ? 26.210 18.728  7.402   1.00 39.00  ? 556  LEU A C     1 
ATOM   4649 O  O     . LEU C 3 550 ? 26.464 17.585  7.785   1.00 40.80  ? 556  LEU A O     1 
ATOM   4650 C  CB    . LEU C 3 550 ? 27.436 20.429  8.814   1.00 42.26  ? 556  LEU A CB    1 
ATOM   4651 C  CG    . LEU C 3 550 ? 27.914 19.550  9.975   1.00 49.71  ? 556  LEU A CG    1 
ATOM   4652 C  CD1   . LEU C 3 550 ? 29.193 18.804  9.613   1.00 43.21  ? 556  LEU A CD1   1 
ATOM   4653 C  CD2   . LEU C 3 550 ? 28.136 20.436  11.189  1.00 47.89  ? 556  LEU A CD2   1 
ATOM   4654 N  N     . GLU C 3 551 ? 25.011 19.092  6.952   1.00 35.15  ? 557  GLU A N     1 
ATOM   4655 C  CA    . GLU C 3 551 ? 23.896 18.152  6.867   1.00 34.79  ? 557  GLU A CA    1 
ATOM   4656 C  C     . GLU C 3 551 ? 24.041 17.295  5.598   1.00 31.43  ? 557  GLU A C     1 
ATOM   4657 O  O     . GLU C 3 551 ? 23.629 16.131  5.572   1.00 32.80  ? 557  GLU A O     1 
ATOM   4658 C  CB    . GLU C 3 551 ? 22.561 18.910  6.846   1.00 44.05  ? 557  GLU A CB    1 
ATOM   4659 C  CG    . GLU C 3 551 ? 21.494 18.399  7.826   1.00 60.19  ? 557  GLU A CG    1 
ATOM   4660 C  CD    . GLU C 3 551 ? 21.760 18.775  9.287   1.00 70.37  ? 557  GLU A CD    1 
ATOM   4661 O  OE1   . GLU C 3 551 ? 22.725 18.252  9.889   1.00 78.77  ? 557  GLU A OE1   1 
ATOM   4662 O  OE2   . GLU C 3 551 ? 20.985 19.588  9.840   1.00 66.00  ? 557  GLU A OE2   1 
ATOM   4663 N  N     . ASN C 3 552 ? 24.644 17.874  4.558   1.00 30.00  ? 558  ASN A N     1 
ATOM   4664 C  CA    . ASN C 3 552 ? 24.856 17.173  3.290   1.00 31.08  ? 558  ASN A CA    1 
ATOM   4665 C  C     . ASN C 3 552 ? 25.885 16.055  3.474   1.00 32.56  ? 558  ASN A C     1 
ATOM   4666 O  O     . ASN C 3 552 ? 25.703 14.943  2.966   1.00 31.62  ? 558  ASN A O     1 
ATOM   4667 C  CB    . ASN C 3 552 ? 25.317 18.149  2.201   1.00 32.22  ? 558  ASN A CB    1 
ATOM   4668 C  CG    . ASN C 3 552 ? 25.330 17.517  0.820   1.00 34.93  ? 558  ASN A CG    1 
ATOM   4669 O  OD1   . ASN C 3 552 ? 24.325 16.964  0.368   1.00 32.67  ? 558  ASN A OD1   1 
ATOM   4670 N  ND2   . ASN C 3 552 ? 26.469 17.592  0.142   1.00 35.49  ? 558  ASN A ND2   1 
ATOM   4671 N  N     . THR C 3 553 ? 26.967 16.360  4.190   1.00 30.04  ? 559  THR A N     1 
ATOM   4672 C  CA    . THR C 3 553 ? 28.013 15.378  4.475   1.00 30.88  ? 559  THR A CA    1 
ATOM   4673 C  C     . THR C 3 553 ? 28.175 15.279  6.001   1.00 27.35  ? 559  THR A C     1 
ATOM   4674 O  O     . THR C 3 553 ? 29.102 15.849  6.575   1.00 27.01  ? 559  THR A O     1 
ATOM   4675 C  CB    . THR C 3 553 ? 29.375 15.753  3.811   1.00 32.83  ? 559  THR A CB    1 
ATOM   4676 O  OG1   . THR C 3 553 ? 29.762 17.073  4.203   1.00 38.06  ? 559  THR A OG1   1 
ATOM   4677 C  CG2   . THR C 3 553 ? 29.273 15.695  2.292   1.00 36.34  ? 559  THR A CG2   1 
ATOM   4678 N  N     . PRO C 3 554 ? 27.250 14.566  6.679   1.00 25.63  ? 560  PRO A N     1 
ATOM   4679 C  CA    . PRO C 3 554 ? 27.292 14.396  8.137   1.00 22.94  ? 560  PRO A CA    1 
ATOM   4680 C  C     . PRO C 3 554 ? 28.478 13.588  8.673   1.00 26.13  ? 560  PRO A C     1 
ATOM   4681 O  O     . PRO C 3 554 ? 28.701 13.542  9.885   1.00 29.05  ? 560  PRO A O     1 
ATOM   4682 C  CB    . PRO C 3 554 ? 25.950 13.729  8.435   1.00 22.38  ? 560  PRO A CB    1 
ATOM   4683 C  CG    . PRO C 3 554 ? 25.716 12.909  7.213   1.00 25.96  ? 560  PRO A CG    1 
ATOM   4684 C  CD    . PRO C 3 554 ? 26.061 13.892  6.124   1.00 28.05  ? 560  PRO A CD    1 
ATOM   4685 N  N     . ALA C 3 555 ? 29.243 12.969  7.773   1.00 18.79  ? 561  ALA A N     1 
ATOM   4686 C  CA    . ALA C 3 555 ? 30.408 12.183  8.169   1.00 15.28  ? 561  ALA A CA    1 
ATOM   4687 C  C     . ALA C 3 555 ? 31.532 13.105  8.644   1.00 15.80  ? 561  ALA A C     1 
ATOM   4688 O  O     . ALA C 3 555 ? 32.537 12.638  9.191   1.00 16.41  ? 561  ALA A O     1 
ATOM   4689 C  CB    . ALA C 3 555 ? 30.890 11.314  7.009   1.00 15.94  ? 561  ALA A CB    1 
ATOM   4690 N  N     . ILE C 3 556 ? 31.375 14.409  8.406   1.00 8.80   ? 562  ILE A N     1 
ATOM   4691 C  CA    . ILE C 3 556 ? 32.371 15.382  8.841   1.00 13.38  ? 562  ILE A CA    1 
ATOM   4692 C  C     . ILE C 3 556 ? 32.358 15.404  10.364  1.00 13.11  ? 562  ILE A C     1 
ATOM   4693 O  O     . ILE C 3 556 ? 33.414 15.455  10.989  1.00 22.11  ? 562  ILE A O     1 
ATOM   4694 C  CB    . ILE C 3 556 ? 32.080 16.806  8.312   1.00 17.29  ? 562  ILE A CB    1 
ATOM   4695 C  CG1   . ILE C 3 556 ? 32.183 16.836  6.782   1.00 17.48  ? 562  ILE A CG1   1 
ATOM   4696 C  CG2   . ILE C 3 556 ? 33.075 17.800  8.919   1.00 18.28  ? 562  ILE A CG2   1 
ATOM   4697 C  CD1   . ILE C 3 556 ? 31.968 18.216  6.181   1.00 10.43  ? 562  ILE A CD1   1 
ATOM   4698 N  N     . ALA C 3 557 ? 31.158 15.344  10.946  1.00 15.14  ? 563  ALA A N     1 
ATOM   4699 C  CA    . ALA C 3 557 ? 30.977 15.334  12.402  1.00 18.35  ? 563  ALA A CA    1 
ATOM   4700 C  C     . ALA C 3 557 ? 31.583 14.070  13.033  1.00 12.14  ? 563  ALA A C     1 
ATOM   4701 O  O     . ALA C 3 557 ? 32.269 14.142  14.046  1.00 19.20  ? 563  ALA A O     1 
ATOM   4702 C  CB    . ALA C 3 557 ? 29.497 15.433  12.744  1.00 18.80  ? 563  ALA A CB    1 
ATOM   4703 N  N     . ALA C 3 558 ? 31.323 12.920  12.421  1.00 14.67  ? 564  ALA A N     1 
ATOM   4704 C  CA    . ALA C 3 558 ? 31.851 11.640  12.897  1.00 15.82  ? 564  ALA A CA    1 
ATOM   4705 C  C     . ALA C 3 558 ? 33.379 11.623  12.823  1.00 15.74  ? 564  ALA A C     1 
ATOM   4706 O  O     . ALA C 3 558 ? 34.043 11.076  13.703  1.00 11.70  ? 564  ALA A O     1 
ATOM   4707 C  CB    . ALA C 3 558 ? 31.283 10.509  12.065  1.00 8.76   ? 564  ALA A CB    1 
ATOM   4708 N  N     . LEU C 3 559 ? 33.933 12.224  11.770  1.00 20.78  ? 565  LEU A N     1 
ATOM   4709 C  CA    . LEU C 3 559 ? 35.388 12.276  11.597  1.00 17.56  ? 565  LEU A CA    1 
ATOM   4710 C  C     . LEU C 3 559 ? 36.031 13.140  12.676  1.00 15.67  ? 565  LEU A C     1 
ATOM   4711 O  O     . LEU C 3 559 ? 37.039 12.750  13.261  1.00 15.14  ? 565  LEU A O     1 
ATOM   4712 C  CB    . LEU C 3 559 ? 35.755 12.800  10.202  1.00 11.40  ? 565  LEU A CB    1 
ATOM   4713 C  CG    . LEU C 3 559 ? 37.236 13.016  9.861   1.00 9.37   ? 565  LEU A CG    1 
ATOM   4714 C  CD1   . LEU C 3 559 ? 38.035 11.731  10.064  1.00 9.65   ? 565  LEU A CD1   1 
ATOM   4715 C  CD2   . LEU C 3 559 ? 37.362 13.506  8.414   1.00 14.83  ? 565  LEU A CD2   1 
ATOM   4716 N  N     . ARG C 3 560 ? 35.439 14.305  12.932  1.00 16.65  ? 566  ARG A N     1 
ATOM   4717 C  CA    . ARG C 3 560 ? 35.936 15.233  13.950  1.00 19.48  ? 566  ARG A CA    1 
ATOM   4718 C  C     . ARG C 3 560 ? 35.929 14.588  15.339  1.00 13.83  ? 566  ARG A C     1 
ATOM   4719 O  O     . ARG C 3 560 ? 36.897 14.696  16.096  1.00 14.33  ? 566  ARG A O     1 
ATOM   4720 C  CB    . ARG C 3 560 ? 35.066 16.495  13.993  1.00 18.60  ? 566  ARG A CB    1 
ATOM   4721 C  CG    . ARG C 3 560 ? 35.159 17.400  12.784  1.00 21.91  ? 566  ARG A CG    1 
ATOM   4722 C  CD    . ARG C 3 560 ? 34.140 18.523  12.906  1.00 28.23  ? 566  ARG A CD    1 
ATOM   4723 N  NE    . ARG C 3 560 ? 34.292 19.555  11.880  1.00 33.59  ? 566  ARG A NE    1 
ATOM   4724 C  CZ    . ARG C 3 560 ? 33.319 20.382  11.502  1.00 35.02  ? 566  ARG A CZ    1 
ATOM   4725 N  NH1   . ARG C 3 560 ? 32.118 20.295  12.063  1.00 27.82  ? 566  ARG A NH1   1 
ATOM   4726 N  NH2   . ARG C 3 560 ? 33.552 21.309  10.578  1.00 32.48  ? 566  ARG A NH2   1 
ATOM   4727 N  N     . GLU C 3 561 ? 34.830 13.905  15.650  1.00 17.00  ? 567  GLU A N     1 
ATOM   4728 C  CA    . GLU C 3 561 ? 34.662 13.239  16.937  1.00 20.03  ? 567  GLU A CA    1 
ATOM   4729 C  C     . GLU C 3 561 ? 35.680 12.133  17.189  1.00 21.28  ? 567  GLU A C     1 
ATOM   4730 O  O     . GLU C 3 561 ? 36.234 12.044  18.286  1.00 27.63  ? 567  GLU A O     1 
ATOM   4731 C  CB    . GLU C 3 561 ? 33.236 12.702  17.062  1.00 30.06  ? 567  GLU A CB    1 
ATOM   4732 C  CG    . GLU C 3 561 ? 32.191 13.814  17.131  1.00 35.92  ? 567  GLU A CG    1 
ATOM   4733 C  CD    . GLU C 3 561 ? 30.754 13.324  17.016  1.00 42.75  ? 567  GLU A CD    1 
ATOM   4734 O  OE1   . GLU C 3 561 ? 30.521 12.129  16.715  1.00 43.73  ? 567  GLU A OE1   1 
ATOM   4735 O  OE2   . GLU C 3 561 ? 29.848 14.160  17.220  1.00 45.66  ? 567  GLU A OE2   1 
ATOM   4736 N  N     . SER C 3 562 ? 35.945 11.313  16.173  1.00 16.92  ? 568  SER A N     1 
ATOM   4737 C  CA    . SER C 3 562 ? 36.907 10.226  16.314  1.00 17.11  ? 568  SER A CA    1 
ATOM   4738 C  C     . SER C 3 562 ? 38.303 10.787  16.551  1.00 18.27  ? 568  SER A C     1 
ATOM   4739 O  O     . SER C 3 562 ? 39.091 10.196  17.289  1.00 23.29  ? 568  SER A O     1 
ATOM   4740 C  CB    . SER C 3 562 ? 36.879 9.301   15.090  1.00 22.42  ? 568  SER A CB    1 
ATOM   4741 O  OG    . SER C 3 562 ? 37.044 10.018  13.882  1.00 37.50  ? 568  SER A OG    1 
ATOM   4742 N  N     . ILE C 3 563 ? 38.589 11.941  15.942  1.00 17.81  ? 569  ILE A N     1 
ATOM   4743 C  CA    . ILE C 3 563 ? 39.885 12.606  16.094  1.00 16.70  ? 569  ILE A CA    1 
ATOM   4744 C  C     . ILE C 3 563 ? 40.028 13.038  17.552  1.00 18.74  ? 569  ILE A C     1 
ATOM   4745 O  O     . ILE C 3 563 ? 41.090 12.873  18.148  1.00 20.78  ? 569  ILE A O     1 
ATOM   4746 C  CB    . ILE C 3 563 ? 39.999 13.857  15.171  1.00 16.47  ? 569  ILE A CB    1 
ATOM   4747 C  CG1   . ILE C 3 563 ? 40.061 13.425  13.704  1.00 19.56  ? 569  ILE A CG1   1 
ATOM   4748 C  CG2   . ILE C 3 563 ? 41.226 14.677  15.521  1.00 6.37   ? 569  ILE A CG2   1 
ATOM   4749 C  CD1   . ILE C 3 563 ? 40.049 14.581  12.726  1.00 16.20  ? 569  ILE A CD1   1 
ATOM   4750 N  N     . GLN C 3 564 ? 38.940 13.568  18.116  1.00 27.44  ? 570  GLN A N     1 
ATOM   4751 C  CA    . GLN C 3 564 ? 38.904 14.026  19.508  1.00 33.06  ? 570  GLN A CA    1 
ATOM   4752 C  C     . GLN C 3 564 ? 39.079 12.899  20.510  1.00 37.97  ? 570  GLN A C     1 
ATOM   4753 O  O     . GLN C 3 564 ? 39.813 13.041  21.486  1.00 41.63  ? 570  GLN A O     1 
ATOM   4754 C  CB    . GLN C 3 564 ? 37.586 14.738  19.803  1.00 38.05  ? 570  GLN A CB    1 
ATOM   4755 C  CG    . GLN C 3 564 ? 37.520 16.154  19.292  1.00 49.62  ? 570  GLN A CG    1 
ATOM   4756 C  CD    . GLN C 3 564 ? 38.579 17.039  19.919  1.00 53.18  ? 570  GLN A CD    1 
ATOM   4757 O  OE1   . GLN C 3 564 ? 38.645 17.186  21.145  1.00 48.84  ? 570  GLN A OE1   1 
ATOM   4758 N  NE2   . GLN C 3 564 ? 39.423 17.628  19.078  1.00 50.76  ? 570  GLN A NE2   1 
ATOM   4759 N  N     . GLN C 3 565 ? 38.385 11.788  20.273  1.00 39.70  ? 571  GLN A N     1 
ATOM   4760 C  CA    . GLN C 3 565 ? 38.458 10.623  21.149  1.00 36.25  ? 571  GLN A CA    1 
ATOM   4761 C  C     . GLN C 3 565 ? 39.872 10.036  21.115  1.00 30.78  ? 571  GLN A C     1 
ATOM   4762 O  O     . GLN C 3 565 ? 40.325 9.435   22.082  1.00 30.77  ? 571  GLN A O     1 
ATOM   4763 C  CB    . GLN C 3 565 ? 37.426 9.566   20.717  1.00 33.83  ? 571  GLN A CB    1 
ATOM   4764 N  N     . THR C 3 566 ? 40.566 10.234  20.000  1.00 22.67  ? 572  THR A N     1 
ATOM   4765 C  CA    . THR C 3 566 ? 41.925 9.735   19.828  1.00 21.26  ? 572  THR A CA    1 
ATOM   4766 C  C     . THR C 3 566 ? 42.971 10.667  20.460  1.00 23.17  ? 572  THR A C     1 
ATOM   4767 O  O     . THR C 3 566 ? 43.968 10.204  21.018  1.00 28.40  ? 572  THR A O     1 
ATOM   4768 C  CB    . THR C 3 566 ? 42.247 9.544   18.321  1.00 27.22  ? 572  THR A CB    1 
ATOM   4769 O  OG1   . THR C 3 566 ? 41.283 8.661   17.732  1.00 27.25  ? 572  THR A OG1   1 
ATOM   4770 C  CG2   . THR C 3 566 ? 43.639 8.956   18.129  1.00 33.35  ? 572  THR A CG2   1 
ATOM   4771 N  N     . LEU C 3 567 ? 42.719 11.972  20.406  1.00 23.24  ? 573  LEU A N     1 
ATOM   4772 C  CA    . LEU C 3 567 ? 43.665 12.945  20.935  1.00 22.26  ? 573  LEU A CA    1 
ATOM   4773 C  C     . LEU C 3 567 ? 43.436 13.508  22.339  1.00 22.66  ? 573  LEU A C     1 
ATOM   4774 O  O     . LEU C 3 567 ? 44.399 13.709  23.069  1.00 18.23  ? 573  LEU A O     1 
ATOM   4775 C  CB    . LEU C 3 567 ? 43.809 14.121  19.967  1.00 19.45  ? 573  LEU A CB    1 
ATOM   4776 C  CG    . LEU C 3 567 ? 44.263 13.833  18.531  1.00 16.96  ? 573  LEU A CG    1 
ATOM   4777 C  CD1   . LEU C 3 567 ? 44.296 15.130  17.750  1.00 15.84  ? 573  LEU A CD1   1 
ATOM   4778 C  CD2   . LEU C 3 567 ? 45.629 13.169  18.512  1.00 14.92  ? 573  LEU A CD2   1 
ATOM   4779 N  N     . VAL C 3 568 ? 42.180 13.799  22.686  1.00 23.94  ? 574  VAL A N     1 
ATOM   4780 C  CA    . VAL C 3 568 ? 41.813 14.377  23.979  1.00 26.57  ? 574  VAL A CA    1 
ATOM   4781 C  C     . VAL C 3 568 ? 41.061 13.474  24.960  1.00 28.69  ? 574  VAL A C     1 
ATOM   4782 O  O     . VAL C 3 568 ? 40.191 12.696  24.568  1.00 27.67  ? 574  VAL A O     1 
ATOM   4783 C  CB    . VAL C 3 568 ? 40.964 15.665  23.763  1.00 28.06  ? 574  VAL A CB    1 
ATOM   4784 C  CG1   . VAL C 3 568 ? 40.585 16.319  25.093  1.00 26.60  ? 574  VAL A CG1   1 
ATOM   4785 C  CG2   . VAL C 3 568 ? 41.732 16.644  22.879  1.00 25.09  ? 574  VAL A CG2   1 
ATOM   4786 N  N     . GLU C 3 569 ? 41.391 13.601  26.248  1.00 45.07  ? 575  GLU A N     1 
ATOM   4787 C  CA    . GLU C 3 569 ? 40.740 12.830  27.317  1.00 56.37  ? 575  GLU A CA    1 
ATOM   4788 C  C     . GLU C 3 569 ? 40.287 13.756  28.446  1.00 56.77  ? 575  GLU A C     1 
ATOM   4789 O  O     . GLU C 3 569 ? 40.098 14.951  28.262  1.00 50.48  ? 575  GLU A O     1 
ATOM   4790 C  CB    . GLU C 3 569 ? 41.682 11.756  27.861  1.00 60.50  ? 575  GLU A CB    1 
ATOM   4791 C  CG    . GLU C 3 569 ? 42.907 12.294  28.610  1.00 69.28  ? 575  GLU A CG    1 
ATOM   4792 C  CD    . GLU C 3 569 ? 43.737 11.197  29.270  1.00 76.19  ? 575  GLU A CD    1 
ATOM   4793 O  OE1   . GLU C 3 569 ? 44.047 10.170  28.612  1.00 75.19  ? 575  GLU A OE1   1 
ATOM   4794 O  OE2   . GLU C 3 569 ? 44.091 11.374  30.460  1.00 71.43  ? 575  GLU A OE2   1 
ATOM   4795 N  N     . LYS C 3 581 ? 42.551 15.914  28.894  1.00 59.58  ? 587  LYS A N     1 
ATOM   4796 C  CA    . LYS C 3 581 ? 43.914 16.354  28.640  1.00 51.07  ? 587  LYS A CA    1 
ATOM   4797 C  C     . LYS C 3 581 ? 44.367 15.653  27.353  1.00 45.32  ? 587  LYS A C     1 
ATOM   4798 O  O     . LYS C 3 581 ? 43.534 15.306  26.535  1.00 44.68  ? 587  LYS A O     1 
ATOM   4799 C  CB    . LYS C 3 581 ? 44.810 15.933  29.819  1.00 48.73  ? 587  LYS A CB    1 
ATOM   4800 C  CG    . LYS C 3 581 ? 44.384 16.556  31.142  1.00 40.68  ? 587  LYS A CG    1 
ATOM   4801 C  CD    . LYS C 3 581 ? 44.178 15.501  32.225  1.00 43.02  ? 587  LYS A CD    1 
ATOM   4802 C  CE    . LYS C 3 581 ? 43.916 16.169  33.581  1.00 43.55  ? 587  LYS A CE    1 
ATOM   4803 N  NZ    . LYS C 3 581 ? 43.786 15.196  34.716  1.00 39.02  ? 587  LYS A NZ    1 
ATOM   4804 N  N     . TRP C 3 582 ? 45.669 15.438  27.172  1.00 30.23  ? 588  TRP A N     1 
ATOM   4805 C  CA    . TRP C 3 582 ? 46.126 14.802  25.953  1.00 17.79  ? 588  TRP A CA    1 
ATOM   4806 C  C     . TRP C 3 582 ? 46.389 13.326  26.133  1.00 18.99  ? 588  TRP A C     1 
ATOM   4807 O  O     . TRP C 3 582 ? 47.129 12.902  27.021  1.00 20.45  ? 588  TRP A O     1 
ATOM   4808 C  CB    . TRP C 3 582 ? 47.365 15.490  25.372  1.00 13.56  ? 588  TRP A CB    1 
ATOM   4809 C  CG    . TRP C 3 582 ? 47.106 16.861  24.806  1.00 20.16  ? 588  TRP A CG    1 
ATOM   4810 C  CD1   . TRP C 3 582 ? 47.348 18.057  25.415  1.00 17.91  ? 588  TRP A CD1   1 
ATOM   4811 C  CD2   . TRP C 3 582 ? 46.559 17.175  23.516  1.00 19.56  ? 588  TRP A CD2   1 
ATOM   4812 N  NE1   . TRP C 3 582 ? 46.983 19.095  24.593  1.00 14.26  ? 588  TRP A NE1   1 
ATOM   4813 C  CE2   . TRP C 3 582 ? 46.499 18.579  23.420  1.00 20.61  ? 588  TRP A CE2   1 
ATOM   4814 C  CE3   . TRP C 3 582 ? 46.115 16.401  22.433  1.00 17.87  ? 588  TRP A CE3   1 
ATOM   4815 C  CZ2   . TRP C 3 582 ? 46.013 19.231  22.274  1.00 17.52  ? 588  TRP A CZ2   1 
ATOM   4816 C  CZ3   . TRP C 3 582 ? 45.634 17.056  21.298  1.00 11.04  ? 588  TRP A CZ3   1 
ATOM   4817 C  CH2   . TRP C 3 582 ? 45.587 18.458  21.233  1.00 16.05  ? 588  TRP A CH2   1 
ATOM   4818 N  N     . LYS C 3 583 ? 45.695 12.554  25.312  1.00 18.64  ? 589  LYS A N     1 
ATOM   4819 C  CA    . LYS C 3 583 ? 45.796 11.116  25.279  1.00 18.62  ? 589  LYS A CA    1 
ATOM   4820 C  C     . LYS C 3 583 ? 47.051 10.852  24.434  1.00 20.01  ? 589  LYS A C     1 
ATOM   4821 O  O     . LYS C 3 583 ? 47.893 10.012  24.774  1.00 21.17  ? 589  LYS A O     1 
ATOM   4822 C  CB    . LYS C 3 583 ? 44.539 10.572  24.603  1.00 24.25  ? 589  LYS A CB    1 
ATOM   4823 C  CG    . LYS C 3 583 ? 44.182 9.146   24.917  1.00 30.19  ? 589  LYS A CG    1 
ATOM   4824 C  CD    . LYS C 3 583 ? 42.783 8.793   24.409  1.00 29.62  ? 589  LYS A CD    1 
ATOM   4825 C  CE    . LYS C 3 583 ? 41.702 9.636   25.086  1.00 27.49  ? 589  LYS A CE    1 
ATOM   4826 N  NZ    . LYS C 3 583 ? 40.321 9.129   24.807  1.00 26.29  ? 589  LYS A NZ    1 
ATOM   4827 N  N     . ARG C 3 584 ? 47.181 11.633  23.359  1.00 26.30  ? 590  ARG A N     1 
ATOM   4828 C  CA    . ARG C 3 584 ? 48.304 11.598  22.415  1.00 28.06  ? 590  ARG A CA    1 
ATOM   4829 C  C     . ARG C 3 584 ? 48.300 12.974  21.760  1.00 29.87  ? 590  ARG A C     1 
ATOM   4830 O  O     . ARG C 3 584 ? 47.261 13.442  21.304  1.00 38.72  ? 590  ARG A O     1 
ATOM   4831 C  CB    . ARG C 3 584 ? 48.094 10.539  21.337  1.00 35.09  ? 590  ARG A CB    1 
ATOM   4832 C  CG    . ARG C 3 584 ? 49.282 10.321  20.392  1.00 44.63  ? 590  ARG A CG    1 
ATOM   4833 C  CD    . ARG C 3 584 ? 48.863 9.465   19.206  1.00 47.35  ? 590  ARG A CD    1 
ATOM   4834 N  NE    . ARG C 3 584 ? 48.000 8.367   19.639  1.00 51.16  ? 590  ARG A NE    1 
ATOM   4835 C  CZ    . ARG C 3 584 ? 47.083 7.778   18.874  1.00 52.68  ? 590  ARG A CZ    1 
ATOM   4836 N  NH1   . ARG C 3 584 ? 46.906 8.168   17.618  1.00 54.56  ? 590  ARG A NH1   1 
ATOM   4837 N  NH2   . ARG C 3 584 ? 46.309 6.824   19.388  1.00 53.18  ? 590  ARG A NH2   1 
ATOM   4838 N  N     . ARG C 3 585 ? 49.457 13.617  21.683  1.00 31.33  ? 591  ARG A N     1 
ATOM   4839 C  CA    . ARG C 3 585 ? 49.488 14.934  21.083  1.00 38.34  ? 591  ARG A CA    1 
ATOM   4840 C  C     . ARG C 3 585 ? 49.672 14.956  19.566  1.00 31.09  ? 591  ARG A C     1 
ATOM   4841 O  O     . ARG C 3 585 ? 49.178 15.854  18.908  1.00 45.66  ? 591  ARG A O     1 
ATOM   4842 C  CB    . ARG C 3 585 ? 50.514 15.835  21.761  1.00 55.22  ? 591  ARG A CB    1 
ATOM   4843 C  CG    . ARG C 3 585 ? 50.407 17.270  21.284  1.00 71.46  ? 591  ARG A CG    1 
ATOM   4844 C  CD    . ARG C 3 585 ? 50.382 18.256  22.423  1.00 76.61  ? 591  ARG A CD    1 
ATOM   4845 N  NE    . ARG C 3 585 ? 50.296 19.595  21.887  1.00 77.54  ? 591  ARG A NE    1 
ATOM   4846 C  CZ    . ARG C 3 585 ? 50.502 20.690  22.629  1.00 78.87  ? 591  ARG A CZ    1 
ATOM   4847 N  NH1   . ARG C 3 585 ? 50.773 20.606  23.915  1.00 79.70  ? 591  ARG A NH1   1 
ATOM   4848 N  NH2   . ARG C 3 585 ? 50.344 21.908  22.074  1.00 76.09  ? 591  ARG A NH2   1 
ATOM   4849 N  N     . TRP C 3 586 ? 50.395 13.990  19.013  1.00 21.47  ? 592  TRP A N     1 
ATOM   4850 C  CA    . TRP C 3 586 ? 50.613 13.934  17.573  1.00 20.95  ? 592  TRP A CA    1 
ATOM   4851 C  C     . TRP C 3 586 ? 49.671 13.020  16.783  1.00 25.16  ? 592  TRP A C     1 
ATOM   4852 O  O     . TRP C 3 586 ? 48.960 12.185  17.347  1.00 21.55  ? 592  TRP A O     1 
ATOM   4853 C  CB    . TRP C 3 586 ? 52.064 13.538  17.280  1.00 16.54  ? 592  TRP A CB    1 
ATOM   4854 C  CG    . TRP C 3 586 ? 52.482 12.269  17.947  1.00 19.64  ? 592  TRP A CG    1 
ATOM   4855 C  CD1   . TRP C 3 586 ? 53.001 12.132  19.205  1.00 15.58  ? 592  TRP A CD1   1 
ATOM   4856 C  CD2   . TRP C 3 586 ? 52.463 10.960  17.376  1.00 21.76  ? 592  TRP A CD2   1 
ATOM   4857 N  NE1   . TRP C 3 586 ? 53.314 10.816  19.447  1.00 13.95  ? 592  TRP A NE1   1 
ATOM   4858 C  CE2   . TRP C 3 586 ? 52.993 10.074  18.344  1.00 16.08  ? 592  TRP A CE2   1 
ATOM   4859 C  CE3   . TRP C 3 586 ? 52.047 10.445  16.140  1.00 17.50  ? 592  TRP A CE3   1 
ATOM   4860 C  CZ2   . TRP C 3 586 ? 53.126 8.703   18.106  1.00 17.37  ? 592  TRP A CZ2   1 
ATOM   4861 C  CZ3   . TRP C 3 586 ? 52.176 9.084   15.904  1.00 17.62  ? 592  TRP A CZ3   1 
ATOM   4862 C  CH2   . TRP C 3 586 ? 52.712 8.226   16.885  1.00 21.07  ? 592  TRP A CH2   1 
ATOM   4863 N  N     . ILE C 3 587 ? 49.667 13.242  15.469  1.00 23.05  ? 593  ILE A N     1 
ATOM   4864 C  CA    . ILE C 3 587 ? 48.890 12.492  14.484  1.00 20.53  ? 593  ILE A CA    1 
ATOM   4865 C  C     . ILE C 3 587 ? 49.954 11.756  13.660  1.00 13.85  ? 593  ILE A C     1 
ATOM   4866 O  O     . ILE C 3 587 ? 51.040 12.291  13.435  1.00 13.39  ? 593  ILE A O     1 
ATOM   4867 C  CB    . ILE C 3 587 ? 48.117 13.464  13.531  1.00 24.97  ? 593  ILE A CB    1 
ATOM   4868 C  CG1   . ILE C 3 587 ? 46.949 14.131  14.256  1.00 27.40  ? 593  ILE A CG1   1 
ATOM   4869 C  CG2   . ILE C 3 587 ? 47.642 12.740  12.278  1.00 27.00  ? 593  ILE A CG2   1 
ATOM   4870 C  CD1   . ILE C 3 587 ? 45.883 13.176  14.725  1.00 38.16  ? 593  ILE A CD1   1 
ATOM   4871 N  N     . LYS C 3 588 ? 49.665 10.528  13.235  1.00 21.99  ? 594  LYS A N     1 
ATOM   4872 C  CA    . LYS C 3 588 ? 50.623 9.788   12.415  1.00 24.65  ? 594  LYS A CA    1 
ATOM   4873 C  C     . LYS C 3 588 ? 50.433 10.202  10.960  1.00 18.62  ? 594  LYS A C     1 
ATOM   4874 O  O     . LYS C 3 588 ? 49.359 10.008  10.394  1.00 15.42  ? 594  LYS A O     1 
ATOM   4875 C  CB    . LYS C 3 588 ? 50.425 8.276   12.513  1.00 25.80  ? 594  LYS A CB    1 
ATOM   4876 C  CG    . LYS C 3 588 ? 51.541 7.495   11.811  1.00 36.91  ? 594  LYS A CG    1 
ATOM   4877 C  CD    . LYS C 3 588 ? 51.073 6.128   11.325  1.00 39.83  ? 594  LYS A CD    1 
ATOM   4878 C  CE    . LYS C 3 588 ? 50.597 5.245   12.463  1.00 45.82  ? 594  LYS A CE    1 
ATOM   4879 N  NZ    . LYS C 3 588 ? 49.336 4.541   12.080  1.00 40.17  ? 594  LYS A NZ    1 
ATOM   4880 N  N     . GLY C 3 589 ? 51.483 10.765  10.367  1.00 12.97  ? 595  GLY A N     1 
ATOM   4881 C  CA    . GLY C 3 589 ? 51.423 11.202  8.981   1.00 15.30  ? 595  GLY A CA    1 
ATOM   4882 C  C     . GLY C 3 589 ? 51.420 10.070  7.968   1.00 11.34  ? 595  GLY A C     1 
ATOM   4883 O  O     . GLY C 3 589 ? 51.750 8.934   8.295   1.00 13.62  ? 595  GLY A O     1 
ATOM   4884 N  N     . LEU C 3 590 ? 51.075 10.397  6.725   1.00 10.68  ? 596  LEU A N     1 
ATOM   4885 C  CA    . LEU C 3 590 ? 51.022 9.424   5.633   1.00 12.81  ? 596  LEU A CA    1 
ATOM   4886 C  C     . LEU C 3 590 ? 52.336 8.667   5.432   1.00 9.11   ? 596  LEU A C     1 
ATOM   4887 O  O     . LEU C 3 590 ? 52.332 7.524   4.969   1.00 14.67  ? 596  LEU A O     1 
ATOM   4888 C  CB    . LEU C 3 590 ? 50.613 10.110  4.322   1.00 13.47  ? 596  LEU A CB    1 
ATOM   4889 C  CG    . LEU C 3 590 ? 49.233 10.768  4.266   1.00 16.80  ? 596  LEU A CG    1 
ATOM   4890 C  CD1   . LEU C 3 590 ? 49.074 11.462  2.928   1.00 25.72  ? 596  LEU A CD1   1 
ATOM   4891 C  CD2   . LEU C 3 590 ? 48.125 9.739   4.470   1.00 23.00  ? 596  LEU A CD2   1 
ATOM   4892 N  N     . ASP C 3 591 ? 53.456 9.303   5.758   1.00 7.80   ? 597  ASP A N     1 
ATOM   4893 C  CA    . ASP C 3 591 ? 54.759 8.652   5.620   1.00 7.27   ? 597  ASP A CA    1 
ATOM   4894 C  C     . ASP C 3 591 ? 55.287 8.140   6.971   1.00 7.81   ? 597  ASP A C     1 
ATOM   4895 O  O     . ASP C 3 591 ? 56.460 7.788   7.106   1.00 5.19   ? 597  ASP A O     1 
ATOM   4896 C  CB    . ASP C 3 591 ? 55.769 9.578   4.935   1.00 5.30   ? 597  ASP A CB    1 
ATOM   4897 C  CG    . ASP C 3 591 ? 55.963 10.894  5.663   1.00 16.12  ? 597  ASP A CG    1 
ATOM   4898 O  OD1   . ASP C 3 591 ? 55.300 11.129  6.696   1.00 9.20   ? 597  ASP A OD1   1 
ATOM   4899 O  OD2   . ASP C 3 591 ? 56.791 11.696  5.191   1.00 7.27   ? 597  ASP A OD2   1 
ATOM   4900 N  N     . GLY C 3 592 ? 54.395 8.110   7.963   1.00 10.22  ? 598  GLY A N     1 
ATOM   4901 C  CA    . GLY C 3 592 ? 54.734 7.620   9.290   1.00 11.25  ? 598  GLY A CA    1 
ATOM   4902 C  C     . GLY C 3 592 ? 55.189 8.607   10.347  1.00 13.79  ? 598  GLY A C     1 
ATOM   4903 O  O     . GLY C 3 592 ? 55.155 8.277   11.531  1.00 14.79  ? 598  GLY A O     1 
ATOM   4904 N  N     . ARG C 3 593 ? 55.577 9.813   9.936   1.00 14.05  ? 599  ARG A N     1 
ATOM   4905 C  CA    . ARG C 3 593 ? 56.063 10.854  10.850  1.00 16.24  ? 599  ARG A CA    1 
ATOM   4906 C  C     . ARG C 3 593 ? 55.053 11.300  11.915  1.00 11.62  ? 599  ARG A C     1 
ATOM   4907 O  O     . ARG C 3 593 ? 53.854 11.064  11.791  1.00 12.51  ? 599  ARG A O     1 
ATOM   4908 C  CB    . ARG C 3 593 ? 56.479 12.098  10.044  1.00 9.73   ? 599  ARG A CB    1 
ATOM   4909 C  CG    . ARG C 3 593 ? 55.298 13.011  9.688   1.00 7.15   ? 599  ARG A CG    1 
ATOM   4910 C  CD    . ARG C 3 593 ? 55.379 13.557  8.279   1.00 15.50  ? 599  ARG A CD    1 
ATOM   4911 N  NE    . ARG C 3 593 ? 56.137 14.791  8.170   1.00 25.94  ? 599  ARG A NE    1 
ATOM   4912 C  CZ    . ARG C 3 593 ? 57.056 15.042  7.243   1.00 14.88  ? 599  ARG A CZ    1 
ATOM   4913 N  NH1   . ARG C 3 593 ? 57.364 14.146  6.325   1.00 8.43   ? 599  ARG A NH1   1 
ATOM   4914 N  NH2   . ARG C 3 593 ? 57.668 16.213  7.247   1.00 14.68  ? 599  ARG A NH2   1 
ATOM   4915 N  N     . LYS C 3 594 ? 55.562 11.940  12.963  1.00 12.00  ? 600  LYS A N     1 
ATOM   4916 C  CA    . LYS C 3 594 ? 54.712 12.474  14.017  1.00 15.48  ? 600  LYS A CA    1 
ATOM   4917 C  C     . LYS C 3 594 ? 54.345 13.892  13.591  1.00 11.27  ? 600  LYS A C     1 
ATOM   4918 O  O     . LYS C 3 594 ? 55.224 14.692  13.292  1.00 18.33  ? 600  LYS A O     1 
ATOM   4919 C  CB    . LYS C 3 594 ? 55.452 12.565  15.351  1.00 13.35  ? 600  LYS A CB    1 
ATOM   4920 C  CG    . LYS C 3 594 ? 55.743 11.261  16.049  1.00 19.14  ? 600  LYS A CG    1 
ATOM   4921 C  CD    . LYS C 3 594 ? 56.410 11.562  17.385  1.00 27.50  ? 600  LYS A CD    1 
ATOM   4922 C  CE    . LYS C 3 594 ? 56.741 10.317  18.174  1.00 24.03  ? 600  LYS A CE    1 
ATOM   4923 N  NZ    . LYS C 3 594 ? 57.432 10.661  19.453  1.00 21.81  ? 600  LYS A NZ    1 
ATOM   4924 N  N     . VAL C 3 595 ? 53.055 14.199  13.554  1.00 11.78  ? 601  VAL A N     1 
ATOM   4925 C  CA    . VAL C 3 595 ? 52.600 15.532  13.179  1.00 13.45  ? 601  VAL A CA    1 
ATOM   4926 C  C     . VAL C 3 595 ? 51.974 16.156  14.430  1.00 16.93  ? 601  VAL A C     1 
ATOM   4927 O  O     . VAL C 3 595 ? 50.852 15.820  14.825  1.00 14.80  ? 601  VAL A O     1 
ATOM   4928 C  CB    . VAL C 3 595 ? 51.559 15.508  12.005  1.00 13.36  ? 601  VAL A CB    1 
ATOM   4929 C  CG1   . VAL C 3 595 ? 51.146 16.927  11.643  1.00 13.20  ? 601  VAL A CG1   1 
ATOM   4930 C  CG2   . VAL C 3 595 ? 52.157 14.828  10.773  1.00 11.47  ? 601  VAL A CG2   1 
ATOM   4931 N  N     . HIS C 3 596 ? 52.728 17.050  15.064  1.00 19.07  ? 602  HIS A N     1 
ATOM   4932 C  CA    . HIS C 3 596 ? 52.306 17.743  16.284  1.00 15.70  ? 602  HIS A CA    1 
ATOM   4933 C  C     . HIS C 3 596 ? 50.981 18.503  16.176  1.00 15.55  ? 602  HIS A C     1 
ATOM   4934 O  O     . HIS C 3 596 ? 50.809 19.338  15.290  1.00 14.35  ? 602  HIS A O     1 
ATOM   4935 C  CB    . HIS C 3 596 ? 53.405 18.729  16.706  1.00 21.36  ? 602  HIS A CB    1 
ATOM   4936 C  CG    . HIS C 3 596 ? 53.114 19.465  17.975  1.00 18.58  ? 602  HIS A CG    1 
ATOM   4937 N  ND1   . HIS C 3 596 ? 53.103 18.846  19.212  1.00 16.24  ? 602  HIS A ND1   1 
ATOM   4938 C  CD2   . HIS C 3 596 ? 52.830 20.773  18.207  1.00 14.82  ? 602  HIS A CD2   1 
ATOM   4939 C  CE1   . HIS C 3 596 ? 52.830 19.735  20.140  1.00 13.11  ? 602  HIS A CE1   1 
ATOM   4940 N  NE2   . HIS C 3 596 ? 52.661 20.908  19.561  1.00 11.26  ? 602  HIS A NE2   1 
ATOM   4941 N  N     . VAL C 3 597 ? 50.045 18.202  17.078  1.00 12.18  ? 603  VAL A N     1 
ATOM   4942 C  CA    . VAL C 3 597 ? 48.761 18.899  17.091  1.00 10.75  ? 603  VAL A CA    1 
ATOM   4943 C  C     . VAL C 3 597 ? 48.841 20.024  18.129  1.00 14.94  ? 603  VAL A C     1 
ATOM   4944 O  O     . VAL C 3 597 ? 49.116 19.777  19.301  1.00 9.92   ? 603  VAL A O     1 
ATOM   4945 C  CB    . VAL C 3 597 ? 47.586 17.963  17.432  1.00 10.39  ? 603  VAL A CB    1 
ATOM   4946 C  CG1   . VAL C 3 597 ? 46.278 18.726  17.376  1.00 10.49  ? 603  VAL A CG1   1 
ATOM   4947 C  CG2   . VAL C 3 597 ? 47.552 16.802  16.458  1.00 10.33  ? 603  VAL A CG2   1 
ATOM   4948 N  N     . ARG C 3 598 ? 48.649 21.261  17.677  1.00 15.66  ? 604  ARG A N     1 
ATOM   4949 C  CA    . ARG C 3 598 ? 48.714 22.428  18.552  1.00 17.48  ? 604  ARG A CA    1 
ATOM   4950 C  C     . ARG C 3 598 ? 47.464 22.647  19.404  1.00 20.03  ? 604  ARG A C     1 
ATOM   4951 O  O     . ARG C 3 598 ? 47.564 22.930  20.602  1.00 23.60  ? 604  ARG A O     1 
ATOM   4952 C  CB    . ARG C 3 598 ? 48.987 23.696  17.735  1.00 12.11  ? 604  ARG A CB    1 
ATOM   4953 C  CG    . ARG C 3 598 ? 50.379 23.779  17.141  1.00 10.88  ? 604  ARG A CG    1 
ATOM   4954 C  CD    . ARG C 3 598 ? 50.546 25.075  16.352  1.00 5.37   ? 604  ARG A CD    1 
ATOM   4955 N  NE    . ARG C 3 598 ? 51.920 25.242  15.893  1.00 4.86   ? 604  ARG A NE    1 
ATOM   4956 C  CZ    . ARG C 3 598 ? 52.298 26.023  14.888  1.00 10.46  ? 604  ARG A CZ    1 
ATOM   4957 N  NH1   . ARG C 3 598 ? 51.407 26.730  14.202  1.00 7.80   ? 604  ARG A NH1   1 
ATOM   4958 N  NH2   . ARG C 3 598 ? 53.585 26.114  14.580  1.00 10.39  ? 604  ARG A NH2   1 
ATOM   4959 N  N     . SER C 3 599 ? 46.290 22.516  18.791  1.00 15.44  ? 605  SER A N     1 
ATOM   4960 C  CA    . SER C 3 599 ? 45.033 22.718  19.500  1.00 13.63  ? 605  SER A CA    1 
ATOM   4961 C  C     . SER C 3 599 ? 43.949 21.757  19.025  1.00 20.57  ? 605  SER A C     1 
ATOM   4962 O  O     . SER C 3 599 ? 43.893 21.410  17.842  1.00 20.84  ? 605  SER A O     1 
ATOM   4963 C  CB    . SER C 3 599 ? 44.555 24.160  19.305  1.00 22.38  ? 605  SER A CB    1 
ATOM   4964 O  OG    . SER C 3 599 ? 43.322 24.378  19.956  1.00 27.23  ? 605  SER A OG    1 
ATOM   4965 N  N     . PRO C 3 600 ? 43.063 21.328  19.944  1.00 15.31  ? 606  PRO A N     1 
ATOM   4966 C  CA    . PRO C 3 600 ? 41.968 20.405  19.634  1.00 17.82  ? 606  PRO A CA    1 
ATOM   4967 C  C     . PRO C 3 600 ? 41.056 20.855  18.489  1.00 20.07  ? 606  PRO A C     1 
ATOM   4968 O  O     . PRO C 3 600 ? 40.559 20.023  17.728  1.00 24.29  ? 606  PRO A O     1 
ATOM   4969 C  CB    . PRO C 3 600 ? 41.210 20.332  20.962  1.00 19.76  ? 606  PRO A CB    1 
ATOM   4970 C  CG    . PRO C 3 600 ? 42.311 20.453  21.963  1.00 11.83  ? 606  PRO A CG    1 
ATOM   4971 C  CD    . PRO C 3 600 ? 43.094 21.615  21.392  1.00 14.67  ? 606  PRO A CD    1 
ATOM   4972 N  N     . HIS C 3 601 ? 40.847 22.164  18.359  1.00 19.63  ? 607  HIS A N     1 
ATOM   4973 C  CA    . HIS C 3 601 ? 39.975 22.692  17.309  1.00 20.65  ? 607  HIS A CA    1 
ATOM   4974 C  C     . HIS C 3 601 ? 40.646 22.781  15.933  1.00 22.82  ? 607  HIS A C     1 
ATOM   4975 O  O     . HIS C 3 601 ? 39.970 22.996  14.927  1.00 25.03  ? 607  HIS A O     1 
ATOM   4976 C  CB    . HIS C 3 601 ? 39.402 24.058  17.719  1.00 17.85  ? 607  HIS A CB    1 
ATOM   4977 C  CG    . HIS C 3 601 ? 40.267 25.223  17.352  1.00 15.77  ? 607  HIS A CG    1 
ATOM   4978 N  ND1   . HIS C 3 601 ? 41.377 25.594  18.079  1.00 21.96  ? 607  HIS A ND1   1 
ATOM   4979 C  CD2   . HIS C 3 601 ? 40.178 26.104  16.327  1.00 18.30  ? 607  HIS A CD2   1 
ATOM   4980 C  CE1   . HIS C 3 601 ? 41.937 26.651  17.518  1.00 20.15  ? 607  HIS A CE1   1 
ATOM   4981 N  NE2   . HIS C 3 601 ? 41.227 26.980  16.454  1.00 13.02  ? 607  HIS A NE2   1 
ATOM   4982 N  N     . ALA C 3 602 ? 41.971 22.654  15.901  1.00 18.43  ? 608  ALA A N     1 
ATOM   4983 C  CA    . ALA C 3 602 ? 42.723 22.702  14.652  1.00 15.75  ? 608  ALA A CA    1 
ATOM   4984 C  C     . ALA C 3 602 ? 43.266 21.313  14.289  1.00 14.40  ? 608  ALA A C     1 
ATOM   4985 O  O     . ALA C 3 602 ? 44.102 21.182  13.398  1.00 14.47  ? 608  ALA A O     1 
ATOM   4986 C  CB    . ALA C 3 602 ? 43.863 23.708  14.766  1.00 18.42  ? 608  ALA A CB    1 
ATOM   4987 N  N     . ALA C 3 603 ? 42.764 20.283  14.972  1.00 12.19  ? 609  ALA A N     1 
ATOM   4988 C  CA    . ALA C 3 603 ? 43.192 18.903  14.751  1.00 10.51  ? 609  ALA A CA    1 
ATOM   4989 C  C     . ALA C 3 603 ? 42.784 18.337  13.398  1.00 10.75  ? 609  ALA A C     1 
ATOM   4990 O  O     . ALA C 3 603 ? 43.513 17.525  12.825  1.00 12.14  ? 609  ALA A O     1 
ATOM   4991 C  CB    . ALA C 3 603 ? 42.677 18.003  15.873  1.00 10.15  ? 609  ALA A CB    1 
ATOM   4992 N  N     . LEU C 3 604 ? 41.604 18.717  12.907  1.00 11.35  ? 610  LEU A N     1 
ATOM   4993 C  CA    . LEU C 3 604 ? 41.156 18.237  11.601  1.00 16.16  ? 610  LEU A CA    1 
ATOM   4994 C  C     . LEU C 3 604 ? 42.034 18.920  10.542  1.00 17.53  ? 610  LEU A C     1 
ATOM   4995 O  O     . LEU C 3 604 ? 42.412 18.289  9.552   1.00 14.46  ? 610  LEU A O     1 
ATOM   4996 C  CB    . LEU C 3 604 ? 39.670 18.552  11.356  1.00 16.85  ? 610  LEU A CB    1 
ATOM   4997 C  CG    . LEU C 3 604 ? 39.115 18.129  9.983   1.00 15.93  ? 610  LEU A CG    1 
ATOM   4998 C  CD1   . LEU C 3 604 ? 39.267 16.629  9.793   1.00 13.50  ? 610  LEU A CD1   1 
ATOM   4999 C  CD2   . LEU C 3 604 ? 37.662 18.539  9.835   1.00 13.74  ? 610  LEU A CD2   1 
ATOM   5000 N  N     . ASN C 3 605 ? 42.375 20.192  10.780  1.00 8.18   ? 611  ASN A N     1 
ATOM   5001 C  CA    . ASN C 3 605 ? 43.221 20.957  9.872   1.00 7.90   ? 611  ASN A CA    1 
ATOM   5002 C  C     . ASN C 3 605 ? 44.633 20.369  9.857   1.00 12.98  ? 611  ASN A C     1 
ATOM   5003 O  O     . ASN C 3 605 ? 45.303 20.373  8.825   1.00 13.34  ? 611  ASN A O     1 
ATOM   5004 C  CB    . ASN C 3 605 ? 43.265 22.434  10.283  1.00 16.84  ? 611  ASN A CB    1 
ATOM   5005 C  CG    . ASN C 3 605 ? 44.184 23.262  9.394   1.00 15.15  ? 611  ASN A CG    1 
ATOM   5006 O  OD1   . ASN C 3 605 ? 45.323 23.556  9.759   1.00 18.11  ? 611  ASN A OD1   1 
ATOM   5007 N  ND2   . ASN C 3 605 ? 43.696 23.625  8.216   1.00 12.52  ? 611  ASN A ND2   1 
ATOM   5008 N  N     . THR C 3 606 ? 45.083 19.871  11.007  1.00 13.63  ? 612  THR A N     1 
ATOM   5009 C  CA    . THR C 3 606 ? 46.404 19.264  11.107  1.00 7.88   ? 612  THR A CA    1 
ATOM   5010 C  C     . THR C 3 606 ? 46.411 17.983  10.272  1.00 6.82   ? 612  THR A C     1 
ATOM   5011 O  O     . THR C 3 606 ? 47.335 17.738  9.500   1.00 5.46   ? 612  THR A O     1 
ATOM   5012 C  CB    . THR C 3 606 ? 46.757 18.911  12.572  1.00 14.62  ? 612  THR A CB    1 
ATOM   5013 O  OG1   . THR C 3 606 ? 46.795 20.107  13.356  1.00 12.83  ? 612  THR A OG1   1 
ATOM   5014 C  CG2   . THR C 3 606 ? 48.116 18.238  12.652  1.00 10.70  ? 612  THR A CG2   1 
ATOM   5015 N  N     . LEU C 3 607 ? 45.353 17.193  10.412  1.00 5.50   ? 613  LEU A N     1 
ATOM   5016 C  CA    . LEU C 3 607 ? 45.215 15.932  9.691   1.00 12.17  ? 613  LEU A CA    1 
ATOM   5017 C  C     . LEU C 3 607 ? 45.133 16.124  8.180   1.00 18.15  ? 613  LEU A C     1 
ATOM   5018 O  O     . LEU C 3 607 ? 45.855 15.469  7.424   1.00 19.12  ? 613  LEU A O     1 
ATOM   5019 C  CB    . LEU C 3 607 ? 43.962 15.191  10.167  1.00 10.42  ? 613  LEU A CB    1 
ATOM   5020 C  CG    . LEU C 3 607 ? 43.656 13.819  9.553   1.00 16.40  ? 613  LEU A CG    1 
ATOM   5021 C  CD1   . LEU C 3 607 ? 44.694 12.810  10.007  1.00 12.08  ? 613  LEU A CD1   1 
ATOM   5022 C  CD2   . LEU C 3 607 ? 42.256 13.359  9.962   1.00 13.73  ? 613  LEU A CD2   1 
ATOM   5023 N  N     . LEU C 3 608 ? 44.249 17.019  7.748   1.00 16.30  ? 614  LEU A N     1 
ATOM   5024 C  CA    . LEU C 3 608 ? 44.053 17.285  6.327   1.00 15.51  ? 614  LEU A CA    1 
ATOM   5025 C  C     . LEU C 3 608 ? 45.166 18.090  5.654   1.00 13.22  ? 614  LEU A C     1 
ATOM   5026 O  O     . LEU C 3 608 ? 45.605 17.733  4.555   1.00 10.48  ? 614  LEU A O     1 
ATOM   5027 C  CB    . LEU C 3 608 ? 42.690 17.942  6.096   1.00 13.74  ? 614  LEU A CB    1 
ATOM   5028 C  CG    . LEU C 3 608 ? 41.491 17.157  6.643   1.00 3.27   ? 614  LEU A CG    1 
ATOM   5029 C  CD1   . LEU C 3 608 ? 40.202 17.766  6.140   1.00 4.35   ? 614  LEU A CD1   1 
ATOM   5030 C  CD2   . LEU C 3 608 ? 41.579 15.709  6.209   1.00 9.24   ? 614  LEU A CD2   1 
ATOM   5031 N  N     . GLN C 3 609 ? 45.640 19.152  6.307   1.00 11.16  ? 615  GLN A N     1 
ATOM   5032 C  CA    . GLN C 3 609 ? 46.707 19.963  5.724   1.00 6.68   ? 615  GLN A CA    1 
ATOM   5033 C  C     . GLN C 3 609 ? 48.008 19.173  5.645   1.00 7.36   ? 615  GLN A C     1 
ATOM   5034 O  O     . GLN C 3 609 ? 48.821 19.401  4.745   1.00 8.69   ? 615  GLN A O     1 
ATOM   5035 C  CB    . GLN C 3 609 ? 46.931 21.269  6.495   1.00 8.30   ? 615  GLN A CB    1 
ATOM   5036 C  CG    . GLN C 3 609 ? 47.850 22.241  5.744   1.00 6.57   ? 615  GLN A CG    1 
ATOM   5037 C  CD    . GLN C 3 609 ? 48.242 23.462  6.549   1.00 6.17   ? 615  GLN A CD    1 
ATOM   5038 O  OE1   . GLN C 3 609 ? 49.330 23.517  7.134   1.00 6.56   ? 615  GLN A OE1   1 
ATOM   5039 N  NE2   . GLN C 3 609 ? 47.377 24.461  6.558   1.00 2.00   ? 615  GLN A NE2   1 
ATOM   5040 N  N     . SER C 3 610 ? 48.205 18.239  6.576   1.00 9.64   ? 616  SER A N     1 
ATOM   5041 C  CA    . SER C 3 610 ? 49.418 17.420  6.568   1.00 8.16   ? 616  SER A CA    1 
ATOM   5042 C  C     . SER C 3 610 ? 49.343 16.394  5.446   1.00 11.26  ? 616  SER A C     1 
ATOM   5043 O  O     . SER C 3 610 ? 50.347 16.132  4.781   1.00 8.23   ? 616  SER A O     1 
ATOM   5044 C  CB    . SER C 3 610 ? 49.618 16.697  7.897   1.00 10.76  ? 616  SER A CB    1 
ATOM   5045 O  OG    . SER C 3 610 ? 50.836 15.978  7.881   1.00 9.03   ? 616  SER A OG    1 
ATOM   5046 N  N     . ALA C 3 611 ? 48.157 15.813  5.247   1.00 9.95   ? 617  ALA A N     1 
ATOM   5047 C  CA    . ALA C 3 611 ? 47.956 14.814  4.197   1.00 10.21  ? 617  ALA A CA    1 
ATOM   5048 C  C     . ALA C 3 611 ? 48.209 15.437  2.830   1.00 2.00   ? 617  ALA A C     1 
ATOM   5049 O  O     . ALA C 3 611 ? 48.908 14.859  2.010   1.00 11.51  ? 617  ALA A O     1 
ATOM   5050 C  CB    . ALA C 3 611 ? 46.558 14.243  4.266   1.00 7.51   ? 617  ALA A CB    1 
ATOM   5051 N  N     . GLY C 3 612 ? 47.656 16.626  2.606   1.00 8.23   ? 618  GLY A N     1 
ATOM   5052 C  CA    . GLY C 3 612 ? 47.848 17.320  1.342   1.00 8.11   ? 618  GLY A CA    1 
ATOM   5053 C  C     . GLY C 3 612 ? 49.301 17.711  1.121   1.00 11.22  ? 618  GLY A C     1 
ATOM   5054 O  O     . GLY C 3 612 ? 49.824 17.613  0.007   1.00 11.17  ? 618  GLY A O     1 
ATOM   5055 N  N     . ALA C 3 613 ? 49.964 18.127  2.198   1.00 10.32  ? 619  ALA A N     1 
ATOM   5056 C  CA    . ALA C 3 613 ? 51.364 18.533  2.146   1.00 8.15   ? 619  ALA A CA    1 
ATOM   5057 C  C     . ALA C 3 613 ? 52.311 17.385  1.838   1.00 10.97  ? 619  ALA A C     1 
ATOM   5058 O  O     . ALA C 3 613 ? 53.245 17.546  1.057   1.00 13.53  ? 619  ALA A O     1 
ATOM   5059 C  CB    . ALA C 3 613 ? 51.773 19.197  3.452   1.00 14.56  ? 619  ALA A CB    1 
ATOM   5060 N  N     . LEU C 3 614 ? 52.088 16.238  2.472   1.00 7.81   ? 620  LEU A N     1 
ATOM   5061 C  CA    . LEU C 3 614 ? 52.945 15.082  2.245   1.00 12.12  ? 620  LEU A CA    1 
ATOM   5062 C  C     . LEU C 3 614 ? 52.695 14.474  0.862   1.00 9.52   ? 620  LEU A C     1 
ATOM   5063 O  O     . LEU C 3 614 ? 53.628 13.971  0.229   1.00 4.51   ? 620  LEU A O     1 
ATOM   5064 C  CB    . LEU C 3 614 ? 52.750 14.043  3.345   1.00 6.46   ? 620  LEU A CB    1 
ATOM   5065 C  CG    . LEU C 3 614 ? 53.060 14.523  4.762   1.00 7.12   ? 620  LEU A CG    1 
ATOM   5066 C  CD1   . LEU C 3 614 ? 53.085 13.303  5.660   1.00 4.90   ? 620  LEU A CD1   1 
ATOM   5067 C  CD2   . LEU C 3 614 ? 54.399 15.252  4.817   1.00 2.00   ? 620  LEU A CD2   1 
ATOM   5068 N  N     . ILE C 3 615 ? 51.439 14.530  0.413   1.00 6.30   ? 621  ILE A N     1 
ATOM   5069 C  CA    . ILE C 3 615 ? 51.033 14.032  -0.903  1.00 5.95   ? 621  ILE A CA    1 
ATOM   5070 C  C     . ILE C 3 615 ? 51.751 14.883  -1.949  1.00 12.85  ? 621  ILE A C     1 
ATOM   5071 O  O     . ILE C 3 615 ? 52.367 14.357  -2.873  1.00 12.00  ? 621  ILE A O     1 
ATOM   5072 C  CB    . ILE C 3 615 ? 49.495 14.176  -1.108  1.00 12.82  ? 621  ILE A CB    1 
ATOM   5073 C  CG1   . ILE C 3 615 ? 48.765 13.024  -0.422  1.00 16.08  ? 621  ILE A CG1   1 
ATOM   5074 C  CG2   . ILE C 3 615 ? 49.126 14.223  -2.602  1.00 17.11  ? 621  ILE A CG2   1 
ATOM   5075 C  CD1   . ILE C 3 615 ? 47.273 13.225  -0.343  1.00 5.55   ? 621  ILE A CD1   1 
ATOM   5076 N  N     . CYS C 3 616 ? 51.685 16.202  -1.776  1.00 11.11  ? 622  CYS A N     1 
ATOM   5077 C  CA    . CYS C 3 616 ? 52.328 17.124  -2.704  1.00 16.89  ? 622  CYS A CA    1 
ATOM   5078 C  C     . CYS C 3 616 ? 53.845 17.035  -2.670  1.00 14.57  ? 622  CYS A C     1 
ATOM   5079 O  O     . CYS C 3 616 ? 54.503 17.212  -3.698  1.00 12.66  ? 622  CYS A O     1 
ATOM   5080 C  CB    . CYS C 3 616 ? 51.893 18.561  -2.429  1.00 12.45  ? 622  CYS A CB    1 
ATOM   5081 S  SG    . CYS C 3 616 ? 50.175 18.868  -2.833  1.00 13.45  ? 622  CYS A SG    1 
ATOM   5082 N  N     . LYS C 3 617 ? 54.394 16.744  -1.495  1.00 9.42   ? 623  LYS A N     1 
ATOM   5083 C  CA    . LYS C 3 617 ? 55.832 16.638  -1.355  1.00 6.96   ? 623  LYS A CA    1 
ATOM   5084 C  C     . LYS C 3 617 ? 56.361 15.409  -2.110  1.00 11.27  ? 623  LYS A C     1 
ATOM   5085 O  O     . LYS C 3 617 ? 57.388 15.490  -2.804  1.00 9.49   ? 623  LYS A O     1 
ATOM   5086 C  CB    . LYS C 3 617 ? 56.209 16.610  0.127   1.00 9.75   ? 623  LYS A CB    1 
ATOM   5087 C  CG    . LYS C 3 617 ? 57.686 16.831  0.404   1.00 14.02  ? 623  LYS A CG    1 
ATOM   5088 C  CD    . LYS C 3 617 ? 57.968 16.955  1.893   1.00 11.68  ? 623  LYS A CD    1 
ATOM   5089 C  CE    . LYS C 3 617 ? 57.335 18.199  2.482   1.00 18.45  ? 623  LYS A CE    1 
ATOM   5090 N  NZ    . LYS C 3 617 ? 57.785 18.435  3.883   1.00 14.47  ? 623  LYS A NZ    1 
ATOM   5091 N  N     . LEU C 3 618 ? 55.659 14.279  -1.985  1.00 10.69  ? 624  LEU A N     1 
ATOM   5092 C  CA    . LEU C 3 618 ? 56.054 13.048  -2.677  1.00 11.08  ? 624  LEU A CA    1 
ATOM   5093 C  C     . LEU C 3 618 ? 55.772 13.234  -4.183  1.00 14.06  ? 624  LEU A C     1 
ATOM   5094 O  O     . LEU C 3 618 ? 56.440 12.647  -5.037  1.00 14.92  ? 624  LEU A O     1 
ATOM   5095 C  CB    . LEU C 3 618 ? 55.239 11.856  -2.167  1.00 13.05  ? 624  LEU A CB    1 
ATOM   5096 C  CG    . LEU C 3 618 ? 55.893 10.480  -1.994  1.00 16.28  ? 624  LEU A CG    1 
ATOM   5097 C  CD1   . LEU C 3 618 ? 54.793 9.424   -2.069  1.00 9.91   ? 624  LEU A CD1   1 
ATOM   5098 C  CD2   . LEU C 3 618 ? 56.960 10.208  -3.042  1.00 18.77  ? 624  LEU A CD2   1 
ATOM   5099 N  N     . TRP C 3 619 ? 54.759 14.043  -4.484  1.00 7.80   ? 625  TRP A N     1 
ATOM   5100 C  CA    . TRP C 3 619 ? 54.362 14.346  -5.851  1.00 5.91   ? 625  TRP A CA    1 
ATOM   5101 C  C     . TRP C 3 619 ? 55.456 15.068  -6.647  1.00 13.07  ? 625  TRP A C     1 
ATOM   5102 O  O     . TRP C 3 619 ? 55.771 14.652  -7.765  1.00 12.72  ? 625  TRP A O     1 
ATOM   5103 C  CB    . TRP C 3 619 ? 53.080 15.190  -5.842  1.00 8.07   ? 625  TRP A CB    1 
ATOM   5104 C  CG    . TRP C 3 619 ? 52.698 15.791  -7.172  1.00 15.27  ? 625  TRP A CG    1 
ATOM   5105 C  CD1   . TRP C 3 619 ? 52.521 15.133  -8.355  1.00 12.92  ? 625  TRP A CD1   1 
ATOM   5106 C  CD2   . TRP C 3 619 ? 52.429 17.172  -7.436  1.00 14.62  ? 625  TRP A CD2   1 
ATOM   5107 N  NE1   . TRP C 3 619 ? 52.157 16.017  -9.336  1.00 8.87   ? 625  TRP A NE1   1 
ATOM   5108 C  CE2   . TRP C 3 619 ? 52.088 17.275  -8.803  1.00 14.36  ? 625  TRP A CE2   1 
ATOM   5109 C  CE3   . TRP C 3 619 ? 52.439 18.334  -6.648  1.00 13.60  ? 625  TRP A CE3   1 
ATOM   5110 C  CZ2   . TRP C 3 619 ? 51.757 18.495  -9.407  1.00 15.05  ? 625  TRP A CZ2   1 
ATOM   5111 C  CZ3   . TRP C 3 619 ? 52.110 19.551  -7.245  1.00 16.89  ? 625  TRP A CZ3   1 
ATOM   5112 C  CH2   . TRP C 3 619 ? 51.773 19.619  -8.615  1.00 16.74  ? 625  TRP A CH2   1 
ATOM   5113 N  N     . ILE C 3 620 ? 56.028 16.138  -6.083  1.00 7.76   ? 626  ILE A N     1 
ATOM   5114 C  CA    . ILE C 3 620 ? 57.078 16.900  -6.777  1.00 7.73   ? 626  ILE A CA    1 
ATOM   5115 C  C     . ILE C 3 620 ? 58.360 16.085  -6.964  1.00 13.63  ? 626  ILE A C     1 
ATOM   5116 O  O     . ILE C 3 620 ? 59.109 16.290  -7.927  1.00 11.39  ? 626  ILE A O     1 
ATOM   5117 C  CB    . ILE C 3 620 ? 57.412 18.245  -6.060  1.00 9.75   ? 626  ILE A CB    1 
ATOM   5118 C  CG1   . ILE C 3 620 ? 58.129 18.004  -4.727  1.00 3.90   ? 626  ILE A CG1   1 
ATOM   5119 C  CG2   . ILE C 3 620 ? 56.139 19.037  -5.833  1.00 4.43   ? 626  ILE A CG2   1 
ATOM   5120 C  CD1   . ILE C 3 620 ? 58.780 19.259  -4.148  1.00 3.80   ? 626  ILE A CD1   1 
ATOM   5121 N  N     . ILE C 3 621 ? 58.602 15.169  -6.023  1.00 11.28  ? 627  ILE A N     1 
ATOM   5122 C  CA    . ILE C 3 621 ? 59.770 14.292  -6.046  1.00 13.06  ? 627  ILE A CA    1 
ATOM   5123 C  C     . ILE C 3 621 ? 59.601 13.254  -7.157  1.00 9.33   ? 627  ILE A C     1 
ATOM   5124 O  O     . ILE C 3 621 ? 60.524 13.011  -7.940  1.00 8.60   ? 627  ILE A O     1 
ATOM   5125 C  CB    . ILE C 3 621 ? 59.944 13.530  -4.682  1.00 16.64  ? 627  ILE A CB    1 
ATOM   5126 C  CG1   . ILE C 3 621 ? 60.267 14.508  -3.553  1.00 21.26  ? 627  ILE A CG1   1 
ATOM   5127 C  CG2   . ILE C 3 621 ? 61.067 12.501  -4.775  1.00 14.01  ? 627  ILE A CG2   1 
ATOM   5128 C  CD1   . ILE C 3 621 ? 60.272 13.857  -2.178  1.00 18.58  ? 627  ILE A CD1   1 
ATOM   5129 N  N     . LYS C 3 622 ? 58.414 12.652  -7.216  1.00 5.80   ? 628  LYS A N     1 
ATOM   5130 C  CA    . LYS C 3 622 ? 58.118 11.626  -8.210  1.00 9.96   ? 628  LYS A CA    1 
ATOM   5131 C  C     . LYS C 3 622 ? 58.056 12.192  -9.619  1.00 8.51   ? 628  LYS A C     1 
ATOM   5132 O  O     . LYS C 3 622 ? 58.493 11.543  -10.563 1.00 10.67  ? 628  LYS A O     1 
ATOM   5133 C  CB    . LYS C 3 622 ? 56.805 10.911  -7.864  1.00 12.41  ? 628  LYS A CB    1 
ATOM   5134 C  CG    . LYS C 3 622 ? 56.508 9.671   -8.708  1.00 14.24  ? 628  LYS A CG    1 
ATOM   5135 C  CD    . LYS C 3 622 ? 57.623 8.642   -8.589  1.00 14.47  ? 628  LYS A CD    1 
ATOM   5136 C  CE    . LYS C 3 622 ? 57.370 7.454   -9.485  1.00 15.58  ? 628  LYS A CE    1 
ATOM   5137 N  NZ    . LYS C 3 622 ? 58.580 6.606   -9.596  1.00 23.48  ? 628  LYS A NZ    1 
ATOM   5138 N  N     . THR C 3 623 ? 57.517 13.403  -9.749  1.00 8.66   ? 629  THR A N     1 
ATOM   5139 C  CA    . THR C 3 623 ? 57.394 14.072  -11.044 1.00 7.71   ? 629  THR A CA    1 
ATOM   5140 C  C     . THR C 3 623 ? 58.780 14.246  -11.651 1.00 2.56   ? 629  THR A C     1 
ATOM   5141 O  O     . THR C 3 623 ? 59.029 13.776  -12.755 1.00 14.55  ? 629  THR A O     1 
ATOM   5142 C  CB    . THR C 3 623 ? 56.677 15.452  -10.905 1.00 2.00   ? 629  THR A CB    1 
ATOM   5143 O  OG1   . THR C 3 623 ? 55.314 15.242  -10.531 1.00 5.69   ? 629  THR A OG1   1 
ATOM   5144 C  CG2   . THR C 3 623 ? 56.699 16.233  -12.203 1.00 6.52   ? 629  THR A CG2   1 
ATOM   5145 N  N     . GLU C 3 624 ? 59.697 14.846  -10.898 1.00 5.78   ? 630  GLU A N     1 
ATOM   5146 C  CA    . GLU C 3 624 ? 61.052 15.066  -11.388 1.00 6.73   ? 630  GLU A CA    1 
ATOM   5147 C  C     . GLU C 3 624 ? 61.758 13.759  -11.733 1.00 11.04  ? 630  GLU A C     1 
ATOM   5148 O  O     . GLU C 3 624 ? 62.474 13.689  -12.726 1.00 15.54  ? 630  GLU A O     1 
ATOM   5149 C  CB    . GLU C 3 624 ? 61.893 15.827  -10.364 1.00 6.67   ? 630  GLU A CB    1 
ATOM   5150 C  CG    . GLU C 3 624 ? 63.210 16.343  -10.968 1.00 16.86  ? 630  GLU A CG    1 
ATOM   5151 C  CD    . GLU C 3 624 ? 64.445 16.054  -10.124 1.00 14.71  ? 630  GLU A CD    1 
ATOM   5152 O  OE1   . GLU C 3 624 ? 64.368 15.259  -9.168  1.00 20.20  ? 630  GLU A OE1   1 
ATOM   5153 O  OE2   . GLU C 3 624 ? 65.509 16.626  -10.420 1.00 18.56  ? 630  GLU A OE2   1 
ATOM   5154 N  N     . GLU C 3 625 ? 61.566 12.737  -10.901 1.00 11.88  ? 631  GLU A N     1 
ATOM   5155 C  CA    . GLU C 3 625 ? 62.182 11.431  -11.110 1.00 15.23  ? 631  GLU A CA    1 
ATOM   5156 C  C     . GLU C 3 625 ? 61.678 10.757  -12.387 1.00 15.77  ? 631  GLU A C     1 
ATOM   5157 O  O     . GLU C 3 625 ? 62.445 10.095  -13.079 1.00 12.75  ? 631  GLU A O     1 
ATOM   5158 C  CB    . GLU C 3 625 ? 61.937 10.530  -9.904  1.00 19.20  ? 631  GLU A CB    1 
ATOM   5159 C  CG    . GLU C 3 625 ? 62.702 9.232   -9.958  1.00 27.98  ? 631  GLU A CG    1 
ATOM   5160 C  CD    . GLU C 3 625 ? 62.732 8.522   -8.626  1.00 33.80  ? 631  GLU A CD    1 
ATOM   5161 O  OE1   . GLU C 3 625 ? 61.656 8.128   -8.128  1.00 35.40  ? 631  GLU A OE1   1 
ATOM   5162 O  OE2   . GLU C 3 625 ? 63.840 8.366   -8.075  1.00 36.44  ? 631  GLU A OE2   1 
ATOM   5163 N  N     . MET C 3 626 ? 60.394 10.932  -12.691 1.00 17.10  ? 632  MET A N     1 
ATOM   5164 C  CA    . MET C 3 626 ? 59.804 10.355  -13.896 1.00 24.60  ? 632  MET A CA    1 
ATOM   5165 C  C     . MET C 3 626 ? 60.342 11.076  -15.131 1.00 18.26  ? 632  MET A C     1 
ATOM   5166 O  O     . MET C 3 626 ? 60.668 10.438  -16.128 1.00 24.76  ? 632  MET A O     1 
ATOM   5167 C  CB    . MET C 3 626 ? 58.278 10.438  -13.855 1.00 31.71  ? 632  MET A CB    1 
ATOM   5168 C  CG    . MET C 3 626 ? 57.628 9.496   -12.864 1.00 40.86  ? 632  MET A CG    1 
ATOM   5169 S  SD    . MET C 3 626 ? 55.815 9.583   -12.914 1.00 18.39  ? 632  MET A SD    1 
ATOM   5170 C  CE    . MET C 3 626 ? 55.437 8.372   -14.184 1.00 54.07  ? 632  MET A CE    1 
ATOM   5171 N  N     . LEU C 3 627 ? 60.451 12.403  -15.043 1.00 13.71  ? 633  LEU A N     1 
ATOM   5172 C  CA    . LEU C 3 627 ? 60.969 13.222  -16.135 1.00 7.26   ? 633  LEU A CA    1 
ATOM   5173 C  C     . LEU C 3 627 ? 62.403 12.804  -16.437 1.00 8.22   ? 633  LEU A C     1 
ATOM   5174 O  O     . LEU C 3 627 ? 62.764 12.594  -17.587 1.00 9.09   ? 633  LEU A O     1 
ATOM   5175 C  CB    . LEU C 3 627 ? 60.932 14.707  -15.755 1.00 10.34  ? 633  LEU A CB    1 
ATOM   5176 C  CG    . LEU C 3 627 ? 59.556 15.364  -15.626 1.00 2.00   ? 633  LEU A CG    1 
ATOM   5177 C  CD1   . LEU C 3 627 ? 59.701 16.808  -15.182 1.00 2.61   ? 633  LEU A CD1   1 
ATOM   5178 C  CD2   . LEU C 3 627 ? 58.844 15.296  -16.963 1.00 9.17   ? 633  LEU A CD2   1 
ATOM   5179 N  N     . VAL C 3 628 ? 63.204 12.650  -15.388 1.00 10.84  ? 634  VAL A N     1 
ATOM   5180 C  CA    . VAL C 3 628 ? 64.602 12.246  -15.524 1.00 14.09  ? 634  VAL A CA    1 
ATOM   5181 C  C     . VAL C 3 628 ? 64.753 10.855  -16.165 1.00 16.42  ? 634  VAL A C     1 
ATOM   5182 O  O     . VAL C 3 628 ? 65.671 10.636  -16.963 1.00 20.07  ? 634  VAL A O     1 
ATOM   5183 C  CB    . VAL C 3 628 ? 65.329 12.281  -14.147 1.00 20.64  ? 634  VAL A CB    1 
ATOM   5184 C  CG1   . VAL C 3 628 ? 66.722 11.651  -14.250 1.00 21.41  ? 634  VAL A CG1   1 
ATOM   5185 C  CG2   . VAL C 3 628 ? 65.441 13.717  -13.658 1.00 15.84  ? 634  VAL A CG2   1 
ATOM   5186 N  N     . GLU C 3 629 ? 63.868 9.919   -15.823 1.00 12.57  ? 635  GLU A N     1 
ATOM   5187 C  CA    . GLU C 3 629 ? 63.951 8.575   -16.401 1.00 20.37  ? 635  GLU A CA    1 
ATOM   5188 C  C     . GLU C 3 629 ? 63.383 8.524   -17.828 1.00 20.51  ? 635  GLU A C     1 
ATOM   5189 O  O     . GLU C 3 629 ? 63.417 7.486   -18.489 1.00 21.55  ? 635  GLU A O     1 
ATOM   5190 C  CB    . GLU C 3 629 ? 63.326 7.514   -15.472 1.00 26.92  ? 635  GLU A CB    1 
ATOM   5191 C  CG    . GLU C 3 629 ? 61.869 7.718   -15.075 1.00 41.47  ? 635  GLU A CG    1 
ATOM   5192 C  CD    . GLU C 3 629 ? 61.403 6.788   -13.940 1.00 44.04  ? 635  GLU A CD    1 
ATOM   5193 O  OE1   . GLU C 3 629 ? 62.223 6.404   -13.073 1.00 33.06  ? 635  GLU A OE1   1 
ATOM   5194 O  OE2   . GLU C 3 629 ? 60.198 6.455   -13.908 1.00 47.65  ? 635  GLU A OE2   1 
ATOM   5195 N  N     . LYS C 3 630 ? 62.881 9.670   -18.289 1.00 23.65  ? 636  LYS A N     1 
ATOM   5196 C  CA    . LYS C 3 630 ? 62.342 9.828   -19.636 1.00 17.58  ? 636  LYS A CA    1 
ATOM   5197 C  C     . LYS C 3 630 ? 63.383 10.542  -20.496 1.00 16.77  ? 636  LYS A C     1 
ATOM   5198 O  O     . LYS C 3 630 ? 63.078 10.988  -21.603 1.00 25.37  ? 636  LYS A O     1 
ATOM   5199 C  CB    . LYS C 3 630 ? 61.060 10.657  -19.624 1.00 20.15  ? 636  LYS A CB    1 
ATOM   5200 C  CG    . LYS C 3 630 ? 59.835 9.905   -19.174 1.00 16.10  ? 636  LYS A CG    1 
ATOM   5201 C  CD    . LYS C 3 630 ? 58.596 10.779  -19.287 1.00 21.95  ? 636  LYS A CD    1 
ATOM   5202 C  CE    . LYS C 3 630 ? 57.353 10.016  -18.858 1.00 30.82  ? 636  LYS A CE    1 
ATOM   5203 N  NZ    . LYS C 3 630 ? 56.121 10.823  -19.036 1.00 26.89  ? 636  LYS A NZ    1 
ATOM   5204 N  N     . GLY C 3 631 ? 64.603 10.665  -19.967 1.00 16.61  ? 637  GLY A N     1 
ATOM   5205 C  CA    . GLY C 3 631 ? 65.689 11.320  -20.680 1.00 18.51  ? 637  GLY A CA    1 
ATOM   5206 C  C     . GLY C 3 631 ? 65.859 12.812  -20.439 1.00 21.98  ? 637  GLY A C     1 
ATOM   5207 O  O     . GLY C 3 631 ? 66.880 13.384  -20.816 1.00 31.72  ? 637  GLY A O     1 
ATOM   5208 N  N     . LEU C 3 632 ? 64.872 13.443  -19.807 1.00 19.95  ? 638  LEU A N     1 
ATOM   5209 C  CA    . LEU C 3 632 ? 64.910 14.881  -19.525 1.00 14.61  ? 638  LEU A CA    1 
ATOM   5210 C  C     . LEU C 3 632 ? 65.939 15.302  -18.472 1.00 13.53  ? 638  LEU A C     1 
ATOM   5211 O  O     . LEU C 3 632 ? 66.115 14.632  -17.455 1.00 12.16  ? 638  LEU A O     1 
ATOM   5212 C  CB    . LEU C 3 632 ? 63.508 15.361  -19.126 1.00 6.95   ? 638  LEU A CB    1 
ATOM   5213 C  CG    . LEU C 3 632 ? 62.494 15.687  -20.229 1.00 6.94   ? 638  LEU A CG    1 
ATOM   5214 C  CD1   . LEU C 3 632 ? 62.867 15.055  -21.549 1.00 7.67   ? 638  LEU A CD1   1 
ATOM   5215 C  CD2   . LEU C 3 632 ? 61.109 15.277  -19.796 1.00 7.94   ? 638  LEU A CD2   1 
ATOM   5216 N  N     . LYS C 3 633 ? 66.622 16.414  -18.733 1.00 14.78  ? 639  LYS A N     1 
ATOM   5217 C  CA    . LYS C 3 633 ? 67.631 16.932  -17.814 1.00 17.59  ? 639  LYS A CA    1 
ATOM   5218 C  C     . LYS C 3 633 ? 67.149 18.177  -17.074 1.00 14.87  ? 639  LYS A C     1 
ATOM   5219 O  O     . LYS C 3 633 ? 66.559 19.081  -17.664 1.00 17.23  ? 639  LYS A O     1 
ATOM   5220 C  CB    . LYS C 3 633 ? 68.943 17.233  -18.545 1.00 25.88  ? 639  LYS A CB    1 
ATOM   5221 C  CG    . LYS C 3 633 ? 69.977 17.932  -17.654 1.00 37.49  ? 639  LYS A CG    1 
ATOM   5222 C  CD    . LYS C 3 633 ? 71.291 18.197  -18.370 1.00 49.61  ? 639  LYS A CD    1 
ATOM   5223 C  CE    . LYS C 3 633 ? 72.205 19.092  -17.539 1.00 47.15  ? 639  LYS A CE    1 
ATOM   5224 N  NZ    . LYS C 3 633 ? 72.427 18.582  -16.156 1.00 49.96  ? 639  LYS A NZ    1 
ATOM   5225 N  N     . HIS C 3 634 ? 67.426 18.205  -15.774 1.00 15.98  ? 640  HIS A N     1 
ATOM   5226 C  CA    . HIS C 3 634 ? 67.038 19.303  -14.898 1.00 8.92   ? 640  HIS A CA    1 
ATOM   5227 C  C     . HIS C 3 634 ? 68.130 20.363  -14.844 1.00 11.35  ? 640  HIS A C     1 
ATOM   5228 O  O     . HIS C 3 634 ? 69.243 20.096  -14.404 1.00 8.17   ? 640  HIS A O     1 
ATOM   5229 C  CB    . HIS C 3 634 ? 66.763 18.766  -13.491 1.00 10.90  ? 640  HIS A CB    1 
ATOM   5230 C  CG    . HIS C 3 634 ? 65.992 19.713  -12.627 1.00 10.95  ? 640  HIS A CG    1 
ATOM   5231 N  ND1   . HIS C 3 634 ? 65.259 19.294  -11.541 1.00 8.88   ? 640  HIS A ND1   1 
ATOM   5232 C  CD2   . HIS C 3 634 ? 65.820 21.053  -12.702 1.00 7.89   ? 640  HIS A CD2   1 
ATOM   5233 C  CE1   . HIS C 3 634 ? 64.667 20.334  -10.982 1.00 7.82   ? 640  HIS A CE1   1 
ATOM   5234 N  NE2   . HIS C 3 634 ? 64.992 21.414  -11.669 1.00 9.40   ? 640  HIS A NE2   1 
ATOM   5235 N  N     . GLY C 3 635 ? 67.795 21.566  -15.297 1.00 11.05  ? 641  GLY A N     1 
ATOM   5236 C  CA    . GLY C 3 635 ? 68.734 22.671  -15.305 1.00 11.57  ? 641  GLY A CA    1 
ATOM   5237 C  C     . GLY C 3 635 ? 68.507 23.574  -16.507 1.00 13.09  ? 641  GLY A C     1 
ATOM   5238 O  O     . GLY C 3 635 ? 67.813 23.191  -17.454 1.00 10.91  ? 641  GLY A O     1 
ATOM   5239 N  N     . TRP C 3 636 ? 69.072 24.778  -16.465 1.00 10.32  ? 642  TRP A N     1 
ATOM   5240 C  CA    . TRP C 3 636 ? 68.935 25.726  -17.571 1.00 15.77  ? 642  TRP A CA    1 
ATOM   5241 C  C     . TRP C 3 636 ? 69.764 25.269  -18.774 1.00 12.77  ? 642  TRP A C     1 
ATOM   5242 O  O     . TRP C 3 636 ? 69.554 25.728  -19.895 1.00 17.35  ? 642  TRP A O     1 
ATOM   5243 C  CB    . TRP C 3 636 ? 69.359 27.136  -17.145 1.00 8.83   ? 642  TRP A CB    1 
ATOM   5244 C  CG    . TRP C 3 636 ? 68.520 27.733  -16.038 1.00 9.77   ? 642  TRP A CG    1 
ATOM   5245 C  CD1   . TRP C 3 636 ? 68.970 28.192  -14.833 1.00 2.93   ? 642  TRP A CD1   1 
ATOM   5246 C  CD2   . TRP C 3 636 ? 67.099 27.961  -16.048 1.00 7.50   ? 642  TRP A CD2   1 
ATOM   5247 N  NE1   . TRP C 3 636 ? 67.926 28.698  -14.094 1.00 4.79   ? 642  TRP A NE1   1 
ATOM   5248 C  CE2   . TRP C 3 636 ? 66.765 28.572  -14.811 1.00 6.20   ? 642  TRP A CE2   1 
ATOM   5249 C  CE3   . TRP C 3 636 ? 66.078 27.710  -16.980 1.00 5.32   ? 642  TRP A CE3   1 
ATOM   5250 C  CZ2   . TRP C 3 636 ? 65.450 28.937  -14.478 1.00 2.00   ? 642  TRP A CZ2   1 
ATOM   5251 C  CZ3   . TRP C 3 636 ? 64.762 28.073  -16.648 1.00 8.19   ? 642  TRP A CZ3   1 
ATOM   5252 C  CH2   . TRP C 3 636 ? 64.465 28.682  -15.400 1.00 4.08   ? 642  TRP A CH2   1 
ATOM   5253 N  N     . ASP C 3 637 ? 70.720 24.380  -18.520 1.00 16.09  ? 643  ASP A N     1 
ATOM   5254 C  CA    . ASP C 3 637 ? 71.580 23.818  -19.559 1.00 13.89  ? 643  ASP A CA    1 
ATOM   5255 C  C     . ASP C 3 637 ? 70.984 22.471  -19.988 1.00 15.13  ? 643  ASP A C     1 
ATOM   5256 O  O     . ASP C 3 637 ? 71.654 21.646  -20.619 1.00 11.44  ? 643  ASP A O     1 
ATOM   5257 C  CB    . ASP C 3 637 ? 73.014 23.624  -19.023 1.00 18.92  ? 643  ASP A CB    1 
ATOM   5258 C  CG    . ASP C 3 637 ? 73.094 22.666  -17.813 1.00 19.20  ? 643  ASP A CG    1 
ATOM   5259 O  OD1   . ASP C 3 637 ? 72.050 22.294  -17.229 1.00 18.14  ? 643  ASP A OD1   1 
ATOM   5260 O  OD2   . ASP C 3 637 ? 74.228 22.288  -17.440 1.00 13.58  ? 643  ASP A OD2   1 
ATOM   5261 N  N     . GLY C 3 638 ? 69.714 22.267  -19.636 1.00 14.88  ? 644  GLY A N     1 
ATOM   5262 C  CA    . GLY C 3 638 ? 69.034 21.031  -19.954 1.00 14.25  ? 644  GLY A CA    1 
ATOM   5263 C  C     . GLY C 3 638 ? 67.713 21.216  -20.664 1.00 11.43  ? 644  GLY A C     1 
ATOM   5264 O  O     . GLY C 3 638 ? 67.628 21.970  -21.624 1.00 9.44   ? 644  GLY A O     1 
ATOM   5265 N  N     . ASP C 3 639 ? 66.685 20.526  -20.170 1.00 12.22  ? 645  ASP A N     1 
ATOM   5266 C  CA    . ASP C 3 639 ? 65.341 20.559  -20.750 1.00 9.77   ? 645  ASP A CA    1 
ATOM   5267 C  C     . ASP C 3 639 ? 64.251 21.228  -19.915 1.00 13.33  ? 645  ASP A C     1 
ATOM   5268 O  O     . ASP C 3 639 ? 63.319 21.804  -20.472 1.00 9.83   ? 645  ASP A O     1 
ATOM   5269 C  CB    . ASP C 3 639 ? 64.907 19.128  -21.092 1.00 9.27   ? 645  ASP A CB    1 
ATOM   5270 C  CG    . ASP C 3 639 ? 65.908 18.416  -21.996 1.00 16.57  ? 645  ASP A CG    1 
ATOM   5271 O  OD1   . ASP C 3 639 ? 66.195 18.921  -23.102 1.00 14.92  ? 645  ASP A OD1   1 
ATOM   5272 O  OD2   . ASP C 3 639 ? 66.432 17.362  -21.591 1.00 15.11  ? 645  ASP A OD2   1 
ATOM   5273 N  N     . PHE C 3 640 ? 64.345 21.121  -18.590 1.00 8.68   ? 646  PHE A N     1 
ATOM   5274 C  CA    . PHE C 3 640 ? 63.353 21.722  -17.698 1.00 6.74   ? 646  PHE A CA    1 
ATOM   5275 C  C     . PHE C 3 640 ? 64.029 22.250  -16.437 1.00 11.38  ? 646  PHE A C     1 
ATOM   5276 O  O     . PHE C 3 640 ? 65.157 21.876  -16.131 1.00 13.37  ? 646  PHE A O     1 
ATOM   5277 C  CB    . PHE C 3 640 ? 62.259 20.704  -17.320 1.00 9.75   ? 646  PHE A CB    1 
ATOM   5278 C  CG    . PHE C 3 640 ? 62.734 19.597  -16.401 1.00 16.47  ? 646  PHE A CG    1 
ATOM   5279 C  CD1   . PHE C 3 640 ? 63.333 18.447  -16.919 1.00 10.09  ? 646  PHE A CD1   1 
ATOM   5280 C  CD2   . PHE C 3 640 ? 62.598 19.714  -15.015 1.00 10.44  ? 646  PHE A CD2   1 
ATOM   5281 C  CE1   . PHE C 3 640 ? 63.794 17.432  -16.069 1.00 12.03  ? 646  PHE A CE1   1 
ATOM   5282 C  CE2   . PHE C 3 640 ? 63.055 18.709  -14.162 1.00 3.08   ? 646  PHE A CE2   1 
ATOM   5283 C  CZ    . PHE C 3 640 ? 63.653 17.568  -14.687 1.00 10.63  ? 646  PHE A CZ    1 
ATOM   5284 N  N     . ALA C 3 641 ? 63.318 23.090  -15.691 1.00 11.76  ? 647  ALA A N     1 
ATOM   5285 C  CA    . ALA C 3 641 ? 63.856 23.669  -14.465 1.00 9.46   ? 647  ALA A CA    1 
ATOM   5286 C  C     . ALA C 3 641 ? 62.763 24.123  -13.513 1.00 11.42  ? 647  ALA A C     1 
ATOM   5287 O  O     . ALA C 3 641 ? 61.939 24.964  -13.866 1.00 10.52  ? 647  ALA A O     1 
ATOM   5288 C  CB    . ALA C 3 641 ? 64.769 24.846  -14.791 1.00 10.15  ? 647  ALA A CB    1 
ATOM   5289 N  N     . TYR C 3 642 ? 62.744 23.535  -12.317 1.00 10.99  ? 648  TYR A N     1 
ATOM   5290 C  CA    . TYR C 3 642 ? 61.773 23.900  -11.284 1.00 12.27  ? 648  TYR A CA    1 
ATOM   5291 C  C     . TYR C 3 642 ? 62.053 25.344  -10.889 1.00 6.95   ? 648  TYR A C     1 
ATOM   5292 O  O     . TYR C 3 642 ? 63.192 25.689  -10.565 1.00 6.16   ? 648  TYR A O     1 
ATOM   5293 C  CB    . TYR C 3 642 ? 61.937 23.019  -10.039 1.00 8.09   ? 648  TYR A CB    1 
ATOM   5294 C  CG    . TYR C 3 642 ? 61.165 21.718  -10.049 1.00 11.00  ? 648  TYR A CG    1 
ATOM   5295 C  CD1   . TYR C 3 642 ? 61.216 20.850  -11.144 1.00 6.83   ? 648  TYR A CD1   1 
ATOM   5296 C  CD2   . TYR C 3 642 ? 60.384 21.349  -8.950  1.00 11.28  ? 648  TYR A CD2   1 
ATOM   5297 C  CE1   . TYR C 3 642 ? 60.511 19.648  -11.144 1.00 7.28   ? 648  TYR A CE1   1 
ATOM   5298 C  CE2   . TYR C 3 642 ? 59.678 20.152  -8.938  1.00 11.32  ? 648  TYR A CE2   1 
ATOM   5299 C  CZ    . TYR C 3 642 ? 59.745 19.305  -10.038 1.00 12.01  ? 648  TYR A CZ    1 
ATOM   5300 O  OH    . TYR C 3 642 ? 59.056 18.116  -10.014 1.00 8.44   ? 648  TYR A OH    1 
ATOM   5301 N  N     . MET C 3 643 ? 61.018 26.176  -10.937 1.00 7.31   ? 649  MET A N     1 
ATOM   5302 C  CA    . MET C 3 643 ? 61.146 27.592  -10.590 1.00 11.35  ? 649  MET A CA    1 
ATOM   5303 C  C     . MET C 3 643 ? 60.446 27.922  -9.273  1.00 10.78  ? 649  MET A C     1 
ATOM   5304 O  O     . MET C 3 643 ? 60.901 28.781  -8.517  1.00 14.67  ? 649  MET A O     1 
ATOM   5305 C  CB    . MET C 3 643 ? 60.591 28.457  -11.720 1.00 4.07   ? 649  MET A CB    1 
ATOM   5306 C  CG    . MET C 3 643 ? 61.236 28.174  -13.084 1.00 9.93   ? 649  MET A CG    1 
ATOM   5307 S  SD    . MET C 3 643 ? 60.623 29.177  -14.458 1.00 27.32  ? 649  MET A SD    1 
ATOM   5308 C  CE    . MET C 3 643 ? 58.943 28.728  -14.521 1.00 2.00   ? 649  MET A CE    1 
ATOM   5309 N  N     . ALA C 3 644 ? 59.354 27.217  -8.989  1.00 10.85  ? 650  ALA A N     1 
ATOM   5310 C  CA    . ALA C 3 644 ? 58.613 27.437  -7.753  1.00 14.10  ? 650  ALA A CA    1 
ATOM   5311 C  C     . ALA C 3 644 ? 57.671 26.297  -7.386  1.00 14.39  ? 650  ALA A C     1 
ATOM   5312 O  O     . ALA C 3 644 ? 57.140 25.603  -8.253  1.00 11.90  ? 650  ALA A O     1 
ATOM   5313 C  CB    . ALA C 3 644 ? 57.836 28.744  -7.828  1.00 8.84   ? 650  ALA A CB    1 
ATOM   5314 N  N     . TRP C 3 645 ? 57.518 26.096  -6.079  1.00 12.02  ? 651  TRP A N     1 
ATOM   5315 C  CA    . TRP C 3 645 ? 56.629 25.088  -5.505  1.00 11.95  ? 651  TRP A CA    1 
ATOM   5316 C  C     . TRP C 3 645 ? 55.836 25.835  -4.441  1.00 5.88   ? 651  TRP A C     1 
ATOM   5317 O  O     . TRP C 3 645 ? 56.383 26.230  -3.410  1.00 8.87   ? 651  TRP A O     1 
ATOM   5318 C  CB    . TRP C 3 645 ? 57.401 23.937  -4.854  1.00 8.05   ? 651  TRP A CB    1 
ATOM   5319 C  CG    . TRP C 3 645 ? 56.486 22.941  -4.184  1.00 13.43  ? 651  TRP A CG    1 
ATOM   5320 C  CD1   . TRP C 3 645 ? 55.262 22.510  -4.635  1.00 11.81  ? 651  TRP A CD1   1 
ATOM   5321 C  CD2   . TRP C 3 645 ? 56.698 22.292  -2.925  1.00 7.95   ? 651  TRP A CD2   1 
ATOM   5322 N  NE1   . TRP C 3 645 ? 54.704 21.644  -3.732  1.00 12.66  ? 651  TRP A NE1   1 
ATOM   5323 C  CE2   . TRP C 3 645 ? 55.561 21.490  -2.672  1.00 16.22  ? 651  TRP A CE2   1 
ATOM   5324 C  CE3   . TRP C 3 645 ? 57.735 22.313  -1.981  1.00 11.27  ? 651  TRP A CE3   1 
ATOM   5325 C  CZ2   . TRP C 3 645 ? 55.434 20.713  -1.512  1.00 13.93  ? 651  TRP A CZ2   1 
ATOM   5326 C  CZ3   . TRP C 3 645 ? 57.610 21.541  -0.829  1.00 10.19  ? 651  TRP A CZ3   1 
ATOM   5327 C  CH2   . TRP C 3 645 ? 56.466 20.754  -0.605  1.00 10.85  ? 651  TRP A CH2   1 
ATOM   5328 N  N     . VAL C 3 646 ? 54.560 26.061  -4.727  1.00 7.58   ? 652  VAL A N     1 
ATOM   5329 C  CA    . VAL C 3 646 ? 53.666 26.779  -3.826  1.00 11.97  ? 652  VAL A CA    1 
ATOM   5330 C  C     . VAL C 3 646 ? 52.576 25.852  -3.278  1.00 11.71  ? 652  VAL A C     1 
ATOM   5331 O  O     . VAL C 3 646 ? 51.436 25.850  -3.747  1.00 10.21  ? 652  VAL A O     1 
ATOM   5332 C  CB    . VAL C 3 646 ? 53.050 28.010  -4.554  1.00 12.86  ? 652  VAL A CB    1 
ATOM   5333 C  CG1   . VAL C 3 646 ? 52.102 28.771  -3.639  1.00 9.32   ? 652  VAL A CG1   1 
ATOM   5334 C  CG2   . VAL C 3 646 ? 54.169 28.926  -5.034  1.00 11.29  ? 652  VAL A CG2   1 
ATOM   5335 N  N     . HIS C 3 647 ? 52.970 25.056  -2.284  1.00 7.53   ? 653  HIS A N     1 
ATOM   5336 C  CA    . HIS C 3 647 ? 52.105 24.100  -1.598  1.00 11.74  ? 653  HIS A CA    1 
ATOM   5337 C  C     . HIS C 3 647 ? 51.635 22.928  -2.452  1.00 13.20  ? 653  HIS A C     1 
ATOM   5338 O  O     . HIS C 3 647 ? 52.153 21.822  -2.310  1.00 16.34  ? 653  HIS A O     1 
ATOM   5339 C  CB    . HIS C 3 647 ? 50.934 24.835  -0.944  1.00 7.25   ? 653  HIS A CB    1 
ATOM   5340 C  CG    . HIS C 3 647 ? 51.374 25.943  -0.040  1.00 10.29  ? 653  HIS A CG    1 
ATOM   5341 N  ND1   . HIS C 3 647 ? 52.278 25.748  0.982   1.00 3.18   ? 653  HIS A ND1   1 
ATOM   5342 C  CD2   . HIS C 3 647 ? 51.087 27.265  -0.041  1.00 6.37   ? 653  HIS A CD2   1 
ATOM   5343 C  CE1   . HIS C 3 647 ? 52.533 26.904  1.566   1.00 6.80   ? 653  HIS A CE1   1 
ATOM   5344 N  NE2   . HIS C 3 647 ? 51.822 27.839  0.963   1.00 4.87   ? 653  HIS A NE2   1 
ATOM   5345 N  N     . ASP C 3 648 ? 50.653 23.147  -3.320  1.00 10.45  ? 654  ASP A N     1 
ATOM   5346 C  CA    . ASP C 3 648 ? 50.173 22.073  -4.179  1.00 11.22  ? 654  ASP A CA    1 
ATOM   5347 C  C     . ASP C 3 648 ? 50.318 22.434  -5.653  1.00 13.00  ? 654  ASP A C     1 
ATOM   5348 O  O     . ASP C 3 648 ? 49.576 21.945  -6.505  1.00 14.91  ? 654  ASP A O     1 
ATOM   5349 C  CB    . ASP C 3 648 ? 48.728 21.687  -3.834  1.00 12.35  ? 654  ASP A CB    1 
ATOM   5350 C  CG    . ASP C 3 648 ? 47.719 22.794  -4.105  1.00 14.05  ? 654  ASP A CG    1 
ATOM   5351 O  OD1   . ASP C 3 648 ? 48.079 23.988  -4.164  1.00 13.41  ? 654  ASP A OD1   1 
ATOM   5352 O  OD2   . ASP C 3 648 ? 46.534 22.450  -4.242  1.00 15.44  ? 654  ASP A OD2   1 
ATOM   5353 N  N     . GLU C 3 649 ? 51.279 23.299  -5.952  1.00 16.62  ? 655  GLU A N     1 
ATOM   5354 C  CA    . GLU C 3 649 ? 51.503 23.694  -7.330  1.00 19.12  ? 655  GLU A CA    1 
ATOM   5355 C  C     . GLU C 3 649 ? 52.967 23.904  -7.634  1.00 14.14  ? 655  GLU A C     1 
ATOM   5356 O  O     . GLU C 3 649 ? 53.744 24.338  -6.785  1.00 13.46  ? 655  GLU A O     1 
ATOM   5357 C  CB    . GLU C 3 649 ? 50.743 24.971  -7.691  1.00 21.10  ? 655  GLU A CB    1 
ATOM   5358 C  CG    . GLU C 3 649 ? 51.428 26.242  -7.261  1.00 32.20  ? 655  GLU A CG    1 
ATOM   5359 C  CD    . GLU C 3 649 ? 51.004 27.459  -8.061  1.00 28.18  ? 655  GLU A CD    1 
ATOM   5360 O  OE1   . GLU C 3 649 ? 50.742 27.342  -9.273  1.00 27.17  ? 655  GLU A OE1   1 
ATOM   5361 O  OE2   . GLU C 3 649 ? 50.952 28.547  -7.470  1.00 25.67  ? 655  GLU A OE2   1 
ATOM   5362 N  N     . ILE C 3 650 ? 53.332 23.561  -8.859  1.00 9.70   ? 656  ILE A N     1 
ATOM   5363 C  CA    . ILE C 3 650 ? 54.689 23.721  -9.331  1.00 9.45   ? 656  ILE A CA    1 
ATOM   5364 C  C     . ILE C 3 650 ? 54.655 24.500  -10.630 1.00 11.21  ? 656  ILE A C     1 
ATOM   5365 O  O     . ILE C 3 650 ? 53.711 24.385  -11.423 1.00 6.33   ? 656  ILE A O     1 
ATOM   5366 C  CB    . ILE C 3 650 ? 55.396 22.372  -9.585  1.00 13.01  ? 656  ILE A CB    1 
ATOM   5367 C  CG1   . ILE C 3 650 ? 54.504 21.444  -10.426 1.00 11.04  ? 656  ILE A CG1   1 
ATOM   5368 C  CG2   . ILE C 3 650 ? 55.835 21.754  -8.262  1.00 12.33  ? 656  ILE A CG2   1 
ATOM   5369 C  CD1   . ILE C 3 650 ? 55.151 20.104  -10.762 1.00 14.04  ? 656  ILE A CD1   1 
ATOM   5370 N  N     . GLN C 3 651 ? 55.674 25.330  -10.803 1.00 7.05   ? 657  GLN A N     1 
ATOM   5371 C  CA    . GLN C 3 651 ? 55.849 26.138  -11.991 1.00 4.52   ? 657  GLN A CA    1 
ATOM   5372 C  C     . GLN C 3 651 ? 57.216 25.691  -12.481 1.00 8.42   ? 657  GLN A C     1 
ATOM   5373 O  O     . GLN C 3 651 ? 58.215 25.836  -11.773 1.00 11.02  ? 657  GLN A O     1 
ATOM   5374 C  CB    . GLN C 3 651 ? 55.819 27.629  -11.640 1.00 6.44   ? 657  GLN A CB    1 
ATOM   5375 C  CG    . GLN C 3 651 ? 54.458 28.110  -11.150 1.00 2.00   ? 657  GLN A CG    1 
ATOM   5376 C  CD    . GLN C 3 651 ? 53.342 27.935  -12.188 1.00 14.23  ? 657  GLN A CD    1 
ATOM   5377 O  OE1   . GLN C 3 651 ? 53.592 27.908  -13.394 1.00 11.29  ? 657  GLN A OE1   1 
ATOM   5378 N  NE2   . GLN C 3 651 ? 52.104 27.830  -11.718 1.00 2.00   ? 657  GLN A NE2   1 
ATOM   5379 N  N     . VAL C 3 652 ? 57.230 25.056  -13.653 1.00 12.63  ? 658  VAL A N     1 
ATOM   5380 C  CA    . VAL C 3 652 ? 58.456 24.535  -14.260 1.00 6.87   ? 658  VAL A CA    1 
ATOM   5381 C  C     . VAL C 3 652 ? 58.778 25.207  -15.600 1.00 5.08   ? 658  VAL A C     1 
ATOM   5382 O  O     . VAL C 3 652 ? 57.904 25.352  -16.454 1.00 7.14   ? 658  VAL A O     1 
ATOM   5383 C  CB    . VAL C 3 652 ? 58.334 22.994  -14.504 1.00 7.48   ? 658  VAL A CB    1 
ATOM   5384 C  CG1   . VAL C 3 652 ? 59.669 22.403  -14.966 1.00 2.00   ? 658  VAL A CG1   1 
ATOM   5385 C  CG2   . VAL C 3 652 ? 57.841 22.294  -13.238 1.00 4.92   ? 658  VAL A CG2   1 
ATOM   5386 N  N     . GLY C 3 653 ? 60.019 25.660  -15.752 1.00 9.97   ? 659  GLY A N     1 
ATOM   5387 C  CA    . GLY C 3 653 ? 60.458 26.268  -17.000 1.00 10.68  ? 659  GLY A CA    1 
ATOM   5388 C  C     . GLY C 3 653 ? 60.804 25.124  -17.947 1.00 12.85  ? 659  GLY A C     1 
ATOM   5389 O  O     . GLY C 3 653 ? 61.420 24.148  -17.524 1.00 6.42   ? 659  GLY A O     1 
ATOM   5390 N  N     . CYS C 3 654 ? 60.428 25.230  -19.218 1.00 15.04  ? 660  CYS A N     1 
ATOM   5391 C  CA    . CYS C 3 654 ? 60.697 24.168  -20.204 1.00 12.62  ? 660  CYS A CA    1 
ATOM   5392 C  C     . CYS C 3 654 ? 61.332 24.748  -21.461 1.00 14.05  ? 660  CYS A C     1 
ATOM   5393 O  O     . CYS C 3 654 ? 60.852 25.734  -22.002 1.00 9.27   ? 660  CYS A O     1 
ATOM   5394 C  CB    . CYS C 3 654 ? 59.406 23.450  -20.592 1.00 8.59   ? 660  CYS A CB    1 
ATOM   5395 S  SG    . CYS C 3 654 ? 58.449 22.818  -19.197 1.00 15.21  ? 660  CYS A SG    1 
ATOM   5396 N  N     . ARG C 3 655 ? 62.395 24.115  -21.943 1.00 12.60  ? 661  ARG A N     1 
ATOM   5397 C  CA    . ARG C 3 655 ? 63.091 24.601  -23.128 1.00 12.01  ? 661  ARG A CA    1 
ATOM   5398 C  C     . ARG C 3 655 ? 62.188 24.681  -24.367 1.00 14.61  ? 661  ARG A C     1 
ATOM   5399 O  O     . ARG C 3 655 ? 62.343 25.586  -25.186 1.00 16.32  ? 661  ARG A O     1 
ATOM   5400 C  CB    . ARG C 3 655 ? 64.337 23.749  -23.381 1.00 5.69   ? 661  ARG A CB    1 
ATOM   5401 C  CG    . ARG C 3 655 ? 65.246 24.250  -24.482 1.00 7.46   ? 661  ARG A CG    1 
ATOM   5402 C  CD    . ARG C 3 655 ? 66.541 23.434  -24.547 1.00 12.43  ? 661  ARG A CD    1 
ATOM   5403 N  NE    . ARG C 3 655 ? 66.312 21.989  -24.605 1.00 10.49  ? 661  ARG A NE    1 
ATOM   5404 C  CZ    . ARG C 3 655 ? 65.817 21.333  -25.651 1.00 5.21   ? 661  ARG A CZ    1 
ATOM   5405 N  NH1   . ARG C 3 655 ? 65.484 21.969  -26.761 1.00 2.00   ? 661  ARG A NH1   1 
ATOM   5406 N  NH2   . ARG C 3 655 ? 65.633 20.026  -25.576 1.00 9.78   ? 661  ARG A NH2   1 
ATOM   5407 N  N     . THR C 3 656 ? 61.229 23.761  -24.480 1.00 18.73  ? 662  THR A N     1 
ATOM   5408 C  CA    . THR C 3 656 ? 60.301 23.742  -25.617 1.00 15.49  ? 662  THR A CA    1 
ATOM   5409 C  C     . THR C 3 656 ? 58.872 23.461  -25.159 1.00 9.75   ? 662  THR A C     1 
ATOM   5410 O  O     . THR C 3 656 ? 58.656 23.004  -24.041 1.00 12.52  ? 662  THR A O     1 
ATOM   5411 C  CB    . THR C 3 656 ? 60.659 22.638  -26.639 1.00 12.56  ? 662  THR A CB    1 
ATOM   5412 O  OG1   . THR C 3 656 ? 60.336 21.361  -26.083 1.00 8.65   ? 662  THR A OG1   1 
ATOM   5413 C  CG2   . THR C 3 656 ? 62.143 22.659  -26.990 1.00 7.47   ? 662  THR A CG2   1 
ATOM   5414 N  N     . GLU C 3 657 ? 57.907 23.710  -26.043 1.00 9.63   ? 663  GLU A N     1 
ATOM   5415 C  CA    . GLU C 3 657 ? 56.494 23.468  -25.752 1.00 9.22   ? 663  GLU A CA    1 
ATOM   5416 C  C     . GLU C 3 657 ? 56.209 21.981  -25.648 1.00 9.20   ? 663  GLU A C     1 
ATOM   5417 O  O     . GLU C 3 657 ? 55.297 21.562  -24.940 1.00 14.16  ? 663  GLU A O     1 
ATOM   5418 C  CB    . GLU C 3 657 ? 55.602 24.039  -26.845 1.00 15.78  ? 663  GLU A CB    1 
ATOM   5419 C  CG    . GLU C 3 657 ? 55.625 25.539  -26.977 1.00 28.61  ? 663  GLU A CG    1 
ATOM   5420 C  CD    . GLU C 3 657 ? 54.389 26.067  -27.682 1.00 31.62  ? 663  GLU A CD    1 
ATOM   5421 O  OE1   . GLU C 3 657 ? 53.688 25.279  -28.371 1.00 21.58  ? 663  GLU A OE1   1 
ATOM   5422 O  OE2   . GLU C 3 657 ? 54.109 27.278  -27.526 1.00 34.12  ? 663  GLU A OE2   1 
ATOM   5423 N  N     . GLU C 3 658 ? 56.943 21.206  -26.438 1.00 11.23  ? 664  GLU A N     1 
ATOM   5424 C  CA    . GLU C 3 658 ? 56.837 19.751  -26.469 1.00 20.10  ? 664  GLU A CA    1 
ATOM   5425 C  C     . GLU C 3 658 ? 57.200 19.216  -25.072 1.00 13.01  ? 664  GLU A C     1 
ATOM   5426 O  O     . GLU C 3 658 ? 56.505 18.367  -24.522 1.00 23.42  ? 664  GLU A O     1 
ATOM   5427 C  CB    . GLU C 3 658 ? 57.793 19.225  -27.555 1.00 38.68  ? 664  GLU A CB    1 
ATOM   5428 C  CG    . GLU C 3 658 ? 58.563 17.947  -27.240 1.00 61.21  ? 664  GLU A CG    1 
ATOM   5429 C  CD    . GLU C 3 658 ? 57.945 16.708  -27.844 1.00 67.17  ? 664  GLU A CD    1 
ATOM   5430 O  OE1   . GLU C 3 658 ? 58.180 16.458  -29.048 1.00 68.43  ? 664  GLU A OE1   1 
ATOM   5431 O  OE2   . GLU C 3 658 ? 57.236 15.979  -27.115 1.00 75.20  ? 664  GLU A OE2   1 
ATOM   5432 N  N     . ILE C 3 659 ? 58.284 19.749  -24.509 1.00 10.00  ? 665  ILE A N     1 
ATOM   5433 C  CA    . ILE C 3 659 ? 58.763 19.374  -23.183 1.00 8.90   ? 665  ILE A CA    1 
ATOM   5434 C  C     . ILE C 3 659 ? 57.746 19.797  -22.119 1.00 10.20  ? 665  ILE A C     1 
ATOM   5435 O  O     . ILE C 3 659 ? 57.510 19.066  -21.164 1.00 12.91  ? 665  ILE A O     1 
ATOM   5436 C  CB    . ILE C 3 659 ? 60.145 20.018  -22.893 1.00 12.23  ? 665  ILE A CB    1 
ATOM   5437 C  CG1   . ILE C 3 659 ? 61.196 19.425  -23.838 1.00 12.51  ? 665  ILE A CG1   1 
ATOM   5438 C  CG2   . ILE C 3 659 ? 60.565 19.771  -21.444 1.00 12.21  ? 665  ILE A CG2   1 
ATOM   5439 C  CD1   . ILE C 3 659 ? 62.544 20.084  -23.766 1.00 16.79  ? 665  ILE A CD1   1 
ATOM   5440 N  N     . ALA C 3 660 ? 57.126 20.961  -22.304 1.00 9.42   ? 666  ALA A N     1 
ATOM   5441 C  CA    . ALA C 3 660 ? 56.132 21.452  -21.358 1.00 8.41   ? 666  ALA A CA    1 
ATOM   5442 C  C     . ALA C 3 660 ? 54.895 20.549  -21.341 1.00 10.83  ? 666  ALA A C     1 
ATOM   5443 O  O     . ALA C 3 660 ? 54.320 20.300  -20.277 1.00 11.93  ? 666  ALA A O     1 
ATOM   5444 C  CB    . ALA C 3 660 ? 55.748 22.896  -21.684 1.00 5.05   ? 666  ALA A CB    1 
ATOM   5445 N  N     . GLN C 3 661 ? 54.512 20.031  -22.510 1.00 14.91  ? 667  GLN A N     1 
ATOM   5446 C  CA    . GLN C 3 661 ? 53.352 19.147  -22.609 1.00 15.18  ? 667  GLN A CA    1 
ATOM   5447 C  C     . GLN C 3 661 ? 53.629 17.866  -21.820 1.00 8.89   ? 667  GLN A C     1 
ATOM   5448 O  O     . GLN C 3 661 ? 52.738 17.338  -21.162 1.00 11.47  ? 667  GLN A O     1 
ATOM   5449 C  CB    . GLN C 3 661 ? 53.027 18.793  -24.072 1.00 24.05  ? 667  GLN A CB    1 
ATOM   5450 C  CG    . GLN C 3 661 ? 51.679 18.049  -24.218 1.00 43.03  ? 667  GLN A CG    1 
ATOM   5451 C  CD    . GLN C 3 661 ? 51.477 17.348  -25.563 1.00 50.15  ? 667  GLN A CD    1 
ATOM   5452 O  OE1   . GLN C 3 661 ? 51.063 17.972  -26.544 1.00 47.09  ? 667  GLN A OE1   1 
ATOM   5453 N  NE2   . GLN C 3 661 ? 51.735 16.040  -25.595 1.00 44.71  ? 667  GLN A NE2   1 
ATOM   5454 N  N     . VAL C 3 662 ? 54.867 17.377  -21.898 1.00 11.24  ? 668  VAL A N     1 
ATOM   5455 C  CA    . VAL C 3 662 ? 55.277 16.165  -21.189 1.00 16.65  ? 668  VAL A CA    1 
ATOM   5456 C  C     . VAL C 3 662 ? 55.357 16.386  -19.667 1.00 19.84  ? 668  VAL A C     1 
ATOM   5457 O  O     . VAL C 3 662 ? 54.965 15.513  -18.899 1.00 17.97  ? 668  VAL A O     1 
ATOM   5458 C  CB    . VAL C 3 662 ? 56.630 15.622  -21.724 1.00 18.22  ? 668  VAL A CB    1 
ATOM   5459 C  CG1   . VAL C 3 662 ? 57.052 14.368  -20.949 1.00 11.59  ? 668  VAL A CG1   1 
ATOM   5460 C  CG2   . VAL C 3 662 ? 56.503 15.290  -23.207 1.00 15.81  ? 668  VAL A CG2   1 
ATOM   5461 N  N     . VAL C 3 663 ? 55.851 17.549  -19.241 1.00 11.74  ? 669  VAL A N     1 
ATOM   5462 C  CA    . VAL C 3 663 ? 55.951 17.870  -17.816 1.00 10.67  ? 669  VAL A CA    1 
ATOM   5463 C  C     . VAL C 3 663 ? 54.553 17.857  -17.192 1.00 10.24  ? 669  VAL A C     1 
ATOM   5464 O  O     . VAL C 3 663 ? 54.354 17.362  -16.077 1.00 14.00  ? 669  VAL A O     1 
ATOM   5465 C  CB    . VAL C 3 663 ? 56.608 19.248  -17.606 1.00 8.88   ? 669  VAL A CB    1 
ATOM   5466 C  CG1   . VAL C 3 663 ? 56.474 19.701  -16.162 1.00 9.60   ? 669  VAL A CG1   1 
ATOM   5467 C  CG2   . VAL C 3 663 ? 58.066 19.170  -17.975 1.00 7.38   ? 669  VAL A CG2   1 
ATOM   5468 N  N     . ILE C 3 664 ? 53.588 18.383  -17.941 1.00 7.47   ? 670  ILE A N     1 
ATOM   5469 C  CA    . ILE C 3 664 ? 52.201 18.440  -17.511 1.00 10.34  ? 670  ILE A CA    1 
ATOM   5470 C  C     . ILE C 3 664 ? 51.577 17.042  -17.430 1.00 13.64  ? 670  ILE A C     1 
ATOM   5471 O  O     . ILE C 3 664 ? 50.822 16.753  -16.500 1.00 13.19  ? 670  ILE A O     1 
ATOM   5472 C  CB    . ILE C 3 664 ? 51.380 19.368  -18.454 1.00 11.51  ? 670  ILE A CB    1 
ATOM   5473 C  CG1   . ILE C 3 664 ? 51.817 20.825  -18.251 1.00 10.97  ? 670  ILE A CG1   1 
ATOM   5474 C  CG2   . ILE C 3 664 ? 49.884 19.220  -18.202 1.00 8.97   ? 670  ILE A CG2   1 
ATOM   5475 C  CD1   . ILE C 3 664 ? 51.079 21.809  -19.107 1.00 8.93   ? 670  ILE A CD1   1 
ATOM   5476 N  N     . GLU C 3 665 ? 51.911 16.179  -18.387 1.00 12.73  ? 671  GLU A N     1 
ATOM   5477 C  CA    . GLU C 3 665 ? 51.389 14.813  -18.418 1.00 15.12  ? 671  GLU A CA    1 
ATOM   5478 C  C     . GLU C 3 665 ? 52.054 13.950  -17.348 1.00 14.80  ? 671  GLU A C     1 
ATOM   5479 O  O     . GLU C 3 665 ? 51.419 13.090  -16.734 1.00 10.21  ? 671  GLU A O     1 
ATOM   5480 C  CB    . GLU C 3 665 ? 51.642 14.171  -19.777 1.00 20.39  ? 671  GLU A CB    1 
ATOM   5481 C  CG    . GLU C 3 665 ? 50.957 14.833  -20.951 1.00 19.63  ? 671  GLU A CG    1 
ATOM   5482 C  CD    . GLU C 3 665 ? 51.442 14.267  -22.273 1.00 21.68  ? 671  GLU A CD    1 
ATOM   5483 O  OE1   . GLU C 3 665 ? 52.571 13.730  -22.327 1.00 30.74  ? 671  GLU A OE1   1 
ATOM   5484 O  OE2   . GLU C 3 665 ? 50.702 14.349  -23.267 1.00 22.84  ? 671  GLU A OE2   1 
ATOM   5485 N  N     . THR C 3 666 ? 53.350 14.171  -17.155 1.00 7.89   ? 672  THR A N     1 
ATOM   5486 C  CA    . THR C 3 666 ? 54.129 13.437  -16.165 1.00 11.20  ? 672  THR A CA    1 
ATOM   5487 C  C     . THR C 3 666 ? 53.662 13.782  -14.752 1.00 12.99  ? 672  THR A C     1 
ATOM   5488 O  O     . THR C 3 666 ? 53.597 12.901  -13.894 1.00 15.85  ? 672  THR A O     1 
ATOM   5489 C  CB    . THR C 3 666 ? 55.617 13.747  -16.315 1.00 11.74  ? 672  THR A CB    1 
ATOM   5490 O  OG1   . THR C 3 666 ? 56.046 13.323  -17.613 1.00 16.12  ? 672  THR A OG1   1 
ATOM   5491 C  CG2   . THR C 3 666 ? 56.433 13.030  -15.254 1.00 7.11   ? 672  THR A CG2   1 
ATOM   5492 N  N     . ALA C 3 667 ? 53.317 15.053  -14.525 1.00 5.29   ? 673  ALA A N     1 
ATOM   5493 C  CA    . ALA C 3 667 ? 52.832 15.499  -13.220 1.00 6.79   ? 673  ALA A CA    1 
ATOM   5494 C  C     . ALA C 3 667 ? 51.495 14.836  -12.870 1.00 11.67  ? 673  ALA A C     1 
ATOM   5495 O  O     . ALA C 3 667 ? 51.212 14.581  -11.700 1.00 12.94  ? 673  ALA A O     1 
ATOM   5496 C  CB    . ALA C 3 667 ? 52.695 16.990  -13.194 1.00 2.45   ? 673  ALA A CB    1 
ATOM   5497 N  N     . GLN C 3 668 ? 50.670 14.579  -13.884 1.00 10.05  ? 674  GLN A N     1 
ATOM   5498 C  CA    . GLN C 3 668 ? 49.380 13.922  -13.676 1.00 8.91   ? 674  GLN A CA    1 
ATOM   5499 C  C     . GLN C 3 668 ? 49.618 12.446  -13.332 1.00 15.30  ? 674  GLN A C     1 
ATOM   5500 O  O     . GLN C 3 668 ? 48.937 11.882  -12.473 1.00 12.81  ? 674  GLN A O     1 
ATOM   5501 C  CB    . GLN C 3 668 ? 48.497 14.060  -14.924 1.00 9.09   ? 674  GLN A CB    1 
ATOM   5502 C  CG    . GLN C 3 668 ? 47.210 13.234  -14.910 1.00 8.90   ? 674  GLN A CG    1 
ATOM   5503 C  CD    . GLN C 3 668 ? 46.245 13.574  -13.770 1.00 12.86  ? 674  GLN A CD    1 
ATOM   5504 O  OE1   . GLN C 3 668 ? 46.419 14.548  -13.044 1.00 9.70   ? 674  GLN A OE1   1 
ATOM   5505 N  NE2   . GLN C 3 668 ? 45.206 12.763  -13.628 1.00 12.96  ? 674  GLN A NE2   1 
ATOM   5506 N  N     . GLU C 3 669 ? 50.602 11.834  -13.993 1.00 15.08  ? 675  GLU A N     1 
ATOM   5507 C  CA    . GLU C 3 669 ? 50.949 10.432  -13.753 1.00 17.93  ? 675  GLU A CA    1 
ATOM   5508 C  C     . GLU C 3 669 ? 51.545 10.252  -12.361 1.00 12.79  ? 675  GLU A C     1 
ATOM   5509 O  O     . GLU C 3 669 ? 51.296 9.243   -11.699 1.00 12.09  ? 675  GLU A O     1 
ATOM   5510 C  CB    . GLU C 3 669 ? 51.975 9.943   -14.778 1.00 14.83  ? 675  GLU A CB    1 
ATOM   5511 C  CG    . GLU C 3 669 ? 51.441 9.721   -16.178 1.00 25.25  ? 675  GLU A CG    1 
ATOM   5512 C  CD    . GLU C 3 669 ? 52.548 9.452   -17.188 1.00 28.83  ? 675  GLU A CD    1 
ATOM   5513 O  OE1   . GLU C 3 669 ? 53.515 8.721   -16.870 1.00 29.41  ? 675  GLU A OE1   1 
ATOM   5514 O  OE2   . GLU C 3 669 ? 52.452 9.985   -18.312 1.00 42.47  ? 675  GLU A OE2   1 
ATOM   5515 N  N     . ALA C 3 670 ? 52.342 11.233  -11.939 1.00 8.55   ? 676  ALA A N     1 
ATOM   5516 C  CA    . ALA C 3 670 ? 53.002 11.204  -10.638 1.00 10.87  ? 676  ALA A CA    1 
ATOM   5517 C  C     . ALA C 3 670 ? 52.017 11.379  -9.497  1.00 11.84  ? 676  ALA A C     1 
ATOM   5518 O  O     . ALA C 3 670 ? 52.247 10.874  -8.398  1.00 17.50  ? 676  ALA A O     1 
ATOM   5519 C  CB    . ALA C 3 670 ? 54.078 12.268  -10.572 1.00 7.94   ? 676  ALA A CB    1 
ATOM   5520 N  N     . MET C 3 671 ? 50.933 12.108  -9.751  1.00 7.09   ? 677  MET A N     1 
ATOM   5521 C  CA    . MET C 3 671 ? 49.919 12.324  -8.728  1.00 11.07  ? 677  MET A CA    1 
ATOM   5522 C  C     . MET C 3 671 ? 49.107 11.046  -8.549  1.00 10.99  ? 677  MET A C     1 
ATOM   5523 O  O     . MET C 3 671 ? 48.809 10.653  -7.417  1.00 19.94  ? 677  MET A O     1 
ATOM   5524 C  CB    . MET C 3 671 ? 49.010 13.505  -9.087  1.00 6.87   ? 677  MET A CB    1 
ATOM   5525 C  CG    . MET C 3 671 ? 47.968 13.850  -8.006  1.00 17.70  ? 677  MET A CG    1 
ATOM   5526 S  SD    . MET C 3 671 ? 48.630 14.237  -6.330  1.00 39.49  ? 677  MET A SD    1 
ATOM   5527 C  CE    . MET C 3 671 ? 48.855 16.027  -6.459  1.00 15.59  ? 677  MET A CE    1 
ATOM   5528 N  N     . ARG C 3 672 ? 48.787 10.380  -9.662  1.00 7.81   ? 678  ARG A N     1 
ATOM   5529 C  CA    . ARG C 3 672 ? 48.019 9.135   -9.623  1.00 4.78   ? 678  ARG A CA    1 
ATOM   5530 C  C     . ARG C 3 672 ? 48.873 8.062   -8.951  1.00 6.33   ? 678  ARG A C     1 
ATOM   5531 O  O     . ARG C 3 672 ? 48.358 7.211   -8.224  1.00 9.46   ? 678  ARG A O     1 
ATOM   5532 C  CB    . ARG C 3 672 ? 47.613 8.700   -11.034 1.00 9.44   ? 678  ARG A CB    1 
ATOM   5533 C  CG    . ARG C 3 672 ? 46.847 9.763   -11.815 1.00 10.60  ? 678  ARG A CG    1 
ATOM   5534 C  CD    . ARG C 3 672 ? 45.472 10.071  -11.236 1.00 19.22  ? 678  ARG A CD    1 
ATOM   5535 N  NE    . ARG C 3 672 ? 44.515 9.050   -11.626 1.00 22.40  ? 678  ARG A NE    1 
ATOM   5536 C  CZ    . ARG C 3 672 ? 43.430 9.259   -12.369 1.00 17.68  ? 678  ARG A CZ    1 
ATOM   5537 N  NH1   . ARG C 3 672 ? 43.119 10.464  -12.816 1.00 13.61  ? 678  ARG A NH1   1 
ATOM   5538 N  NH2   . ARG C 3 672 ? 42.680 8.230   -12.719 1.00 26.66  ? 678  ARG A NH2   1 
ATOM   5539 N  N     . TRP C 3 673 ? 50.183 8.133   -9.179  1.00 4.81   ? 679  TRP A N     1 
ATOM   5540 C  CA    . TRP C 3 673 ? 51.133 7.204   -8.583  1.00 9.46   ? 679  TRP A CA    1 
ATOM   5541 C  C     . TRP C 3 673 ? 51.150 7.404   -7.062  1.00 12.74  ? 679  TRP A C     1 
ATOM   5542 O  O     . TRP C 3 673 ? 51.114 6.430   -6.308  1.00 15.34  ? 679  TRP A O     1 
ATOM   5543 C  CB    . TRP C 3 673 ? 52.542 7.439   -9.139  1.00 6.58   ? 679  TRP A CB    1 
ATOM   5544 C  CG    . TRP C 3 673 ? 53.556 6.490   -8.566  1.00 10.91  ? 679  TRP A CG    1 
ATOM   5545 C  CD1   . TRP C 3 673 ? 53.902 5.273   -9.070  1.00 14.19  ? 679  TRP A CD1   1 
ATOM   5546 C  CD2   . TRP C 3 673 ? 54.322 6.659   -7.359  1.00 13.29  ? 679  TRP A CD2   1 
ATOM   5547 N  NE1   . TRP C 3 673 ? 54.828 4.667   -8.254  1.00 14.32  ? 679  TRP A NE1   1 
ATOM   5548 C  CE2   . TRP C 3 673 ? 55.103 5.492   -7.195  1.00 17.26  ? 679  TRP A CE2   1 
ATOM   5549 C  CE3   . TRP C 3 673 ? 54.420 7.678   -6.397  1.00 13.17  ? 679  TRP A CE3   1 
ATOM   5550 C  CZ2   . TRP C 3 673 ? 55.975 5.314   -6.106  1.00 12.84  ? 679  TRP A CZ2   1 
ATOM   5551 C  CZ3   . TRP C 3 673 ? 55.286 7.502   -5.311  1.00 4.70   ? 679  TRP A CZ3   1 
ATOM   5552 C  CH2   . TRP C 3 673 ? 56.050 6.328   -5.180  1.00 14.95  ? 679  TRP A CH2   1 
ATOM   5553 N  N     . VAL C 3 674 ? 51.220 8.664   -6.625  1.00 12.72  ? 680  VAL A N     1 
ATOM   5554 C  CA    . VAL C 3 674 ? 51.241 9.004   -5.195  1.00 9.91   ? 680  VAL A CA    1 
ATOM   5555 C  C     . VAL C 3 674 ? 49.993 8.464   -4.495  1.00 8.98   ? 680  VAL A C     1 
ATOM   5556 O  O     . VAL C 3 674 ? 50.088 7.862   -3.420  1.00 12.96  ? 680  VAL A O     1 
ATOM   5557 C  CB    . VAL C 3 674 ? 51.358 10.549  -4.974  1.00 9.69   ? 680  VAL A CB    1 
ATOM   5558 C  CG1   . VAL C 3 674 ? 51.211 10.897  -3.501  1.00 19.29  ? 680  VAL A CG1   1 
ATOM   5559 C  CG2   . VAL C 3 674 ? 52.708 11.049  -5.457  1.00 5.27   ? 680  VAL A CG2   1 
ATOM   5560 N  N     . GLY C 3 675 ? 48.835 8.663   -5.120  1.00 8.92   ? 681  GLY A N     1 
ATOM   5561 C  CA    . GLY C 3 675 ? 47.583 8.185   -4.560  1.00 8.02   ? 681  GLY A CA    1 
ATOM   5562 C  C     . GLY C 3 675 ? 47.546 6.674   -4.373  1.00 14.13  ? 681  GLY A C     1 
ATOM   5563 O  O     . GLY C 3 675 ? 47.031 6.181   -3.370  1.00 15.23  ? 681  GLY A O     1 
ATOM   5564 N  N     . ASP C 3 676 ? 48.066 5.936   -5.350  1.00 5.93   ? 682  ASP A N     1 
ATOM   5565 C  CA    . ASP C 3 676 ? 48.101 4.481   -5.277  1.00 12.56  ? 682  ASP A CA    1 
ATOM   5566 C  C     . ASP C 3 676 ? 49.134 4.018   -4.255  1.00 15.30  ? 682  ASP A C     1 
ATOM   5567 O  O     . ASP C 3 676 ? 48.974 2.966   -3.629  1.00 12.71  ? 682  ASP A O     1 
ATOM   5568 C  CB    . ASP C 3 676 ? 48.441 3.887   -6.645  1.00 23.42  ? 682  ASP A CB    1 
ATOM   5569 C  CG    . ASP C 3 676 ? 48.491 2.372   -6.623  1.00 28.06  ? 682  ASP A CG    1 
ATOM   5570 O  OD1   . ASP C 3 676 ? 47.411 1.747   -6.677  1.00 34.82  ? 682  ASP A OD1   1 
ATOM   5571 O  OD2   . ASP C 3 676 ? 49.606 1.811   -6.538  1.00 28.29  ? 682  ASP A OD2   1 
ATOM   5572 N  N     . HIS C 3 677 ? 50.193 4.816   -4.107  1.00 16.50  ? 683  HIS A N     1 
ATOM   5573 C  CA    . HIS C 3 677 ? 51.291 4.537   -3.179  1.00 15.63  ? 683  HIS A CA    1 
ATOM   5574 C  C     . HIS C 3 677 ? 50.804 4.453   -1.739  1.00 7.49   ? 683  HIS A C     1 
ATOM   5575 O  O     . HIS C 3 677 ? 51.169 3.539   -1.006  1.00 12.23  ? 683  HIS A O     1 
ATOM   5576 C  CB    . HIS C 3 677 ? 52.375 5.618   -3.296  1.00 8.69   ? 683  HIS A CB    1 
ATOM   5577 C  CG    . HIS C 3 677 ? 53.554 5.393   -2.398  1.00 8.44   ? 683  HIS A CG    1 
ATOM   5578 N  ND1   . HIS C 3 677 ? 54.474 4.392   -2.620  1.00 9.20   ? 683  HIS A ND1   1 
ATOM   5579 C  CD2   . HIS C 3 677 ? 53.966 6.038   -1.279  1.00 4.18   ? 683  HIS A CD2   1 
ATOM   5580 C  CE1   . HIS C 3 677 ? 55.402 4.428   -1.679  1.00 2.75   ? 683  HIS A CE1   1 
ATOM   5581 N  NE2   . HIS C 3 677 ? 55.117 5.419   -0.853  1.00 7.25   ? 683  HIS A NE2   1 
ATOM   5582 N  N     . TRP C 3 678 ? 49.978 5.411   -1.344  1.00 2.98   ? 684  TRP A N     1 
ATOM   5583 C  CA    . TRP C 3 678 ? 49.448 5.437   0.006   1.00 8.93   ? 684  TRP A CA    1 
ATOM   5584 C  C     . TRP C 3 678 ? 48.022 4.902   0.127   1.00 11.52  ? 684  TRP A C     1 
ATOM   5585 O  O     . TRP C 3 678 ? 47.348 5.131   1.132   1.00 10.84  ? 684  TRP A O     1 
ATOM   5586 C  CB    . TRP C 3 678 ? 49.582 6.853   0.581   1.00 10.78  ? 684  TRP A CB    1 
ATOM   5587 C  CG    . TRP C 3 678 ? 51.007 7.169   1.006   1.00 11.40  ? 684  TRP A CG    1 
ATOM   5588 C  CD1   . TRP C 3 678 ? 51.921 6.289   1.525   1.00 2.62   ? 684  TRP A CD1   1 
ATOM   5589 C  CD2   . TRP C 3 678 ? 51.659 8.446   0.966   1.00 10.18  ? 684  TRP A CD2   1 
ATOM   5590 N  NE1   . TRP C 3 678 ? 53.095 6.941   1.807   1.00 6.90   ? 684  TRP A NE1   1 
ATOM   5591 C  CE2   . TRP C 3 678 ? 52.965 8.264   1.478   1.00 4.89   ? 684  TRP A CE2   1 
ATOM   5592 C  CE3   . TRP C 3 678 ? 51.264 9.733   0.552   1.00 7.21   ? 684  TRP A CE3   1 
ATOM   5593 C  CZ2   . TRP C 3 678 ? 53.885 9.319   1.592   1.00 11.57  ? 684  TRP A CZ2   1 
ATOM   5594 C  CZ3   . TRP C 3 678 ? 52.177 10.782  0.666   1.00 7.46   ? 684  TRP A CZ3   1 
ATOM   5595 C  CH2   . TRP C 3 678 ? 53.476 10.566  1.184   1.00 8.01   ? 684  TRP A CH2   1 
ATOM   5596 N  N     . ASN C 3 679 ? 47.576 4.184   -0.904  1.00 8.98   ? 685  ASN A N     1 
ATOM   5597 C  CA    . ASN C 3 679 ? 46.241 3.589   -0.936  1.00 9.47   ? 685  ASN A CA    1 
ATOM   5598 C  C     . ASN C 3 679 ? 45.116 4.555   -0.585  1.00 12.41  ? 685  ASN A C     1 
ATOM   5599 O  O     . ASN C 3 679 ? 44.249 4.247   0.237   1.00 14.29  ? 685  ASN A O     1 
ATOM   5600 C  CB    . ASN C 3 679 ? 46.192 2.383   0.003   1.00 13.25  ? 685  ASN A CB    1 
ATOM   5601 C  CG    . ASN C 3 679 ? 47.192 1.330   -0.370  1.00 18.67  ? 685  ASN A CG    1 
ATOM   5602 O  OD1   . ASN C 3 679 ? 47.082 0.697   -1.423  1.00 19.45  ? 685  ASN A OD1   1 
ATOM   5603 N  ND2   . ASN C 3 679 ? 48.200 1.153   0.473   1.00 23.11  ? 685  ASN A ND2   1 
ATOM   5604 N  N     . PHE C 3 680 ? 45.132 5.727   -1.207  1.00 9.87   ? 686  PHE A N     1 
ATOM   5605 C  CA    . PHE C 3 680 ? 44.118 6.739   -0.962  1.00 10.30  ? 686  PHE A CA    1 
ATOM   5606 C  C     . PHE C 3 680 ? 42.745 6.258   -1.408  1.00 15.95  ? 686  PHE A C     1 
ATOM   5607 O  O     . PHE C 3 680 ? 42.610 5.565   -2.419  1.00 15.60  ? 686  PHE A O     1 
ATOM   5608 C  CB    . PHE C 3 680 ? 44.492 8.049   -1.662  1.00 13.79  ? 686  PHE A CB    1 
ATOM   5609 C  CG    . PHE C 3 680 ? 44.574 9.221   -0.734  1.00 10.49  ? 686  PHE A CG    1 
ATOM   5610 C  CD1   . PHE C 3 680 ? 45.349 9.152   0.425   1.00 12.17  ? 686  PHE A CD1   1 
ATOM   5611 C  CD2   . PHE C 3 680 ? 43.866 10.391  -1.002  1.00 11.30  ? 686  PHE A CD2   1 
ATOM   5612 C  CE1   . PHE C 3 680 ? 45.413 10.238  1.313   1.00 13.56  ? 686  PHE A CE1   1 
ATOM   5613 C  CE2   . PHE C 3 680 ? 43.921 11.483  -0.124  1.00 9.75   ? 686  PHE A CE2   1 
ATOM   5614 C  CZ    . PHE C 3 680 ? 44.696 11.403  1.036   1.00 4.51   ? 686  PHE A CZ    1 
ATOM   5615 N  N     . ARG C 3 681 ? 41.734 6.627   -0.625  1.00 13.61  ? 687  ARG A N     1 
ATOM   5616 C  CA    . ARG C 3 681 ? 40.348 6.247   -0.871  1.00 16.40  ? 687  ARG A CA    1 
ATOM   5617 C  C     . ARG C 3 681 ? 39.669 7.257   -1.791  1.00 18.15  ? 687  ARG A C     1 
ATOM   5618 O  O     . ARG C 3 681 ? 38.466 7.169   -2.040  1.00 19.90  ? 687  ARG A O     1 
ATOM   5619 C  CB    . ARG C 3 681 ? 39.596 6.142   0.459   1.00 17.37  ? 687  ARG A CB    1 
ATOM   5620 C  CG    . ARG C 3 681 ? 40.319 5.316   1.509   1.00 19.71  ? 687  ARG A CG    1 
ATOM   5621 C  CD    . ARG C 3 681 ? 39.860 3.877   1.546   1.00 22.29  ? 687  ARG A CD    1 
ATOM   5622 N  NE    . ARG C 3 681 ? 38.626 3.713   2.319   1.00 25.12  ? 687  ARG A NE    1 
ATOM   5623 C  CZ    . ARG C 3 681 ? 37.481 3.267   1.815   1.00 20.93  ? 687  ARG A CZ    1 
ATOM   5624 N  NH1   . ARG C 3 681 ? 37.403 2.942   0.532   1.00 31.16  ? 687  ARG A NH1   1 
ATOM   5625 N  NH2   . ARG C 3 681 ? 36.416 3.139   2.591   1.00 21.86  ? 687  ARG A NH2   1 
ATOM   5626 N  N     . CYS C 3 682 ? 40.442 8.233   -2.265  1.00 12.44  ? 688  CYS A N     1 
ATOM   5627 C  CA    . CYS C 3 682 ? 39.931 9.243   -3.182  1.00 15.45  ? 688  CYS A CA    1 
ATOM   5628 C  C     . CYS C 3 682 ? 40.965 9.443   -4.279  1.00 13.02  ? 688  CYS A C     1 
ATOM   5629 O  O     . CYS C 3 682 ? 42.165 9.545   -4.015  1.00 11.22  ? 688  CYS A O     1 
ATOM   5630 C  CB    . CYS C 3 682 ? 39.648 10.573  -2.471  1.00 14.35  ? 688  CYS A CB    1 
ATOM   5631 S  SG    . CYS C 3 682 ? 38.818 11.819  -3.523  1.00 9.32   ? 688  CYS A SG    1 
ATOM   5632 N  N     . LEU C 3 683 ? 40.486 9.468   -5.515  1.00 16.51  ? 689  LEU A N     1 
ATOM   5633 C  CA    . LEU C 3 683 ? 41.344 9.651   -6.680  1.00 14.53  ? 689  LEU A CA    1 
ATOM   5634 C  C     . LEU C 3 683 ? 41.928 11.067  -6.682  1.00 10.10  ? 689  LEU A C     1 
ATOM   5635 O  O     . LEU C 3 683 ? 41.205 12.049  -6.523  1.00 10.96  ? 689  LEU A O     1 
ATOM   5636 C  CB    . LEU C 3 683 ? 40.527 9.403   -7.954  1.00 17.28  ? 689  LEU A CB    1 
ATOM   5637 C  CG    . LEU C 3 683 ? 41.205 9.234   -9.315  1.00 15.31  ? 689  LEU A CG    1 
ATOM   5638 C  CD1   . LEU C 3 683 ? 41.990 7.930   -9.352  1.00 21.30  ? 689  LEU A CD1   1 
ATOM   5639 C  CD2   . LEU C 3 683 ? 40.138 9.231   -10.391 1.00 16.96  ? 689  LEU A CD2   1 
ATOM   5640 N  N     . LEU C 3 684 ? 43.246 11.151  -6.824  1.00 9.87   ? 690  LEU A N     1 
ATOM   5641 C  CA    . LEU C 3 684 ? 43.954 12.426  -6.850  1.00 13.37  ? 690  LEU A CA    1 
ATOM   5642 C  C     . LEU C 3 684 ? 44.185 12.867  -8.297  1.00 14.66  ? 690  LEU A C     1 
ATOM   5643 O  O     . LEU C 3 684 ? 44.539 12.049  -9.144  1.00 13.96  ? 690  LEU A O     1 
ATOM   5644 C  CB    . LEU C 3 684 ? 45.287 12.295  -6.111  1.00 8.58   ? 690  LEU A CB    1 
ATOM   5645 C  CG    . LEU C 3 684 ? 45.236 11.848  -4.647  1.00 11.82  ? 690  LEU A CG    1 
ATOM   5646 C  CD1   . LEU C 3 684 ? 46.656 11.748  -4.102  1.00 4.94   ? 690  LEU A CD1   1 
ATOM   5647 C  CD2   . LEU C 3 684 ? 44.399 12.834  -3.826  1.00 6.73   ? 690  LEU A CD2   1 
ATOM   5648 N  N     . ASP C 3 685 ? 43.982 14.157  -8.568  1.00 12.70  ? 691  ASP A N     1 
ATOM   5649 C  CA    . ASP C 3 685 ? 44.147 14.725  -9.911  1.00 10.40  ? 691  ASP A CA    1 
ATOM   5650 C  C     . ASP C 3 685 ? 44.860 16.076  -9.896  1.00 14.58  ? 691  ASP A C     1 
ATOM   5651 O  O     . ASP C 3 685 ? 45.000 16.709  -8.845  1.00 19.51  ? 691  ASP A O     1 
ATOM   5652 C  CB    . ASP C 3 685 ? 42.775 14.923  -10.579 1.00 11.52  ? 691  ASP A CB    1 
ATOM   5653 C  CG    . ASP C 3 685 ? 42.144 13.621  -11.036 1.00 11.09  ? 691  ASP A CG    1 
ATOM   5654 O  OD1   . ASP C 3 685 ? 42.691 12.987  -11.953 1.00 15.15  ? 691  ASP A OD1   1 
ATOM   5655 O  OD2   . ASP C 3 685 ? 41.095 13.233  -10.497 1.00 13.07  ? 691  ASP A OD2   1 
ATOM   5656 N  N     . THR C 3 686 ? 45.323 16.504  -11.068 1.00 11.09  ? 692  THR A N     1 
ATOM   5657 C  CA    . THR C 3 686 ? 45.989 17.793  -11.216 1.00 2.89   ? 692  THR A CA    1 
ATOM   5658 C  C     . THR C 3 686 ? 45.411 18.495  -12.441 1.00 10.58  ? 692  THR A C     1 
ATOM   5659 O  O     . THR C 3 686 ? 44.721 17.877  -13.259 1.00 11.08  ? 692  THR A O     1 
ATOM   5660 C  CB    . THR C 3 686 ? 47.519 17.675  -11.435 1.00 9.24   ? 692  THR A CB    1 
ATOM   5661 O  OG1   . THR C 3 686 ? 47.780 16.896  -12.606 1.00 10.76  ? 692  THR A OG1   1 
ATOM   5662 C  CG2   . THR C 3 686 ? 48.208 17.054  -10.237 1.00 6.43   ? 692  THR A CG2   1 
ATOM   5663 N  N     . GLU C 3 687 ? 45.697 19.785  -12.554 1.00 12.05  ? 693  GLU A N     1 
ATOM   5664 C  CA    . GLU C 3 687 ? 45.250 20.603  -13.672 1.00 16.04  ? 693  GLU A CA    1 
ATOM   5665 C  C     . GLU C 3 687 ? 46.517 21.317  -14.149 1.00 16.16  ? 693  GLU A C     1 
ATOM   5666 O  O     . GLU C 3 687 ? 47.179 22.003  -13.368 1.00 18.24  ? 693  GLU A O     1 
ATOM   5667 C  CB    . GLU C 3 687 ? 44.190 21.621  -13.219 1.00 17.86  ? 693  GLU A CB    1 
ATOM   5668 C  CG    . GLU C 3 687 ? 43.655 22.526  -14.341 1.00 27.39  ? 693  GLU A CG    1 
ATOM   5669 C  CD    . GLU C 3 687 ? 42.631 23.562  -13.865 1.00 31.41  ? 693  GLU A CD    1 
ATOM   5670 O  OE1   . GLU C 3 687 ? 42.873 24.235  -12.835 1.00 33.96  ? 693  GLU A OE1   1 
ATOM   5671 O  OE2   . GLU C 3 687 ? 41.581 23.713  -14.530 1.00 28.52  ? 693  GLU A OE2   1 
ATOM   5672 N  N     . GLY C 3 688 ? 46.881 21.095  -15.411 1.00 12.87  ? 694  GLY A N     1 
ATOM   5673 C  CA    . GLY C 3 688 ? 48.070 21.713  -15.979 1.00 8.06   ? 694  GLY A CA    1 
ATOM   5674 C  C     . GLY C 3 688 ? 47.786 22.845  -16.953 1.00 10.61  ? 694  GLY A C     1 
ATOM   5675 O  O     . GLY C 3 688 ? 46.765 22.845  -17.652 1.00 12.03  ? 694  GLY A O     1 
ATOM   5676 N  N     . LYS C 3 689 ? 48.705 23.805  -17.011 1.00 10.49  ? 695  LYS A N     1 
ATOM   5677 C  CA    . LYS C 3 689 ? 48.575 24.965  -17.890 1.00 15.05  ? 695  LYS A CA    1 
ATOM   5678 C  C     . LYS C 3 689 ? 49.897 25.336  -18.533 1.00 10.00  ? 695  LYS A C     1 
ATOM   5679 O  O     . LYS C 3 689 ? 50.918 25.429  -17.857 1.00 17.38  ? 695  LYS A O     1 
ATOM   5680 C  CB    . LYS C 3 689 ? 48.047 26.179  -17.111 1.00 18.76  ? 695  LYS A CB    1 
ATOM   5681 C  CG    . LYS C 3 689 ? 46.618 26.013  -16.624 1.00 29.80  ? 695  LYS A CG    1 
ATOM   5682 C  CD    . LYS C 3 689 ? 46.108 27.218  -15.860 1.00 29.51  ? 695  LYS A CD    1 
ATOM   5683 C  CE    . LYS C 3 689 ? 44.660 26.997  -15.446 1.00 40.84  ? 695  LYS A CE    1 
ATOM   5684 N  NZ    . LYS C 3 689 ? 44.117 28.129  -14.648 1.00 36.66  ? 695  LYS A NZ    1 
ATOM   5685 N  N     . MET C 3 690 ? 49.890 25.511  -19.847 1.00 12.79  ? 696  MET A N     1 
ATOM   5686 C  CA    . MET C 3 690 ? 51.106 25.901  -20.557 1.00 12.34  ? 696  MET A CA    1 
ATOM   5687 C  C     . MET C 3 690 ? 50.990 27.402  -20.844 1.00 7.90   ? 696  MET A C     1 
ATOM   5688 O  O     . MET C 3 690 ? 49.894 27.902  -21.112 1.00 21.50  ? 696  MET A O     1 
ATOM   5689 C  CB    . MET C 3 690 ? 51.250 25.110  -21.862 1.00 15.85  ? 696  MET A CB    1 
ATOM   5690 C  CG    . MET C 3 690 ? 52.623 25.222  -22.513 1.00 21.93  ? 696  MET A CG    1 
ATOM   5691 S  SD    . MET C 3 690 ? 52.747 24.374  -24.101 1.00 31.43  ? 696  MET A SD    1 
ATOM   5692 C  CE    . MET C 3 690 ? 52.535 22.719  -23.605 1.00 20.10  ? 696  MET A CE    1 
ATOM   5693 N  N     . GLY C 3 691 ? 52.105 28.121  -20.769 1.00 7.66   ? 697  GLY A N     1 
ATOM   5694 C  CA    . GLY C 3 691 ? 52.063 29.551  -21.024 1.00 8.36   ? 697  GLY A CA    1 
ATOM   5695 C  C     . GLY C 3 691 ? 53.414 30.202  -20.850 1.00 7.57   ? 697  GLY A C     1 
ATOM   5696 O  O     . GLY C 3 691 ? 54.369 29.536  -20.471 1.00 8.21   ? 697  GLY A O     1 
ATOM   5697 N  N     . PRO C 3 692 ? 53.544 31.497  -21.169 1.00 10.34  ? 698  PRO A N     1 
ATOM   5698 C  CA    . PRO C 3 692 ? 54.842 32.156  -21.011 1.00 10.96  ? 698  PRO A CA    1 
ATOM   5699 C  C     . PRO C 3 692 ? 55.192 32.578  -19.576 1.00 8.98   ? 698  PRO A C     1 
ATOM   5700 O  O     . PRO C 3 692 ? 56.372 32.678  -19.232 1.00 8.36   ? 698  PRO A O     1 
ATOM   5701 C  CB    . PRO C 3 692 ? 54.718 33.356  -21.951 1.00 5.75   ? 698  PRO A CB    1 
ATOM   5702 C  CG    . PRO C 3 692 ? 53.297 33.725  -21.816 1.00 8.01   ? 698  PRO A CG    1 
ATOM   5703 C  CD    . PRO C 3 692 ? 52.609 32.368  -21.906 1.00 11.42  ? 698  PRO A CD    1 
ATOM   5704 N  N     . ASN C 3 693 ? 54.179 32.791  -18.737 1.00 10.64  ? 699  ASN A N     1 
ATOM   5705 C  CA    . ASN C 3 693 ? 54.424 33.233  -17.365 1.00 13.56  ? 699  ASN A CA    1 
ATOM   5706 C  C     . ASN C 3 693 ? 53.397 32.793  -16.319 1.00 9.55   ? 699  ASN A C     1 
ATOM   5707 O  O     . ASN C 3 693 ? 52.434 32.106  -16.637 1.00 11.18  ? 699  ASN A O     1 
ATOM   5708 C  CB    . ASN C 3 693 ? 54.562 34.755  -17.354 1.00 13.02  ? 699  ASN A CB    1 
ATOM   5709 C  CG    . ASN C 3 693 ? 53.359 35.445  -17.947 1.00 11.49  ? 699  ASN A CG    1 
ATOM   5710 O  OD1   . ASN C 3 693 ? 52.258 35.360  -17.416 1.00 11.10  ? 699  ASN A OD1   1 
ATOM   5711 N  ND2   . ASN C 3 693 ? 53.561 36.123  -19.065 1.00 16.88  ? 699  ASN A ND2   1 
ATOM   5712 N  N     . TRP C 3 694 ? 53.593 33.237  -15.078 1.00 7.31   ? 700  TRP A N     1 
ATOM   5713 C  CA    . TRP C 3 694 ? 52.712 32.881  -13.968 1.00 8.59   ? 700  TRP A CA    1 
ATOM   5714 C  C     . TRP C 3 694 ? 51.295 33.445  -14.060 1.00 7.21   ? 700  TRP A C     1 
ATOM   5715 O  O     . TRP C 3 694 ? 50.364 32.854  -13.514 1.00 12.37  ? 700  TRP A O     1 
ATOM   5716 C  CB    . TRP C 3 694 ? 53.353 33.284  -12.633 1.00 12.02  ? 700  TRP A CB    1 
ATOM   5717 C  CG    . TRP C 3 694 ? 53.019 32.372  -11.473 1.00 8.92   ? 700  TRP A CG    1 
ATOM   5718 C  CD1   . TRP C 3 694 ? 52.050 31.410  -11.433 1.00 6.56   ? 700  TRP A CD1   1 
ATOM   5719 C  CD2   . TRP C 3 694 ? 53.705 32.303  -10.212 1.00 8.93   ? 700  TRP A CD2   1 
ATOM   5720 N  NE1   . TRP C 3 694 ? 52.097 30.740  -10.235 1.00 12.56  ? 700  TRP A NE1   1 
ATOM   5721 C  CE2   . TRP C 3 694 ? 53.103 31.266  -9.465  1.00 14.60  ? 700  TRP A CE2   1 
ATOM   5722 C  CE3   . TRP C 3 694 ? 54.773 33.018  -9.642  1.00 6.16   ? 700  TRP A CE3   1 
ATOM   5723 C  CZ2   . TRP C 3 694 ? 53.535 30.918  -8.171  1.00 18.68  ? 700  TRP A CZ2   1 
ATOM   5724 C  CZ3   . TRP C 3 694 ? 55.205 32.674  -8.353  1.00 14.50  ? 700  TRP A CZ3   1 
ATOM   5725 C  CH2   . TRP C 3 694 ? 54.585 31.630  -7.635  1.00 14.55  ? 700  TRP A CH2   1 
ATOM   5726 N  N     . ALA C 3 695 ? 51.119 34.582  -14.731 1.00 12.77  ? 701  ALA A N     1 
ATOM   5727 C  CA    . ALA C 3 695 ? 49.783 35.167  -14.876 1.00 6.83   ? 701  ALA A CA    1 
ATOM   5728 C  C     . ALA C 3 695 ? 48.907 34.250  -15.723 1.00 13.92  ? 701  ALA A C     1 
ATOM   5729 O  O     . ALA C 3 695 ? 47.698 34.154  -15.512 1.00 17.98  ? 701  ALA A O     1 
ATOM   5730 C  CB    . ALA C 3 695 ? 49.861 36.535  -15.519 1.00 7.95   ? 701  ALA A CB    1 
ATOM   5731 N  N     . ILE C 3 696 ? 49.543 33.550  -16.657 1.00 17.13  ? 702  ILE A N     1 
ATOM   5732 C  CA    . ILE C 3 696 ? 48.848 32.639  -17.560 1.00 20.58  ? 702  ILE A CA    1 
ATOM   5733 C  C     . ILE C 3 696 ? 48.827 31.175  -17.097 1.00 17.37  ? 702  ILE A C     1 
ATOM   5734 O  O     . ILE C 3 696 ? 47.907 30.430  -17.433 1.00 20.26  ? 702  ILE A O     1 
ATOM   5735 C  CB    . ILE C 3 696 ? 49.458 32.757  -18.978 1.00 21.45  ? 702  ILE A CB    1 
ATOM   5736 C  CG1   . ILE C 3 696 ? 49.337 34.209  -19.446 1.00 19.16  ? 702  ILE A CG1   1 
ATOM   5737 C  CG2   . ILE C 3 696 ? 48.760 31.802  -19.955 1.00 18.53  ? 702  ILE A CG2   1 
ATOM   5738 C  CD1   . ILE C 3 696 ? 49.963 34.490  -20.769 1.00 29.44  ? 702  ILE A CD1   1 
ATOM   5739 N  N     . CYS C 3 697 ? 49.812 30.771  -16.301 1.00 16.93  ? 703  CYS A N     1 
ATOM   5740 C  CA    . CYS C 3 697 ? 49.880 29.386  -15.823 1.00 19.25  ? 703  CYS A CA    1 
ATOM   5741 C  C     . CYS C 3 697 ? 49.273 29.065  -14.448 1.00 22.18  ? 703  CYS A C     1 
ATOM   5742 O  O     . CYS C 3 697 ? 49.543 28.002  -13.876 1.00 24.50  ? 703  CYS A O     1 
ATOM   5743 C  CB    . CYS C 3 697 ? 51.322 28.885  -15.900 1.00 9.92   ? 703  CYS A CB    1 
ATOM   5744 S  SG    . CYS C 3 697 ? 51.944 28.760  -17.595 1.00 4.48   ? 703  CYS A SG    1 
ATOM   5745 N  N     . HIS C 3 698 ? 48.430 29.960  -13.937 1.00 24.30  ? 704  HIS A N     1 
ATOM   5746 C  CA    . HIS C 3 698 ? 47.784 29.749  -12.643 1.00 23.95  ? 704  HIS A CA    1 
ATOM   5747 C  C     . HIS C 3 698 ? 46.597 30.690  -12.512 1.00 23.22  ? 704  HIS A C     1 
ATOM   5748 O  O     . HIS C 3 698 ? 45.465 30.240  -12.359 1.00 33.97  ? 704  HIS A O     1 
ATOM   5749 C  CB    . HIS C 3 698 ? 48.781 29.987  -11.501 1.00 28.98  ? 704  HIS A CB    1 
ATOM   5750 C  CG    . HIS C 3 698 ? 48.257 29.631  -10.142 1.00 34.27  ? 704  HIS A CG    1 
ATOM   5751 N  ND1   . HIS C 3 698 ? 48.039 28.329  -9.743  1.00 37.23  ? 704  HIS A ND1   1 
ATOM   5752 C  CD2   . HIS C 3 698 ? 47.925 30.407  -9.082  1.00 36.52  ? 704  HIS A CD2   1 
ATOM   5753 C  CE1   . HIS C 3 698 ? 47.596 28.319  -8.498  1.00 36.65  ? 704  HIS A CE1   1 
ATOM   5754 N  NE2   . HIS C 3 698 ? 47.518 29.567  -8.075  1.00 31.36  ? 704  HIS A NE2   1 
ATOM   5755 N  N     . LYS D 4 3   ? 39.447 92.257  25.292  1.00 53.44  ? 3    LYS B N     1 
ATOM   5756 C  CA    . LYS D 4 3   ? 40.092 93.171  24.351  1.00 55.28  ? 3    LYS B CA    1 
ATOM   5757 C  C     . LYS D 4 3   ? 41.138 92.459  23.496  1.00 51.88  ? 3    LYS B C     1 
ATOM   5758 O  O     . LYS D 4 3   ? 42.074 93.088  22.997  1.00 58.68  ? 3    LYS B O     1 
ATOM   5759 C  CB    . LYS D 4 3   ? 40.756 94.328  25.106  1.00 63.29  ? 3    LYS B CB    1 
ATOM   5760 C  CG    . LYS D 4 3   ? 39.818 95.136  25.978  1.00 71.48  ? 3    LYS B CG    1 
ATOM   5761 C  CD    . LYS D 4 3   ? 40.545 96.313  26.619  1.00 76.37  ? 3    LYS B CD    1 
ATOM   5762 C  CE    . LYS D 4 3   ? 39.671 97.066  27.622  1.00 76.12  ? 3    LYS B CE    1 
ATOM   5763 N  NZ    . LYS D 4 3   ? 39.301 96.226  28.797  1.00 81.97  ? 3    LYS B NZ    1 
ATOM   5764 N  N     . ILE D 4 4   ? 40.978 91.147  23.340  1.00 43.35  ? 4    ILE B N     1 
ATOM   5765 C  CA    . ILE D 4 4   ? 41.919 90.348  22.550  1.00 36.37  ? 4    ILE B CA    1 
ATOM   5766 C  C     . ILE D 4 4   ? 41.358 90.105  21.162  1.00 32.17  ? 4    ILE B C     1 
ATOM   5767 O  O     . ILE D 4 4   ? 40.147 89.959  20.988  1.00 36.29  ? 4    ILE B O     1 
ATOM   5768 C  CB    . ILE D 4 4   ? 42.171 88.954  23.161  1.00 36.79  ? 4    ILE B CB    1 
ATOM   5769 C  CG1   . ILE D 4 4   ? 42.703 89.080  24.585  1.00 38.34  ? 4    ILE B CG1   1 
ATOM   5770 C  CG2   . ILE D 4 4   ? 43.155 88.160  22.281  1.00 30.64  ? 4    ILE B CG2   1 
ATOM   5771 C  CD1   . ILE D 4 4   ? 43.098 87.774  25.203  1.00 42.58  ? 4    ILE B CD1   1 
ATOM   5772 N  N     . ILE D 4 5   ? 42.247 90.107  20.175  1.00 34.28  ? 5    ILE B N     1 
ATOM   5773 C  CA    . ILE D 4 5   ? 41.873 89.848  18.794  1.00 34.87  ? 5    ILE B CA    1 
ATOM   5774 C  C     . ILE D 4 5   ? 42.137 88.365  18.550  1.00 29.12  ? 5    ILE B C     1 
ATOM   5775 O  O     . ILE D 4 5   ? 43.286 87.916  18.561  1.00 34.45  ? 5    ILE B O     1 
ATOM   5776 C  CB    . ILE D 4 5   ? 42.713 90.696  17.805  1.00 45.26  ? 5    ILE B CB    1 
ATOM   5777 C  CG1   . ILE D 4 5   ? 42.520 92.189  18.112  1.00 50.66  ? 5    ILE B CG1   1 
ATOM   5778 C  CG2   . ILE D 4 5   ? 42.306 90.389  16.367  1.00 50.12  ? 5    ILE B CG2   1 
ATOM   5779 C  CD1   . ILE D 4 5   ? 43.231 93.116  17.146  1.00 54.46  ? 5    ILE B CD1   1 
ATOM   5780 N  N     . HIS D 4 6   ? 41.065 87.598  18.394  1.00 24.04  ? 6    HIS B N     1 
ATOM   5781 C  CA    . HIS D 4 6   ? 41.186 86.170  18.147  1.00 19.71  ? 6    HIS B CA    1 
ATOM   5782 C  C     . HIS D 4 6   ? 41.334 85.921  16.649  1.00 24.34  ? 6    HIS B C     1 
ATOM   5783 O  O     . HIS D 4 6   ? 40.392 86.084  15.865  1.00 25.25  ? 6    HIS B O     1 
ATOM   5784 C  CB    . HIS D 4 6   ? 39.992 85.433  18.755  1.00 28.00  ? 6    HIS B CB    1 
ATOM   5785 C  CG    . HIS D 4 6   ? 39.927 85.547  20.251  1.00 37.59  ? 6    HIS B CG    1 
ATOM   5786 N  ND1   . HIS D 4 6   ? 40.608 84.693  21.093  1.00 43.26  ? 6    HIS B ND1   1 
ATOM   5787 C  CD2   . HIS D 4 6   ? 39.298 86.440  21.053  1.00 38.81  ? 6    HIS B CD2   1 
ATOM   5788 C  CE1   . HIS D 4 6   ? 40.404 85.054  22.346  1.00 50.13  ? 6    HIS B CE1   1 
ATOM   5789 N  NE2   . HIS D 4 6   ? 39.612 86.112  22.351  1.00 40.80  ? 6    HIS B NE2   1 
ATOM   5790 N  N     . LEU D 4 7   ? 42.561 85.583  16.267  1.00 22.63  ? 7    LEU B N     1 
ATOM   5791 C  CA    . LEU D 4 7   ? 42.937 85.323  14.883  1.00 23.38  ? 7    LEU B CA    1 
ATOM   5792 C  C     . LEU D 4 7   ? 42.483 84.005  14.279  1.00 23.92  ? 7    LEU B C     1 
ATOM   5793 O  O     . LEU D 4 7   ? 42.112 83.059  14.978  1.00 16.50  ? 7    LEU B O     1 
ATOM   5794 C  CB    . LEU D 4 7   ? 44.453 85.383  14.754  1.00 16.38  ? 7    LEU B CB    1 
ATOM   5795 C  CG    . LEU D 4 7   ? 45.152 86.660  15.176  1.00 17.61  ? 7    LEU B CG    1 
ATOM   5796 C  CD1   . LEU D 4 7   ? 46.648 86.399  15.168  1.00 14.91  ? 7    LEU B CD1   1 
ATOM   5797 C  CD2   . LEU D 4 7   ? 44.765 87.798  14.247  1.00 14.34  ? 7    LEU B CD2   1 
ATOM   5798 N  N     . THR D 4 8   ? 42.543 83.973  12.951  1.00 16.30  ? 8    THR B N     1 
ATOM   5799 C  CA    . THR D 4 8   ? 42.200 82.807  12.155  1.00 12.51  ? 8    THR B CA    1 
ATOM   5800 C  C     . THR D 4 8   ? 43.314 82.754  11.115  1.00 12.37  ? 8    THR B C     1 
ATOM   5801 O  O     . THR D 4 8   ? 44.092 83.699  10.989  1.00 14.87  ? 8    THR B O     1 
ATOM   5802 C  CB    . THR D 4 8   ? 40.852 82.951  11.422  1.00 15.37  ? 8    THR B CB    1 
ATOM   5803 O  OG1   . THR D 4 8   ? 40.954 83.978  10.434  1.00 25.85  ? 8    THR B OG1   1 
ATOM   5804 C  CG2   . THR D 4 8   ? 39.731 83.285  12.396  1.00 17.83  ? 8    THR B CG2   1 
ATOM   5805 N  N     . ASP D 4 9   ? 43.416 81.646  10.394  1.00 16.32  ? 9    ASP B N     1 
ATOM   5806 C  CA    . ASP D 4 9   ? 44.450 81.523  9.376   1.00 19.35  ? 9    ASP B CA    1 
ATOM   5807 C  C     . ASP D 4 9   ? 44.253 82.571  8.294   1.00 18.34  ? 9    ASP B C     1 
ATOM   5808 O  O     . ASP D 4 9   ? 45.199 83.253  7.898   1.00 18.30  ? 9    ASP B O     1 
ATOM   5809 C  CB    . ASP D 4 9   ? 44.420 80.134  8.726   1.00 15.59  ? 9    ASP B CB    1 
ATOM   5810 C  CG    . ASP D 4 9   ? 45.038 79.061  9.594   1.00 21.41  ? 9    ASP B CG    1 
ATOM   5811 O  OD1   . ASP D 4 9   ? 46.038 79.346  10.294  1.00 9.20   ? 9    ASP B OD1   1 
ATOM   5812 O  OD2   . ASP D 4 9   ? 44.527 77.922  9.555   1.00 19.89  ? 9    ASP B OD2   1 
ATOM   5813 N  N     . ASP D 4 10  ? 43.005 82.703  7.847   1.00 18.06  ? 10   ASP B N     1 
ATOM   5814 C  CA    . ASP D 4 10  ? 42.634 83.639  6.796   1.00 21.20  ? 10   ASP B CA    1 
ATOM   5815 C  C     . ASP D 4 10  ? 42.701 85.121  7.173   1.00 20.70  ? 10   ASP B C     1 
ATOM   5816 O  O     . ASP D 4 10  ? 42.885 85.963  6.299   1.00 25.61  ? 10   ASP B O     1 
ATOM   5817 C  CB    . ASP D 4 10  ? 41.230 83.302  6.264   1.00 27.38  ? 10   ASP B CB    1 
ATOM   5818 C  CG    . ASP D 4 10  ? 41.147 81.914  5.614   1.00 36.34  ? 10   ASP B CG    1 
ATOM   5819 O  OD1   . ASP D 4 10  ? 42.196 81.275  5.364   1.00 43.59  ? 10   ASP B OD1   1 
ATOM   5820 O  OD2   . ASP D 4 10  ? 40.014 81.459  5.344   1.00 36.75  ? 10   ASP B OD2   1 
ATOM   5821 N  N     . SER D 4 11  ? 42.556 85.445  8.458   1.00 18.52  ? 11   SER B N     1 
ATOM   5822 C  CA    . SER D 4 11  ? 42.600 86.845  8.882   1.00 15.65  ? 11   SER B CA    1 
ATOM   5823 C  C     . SER D 4 11  ? 43.986 87.285  9.336   1.00 14.22  ? 11   SER B C     1 
ATOM   5824 O  O     . SER D 4 11  ? 44.255 88.481  9.423   1.00 22.25  ? 11   SER B O     1 
ATOM   5825 C  CB    . SER D 4 11  ? 41.596 87.109  10.011  1.00 17.01  ? 11   SER B CB    1 
ATOM   5826 O  OG    . SER D 4 11  ? 42.144 86.809  11.284  1.00 24.87  ? 11   SER B OG    1 
ATOM   5827 N  N     . PHE D 4 12  ? 44.857 86.315  9.609   1.00 12.41  ? 12   PHE B N     1 
ATOM   5828 C  CA    . PHE D 4 12  ? 46.214 86.580  10.085  1.00 12.50  ? 12   PHE B CA    1 
ATOM   5829 C  C     . PHE D 4 12  ? 47.043 87.588  9.277   1.00 17.02  ? 12   PHE B C     1 
ATOM   5830 O  O     . PHE D 4 12  ? 47.633 88.500  9.852   1.00 19.01  ? 12   PHE B O     1 
ATOM   5831 C  CB    . PHE D 4 12  ? 46.986 85.264  10.208  1.00 11.81  ? 12   PHE B CB    1 
ATOM   5832 C  CG    . PHE D 4 12  ? 48.266 85.385  10.984  1.00 20.65  ? 12   PHE B CG    1 
ATOM   5833 C  CD1   . PHE D 4 12  ? 49.452 85.758  10.352  1.00 23.20  ? 12   PHE B CD1   1 
ATOM   5834 C  CD2   . PHE D 4 12  ? 48.284 85.135  12.353  1.00 18.41  ? 12   PHE B CD2   1 
ATOM   5835 C  CE1   . PHE D 4 12  ? 50.640 85.882  11.074  1.00 24.63  ? 12   PHE B CE1   1 
ATOM   5836 C  CE2   . PHE D 4 12  ? 49.467 85.254  13.085  1.00 24.31  ? 12   PHE B CE2   1 
ATOM   5837 C  CZ    . PHE D 4 12  ? 50.647 85.630  12.444  1.00 22.03  ? 12   PHE B CZ    1 
ATOM   5838 N  N     . ASP D 4 13  ? 47.089 87.414  7.957   1.00 22.72  ? 13   ASP B N     1 
ATOM   5839 C  CA    . ASP D 4 13  ? 47.859 88.288  7.068   1.00 26.73  ? 13   ASP B CA    1 
ATOM   5840 C  C     . ASP D 4 13  ? 47.513 89.760  7.252   1.00 25.21  ? 13   ASP B C     1 
ATOM   5841 O  O     . ASP D 4 13  ? 48.403 90.583  7.442   1.00 38.86  ? 13   ASP B O     1 
ATOM   5842 C  CB    . ASP D 4 13  ? 47.648 87.872  5.602   1.00 53.87  ? 13   ASP B CB    1 
ATOM   5843 C  CG    . ASP D 4 13  ? 48.693 88.459  4.652   1.00 63.20  ? 13   ASP B CG    1 
ATOM   5844 O  OD1   . ASP D 4 13  ? 48.669 89.682  4.394   1.00 77.12  ? 13   ASP B OD1   1 
ATOM   5845 O  OD2   . ASP D 4 13  ? 49.531 87.683  4.142   1.00 72.93  ? 13   ASP B OD2   1 
ATOM   5846 N  N     . THR D 4 14  ? 46.224 90.085  7.218   1.00 22.70  ? 14   THR B N     1 
ATOM   5847 C  CA    . THR D 4 14  ? 45.781 91.468  7.376   1.00 25.37  ? 14   THR B CA    1 
ATOM   5848 C  C     . THR D 4 14  ? 45.857 91.964  8.818   1.00 22.17  ? 14   THR B C     1 
ATOM   5849 O  O     . THR D 4 14  ? 46.463 92.999  9.090   1.00 24.63  ? 14   THR B O     1 
ATOM   5850 C  CB    . THR D 4 14  ? 44.337 91.671  6.843   1.00 32.29  ? 14   THR B CB    1 
ATOM   5851 O  OG1   . THR D 4 14  ? 43.439 90.788  7.523   1.00 43.13  ? 14   THR B OG1   1 
ATOM   5852 C  CG2   . THR D 4 14  ? 44.272 91.399  5.349   1.00 37.17  ? 14   THR B CG2   1 
ATOM   5853 N  N     . ASP D 4 15  ? 45.248 91.216  9.735   1.00 21.54  ? 15   ASP B N     1 
ATOM   5854 C  CA    . ASP D 4 15  ? 45.228 91.573  11.153  1.00 17.45  ? 15   ASP B CA    1 
ATOM   5855 C  C     . ASP D 4 15  ? 46.600 91.680  11.819  1.00 19.52  ? 15   ASP B C     1 
ATOM   5856 O  O     . ASP D 4 15  ? 46.782 92.462  12.748  1.00 20.51  ? 15   ASP B O     1 
ATOM   5857 C  CB    . ASP D 4 15  ? 44.354 90.585  11.939  1.00 14.65  ? 15   ASP B CB    1 
ATOM   5858 C  CG    . ASP D 4 15  ? 42.863 90.828  11.750  1.00 22.50  ? 15   ASP B CG    1 
ATOM   5859 O  OD1   . ASP D 4 15  ? 42.443 92.002  11.635  1.00 30.55  ? 15   ASP B OD1   1 
ATOM   5860 O  OD2   . ASP D 4 15  ? 42.096 89.843  11.744  1.00 27.75  ? 15   ASP B OD2   1 
ATOM   5861 N  N     . VAL D 4 16  ? 47.567 90.912  11.331  1.00 23.69  ? 16   VAL B N     1 
ATOM   5862 C  CA    . VAL D 4 16  ? 48.904 90.926  11.908  1.00 23.36  ? 16   VAL B CA    1 
ATOM   5863 C  C     . VAL D 4 16  ? 49.969 91.589  11.032  1.00 24.37  ? 16   VAL B C     1 
ATOM   5864 O  O     . VAL D 4 16  ? 50.542 92.613  11.417  1.00 26.58  ? 16   VAL B O     1 
ATOM   5865 C  CB    . VAL D 4 16  ? 49.366 89.483  12.277  1.00 26.56  ? 16   VAL B CB    1 
ATOM   5866 C  CG1   . VAL D 4 16  ? 50.756 89.504  12.886  1.00 27.84  ? 16   VAL B CG1   1 
ATOM   5867 C  CG2   . VAL D 4 16  ? 48.391 88.858  13.252  1.00 30.73  ? 16   VAL B CG2   1 
ATOM   5868 N  N     . LEU D 4 17  ? 50.214 91.015  9.855   1.00 22.70  ? 17   LEU B N     1 
ATOM   5869 C  CA    . LEU D 4 17  ? 51.231 91.513  8.924   1.00 27.78  ? 17   LEU B CA    1 
ATOM   5870 C  C     . LEU D 4 17  ? 50.992 92.866  8.233   1.00 29.03  ? 17   LEU B C     1 
ATOM   5871 O  O     . LEU D 4 17  ? 51.886 93.385  7.565   1.00 33.89  ? 17   LEU B O     1 
ATOM   5872 C  CB    . LEU D 4 17  ? 51.545 90.443  7.868   1.00 28.29  ? 17   LEU B CB    1 
ATOM   5873 C  CG    . LEU D 4 17  ? 51.809 89.007  8.340   1.00 28.41  ? 17   LEU B CG    1 
ATOM   5874 C  CD1   . LEU D 4 17  ? 52.369 88.184  7.187   1.00 30.23  ? 17   LEU B CD1   1 
ATOM   5875 C  CD2   . LEU D 4 17  ? 52.781 89.000  9.498   1.00 28.34  ? 17   LEU B CD2   1 
ATOM   5876 N  N     . LYS D 4 18  ? 49.802 93.436  8.393   1.00 30.47  ? 18   LYS B N     1 
ATOM   5877 C  CA    . LYS D 4 18  ? 49.486 94.728  7.775   1.00 33.75  ? 18   LYS B CA    1 
ATOM   5878 C  C     . LYS D 4 18  ? 48.943 95.729  8.796   1.00 33.49  ? 18   LYS B C     1 
ATOM   5879 O  O     . LYS D 4 18  ? 48.518 96.829  8.432   1.00 32.31  ? 18   LYS B O     1 
ATOM   5880 C  CB    . LYS D 4 18  ? 48.452 94.546  6.661   1.00 36.11  ? 18   LYS B CB    1 
ATOM   5881 C  CG    . LYS D 4 18  ? 48.904 93.714  5.476   1.00 37.91  ? 18   LYS B CG    1 
ATOM   5882 C  CD    . LYS D 4 18  ? 47.758 93.576  4.495   1.00 45.20  ? 18   LYS B CD    1 
ATOM   5883 C  CE    . LYS D 4 18  ? 48.151 92.784  3.268   1.00 52.89  ? 18   LYS B CE    1 
ATOM   5884 N  NZ    . LYS D 4 18  ? 46.994 92.693  2.334   1.00 51.14  ? 18   LYS B NZ    1 
ATOM   5885 N  N     . ALA D 4 19  ? 48.969 95.337  10.069  1.00 36.05  ? 19   ALA B N     1 
ATOM   5886 C  CA    . ALA D 4 19  ? 48.472 96.152  11.172  1.00 39.38  ? 19   ALA B CA    1 
ATOM   5887 C  C     . ALA D 4 19  ? 49.135 97.508  11.409  1.00 44.34  ? 19   ALA B C     1 
ATOM   5888 O  O     . ALA D 4 19  ? 48.476 98.432  11.896  1.00 44.53  ? 19   ALA B O     1 
ATOM   5889 C  CB    . ALA D 4 19  ? 48.502 95.343  12.450  1.00 45.73  ? 19   ALA B CB    1 
ATOM   5890 N  N     . ASP D 4 20  ? 50.420 97.631  11.077  1.00 51.28  ? 20   ASP B N     1 
ATOM   5891 C  CA    . ASP D 4 20  ? 51.158 98.886  11.283  1.00 61.99  ? 20   ASP B CA    1 
ATOM   5892 C  C     . ASP D 4 20  ? 51.099 99.318  12.748  1.00 62.30  ? 20   ASP B C     1 
ATOM   5893 O  O     . ASP D 4 20  ? 50.402 100.270 13.119  1.00 61.54  ? 20   ASP B O     1 
ATOM   5894 C  CB    . ASP D 4 20  ? 50.637 100.004 10.362  1.00 64.79  ? 20   ASP B CB    1 
ATOM   5895 C  CG    . ASP D 4 20  ? 51.295 99.994  8.989   1.00 73.38  ? 20   ASP B CG    1 
ATOM   5896 O  OD1   . ASP D 4 20  ? 51.649 98.903  8.484   1.00 72.54  ? 20   ASP B OD1   1 
ATOM   5897 O  OD2   . ASP D 4 20  ? 51.462 101.091 8.415   1.00 76.19  ? 20   ASP B OD2   1 
ATOM   5898 N  N     . GLY D 4 21  ? 51.838 98.579  13.567  1.00 64.32  ? 21   GLY B N     1 
ATOM   5899 C  CA    . GLY D 4 21  ? 51.900 98.823  14.994  1.00 59.66  ? 21   GLY B CA    1 
ATOM   5900 C  C     . GLY D 4 21  ? 52.505 97.599  15.649  1.00 55.33  ? 21   GLY B C     1 
ATOM   5901 O  O     . GLY D 4 21  ? 53.082 96.749  14.970  1.00 60.20  ? 21   GLY B O     1 
ATOM   5902 N  N     . ALA D 4 22  ? 52.366 97.494  16.965  1.00 43.31  ? 22   ALA B N     1 
ATOM   5903 C  CA    . ALA D 4 22  ? 52.914 96.360  17.693  1.00 33.02  ? 22   ALA B CA    1 
ATOM   5904 C  C     . ALA D 4 22  ? 51.816 95.361  18.033  1.00 27.25  ? 22   ALA B C     1 
ATOM   5905 O  O     . ALA D 4 22  ? 50.814 95.711  18.657  1.00 23.21  ? 22   ALA B O     1 
ATOM   5906 C  CB    . ALA D 4 22  ? 53.629 96.836  18.961  1.00 20.16  ? 22   ALA B CB    1 
ATOM   5907 N  N     . ILE D 4 23  ? 52.005 94.122  17.582  1.00 27.90  ? 23   ILE B N     1 
ATOM   5908 C  CA    . ILE D 4 23  ? 51.055 93.032  17.813  1.00 27.86  ? 23   ILE B CA    1 
ATOM   5909 C  C     . ILE D 4 23  ? 51.776 91.876  18.505  1.00 27.61  ? 23   ILE B C     1 
ATOM   5910 O  O     . ILE D 4 23  ? 52.830 91.445  18.048  1.00 29.83  ? 23   ILE B O     1 
ATOM   5911 C  CB    . ILE D 4 23  ? 50.483 92.462  16.470  1.00 29.55  ? 23   ILE B CB    1 
ATOM   5912 C  CG1   . ILE D 4 23  ? 49.989 93.586  15.549  1.00 27.07  ? 23   ILE B CG1   1 
ATOM   5913 C  CG2   . ILE D 4 23  ? 49.346 91.479  16.760  1.00 28.93  ? 23   ILE B CG2   1 
ATOM   5914 C  CD1   . ILE D 4 23  ? 48.763 94.328  16.050  1.00 23.79  ? 23   ILE B CD1   1 
ATOM   5915 N  N     . LEU D 4 24  ? 51.223 91.385  19.608  1.00 28.59  ? 24   LEU B N     1 
ATOM   5916 C  CA    . LEU D 4 24  ? 51.816 90.260  20.323  1.00 29.18  ? 24   LEU B CA    1 
ATOM   5917 C  C     . LEU D 4 24  ? 50.936 89.050  20.055  1.00 28.30  ? 24   LEU B C     1 
ATOM   5918 O  O     . LEU D 4 24  ? 49.841 88.944  20.600  1.00 29.60  ? 24   LEU B O     1 
ATOM   5919 C  CB    . LEU D 4 24  ? 51.870 90.509  21.834  1.00 31.35  ? 24   LEU B CB    1 
ATOM   5920 C  CG    . LEU D 4 24  ? 52.356 89.309  22.666  1.00 33.33  ? 24   LEU B CG    1 
ATOM   5921 C  CD1   . LEU D 4 24  ? 53.852 89.089  22.448  1.00 28.73  ? 24   LEU B CD1   1 
ATOM   5922 C  CD2   . LEU D 4 24  ? 52.063 89.532  24.142  1.00 26.79  ? 24   LEU B CD2   1 
ATOM   5923 N  N     . VAL D 4 25  ? 51.404 88.156  19.193  1.00 25.15  ? 25   VAL B N     1 
ATOM   5924 C  CA    . VAL D 4 25  ? 50.649 86.954  18.867  1.00 18.92  ? 25   VAL B CA    1 
ATOM   5925 C  C     . VAL D 4 25  ? 51.049 85.767  19.745  1.00 21.53  ? 25   VAL B C     1 
ATOM   5926 O  O     . VAL D 4 25  ? 52.230 85.444  19.893  1.00 23.82  ? 25   VAL B O     1 
ATOM   5927 C  CB    . VAL D 4 25  ? 50.797 86.576  17.377  1.00 22.17  ? 25   VAL B CB    1 
ATOM   5928 C  CG1   . VAL D 4 25  ? 49.999 85.318  17.074  1.00 24.13  ? 25   VAL B CG1   1 
ATOM   5929 C  CG2   . VAL D 4 25  ? 50.308 87.724  16.494  1.00 16.21  ? 25   VAL B CG2   1 
ATOM   5930 N  N     . ASP D 4 26  ? 50.035 85.148  20.340  1.00 17.16  ? 26   ASP B N     1 
ATOM   5931 C  CA    . ASP D 4 26  ? 50.187 83.992  21.208  1.00 9.97   ? 26   ASP B CA    1 
ATOM   5932 C  C     . ASP D 4 26  ? 49.680 82.751  20.475  1.00 9.45   ? 26   ASP B C     1 
ATOM   5933 O  O     . ASP D 4 26  ? 48.488 82.618  20.215  1.00 12.45  ? 26   ASP B O     1 
ATOM   5934 C  CB    . ASP D 4 26  ? 49.391 84.220  22.505  1.00 5.89   ? 26   ASP B CB    1 
ATOM   5935 C  CG    . ASP D 4 26  ? 49.234 82.954  23.347  1.00 14.49  ? 26   ASP B CG    1 
ATOM   5936 O  OD1   . ASP D 4 26  ? 50.218 82.200  23.535  1.00 17.42  ? 26   ASP B OD1   1 
ATOM   5937 O  OD2   . ASP D 4 26  ? 48.111 82.714  23.837  1.00 17.43  ? 26   ASP B OD2   1 
ATOM   5938 N  N     . PHE D 4 27  ? 50.604 81.879  20.088  1.00 12.87  ? 27   PHE B N     1 
ATOM   5939 C  CA    . PHE D 4 27  ? 50.253 80.639  19.404  1.00 17.45  ? 27   PHE B CA    1 
ATOM   5940 C  C     . PHE D 4 27  ? 50.031 79.641  20.535  1.00 18.20  ? 27   PHE B C     1 
ATOM   5941 O  O     . PHE D 4 27  ? 50.979 79.283  21.239  1.00 24.27  ? 27   PHE B O     1 
ATOM   5942 C  CB    . PHE D 4 27  ? 51.401 80.179  18.494  1.00 17.55  ? 27   PHE B CB    1 
ATOM   5943 C  CG    . PHE D 4 27  ? 51.650 81.087  17.317  1.00 16.33  ? 27   PHE B CG    1 
ATOM   5944 C  CD1   . PHE D 4 27  ? 52.421 82.240  17.457  1.00 14.54  ? 27   PHE B CD1   1 
ATOM   5945 C  CD2   . PHE D 4 27  ? 51.124 80.782  16.061  1.00 14.77  ? 27   PHE B CD2   1 
ATOM   5946 C  CE1   . PHE D 4 27  ? 52.671 83.080  16.357  1.00 20.59  ? 27   PHE B CE1   1 
ATOM   5947 C  CE2   . PHE D 4 27  ? 51.366 81.615  14.954  1.00 19.61  ? 27   PHE B CE2   1 
ATOM   5948 C  CZ    . PHE D 4 27  ? 52.142 82.766  15.104  1.00 18.36  ? 27   PHE B CZ    1 
ATOM   5949 N  N     . TRP D 4 28  ? 48.788 79.192  20.702  1.00 15.28  ? 28   TRP B N     1 
ATOM   5950 C  CA    . TRP D 4 28  ? 48.448 78.267  21.782  1.00 14.68  ? 28   TRP B CA    1 
ATOM   5951 C  C     . TRP D 4 28  ? 47.567 77.061  21.417  1.00 18.68  ? 28   TRP B C     1 
ATOM   5952 O  O     . TRP D 4 28  ? 47.069 76.939  20.299  1.00 17.26  ? 28   TRP B O     1 
ATOM   5953 C  CB    . TRP D 4 28  ? 47.745 79.050  22.887  1.00 16.48  ? 28   TRP B CB    1 
ATOM   5954 C  CG    . TRP D 4 28  ? 46.372 79.518  22.476  1.00 17.94  ? 28   TRP B CG    1 
ATOM   5955 C  CD1   . TRP D 4 28  ? 46.074 80.537  21.612  1.00 12.91  ? 28   TRP B CD1   1 
ATOM   5956 C  CD2   . TRP D 4 28  ? 45.116 78.965  22.897  1.00 11.06  ? 28   TRP B CD2   1 
ATOM   5957 N  NE1   . TRP D 4 28  ? 44.711 80.652  21.471  1.00 8.46   ? 28   TRP B NE1   1 
ATOM   5958 C  CE2   . TRP D 4 28  ? 44.100 79.705  22.247  1.00 3.78   ? 28   TRP B CE2   1 
ATOM   5959 C  CE3   . TRP D 4 28  ? 44.750 77.923  23.761  1.00 14.69  ? 28   TRP B CE3   1 
ATOM   5960 C  CZ2   . TRP D 4 28  ? 42.742 79.428  22.433  1.00 8.66   ? 28   TRP B CZ2   1 
ATOM   5961 C  CZ3   . TRP D 4 28  ? 43.398 77.647  23.946  1.00 11.78  ? 28   TRP B CZ3   1 
ATOM   5962 C  CH2   . TRP D 4 28  ? 42.409 78.402  23.284  1.00 14.37  ? 28   TRP B CH2   1 
ATOM   5963 N  N     . ALA D 4 29  ? 47.343 76.204  22.409  1.00 14.89  ? 29   ALA B N     1 
ATOM   5964 C  CA    . ALA D 4 29  ? 46.518 75.007  22.257  1.00 18.90  ? 29   ALA B CA    1 
ATOM   5965 C  C     . ALA D 4 29  ? 45.826 74.710  23.584  1.00 22.87  ? 29   ALA B C     1 
ATOM   5966 O  O     . ALA D 4 29  ? 46.422 74.871  24.656  1.00 25.21  ? 29   ALA B O     1 
ATOM   5967 C  CB    . ALA D 4 29  ? 47.371 73.831  21.839  1.00 16.61  ? 29   ALA B CB    1 
ATOM   5968 N  N     . GLU D 4 30  ? 44.568 74.280  23.507  1.00 23.99  ? 30   GLU B N     1 
ATOM   5969 C  CA    . GLU D 4 30  ? 43.771 73.971  24.696  1.00 29.02  ? 30   GLU B CA    1 
ATOM   5970 C  C     . GLU D 4 30  ? 44.331 72.828  25.555  1.00 30.74  ? 30   GLU B C     1 
ATOM   5971 O  O     . GLU D 4 30  ? 44.047 72.751  26.751  1.00 25.91  ? 30   GLU B O     1 
ATOM   5972 C  CB    . GLU D 4 30  ? 42.324 73.659  24.287  1.00 33.39  ? 30   GLU B CB    1 
ATOM   5973 C  CG    . GLU D 4 30  ? 41.307 73.681  25.433  1.00 34.62  ? 30   GLU B CG    1 
ATOM   5974 C  CD    . GLU D 4 30  ? 41.063 75.080  25.998  1.00 40.03  ? 30   GLU B CD    1 
ATOM   5975 O  OE1   . GLU D 4 30  ? 40.325 75.867  25.360  1.00 39.17  ? 30   GLU B OE1   1 
ATOM   5976 O  OE2   . GLU D 4 30  ? 41.603 75.391  27.084  1.00 41.81  ? 30   GLU B OE2   1 
ATOM   5977 N  N     . TRP D 4 31  ? 45.135 71.958  24.947  1.00 24.71  ? 31   TRP B N     1 
ATOM   5978 C  CA    . TRP D 4 31  ? 45.723 70.824  25.658  1.00 22.39  ? 31   TRP B CA    1 
ATOM   5979 C  C     . TRP D 4 31  ? 47.053 71.094  26.343  1.00 24.97  ? 31   TRP B C     1 
ATOM   5980 O  O     . TRP D 4 31  ? 47.620 70.201  26.961  1.00 26.60  ? 31   TRP B O     1 
ATOM   5981 C  CB    . TRP D 4 31  ? 45.852 69.608  24.728  1.00 16.66  ? 31   TRP B CB    1 
ATOM   5982 C  CG    . TRP D 4 31  ? 46.318 69.917  23.326  1.00 15.99  ? 31   TRP B CG    1 
ATOM   5983 C  CD1   . TRP D 4 31  ? 45.526 70.135  22.231  1.00 17.58  ? 31   TRP B CD1   1 
ATOM   5984 C  CD2   . TRP D 4 31  ? 47.674 70.032  22.867  1.00 20.36  ? 31   TRP B CD2   1 
ATOM   5985 N  NE1   . TRP D 4 31  ? 46.302 70.378  21.119  1.00 8.87   ? 31   TRP B NE1   1 
ATOM   5986 C  CE2   . TRP D 4 31  ? 47.620 70.325  21.477  1.00 11.77  ? 31   TRP B CE2   1 
ATOM   5987 C  CE3   . TRP D 4 31  ? 48.927 69.921  23.488  1.00 19.52  ? 31   TRP B CE3   1 
ATOM   5988 C  CZ2   . TRP D 4 31  ? 48.774 70.508  20.704  1.00 12.78  ? 31   TRP B CZ2   1 
ATOM   5989 C  CZ3   . TRP D 4 31  ? 50.075 70.103  22.715  1.00 19.94  ? 31   TRP B CZ3   1 
ATOM   5990 C  CH2   . TRP D 4 31  ? 49.987 70.395  21.334  1.00 19.94  ? 31   TRP B CH2   1 
ATOM   5991 N  N     . CYS D 4 32  ? 47.536 72.328  26.255  1.00 32.20  ? 32   CYS B N     1 
ATOM   5992 C  CA    . CYS D 4 32  ? 48.809 72.691  26.866  1.00 32.33  ? 32   CYS B CA    1 
ATOM   5993 C  C     . CYS D 4 32  ? 48.657 73.290  28.263  1.00 33.65  ? 32   CYS B C     1 
ATOM   5994 O  O     . CYS D 4 32  ? 47.802 74.155  28.495  1.00 34.30  ? 32   CYS B O     1 
ATOM   5995 C  CB    . CYS D 4 32  ? 49.562 73.663  25.953  1.00 24.78  ? 32   CYS B CB    1 
ATOM   5996 S  SG    . CYS D 4 32  ? 51.163 74.231  26.566  1.00 28.02  ? 32   CYS B SG    1 
ATOM   5997 N  N     . GLY D 4 33  ? 49.493 72.811  29.184  1.00 26.22  ? 33   GLY B N     1 
ATOM   5998 C  CA    . GLY D 4 33  ? 49.477 73.293  30.557  1.00 16.03  ? 33   GLY B CA    1 
ATOM   5999 C  C     . GLY D 4 33  ? 49.946 74.731  30.654  1.00 15.96  ? 33   GLY B C     1 
ATOM   6000 O  O     . GLY D 4 33  ? 49.248 75.556  31.239  1.00 17.32  ? 33   GLY B O     1 
ATOM   6001 N  N     . PRO D 4 34  ? 51.143 75.056  30.126  1.00 18.10  ? 34   PRO B N     1 
ATOM   6002 C  CA    . PRO D 4 34  ? 51.707 76.408  30.145  1.00 20.03  ? 34   PRO B CA    1 
ATOM   6003 C  C     . PRO D 4 34  ? 50.831 77.459  29.445  1.00 24.68  ? 34   PRO B C     1 
ATOM   6004 O  O     . PRO D 4 34  ? 50.842 78.631  29.830  1.00 22.69  ? 34   PRO B O     1 
ATOM   6005 C  CB    . PRO D 4 34  ? 53.046 76.215  29.435  1.00 22.25  ? 34   PRO B CB    1 
ATOM   6006 C  CG    . PRO D 4 34  ? 53.453 74.860  29.911  1.00 17.81  ? 34   PRO B CG    1 
ATOM   6007 C  CD    . PRO D 4 34  ? 52.171 74.089  29.693  1.00 23.53  ? 34   PRO B CD    1 
ATOM   6008 N  N     . CYS D 4 35  ? 50.087 77.042  28.417  1.00 30.83  ? 35   CYS B N     1 
ATOM   6009 C  CA    . CYS D 4 35  ? 49.202 77.954  27.680  1.00 30.01  ? 35   CYS B CA    1 
ATOM   6010 C  C     . CYS D 4 35  ? 48.080 78.488  28.571  1.00 31.65  ? 35   CYS B C     1 
ATOM   6011 O  O     . CYS D 4 35  ? 47.776 79.684  28.553  1.00 20.61  ? 35   CYS B O     1 
ATOM   6012 C  CB    . CYS D 4 35  ? 48.594 77.263  26.449  1.00 21.71  ? 35   CYS B CB    1 
ATOM   6013 S  SG    . CYS D 4 35  ? 49.735 77.008  25.069  1.00 17.71  ? 35   CYS B SG    1 
ATOM   6014 N  N     . LYS D 4 36  ? 47.484 77.594  29.357  1.00 33.36  ? 36   LYS B N     1 
ATOM   6015 C  CA    . LYS D 4 36  ? 46.400 77.959  30.264  1.00 39.65  ? 36   LYS B CA    1 
ATOM   6016 C  C     . LYS D 4 36  ? 46.889 78.911  31.366  1.00 35.47  ? 36   LYS B C     1 
ATOM   6017 O  O     . LYS D 4 36  ? 46.114 79.701  31.908  1.00 42.48  ? 36   LYS B O     1 
ATOM   6018 C  CB    . LYS D 4 36  ? 45.789 76.701  30.883  1.00 45.31  ? 36   LYS B CB    1 
ATOM   6019 C  CG    . LYS D 4 36  ? 44.599 76.971  31.785  1.00 56.83  ? 36   LYS B CG    1 
ATOM   6020 C  CD    . LYS D 4 36  ? 44.117 75.702  32.454  1.00 57.48  ? 36   LYS B CD    1 
ATOM   6021 C  CE    . LYS D 4 36  ? 43.044 76.000  33.483  1.00 53.89  ? 36   LYS B CE    1 
ATOM   6022 N  NZ    . LYS D 4 36  ? 42.610 74.752  34.168  1.00 59.76  ? 36   LYS B NZ    1 
ATOM   6023 N  N     . MET D 4 37  ? 48.180 78.833  31.679  1.00 30.61  ? 37   MET B N     1 
ATOM   6024 C  CA    . MET D 4 37  ? 48.788 79.676  32.702  1.00 29.83  ? 37   MET B CA    1 
ATOM   6025 C  C     . MET D 4 37  ? 48.966 81.108  32.239  1.00 25.93  ? 37   MET B C     1 
ATOM   6026 O  O     . MET D 4 37  ? 48.618 82.040  32.957  1.00 29.23  ? 37   MET B O     1 
ATOM   6027 C  CB    . MET D 4 37  ? 50.166 79.139  33.090  1.00 35.16  ? 37   MET B CB    1 
ATOM   6028 C  CG    . MET D 4 37  ? 50.172 77.874  33.925  1.00 48.38  ? 37   MET B CG    1 
ATOM   6029 S  SD    . MET D 4 37  ? 51.873 77.294  34.156  1.00 56.80  ? 37   MET B SD    1 
ATOM   6030 C  CE    . MET D 4 37  ? 52.635 78.725  34.971  1.00 49.64  ? 37   MET B CE    1 
ATOM   6031 N  N     . ILE D 4 38  ? 49.535 81.276  31.048  1.00 28.98  ? 38   ILE B N     1 
ATOM   6032 C  CA    . ILE D 4 38  ? 49.785 82.605  30.501  1.00 29.66  ? 38   ILE B CA    1 
ATOM   6033 C  C     . ILE D 4 38  ? 48.545 83.312  29.937  1.00 27.05  ? 38   ILE B C     1 
ATOM   6034 O  O     . ILE D 4 38  ? 48.577 84.518  29.716  1.00 26.32  ? 38   ILE B O     1 
ATOM   6035 C  CB    . ILE D 4 38  ? 50.945 82.561  29.444  1.00 33.71  ? 38   ILE B CB    1 
ATOM   6036 C  CG1   . ILE D 4 38  ? 51.600 83.940  29.313  1.00 26.43  ? 38   ILE B CG1   1 
ATOM   6037 C  CG2   . ILE D 4 38  ? 50.434 82.070  28.087  1.00 24.07  ? 38   ILE B CG2   1 
ATOM   6038 C  CD1   . ILE D 4 38  ? 52.863 83.938  28.481  1.00 23.35  ? 38   ILE B CD1   1 
ATOM   6039 N  N     . ALA D 4 39  ? 47.449 82.574  29.749  1.00 29.46  ? 39   ALA B N     1 
ATOM   6040 C  CA    . ALA D 4 39  ? 46.208 83.143  29.212  1.00 27.22  ? 39   ALA B CA    1 
ATOM   6041 C  C     . ALA D 4 39  ? 45.672 84.323  30.027  1.00 30.30  ? 39   ALA B C     1 
ATOM   6042 O  O     . ALA D 4 39  ? 45.438 85.393  29.463  1.00 32.11  ? 39   ALA B O     1 
ATOM   6043 C  CB    . ALA D 4 39  ? 45.134 82.065  29.055  1.00 28.11  ? 39   ALA B CB    1 
ATOM   6044 N  N     . PRO D 4 40  ? 45.458 84.147  31.353  1.00 29.69  ? 40   PRO B N     1 
ATOM   6045 C  CA    . PRO D 4 40  ? 44.950 85.238  32.198  1.00 27.14  ? 40   PRO B CA    1 
ATOM   6046 C  C     . PRO D 4 40  ? 45.895 86.445  32.254  1.00 22.63  ? 40   PRO B C     1 
ATOM   6047 O  O     . PRO D 4 40  ? 45.443 87.577  32.407  1.00 28.23  ? 40   PRO B O     1 
ATOM   6048 C  CB    . PRO D 4 40  ? 44.817 84.569  33.565  1.00 32.66  ? 40   PRO B CB    1 
ATOM   6049 C  CG    . PRO D 4 40  ? 44.475 83.167  33.204  1.00 33.21  ? 40   PRO B CG    1 
ATOM   6050 C  CD    . PRO D 4 40  ? 45.506 82.901  32.139  1.00 27.49  ? 40   PRO B CD    1 
ATOM   6051 N  N     . ILE D 4 41  ? 47.199 86.192  32.123  1.00 25.78  ? 41   ILE B N     1 
ATOM   6052 C  CA    . ILE D 4 41  ? 48.218 87.247  32.147  1.00 26.30  ? 41   ILE B CA    1 
ATOM   6053 C  C     . ILE D 4 41  ? 48.052 88.138  30.908  1.00 25.60  ? 41   ILE B C     1 
ATOM   6054 O  O     . ILE D 4 41  ? 48.173 89.365  30.986  1.00 26.97  ? 41   ILE B O     1 
ATOM   6055 C  CB    . ILE D 4 41  ? 49.656 86.648  32.134  1.00 27.52  ? 41   ILE B CB    1 
ATOM   6056 C  CG1   . ILE D 4 41  ? 49.831 85.624  33.258  1.00 29.61  ? 41   ILE B CG1   1 
ATOM   6057 C  CG2   . ILE D 4 41  ? 50.694 87.754  32.262  1.00 25.67  ? 41   ILE B CG2   1 
ATOM   6058 C  CD1   . ILE D 4 41  ? 49.682 86.189  34.643  1.00 30.61  ? 41   ILE B CD1   1 
ATOM   6059 N  N     . LEU D 4 42  ? 47.774 87.498  29.771  1.00 22.43  ? 42   LEU B N     1 
ATOM   6060 C  CA    . LEU D 4 42  ? 47.575 88.190  28.503  1.00 21.35  ? 42   LEU B CA    1 
ATOM   6061 C  C     . LEU D 4 42  ? 46.357 89.107  28.574  1.00 19.80  ? 42   LEU B C     1 
ATOM   6062 O  O     . LEU D 4 42  ? 46.413 90.242  28.107  1.00 21.15  ? 42   LEU B O     1 
ATOM   6063 C  CB    . LEU D 4 42  ? 47.408 87.172  27.371  1.00 25.47  ? 42   LEU B CB    1 
ATOM   6064 C  CG    . LEU D 4 42  ? 48.643 86.320  27.060  1.00 25.56  ? 42   LEU B CG    1 
ATOM   6065 C  CD1   . LEU D 4 42  ? 48.258 85.170  26.166  1.00 26.43  ? 42   LEU B CD1   1 
ATOM   6066 C  CD2   . LEU D 4 42  ? 49.733 87.170  26.420  1.00 23.70  ? 42   LEU B CD2   1 
ATOM   6067 N  N     . ASP D 4 43  ? 45.279 88.617  29.192  1.00 19.49  ? 43   ASP B N     1 
ATOM   6068 C  CA    . ASP D 4 43  ? 44.026 89.363  29.357  1.00 25.08  ? 43   ASP B CA    1 
ATOM   6069 C  C     . ASP D 4 43  ? 44.185 90.706  30.059  1.00 29.37  ? 43   ASP B C     1 
ATOM   6070 O  O     . ASP D 4 43  ? 43.342 91.592  29.916  1.00 31.04  ? 43   ASP B O     1 
ATOM   6071 C  CB    . ASP D 4 43  ? 43.011 88.537  30.154  1.00 30.04  ? 43   ASP B CB    1 
ATOM   6072 C  CG    . ASP D 4 43  ? 42.456 87.356  29.372  1.00 39.81  ? 43   ASP B CG    1 
ATOM   6073 O  OD1   . ASP D 4 43  ? 42.747 87.232  28.162  1.00 38.81  ? 43   ASP B OD1   1 
ATOM   6074 O  OD2   . ASP D 4 43  ? 41.712 86.550  29.972  1.00 24.45  ? 43   ASP B OD2   1 
ATOM   6075 N  N     . GLU D 4 44  ? 45.257 90.842  30.832  1.00 36.92  ? 44   GLU B N     1 
ATOM   6076 C  CA    . GLU D 4 44  ? 45.533 92.064  31.571  1.00 43.46  ? 44   GLU B CA    1 
ATOM   6077 C  C     . GLU D 4 44  ? 46.500 92.955  30.820  1.00 42.53  ? 44   GLU B C     1 
ATOM   6078 O  O     . GLU D 4 44  ? 46.379 94.176  30.859  1.00 47.97  ? 44   GLU B O     1 
ATOM   6079 C  CB    . GLU D 4 44  ? 46.082 91.720  32.953  1.00 48.63  ? 44   GLU B CB    1 
ATOM   6080 C  CG    . GLU D 4 44  ? 45.147 90.809  33.738  1.00 53.93  ? 44   GLU B CG    1 
ATOM   6081 C  CD    . GLU D 4 44  ? 45.628 90.515  35.139  1.00 51.02  ? 44   GLU B CD    1 
ATOM   6082 O  OE1   . GLU D 4 44  ? 46.825 90.198  35.324  1.00 54.84  ? 44   GLU B OE1   1 
ATOM   6083 O  OE2   . GLU D 4 44  ? 44.792 90.595  36.060  1.00 61.06  ? 44   GLU B OE2   1 
ATOM   6084 N  N     . ILE D 4 45  ? 47.453 92.338  30.130  1.00 40.76  ? 45   ILE B N     1 
ATOM   6085 C  CA    . ILE D 4 45  ? 48.437 93.084  29.354  1.00 41.86  ? 45   ILE B CA    1 
ATOM   6086 C  C     . ILE D 4 45  ? 47.738 93.856  28.231  1.00 42.59  ? 45   ILE B C     1 
ATOM   6087 O  O     . ILE D 4 45  ? 48.186 94.935  27.838  1.00 44.16  ? 45   ILE B O     1 
ATOM   6088 C  CB    . ILE D 4 45  ? 49.503 92.142  28.752  1.00 39.90  ? 45   ILE B CB    1 
ATOM   6089 C  CG1   . ILE D 4 45  ? 50.330 91.503  29.874  1.00 41.07  ? 45   ILE B CG1   1 
ATOM   6090 C  CG2   . ILE D 4 45  ? 50.389 92.892  27.769  1.00 35.31  ? 45   ILE B CG2   1 
ATOM   6091 C  CD1   . ILE D 4 45  ? 51.041 92.500  30.787  1.00 38.72  ? 45   ILE B CD1   1 
ATOM   6092 N  N     . ALA D 4 46  ? 46.632 93.302  27.739  1.00 35.68  ? 46   ALA B N     1 
ATOM   6093 C  CA    . ALA D 4 46  ? 45.854 93.920  26.674  1.00 32.08  ? 46   ALA B CA    1 
ATOM   6094 C  C     . ALA D 4 46  ? 45.233 95.234  27.135  1.00 32.54  ? 46   ALA B C     1 
ATOM   6095 O  O     . ALA D 4 46  ? 45.082 96.165  26.341  1.00 35.16  ? 46   ALA B O     1 
ATOM   6096 C  CB    . ALA D 4 46  ? 44.770 92.969  26.199  1.00 22.65  ? 46   ALA B CB    1 
ATOM   6097 N  N     . ASP D 4 47  ? 44.881 95.311  28.416  1.00 32.53  ? 47   ASP B N     1 
ATOM   6098 C  CA    . ASP D 4 47  ? 44.277 96.521  28.975  1.00 36.37  ? 47   ASP B CA    1 
ATOM   6099 C  C     . ASP D 4 47  ? 45.345 97.576  29.254  1.00 35.60  ? 47   ASP B C     1 
ATOM   6100 O  O     . ASP D 4 47  ? 45.192 98.741  28.885  1.00 41.14  ? 47   ASP B O     1 
ATOM   6101 C  CB    . ASP D 4 47  ? 43.522 96.196  30.268  1.00 40.91  ? 47   ASP B CB    1 
ATOM   6102 C  CG    . ASP D 4 47  ? 42.546 95.038  30.110  1.00 50.90  ? 47   ASP B CG    1 
ATOM   6103 O  OD1   . ASP D 4 47  ? 42.152 94.714  28.970  1.00 55.27  ? 47   ASP B OD1   1 
ATOM   6104 O  OD2   . ASP D 4 47  ? 42.174 94.438  31.139  1.00 48.91  ? 47   ASP B OD2   1 
ATOM   6105 N  N     . GLU D 4 48  ? 46.434 97.148  29.889  1.00 38.90  ? 48   GLU B N     1 
ATOM   6106 C  CA    . GLU D 4 48  ? 47.544 98.031  30.239  1.00 44.54  ? 48   GLU B CA    1 
ATOM   6107 C  C     . GLU D 4 48  ? 48.278 98.616  29.040  1.00 42.39  ? 48   GLU B C     1 
ATOM   6108 O  O     . GLU D 4 48  ? 48.653 99.794  29.036  1.00 50.33  ? 48   GLU B O     1 
ATOM   6109 C  CB    . GLU D 4 48  ? 48.549 97.284  31.117  1.00 54.35  ? 48   GLU B CB    1 
ATOM   6110 C  CG    . GLU D 4 48  ? 48.020 96.883  32.485  1.00 64.61  ? 48   GLU B CG    1 
ATOM   6111 C  CD    . GLU D 4 48  ? 49.066 96.184  33.349  1.00 68.20  ? 48   GLU B CD    1 
ATOM   6112 O  OE1   . GLU D 4 48  ? 50.283 96.316  33.074  1.00 71.52  ? 48   GLU B OE1   1 
ATOM   6113 O  OE2   . GLU D 4 48  ? 48.663 95.502  34.314  1.00 67.95  ? 48   GLU B OE2   1 
ATOM   6114 N  N     . TYR D 4 49  ? 48.486 97.786  28.025  1.00 36.74  ? 49   TYR B N     1 
ATOM   6115 C  CA    . TYR D 4 49  ? 49.191 98.213  26.824  1.00 38.92  ? 49   TYR B CA    1 
ATOM   6116 C  C     . TYR D 4 49  ? 48.277 98.669  25.694  1.00 38.33  ? 49   TYR B C     1 
ATOM   6117 O  O     . TYR D 4 49  ? 48.717 98.805  24.553  1.00 42.23  ? 49   TYR B O     1 
ATOM   6118 C  CB    . TYR D 4 49  ? 50.129 97.101  26.350  1.00 35.78  ? 49   TYR B CB    1 
ATOM   6119 C  CG    . TYR D 4 49  ? 51.299 96.878  27.278  1.00 36.73  ? 49   TYR B CG    1 
ATOM   6120 C  CD1   . TYR D 4 49  ? 51.106 96.445  28.597  1.00 36.57  ? 49   TYR B CD1   1 
ATOM   6121 C  CD2   . TYR D 4 49  ? 52.603 97.119  26.847  1.00 34.67  ? 49   TYR B CD2   1 
ATOM   6122 C  CE1   . TYR D 4 49  ? 52.186 96.262  29.464  1.00 32.74  ? 49   TYR B CE1   1 
ATOM   6123 C  CE2   . TYR D 4 49  ? 53.692 96.938  27.706  1.00 39.08  ? 49   TYR B CE2   1 
ATOM   6124 C  CZ    . TYR D 4 49  ? 53.474 96.510  29.010  1.00 35.66  ? 49   TYR B CZ    1 
ATOM   6125 O  OH    . TYR D 4 49  ? 54.549 96.325  29.847  1.00 37.66  ? 49   TYR B OH    1 
ATOM   6126 N  N     . GLN D 4 50  ? 47.019 98.944  26.032  1.00 48.28  ? 50   GLN B N     1 
ATOM   6127 C  CA    . GLN D 4 50  ? 46.026 99.394  25.060  1.00 56.25  ? 50   GLN B CA    1 
ATOM   6128 C  C     . GLN D 4 50  ? 46.370 100.797 24.569  1.00 55.35  ? 50   GLN B C     1 
ATOM   6129 O  O     . GLN D 4 50  ? 46.075 101.799 25.225  1.00 56.78  ? 50   GLN B O     1 
ATOM   6130 C  CB    . GLN D 4 50  ? 44.630 99.361  25.690  1.00 63.89  ? 50   GLN B CB    1 
ATOM   6131 C  CG    . GLN D 4 50  ? 43.491 99.721  24.747  1.00 68.86  ? 50   GLN B CG    1 
ATOM   6132 C  CD    . GLN D 4 50  ? 42.129 99.366  25.319  1.00 67.60  ? 50   GLN B CD    1 
ATOM   6133 O  OE1   . GLN D 4 50  ? 41.268 98.847  24.609  1.00 69.68  ? 50   GLN B OE1   1 
ATOM   6134 N  NE2   . GLN D 4 50  ? 41.933 99.631  26.611  1.00 68.33  ? 50   GLN B NE2   1 
ATOM   6135 N  N     . GLY D 4 51  ? 47.031 100.844 23.417  1.00 51.29  ? 51   GLY B N     1 
ATOM   6136 C  CA    . GLY D 4 51  ? 47.428 102.107 22.833  1.00 48.36  ? 51   GLY B CA    1 
ATOM   6137 C  C     . GLY D 4 51  ? 48.763 101.964 22.136  1.00 47.89  ? 51   GLY B C     1 
ATOM   6138 O  O     . GLY D 4 51  ? 48.938 102.453 21.018  1.00 50.53  ? 51   GLY B O     1 
ATOM   6139 N  N     . LYS D 4 52  ? 49.703 101.287 22.794  1.00 47.92  ? 52   LYS B N     1 
ATOM   6140 C  CA    . LYS D 4 52  ? 51.033 101.080 22.230  1.00 55.60  ? 52   LYS B CA    1 
ATOM   6141 C  C     . LYS D 4 52  ? 51.290 99.651  21.733  1.00 54.62  ? 52   LYS B C     1 
ATOM   6142 O  O     . LYS D 4 52  ? 52.318 99.380  21.101  1.00 56.71  ? 52   LYS B O     1 
ATOM   6143 C  CB    . LYS D 4 52  ? 52.106 101.500 23.242  1.00 65.89  ? 52   LYS B CB    1 
ATOM   6144 C  CG    . LYS D 4 52  ? 52.085 100.766 24.573  1.00 73.32  ? 52   LYS B CG    1 
ATOM   6145 C  CD    . LYS D 4 52  ? 53.153 101.348 25.492  1.00 79.78  ? 52   LYS B CD    1 
ATOM   6146 C  CE    . LYS D 4 52  ? 53.264 100.582 26.798  1.00 76.98  ? 52   LYS B CE    1 
ATOM   6147 N  NZ    . LYS D 4 52  ? 54.261 101.186 27.729  1.00 77.70  ? 52   LYS B NZ    1 
ATOM   6148 N  N     . LEU D 4 53  ? 50.334 98.759  21.988  1.00 53.69  ? 53   LEU B N     1 
ATOM   6149 C  CA    . LEU D 4 53  ? 50.426 97.356  21.581  1.00 47.34  ? 53   LEU B CA    1 
ATOM   6150 C  C     . LEU D 4 53  ? 49.041 96.715  21.493  1.00 44.45  ? 53   LEU B C     1 
ATOM   6151 O  O     . LEU D 4 53  ? 48.072 97.220  22.063  1.00 38.10  ? 53   LEU B O     1 
ATOM   6152 C  CB    . LEU D 4 53  ? 51.309 96.566  22.570  1.00 43.70  ? 53   LEU B CB    1 
ATOM   6153 C  CG    . LEU D 4 53  ? 51.408 95.034  22.463  1.00 34.35  ? 53   LEU B CG    1 
ATOM   6154 C  CD1   . LEU D 4 53  ? 52.850 94.597  22.382  1.00 43.91  ? 53   LEU B CD1   1 
ATOM   6155 C  CD2   . LEU D 4 53  ? 50.728 94.381  23.654  1.00 33.82  ? 53   LEU B CD2   1 
ATOM   6156 N  N     . THR D 4 54  ? 48.960 95.608  20.756  1.00 35.62  ? 54   THR B N     1 
ATOM   6157 C  CA    . THR D 4 54  ? 47.721 94.858  20.580  1.00 29.37  ? 54   THR B CA    1 
ATOM   6158 C  C     . THR D 4 54  ? 48.028 93.384  20.825  1.00 22.09  ? 54   THR B C     1 
ATOM   6159 O  O     . THR D 4 54  ? 48.999 92.863  20.295  1.00 15.03  ? 54   THR B O     1 
ATOM   6160 C  CB    . THR D 4 54  ? 47.187 94.970  19.144  1.00 32.38  ? 54   THR B CB    1 
ATOM   6161 O  OG1   . THR D 4 54  ? 47.141 96.345  18.739  1.00 38.98  ? 54   THR B OG1   1 
ATOM   6162 C  CG2   . THR D 4 54  ? 45.801 94.358  19.062  1.00 31.43  ? 54   THR B CG2   1 
ATOM   6163 N  N     . VAL D 4 55  ? 47.208 92.727  21.641  1.00 25.05  ? 55   VAL B N     1 
ATOM   6164 C  CA    . VAL D 4 55  ? 47.388 91.309  21.942  1.00 25.64  ? 55   VAL B CA    1 
ATOM   6165 C  C     . VAL D 4 55  ? 46.437 90.466  21.087  1.00 27.72  ? 55   VAL B C     1 
ATOM   6166 O  O     . VAL D 4 55  ? 45.228 90.702  21.061  1.00 32.27  ? 55   VAL B O     1 
ATOM   6167 C  CB    . VAL D 4 55  ? 47.149 91.013  23.449  1.00 27.20  ? 55   VAL B CB    1 
ATOM   6168 C  CG1   . VAL D 4 55  ? 47.363 89.526  23.748  1.00 13.88  ? 55   VAL B CG1   1 
ATOM   6169 C  CG2   . VAL D 4 55  ? 48.092 91.857  24.289  1.00 27.00  ? 55   VAL B CG2   1 
ATOM   6170 N  N     . ALA D 4 56  ? 47.002 89.486  20.388  1.00 28.70  ? 56   ALA B N     1 
ATOM   6171 C  CA    . ALA D 4 56  ? 46.240 88.590  19.519  1.00 28.62  ? 56   ALA B CA    1 
ATOM   6172 C  C     . ALA D 4 56  ? 46.534 87.130  19.860  1.00 29.23  ? 56   ALA B C     1 
ATOM   6173 O  O     . ALA D 4 56  ? 47.628 86.798  20.313  1.00 25.92  ? 56   ALA B O     1 
ATOM   6174 C  CB    . ALA D 4 56  ? 46.582 88.863  18.058  1.00 13.56  ? 56   ALA B CB    1 
ATOM   6175 N  N     . LYS D 4 57  ? 45.549 86.261  19.656  1.00 26.91  ? 57   LYS B N     1 
ATOM   6176 C  CA    . LYS D 4 57  ? 45.724 84.843  19.945  1.00 22.82  ? 57   LYS B CA    1 
ATOM   6177 C  C     . LYS D 4 57  ? 45.287 83.952  18.794  1.00 19.79  ? 57   LYS B C     1 
ATOM   6178 O  O     . LYS D 4 57  ? 44.219 84.145  18.215  1.00 19.67  ? 57   LYS B O     1 
ATOM   6179 C  CB    . LYS D 4 57  ? 44.982 84.454  21.232  1.00 24.61  ? 57   LYS B CB    1 
ATOM   6180 C  CG    . LYS D 4 57  ? 45.503 85.165  22.479  1.00 21.81  ? 57   LYS B CG    1 
ATOM   6181 C  CD    . LYS D 4 57  ? 45.318 84.336  23.731  1.00 22.99  ? 57   LYS B CD    1 
ATOM   6182 C  CE    . LYS D 4 57  ? 43.873 84.067  24.045  1.00 24.48  ? 57   LYS B CE    1 
ATOM   6183 N  NZ    . LYS D 4 57  ? 43.760 83.138  25.208  1.00 16.31  ? 57   LYS B NZ    1 
ATOM   6184 N  N     . LEU D 4 58  ? 46.136 82.983  18.462  1.00 19.27  ? 58   LEU B N     1 
ATOM   6185 C  CA    . LEU D 4 58  ? 45.870 82.036  17.380  1.00 15.91  ? 58   LEU B CA    1 
ATOM   6186 C  C     . LEU D 4 58  ? 46.000 80.600  17.868  1.00 12.41  ? 58   LEU B C     1 
ATOM   6187 O  O     . LEU D 4 58  ? 47.112 80.123  18.144  1.00 13.37  ? 58   LEU B O     1 
ATOM   6188 C  CB    . LEU D 4 58  ? 46.851 82.241  16.217  1.00 20.43  ? 58   LEU B CB    1 
ATOM   6189 C  CG    . LEU D 4 58  ? 46.573 81.335  15.007  1.00 20.98  ? 58   LEU B CG    1 
ATOM   6190 C  CD1   . LEU D 4 58  ? 45.600 82.018  14.044  1.00 17.23  ? 58   LEU B CD1   1 
ATOM   6191 C  CD2   . LEU D 4 58  ? 47.864 81.007  14.300  1.00 20.05  ? 58   LEU B CD2   1 
ATOM   6192 N  N     . ASN D 4 59  ? 44.861 79.914  17.934  1.00 9.68   ? 59   ASN B N     1 
ATOM   6193 C  CA    . ASN D 4 59  ? 44.796 78.521  18.368  1.00 14.43  ? 59   ASN B CA    1 
ATOM   6194 C  C     . ASN D 4 59  ? 45.294 77.626  17.233  1.00 14.71  ? 59   ASN B C     1 
ATOM   6195 O  O     . ASN D 4 59  ? 44.646 77.533  16.192  1.00 21.58  ? 59   ASN B O     1 
ATOM   6196 C  CB    . ASN D 4 59  ? 43.358 78.156  18.731  1.00 15.89  ? 59   ASN B CB    1 
ATOM   6197 C  CG    . ASN D 4 59  ? 43.247 76.765  19.294  1.00 31.14  ? 59   ASN B CG    1 
ATOM   6198 O  OD1   . ASN D 4 59  ? 42.889 75.824  18.590  1.00 34.70  ? 59   ASN B OD1   1 
ATOM   6199 N  ND2   . ASN D 4 59  ? 43.590 76.616  20.562  1.00 32.80  ? 59   ASN B ND2   1 
ATOM   6200 N  N     . ILE D 4 60  ? 46.432 76.962  17.437  1.00 16.68  ? 60   ILE B N     1 
ATOM   6201 C  CA    . ILE D 4 60  ? 47.016 76.106  16.400  1.00 16.01  ? 60   ILE B CA    1 
ATOM   6202 C  C     . ILE D 4 60  ? 46.209 74.894  15.945  1.00 23.72  ? 60   ILE B C     1 
ATOM   6203 O  O     . ILE D 4 60  ? 46.536 74.282  14.922  1.00 25.68  ? 60   ILE B O     1 
ATOM   6204 C  CB    . ILE D 4 60  ? 48.458 75.666  16.759  1.00 17.24  ? 60   ILE B CB    1 
ATOM   6205 C  CG1   . ILE D 4 60  ? 48.487 74.815  18.035  1.00 16.26  ? 60   ILE B CG1   1 
ATOM   6206 C  CG2   . ILE D 4 60  ? 49.332 76.892  16.918  1.00 19.24  ? 60   ILE B CG2   1 
ATOM   6207 C  CD1   . ILE D 4 60  ? 49.888 74.350  18.419  1.00 13.68  ? 60   ILE B CD1   1 
ATOM   6208 N  N     . ASP D 4 61  ? 45.163 74.549  16.694  1.00 25.58  ? 61   ASP B N     1 
ATOM   6209 C  CA    . ASP D 4 61  ? 44.311 73.417  16.338  1.00 24.52  ? 61   ASP B CA    1 
ATOM   6210 C  C     . ASP D 4 61  ? 43.225 73.815  15.350  1.00 23.07  ? 61   ASP B C     1 
ATOM   6211 O  O     . ASP D 4 61  ? 42.983 73.109  14.377  1.00 26.05  ? 61   ASP B O     1 
ATOM   6212 C  CB    . ASP D 4 61  ? 43.680 72.792  17.584  1.00 25.22  ? 61   ASP B CB    1 
ATOM   6213 C  CG    . ASP D 4 61  ? 44.636 71.866  18.336  1.00 28.62  ? 61   ASP B CG    1 
ATOM   6214 O  OD1   . ASP D 4 61  ? 45.829 71.793  17.984  1.00 30.82  ? 61   ASP B OD1   1 
ATOM   6215 O  OD2   . ASP D 4 61  ? 44.188 71.200  19.290  1.00 27.39  ? 61   ASP B OD2   1 
ATOM   6216 N  N     . GLN D 4 62  ? 42.571 74.941  15.611  1.00 24.70  ? 62   GLN B N     1 
ATOM   6217 C  CA    . GLN D 4 62  ? 41.510 75.443  14.741  1.00 25.67  ? 62   GLN B CA    1 
ATOM   6218 C  C     . GLN D 4 62  ? 42.120 76.114  13.517  1.00 26.45  ? 62   GLN B C     1 
ATOM   6219 O  O     . GLN D 4 62  ? 41.501 76.170  12.450  1.00 32.78  ? 62   GLN B O     1 
ATOM   6220 C  CB    . GLN D 4 62  ? 40.654 76.457  15.493  1.00 32.19  ? 62   GLN B CB    1 
ATOM   6221 C  CG    . GLN D 4 62  ? 40.039 75.904  16.759  1.00 45.23  ? 62   GLN B CG    1 
ATOM   6222 C  CD    . GLN D 4 62  ? 39.332 76.958  17.591  1.00 51.61  ? 62   GLN B CD    1 
ATOM   6223 O  OE1   . GLN D 4 62  ? 39.429 78.161  17.324  1.00 55.53  ? 62   GLN B OE1   1 
ATOM   6224 N  NE2   . GLN D 4 62  ? 38.628 76.508  18.622  1.00 49.14  ? 62   GLN B NE2   1 
ATOM   6225 N  N     . ASN D 4 63  ? 43.346 76.608  13.680  1.00 18.94  ? 63   ASN B N     1 
ATOM   6226 C  CA    . ASN D 4 63  ? 44.061 77.295  12.612  1.00 18.86  ? 63   ASN B CA    1 
ATOM   6227 C  C     . ASN D 4 63  ? 45.441 76.672  12.463  1.00 20.45  ? 63   ASN B C     1 
ATOM   6228 O  O     . ASN D 4 63  ? 46.406 77.187  13.011  1.00 19.81  ? 63   ASN B O     1 
ATOM   6229 C  CB    . ASN D 4 63  ? 44.192 78.784  12.956  1.00 14.82  ? 63   ASN B CB    1 
ATOM   6230 C  CG    . ASN D 4 63  ? 42.865 79.412  13.312  1.00 19.35  ? 63   ASN B CG    1 
ATOM   6231 O  OD1   . ASN D 4 63  ? 42.005 79.598  12.454  1.00 26.61  ? 63   ASN B OD1   1 
ATOM   6232 N  ND2   . ASN D 4 63  ? 42.684 79.726  14.586  1.00 25.48  ? 63   ASN B ND2   1 
ATOM   6233 N  N     . PRO D 4 64  ? 45.551 75.561  11.705  1.00 23.64  ? 64   PRO B N     1 
ATOM   6234 C  CA    . PRO D 4 64  ? 46.805 74.832  11.466  1.00 23.07  ? 64   PRO B CA    1 
ATOM   6235 C  C     . PRO D 4 64  ? 47.799 75.333  10.410  1.00 19.55  ? 64   PRO B C     1 
ATOM   6236 O  O     . PRO D 4 64  ? 48.918 74.813  10.322  1.00 22.49  ? 64   PRO B O     1 
ATOM   6237 C  CB    . PRO D 4 64  ? 46.304 73.434  11.128  1.00 30.58  ? 64   PRO B CB    1 
ATOM   6238 C  CG    . PRO D 4 64  ? 45.099 73.737  10.301  1.00 33.07  ? 64   PRO B CG    1 
ATOM   6239 C  CD    . PRO D 4 64  ? 44.412 74.822  11.120  1.00 30.45  ? 64   PRO B CD    1 
ATOM   6240 N  N     . GLY D 4 65  ? 47.426 76.351  9.645   1.00 22.34  ? 65   GLY B N     1 
ATOM   6241 C  CA    . GLY D 4 65  ? 48.316 76.842  8.605   1.00 22.65  ? 65   GLY B CA    1 
ATOM   6242 C  C     . GLY D 4 65  ? 49.364 77.889  8.936   1.00 23.58  ? 65   GLY B C     1 
ATOM   6243 O  O     . GLY D 4 65  ? 50.414 77.931  8.287   1.00 20.65  ? 65   GLY B O     1 
ATOM   6244 N  N     . THR D 4 66  ? 49.104 78.714  9.945   1.00 21.18  ? 66   THR B N     1 
ATOM   6245 C  CA    . THR D 4 66  ? 50.032 79.780  10.321  1.00 21.69  ? 66   THR B CA    1 
ATOM   6246 C  C     . THR D 4 66  ? 51.297 79.411  11.097  1.00 20.90  ? 66   THR B C     1 
ATOM   6247 O  O     . THR D 4 66  ? 52.384 79.872  10.757  1.00 26.27  ? 66   THR B O     1 
ATOM   6248 C  CB    . THR D 4 66  ? 49.297 80.876  11.101  1.00 11.63  ? 66   THR B CB    1 
ATOM   6249 O  OG1   . THR D 4 66  ? 48.108 81.241  10.392  1.00 15.78  ? 66   THR B OG1   1 
ATOM   6250 C  CG2   . THR D 4 66  ? 50.186 82.099  11.265  1.00 7.17   ? 66   THR B CG2   1 
ATOM   6251 N  N     . ALA D 4 67  ? 51.151 78.598  12.141  1.00 22.91  ? 67   ALA B N     1 
ATOM   6252 C  CA    . ALA D 4 67  ? 52.280 78.190  12.984  1.00 24.05  ? 67   ALA B CA    1 
ATOM   6253 C  C     . ALA D 4 67  ? 53.506 77.606  12.275  1.00 22.05  ? 67   ALA B C     1 
ATOM   6254 O  O     . ALA D 4 67  ? 54.630 78.020  12.569  1.00 21.02  ? 67   ALA B O     1 
ATOM   6255 C  CB    . ALA D 4 67  ? 51.807 77.250  14.094  1.00 20.67  ? 67   ALA B CB    1 
ATOM   6256 N  N     . PRO D 4 68  ? 53.317 76.639  11.344  1.00 21.75  ? 68   PRO B N     1 
ATOM   6257 C  CA    . PRO D 4 68  ? 54.449 76.037  10.621  1.00 17.11  ? 68   PRO B CA    1 
ATOM   6258 C  C     . PRO D 4 68  ? 55.350 77.064  9.921   1.00 19.97  ? 68   PRO B C     1 
ATOM   6259 O  O     . PRO D 4 68  ? 56.570 76.903  9.877   1.00 22.03  ? 68   PRO B O     1 
ATOM   6260 C  CB    . PRO D 4 68  ? 53.754 75.123  9.620   1.00 21.04  ? 68   PRO B CB    1 
ATOM   6261 C  CG    . PRO D 4 68  ? 52.548 74.675  10.374  1.00 25.22  ? 68   PRO B CG    1 
ATOM   6262 C  CD    . PRO D 4 68  ? 52.057 75.985  10.941  1.00 20.97  ? 68   PRO B CD    1 
ATOM   6263 N  N     . LYS D 4 69  ? 54.744 78.131  9.401   1.00 25.70  ? 69   LYS B N     1 
ATOM   6264 C  CA    . LYS D 4 69  ? 55.478 79.193  8.710   1.00 29.04  ? 69   LYS B CA    1 
ATOM   6265 C  C     . LYS D 4 69  ? 56.468 79.916  9.620   1.00 31.56  ? 69   LYS B C     1 
ATOM   6266 O  O     . LYS D 4 69  ? 57.396 80.565  9.140   1.00 32.96  ? 69   LYS B O     1 
ATOM   6267 C  CB    . LYS D 4 69  ? 54.505 80.221  8.123   1.00 35.00  ? 69   LYS B CB    1 
ATOM   6268 C  CG    . LYS D 4 69  ? 53.658 79.726  6.959   1.00 29.50  ? 69   LYS B CG    1 
ATOM   6269 C  CD    . LYS D 4 69  ? 52.713 80.822  6.487   1.00 34.27  ? 69   LYS B CD    1 
ATOM   6270 C  CE    . LYS D 4 69  ? 51.974 80.411  5.235   1.00 35.37  ? 69   LYS B CE    1 
ATOM   6271 N  NZ    . LYS D 4 69  ? 50.509 80.534  5.415   1.00 41.93  ? 69   LYS B NZ    1 
ATOM   6272 N  N     . TYR D 4 70  ? 56.258 79.821  10.932  1.00 33.97  ? 70   TYR B N     1 
ATOM   6273 C  CA    . TYR D 4 70  ? 57.138 80.473  11.896  1.00 30.50  ? 70   TYR B CA    1 
ATOM   6274 C  C     . TYR D 4 70  ? 58.006 79.503  12.686  1.00 30.31  ? 70   TYR B C     1 
ATOM   6275 O  O     . TYR D 4 70  ? 58.633 79.884  13.675  1.00 32.64  ? 70   TYR B O     1 
ATOM   6276 C  CB    . TYR D 4 70  ? 56.321 81.383  12.818  1.00 28.91  ? 70   TYR B CB    1 
ATOM   6277 C  CG    . TYR D 4 70  ? 55.706 82.545  12.063  1.00 32.12  ? 70   TYR B CG    1 
ATOM   6278 C  CD1   . TYR D 4 70  ? 56.511 83.569  11.549  1.00 32.33  ? 70   TYR B CD1   1 
ATOM   6279 C  CD2   . TYR D 4 70  ? 54.330 82.598  11.814  1.00 27.64  ? 70   TYR B CD2   1 
ATOM   6280 C  CE1   . TYR D 4 70  ? 55.966 84.617  10.801  1.00 32.37  ? 70   TYR B CE1   1 
ATOM   6281 C  CE2   . TYR D 4 70  ? 53.773 83.643  11.066  1.00 32.37  ? 70   TYR B CE2   1 
ATOM   6282 C  CZ    . TYR D 4 70  ? 54.601 84.648  10.561  1.00 30.80  ? 70   TYR B CZ    1 
ATOM   6283 O  OH    . TYR D 4 70  ? 54.069 85.674  9.812   1.00 30.11  ? 70   TYR B OH    1 
ATOM   6284 N  N     . GLY D 4 71  ? 58.038 78.252  12.228  1.00 25.97  ? 71   GLY B N     1 
ATOM   6285 C  CA    . GLY D 4 71  ? 58.842 77.219  12.861  1.00 26.91  ? 71   GLY B CA    1 
ATOM   6286 C  C     . GLY D 4 71  ? 58.593 77.015  14.340  1.00 28.83  ? 71   GLY B C     1 
ATOM   6287 O  O     . GLY D 4 71  ? 59.520 77.091  15.145  1.00 35.27  ? 71   GLY B O     1 
ATOM   6288 N  N     . ILE D 4 72  ? 57.337 76.761  14.689  1.00 34.77  ? 72   ILE B N     1 
ATOM   6289 C  CA    . ILE D 4 72  ? 56.930 76.535  16.071  1.00 31.83  ? 72   ILE B CA    1 
ATOM   6290 C  C     . ILE D 4 72  ? 57.422 75.168  16.562  1.00 31.91  ? 72   ILE B C     1 
ATOM   6291 O  O     . ILE D 4 72  ? 57.079 74.129  15.995  1.00 30.68  ? 72   ILE B O     1 
ATOM   6292 C  CB    . ILE D 4 72  ? 55.388 76.632  16.190  1.00 28.42  ? 72   ILE B CB    1 
ATOM   6293 C  CG1   . ILE D 4 72  ? 54.937 78.031  15.756  1.00 27.45  ? 72   ILE B CG1   1 
ATOM   6294 C  CG2   . ILE D 4 72  ? 54.914 76.294  17.603  1.00 24.33  ? 72   ILE B CG2   1 
ATOM   6295 C  CD1   . ILE D 4 72  ? 55.593 79.165  16.502  1.00 16.49  ? 72   ILE B CD1   1 
ATOM   6296 N  N     . ARG D 4 73  ? 58.243 75.183  17.607  1.00 28.20  ? 73   ARG B N     1 
ATOM   6297 C  CA    . ARG D 4 73  ? 58.780 73.954  18.169  1.00 39.52  ? 73   ARG B CA    1 
ATOM   6298 C  C     . ARG D 4 73  ? 58.344 73.812  19.640  1.00 33.63  ? 73   ARG B C     1 
ATOM   6299 O  O     . ARG D 4 73  ? 58.700 72.846  20.314  1.00 51.78  ? 73   ARG B O     1 
ATOM   6300 C  CB    . ARG D 4 73  ? 60.309 73.955  18.014  1.00 67.76  ? 73   ARG B CB    1 
ATOM   6301 C  CG    . ARG D 4 73  ? 60.968 72.576  17.838  1.00 92.42  ? 73   ARG B CG    1 
ATOM   6302 C  CD    . ARG D 4 73  ? 61.197 71.857  19.163  1.00 99.05  ? 73   ARG B CD    1 
ATOM   6303 N  NE    . ARG D 4 73  ? 62.001 72.673  20.073  1.00 99.63  ? 73   ARG B NE    1 
ATOM   6304 C  CZ    . ARG D 4 73  ? 62.085 72.492  21.390  1.00 99.29  ? 73   ARG B CZ    1 
ATOM   6305 N  NH1   . ARG D 4 73  ? 61.414 71.515  21.989  1.00 94.11  ? 73   ARG B NH1   1 
ATOM   6306 N  NH2   . ARG D 4 73  ? 62.842 73.306  22.113  1.00 95.10  ? 73   ARG B NH2   1 
ATOM   6307 N  N     . GLY D 4 74  ? 57.531 74.758  20.113  1.00 29.20  ? 74   GLY B N     1 
ATOM   6308 C  CA    . GLY D 4 74  ? 57.046 74.726  21.487  1.00 17.55  ? 74   GLY B CA    1 
ATOM   6309 C  C     . GLY D 4 74  ? 55.953 75.754  21.742  1.00 22.09  ? 74   GLY B C     1 
ATOM   6310 O  O     . GLY D 4 74  ? 55.916 76.794  21.086  1.00 18.85  ? 74   GLY B O     1 
ATOM   6311 N  N     . ILE D 4 75  ? 55.057 75.471  22.686  1.00 17.48  ? 75   ILE B N     1 
ATOM   6312 C  CA    . ILE D 4 75  ? 53.968 76.391  23.013  1.00 18.00  ? 75   ILE B CA    1 
ATOM   6313 C  C     . ILE D 4 75  ? 53.844 76.631  24.525  1.00 19.62  ? 75   ILE B C     1 
ATOM   6314 O  O     . ILE D 4 75  ? 54.213 75.776  25.321  1.00 20.38  ? 75   ILE B O     1 
ATOM   6315 C  CB    . ILE D 4 75  ? 52.600 75.887  22.450  1.00 17.42  ? 75   ILE B CB    1 
ATOM   6316 C  CG1   . ILE D 4 75  ? 52.343 74.439  22.874  1.00 16.29  ? 75   ILE B CG1   1 
ATOM   6317 C  CG2   . ILE D 4 75  ? 52.566 76.041  20.927  1.00 22.97  ? 75   ILE B CG2   1 
ATOM   6318 C  CD1   . ILE D 4 75  ? 50.967 73.915  22.501  1.00 11.79  ? 75   ILE B CD1   1 
ATOM   6319 N  N     . PRO D 4 76  ? 53.367 77.822  24.938  1.00 22.30  ? 76   PRO B N     1 
ATOM   6320 C  CA    . PRO D 4 76  ? 52.944 78.945  24.093  1.00 18.14  ? 76   PRO B CA    1 
ATOM   6321 C  C     . PRO D 4 76  ? 54.107 79.726  23.474  1.00 15.44  ? 76   PRO B C     1 
ATOM   6322 O  O     . PRO D 4 76  ? 55.147 79.915  24.105  1.00 17.23  ? 76   PRO B O     1 
ATOM   6323 C  CB    . PRO D 4 76  ? 52.140 79.806  25.068  1.00 22.32  ? 76   PRO B CB    1 
ATOM   6324 C  CG    . PRO D 4 76  ? 52.891 79.606  26.357  1.00 21.90  ? 76   PRO B CG    1 
ATOM   6325 C  CD    . PRO D 4 76  ? 53.065 78.107  26.355  1.00 22.67  ? 76   PRO B CD    1 
ATOM   6326 N  N     . THR D 4 77  ? 53.938 80.143  22.221  1.00 11.31  ? 77   THR B N     1 
ATOM   6327 C  CA    . THR D 4 77  ? 54.958 80.921  21.531  1.00 11.66  ? 77   THR B CA    1 
ATOM   6328 C  C     . THR D 4 77  ? 54.455 82.350  21.421  1.00 14.04  ? 77   THR B C     1 
ATOM   6329 O  O     . THR D 4 77  ? 53.392 82.601  20.854  1.00 21.16  ? 77   THR B O     1 
ATOM   6330 C  CB    . THR D 4 77  ? 55.249 80.370  20.123  1.00 9.40   ? 77   THR B CB    1 
ATOM   6331 O  OG1   . THR D 4 77  ? 55.793 79.062  20.243  1.00 13.95  ? 77   THR B OG1   1 
ATOM   6332 C  CG2   . THR D 4 77  ? 56.262 81.228  19.401  1.00 18.68  ? 77   THR B CG2   1 
ATOM   6333 N  N     . LEU D 4 78  ? 55.206 83.277  22.001  1.00 21.13  ? 78   LEU B N     1 
ATOM   6334 C  CA    . LEU D 4 78  ? 54.847 84.687  21.974  1.00 20.66  ? 78   LEU B CA    1 
ATOM   6335 C  C     . LEU D 4 78  ? 55.701 85.392  20.936  1.00 26.73  ? 78   LEU B C     1 
ATOM   6336 O  O     . LEU D 4 78  ? 56.906 85.558  21.125  1.00 24.15  ? 78   LEU B O     1 
ATOM   6337 C  CB    . LEU D 4 78  ? 55.081 85.332  23.342  1.00 23.57  ? 78   LEU B CB    1 
ATOM   6338 C  CG    . LEU D 4 78  ? 54.454 84.696  24.583  1.00 26.55  ? 78   LEU B CG    1 
ATOM   6339 C  CD1   . LEU D 4 78  ? 54.792 85.565  25.774  1.00 24.91  ? 78   LEU B CD1   1 
ATOM   6340 C  CD2   . LEU D 4 78  ? 52.948 84.551  24.429  1.00 20.80  ? 78   LEU B CD2   1 
ATOM   6341 N  N     . LEU D 4 79  ? 55.077 85.765  19.824  1.00 28.70  ? 79   LEU B N     1 
ATOM   6342 C  CA    . LEU D 4 79  ? 55.756 86.463  18.740  1.00 24.67  ? 79   LEU B CA    1 
ATOM   6343 C  C     . LEU D 4 79  ? 55.304 87.912  18.687  1.00 27.97  ? 79   LEU B C     1 
ATOM   6344 O  O     . LEU D 4 79  ? 54.119 88.189  18.508  1.00 34.79  ? 79   LEU B O     1 
ATOM   6345 C  CB    . LEU D 4 79  ? 55.449 85.785  17.406  1.00 26.65  ? 79   LEU B CB    1 
ATOM   6346 C  CG    . LEU D 4 79  ? 56.506 84.875  16.781  1.00 30.52  ? 79   LEU B CG    1 
ATOM   6347 C  CD1   . LEU D 4 79  ? 57.044 83.909  17.792  1.00 27.72  ? 79   LEU B CD1   1 
ATOM   6348 C  CD2   . LEU D 4 79  ? 55.906 84.138  15.599  1.00 22.67  ? 79   LEU B CD2   1 
ATOM   6349 N  N     . LEU D 4 80  ? 56.243 88.835  18.867  1.00 24.95  ? 80   LEU B N     1 
ATOM   6350 C  CA    . LEU D 4 80  ? 55.934 90.263  18.831  1.00 33.61  ? 80   LEU B CA    1 
ATOM   6351 C  C     . LEU D 4 80  ? 56.184 90.820  17.419  1.00 32.17  ? 80   LEU B C     1 
ATOM   6352 O  O     . LEU D 4 80  ? 57.327 91.000  17.001  1.00 37.38  ? 80   LEU B O     1 
ATOM   6353 C  CB    . LEU D 4 80  ? 56.767 91.003  19.889  1.00 30.93  ? 80   LEU B CB    1 
ATOM   6354 C  CG    . LEU D 4 80  ? 56.431 92.451  20.278  1.00 43.86  ? 80   LEU B CG    1 
ATOM   6355 C  CD1   . LEU D 4 80  ? 57.070 92.775  21.626  1.00 44.79  ? 80   LEU B CD1   1 
ATOM   6356 C  CD2   . LEU D 4 80  ? 56.896 93.440  19.214  1.00 38.91  ? 80   LEU B CD2   1 
ATOM   6357 N  N     . PHE D 4 81  ? 55.097 91.040  16.682  1.00 36.44  ? 81   PHE B N     1 
ATOM   6358 C  CA    . PHE D 4 81  ? 55.144 91.573  15.317  1.00 36.47  ? 81   PHE B CA    1 
ATOM   6359 C  C     . PHE D 4 81  ? 55.150 93.095  15.248  1.00 39.26  ? 81   PHE B C     1 
ATOM   6360 O  O     . PHE D 4 81  ? 54.363 93.769  15.918  1.00 31.78  ? 81   PHE B O     1 
ATOM   6361 C  CB    . PHE D 4 81  ? 53.956 91.066  14.495  1.00 31.90  ? 81   PHE B CB    1 
ATOM   6362 C  CG    . PHE D 4 81  ? 54.053 89.622  14.092  1.00 29.70  ? 81   PHE B CG    1 
ATOM   6363 C  CD1   . PHE D 4 81  ? 53.641 88.611  14.959  1.00 24.40  ? 81   PHE B CD1   1 
ATOM   6364 C  CD2   . PHE D 4 81  ? 54.530 89.274  12.831  1.00 20.57  ? 81   PHE B CD2   1 
ATOM   6365 C  CE1   . PHE D 4 81  ? 53.688 87.271  14.572  1.00 25.87  ? 81   PHE B CE1   1 
ATOM   6366 C  CE2   . PHE D 4 81  ? 54.584 87.940  12.430  1.00 24.37  ? 81   PHE B CE2   1 
ATOM   6367 C  CZ    . PHE D 4 81  ? 54.164 86.933  13.305  1.00 26.17  ? 81   PHE B CZ    1 
ATOM   6368 N  N     . LYS D 4 82  ? 56.016 93.617  14.386  1.00 42.08  ? 82   LYS B N     1 
ATOM   6369 C  CA    . LYS D 4 82  ? 56.157 95.052  14.179  1.00 49.51  ? 82   LYS B CA    1 
ATOM   6370 C  C     . LYS D 4 82  ? 56.264 95.265  12.670  1.00 50.51  ? 82   LYS B C     1 
ATOM   6371 O  O     . LYS D 4 82  ? 57.321 95.050  12.073  1.00 51.12  ? 82   LYS B O     1 
ATOM   6372 C  CB    . LYS D 4 82  ? 57.408 95.572  14.898  1.00 58.46  ? 82   LYS B CB    1 
ATOM   6373 C  CG    . LYS D 4 82  ? 57.472 97.085  15.045  1.00 66.77  ? 82   LYS B CG    1 
ATOM   6374 C  CD    . LYS D 4 82  ? 56.311 97.609  15.887  1.00 74.49  ? 82   LYS B CD    1 
ATOM   6375 C  CE    . LYS D 4 82  ? 56.339 99.128  16.020  1.00 70.71  ? 82   LYS B CE    1 
ATOM   6376 N  NZ    . LYS D 4 82  ? 56.219 99.817  14.705  1.00 64.60  ? 82   LYS B NZ    1 
ATOM   6377 N  N     . ASN D 4 83  ? 55.138 95.649  12.067  1.00 63.10  ? 83   ASN B N     1 
ATOM   6378 C  CA    . ASN D 4 83  ? 55.026 95.895  10.628  1.00 67.10  ? 83   ASN B CA    1 
ATOM   6379 C  C     . ASN D 4 83  ? 55.321 94.665  9.761   1.00 65.75  ? 83   ASN B C     1 
ATOM   6380 O  O     . ASN D 4 83  ? 56.179 94.705  8.871   1.00 64.14  ? 83   ASN B O     1 
ATOM   6381 C  CB    . ASN D 4 83  ? 55.902 97.084  10.206  1.00 67.71  ? 83   ASN B CB    1 
ATOM   6382 C  CG    . ASN D 4 83  ? 55.366 98.410  10.712  1.00 75.45  ? 83   ASN B CG    1 
ATOM   6383 O  OD1   . ASN D 4 83  ? 55.485 98.732  11.894  1.00 72.51  ? 83   ASN B OD1   1 
ATOM   6384 N  ND2   . ASN D 4 83  ? 54.763 99.182  9.817   1.00 77.66  ? 83   ASN B ND2   1 
ATOM   6385 N  N     . GLY D 4 84  ? 54.598 93.577  10.039  1.00 51.81  ? 84   GLY B N     1 
ATOM   6386 C  CA    . GLY D 4 84  ? 54.756 92.336  9.295   1.00 42.63  ? 84   GLY B CA    1 
ATOM   6387 C  C     . GLY D 4 84  ? 56.052 91.566  9.490   1.00 39.76  ? 84   GLY B C     1 
ATOM   6388 O  O     . GLY D 4 84  ? 56.264 90.529  8.851   1.00 29.05  ? 84   GLY B O     1 
ATOM   6389 N  N     . GLU D 4 85  ? 56.914 92.074  10.367  1.00 46.86  ? 85   GLU B N     1 
ATOM   6390 C  CA    . GLU D 4 85  ? 58.204 91.455  10.659  1.00 57.15  ? 85   GLU B CA    1 
ATOM   6391 C  C     . GLU D 4 85  ? 58.211 90.992  12.109  1.00 56.20  ? 85   GLU B C     1 
ATOM   6392 O  O     . GLU D 4 85  ? 57.647 91.660  12.978  1.00 66.46  ? 85   GLU B O     1 
ATOM   6393 C  CB    . GLU D 4 85  ? 59.327 92.481  10.482  1.00 69.97  ? 85   GLU B CB    1 
ATOM   6394 C  CG    . GLU D 4 85  ? 59.294 93.257  9.171   1.00 88.73  ? 85   GLU B CG    1 
ATOM   6395 C  CD    . GLU D 4 85  ? 60.136 94.531  9.206   1.00 96.23  ? 85   GLU B CD    1 
ATOM   6396 O  OE1   . GLU D 4 85  ? 60.311 95.118  10.301  1.00 93.63  ? 85   GLU B OE1   1 
ATOM   6397 O  OE2   . GLU D 4 85  ? 60.611 94.954  8.129   1.00 96.70  ? 85   GLU B OE2   1 
ATOM   6398 N  N     . VAL D 4 86  ? 58.825 89.842  12.368  1.00 49.18  ? 86   VAL B N     1 
ATOM   6399 C  CA    . VAL D 4 86  ? 58.915 89.336  13.734  1.00 43.87  ? 86   VAL B CA    1 
ATOM   6400 C  C     . VAL D 4 86  ? 60.029 90.128  14.432  1.00 42.83  ? 86   VAL B C     1 
ATOM   6401 O  O     . VAL D 4 86  ? 61.207 90.016  14.071  1.00 36.11  ? 86   VAL B O     1 
ATOM   6402 C  CB    . VAL D 4 86  ? 59.246 87.821  13.769  1.00 37.39  ? 86   VAL B CB    1 
ATOM   6403 C  CG1   . VAL D 4 86  ? 59.393 87.343  15.212  1.00 30.46  ? 86   VAL B CG1   1 
ATOM   6404 C  CG2   . VAL D 4 86  ? 58.151 87.036  13.080  1.00 34.44  ? 86   VAL B CG2   1 
ATOM   6405 N  N     . ALA D 4 87  ? 59.641 90.952  15.403  1.00 36.61  ? 87   ALA B N     1 
ATOM   6406 C  CA    . ALA D 4 87  ? 60.586 91.773  16.148  1.00 34.64  ? 87   ALA B CA    1 
ATOM   6407 C  C     . ALA D 4 87  ? 61.267 91.018  17.293  1.00 38.53  ? 87   ALA B C     1 
ATOM   6408 O  O     . ALA D 4 87  ? 62.454 91.221  17.557  1.00 45.90  ? 87   ALA B O     1 
ATOM   6409 C  CB    . ALA D 4 87  ? 59.886 93.021  16.676  1.00 28.19  ? 87   ALA B CB    1 
ATOM   6410 N  N     . ALA D 4 88  ? 60.515 90.146  17.962  1.00 38.29  ? 88   ALA B N     1 
ATOM   6411 C  CA    . ALA D 4 88  ? 61.037 89.365  19.082  1.00 35.77  ? 88   ALA B CA    1 
ATOM   6412 C  C     . ALA D 4 88  ? 60.194 88.116  19.301  1.00 35.54  ? 88   ALA B C     1 
ATOM   6413 O  O     . ALA D 4 88  ? 58.978 88.143  19.128  1.00 41.27  ? 88   ALA B O     1 
ATOM   6414 C  CB    . ALA D 4 88  ? 61.046 90.212  20.353  1.00 38.69  ? 88   ALA B CB    1 
ATOM   6415 N  N     . THR D 4 89  ? 60.846 87.015  19.656  1.00 30.44  ? 89   THR B N     1 
ATOM   6416 C  CA    . THR D 4 89  ? 60.140 85.763  19.906  1.00 33.56  ? 89   THR B CA    1 
ATOM   6417 C  C     . THR D 4 89  ? 60.504 85.234  21.297  1.00 29.03  ? 89   THR B C     1 
ATOM   6418 O  O     . THR D 4 89  ? 61.662 85.288  21.713  1.00 31.83  ? 89   THR B O     1 
ATOM   6419 C  CB    . THR D 4 89  ? 60.401 84.692  18.767  1.00 37.12  ? 89   THR B CB    1 
ATOM   6420 O  OG1   . THR D 4 89  ? 60.968 83.496  19.319  1.00 49.41  ? 89   THR B OG1   1 
ATOM   6421 C  CG2   . THR D 4 89  ? 61.323 85.247  17.672  1.00 46.23  ? 89   THR B CG2   1 
ATOM   6422 N  N     . LYS D 4 90  ? 59.503 84.739  22.014  1.00 36.26  ? 90   LYS B N     1 
ATOM   6423 C  CA    . LYS D 4 90  ? 59.710 84.215  23.359  1.00 41.04  ? 90   LYS B CA    1 
ATOM   6424 C  C     . LYS D 4 90  ? 58.785 83.019  23.623  1.00 41.44  ? 90   LYS B C     1 
ATOM   6425 O  O     . LYS D 4 90  ? 57.565 83.149  23.540  1.00 41.73  ? 90   LYS B O     1 
ATOM   6426 C  CB    . LYS D 4 90  ? 59.444 85.335  24.370  1.00 43.14  ? 90   LYS B CB    1 
ATOM   6427 C  CG    . LYS D 4 90  ? 59.929 85.058  25.773  1.00 47.56  ? 90   LYS B CG    1 
ATOM   6428 C  CD    . LYS D 4 90  ? 61.449 85.008  25.858  1.00 49.68  ? 90   LYS B CD    1 
ATOM   6429 C  CE    . LYS D 4 90  ? 62.091 86.360  25.599  1.00 49.60  ? 90   LYS B CE    1 
ATOM   6430 N  NZ    . LYS D 4 90  ? 63.561 86.314  25.841  1.00 45.00  ? 90   LYS B NZ    1 
ATOM   6431 N  N     . VAL D 4 91  ? 59.369 81.862  23.940  1.00 40.42  ? 91   VAL B N     1 
ATOM   6432 C  CA    . VAL D 4 91  ? 58.596 80.644  24.205  1.00 33.19  ? 91   VAL B CA    1 
ATOM   6433 C  C     . VAL D 4 91  ? 58.502 80.270  25.691  1.00 33.69  ? 91   VAL B C     1 
ATOM   6434 O  O     . VAL D 4 91  ? 59.515 80.200  26.402  1.00 28.08  ? 91   VAL B O     1 
ATOM   6435 C  CB    . VAL D 4 91  ? 59.173 79.422  23.423  1.00 30.47  ? 91   VAL B CB    1 
ATOM   6436 C  CG1   . VAL D 4 91  ? 58.262 78.197  23.586  1.00 20.92  ? 91   VAL B CG1   1 
ATOM   6437 C  CG2   . VAL D 4 91  ? 59.349 79.772  21.952  1.00 26.88  ? 91   VAL B CG2   1 
ATOM   6438 N  N     . GLY D 4 92  ? 57.274 80.016  26.143  1.00 25.38  ? 92   GLY B N     1 
ATOM   6439 C  CA    . GLY D 4 92  ? 57.040 79.644  27.525  1.00 24.51  ? 92   GLY B CA    1 
ATOM   6440 C  C     . GLY D 4 92  ? 55.984 80.486  28.210  1.00 25.98  ? 92   GLY B C     1 
ATOM   6441 O  O     . GLY D 4 92  ? 55.593 81.543  27.708  1.00 36.45  ? 92   GLY B O     1 
ATOM   6442 N  N     . ALA D 4 93  ? 55.524 80.015  29.367  1.00 24.50  ? 93   ALA B N     1 
ATOM   6443 C  CA    . ALA D 4 93  ? 54.515 80.709  30.154  1.00 26.85  ? 93   ALA B CA    1 
ATOM   6444 C  C     . ALA D 4 93  ? 55.191 81.659  31.135  1.00 29.96  ? 93   ALA B C     1 
ATOM   6445 O  O     . ALA D 4 93  ? 55.371 81.331  32.307  1.00 30.07  ? 93   ALA B O     1 
ATOM   6446 C  CB    . ALA D 4 93  ? 53.649 79.709  30.902  1.00 25.39  ? 93   ALA B CB    1 
ATOM   6447 N  N     . LEU D 4 94  ? 55.569 82.835  30.643  1.00 36.07  ? 94   LEU B N     1 
ATOM   6448 C  CA    . LEU D 4 94  ? 56.228 83.843  31.467  1.00 35.58  ? 94   LEU B CA    1 
ATOM   6449 C  C     . LEU D 4 94  ? 55.251 84.362  32.516  1.00 37.63  ? 94   LEU B C     1 
ATOM   6450 O  O     . LEU D 4 94  ? 54.057 84.044  32.485  1.00 36.17  ? 94   LEU B O     1 
ATOM   6451 C  CB    . LEU D 4 94  ? 56.691 85.027  30.612  1.00 33.72  ? 94   LEU B CB    1 
ATOM   6452 C  CG    . LEU D 4 94  ? 57.367 84.818  29.258  1.00 28.63  ? 94   LEU B CG    1 
ATOM   6453 C  CD1   . LEU D 4 94  ? 57.816 86.168  28.730  1.00 26.52  ? 94   LEU B CD1   1 
ATOM   6454 C  CD2   . LEU D 4 94  ? 58.544 83.886  29.374  1.00 27.15  ? 94   LEU B CD2   1 
ATOM   6455 N  N     . SER D 4 95  ? 55.767 85.158  33.446  1.00 38.10  ? 95   SER B N     1 
ATOM   6456 C  CA    . SER D 4 95  ? 54.948 85.741  34.500  1.00 37.39  ? 95   SER B CA    1 
ATOM   6457 C  C     . SER D 4 95  ? 54.576 87.159  34.081  1.00 37.67  ? 95   SER B C     1 
ATOM   6458 O  O     . SER D 4 95  ? 55.110 87.690  33.100  1.00 28.97  ? 95   SER B O     1 
ATOM   6459 C  CB    . SER D 4 95  ? 55.721 85.777  35.818  1.00 30.05  ? 95   SER B CB    1 
ATOM   6460 O  OG    . SER D 4 95  ? 56.877 86.589  35.705  1.00 29.90  ? 95   SER B OG    1 
ATOM   6461 N  N     . LYS D 4 96  ? 53.676 87.772  34.842  1.00 37.97  ? 96   LYS B N     1 
ATOM   6462 C  CA    . LYS D 4 96  ? 53.218 89.132  34.574  1.00 35.95  ? 96   LYS B CA    1 
ATOM   6463 C  C     . LYS D 4 96  ? 54.413 90.087  34.454  1.00 36.74  ? 96   LYS B C     1 
ATOM   6464 O  O     . LYS D 4 96  ? 54.433 90.956  33.580  1.00 38.54  ? 96   LYS B O     1 
ATOM   6465 C  CB    . LYS D 4 96  ? 52.279 89.583  35.701  1.00 36.28  ? 96   LYS B CB    1 
ATOM   6466 C  CG    . LYS D 4 96  ? 51.685 90.982  35.557  1.00 34.10  ? 96   LYS B CG    1 
ATOM   6467 C  CD    . LYS D 4 96  ? 50.532 91.028  34.580  1.00 32.98  ? 96   LYS B CD    1 
ATOM   6468 C  CE    . LYS D 4 96  ? 49.926 92.420  34.519  1.00 35.80  ? 96   LYS B CE    1 
ATOM   6469 N  NZ    . LYS D 4 96  ? 49.338 92.852  35.816  1.00 33.24  ? 96   LYS B NZ    1 
ATOM   6470 N  N     . GLY D 4 97  ? 55.417 89.881  35.308  1.00 34.07  ? 97   GLY B N     1 
ATOM   6471 C  CA    . GLY D 4 97  ? 56.605 90.717  35.305  1.00 31.95  ? 97   GLY B CA    1 
ATOM   6472 C  C     . GLY D 4 97  ? 57.523 90.480  34.121  1.00 36.42  ? 97   GLY B C     1 
ATOM   6473 O  O     . GLY D 4 97  ? 58.057 91.424  33.536  1.00 35.42  ? 97   GLY B O     1 
ATOM   6474 N  N     . GLN D 4 98  ? 57.694 89.212  33.759  1.00 44.35  ? 98   GLN B N     1 
ATOM   6475 C  CA    . GLN D 4 98  ? 58.553 88.832  32.640  1.00 47.17  ? 98   GLN B CA    1 
ATOM   6476 C  C     . GLN D 4 98  ? 58.023 89.326  31.293  1.00 42.55  ? 98   GLN B C     1 
ATOM   6477 O  O     . GLN D 4 98  ? 58.797 89.652  30.392  1.00 38.63  ? 98   GLN B O     1 
ATOM   6478 C  CB    . GLN D 4 98  ? 58.731 87.314  32.620  1.00 48.26  ? 98   GLN B CB    1 
ATOM   6479 C  CG    . GLN D 4 98  ? 59.390 86.763  33.876  1.00 42.95  ? 98   GLN B CG    1 
ATOM   6480 C  CD    . GLN D 4 98  ? 59.481 85.253  33.874  1.00 41.58  ? 98   GLN B CD    1 
ATOM   6481 O  OE1   . GLN D 4 98  ? 58.512 84.564  33.566  1.00 43.65  ? 98   GLN B OE1   1 
ATOM   6482 N  NE2   . GLN D 4 98  ? 60.647 84.730  34.223  1.00 46.78  ? 98   GLN B NE2   1 
ATOM   6483 N  N     . LEU D 4 99  ? 56.701 89.366  31.161  1.00 40.22  ? 99   LEU B N     1 
ATOM   6484 C  CA    . LEU D 4 99  ? 56.072 89.835  29.935  1.00 36.27  ? 99   LEU B CA    1 
ATOM   6485 C  C     . LEU D 4 99  ? 56.205 91.357  29.916  1.00 39.62  ? 99   LEU B C     1 
ATOM   6486 O  O     . LEU D 4 99  ? 56.545 91.940  28.888  1.00 36.00  ? 99   LEU B O     1 
ATOM   6487 C  CB    . LEU D 4 99  ? 54.592 89.450  29.906  1.00 30.67  ? 99   LEU B CB    1 
ATOM   6488 C  CG    . LEU D 4 99  ? 54.054 88.753  28.654  1.00 38.63  ? 99   LEU B CG    1 
ATOM   6489 C  CD1   . LEU D 4 99  ? 52.536 88.743  28.715  1.00 32.63  ? 99   LEU B CD1   1 
ATOM   6490 C  CD2   . LEU D 4 99  ? 54.516 89.459  27.393  1.00 32.41  ? 99   LEU B CD2   1 
ATOM   6491 N  N     . LYS D 4 100 ? 55.960 91.984  31.069  1.00 51.89  ? 100  LYS B N     1 
ATOM   6492 C  CA    . LYS D 4 100 ? 56.055 93.437  31.209  1.00 61.02  ? 100  LYS B CA    1 
ATOM   6493 C  C     . LYS D 4 100 ? 57.439 93.917  30.766  1.00 58.57  ? 100  LYS B C     1 
ATOM   6494 O  O     . LYS D 4 100 ? 57.546 94.869  29.997  1.00 70.32  ? 100  LYS B O     1 
ATOM   6495 C  CB    . LYS D 4 100 ? 55.770 93.854  32.655  1.00 77.61  ? 100  LYS B CB    1 
ATOM   6496 C  CG    . LYS D 4 100 ? 55.698 95.363  32.872  1.00 93.13  ? 100  LYS B CG    1 
ATOM   6497 C  CD    . LYS D 4 100 ? 55.326 95.750  34.306  1.00 97.31  ? 100  LYS B CD    1 
ATOM   6498 C  CE    . LYS D 4 100 ? 56.396 95.366  35.337  1.00 99.17  ? 100  LYS B CE    1 
ATOM   6499 N  NZ    . LYS D 4 100 ? 56.452 93.907  35.656  1.00 98.99  ? 100  LYS B NZ    1 
ATOM   6500 N  N     . GLU D 4 101 ? 58.486 93.237  31.237  1.00 53.50  ? 101  GLU B N     1 
ATOM   6501 C  CA    . GLU D 4 101 ? 59.869 93.567  30.873  1.00 53.17  ? 101  GLU B CA    1 
ATOM   6502 C  C     . GLU D 4 101 ? 60.026 93.476  29.362  1.00 46.79  ? 101  GLU B C     1 
ATOM   6503 O  O     . GLU D 4 101 ? 60.346 94.458  28.698  1.00 48.86  ? 101  GLU B O     1 
ATOM   6504 C  CB    . GLU D 4 101 ? 60.859 92.566  31.471  1.00 58.43  ? 101  GLU B CB    1 
ATOM   6505 C  CG    . GLU D 4 101 ? 61.132 92.652  32.951  1.00 68.97  ? 101  GLU B CG    1 
ATOM   6506 C  CD    . GLU D 4 101 ? 62.244 91.696  33.369  1.00 75.09  ? 101  GLU B CD    1 
ATOM   6507 O  OE1   . GLU D 4 101 ? 63.264 91.598  32.647  1.00 70.95  ? 101  GLU B OE1   1 
ATOM   6508 O  OE2   . GLU D 4 101 ? 62.099 91.037  34.419  1.00 72.46  ? 101  GLU B OE2   1 
ATOM   6509 N  N     . PHE D 4 102 ? 59.809 92.263  28.856  1.00 39.86  ? 102  PHE B N     1 
ATOM   6510 C  CA    . PHE D 4 102 ? 59.897 91.912  27.439  1.00 36.22  ? 102  PHE B CA    1 
ATOM   6511 C  C     . PHE D 4 102 ? 59.202 92.908  26.505  1.00 35.33  ? 102  PHE B C     1 
ATOM   6512 O  O     . PHE D 4 102 ? 59.762 93.299  25.478  1.00 32.00  ? 102  PHE B O     1 
ATOM   6513 C  CB    . PHE D 4 102 ? 59.312 90.506  27.254  1.00 33.52  ? 102  PHE B CB    1 
ATOM   6514 C  CG    . PHE D 4 102 ? 59.233 90.039  25.821  1.00 35.76  ? 102  PHE B CG    1 
ATOM   6515 C  CD1   . PHE D 4 102 ? 60.380 89.627  25.138  1.00 28.78  ? 102  PHE B CD1   1 
ATOM   6516 C  CD2   . PHE D 4 102 ? 58.001 89.978  25.166  1.00 29.85  ? 102  PHE B CD2   1 
ATOM   6517 C  CE1   . PHE D 4 102 ? 60.299 89.146  23.831  1.00 33.71  ? 102  PHE B CE1   1 
ATOM   6518 C  CE2   . PHE D 4 102 ? 57.909 89.499  23.860  1.00 30.92  ? 102  PHE B CE2   1 
ATOM   6519 C  CZ    . PHE D 4 102 ? 59.063 89.086  23.190  1.00 33.60  ? 102  PHE B CZ    1 
ATOM   6520 N  N     . LEU D 4 103 ? 57.994 93.324  26.873  1.00 28.85  ? 103  LEU B N     1 
ATOM   6521 C  CA    . LEU D 4 103 ? 57.237 94.266  26.065  1.00 31.56  ? 103  LEU B CA    1 
ATOM   6522 C  C     . LEU D 4 103 ? 57.877 95.655  26.073  1.00 37.17  ? 103  LEU B C     1 
ATOM   6523 O  O     . LEU D 4 103 ? 58.164 96.213  25.013  1.00 33.58  ? 103  LEU B O     1 
ATOM   6524 C  CB    . LEU D 4 103 ? 55.794 94.326  26.555  1.00 29.63  ? 103  LEU B CB    1 
ATOM   6525 C  CG    . LEU D 4 103 ? 55.004 93.032  26.361  1.00 25.42  ? 103  LEU B CG    1 
ATOM   6526 C  CD1   . LEU D 4 103 ? 53.657 93.157  27.002  1.00 22.33  ? 103  LEU B CD1   1 
ATOM   6527 C  CD2   . LEU D 4 103 ? 54.854 92.726  24.888  1.00 25.79  ? 103  LEU B CD2   1 
ATOM   6528 N  N     . ASP D 4 104 ? 58.148 96.176  27.270  1.00 45.82  ? 104  ASP B N     1 
ATOM   6529 C  CA    . ASP D 4 104 ? 58.763 97.495  27.437  1.00 48.49  ? 104  ASP B CA    1 
ATOM   6530 C  C     . ASP D 4 104 ? 60.122 97.611  26.748  1.00 48.28  ? 104  ASP B C     1 
ATOM   6531 O  O     . ASP D 4 104 ? 60.421 98.622  26.108  1.00 56.83  ? 104  ASP B O     1 
ATOM   6532 C  CB    . ASP D 4 104 ? 58.914 97.818  28.927  1.00 51.88  ? 104  ASP B CB    1 
ATOM   6533 C  CG    . ASP D 4 104 ? 57.580 97.851  29.663  1.00 52.52  ? 104  ASP B CG    1 
ATOM   6534 O  OD1   . ASP D 4 104 ? 56.555 98.223  29.053  1.00 61.43  ? 104  ASP B OD1   1 
ATOM   6535 O  OD2   . ASP D 4 104 ? 57.556 97.502  30.862  1.00 64.12  ? 104  ASP B OD2   1 
ATOM   6536 N  N     . ALA D 4 105 ? 60.924 96.557  26.861  1.00 43.13  ? 105  ALA B N     1 
ATOM   6537 C  CA    . ALA D 4 105 ? 62.257 96.510  26.273  1.00 37.31  ? 105  ALA B CA    1 
ATOM   6538 C  C     . ALA D 4 105 ? 62.225 96.482  24.752  1.00 38.17  ? 105  ALA B C     1 
ATOM   6539 O  O     . ALA D 4 105 ? 63.104 97.047  24.098  1.00 39.44  ? 105  ALA B O     1 
ATOM   6540 C  CB    . ALA D 4 105 ? 63.012 95.293  26.798  1.00 38.86  ? 105  ALA B CB    1 
ATOM   6541 N  N     . ASN D 4 106 ? 61.221 95.814  24.191  1.00 39.28  ? 106  ASN B N     1 
ATOM   6542 C  CA    . ASN D 4 106 ? 61.101 95.717  22.739  1.00 41.06  ? 106  ASN B CA    1 
ATOM   6543 C  C     . ASN D 4 106 ? 60.170 96.754  22.108  1.00 41.03  ? 106  ASN B C     1 
ATOM   6544 O  O     . ASN D 4 106 ? 60.051 96.820  20.882  1.00 38.34  ? 106  ASN B O     1 
ATOM   6545 C  CB    . ASN D 4 106 ? 60.694 94.295  22.331  1.00 40.53  ? 106  ASN B CB    1 
ATOM   6546 C  CG    . ASN D 4 106 ? 61.783 93.270  22.620  1.00 40.76  ? 106  ASN B CG    1 
ATOM   6547 O  OD1   . ASN D 4 106 ? 62.861 93.310  22.025  1.00 39.12  ? 106  ASN B OD1   1 
ATOM   6548 N  ND2   . ASN D 4 106 ? 61.504 92.347  23.530  1.00 37.82  ? 106  ASN B ND2   1 
ATOM   6549 N  N     . LEU D 4 107 ? 59.526 97.565  22.947  1.00 46.07  ? 107  LEU B N     1 
ATOM   6550 C  CA    . LEU D 4 107 ? 58.614 98.615  22.483  1.00 50.09  ? 107  LEU B CA    1 
ATOM   6551 C  C     . LEU D 4 107 ? 59.296 99.983  22.438  1.00 50.93  ? 107  LEU B C     1 
ATOM   6552 O  O     . LEU D 4 107 ? 60.522 100.084 22.494  1.00 49.47  ? 107  LEU B O     1 
ATOM   6553 C  CB    . LEU D 4 107 ? 57.371 98.690  23.382  1.00 52.78  ? 107  LEU B CB    1 
ATOM   6554 C  CG    . LEU D 4 107 ? 56.077 97.983  22.955  1.00 47.55  ? 107  LEU B CG    1 
ATOM   6555 C  CD1   . LEU D 4 107 ? 56.325 96.542  22.535  1.00 51.63  ? 107  LEU B CD1   1 
ATOM   6556 C  CD2   . LEU D 4 107 ? 55.089 98.044  24.103  1.00 49.03  ? 107  LEU B CD2   1 
HETATM 6557 P  PG    . DG3 E 5 .   ? 41.871 23.995  -6.891  1.00 23.58  ? 23   DG3 P PG    1 
HETATM 6558 O  O1G   . DG3 E 5 .   ? 43.348 24.035  -7.006  1.00 27.58  ? 23   DG3 P O1G   1 
HETATM 6559 O  O2G   . DG3 E 5 .   ? 41.117 22.876  -7.518  1.00 23.70  ? 23   DG3 P O2G   1 
HETATM 6560 O  O3G   . DG3 E 5 .   ? 41.267 25.385  -7.410  1.00 22.16  ? 23   DG3 P O3G   1 
HETATM 6561 O  O3B   . DG3 E 5 .   ? 41.482 24.141  -5.327  1.00 33.18  ? 23   DG3 P O3B   1 
HETATM 6562 P  PB    . DG3 E 5 .   ? 42.136 23.544  -3.966  1.00 20.03  ? 23   DG3 P PB    1 
HETATM 6563 O  O1B   . DG3 E 5 .   ? 40.977 23.178  -3.128  1.00 26.25  ? 23   DG3 P O1B   1 
HETATM 6564 O  O2B   . DG3 E 5 .   ? 43.153 22.513  -4.288  1.00 20.73  ? 23   DG3 P O2B   1 
HETATM 6565 O  O3A   . DG3 E 5 .   ? 42.842 24.811  -3.246  1.00 23.57  ? 23   DG3 P O3A   1 
HETATM 6566 P  PA    . DG3 E 5 .   ? 44.159 25.684  -3.539  1.00 21.87  ? 23   DG3 P PA    1 
HETATM 6567 O  O1A   . DG3 E 5 .   ? 43.765 27.098  -3.728  1.00 13.56  ? 23   DG3 P O1A   1 
HETATM 6568 O  O2A   . DG3 E 5 .   ? 44.987 25.006  -4.566  1.00 22.83  ? 23   DG3 P O2A   1 
HETATM 6569 O  "O5'" . DG3 E 5 .   ? 44.901 25.599  -2.137  1.00 15.38  ? 23   DG3 P "O5'" 1 
HETATM 6570 C  "C5'" . DG3 E 5 .   ? 45.651 24.435  -1.751  1.00 19.16  ? 23   DG3 P "C5'" 1 
HETATM 6571 C  "C4'" . DG3 E 5 .   ? 45.181 23.951  -0.397  1.00 17.03  ? 23   DG3 P "C4'" 1 
HETATM 6572 O  "O4'" . DG3 E 5 .   ? 45.421 24.984  0.599   1.00 15.78  ? 23   DG3 P "O4'" 1 
HETATM 6573 C  "C3'" . DG3 E 5 .   ? 43.690 23.672  -0.301  1.00 14.49  ? 23   DG3 P "C3'" 1 
HETATM 6574 C  "C2'" . DG3 E 5 .   ? 43.430 23.821  1.191   1.00 14.47  ? 23   DG3 P "C2'" 1 
HETATM 6575 C  "C1'" . DG3 E 5 .   ? 44.386 24.955  1.566   1.00 17.43  ? 23   DG3 P "C1'" 1 
HETATM 6576 N  N9    . DG3 E 5 .   ? 43.708 26.248  1.591   1.00 19.37  ? 23   DG3 P N9    1 
HETATM 6577 C  C8    . DG3 E 5 .   ? 43.470 27.098  0.540   1.00 17.20  ? 23   DG3 P C8    1 
HETATM 6578 N  N7    . DG3 E 5 .   ? 42.788 28.160  0.882   1.00 16.67  ? 23   DG3 P N7    1 
HETATM 6579 C  C5    . DG3 E 5 .   ? 42.576 28.002  2.247   1.00 17.36  ? 23   DG3 P C5    1 
HETATM 6580 C  C6    . DG3 E 5 .   ? 41.889 28.838  3.179   1.00 20.71  ? 23   DG3 P C6    1 
HETATM 6581 O  O6    . DG3 E 5 .   ? 41.312 29.914  2.979   1.00 19.14  ? 23   DG3 P O6    1 
HETATM 6582 N  N1    . DG3 E 5 .   ? 41.918 28.298  4.461   1.00 11.74  ? 23   DG3 P N1    1 
HETATM 6583 C  C2    . DG3 E 5 .   ? 42.527 27.125  4.806   1.00 8.38   ? 23   DG3 P C2    1 
HETATM 6584 N  N2    . DG3 E 5 .   ? 42.451 26.777  6.092   1.00 14.57  ? 23   DG3 P N2    1 
HETATM 6585 N  N3    . DG3 E 5 .   ? 43.169 26.344  3.954   1.00 14.95  ? 23   DG3 P N3    1 
HETATM 6586 C  C4    . DG3 E 5 .   ? 43.150 26.840  2.701   1.00 17.78  ? 23   DG3 P C4    1 
HETATM 6587 MG MG    . MG  F 6 .   ? 44.774 22.993  -5.708  1.00 23.16  ? 4001 MG  A MG    1 
HETATM 6588 MG MG    . MG  G 6 .   ? 47.137 25.803  -5.218  1.00 31.65  ? 4002 MG  A MG    1 
HETATM 6589 MG MG    . MG  H 6 .   ? 78.580 24.736  7.428   1.00 23.54  ? 4003 MG  A MG    1 
HETATM 6590 O  O     . HOH I 7 .   ? 44.843 34.812  -4.577  1.00 18.45  ? 3027 HOH P O     1 
HETATM 6591 O  O     . HOH I 7 .   ? 44.304 26.636  -7.475  1.00 32.18  ? 3107 HOH P O     1 
HETATM 6592 O  O     . HOH I 7 .   ? 43.230 41.356  9.904   1.00 25.96  ? 3112 HOH P O     1 
HETATM 6593 O  O     . HOH I 7 .   ? 59.907 44.295  12.800  1.00 27.21  ? 3118 HOH P O     1 
HETATM 6594 O  O     . HOH I 7 .   ? 51.493 30.679  0.952   1.00 2.00   ? 3123 HOH P O     1 
HETATM 6595 O  O     . HOH I 7 .   ? 45.636 46.816  1.663   1.00 29.29  ? 3149 HOH P O     1 
HETATM 6596 O  O     . HOH I 7 .   ? 69.188 41.458  18.766  1.00 27.04  ? 3164 HOH P O     1 
HETATM 6597 O  O     . HOH I 7 .   ? 46.164 27.920  -5.623  1.00 22.25  ? 3180 HOH P O     1 
HETATM 6598 O  O     . HOH I 7 .   ? 45.862 32.501  -7.593  1.00 19.05  ? 3276 HOH P O     1 
HETATM 6599 O  O     . HOH I 7 .   ? 42.333 40.896  4.433   1.00 25.70  ? 3291 HOH P O     1 
HETATM 6600 O  O     . HOH I 7 .   ? 44.551 38.042  6.293   1.00 15.66  ? 3314 HOH P O     1 
HETATM 6601 O  O     . HOH I 7 .   ? 71.894 43.334  17.453  1.00 28.70  ? 3353 HOH P O     1 
HETATM 6602 O  O     . HOH I 7 .   ? 63.893 47.672  22.312  1.00 30.95  ? 3356 HOH P O     1 
HETATM 6603 O  O     . HOH I 7 .   ? 44.660 24.345  5.220   1.00 8.14   ? 3405 HOH P O     1 
HETATM 6604 O  O     . HOH I 7 .   ? 68.064 47.547  20.126  1.00 37.83  ? 3462 HOH P O     1 
HETATM 6605 O  O     . HOH I 7 .   ? 46.395 38.155  10.254  1.00 16.27  ? 3504 HOH P O     1 
HETATM 6606 O  O     . HOH J 7 .   ? 53.096 60.709  13.697  1.00 20.24  ? 3067 HOH T O     1 
HETATM 6607 O  O     . HOH J 7 .   ? 50.463 30.258  11.993  1.00 27.04  ? 3079 HOH T O     1 
HETATM 6608 O  O     . HOH J 7 .   ? 45.636 33.878  8.993   1.00 19.91  ? 3085 HOH T O     1 
HETATM 6609 O  O     . HOH J 7 .   ? 36.977 36.466  15.030  1.00 29.01  ? 3162 HOH T O     1 
HETATM 6610 O  O     . HOH J 7 .   ? 49.797 29.110  16.705  1.00 32.28  ? 3192 HOH T O     1 
HETATM 6611 O  O     . HOH J 7 .   ? 52.529 34.694  10.432  1.00 15.17  ? 3202 HOH T O     1 
HETATM 6612 O  O     . HOH J 7 .   ? 58.205 49.563  6.779   1.00 22.16  ? 3213 HOH T O     1 
HETATM 6613 O  O     . HOH J 7 .   ? 50.265 58.672  16.052  1.00 23.62  ? 3245 HOH T O     1 
HETATM 6614 O  O     . HOH J 7 .   ? 58.313 57.013  7.307   1.00 29.40  ? 3249 HOH T O     1 
HETATM 6615 O  O     . HOH J 7 .   ? 53.196 43.352  4.418   1.00 18.47  ? 3268 HOH T O     1 
HETATM 6616 O  O     . HOH J 7 .   ? 54.311 29.134  13.446  1.00 20.89  ? 3280 HOH T O     1 
HETATM 6617 O  O     . HOH J 7 .   ? 54.064 32.090  11.305  1.00 28.94  ? 3301 HOH T O     1 
HETATM 6618 O  O     . HOH J 7 .   ? 51.958 27.838  18.306  1.00 32.94  ? 3321 HOH T O     1 
HETATM 6619 O  O     . HOH J 7 .   ? 54.014 29.429  16.261  1.00 32.27  ? 3346 HOH T O     1 
HETATM 6620 O  O     . HOH J 7 .   ? 46.148 30.143  15.052  1.00 19.40  ? 3377 HOH T O     1 
HETATM 6621 O  O     . HOH J 7 .   ? 51.349 27.401  4.526   1.00 17.39  ? 3398 HOH T O     1 
HETATM 6622 O  O     . HOH J 7 .   ? 59.974 29.078  8.324   1.00 7.75   ? 3401 HOH T O     1 
HETATM 6623 O  O     . HOH J 7 .   ? 61.156 41.409  6.671   1.00 24.05  ? 3413 HOH T O     1 
HETATM 6624 O  O     . HOH J 7 .   ? 48.354 23.528  14.163  1.00 15.92  ? 3419 HOH T O     1 
HETATM 6625 O  O     . HOH J 7 .   ? 53.214 32.026  2.843   1.00 17.44  ? 3426 HOH T O     1 
HETATM 6626 O  O     . HOH J 7 .   ? 61.064 32.598  7.545   1.00 16.68  ? 3444 HOH T O     1 
HETATM 6627 O  O     . HOH J 7 .   ? 57.990 41.542  0.772   1.00 20.41  ? 3451 HOH T O     1 
HETATM 6628 O  O     . HOH J 7 .   ? 53.571 58.883  10.406  1.00 30.94  ? 3466 HOH T O     1 
HETATM 6629 O  O     . HOH J 7 .   ? 49.801 53.684  13.184  1.00 26.65  ? 3471 HOH T O     1 
HETATM 6630 O  O     . HOH J 7 .   ? 53.283 47.637  2.280   1.00 32.43  ? 3488 HOH T O     1 
HETATM 6631 O  O     . HOH J 7 .   ? 61.399 35.416  7.572   1.00 23.09  ? 3513 HOH T O     1 
HETATM 6632 O  O     . HOH J 7 .   ? 41.226 32.994  12.603  1.00 29.51  ? 3515 HOH T O     1 
HETATM 6633 O  O     . HOH J 7 .   ? 58.459 51.862  2.151   1.00 22.62  ? 3518 HOH T O     1 
HETATM 6634 O  O     . HOH J 7 .   ? 48.088 35.409  9.575   1.00 20.59  ? 3526 HOH T O     1 
HETATM 6635 O  O     . HOH K 7 .   ? 93.021 17.327  -7.933  1.00 7.65   ? 3001 HOH A O     1 
HETATM 6636 O  O     . HOH K 7 .   ? 73.207 20.770  -10.349 1.00 7.93   ? 3002 HOH A O     1 
HETATM 6637 O  O     . HOH K 7 .   ? 65.359 19.367  22.716  1.00 11.47  ? 3003 HOH A O     1 
HETATM 6638 O  O     . HOH K 7 .   ? 74.165 17.191  3.437   1.00 15.16  ? 3004 HOH A O     1 
HETATM 6639 O  O     . HOH K 7 .   ? 90.879 9.660   0.530   1.00 9.72   ? 3005 HOH A O     1 
HETATM 6640 O  O     . HOH K 7 .   ? 78.769 17.656  -4.855  1.00 8.69   ? 3006 HOH A O     1 
HETATM 6641 O  O     . HOH K 7 .   ? 69.849 24.822  -26.555 1.00 22.39  ? 3007 HOH A O     1 
HETATM 6642 O  O     . HOH K 7 .   ? 82.788 20.119  -10.097 1.00 4.54   ? 3009 HOH A O     1 
HETATM 6643 O  O     . HOH K 7 .   ? 52.494 21.229  0.518   1.00 6.99   ? 3012 HOH A O     1 
HETATM 6644 O  O     . HOH K 7 .   ? 65.051 24.572  -0.314  1.00 7.35   ? 3013 HOH A O     1 
HETATM 6645 O  O     . HOH K 7 .   ? 67.546 25.215  16.594  1.00 13.84  ? 3014 HOH A O     1 
HETATM 6646 O  O     . HOH K 7 .   ? 45.639 9.430   11.103  1.00 24.51  ? 3016 HOH A O     1 
HETATM 6647 O  O     . HOH K 7 .   ? 74.008 31.944  6.315   1.00 28.79  ? 3017 HOH A O     1 
HETATM 6648 O  O     . HOH K 7 .   ? 37.463 9.300   -5.844  1.00 6.63   ? 3018 HOH A O     1 
HETATM 6649 O  O     . HOH K 7 .   ? 52.366 33.005  -4.989  1.00 14.41  ? 3019 HOH A O     1 
HETATM 6650 O  O     . HOH K 7 .   ? 52.355 3.828   -6.666  1.00 18.93  ? 3020 HOH A O     1 
HETATM 6651 O  O     . HOH K 7 .   ? 67.535 24.700  24.421  1.00 15.91  ? 3021 HOH A O     1 
HETATM 6652 O  O     . HOH K 7 .   ? 95.265 18.164  -1.656  1.00 22.23  ? 3022 HOH A O     1 
HETATM 6653 O  O     . HOH K 7 .   ? 45.003 8.577   -7.269  1.00 15.20  ? 3023 HOH A O     1 
HETATM 6654 O  O     . HOH K 7 .   ? 45.417 19.433  -17.198 1.00 9.94   ? 3024 HOH A O     1 
HETATM 6655 O  O     . HOH K 7 .   ? 97.506 25.530  3.454   1.00 15.62  ? 3025 HOH A O     1 
HETATM 6656 O  O     . HOH K 7 .   ? 60.257 9.167   -5.353  1.00 23.52  ? 3026 HOH A O     1 
HETATM 6657 O  O     . HOH K 7 .   ? 47.328 10.651  8.617   1.00 12.40  ? 3028 HOH A O     1 
HETATM 6658 O  O     . HOH K 7 .   ? 78.369 21.452  10.553  1.00 10.37  ? 3029 HOH A O     1 
HETATM 6659 O  O     . HOH K 7 .   ? 48.879 17.983  -15.019 1.00 10.44  ? 3030 HOH A O     1 
HETATM 6660 O  O     . HOH K 7 .   ? 76.193 20.143  -6.840  1.00 10.68  ? 3031 HOH A O     1 
HETATM 6661 O  O     . HOH K 7 .   ? 88.965 9.169   -3.798  1.00 18.75  ? 3032 HOH A O     1 
HETATM 6662 O  O     . HOH K 7 .   ? 67.856 20.887  22.889  1.00 22.95  ? 3033 HOH A O     1 
HETATM 6663 O  O     . HOH K 7 .   ? 65.615 10.993  -8.313  1.00 20.83  ? 3035 HOH A O     1 
HETATM 6664 O  O     . HOH K 7 .   ? 73.733 -2.320  12.931  1.00 23.77  ? 3036 HOH A O     1 
HETATM 6665 O  O     . HOH K 7 .   ? 61.506 19.183  -27.223 1.00 15.58  ? 3037 HOH A O     1 
HETATM 6666 O  O     . HOH K 7 .   ? 54.412 53.197  -15.438 1.00 21.38  ? 3038 HOH A O     1 
HETATM 6667 O  O     . HOH K 7 .   ? 34.229 9.739   0.967   1.00 12.32  ? 3039 HOH A O     1 
HETATM 6668 O  O     . HOH K 7 .   ? 53.973 16.164  19.367  1.00 21.29  ? 3040 HOH A O     1 
HETATM 6669 O  O     . HOH K 7 .   ? 92.850 21.290  13.347  1.00 21.73  ? 3041 HOH A O     1 
HETATM 6670 O  O     . HOH K 7 .   ? 56.559 41.078  -17.315 1.00 15.90  ? 3042 HOH A O     1 
HETATM 6671 O  O     . HOH K 7 .   ? 68.341 23.711  14.022  1.00 32.41  ? 3043 HOH A O     1 
HETATM 6672 O  O     . HOH K 7 .   ? 69.535 28.172  -20.928 1.00 18.71  ? 3044 HOH A O     1 
HETATM 6673 O  O     . HOH K 7 .   ? 62.614 28.773  8.358   1.00 10.29  ? 3045 HOH A O     1 
HETATM 6674 O  O     . HOH K 7 .   ? 51.195 37.723  -19.968 1.00 18.87  ? 3046 HOH A O     1 
HETATM 6675 O  O     . HOH K 7 .   ? 80.904 11.171  -5.976  1.00 9.68   ? 3047 HOH A O     1 
HETATM 6676 O  O     . HOH K 7 .   ? 72.244 12.731  -7.188  1.00 15.23  ? 3048 HOH A O     1 
HETATM 6677 O  O     . HOH K 7 .   ? 68.517 15.958  -14.459 1.00 13.36  ? 3049 HOH A O     1 
HETATM 6678 O  O     . HOH K 7 .   ? 68.372 31.094  -2.696  1.00 23.00  ? 3050 HOH A O     1 
HETATM 6679 O  O     . HOH K 7 .   ? 64.062 52.929  -4.002  1.00 30.53  ? 3051 HOH A O     1 
HETATM 6680 O  O     . HOH K 7 .   ? 69.959 12.939  0.536   1.00 2.00   ? 3052 HOH A O     1 
HETATM 6681 O  O     . HOH K 7 .   ? 38.272 63.572  -1.389  1.00 22.69  ? 3053 HOH A O     1 
HETATM 6682 O  O     . HOH K 7 .   ? 52.356 63.835  -2.810  1.00 22.00  ? 3054 HOH A O     1 
HETATM 6683 O  O     . HOH K 7 .   ? 60.307 27.247  18.675  1.00 12.31  ? 3055 HOH A O     1 
HETATM 6684 O  O     . HOH K 7 .   ? 71.334 25.320  -14.540 1.00 16.29  ? 3056 HOH A O     1 
HETATM 6685 O  O     . HOH K 7 .   ? 62.680 7.383   21.211  1.00 16.88  ? 3057 HOH A O     1 
HETATM 6686 O  O     . HOH K 7 .   ? 65.698 48.253  -5.463  1.00 23.71  ? 3058 HOH A O     1 
HETATM 6687 O  O     . HOH K 7 .   ? 54.524 30.710  -24.287 1.00 33.05  ? 3059 HOH A O     1 
HETATM 6688 O  O     . HOH K 7 .   ? 72.685 24.022  -10.040 1.00 17.96  ? 3060 HOH A O     1 
HETATM 6689 O  O     . HOH K 7 .   ? 48.199 21.092  2.275   1.00 28.90  ? 3061 HOH A O     1 
HETATM 6690 O  O     . HOH K 7 .   ? 71.997 33.468  23.416  1.00 27.30  ? 3062 HOH A O     1 
HETATM 6691 O  O     . HOH K 7 .   ? 64.019 29.136  4.089   1.00 14.36  ? 3063 HOH A O     1 
HETATM 6692 O  O     . HOH K 7 .   ? 60.215 1.718   9.138   1.00 26.80  ? 3064 HOH A O     1 
HETATM 6693 O  O     . HOH K 7 .   ? 58.428 22.096  -29.300 1.00 10.74  ? 3065 HOH A O     1 
HETATM 6694 O  O     . HOH K 7 .   ? 45.169 10.535  -15.631 1.00 19.86  ? 3066 HOH A O     1 
HETATM 6695 O  O     . HOH K 7 .   ? 66.619 22.232  0.392   1.00 12.86  ? 3068 HOH A O     1 
HETATM 6696 O  O     . HOH K 7 .   ? 53.256 28.328  -24.038 1.00 25.44  ? 3069 HOH A O     1 
HETATM 6697 O  O     . HOH K 7 .   ? 62.094 29.886  11.379  1.00 18.65  ? 3070 HOH A O     1 
HETATM 6698 O  O     . HOH K 7 .   ? 48.296 33.152  -11.794 1.00 20.23  ? 3071 HOH A O     1 
HETATM 6699 O  O     . HOH K 7 .   ? 48.028 44.225  -13.537 1.00 19.22  ? 3072 HOH A O     1 
HETATM 6700 O  O     . HOH K 7 .   ? 60.772 31.754  -1.406  1.00 12.30  ? 3073 HOH A O     1 
HETATM 6701 O  O     . HOH K 7 .   ? 72.660 14.982  -16.407 1.00 33.92  ? 3074 HOH A O     1 
HETATM 6702 O  O     . HOH K 7 .   ? 66.370 46.071  -9.556  1.00 32.44  ? 3075 HOH A O     1 
HETATM 6703 O  O     . HOH K 7 .   ? 94.361 16.381  10.872  1.00 19.20  ? 3076 HOH A O     1 
HETATM 6704 O  O     . HOH K 7 .   ? 75.341 0.454   0.603   1.00 18.07  ? 3077 HOH A O     1 
HETATM 6705 O  O     . HOH K 7 .   ? 87.074 9.840   5.960   1.00 21.64  ? 3080 HOH A O     1 
HETATM 6706 O  O     . HOH K 7 .   ? 36.930 20.818  12.212  1.00 20.08  ? 3082 HOH A O     1 
HETATM 6707 O  O     . HOH K 7 .   ? 58.287 2.927   -3.621  1.00 31.68  ? 3083 HOH A O     1 
HETATM 6708 O  O     . HOH K 7 .   ? 48.519 66.577  6.078   1.00 27.71  ? 3084 HOH A O     1 
HETATM 6709 O  O     . HOH K 7 .   ? 55.466 24.536  -1.055  1.00 3.39   ? 3086 HOH A O     1 
HETATM 6710 O  O     . HOH K 7 .   ? 67.141 10.209  0.063   1.00 17.66  ? 3087 HOH A O     1 
HETATM 6711 O  O     . HOH K 7 .   ? 46.456 22.884  12.075  1.00 18.57  ? 3088 HOH A O     1 
HETATM 6712 O  O     . HOH K 7 .   ? 46.493 21.894  15.733  1.00 17.54  ? 3089 HOH A O     1 
HETATM 6713 O  O     . HOH K 7 .   ? 34.539 70.144  1.060   1.00 19.93  ? 3090 HOH A O     1 
HETATM 6714 O  O     . HOH K 7 .   ? 54.130 28.039  4.612   1.00 11.70  ? 3091 HOH A O     1 
HETATM 6715 O  O     . HOH K 7 .   ? 67.954 35.972  -5.857  1.00 14.43  ? 3092 HOH A O     1 
HETATM 6716 O  O     . HOH K 7 .   ? 69.746 25.543  -22.692 1.00 13.79  ? 3093 HOH A O     1 
HETATM 6717 O  O     . HOH K 7 .   ? 66.896 34.205  -1.047  1.00 19.42  ? 3094 HOH A O     1 
HETATM 6718 O  O     . HOH K 7 .   ? 61.415 29.638  4.482   1.00 9.55   ? 3095 HOH A O     1 
HETATM 6719 O  O     . HOH K 7 .   ? 63.373 29.280  -7.597  1.00 2.00   ? 3096 HOH A O     1 
HETATM 6720 O  O     . HOH K 7 .   ? 32.965 9.087   15.283  1.00 23.28  ? 3097 HOH A O     1 
HETATM 6721 O  O     . HOH K 7 .   ? 69.368 18.149  -10.517 1.00 30.38  ? 3098 HOH A O     1 
HETATM 6722 O  O     . HOH K 7 .   ? 86.257 14.142  -8.808  1.00 20.82  ? 3099 HOH A O     1 
HETATM 6723 O  O     . HOH K 7 .   ? 58.697 40.518  -1.805  1.00 22.41  ? 3101 HOH A O     1 
HETATM 6724 O  O     . HOH K 7 .   ? 65.081 24.178  16.718  1.00 17.32  ? 3103 HOH A O     1 
HETATM 6725 O  O     . HOH K 7 .   ? 87.341 15.777  -12.944 1.00 13.42  ? 3104 HOH A O     1 
HETATM 6726 O  O     . HOH K 7 .   ? 54.340 23.463  17.084  1.00 17.84  ? 3105 HOH A O     1 
HETATM 6727 O  O     . HOH K 7 .   ? 47.961 21.172  23.143  1.00 38.63  ? 3106 HOH A O     1 
HETATM 6728 O  O     . HOH K 7 .   ? 71.530 25.025  -3.136  1.00 11.60  ? 3108 HOH A O     1 
HETATM 6729 O  O     . HOH K 7 .   ? 40.239 21.825  12.193  1.00 14.63  ? 3109 HOH A O     1 
HETATM 6730 O  O     . HOH K 7 .   ? 44.370 22.528  -9.768  1.00 20.13  ? 3110 HOH A O     1 
HETATM 6731 O  O     . HOH K 7 .   ? 57.453 15.530  11.858  1.00 19.23  ? 3111 HOH A O     1 
HETATM 6732 O  O     . HOH K 7 .   ? 71.580 4.397   15.054  1.00 20.26  ? 3113 HOH A O     1 
HETATM 6733 O  O     . HOH K 7 .   ? 56.601 17.376  9.844   1.00 9.15   ? 3114 HOH A O     1 
HETATM 6734 O  O     . HOH K 7 .   ? 63.709 20.311  5.406   1.00 10.28  ? 3115 HOH A O     1 
HETATM 6735 O  O     . HOH K 7 .   ? 53.277 2.752   0.744   1.00 25.04  ? 3117 HOH A O     1 
HETATM 6736 O  O     . HOH K 7 .   ? 39.144 65.565  10.247  1.00 16.75  ? 3119 HOH A O     1 
HETATM 6737 O  O     . HOH K 7 .   ? 62.019 24.982  10.511  1.00 18.36  ? 3120 HOH A O     1 
HETATM 6738 O  O     . HOH K 7 .   ? 50.292 13.243  6.699   1.00 20.50  ? 3121 HOH A O     1 
HETATM 6739 O  O     . HOH K 7 .   ? 49.832 41.068  -17.446 1.00 26.76  ? 3122 HOH A O     1 
HETATM 6740 O  O     . HOH K 7 .   ? 80.392 36.006  9.720   1.00 17.29  ? 3124 HOH A O     1 
HETATM 6741 O  O     . HOH K 7 .   ? 55.311 30.060  2.973   1.00 13.44  ? 3125 HOH A O     1 
HETATM 6742 O  O     . HOH K 7 .   ? 81.381 29.080  11.410  1.00 10.60  ? 3126 HOH A O     1 
HETATM 6743 O  O     . HOH K 7 .   ? 43.760 35.563  -8.403  1.00 23.32  ? 3128 HOH A O     1 
HETATM 6744 O  O     . HOH K 7 .   ? 51.012 51.180  4.752   1.00 29.49  ? 3129 HOH A O     1 
HETATM 6745 O  O     . HOH K 7 .   ? 67.717 35.437  -20.001 1.00 21.56  ? 3130 HOH A O     1 
HETATM 6746 O  O     . HOH K 7 .   ? 68.044 20.846  15.330  1.00 15.30  ? 3131 HOH A O     1 
HETATM 6747 O  O     . HOH K 7 .   ? 49.567 49.104  3.170   1.00 21.36  ? 3132 HOH A O     1 
HETATM 6748 O  O     . HOH K 7 .   ? 70.467 25.513  -11.704 1.00 13.09  ? 3133 HOH A O     1 
HETATM 6749 O  O     . HOH K 7 .   ? 58.678 6.574   -0.454  1.00 9.70   ? 3134 HOH A O     1 
HETATM 6750 O  O     . HOH K 7 .   ? 71.342 18.796  24.082  1.00 36.94  ? 3136 HOH A O     1 
HETATM 6751 O  O     . HOH K 7 .   ? 38.770 18.379  -7.108  1.00 9.66   ? 3137 HOH A O     1 
HETATM 6752 O  O     . HOH K 7 .   ? 56.548 6.621   18.630  1.00 17.07  ? 3139 HOH A O     1 
HETATM 6753 O  O     . HOH K 7 .   ? 47.018 9.175   13.665  1.00 18.46  ? 3140 HOH A O     1 
HETATM 6754 O  O     . HOH K 7 .   ? 66.040 22.723  12.648  1.00 17.61  ? 3141 HOH A O     1 
HETATM 6755 O  O     . HOH K 7 .   ? 64.492 12.115  -5.498  1.00 11.39  ? 3142 HOH A O     1 
HETATM 6756 O  O     . HOH K 7 .   ? 37.681 32.524  -8.798  1.00 28.49  ? 3143 HOH A O     1 
HETATM 6757 O  O     . HOH K 7 .   ? 68.674 13.757  -8.301  1.00 23.09  ? 3144 HOH A O     1 
HETATM 6758 O  O     . HOH K 7 .   ? 63.784 27.760  -25.636 1.00 23.81  ? 3145 HOH A O     1 
HETATM 6759 O  O     . HOH K 7 .   ? 77.704 4.564   -3.288  1.00 13.78  ? 3146 HOH A O     1 
HETATM 6760 O  O     . HOH K 7 .   ? 90.033 36.960  6.498   1.00 23.54  ? 3147 HOH A O     1 
HETATM 6761 O  O     . HOH K 7 .   ? 78.209 20.339  7.879   1.00 12.21  ? 3150 HOH A O     1 
HETATM 6762 O  O     . HOH K 7 .   ? 54.061 23.565  1.224   1.00 21.38  ? 3151 HOH A O     1 
HETATM 6763 O  O     . HOH K 7 .   ? 60.645 30.700  -27.682 1.00 13.15  ? 3152 HOH A O     1 
HETATM 6764 O  O     . HOH K 7 .   ? 87.150 2.993   15.727  1.00 27.72  ? 3154 HOH A O     1 
HETATM 6765 O  O     . HOH K 7 .   ? 49.428 4.981   -10.667 1.00 24.83  ? 3155 HOH A O     1 
HETATM 6766 O  O     . HOH K 7 .   ? 38.790 71.561  0.674   1.00 27.62  ? 3156 HOH A O     1 
HETATM 6767 O  O     . HOH K 7 .   ? 42.402 4.890   -11.584 1.00 27.11  ? 3157 HOH A O     1 
HETATM 6768 O  O     . HOH K 7 .   ? 38.137 35.458  -8.955  1.00 29.80  ? 3158 HOH A O     1 
HETATM 6769 O  O     . HOH K 7 .   ? 90.765 17.397  13.152  1.00 25.00  ? 3159 HOH A O     1 
HETATM 6770 O  O     . HOH K 7 .   ? 70.439 24.865  12.709  1.00 5.66   ? 3161 HOH A O     1 
HETATM 6771 O  O     . HOH K 7 .   ? 87.159 6.994   -4.567  1.00 27.82  ? 3163 HOH A O     1 
HETATM 6772 O  O     . HOH K 7 .   ? 53.090 73.684  45.518  1.00 33.22  ? 3165 HOH A O     1 
HETATM 6773 O  O     . HOH K 7 .   ? 34.908 11.456  -12.803 1.00 30.13  ? 3166 HOH A O     1 
HETATM 6774 O  O     . HOH K 7 .   ? 74.203 18.837  -5.495  1.00 10.12  ? 3169 HOH A O     1 
HETATM 6775 O  O     . HOH K 7 .   ? 42.584 39.099  21.013  1.00 33.12  ? 3170 HOH A O     1 
HETATM 6776 O  O     . HOH K 7 .   ? 68.592 5.543   -4.737  1.00 24.75  ? 3171 HOH A O     1 
HETATM 6777 O  O     . HOH K 7 .   ? 38.935 6.238   5.552   1.00 27.22  ? 3172 HOH A O     1 
HETATM 6778 O  O     . HOH K 7 .   ? 56.703 74.549  12.804  1.00 28.03  ? 3173 HOH A O     1 
HETATM 6779 O  O     . HOH K 7 .   ? 38.231 17.310  15.519  1.00 28.57  ? 3174 HOH A O     1 
HETATM 6780 O  O     . HOH K 7 .   ? 75.947 18.389  -9.076  1.00 15.81  ? 3175 HOH A O     1 
HETATM 6781 O  O     . HOH K 7 .   ? 48.607 26.146  -11.809 1.00 20.17  ? 3176 HOH A O     1 
HETATM 6782 O  O     . HOH K 7 .   ? 71.068 9.945   -7.550  1.00 32.36  ? 3177 HOH A O     1 
HETATM 6783 O  O     . HOH K 7 .   ? 92.577 9.429   10.587  1.00 25.07  ? 3178 HOH A O     1 
HETATM 6784 O  O     . HOH K 7 .   ? 83.213 6.065   16.150  1.00 28.60  ? 3179 HOH A O     1 
HETATM 6785 O  O     . HOH K 7 .   ? 54.568 42.610  -15.877 1.00 15.90  ? 3182 HOH A O     1 
HETATM 6786 O  O     . HOH K 7 .   ? 79.218 41.904  5.405   1.00 34.63  ? 3183 HOH A O     1 
HETATM 6787 O  O     . HOH K 7 .   ? 84.580 12.438  -12.239 1.00 33.01  ? 3184 HOH A O     1 
HETATM 6788 O  O     . HOH K 7 .   ? 63.495 13.221  19.241  1.00 26.99  ? 3185 HOH A O     1 
HETATM 6789 O  O     . HOH K 7 .   ? 30.210 19.571  -1.562  1.00 21.32  ? 3186 HOH A O     1 
HETATM 6790 O  O     . HOH K 7 .   ? 94.481 20.493  -3.284  1.00 17.05  ? 3187 HOH A O     1 
HETATM 6791 O  O     . HOH K 7 .   ? 65.769 42.590  10.038  1.00 34.53  ? 3189 HOH A O     1 
HETATM 6792 O  O     . HOH K 7 .   ? 38.633 20.147  -11.481 1.00 23.90  ? 3190 HOH A O     1 
HETATM 6793 O  O     . HOH K 7 .   ? 63.183 18.359  3.374   1.00 10.66  ? 3191 HOH A O     1 
HETATM 6794 O  O     . HOH K 7 .   ? 88.877 35.299  -4.498  1.00 33.26  ? 3193 HOH A O     1 
HETATM 6795 O  O     . HOH K 7 .   ? 81.495 5.744   -6.322  1.00 26.18  ? 3194 HOH A O     1 
HETATM 6796 O  O     . HOH K 7 .   ? 49.112 27.152  -5.089  1.00 14.23  ? 3195 HOH A O     1 
HETATM 6797 O  O     . HOH K 7 .   ? 55.633 58.162  -4.373  1.00 25.46  ? 3196 HOH A O     1 
HETATM 6798 O  O     . HOH K 7 .   ? 65.623 26.835  -27.835 1.00 22.88  ? 3197 HOH A O     1 
HETATM 6799 O  O     . HOH K 7 .   ? 85.028 36.398  -3.829  1.00 27.10  ? 3198 HOH A O     1 
HETATM 6800 O  O     . HOH K 7 .   ? 42.625 37.536  -6.351  1.00 24.38  ? 3199 HOH A O     1 
HETATM 6801 O  O     . HOH K 7 .   ? 62.592 58.069  17.641  1.00 27.57  ? 3200 HOH A O     1 
HETATM 6802 O  O     . HOH K 7 .   ? 65.856 39.520  8.338   1.00 34.35  ? 3201 HOH A O     1 
HETATM 6803 O  O     . HOH K 7 .   ? 62.915 13.675  -7.554  1.00 9.52   ? 3203 HOH A O     1 
HETATM 6804 O  O     . HOH K 7 .   ? 54.978 5.596   12.265  1.00 21.39  ? 3204 HOH A O     1 
HETATM 6805 O  O     . HOH K 7 .   ? 70.566 39.975  -4.931  1.00 24.00  ? 3205 HOH A O     1 
HETATM 6806 O  O     . HOH K 7 .   ? 59.046 7.744   -16.455 1.00 18.64  ? 3206 HOH A O     1 
HETATM 6807 O  O     . HOH K 7 .   ? 53.645 37.025  -23.192 1.00 23.69  ? 3207 HOH A O     1 
HETATM 6808 O  O     . HOH K 7 .   ? 66.658 83.623  30.779  1.00 28.87  ? 3208 HOH A O     1 
HETATM 6809 O  O     . HOH K 7 .   ? 56.523 16.840  15.991  1.00 23.31  ? 3209 HOH A O     1 
HETATM 6810 O  O     . HOH K 7 .   ? 72.291 -3.945  10.479  1.00 25.15  ? 3210 HOH A O     1 
HETATM 6811 O  O     . HOH K 7 .   ? 47.477 8.007   7.638   1.00 26.48  ? 3211 HOH A O     1 
HETATM 6812 O  O     . HOH K 7 .   ? 36.671 4.631   -1.451  1.00 30.43  ? 3212 HOH A O     1 
HETATM 6813 O  O     . HOH K 7 .   ? 56.983 38.134  -2.610  1.00 14.78  ? 3214 HOH A O     1 
HETATM 6814 O  O     . HOH K 7 .   ? 92.759 45.075  9.397   1.00 31.32  ? 3215 HOH A O     1 
HETATM 6815 O  O     . HOH K 7 .   ? 82.732 -1.154  -3.245  1.00 31.53  ? 3216 HOH A O     1 
HETATM 6816 O  O     . HOH K 7 .   ? 58.382 27.963  10.592  1.00 22.51  ? 3217 HOH A O     1 
HETATM 6817 O  O     . HOH K 7 .   ? 50.178 61.781  -11.613 1.00 19.57  ? 3220 HOH A O     1 
HETATM 6818 O  O     . HOH K 7 .   ? 78.104 2.607   17.671  1.00 28.71  ? 3221 HOH A O     1 
HETATM 6819 O  O     . HOH K 7 .   ? 47.629 72.383  7.526   1.00 36.19  ? 3222 HOH A O     1 
HETATM 6820 O  O     . HOH K 7 .   ? 45.555 7.214   5.545   1.00 17.70  ? 3223 HOH A O     1 
HETATM 6821 O  O     . HOH K 7 .   ? 69.047 19.558  -23.813 1.00 30.01  ? 3224 HOH A O     1 
HETATM 6822 O  O     . HOH K 7 .   ? 58.052 3.895   7.104   1.00 21.67  ? 3225 HOH A O     1 
HETATM 6823 O  O     . HOH K 7 .   ? 61.098 15.460  18.606  1.00 23.70  ? 3226 HOH A O     1 
HETATM 6824 O  O     . HOH K 7 .   ? 75.245 33.205  12.778  1.00 16.36  ? 3227 HOH A O     1 
HETATM 6825 O  O     . HOH K 7 .   ? 89.255 11.575  6.557   1.00 20.51  ? 3228 HOH A O     1 
HETATM 6826 O  O     . HOH K 7 .   ? 79.379 30.933  22.555  1.00 38.99  ? 3229 HOH A O     1 
HETATM 6827 O  O     . HOH K 7 .   ? 58.409 25.312  22.943  1.00 17.62  ? 3230 HOH A O     1 
HETATM 6828 O  O     . HOH K 7 .   ? 67.187 4.480   18.523  1.00 33.10  ? 3232 HOH A O     1 
HETATM 6829 O  O     . HOH K 7 .   ? 81.983 35.096  20.377  1.00 26.01  ? 3233 HOH A O     1 
HETATM 6830 O  O     . HOH K 7 .   ? 89.989 9.302   9.719   1.00 22.45  ? 3234 HOH A O     1 
HETATM 6831 O  O     . HOH K 7 .   ? 55.187 39.580  -19.587 1.00 20.12  ? 3236 HOH A O     1 
HETATM 6832 O  O     . HOH K 7 .   ? 78.693 6.241   18.302  1.00 35.21  ? 3237 HOH A O     1 
HETATM 6833 O  O     . HOH K 7 .   ? 72.573 26.105  -22.307 1.00 20.30  ? 3238 HOH A O     1 
HETATM 6834 O  O     . HOH K 7 .   ? 41.465 67.123  8.820   1.00 31.82  ? 3239 HOH A O     1 
HETATM 6835 O  O     . HOH K 7 .   ? 92.099 35.583  7.965   1.00 24.90  ? 3240 HOH A O     1 
HETATM 6836 O  O     . HOH K 7 .   ? 57.728 26.397  18.700  1.00 21.56  ? 3242 HOH A O     1 
HETATM 6837 O  O     . HOH K 7 .   ? 44.625 70.112  10.907  1.00 22.07  ? 3244 HOH A O     1 
HETATM 6838 O  O     . HOH K 7 .   ? 63.185 54.864  -6.974  1.00 40.08  ? 3246 HOH A O     1 
HETATM 6839 O  O     . HOH K 7 .   ? 28.398 19.406  1.200   1.00 30.33  ? 3248 HOH A O     1 
HETATM 6840 O  O     . HOH K 7 .   ? 79.808 44.595  1.470   1.00 31.78  ? 3250 HOH A O     1 
HETATM 6841 O  O     . HOH K 7 .   ? 77.339 12.397  20.552  1.00 27.46  ? 3251 HOH A O     1 
HETATM 6842 O  O     . HOH K 7 .   ? 75.672 22.847  -7.975  1.00 23.97  ? 3252 HOH A O     1 
HETATM 6843 O  O     . HOH K 7 .   ? 67.896 15.778  -11.689 1.00 20.44  ? 3253 HOH A O     1 
HETATM 6844 O  O     . HOH K 7 .   ? 63.132 31.054  6.547   1.00 15.32  ? 3254 HOH A O     1 
HETATM 6845 O  O     . HOH K 7 .   ? 31.863 18.101  -7.304  1.00 19.54  ? 3255 HOH A O     1 
HETATM 6846 O  O     . HOH K 7 .   ? 77.713 23.693  22.119  1.00 30.10  ? 3256 HOH A O     1 
HETATM 6847 O  O     . HOH K 7 .   ? 58.999 31.177  11.211  1.00 26.00  ? 3258 HOH A O     1 
HETATM 6848 O  O     . HOH K 7 .   ? 78.452 4.158   5.815   1.00 16.49  ? 3259 HOH A O     1 
HETATM 6849 O  O     . HOH K 7 .   ? 85.150 19.089  21.498  1.00 35.64  ? 3260 HOH A O     1 
HETATM 6850 O  O     . HOH K 7 .   ? 62.734 48.225  7.559   1.00 26.24  ? 3261 HOH A O     1 
HETATM 6851 O  O     . HOH K 7 .   ? 61.733 52.181  -11.147 1.00 25.11  ? 3262 HOH A O     1 
HETATM 6852 O  O     . HOH K 7 .   ? 76.402 6.253   -5.169  1.00 17.83  ? 3264 HOH A O     1 
HETATM 6853 O  O     . HOH K 7 .   ? 67.986 12.519  -17.421 1.00 28.08  ? 3265 HOH A O     1 
HETATM 6854 O  O     . HOH K 7 .   ? 63.119 -1.039  9.593   1.00 32.77  ? 3266 HOH A O     1 
HETATM 6855 O  O     . HOH K 7 .   ? 49.250 11.991  -17.727 1.00 16.31  ? 3270 HOH A O     1 
HETATM 6856 O  O     . HOH K 7 .   ? 60.769 3.050   12.735  1.00 24.13  ? 3271 HOH A O     1 
HETATM 6857 O  O     . HOH K 7 .   ? 57.615 38.567  0.065   1.00 11.99  ? 3272 HOH A O     1 
HETATM 6858 O  O     . HOH K 7 .   ? 51.900 23.360  20.575  1.00 20.46  ? 3273 HOH A O     1 
HETATM 6859 O  O     . HOH K 7 .   ? 50.654 6.457   -12.630 1.00 20.36  ? 3275 HOH A O     1 
HETATM 6860 O  O     . HOH K 7 .   ? 76.113 16.813  -5.749  1.00 15.67  ? 3278 HOH A O     1 
HETATM 6861 O  O     . HOH K 7 .   ? 68.989 26.564  5.086   1.00 22.89  ? 3281 HOH A O     1 
HETATM 6862 O  O     . HOH K 7 .   ? 67.192 6.187   -1.899  1.00 30.11  ? 3282 HOH A O     1 
HETATM 6863 O  O     . HOH K 7 .   ? 71.275 15.264  -8.370  1.00 21.29  ? 3283 HOH A O     1 
HETATM 6864 O  O     . HOH K 7 .   ? 71.281 27.979  -12.621 1.00 28.95  ? 3285 HOH A O     1 
HETATM 6865 O  O     . HOH K 7 .   ? 62.677 -2.679  6.412   1.00 38.09  ? 3286 HOH A O     1 
HETATM 6866 O  O     . HOH K 7 .   ? 70.175 29.111  4.962   1.00 23.51  ? 3287 HOH A O     1 
HETATM 6867 O  O     . HOH K 7 .   ? 31.224 61.798  -1.098  1.00 19.58  ? 3288 HOH A O     1 
HETATM 6868 O  O     . HOH K 7 .   ? 46.682 27.561  -20.262 1.00 27.60  ? 3289 HOH A O     1 
HETATM 6869 O  O     . HOH K 7 .   ? 67.214 18.142  -8.213  1.00 17.94  ? 3290 HOH A O     1 
HETATM 6870 O  O     . HOH K 7 .   ? 72.535 19.190  -3.058  1.00 8.78   ? 3294 HOH A O     1 
HETATM 6871 O  O     . HOH K 7 .   ? 36.485 50.492  14.276  1.00 20.22  ? 3295 HOH A O     1 
HETATM 6872 O  O     . HOH K 7 .   ? 66.094 35.415  -16.435 1.00 20.76  ? 3296 HOH A O     1 
HETATM 6873 O  O     . HOH K 7 .   ? 77.538 25.644  11.611  1.00 18.81  ? 3297 HOH A O     1 
HETATM 6874 O  O     . HOH K 7 .   ? 88.016 23.290  17.630  1.00 30.60  ? 3298 HOH A O     1 
HETATM 6875 O  O     . HOH K 7 .   ? 58.815 58.710  -2.666  1.00 35.63  ? 3299 HOH A O     1 
HETATM 6876 O  O     . HOH K 7 .   ? 70.524 30.650  -12.119 1.00 39.73  ? 3300 HOH A O     1 
HETATM 6877 O  O     . HOH K 7 .   ? 59.755 36.466  -23.991 1.00 24.98  ? 3302 HOH A O     1 
HETATM 6878 O  O     . HOH K 7 .   ? 74.351 29.168  3.629   1.00 39.27  ? 3303 HOH A O     1 
HETATM 6879 O  O     . HOH K 7 .   ? 68.354 46.822  -2.659  1.00 32.99  ? 3304 HOH A O     1 
HETATM 6880 O  O     . HOH K 7 .   ? 47.295 25.069  -21.245 1.00 22.21  ? 3305 HOH A O     1 
HETATM 6881 O  O     . HOH K 7 .   ? 75.696 4.465   8.586   1.00 17.83  ? 3309 HOH A O     1 
HETATM 6882 O  O     . HOH K 7 .   ? 55.193 60.474  17.402  1.00 34.13  ? 3310 HOH A O     1 
HETATM 6883 O  O     . HOH K 7 .   ? 86.216 19.403  -15.605 1.00 33.03  ? 3311 HOH A O     1 
HETATM 6884 O  O     . HOH K 7 .   ? 22.020 14.938  8.104   1.00 26.60  ? 3312 HOH A O     1 
HETATM 6885 O  O     . HOH K 7 .   ? 29.842 56.613  12.851  1.00 26.11  ? 3313 HOH A O     1 
HETATM 6886 O  O     . HOH K 7 .   ? 74.142 30.246  0.209   1.00 22.57  ? 3315 HOH A O     1 
HETATM 6887 O  O     . HOH K 7 .   ? 70.862 29.553  15.572  1.00 20.82  ? 3316 HOH A O     1 
HETATM 6888 O  O     . HOH K 7 .   ? 91.195 12.696  16.165  1.00 22.10  ? 3318 HOH A O     1 
HETATM 6889 O  O     . HOH K 7 .   ? 57.037 31.605  -23.731 1.00 20.88  ? 3319 HOH A O     1 
HETATM 6890 O  O     . HOH K 7 .   ? 81.007 20.587  22.353  1.00 35.97  ? 3320 HOH A O     1 
HETATM 6891 O  O     . HOH K 7 .   ? 39.917 7.728   8.596   1.00 21.55  ? 3323 HOH A O     1 
HETATM 6892 O  O     . HOH K 7 .   ? 64.774 39.320  -18.406 1.00 33.65  ? 3325 HOH A O     1 
HETATM 6893 O  O     . HOH K 7 .   ? 29.199 12.002  1.981   1.00 22.49  ? 3326 HOH A O     1 
HETATM 6894 O  O     . HOH K 7 .   ? 63.740 42.949  -17.362 1.00 18.89  ? 3328 HOH A O     1 
HETATM 6895 O  O     . HOH K 7 .   ? 67.709 47.526  -15.115 1.00 30.33  ? 3329 HOH A O     1 
HETATM 6896 O  O     . HOH K 7 .   ? 83.197 48.492  6.944   1.00 30.96  ? 3330 HOH A O     1 
HETATM 6897 O  O     . HOH K 7 .   ? 44.133 19.251  25.579  1.00 28.16  ? 3331 HOH A O     1 
HETATM 6898 O  O     . HOH K 7 .   ? 52.076 1.572   -8.828  1.00 30.55  ? 3332 HOH A O     1 
HETATM 6899 O  O     . HOH K 7 .   ? 68.461 27.641  15.182  1.00 25.97  ? 3333 HOH A O     1 
HETATM 6900 O  O     . HOH K 7 .   ? 62.236 22.479  13.232  1.00 17.47  ? 3334 HOH A O     1 
HETATM 6901 O  O     . HOH K 7 .   ? 67.706 11.532  -6.537  1.00 30.33  ? 3336 HOH A O     1 
HETATM 6902 O  O     . HOH K 7 .   ? 44.006 7.398   -4.955  1.00 22.26  ? 3337 HOH A O     1 
HETATM 6903 O  O     . HOH K 7 .   ? 49.937 6.192   4.569   1.00 13.97  ? 3338 HOH A O     1 
HETATM 6904 O  O     . HOH K 7 .   ? 54.521 5.104   5.942   1.00 31.42  ? 3339 HOH A O     1 
HETATM 6905 O  O     . HOH K 7 .   ? 57.304 4.661   13.727  1.00 21.38  ? 3340 HOH A O     1 
HETATM 6906 O  O     . HOH K 7 .   ? 27.538 12.997  14.766  1.00 24.13  ? 3341 HOH A O     1 
HETATM 6907 O  O     . HOH K 7 .   ? 35.036 32.424  -10.298 1.00 31.37  ? 3342 HOH A O     1 
HETATM 6908 O  O     . HOH K 7 .   ? 56.430 28.786  -27.730 1.00 29.07  ? 3343 HOH A O     1 
HETATM 6909 O  O     . HOH K 7 .   ? 48.318 70.770  -4.066  1.00 25.38  ? 3344 HOH A O     1 
HETATM 6910 O  O     . HOH K 7 .   ? 54.507 16.172  -25.730 1.00 21.55  ? 3345 HOH A O     1 
HETATM 6911 O  O     . HOH K 7 .   ? 47.489 13.242  7.495   1.00 11.42  ? 3347 HOH A O     1 
HETATM 6912 O  O     . HOH K 7 .   ? 78.705 42.430  -12.324 1.00 40.34  ? 3348 HOH A O     1 
HETATM 6913 O  O     . HOH K 7 .   ? 77.451 -1.375  16.474  1.00 26.90  ? 3349 HOH A O     1 
HETATM 6914 O  O     . HOH K 7 .   ? 66.405 15.701  -7.246  1.00 19.35  ? 3350 HOH A O     1 
HETATM 6915 O  O     . HOH K 7 .   ? 46.652 37.150  -17.240 1.00 25.71  ? 3351 HOH A O     1 
HETATM 6916 O  O     . HOH K 7 .   ? 63.804 6.373   4.796   1.00 27.23  ? 3352 HOH A O     1 
HETATM 6917 O  O     . HOH K 7 .   ? 72.365 18.247  -7.730  1.00 27.30  ? 3354 HOH A O     1 
HETATM 6918 O  O     . HOH K 7 .   ? 55.700 59.932  6.800   1.00 33.42  ? 3357 HOH A O     1 
HETATM 6919 O  O     . HOH K 7 .   ? 84.932 10.036  -8.981  1.00 30.02  ? 3358 HOH A O     1 
HETATM 6920 O  O     . HOH K 7 .   ? 82.237 38.161  4.138   1.00 25.37  ? 3360 HOH A O     1 
HETATM 6921 O  O     . HOH K 7 .   ? 61.083 -0.015  2.984   1.00 34.05  ? 3362 HOH A O     1 
HETATM 6922 O  O     . HOH K 7 .   ? 74.819 6.780   17.502  1.00 27.38  ? 3363 HOH A O     1 
HETATM 6923 O  O     . HOH K 7 .   ? 23.977 20.839  10.958  1.00 26.29  ? 3364 HOH A O     1 
HETATM 6924 O  O     . HOH K 7 .   ? 87.554 1.378   1.988   1.00 33.03  ? 3365 HOH A O     1 
HETATM 6925 O  O     . HOH K 7 .   ? 40.314 16.963  31.379  1.00 28.58  ? 3366 HOH A O     1 
HETATM 6926 O  O     . HOH K 7 .   ? 92.150 12.098  3.511   1.00 25.24  ? 3368 HOH A O     1 
HETATM 6927 O  O     . HOH K 7 .   ? 32.001 65.153  8.548   1.00 20.24  ? 3369 HOH A O     1 
HETATM 6928 O  O     . HOH K 7 .   ? 56.026 10.613  -21.885 1.00 38.73  ? 3370 HOH A O     1 
HETATM 6929 O  O     . HOH K 7 .   ? 68.890 37.909  2.072   1.00 34.44  ? 3371 HOH A O     1 
HETATM 6930 O  O     . HOH K 7 .   ? 73.614 35.446  -10.387 1.00 30.26  ? 3372 HOH A O     1 
HETATM 6931 O  O     . HOH K 7 .   ? 68.725 -2.742  20.794  1.00 27.87  ? 3373 HOH A O     1 
HETATM 6932 O  O     . HOH K 7 .   ? 58.859 27.505  -3.858  1.00 11.03  ? 3376 HOH A O     1 
HETATM 6933 O  O     . HOH K 7 .   ? 59.732 22.275  11.015  1.00 26.29  ? 3381 HOH A O     1 
HETATM 6934 O  O     . HOH K 7 .   ? 42.604 19.396  -15.503 1.00 40.19  ? 3383 HOH A O     1 
HETATM 6935 O  O     . HOH K 7 .   ? 76.334 35.415  -2.209  1.00 30.21  ? 3384 HOH A O     1 
HETATM 6936 O  O     . HOH K 7 .   ? 67.033 41.820  2.565   1.00 30.94  ? 3385 HOH A O     1 
HETATM 6937 O  O     . HOH K 7 .   ? 24.440 25.820  11.951  1.00 31.51  ? 3387 HOH A O     1 
HETATM 6938 O  O     . HOH K 7 .   ? 74.438 13.101  21.148  1.00 26.77  ? 3388 HOH A O     1 
HETATM 6939 O  O     . HOH K 7 .   ? 30.357 11.833  -9.936  1.00 32.18  ? 3389 HOH A O     1 
HETATM 6940 O  O     . HOH K 7 .   ? 83.450 13.825  19.476  1.00 30.58  ? 3391 HOH A O     1 
HETATM 6941 O  O     . HOH K 7 .   ? 53.920 64.101  26.536  1.00 38.95  ? 3392 HOH A O     1 
HETATM 6942 O  O     . HOH K 7 .   ? 54.857 62.473  24.026  1.00 27.52  ? 3393 HOH A O     1 
HETATM 6943 O  O     . HOH K 7 .   ? 47.772 22.432  25.782  1.00 30.76  ? 3394 HOH A O     1 
HETATM 6944 O  O     . HOH K 7 .   ? 44.942 51.588  -7.777  1.00 22.15  ? 3396 HOH A O     1 
HETATM 6945 O  O     . HOH K 7 .   ? 36.668 58.925  -3.935  1.00 24.67  ? 3397 HOH A O     1 
HETATM 6946 O  O     . HOH K 7 .   ? 75.340 9.858   21.758  1.00 33.54  ? 3399 HOH A O     1 
HETATM 6947 O  O     . HOH K 7 .   ? 65.117 24.142  -28.169 1.00 37.54  ? 3400 HOH A O     1 
HETATM 6948 O  O     . HOH K 7 .   ? 50.610 30.818  -6.230  1.00 10.96  ? 3402 HOH A O     1 
HETATM 6949 O  O     . HOH K 7 .   ? 62.814 18.306  7.244   1.00 8.21   ? 3403 HOH A O     1 
HETATM 6950 O  O     . HOH K 7 .   ? 60.279 29.794  -3.801  1.00 11.50  ? 3406 HOH A O     1 
HETATM 6951 O  O     . HOH K 7 .   ? 70.486 19.456  -4.959  1.00 19.02  ? 3407 HOH A O     1 
HETATM 6952 O  O     . HOH K 7 .   ? 70.317 22.130  3.498   1.00 14.03  ? 3408 HOH A O     1 
HETATM 6953 O  O     . HOH K 7 .   ? 67.471 21.792  3.108   1.00 13.44  ? 3409 HOH A O     1 
HETATM 6954 O  O     . HOH K 7 .   ? 51.227 43.373  -2.581  1.00 21.34  ? 3411 HOH A O     1 
HETATM 6955 O  O     . HOH K 7 .   ? 49.557 21.070  13.622  1.00 21.11  ? 3412 HOH A O     1 
HETATM 6956 O  O     . HOH K 7 .   ? 32.481 25.747  10.745  1.00 20.83  ? 3414 HOH A O     1 
HETATM 6957 O  O     . HOH K 7 .   ? 65.967 14.476  -4.721  1.00 14.88  ? 3415 HOH A O     1 
HETATM 6958 O  O     . HOH K 7 .   ? 43.979 16.060  -6.329  1.00 13.46  ? 3416 HOH A O     1 
HETATM 6959 O  O     . HOH K 7 .   ? 36.132 18.228  -7.983  1.00 19.11  ? 3417 HOH A O     1 
HETATM 6960 O  O     . HOH K 7 .   ? 65.982 27.017  4.428   1.00 21.97  ? 3418 HOH A O     1 
HETATM 6961 O  O     . HOH K 7 .   ? 65.820 21.995  5.349   1.00 11.39  ? 3420 HOH A O     1 
HETATM 6962 O  O     . HOH K 7 .   ? 92.683 18.363  -11.143 1.00 30.52  ? 3422 HOH A O     1 
HETATM 6963 O  O     . HOH K 7 .   ? 61.124 27.327  11.813  1.00 20.68  ? 3424 HOH A O     1 
HETATM 6964 O  O     . HOH K 7 .   ? 51.831 62.018  -9.340  1.00 28.24  ? 3425 HOH A O     1 
HETATM 6965 O  O     . HOH K 7 .   ? 89.538 5.835   2.364   1.00 18.71  ? 3427 HOH A O     1 
HETATM 6966 O  O     . HOH K 7 .   ? 40.696 69.319  7.499   1.00 29.51  ? 3428 HOH A O     1 
HETATM 6967 O  O     . HOH K 7 .   ? 49.852 21.377  0.092   1.00 14.15  ? 3429 HOH A O     1 
HETATM 6968 O  O     . HOH K 7 .   ? 50.305 10.683  -20.083 1.00 29.03  ? 3430 HOH A O     1 
HETATM 6969 O  O     . HOH K 7 .   ? 64.466 21.878  14.841  1.00 20.19  ? 3431 HOH A O     1 
HETATM 6970 O  O     . HOH K 7 .   ? 58.999 33.025  -28.112 1.00 30.32  ? 3432 HOH A O     1 
HETATM 6971 O  O     . HOH K 7 .   ? 33.998 58.852  17.944  1.00 33.17  ? 3433 HOH A O     1 
HETATM 6972 O  O     . HOH K 7 .   ? 46.452 56.850  10.488  1.00 29.25  ? 3435 HOH A O     1 
HETATM 6973 O  O     . HOH K 7 .   ? 59.001 6.096   -3.294  1.00 22.00  ? 3437 HOH A O     1 
HETATM 6974 O  O     . HOH K 7 .   ? 69.331 27.134  11.778  1.00 18.99  ? 3438 HOH A O     1 
HETATM 6975 O  O     . HOH K 7 .   ? 88.125 11.472  9.513   1.00 22.72  ? 3439 HOH A O     1 
HETATM 6976 O  O     . HOH K 7 .   ? 48.043 17.772  -20.172 1.00 39.53  ? 3440 HOH A O     1 
HETATM 6977 O  O     . HOH K 7 .   ? 47.796 18.059  28.721  1.00 48.01  ? 3441 HOH A O     1 
HETATM 6978 O  O     . HOH K 7 .   ? 32.409 50.458  9.694   1.00 22.40  ? 3445 HOH A O     1 
HETATM 6979 O  O     . HOH K 7 .   ? 59.100 28.299  -27.181 1.00 37.54  ? 3446 HOH A O     1 
HETATM 6980 O  O     . HOH K 7 .   ? 79.821 9.227   -7.833  1.00 28.20  ? 3447 HOH A O     1 
HETATM 6981 O  O     . HOH K 7 .   ? 72.353 7.546   18.512  1.00 24.05  ? 3448 HOH A O     1 
HETATM 6982 O  O     . HOH K 7 .   ? 63.919 50.272  -4.841  1.00 27.73  ? 3449 HOH A O     1 
HETATM 6983 O  O     . HOH K 7 .   ? 55.910 59.454  -8.170  1.00 28.04  ? 3450 HOH A O     1 
HETATM 6984 O  O     . HOH K 7 .   ? 59.927 46.902  4.855   1.00 25.29  ? 3452 HOH A O     1 
HETATM 6985 O  O     . HOH K 7 .   ? 68.622 35.559  -2.868  1.00 23.58  ? 3453 HOH A O     1 
HETATM 6986 O  O     . HOH K 7 .   ? 41.223 9.289   10.935  1.00 26.56  ? 3454 HOH A O     1 
HETATM 6987 O  O     . HOH K 7 .   ? 89.716 7.662   7.291   1.00 25.10  ? 3455 HOH A O     1 
HETATM 6988 O  O     . HOH K 7 .   ? 76.015 27.065  -7.805  1.00 22.40  ? 3456 HOH A O     1 
HETATM 6989 O  O     . HOH K 7 .   ? 40.813 71.389  5.535   1.00 27.90  ? 3457 HOH A O     1 
HETATM 6990 O  O     . HOH K 7 .   ? 59.792 9.315   19.498  1.00 13.31  ? 3458 HOH A O     1 
HETATM 6991 O  O     . HOH K 7 .   ? 47.014 13.454  -19.147 1.00 25.48  ? 3459 HOH A O     1 
HETATM 6992 O  O     . HOH K 7 .   ? 61.569 39.237  -20.988 1.00 30.56  ? 3460 HOH A O     1 
HETATM 6993 O  O     . HOH K 7 .   ? 37.789 9.891   -12.787 1.00 25.91  ? 3461 HOH A O     1 
HETATM 6994 O  O     . HOH K 7 .   ? 46.807 17.194  -16.647 1.00 35.84  ? 3463 HOH A O     1 
HETATM 6995 O  O     . HOH K 7 .   ? 48.704 15.629  28.106  1.00 48.01  ? 3464 HOH A O     1 
HETATM 6996 O  O     . HOH K 7 .   ? 39.242 19.931  14.588  1.00 18.24  ? 3465 HOH A O     1 
HETATM 6997 O  O     . HOH K 7 .   ? 82.482 29.286  5.845   1.00 28.57  ? 3467 HOH A O     1 
HETATM 6998 O  O     . HOH K 7 .   ? 91.542 25.841  -1.365  1.00 30.01  ? 3470 HOH A O     1 
HETATM 6999 O  O     . HOH K 7 .   ? 50.971 25.601  -28.556 1.00 35.33  ? 3472 HOH A O     1 
HETATM 7000 O  O     . HOH K 7 .   ? 62.769 28.906  -4.858  1.00 9.79   ? 3473 HOH A O     1 
HETATM 7001 O  O     . HOH K 7 .   ? 70.123 12.566  -13.097 1.00 23.37  ? 3474 HOH A O     1 
HETATM 7002 O  O     . HOH K 7 .   ? 62.922 19.076  -30.250 1.00 30.72  ? 3475 HOH A O     1 
HETATM 7003 O  O     . HOH K 7 .   ? 57.905 70.015  13.440  1.00 37.64  ? 3477 HOH A O     1 
HETATM 7004 O  O     . HOH K 7 .   ? 54.949 72.035  36.123  1.00 33.16  ? 3478 HOH A O     1 
HETATM 7005 O  O     . HOH K 7 .   ? 46.454 59.450  -10.576 1.00 27.94  ? 3479 HOH A O     1 
HETATM 7006 O  O     . HOH K 7 .   ? 70.240 27.502  -2.577  1.00 17.52  ? 3480 HOH A O     1 
HETATM 7007 O  O     . HOH K 7 .   ? 66.170 13.899  18.654  1.00 30.25  ? 3481 HOH A O     1 
HETATM 7008 O  O     . HOH K 7 .   ? 93.368 25.728  14.279  1.00 30.59  ? 3482 HOH A O     1 
HETATM 7009 O  O     . HOH K 7 .   ? 72.067 27.709  2.888   1.00 19.17  ? 3483 HOH A O     1 
HETATM 7010 O  O     . HOH K 7 .   ? 58.679 13.924  15.568  1.00 14.94  ? 3485 HOH A O     1 
HETATM 7011 O  O     . HOH K 7 .   ? 41.732 22.066  -10.347 1.00 30.70  ? 3486 HOH A O     1 
HETATM 7012 O  O     . HOH K 7 .   ? 67.587 29.904  3.663   1.00 22.65  ? 3487 HOH A O     1 
HETATM 7013 O  O     . HOH K 7 .   ? 44.900 77.713  37.606  1.00 37.55  ? 3489 HOH A O     1 
HETATM 7014 O  O     . HOH K 7 .   ? 40.746 35.255  8.699   1.00 24.79  ? 3490 HOH A O     1 
HETATM 7015 O  O     . HOH K 7 .   ? 48.319 48.894  -14.302 1.00 26.76  ? 3492 HOH A O     1 
HETATM 7016 O  O     . HOH K 7 .   ? 39.915 65.962  -2.920  1.00 33.25  ? 3493 HOH A O     1 
HETATM 7017 O  O     . HOH K 7 .   ? 42.386 69.915  33.134  1.00 41.13  ? 3495 HOH A O     1 
HETATM 7018 O  O     . HOH K 7 .   ? 83.225 5.426   6.912   1.00 25.25  ? 3496 HOH A O     1 
HETATM 7019 O  O     . HOH K 7 .   ? 78.439 35.893  -0.147  1.00 28.72  ? 3497 HOH A O     1 
HETATM 7020 O  O     . HOH K 7 .   ? 68.351 43.474  -6.990  1.00 28.11  ? 3498 HOH A O     1 
HETATM 7021 O  O     . HOH K 7 .   ? 56.894 57.808  -10.455 1.00 19.13  ? 3500 HOH A O     1 
HETATM 7022 O  O     . HOH K 7 .   ? 41.514 4.612   4.423   1.00 34.57  ? 3501 HOH A O     1 
HETATM 7023 O  O     . HOH K 7 .   ? 93.308 15.418  -5.100  1.00 21.61  ? 3502 HOH A O     1 
HETATM 7024 O  O     . HOH K 7 .   ? 69.699 22.807  -23.324 1.00 22.96  ? 3503 HOH A O     1 
HETATM 7025 O  O     . HOH K 7 .   ? 68.100 38.291  -17.414 1.00 26.59  ? 3505 HOH A O     1 
HETATM 7026 O  O     . HOH K 7 .   ? 45.233 42.176  -12.151 1.00 23.59  ? 3506 HOH A O     1 
HETATM 7027 O  O     . HOH K 7 .   ? 87.297 8.699   3.143   1.00 15.68  ? 3508 HOH A O     1 
HETATM 7028 O  O     . HOH K 7 .   ? 54.867 62.530  -2.186  1.00 26.42  ? 3509 HOH A O     1 
HETATM 7029 O  O     . HOH K 7 .   ? 56.157 33.719  -30.655 1.00 27.94  ? 3512 HOH A O     1 
HETATM 7030 O  O     . HOH K 7 .   ? 40.225 60.463  17.781  1.00 24.77  ? 3516 HOH A O     1 
HETATM 7031 O  O     . HOH K 7 .   ? 46.114 23.175  23.152  1.00 31.61  ? 3517 HOH A O     1 
HETATM 7032 O  O     . HOH K 7 .   ? 34.372 6.375   -3.875  1.00 27.04  ? 3520 HOH A O     1 
HETATM 7033 O  O     . HOH K 7 .   ? 75.003 30.904  10.044  1.00 20.18  ? 3521 HOH A O     1 
HETATM 7034 O  O     . HOH K 7 .   ? 61.596 54.807  -9.605  1.00 31.90  ? 3523 HOH A O     1 
HETATM 7035 O  O     . HOH K 7 .   ? 72.531 29.372  -9.166  1.00 25.68  ? 3524 HOH A O     1 
HETATM 7036 O  O     . HOH K 7 .   ? 47.933 9.820   -15.809 1.00 23.21  ? 3525 HOH A O     1 
HETATM 7037 O  O     . HOH K 7 .   ? 48.449 15.653  -18.456 1.00 24.52  ? 3527 HOH A O     1 
HETATM 7038 O  O     . HOH K 7 .   ? 48.817 38.268  -18.711 1.00 25.78  ? 3528 HOH A O     1 
HETATM 7039 O  O     . HOH K 7 .   ? 80.273 14.595  19.174  1.00 22.74  ? 3529 HOH A O     1 
HETATM 7040 O  O     . HOH K 7 .   ? 52.378 66.447  32.625  1.00 24.14  ? 3530 HOH A O     1 
HETATM 7041 O  O     . HOH K 7 .   ? 80.152 2.928   13.966  1.00 26.58  ? 3531 HOH A O     1 
HETATM 7042 O  O     . HOH K 7 .   ? 80.372 25.740  8.525   1.00 9.06   ? 3532 HOH A O     1 
HETATM 7043 O  O     . HOH K 7 .   ? 77.643 23.987  9.585   1.00 15.47  ? 3533 HOH A O     1 
HETATM 7044 O  O     . HOH K 7 .   ? 77.541 22.796  6.818   1.00 20.68  ? 3534 HOH A O     1 
HETATM 7045 O  O     . HOH K 7 .   ? 79.908 24.512  5.564   1.00 17.86  ? 3535 HOH A O     1 
HETATM 7046 O  O     . HOH K 7 .   ? 60.759 60.111  17.412  1.00 31.14  ? 3537 HOH A O     1 
HETATM 7047 O  O     . HOH K 7 .   ? 69.886 21.689  26.019  1.00 19.70  ? 3538 HOH A O     1 
HETATM 7048 O  O     . HOH K 7 .   ? 79.715 24.832  20.477  1.00 23.46  ? 3539 HOH A O     1 
HETATM 7049 O  O     . HOH K 7 .   ? 90.713 8.175   -1.613  1.00 25.67  ? 3540 HOH A O     1 
HETATM 7050 O  O     . HOH K 7 .   ? 83.255 7.857   -5.414  1.00 26.09  ? 3541 HOH A O     1 
HETATM 7051 O  O     . HOH K 7 .   ? 82.041 13.025  -7.796  1.00 23.08  ? 3542 HOH A O     1 
HETATM 7052 O  O     . HOH K 7 .   ? 45.167 6.132   -11.147 1.00 24.86  ? 3543 HOH A O     1 
HETATM 7053 O  O     . HOH K 7 .   ? 47.357 34.230  -9.459  1.00 18.60  ? 3545 HOH A O     1 
HETATM 7054 O  O     . HOH L 7 .   ? 42.196 82.117  20.102  1.00 5.22   ? 3008 HOH B O     1 
HETATM 7055 O  O     . HOH L 7 .   ? 48.148 81.351  7.011   1.00 33.43  ? 3034 HOH B O     1 
HETATM 7056 O  O     . HOH L 7 .   ? 60.041 79.560  17.183  1.00 27.08  ? 3081 HOH B O     1 
HETATM 7057 O  O     . HOH L 7 .   ? 45.977 85.347  6.277   1.00 16.87  ? 3100 HOH B O     1 
HETATM 7058 O  O     . HOH L 7 .   ? 40.912 72.993  11.624  1.00 24.90  ? 3127 HOH B O     1 
HETATM 7059 O  O     . HOH L 7 .   ? 41.357 82.391  23.733  1.00 32.89  ? 3135 HOH B O     1 
HETATM 7060 O  O     . HOH L 7 .   ? 46.408 99.736  8.772   1.00 32.45  ? 3138 HOH B O     1 
HETATM 7061 O  O     . HOH L 7 .   ? 45.467 80.614  25.836  1.00 20.37  ? 3148 HOH B O     1 
HETATM 7062 O  O     . HOH L 7 .   ? 63.007 89.618  29.655  1.00 29.20  ? 3153 HOH B O     1 
HETATM 7063 O  O     . HOH L 7 .   ? 43.419 70.139  28.806  1.00 26.03  ? 3160 HOH B O     1 
HETATM 7064 O  O     . HOH L 7 .   ? 40.773 80.736  8.712   1.00 16.18  ? 3181 HOH B O     1 
HETATM 7065 O  O     . HOH L 7 .   ? 62.303 79.906  14.599  1.00 33.70  ? 3188 HOH B O     1 
HETATM 7066 O  O     . HOH L 7 .   ? 39.427 79.141  11.573  1.00 25.43  ? 3219 HOH B O     1 
HETATM 7067 O  O     . HOH L 7 .   ? 39.579 89.461  14.139  1.00 26.49  ? 3235 HOH B O     1 
HETATM 7068 O  O     . HOH L 7 .   ? 58.170 103.055 22.705  1.00 43.09  ? 3243 HOH B O     1 
HETATM 7069 O  O     . HOH L 7 .   ? 62.617 99.984  19.526  1.00 33.23  ? 3247 HOH B O     1 
HETATM 7070 O  O     . HOH L 7 .   ? 64.050 90.433  23.108  1.00 31.14  ? 3263 HOH B O     1 
HETATM 7071 O  O     . HOH L 7 .   ? 40.248 80.484  2.403   1.00 23.35  ? 3267 HOH B O     1 
HETATM 7072 O  O     . HOH L 7 .   ? 64.078 84.651  19.746  1.00 36.88  ? 3269 HOH B O     1 
HETATM 7073 O  O     . HOH L 7 .   ? 46.457 96.152  23.748  1.00 29.74  ? 3279 HOH B O     1 
HETATM 7074 O  O     . HOH L 7 .   ? 38.691 78.969  5.841   1.00 26.97  ? 3292 HOH B O     1 
HETATM 7075 O  O     . HOH L 7 .   ? 42.903 72.149  36.162  1.00 33.65  ? 3307 HOH B O     1 
HETATM 7076 O  O     . HOH L 7 .   ? 51.920 86.540  36.891  1.00 32.10  ? 3317 HOH B O     1 
HETATM 7077 O  O     . HOH L 7 .   ? 58.938 86.603  38.030  1.00 41.96  ? 3359 HOH B O     1 
HETATM 7078 O  O     . HOH L 7 .   ? 49.442 79.257  3.064   1.00 26.21  ? 3361 HOH B O     1 
HETATM 7079 O  O     . HOH L 7 .   ? 38.588 89.086  17.634  1.00 30.43  ? 3374 HOH B O     1 
HETATM 7080 O  O     . HOH L 7 .   ? 63.912 87.619  22.251  1.00 33.23  ? 3375 HOH B O     1 
HETATM 7081 O  O     . HOH L 7 .   ? 42.831 81.877  1.822   1.00 28.38  ? 3380 HOH B O     1 
HETATM 7082 O  O     . HOH L 7 .   ? 65.846 89.449  33.284  1.00 33.56  ? 3382 HOH B O     1 
HETATM 7083 O  O     . HOH L 7 .   ? 48.983 77.105  13.110  1.00 22.32  ? 3386 HOH B O     1 
HETATM 7084 O  O     . HOH L 7 .   ? 42.416 81.442  17.121  1.00 16.58  ? 3390 HOH B O     1 
HETATM 7085 O  O     . HOH L 7 .   ? 43.169 73.497  21.114  1.00 27.85  ? 3395 HOH B O     1 
HETATM 7086 O  O     . HOH L 7 .   ? 45.105 73.712  35.166  1.00 29.81  ? 3434 HOH B O     1 
HETATM 7087 O  O     . HOH L 7 .   ? 66.170 89.930  28.357  1.00 24.02  ? 3442 HOH B O     1 
HETATM 7088 O  O     . HOH L 7 .   ? 44.491 87.921  5.923   1.00 18.37  ? 3484 HOH B O     1 
HETATM 7089 O  O     . HOH L 7 .   ? 47.459 71.308  15.870  1.00 23.06  ? 3491 HOH B O     1 
HETATM 7090 O  O     . HOH L 7 .   ? 45.001 89.993  26.107  1.00 42.27  ? 3499 HOH B O     1 
HETATM 7091 O  O     . HOH L 7 .   ? 45.175 95.611  9.556   1.00 30.28  ? 3514 HOH B O     1 
HETATM 7092 O  O     . HOH L 7 .   ? 44.616 93.578  22.527  1.00 24.15  ? 3544 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   12  12  DG  G   P . n 
A 1 2   DC  2   13  13  DC  C   P . n 
A 1 3   DC  3   14  14  DC  C   P . n 
A 1 4   DA  4   15  15  DA  A   P . n 
A 1 5   DG  5   16  16  DG  G   P . n 
A 1 6   DT  6   17  17  DT  T   P . n 
A 1 7   DG  7   18  18  DG  G   P . n 
A 1 8   DC  8   19  19  DC  C   P . n 
A 1 9   DC  9   20  20  DC  C   P . n 
A 1 10  DA  10  21  21  DA  A   P . n 
A 1 11  2DA 11  22  22  2DA 2DA P . n 
B 2 1   DC  1   3   3   DC  C   T . n 
B 2 2   DC  2   4   4   DC  C   T . n 
B 2 3   DT  3   5   5   DT  T   T . n 
B 2 4   DT  4   6   6   DT  T   T . n 
B 2 5   DG  5   7   7   DG  G   T . n 
B 2 6   DG  6   8   8   DG  G   T . n 
B 2 7   DC  7   9   9   DC  C   T . n 
B 2 8   DA  8   10  10  DA  A   T . n 
B 2 9   DC  9   11  11  DC  C   T . n 
B 2 10  DT  10  12  12  DT  T   T . n 
B 2 11  DG  11  13  13  DG  G   T . n 
B 2 12  DG  12  14  14  DG  G   T . n 
B 2 13  DC  13  15  15  DC  C   T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   SER 4   4   4   SER SER A . n 
C 3 5   ASP 5   5   5   ASP ASP A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   ALA 8   8   8   ALA ALA A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  GLU 13  13  13  GLU GLU A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  LYS 17  17  17  LYS LYS A . n 
C 3 18  PHE 18  18  18  PHE PHE A . n 
C 3 19  HIS 19  19  19  HIS HIS A . n 
C 3 20  CYS 20  20  20  CYS CYS A . n 
C 3 21  GLY 21  21  21  GLY GLY A . n 
C 3 22  VAL 22  22  22  VAL VAL A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  TYR 24  24  24  TYR TYR A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  TYR 26  26  26  TYR TYR A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ALA 29  29  29  ALA ALA A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  TYR 31  31  31  TYR TYR A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  SER 33  33  33  SER SER A . n 
C 3 34  TYR 34  34  34  TYR TYR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  PRO 36  36  36  PRO PRO A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  ASP 38  38  38  ASP ASP A . n 
C 3 39  PHE 39  39  39  PHE PHE A . n 
C 3 40  GLY 40  40  40  GLY GLY A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  LEU 43  43  43  LEU LEU A . n 
C 3 44  ASP 44  44  44  ASP ASP A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  LEU 46  46  46  LEU LEU A . n 
C 3 47  GLU 47  47  47  GLU GLU A . n 
C 3 48  ALA 48  48  48  ALA ALA A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  VAL 50  50  50  VAL VAL A . n 
C 3 51  ALA 51  51  51  ALA ALA A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  GLY 53  53  53  GLY GLY A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  ILE 56  56  56  ILE ILE A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  HIS 59  59  59  HIS HIS A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  GLY 61  61  61  GLY GLY A . n 
C 3 62  HIS 62  62  62  HIS HIS A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  TYR 64  64  64  TYR TYR A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  PRO 67  67  67  PRO PRO A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  THR 70  70  70  THR THR A . n 
C 3 71  LYS 71  71  71  LYS LYS A . n 
C 3 72  LEU 72  72  72  LEU LEU A . n 
C 3 73  ALA 73  73  73  ALA ALA A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  GLN 76  76  76  GLN GLN A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ASN 78  78  78  ASN ASN A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  GLU 80  80  80  GLU GLU A . n 
C 3 81  PHE 81  81  81  PHE PHE A . n 
C 3 82  HIS 82  82  82  HIS HIS A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  PRO 84  84  84  PRO PRO A . n 
C 3 85  ARG 85  85  85  ARG ARG A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  ASN 87  87  87  ASN ASN A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  ILE 89  89  89  ILE ILE A . n 
C 3 90  ASP 90  90  90  ASP ASP A . n 
C 3 91  THR 91  91  91  THR THR A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  VAL 93  93  93  VAL VAL A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  LEU 97  97  97  LEU LEU A . n 
C 3 98  ILE 98  98  98  ILE ILE A . n 
C 3 99  HIS 99  99  99  HIS HIS A . n 
C 3 100 SER 100 100 100 SER SER A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 LYS 103 103 103 LYS LYS A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 THR 105 105 105 THR THR A . n 
C 3 106 ASP 106 106 106 ASP ASP A . n 
C 3 107 MET 107 107 107 MET MET A . n 
C 3 108 GLY 108 108 108 GLY GLY A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 LEU 110 110 110 LEU LEU A . n 
C 3 111 ARG 111 111 111 ARG ARG A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 GLY 113 113 113 GLY GLY A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 PRO 116 116 116 PRO PRO A . n 
C 3 117 GLY 117 117 117 GLY GLY A . n 
C 3 118 ALA 118 124 124 ALA ALA A . n 
C 3 119 LEU 119 125 125 LEU LEU A . n 
C 3 120 GLU 120 126 126 GLU GLU A . n 
C 3 121 ALA 121 127 127 ALA ALA A . n 
C 3 122 TRP 122 128 128 TRP TRP A . n 
C 3 123 GLY 123 129 129 GLY GLY A . n 
C 3 124 TYR 124 130 130 TYR TYR A . n 
C 3 125 ARG 125 131 131 ARG ARG A . n 
C 3 126 LEU 126 132 132 LEU LEU A . n 
C 3 127 GLY 127 133 133 GLY GLY A . n 
C 3 128 GLU 128 134 134 GLU GLU A . n 
C 3 129 MET 129 135 135 MET MET A . n 
C 3 130 LYS 130 136 136 LYS LYS A . n 
C 3 131 GLY 131 137 137 GLY GLY A . n 
C 3 132 GLU 132 138 138 GLU GLU A . n 
C 3 133 TYR 133 139 139 TYR TYR A . n 
C 3 134 LYS 134 140 140 LYS LYS A . n 
C 3 135 ASP 135 141 141 ASP ASP A . n 
C 3 136 ASP 136 142 142 ASP ASP A . n 
C 3 137 PHE 137 143 143 PHE PHE A . n 
C 3 138 LYS 138 144 144 LYS LYS A . n 
C 3 139 ARG 139 145 145 ARG ARG A . n 
C 3 140 MET 140 146 146 MET MET A . n 
C 3 141 LEU 141 147 147 LEU LEU A . n 
C 3 142 GLU 142 148 148 GLU GLU A . n 
C 3 143 GLU 143 149 149 GLU GLU A . n 
C 3 144 GLN 144 150 150 GLN GLN A . n 
C 3 145 GLY 145 151 151 GLY GLY A . n 
C 3 146 GLU 146 152 152 GLU GLU A . n 
C 3 147 GLU 147 153 153 GLU GLU A . n 
C 3 148 TYR 148 154 154 TYR TYR A . n 
C 3 149 VAL 149 155 155 VAL VAL A . n 
C 3 150 ASP 150 156 156 ASP ASP A . n 
C 3 151 GLY 151 157 157 GLY GLY A . n 
C 3 152 MET 152 158 158 MET MET A . n 
C 3 153 GLU 153 159 159 GLU GLU A . n 
C 3 154 TRP 154 160 160 TRP TRP A . n 
C 3 155 TRP 155 161 161 TRP TRP A . n 
C 3 156 ASN 156 162 162 ASN ASN A . n 
C 3 157 PHE 157 163 163 PHE PHE A . n 
C 3 158 ASN 158 164 164 ASN ASN A . n 
C 3 159 GLU 159 165 165 GLU GLU A . n 
C 3 160 GLU 160 166 166 GLU GLU A . n 
C 3 161 MET 161 167 167 MET MET A . n 
C 3 162 MET 162 168 168 MET MET A . n 
C 3 163 ASP 163 169 169 ASP ASP A . n 
C 3 164 TYR 164 170 170 TYR TYR A . n 
C 3 165 ASN 165 171 171 ASN ASN A . n 
C 3 166 VAL 166 172 172 VAL VAL A . n 
C 3 167 GLN 167 173 173 GLN GLN A . n 
C 3 168 ASP 168 174 174 ASP ASP A . n 
C 3 169 VAL 169 175 175 VAL VAL A . n 
C 3 170 VAL 170 176 176 VAL VAL A . n 
C 3 171 VAL 171 177 177 VAL VAL A . n 
C 3 172 THR 172 178 178 THR THR A . n 
C 3 173 LYS 173 179 179 LYS LYS A . n 
C 3 174 ALA 174 180 180 ALA ALA A . n 
C 3 175 LEU 175 181 181 LEU LEU A . n 
C 3 176 LEU 176 182 182 LEU LEU A . n 
C 3 177 GLU 177 183 183 GLU GLU A . n 
C 3 178 LYS 178 184 184 LYS LYS A . n 
C 3 179 LEU 179 185 185 LEU LEU A . n 
C 3 180 LEU 180 186 186 LEU LEU A . n 
C 3 181 SER 181 187 187 SER SER A . n 
C 3 182 ASP 182 188 188 ASP ASP A . n 
C 3 183 LYS 183 189 189 LYS LYS A . n 
C 3 184 HIS 184 190 190 HIS HIS A . n 
C 3 185 TYR 185 191 191 TYR TYR A . n 
C 3 186 PHE 186 192 192 PHE PHE A . n 
C 3 187 PRO 187 193 193 PRO PRO A . n 
C 3 188 PRO 188 194 194 PRO PRO A . n 
C 3 189 GLU 189 195 195 GLU GLU A . n 
C 3 190 ILE 190 196 196 ILE ILE A . n 
C 3 191 ASP 191 197 197 ASP ASP A . n 
C 3 192 PHE 192 198 198 PHE PHE A . n 
C 3 193 THR 193 199 199 THR THR A . n 
C 3 194 ASP 194 200 200 ASP ASP A . n 
C 3 195 VAL 195 201 201 VAL VAL A . n 
C 3 196 GLY 196 202 202 GLY GLY A . n 
C 3 197 TYR 197 203 203 TYR TYR A . n 
C 3 198 THR 198 204 204 THR THR A . n 
C 3 199 THR 199 205 205 THR THR A . n 
C 3 200 PHE 200 206 206 PHE PHE A . n 
C 3 201 TRP 201 207 207 TRP TRP A . n 
C 3 202 SER 202 208 208 SER SER A . n 
C 3 203 GLU 203 209 209 GLU GLU A . n 
C 3 204 SER 204 210 210 SER SER A . n 
C 3 205 LEU 205 211 211 LEU LEU A . n 
C 3 206 GLU 206 212 212 GLU GLU A . n 
C 3 207 ALA 207 213 213 ALA ALA A . n 
C 3 208 VAL 208 214 214 VAL VAL A . n 
C 3 209 ASP 209 215 215 ASP ASP A . n 
C 3 210 ILE 210 216 216 ILE ILE A . n 
C 3 211 GLU 211 217 217 GLU GLU A . n 
C 3 212 HIS 212 218 218 HIS HIS A . n 
C 3 213 ARG 213 219 219 ARG ARG A . n 
C 3 214 ALA 214 220 220 ALA ALA A . n 
C 3 215 ALA 215 221 221 ALA ALA A . n 
C 3 216 TRP 216 222 222 TRP TRP A . n 
C 3 217 LEU 217 223 223 LEU LEU A . n 
C 3 218 LEU 218 224 224 LEU LEU A . n 
C 3 219 ALA 219 225 225 ALA ALA A . n 
C 3 220 LYS 220 226 226 LYS LYS A . n 
C 3 221 GLN 221 227 227 GLN GLN A . n 
C 3 222 GLU 222 228 228 GLU GLU A . n 
C 3 223 ARG 223 229 229 ARG ARG A . n 
C 3 224 ASN 224 230 230 ASN ASN A . n 
C 3 225 GLY 225 231 231 GLY GLY A . n 
C 3 226 PHE 226 232 232 PHE PHE A . n 
C 3 227 PRO 227 233 233 PRO PRO A . n 
C 3 228 PHE 228 234 234 PHE PHE A . n 
C 3 229 ASP 229 235 235 ASP ASP A . n 
C 3 230 THR 230 236 236 THR THR A . n 
C 3 231 LYS 231 237 237 LYS LYS A . n 
C 3 232 ALA 232 238 238 ALA ALA A . n 
C 3 233 ILE 233 239 239 ILE ILE A . n 
C 3 234 GLU 234 240 240 GLU GLU A . n 
C 3 235 GLU 235 241 241 GLU GLU A . n 
C 3 236 LEU 236 242 242 LEU LEU A . n 
C 3 237 TYR 237 243 243 TYR TYR A . n 
C 3 238 VAL 238 244 244 VAL VAL A . n 
C 3 239 GLU 239 245 245 GLU GLU A . n 
C 3 240 LEU 240 246 246 LEU LEU A . n 
C 3 241 ALA 241 247 247 ALA ALA A . n 
C 3 242 ALA 242 248 248 ALA ALA A . n 
C 3 243 ARG 243 249 249 ARG ARG A . n 
C 3 244 ARG 244 250 250 ARG ARG A . n 
C 3 245 SER 245 251 251 SER SER A . n 
C 3 246 GLU 246 252 252 GLU GLU A . n 
C 3 247 LEU 247 253 253 LEU LEU A . n 
C 3 248 LEU 248 254 254 LEU LEU A . n 
C 3 249 ARG 249 255 255 ARG ARG A . n 
C 3 250 LYS 250 256 256 LYS LYS A . n 
C 3 251 LEU 251 257 257 LEU LEU A . n 
C 3 252 THR 252 258 258 THR THR A . n 
C 3 253 GLU 253 259 259 GLU GLU A . n 
C 3 254 THR 254 260 260 THR THR A . n 
C 3 255 PHE 255 261 261 PHE PHE A . n 
C 3 256 GLY 256 262 262 GLY GLY A . n 
C 3 257 SER 257 263 263 SER SER A . n 
C 3 258 TRP 258 264 264 TRP TRP A . n 
C 3 259 TYR 259 265 265 TYR TYR A . n 
C 3 260 GLN 260 266 266 GLN GLN A . n 
C 3 261 PRO 261 267 267 PRO PRO A . n 
C 3 262 LYS 262 268 268 LYS LYS A . n 
C 3 263 GLY 263 269 269 GLY GLY A . n 
C 3 264 GLY 264 270 270 GLY GLY A . n 
C 3 265 THR 265 271 271 THR THR A . n 
C 3 266 GLU 266 272 272 GLU GLU A . n 
C 3 267 MET 267 273 273 MET MET A . n 
C 3 268 PHE 268 274 274 PHE PHE A . n 
C 3 269 CYS 269 275 275 CYS CYS A . n 
C 3 270 HIS 270 276 276 HIS HIS A . n 
C 3 271 PRO 271 277 277 PRO PRO A . n 
C 3 272 ARG 272 278 278 ARG ARG A . n 
C 3 273 THR 273 279 279 THR THR A . n 
C 3 274 GLY 274 280 280 GLY GLY A . n 
C 3 275 LYS 275 281 281 LYS LYS A . n 
C 3 276 PRO 276 282 282 PRO PRO A . n 
C 3 277 LEU 277 283 283 LEU LEU A . n 
C 3 278 PRO 278 284 284 PRO PRO A . n 
C 3 279 LYS 279 285 285 LYS LYS A . n 
C 3 280 TYR 280 286 286 TYR TYR A . n 
C 3 281 PRO 281 287 287 PRO PRO A . n 
C 3 282 ARG 282 288 288 ARG ARG A . n 
C 3 283 ILE 283 289 289 ILE ILE A . n 
C 3 284 LYS 284 290 290 LYS LYS A . n 
C 3 285 THR 285 291 291 THR THR A . n 
C 3 286 PRO 286 292 292 PRO PRO A . n 
C 3 287 LYS 287 293 293 LYS LYS A . n 
C 3 288 VAL 288 294 ?   ?   ?   A . n 
C 3 289 GLY 289 295 ?   ?   ?   A . n 
C 3 290 GLY 290 296 ?   ?   ?   A . n 
C 3 291 ILE 291 297 ?   ?   ?   A . n 
C 3 292 PHE 292 298 ?   ?   ?   A . n 
C 3 293 LYS 293 299 ?   ?   ?   A . n 
C 3 294 LYS 294 300 ?   ?   ?   A . n 
C 3 295 PRO 295 301 ?   ?   ?   A . n 
C 3 296 LYS 296 302 ?   ?   ?   A . n 
C 3 297 ASN 297 303 ?   ?   ?   A . n 
C 3 298 LYS 298 304 ?   ?   ?   A . n 
C 3 299 ALA 299 305 ?   ?   ?   A . n 
C 3 300 GLN 300 306 ?   ?   ?   A . n 
C 3 301 ARG 301 307 ?   ?   ?   A . n 
C 3 302 GLU 302 308 ?   ?   ?   A . n 
C 3 303 GLY 303 309 ?   ?   ?   A . n 
C 3 304 ARG 304 310 ?   ?   ?   A . n 
C 3 305 GLU 305 311 ?   ?   ?   A . n 
C 3 306 PRO 306 312 ?   ?   ?   A . n 
C 3 307 CYS 307 313 ?   ?   ?   A . n 
C 3 308 GLU 308 314 ?   ?   ?   A . n 
C 3 309 LEU 309 315 ?   ?   ?   A . n 
C 3 310 ASP 310 316 ?   ?   ?   A . n 
C 3 311 THR 311 317 ?   ?   ?   A . n 
C 3 312 ARG 312 318 ?   ?   ?   A . n 
C 3 313 GLU 313 319 319 GLU GLU A . n 
C 3 314 TYR 314 320 320 TYR TYR A . n 
C 3 315 VAL 315 321 321 VAL VAL A . n 
C 3 316 ALA 316 322 322 ALA ALA A . n 
C 3 317 GLY 317 323 323 GLY GLY A . n 
C 3 318 ALA 318 324 324 ALA ALA A . n 
C 3 319 PRO 319 325 325 PRO PRO A . n 
C 3 320 TYR 320 326 326 TYR TYR A . n 
C 3 321 THR 321 327 327 THR THR A . n 
C 3 322 PRO 322 328 328 PRO PRO A . n 
C 3 323 VAL 323 329 329 VAL VAL A . n 
C 3 324 GLU 324 330 330 GLU GLU A . n 
C 3 325 HIS 325 331 331 HIS HIS A . n 
C 3 326 VAL 326 332 332 VAL VAL A . n 
C 3 327 VAL 327 333 333 VAL VAL A . n 
C 3 328 PHE 328 334 334 PHE PHE A . n 
C 3 329 ASN 329 335 335 ASN ASN A . n 
C 3 330 PRO 330 336 336 PRO PRO A . n 
C 3 331 SER 331 337 337 SER SER A . n 
C 3 332 SER 332 338 338 SER SER A . n 
C 3 333 ARG 333 339 339 ARG ARG A . n 
C 3 334 ASP 334 340 340 ASP ASP A . n 
C 3 335 HIS 335 341 341 HIS HIS A . n 
C 3 336 ILE 336 342 342 ILE ILE A . n 
C 3 337 GLN 337 343 343 GLN GLN A . n 
C 3 338 LYS 338 344 344 LYS LYS A . n 
C 3 339 LYS 339 345 345 LYS LYS A . n 
C 3 340 LEU 340 346 346 LEU LEU A . n 
C 3 341 GLN 341 347 347 GLN GLN A . n 
C 3 342 GLU 342 348 348 GLU GLU A . n 
C 3 343 ALA 343 349 349 ALA ALA A . n 
C 3 344 GLY 344 350 350 GLY GLY A . n 
C 3 345 TRP 345 351 351 TRP TRP A . n 
C 3 346 VAL 346 352 352 VAL VAL A . n 
C 3 347 PRO 347 353 353 PRO PRO A . n 
C 3 348 THR 348 354 354 THR THR A . n 
C 3 349 LYS 349 355 355 LYS LYS A . n 
C 3 350 TYR 350 356 356 TYR TYR A . n 
C 3 351 THR 351 357 357 THR THR A . n 
C 3 352 ASP 352 358 358 ASP ASP A . n 
C 3 353 LYS 353 359 359 LYS LYS A . n 
C 3 354 GLY 354 360 360 GLY GLY A . n 
C 3 355 ALA 355 361 361 ALA ALA A . n 
C 3 356 PRO 356 362 362 PRO PRO A . n 
C 3 357 VAL 357 363 363 VAL VAL A . n 
C 3 358 VAL 358 364 364 VAL VAL A . n 
C 3 359 ASP 359 365 365 ASP ASP A . n 
C 3 360 ASP 360 366 366 ASP ASP A . n 
C 3 361 GLU 361 367 367 GLU GLU A . n 
C 3 362 VAL 362 368 368 VAL VAL A . n 
C 3 363 LEU 363 369 369 LEU LEU A . n 
C 3 364 GLU 364 370 370 GLU GLU A . n 
C 3 365 GLY 365 371 371 GLY GLY A . n 
C 3 366 VAL 366 372 372 VAL VAL A . n 
C 3 367 ARG 367 373 373 ARG ARG A . n 
C 3 368 VAL 368 374 374 VAL VAL A . n 
C 3 369 ASP 369 375 375 ASP ASP A . n 
C 3 370 ASP 370 376 376 ASP ASP A . n 
C 3 371 PRO 371 377 377 PRO PRO A . n 
C 3 372 GLU 372 378 378 GLU GLU A . n 
C 3 373 LYS 373 379 379 LYS LYS A . n 
C 3 374 GLN 374 380 380 GLN GLN A . n 
C 3 375 ALA 375 381 381 ALA ALA A . n 
C 3 376 ALA 376 382 382 ALA ALA A . n 
C 3 377 ILE 377 383 383 ILE ILE A . n 
C 3 378 ASP 378 384 384 ASP ASP A . n 
C 3 379 LEU 379 385 385 LEU LEU A . n 
C 3 380 ILE 380 386 386 ILE ILE A . n 
C 3 381 LYS 381 387 387 LYS LYS A . n 
C 3 382 GLU 382 388 388 GLU GLU A . n 
C 3 383 TYR 383 389 389 TYR TYR A . n 
C 3 384 LEU 384 390 390 LEU LEU A . n 
C 3 385 MET 385 391 391 MET MET A . n 
C 3 386 ILE 386 392 392 ILE ILE A . n 
C 3 387 GLN 387 393 393 GLN GLN A . n 
C 3 388 LYS 388 394 394 LYS LYS A . n 
C 3 389 ARG 389 395 395 ARG ARG A . n 
C 3 390 ILE 390 396 396 ILE ILE A . n 
C 3 391 GLY 391 397 397 GLY GLY A . n 
C 3 392 GLN 392 398 398 GLN GLN A . n 
C 3 393 SER 393 399 399 SER SER A . n 
C 3 394 ALA 394 400 400 ALA ALA A . n 
C 3 395 GLU 395 401 401 GLU GLU A . n 
C 3 396 GLY 396 402 402 GLY GLY A . n 
C 3 397 ASP 397 403 403 ASP ASP A . n 
C 3 398 LYS 398 404 404 LYS LYS A . n 
C 3 399 ALA 399 405 405 ALA ALA A . n 
C 3 400 TRP 400 406 406 TRP TRP A . n 
C 3 401 LEU 401 407 407 LEU LEU A . n 
C 3 402 ARG 402 408 408 ARG ARG A . n 
C 3 403 TYR 403 409 409 TYR TYR A . n 
C 3 404 VAL 404 410 410 VAL VAL A . n 
C 3 405 ALA 405 411 411 ALA ALA A . n 
C 3 406 GLU 406 412 412 GLU GLU A . n 
C 3 407 ASP 407 413 413 ASP ASP A . n 
C 3 408 GLY 408 414 414 GLY GLY A . n 
C 3 409 LYS 409 415 415 LYS LYS A . n 
C 3 410 ILE 410 416 416 ILE ILE A . n 
C 3 411 HIS 411 417 417 HIS HIS A . n 
C 3 412 GLY 412 418 418 GLY GLY A . n 
C 3 413 SER 413 419 419 SER SER A . n 
C 3 414 VAL 414 420 420 VAL VAL A . n 
C 3 415 ASN 415 421 421 ASN ASN A . n 
C 3 416 PRO 416 422 422 PRO PRO A . n 
C 3 417 ASN 417 423 423 ASN ASN A . n 
C 3 418 GLY 418 424 424 GLY GLY A . n 
C 3 419 ALA 419 425 425 ALA ALA A . n 
C 3 420 VAL 420 426 426 VAL VAL A . n 
C 3 421 THR 421 427 427 THR THR A . n 
C 3 422 GLY 422 428 428 GLY GLY A . n 
C 3 423 ARG 423 429 429 ARG ARG A . n 
C 3 424 ALA 424 430 430 ALA ALA A . n 
C 3 425 THR 425 431 431 THR THR A . n 
C 3 426 HIS 426 432 432 HIS HIS A . n 
C 3 427 ALA 427 433 433 ALA ALA A . n 
C 3 428 PHE 428 434 434 PHE PHE A . n 
C 3 429 PRO 429 435 435 PRO PRO A . n 
C 3 430 ASN 430 436 436 ASN ASN A . n 
C 3 431 LEU 431 437 437 LEU LEU A . n 
C 3 432 ALA 432 438 438 ALA ALA A . n 
C 3 433 GLN 433 439 439 GLN GLN A . n 
C 3 434 ILE 434 440 440 ILE ILE A . n 
C 3 435 PRO 435 441 441 PRO PRO A . n 
C 3 436 GLY 436 442 442 GLY GLY A . n 
C 3 437 VAL 437 443 443 VAL VAL A . n 
C 3 438 ARG 438 444 444 ARG ARG A . n 
C 3 439 SER 439 445 445 SER SER A . n 
C 3 440 PRO 440 446 446 PRO PRO A . n 
C 3 441 TYR 441 447 447 TYR TYR A . n 
C 3 442 GLY 442 448 448 GLY GLY A . n 
C 3 443 GLU 443 449 449 GLU GLU A . n 
C 3 444 GLN 444 450 450 GLN GLN A . n 
C 3 445 CYS 445 451 451 CYS CYS A . n 
C 3 446 ARG 446 452 452 ARG ARG A . n 
C 3 447 ALA 447 453 453 ALA ALA A . n 
C 3 448 ALA 448 454 454 ALA ALA A . n 
C 3 449 PHE 449 455 455 PHE PHE A . n 
C 3 450 GLY 450 456 456 GLY GLY A . n 
C 3 451 ALA 451 457 457 ALA ALA A . n 
C 3 452 GLU 452 458 458 GLU GLU A . n 
C 3 453 HIS 453 459 459 HIS HIS A . n 
C 3 454 HIS 454 460 460 HIS HIS A . n 
C 3 455 LEU 455 461 461 LEU LEU A . n 
C 3 456 ASP 456 462 462 ASP ASP A . n 
C 3 457 GLY 457 463 463 GLY GLY A . n 
C 3 458 ILE 458 464 464 ILE ILE A . n 
C 3 459 THR 459 465 465 THR THR A . n 
C 3 460 GLY 460 466 466 GLY GLY A . n 
C 3 461 LYS 461 467 467 LYS LYS A . n 
C 3 462 PRO 462 468 468 PRO PRO A . n 
C 3 463 TRP 463 469 469 TRP TRP A . n 
C 3 464 VAL 464 470 470 VAL VAL A . n 
C 3 465 GLN 465 471 471 GLN GLN A . n 
C 3 466 ALA 466 472 472 ALA ALA A . n 
C 3 467 GLY 467 473 473 GLY GLY A . n 
C 3 468 ILE 468 474 474 ILE ILE A . n 
C 3 469 ASP 469 475 475 ASP ASP A . n 
C 3 470 ALA 470 476 476 ALA ALA A . n 
C 3 471 SER 471 477 477 SER SER A . n 
C 3 472 GLY 472 478 478 GLY GLY A . n 
C 3 473 LEU 473 479 479 LEU LEU A . n 
C 3 474 GLU 474 480 480 GLU GLU A . n 
C 3 475 LEU 475 481 481 LEU LEU A . n 
C 3 476 ARG 476 482 482 ARG ARG A . n 
C 3 477 CYS 477 483 483 CYS CYS A . n 
C 3 478 LEU 478 484 484 LEU LEU A . n 
C 3 479 ALA 479 485 485 ALA ALA A . n 
C 3 480 HIS 480 486 486 HIS HIS A . n 
C 3 481 PHE 481 487 487 PHE PHE A . n 
C 3 482 MET 482 488 488 MET MET A . n 
C 3 483 ALA 483 489 489 ALA ALA A . n 
C 3 484 ARG 484 490 490 ARG ARG A . n 
C 3 485 PHE 485 491 491 PHE PHE A . n 
C 3 486 ASP 486 492 492 ASP ASP A . n 
C 3 487 ASN 487 493 493 ASN ASN A . n 
C 3 488 GLY 488 494 494 GLY GLY A . n 
C 3 489 GLU 489 495 495 GLU GLU A . n 
C 3 490 TYR 490 496 496 TYR TYR A . n 
C 3 491 ALA 491 497 497 ALA ALA A . n 
C 3 492 HIS 492 498 498 HIS HIS A . n 
C 3 493 GLU 493 499 499 GLU GLU A . n 
C 3 494 ILE 494 500 500 ILE ILE A . n 
C 3 495 LEU 495 501 501 LEU LEU A . n 
C 3 496 ASN 496 502 502 ASN ASN A . n 
C 3 497 GLY 497 503 503 GLY GLY A . n 
C 3 498 ASP 498 504 504 ASP ASP A . n 
C 3 499 ILE 499 505 505 ILE ILE A . n 
C 3 500 HIS 500 506 506 HIS HIS A . n 
C 3 501 THR 501 507 507 THR THR A . n 
C 3 502 LYS 502 508 508 LYS LYS A . n 
C 3 503 ASN 503 509 509 ASN ASN A . n 
C 3 504 GLN 504 510 510 GLN GLN A . n 
C 3 505 ILE 505 511 511 ILE ILE A . n 
C 3 506 ALA 506 512 512 ALA ALA A . n 
C 3 507 ALA 507 513 513 ALA ALA A . n 
C 3 508 GLU 508 514 514 GLU GLU A . n 
C 3 509 LEU 509 515 515 LEU LEU A . n 
C 3 510 PRO 510 516 516 PRO PRO A . n 
C 3 511 THR 511 517 517 THR THR A . n 
C 3 512 ARG 512 518 518 ARG ARG A . n 
C 3 513 ASP 513 519 519 ASP ASP A . n 
C 3 514 ASN 514 520 520 ASN ASN A . n 
C 3 515 ALA 515 521 521 ALA ALA A . n 
C 3 516 LYS 516 522 522 LYS LYS A . n 
C 3 517 THR 517 523 523 THR THR A . n 
C 3 518 PHE 518 524 524 PHE PHE A . n 
C 3 519 ILE 519 525 525 ILE ILE A . n 
C 3 520 TYR 520 526 526 TYR TYR A . n 
C 3 521 GLY 521 527 527 GLY GLY A . n 
C 3 522 PHE 522 528 528 PHE PHE A . n 
C 3 523 LEU 523 529 529 LEU LEU A . n 
C 3 524 TYR 524 530 530 TYR TYR A . n 
C 3 525 GLY 525 531 531 GLY GLY A . n 
C 3 526 ALA 526 532 532 ALA ALA A . n 
C 3 527 GLY 527 533 533 GLY GLY A . n 
C 3 528 ASP 528 534 534 ASP ASP A . n 
C 3 529 GLU 529 535 535 GLU GLU A . n 
C 3 530 LYS 530 536 536 LYS LYS A . n 
C 3 531 ILE 531 537 537 ILE ILE A . n 
C 3 532 GLY 532 538 538 GLY GLY A . n 
C 3 533 GLN 533 539 539 GLN GLN A . n 
C 3 534 ILE 534 540 540 ILE ILE A . n 
C 3 535 VAL 535 541 541 VAL VAL A . n 
C 3 536 GLY 536 542 542 GLY GLY A . n 
C 3 537 ALA 537 543 543 ALA ALA A . n 
C 3 538 GLY 538 544 544 GLY GLY A . n 
C 3 539 LYS 539 545 545 LYS LYS A . n 
C 3 540 GLU 540 546 546 GLU GLU A . n 
C 3 541 ARG 541 547 547 ARG ARG A . n 
C 3 542 GLY 542 548 548 GLY GLY A . n 
C 3 543 LYS 543 549 549 LYS LYS A . n 
C 3 544 GLU 544 550 550 GLU GLU A . n 
C 3 545 LEU 545 551 551 LEU LEU A . n 
C 3 546 LYS 546 552 552 LYS LYS A . n 
C 3 547 LYS 547 553 553 LYS LYS A . n 
C 3 548 LYS 548 554 554 LYS LYS A . n 
C 3 549 PHE 549 555 555 PHE PHE A . n 
C 3 550 LEU 550 556 556 LEU LEU A . n 
C 3 551 GLU 551 557 557 GLU GLU A . n 
C 3 552 ASN 552 558 558 ASN ASN A . n 
C 3 553 THR 553 559 559 THR THR A . n 
C 3 554 PRO 554 560 560 PRO PRO A . n 
C 3 555 ALA 555 561 561 ALA ALA A . n 
C 3 556 ILE 556 562 562 ILE ILE A . n 
C 3 557 ALA 557 563 563 ALA ALA A . n 
C 3 558 ALA 558 564 564 ALA ALA A . n 
C 3 559 LEU 559 565 565 LEU LEU A . n 
C 3 560 ARG 560 566 566 ARG ARG A . n 
C 3 561 GLU 561 567 567 GLU GLU A . n 
C 3 562 SER 562 568 568 SER SER A . n 
C 3 563 ILE 563 569 569 ILE ILE A . n 
C 3 564 GLN 564 570 570 GLN GLN A . n 
C 3 565 GLN 565 571 571 GLN GLN A . n 
C 3 566 THR 566 572 572 THR THR A . n 
C 3 567 LEU 567 573 573 LEU LEU A . n 
C 3 568 VAL 568 574 574 VAL VAL A . n 
C 3 569 GLU 569 575 575 GLU GLU A . n 
C 3 570 SER 570 576 ?   ?   ?   A . n 
C 3 571 SER 571 577 ?   ?   ?   A . n 
C 3 572 GLN 572 578 ?   ?   ?   A . n 
C 3 573 TRP 573 579 ?   ?   ?   A . n 
C 3 574 VAL 574 580 ?   ?   ?   A . n 
C 3 575 ALA 575 581 ?   ?   ?   A . n 
C 3 576 GLY 576 582 ?   ?   ?   A . n 
C 3 577 GLU 577 583 ?   ?   ?   A . n 
C 3 578 GLN 578 584 ?   ?   ?   A . n 
C 3 579 GLN 579 585 ?   ?   ?   A . n 
C 3 580 VAL 580 586 ?   ?   ?   A . n 
C 3 581 LYS 581 587 587 LYS LYS A . n 
C 3 582 TRP 582 588 588 TRP TRP A . n 
C 3 583 LYS 583 589 589 LYS LYS A . n 
C 3 584 ARG 584 590 590 ARG ARG A . n 
C 3 585 ARG 585 591 591 ARG ARG A . n 
C 3 586 TRP 586 592 592 TRP TRP A . n 
C 3 587 ILE 587 593 593 ILE ILE A . n 
C 3 588 LYS 588 594 594 LYS LYS A . n 
C 3 589 GLY 589 595 595 GLY GLY A . n 
C 3 590 LEU 590 596 596 LEU LEU A . n 
C 3 591 ASP 591 597 597 ASP ASP A . n 
C 3 592 GLY 592 598 598 GLY GLY A . n 
C 3 593 ARG 593 599 599 ARG ARG A . n 
C 3 594 LYS 594 600 600 LYS LYS A . n 
C 3 595 VAL 595 601 601 VAL VAL A . n 
C 3 596 HIS 596 602 602 HIS HIS A . n 
C 3 597 VAL 597 603 603 VAL VAL A . n 
C 3 598 ARG 598 604 604 ARG ARG A . n 
C 3 599 SER 599 605 605 SER SER A . n 
C 3 600 PRO 600 606 606 PRO PRO A . n 
C 3 601 HIS 601 607 607 HIS HIS A . n 
C 3 602 ALA 602 608 608 ALA ALA A . n 
C 3 603 ALA 603 609 609 ALA ALA A . n 
C 3 604 LEU 604 610 610 LEU LEU A . n 
C 3 605 ASN 605 611 611 ASN ASN A . n 
C 3 606 THR 606 612 612 THR THR A . n 
C 3 607 LEU 607 613 613 LEU LEU A . n 
C 3 608 LEU 608 614 614 LEU LEU A . n 
C 3 609 GLN 609 615 615 GLN GLN A . n 
C 3 610 SER 610 616 616 SER SER A . n 
C 3 611 ALA 611 617 617 ALA ALA A . n 
C 3 612 GLY 612 618 618 GLY GLY A . n 
C 3 613 ALA 613 619 619 ALA ALA A . n 
C 3 614 LEU 614 620 620 LEU LEU A . n 
C 3 615 ILE 615 621 621 ILE ILE A . n 
C 3 616 CYS 616 622 622 CYS CYS A . n 
C 3 617 LYS 617 623 623 LYS LYS A . n 
C 3 618 LEU 618 624 624 LEU LEU A . n 
C 3 619 TRP 619 625 625 TRP TRP A . n 
C 3 620 ILE 620 626 626 ILE ILE A . n 
C 3 621 ILE 621 627 627 ILE ILE A . n 
C 3 622 LYS 622 628 628 LYS LYS A . n 
C 3 623 THR 623 629 629 THR THR A . n 
C 3 624 GLU 624 630 630 GLU GLU A . n 
C 3 625 GLU 625 631 631 GLU GLU A . n 
C 3 626 MET 626 632 632 MET MET A . n 
C 3 627 LEU 627 633 633 LEU LEU A . n 
C 3 628 VAL 628 634 634 VAL VAL A . n 
C 3 629 GLU 629 635 635 GLU GLU A . n 
C 3 630 LYS 630 636 636 LYS LYS A . n 
C 3 631 GLY 631 637 637 GLY GLY A . n 
C 3 632 LEU 632 638 638 LEU LEU A . n 
C 3 633 LYS 633 639 639 LYS LYS A . n 
C 3 634 HIS 634 640 640 HIS HIS A . n 
C 3 635 GLY 635 641 641 GLY GLY A . n 
C 3 636 TRP 636 642 642 TRP TRP A . n 
C 3 637 ASP 637 643 643 ASP ASP A . n 
C 3 638 GLY 638 644 644 GLY GLY A . n 
C 3 639 ASP 639 645 645 ASP ASP A . n 
C 3 640 PHE 640 646 646 PHE PHE A . n 
C 3 641 ALA 641 647 647 ALA ALA A . n 
C 3 642 TYR 642 648 648 TYR TYR A . n 
C 3 643 MET 643 649 649 MET MET A . n 
C 3 644 ALA 644 650 650 ALA ALA A . n 
C 3 645 TRP 645 651 651 TRP TRP A . n 
C 3 646 VAL 646 652 652 VAL VAL A . n 
C 3 647 HIS 647 653 653 HIS HIS A . n 
C 3 648 ASP 648 654 654 ASP ASP A . n 
C 3 649 GLU 649 655 655 GLU GLU A . n 
C 3 650 ILE 650 656 656 ILE ILE A . n 
C 3 651 GLN 651 657 657 GLN GLN A . n 
C 3 652 VAL 652 658 658 VAL VAL A . n 
C 3 653 GLY 653 659 659 GLY GLY A . n 
C 3 654 CYS 654 660 660 CYS CYS A . n 
C 3 655 ARG 655 661 661 ARG ARG A . n 
C 3 656 THR 656 662 662 THR THR A . n 
C 3 657 GLU 657 663 663 GLU GLU A . n 
C 3 658 GLU 658 664 664 GLU GLU A . n 
C 3 659 ILE 659 665 665 ILE ILE A . n 
C 3 660 ALA 660 666 666 ALA ALA A . n 
C 3 661 GLN 661 667 667 GLN GLN A . n 
C 3 662 VAL 662 668 668 VAL VAL A . n 
C 3 663 VAL 663 669 669 VAL VAL A . n 
C 3 664 ILE 664 670 670 ILE ILE A . n 
C 3 665 GLU 665 671 671 GLU GLU A . n 
C 3 666 THR 666 672 672 THR THR A . n 
C 3 667 ALA 667 673 673 ALA ALA A . n 
C 3 668 GLN 668 674 674 GLN GLN A . n 
C 3 669 GLU 669 675 675 GLU GLU A . n 
C 3 670 ALA 670 676 676 ALA ALA A . n 
C 3 671 MET 671 677 677 MET MET A . n 
C 3 672 ARG 672 678 678 ARG ARG A . n 
C 3 673 TRP 673 679 679 TRP TRP A . n 
C 3 674 VAL 674 680 680 VAL VAL A . n 
C 3 675 GLY 675 681 681 GLY GLY A . n 
C 3 676 ASP 676 682 682 ASP ASP A . n 
C 3 677 HIS 677 683 683 HIS HIS A . n 
C 3 678 TRP 678 684 684 TRP TRP A . n 
C 3 679 ASN 679 685 685 ASN ASN A . n 
C 3 680 PHE 680 686 686 PHE PHE A . n 
C 3 681 ARG 681 687 687 ARG ARG A . n 
C 3 682 CYS 682 688 688 CYS CYS A . n 
C 3 683 LEU 683 689 689 LEU LEU A . n 
C 3 684 LEU 684 690 690 LEU LEU A . n 
C 3 685 ASP 685 691 691 ASP ASP A . n 
C 3 686 THR 686 692 692 THR THR A . n 
C 3 687 GLU 687 693 693 GLU GLU A . n 
C 3 688 GLY 688 694 694 GLY GLY A . n 
C 3 689 LYS 689 695 695 LYS LYS A . n 
C 3 690 MET 690 696 696 MET MET A . n 
C 3 691 GLY 691 697 697 GLY GLY A . n 
C 3 692 PRO 692 698 698 PRO PRO A . n 
C 3 693 ASN 693 699 699 ASN ASN A . n 
C 3 694 TRP 694 700 700 TRP TRP A . n 
C 3 695 ALA 695 701 701 ALA ALA A . n 
C 3 696 ILE 696 702 702 ILE ILE A . n 
C 3 697 CYS 697 703 703 CYS CYS A . n 
C 3 698 HIS 698 704 704 HIS HIS A . n 
D 4 1   SER 1   1   ?   ?   ?   B . n 
D 4 2   ASP 2   2   ?   ?   ?   B . n 
D 4 3   LYS 3   3   3   LYS LYS B . n 
D 4 4   ILE 4   4   4   ILE ILE B . n 
D 4 5   ILE 5   5   5   ILE ILE B . n 
D 4 6   HIS 6   6   6   HIS HIS B . n 
D 4 7   LEU 7   7   7   LEU LEU B . n 
D 4 8   THR 8   8   8   THR THR B . n 
D 4 9   ASP 9   9   9   ASP ASP B . n 
D 4 10  ASP 10  10  10  ASP ASP B . n 
D 4 11  SER 11  11  11  SER SER B . n 
D 4 12  PHE 12  12  12  PHE PHE B . n 
D 4 13  ASP 13  13  13  ASP ASP B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  LEU 17  17  17  LEU LEU B . n 
D 4 18  LYS 18  18  18  LYS LYS B . n 
D 4 19  ALA 19  19  19  ALA ALA B . n 
D 4 20  ASP 20  20  20  ASP ASP B . n 
D 4 21  GLY 21  21  21  GLY GLY B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  ILE 23  23  23  ILE ILE B . n 
D 4 24  LEU 24  24  24  LEU LEU B . n 
D 4 25  VAL 25  25  25  VAL VAL B . n 
D 4 26  ASP 26  26  26  ASP ASP B . n 
D 4 27  PHE 27  27  27  PHE PHE B . n 
D 4 28  TRP 28  28  28  TRP TRP B . n 
D 4 29  ALA 29  29  29  ALA ALA B . n 
D 4 30  GLU 30  30  30  GLU GLU B . n 
D 4 31  TRP 31  31  31  TRP TRP B . n 
D 4 32  CYS 32  32  32  CYS CYS B . n 
D 4 33  GLY 33  33  33  GLY GLY B . n 
D 4 34  PRO 34  34  34  PRO PRO B . n 
D 4 35  CYS 35  35  35  CYS CYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  MET 37  37  37  MET MET B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  ALA 39  39  39  ALA ALA B . n 
D 4 40  PRO 40  40  40  PRO PRO B . n 
D 4 41  ILE 41  41  41  ILE ILE B . n 
D 4 42  LEU 42  42  42  LEU LEU B . n 
D 4 43  ASP 43  43  43  ASP ASP B . n 
D 4 44  GLU 44  44  44  GLU GLU B . n 
D 4 45  ILE 45  45  45  ILE ILE B . n 
D 4 46  ALA 46  46  46  ALA ALA B . n 
D 4 47  ASP 47  47  47  ASP ASP B . n 
D 4 48  GLU 48  48  48  GLU GLU B . n 
D 4 49  TYR 49  49  49  TYR TYR B . n 
D 4 50  GLN 50  50  50  GLN GLN B . n 
D 4 51  GLY 51  51  51  GLY GLY B . n 
D 4 52  LYS 52  52  52  LYS LYS B . n 
D 4 53  LEU 53  53  53  LEU LEU B . n 
D 4 54  THR 54  54  54  THR THR B . n 
D 4 55  VAL 55  55  55  VAL VAL B . n 
D 4 56  ALA 56  56  56  ALA ALA B . n 
D 4 57  LYS 57  57  57  LYS LYS B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  ASN 59  59  59  ASN ASN B . n 
D 4 60  ILE 60  60  60  ILE ILE B . n 
D 4 61  ASP 61  61  61  ASP ASP B . n 
D 4 62  GLN 62  62  62  GLN GLN B . n 
D 4 63  ASN 63  63  63  ASN ASN B . n 
D 4 64  PRO 64  64  64  PRO PRO B . n 
D 4 65  GLY 65  65  65  GLY GLY B . n 
D 4 66  THR 66  66  66  THR THR B . n 
D 4 67  ALA 67  67  67  ALA ALA B . n 
D 4 68  PRO 68  68  68  PRO PRO B . n 
D 4 69  LYS 69  69  69  LYS LYS B . n 
D 4 70  TYR 70  70  70  TYR TYR B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ILE 72  72  72  ILE ILE B . n 
D 4 73  ARG 73  73  73  ARG ARG B . n 
D 4 74  GLY 74  74  74  GLY GLY B . n 
D 4 75  ILE 75  75  75  ILE ILE B . n 
D 4 76  PRO 76  76  76  PRO PRO B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  LEU 78  78  78  LEU LEU B . n 
D 4 79  LEU 79  79  79  LEU LEU B . n 
D 4 80  LEU 80  80  80  LEU LEU B . n 
D 4 81  PHE 81  81  81  PHE PHE B . n 
D 4 82  LYS 82  82  82  LYS LYS B . n 
D 4 83  ASN 83  83  83  ASN ASN B . n 
D 4 84  GLY 84  84  84  GLY GLY B . n 
D 4 85  GLU 85  85  85  GLU GLU B . n 
D 4 86  VAL 86  86  86  VAL VAL B . n 
D 4 87  ALA 87  87  87  ALA ALA B . n 
D 4 88  ALA 88  88  88  ALA ALA B . n 
D 4 89  THR 89  89  89  THR THR B . n 
D 4 90  LYS 90  90  90  LYS LYS B . n 
D 4 91  VAL 91  91  91  VAL VAL B . n 
D 4 92  GLY 92  92  92  GLY GLY B . n 
D 4 93  ALA 93  93  93  ALA ALA B . n 
D 4 94  LEU 94  94  94  LEU LEU B . n 
D 4 95  SER 95  95  95  SER SER B . n 
D 4 96  LYS 96  96  96  LYS LYS B . n 
D 4 97  GLY 97  97  97  GLY GLY B . n 
D 4 98  GLN 98  98  98  GLN GLN B . n 
D 4 99  LEU 99  99  99  LEU LEU B . n 
D 4 100 LYS 100 100 100 LYS LYS B . n 
D 4 101 GLU 101 101 101 GLU GLU B . n 
D 4 102 PHE 102 102 102 PHE PHE B . n 
D 4 103 LEU 103 103 103 LEU LEU B . n 
D 4 104 ASP 104 104 104 ASP ASP B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASN 106 106 106 ASN ASN B . n 
D 4 107 LEU 107 107 107 LEU LEU B . n 
D 4 108 ALA 108 108 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 DG3 1   23   23   DG3 DG3 P . 
F 6 MG  1   4001 4001 MG  MG  A . 
G 6 MG  1   4002 4002 MG  MG  A . 
H 6 MG  1   4003 4003 MG  MG  A . 
I 7 HOH 1   3027 3027 HOH HOH P . 
I 7 HOH 2   3107 3107 HOH HOH P . 
I 7 HOH 3   3112 3112 HOH HOH P . 
I 7 HOH 4   3118 3118 HOH HOH P . 
I 7 HOH 5   3123 3123 HOH HOH P . 
I 7 HOH 6   3149 3149 HOH HOH P . 
I 7 HOH 7   3164 3164 HOH HOH P . 
I 7 HOH 8   3180 3180 HOH HOH P . 
I 7 HOH 9   3276 3276 HOH HOH P . 
I 7 HOH 10  3291 3291 HOH HOH P . 
I 7 HOH 11  3314 3314 HOH HOH P . 
I 7 HOH 12  3353 3353 HOH HOH P . 
I 7 HOH 13  3356 3356 HOH HOH P . 
I 7 HOH 14  3405 3405 HOH HOH P . 
I 7 HOH 15  3462 3462 HOH HOH P . 
I 7 HOH 16  3504 3504 HOH HOH P . 
J 7 HOH 1   3067 3067 HOH HOH T . 
J 7 HOH 2   3079 3079 HOH HOH T . 
J 7 HOH 3   3085 3085 HOH HOH T . 
J 7 HOH 4   3162 3162 HOH HOH T . 
J 7 HOH 5   3192 3192 HOH HOH T . 
J 7 HOH 6   3202 3202 HOH HOH T . 
J 7 HOH 7   3213 3213 HOH HOH T . 
J 7 HOH 8   3245 3245 HOH HOH T . 
J 7 HOH 9   3249 3249 HOH HOH T . 
J 7 HOH 10  3268 3268 HOH HOH T . 
J 7 HOH 11  3280 3280 HOH HOH T . 
J 7 HOH 12  3301 3301 HOH HOH T . 
J 7 HOH 13  3321 3321 HOH HOH T . 
J 7 HOH 14  3346 3346 HOH HOH T . 
J 7 HOH 15  3377 3377 HOH HOH T . 
J 7 HOH 16  3398 3398 HOH HOH T . 
J 7 HOH 17  3401 3401 HOH HOH T . 
J 7 HOH 18  3413 3413 HOH HOH T . 
J 7 HOH 19  3419 3419 HOH HOH T . 
J 7 HOH 20  3426 3426 HOH HOH T . 
J 7 HOH 21  3444 3444 HOH HOH T . 
J 7 HOH 22  3451 3451 HOH HOH T . 
J 7 HOH 23  3466 3466 HOH HOH T . 
J 7 HOH 24  3471 3471 HOH HOH T . 
J 7 HOH 25  3488 3488 HOH HOH T . 
J 7 HOH 26  3513 3513 HOH HOH T . 
J 7 HOH 27  3515 3515 HOH HOH T . 
J 7 HOH 28  3518 3518 HOH HOH T . 
J 7 HOH 29  3526 3526 HOH HOH T . 
K 7 HOH 1   3001 3001 HOH HOH A . 
K 7 HOH 2   3002 3002 HOH HOH A . 
K 7 HOH 3   3003 3003 HOH HOH A . 
K 7 HOH 4   3004 3004 HOH HOH A . 
K 7 HOH 5   3005 3005 HOH HOH A . 
K 7 HOH 6   3006 3006 HOH HOH A . 
K 7 HOH 7   3007 3007 HOH HOH A . 
K 7 HOH 8   3009 3009 HOH HOH A . 
K 7 HOH 9   3012 3012 HOH HOH A . 
K 7 HOH 10  3013 3013 HOH HOH A . 
K 7 HOH 11  3014 3014 HOH HOH A . 
K 7 HOH 12  3016 3016 HOH HOH A . 
K 7 HOH 13  3017 3017 HOH HOH A . 
K 7 HOH 14  3018 3018 HOH HOH A . 
K 7 HOH 15  3019 3019 HOH HOH A . 
K 7 HOH 16  3020 3020 HOH HOH A . 
K 7 HOH 17  3021 3021 HOH HOH A . 
K 7 HOH 18  3022 3022 HOH HOH A . 
K 7 HOH 19  3023 3023 HOH HOH A . 
K 7 HOH 20  3024 3024 HOH HOH A . 
K 7 HOH 21  3025 3025 HOH HOH A . 
K 7 HOH 22  3026 3026 HOH HOH A . 
K 7 HOH 23  3028 3028 HOH HOH A . 
K 7 HOH 24  3029 3029 HOH HOH A . 
K 7 HOH 25  3030 3030 HOH HOH A . 
K 7 HOH 26  3031 3031 HOH HOH A . 
K 7 HOH 27  3032 3032 HOH HOH A . 
K 7 HOH 28  3033 3033 HOH HOH A . 
K 7 HOH 29  3035 3035 HOH HOH A . 
K 7 HOH 30  3036 3036 HOH HOH A . 
K 7 HOH 31  3037 3037 HOH HOH A . 
K 7 HOH 32  3038 3038 HOH HOH A . 
K 7 HOH 33  3039 3039 HOH HOH A . 
K 7 HOH 34  3040 3040 HOH HOH A . 
K 7 HOH 35  3041 3041 HOH HOH A . 
K 7 HOH 36  3042 3042 HOH HOH A . 
K 7 HOH 37  3043 3043 HOH HOH A . 
K 7 HOH 38  3044 3044 HOH HOH A . 
K 7 HOH 39  3045 3045 HOH HOH A . 
K 7 HOH 40  3046 3046 HOH HOH A . 
K 7 HOH 41  3047 3047 HOH HOH A . 
K 7 HOH 42  3048 3048 HOH HOH A . 
K 7 HOH 43  3049 3049 HOH HOH A . 
K 7 HOH 44  3050 3050 HOH HOH A . 
K 7 HOH 45  3051 3051 HOH HOH A . 
K 7 HOH 46  3052 3052 HOH HOH A . 
K 7 HOH 47  3053 3053 HOH HOH A . 
K 7 HOH 48  3054 3054 HOH HOH A . 
K 7 HOH 49  3055 3055 HOH HOH A . 
K 7 HOH 50  3056 3056 HOH HOH A . 
K 7 HOH 51  3057 3057 HOH HOH A . 
K 7 HOH 52  3058 3058 HOH HOH A . 
K 7 HOH 53  3059 3059 HOH HOH A . 
K 7 HOH 54  3060 3060 HOH HOH A . 
K 7 HOH 55  3061 3061 HOH HOH A . 
K 7 HOH 56  3062 3062 HOH HOH A . 
K 7 HOH 57  3063 3063 HOH HOH A . 
K 7 HOH 58  3064 3064 HOH HOH A . 
K 7 HOH 59  3065 3065 HOH HOH A . 
K 7 HOH 60  3066 3066 HOH HOH A . 
K 7 HOH 61  3068 3068 HOH HOH A . 
K 7 HOH 62  3069 3069 HOH HOH A . 
K 7 HOH 63  3070 3070 HOH HOH A . 
K 7 HOH 64  3071 3071 HOH HOH A . 
K 7 HOH 65  3072 3072 HOH HOH A . 
K 7 HOH 66  3073 3073 HOH HOH A . 
K 7 HOH 67  3074 3074 HOH HOH A . 
K 7 HOH 68  3075 3075 HOH HOH A . 
K 7 HOH 69  3076 3076 HOH HOH A . 
K 7 HOH 70  3077 3077 HOH HOH A . 
K 7 HOH 71  3080 3080 HOH HOH A . 
K 7 HOH 72  3082 3082 HOH HOH A . 
K 7 HOH 73  3083 3083 HOH HOH A . 
K 7 HOH 74  3084 3084 HOH HOH A . 
K 7 HOH 75  3086 3086 HOH HOH A . 
K 7 HOH 76  3087 3087 HOH HOH A . 
K 7 HOH 77  3088 3088 HOH HOH A . 
K 7 HOH 78  3089 3089 HOH HOH A . 
K 7 HOH 79  3090 3090 HOH HOH A . 
K 7 HOH 80  3091 3091 HOH HOH A . 
K 7 HOH 81  3092 3092 HOH HOH A . 
K 7 HOH 82  3093 3093 HOH HOH A . 
K 7 HOH 83  3094 3094 HOH HOH A . 
K 7 HOH 84  3095 3095 HOH HOH A . 
K 7 HOH 85  3096 3096 HOH HOH A . 
K 7 HOH 86  3097 3097 HOH HOH A . 
K 7 HOH 87  3098 3098 HOH HOH A . 
K 7 HOH 88  3099 3099 HOH HOH A . 
K 7 HOH 89  3101 3101 HOH HOH A . 
K 7 HOH 90  3103 3103 HOH HOH A . 
K 7 HOH 91  3104 3104 HOH HOH A . 
K 7 HOH 92  3105 3105 HOH HOH A . 
K 7 HOH 93  3106 3106 HOH HOH A . 
K 7 HOH 94  3108 3108 HOH HOH A . 
K 7 HOH 95  3109 3109 HOH HOH A . 
K 7 HOH 96  3110 3110 HOH HOH A . 
K 7 HOH 97  3111 3111 HOH HOH A . 
K 7 HOH 98  3113 3113 HOH HOH A . 
K 7 HOH 99  3114 3114 HOH HOH A . 
K 7 HOH 100 3115 3115 HOH HOH A . 
K 7 HOH 101 3117 3117 HOH HOH A . 
K 7 HOH 102 3119 3119 HOH HOH A . 
K 7 HOH 103 3120 3120 HOH HOH A . 
K 7 HOH 104 3121 3121 HOH HOH A . 
K 7 HOH 105 3122 3122 HOH HOH A . 
K 7 HOH 106 3124 3124 HOH HOH A . 
K 7 HOH 107 3125 3125 HOH HOH A . 
K 7 HOH 108 3126 3126 HOH HOH A . 
K 7 HOH 109 3128 3128 HOH HOH A . 
K 7 HOH 110 3129 3129 HOH HOH A . 
K 7 HOH 111 3130 3130 HOH HOH A . 
K 7 HOH 112 3131 3131 HOH HOH A . 
K 7 HOH 113 3132 3132 HOH HOH A . 
K 7 HOH 114 3133 3133 HOH HOH A . 
K 7 HOH 115 3134 3134 HOH HOH A . 
K 7 HOH 116 3136 3136 HOH HOH A . 
K 7 HOH 117 3137 3137 HOH HOH A . 
K 7 HOH 118 3139 3139 HOH HOH A . 
K 7 HOH 119 3140 3140 HOH HOH A . 
K 7 HOH 120 3141 3141 HOH HOH A . 
K 7 HOH 121 3142 3142 HOH HOH A . 
K 7 HOH 122 3143 3143 HOH HOH A . 
K 7 HOH 123 3144 3144 HOH HOH A . 
K 7 HOH 124 3145 3145 HOH HOH A . 
K 7 HOH 125 3146 3146 HOH HOH A . 
K 7 HOH 126 3147 3147 HOH HOH A . 
K 7 HOH 127 3150 3150 HOH HOH A . 
K 7 HOH 128 3151 3151 HOH HOH A . 
K 7 HOH 129 3152 3152 HOH HOH A . 
K 7 HOH 130 3154 3154 HOH HOH A . 
K 7 HOH 131 3155 3155 HOH HOH A . 
K 7 HOH 132 3156 3156 HOH HOH A . 
K 7 HOH 133 3157 3157 HOH HOH A . 
K 7 HOH 134 3158 3158 HOH HOH A . 
K 7 HOH 135 3159 3159 HOH HOH A . 
K 7 HOH 136 3161 3161 HOH HOH A . 
K 7 HOH 137 3163 3163 HOH HOH A . 
K 7 HOH 138 3165 3165 HOH HOH A . 
K 7 HOH 139 3166 3166 HOH HOH A . 
K 7 HOH 140 3169 3169 HOH HOH A . 
K 7 HOH 141 3170 3170 HOH HOH A . 
K 7 HOH 142 3171 3171 HOH HOH A . 
K 7 HOH 143 3172 3172 HOH HOH A . 
K 7 HOH 144 3173 3173 HOH HOH A . 
K 7 HOH 145 3174 3174 HOH HOH A . 
K 7 HOH 146 3175 3175 HOH HOH A . 
K 7 HOH 147 3176 3176 HOH HOH A . 
K 7 HOH 148 3177 3177 HOH HOH A . 
K 7 HOH 149 3178 3178 HOH HOH A . 
K 7 HOH 150 3179 3179 HOH HOH A . 
K 7 HOH 151 3182 3182 HOH HOH A . 
K 7 HOH 152 3183 3183 HOH HOH A . 
K 7 HOH 153 3184 3184 HOH HOH A . 
K 7 HOH 154 3185 3185 HOH HOH A . 
K 7 HOH 155 3186 3186 HOH HOH A . 
K 7 HOH 156 3187 3187 HOH HOH A . 
K 7 HOH 157 3189 3189 HOH HOH A . 
K 7 HOH 158 3190 3190 HOH HOH A . 
K 7 HOH 159 3191 3191 HOH HOH A . 
K 7 HOH 160 3193 3193 HOH HOH A . 
K 7 HOH 161 3194 3194 HOH HOH A . 
K 7 HOH 162 3195 3195 HOH HOH A . 
K 7 HOH 163 3196 3196 HOH HOH A . 
K 7 HOH 164 3197 3197 HOH HOH A . 
K 7 HOH 165 3198 3198 HOH HOH A . 
K 7 HOH 166 3199 3199 HOH HOH A . 
K 7 HOH 167 3200 3200 HOH HOH A . 
K 7 HOH 168 3201 3201 HOH HOH A . 
K 7 HOH 169 3203 3203 HOH HOH A . 
K 7 HOH 170 3204 3204 HOH HOH A . 
K 7 HOH 171 3205 3205 HOH HOH A . 
K 7 HOH 172 3206 3206 HOH HOH A . 
K 7 HOH 173 3207 3207 HOH HOH A . 
K 7 HOH 174 3208 3208 HOH HOH A . 
K 7 HOH 175 3209 3209 HOH HOH A . 
K 7 HOH 176 3210 3210 HOH HOH A . 
K 7 HOH 177 3211 3211 HOH HOH A . 
K 7 HOH 178 3212 3212 HOH HOH A . 
K 7 HOH 179 3214 3214 HOH HOH A . 
K 7 HOH 180 3215 3215 HOH HOH A . 
K 7 HOH 181 3216 3216 HOH HOH A . 
K 7 HOH 182 3217 3217 HOH HOH A . 
K 7 HOH 183 3220 3220 HOH HOH A . 
K 7 HOH 184 3221 3221 HOH HOH A . 
K 7 HOH 185 3222 3222 HOH HOH A . 
K 7 HOH 186 3223 3223 HOH HOH A . 
K 7 HOH 187 3224 3224 HOH HOH A . 
K 7 HOH 188 3225 3225 HOH HOH A . 
K 7 HOH 189 3226 3226 HOH HOH A . 
K 7 HOH 190 3227 3227 HOH HOH A . 
K 7 HOH 191 3228 3228 HOH HOH A . 
K 7 HOH 192 3229 3229 HOH HOH A . 
K 7 HOH 193 3230 3230 HOH HOH A . 
K 7 HOH 194 3232 3232 HOH HOH A . 
K 7 HOH 195 3233 3233 HOH HOH A . 
K 7 HOH 196 3234 3234 HOH HOH A . 
K 7 HOH 197 3236 3236 HOH HOH A . 
K 7 HOH 198 3237 3237 HOH HOH A . 
K 7 HOH 199 3238 3238 HOH HOH A . 
K 7 HOH 200 3239 3239 HOH HOH A . 
K 7 HOH 201 3240 3240 HOH HOH A . 
K 7 HOH 202 3242 3242 HOH HOH A . 
K 7 HOH 203 3244 3244 HOH HOH A . 
K 7 HOH 204 3246 3246 HOH HOH A . 
K 7 HOH 205 3248 3248 HOH HOH A . 
K 7 HOH 206 3250 3250 HOH HOH A . 
K 7 HOH 207 3251 3251 HOH HOH A . 
K 7 HOH 208 3252 3252 HOH HOH A . 
K 7 HOH 209 3253 3253 HOH HOH A . 
K 7 HOH 210 3254 3254 HOH HOH A . 
K 7 HOH 211 3255 3255 HOH HOH A . 
K 7 HOH 212 3256 3256 HOH HOH A . 
K 7 HOH 213 3258 3258 HOH HOH A . 
K 7 HOH 214 3259 3259 HOH HOH A . 
K 7 HOH 215 3260 3260 HOH HOH A . 
K 7 HOH 216 3261 3261 HOH HOH A . 
K 7 HOH 217 3262 3262 HOH HOH A . 
K 7 HOH 218 3264 3264 HOH HOH A . 
K 7 HOH 219 3265 3265 HOH HOH A . 
K 7 HOH 220 3266 3266 HOH HOH A . 
K 7 HOH 221 3270 3270 HOH HOH A . 
K 7 HOH 222 3271 3271 HOH HOH A . 
K 7 HOH 223 3272 3272 HOH HOH A . 
K 7 HOH 224 3273 3273 HOH HOH A . 
K 7 HOH 225 3275 3275 HOH HOH A . 
K 7 HOH 226 3278 3278 HOH HOH A . 
K 7 HOH 227 3281 3281 HOH HOH A . 
K 7 HOH 228 3282 3282 HOH HOH A . 
K 7 HOH 229 3283 3283 HOH HOH A . 
K 7 HOH 230 3285 3285 HOH HOH A . 
K 7 HOH 231 3286 3286 HOH HOH A . 
K 7 HOH 232 3287 3287 HOH HOH A . 
K 7 HOH 233 3288 3288 HOH HOH A . 
K 7 HOH 234 3289 3289 HOH HOH A . 
K 7 HOH 235 3290 3290 HOH HOH A . 
K 7 HOH 236 3294 3294 HOH HOH A . 
K 7 HOH 237 3295 3295 HOH HOH A . 
K 7 HOH 238 3296 3296 HOH HOH A . 
K 7 HOH 239 3297 3297 HOH HOH A . 
K 7 HOH 240 3298 3298 HOH HOH A . 
K 7 HOH 241 3299 3299 HOH HOH A . 
K 7 HOH 242 3300 3300 HOH HOH A . 
K 7 HOH 243 3302 3302 HOH HOH A . 
K 7 HOH 244 3303 3303 HOH HOH A . 
K 7 HOH 245 3304 3304 HOH HOH A . 
K 7 HOH 246 3305 3305 HOH HOH A . 
K 7 HOH 247 3309 3309 HOH HOH A . 
K 7 HOH 248 3310 3310 HOH HOH A . 
K 7 HOH 249 3311 3311 HOH HOH A . 
K 7 HOH 250 3312 3312 HOH HOH A . 
K 7 HOH 251 3313 3313 HOH HOH A . 
K 7 HOH 252 3315 3315 HOH HOH A . 
K 7 HOH 253 3316 3316 HOH HOH A . 
K 7 HOH 254 3318 3318 HOH HOH A . 
K 7 HOH 255 3319 3319 HOH HOH A . 
K 7 HOH 256 3320 3320 HOH HOH A . 
K 7 HOH 257 3323 3323 HOH HOH A . 
K 7 HOH 258 3325 3325 HOH HOH A . 
K 7 HOH 259 3326 3326 HOH HOH A . 
K 7 HOH 260 3328 3328 HOH HOH A . 
K 7 HOH 261 3329 3329 HOH HOH A . 
K 7 HOH 262 3330 3330 HOH HOH A . 
K 7 HOH 263 3331 3331 HOH HOH A . 
K 7 HOH 264 3332 3332 HOH HOH A . 
K 7 HOH 265 3333 3333 HOH HOH A . 
K 7 HOH 266 3334 3334 HOH HOH A . 
K 7 HOH 267 3336 3336 HOH HOH A . 
K 7 HOH 268 3337 3337 HOH HOH A . 
K 7 HOH 269 3338 3338 HOH HOH A . 
K 7 HOH 270 3339 3339 HOH HOH A . 
K 7 HOH 271 3340 3340 HOH HOH A . 
K 7 HOH 272 3341 3341 HOH HOH A . 
K 7 HOH 273 3342 3342 HOH HOH A . 
K 7 HOH 274 3343 3343 HOH HOH A . 
K 7 HOH 275 3344 3344 HOH HOH A . 
K 7 HOH 276 3345 3345 HOH HOH A . 
K 7 HOH 277 3347 3347 HOH HOH A . 
K 7 HOH 278 3348 3348 HOH HOH A . 
K 7 HOH 279 3349 3349 HOH HOH A . 
K 7 HOH 280 3350 3350 HOH HOH A . 
K 7 HOH 281 3351 3351 HOH HOH A . 
K 7 HOH 282 3352 3352 HOH HOH A . 
K 7 HOH 283 3354 3354 HOH HOH A . 
K 7 HOH 284 3357 3357 HOH HOH A . 
K 7 HOH 285 3358 3358 HOH HOH A . 
K 7 HOH 286 3360 3360 HOH HOH A . 
K 7 HOH 287 3362 3362 HOH HOH A . 
K 7 HOH 288 3363 3363 HOH HOH A . 
K 7 HOH 289 3364 3364 HOH HOH A . 
K 7 HOH 290 3365 3365 HOH HOH A . 
K 7 HOH 291 3366 3366 HOH HOH A . 
K 7 HOH 292 3368 3368 HOH HOH A . 
K 7 HOH 293 3369 3369 HOH HOH A . 
K 7 HOH 294 3370 3370 HOH HOH A . 
K 7 HOH 295 3371 3371 HOH HOH A . 
K 7 HOH 296 3372 3372 HOH HOH A . 
K 7 HOH 297 3373 3373 HOH HOH A . 
K 7 HOH 298 3376 3376 HOH HOH A . 
K 7 HOH 299 3381 3381 HOH HOH A . 
K 7 HOH 300 3383 3383 HOH HOH A . 
K 7 HOH 301 3384 3384 HOH HOH A . 
K 7 HOH 302 3385 3385 HOH HOH A . 
K 7 HOH 303 3387 3387 HOH HOH A . 
K 7 HOH 304 3388 3388 HOH HOH A . 
K 7 HOH 305 3389 3389 HOH HOH A . 
K 7 HOH 306 3391 3391 HOH HOH A . 
K 7 HOH 307 3392 3392 HOH HOH A . 
K 7 HOH 308 3393 3393 HOH HOH A . 
K 7 HOH 309 3394 3394 HOH HOH A . 
K 7 HOH 310 3396 3396 HOH HOH A . 
K 7 HOH 311 3397 3397 HOH HOH A . 
K 7 HOH 312 3399 3399 HOH HOH A . 
K 7 HOH 313 3400 3400 HOH HOH A . 
K 7 HOH 314 3402 3402 HOH HOH A . 
K 7 HOH 315 3403 3403 HOH HOH A . 
K 7 HOH 316 3406 3406 HOH HOH A . 
K 7 HOH 317 3407 3407 HOH HOH A . 
K 7 HOH 318 3408 3408 HOH HOH A . 
K 7 HOH 319 3409 3409 HOH HOH A . 
K 7 HOH 320 3411 3411 HOH HOH A . 
K 7 HOH 321 3412 3412 HOH HOH A . 
K 7 HOH 322 3414 3414 HOH HOH A . 
K 7 HOH 323 3415 3415 HOH HOH A . 
K 7 HOH 324 3416 3416 HOH HOH A . 
K 7 HOH 325 3417 3417 HOH HOH A . 
K 7 HOH 326 3418 3418 HOH HOH A . 
K 7 HOH 327 3420 3420 HOH HOH A . 
K 7 HOH 328 3422 3422 HOH HOH A . 
K 7 HOH 329 3424 3424 HOH HOH A . 
K 7 HOH 330 3425 3425 HOH HOH A . 
K 7 HOH 331 3427 3427 HOH HOH A . 
K 7 HOH 332 3428 3428 HOH HOH A . 
K 7 HOH 333 3429 3429 HOH HOH A . 
K 7 HOH 334 3430 3430 HOH HOH A . 
K 7 HOH 335 3431 3431 HOH HOH A . 
K 7 HOH 336 3432 3432 HOH HOH A . 
K 7 HOH 337 3433 3433 HOH HOH A . 
K 7 HOH 338 3435 3435 HOH HOH A . 
K 7 HOH 339 3437 3437 HOH HOH A . 
K 7 HOH 340 3438 3438 HOH HOH A . 
K 7 HOH 341 3439 3439 HOH HOH A . 
K 7 HOH 342 3440 3440 HOH HOH A . 
K 7 HOH 343 3441 3441 HOH HOH A . 
K 7 HOH 344 3445 3445 HOH HOH A . 
K 7 HOH 345 3446 3446 HOH HOH A . 
K 7 HOH 346 3447 3447 HOH HOH A . 
K 7 HOH 347 3448 3448 HOH HOH A . 
K 7 HOH 348 3449 3449 HOH HOH A . 
K 7 HOH 349 3450 3450 HOH HOH A . 
K 7 HOH 350 3452 3452 HOH HOH A . 
K 7 HOH 351 3453 3453 HOH HOH A . 
K 7 HOH 352 3454 3454 HOH HOH A . 
K 7 HOH 353 3455 3455 HOH HOH A . 
K 7 HOH 354 3456 3456 HOH HOH A . 
K 7 HOH 355 3457 3457 HOH HOH A . 
K 7 HOH 356 3458 3458 HOH HOH A . 
K 7 HOH 357 3459 3459 HOH HOH A . 
K 7 HOH 358 3460 3460 HOH HOH A . 
K 7 HOH 359 3461 3461 HOH HOH A . 
K 7 HOH 360 3463 3463 HOH HOH A . 
K 7 HOH 361 3464 3464 HOH HOH A . 
K 7 HOH 362 3465 3465 HOH HOH A . 
K 7 HOH 363 3467 3467 HOH HOH A . 
K 7 HOH 364 3470 3470 HOH HOH A . 
K 7 HOH 365 3472 3472 HOH HOH A . 
K 7 HOH 366 3473 3473 HOH HOH A . 
K 7 HOH 367 3474 3474 HOH HOH A . 
K 7 HOH 368 3475 3475 HOH HOH A . 
K 7 HOH 369 3477 3477 HOH HOH A . 
K 7 HOH 370 3478 3478 HOH HOH A . 
K 7 HOH 371 3479 3479 HOH HOH A . 
K 7 HOH 372 3480 3480 HOH HOH A . 
K 7 HOH 373 3481 3481 HOH HOH A . 
K 7 HOH 374 3482 3482 HOH HOH A . 
K 7 HOH 375 3483 3483 HOH HOH A . 
K 7 HOH 376 3485 3485 HOH HOH A . 
K 7 HOH 377 3486 3486 HOH HOH A . 
K 7 HOH 378 3487 3487 HOH HOH A . 
K 7 HOH 379 3489 3489 HOH HOH A . 
K 7 HOH 380 3490 3490 HOH HOH A . 
K 7 HOH 381 3492 3492 HOH HOH A . 
K 7 HOH 382 3493 3493 HOH HOH A . 
K 7 HOH 383 3495 3495 HOH HOH A . 
K 7 HOH 384 3496 3496 HOH HOH A . 
K 7 HOH 385 3497 3497 HOH HOH A . 
K 7 HOH 386 3498 3498 HOH HOH A . 
K 7 HOH 387 3500 3500 HOH HOH A . 
K 7 HOH 388 3501 3501 HOH HOH A . 
K 7 HOH 389 3502 3502 HOH HOH A . 
K 7 HOH 390 3503 3503 HOH HOH A . 
K 7 HOH 391 3505 3505 HOH HOH A . 
K 7 HOH 392 3506 3506 HOH HOH A . 
K 7 HOH 393 3508 3508 HOH HOH A . 
K 7 HOH 394 3509 3509 HOH HOH A . 
K 7 HOH 395 3512 3512 HOH HOH A . 
K 7 HOH 396 3516 3516 HOH HOH A . 
K 7 HOH 397 3517 3517 HOH HOH A . 
K 7 HOH 398 3520 3520 HOH HOH A . 
K 7 HOH 399 3521 3521 HOH HOH A . 
K 7 HOH 400 3523 3523 HOH HOH A . 
K 7 HOH 401 3524 3524 HOH HOH A . 
K 7 HOH 402 3525 3525 HOH HOH A . 
K 7 HOH 403 3527 3527 HOH HOH A . 
K 7 HOH 404 3528 3528 HOH HOH A . 
K 7 HOH 405 3529 3529 HOH HOH A . 
K 7 HOH 406 3530 3530 HOH HOH A . 
K 7 HOH 407 3531 3531 HOH HOH A . 
K 7 HOH 408 3532 3532 HOH HOH A . 
K 7 HOH 409 3533 3533 HOH HOH A . 
K 7 HOH 410 3534 3534 HOH HOH A . 
K 7 HOH 411 3535 3535 HOH HOH A . 
K 7 HOH 412 3537 3537 HOH HOH A . 
K 7 HOH 413 3538 3538 HOH HOH A . 
K 7 HOH 414 3539 3539 HOH HOH A . 
K 7 HOH 415 3540 3540 HOH HOH A . 
K 7 HOH 416 3541 3541 HOH HOH A . 
K 7 HOH 417 3542 3542 HOH HOH A . 
K 7 HOH 418 3543 3543 HOH HOH A . 
K 7 HOH 419 3545 3545 HOH HOH A . 
L 7 HOH 1   3008 3008 HOH HOH B . 
L 7 HOH 2   3034 3034 HOH HOH B . 
L 7 HOH 3   3081 3081 HOH HOH B . 
L 7 HOH 4   3100 3100 HOH HOH B . 
L 7 HOH 5   3127 3127 HOH HOH B . 
L 7 HOH 6   3135 3135 HOH HOH B . 
L 7 HOH 7   3138 3138 HOH HOH B . 
L 7 HOH 8   3148 3148 HOH HOH B . 
L 7 HOH 9   3153 3153 HOH HOH B . 
L 7 HOH 10  3160 3160 HOH HOH B . 
L 7 HOH 11  3181 3181 HOH HOH B . 
L 7 HOH 12  3188 3188 HOH HOH B . 
L 7 HOH 13  3219 3219 HOH HOH B . 
L 7 HOH 14  3235 3235 HOH HOH B . 
L 7 HOH 15  3243 3243 HOH HOH B . 
L 7 HOH 16  3247 3247 HOH HOH B . 
L 7 HOH 17  3263 3263 HOH HOH B . 
L 7 HOH 18  3267 3267 HOH HOH B . 
L 7 HOH 19  3269 3269 HOH HOH B . 
L 7 HOH 20  3279 3279 HOH HOH B . 
L 7 HOH 21  3292 3292 HOH HOH B . 
L 7 HOH 22  3307 3307 HOH HOH B . 
L 7 HOH 23  3317 3317 HOH HOH B . 
L 7 HOH 24  3359 3359 HOH HOH B . 
L 7 HOH 25  3361 3361 HOH HOH B . 
L 7 HOH 26  3374 3374 HOH HOH B . 
L 7 HOH 27  3375 3375 HOH HOH B . 
L 7 HOH 28  3380 3380 HOH HOH B . 
L 7 HOH 29  3382 3382 HOH HOH B . 
L 7 HOH 30  3386 3386 HOH HOH B . 
L 7 HOH 31  3390 3390 HOH HOH B . 
L 7 HOH 32  3395 3395 HOH HOH B . 
L 7 HOH 33  3434 3434 HOH HOH B . 
L 7 HOH 34  3442 3442 HOH HOH B . 
L 7 HOH 35  3484 3484 HOH HOH B . 
L 7 HOH 36  3491 3491 HOH HOH B . 
L 7 HOH 37  3499 3499 HOH HOH B . 
L 7 HOH 38  3514 3514 HOH HOH B . 
L 7 HOH 39  3544 3544 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    2DA 
_pdbx_struct_mod_residue.label_seq_id     11 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     2DA 
_pdbx_struct_mod_residue.auth_seq_id      22 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DA 
_pdbx_struct_mod_residue.details          "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 3195 ? 1_555 94.7  ? 
2  OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 97.6  ? 
3  O   ? K HOH .   ? A HOH 3195 ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 90.8  ? 
4  OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 O2A ? E DG3 .   ? P DG3 23   ? 1_555 88.9  ? 
5  O   ? K HOH .   ? A HOH 3195 ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 O2A ? E DG3 .   ? P DG3 23   ? 1_555 156.5 ? 
6  OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 O2A ? E DG3 .   ? P DG3 23   ? 1_555 111.7 ? 
7  OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 O   ? I HOH .   ? P HOH 3180 ? 1_555 162.4 ? 
8  O   ? K HOH .   ? A HOH 3195 ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 O   ? I HOH .   ? P HOH 3180 ? 1_555 81.0  ? 
9  OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 O   ? I HOH .   ? P HOH 3180 ? 1_555 99.6  ? 
10 O2A ? E DG3 .   ? P DG3 23   ? 1_555 MG ? G MG . ? A MG 4002 ? 1_555 O   ? I HOH .   ? P HOH 3180 ? 1_555 88.6  ? 
11 O1G ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 O2B ? E DG3 .   ? P DG3 23   ? 1_555 90.4  ? 
12 O1G ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 O   ? C ALA 470 ? A ALA 476  ? 1_555 98.2  ? 
13 O2B ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 O   ? C ALA 470 ? A ALA 476  ? 1_555 95.4  ? 
14 O1G ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 164.8 ? 
15 O2B ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 95.6  ? 
16 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 95.2  ? 
17 O1G ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 76.3  ? 
18 O2B ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 166.6 ? 
19 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 84.8  ? 
20 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 97.7  ? 
21 O1G ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 O2A ? E DG3 .   ? P DG3 23   ? 1_555 86.5  ? 
22 O2B ? E DG3 .   ? P DG3 23   ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 O2A ? E DG3 .   ? P DG3 23   ? 1_555 86.5  ? 
23 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 O2A ? E DG3 .   ? P DG3 23   ? 1_555 174.9 ? 
24 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 O2A ? E DG3 .   ? P DG3 23   ? 1_555 79.9  ? 
25 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4001 ? 1_555 O2A ? E DG3 .   ? P DG3 23   ? 1_555 94.4  ? 
26 O   ? K HOH .   ? A HOH 3534 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 3533 ? 1_555 78.6  ? 
27 O   ? K HOH .   ? A HOH 3534 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 3535 ? 1_555 87.9  ? 
28 O   ? K HOH .   ? A HOH 3533 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 3535 ? 1_555 153.9 ? 
29 O   ? K HOH .   ? A HOH 3534 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 69.5  ? 
30 O   ? K HOH .   ? A HOH 3533 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 79.4  ? 
31 O   ? K HOH .   ? A HOH 3535 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 74.9  ? 
32 O   ? K HOH .   ? A HOH 3534 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 3532 ? 1_555 147.4 ? 
33 O   ? K HOH .   ? A HOH 3533 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 3532 ? 1_555 90.6  ? 
34 O   ? K HOH .   ? A HOH 3535 ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 3532 ? 1_555 88.8  ? 
35 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 MG ? H MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 3532 ? 1_555 78.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-02-25 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Source and taxonomy'       
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity              
2 4 'Structure model' entity_name_com     
3 4 'Structure model' entity_src_gen      
4 4 'Structure model' pdbx_entity_src_syn 
5 4 'Structure model' struct_ref          
6 4 'Structure model' struct_ref_seq      
7 4 'Structure model' struct_ref_seq_dif  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_entity.pdbx_description'                       
2  4 'Structure model' '_entity.pdbx_ec'                                
3  4 'Structure model' '_entity_src_gen.gene_src_common_name'           
4  4 'Structure model' '_entity_src_gen.pdbx_beg_seq_num'               
5  4 'Structure model' '_entity_src_gen.pdbx_end_seq_num'               
6  4 'Structure model' '_entity_src_gen.pdbx_gene_src_gene'             
7  4 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 
8  4 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name'  
9  4 'Structure model' '_entity_src_gen.pdbx_seq_type'                  
10 4 'Structure model' '_struct_ref.db_code'                            
11 4 'Structure model' '_struct_ref.db_name'                            
12 4 'Structure model' '_struct_ref.entity_id'                          
13 4 'Structure model' '_struct_ref.pdbx_align_begin'                   
14 4 'Structure model' '_struct_ref.pdbx_db_accession'                  
15 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'           
16 4 'Structure model' '_struct_ref_seq.db_align_beg'                   
17 4 'Structure model' '_struct_ref_seq.db_align_end'                   
18 4 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg'        
19 4 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end'        
20 4 'Structure model' '_struct_ref_seq.pdbx_db_accession'              
21 4 'Structure model' '_struct_ref_seq.pdbx_strand_id'                 
22 4 'Structure model' '_struct_ref_seq.seq_align_end'                  
23 4 'Structure model' '_struct_ref_seq_dif.align_id'                   
24 4 'Structure model' '_struct_ref_seq_dif.details'                    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE   phasing          .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 60  ? ? 77.50   32.01   
2  1 TYR A 64  ? ? -117.78 -71.08  
3  1 HIS A 99  ? ? -104.28 49.01   
4  1 ASP A 156 ? ? 22.58   -82.24  
5  1 THR A 279 ? ? -78.19  -99.40  
6  1 ILE A 289 ? ? -100.87 -167.75 
7  1 LYS A 359 ? ? -178.32 -53.73  
8  1 VAL A 364 ? ? -118.31 77.02   
9  1 VAL A 374 ? ? -114.10 -160.54 
10 1 ALA A 400 ? ? -130.77 -44.17  
11 1 LEU A 479 ? ? -32.51  -76.41  
12 1 TYR A 530 ? ? -93.73  30.07   
13 1 VAL A 652 ? ? -113.24 78.81   
14 1 HIS A 653 ? ? 67.23   -77.42  
15 1 VAL B 16  ? ? -108.84 -62.82  
16 1 ASP B 20  ? ? 56.52   72.49   
17 1 GLN B 50  ? ? -68.55  97.01   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC P 20 ? ? 0.067 'SIDE CHAIN' 
2 1 DG T 7  ? ? 0.071 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 166 ? CG  ? C GLU 160 CG  
2  1 Y 1 A GLU 166 ? CD  ? C GLU 160 CD  
3  1 Y 1 A GLU 166 ? OE1 ? C GLU 160 OE1 
4  1 Y 1 A GLU 166 ? OE2 ? C GLU 160 OE2 
5  1 Y 1 A LYS 189 ? CG  ? C LYS 183 CG  
6  1 Y 1 A LYS 189 ? CD  ? C LYS 183 CD  
7  1 Y 1 A LYS 189 ? CE  ? C LYS 183 CE  
8  1 Y 1 A LYS 189 ? NZ  ? C LYS 183 NZ  
9  1 Y 1 A LYS 285 ? CG  ? C LYS 279 CG  
10 1 Y 1 A LYS 285 ? CD  ? C LYS 279 CD  
11 1 Y 1 A LYS 285 ? CE  ? C LYS 279 CE  
12 1 Y 1 A LYS 285 ? NZ  ? C LYS 279 NZ  
13 1 Y 1 A LYS 293 ? CG  ? C LYS 287 CG  
14 1 Y 1 A LYS 293 ? CD  ? C LYS 287 CD  
15 1 Y 1 A LYS 293 ? CE  ? C LYS 287 CE  
16 1 Y 1 A LYS 293 ? NZ  ? C LYS 287 NZ  
17 1 Y 1 A GLN 571 ? CG  ? C GLN 565 CG  
18 1 Y 1 A GLN 571 ? CD  ? C GLN 565 CD  
19 1 Y 1 A GLN 571 ? OE1 ? C GLN 565 OE1 
20 1 Y 1 A GLN 571 ? NE2 ? C GLN 565 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 294 ? C VAL 288 
2  1 Y 1 A GLY 295 ? C GLY 289 
3  1 Y 1 A GLY 296 ? C GLY 290 
4  1 Y 1 A ILE 297 ? C ILE 291 
5  1 Y 1 A PHE 298 ? C PHE 292 
6  1 Y 1 A LYS 299 ? C LYS 293 
7  1 Y 1 A LYS 300 ? C LYS 294 
8  1 Y 1 A PRO 301 ? C PRO 295 
9  1 Y 1 A LYS 302 ? C LYS 296 
10 1 Y 1 A ASN 303 ? C ASN 297 
11 1 Y 1 A LYS 304 ? C LYS 298 
12 1 Y 1 A ALA 305 ? C ALA 299 
13 1 Y 1 A GLN 306 ? C GLN 300 
14 1 Y 1 A ARG 307 ? C ARG 301 
15 1 Y 1 A GLU 308 ? C GLU 302 
16 1 Y 1 A GLY 309 ? C GLY 303 
17 1 Y 1 A ARG 310 ? C ARG 304 
18 1 Y 1 A GLU 311 ? C GLU 305 
19 1 Y 1 A PRO 312 ? C PRO 306 
20 1 Y 1 A CYS 313 ? C CYS 307 
21 1 Y 1 A GLU 314 ? C GLU 308 
22 1 Y 1 A LEU 315 ? C LEU 309 
23 1 Y 1 A ASP 316 ? C ASP 310 
24 1 Y 1 A THR 317 ? C THR 311 
25 1 Y 1 A ARG 318 ? C ARG 312 
26 1 Y 1 A SER 576 ? C SER 570 
27 1 Y 1 A SER 577 ? C SER 571 
28 1 Y 1 A GLN 578 ? C GLN 572 
29 1 Y 1 A TRP 579 ? C TRP 573 
30 1 Y 1 A VAL 580 ? C VAL 574 
31 1 Y 1 A ALA 581 ? C ALA 575 
32 1 Y 1 A GLY 582 ? C GLY 576 
33 1 Y 1 A GLU 583 ? C GLU 577 
34 1 Y 1 A GLN 584 ? C GLN 578 
35 1 Y 1 A GLN 585 ? C GLN 579 
36 1 Y 1 A VAL 586 ? C VAL 580 
37 1 Y 1 B SER 1   ? D SER 1   
38 1 Y 1 B ASP 2   ? D ASP 2   
39 1 Y 1 B ALA 108 ? D ALA 108 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1T7P 'double helix'        
1T7P 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC  2  1_555 B DG 12 1_555 -0.134 0.206  -0.177 3.858   -12.758 -1.088 1  P_DC13:DG14_T P 13 ? T 14 ? 19 1 
1 A DC  3  1_555 B DG 11 1_555 0.568  -0.068 0.174  -6.427  -10.155 2.477  2  P_DC14:DG13_T P 14 ? T 13 ? 19 1 
1 A DA  4  1_555 B DT 10 1_555 0.013  -0.034 0.066  -8.910  -9.782  -1.561 3  P_DA15:DT12_T P 15 ? T 12 ? 20 1 
1 A DG  5  1_555 B DC 9  1_555 -0.346 -0.029 -0.169 -10.991 -14.519 2.436  4  P_DG16:DC11_T P 16 ? T 11 ? 19 1 
1 A DT  6  1_555 B DA 8  1_555 0.082  -0.014 0.036  1.903   -5.424  2.570  5  P_DT17:DA10_T P 17 ? T 10 ? 20 1 
1 A DG  7  1_555 B DC 7  1_555 -0.483 -0.262 -0.906 -5.274  -1.132  0.479  6  P_DG18:DC9_T  P 18 ? T 9  ? 19 1 
1 A DC  8  1_555 B DG 6  1_555 0.203  0.020  -0.240 5.796   2.644   -1.536 7  P_DC19:DG8_T  P 19 ? T 8  ? 19 1 
1 A DC  9  1_555 B DG 5  1_555 -0.270 -0.509 -0.798 5.295   3.917   -2.767 8  P_DC20:DG7_T  P 20 ? T 7  ? 19 1 
1 A DA  10 1_555 B DT 4  1_555 0.048  -0.234 -0.321 -4.410  0.469   -1.159 9  P_DA21:DT6_T  P 21 ? T 6  ? 20 1 
1 A 2DA 11 1_555 B DT 3  1_555 0.044  -0.076 -0.245 1.354   -9.189  1.634  10 P_2DA22:DT5_T P 22 ? T 5  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2  1_555 B DG 12 1_555 A DC  3  1_555 B DG 11 1_555 1.008  -0.561 3.515 0.908  10.107 37.069 -2.188 -1.413 3.279 15.543 
-1.397  38.385 1 PP_DC13DC14:DG13DG14_TT P 13 ? T 14 ? P 14 ? T 13 ? 
1 A DC 3  1_555 B DG 11 1_555 A DA  4  1_555 B DT 10 1_555 -0.863 0.046  3.171 -2.631 12.454 30.234 -2.036 1.083  3.019 22.657 
4.786   32.746 2 PP_DC14DA15:DT12DG13_TT P 14 ? T 13 ? P 15 ? T 12 ? 
1 A DA 4  1_555 B DT 10 1_555 A DG  5  1_555 B DC 9  1_555 0.341  -0.277 3.496 0.560  4.558  32.367 -1.332 -0.502 3.431 8.125  
-0.998  32.683 3 PP_DA15DG16:DC11DT12_TT P 15 ? T 12 ? P 16 ? T 11 ? 
1 A DG 5  1_555 B DC 9  1_555 A DT  6  1_555 B DA 8  1_555 0.379  -0.312 3.087 -0.952 3.884  31.058 -1.265 -0.871 3.014 7.216  
1.769   31.308 4 PP_DG16DT17:DA10DC11_TT P 16 ? T 11 ? P 17 ? T 10 ? 
1 A DT 6  1_555 B DA 8  1_555 A DG  7  1_555 B DC 7  1_555 0.869  -0.120 3.610 8.764  7.871  30.760 -1.743 0.171  3.580 14.201 
-15.812 32.887 5 PP_DT17DG18:DC9DA10_TT  P 17 ? T 10 ? P 18 ? T 9  ? 
1 A DG 7  1_555 B DC 7  1_555 A DC  8  1_555 B DG 6  1_555 -0.583 -0.317 3.108 -5.708 2.618  30.870 -1.055 0.048  3.126 4.855  
10.587  31.487 6 PP_DG18DC19:DG8DC9_TT   P 18 ? T 9  ? P 19 ? T 8  ? 
1 A DC 8  1_555 B DG 6  1_555 A DC  9  1_555 B DG 5  1_555 -0.228 -0.728 3.501 -2.572 9.385  35.385 -2.504 -0.007 3.218 15.091 
4.136   36.658 7 PP_DC19DC20:DG7DG8_TT   P 19 ? T 8  ? P 20 ? T 7  ? 
1 A DC 9  1_555 B DG 5  1_555 A DA  10 1_555 B DT 4  1_555 -0.551 -1.308 3.856 -4.723 16.590 24.777 -6.187 0.016  2.560 33.912 
9.654   30.113 8 PP_DC20DA21:DT6DG7_TT   P 20 ? T 7  ? P 21 ? T 6  ? 
1 A DA 10 1_555 B DT 4  1_555 A 2DA 11 1_555 B DT 3  1_555 0.125  -0.612 3.301 1.559  -1.380 33.886 -0.824 0.039  3.325 -2.364 
-2.671  33.948 9 PP_DA212DA22:DT5DT6_TT  P 21 ? T 6  ? P 22 ? T 5  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 "2'-3'-DIDEOXYGUANOSINE-5'-TRIPHOSPHATE" DG3 
6 'MAGNESIUM ION'                          MG  
7 water                                    HOH 
#