data_1TCR
# 
_entry.id   1TCR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TCR         
WWPDB D_1000176621 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TCR 
_pdbx_database_status.recvd_initial_deposition_date   1996-09-12 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Garcia, K.C.'    1 
'Degano, M.'      2 
'Stanfield, R.L.' 3 
'Wilson, I.A.'    4 
# 
_citation.id                        primary 
_citation.title                     'An alphabeta T cell receptor structure at 2.5 A and its orientation in the TCR-MHC complex.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            274 
_citation.page_first                209 
_citation.page_last                 219 
_citation.year                      1996 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8824178 
_citation.pdbx_database_id_DOI      10.1126/science.274.5285.209 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Garcia, K.C.'    1 ? 
primary 'Degano, M.'      2 ? 
primary 'Stanfield, R.L.' 3 ? 
primary 'Brunmark, A.'    4 ? 
primary 'Jackson, M.R.'   5 ? 
primary 'Peterson, P.A.'  6 ? 
primary 'Teyton, L.'      7 ? 
primary 'Wilson, I.A.'    8 ? 
# 
_cell.entry_id           1TCR 
_cell.length_a           138.000 
_cell.length_b           72.900 
_cell.length_c           57.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TCR 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA)' 22298.889 1  ? ? ? ? 
2 polymer     man 'ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA)' 26284.180 1  ? ? ? ? 
3 branched    man 
;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
732.682   1  ? ? ? ? 
4 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   1  
? ? ? ? 
5 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1  ? ? ? ? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1  ? ? ? ? 
7 non-polymer syn 'SULFATE ION' 96.063    3  ? ? ? ? 
8 water       nat water 18.015    22 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 TCR 
2 TCR 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASV
HWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYALKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDATV
LDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC
;
;QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASV
HWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYALKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDATV
LDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC
;
A ? 
2 'polypeptide(L)' no no 
;EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILEL
ATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGK
EVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC
;
;EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILEL
ATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGK
EVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   SER n 
1 3   VAL n 
1 4   THR n 
1 5   GLN n 
1 6   PRO n 
1 7   ASP n 
1 8   ALA n 
1 9   ARG n 
1 10  VAL n 
1 11  THR n 
1 12  VAL n 
1 13  SER n 
1 14  GLU n 
1 15  GLY n 
1 16  ALA n 
1 17  SER n 
1 18  LEU n 
1 19  GLN n 
1 20  LEU n 
1 21  ARG n 
1 22  CYS n 
1 23  LYS n 
1 24  TYR n 
1 25  SER n 
1 26  TYR n 
1 27  SER n 
1 28  ALA n 
1 29  THR n 
1 30  PRO n 
1 31  TYR n 
1 32  LEU n 
1 33  PHE n 
1 34  TRP n 
1 35  TYR n 
1 36  VAL n 
1 37  GLN n 
1 38  TYR n 
1 39  PRO n 
1 40  ARG n 
1 41  GLN n 
1 42  GLY n 
1 43  LEU n 
1 44  GLN n 
1 45  LEU n 
1 46  LEU n 
1 47  LEU n 
1 48  LYS n 
1 49  TYR n 
1 50  TYR n 
1 51  SER n 
1 52  GLY n 
1 53  ASP n 
1 54  PRO n 
1 55  VAL n 
1 56  VAL n 
1 57  GLN n 
1 58  GLY n 
1 59  VAL n 
1 60  ASN n 
1 61  GLY n 
1 62  PHE n 
1 63  GLU n 
1 64  ALA n 
1 65  GLU n 
1 66  PHE n 
1 67  SER n 
1 68  LYS n 
1 69  SER n 
1 70  ASN n 
1 71  SER n 
1 72  SER n 
1 73  PHE n 
1 74  HIS n 
1 75  LEU n 
1 76  ARG n 
1 77  LYS n 
1 78  ALA n 
1 79  SER n 
1 80  VAL n 
1 81  HIS n 
1 82  TRP n 
1 83  SER n 
1 84  ASP n 
1 85  SER n 
1 86  ALA n 
1 87  VAL n 
1 88  TYR n 
1 89  PHE n 
1 90  CYS n 
1 91  ALA n 
1 92  VAL n 
1 93  SER n 
1 94  GLY n 
1 95  PHE n 
1 96  ALA n 
1 97  SER n 
1 98  ALA n 
1 99  LEU n 
1 100 THR n 
1 101 PHE n 
1 102 GLY n 
1 103 SER n 
1 104 GLY n 
1 105 THR n 
1 106 LYS n 
1 107 VAL n 
1 108 ILE n 
1 109 VAL n 
1 110 LEU n 
1 111 PRO n 
1 112 TYR n 
1 113 ILE n 
1 114 GLN n 
1 115 ASN n 
1 116 PRO n 
1 117 GLU n 
1 118 PRO n 
1 119 ALA n 
1 120 VAL n 
1 121 TYR n 
1 122 ALA n 
1 123 LEU n 
1 124 LYS n 
1 125 ASP n 
1 126 PRO n 
1 127 ARG n 
1 128 SER n 
1 129 GLN n 
1 130 ASP n 
1 131 SER n 
1 132 THR n 
1 133 LEU n 
1 134 CYS n 
1 135 LEU n 
1 136 PHE n 
1 137 THR n 
1 138 ASP n 
1 139 PHE n 
1 140 ASP n 
1 141 SER n 
1 142 GLN n 
1 143 ILE n 
1 144 ASN n 
1 145 VAL n 
1 146 PRO n 
1 147 LYS n 
1 148 THR n 
1 149 MET n 
1 150 GLU n 
1 151 SER n 
1 152 GLY n 
1 153 THR n 
1 154 PHE n 
1 155 ILE n 
1 156 THR n 
1 157 ASP n 
1 158 ALA n 
1 159 THR n 
1 160 VAL n 
1 161 LEU n 
1 162 ASP n 
1 163 MET n 
1 164 LYS n 
1 165 ALA n 
1 166 MET n 
1 167 ASP n 
1 168 SER n 
1 169 LYS n 
1 170 SER n 
1 171 ASN n 
1 172 GLY n 
1 173 ALA n 
1 174 ILE n 
1 175 ALA n 
1 176 TRP n 
1 177 SER n 
1 178 ASN n 
1 179 GLN n 
1 180 THR n 
1 181 SER n 
1 182 PHE n 
1 183 THR n 
1 184 CYS n 
1 185 GLN n 
1 186 ASP n 
1 187 ILE n 
1 188 PHE n 
1 189 LYS n 
1 190 GLU n 
1 191 THR n 
1 192 ASN n 
1 193 ALA n 
1 194 THR n 
1 195 TYR n 
1 196 PRO n 
1 197 SER n 
1 198 SER n 
1 199 ASP n 
1 200 VAL n 
1 201 PRO n 
1 202 CYS n 
2 1   GLU n 
2 2   ALA n 
2 3   ALA n 
2 4   VAL n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   ARG n 
2 10  ASN n 
2 11  LYS n 
2 12  VAL n 
2 13  ALA n 
2 14  VAL n 
2 15  THR n 
2 16  GLY n 
2 17  GLY n 
2 18  LYS n 
2 19  VAL n 
2 20  THR n 
2 21  LEU n 
2 22  SER n 
2 23  CYS n 
2 24  ASN n 
2 25  GLN n 
2 26  THR n 
2 27  ASN n 
2 28  ASN n 
2 29  HIS n 
2 30  ASN n 
2 31  ASN n 
2 32  MET n 
2 33  TYR n 
2 34  TRP n 
2 35  TYR n 
2 36  ARG n 
2 37  GLN n 
2 38  ASP n 
2 39  THR n 
2 40  GLY n 
2 41  HIS n 
2 42  GLY n 
2 43  LEU n 
2 44  ARG n 
2 45  LEU n 
2 46  ILE n 
2 47  HIS n 
2 48  TYR n 
2 49  SER n 
2 50  TYR n 
2 51  GLY n 
2 52  ALA n 
2 53  GLY n 
2 54  SER n 
2 55  THR n 
2 56  GLU n 
2 57  LYS n 
2 58  GLY n 
2 59  ASP n 
2 60  ILE n 
2 61  PRO n 
2 62  ASP n 
2 63  GLY n 
2 64  TYR n 
2 65  LYS n 
2 66  ALA n 
2 67  SER n 
2 68  ARG n 
2 69  PRO n 
2 70  SER n 
2 71  GLN n 
2 72  GLU n 
2 73  ASN n 
2 74  PHE n 
2 75  SER n 
2 76  LEU n 
2 77  ILE n 
2 78  LEU n 
2 79  GLU n 
2 80  LEU n 
2 81  ALA n 
2 82  THR n 
2 83  PRO n 
2 84  SER n 
2 85  GLN n 
2 86  THR n 
2 87  SER n 
2 88  VAL n 
2 89  TYR n 
2 90  PHE n 
2 91  CYS n 
2 92  ALA n 
2 93  SER n 
2 94  GLY n 
2 95  GLY n 
2 96  GLY n 
2 97  GLY n 
2 98  THR n 
2 99  LEU n 
2 100 TYR n 
2 101 PHE n 
2 102 GLY n 
2 103 ALA n 
2 104 GLY n 
2 105 THR n 
2 106 ARG n 
2 107 LEU n 
2 108 SER n 
2 109 VAL n 
2 110 LEU n 
2 111 GLU n 
2 112 ASP n 
2 113 LEU n 
2 114 ARG n 
2 115 ASN n 
2 116 VAL n 
2 117 THR n 
2 118 PRO n 
2 119 PRO n 
2 120 LYS n 
2 121 VAL n 
2 122 SER n 
2 123 LEU n 
2 124 PHE n 
2 125 GLU n 
2 126 PRO n 
2 127 SER n 
2 128 LYS n 
2 129 ALA n 
2 130 GLU n 
2 131 ILE n 
2 132 ALA n 
2 133 ASN n 
2 134 LYS n 
2 135 GLN n 
2 136 LYS n 
2 137 ALA n 
2 138 THR n 
2 139 LEU n 
2 140 VAL n 
2 141 CYS n 
2 142 LEU n 
2 143 ALA n 
2 144 ARG n 
2 145 GLY n 
2 146 PHE n 
2 147 PHE n 
2 148 PRO n 
2 149 ASP n 
2 150 HIS n 
2 151 VAL n 
2 152 GLU n 
2 153 LEU n 
2 154 SER n 
2 155 TRP n 
2 156 TRP n 
2 157 VAL n 
2 158 ASN n 
2 159 GLY n 
2 160 LYS n 
2 161 GLU n 
2 162 VAL n 
2 163 HIS n 
2 164 SER n 
2 165 GLY n 
2 166 VAL n 
2 167 SER n 
2 168 THR n 
2 169 ASP n 
2 170 PRO n 
2 171 GLN n 
2 172 ALA n 
2 173 TYR n 
2 174 LYS n 
2 175 GLU n 
2 176 SER n 
2 177 ASN n 
2 178 TYR n 
2 179 SER n 
2 180 TYR n 
2 181 CYS n 
2 182 LEU n 
2 183 SER n 
2 184 SER n 
2 185 ARG n 
2 186 LEU n 
2 187 ARG n 
2 188 VAL n 
2 189 SER n 
2 190 ALA n 
2 191 THR n 
2 192 PHE n 
2 193 TRP n 
2 194 HIS n 
2 195 ASN n 
2 196 PRO n 
2 197 ARG n 
2 198 ASN n 
2 199 HIS n 
2 200 PHE n 
2 201 ARG n 
2 202 CYS n 
2 203 GLN n 
2 204 VAL n 
2 205 GLN n 
2 206 PHE n 
2 207 HIS n 
2 208 GLY n 
2 209 LEU n 
2 210 SER n 
2 211 GLU n 
2 212 GLU n 
2 213 ASP n 
2 214 LYS n 
2 215 TRP n 
2 216 PRO n 
2 217 GLU n 
2 218 GLY n 
2 219 SER n 
2 220 PRO n 
2 221 LYS n 
2 222 PRO n 
2 223 VAL n 
2 224 THR n 
2 225 GLN n 
2 226 ASN n 
2 227 ILE n 
2 228 SER n 
2 229 ALA n 
2 230 GLU n 
2 231 ALA n 
2 232 TRP n 
2 233 GLY n 
2 234 ARG n 
2 235 ALA n 
2 236 ASP n 
2 237 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? T-LYMPHOCYTES ? 'fruit fly' 
'Drosophila melanogaster' 7227 Drosophila ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? T-LYMPHOCYTES ? 'fruit fly' 
'Drosophila melanogaster' 7227 Drosophila ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 EMBL CAA25595 1 X01134  1 
;MLLALLPVLGIHFVLRDAQAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVN
GFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYQLKDPRSQDSTLCLFTDFD
SQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQ
NLSVMGLRILLLKVAGFNLLMTLRLWSS
;
? 
2 GB   AAB41230 2 1791255 1 
;MSNTAFPDPAWNTTLLSWVALFLLGTKHMEAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYG
AGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGQGRAEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKA
EIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL
SEEDKWPEGSPKPVTQNISAEAWGRADC
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TCR A 1 ? 202 ? X01134  21 ? 222 ? 1 213 
2 2 1TCR B 1 ? 237 ? 1791255 30 ? 268 ? 1 247 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1TCR ALA A 122 ? EMBL X01134  GLN 142 conflict 127 1  
1 1TCR ALA A 158 ? EMBL X01134  LYS 178 conflict 165 2  
2 1TCR GLY B 96  ? GB   1791255 GLN 125 conflict 97  3  
2 1TCR ?   B ?   ? GB   1791255 ARG 127 deletion ?   4  
2 1TCR ?   B ?   ? GB   1791255 ALA 128 deletion ?   5  
2 1TCR THR B 98  ? GB   1791255 GLU 129 conflict 105 6  
2 1TCR LEU B 99  ? GB   1791255 GLN 130 conflict 106 7  
2 1TCR TYR B 100 ? GB   1791255 PHE 131 conflict 107 8  
2 1TCR ALA B 103 ? GB   1791255 PRO 134 conflict 110 9  
2 1TCR SER B 108 ? GB   1791255 THR 139 conflict 115 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                   . 'SULFATE ION'                            ? 'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1TCR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_percent_sol   58. 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-06 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1TCR 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   18337 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.048 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.6 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.237 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1TCR 
_refine.ls_number_reflns_obs                     18337 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    93.4 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.208 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4. 
_refine.ls_number_reflns_R_free                  1536 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               35.8 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               RFREE 
_refine.details                                  
;REMARK: MANY RESIDUES OF CHAIN A HAVE HIGHER TEMPERATURE
FACTORS ASSOCIATED WITH THEM THAN THE REST OF THE MOLECULE.
THE IMPLICATIONS ARE DISCUSSED IN THE ARTICLE.

RESIDUES A 185 - A 213 AND THE CARBOHYDRATE RESIDUE 200
HAVE ASSOCIATED HIGH TEMPERATURE FACTORS.  THESE RESIDUES
ARE NOT IN CONTACT WITH OTHER SECONDARY STRUCTURE ELEMENTS
OR SYMMETRY RELATED MOLECULES.  NEVERTHELESS, THE ELECTRON
DENSITY ASSOCIATED WITH THE ATOMS IS UNAMBIGUOUS AND OF
GOOD QUALITY.
;
_refine.pdbx_starting_model                      'ISOLATED BETA CHAIN, V(ALPHA) DOMAIN' 
_refine.pdbx_method_to_determine_struct          MR/MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RESOLUTION 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3423 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         144 
_refine_hist.number_atoms_solvent             22 
_refine_hist.number_atoms_total               3589 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.823 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      27.54 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.484 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.61 
_refine_ls_shell.number_reflns_R_work             1887 
_refine_ls_shell.R_factor_R_work                  0.315 
_refine_ls_shell.percent_reflns_obs               81.3 
_refine_ls_shell.R_factor_R_free                  0.327 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            3.8 
_refine_ls_shell.number_reflns_R_free             116 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO ? 'X-RAY DIFFRACTION' 
2 PARAM3.CHO   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1TCR 
_struct.title                     'MURINE T-CELL ANTIGEN RECEPTOR 2C CLONE' 
_struct.pdbx_descriptor           'ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TCR 
_struct_keywords.pdbx_keywords   RECEPTOR 
_struct_keywords.text            'T-CELL, RECEPTOR, TRANSMEMBRANE, GLYCOPROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TRP A 82  ? ASP A 84  ? TRP A 82  ASP A 84  5 ? 3 
HELX_P HELX_P2 2 CYS A 184 ? ILE A 187 ? CYS A 191 ILE A 194 1 ? 4 
HELX_P HELX_P3 3 PRO B 83  ? GLN B 85  ? PRO B 84  GLN B 86  5 ? 3 
HELX_P HELX_P4 4 LEU B 113 ? ASN B 115 ? LEU B 119 ASN B 121 5 ? 3 
HELX_P HELX_P5 5 LYS B 128 ? LYS B 134 ? LYS B 134 LYS B 140 1 ? 7 
HELX_P HELX_P6 6 ALA B 190 ? TRP B 193 ? ALA B 200 TRP B 203 1 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 22  SG  ? ? ? 1_555 A CYS 90  SG  ? ? A CYS 22  A CYS 90  1_555 ? ? ? ? ? ? ? 2.207 ? ?               
disulf2  disulf ?    ? A CYS 134 SG  ? ? ? 1_555 A CYS 184 SG  ? ? A CYS 141 A CYS 191 1_555 ? ? ? ? ? ? ? 2.506 ? ?               
disulf3  disulf ?    ? B CYS 23  SG  ? ? ? 1_555 B CYS 91  SG  ? ? B CYS 23  B CYS 92  1_555 ? ? ? ? ? ? ? 2.253 ? ?               
disulf4  disulf ?    ? B CYS 141 SG  ? ? ? 1_555 B CYS 202 SG  ? ? B CYS 147 B CYS 212 1_555 ? ? ? ? ? ? ? 2.050 ? ?               
covale1  covale one  ? A ASN 70  ND2 ? ? ? 1_555 D NAG .   C1  ? ? A ASN 70  D NAG 1   1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale2  covale one  ? A ASN 178 ND2 ? ? ? 1_555 C NAG .   C1  ? ? A ASN 185 C NAG 1   1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
covale3  covale one  ? F NAG .   C1  ? ? ? 1_555 A ASN 192 ND2 ? ? A NAG 200 A ASN 203 1_555 ? ? ? ? ? ? ? 1.555 ? N-Glycosylation 
covale4  covale one  ? B ASN 226 ND2 ? ? ? 1_555 E NAG .   C1  ? ? B ASN 236 E NAG 1   1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale5  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1  ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.387 ? ?               
covale6  covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1  ? ? C NAG 1   C FUC 4   1_555 ? ? ? ? ? ? ? 1.404 ? ?               
covale7  covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1  ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.382 ? ?               
covale8  covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1  ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.393 ? ?               
covale9  covale both ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1  ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.409 ? ?               
covale10 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1  ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.395 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           7 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            7 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    8 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     8 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 2 ? 
E ? 2 ? 
F ? 5 ? 
G ? 3 ? 
H ? 2 ? 
I ? 4 ? 
J ? 3 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 9   ? SER A 13  ? ARG A 9   SER A 13  
A 2 THR A 105 ? LEU A 110 ? THR A 110 LEU A 115 
A 3 ALA A 86  ? SER A 93  ? ALA A 86  SER A 93  
A 4 TYR A 31  ? GLN A 37  ? TYR A 31  GLN A 37  
A 5 GLN A 44  ? TYR A 49  ? GLN A 44  TYR A 49  
B 1 LEU A 18  ? LEU A 20  ? LEU A 18  LEU A 20  
B 2 SER A 72  ? LYS A 77  ? SER A 72  LYS A 77  
B 3 PHE A 62  ? SER A 67  ? PHE A 62  SER A 67  
B 4 VAL A 55  ? GLN A 57  ? VAL A 55  GLN A 57  
C 1 ALA A 119 ? LYS A 124 ? ALA A 124 LYS A 129 
C 2 THR A 132 ? THR A 137 ? THR A 139 THR A 144 
C 3 GLY A 172 ? SER A 177 ? GLY A 179 SER A 184 
C 4 THR A 153 ? ILE A 155 ? THR A 160 ILE A 162 
D 1 THR A 159 ? ASP A 162 ? THR A 166 ASP A 169 
D 2 LYS A 169 ? GLY A 172 ? LYS A 176 GLY A 179 
E 1 VAL B 4   ? SER B 7   ? VAL B 4   SER B 7   
E 2 SER B 22  ? GLN B 25  ? SER B 22  GLN B 25  
F 1 ASN B 10  ? VAL B 14  ? ASN B 10  VAL B 14  
F 2 THR B 105 ? LEU B 110 A THR B 112 LEU B 116 
F 3 SER B 87  ? GLY B 94  ? SER B 88  GLY B 95  
F 4 ASN B 31  ? ASP B 38  ? ASN B 31  ASP B 38  
F 5 GLY B 42  ? SER B 49  ? GLY B 42  SER B 49  
G 1 VAL B 19  ? LEU B 21  ? VAL B 19  LEU B 21  
G 2 SER B 75  ? LEU B 78  ? SER B 76  LEU B 79  
G 3 LYS B 65  ? SER B 67  ? LYS B 66  SER B 68  
H 1 ALA B 92  ? GLY B 94  ? ALA B 93  GLY B 95  
H 2 LEU B 99  ? PHE B 101 ? LEU B 106 PHE B 108 
I 1 LYS B 120 ? PHE B 124 ? LYS B 126 PHE B 130 
I 2 LYS B 136 ? PHE B 146 ? LYS B 142 PHE B 152 
I 3 TYR B 180 ? SER B 189 ? TYR B 190 SER B 199 
I 4 VAL B 166 ? THR B 168 ? VAL B 172 THR B 174 
J 1 VAL B 151 ? VAL B 157 ? VAL B 157 VAL B 163 
J 2 HIS B 199 ? PHE B 206 ? HIS B 209 PHE B 216 
J 3 GLN B 225 ? TRP B 232 ? GLN B 235 TRP B 242 
K 1 TYR B 173 ? SER B 176 ? TYR B 179 SER B 182 
K 2 SER B 179 ? CYS B 181 ? SER B 189 CYS B 191 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 10  ? O VAL A 10  N LYS A 106 ? N LYS A 111 
A 2 3 O THR A 105 ? O THR A 110 N TYR A 88  ? N TYR A 88  
A 3 4 O VAL A 87  ? O VAL A 87  N GLN A 37  ? N GLN A 37  
A 4 5 O LEU A 32  ? O LEU A 32  N TYR A 49  ? N TYR A 49  
B 1 2 O LEU A 18  ? O LEU A 18  N LYS A 77  ? N LYS A 77  
B 2 3 O SER A 72  ? O SER A 72  N SER A 67  ? N SER A 67  
B 3 4 O ALA A 64  ? O ALA A 64  N VAL A 56  ? N VAL A 56  
C 1 2 O ALA A 119 ? O ALA A 124 N THR A 137 ? N THR A 144 
C 2 3 O CYS A 134 ? O CYS A 141 N ALA A 175 ? N ALA A 182 
C 3 4 O TRP A 176 ? O TRP A 183 N PHE A 154 ? N PHE A 161 
D 1 2 O THR A 159 ? O THR A 166 N GLY A 172 ? N GLY A 179 
E 1 2 O THR B 5   ? O THR B 5   N ASN B 24  ? N ASN B 24  
F 1 2 O LYS B 11  ? O LYS B 11  N ARG B 106 ? N ARG B 113 
F 2 3 O THR B 105 ? O THR B 112 N TYR B 89  ? N TYR B 90  
F 3 4 O VAL B 88  ? O VAL B 89  N GLN B 37  ? N GLN B 37  
F 4 5 O MET B 32  ? O MET B 32  N SER B 49  ? N SER B 49  
G 1 2 O VAL B 19  ? O VAL B 19  N LEU B 78  ? N LEU B 79  
G 2 3 O SER B 75  ? O SER B 76  N SER B 67  ? N SER B 68  
H 1 2 O SER B 93  ? O SER B 94  N TYR B 100 ? N TYR B 107 
I 1 2 O LYS B 120 ? O LYS B 126 N ARG B 144 ? N ARG B 150 
I 2 3 O ALA B 137 ? O ALA B 143 N VAL B 188 ? N VAL B 198 
I 3 4 O ARG B 185 ? O ARG B 195 N SER B 167 ? N SER B 173 
J 1 2 O GLU B 152 ? O GLU B 158 N GLN B 205 ? N GLN B 215 
J 2 3 O PHE B 200 ? O PHE B 210 N ALA B 231 ? N ALA B 241 
K 1 2 O TYR B 173 ? O TYR B 179 N CYS B 181 ? N CYS B 191 
# 
_database_PDB_matrix.entry_id          1TCR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TCR 
_atom_sites.fract_transf_matrix[1][1]   0.007246 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001435 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013717 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017791 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 1   ? 47.960 6.731   -0.495  1.00 51.05  ? 1   GLN A N   1 
ATOM   2    C CA  . GLN A 1 1   ? 47.740 5.861   -1.689  1.00 54.00  ? 1   GLN A CA  1 
ATOM   3    C C   . GLN A 1 1   ? 47.381 4.402   -1.312  1.00 54.47  ? 1   GLN A C   1 
ATOM   4    O O   . GLN A 1 1   ? 46.866 3.664   -2.144  1.00 56.13  ? 1   GLN A O   1 
ATOM   5    C CB  . GLN A 1 1   ? 48.950 5.915   -2.638  1.00 55.14  ? 1   GLN A CB  1 
ATOM   6    C CG  . GLN A 1 1   ? 48.733 5.306   -4.045  1.00 56.97  ? 1   GLN A CG  1 
ATOM   7    C CD  . GLN A 1 1   ? 49.042 3.782   -4.163  1.00 61.57  ? 1   GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 1   ? 48.501 3.100   -5.049  1.00 62.14  ? 1   GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 1   ? 49.943 3.267   -3.313  1.00 59.35  ? 1   GLN A NE2 1 
ATOM   10   N N   . SER A 1 2   ? 47.634 3.978   -0.075  1.00 51.03  ? 2   SER A N   1 
ATOM   11   C CA  . SER A 1 2   ? 47.267 2.616   0.314   1.00 45.26  ? 2   SER A CA  1 
ATOM   12   C C   . SER A 1 2   ? 47.397 2.441   1.818   1.00 43.02  ? 2   SER A C   1 
ATOM   13   O O   . SER A 1 2   ? 48.358 2.926   2.404   1.00 43.16  ? 2   SER A O   1 
ATOM   14   C CB  . SER A 1 2   ? 48.131 1.590   -0.417  1.00 48.60  ? 2   SER A CB  1 
ATOM   15   O OG  . SER A 1 2   ? 47.742 0.260   -0.116  1.00 47.51  ? 2   SER A OG  1 
ATOM   16   N N   . VAL A 1 3   ? 46.374 1.840   2.432   1.00 39.36  ? 3   VAL A N   1 
ATOM   17   C CA  . VAL A 1 3   ? 46.303 1.562   3.876   1.00 35.77  ? 3   VAL A CA  1 
ATOM   18   C C   . VAL A 1 3   ? 45.763 0.137   4.008   1.00 35.20  ? 3   VAL A C   1 
ATOM   19   O O   . VAL A 1 3   ? 44.865 -0.255  3.255   1.00 37.17  ? 3   VAL A O   1 
ATOM   20   C CB  . VAL A 1 3   ? 45.367 2.560   4.629   1.00 34.72  ? 3   VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 3   ? 44.982 2.018   5.996   1.00 35.28  ? 3   VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 3   ? 46.060 3.877   4.815   1.00 30.12  ? 3   VAL A CG2 1 
ATOM   23   N N   . THR A 1 4   ? 46.286 -0.617  4.977   1.00 36.31  ? 4   THR A N   1 
ATOM   24   C CA  . THR A 1 4   ? 45.893 -2.009  5.199   1.00 34.52  ? 4   THR A CA  1 
ATOM   25   C C   . THR A 1 4   ? 45.622 -2.389  6.665   1.00 30.99  ? 4   THR A C   1 
ATOM   26   O O   . THR A 1 4   ? 46.485 -2.287  7.513   1.00 33.95  ? 4   THR A O   1 
ATOM   27   C CB  . THR A 1 4   ? 46.949 -2.991  4.587   1.00 37.36  ? 4   THR A CB  1 
ATOM   28   O OG1 . THR A 1 4   ? 47.142 -2.694  3.189   1.00 36.52  ? 4   THR A OG1 1 
ATOM   29   C CG2 . THR A 1 4   ? 46.481 -4.443  4.731   1.00 38.00  ? 4   THR A CG2 1 
ATOM   30   N N   . GLN A 1 5   ? 44.383 -2.776  6.942   1.00 31.22  ? 5   GLN A N   1 
ATOM   31   C CA  . GLN A 1 5   ? 43.934 -3.212  8.259   1.00 29.89  ? 5   GLN A CA  1 
ATOM   32   C C   . GLN A 1 5   ? 43.666 -4.718  8.113   1.00 31.93  ? 5   GLN A C   1 
ATOM   33   O O   . GLN A 1 5   ? 42.678 -5.148  7.499   1.00 31.76  ? 5   GLN A O   1 
ATOM   34   C CB  . GLN A 1 5   ? 42.668 -2.450  8.682   1.00 27.72  ? 5   GLN A CB  1 
ATOM   35   C CG  . GLN A 1 5   ? 42.885 -0.960  8.752   1.00 24.06  ? 5   GLN A CG  1 
ATOM   36   C CD  . GLN A 1 5   ? 41.717 -0.185  9.307   1.00 22.52  ? 5   GLN A CD  1 
ATOM   37   O OE1 . GLN A 1 5   ? 41.031 0.548   8.585   1.00 23.11  ? 5   GLN A OE1 1 
ATOM   38   N NE2 . GLN A 1 5   ? 41.528 -0.279  10.600  1.00 24.93  ? 5   GLN A NE2 1 
ATOM   39   N N   . PRO A 1 6   ? 44.588 -5.536  8.640   1.00 31.87  ? 6   PRO A N   1 
ATOM   40   C CA  . PRO A 1 6   ? 44.624 -7.003  8.650   1.00 30.49  ? 6   PRO A CA  1 
ATOM   41   C C   . PRO A 1 6   ? 43.478 -7.712  9.329   1.00 33.41  ? 6   PRO A C   1 
ATOM   42   O O   . PRO A 1 6   ? 43.170 -8.852  8.997   1.00 35.49  ? 6   PRO A O   1 
ATOM   43   C CB  . PRO A 1 6   ? 45.941 -7.294  9.362   1.00 33.04  ? 6   PRO A CB  1 
ATOM   44   C CG  . PRO A 1 6   ? 46.077 -6.133  10.327  1.00 31.57  ? 6   PRO A CG  1 
ATOM   45   C CD  . PRO A 1 6   ? 45.710 -4.980  9.425   1.00 32.73  ? 6   PRO A CD  1 
ATOM   46   N N   . ASP A 1 7   ? 42.901 -7.068  10.338  1.00 38.76  ? 7   ASP A N   1 
ATOM   47   C CA  . ASP A 1 7   ? 41.787 -7.637  11.084  1.00 36.90  ? 7   ASP A CA  1 
ATOM   48   C C   . ASP A 1 7   ? 40.513 -6.860  10.826  1.00 33.74  ? 7   ASP A C   1 
ATOM   49   O O   . ASP A 1 7   ? 40.447 -5.663  11.070  1.00 34.16  ? 7   ASP A O   1 
ATOM   50   C CB  . ASP A 1 7   ? 42.099 -7.619  12.578  1.00 42.27  ? 7   ASP A CB  1 
ATOM   51   C CG  . ASP A 1 7   ? 43.401 -8.319  12.904  1.00 48.81  ? 7   ASP A CG  1 
ATOM   52   O OD1 . ASP A 1 7   ? 43.488 -9.560  12.685  1.00 50.01  ? 7   ASP A OD1 1 
ATOM   53   O OD2 . ASP A 1 7   ? 44.333 -7.622  13.369  1.00 50.63  ? 7   ASP A OD2 1 
ATOM   54   N N   . ALA A 1 8   ? 39.503 -7.556  10.337  1.00 30.65  ? 8   ALA A N   1 
ATOM   55   C CA  . ALA A 1 8   ? 38.224 -6.941  10.052  1.00 27.88  ? 8   ALA A CA  1 
ATOM   56   C C   . ALA A 1 8   ? 37.345 -6.867  11.284  1.00 28.18  ? 8   ALA A C   1 
ATOM   57   O O   . ALA A 1 8   ? 36.424 -6.061  11.341  1.00 27.42  ? 8   ALA A O   1 
ATOM   58   C CB  . ALA A 1 8   ? 37.531 -7.713  8.979   1.00 30.79  ? 8   ALA A CB  1 
ATOM   59   N N   . ARG A 1 9   ? 37.593 -7.750  12.246  1.00 33.01  ? 9   ARG A N   1 
ATOM   60   C CA  . ARG A 1 9   ? 36.826 -7.774  13.494  1.00 34.43  ? 9   ARG A CA  1 
ATOM   61   C C   . ARG A 1 9   ? 37.710 -8.076  14.715  1.00 34.41  ? 9   ARG A C   1 
ATOM   62   O O   . ARG A 1 9   ? 38.657 -8.861  14.631  1.00 30.87  ? 9   ARG A O   1 
ATOM   63   C CB  . ARG A 1 9   ? 35.680 -8.781  13.410  1.00 32.31  ? 9   ARG A CB  1 
ATOM   64   C CG  . ARG A 1 9   ? 34.769 -8.733  14.604  1.00 38.59  ? 9   ARG A CG  1 
ATOM   65   C CD  . ARG A 1 9   ? 33.705 -9.801  14.543  1.00 49.43  ? 9   ARG A CD  1 
ATOM   66   N NE  . ARG A 1 9   ? 32.728 -9.567  13.484  1.00 54.86  ? 9   ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 9   ? 31.516 -10.109 13.468  1.00 58.60  ? 9   ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 9   ? 31.138 -10.915 14.460  1.00 57.52  ? 9   ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 9   ? 30.689 -9.857  12.455  1.00 60.64  ? 9   ARG A NH2 1 
ATOM   70   N N   . VAL A 1 10  ? 37.437 -7.386  15.818  1.00 33.68  ? 10  VAL A N   1 
ATOM   71   C CA  . VAL A 1 10  ? 38.183 -7.567  17.057  1.00 33.91  ? 10  VAL A CA  1 
ATOM   72   C C   . VAL A 1 10  ? 37.177 -7.543  18.201  1.00 34.62  ? 10  VAL A C   1 
ATOM   73   O O   . VAL A 1 10  ? 36.558 -6.507  18.482  1.00 34.47  ? 10  VAL A O   1 
ATOM   74   C CB  . VAL A 1 10  ? 39.226 -6.439  17.312  1.00 34.86  ? 10  VAL A CB  1 
ATOM   75   C CG1 . VAL A 1 10  ? 39.744 -6.426  18.751  1.00 28.63  ? 10  VAL A CG1 1 
ATOM   76   C CG2 . VAL A 1 10  ? 40.461 -6.561  16.417  1.00 33.55  ? 10  VAL A CG2 1 
ATOM   77   N N   . THR A 1 11  ? 37.017 -8.694  18.812  1.00 36.25  ? 11  THR A N   1 
ATOM   78   C CA  . THR A 1 11  ? 36.119 -8.852  19.959  1.00 35.86  ? 11  THR A CA  1 
ATOM   79   C C   . THR A 1 11  ? 36.962 -8.842  21.231  1.00 37.41  ? 11  THR A C   1 
ATOM   80   O O   . THR A 1 11  ? 37.838 -9.693  21.425  1.00 36.04  ? 11  THR A O   1 
ATOM   81   C CB  . THR A 1 11  ? 35.349 -10.173 19.855  1.00 35.65  ? 11  THR A CB  1 
ATOM   82   O OG1 . THR A 1 11  ? 34.805 -10.323 18.550  1.00 31.81  ? 11  THR A OG1 1 
ATOM   83   C CG2 . THR A 1 11  ? 34.188 -10.264 20.848  1.00 32.98  ? 11  THR A CG2 1 
ATOM   84   N N   . VAL A 1 12  ? 36.690 -7.864  22.069  1.00 37.66  ? 12  VAL A N   1 
ATOM   85   C CA  . VAL A 1 12  ? 37.414 -7.691  23.336  1.00 36.96  ? 12  VAL A CA  1 
ATOM   86   C C   . VAL A 1 12  ? 36.406 -7.518  24.471  1.00 35.83  ? 12  VAL A C   1 
ATOM   87   O O   . VAL A 1 12  ? 35.280 -7.055  24.262  1.00 37.62  ? 12  VAL A O   1 
ATOM   88   C CB  . VAL A 1 12  ? 38.324 -6.457  23.238  1.00 38.11  ? 12  VAL A CB  1 
ATOM   89   C CG1 . VAL A 1 12  ? 37.590 -5.209  22.738  1.00 35.50  ? 12  VAL A CG1 1 
ATOM   90   C CG2 . VAL A 1 12  ? 38.953 -6.063  24.575  1.00 45.37  ? 12  VAL A CG2 1 
ATOM   91   N N   . SER A 1 13  ? 36.820 -7.909  25.659  1.00 35.42  ? 13  SER A N   1 
ATOM   92   C CA  . SER A 1 13  ? 35.973 -7.776  26.850  1.00 33.24  ? 13  SER A CA  1 
ATOM   93   C C   . SER A 1 13  ? 36.175 -6.394  27.455  1.00 36.09  ? 13  SER A C   1 
ATOM   94   O O   . SER A 1 13  ? 37.260 -5.809  27.347  1.00 38.79  ? 13  SER A O   1 
ATOM   95   C CB  . SER A 1 13  ? 36.353 -8.819  27.904  1.00 31.58  ? 13  SER A CB  1 
ATOM   96   O OG  . SER A 1 13  ? 36.159 -10.127 27.394  1.00 41.26  ? 13  SER A OG  1 
ATOM   97   N N   . GLU A 1 14  ? 35.119 -5.903  28.060  1.00 38.00  ? 14  GLU A N   1 
ATOM   98   C CA  . GLU A 1 14  ? 35.145 -4.621  28.771  1.00 42.44  ? 14  GLU A CA  1 
ATOM   99   C C   . GLU A 1 14  ? 36.248 -4.736  29.833  1.00 43.86  ? 14  GLU A C   1 
ATOM   100  O O   . GLU A 1 14  ? 36.302 -5.728  30.563  1.00 47.75  ? 14  GLU A O   1 
ATOM   101  C CB  . GLU A 1 14  ? 33.773 -4.424  29.444  1.00 47.70  ? 14  GLU A CB  1 
ATOM   102  C CG  . GLU A 1 14  ? 33.413 -2.971  29.772  1.00 55.85  ? 14  GLU A CG  1 
ATOM   103  C CD  . GLU A 1 14  ? 31.935 -2.806  30.168  1.00 59.33  ? 14  GLU A CD  1 
ATOM   104  O OE1 . GLU A 1 14  ? 31.296 -3.787  30.717  1.00 58.81  ? 14  GLU A OE1 1 
ATOM   105  O OE2 . GLU A 1 14  ? 31.325 -1.692  29.947  1.00 60.63  ? 14  GLU A OE2 1 
ATOM   106  N N   . GLY A 1 15  ? 37.158 -3.767  29.880  1.00 44.10  ? 15  GLY A N   1 
ATOM   107  C CA  . GLY A 1 15  ? 38.253 -3.829  30.840  1.00 42.39  ? 15  GLY A CA  1 
ATOM   108  C C   . GLY A 1 15  ? 39.589 -4.192  30.204  1.00 42.52  ? 15  GLY A C   1 
ATOM   109  O O   . GLY A 1 15  ? 40.633 -3.643  30.582  1.00 45.53  ? 15  GLY A O   1 
ATOM   110  N N   . ALA A 1 16  ? 39.550 -5.097  29.229  1.00 37.80  ? 16  ALA A N   1 
ATOM   111  C CA  . ALA A 1 16  ? 40.735 -5.539  28.517  1.00 33.46  ? 16  ALA A CA  1 
ATOM   112  C C   . ALA A 1 16  ? 41.234 -4.432  27.610  1.00 35.96  ? 16  ALA A C   1 
ATOM   113  O O   . ALA A 1 16  ? 40.511 -3.489  27.309  1.00 39.46  ? 16  ALA A O   1 
ATOM   114  C CB  . ALA A 1 16  ? 40.416 -6.775  27.690  1.00 36.73  ? 16  ALA A CB  1 
ATOM   115  N N   . SER A 1 17  ? 42.483 -4.544  27.181  1.00 38.80  ? 17  SER A N   1 
ATOM   116  C CA  . SER A 1 17  ? 43.085 -3.552  26.306  1.00 33.32  ? 17  SER A CA  1 
ATOM   117  C C   . SER A 1 17  ? 42.777 -3.849  24.838  1.00 32.96  ? 17  SER A C   1 
ATOM   118  O O   . SER A 1 17  ? 42.424 -4.977  24.477  1.00 33.36  ? 17  SER A O   1 
ATOM   119  C CB  . SER A 1 17  ? 44.599 -3.503  26.554  1.00 32.43  ? 17  SER A CB  1 
ATOM   120  O OG  . SER A 1 17  ? 45.175 -4.806  26.599  1.00 34.85  ? 17  SER A OG  1 
ATOM   121  N N   . LEU A 1 18  ? 42.934 -2.830  23.997  1.00 32.76  ? 18  LEU A N   1 
ATOM   122  C CA  . LEU A 1 18  ? 42.691 -2.936  22.564  1.00 33.25  ? 18  LEU A CA  1 
ATOM   123  C C   . LEU A 1 18  ? 43.813 -2.306  21.692  1.00 34.18  ? 18  LEU A C   1 
ATOM   124  O O   . LEU A 1 18  ? 44.341 -1.232  22.008  1.00 33.64  ? 18  LEU A O   1 
ATOM   125  C CB  . LEU A 1 18  ? 41.335 -2.293  22.216  1.00 32.45  ? 18  LEU A CB  1 
ATOM   126  C CG  . LEU A 1 18  ? 41.027 -1.991  20.739  1.00 36.31  ? 18  LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 18  ? 40.679 -3.272  20.019  1.00 29.22  ? 18  LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 18  ? 39.884 -0.992  20.624  1.00 37.48  ? 18  LEU A CD2 1 
ATOM   129  N N   . GLN A 1 19  ? 44.161 -2.990  20.601  1.00 33.09  ? 19  GLN A N   1 
ATOM   130  C CA  . GLN A 1 19  ? 45.151 -2.517  19.643  1.00 36.33  ? 19  GLN A CA  1 
ATOM   131  C C   . GLN A 1 19  ? 44.595 -2.823  18.252  1.00 34.74  ? 19  GLN A C   1 
ATOM   132  O O   . GLN A 1 19  ? 44.159 -3.948  17.973  1.00 35.76  ? 19  GLN A O   1 
ATOM   133  C CB  . GLN A 1 19  ? 46.468 -3.277  19.773  1.00 37.63  ? 19  GLN A CB  1 
ATOM   134  C CG  . GLN A 1 19  ? 47.481 -2.857  18.705  1.00 45.56  ? 19  GLN A CG  1 
ATOM   135  C CD  . GLN A 1 19  ? 48.739 -3.722  18.685  1.00 49.08  ? 19  GLN A CD  1 
ATOM   136  O OE1 . GLN A 1 19  ? 49.464 -3.770  19.677  1.00 53.98  ? 19  GLN A OE1 1 
ATOM   137  N NE2 . GLN A 1 19  ? 49.045 -4.410  17.603  1.00 49.38  ? 19  GLN A NE2 1 
ATOM   138  N N   . LEU A 1 20  ? 44.585 -1.825  17.411  1.00 29.00  ? 20  LEU A N   1 
ATOM   139  C CA  . LEU A 1 20  ? 44.149 -1.989  16.021  1.00 26.08  ? 20  LEU A CA  1 
ATOM   140  C C   . LEU A 1 20  ? 45.341 -1.707  15.150  1.00 29.55  ? 20  LEU A C   1 
ATOM   141  O O   . LEU A 1 20  ? 45.988 -0.664  15.281  1.00 29.59  ? 20  LEU A O   1 
ATOM   142  C CB  . LEU A 1 20  ? 43.040 -1.003  15.675  1.00 25.83  ? 20  LEU A CB  1 
ATOM   143  C CG  . LEU A 1 20  ? 41.821 -1.106  16.583  1.00 30.06  ? 20  LEU A CG  1 
ATOM   144  C CD1 . LEU A 1 20  ? 40.642 -0.274  16.076  1.00 26.81  ? 20  LEU A CD1 1 
ATOM   145  C CD2 . LEU A 1 20  ? 41.301 -2.535  16.726  1.00 32.48  ? 20  LEU A CD2 1 
ATOM   146  N N   . ARG A 1 21  ? 45.628 -2.623  14.279  1.00 32.72  ? 21  ARG A N   1 
ATOM   147  C CA  . ARG A 1 21  ? 46.802 -2.486  13.440  1.00 35.33  ? 21  ARG A CA  1 
ATOM   148  C C   . ARG A 1 21  ? 46.481 -1.822  12.113  1.00 34.85  ? 21  ARG A C   1 
ATOM   149  O O   . ARG A 1 21  ? 45.426 -2.055  11.526  1.00 36.74  ? 21  ARG A O   1 
ATOM   150  C CB  . ARG A 1 21  ? 47.415 -3.858  13.196  1.00 38.48  ? 21  ARG A CB  1 
ATOM   151  C CG  . ARG A 1 21  ? 47.643 -4.628  14.498  1.00 43.63  ? 21  ARG A CG  1 
ATOM   152  C CD  . ARG A 1 21  ? 48.995 -5.328  14.543  1.00 56.30  ? 21  ARG A CD  1 
ATOM   153  N NE  . ARG A 1 21  ? 49.270 -6.077  13.315  1.00 65.55  ? 21  ARG A NE  1 
ATOM   154  C CZ  . ARG A 1 21  ? 48.607 -7.179  12.955  1.00 70.94  ? 21  ARG A CZ  1 
ATOM   155  N NH1 . ARG A 1 21  ? 47.631 -7.676  13.726  1.00 72.84  ? 21  ARG A NH1 1 
ATOM   156  N NH2 . ARG A 1 21  ? 48.854 -7.859  11.830  1.00 72.13  ? 21  ARG A NH2 1 
ATOM   157  N N   . CYS A 1 22  ? 47.377 -0.930  11.707  1.00 34.51  ? 22  CYS A N   1 
ATOM   158  C CA  . CYS A 1 22  ? 47.278 -0.206  10.457  1.00 34.06  ? 22  CYS A CA  1 
ATOM   159  C C   . CYS A 1 22  ? 48.647 -0.115  9.773   1.00 34.27  ? 22  CYS A C   1 
ATOM   160  O O   . CYS A 1 22  ? 49.648 0.313   10.382  1.00 31.47  ? 22  CYS A O   1 
ATOM   161  C CB  . CYS A 1 22  ? 46.710 1.202   10.667  1.00 32.91  ? 22  CYS A CB  1 
ATOM   162  S SG  . CYS A 1 22  ? 46.407 2.030   9.079   1.00 31.75  ? 22  CYS A SG  1 
ATOM   163  N N   . LYS A 1 23  ? 48.673 -0.559  8.521   1.00 35.49  ? 23  LYS A N   1 
ATOM   164  C CA  . LYS A 1 23  ? 49.861 -0.553  7.684   1.00 42.22  ? 23  LYS A CA  1 
ATOM   165  C C   . LYS A 1 23  ? 49.509 0.380   6.516   1.00 46.50  ? 23  LYS A C   1 
ATOM   166  O O   . LYS A 1 23  ? 48.351 0.428   6.112   1.00 45.73  ? 23  LYS A O   1 
ATOM   167  C CB  . LYS A 1 23  ? 50.142 -1.982  7.163   1.00 42.81  ? 23  LYS A CB  1 
ATOM   168  C CG  . LYS A 1 23  ? 51.503 -2.595  7.585   1.00 46.47  ? 23  LYS A CG  1 
ATOM   169  C CD  . LYS A 1 23  ? 51.520 -3.166  9.015   1.00 47.26  ? 23  LYS A CD  1 
ATOM   170  C CE  . LYS A 1 23  ? 50.832 -4.553  9.114   1.00 52.22  ? 23  LYS A CE  1 
ATOM   171  N NZ  . LYS A 1 23  ? 50.849 -5.137  10.507  1.00 49.44  ? 23  LYS A NZ  1 
ATOM   172  N N   . TYR A 1 24  ? 50.473 1.153   6.014   1.00 50.87  ? 24  TYR A N   1 
ATOM   173  C CA  . TYR A 1 24  ? 50.223 2.069   4.886   1.00 55.70  ? 24  TYR A CA  1 
ATOM   174  C C   . TYR A 1 24  ? 51.365 2.033   3.860   1.00 57.97  ? 24  TYR A C   1 
ATOM   175  O O   . TYR A 1 24  ? 52.515 1.808   4.227   1.00 60.75  ? 24  TYR A O   1 
ATOM   176  C CB  . TYR A 1 24  ? 50.030 3.512   5.379   1.00 54.23  ? 24  TYR A CB  1 
ATOM   177  C CG  . TYR A 1 24  ? 51.311 4.178   5.808   1.00 55.21  ? 24  TYR A CG  1 
ATOM   178  C CD1 . TYR A 1 24  ? 52.226 4.652   4.860   1.00 53.08  ? 24  TYR A CD1 1 
ATOM   179  C CD2 . TYR A 1 24  ? 51.647 4.278   7.158   1.00 54.37  ? 24  TYR A CD2 1 
ATOM   180  C CE1 . TYR A 1 24  ? 53.439 5.192   5.243   1.00 51.40  ? 24  TYR A CE1 1 
ATOM   181  C CE2 . TYR A 1 24  ? 52.863 4.821   7.552   1.00 53.91  ? 24  TYR A CE2 1 
ATOM   182  C CZ  . TYR A 1 24  ? 53.748 5.271   6.586   1.00 52.69  ? 24  TYR A CZ  1 
ATOM   183  O OH  . TYR A 1 24  ? 54.950 5.796   6.959   1.00 58.57  ? 24  TYR A OH  1 
ATOM   184  N N   . SER A 1 25  ? 51.056 2.344   2.604   1.00 59.11  ? 25  SER A N   1 
ATOM   185  C CA  . SER A 1 25  ? 52.034 2.348   1.519   1.00 58.16  ? 25  SER A CA  1 
ATOM   186  C C   . SER A 1 25  ? 51.924 3.695   0.801   1.00 60.26  ? 25  SER A C   1 
ATOM   187  O O   . SER A 1 25  ? 51.173 3.824   -0.166  1.00 62.08  ? 25  SER A O   1 
ATOM   188  C CB  . SER A 1 25  ? 51.718 1.196   0.551   1.00 55.72  ? 25  SER A CB  1 
ATOM   189  O OG  . SER A 1 25  ? 52.648 1.105   -0.517  1.00 56.54  ? 25  SER A OG  1 
ATOM   190  N N   . TYR A 1 26  ? 52.636 4.713   1.283   1.00 62.74  ? 26  TYR A N   1 
ATOM   191  C CA  . TYR A 1 26  ? 52.554 6.029   0.653   1.00 62.86  ? 26  TYR A CA  1 
ATOM   192  C C   . TYR A 1 26  ? 53.898 6.686   0.449   1.00 65.23  ? 26  TYR A C   1 
ATOM   193  O O   . TYR A 1 26  ? 54.698 6.812   1.390   1.00 63.69  ? 26  TYR A O   1 
ATOM   194  C CB  . TYR A 1 26  ? 51.774 7.006   1.534   1.00 63.43  ? 26  TYR A CB  1 
ATOM   195  C CG  . TYR A 1 26  ? 51.461 8.336   0.850   1.00 63.53  ? 26  TYR A CG  1 
ATOM   196  C CD1 . TYR A 1 26  ? 50.619 8.369   -0.267  1.00 65.54  ? 26  TYR A CD1 1 
ATOM   197  C CD2 . TYR A 1 26  ? 52.014 9.522   1.348   1.00 62.90  ? 26  TYR A CD2 1 
ATOM   198  C CE1 . TYR A 1 26  ? 50.327 9.589   -0.886  1.00 64.18  ? 26  TYR A CE1 1 
ATOM   199  C CE2 . TYR A 1 26  ? 51.721 10.743  0.729   1.00 60.15  ? 26  TYR A CE2 1 
ATOM   200  C CZ  . TYR A 1 26  ? 50.877 10.777  -0.387  1.00 62.52  ? 26  TYR A CZ  1 
ATOM   201  O OH  . TYR A 1 26  ? 50.590 11.963  -0.987  1.00 64.93  ? 26  TYR A OH  1 
ATOM   202  N N   . SER A 1 27  ? 54.070 7.090   -0.783  1.00 67.00  ? 27  SER A N   1 
ATOM   203  C CA  . SER A 1 27  ? 55.229 7.847   -1.200  1.00 68.87  ? 27  SER A CA  1 
ATOM   204  C C   . SER A 1 27  ? 55.008 9.261   -0.823  1.00 67.14  ? 27  SER A C   1 
ATOM   205  O O   . SER A 1 27  ? 54.219 9.988   -1.418  1.00 69.01  ? 27  SER A O   1 
ATOM   206  C CB  . SER A 1 27  ? 55.371 7.870   -2.708  1.00 71.37  ? 27  SER A CB  1 
ATOM   207  O OG  . SER A 1 27  ? 55.715 6.598   -3.187  1.00 80.80  ? 27  SER A OG  1 
ATOM   208  N N   . ALA A 1 28  ? 55.662 9.680   0.142   1.00 65.06  ? 28  ALA A N   1 
ATOM   209  C CA  . ALA A 1 28  ? 55.483 11.017  0.500   1.00 63.28  ? 28  ALA A CA  1 
ATOM   210  C C   . ALA A 1 28  ? 55.530 11.057  1.912   1.00 62.02  ? 28  ALA A C   1 
ATOM   211  O O   . ALA A 1 28  ? 55.896 10.120  2.607   1.00 61.24  ? 28  ALA A O   1 
ATOM   212  C CB  . ALA A 1 28  ? 54.126 11.540  -0.007  1.00 64.04  ? 28  ALA A CB  1 
ATOM   213  N N   . THR A 1 29  ? 55.211 12.077  2.384   1.00 62.95  ? 29  THR A N   1 
ATOM   214  C CA  . THR A 1 29  ? 55.263 12.072  3.701   1.00 67.24  ? 29  THR A CA  1 
ATOM   215  C C   . THR A 1 29  ? 53.896 12.131  4.038   1.00 66.59  ? 29  THR A C   1 
ATOM   216  O O   . THR A 1 29  ? 53.304 13.212  4.000   1.00 70.44  ? 29  THR A O   1 
ATOM   217  C CB  . THR A 1 29  ? 56.222 13.094  4.074   1.00 69.01  ? 29  THR A CB  1 
ATOM   218  O OG1 . THR A 1 29  ? 57.519 12.667  3.669   1.00 71.68  ? 29  THR A OG1 1 
ATOM   219  C CG2 . THR A 1 29  ? 56.214 13.302  5.563   1.00 68.90  ? 29  THR A CG2 1 
ATOM   220  N N   . PRO A 1 30  ? 53.477 11.015  4.345   1.00 63.54  ? 30  PRO A N   1 
ATOM   221  C CA  . PRO A 1 30  ? 52.059 10.807  4.545   1.00 59.96  ? 30  PRO A CA  1 
ATOM   222  C C   . PRO A 1 30  ? 51.634 11.521  5.783   1.00 57.78  ? 30  PRO A C   1 
ATOM   223  O O   . PRO A 1 30  ? 52.401 11.743  6.756   1.00 56.61  ? 30  PRO A O   1 
ATOM   224  C CB  . PRO A 1 30  ? 51.940 9.312   4.665   1.00 58.10  ? 30  PRO A CB  1 
ATOM   225  C CG  . PRO A 1 30  ? 53.287 8.849   5.141   1.00 57.36  ? 30  PRO A CG  1 
ATOM   226  C CD  . PRO A 1 30  ? 54.279 9.804   4.542   1.00 60.61  ? 30  PRO A CD  1 
ATOM   227  N N   . TYR A 1 31  ? 50.308 11.834  5.744   1.00 56.61  ? 31  TYR A N   1 
ATOM   228  C CA  . TYR A 1 31  ? 49.526 12.325  6.913   1.00 55.49  ? 31  TYR A CA  1 
ATOM   229  C C   . TYR A 1 31  ? 48.761 11.101  7.406   1.00 53.68  ? 31  TYR A C   1 
ATOM   230  O O   . TYR A 1 31  ? 48.400 10.217  6.620   1.00 52.22  ? 31  TYR A O   1 
ATOM   231  C CB  . TYR A 1 31  ? 48.465 13.358  6.505   1.00 59.40  ? 31  TYR A CB  1 
ATOM   232  C CG  . TYR A 1 31  ? 48.985 14.630  5.833   1.00 67.98  ? 31  TYR A CG  1 
ATOM   233  C CD1 . TYR A 1 31  ? 50.353 14.817  5.605   1.00 72.85  ? 31  TYR A CD1 1 
ATOM   234  C CD2 . TYR A 1 31  ? 48.065 15.611  5.442   1.00 70.23  ? 31  TYR A CD2 1 
ATOM   235  C CE1 . TYR A 1 31  ? 50.801 15.989  4.975   1.00 76.31  ? 31  TYR A CE1 1 
ATOM   236  C CE2 . TYR A 1 31  ? 48.510 16.778  4.811   1.00 75.12  ? 31  TYR A CE2 1 
ATOM   237  C CZ  . TYR A 1 31  ? 49.878 16.967  4.576   1.00 77.23  ? 31  TYR A CZ  1 
ATOM   238  O OH  . TYR A 1 31  ? 50.309 18.100  3.957   1.00 76.71  ? 31  TYR A OH  1 
ATOM   239  N N   . LEU A 1 32  ? 48.476 10.986  8.683   1.00 47.76  ? 32  LEU A N   1 
ATOM   240  C CA  . LEU A 1 32  ? 47.794 9.761   9.133   1.00 42.36  ? 32  LEU A CA  1 
ATOM   241  C C   . LEU A 1 32  ? 46.633 10.029  10.082  1.00 37.27  ? 32  LEU A C   1 
ATOM   242  O O   . LEU A 1 32  ? 46.742 10.883  10.953  1.00 35.42  ? 32  LEU A O   1 
ATOM   243  C CB  . LEU A 1 32  ? 48.799 8.827   9.803   1.00 41.95  ? 32  LEU A CB  1 
ATOM   244  C CG  . LEU A 1 32  ? 49.795 8.237   8.798   1.00 47.37  ? 32  LEU A CG  1 
ATOM   245  C CD1 . LEU A 1 32  ? 50.725 7.193   9.414   1.00 49.55  ? 32  LEU A CD1 1 
ATOM   246  C CD2 . LEU A 1 32  ? 49.114 7.539   7.616   1.00 45.03  ? 32  LEU A CD2 1 
ATOM   247  N N   . PHE A 1 33  ? 45.517 9.319   9.887   1.00 34.55  ? 33  PHE A N   1 
ATOM   248  C CA  . PHE A 1 33  ? 44.332 9.476   10.740  1.00 34.12  ? 33  PHE A CA  1 
ATOM   249  C C   . PHE A 1 33  ? 43.681 8.160   11.153  1.00 30.84  ? 33  PHE A C   1 
ATOM   250  O O   . PHE A 1 33  ? 43.971 7.092   10.627  1.00 25.43  ? 33  PHE A O   1 
ATOM   251  C CB  . PHE A 1 33  ? 43.213 10.253  10.038  1.00 36.25  ? 33  PHE A CB  1 
ATOM   252  C CG  . PHE A 1 33  ? 43.654 11.501  9.354   1.00 42.89  ? 33  PHE A CG  1 
ATOM   253  C CD1 . PHE A 1 33  ? 44.365 11.441  8.150   1.00 45.03  ? 33  PHE A CD1 1 
ATOM   254  C CD2 . PHE A 1 33  ? 43.303 12.744  9.862   1.00 43.61  ? 33  PHE A CD2 1 
ATOM   255  C CE1 . PHE A 1 33  ? 44.714 12.598  7.462   1.00 41.22  ? 33  PHE A CE1 1 
ATOM   256  C CE2 . PHE A 1 33  ? 43.647 13.901  9.180   1.00 42.38  ? 33  PHE A CE2 1 
ATOM   257  C CZ  . PHE A 1 33  ? 44.354 13.823  7.978   1.00 43.11  ? 33  PHE A CZ  1 
ATOM   258  N N   . TRP A 1 34  ? 42.755 8.297   12.089  1.00 29.76  ? 34  TRP A N   1 
ATOM   259  C CA  . TRP A 1 34  ? 41.929 7.217   12.576  1.00 29.26  ? 34  TRP A CA  1 
ATOM   260  C C   . TRP A 1 34  ? 40.561 7.871   12.754  1.00 28.57  ? 34  TRP A C   1 
ATOM   261  O O   . TRP A 1 34  ? 40.463 8.913   13.387  1.00 27.43  ? 34  TRP A O   1 
ATOM   262  C CB  . TRP A 1 34  ? 42.431 6.663   13.912  1.00 32.35  ? 34  TRP A CB  1 
ATOM   263  C CG  . TRP A 1 34  ? 43.430 5.551   13.785  1.00 34.17  ? 34  TRP A CG  1 
ATOM   264  C CD1 . TRP A 1 34  ? 44.780 5.643   13.943  1.00 36.77  ? 34  TRP A CD1 1 
ATOM   265  C CD2 . TRP A 1 34  ? 43.153 4.167   13.515  1.00 35.51  ? 34  TRP A CD2 1 
ATOM   266  N NE1 . TRP A 1 34  ? 45.363 4.408   13.793  1.00 37.62  ? 34  TRP A NE1 1 
ATOM   267  C CE2 . TRP A 1 34  ? 44.389 3.483   13.532  1.00 34.69  ? 34  TRP A CE2 1 
ATOM   268  C CE3 . TRP A 1 34  ? 41.981 3.438   13.263  1.00 30.61  ? 34  TRP A CE3 1 
ATOM   269  C CZ2 . TRP A 1 34  ? 44.485 2.113   13.308  1.00 33.91  ? 34  TRP A CZ2 1 
ATOM   270  C CZ3 . TRP A 1 34  ? 42.078 2.083   13.040  1.00 26.07  ? 34  TRP A CZ3 1 
ATOM   271  C CH2 . TRP A 1 34  ? 43.316 1.431   13.063  1.00 29.79  ? 34  TRP A CH2 1 
ATOM   272  N N   . TYR A 1 35  ? 39.566 7.341   12.047  1.00 28.47  ? 35  TYR A N   1 
ATOM   273  C CA  . TYR A 1 35  ? 38.174 7.777   12.102  1.00 28.79  ? 35  TYR A CA  1 
ATOM   274  C C   . TYR A 1 35  ? 37.380 6.640   12.721  1.00 32.73  ? 35  TYR A C   1 
ATOM   275  O O   . TYR A 1 35  ? 37.759 5.469   12.590  1.00 37.44  ? 35  TYR A O   1 
ATOM   276  C CB  . TYR A 1 35  ? 37.632 7.999   10.700  1.00 26.89  ? 35  TYR A CB  1 
ATOM   277  C CG  . TYR A 1 35  ? 38.042 9.313   10.129  1.00 31.41  ? 35  TYR A CG  1 
ATOM   278  C CD1 . TYR A 1 35  ? 39.340 9.518   9.664   1.00 35.41  ? 35  TYR A CD1 1 
ATOM   279  C CD2 . TYR A 1 35  ? 37.151 10.372  10.088  1.00 27.80  ? 35  TYR A CD2 1 
ATOM   280  C CE1 . TYR A 1 35  ? 39.741 10.761  9.172   1.00 36.24  ? 35  TYR A CE1 1 
ATOM   281  C CE2 . TYR A 1 35  ? 37.531 11.611  9.601   1.00 28.24  ? 35  TYR A CE2 1 
ATOM   282  C CZ  . TYR A 1 35  ? 38.824 11.811  9.144   1.00 34.41  ? 35  TYR A CZ  1 
ATOM   283  O OH  . TYR A 1 35  ? 39.212 13.054  8.677   1.00 32.83  ? 35  TYR A OH  1 
ATOM   284  N N   . VAL A 1 36  ? 36.260 6.959   13.356  1.00 32.09  ? 36  VAL A N   1 
ATOM   285  C CA  . VAL A 1 36  ? 35.421 5.937   13.965  1.00 31.37  ? 36  VAL A CA  1 
ATOM   286  C C   . VAL A 1 36  ? 33.980 6.162   13.485  1.00 33.47  ? 36  VAL A C   1 
ATOM   287  O O   . VAL A 1 36  ? 33.560 7.298   13.224  1.00 34.00  ? 36  VAL A O   1 
ATOM   288  C CB  . VAL A 1 36  ? 35.576 5.971   15.518  1.00 31.91  ? 36  VAL A CB  1 
ATOM   289  C CG1 . VAL A 1 36  ? 35.385 7.372   16.101  1.00 34.08  ? 36  VAL A CG1 1 
ATOM   290  C CG2 . VAL A 1 36  ? 34.571 5.069   16.235  1.00 28.72  ? 36  VAL A CG2 1 
ATOM   291  N N   . GLN A 1 37  ? 33.244 5.070   13.348  1.00 31.10  ? 37  GLN A N   1 
ATOM   292  C CA  . GLN A 1 37  ? 31.855 5.132   12.865  1.00 30.95  ? 37  GLN A CA  1 
ATOM   293  C C   . GLN A 1 37  ? 30.914 4.346   13.772  1.00 34.70  ? 37  GLN A C   1 
ATOM   294  O O   . GLN A 1 37  ? 31.007 3.103   13.858  1.00 33.30  ? 37  GLN A O   1 
ATOM   295  C CB  . GLN A 1 37  ? 31.748 4.557   11.447  1.00 27.50  ? 37  GLN A CB  1 
ATOM   296  C CG  . GLN A 1 37  ? 30.339 4.680   10.848  1.00 23.71  ? 37  GLN A CG  1 
ATOM   297  C CD  . GLN A 1 37  ? 30.243 4.151   9.411   1.00 27.86  ? 37  GLN A CD  1 
ATOM   298  O OE1 . GLN A 1 37  ? 31.248 3.724   8.844   1.00 34.34  ? 37  GLN A OE1 1 
ATOM   299  N NE2 . GLN A 1 37  ? 29.082 4.153   8.780   1.00 25.04  ? 37  GLN A NE2 1 
ATOM   300  N N   . TYR A 1 38  ? 30.055 5.130   14.409  1.00 41.36  ? 38  TYR A N   1 
ATOM   301  C CA  . TYR A 1 38  ? 28.995 4.620   15.271  1.00 46.67  ? 38  TYR A CA  1 
ATOM   302  C C   . TYR A 1 38  ? 27.879 4.195   14.359  1.00 53.14  ? 38  TYR A C   1 
ATOM   303  O O   . TYR A 1 38  ? 27.761 4.686   13.223  1.00 53.31  ? 38  TYR A O   1 
ATOM   304  C CB  . TYR A 1 38  ? 28.603 5.647   16.318  1.00 44.50  ? 38  TYR A CB  1 
ATOM   305  C CG  . TYR A 1 38  ? 29.769 5.916   17.264  1.00 41.50  ? 38  TYR A CG  1 
ATOM   306  C CD1 . TYR A 1 38  ? 29.961 5.127   18.411  1.00 42.52  ? 38  TYR A CD1 1 
ATOM   307  C CD2 . TYR A 1 38  ? 30.657 6.945   16.967  1.00 41.34  ? 38  TYR A CD2 1 
ATOM   308  C CE1 . TYR A 1 38  ? 31.039 5.393   19.262  1.00 42.67  ? 38  TYR A CE1 1 
ATOM   309  C CE2 . TYR A 1 38  ? 31.732 7.207   17.813  1.00 42.17  ? 38  TYR A CE2 1 
ATOM   310  C CZ  . TYR A 1 38  ? 31.924 6.434   18.962  1.00 43.03  ? 38  TYR A CZ  1 
ATOM   311  O OH  . TYR A 1 38  ? 32.971 6.700   19.787  1.00 50.69  ? 38  TYR A OH  1 
ATOM   312  N N   . PRO A 1 39  ? 27.053 3.347   14.849  1.00 60.47  ? 39  PRO A N   1 
ATOM   313  C CA  . PRO A 1 39  ? 26.152 2.628   13.952  1.00 63.89  ? 39  PRO A CA  1 
ATOM   314  C C   . PRO A 1 39  ? 25.279 3.584   13.194  1.00 66.84  ? 39  PRO A C   1 
ATOM   315  O O   . PRO A 1 39  ? 24.536 4.365   13.858  1.00 68.89  ? 39  PRO A O   1 
ATOM   316  C CB  . PRO A 1 39  ? 25.351 1.756   14.883  1.00 66.31  ? 39  PRO A CB  1 
ATOM   317  C CG  . PRO A 1 39  ? 26.189 1.630   16.124  1.00 66.37  ? 39  PRO A CG  1 
ATOM   318  C CD  . PRO A 1 39  ? 26.933 2.923   16.245  1.00 61.78  ? 39  PRO A CD  1 
ATOM   319  N N   . ARG A 1 40  ? 25.423 3.492   11.898  1.00 67.12  ? 40  ARG A N   1 
ATOM   320  C CA  . ARG A 1 40  ? 24.676 4.239   10.852  1.00 69.10  ? 40  ARG A CA  1 
ATOM   321  C C   . ARG A 1 40  ? 24.841 5.782   10.794  1.00 68.60  ? 40  ARG A C   1 
ATOM   322  O O   . ARG A 1 40  ? 23.982 6.502   10.245  1.00 68.70  ? 40  ARG A O   1 
ATOM   323  C CB  . ARG A 1 40  ? 23.198 3.987   10.867  1.00 71.73  ? 40  ARG A CB  1 
ATOM   324  C CG  . ARG A 1 40  ? 22.693 3.946   9.425   1.00 79.47  ? 40  ARG A CG  1 
ATOM   325  C CD  . ARG A 1 40  ? 22.234 5.315   8.924   1.00 85.06  ? 40  ARG A CD  1 
ATOM   326  N NE  . ARG A 1 40  ? 22.784 5.733   7.615   1.00 86.59  ? 40  ARG A NE  1 
ATOM   327  C CZ  . ARG A 1 40  ? 22.179 6.651   6.836   1.00 87.96  ? 40  ARG A CZ  1 
ATOM   328  N NH1 . ARG A 1 40  ? 21.031 7.232   7.224   1.00 89.13  ? 40  ARG A NH1 1 
ATOM   329  N NH2 . ARG A 1 40  ? 22.639 7.061   5.647   1.00 83.81  ? 40  ARG A NH2 1 
ATOM   330  N N   . GLN A 1 41  ? 25.931 6.299   11.313  1.00 66.18  ? 41  GLN A N   1 
ATOM   331  C CA  . GLN A 1 41  ? 26.252 7.724   11.107  1.00 62.22  ? 41  GLN A CA  1 
ATOM   332  C C   . GLN A 1 41  ? 27.544 7.808   10.306  1.00 58.98  ? 41  GLN A C   1 
ATOM   333  O O   . GLN A 1 41  ? 28.156 6.776   9.992   1.00 58.72  ? 41  GLN A O   1 
ATOM   334  C CB  . GLN A 1 41  ? 26.425 8.504   12.394  1.00 63.20  ? 41  GLN A CB  1 
ATOM   335  C CG  . GLN A 1 41  ? 27.151 7.766   13.473  1.00 62.77  ? 41  GLN A CG  1 
ATOM   336  C CD  . GLN A 1 41  ? 26.601 8.187   14.806  1.00 65.66  ? 41  GLN A CD  1 
ATOM   337  O OE1 . GLN A 1 41  ? 27.232 8.965   15.505  1.00 65.85  ? 41  GLN A OE1 1 
ATOM   338  N NE2 . GLN A 1 41  ? 25.428 7.726   15.185  1.00 64.95  ? 41  GLN A NE2 1 
ATOM   339  N N   . GLY A 1 42  ? 27.912 9.036   9.975   1.00 56.86  ? 42  GLY A N   1 
ATOM   340  C CA  . GLY A 1 42  ? 29.136 9.315   9.205   1.00 49.62  ? 42  GLY A CA  1 
ATOM   341  C C   . GLY A 1 42  ? 30.343 9.004   10.079  1.00 43.82  ? 42  GLY A C   1 
ATOM   342  O O   . GLY A 1 42  ? 30.204 8.563   11.226  1.00 40.62  ? 42  GLY A O   1 
ATOM   343  N N   . LEU A 1 43  ? 31.516 9.216   9.533   1.00 41.30  ? 43  LEU A N   1 
ATOM   344  C CA  . LEU A 1 43  ? 32.741 8.999   10.298  1.00 38.51  ? 43  LEU A CA  1 
ATOM   345  C C   . LEU A 1 43  ? 33.081 10.268  11.066  1.00 34.06  ? 43  LEU A C   1 
ATOM   346  O O   . LEU A 1 43  ? 32.849 11.370  10.573  1.00 33.11  ? 43  LEU A O   1 
ATOM   347  C CB  . LEU A 1 43  ? 33.966 8.737   9.390   1.00 38.04  ? 43  LEU A CB  1 
ATOM   348  C CG  . LEU A 1 43  ? 33.804 7.664   8.298   1.00 36.93  ? 43  LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 43  ? 35.159 7.085   7.849   1.00 33.08  ? 43  LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 43  ? 32.965 6.463   8.722   1.00 32.94  ? 43  LEU A CD2 1 
ATOM   351  N N   . GLN A 1 44  ? 33.546 10.098  12.296  1.00 34.25  ? 44  GLN A N   1 
ATOM   352  C CA  . GLN A 1 44  ? 33.975 11.198  13.148  1.00 37.46  ? 44  GLN A CA  1 
ATOM   353  C C   . GLN A 1 44  ? 35.475 10.967  13.327  1.00 39.95  ? 44  GLN A C   1 
ATOM   354  O O   . GLN A 1 44  ? 35.886 9.819   13.485  1.00 43.12  ? 44  GLN A O   1 
ATOM   355  C CB  . GLN A 1 44  ? 33.285 11.117  14.513  1.00 35.65  ? 44  GLN A CB  1 
ATOM   356  C CG  . GLN A 1 44  ? 31.841 11.559  14.490  1.00 46.01  ? 44  GLN A CG  1 
ATOM   357  C CD  . GLN A 1 44  ? 30.915 10.569  15.171  1.00 53.51  ? 44  GLN A CD  1 
ATOM   358  O OE1 . GLN A 1 44  ? 30.704 10.644  16.379  1.00 55.91  ? 44  GLN A OE1 1 
ATOM   359  N NE2 . GLN A 1 44  ? 30.363 9.624   14.401  1.00 54.80  ? 44  GLN A NE2 1 
ATOM   360  N N   . LEU A 1 45  ? 36.303 12.004  13.194  1.00 39.26  ? 45  LEU A N   1 
ATOM   361  C CA  . LEU A 1 45  ? 37.743 11.820  13.408  1.00 37.68  ? 45  LEU A CA  1 
ATOM   362  C C   . LEU A 1 45  ? 38.005 11.448  14.891  1.00 38.93  ? 45  LEU A C   1 
ATOM   363  O O   . LEU A 1 45  ? 37.337 11.952  15.815  1.00 38.97  ? 45  LEU A O   1 
ATOM   364  C CB  . LEU A 1 45  ? 38.543 13.077  13.038  1.00 36.86  ? 45  LEU A CB  1 
ATOM   365  C CG  . LEU A 1 45  ? 40.063 13.026  13.298  1.00 33.55  ? 45  LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 45  ? 40.778 12.346  12.161  1.00 32.89  ? 45  LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 45  ? 40.614 14.412  13.471  1.00 29.45  ? 45  LEU A CD2 1 
ATOM   368  N N   . LEU A 1 46  ? 38.972 10.556  15.097  1.00 37.17  ? 46  LEU A N   1 
ATOM   369  C CA  . LEU A 1 46  ? 39.346 10.079  16.425  1.00 36.78  ? 46  LEU A CA  1 
ATOM   370  C C   . LEU A 1 46  ? 40.711 10.688  16.810  1.00 36.87  ? 46  LEU A C   1 
ATOM   371  O O   . LEU A 1 46  ? 40.875 11.200  17.933  1.00 39.65  ? 46  LEU A O   1 
ATOM   372  C CB  . LEU A 1 46  ? 39.391 8.540   16.424  1.00 32.67  ? 46  LEU A CB  1 
ATOM   373  C CG  . LEU A 1 46  ? 39.458 7.734   17.720  1.00 28.24  ? 46  LEU A CG  1 
ATOM   374  C CD1 . LEU A 1 46  ? 38.155 7.805   18.457  1.00 20.87  ? 46  LEU A CD1 1 
ATOM   375  C CD2 . LEU A 1 46  ? 39.774 6.306   17.368  1.00 27.85  ? 46  LEU A CD2 1 
ATOM   376  N N   . LEU A 1 47  ? 41.672 10.640  15.885  1.00 31.60  ? 47  LEU A N   1 
ATOM   377  C CA  . LEU A 1 47  ? 42.989 11.218  16.116  1.00 32.81  ? 47  LEU A CA  1 
ATOM   378  C C   . LEU A 1 47  ? 43.790 11.388  14.836  1.00 33.56  ? 47  LEU A C   1 
ATOM   379  O O   . LEU A 1 47  ? 43.558 10.675  13.854  1.00 33.03  ? 47  LEU A O   1 
ATOM   380  C CB  . LEU A 1 47  ? 43.770 10.450  17.187  1.00 33.69  ? 47  LEU A CB  1 
ATOM   381  C CG  . LEU A 1 47  ? 43.919 8.940   17.152  1.00 31.93  ? 47  LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 47  ? 44.667 8.473   15.923  1.00 30.22  ? 47  LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 47  ? 44.648 8.561   18.381  1.00 27.24  ? 47  LEU A CD2 1 
ATOM   384  N N   . LYS A 1 48  ? 44.733 12.330  14.845  1.00 35.54  ? 48  LYS A N   1 
ATOM   385  C CA  . LYS A 1 48  ? 45.518 12.607  13.649  1.00 38.02  ? 48  LYS A CA  1 
ATOM   386  C C   . LYS A 1 48  ? 46.996 12.939  13.862  1.00 39.29  ? 48  LYS A C   1 
ATOM   387  O O   . LYS A 1 48  ? 47.378 13.425  14.921  1.00 39.51  ? 48  LYS A O   1 
ATOM   388  C CB  . LYS A 1 48  ? 44.845 13.740  12.858  1.00 38.46  ? 48  LYS A CB  1 
ATOM   389  C CG  . LYS A 1 48  ? 44.686 15.032  13.631  1.00 37.48  ? 48  LYS A CG  1 
ATOM   390  C CD  . LYS A 1 48  ? 44.151 16.131  12.745  1.00 42.51  ? 48  LYS A CD  1 
ATOM   391  C CE  . LYS A 1 48  ? 43.995 17.440  13.509  1.00 44.59  ? 48  LYS A CE  1 
ATOM   392  N NZ  . LYS A 1 48  ? 43.208 17.264  14.779  1.00 49.26  ? 48  LYS A NZ  1 
ATOM   393  N N   . TYR A 1 49  ? 47.796 12.726  12.814  1.00 40.92  ? 49  TYR A N   1 
ATOM   394  C CA  . TYR A 1 49  ? 49.230 13.000  12.831  1.00 47.01  ? 49  TYR A CA  1 
ATOM   395  C C   . TYR A 1 49  ? 49.756 13.574  11.511  1.00 49.23  ? 49  TYR A C   1 
ATOM   396  O O   . TYR A 1 49  ? 49.587 12.981  10.449  1.00 44.48  ? 49  TYR A O   1 
ATOM   397  C CB  . TYR A 1 49  ? 50.039 11.745  13.171  1.00 51.39  ? 49  TYR A CB  1 
ATOM   398  C CG  . TYR A 1 49  ? 51.533 11.933  12.976  1.00 57.31  ? 49  TYR A CG  1 
ATOM   399  C CD1 . TYR A 1 49  ? 52.310 12.568  13.950  1.00 60.12  ? 49  TYR A CD1 1 
ATOM   400  C CD2 . TYR A 1 49  ? 52.160 11.534  11.791  1.00 57.90  ? 49  TYR A CD2 1 
ATOM   401  C CE1 . TYR A 1 49  ? 53.679 12.806  13.747  1.00 61.42  ? 49  TYR A CE1 1 
ATOM   402  C CE2 . TYR A 1 49  ? 53.526 11.772  11.578  1.00 61.29  ? 49  TYR A CE2 1 
ATOM   403  C CZ  . TYR A 1 49  ? 54.282 12.408  12.561  1.00 62.04  ? 49  TYR A CZ  1 
ATOM   404  O OH  . TYR A 1 49  ? 55.630 12.641  12.363  1.00 59.46  ? 49  TYR A OH  1 
ATOM   405  N N   . TYR A 1 50  ? 50.463 14.700  11.616  1.00 55.26  ? 50  TYR A N   1 
ATOM   406  C CA  . TYR A 1 50  ? 51.060 15.374  10.469  1.00 56.34  ? 50  TYR A CA  1 
ATOM   407  C C   . TYR A 1 50  ? 52.584 15.496  10.578  1.00 57.84  ? 50  TYR A C   1 
ATOM   408  O O   . TYR A 1 50  ? 53.305 15.122  9.658   1.00 58.09  ? 50  TYR A O   1 
ATOM   409  C CB  . TYR A 1 50  ? 50.464 16.761  10.300  1.00 58.58  ? 50  TYR A CB  1 
ATOM   410  C CG  . TYR A 1 50  ? 48.961 16.781  10.155  1.00 65.35  ? 50  TYR A CG  1 
ATOM   411  C CD1 . TYR A 1 50  ? 48.334 16.314  8.990   1.00 68.52  ? 50  TYR A CD1 1 
ATOM   412  C CD2 . TYR A 1 50  ? 48.159 17.332  11.159  1.00 68.48  ? 50  TYR A CD2 1 
ATOM   413  C CE1 . TYR A 1 50  ? 46.931 16.409  8.826   1.00 67.36  ? 50  TYR A CE1 1 
ATOM   414  C CE2 . TYR A 1 50  ? 46.765 17.429  11.010  1.00 68.44  ? 50  TYR A CE2 1 
ATOM   415  C CZ  . TYR A 1 50  ? 46.159 16.973  9.845   1.00 68.65  ? 50  TYR A CZ  1 
ATOM   416  O OH  . TYR A 1 50  ? 44.792 17.118  9.714   1.00 66.84  ? 50  TYR A OH  1 
ATOM   417  N N   . SER A 1 51  ? 53.080 15.995  11.707  1.00 61.37  ? 51  SER A N   1 
ATOM   418  C CA  . SER A 1 51  ? 54.526 16.171  11.878  1.00 61.64  ? 51  SER A CA  1 
ATOM   419  C C   . SER A 1 51  ? 54.949 16.268  13.337  1.00 62.26  ? 51  SER A C   1 
ATOM   420  O O   . SER A 1 51  ? 54.142 16.633  14.205  1.00 61.33  ? 51  SER A O   1 
ATOM   421  C CB  . SER A 1 51  ? 54.970 17.444  11.150  1.00 60.67  ? 51  SER A CB  1 
ATOM   422  O OG  . SER A 1 51  ? 54.065 18.518  11.413  1.00 57.68  ? 51  SER A OG  1 
ATOM   423  N N   . GLY A 1 52  ? 56.214 15.936  13.590  1.00 62.17  ? 52  GLY A N   1 
ATOM   424  C CA  . GLY A 1 52  ? 56.768 16.019  14.932  1.00 62.60  ? 52  GLY A CA  1 
ATOM   425  C C   . GLY A 1 52  ? 56.638 14.842  15.888  1.00 63.68  ? 52  GLY A C   1 
ATOM   426  O O   . GLY A 1 52  ? 57.338 13.831  15.756  1.00 61.29  ? 52  GLY A O   1 
ATOM   427  N N   . ASP A 1 53  ? 55.800 15.014  16.909  1.00 64.64  ? 53  ASP A N   1 
ATOM   428  C CA  . ASP A 1 53  ? 55.580 13.978  17.911  1.00 65.01  ? 53  ASP A CA  1 
ATOM   429  C C   . ASP A 1 53  ? 54.951 12.775  17.226  1.00 64.54  ? 53  ASP A C   1 
ATOM   430  O O   . ASP A 1 53  ? 53.787 12.834  16.810  1.00 65.97  ? 53  ASP A O   1 
ATOM   431  C CB  . ASP A 1 53  ? 54.654 14.498  19.025  1.00 67.07  ? 53  ASP A CB  1 
ATOM   432  C CG  . ASP A 1 53  ? 54.765 13.684  20.323  1.00 69.40  ? 53  ASP A CG  1 
ATOM   433  O OD1 . ASP A 1 53  ? 55.640 12.793  20.429  1.00 70.01  ? 53  ASP A OD1 1 
ATOM   434  O OD2 . ASP A 1 53  ? 53.972 13.946  21.251  1.00 71.01  ? 53  ASP A OD2 1 
ATOM   435  N N   . PRO A 1 54  ? 55.706 11.661  17.116  1.00 62.46  ? 54  PRO A N   1 
ATOM   436  C CA  . PRO A 1 54  ? 55.225 10.428  16.475  1.00 62.78  ? 54  PRO A CA  1 
ATOM   437  C C   . PRO A 1 54  ? 54.008 9.768   17.161  1.00 63.42  ? 54  PRO A C   1 
ATOM   438  O O   . PRO A 1 54  ? 53.305 8.970   16.532  1.00 65.50  ? 54  PRO A O   1 
ATOM   439  C CB  . PRO A 1 54  ? 56.463 9.518   16.507  1.00 59.36  ? 54  PRO A CB  1 
ATOM   440  C CG  . PRO A 1 54  ? 57.184 9.966   17.735  1.00 57.24  ? 54  PRO A CG  1 
ATOM   441  C CD  . PRO A 1 54  ? 57.068 11.473  17.649  1.00 58.51  ? 54  PRO A CD  1 
ATOM   442  N N   . VAL A 1 55  ? 53.793 10.084  18.444  1.00 60.64  ? 55  VAL A N   1 
ATOM   443  C CA  . VAL A 1 55  ? 52.690 9.548   19.236  1.00 55.28  ? 55  VAL A CA  1 
ATOM   444  C C   . VAL A 1 55  ? 51.636 10.613  19.440  1.00 57.34  ? 55  VAL A C   1 
ATOM   445  O O   . VAL A 1 55  ? 51.859 11.596  20.166  1.00 56.44  ? 55  VAL A O   1 
ATOM   446  C CB  . VAL A 1 55  ? 53.162 9.049   20.617  1.00 56.43  ? 55  VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 55  ? 51.961 8.813   21.557  1.00 52.21  ? 55  VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 55  ? 53.987 7.769   20.449  1.00 52.25  ? 55  VAL A CG2 1 
ATOM   449  N N   . VAL A 1 56  ? 50.493 10.390  18.786  1.00 58.18  ? 56  VAL A N   1 
ATOM   450  C CA  . VAL A 1 56  ? 49.339 11.281  18.830  1.00 56.76  ? 56  VAL A CA  1 
ATOM   451  C C   . VAL A 1 56  ? 48.256 10.709  19.721  1.00 55.76  ? 56  VAL A C   1 
ATOM   452  O O   . VAL A 1 56  ? 48.085 9.493   19.810  1.00 57.13  ? 56  VAL A O   1 
ATOM   453  C CB  . VAL A 1 56  ? 48.734 11.498  17.431  1.00 57.23  ? 56  VAL A CB  1 
ATOM   454  C CG1 . VAL A 1 56  ? 47.501 12.402  17.530  1.00 58.01  ? 56  VAL A CG1 1 
ATOM   455  C CG2 . VAL A 1 56  ? 49.777 12.118  16.500  1.00 57.66  ? 56  VAL A CG2 1 
ATOM   456  N N   . GLN A 1 57  ? 47.548 11.604  20.397  1.00 57.28  ? 57  GLN A N   1 
ATOM   457  C CA  . GLN A 1 57  ? 46.465 11.229  21.290  1.00 57.04  ? 57  GLN A CA  1 
ATOM   458  C C   . GLN A 1 57  ? 45.123 11.650  20.705  1.00 55.26  ? 57  GLN A C   1 
ATOM   459  O O   . GLN A 1 57  ? 45.035 12.430  19.746  1.00 52.06  ? 57  GLN A O   1 
ATOM   460  C CB  . GLN A 1 57  ? 46.635 11.865  22.689  1.00 57.63  ? 57  GLN A CB  1 
ATOM   461  C CG  . GLN A 1 57  ? 47.585 11.138  23.651  1.00 58.58  ? 57  GLN A CG  1 
ATOM   462  C CD  . GLN A 1 57  ? 49.058 11.328  23.306  1.00 63.88  ? 57  GLN A CD  1 
ATOM   463  O OE1 . GLN A 1 57  ? 49.445 12.342  22.714  1.00 62.52  ? 57  GLN A OE1 1 
ATOM   464  N NE2 . GLN A 1 57  ? 49.895 10.371  23.710  1.00 65.20  ? 57  GLN A NE2 1 
ATOM   465  N N   . GLY A 1 58  ? 44.083 11.088  21.288  1.00 53.34  ? 58  GLY A N   1 
ATOM   466  C CA  . GLY A 1 58  ? 42.740 11.392  20.879  1.00 55.05  ? 58  GLY A CA  1 
ATOM   467  C C   . GLY A 1 58  ? 41.918 11.389  22.149  1.00 55.75  ? 58  GLY A C   1 
ATOM   468  O O   . GLY A 1 58  ? 42.462 11.351  23.271  1.00 55.79  ? 58  GLY A O   1 
ATOM   469  N N   . VAL A 1 59  ? 40.605 11.422  21.977  1.00 56.89  ? 59  VAL A N   1 
ATOM   470  C CA  . VAL A 1 59  ? 39.687 11.417  23.102  1.00 60.14  ? 59  VAL A CA  1 
ATOM   471  C C   . VAL A 1 59  ? 39.664 10.034  23.761  1.00 60.36  ? 59  VAL A C   1 
ATOM   472  O O   . VAL A 1 59  ? 39.611 9.025   23.068  1.00 64.99  ? 59  VAL A O   1 
ATOM   473  C CB  . VAL A 1 59  ? 38.264 11.829  22.638  1.00 61.01  ? 59  VAL A CB  1 
ATOM   474  C CG1 . VAL A 1 59  ? 37.233 11.457  23.682  1.00 62.71  ? 59  VAL A CG1 1 
ATOM   475  C CG2 . VAL A 1 59  ? 38.213 13.335  22.344  1.00 57.32  ? 59  VAL A CG2 1 
ATOM   476  N N   . ASN A 1 60  ? 39.761 10.000  25.089  1.00 60.17  ? 60  ASN A N   1 
ATOM   477  C CA  . ASN A 1 60  ? 39.732 8.757   25.877  1.00 60.85  ? 60  ASN A CA  1 
ATOM   478  C C   . ASN A 1 60  ? 40.987 7.901   25.906  1.00 60.25  ? 60  ASN A C   1 
ATOM   479  O O   . ASN A 1 60  ? 40.903 6.679   26.046  1.00 60.39  ? 60  ASN A O   1 
ATOM   480  C CB  . ASN A 1 60  ? 38.559 7.866   25.483  1.00 64.37  ? 60  ASN A CB  1 
ATOM   481  C CG  . ASN A 1 60  ? 37.231 8.538   25.679  1.00 69.84  ? 60  ASN A CG  1 
ATOM   482  O OD1 . ASN A 1 60  ? 36.293 8.288   24.924  1.00 70.63  ? 60  ASN A OD1 1 
ATOM   483  N ND2 . ASN A 1 60  ? 37.133 9.404   26.695  1.00 70.91  ? 60  ASN A ND2 1 
ATOM   484  N N   . GLY A 1 61  ? 42.149 8.532   25.791  1.00 59.23  ? 61  GLY A N   1 
ATOM   485  C CA  . GLY A 1 61  ? 43.385 7.780   25.846  1.00 58.04  ? 61  GLY A CA  1 
ATOM   486  C C   . GLY A 1 61  ? 43.613 6.876   24.656  1.00 55.86  ? 61  GLY A C   1 
ATOM   487  O O   . GLY A 1 61  ? 44.195 5.795   24.787  1.00 58.53  ? 61  GLY A O   1 
ATOM   488  N N   . PHE A 1 62  ? 43.071 7.280   23.515  1.00 52.04  ? 62  PHE A N   1 
ATOM   489  C CA  . PHE A 1 62  ? 43.275 6.556   22.282  1.00 48.94  ? 62  PHE A CA  1 
ATOM   490  C C   . PHE A 1 62  ? 44.591 7.086   21.772  1.00 48.47  ? 62  PHE A C   1 
ATOM   491  O O   . PHE A 1 62  ? 44.771 8.304   21.637  1.00 48.88  ? 62  PHE A O   1 
ATOM   492  C CB  . PHE A 1 62  ? 42.163 6.839   21.281  1.00 46.09  ? 62  PHE A CB  1 
ATOM   493  C CG  . PHE A 1 62  ? 41.100 5.790   21.278  1.00 45.81  ? 62  PHE A CG  1 
ATOM   494  C CD1 . PHE A 1 62  ? 41.353 4.536   20.727  1.00 39.76  ? 62  PHE A CD1 1 
ATOM   495  C CD2 . PHE A 1 62  ? 39.867 6.025   21.868  1.00 42.97  ? 62  PHE A CD2 1 
ATOM   496  C CE1 . PHE A 1 62  ? 40.413 3.545   20.765  1.00 37.77  ? 62  PHE A CE1 1 
ATOM   497  C CE2 . PHE A 1 62  ? 38.914 5.028   21.909  1.00 43.26  ? 62  PHE A CE2 1 
ATOM   498  C CZ  . PHE A 1 62  ? 39.189 3.784   21.356  1.00 40.71  ? 62  PHE A CZ  1 
ATOM   499  N N   . GLU A 1 63  ? 45.534 6.179   21.570  1.00 48.25  ? 63  GLU A N   1 
ATOM   500  C CA  . GLU A 1 63  ? 46.859 6.542   21.106  1.00 48.20  ? 63  GLU A CA  1 
ATOM   501  C C   . GLU A 1 63  ? 47.139 5.944   19.748  1.00 47.57  ? 63  GLU A C   1 
ATOM   502  O O   . GLU A 1 63  ? 46.629 4.884   19.406  1.00 47.94  ? 63  GLU A O   1 
ATOM   503  C CB  . GLU A 1 63  ? 47.885 6.023   22.095  1.00 51.56  ? 63  GLU A CB  1 
ATOM   504  C CG  . GLU A 1 63  ? 48.876 7.041   22.573  1.00 55.46  ? 63  GLU A CG  1 
ATOM   505  C CD  . GLU A 1 63  ? 49.432 6.654   23.922  1.00 58.30  ? 63  GLU A CD  1 
ATOM   506  O OE1 . GLU A 1 63  ? 50.081 5.579   24.010  1.00 54.66  ? 63  GLU A OE1 1 
ATOM   507  O OE2 . GLU A 1 63  ? 49.174 7.399   24.897  1.00 58.00  ? 63  GLU A OE2 1 
ATOM   508  N N   . ALA A 1 64  ? 47.954 6.631   18.973  1.00 47.94  ? 64  ALA A N   1 
ATOM   509  C CA  . ALA A 1 64  ? 48.322 6.151   17.662  1.00 49.98  ? 64  ALA A CA  1 
ATOM   510  C C   . ALA A 1 64  ? 49.757 6.587   17.502  1.00 52.26  ? 64  ALA A C   1 
ATOM   511  O O   . ALA A 1 64  ? 50.077 7.754   17.697  1.00 54.12  ? 64  ALA A O   1 
ATOM   512  C CB  . ALA A 1 64  ? 47.456 6.773   16.600  1.00 48.24  ? 64  ALA A CB  1 
ATOM   513  N N   . GLU A 1 65  ? 50.630 5.626   17.239  1.00 54.35  ? 65  GLU A N   1 
ATOM   514  C CA  . GLU A 1 65  ? 52.041 5.901   17.060  1.00 56.12  ? 65  GLU A CA  1 
ATOM   515  C C   . GLU A 1 65  ? 52.459 5.697   15.614  1.00 56.26  ? 65  GLU A C   1 
ATOM   516  O O   . GLU A 1 65  ? 52.158 4.674   14.985  1.00 54.75  ? 65  GLU A O   1 
ATOM   517  C CB  . GLU A 1 65  ? 52.879 5.020   17.981  1.00 60.82  ? 65  GLU A CB  1 
ATOM   518  C CG  . GLU A 1 65  ? 54.375 5.176   17.752  1.00 71.78  ? 65  GLU A CG  1 
ATOM   519  C CD  . GLU A 1 65  ? 55.217 4.641   18.896  1.00 75.74  ? 65  GLU A CD  1 
ATOM   520  O OE1 . GLU A 1 65  ? 54.985 3.480   19.319  1.00 75.90  ? 65  GLU A OE1 1 
ATOM   521  O OE2 . GLU A 1 65  ? 56.111 5.395   19.363  1.00 79.87  ? 65  GLU A OE2 1 
ATOM   522  N N   . PHE A 1 66  ? 53.156 6.691   15.091  1.00 56.99  ? 66  PHE A N   1 
ATOM   523  C CA  . PHE A 1 66  ? 53.625 6.657   13.727  1.00 58.87  ? 66  PHE A CA  1 
ATOM   524  C C   . PHE A 1 66  ? 55.025 6.055   13.696  1.00 61.36  ? 66  PHE A C   1 
ATOM   525  O O   . PHE A 1 66  ? 55.752 6.089   14.697  1.00 64.78  ? 66  PHE A O   1 
ATOM   526  C CB  . PHE A 1 66  ? 53.651 8.080   13.161  1.00 56.52  ? 66  PHE A CB  1 
ATOM   527  C CG  . PHE A 1 66  ? 54.151 8.161   11.746  1.00 58.73  ? 66  PHE A CG  1 
ATOM   528  C CD1 . PHE A 1 66  ? 53.685 7.275   10.776  1.00 59.16  ? 66  PHE A CD1 1 
ATOM   529  C CD2 . PHE A 1 66  ? 55.095 9.109   11.382  1.00 57.68  ? 66  PHE A CD2 1 
ATOM   530  C CE1 . PHE A 1 66  ? 54.152 7.331   9.466   1.00 59.64  ? 66  PHE A CE1 1 
ATOM   531  C CE2 . PHE A 1 66  ? 55.569 9.174   10.071  1.00 59.95  ? 66  PHE A CE2 1 
ATOM   532  C CZ  . PHE A 1 66  ? 55.095 8.282   9.111   1.00 59.63  ? 66  PHE A CZ  1 
ATOM   533  N N   . SER A 1 67  ? 55.384 5.465   12.561  1.00 60.64  ? 67  SER A N   1 
ATOM   534  C CA  . SER A 1 67  ? 56.708 4.902   12.389  1.00 62.49  ? 67  SER A CA  1 
ATOM   535  C C   . SER A 1 67  ? 57.043 4.775   10.909  1.00 64.29  ? 67  SER A C   1 
ATOM   536  O O   . SER A 1 67  ? 56.500 3.904   10.222  1.00 62.08  ? 67  SER A O   1 
ATOM   537  C CB  . SER A 1 67  ? 56.832 3.541   13.086  1.00 62.28  ? 67  SER A CB  1 
ATOM   538  O OG  . SER A 1 67  ? 56.147 2.506   12.398  1.00 61.96  ? 67  SER A OG  1 
ATOM   539  N N   . LYS A 1 68  ? 57.861 5.701   10.395  1.00 67.72  ? 68  LYS A N   1 
ATOM   540  C CA  . LYS A 1 68  ? 58.289 5.632   8.991   1.00 69.18  ? 68  LYS A CA  1 
ATOM   541  C C   . LYS A 1 68  ? 59.109 4.361   8.960   1.00 69.02  ? 68  LYS A C   1 
ATOM   542  O O   . LYS A 1 68  ? 59.097 3.609   7.989   1.00 68.57  ? 68  LYS A O   1 
ATOM   543  C CB  . LYS A 1 68  ? 59.190 6.810   8.597   1.00 69.33  ? 68  LYS A CB  1 
ATOM   544  C CG  . LYS A 1 68  ? 59.800 6.660   7.185   1.00 75.75  ? 68  LYS A CG  1 
ATOM   545  C CD  . LYS A 1 68  ? 60.891 7.706   6.875   1.00 81.19  ? 68  LYS A CD  1 
ATOM   546  C CE  . LYS A 1 68  ? 61.523 7.524   5.465   1.00 84.76  ? 68  LYS A CE  1 
ATOM   547  N NZ  . LYS A 1 68  ? 62.673 8.467   5.133   1.00 84.05  ? 68  LYS A NZ  1 
ATOM   548  N N   . SER A 1 69  ? 59.806 4.145   10.073  1.00 69.51  ? 69  SER A N   1 
ATOM   549  C CA  . SER A 1 69  ? 60.653 2.993   10.303  1.00 68.97  ? 69  SER A CA  1 
ATOM   550  C C   . SER A 1 69  ? 60.020 1.740   9.706   1.00 68.55  ? 69  SER A C   1 
ATOM   551  O O   . SER A 1 69  ? 60.549 1.161   8.759   1.00 69.13  ? 69  SER A O   1 
ATOM   552  C CB  . SER A 1 69  ? 60.860 2.817   11.820  1.00 70.44  ? 69  SER A CB  1 
ATOM   553  O OG  . SER A 1 69  ? 60.219 3.853   12.571  1.00 65.05  ? 69  SER A OG  1 
ATOM   554  N N   . ASN A 1 70  ? 58.839 1.383   10.203  1.00 68.51  ? 70  ASN A N   1 
ATOM   555  C CA  . ASN A 1 70  ? 58.145 0.191   9.736   1.00 66.43  ? 70  ASN A CA  1 
ATOM   556  C C   . ASN A 1 70  ? 56.717 0.398   9.205   1.00 63.65  ? 70  ASN A C   1 
ATOM   557  O O   . ASN A 1 70  ? 55.918 -0.537  9.176   1.00 66.00  ? 70  ASN A O   1 
ATOM   558  C CB  . ASN A 1 70  ? 58.216 -0.932  10.798  1.00 69.43  ? 70  ASN A CB  1 
ATOM   559  C CG  . ASN A 1 70  ? 58.182 -0.412  12.245  1.00 70.80  ? 70  ASN A CG  1 
ATOM   560  O OD1 . ASN A 1 70  ? 58.269 0.794   12.509  1.00 72.77  ? 70  ASN A OD1 1 
ATOM   561  N ND2 . ASN A 1 70  ? 58.029 -1.341  13.187  1.00 69.48  ? 70  ASN A ND2 1 
ATOM   562  N N   . SER A 1 71  ? 56.430 1.612   8.735   1.00 59.12  ? 71  SER A N   1 
ATOM   563  C CA  . SER A 1 71  ? 55.132 1.990   8.163   1.00 54.39  ? 71  SER A CA  1 
ATOM   564  C C   . SER A 1 71  ? 53.871 1.416   8.831   1.00 50.83  ? 71  SER A C   1 
ATOM   565  O O   . SER A 1 71  ? 53.155 0.584   8.263   1.00 46.28  ? 71  SER A O   1 
ATOM   566  C CB  . SER A 1 71  ? 55.134 1.731   6.645   1.00 58.51  ? 71  SER A CB  1 
ATOM   567  O OG  . SER A 1 71  ? 55.839 0.545   6.304   1.00 59.59  ? 71  SER A OG  1 
ATOM   568  N N   . SER A 1 72  ? 53.584 1.921   10.022  1.00 48.91  ? 72  SER A N   1 
ATOM   569  C CA  . SER A 1 72  ? 52.441 1.485   10.802  1.00 47.91  ? 72  SER A CA  1 
ATOM   570  C C   . SER A 1 72  ? 51.881 2.722   11.494  1.00 49.28  ? 72  SER A C   1 
ATOM   571  O O   . SER A 1 72  ? 52.539 3.763   11.509  1.00 51.96  ? 72  SER A O   1 
ATOM   572  C CB  . SER A 1 72  ? 52.907 0.492   11.864  1.00 47.70  ? 72  SER A CB  1 
ATOM   573  O OG  . SER A 1 72  ? 53.611 1.154   12.910  1.00 43.53  ? 72  SER A OG  1 
ATOM   574  N N   . PHE A 1 73  ? 50.663 2.619   12.026  1.00 49.42  ? 73  PHE A N   1 
ATOM   575  C CA  . PHE A 1 73  ? 50.010 3.716   12.766  1.00 44.37  ? 73  PHE A CA  1 
ATOM   576  C C   . PHE A 1 73  ? 48.991 2.983   13.581  1.00 40.70  ? 73  PHE A C   1 
ATOM   577  O O   . PHE A 1 73  ? 47.802 3.095   13.346  1.00 44.17  ? 73  PHE A O   1 
ATOM   578  C CB  . PHE A 1 73  ? 49.307 4.711   11.825  1.00 40.48  ? 73  PHE A CB  1 
ATOM   579  C CG  . PHE A 1 73  ? 48.891 6.009   12.492  1.00 39.04  ? 73  PHE A CG  1 
ATOM   580  C CD1 . PHE A 1 73  ? 49.767 6.701   13.321  1.00 35.07  ? 73  PHE A CD1 1 
ATOM   581  C CD2 . PHE A 1 73  ? 47.620 6.547   12.270  1.00 35.17  ? 73  PHE A CD2 1 
ATOM   582  C CE1 . PHE A 1 73  ? 49.384 7.901   13.914  1.00 33.04  ? 73  PHE A CE1 1 
ATOM   583  C CE2 . PHE A 1 73  ? 47.234 7.747   12.861  1.00 33.66  ? 73  PHE A CE2 1 
ATOM   584  C CZ  . PHE A 1 73  ? 48.115 8.424   13.683  1.00 33.59  ? 73  PHE A CZ  1 
ATOM   585  N N   . HIS A 1 74  ? 49.472 2.164   14.496  1.00 37.74  ? 74  HIS A N   1 
ATOM   586  C CA  . HIS A 1 74  ? 48.575 1.368   15.314  1.00 37.45  ? 74  HIS A CA  1 
ATOM   587  C C   . HIS A 1 74  ? 47.855 2.162   16.383  1.00 37.02  ? 74  HIS A C   1 
ATOM   588  O O   . HIS A 1 74  ? 48.448 3.048   17.003  1.00 36.07  ? 74  HIS A O   1 
ATOM   589  C CB  . HIS A 1 74  ? 49.323 0.182   15.923  1.00 32.27  ? 74  HIS A CB  1 
ATOM   590  C CG  . HIS A 1 74  ? 49.974 -0.688  14.897  1.00 34.50  ? 74  HIS A CG  1 
ATOM   591  N ND1 . HIS A 1 74  ? 51.008 -1.549  15.187  1.00 35.78  ? 74  HIS A ND1 1 
ATOM   592  C CD2 . HIS A 1 74  ? 49.753 -0.803  13.567  1.00 35.51  ? 74  HIS A CD2 1 
ATOM   593  C CE1 . HIS A 1 74  ? 51.394 -2.159  14.081  1.00 37.12  ? 74  HIS A CE1 1 
ATOM   594  N NE2 . HIS A 1 74  ? 50.648 -1.723  13.083  1.00 34.14  ? 74  HIS A NE2 1 
ATOM   595  N N   . LEU A 1 75  ? 46.563 1.872   16.531  1.00 34.53  ? 75  LEU A N   1 
ATOM   596  C CA  . LEU A 1 75  ? 45.711 2.512   17.521  1.00 33.31  ? 75  LEU A CA  1 
ATOM   597  C C   . LEU A 1 75  ? 45.714 1.643   18.759  1.00 34.26  ? 75  LEU A C   1 
ATOM   598  O O   . LEU A 1 75  ? 45.732 0.419   18.669  1.00 34.76  ? 75  LEU A O   1 
ATOM   599  C CB  . LEU A 1 75  ? 44.286 2.636   16.985  1.00 32.13  ? 75  LEU A CB  1 
ATOM   600  C CG  . LEU A 1 75  ? 43.216 3.239   17.882  1.00 30.14  ? 75  LEU A CG  1 
ATOM   601  C CD1 . LEU A 1 75  ? 43.484 4.711   18.096  1.00 31.77  ? 75  LEU A CD1 1 
ATOM   602  C CD2 . LEU A 1 75  ? 41.906 3.071   17.205  1.00 31.43  ? 75  LEU A CD2 1 
ATOM   603  N N   . ARG A 1 76  ? 45.670 2.270   19.918  1.00 37.43  ? 76  ARG A N   1 
ATOM   604  C CA  . ARG A 1 76  ? 45.684 1.537   21.165  1.00 39.19  ? 76  ARG A CA  1 
ATOM   605  C C   . ARG A 1 76  ? 44.865 2.241   22.240  1.00 40.55  ? 76  ARG A C   1 
ATOM   606  O O   . ARG A 1 76  ? 44.843 3.476   22.311  1.00 39.64  ? 76  ARG A O   1 
ATOM   607  C CB  . ARG A 1 76  ? 47.121 1.388   21.631  1.00 46.66  ? 76  ARG A CB  1 
ATOM   608  C CG  . ARG A 1 76  ? 47.979 0.540   20.713  1.00 56.86  ? 76  ARG A CG  1 
ATOM   609  C CD  . ARG A 1 76  ? 49.439 0.895   20.867  1.00 65.17  ? 76  ARG A CD  1 
ATOM   610  N NE  . ARG A 1 76  ? 50.326 -0.042  20.175  1.00 73.55  ? 76  ARG A NE  1 
ATOM   611  C CZ  . ARG A 1 76  ? 50.693 -1.235  20.651  1.00 76.62  ? 76  ARG A CZ  1 
ATOM   612  N NH1 . ARG A 1 76  ? 50.247 -1.671  21.828  1.00 75.04  ? 76  ARG A NH1 1 
ATOM   613  N NH2 . ARG A 1 76  ? 51.558 -1.980  19.967  1.00 79.25  ? 76  ARG A NH2 1 
ATOM   614  N N   . LYS A 1 77  ? 44.186 1.449   23.064  1.00 39.39  ? 77  LYS A N   1 
ATOM   615  C CA  . LYS A 1 77  ? 43.358 1.958   24.152  1.00 38.04  ? 77  LYS A CA  1 
ATOM   616  C C   . LYS A 1 77  ? 43.671 1.068   25.344  1.00 39.51  ? 77  LYS A C   1 
ATOM   617  O O   . LYS A 1 77  ? 43.502 -0.147  25.276  1.00 35.14  ? 77  LYS A O   1 
ATOM   618  C CB  . LYS A 1 77  ? 41.881 1.848   23.785  1.00 41.94  ? 77  LYS A CB  1 
ATOM   619  C CG  . LYS A 1 77  ? 40.872 2.275   24.881  1.00 46.52  ? 77  LYS A CG  1 
ATOM   620  C CD  . LYS A 1 77  ? 40.788 3.791   25.087  1.00 47.94  ? 77  LYS A CD  1 
ATOM   621  C CE  . LYS A 1 77  ? 39.343 4.251   25.317  1.00 43.76  ? 77  LYS A CE  1 
ATOM   622  N NZ  . LYS A 1 77  ? 38.628 3.421   26.331  1.00 45.55  ? 77  LYS A NZ  1 
ATOM   623  N N   . ALA A 1 78  ? 44.180 1.679   26.412  1.00 42.24  ? 78  ALA A N   1 
ATOM   624  C CA  . ALA A 1 78  ? 44.552 0.975   27.634  1.00 43.20  ? 78  ALA A CA  1 
ATOM   625  C C   . ALA A 1 78  ? 43.460 0.011   28.137  1.00 47.28  ? 78  ALA A C   1 
ATOM   626  O O   . ALA A 1 78  ? 43.725 -1.180  28.348  1.00 47.70  ? 78  ALA A O   1 
ATOM   627  C CB  . ALA A 1 78  ? 44.912 1.983   28.706  1.00 38.52  ? 78  ALA A CB  1 
ATOM   628  N N   . SER A 1 79  ? 42.242 0.521   28.323  1.00 49.11  ? 79  SER A N   1 
ATOM   629  C CA  . SER A 1 79  ? 41.117 -0.290  28.796  1.00 49.06  ? 79  SER A CA  1 
ATOM   630  C C   . SER A 1 79  ? 39.880 0.115   28.008  1.00 51.00  ? 79  SER A C   1 
ATOM   631  O O   . SER A 1 79  ? 39.554 1.308   27.947  1.00 53.40  ? 79  SER A O   1 
ATOM   632  C CB  . SER A 1 79  ? 40.876 -0.038  30.281  1.00 49.29  ? 79  SER A CB  1 
ATOM   633  O OG  . SER A 1 79  ? 39.751 -0.755  30.751  1.00 52.28  ? 79  SER A OG  1 
ATOM   634  N N   . VAL A 1 80  ? 39.213 -0.855  27.377  1.00 50.15  ? 80  VAL A N   1 
ATOM   635  C CA  . VAL A 1 80  ? 38.016 -0.565  26.585  1.00 49.24  ? 80  VAL A CA  1 
ATOM   636  C C   . VAL A 1 80  ? 36.721 -0.663  27.351  1.00 51.19  ? 80  VAL A C   1 
ATOM   637  O O   . VAL A 1 80  ? 36.597 -1.397  28.328  1.00 52.40  ? 80  VAL A O   1 
ATOM   638  C CB  . VAL A 1 80  ? 37.864 -1.476  25.366  1.00 48.79  ? 80  VAL A CB  1 
ATOM   639  C CG1 . VAL A 1 80  ? 39.010 -1.260  24.405  1.00 47.89  ? 80  VAL A CG1 1 
ATOM   640  C CG2 . VAL A 1 80  ? 37.717 -2.939  25.798  1.00 42.08  ? 80  VAL A CG2 1 
ATOM   641  N N   . HIS A 1 81  ? 35.726 0.045   26.848  1.00 53.61  ? 81  HIS A N   1 
ATOM   642  C CA  . HIS A 1 81  ? 34.423 0.070   27.459  1.00 57.08  ? 81  HIS A CA  1 
ATOM   643  C C   . HIS A 1 81  ? 33.368 -0.156  26.402  1.00 56.07  ? 81  HIS A C   1 
ATOM   644  O O   . HIS A 1 81  ? 33.589 0.125   25.232  1.00 57.74  ? 81  HIS A O   1 
ATOM   645  C CB  . HIS A 1 81  ? 34.229 1.408   28.158  1.00 63.72  ? 81  HIS A CB  1 
ATOM   646  C CG  . HIS A 1 81  ? 35.124 1.580   29.342  1.00 72.74  ? 81  HIS A CG  1 
ATOM   647  N ND1 . HIS A 1 81  ? 36.108 2.544   29.399  1.00 75.18  ? 81  HIS A ND1 1 
ATOM   648  C CD2 . HIS A 1 81  ? 35.235 0.858   30.486  1.00 74.05  ? 81  HIS A CD2 1 
ATOM   649  C CE1 . HIS A 1 81  ? 36.790 2.406   30.525  1.00 79.16  ? 81  HIS A CE1 1 
ATOM   650  N NE2 . HIS A 1 81  ? 36.280 1.390   31.201  1.00 77.74  ? 81  HIS A NE2 1 
ATOM   651  N N   . TRP A 1 82  ? 32.221 -0.666  26.822  1.00 54.56  ? 82  TRP A N   1 
ATOM   652  C CA  . TRP A 1 82  ? 31.117 -0.948  25.928  1.00 47.95  ? 82  TRP A CA  1 
ATOM   653  C C   . TRP A 1 82  ? 30.887 0.128   24.869  1.00 42.63  ? 82  TRP A C   1 
ATOM   654  O O   . TRP A 1 82  ? 30.827 -0.192  23.691  1.00 42.72  ? 82  TRP A O   1 
ATOM   655  C CB  . TRP A 1 82  ? 29.849 -1.213  26.738  1.00 52.57  ? 82  TRP A CB  1 
ATOM   656  C CG  . TRP A 1 82  ? 28.724 -1.738  25.907  1.00 56.02  ? 82  TRP A CG  1 
ATOM   657  C CD1 . TRP A 1 82  ? 28.772 -2.782  25.023  1.00 55.11  ? 82  TRP A CD1 1 
ATOM   658  C CD2 . TRP A 1 82  ? 27.404 -1.189  25.813  1.00 55.92  ? 82  TRP A CD2 1 
ATOM   659  N NE1 . TRP A 1 82  ? 27.569 -2.901  24.376  1.00 56.21  ? 82  TRP A NE1 1 
ATOM   660  C CE2 . TRP A 1 82  ? 26.709 -1.938  24.840  1.00 56.60  ? 82  TRP A CE2 1 
ATOM   661  C CE3 . TRP A 1 82  ? 26.741 -0.130  26.455  1.00 56.66  ? 82  TRP A CE3 1 
ATOM   662  C CZ2 . TRP A 1 82  ? 25.372 -1.661  24.487  1.00 57.98  ? 82  TRP A CZ2 1 
ATOM   663  C CZ3 . TRP A 1 82  ? 25.408 0.144   26.104  1.00 56.38  ? 82  TRP A CZ3 1 
ATOM   664  C CH2 . TRP A 1 82  ? 24.743 -0.621  25.128  1.00 54.25  ? 82  TRP A CH2 1 
ATOM   665  N N   . SER A 1 83  ? 30.853 1.396   25.262  1.00 37.32  ? 83  SER A N   1 
ATOM   666  C CA  . SER A 1 83  ? 30.630 2.482   24.306  1.00 35.92  ? 83  SER A CA  1 
ATOM   667  C C   . SER A 1 83  ? 31.663 2.599   23.176  1.00 34.92  ? 83  SER A C   1 
ATOM   668  O O   . SER A 1 83  ? 31.461 3.328   22.203  1.00 34.87  ? 83  SER A O   1 
ATOM   669  C CB  . SER A 1 83  ? 30.532 3.818   25.043  1.00 40.85  ? 83  SER A CB  1 
ATOM   670  O OG  . SER A 1 83  ? 31.761 4.165   25.658  1.00 43.79  ? 83  SER A OG  1 
ATOM   671  N N   . ASP A 1 84  ? 32.780 1.897   23.326  1.00 36.61  ? 84  ASP A N   1 
ATOM   672  C CA  . ASP A 1 84  ? 33.857 1.893   22.332  1.00 33.81  ? 84  ASP A CA  1 
ATOM   673  C C   . ASP A 1 84  ? 33.550 1.049   21.099  1.00 33.51  ? 84  ASP A C   1 
ATOM   674  O O   . ASP A 1 84  ? 34.271 1.128   20.111  1.00 31.06  ? 84  ASP A O   1 
ATOM   675  C CB  . ASP A 1 84  ? 35.168 1.411   22.957  1.00 31.29  ? 84  ASP A CB  1 
ATOM   676  C CG  . ASP A 1 84  ? 35.829 2.479   23.784  1.00 33.39  ? 84  ASP A CG  1 
ATOM   677  O OD1 . ASP A 1 84  ? 36.030 3.591   23.256  1.00 32.19  ? 84  ASP A OD1 1 
ATOM   678  O OD2 . ASP A 1 84  ? 36.147 2.219   24.956  1.00 36.83  ? 84  ASP A OD2 1 
ATOM   679  N N   . SER A 1 85  ? 32.524 0.198   21.179  1.00 30.49  ? 85  SER A N   1 
ATOM   680  C CA  . SER A 1 85  ? 32.146 -0.648  20.060  1.00 27.49  ? 85  SER A CA  1 
ATOM   681  C C   . SER A 1 85  ? 31.772 0.238   18.867  1.00 30.01  ? 85  SER A C   1 
ATOM   682  O O   . SER A 1 85  ? 30.820 1.038   18.932  1.00 31.47  ? 85  SER A O   1 
ATOM   683  C CB  . SER A 1 85  ? 30.951 -1.532  20.430  1.00 22.29  ? 85  SER A CB  1 
ATOM   684  O OG  . SER A 1 85  ? 31.095 -2.127  21.697  1.00 25.48  ? 85  SER A OG  1 
ATOM   685  N N   . ALA A 1 86  ? 32.524 0.095   17.782  1.00 27.14  ? 86  ALA A N   1 
ATOM   686  C CA  . ALA A 1 86  ? 32.279 0.861   16.572  1.00 25.45  ? 86  ALA A CA  1 
ATOM   687  C C   . ALA A 1 86  ? 33.155 0.282   15.479  1.00 24.07  ? 86  ALA A C   1 
ATOM   688  O O   . ALA A 1 86  ? 33.684 -0.816  15.643  1.00 25.44  ? 86  ALA A O   1 
ATOM   689  C CB  . ALA A 1 86  ? 32.607 2.337   16.800  1.00 23.82  ? 86  ALA A CB  1 
ATOM   690  N N   . VAL A 1 87  ? 33.208 0.961   14.334  1.00 26.21  ? 87  VAL A N   1 
ATOM   691  C CA  . VAL A 1 87  ? 34.063 0.556   13.213  1.00 21.40  ? 87  VAL A CA  1 
ATOM   692  C C   . VAL A 1 87  ? 35.157 1.616   13.170  1.00 22.17  ? 87  VAL A C   1 
ATOM   693  O O   . VAL A 1 87  ? 34.880 2.819   13.151  1.00 25.18  ? 87  VAL A O   1 
ATOM   694  C CB  . VAL A 1 87  ? 33.282 0.484   11.847  1.00 19.63  ? 87  VAL A CB  1 
ATOM   695  C CG1 . VAL A 1 87  ? 34.202 0.081   10.716  1.00 13.13  ? 87  VAL A CG1 1 
ATOM   696  C CG2 . VAL A 1 87  ? 32.182 -0.583  11.929  1.00 18.78  ? 87  VAL A CG2 1 
ATOM   697  N N   . TYR A 1 88  ? 36.397 1.169   13.265  1.00 24.02  ? 88  TYR A N   1 
ATOM   698  C CA  . TYR A 1 88  ? 37.536 2.066   13.238  1.00 20.45  ? 88  TYR A CA  1 
ATOM   699  C C   . TYR A 1 88  ? 38.224 1.993   11.909  1.00 21.28  ? 88  TYR A C   1 
ATOM   700  O O   . TYR A 1 88  ? 38.532 0.906   11.445  1.00 24.46  ? 88  TYR A O   1 
ATOM   701  C CB  . TYR A 1 88  ? 38.486 1.710   14.361  1.00 21.76  ? 88  TYR A CB  1 
ATOM   702  C CG  . TYR A 1 88  ? 37.871 2.000   15.712  1.00 21.21  ? 88  TYR A CG  1 
ATOM   703  C CD1 . TYR A 1 88  ? 37.062 1.070   16.356  1.00 22.19  ? 88  TYR A CD1 1 
ATOM   704  C CD2 . TYR A 1 88  ? 38.061 3.224   16.322  1.00 21.58  ? 88  TYR A CD2 1 
ATOM   705  C CE1 . TYR A 1 88  ? 36.460 1.361   17.577  1.00 18.35  ? 88  TYR A CE1 1 
ATOM   706  C CE2 . TYR A 1 88  ? 37.462 3.525   17.533  1.00 22.34  ? 88  TYR A CE2 1 
ATOM   707  C CZ  . TYR A 1 88  ? 36.669 2.595   18.151  1.00 22.13  ? 88  TYR A CZ  1 
ATOM   708  O OH  . TYR A 1 88  ? 36.094 2.938   19.336  1.00 27.48  ? 88  TYR A OH  1 
ATOM   709  N N   . PHE A 1 89  ? 38.363 3.148   11.263  1.00 23.14  ? 89  PHE A N   1 
ATOM   710  C CA  . PHE A 1 89  ? 38.999 3.267   9.954   1.00 21.79  ? 89  PHE A CA  1 
ATOM   711  C C   . PHE A 1 89  ? 40.305 4.021   10.044  1.00 23.74  ? 89  PHE A C   1 
ATOM   712  O O   . PHE A 1 89  ? 40.421 4.992   10.775  1.00 23.93  ? 89  PHE A O   1 
ATOM   713  C CB  . PHE A 1 89  ? 38.113 4.019   8.962   1.00 23.14  ? 89  PHE A CB  1 
ATOM   714  C CG  . PHE A 1 89  ? 36.889 3.264   8.531   1.00 21.21  ? 89  PHE A CG  1 
ATOM   715  C CD1 . PHE A 1 89  ? 36.958 2.342   7.499   1.00 20.10  ? 89  PHE A CD1 1 
ATOM   716  C CD2 . PHE A 1 89  ? 35.669 3.470   9.166   1.00 20.88  ? 89  PHE A CD2 1 
ATOM   717  C CE1 . PHE A 1 89  ? 35.829 1.624   7.095   1.00 24.77  ? 89  PHE A CE1 1 
ATOM   718  C CE2 . PHE A 1 89  ? 34.535 2.759   8.772   1.00 23.53  ? 89  PHE A CE2 1 
ATOM   719  C CZ  . PHE A 1 89  ? 34.619 1.829   7.730   1.00 22.45  ? 89  PHE A CZ  1 
ATOM   720  N N   . CYS A 1 90  ? 41.302 3.534   9.329   1.00 25.22  ? 90  CYS A N   1 
ATOM   721  C CA  . CYS A 1 90  ? 42.590 4.183   9.285   1.00 25.80  ? 90  CYS A CA  1 
ATOM   722  C C   . CYS A 1 90  ? 42.621 4.857   7.918   1.00 27.58  ? 90  CYS A C   1 
ATOM   723  O O   . CYS A 1 90  ? 42.014 4.339   6.956   1.00 29.34  ? 90  CYS A O   1 
ATOM   724  C CB  . CYS A 1 90  ? 43.701 3.153   9.369   1.00 28.85  ? 90  CYS A CB  1 
ATOM   725  S SG  . CYS A 1 90  ? 45.333 3.895   9.568   1.00 34.89  ? 90  CYS A SG  1 
ATOM   726  N N   . ALA A 1 91  ? 43.318 5.990   7.816   1.00 27.70  ? 91  ALA A N   1 
ATOM   727  C CA  . ALA A 1 91  ? 43.399 6.726   6.557   1.00 26.68  ? 91  ALA A CA  1 
ATOM   728  C C   . ALA A 1 91  ? 44.766 7.413   6.373   1.00 28.96  ? 91  ALA A C   1 
ATOM   729  O O   . ALA A 1 91  ? 45.445 7.767   7.343   1.00 27.58  ? 91  ALA A O   1 
ATOM   730  C CB  . ALA A 1 91  ? 42.260 7.748   6.498   1.00 19.25  ? 91  ALA A CB  1 
ATOM   731  N N   . VAL A 1 92  ? 45.131 7.577   5.100   1.00 30.63  ? 92  VAL A N   1 
ATOM   732  C CA  . VAL A 1 92  ? 46.407 8.212   4.699   1.00 33.81  ? 92  VAL A CA  1 
ATOM   733  C C   . VAL A 1 92  ? 46.164 9.252   3.589   1.00 38.56  ? 92  VAL A C   1 
ATOM   734  O O   . VAL A 1 92  ? 45.386 9.021   2.655   1.00 39.99  ? 92  VAL A O   1 
ATOM   735  C CB  . VAL A 1 92  ? 47.392 7.146   4.180   1.00 37.03  ? 92  VAL A CB  1 
ATOM   736  C CG1 . VAL A 1 92  ? 46.979 6.538   2.834   1.00 38.80  ? 92  VAL A CG1 1 
ATOM   737  C CG2 . VAL A 1 92  ? 48.810 7.689   3.967   1.00 36.78  ? 92  VAL A CG2 1 
ATOM   738  N N   . SER A 1 93  ? 46.837 10.391  3.731   1.00 44.00  ? 93  SER A N   1 
ATOM   739  C CA  . SER A 1 93  ? 46.770 11.493  2.744   1.00 47.85  ? 93  SER A CA  1 
ATOM   740  C C   . SER A 1 93  ? 48.174 12.102  2.557   1.00 52.32  ? 93  SER A C   1 
ATOM   741  O O   . SER A 1 93  ? 49.187 11.419  2.759   1.00 52.62  ? 93  SER A O   1 
ATOM   742  C CB  . SER A 1 93  ? 45.780 12.577  3.185   1.00 44.59  ? 93  SER A CB  1 
ATOM   743  O OG  . SER A 1 93  ? 45.833 12.760  4.586   1.00 50.73  ? 93  SER A OG  1 
ATOM   744  N N   . GLY A 1 94  ? 48.240 13.376  2.170   1.00 55.24  ? 99  GLY A N   1 
ATOM   745  C CA  . GLY A 1 94  ? 49.521 14.042  1.971   1.00 52.90  ? 99  GLY A CA  1 
ATOM   746  C C   . GLY A 1 94  ? 49.232 15.339  1.294   1.00 51.77  ? 99  GLY A C   1 
ATOM   747  O O   . GLY A 1 94  ? 48.091 15.632  0.931   1.00 51.81  ? 99  GLY A O   1 
ATOM   748  N N   . PHE A 1 95  ? 50.237 16.121  1.124   1.00 50.22  ? 100 PHE A N   1 
ATOM   749  C CA  . PHE A 1 95  ? 50.018 17.373  0.455   1.00 45.31  ? 100 PHE A CA  1 
ATOM   750  C C   . PHE A 1 95  ? 49.345 17.098  -0.886  1.00 43.14  ? 100 PHE A C   1 
ATOM   751  O O   . PHE A 1 95  ? 49.848 16.327  -1.709  1.00 40.97  ? 100 PHE A O   1 
ATOM   752  C CB  . PHE A 1 95  ? 51.328 18.090  0.212   1.00 42.83  ? 100 PHE A CB  1 
ATOM   753  C CG  . PHE A 1 95  ? 51.110 19.432  -0.475  1.00 42.46  ? 100 PHE A CG  1 
ATOM   754  C CD1 . PHE A 1 95  ? 50.866 20.573  0.294   1.00 40.05  ? 100 PHE A CD1 1 
ATOM   755  C CD2 . PHE A 1 95  ? 51.147 19.516  -1.871  1.00 39.16  ? 100 PHE A CD2 1 
ATOM   756  C CE1 . PHE A 1 95  ? 50.667 21.807  -0.333  1.00 38.21  ? 100 PHE A CE1 1 
ATOM   757  C CE2 . PHE A 1 95  ? 50.951 20.751  -2.499  1.00 36.44  ? 100 PHE A CE2 1 
ATOM   758  C CZ  . PHE A 1 95  ? 50.712 21.897  -1.730  1.00 39.73  ? 100 PHE A CZ  1 
ATOM   759  N N   . ALA A 1 96  ? 48.212 17.727  -1.070  1.00 41.70  ? 101 ALA A N   1 
ATOM   760  C CA  . ALA A 1 96  ? 47.446 17.631  -2.322  1.00 48.78  ? 101 ALA A CA  1 
ATOM   761  C C   . ALA A 1 96  ? 47.086 16.169  -2.699  1.00 52.39  ? 101 ALA A C   1 
ATOM   762  O O   . ALA A 1 96  ? 47.068 15.799  -3.882  1.00 52.01  ? 101 ALA A O   1 
ATOM   763  C CB  . ALA A 1 96  ? 48.257 18.229  -3.477  1.00 49.08  ? 101 ALA A CB  1 
ATOM   764  N N   . SER A 1 97  ? 46.796 15.356  -1.689  1.00 51.95  ? 102 SER A N   1 
ATOM   765  C CA  . SER A 1 97  ? 46.344 13.947  -1.879  1.00 47.08  ? 102 SER A CA  1 
ATOM   766  C C   . SER A 1 97  ? 45.125 13.729  -0.979  1.00 45.19  ? 102 SER A C   1 
ATOM   767  O O   . SER A 1 97  ? 45.175 13.958  0.234   1.00 49.14  ? 102 SER A O   1 
ATOM   768  C CB  . SER A 1 97  ? 47.469 12.969  -1.543  1.00 47.82  ? 102 SER A CB  1 
ATOM   769  O OG  . SER A 1 97  ? 47.934 12.347  -2.737  1.00 52.12  ? 102 SER A OG  1 
ATOM   770  N N   . ALA A 1 98  ? 44.014 13.349  -1.591  1.00 40.78  ? 103 ALA A N   1 
ATOM   771  C CA  . ALA A 1 98  ? 42.773 13.139  -0.871  1.00 38.83  ? 103 ALA A CA  1 
ATOM   772  C C   . ALA A 1 98  ? 42.871 11.913  0.026   1.00 37.34  ? 103 ALA A C   1 
ATOM   773  O O   . ALA A 1 98  ? 43.552 10.958  -0.323  1.00 40.86  ? 103 ALA A O   1 
ATOM   774  C CB  . ALA A 1 98  ? 41.638 12.990  -1.874  1.00 39.60  ? 103 ALA A CB  1 
ATOM   775  N N   . LEU A 1 99  ? 42.186 11.939  1.166   1.00 33.91  ? 104 LEU A N   1 
ATOM   776  C CA  . LEU A 1 99  ? 42.197 10.831  2.124   1.00 32.37  ? 104 LEU A CA  1 
ATOM   777  C C   . LEU A 1 99  ? 41.897 9.457   1.541   1.00 33.71  ? 104 LEU A C   1 
ATOM   778  O O   . LEU A 1 99  ? 40.896 9.281   0.852   1.00 34.88  ? 104 LEU A O   1 
ATOM   779  C CB  . LEU A 1 99  ? 41.183 11.072  3.243   1.00 29.33  ? 104 LEU A CB  1 
ATOM   780  C CG  . LEU A 1 99  ? 41.673 11.517  4.613   1.00 34.51  ? 104 LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 99  ? 40.549 11.401  5.631   1.00 31.00  ? 104 LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 99  ? 42.817 10.636  5.039   1.00 40.41  ? 104 LEU A CD2 1 
ATOM   783  N N   . THR A 1 100 ? 42.751 8.487   1.850   1.00 32.74  ? 105 THR A N   1 
ATOM   784  C CA  . THR A 1 100 ? 42.574 7.101   1.421   1.00 32.86  ? 105 THR A CA  1 
ATOM   785  C C   . THR A 1 100 ? 42.228 6.317   2.704   1.00 33.25  ? 105 THR A C   1 
ATOM   786  O O   . THR A 1 100 ? 42.865 6.520   3.741   1.00 33.63  ? 105 THR A O   1 
ATOM   787  C CB  . THR A 1 100 ? 43.883 6.560   0.781   1.00 33.38  ? 105 THR A CB  1 
ATOM   788  O OG1 . THR A 1 100 ? 44.117 7.228   -0.463  1.00 38.79  ? 105 THR A OG1 1 
ATOM   789  C CG2 . THR A 1 100 ? 43.808 5.058   0.521   1.00 31.63  ? 105 THR A CG2 1 
ATOM   790  N N   . PHE A 1 101 ? 41.199 5.477   2.662   1.00 30.16  ? 106 PHE A N   1 
ATOM   791  C CA  . PHE A 1 101 ? 40.799 4.717   3.841   1.00 30.48  ? 106 PHE A CA  1 
ATOM   792  C C   . PHE A 1 101 ? 41.143 3.238   3.816   1.00 34.77  ? 106 PHE A C   1 
ATOM   793  O O   . PHE A 1 101 ? 41.278 2.641   2.746   1.00 34.83  ? 106 PHE A O   1 
ATOM   794  C CB  . PHE A 1 101 ? 39.293 4.824   4.040   1.00 25.36  ? 106 PHE A CB  1 
ATOM   795  C CG  . PHE A 1 101 ? 38.846 6.157   4.485   1.00 23.39  ? 106 PHE A CG  1 
ATOM   796  C CD1 . PHE A 1 101 ? 38.770 6.458   5.842   1.00 21.64  ? 106 PHE A CD1 1 
ATOM   797  C CD2 . PHE A 1 101 ? 38.489 7.130   3.553   1.00 23.43  ? 106 PHE A CD2 1 
ATOM   798  C CE1 . PHE A 1 101 ? 38.349 7.719   6.277   1.00 20.03  ? 106 PHE A CE1 1 
ATOM   799  C CE2 . PHE A 1 101 ? 38.063 8.397   3.978   1.00 21.74  ? 106 PHE A CE2 1 
ATOM   800  C CZ  . PHE A 1 101 ? 37.991 8.688   5.349   1.00 14.29  ? 106 PHE A CZ  1 
ATOM   801  N N   . GLY A 1 102 ? 41.262 2.648   5.008   1.00 37.40  ? 107 GLY A N   1 
ATOM   802  C CA  . GLY A 1 102 ? 41.506 1.218   5.118   1.00 36.81  ? 107 GLY A CA  1 
ATOM   803  C C   . GLY A 1 102 ? 40.153 0.525   4.937   1.00 34.84  ? 107 GLY A C   1 
ATOM   804  O O   . GLY A 1 102 ? 39.154 1.190   4.646   1.00 37.46  ? 107 GLY A O   1 
ATOM   805  N N   . SER A 1 103 ? 40.077 -0.790  5.113   1.00 29.66  ? 108 SER A N   1 
ATOM   806  C CA  . SER A 1 103 ? 38.798 -1.460  4.943   1.00 27.80  ? 108 SER A CA  1 
ATOM   807  C C   . SER A 1 103 ? 37.955 -1.408  6.224   1.00 26.16  ? 108 SER A C   1 
ATOM   808  O O   . SER A 1 103 ? 36.756 -1.705  6.208   1.00 28.24  ? 108 SER A O   1 
ATOM   809  C CB  . SER A 1 103 ? 38.996 -2.880  4.410   1.00 24.48  ? 108 SER A CB  1 
ATOM   810  O OG  . SER A 1 103 ? 39.911 -3.591  5.217   1.00 37.90  ? 108 SER A OG  1 
ATOM   811  N N   . GLY A 1 104 ? 38.573 -0.945  7.303   1.00 25.12  ? 109 GLY A N   1 
ATOM   812  C CA  . GLY A 1 104 ? 37.887 -0.825  8.578   1.00 25.68  ? 109 GLY A CA  1 
ATOM   813  C C   . GLY A 1 104 ? 37.946 -2.018  9.514   1.00 25.06  ? 109 GLY A C   1 
ATOM   814  O O   . GLY A 1 104 ? 38.120 -3.151  9.086   1.00 28.34  ? 109 GLY A O   1 
ATOM   815  N N   . THR A 1 105 ? 37.787 -1.762  10.803  1.00 22.12  ? 110 THR A N   1 
ATOM   816  C CA  . THR A 1 105 ? 37.811 -2.824  11.784  1.00 20.18  ? 110 THR A CA  1 
ATOM   817  C C   . THR A 1 105 ? 36.673 -2.607  12.744  1.00 22.46  ? 110 THR A C   1 
ATOM   818  O O   . THR A 1 105 ? 36.611 -1.588  13.410  1.00 26.46  ? 110 THR A O   1 
ATOM   819  C CB  . THR A 1 105 ? 39.132 -2.853  12.546  1.00 15.62  ? 110 THR A CB  1 
ATOM   820  O OG1 . THR A 1 105 ? 40.193 -3.064  11.619  1.00 18.30  ? 110 THR A OG1 1 
ATOM   821  C CG2 . THR A 1 105 ? 39.155 -3.993  13.573  1.00 12.77  ? 110 THR A CG2 1 
ATOM   822  N N   . LYS A 1 106 ? 35.753 -3.558  12.779  1.00 21.97  ? 111 LYS A N   1 
ATOM   823  C CA  . LYS A 1 106 ? 34.600 -3.487  13.649  1.00 23.07  ? 111 LYS A CA  1 
ATOM   824  C C   . LYS A 1 106 ? 35.047 -3.977  15.001  1.00 27.23  ? 111 LYS A C   1 
ATOM   825  O O   . LYS A 1 106 ? 35.527 -5.107  15.132  1.00 28.50  ? 111 LYS A O   1 
ATOM   826  C CB  . LYS A 1 106 ? 33.512 -4.416  13.114  1.00 28.72  ? 111 LYS A CB  1 
ATOM   827  C CG  . LYS A 1 106 ? 32.165 -4.324  13.804  1.00 27.94  ? 111 LYS A CG  1 
ATOM   828  C CD  . LYS A 1 106 ? 31.515 -5.690  13.832  1.00 33.03  ? 111 LYS A CD  1 
ATOM   829  C CE  . LYS A 1 106 ? 30.023 -5.578  13.715  1.00 37.18  ? 111 LYS A CE  1 
ATOM   830  N NZ  . LYS A 1 106 ? 29.731 -4.809  12.463  1.00 40.87  ? 111 LYS A NZ  1 
ATOM   831  N N   . VAL A 1 107 ? 34.964 -3.117  16.002  1.00 31.46  ? 112 VAL A N   1 
ATOM   832  C CA  . VAL A 1 107 ? 35.351 -3.503  17.356  1.00 33.43  ? 112 VAL A CA  1 
ATOM   833  C C   . VAL A 1 107 ? 34.076 -3.821  18.144  1.00 36.84  ? 112 VAL A C   1 
ATOM   834  O O   . VAL A 1 107 ? 33.153 -3.002  18.226  1.00 38.46  ? 112 VAL A O   1 
ATOM   835  C CB  . VAL A 1 107 ? 36.183 -2.394  18.066  1.00 30.19  ? 112 VAL A CB  1 
ATOM   836  C CG1 . VAL A 1 107 ? 36.388 -2.734  19.532  1.00 21.85  ? 112 VAL A CG1 1 
ATOM   837  C CG2 . VAL A 1 107 ? 37.528 -2.235  17.382  1.00 25.85  ? 112 VAL A CG2 1 
ATOM   838  N N   . ILE A 1 108 ? 34.012 -5.056  18.638  1.00 38.94  ? 113 ILE A N   1 
ATOM   839  C CA  . ILE A 1 108 ? 32.894 -5.561  19.424  1.00 36.56  ? 113 ILE A CA  1 
ATOM   840  C C   . ILE A 1 108 ? 33.354 -5.797  20.879  1.00 36.03  ? 113 ILE A C   1 
ATOM   841  O O   . ILE A 1 108 ? 34.055 -6.773  21.158  1.00 38.19  ? 113 ILE A O   1 
ATOM   842  C CB  . ILE A 1 108 ? 32.387 -6.882  18.802  1.00 38.43  ? 113 ILE A CB  1 
ATOM   843  C CG1 . ILE A 1 108 ? 31.984 -6.634  17.346  1.00 39.25  ? 113 ILE A CG1 1 
ATOM   844  C CG2 . ILE A 1 108 ? 31.214 -7.462  19.601  1.00 33.15  ? 113 ILE A CG2 1 
ATOM   845  C CD1 . ILE A 1 108 ? 31.465 -7.856  16.631  1.00 45.11  ? 113 ILE A CD1 1 
ATOM   846  N N   . VAL A 1 109 ? 33.038 -4.868  21.782  1.00 33.52  ? 114 VAL A N   1 
ATOM   847  C CA  . VAL A 1 109 ? 33.416 -5.028  23.186  1.00 33.44  ? 114 VAL A CA  1 
ATOM   848  C C   . VAL A 1 109 ? 32.251 -5.609  24.002  1.00 35.31  ? 114 VAL A C   1 
ATOM   849  O O   . VAL A 1 109 ? 31.166 -4.990  24.080  1.00 34.72  ? 114 VAL A O   1 
ATOM   850  C CB  . VAL A 1 109 ? 34.021 -3.709  23.828  1.00 29.60  ? 114 VAL A CB  1 
ATOM   851  C CG1 . VAL A 1 109 ? 33.922 -2.556  22.895  1.00 29.41  ? 114 VAL A CG1 1 
ATOM   852  C CG2 . VAL A 1 109 ? 33.397 -3.376  25.178  1.00 27.23  ? 114 VAL A CG2 1 
ATOM   853  N N   . LEU A 1 110 ? 32.485 -6.827  24.529  1.00 33.62  ? 115 LEU A N   1 
ATOM   854  C CA  . LEU A 1 110 ? 31.536 -7.614  25.342  1.00 36.36  ? 115 LEU A CA  1 
ATOM   855  C C   . LEU A 1 110 ? 31.458 -7.109  26.790  1.00 41.15  ? 115 LEU A C   1 
ATOM   856  O O   . LEU A 1 110 ? 32.474 -7.116  27.488  1.00 45.10  ? 115 LEU A O   1 
ATOM   857  C CB  . LEU A 1 110 ? 31.982 -9.078  25.372  1.00 34.81  ? 115 LEU A CB  1 
ATOM   858  C CG  . LEU A 1 110 ? 32.489 -9.717  24.071  1.00 34.40  ? 115 LEU A CG  1 
ATOM   859  C CD1 . LEU A 1 110 ? 32.972 -11.117 24.337  1.00 29.29  ? 115 LEU A CD1 1 
ATOM   860  C CD2 . LEU A 1 110 ? 31.398 -9.748  23.047  1.00 31.00  ? 115 LEU A CD2 1 
ATOM   861  N N   . PRO A 1 111 ? 30.257 -6.692  27.270  1.00 42.74  ? 116 PRO A N   1 
ATOM   862  C CA  . PRO A 1 111 ? 30.120 -6.195  28.645  1.00 42.94  ? 116 PRO A CA  1 
ATOM   863  C C   . PRO A 1 111 ? 30.061 -7.332  29.671  1.00 45.38  ? 116 PRO A C   1 
ATOM   864  O O   . PRO A 1 111 ? 29.764 -8.476  29.313  1.00 43.27  ? 116 PRO A O   1 
ATOM   865  C CB  . PRO A 1 111 ? 28.821 -5.389  28.581  1.00 42.39  ? 116 PRO A CB  1 
ATOM   866  C CG  . PRO A 1 111 ? 27.998 -6.187  27.660  1.00 40.33  ? 116 PRO A CG  1 
ATOM   867  C CD  . PRO A 1 111 ? 28.972 -6.572  26.552  1.00 44.63  ? 116 PRO A CD  1 
ATOM   868  N N   . TYR A 1 112 ? 30.378 -7.022  30.932  1.00 46.54  ? 117 TYR A N   1 
ATOM   869  C CA  . TYR A 1 112 ? 30.372 -8.025  32.000  1.00 47.54  ? 117 TYR A CA  1 
ATOM   870  C C   . TYR A 1 112 ? 29.006 -8.153  32.647  1.00 48.63  ? 117 TYR A C   1 
ATOM   871  O O   . TYR A 1 112 ? 28.542 -7.239  33.325  1.00 50.38  ? 117 TYR A O   1 
ATOM   872  C CB  . TYR A 1 112 ? 31.424 -7.702  33.078  1.00 51.14  ? 117 TYR A CB  1 
ATOM   873  C CG  . TYR A 1 112 ? 31.423 -8.637  34.279  1.00 50.67  ? 117 TYR A CG  1 
ATOM   874  C CD1 . TYR A 1 112 ? 31.833 -9.967  34.164  1.00 51.23  ? 117 TYR A CD1 1 
ATOM   875  C CD2 . TYR A 1 112 ? 30.973 -8.194  35.519  1.00 52.36  ? 117 TYR A CD2 1 
ATOM   876  C CE1 . TYR A 1 112 ? 31.784 -10.834 35.255  1.00 54.35  ? 117 TYR A CE1 1 
ATOM   877  C CE2 . TYR A 1 112 ? 30.921 -9.044  36.614  1.00 58.27  ? 117 TYR A CE2 1 
ATOM   878  C CZ  . TYR A 1 112 ? 31.324 -10.366 36.483  1.00 60.30  ? 117 TYR A CZ  1 
ATOM   879  O OH  . TYR A 1 112 ? 31.245 -11.203 37.588  1.00 63.42  ? 117 TYR A OH  1 
ATOM   880  N N   . ILE A 1 113 ? 28.370 -9.299  32.429  1.00 49.76  ? 118 ILE A N   1 
ATOM   881  C CA  . ILE A 1 113 ? 27.059 -9.602  32.999  1.00 45.66  ? 118 ILE A CA  1 
ATOM   882  C C   . ILE A 1 113 ? 27.361 -10.284 34.329  1.00 45.69  ? 118 ILE A C   1 
ATOM   883  O O   . ILE A 1 113 ? 27.674 -11.479 34.356  1.00 43.20  ? 118 ILE A O   1 
ATOM   884  C CB  . ILE A 1 113 ? 26.288 -10.577 32.089  1.00 41.12  ? 118 ILE A CB  1 
ATOM   885  C CG1 . ILE A 1 113 ? 26.249 -10.049 30.650  1.00 38.92  ? 118 ILE A CG1 1 
ATOM   886  C CG2 . ILE A 1 113 ? 24.893 -10.768 32.609  1.00 40.28  ? 118 ILE A CG2 1 
ATOM   887  C CD1 . ILE A 1 113 ? 25.461 -8.744  30.461  1.00 34.94  ? 118 ILE A CD1 1 
ATOM   888  N N   . GLN A 1 114 ? 27.325 -9.509  35.414  1.00 49.41  ? 119 GLN A N   1 
ATOM   889  C CA  . GLN A 1 114 ? 27.630 -10.045 36.744  1.00 54.53  ? 119 GLN A CA  1 
ATOM   890  C C   . GLN A 1 114 ? 26.800 -11.258 37.118  1.00 55.60  ? 119 GLN A C   1 
ATOM   891  O O   . GLN A 1 114 ? 27.359 -12.337 37.319  1.00 58.64  ? 119 GLN A O   1 
ATOM   892  C CB  . GLN A 1 114 ? 27.538 -8.975  37.834  1.00 58.01  ? 119 GLN A CB  1 
ATOM   893  C CG  . GLN A 1 114 ? 28.201 -9.402  39.143  1.00 64.56  ? 119 GLN A CG  1 
ATOM   894  C CD  . GLN A 1 114 ? 28.391 -8.244  40.110  1.00 69.75  ? 119 GLN A CD  1 
ATOM   895  O OE1 . GLN A 1 114 ? 27.875 -8.256  41.240  1.00 74.66  ? 119 GLN A OE1 1 
ATOM   896  N NE2 . GLN A 1 114 ? 29.149 -7.240  39.680  1.00 70.61  ? 119 GLN A NE2 1 
ATOM   897  N N   . ASN A 1 115 ? 25.480 -11.098 37.203  1.00 53.16  ? 120 ASN A N   1 
ATOM   898  C CA  . ASN A 1 115 ? 24.618 -12.228 37.543  1.00 52.60  ? 120 ASN A CA  1 
ATOM   899  C C   . ASN A 1 115 ? 23.667 -12.598 36.396  1.00 52.06  ? 120 ASN A C   1 
ATOM   900  O O   . ASN A 1 115 ? 22.569 -12.041 36.286  1.00 51.51  ? 120 ASN A O   1 
ATOM   901  C CB  . ASN A 1 115 ? 23.850 -11.953 38.842  1.00 53.67  ? 120 ASN A CB  1 
ATOM   902  C CG  . ASN A 1 115 ? 24.724 -12.110 40.092  1.00 55.57  ? 120 ASN A CG  1 
ATOM   903  O OD1 . ASN A 1 115 ? 25.215 -13.203 40.405  1.00 54.09  ? 120 ASN A OD1 1 
ATOM   904  N ND2 . ASN A 1 115 ? 24.906 -11.020 40.819  1.00 58.44  ? 120 ASN A ND2 1 
ATOM   905  N N   . PRO A 1 116 ? 24.130 -13.467 35.467  1.00 50.99  ? 121 PRO A N   1 
ATOM   906  C CA  . PRO A 1 116 ? 23.387 -13.955 34.292  1.00 52.77  ? 121 PRO A CA  1 
ATOM   907  C C   . PRO A 1 116 ? 22.352 -15.061 34.538  1.00 53.31  ? 121 PRO A C   1 
ATOM   908  O O   . PRO A 1 116 ? 22.659 -16.091 35.146  1.00 54.95  ? 121 PRO A O   1 
ATOM   909  C CB  . PRO A 1 116 ? 24.504 -14.467 33.371  1.00 51.73  ? 121 PRO A CB  1 
ATOM   910  C CG  . PRO A 1 116 ? 25.511 -14.960 34.298  1.00 49.34  ? 121 PRO A CG  1 
ATOM   911  C CD  . PRO A 1 116 ? 25.552 -13.845 35.345  1.00 50.24  ? 121 PRO A CD  1 
ATOM   912  N N   . GLU A 1 117 ? 21.161 -14.888 33.971  1.00 51.35  ? 122 GLU A N   1 
ATOM   913  C CA  . GLU A 1 117 ? 20.088 -15.864 34.128  1.00 49.27  ? 122 GLU A CA  1 
ATOM   914  C C   . GLU A 1 117 ? 19.583 -16.295 32.763  1.00 45.84  ? 122 GLU A C   1 
ATOM   915  O O   . GLU A 1 117 ? 18.511 -15.878 32.363  1.00 48.22  ? 122 GLU A O   1 
ATOM   916  C CB  . GLU A 1 117 ? 18.912 -15.245 34.901  1.00 53.25  ? 122 GLU A CB  1 
ATOM   917  C CG  . GLU A 1 117 ? 19.069 -15.113 36.408  1.00 58.53  ? 122 GLU A CG  1 
ATOM   918  C CD  . GLU A 1 117 ? 18.000 -14.219 37.010  1.00 64.18  ? 122 GLU A CD  1 
ATOM   919  O OE1 . GLU A 1 117 ? 16.827 -14.654 37.125  1.00 68.64  ? 122 GLU A OE1 1 
ATOM   920  O OE2 . GLU A 1 117 ? 18.333 -13.065 37.349  1.00 65.14  ? 122 GLU A OE2 1 
ATOM   921  N N   . PRO A 1 118 ? 20.324 -17.150 32.042  1.00 42.11  ? 123 PRO A N   1 
ATOM   922  C CA  . PRO A 1 118 ? 19.909 -17.612 30.710  1.00 41.01  ? 123 PRO A CA  1 
ATOM   923  C C   . PRO A 1 118 ? 18.488 -18.154 30.671  1.00 39.29  ? 123 PRO A C   1 
ATOM   924  O O   . PRO A 1 118 ? 18.190 -19.143 31.326  1.00 46.24  ? 123 PRO A O   1 
ATOM   925  C CB  . PRO A 1 118 ? 20.914 -18.717 30.409  1.00 36.88  ? 123 PRO A CB  1 
ATOM   926  C CG  . PRO A 1 118 ? 22.108 -18.259 31.106  1.00 39.54  ? 123 PRO A CG  1 
ATOM   927  C CD  . PRO A 1 118 ? 21.586 -17.788 32.432  1.00 41.20  ? 123 PRO A CD  1 
ATOM   928  N N   . ALA A 1 119 ? 17.620 -17.519 29.896  1.00 35.59  ? 124 ALA A N   1 
ATOM   929  C CA  . ALA A 1 119 ? 16.234 -17.954 29.783  1.00 34.60  ? 124 ALA A CA  1 
ATOM   930  C C   . ALA A 1 119 ? 15.727 -17.730 28.375  1.00 36.01  ? 124 ALA A C   1 
ATOM   931  O O   . ALA A 1 119 ? 16.071 -16.734 27.745  1.00 40.45  ? 124 ALA A O   1 
ATOM   932  C CB  . ALA A 1 119 ? 15.379 -17.197 30.754  1.00 30.18  ? 124 ALA A CB  1 
ATOM   933  N N   . VAL A 1 120 ? 14.953 -18.674 27.854  1.00 35.98  ? 125 VAL A N   1 
ATOM   934  C CA  . VAL A 1 120 ? 14.395 -18.523 26.513  1.00 34.80  ? 125 VAL A CA  1 
ATOM   935  C C   . VAL A 1 120 ? 12.882 -18.471 26.656  1.00 36.86  ? 125 VAL A C   1 
ATOM   936  O O   . VAL A 1 120 ? 12.262 -19.404 27.167  1.00 41.94  ? 125 VAL A O   1 
ATOM   937  C CB  . VAL A 1 120 ? 14.801 -19.667 25.572  1.00 30.86  ? 125 VAL A CB  1 
ATOM   938  C CG1 . VAL A 1 120 ? 14.233 -19.427 24.189  1.00 29.38  ? 125 VAL A CG1 1 
ATOM   939  C CG2 . VAL A 1 120 ? 16.295 -19.761 25.500  1.00 27.94  ? 125 VAL A CG2 1 
ATOM   940  N N   . TYR A 1 121 ? 12.299 -17.354 26.244  1.00 37.11  ? 126 TYR A N   1 
ATOM   941  C CA  . TYR A 1 121 ? 10.866 -17.142 26.340  1.00 35.62  ? 126 TYR A CA  1 
ATOM   942  C C   . TYR A 1 121 ? 10.152 -17.182 25.004  1.00 36.43  ? 126 TYR A C   1 
ATOM   943  O O   . TYR A 1 121 ? 10.667 -16.691 24.019  1.00 40.23  ? 126 TYR A O   1 
ATOM   944  C CB  . TYR A 1 121 ? 10.626 -15.778 26.940  1.00 31.73  ? 126 TYR A CB  1 
ATOM   945  C CG  . TYR A 1 121 ? 11.361 -15.530 28.225  1.00 34.84  ? 126 TYR A CG  1 
ATOM   946  C CD1 . TYR A 1 121 ? 10.969 -16.167 29.403  1.00 36.33  ? 126 TYR A CD1 1 
ATOM   947  C CD2 . TYR A 1 121 ? 12.398 -14.601 28.281  1.00 31.23  ? 126 TYR A CD2 1 
ATOM   948  C CE1 . TYR A 1 121 ? 11.579 -15.883 30.604  1.00 37.00  ? 126 TYR A CE1 1 
ATOM   949  C CE2 . TYR A 1 121 ? 13.016 -14.299 29.470  1.00 36.64  ? 126 TYR A CE2 1 
ATOM   950  C CZ  . TYR A 1 121 ? 12.604 -14.938 30.642  1.00 42.38  ? 126 TYR A CZ  1 
ATOM   951  O OH  . TYR A 1 121 ? 13.179 -14.590 31.857  1.00 41.21  ? 126 TYR A OH  1 
ATOM   952  N N   . ALA A 1 122 ? 8.952  -17.742 24.975  1.00 38.71  ? 127 ALA A N   1 
ATOM   953  C CA  . ALA A 1 122 ? 8.163  -17.770 23.750  1.00 40.72  ? 127 ALA A CA  1 
ATOM   954  C C   . ALA A 1 122 ? 7.187  -16.589 23.862  1.00 40.26  ? 127 ALA A C   1 
ATOM   955  O O   . ALA A 1 122 ? 6.416  -16.524 24.821  1.00 38.36  ? 127 ALA A O   1 
ATOM   956  C CB  . ALA A 1 122 ? 7.398  -19.111 23.629  1.00 42.44  ? 127 ALA A CB  1 
ATOM   957  N N   . LEU A 1 123 ? 7.289  -15.611 22.958  1.00 40.91  ? 128 LEU A N   1 
ATOM   958  C CA  . LEU A 1 123 ? 6.388  -14.454 22.979  1.00 38.50  ? 128 LEU A CA  1 
ATOM   959  C C   . LEU A 1 123 ? 5.295  -14.663 21.939  1.00 40.25  ? 128 LEU A C   1 
ATOM   960  O O   . LEU A 1 123 ? 5.462  -15.450 21.012  1.00 42.54  ? 128 LEU A O   1 
ATOM   961  C CB  . LEU A 1 123 ? 7.129  -13.151 22.670  1.00 36.00  ? 128 LEU A CB  1 
ATOM   962  C CG  . LEU A 1 123 ? 8.497  -12.838 23.278  1.00 33.99  ? 128 LEU A CG  1 
ATOM   963  C CD1 . LEU A 1 123 ? 8.620  -11.355 23.474  1.00 27.62  ? 128 LEU A CD1 1 
ATOM   964  C CD2 . LEU A 1 123 ? 8.662  -13.506 24.598  1.00 31.29  ? 128 LEU A CD2 1 
ATOM   965  N N   . LYS A 1 124 ? 4.195  -13.930 22.064  1.00 44.54  ? 129 LYS A N   1 
ATOM   966  C CA  . LYS A 1 124 ? 3.076  -14.047 21.131  1.00 44.97  ? 129 LYS A CA  1 
ATOM   967  C C   . LYS A 1 124 ? 2.616  -12.711 20.558  1.00 45.23  ? 129 LYS A C   1 
ATOM   968  O O   . LYS A 1 124 ? 2.617  -11.678 21.249  1.00 43.04  ? 129 LYS A O   1 
ATOM   969  C CB  . LYS A 1 124 ? 1.855  -14.673 21.813  1.00 48.13  ? 129 LYS A CB  1 
ATOM   970  C CG  . LYS A 1 124 ? 2.007  -16.091 22.305  1.00 57.43  ? 129 LYS A CG  1 
ATOM   971  C CD  . LYS A 1 124 ? 0.657  -16.577 22.838  1.00 62.63  ? 129 LYS A CD  1 
ATOM   972  C CE  . LYS A 1 124 ? 0.735  -17.954 23.503  1.00 64.91  ? 129 LYS A CE  1 
ATOM   973  N NZ  . LYS A 1 124 ? -0.537 -18.243 24.250  1.00 61.46  ? 129 LYS A NZ  1 
ATOM   974  N N   . ASP A 1 125 ? 2.199  -12.754 19.296  1.00 45.12  ? 132 ASP A N   1 
ATOM   975  C CA  . ASP A 1 125 ? 1.649  -11.598 18.599  1.00 46.46  ? 132 ASP A CA  1 
ATOM   976  C C   . ASP A 1 125 ? 0.148  -11.873 18.703  1.00 49.93  ? 132 ASP A C   1 
ATOM   977  O O   . ASP A 1 125 ? -0.361 -12.760 18.026  1.00 52.72  ? 132 ASP A O   1 
ATOM   978  C CB  . ASP A 1 125 ? 2.084  -11.614 17.131  1.00 43.71  ? 132 ASP A CB  1 
ATOM   979  C CG  . ASP A 1 125 ? 1.474  -10.483 16.318  1.00 43.33  ? 132 ASP A CG  1 
ATOM   980  O OD1 . ASP A 1 125 ? 0.855  -9.583  16.927  1.00 36.74  ? 132 ASP A OD1 1 
ATOM   981  O OD2 . ASP A 1 125 ? 1.619  -10.498 15.065  1.00 41.42  ? 132 ASP A OD2 1 
ATOM   982  N N   . PRO A 1 126 ? -0.570 -11.158 19.589  1.00 52.06  ? 133 PRO A N   1 
ATOM   983  C CA  . PRO A 1 126 ? -2.014 -11.349 19.778  1.00 54.33  ? 133 PRO A CA  1 
ATOM   984  C C   . PRO A 1 126 ? -2.835 -11.095 18.523  1.00 58.49  ? 133 PRO A C   1 
ATOM   985  O O   . PRO A 1 126 ? -3.643 -11.920 18.127  1.00 63.03  ? 133 PRO A O   1 
ATOM   986  C CB  . PRO A 1 126 ? -2.347 -10.342 20.869  1.00 52.88  ? 133 PRO A CB  1 
ATOM   987  C CG  . PRO A 1 126 ? -1.070 -10.238 21.632  1.00 52.22  ? 133 PRO A CG  1 
ATOM   988  C CD  . PRO A 1 126 ? -0.071 -10.133 20.518  1.00 54.48  ? 133 PRO A CD  1 
ATOM   989  N N   . ARG A 1 127 ? -2.577 -9.980  17.858  1.00 61.15  ? 134 ARG A N   1 
ATOM   990  C CA  . ARG A 1 127 ? -3.296 -9.633  16.639  1.00 62.90  ? 134 ARG A CA  1 
ATOM   991  C C   . ARG A 1 127 ? -2.845 -10.509 15.449  1.00 66.54  ? 134 ARG A C   1 
ATOM   992  O O   . ARG A 1 127 ? -2.670 -9.992  14.340  1.00 68.52  ? 134 ARG A O   1 
ATOM   993  C CB  . ARG A 1 127 ? -3.074 -8.144  16.336  1.00 61.10  ? 134 ARG A CB  1 
ATOM   994  C CG  . ARG A 1 127 ? -2.815 -7.306  17.604  1.00 64.65  ? 134 ARG A CG  1 
ATOM   995  C CD  . ARG A 1 127 ? -3.693 -6.062  17.731  1.00 64.11  ? 134 ARG A CD  1 
ATOM   996  N NE  . ARG A 1 127 ? -5.100 -6.415  17.613  1.00 66.28  ? 134 ARG A NE  1 
ATOM   997  C CZ  . ARG A 1 127 ? -5.933 -5.886  16.722  1.00 65.42  ? 134 ARG A CZ  1 
ATOM   998  N NH1 . ARG A 1 127 ? -5.514 -4.958  15.872  1.00 62.71  ? 134 ARG A NH1 1 
ATOM   999  N NH2 . ARG A 1 127 ? -7.167 -6.355  16.623  1.00 65.41  ? 134 ARG A NH2 1 
ATOM   1000 N N   . SER A 1 128 ? -2.659 -11.817 15.684  1.00 66.58  ? 135 SER A N   1 
ATOM   1001 C CA  . SER A 1 128 ? -2.222 -12.791 14.673  1.00 69.30  ? 135 SER A CA  1 
ATOM   1002 C C   . SER A 1 128 ? -2.121 -14.178 15.290  1.00 71.75  ? 135 SER A C   1 
ATOM   1003 O O   . SER A 1 128 ? -1.154 -14.454 15.992  1.00 73.69  ? 135 SER A O   1 
ATOM   1004 C CB  . SER A 1 128 ? -0.825 -12.448 14.129  1.00 70.35  ? 135 SER A CB  1 
ATOM   1005 O OG  . SER A 1 128 ? -0.836 -11.416 13.157  1.00 73.79  ? 135 SER A OG  1 
ATOM   1006 N N   . GLN A 1 129 ? -3.079 -15.063 15.024  1.00 75.31  ? 136 GLN A N   1 
ATOM   1007 C CA  . GLN A 1 129 ? -3.012 -16.427 15.576  1.00 78.43  ? 136 GLN A CA  1 
ATOM   1008 C C   . GLN A 1 129 ? -1.796 -17.158 14.988  1.00 76.40  ? 136 GLN A C   1 
ATOM   1009 O O   . GLN A 1 129 ? -1.426 -16.915 13.847  1.00 77.19  ? 136 GLN A O   1 
ATOM   1010 C CB  . GLN A 1 129 ? -4.310 -17.198 15.275  1.00 82.14  ? 136 GLN A CB  1 
ATOM   1011 C CG  . GLN A 1 129 ? -4.274 -18.725 15.512  1.00 87.37  ? 136 GLN A CG  1 
ATOM   1012 C CD  . GLN A 1 129 ? -4.293 -19.131 16.979  1.00 91.74  ? 136 GLN A CD  1 
ATOM   1013 O OE1 . GLN A 1 129 ? -5.352 -19.222 17.599  1.00 92.56  ? 136 GLN A OE1 1 
ATOM   1014 N NE2 . GLN A 1 129 ? -3.121 -19.431 17.523  1.00 94.38  ? 136 GLN A NE2 1 
ATOM   1015 N N   . ASP A 1 130 ? -1.155 -18.001 15.795  1.00 74.70  ? 137 ASP A N   1 
ATOM   1016 C CA  . ASP A 1 130 ? 0.020  -18.779 15.389  1.00 74.24  ? 137 ASP A CA  1 
ATOM   1017 C C   . ASP A 1 130 ? 1.334  -17.997 15.488  1.00 71.81  ? 137 ASP A C   1 
ATOM   1018 O O   . ASP A 1 130 ? 2.391  -18.595 15.723  1.00 73.61  ? 137 ASP A O   1 
ATOM   1019 C CB  . ASP A 1 130 ? -0.170 -19.430 13.988  1.00 76.96  ? 137 ASP A CB  1 
ATOM   1020 C CG  . ASP A 1 130 ? 0.745  -18.829 12.889  1.00 79.64  ? 137 ASP A CG  1 
ATOM   1021 O OD1 . ASP A 1 130 ? 1.915  -19.260 12.756  1.00 78.65  ? 137 ASP A OD1 1 
ATOM   1022 O OD2 . ASP A 1 130 ? 0.279  -17.960 12.117  1.00 78.96  ? 137 ASP A OD2 1 
ATOM   1023 N N   . SER A 1 131 ? 1.269  -16.672 15.351  1.00 67.92  ? 138 SER A N   1 
ATOM   1024 C CA  . SER A 1 131 ? 2.467  -15.826 15.423  1.00 61.40  ? 138 SER A CA  1 
ATOM   1025 C C   . SER A 1 131 ? 3.138  -15.829 16.809  1.00 58.83  ? 138 SER A C   1 
ATOM   1026 O O   . SER A 1 131 ? 2.601  -15.306 17.790  1.00 54.44  ? 138 SER A O   1 
ATOM   1027 C CB  . SER A 1 131 ? 2.150  -14.388 14.982  1.00 60.36  ? 138 SER A CB  1 
ATOM   1028 O OG  . SER A 1 131 ? 2.774  -14.055 13.750  1.00 55.65  ? 138 SER A OG  1 
ATOM   1029 N N   . THR A 1 132 ? 4.304  -16.466 16.866  1.00 57.88  ? 139 THR A N   1 
ATOM   1030 C CA  . THR A 1 132 ? 5.123  -16.565 18.069  1.00 53.68  ? 139 THR A CA  1 
ATOM   1031 C C   . THR A 1 132 ? 6.613  -16.533 17.677  1.00 49.97  ? 139 THR A C   1 
ATOM   1032 O O   . THR A 1 132 ? 6.981  -16.796 16.515  1.00 46.86  ? 139 THR A O   1 
ATOM   1033 C CB  . THR A 1 132 ? 4.834  -17.870 18.870  1.00 55.08  ? 139 THR A CB  1 
ATOM   1034 O OG1 . THR A 1 132 ? 4.736  -18.979 17.967  1.00 57.81  ? 139 THR A OG1 1 
ATOM   1035 C CG2 . THR A 1 132 ? 3.563  -17.746 19.673  1.00 49.40  ? 139 THR A CG2 1 
ATOM   1036 N N   . LEU A 1 133 ? 7.451  -16.165 18.641  1.00 46.25  ? 140 LEU A N   1 
ATOM   1037 C CA  . LEU A 1 133 ? 8.890  -16.110 18.444  1.00 43.81  ? 140 LEU A CA  1 
ATOM   1038 C C   . LEU A 1 133 ? 9.570  -16.355 19.797  1.00 43.56  ? 140 LEU A C   1 
ATOM   1039 O O   . LEU A 1 133 ? 8.923  -16.273 20.847  1.00 40.40  ? 140 LEU A O   1 
ATOM   1040 C CB  . LEU A 1 133 ? 9.300  -14.786 17.779  1.00 42.14  ? 140 LEU A CB  1 
ATOM   1041 C CG  . LEU A 1 133 ? 9.734  -13.473 18.437  1.00 41.08  ? 140 LEU A CG  1 
ATOM   1042 C CD1 . LEU A 1 133 ? 9.361  -12.336 17.490  1.00 38.62  ? 140 LEU A CD1 1 
ATOM   1043 C CD2 . LEU A 1 133 ? 9.125  -13.238 19.783  1.00 37.45  ? 140 LEU A CD2 1 
ATOM   1044 N N   . CYS A 1 134 ? 10.847 -16.731 19.754  1.00 42.87  ? 141 CYS A N   1 
ATOM   1045 C CA  . CYS A 1 134 ? 11.636 -17.034 20.947  1.00 40.37  ? 141 CYS A CA  1 
ATOM   1046 C C   . CYS A 1 134 ? 12.628 -15.937 21.308  1.00 37.61  ? 141 CYS A C   1 
ATOM   1047 O O   . CYS A 1 134 ? 13.439 -15.540 20.477  1.00 40.08  ? 141 CYS A O   1 
ATOM   1048 C CB  . CYS A 1 134 ? 12.439 -18.313 20.723  1.00 42.63  ? 141 CYS A CB  1 
ATOM   1049 S SG  . CYS A 1 134 ? 11.503 -19.733 20.117  1.00 44.25  ? 141 CYS A SG  1 
ATOM   1050 N N   . LEU A 1 135 ? 12.591 -15.488 22.557  1.00 31.22  ? 142 LEU A N   1 
ATOM   1051 C CA  . LEU A 1 135 ? 13.508 -14.469 23.038  1.00 28.06  ? 142 LEU A CA  1 
ATOM   1052 C C   . LEU A 1 135 ? 14.507 -15.132 23.963  1.00 27.22  ? 142 LEU A C   1 
ATOM   1053 O O   . LEU A 1 135 ? 14.148 -15.663 25.004  1.00 27.30  ? 142 LEU A O   1 
ATOM   1054 C CB  . LEU A 1 135 ? 12.778 -13.357 23.808  1.00 24.28  ? 142 LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 135 ? 13.672 -12.380 24.611  1.00 19.73  ? 142 LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 135 ? 14.541 -11.580 23.669  1.00 12.31  ? 142 LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 135 ? 12.838 -11.456 25.522  1.00 19.24  ? 142 LEU A CD2 1 
ATOM   1058 N N   . PHE A 1 136 ? 15.760 -15.120 23.559  1.00 28.67  ? 143 PHE A N   1 
ATOM   1059 C CA  . PHE A 1 136 ? 16.838 -15.683 24.351  1.00 30.21  ? 143 PHE A CA  1 
ATOM   1060 C C   . PHE A 1 136 ? 17.444 -14.462 25.029  1.00 26.50  ? 143 PHE A C   1 
ATOM   1061 O O   . PHE A 1 136 ? 17.782 -13.497 24.381  1.00 27.22  ? 143 PHE A O   1 
ATOM   1062 C CB  . PHE A 1 136 ? 17.834 -16.352 23.411  1.00 36.33  ? 143 PHE A CB  1 
ATOM   1063 C CG  . PHE A 1 136 ? 19.020 -16.928 24.095  1.00 37.46  ? 143 PHE A CG  1 
ATOM   1064 C CD1 . PHE A 1 136 ? 18.959 -17.275 25.446  1.00 33.57  ? 143 PHE A CD1 1 
ATOM   1065 C CD2 . PHE A 1 136 ? 20.204 -17.115 23.386  1.00 32.94  ? 143 PHE A CD2 1 
ATOM   1066 C CE1 . PHE A 1 136 ? 20.050 -17.794 26.079  1.00 29.28  ? 143 PHE A CE1 1 
ATOM   1067 C CE2 . PHE A 1 136 ? 21.304 -17.633 24.004  1.00 32.38  ? 143 PHE A CE2 1 
ATOM   1068 C CZ  . PHE A 1 136 ? 21.233 -17.978 25.361  1.00 33.26  ? 143 PHE A CZ  1 
ATOM   1069 N N   . THR A 1 137 ? 17.526 -14.459 26.337  1.00 26.87  ? 144 THR A N   1 
ATOM   1070 C CA  . THR A 1 137 ? 18.039 -13.277 26.961  1.00 27.17  ? 144 THR A CA  1 
ATOM   1071 C C   . THR A 1 137 ? 18.756 -13.513 28.304  1.00 31.40  ? 144 THR A C   1 
ATOM   1072 O O   . THR A 1 137 ? 18.805 -14.634 28.828  1.00 29.33  ? 144 THR A O   1 
ATOM   1073 C CB  . THR A 1 137 ? 16.910 -12.183 27.019  1.00 27.23  ? 144 THR A CB  1 
ATOM   1074 O OG1 . THR A 1 137 ? 17.470 -10.898 27.312  1.00 28.23  ? 144 THR A OG1 1 
ATOM   1075 C CG2 . THR A 1 137 ? 15.844 -12.504 28.053  1.00 24.46  ? 144 THR A CG2 1 
ATOM   1076 N N   . ASP A 1 138 ? 19.460 -12.473 28.741  1.00 32.51  ? 145 ASP A N   1 
ATOM   1077 C CA  . ASP A 1 138 ? 20.202 -12.470 29.983  1.00 31.04  ? 145 ASP A CA  1 
ATOM   1078 C C   . ASP A 1 138 ? 21.312 -13.476 30.091  1.00 33.54  ? 145 ASP A C   1 
ATOM   1079 O O   . ASP A 1 138 ? 21.694 -13.854 31.196  1.00 37.48  ? 145 ASP A O   1 
ATOM   1080 C CB  . ASP A 1 138 ? 19.236 -12.602 31.133  1.00 30.03  ? 145 ASP A CB  1 
ATOM   1081 C CG  . ASP A 1 138 ? 18.292 -11.436 31.205  1.00 34.10  ? 145 ASP A CG  1 
ATOM   1082 O OD1 . ASP A 1 138 ? 18.724 -10.323 30.846  1.00 38.19  ? 145 ASP A OD1 1 
ATOM   1083 O OD2 . ASP A 1 138 ? 17.122 -11.610 31.602  1.00 36.87  ? 145 ASP A OD2 1 
ATOM   1084 N N   . PHE A 1 139 ? 21.828 -13.917 28.951  1.00 33.16  ? 146 PHE A N   1 
ATOM   1085 C CA  . PHE A 1 139 ? 22.925 -14.861 28.955  1.00 34.00  ? 146 PHE A CA  1 
ATOM   1086 C C   . PHE A 1 139 ? 24.231 -14.116 29.110  1.00 37.70  ? 146 PHE A C   1 
ATOM   1087 O O   . PHE A 1 139 ? 24.254 -12.885 29.105  1.00 38.87  ? 146 PHE A O   1 
ATOM   1088 C CB  . PHE A 1 139 ? 22.946 -15.734 27.699  1.00 32.67  ? 146 PHE A CB  1 
ATOM   1089 C CG  . PHE A 1 139 ? 22.740 -14.989 26.410  1.00 36.94  ? 146 PHE A CG  1 
ATOM   1090 C CD1 . PHE A 1 139 ? 21.457 -14.769 25.915  1.00 41.13  ? 146 PHE A CD1 1 
ATOM   1091 C CD2 . PHE A 1 139 ? 23.823 -14.583 25.643  1.00 39.89  ? 146 PHE A CD2 1 
ATOM   1092 C CE1 . PHE A 1 139 ? 21.258 -14.168 24.677  1.00 41.62  ? 146 PHE A CE1 1 
ATOM   1093 C CE2 . PHE A 1 139 ? 23.643 -13.980 24.405  1.00 42.55  ? 146 PHE A CE2 1 
ATOM   1094 C CZ  . PHE A 1 139 ? 22.357 -13.772 23.915  1.00 44.27  ? 146 PHE A CZ  1 
ATOM   1095 N N   . ASP A 1 140 ? 25.320 -14.862 29.251  1.00 42.63  ? 147 ASP A N   1 
ATOM   1096 C CA  . ASP A 1 140 ? 26.647 -14.262 29.422  1.00 48.67  ? 147 ASP A CA  1 
ATOM   1097 C C   . ASP A 1 140 ? 27.380 -13.935 28.093  1.00 48.72  ? 147 ASP A C   1 
ATOM   1098 O O   . ASP A 1 140 ? 27.461 -14.765 27.177  1.00 50.45  ? 147 ASP A O   1 
ATOM   1099 C CB  . ASP A 1 140 ? 27.503 -15.160 30.327  1.00 50.38  ? 147 ASP A CB  1 
ATOM   1100 C CG  . ASP A 1 140 ? 28.903 -14.642 30.505  1.00 54.36  ? 147 ASP A CG  1 
ATOM   1101 O OD1 . ASP A 1 140 ? 29.084 -13.562 31.128  1.00 55.56  ? 147 ASP A OD1 1 
ATOM   1102 O OD2 . ASP A 1 140 ? 29.816 -15.327 29.998  1.00 57.15  ? 147 ASP A OD2 1 
ATOM   1103 N N   . SER A 1 141 ? 27.985 -12.753 28.039  1.00 46.58  ? 148 SER A N   1 
ATOM   1104 C CA  . SER A 1 141 ? 28.693 -12.280 26.856  1.00 44.50  ? 148 SER A CA  1 
ATOM   1105 C C   . SER A 1 141 ? 29.660 -13.252 26.191  1.00 44.04  ? 148 SER A C   1 
ATOM   1106 O O   . SER A 1 141 ? 30.052 -13.046 25.051  1.00 42.81  ? 148 SER A O   1 
ATOM   1107 C CB  . SER A 1 141 ? 29.424 -10.982 27.201  1.00 44.32  ? 148 SER A CB  1 
ATOM   1108 O OG  . SER A 1 141 ? 28.540 -10.093 27.856  1.00 42.15  ? 148 SER A OG  1 
ATOM   1109 N N   . GLN A 1 142 ? 30.075 -14.289 26.902  1.00 45.50  ? 149 GLN A N   1 
ATOM   1110 C CA  . GLN A 1 142 ? 31.021 -15.229 26.321  1.00 48.51  ? 149 GLN A CA  1 
ATOM   1111 C C   . GLN A 1 142 ? 30.349 -16.369 25.563  1.00 50.02  ? 149 GLN A C   1 
ATOM   1112 O O   . GLN A 1 142 ? 30.989 -17.025 24.728  1.00 50.67  ? 149 GLN A O   1 
ATOM   1113 C CB  . GLN A 1 142 ? 31.967 -15.786 27.390  1.00 47.24  ? 149 GLN A CB  1 
ATOM   1114 C CG  . GLN A 1 142 ? 32.585 -14.736 28.304  1.00 52.58  ? 149 GLN A CG  1 
ATOM   1115 C CD  . GLN A 1 142 ? 33.418 -13.699 27.567  1.00 54.88  ? 149 GLN A CD  1 
ATOM   1116 O OE1 . GLN A 1 142 ? 34.210 -14.035 26.695  1.00 52.10  ? 149 GLN A OE1 1 
ATOM   1117 N NE2 . GLN A 1 142 ? 33.263 -12.429 27.945  1.00 56.44  ? 149 GLN A NE2 1 
ATOM   1118 N N   . ILE A 1 143 ? 29.078 -16.631 25.853  1.00 50.88  ? 150 ILE A N   1 
ATOM   1119 C CA  . ILE A 1 143 ? 28.405 -17.712 25.155  1.00 53.43  ? 150 ILE A CA  1 
ATOM   1120 C C   . ILE A 1 143 ? 28.163 -17.301 23.715  1.00 55.09  ? 150 ILE A C   1 
ATOM   1121 O O   . ILE A 1 143 ? 27.956 -16.121 23.426  1.00 56.83  ? 150 ILE A O   1 
ATOM   1122 C CB  . ILE A 1 143 ? 27.085 -18.162 25.853  1.00 54.23  ? 150 ILE A CB  1 
ATOM   1123 C CG1 . ILE A 1 143 ? 26.520 -19.401 25.147  1.00 60.88  ? 150 ILE A CG1 1 
ATOM   1124 C CG2 . ILE A 1 143 ? 26.038 -17.083 25.799  1.00 51.82  ? 150 ILE A CG2 1 
ATOM   1125 C CD1 . ILE A 1 143 ? 25.453 -20.176 25.958  1.00 63.47  ? 150 ILE A CD1 1 
ATOM   1126 N N   . ASN A 1 144 ? 28.274 -18.273 22.818  1.00 57.50  ? 151 ASN A N   1 
ATOM   1127 C CA  . ASN A 1 144 ? 28.073 -18.077 21.384  1.00 62.05  ? 151 ASN A CA  1 
ATOM   1128 C C   . ASN A 1 144 ? 26.611 -18.381 21.011  1.00 61.31  ? 151 ASN A C   1 
ATOM   1129 O O   . ASN A 1 144 ? 26.112 -19.464 21.311  1.00 60.62  ? 151 ASN A O   1 
ATOM   1130 C CB  . ASN A 1 144 ? 29.047 -18.985 20.595  1.00 67.37  ? 151 ASN A CB  1 
ATOM   1131 C CG  . ASN A 1 144 ? 29.027 -20.470 21.068  1.00 73.22  ? 151 ASN A CG  1 
ATOM   1132 O OD1 . ASN A 1 144 ? 28.621 -20.793 22.197  1.00 76.47  ? 151 ASN A OD1 1 
ATOM   1133 N ND2 . ASN A 1 144 ? 29.494 -21.366 20.202  1.00 73.50  ? 151 ASN A ND2 1 
ATOM   1134 N N   . VAL A 1 145 ? 25.918 -17.424 20.390  1.00 62.67  ? 152 VAL A N   1 
ATOM   1135 C CA  . VAL A 1 145 ? 24.510 -17.619 19.999  1.00 64.87  ? 152 VAL A CA  1 
ATOM   1136 C C   . VAL A 1 145 ? 24.384 -18.587 18.814  1.00 66.10  ? 152 VAL A C   1 
ATOM   1137 O O   . VAL A 1 145 ? 24.950 -18.349 17.736  1.00 66.22  ? 152 VAL A O   1 
ATOM   1138 C CB  . VAL A 1 145 ? 23.788 -16.266 19.677  1.00 65.79  ? 152 VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 145 ? 24.287 -15.657 18.360  1.00 64.55  ? 152 VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 145 ? 22.283 -16.472 19.633  1.00 68.86  ? 152 VAL A CG2 1 
ATOM   1141 N N   . PRO A 1 146 ? 23.627 -19.687 18.998  1.00 68.40  ? 153 PRO A N   1 
ATOM   1142 C CA  . PRO A 1 146 ? 23.443 -20.686 17.937  1.00 69.38  ? 153 PRO A CA  1 
ATOM   1143 C C   . PRO A 1 146 ? 23.117 -20.090 16.581  1.00 71.78  ? 153 PRO A C   1 
ATOM   1144 O O   . PRO A 1 146 ? 22.481 -19.043 16.480  1.00 72.01  ? 153 PRO A O   1 
ATOM   1145 C CB  . PRO A 1 146 ? 22.313 -21.572 18.476  1.00 67.87  ? 153 PRO A CB  1 
ATOM   1146 C CG  . PRO A 1 146 ? 21.628 -20.712 19.511  1.00 65.65  ? 153 PRO A CG  1 
ATOM   1147 C CD  . PRO A 1 146 ? 22.766 -19.991 20.156  1.00 66.39  ? 153 PRO A CD  1 
ATOM   1148 N N   . LYS A 1 147 ? 23.644 -20.716 15.543  1.00 75.78  ? 154 LYS A N   1 
ATOM   1149 C CA  . LYS A 1 147 ? 23.408 -20.248 14.190  1.00 79.94  ? 154 LYS A CA  1 
ATOM   1150 C C   . LYS A 1 147 ? 22.229 -21.022 13.604  1.00 83.56  ? 154 LYS A C   1 
ATOM   1151 O O   . LYS A 1 147 ? 21.833 -22.075 14.128  1.00 81.20  ? 154 LYS A O   1 
ATOM   1152 C CB  . LYS A 1 147 ? 24.662 -20.441 13.322  1.00 79.59  ? 154 LYS A CB  1 
ATOM   1153 C CG  . LYS A 1 147 ? 25.906 -19.697 13.802  1.00 79.64  ? 154 LYS A CG  1 
ATOM   1154 C CD  . LYS A 1 147 ? 25.654 -18.203 13.874  1.00 81.34  ? 154 LYS A CD  1 
ATOM   1155 C CE  . LYS A 1 147 ? 26.862 -17.444 14.396  1.00 81.83  ? 154 LYS A CE  1 
ATOM   1156 N NZ  . LYS A 1 147 ? 26.478 -16.064 14.821  1.00 80.43  ? 154 LYS A NZ  1 
ATOM   1157 N N   . THR A 1 148 ? 21.648 -20.457 12.549  1.00 89.25  ? 155 THR A N   1 
ATOM   1158 C CA  . THR A 1 148 ? 20.513 -21.045 11.835  1.00 94.74  ? 155 THR A CA  1 
ATOM   1159 C C   . THR A 1 148 ? 20.973 -22.290 11.074  1.00 98.37  ? 155 THR A C   1 
ATOM   1160 O O   . THR A 1 148 ? 22.163 -22.441 10.786  1.00 99.25  ? 155 THR A O   1 
ATOM   1161 C CB  . THR A 1 148 ? 19.972 -20.053 10.777  1.00 96.69  ? 155 THR A CB  1 
ATOM   1162 O OG1 . THR A 1 148 ? 19.712 -18.775 11.382  1.00 97.25  ? 155 THR A OG1 1 
ATOM   1163 C CG2 . THR A 1 148 ? 18.705 -20.596 10.123  1.00 97.05  ? 155 THR A CG2 1 
ATOM   1164 N N   . MET A 1 149 ? 20.032 -23.164 10.729  1.00 101.05 ? 156 MET A N   1 
ATOM   1165 C CA  . MET A 1 149 ? 20.360 -24.368 9.973   1.00 102.59 ? 156 MET A CA  1 
ATOM   1166 C C   . MET A 1 149 ? 19.385 -24.502 8.816   1.00 101.28 ? 156 MET A C   1 
ATOM   1167 O O   . MET A 1 149 ? 19.772 -24.465 7.649   1.00 101.93 ? 156 MET A O   1 
ATOM   1168 C CB  . MET A 1 149 ? 20.275 -25.624 10.857  1.00 106.11 ? 156 MET A CB  1 
ATOM   1169 C CG  . MET A 1 149 ? 20.645 -26.930 10.125  1.00 111.30 ? 156 MET A CG  1 
ATOM   1170 S SD  . MET A 1 149 ? 20.227 -28.478 11.013  1.00 116.55 ? 156 MET A SD  1 
ATOM   1171 C CE  . MET A 1 149 ? 19.604 -29.531 9.647   1.00 114.32 ? 156 MET A CE  1 
ATOM   1172 N N   . GLU A 1 150 ? 18.107 -24.603 9.167   1.00 99.31  ? 157 GLU A N   1 
ATOM   1173 C CA  . GLU A 1 150 ? 17.041 -24.784 8.194   1.00 95.25  ? 157 GLU A CA  1 
ATOM   1174 C C   . GLU A 1 150 ? 16.581 -23.515 7.531   1.00 90.93  ? 157 GLU A C   1 
ATOM   1175 O O   . GLU A 1 150 ? 16.929 -22.407 7.934   1.00 90.08  ? 157 GLU A O   1 
ATOM   1176 C CB  . GLU A 1 150 ? 15.813 -25.448 8.834   1.00 97.21  ? 157 GLU A CB  1 
ATOM   1177 C CG  . GLU A 1 150 ? 16.085 -26.741 9.598   1.00 96.95  ? 157 GLU A CG  1 
ATOM   1178 C CD  . GLU A 1 150 ? 16.695 -26.495 10.968  1.00 98.08  ? 157 GLU A CD  1 
ATOM   1179 O OE1 . GLU A 1 150 ? 16.380 -25.453 11.584  1.00 97.25  ? 157 GLU A OE1 1 
ATOM   1180 O OE2 . GLU A 1 150 ? 17.498 -27.336 11.427  1.00 100.16 ? 157 GLU A OE2 1 
ATOM   1181 N N   . SER A 1 151 ? 15.784 -23.719 6.496   1.00 87.50  ? 158 SER A N   1 
ATOM   1182 C CA  . SER A 1 151 ? 15.184 -22.652 5.732   1.00 84.59  ? 158 SER A CA  1 
ATOM   1183 C C   . SER A 1 151 ? 13.895 -22.408 6.517   1.00 82.08  ? 158 SER A C   1 
ATOM   1184 O O   . SER A 1 151 ? 13.430 -23.305 7.236   1.00 81.85  ? 158 SER A O   1 
ATOM   1185 C CB  . SER A 1 151 ? 14.868 -23.159 4.318   1.00 85.50  ? 158 SER A CB  1 
ATOM   1186 O OG  . SER A 1 151 ? 15.872 -24.060 3.857   1.00 83.12  ? 158 SER A OG  1 
ATOM   1187 N N   . GLY A 1 152 ? 13.354 -21.194 6.434   1.00 78.31  ? 159 GLY A N   1 
ATOM   1188 C CA  . GLY A 1 152 ? 12.129 -20.872 7.154   1.00 73.22  ? 159 GLY A CA  1 
ATOM   1189 C C   . GLY A 1 152 ? 12.295 -20.641 8.657   1.00 71.73  ? 159 GLY A C   1 
ATOM   1190 O O   . GLY A 1 152 ? 11.313 -20.413 9.371   1.00 72.04  ? 159 GLY A O   1 
ATOM   1191 N N   . THR A 1 153 ? 13.540 -20.683 9.129   1.00 66.76  ? 160 THR A N   1 
ATOM   1192 C CA  . THR A 1 153 ? 13.876 -20.475 10.531  1.00 60.61  ? 160 THR A CA  1 
ATOM   1193 C C   . THR A 1 153 ? 15.017 -19.461 10.574  1.00 56.67  ? 160 THR A C   1 
ATOM   1194 O O   . THR A 1 153 ? 15.975 -19.586 9.819   1.00 56.75  ? 160 THR A O   1 
ATOM   1195 C CB  . THR A 1 153 ? 14.352 -21.772 11.154  1.00 59.38  ? 160 THR A CB  1 
ATOM   1196 O OG1 . THR A 1 153 ? 13.461 -22.827 10.772  1.00 63.40  ? 160 THR A OG1 1 
ATOM   1197 C CG2 . THR A 1 153 ? 14.353 -21.648 12.658  1.00 60.49  ? 160 THR A CG2 1 
ATOM   1198 N N   . PHE A 1 154 ? 14.932 -18.470 11.452  1.00 50.03  ? 161 PHE A N   1 
ATOM   1199 C CA  . PHE A 1 154 ? 15.970 -17.452 11.521  1.00 41.94  ? 161 PHE A CA  1 
ATOM   1200 C C   . PHE A 1 154 ? 16.343 -17.172 12.956  1.00 39.15  ? 161 PHE A C   1 
ATOM   1201 O O   . PHE A 1 154 ? 15.507 -17.289 13.839  1.00 42.39  ? 161 PHE A O   1 
ATOM   1202 C CB  . PHE A 1 154 ? 15.455 -16.155 10.872  1.00 40.71  ? 161 PHE A CB  1 
ATOM   1203 C CG  . PHE A 1 154 ? 16.525 -15.140 10.591  1.00 40.02  ? 161 PHE A CG  1 
ATOM   1204 C CD1 . PHE A 1 154 ? 16.902 -14.220 11.559  1.00 41.58  ? 161 PHE A CD1 1 
ATOM   1205 C CD2 . PHE A 1 154 ? 17.199 -15.142 9.370   1.00 43.35  ? 161 PHE A CD2 1 
ATOM   1206 C CE1 . PHE A 1 154 ? 17.945 -13.322 11.320  1.00 44.69  ? 161 PHE A CE1 1 
ATOM   1207 C CE2 . PHE A 1 154 ? 18.240 -14.253 9.117   1.00 43.56  ? 161 PHE A CE2 1 
ATOM   1208 C CZ  . PHE A 1 154 ? 18.615 -13.346 10.095  1.00 45.79  ? 161 PHE A CZ  1 
ATOM   1209 N N   . ILE A 1 155 ? 17.612 -16.856 13.188  1.00 39.45  ? 162 ILE A N   1 
ATOM   1210 C CA  . ILE A 1 155 ? 18.120 -16.483 14.519  1.00 36.97  ? 162 ILE A CA  1 
ATOM   1211 C C   . ILE A 1 155 ? 19.001 -15.248 14.310  1.00 36.02  ? 162 ILE A C   1 
ATOM   1212 O O   . ILE A 1 155 ? 19.907 -15.266 13.472  1.00 40.84  ? 162 ILE A O   1 
ATOM   1213 C CB  . ILE A 1 155 ? 18.985 -17.567 15.166  1.00 34.50  ? 162 ILE A CB  1 
ATOM   1214 C CG1 . ILE A 1 155 ? 18.248 -18.907 15.166  1.00 35.07  ? 162 ILE A CG1 1 
ATOM   1215 C CG2 . ILE A 1 155 ? 19.347 -17.134 16.581  1.00 34.48  ? 162 ILE A CG2 1 
ATOM   1216 C CD1 . ILE A 1 155 ? 18.983 -20.035 15.867  1.00 33.05  ? 162 ILE A CD1 1 
ATOM   1217 N N   . THR A 1 156 ? 18.711 -14.161 15.012  1.00 30.96  ? 163 THR A N   1 
ATOM   1218 C CA  . THR A 1 156 ? 19.494 -12.947 14.849  1.00 28.98  ? 163 THR A CA  1 
ATOM   1219 C C   . THR A 1 156 ? 20.830 -13.043 15.589  1.00 31.55  ? 163 THR A C   1 
ATOM   1220 O O   . THR A 1 156 ? 21.134 -14.087 16.207  1.00 34.73  ? 163 THR A O   1 
ATOM   1221 C CB  . THR A 1 156 ? 18.691 -11.736 15.319  1.00 27.51  ? 163 THR A CB  1 
ATOM   1222 O OG1 . THR A 1 156 ? 18.287 -11.915 16.676  1.00 29.50  ? 163 THR A OG1 1 
ATOM   1223 C CG2 . THR A 1 156 ? 17.453 -11.584 14.494  1.00 29.52  ? 163 THR A CG2 1 
ATOM   1224 N N   . ASP A 1 157 ? 21.660 -12.002 15.465  1.00 32.33  ? 164 ASP A N   1 
ATOM   1225 C CA  . ASP A 1 157 ? 22.967 -11.955 16.149  1.00 30.41  ? 164 ASP A CA  1 
ATOM   1226 C C   . ASP A 1 157 ? 22.724 -11.278 17.504  1.00 27.00  ? 164 ASP A C   1 
ATOM   1227 O O   . ASP A 1 157 ? 21.800 -10.493 17.641  1.00 29.04  ? 164 ASP A O   1 
ATOM   1228 C CB  . ASP A 1 157 ? 24.021 -11.179 15.327  1.00 28.92  ? 164 ASP A CB  1 
ATOM   1229 C CG  . ASP A 1 157 ? 24.301 -11.806 13.952  1.00 29.49  ? 164 ASP A CG  1 
ATOM   1230 O OD1 . ASP A 1 157 ? 23.933 -12.973 13.709  1.00 31.18  ? 164 ASP A OD1 1 
ATOM   1231 O OD2 . ASP A 1 157 ? 24.904 -11.119 13.102  1.00 31.80  ? 164 ASP A OD2 1 
ATOM   1232 N N   . ALA A 1 158 ? 23.546 -11.573 18.498  1.00 25.48  ? 165 ALA A N   1 
ATOM   1233 C CA  . ALA A 1 158 ? 23.355 -11.006 19.827  1.00 25.78  ? 165 ALA A CA  1 
ATOM   1234 C C   . ALA A 1 158 ? 23.390 -9.493  19.807  1.00 28.69  ? 165 ALA A C   1 
ATOM   1235 O O   . ALA A 1 158 ? 24.160 -8.918  19.042  1.00 33.86  ? 165 ALA A O   1 
ATOM   1236 C CB  . ALA A 1 158 ? 24.450 -11.534 20.799  1.00 20.04  ? 165 ALA A CB  1 
ATOM   1237 N N   . THR A 1 159 ? 22.531 -8.844  20.594  1.00 27.57  ? 166 THR A N   1 
ATOM   1238 C CA  . THR A 1 159 ? 22.563 -7.387  20.720  1.00 24.44  ? 166 THR A CA  1 
ATOM   1239 C C   . THR A 1 159 ? 22.566 -7.168  22.220  1.00 25.31  ? 166 THR A C   1 
ATOM   1240 O O   . THR A 1 159 ? 22.144 -8.031  22.966  1.00 28.62  ? 166 THR A O   1 
ATOM   1241 C CB  . THR A 1 159 ? 21.336 -6.644  20.100  1.00 25.98  ? 166 THR A CB  1 
ATOM   1242 O OG1 . THR A 1 159 ? 20.132 -6.974  20.817  1.00 24.47  ? 166 THR A OG1 1 
ATOM   1243 C CG2 . THR A 1 159 ? 21.195 -6.952  18.611  1.00 21.78  ? 166 THR A CG2 1 
ATOM   1244 N N   . VAL A 1 160 ? 23.057 -6.029  22.663  1.00 28.02  ? 167 VAL A N   1 
ATOM   1245 C CA  . VAL A 1 160 ? 23.099 -5.738  24.086  1.00 30.04  ? 167 VAL A CA  1 
ATOM   1246 C C   . VAL A 1 160 ? 22.203 -4.527  24.336  1.00 32.03  ? 167 VAL A C   1 
ATOM   1247 O O   . VAL A 1 160 ? 22.369 -3.475  23.709  1.00 31.72  ? 167 VAL A O   1 
ATOM   1248 C CB  . VAL A 1 160 ? 24.526 -5.314  24.556  1.00 26.80  ? 167 VAL A CB  1 
ATOM   1249 C CG1 . VAL A 1 160 ? 24.645 -5.225  26.078  1.00 22.95  ? 167 VAL A CG1 1 
ATOM   1250 C CG2 . VAL A 1 160 ? 25.613 -6.287  24.100  1.00 24.96  ? 167 VAL A CG2 1 
ATOM   1251 N N   . LEU A 1 161 ? 21.235 -4.646  25.230  1.00 32.85  ? 168 LEU A N   1 
ATOM   1252 C CA  . LEU A 1 161 ? 20.393 -3.474  25.526  1.00 33.52  ? 168 LEU A CA  1 
ATOM   1253 C C   . LEU A 1 161 ? 20.695 -2.996  26.944  1.00 36.77  ? 168 LEU A C   1 
ATOM   1254 O O   . LEU A 1 161 ? 21.094 -3.774  27.818  1.00 34.41  ? 168 LEU A O   1 
ATOM   1255 C CB  . LEU A 1 161 ? 18.901 -3.734  25.163  1.00 29.08  ? 168 LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 161 ? 17.981 -4.455  26.173  1.00 27.75  ? 168 LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 161 ? 17.864 -3.764  27.526  1.00 27.43  ? 168 LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 161 ? 16.527 -4.539  25.645  1.00 24.74  ? 168 LEU A CD2 1 
ATOM   1259 N N   . ASP A 1 162 ? 20.527 -1.704  27.096  1.00 42.08  ? 169 ASP A N   1 
ATOM   1260 C CA  . ASP A 1 162 ? 20.814 -1.007  28.344  1.00 43.94  ? 169 ASP A CA  1 
ATOM   1261 C C   . ASP A 1 162 ? 19.581 -0.257  28.809  1.00 46.33  ? 169 ASP A C   1 
ATOM   1262 O O   . ASP A 1 162 ? 18.881 0.368   27.998  1.00 44.96  ? 169 ASP A O   1 
ATOM   1263 C CB  . ASP A 1 162 ? 21.950 -0.011  28.091  1.00 48.01  ? 169 ASP A CB  1 
ATOM   1264 C CG  . ASP A 1 162 ? 22.683 0.425   29.357  1.00 48.83  ? 169 ASP A CG  1 
ATOM   1265 O OD1 . ASP A 1 162 ? 22.790 -0.384  30.351  1.00 53.20  ? 169 ASP A OD1 1 
ATOM   1266 O OD2 . ASP A 1 162 ? 23.194 1.607   29.423  1.00 46.65  ? 169 ASP A OD2 1 
ATOM   1267 N N   . MET A 1 163 ? 19.262 -0.401  30.090  1.00 50.95  ? 170 MET A N   1 
ATOM   1268 C CA  . MET A 1 163 ? 18.135 0.321   30.675  1.00 57.31  ? 170 MET A CA  1 
ATOM   1269 C C   . MET A 1 163 ? 18.764 1.466   31.485  1.00 64.26  ? 170 MET A C   1 
ATOM   1270 O O   . MET A 1 163 ? 19.977 1.682   31.403  1.00 65.13  ? 170 MET A O   1 
ATOM   1271 C CB  . MET A 1 163 ? 17.267 -0.598  31.551  1.00 50.32  ? 170 MET A CB  1 
ATOM   1272 C CG  . MET A 1 163 ? 16.587 -1.739  30.796  1.00 39.48  ? 170 MET A CG  1 
ATOM   1273 S SD  . MET A 1 163 ? 15.514 -2.754  31.815  1.00 35.79  ? 170 MET A SD  1 
ATOM   1274 C CE  . MET A 1 163 ? 14.326 -1.542  32.283  1.00 35.76  ? 170 MET A CE  1 
ATOM   1275 N N   . LYS A 1 164 ? 17.967 2.209   32.248  1.00 73.10  ? 171 LYS A N   1 
ATOM   1276 C CA  . LYS A 1 164 ? 18.513 3.328   33.031  1.00 80.73  ? 171 LYS A CA  1 
ATOM   1277 C C   . LYS A 1 164 ? 18.807 2.997   34.495  1.00 83.18  ? 171 LYS A C   1 
ATOM   1278 O O   . LYS A 1 164 ? 18.443 3.759   35.390  1.00 85.92  ? 171 LYS A O   1 
ATOM   1279 C CB  . LYS A 1 164 ? 17.591 4.556   32.933  1.00 84.52  ? 171 LYS A CB  1 
ATOM   1280 C CG  . LYS A 1 164 ? 18.203 5.778   32.211  1.00 88.72  ? 171 LYS A CG  1 
ATOM   1281 C CD  . LYS A 1 164 ? 17.150 6.588   31.424  1.00 88.10  ? 171 LYS A CD  1 
ATOM   1282 C CE  . LYS A 1 164 ? 15.904 6.900   32.257  1.00 84.67  ? 171 LYS A CE  1 
ATOM   1283 N NZ  . LYS A 1 164 ? 14.890 7.610   31.447  1.00 81.16  ? 171 LYS A NZ  1 
ATOM   1284 N N   . ALA A 1 165 ? 19.449 1.855   34.732  1.00 85.05  ? 172 ALA A N   1 
ATOM   1285 C CA  . ALA A 1 165 ? 19.811 1.428   36.081  1.00 86.48  ? 172 ALA A CA  1 
ATOM   1286 C C   . ALA A 1 165 ? 21.298 1.129   36.030  1.00 88.70  ? 172 ALA A C   1 
ATOM   1287 O O   . ALA A 1 165 ? 21.868 1.079   34.942  1.00 86.38  ? 172 ALA A O   1 
ATOM   1288 C CB  . ALA A 1 165 ? 19.021 0.188   36.492  1.00 83.65  ? 172 ALA A CB  1 
ATOM   1289 N N   . MET A 1 166 ? 21.928 0.937   37.188  1.00 93.70  ? 173 MET A N   1 
ATOM   1290 C CA  . MET A 1 166 ? 23.368 0.658   37.226  1.00 98.81  ? 173 MET A CA  1 
ATOM   1291 C C   . MET A 1 166 ? 23.734 -0.665  36.541  1.00 99.86  ? 173 MET A C   1 
ATOM   1292 O O   . MET A 1 166 ? 24.793 -0.783  35.907  1.00 100.57 ? 173 MET A O   1 
ATOM   1293 C CB  . MET A 1 166 ? 23.919 0.682   38.664  1.00 103.04 ? 173 MET A CB  1 
ATOM   1294 C CG  . MET A 1 166 ? 25.461 0.775   38.711  1.00 108.29 ? 173 MET A CG  1 
ATOM   1295 S SD  . MET A 1 166 ? 26.273 0.794   40.340  1.00 115.05 ? 173 MET A SD  1 
ATOM   1296 C CE  . MET A 1 166 ? 27.749 -0.236  40.002  1.00 111.26 ? 173 MET A CE  1 
ATOM   1297 N N   . ASP A 1 167 ? 22.870 -1.663  36.705  1.00 98.22  ? 174 ASP A N   1 
ATOM   1298 C CA  . ASP A 1 167 ? 23.075 -2.978  36.099  1.00 96.24  ? 174 ASP A CA  1 
ATOM   1299 C C   . ASP A 1 167 ? 22.514 -2.928  34.647  1.00 91.68  ? 174 ASP A C   1 
ATOM   1300 O O   . ASP A 1 167 ? 23.244 -2.647  33.689  1.00 91.47  ? 174 ASP A O   1 
ATOM   1301 C CB  . ASP A 1 167 ? 22.344 -4.044  36.933  1.00 101.57 ? 174 ASP A CB  1 
ATOM   1302 C CG  . ASP A 1 167 ? 23.265 -5.146  37.443  1.00 105.03 ? 174 ASP A CG  1 
ATOM   1303 O OD1 . ASP A 1 167 ? 24.489 -4.875  37.732  1.00 105.13 ? 174 ASP A OD1 1 
ATOM   1304 O OD2 . ASP A 1 167 ? 22.811 -6.343  37.583  1.00 106.14 ? 174 ASP A OD2 1 
ATOM   1305 N N   . SER A 1 168 ? 21.230 -3.209  34.595  1.00 85.24  ? 175 SER A N   1 
ATOM   1306 C CA  . SER A 1 168 ? 20.327 -3.181  33.407  1.00 77.56  ? 175 SER A CA  1 
ATOM   1307 C C   . SER A 1 168 ? 20.942 -3.397  31.984  1.00 71.51  ? 175 SER A C   1 
ATOM   1308 O O   . SER A 1 168 ? 20.426 -2.880  30.982  1.00 72.41  ? 175 SER A O   1 
ATOM   1309 C CB  . SER A 1 168 ? 19.597 -1.844  33.347  1.00 77.40  ? 175 SER A CB  1 
ATOM   1310 O OG  . SER A 1 168 ? 18.672 -1.764  34.423  1.00 80.97  ? 175 SER A OG  1 
ATOM   1311 N N   . LYS A 1 169 ? 22.019 -4.157  31.851  1.00 62.14  ? 176 LYS A N   1 
ATOM   1312 C CA  . LYS A 1 169 ? 22.547 -4.540  30.499  1.00 51.88  ? 176 LYS A CA  1 
ATOM   1313 C C   . LYS A 1 169 ? 22.091 -5.972  30.305  1.00 46.38  ? 176 LYS A C   1 
ATOM   1314 O O   . LYS A 1 169 ? 22.174 -6.789  31.225  1.00 48.33  ? 176 LYS A O   1 
ATOM   1315 C CB  . LYS A 1 169 ? 24.067 -4.397  30.460  1.00 48.77  ? 176 LYS A CB  1 
ATOM   1316 C CG  . LYS A 1 169 ? 24.513 -3.038  29.917  1.00 47.68  ? 176 LYS A CG  1 
ATOM   1317 C CD  . LYS A 1 169 ? 26.023 -2.824  30.000  1.00 53.38  ? 176 LYS A CD  1 
ATOM   1318 C CE  . LYS A 1 169 ? 26.409 -1.349  30.111  1.00 52.19  ? 176 LYS A CE  1 
ATOM   1319 N NZ  . LYS A 1 169 ? 26.003 -0.744  31.388  1.00 57.80  ? 176 LYS A NZ  1 
ATOM   1320 N N   . SER A 1 170 ? 21.578 -6.275  29.126  1.00 37.24  ? 177 SER A N   1 
ATOM   1321 C CA  . SER A 1 170 ? 21.063 -7.600  28.878  1.00 29.14  ? 177 SER A CA  1 
ATOM   1322 C C   . SER A 1 170 ? 21.359 -8.065  27.473  1.00 26.24  ? 177 SER A C   1 
ATOM   1323 O O   . SER A 1 170 ? 21.214 -7.307  26.520  1.00 27.81  ? 177 SER A O   1 
ATOM   1324 C CB  . SER A 1 170 ? 19.557 -7.559  29.110  1.00 27.43  ? 177 SER A CB  1 
ATOM   1325 O OG  . SER A 1 170 ? 18.933 -8.755  28.703  1.00 33.34  ? 177 SER A OG  1 
ATOM   1326 N N   . ASN A 1 171 ? 21.777 -9.314  27.331  1.00 27.81  ? 178 ASN A N   1 
ATOM   1327 C CA  . ASN A 1 171 ? 22.056 -9.849  25.997  1.00 25.09  ? 178 ASN A CA  1 
ATOM   1328 C C   . ASN A 1 171 ? 20.772 -10.455 25.467  1.00 25.92  ? 178 ASN A C   1 
ATOM   1329 O O   . ASN A 1 171 ? 19.970 -10.998 26.217  1.00 26.93  ? 178 ASN A O   1 
ATOM   1330 C CB  . ASN A 1 171 ? 23.127 -10.936 26.027  1.00 25.43  ? 178 ASN A CB  1 
ATOM   1331 C CG  . ASN A 1 171 ? 24.531 -10.383 26.076  1.00 25.16  ? 178 ASN A CG  1 
ATOM   1332 O OD1 . ASN A 1 171 ? 24.874 -9.428  25.376  1.00 23.95  ? 178 ASN A OD1 1 
ATOM   1333 N ND2 . ASN A 1 171 ? 25.364 -10.999 26.893  1.00 25.57  ? 178 ASN A ND2 1 
ATOM   1334 N N   . GLY A 1 172 ? 20.585 -10.383 24.166  1.00 26.27  ? 179 GLY A N   1 
ATOM   1335 C CA  . GLY A 1 172 ? 19.393 -10.940 23.596  1.00 27.04  ? 179 GLY A CA  1 
ATOM   1336 C C   . GLY A 1 172 ? 19.631 -11.312 22.160  1.00 26.89  ? 179 GLY A C   1 
ATOM   1337 O O   . GLY A 1 172 ? 20.551 -10.817 21.520  1.00 29.82  ? 179 GLY A O   1 
ATOM   1338 N N   . ALA A 1 173 ? 18.803 -12.228 21.695  1.00 25.56  ? 180 ALA A N   1 
ATOM   1339 C CA  . ALA A 1 173 ? 18.804 -12.734 20.348  1.00 29.01  ? 180 ALA A CA  1 
ATOM   1340 C C   . ALA A 1 173 ? 17.339 -13.199 20.178  1.00 32.74  ? 180 ALA A C   1 
ATOM   1341 O O   . ALA A 1 173 ? 16.656 -13.517 21.157  1.00 30.09  ? 180 ALA A O   1 
ATOM   1342 C CB  . ALA A 1 173 ? 19.779 -13.893 20.217  1.00 26.89  ? 180 ALA A CB  1 
ATOM   1343 N N   . ILE A 1 174 ? 16.850 -13.165 18.941  1.00 35.79  ? 181 ILE A N   1 
ATOM   1344 C CA  . ILE A 1 174 ? 15.480 -13.530 18.612  1.00 34.92  ? 181 ILE A CA  1 
ATOM   1345 C C   . ILE A 1 174 ? 15.442 -14.634 17.540  1.00 32.30  ? 181 ILE A C   1 
ATOM   1346 O O   . ILE A 1 174 ? 16.273 -14.669 16.647  1.00 31.79  ? 181 ILE A O   1 
ATOM   1347 C CB  . ILE A 1 174 ? 14.706 -12.225 18.185  1.00 34.90  ? 181 ILE A CB  1 
ATOM   1348 C CG1 . ILE A 1 174 ? 14.161 -11.520 19.435  1.00 34.69  ? 181 ILE A CG1 1 
ATOM   1349 C CG2 . ILE A 1 174 ? 13.619 -12.503 17.164  1.00 34.39  ? 181 ILE A CG2 1 
ATOM   1350 C CD1 . ILE A 1 174 ? 14.815 -10.191 19.727  1.00 33.93  ? 181 ILE A CD1 1 
ATOM   1351 N N   . ALA A 1 175 ? 14.517 -15.571 17.675  1.00 35.40  ? 182 ALA A N   1 
ATOM   1352 C CA  . ALA A 1 175 ? 14.381 -16.657 16.707  1.00 36.87  ? 182 ALA A CA  1 
ATOM   1353 C C   . ALA A 1 175 ? 12.903 -16.907 16.404  1.00 39.93  ? 182 ALA A C   1 
ATOM   1354 O O   . ALA A 1 175 ? 12.021 -16.615 17.218  1.00 38.78  ? 182 ALA A O   1 
ATOM   1355 C CB  . ALA A 1 175 ? 15.045 -17.923 17.232  1.00 35.68  ? 182 ALA A CB  1 
ATOM   1356 N N   . TRP A 1 176 ? 12.628 -17.392 15.206  1.00 43.01  ? 183 TRP A N   1 
ATOM   1357 C CA  . TRP A 1 176 ? 11.262 -17.660 14.798  1.00 48.55  ? 183 TRP A CA  1 
ATOM   1358 C C   . TRP A 1 176 ? 11.310 -18.622 13.626  1.00 53.48  ? 183 TRP A C   1 
ATOM   1359 O O   . TRP A 1 176 ? 12.343 -18.751 12.952  1.00 54.01  ? 183 TRP A O   1 
ATOM   1360 C CB  . TRP A 1 176 ? 10.523 -16.362 14.416  1.00 42.83  ? 183 TRP A CB  1 
ATOM   1361 C CG  . TRP A 1 176 ? 11.053 -15.657 13.186  1.00 42.12  ? 183 TRP A CG  1 
ATOM   1362 C CD1 . TRP A 1 176 ? 10.739 -15.933 11.887  1.00 39.87  ? 183 TRP A CD1 1 
ATOM   1363 C CD2 . TRP A 1 176 ? 11.975 -14.548 13.148  1.00 40.46  ? 183 TRP A CD2 1 
ATOM   1364 N NE1 . TRP A 1 176 ? 11.403 -15.068 11.045  1.00 39.56  ? 183 TRP A NE1 1 
ATOM   1365 C CE2 . TRP A 1 176 ? 12.170 -14.212 11.792  1.00 39.08  ? 183 TRP A CE2 1 
ATOM   1366 C CE3 . TRP A 1 176 ? 12.650 -13.809 14.127  1.00 39.88  ? 183 TRP A CE3 1 
ATOM   1367 C CZ2 . TRP A 1 176 ? 13.013 -13.174 11.393  1.00 41.01  ? 183 TRP A CZ2 1 
ATOM   1368 C CZ3 . TRP A 1 176 ? 13.486 -12.776 13.728  1.00 41.13  ? 183 TRP A CZ3 1 
ATOM   1369 C CH2 . TRP A 1 176 ? 13.661 -12.469 12.375  1.00 41.43  ? 183 TRP A CH2 1 
ATOM   1370 N N   . SER A 1 177 ? 10.189 -19.292 13.386  1.00 60.16  ? 184 SER A N   1 
ATOM   1371 C CA  . SER A 1 177 ? 10.099 -20.269 12.315  1.00 64.83  ? 184 SER A CA  1 
ATOM   1372 C C   . SER A 1 177 ? 8.669  -20.355 11.790  1.00 69.75  ? 184 SER A C   1 
ATOM   1373 O O   . SER A 1 177 ? 7.707  -20.091 12.524  1.00 70.09  ? 184 SER A O   1 
ATOM   1374 C CB  . SER A 1 177 ? 10.541 -21.635 12.837  1.00 59.82  ? 184 SER A CB  1 
ATOM   1375 O OG  . SER A 1 177 ? 10.748 -22.529 11.771  1.00 55.67  ? 184 SER A OG  1 
ATOM   1376 N N   . ASN A 1 178 ? 8.542  -20.681 10.506  1.00 76.91  ? 185 ASN A N   1 
ATOM   1377 C CA  . ASN A 1 178 ? 7.232  -20.826 9.878   1.00 83.04  ? 185 ASN A CA  1 
ATOM   1378 C C   . ASN A 1 178 ? 6.823  -22.319 9.903   1.00 85.56  ? 185 ASN A C   1 
ATOM   1379 O O   . ASN A 1 178 ? 5.948  -22.747 9.143   1.00 85.71  ? 185 ASN A O   1 
ATOM   1380 C CB  . ASN A 1 178 ? 7.239  -20.248 8.442   1.00 84.25  ? 185 ASN A CB  1 
ATOM   1381 C CG  . ASN A 1 178 ? 7.896  -21.180 7.425   1.00 85.60  ? 185 ASN A CG  1 
ATOM   1382 O OD1 . ASN A 1 178 ? 8.703  -22.039 7.798   1.00 82.61  ? 185 ASN A OD1 1 
ATOM   1383 N ND2 . ASN A 1 178 ? 7.526  -21.033 6.149   1.00 88.53  ? 185 ASN A ND2 1 
ATOM   1384 N N   . GLN A 1 179 ? 7.457  -23.091 10.791  1.00 87.24  ? 186 GLN A N   1 
ATOM   1385 C CA  . GLN A 1 179 ? 7.183  -24.518 10.940  1.00 90.25  ? 186 GLN A CA  1 
ATOM   1386 C C   . GLN A 1 179 ? 5.954  -24.795 11.812  1.00 94.26  ? 186 GLN A C   1 
ATOM   1387 O O   . GLN A 1 179 ? 5.607  -23.989 12.688  1.00 93.39  ? 186 GLN A O   1 
ATOM   1388 C CB  . GLN A 1 179 ? 8.407  -25.240 11.498  1.00 90.24  ? 186 GLN A CB  1 
ATOM   1389 C CG  . GLN A 1 179 ? 9.649  -25.122 10.619  1.00 93.68  ? 186 GLN A CG  1 
ATOM   1390 C CD  . GLN A 1 179 ? 9.483  -25.761 9.244   1.00 96.21  ? 186 GLN A CD  1 
ATOM   1391 O OE1 . GLN A 1 179 ? 9.414  -26.988 9.121   1.00 96.38  ? 186 GLN A OE1 1 
ATOM   1392 N NE2 . GLN A 1 179 ? 9.423  -24.933 8.205   1.00 95.34  ? 186 GLN A NE2 1 
ATOM   1393 N N   . THR A 1 180 ? 5.341  -25.964 11.586  1.00 98.57  ? 187 THR A N   1 
ATOM   1394 C CA  . THR A 1 180 ? 4.123  -26.412 12.279  1.00 101.30 ? 187 THR A CA  1 
ATOM   1395 C C   . THR A 1 180 ? 4.211  -26.540 13.798  1.00 102.58 ? 187 THR A C   1 
ATOM   1396 O O   . THR A 1 180 ? 3.244  -26.221 14.496  1.00 103.80 ? 187 THR A O   1 
ATOM   1397 C CB  . THR A 1 180 ? 3.597  -27.757 11.702  1.00 102.97 ? 187 THR A CB  1 
ATOM   1398 O OG1 . THR A 1 180 ? 3.494  -27.667 10.272  1.00 102.27 ? 187 THR A OG1 1 
ATOM   1399 C CG2 . THR A 1 180 ? 2.216  -28.097 12.294  1.00 101.97 ? 187 THR A CG2 1 
ATOM   1400 N N   . SER A 1 181 ? 5.321  -27.071 14.307  1.00 102.18 ? 188 SER A N   1 
ATOM   1401 C CA  . SER A 1 181 ? 5.481  -27.201 15.752  1.00 102.37 ? 188 SER A CA  1 
ATOM   1402 C C   . SER A 1 181 ? 6.911  -27.567 16.167  1.00 103.60 ? 188 SER A C   1 
ATOM   1403 O O   . SER A 1 181 ? 7.233  -28.736 16.410  1.00 104.70 ? 188 SER A O   1 
ATOM   1404 C CB  . SER A 1 181 ? 4.497  -28.226 16.337  1.00 102.06 ? 188 SER A CB  1 
ATOM   1405 O OG  . SER A 1 181 ? 4.359  -28.026 17.736  1.00 97.99  ? 188 SER A OG  1 
ATOM   1406 N N   . PHE A 1 182 ? 7.709  -26.523 16.229  1.00 101.67 ? 189 PHE A N   1 
ATOM   1407 C CA  . PHE A 1 182 ? 9.084  -26.563 16.741  1.00 96.49  ? 189 PHE A CA  1 
ATOM   1408 C C   . PHE A 1 182 ? 9.101  -25.574 17.884  1.00 92.85  ? 189 PHE A C   1 
ATOM   1409 O O   . PHE A 1 182 ? 8.562  -24.466 17.766  1.00 91.13  ? 189 PHE A O   1 
ATOM   1410 C CB  . PHE A 1 182 ? 10.089 -26.121 15.676  1.00 96.83  ? 189 PHE A CB  1 
ATOM   1411 C CG  . PHE A 1 182 ? 10.322 -27.142 14.563  1.00 97.20  ? 189 PHE A CG  1 
ATOM   1412 C CD1 . PHE A 1 182 ? 9.358  -28.118 14.287  1.00 98.75  ? 189 PHE A CD1 1 
ATOM   1413 C CD2 . PHE A 1 182 ? 11.503 -27.090 13.815  1.00 97.71  ? 189 PHE A CD2 1 
ATOM   1414 C CE1 . PHE A 1 182 ? 9.567  -29.029 13.244  1.00 98.19  ? 189 PHE A CE1 1 
ATOM   1415 C CE2 . PHE A 1 182 ? 11.708 -27.994 12.768  1.00 98.54  ? 189 PHE A CE2 1 
ATOM   1416 C CZ  . PHE A 1 182 ? 10.739 -28.963 12.481  1.00 99.14  ? 189 PHE A CZ  1 
ATOM   1417 N N   . THR A 1 183 ? 9.695  -25.953 18.979  1.00 89.08  ? 190 THR A N   1 
ATOM   1418 C CA  . THR A 1 183 ? 9.666  -25.087 20.149  1.00 85.91  ? 190 THR A CA  1 
ATOM   1419 C C   . THR A 1 183 ? 10.966 -24.313 20.347  1.00 85.37  ? 190 THR A C   1 
ATOM   1420 O O   . THR A 1 183 ? 11.943 -24.507 19.617  1.00 83.40  ? 190 THR A O   1 
ATOM   1421 C CB  . THR A 1 183 ? 9.352  -25.903 21.401  1.00 85.66  ? 190 THR A CB  1 
ATOM   1422 O OG1 . THR A 1 183 ? 10.220 -27.019 21.487  1.00 78.69  ? 190 THR A OG1 1 
ATOM   1423 C CG2 . THR A 1 183 ? 7.913  -26.433 21.407  1.00 83.59  ? 190 THR A CG2 1 
ATOM   1424 N N   . CYS A 1 184 ? 10.960 -23.424 21.338  1.00 85.14  ? 191 CYS A N   1 
ATOM   1425 C CA  . CYS A 1 184 ? 12.127 -22.614 21.676  1.00 84.21  ? 191 CYS A CA  1 
ATOM   1426 C C   . CYS A 1 184 ? 13.221 -23.476 22.319  1.00 85.93  ? 191 CYS A C   1 
ATOM   1427 O O   . CYS A 1 184 ? 14.384 -23.067 22.379  1.00 87.25  ? 191 CYS A O   1 
ATOM   1428 C CB  . CYS A 1 184 ? 11.728 -21.496 22.641  1.00 81.59  ? 191 CYS A CB  1 
ATOM   1429 S SG  . CYS A 1 184 ? 10.261 -20.562 22.129  1.00 80.49  ? 191 CYS A SG  1 
ATOM   1430 N N   . GLN A 1 185 ? 12.846 -24.676 22.770  1.00 86.62  ? 192 GLN A N   1 
ATOM   1431 C CA  . GLN A 1 185 ? 13.775 -25.599 23.421  1.00 86.11  ? 192 GLN A CA  1 
ATOM   1432 C C   . GLN A 1 185 ? 14.783 -26.220 22.471  1.00 86.25  ? 192 GLN A C   1 
ATOM   1433 O O   . GLN A 1 185 ? 15.906 -26.510 22.866  1.00 85.40  ? 192 GLN A O   1 
ATOM   1434 C CB  . GLN A 1 185 ? 13.016 -26.719 24.152  1.00 87.47  ? 192 GLN A CB  1 
ATOM   1435 C CG  . GLN A 1 185 ? 12.414 -26.347 25.523  1.00 87.98  ? 192 GLN A CG  1 
ATOM   1436 C CD  . GLN A 1 185 ? 10.912 -26.019 25.489  1.00 87.70  ? 192 GLN A CD  1 
ATOM   1437 O OE1 . GLN A 1 185 ? 10.373 -25.569 24.470  1.00 86.47  ? 192 GLN A OE1 1 
ATOM   1438 N NE2 . GLN A 1 185 ? 10.240 -26.231 26.618  1.00 86.91  ? 192 GLN A NE2 1 
ATOM   1439 N N   . ASP A 1 186 ? 14.394 -26.407 21.217  1.00 87.51  ? 193 ASP A N   1 
ATOM   1440 C CA  . ASP A 1 186 ? 15.286 -27.029 20.248  1.00 90.73  ? 193 ASP A CA  1 
ATOM   1441 C C   . ASP A 1 186 ? 16.030 -26.091 19.313  1.00 90.34  ? 193 ASP A C   1 
ATOM   1442 O O   . ASP A 1 186 ? 17.134 -26.412 18.874  1.00 92.00  ? 193 ASP A O   1 
ATOM   1443 C CB  . ASP A 1 186 ? 14.552 -28.110 19.448  1.00 96.21  ? 193 ASP A CB  1 
ATOM   1444 C CG  . ASP A 1 186 ? 13.250 -27.611 18.828  1.00 101.05 ? 193 ASP A CG  1 
ATOM   1445 O OD1 . ASP A 1 186 ? 12.332 -27.217 19.587  1.00 102.10 ? 193 ASP A OD1 1 
ATOM   1446 O OD2 . ASP A 1 186 ? 13.137 -27.639 17.580  1.00 103.24 ? 193 ASP A OD2 1 
ATOM   1447 N N   . ILE A 1 187 ? 15.429 -24.951 18.979  1.00 88.54  ? 194 ILE A N   1 
ATOM   1448 C CA  . ILE A 1 187 ? 16.086 -23.976 18.103  1.00 86.31  ? 194 ILE A CA  1 
ATOM   1449 C C   . ILE A 1 187 ? 17.266 -23.334 18.850  1.00 86.04  ? 194 ILE A C   1 
ATOM   1450 O O   . ILE A 1 187 ? 18.259 -22.918 18.252  1.00 85.94  ? 194 ILE A O   1 
ATOM   1451 C CB  . ILE A 1 187 ? 15.085 -22.912 17.583  1.00 86.44  ? 194 ILE A CB  1 
ATOM   1452 C CG1 . ILE A 1 187 ? 15.811 -21.809 16.823  1.00 83.56  ? 194 ILE A CG1 1 
ATOM   1453 C CG2 . ILE A 1 187 ? 14.270 -22.330 18.721  1.00 89.15  ? 194 ILE A CG2 1 
ATOM   1454 C CD1 . ILE A 1 187 ? 14.878 -20.903 16.098  1.00 84.75  ? 194 ILE A CD1 1 
ATOM   1455 N N   . PHE A 1 188 ? 17.149 -23.278 20.170  1.00 85.50  ? 195 PHE A N   1 
ATOM   1456 C CA  . PHE A 1 188 ? 18.195 -22.744 21.026  1.00 85.09  ? 195 PHE A CA  1 
ATOM   1457 C C   . PHE A 1 188 ? 18.619 -23.939 21.899  1.00 88.95  ? 195 PHE A C   1 
ATOM   1458 O O   . PHE A 1 188 ? 18.642 -23.841 23.128  1.00 90.97  ? 195 PHE A O   1 
ATOM   1459 C CB  . PHE A 1 188 ? 17.637 -21.616 21.914  1.00 77.38  ? 195 PHE A CB  1 
ATOM   1460 C CG  . PHE A 1 188 ? 17.471 -20.280 21.215  1.00 69.47  ? 195 PHE A CG  1 
ATOM   1461 C CD1 . PHE A 1 188 ? 18.565 -19.456 20.985  1.00 65.74  ? 195 PHE A CD1 1 
ATOM   1462 C CD2 . PHE A 1 188 ? 16.210 -19.808 20.866  1.00 67.93  ? 195 PHE A CD2 1 
ATOM   1463 C CE1 . PHE A 1 188 ? 18.410 -18.181 20.427  1.00 61.62  ? 195 PHE A CE1 1 
ATOM   1464 C CE2 . PHE A 1 188 ? 16.049 -18.528 20.304  1.00 64.13  ? 195 PHE A CE2 1 
ATOM   1465 C CZ  . PHE A 1 188 ? 17.153 -17.719 20.090  1.00 59.95  ? 195 PHE A CZ  1 
ATOM   1466 N N   . LYS A 1 189 ? 18.941 -25.069 21.266  1.00 91.12  ? 196 LYS A N   1 
ATOM   1467 C CA  . LYS A 1 189 ? 19.321 -26.283 21.999  1.00 94.48  ? 196 LYS A CA  1 
ATOM   1468 C C   . LYS A 1 189 ? 20.633 -26.218 22.781  1.00 95.75  ? 196 LYS A C   1 
ATOM   1469 O O   . LYS A 1 189 ? 20.828 -26.960 23.746  1.00 95.79  ? 196 LYS A O   1 
ATOM   1470 C CB  . LYS A 1 189 ? 19.372 -27.497 21.064  1.00 96.50  ? 196 LYS A CB  1 
ATOM   1471 C CG  . LYS A 1 189 ? 19.639 -28.816 21.801  1.00 100.09 ? 196 LYS A CG  1 
ATOM   1472 C CD  . LYS A 1 189 ? 20.035 -29.964 20.867  1.00 104.29 ? 196 LYS A CD  1 
ATOM   1473 C CE  . LYS A 1 189 ? 20.404 -31.228 21.662  1.00 105.75 ? 196 LYS A CE  1 
ATOM   1474 N NZ  . LYS A 1 189 ? 20.871 -32.355 20.798  1.00 104.15 ? 196 LYS A NZ  1 
ATOM   1475 N N   . GLU A 1 190 ? 21.540 -25.351 22.352  1.00 96.32  ? 197 GLU A N   1 
ATOM   1476 C CA  . GLU A 1 190 ? 22.839 -25.223 23.001  1.00 95.66  ? 197 GLU A CA  1 
ATOM   1477 C C   . GLU A 1 190 ? 22.838 -24.116 24.060  1.00 95.07  ? 197 GLU A C   1 
ATOM   1478 O O   . GLU A 1 190 ? 23.609 -23.155 23.960  1.00 95.35  ? 197 GLU A O   1 
ATOM   1479 C CB  . GLU A 1 190 ? 23.906 -24.955 21.934  1.00 96.37  ? 197 GLU A CB  1 
ATOM   1480 C CG  . GLU A 1 190 ? 23.705 -25.730 20.623  1.00 98.40  ? 197 GLU A CG  1 
ATOM   1481 C CD  . GLU A 1 190 ? 23.839 -27.244 20.772  1.00 101.54 ? 197 GLU A CD  1 
ATOM   1482 O OE1 . GLU A 1 190 ? 23.179 -27.844 21.650  1.00 103.26 ? 197 GLU A OE1 1 
ATOM   1483 O OE2 . GLU A 1 190 ? 24.601 -27.844 19.986  1.00 102.41 ? 197 GLU A OE2 1 
ATOM   1484 N N   . THR A 1 191 ? 22.009 -24.279 25.093  1.00 93.14  ? 198 THR A N   1 
ATOM   1485 C CA  . THR A 1 191 ? 21.903 -23.267 26.141  1.00 91.70  ? 198 THR A CA  1 
ATOM   1486 C C   . THR A 1 191 ? 21.193 -23.710 27.439  1.00 89.76  ? 198 THR A C   1 
ATOM   1487 O O   . THR A 1 191 ? 21.026 -24.899 27.712  1.00 90.48  ? 198 THR A O   1 
ATOM   1488 C CB  . THR A 1 191 ? 21.307 -21.959 25.559  1.00 92.76  ? 198 THR A CB  1 
ATOM   1489 O OG1 . THR A 1 191 ? 20.679 -22.224 24.313  1.00 91.91  ? 198 THR A OG1 1 
ATOM   1490 C CG2 . THR A 1 191 ? 22.367 -20.883 25.321  1.00 91.53  ? 198 THR A CG2 1 
ATOM   1491 N N   . ASN A 1 192 ? 20.801 -22.711 28.259  1.00 86.82  ? 203 ASN A N   1 
ATOM   1492 C CA  . ASN A 1 192 ? 20.255 -23.000 29.608  1.00 84.35  ? 203 ASN A CA  1 
ATOM   1493 C C   . ASN A 1 192 ? 18.968 -22.194 30.006  1.00 79.64  ? 203 ASN A C   1 
ATOM   1494 O O   . ASN A 1 192 ? 18.826 -21.008 29.667  1.00 73.82  ? 203 ASN A O   1 
ATOM   1495 C CB  . ASN A 1 192 ? 21.345 -22.682 30.660  1.00 88.95  ? 203 ASN A CB  1 
ATOM   1496 C CG  . ASN A 1 192 ? 22.764 -23.005 30.177  1.00 93.18  ? 203 ASN A CG  1 
ATOM   1497 O OD1 . ASN A 1 192 ? 23.114 -22.697 29.037  1.00 92.47  ? 203 ASN A OD1 1 
ATOM   1498 N ND2 . ASN A 1 192 ? 23.616 -23.613 30.983  1.00 97.49  ? 203 ASN A ND2 1 
ATOM   1499 N N   . ALA A 1 193 ? 18.101 -22.951 30.715  1.00 79.33  ? 204 ALA A N   1 
ATOM   1500 C CA  . ALA A 1 193 ? 16.863 -22.502 31.454  1.00 80.12  ? 204 ALA A CA  1 
ATOM   1501 C C   . ALA A 1 193 ? 15.646 -22.046 30.624  1.00 79.53  ? 204 ALA A C   1 
ATOM   1502 O O   . ALA A 1 193 ? 15.259 -20.871 30.655  1.00 77.98  ? 204 ALA A O   1 
ATOM   1503 C CB  . ALA A 1 193 ? 17.179 -21.299 32.344  1.00 81.50  ? 204 ALA A CB  1 
ATOM   1504 N N   . THR A 1 194 ? 14.992 -22.981 29.951  1.00 81.87  ? 205 THR A N   1 
ATOM   1505 C CA  . THR A 1 194 ? 13.821 -22.653 29.097  1.00 82.95  ? 205 THR A CA  1 
ATOM   1506 C C   . THR A 1 194 ? 12.512 -22.533 29.897  1.00 85.15  ? 205 THR A C   1 
ATOM   1507 O O   . THR A 1 194 ? 11.873 -23.539 30.244  1.00 84.61  ? 205 THR A O   1 
ATOM   1508 C CB  . THR A 1 194 ? 13.587 -23.737 28.047  1.00 81.97  ? 205 THR A CB  1 
ATOM   1509 O OG1 . THR A 1 194 ? 14.711 -23.824 27.186  1.00 79.16  ? 205 THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 194 ? 12.359 -23.453 27.178  1.00 82.37  ? 205 THR A CG2 1 
ATOM   1511 N N   . TYR A 1 195 ? 12.108 -21.290 30.154  1.00 88.94  ? 206 TYR A N   1 
ATOM   1512 C CA  . TYR A 1 195 ? 10.869 -21.040 30.904  1.00 94.65  ? 206 TYR A CA  1 
ATOM   1513 C C   . TYR A 1 195 ? 9.694  -20.884 29.980  1.00 98.65  ? 206 TYR A C   1 
ATOM   1514 O O   . TYR A 1 195 ? 9.502  -19.828 29.378  1.00 99.82  ? 206 TYR A O   1 
ATOM   1515 C CB  . TYR A 1 195 ? 10.989 -19.851 31.843  1.00 98.57  ? 206 TYR A CB  1 
ATOM   1516 C CG  . TYR A 1 195 ? 10.744 -20.310 33.281  1.00 107.65 ? 206 TYR A CG  1 
ATOM   1517 C CD1 . TYR A 1 195 ? 11.736 -21.032 33.952  1.00 109.18 ? 206 TYR A CD1 1 
ATOM   1518 C CD2 . TYR A 1 195 ? 9.527  -20.038 33.921  1.00 110.23 ? 206 TYR A CD2 1 
ATOM   1519 C CE1 . TYR A 1 195 ? 11.510 -21.496 35.252  1.00 108.87 ? 206 TYR A CE1 1 
ATOM   1520 C CE2 . TYR A 1 195 ? 9.298  -20.509 35.221  1.00 109.10 ? 206 TYR A CE2 1 
ATOM   1521 C CZ  . TYR A 1 195 ? 10.289 -21.241 35.885  1.00 109.01 ? 206 TYR A CZ  1 
ATOM   1522 O OH  . TYR A 1 195 ? 10.067 -21.709 37.144  1.00 107.96 ? 206 TYR A OH  1 
ATOM   1523 N N   . PRO A 1 196 ? 8.862  -21.936 29.887  1.00 102.93 ? 207 PRO A N   1 
ATOM   1524 C CA  . PRO A 1 196 ? 7.659  -22.037 29.059  1.00 106.03 ? 207 PRO A CA  1 
ATOM   1525 C C   . PRO A 1 196 ? 6.479  -21.213 29.542  1.00 107.60 ? 207 PRO A C   1 
ATOM   1526 O O   . PRO A 1 196 ? 6.183  -21.154 30.747  1.00 105.43 ? 207 PRO A O   1 
ATOM   1527 C CB  . PRO A 1 196 ? 7.331  -23.524 29.129  1.00 105.67 ? 207 PRO A CB  1 
ATOM   1528 C CG  . PRO A 1 196 ? 7.650  -23.834 30.529  1.00 105.17 ? 207 PRO A CG  1 
ATOM   1529 C CD  . PRO A 1 196 ? 9.009  -23.157 30.696  1.00 103.92 ? 207 PRO A CD  1 
ATOM   1530 N N   . SER A 1 197 ? 5.784  -20.621 28.574  1.00 110.74 ? 208 SER A N   1 
ATOM   1531 C CA  . SER A 1 197 ? 4.614  -19.813 28.848  1.00 112.70 ? 208 SER A CA  1 
ATOM   1532 C C   . SER A 1 197 ? 3.462  -20.684 29.243  1.00 116.45 ? 208 SER A C   1 
ATOM   1533 O O   . SER A 1 197 ? 2.483  -20.828 28.492  1.00 115.65 ? 208 SER A O   1 
ATOM   1534 C CB  . SER A 1 197 ? 4.241  -18.955 27.632  1.00 109.31 ? 208 SER A CB  1 
ATOM   1535 O OG  . SER A 1 197 ? 3.691  -17.718 28.061  1.00 102.34 ? 208 SER A OG  1 
ATOM   1536 N N   . SER A 1 198 ? 3.688  -21.272 30.377  1.00 121.30 ? 209 SER A N   1 
ATOM   1537 C CA  . SER A 1 198 ? 2.613  -21.809 31.145  1.00 125.12 ? 209 SER A CA  1 
ATOM   1538 C C   . SER A 1 198 ? 2.276  -20.549 31.868  1.00 127.56 ? 209 SER A C   1 
ATOM   1539 O O   . SER A 1 198 ? 3.179  -19.800 32.264  1.00 128.34 ? 209 SER A O   1 
ATOM   1540 C CB  . SER A 1 198 ? 3.078  -22.939 32.063  1.00 126.04 ? 209 SER A CB  1 
ATOM   1541 O OG  . SER A 1 198 ? 4.119  -23.676 31.460  1.00 125.48 ? 209 SER A OG  1 
ATOM   1542 N N   . ASP A 1 199 ? 1.056  -20.255 32.015  1.00 129.36 ? 210 ASP A N   1 
ATOM   1543 C CA  . ASP A 1 199 ? 0.707  -18.974 32.594  1.00 131.59 ? 210 ASP A CA  1 
ATOM   1544 C C   . ASP A 1 199 ? -0.038 -19.231 33.901  1.00 133.24 ? 210 ASP A C   1 
ATOM   1545 O O   . ASP A 1 199 ? -0.783 -20.208 34.025  1.00 134.94 ? 210 ASP A O   1 
ATOM   1546 C CB  . ASP A 1 199 ? -0.057 -18.249 31.483  1.00 132.75 ? 210 ASP A CB  1 
ATOM   1547 C CG  . ASP A 1 199 ? -1.085 -17.244 31.949  1.00 133.40 ? 210 ASP A CG  1 
ATOM   1548 O OD1 . ASP A 1 199 ? -0.869 -16.559 33.011  1.00 135.27 ? 210 ASP A OD1 1 
ATOM   1549 O OD2 . ASP A 1 199 ? -2.162 -17.073 31.260  1.00 130.88 ? 210 ASP A OD2 1 
ATOM   1550 N N   . VAL A 1 200 ? 0.181  -18.368 34.895  1.00 133.61 ? 211 VAL A N   1 
ATOM   1551 C CA  . VAL A 1 200 ? -0.513 -18.537 36.189  1.00 133.63 ? 211 VAL A CA  1 
ATOM   1552 C C   . VAL A 1 200 ? -1.002 -17.226 36.792  1.00 135.07 ? 211 VAL A C   1 
ATOM   1553 O O   . VAL A 1 200 ? -0.227 -16.285 36.966  1.00 133.92 ? 211 VAL A O   1 
ATOM   1554 C CB  . VAL A 1 200 ? 0.357  -19.234 37.236  1.00 132.23 ? 211 VAL A CB  1 
ATOM   1555 C CG1 . VAL A 1 200 ? 0.206  -20.759 37.210  1.00 130.80 ? 211 VAL A CG1 1 
ATOM   1556 C CG2 . VAL A 1 200 ? 1.844  -18.954 37.076  1.00 131.45 ? 211 VAL A CG2 1 
ATOM   1557 N N   . PRO A 1 201 ? -2.315 -17.140 37.066  1.00 136.99 ? 212 PRO A N   1 
ATOM   1558 C CA  . PRO A 1 201 ? -2.989 -15.976 37.652  1.00 137.92 ? 212 PRO A CA  1 
ATOM   1559 C C   . PRO A 1 201 ? -2.377 -15.534 38.989  1.00 137.86 ? 212 PRO A C   1 
ATOM   1560 O O   . PRO A 1 201 ? -2.178 -14.341 39.228  1.00 138.15 ? 212 PRO A O   1 
ATOM   1561 C CB  . PRO A 1 201 ? -4.421 -16.486 37.832  1.00 138.18 ? 212 PRO A CB  1 
ATOM   1562 C CG  . PRO A 1 201 ? -4.602 -17.362 36.637  1.00 137.80 ? 212 PRO A CG  1 
ATOM   1563 C CD  . PRO A 1 201 ? -3.308 -18.155 36.656  1.00 138.13 ? 212 PRO A CD  1 
ATOM   1564 N N   . CYS A 1 202 ? -2.059 -16.505 39.842  1.00 138.05 ? 213 CYS A N   1 
ATOM   1565 C CA  . CYS A 1 202 ? -1.472 -16.237 41.154  1.00 137.14 ? 213 CYS A CA  1 
ATOM   1566 C C   . CYS A 1 202 ? -0.393 -17.287 41.478  1.00 136.62 ? 213 CYS A C   1 
ATOM   1567 O O   . CYS A 1 202 ? 0.149  -17.881 40.518  1.00 135.94 ? 213 CYS A O   1 
ATOM   1568 C CB  . CYS A 1 202 ? -2.569 -16.243 42.228  1.00 136.42 ? 213 CYS A CB  1 
ATOM   1569 S SG  . CYS A 1 202 ? -4.061 -15.285 41.813  1.00 135.83 ? 213 CYS A SG  1 
ATOM   1570 O OXT . CYS A 1 202 ? -0.090 -17.510 42.674  1.00 135.06 ? 213 CYS A OXT 1 
ATOM   1571 N N   . GLU B 2 1   ? 29.451 27.762  12.551  1.00 98.27  ? 1   GLU B N   1 
ATOM   1572 C CA  . GLU B 2 1   ? 28.518 26.674  12.117  1.00 96.60  ? 1   GLU B CA  1 
ATOM   1573 C C   . GLU B 2 1   ? 29.164 25.289  12.280  1.00 92.91  ? 1   GLU B C   1 
ATOM   1574 O O   . GLU B 2 1   ? 30.305 25.171  12.746  1.00 93.05  ? 1   GLU B O   1 
ATOM   1575 C CB  . GLU B 2 1   ? 28.074 26.888  10.652  1.00 99.91  ? 1   GLU B CB  1 
ATOM   1576 C CG  . GLU B 2 1   ? 26.640 27.441  10.453  1.00 102.38 ? 1   GLU B CG  1 
ATOM   1577 C CD  . GLU B 2 1   ? 25.541 26.405  10.723  1.00 104.45 ? 1   GLU B CD  1 
ATOM   1578 O OE1 . GLU B 2 1   ? 25.445 25.411  9.972   1.00 104.15 ? 1   GLU B OE1 1 
ATOM   1579 O OE2 . GLU B 2 1   ? 24.763 26.588  11.685  1.00 105.21 ? 1   GLU B OE2 1 
ATOM   1580 N N   . ALA B 2 2   ? 28.401 24.255  11.929  1.00 86.13  ? 2   ALA B N   1 
ATOM   1581 C CA  . ALA B 2 2   ? 28.852 22.872  11.996  1.00 77.96  ? 2   ALA B CA  1 
ATOM   1582 C C   . ALA B 2 2   ? 27.864 22.029  11.165  1.00 72.57  ? 2   ALA B C   1 
ATOM   1583 O O   . ALA B 2 2   ? 26.803 21.628  11.658  1.00 72.30  ? 2   ALA B O   1 
ATOM   1584 C CB  . ALA B 2 2   ? 28.844 22.389  13.455  1.00 75.93  ? 2   ALA B CB  1 
ATOM   1585 N N   . ALA B 2 3   ? 28.179 21.764  9.879   1.00 64.83  ? 3   ALA B N   1 
ATOM   1586 C CA  . ALA B 2 3   ? 27.233 20.965  9.055   1.00 54.49  ? 3   ALA B CA  1 
ATOM   1587 C C   . ALA B 2 3   ? 27.686 20.599  7.612   1.00 49.78  ? 3   ALA B C   1 
ATOM   1588 O O   . ALA B 2 3   ? 28.273 21.409  6.883   1.00 49.17  ? 3   ALA B O   1 
ATOM   1589 C CB  . ALA B 2 3   ? 25.915 21.726  8.883   1.00 54.81  ? 3   ALA B CB  1 
ATOM   1590 N N   . VAL B 2 4   ? 27.351 19.346  7.297   1.00 45.60  ? 4   VAL B N   1 
ATOM   1591 C CA  . VAL B 2 4   ? 27.473 18.710  5.965   1.00 39.02  ? 4   VAL B CA  1 
ATOM   1592 C C   . VAL B 2 4   ? 26.205 17.883  5.799   1.00 37.64  ? 4   VAL B C   1 
ATOM   1593 O O   . VAL B 2 4   ? 25.975 16.914  6.539   1.00 35.96  ? 4   VAL B O   1 
ATOM   1594 C CB  . VAL B 2 4   ? 28.704 17.800  5.847   1.00 37.87  ? 4   VAL B CB  1 
ATOM   1595 C CG1 . VAL B 2 4   ? 28.746 17.042  4.508   1.00 35.20  ? 4   VAL B CG1 1 
ATOM   1596 C CG2 . VAL B 2 4   ? 30.027 18.560  5.925   1.00 36.56  ? 4   VAL B CG2 1 
ATOM   1597 N N   . THR B 2 5   ? 25.396 18.294  4.849   1.00 37.08  ? 5   THR B N   1 
ATOM   1598 C CA  . THR B 2 5   ? 24.079 17.689  4.651   1.00 29.61  ? 5   THR B CA  1 
ATOM   1599 C C   . THR B 2 5   ? 23.914 17.042  3.303   1.00 27.11  ? 5   THR B C   1 
ATOM   1600 O O   . THR B 2 5   ? 24.163 17.666  2.294   1.00 29.60  ? 5   THR B O   1 
ATOM   1601 C CB  . THR B 2 5   ? 23.010 18.769  4.788   1.00 29.09  ? 5   THR B CB  1 
ATOM   1602 O OG1 . THR B 2 5   ? 23.016 19.285  6.112   1.00 31.92  ? 5   THR B OG1 1 
ATOM   1603 C CG2 . THR B 2 5   ? 21.603 18.255  4.494   1.00 29.48  ? 5   THR B CG2 1 
ATOM   1604 N N   . GLN B 2 6   ? 23.453 15.798  3.292   1.00 28.02  ? 6   GLN B N   1 
ATOM   1605 C CA  . GLN B 2 6   ? 23.230 15.060  2.049   1.00 23.79  ? 6   GLN B CA  1 
ATOM   1606 C C   . GLN B 2 6   ? 21.752 14.936  1.770   1.00 23.19  ? 6   GLN B C   1 
ATOM   1607 O O   . GLN B 2 6   ? 20.929 14.921  2.681   1.00 23.20  ? 6   GLN B O   1 
ATOM   1608 C CB  . GLN B 2 6   ? 23.799 13.634  2.127   1.00 22.55  ? 6   GLN B CB  1 
ATOM   1609 C CG  . GLN B 2 6   ? 25.298 13.549  2.059   1.00 23.79  ? 6   GLN B CG  1 
ATOM   1610 C CD  . GLN B 2 6   ? 25.801 12.151  2.250   1.00 27.22  ? 6   GLN B CD  1 
ATOM   1611 O OE1 . GLN B 2 6   ? 26.649 11.912  3.106   1.00 28.61  ? 6   GLN B OE1 1 
ATOM   1612 N NE2 . GLN B 2 6   ? 25.292 11.214  1.459   1.00 29.37  ? 6   GLN B NE2 1 
ATOM   1613 N N   . SER B 2 7   ? 21.422 14.807  0.499   1.00 23.79  ? 7   SER B N   1 
ATOM   1614 C CA  . SER B 2 7   ? 20.050 14.629  0.108   1.00 25.04  ? 7   SER B CA  1 
ATOM   1615 C C   . SER B 2 7   ? 20.038 14.056  -1.292  1.00 24.99  ? 7   SER B C   1 
ATOM   1616 O O   . SER B 2 7   ? 20.884 14.381  -2.127  1.00 25.25  ? 7   SER B O   1 
ATOM   1617 C CB  . SER B 2 7   ? 19.282 15.944  0.153   1.00 24.59  ? 7   SER B CB  1 
ATOM   1618 O OG  . SER B 2 7   ? 19.697 16.775  -0.900  1.00 32.61  ? 7   SER B OG  1 
ATOM   1619 N N   . PRO B 2 8   ? 19.159 13.082  -1.522  1.00 26.97  ? 8   PRO B N   1 
ATOM   1620 C CA  . PRO B 2 8   ? 18.245 12.572  -0.497  1.00 23.19  ? 8   PRO B CA  1 
ATOM   1621 C C   . PRO B 2 8   ? 19.028 11.625  0.381   1.00 23.82  ? 8   PRO B C   1 
ATOM   1622 O O   . PRO B 2 8   ? 20.145 11.253  0.036   1.00 29.44  ? 8   PRO B O   1 
ATOM   1623 C CB  . PRO B 2 8   ? 17.207 11.834  -1.320  1.00 26.07  ? 8   PRO B CB  1 
ATOM   1624 C CG  . PRO B 2 8   ? 18.010 11.310  -2.455  1.00 26.50  ? 8   PRO B CG  1 
ATOM   1625 C CD  . PRO B 2 8   ? 18.906 12.454  -2.827  1.00 25.34  ? 8   PRO B CD  1 
ATOM   1626 N N   . ARG B 2 9   ? 18.478 11.257  1.522   1.00 21.83  ? 9   ARG B N   1 
ATOM   1627 C CA  . ARG B 2 9   ? 19.159 10.348  2.426   1.00 18.80  ? 9   ARG B CA  1 
ATOM   1628 C C   . ARG B 2 9   ? 18.941 8.904   1.969   1.00 19.24  ? 9   ARG B C   1 
ATOM   1629 O O   . ARG B 2 9   ? 19.727 8.030   2.286   1.00 19.85  ? 9   ARG B O   1 
ATOM   1630 C CB  . ARG B 2 9   ? 18.603 10.540  3.817   1.00 15.37  ? 9   ARG B CB  1 
ATOM   1631 C CG  . ARG B 2 9   ? 18.587 11.975  4.252   1.00 23.46  ? 9   ARG B CG  1 
ATOM   1632 C CD  . ARG B 2 9   ? 19.858 12.309  4.988   1.00 33.94  ? 9   ARG B CD  1 
ATOM   1633 N NE  . ARG B 2 9   ? 19.903 11.635  6.288   1.00 40.35  ? 9   ARG B NE  1 
ATOM   1634 C CZ  . ARG B 2 9   ? 20.920 10.889  6.697   1.00 39.39  ? 9   ARG B CZ  1 
ATOM   1635 N NH1 . ARG B 2 9   ? 21.966 10.742  5.893   1.00 43.16  ? 9   ARG B NH1 1 
ATOM   1636 N NH2 . ARG B 2 9   ? 20.895 10.305  7.895   1.00 32.60  ? 9   ARG B NH2 1 
ATOM   1637 N N   . ASN B 2 10  ? 17.850 8.674   1.246   1.00 19.78  ? 10  ASN B N   1 
ATOM   1638 C CA  . ASN B 2 10  ? 17.475 7.363   0.728   1.00 20.46  ? 10  ASN B CA  1 
ATOM   1639 C C   . ASN B 2 10  ? 17.011 7.468   -0.722  1.00 20.86  ? 10  ASN B C   1 
ATOM   1640 O O   . ASN B 2 10  ? 16.321 8.416   -1.092  1.00 22.04  ? 10  ASN B O   1 
ATOM   1641 C CB  . ASN B 2 10  ? 16.340 6.784   1.548   1.00 17.49  ? 10  ASN B CB  1 
ATOM   1642 C CG  . ASN B 2 10  ? 16.681 6.677   3.004   1.00 18.63  ? 10  ASN B CG  1 
ATOM   1643 O OD1 . ASN B 2 10  ? 17.241 5.678   3.447   1.00 24.37  ? 10  ASN B OD1 1 
ATOM   1644 N ND2 . ASN B 2 10  ? 16.337 7.698   3.770   1.00 20.49  ? 10  ASN B ND2 1 
ATOM   1645 N N   . LYS B 2 11  ? 17.316 6.466   -1.531  1.00 18.43  ? 11  LYS B N   1 
ATOM   1646 C CA  . LYS B 2 11  ? 16.910 6.530   -2.915  1.00 19.78  ? 11  LYS B CA  1 
ATOM   1647 C C   . LYS B 2 11  ? 16.836 5.154   -3.592  1.00 19.81  ? 11  LYS B C   1 
ATOM   1648 O O   . LYS B 2 11  ? 17.629 4.273   -3.299  1.00 21.24  ? 11  LYS B O   1 
ATOM   1649 C CB  . LYS B 2 11  ? 17.886 7.466   -3.644  1.00 20.58  ? 11  LYS B CB  1 
ATOM   1650 C CG  . LYS B 2 11  ? 17.709 7.608   -5.147  1.00 21.05  ? 11  LYS B CG  1 
ATOM   1651 C CD  . LYS B 2 11  ? 16.424 8.332   -5.529  1.00 20.11  ? 11  LYS B CD  1 
ATOM   1652 C CE  . LYS B 2 11  ? 16.203 8.275   -7.035  1.00 18.94  ? 11  LYS B CE  1 
ATOM   1653 N NZ  . LYS B 2 11  ? 14.926 8.978   -7.399  1.00 26.19  ? 11  LYS B NZ  1 
ATOM   1654 N N   . VAL B 2 12  ? 15.805 4.944   -4.412  1.00 24.36  ? 12  VAL B N   1 
ATOM   1655 C CA  . VAL B 2 12  ? 15.651 3.701   -5.175  1.00 25.18  ? 12  VAL B CA  1 
ATOM   1656 C C   . VAL B 2 12  ? 15.602 4.137   -6.624  1.00 27.04  ? 12  VAL B C   1 
ATOM   1657 O O   . VAL B 2 12  ? 14.861 5.057   -6.969  1.00 25.39  ? 12  VAL B O   1 
ATOM   1658 C CB  . VAL B 2 12  ? 14.353 2.912   -4.884  1.00 24.56  ? 12  VAL B CB  1 
ATOM   1659 C CG1 . VAL B 2 12  ? 14.479 1.495   -5.486  1.00 22.60  ? 12  VAL B CG1 1 
ATOM   1660 C CG2 . VAL B 2 12  ? 14.076 2.848   -3.390  1.00 19.70  ? 12  VAL B CG2 1 
ATOM   1661 N N   . ALA B 2 13  ? 16.452 3.514   -7.433  1.00 27.52  ? 13  ALA B N   1 
ATOM   1662 C CA  . ALA B 2 13  ? 16.566 3.795   -8.860  1.00 32.92  ? 13  ALA B CA  1 
ATOM   1663 C C   . ALA B 2 13  ? 16.534 2.497   -9.705  1.00 34.78  ? 13  ALA B C   1 
ATOM   1664 O O   . ALA B 2 13  ? 16.806 1.413   -9.200  1.00 33.10  ? 13  ALA B O   1 
ATOM   1665 C CB  . ALA B 2 13  ? 17.854 4.596   -9.144  1.00 30.11  ? 13  ALA B CB  1 
ATOM   1666 N N   . VAL B 2 14  ? 16.161 2.622   -10.978 1.00 37.65  ? 14  VAL B N   1 
ATOM   1667 C CA  . VAL B 2 14  ? 16.084 1.487   -11.881 1.00 37.80  ? 14  VAL B CA  1 
ATOM   1668 C C   . VAL B 2 14  ? 17.326 1.549   -12.748 1.00 39.75  ? 14  VAL B C   1 
ATOM   1669 O O   . VAL B 2 14  ? 17.890 2.631   -12.939 1.00 40.00  ? 14  VAL B O   1 
ATOM   1670 C CB  . VAL B 2 14  ? 14.818 1.584   -12.781 1.00 37.34  ? 14  VAL B CB  1 
ATOM   1671 C CG1 . VAL B 2 14  ? 14.811 0.483   -13.813 1.00 37.99  ? 14  VAL B CG1 1 
ATOM   1672 C CG2 . VAL B 2 14  ? 13.573 1.468   -11.946 1.00 33.55  ? 14  VAL B CG2 1 
ATOM   1673 N N   . THR B 2 15  ? 17.778 0.396   -13.237 1.00 42.07  ? 15  THR B N   1 
ATOM   1674 C CA  . THR B 2 15  ? 18.944 0.354   -14.111 1.00 42.25  ? 15  THR B CA  1 
ATOM   1675 C C   . THR B 2 15  ? 18.687 1.283   -15.297 1.00 45.54  ? 15  THR B C   1 
ATOM   1676 O O   . THR B 2 15  ? 17.688 1.136   -16.010 1.00 47.22  ? 15  THR B O   1 
ATOM   1677 C CB  . THR B 2 15  ? 19.183 -1.052  -14.653 1.00 38.52  ? 15  THR B CB  1 
ATOM   1678 O OG1 . THR B 2 15  ? 19.404 -1.947  -13.559 1.00 37.67  ? 15  THR B OG1 1 
ATOM   1679 C CG2 . THR B 2 15  ? 20.398 -1.063  -15.579 1.00 38.91  ? 15  THR B CG2 1 
ATOM   1680 N N   . GLY B 2 16  ? 19.569 2.252   -15.492 1.00 46.15  ? 16  GLY B N   1 
ATOM   1681 C CA  . GLY B 2 16  ? 19.401 3.179   -16.591 1.00 44.66  ? 16  GLY B CA  1 
ATOM   1682 C C   . GLY B 2 16  ? 18.859 4.520   -16.135 1.00 48.03  ? 16  GLY B C   1 
ATOM   1683 O O   . GLY B 2 16  ? 18.831 5.475   -16.910 1.00 53.12  ? 16  GLY B O   1 
ATOM   1684 N N   . GLY B 2 17  ? 18.428 4.612   -14.882 1.00 46.05  ? 17  GLY B N   1 
ATOM   1685 C CA  . GLY B 2 17  ? 17.901 5.872   -14.397 1.00 42.31  ? 17  GLY B CA  1 
ATOM   1686 C C   . GLY B 2 17  ? 18.982 6.910   -14.174 1.00 42.17  ? 17  GLY B C   1 
ATOM   1687 O O   . GLY B 2 17  ? 20.175 6.611   -14.237 1.00 42.53  ? 17  GLY B O   1 
ATOM   1688 N N   . LYS B 2 18  ? 18.553 8.145   -13.950 1.00 43.44  ? 18  LYS B N   1 
ATOM   1689 C CA  . LYS B 2 18  ? 19.459 9.258   -13.673 1.00 42.77  ? 18  LYS B CA  1 
ATOM   1690 C C   . LYS B 2 18  ? 19.319 9.489   -12.178 1.00 41.21  ? 18  LYS B C   1 
ATOM   1691 O O   . LYS B 2 18  ? 18.195 9.567   -11.668 1.00 43.20  ? 18  LYS B O   1 
ATOM   1692 C CB  . LYS B 2 18  ? 19.011 10.520  -14.423 1.00 41.46  ? 18  LYS B CB  1 
ATOM   1693 C CG  . LYS B 2 18  ? 19.749 11.804  -14.061 1.00 39.47  ? 18  LYS B CG  1 
ATOM   1694 C CD  . LYS B 2 18  ? 20.587 12.281  -15.237 1.00 45.01  ? 18  LYS B CD  1 
ATOM   1695 C CE  . LYS B 2 18  ? 21.077 13.729  -15.084 1.00 48.56  ? 18  LYS B CE  1 
ATOM   1696 N NZ  . LYS B 2 18  ? 20.005 14.785  -15.173 1.00 41.06  ? 18  LYS B NZ  1 
ATOM   1697 N N   . VAL B 2 19  ? 20.439 9.517   -11.461 1.00 37.46  ? 19  VAL B N   1 
ATOM   1698 C CA  . VAL B 2 19  ? 20.405 9.758   -10.019 1.00 29.49  ? 19  VAL B CA  1 
ATOM   1699 C C   . VAL B 2 19  ? 21.404 10.853  -9.731  1.00 30.24  ? 19  VAL B C   1 
ATOM   1700 O O   . VAL B 2 19  ? 22.506 10.862  -10.303 1.00 31.12  ? 19  VAL B O   1 
ATOM   1701 C CB  . VAL B 2 19  ? 20.815 8.518   -9.178  1.00 26.49  ? 19  VAL B CB  1 
ATOM   1702 C CG1 . VAL B 2 19  ? 20.717 8.837   -7.678  1.00 15.81  ? 19  VAL B CG1 1 
ATOM   1703 C CG2 . VAL B 2 19  ? 19.953 7.310   -9.534  1.00 24.92  ? 19  VAL B CG2 1 
ATOM   1704 N N   . THR B 2 20  ? 21.005 11.782  -8.868  1.00 24.34  ? 20  THR B N   1 
ATOM   1705 C CA  . THR B 2 20  ? 21.863 12.872  -8.485  1.00 25.29  ? 20  THR B CA  1 
ATOM   1706 C C   . THR B 2 20  ? 21.885 12.958  -6.984  1.00 25.91  ? 20  THR B C   1 
ATOM   1707 O O   . THR B 2 20  ? 20.866 13.205  -6.362  1.00 27.36  ? 20  THR B O   1 
ATOM   1708 C CB  . THR B 2 20  ? 21.363 14.240  -8.994  1.00 27.96  ? 20  THR B CB  1 
ATOM   1709 O OG1 . THR B 2 20  ? 21.113 14.190  -10.403 1.00 30.16  ? 20  THR B OG1 1 
ATOM   1710 C CG2 . THR B 2 20  ? 22.415 15.313  -8.729  1.00 25.81  ? 20  THR B CG2 1 
ATOM   1711 N N   . LEU B 2 21  ? 23.053 12.757  -6.400  1.00 27.86  ? 21  LEU B N   1 
ATOM   1712 C CA  . LEU B 2 21  ? 23.195 12.863  -4.963  1.00 28.24  ? 21  LEU B CA  1 
ATOM   1713 C C   . LEU B 2 21  ? 23.795 14.266  -4.691  1.00 29.00  ? 21  LEU B C   1 
ATOM   1714 O O   . LEU B 2 21  ? 24.753 14.676  -5.349  1.00 26.68  ? 21  LEU B O   1 
ATOM   1715 C CB  . LEU B 2 21  ? 24.072 11.706  -4.445  1.00 24.82  ? 21  LEU B CB  1 
ATOM   1716 C CG  . LEU B 2 21  ? 23.564 10.313  -4.865  1.00 24.14  ? 21  LEU B CG  1 
ATOM   1717 C CD1 . LEU B 2 21  ? 24.351 9.203   -4.195  1.00 20.27  ? 21  LEU B CD1 1 
ATOM   1718 C CD2 . LEU B 2 21  ? 22.068 10.168  -4.518  1.00 23.04  ? 21  LEU B CD2 1 
ATOM   1719 N N   . SER B 2 22  ? 23.167 15.026  -3.793  1.00 30.15  ? 22  SER B N   1 
ATOM   1720 C CA  . SER B 2 22  ? 23.625 16.380  -3.457  1.00 30.31  ? 22  SER B CA  1 
ATOM   1721 C C   . SER B 2 22  ? 24.243 16.466  -2.073  1.00 28.06  ? 22  SER B C   1 
ATOM   1722 O O   . SER B 2 22  ? 23.893 15.703  -1.184  1.00 29.49  ? 22  SER B O   1 
ATOM   1723 C CB  . SER B 2 22  ? 22.455 17.386  -3.506  1.00 30.82  ? 22  SER B CB  1 
ATOM   1724 O OG  . SER B 2 22  ? 21.834 17.471  -4.794  1.00 34.48  ? 22  SER B OG  1 
ATOM   1725 N N   . CYS B 2 23  ? 25.153 17.416  -1.904  1.00 27.24  ? 23  CYS B N   1 
ATOM   1726 C CA  . CYS B 2 23  ? 25.804 17.674  -0.627  1.00 28.40  ? 23  CYS B CA  1 
ATOM   1727 C C   . CYS B 2 23  ? 25.971 19.191  -0.460  1.00 29.65  ? 23  CYS B C   1 
ATOM   1728 O O   . CYS B 2 23  ? 26.359 19.887  -1.398  1.00 30.94  ? 23  CYS B O   1 
ATOM   1729 C CB  . CYS B 2 23  ? 27.181 17.024  -0.581  1.00 25.12  ? 23  CYS B CB  1 
ATOM   1730 S SG  . CYS B 2 23  ? 27.960 17.171  1.051   1.00 29.76  ? 23  CYS B SG  1 
ATOM   1731 N N   . ASN B 2 24  ? 25.590 19.724  0.688   1.00 29.50  ? 24  ASN B N   1 
ATOM   1732 C CA  . ASN B 2 24  ? 25.770 21.141  0.919   1.00 33.41  ? 24  ASN B CA  1 
ATOM   1733 C C   . ASN B 2 24  ? 26.387 21.310  2.290   1.00 32.80  ? 24  ASN B C   1 
ATOM   1734 O O   . ASN B 2 24  ? 26.023 20.626  3.239   1.00 30.86  ? 24  ASN B O   1 
ATOM   1735 C CB  . ASN B 2 24  ? 24.483 21.976  0.630   1.00 38.55  ? 24  ASN B CB  1 
ATOM   1736 C CG  . ASN B 2 24  ? 23.659 22.354  1.879   1.00 45.81  ? 24  ASN B CG  1 
ATOM   1737 O OD1 . ASN B 2 24  ? 24.182 22.772  2.928   1.00 45.72  ? 24  ASN B OD1 1 
ATOM   1738 N ND2 . ASN B 2 24  ? 22.329 22.297  1.717   1.00 49.26  ? 24  ASN B ND2 1 
ATOM   1739 N N   . GLN B 2 25  ? 27.442 22.108  2.337   1.00 35.22  ? 25  GLN B N   1 
ATOM   1740 C CA  . GLN B 2 25  ? 28.174 22.350  3.569   1.00 38.60  ? 25  GLN B CA  1 
ATOM   1741 C C   . GLN B 2 25  ? 28.092 23.816  4.003   1.00 42.45  ? 25  GLN B C   1 
ATOM   1742 O O   . GLN B 2 25  ? 28.061 24.727  3.173   1.00 47.14  ? 25  GLN B O   1 
ATOM   1743 C CB  . GLN B 2 25  ? 29.637 22.022  3.335   1.00 39.25  ? 25  GLN B CB  1 
ATOM   1744 C CG  . GLN B 2 25  ? 30.237 22.795  2.135   1.00 37.35  ? 25  GLN B CG  1 
ATOM   1745 C CD  . GLN B 2 25  ? 31.642 23.320  2.404   1.00 35.33  ? 25  GLN B CD  1 
ATOM   1746 O OE1 . GLN B 2 25  ? 32.000 23.600  3.561   1.00 27.92  ? 25  GLN B OE1 1 
ATOM   1747 N NE2 . GLN B 2 25  ? 32.442 23.456  1.345   1.00 27.25  ? 25  GLN B NE2 1 
ATOM   1748 N N   . THR B 2 26  ? 28.113 24.048  5.305   1.00 41.53  ? 26  THR B N   1 
ATOM   1749 C CA  . THR B 2 26  ? 28.084 25.394  5.826   1.00 39.71  ? 26  THR B CA  1 
ATOM   1750 C C   . THR B 2 26  ? 29.402 25.527  6.581   1.00 44.45  ? 26  THR B C   1 
ATOM   1751 O O   . THR B 2 26  ? 29.420 25.889  7.767   1.00 46.08  ? 26  THR B O   1 
ATOM   1752 C CB  . THR B 2 26  ? 26.909 25.549  6.769   1.00 39.96  ? 26  THR B CB  1 
ATOM   1753 O OG1 . THR B 2 26  ? 27.072 24.656  7.876   1.00 39.80  ? 26  THR B OG1 1 
ATOM   1754 C CG2 . THR B 2 26  ? 25.596 25.233  6.031   1.00 38.54  ? 26  THR B CG2 1 
ATOM   1755 N N   . ASN B 2 27  ? 30.494 25.162  5.894   1.00 46.39  ? 27  ASN B N   1 
ATOM   1756 C CA  . ASN B 2 27  ? 31.850 25.175  6.459   1.00 47.46  ? 27  ASN B CA  1 
ATOM   1757 C C   . ASN B 2 27  ? 32.852 26.005  5.645   1.00 50.12  ? 27  ASN B C   1 
ATOM   1758 O O   . ASN B 2 27  ? 34.003 26.185  6.051   1.00 47.81  ? 27  ASN B O   1 
ATOM   1759 C CB  . ASN B 2 27  ? 32.387 23.742  6.555   1.00 41.73  ? 27  ASN B CB  1 
ATOM   1760 C CG  . ASN B 2 27  ? 31.648 22.898  7.571   1.00 38.84  ? 27  ASN B CG  1 
ATOM   1761 O OD1 . ASN B 2 27  ? 31.350 23.348  8.675   1.00 36.34  ? 27  ASN B OD1 1 
ATOM   1762 N ND2 . ASN B 2 27  ? 31.367 21.652  7.207   1.00 39.09  ? 27  ASN B ND2 1 
ATOM   1763 N N   . ASN B 2 28  ? 32.429 26.443  4.463   1.00 54.38  ? 28  ASN B N   1 
ATOM   1764 C CA  . ASN B 2 28  ? 33.259 27.239  3.544   1.00 56.02  ? 28  ASN B CA  1 
ATOM   1765 C C   . ASN B 2 28  ? 34.519 26.501  3.054   1.00 56.50  ? 28  ASN B C   1 
ATOM   1766 O O   . ASN B 2 28  ? 35.302 27.044  2.264   1.00 56.55  ? 28  ASN B O   1 
ATOM   1767 C CB  . ASN B 2 28  ? 33.621 28.611  4.147   1.00 56.70  ? 28  ASN B CB  1 
ATOM   1768 C CG  . ASN B 2 28  ? 34.414 29.483  3.182   1.00 56.32  ? 28  ASN B CG  1 
ATOM   1769 O OD1 . ASN B 2 28  ? 34.043 29.645  2.020   1.00 53.55  ? 28  ASN B OD1 1 
ATOM   1770 N ND2 . ASN B 2 28  ? 35.513 30.048  3.665   1.00 60.08  ? 28  ASN B ND2 1 
ATOM   1771 N N   . HIS B 2 29  ? 34.661 25.236  3.458   1.00 51.76  ? 29  HIS B N   1 
ATOM   1772 C CA  . HIS B 2 29  ? 35.799 24.420  3.062   1.00 45.88  ? 29  HIS B CA  1 
ATOM   1773 C C   . HIS B 2 29  ? 35.989 24.443  1.565   1.00 45.18  ? 29  HIS B C   1 
ATOM   1774 O O   . HIS B 2 29  ? 35.033 24.371  0.804   1.00 47.05  ? 29  HIS B O   1 
ATOM   1775 C CB  . HIS B 2 29  ? 35.628 22.973  3.508   1.00 41.22  ? 29  HIS B CB  1 
ATOM   1776 C CG  . HIS B 2 29  ? 35.849 22.766  4.968   1.00 36.82  ? 29  HIS B CG  1 
ATOM   1777 N ND1 . HIS B 2 29  ? 35.169 21.816  5.694   1.00 37.39  ? 29  HIS B ND1 1 
ATOM   1778 C CD2 . HIS B 2 29  ? 36.627 23.429  5.852   1.00 37.19  ? 29  HIS B CD2 1 
ATOM   1779 C CE1 . HIS B 2 29  ? 35.508 21.909  6.967   1.00 37.27  ? 29  HIS B CE1 1 
ATOM   1780 N NE2 . HIS B 2 29  ? 36.391 22.882  7.089   1.00 36.72  ? 29  HIS B NE2 1 
ATOM   1781 N N   . ASN B 2 30  ? 37.242 24.523  1.153   1.00 44.06  ? 30  ASN B N   1 
ATOM   1782 C CA  . ASN B 2 30  ? 37.569 24.553  -0.252  1.00 42.06  ? 30  ASN B CA  1 
ATOM   1783 C C   . ASN B 2 30  ? 37.383 23.190  -0.869  1.00 41.81  ? 30  ASN B C   1 
ATOM   1784 O O   . ASN B 2 30  ? 37.058 23.077  -2.057  1.00 42.77  ? 30  ASN B O   1 
ATOM   1785 C CB  . ASN B 2 30  ? 39.017 25.021  -0.443  1.00 45.10  ? 30  ASN B CB  1 
ATOM   1786 C CG  . ASN B 2 30  ? 39.136 26.535  -0.568  1.00 43.77  ? 30  ASN B CG  1 
ATOM   1787 O OD1 . ASN B 2 30  ? 39.001 27.275  0.414   1.00 40.49  ? 30  ASN B OD1 1 
ATOM   1788 N ND2 . ASN B 2 30  ? 39.379 26.999  -1.785  1.00 41.93  ? 30  ASN B ND2 1 
ATOM   1789 N N   . ASN B 2 31  ? 37.568 22.157  -0.049  1.00 39.57  ? 31  ASN B N   1 
ATOM   1790 C CA  . ASN B 2 31  ? 37.478 20.780  -0.518  1.00 36.99  ? 31  ASN B CA  1 
ATOM   1791 C C   . ASN B 2 31  ? 36.180 20.038  -0.179  1.00 35.92  ? 31  ASN B C   1 
ATOM   1792 O O   . ASN B 2 31  ? 35.628 20.157  0.930   1.00 31.59  ? 31  ASN B O   1 
ATOM   1793 C CB  . ASN B 2 31  ? 38.662 19.952  0.025   1.00 37.36  ? 31  ASN B CB  1 
ATOM   1794 C CG  . ASN B 2 31  ? 40.037 20.544  -0.313  1.00 39.01  ? 31  ASN B CG  1 
ATOM   1795 O OD1 . ASN B 2 31  ? 40.519 20.456  -1.448  1.00 34.91  ? 31  ASN B OD1 1 
ATOM   1796 N ND2 . ASN B 2 31  ? 40.703 21.085  0.701   1.00 35.81  ? 31  ASN B ND2 1 
ATOM   1797 N N   . MET B 2 32  ? 35.714 19.244  -1.137  1.00 35.66  ? 32  MET B N   1 
ATOM   1798 C CA  . MET B 2 32  ? 34.533 18.414  -0.948  1.00 37.72  ? 32  MET B CA  1 
ATOM   1799 C C   . MET B 2 32  ? 34.820 17.094  -1.649  1.00 37.38  ? 32  MET B C   1 
ATOM   1800 O O   . MET B 2 32  ? 35.598 17.066  -2.620  1.00 35.63  ? 32  MET B O   1 
ATOM   1801 C CB  . MET B 2 32  ? 33.276 19.106  -1.482  1.00 37.86  ? 32  MET B CB  1 
ATOM   1802 C CG  . MET B 2 32  ? 32.827 20.235  -0.550  1.00 41.50  ? 32  MET B CG  1 
ATOM   1803 S SD  . MET B 2 32  ? 31.244 21.010  -0.924  1.00 38.39  ? 32  MET B SD  1 
ATOM   1804 C CE  . MET B 2 32  ? 30.164 20.021  0.024   1.00 38.01  ? 32  MET B CE  1 
ATOM   1805 N N   . TYR B 2 33  ? 34.287 15.996  -1.109  1.00 37.11  ? 33  TYR B N   1 
ATOM   1806 C CA  . TYR B 2 33  ? 34.511 14.664  -1.690  1.00 35.92  ? 33  TYR B CA  1 
ATOM   1807 C C   . TYR B 2 33  ? 33.294 13.759  -1.557  1.00 34.25  ? 33  TYR B C   1 
ATOM   1808 O O   . TYR B 2 33  ? 32.528 13.855  -0.580  1.00 33.09  ? 33  TYR B O   1 
ATOM   1809 C CB  . TYR B 2 33  ? 35.655 13.907  -0.986  1.00 35.52  ? 33  TYR B CB  1 
ATOM   1810 C CG  . TYR B 2 33  ? 36.768 14.731  -0.388  1.00 39.66  ? 33  TYR B CG  1 
ATOM   1811 C CD1 . TYR B 2 33  ? 36.539 15.536  0.725   1.00 39.52  ? 33  TYR B CD1 1 
ATOM   1812 C CD2 . TYR B 2 33  ? 38.059 14.692  -0.918  1.00 41.88  ? 33  TYR B CD2 1 
ATOM   1813 C CE1 . TYR B 2 33  ? 37.563 16.288  1.298   1.00 39.69  ? 33  TYR B CE1 1 
ATOM   1814 C CE2 . TYR B 2 33  ? 39.093 15.441  -0.345  1.00 42.50  ? 33  TYR B CE2 1 
ATOM   1815 C CZ  . TYR B 2 33  ? 38.833 16.236  0.766   1.00 41.30  ? 33  TYR B CZ  1 
ATOM   1816 O OH  . TYR B 2 33  ? 39.836 16.957  1.375   1.00 43.46  ? 33  TYR B OH  1 
ATOM   1817 N N   . TRP B 2 34  ? 33.212 12.797  -2.474  1.00 29.97  ? 34  TRP B N   1 
ATOM   1818 C CA  . TRP B 2 34  ? 32.165 11.785  -2.472  1.00 26.05  ? 34  TRP B CA  1 
ATOM   1819 C C   . TRP B 2 34  ? 32.824 10.407  -2.384  1.00 27.31  ? 34  TRP B C   1 
ATOM   1820 O O   . TRP B 2 34  ? 33.697 10.070  -3.208  1.00 24.97  ? 34  TRP B O   1 
ATOM   1821 C CB  . TRP B 2 34  ? 31.315 11.860  -3.745  1.00 25.87  ? 34  TRP B CB  1 
ATOM   1822 C CG  . TRP B 2 34  ? 30.125 12.744  -3.611  1.00 23.76  ? 34  TRP B CG  1 
ATOM   1823 C CD1 . TRP B 2 34  ? 29.956 13.968  -4.176  1.00 18.99  ? 34  TRP B CD1 1 
ATOM   1824 C CD2 . TRP B 2 34  ? 28.960 12.505  -2.810  1.00 21.78  ? 34  TRP B CD2 1 
ATOM   1825 N NE1 . TRP B 2 34  ? 28.772 14.517  -3.762  1.00 19.93  ? 34  TRP B NE1 1 
ATOM   1826 C CE2 . TRP B 2 34  ? 28.135 13.631  -2.932  1.00 22.89  ? 34  TRP B CE2 1 
ATOM   1827 C CE3 . TRP B 2 34  ? 28.534 11.444  -2.010  1.00 23.64  ? 34  TRP B CE3 1 
ATOM   1828 C CZ2 . TRP B 2 34  ? 26.884 13.732  -2.270  1.00 27.65  ? 34  TRP B CZ2 1 
ATOM   1829 C CZ3 . TRP B 2 34  ? 27.277 11.550  -1.351  1.00 27.51  ? 34  TRP B CZ3 1 
ATOM   1830 C CH2 . TRP B 2 34  ? 26.481 12.682  -1.492  1.00 22.94  ? 34  TRP B CH2 1 
ATOM   1831 N N   . TYR B 2 35  ? 32.432 9.642   -1.359  1.00 30.06  ? 35  TYR B N   1 
ATOM   1832 C CA  . TYR B 2 35  ? 32.914 8.270   -1.105  1.00 27.52  ? 35  TYR B CA  1 
ATOM   1833 C C   . TYR B 2 35  ? 31.731 7.284   -1.088  1.00 24.56  ? 35  TYR B C   1 
ATOM   1834 O O   . TYR B 2 35  ? 30.570 7.668   -0.923  1.00 21.78  ? 35  TYR B O   1 
ATOM   1835 C CB  . TYR B 2 35  ? 33.593 8.156   0.272   1.00 27.86  ? 35  TYR B CB  1 
ATOM   1836 C CG  . TYR B 2 35  ? 34.924 8.873   0.469   1.00 30.79  ? 35  TYR B CG  1 
ATOM   1837 C CD1 . TYR B 2 35  ? 34.969 10.173  0.971   1.00 34.63  ? 35  TYR B CD1 1 
ATOM   1838 C CD2 . TYR B 2 35  ? 36.137 8.223   0.238   1.00 28.43  ? 35  TYR B CD2 1 
ATOM   1839 C CE1 . TYR B 2 35  ? 36.202 10.809  1.246   1.00 36.30  ? 35  TYR B CE1 1 
ATOM   1840 C CE2 . TYR B 2 35  ? 37.357 8.848   0.503   1.00 31.30  ? 35  TYR B CE2 1 
ATOM   1841 C CZ  . TYR B 2 35  ? 37.382 10.139  1.008   1.00 33.46  ? 35  TYR B CZ  1 
ATOM   1842 O OH  . TYR B 2 35  ? 38.570 10.771  1.276   1.00 30.23  ? 35  TYR B OH  1 
ATOM   1843 N N   . ARG B 2 36  ? 32.030 6.012   -1.283  1.00 24.36  ? 36  ARG B N   1 
ATOM   1844 C CA  . ARG B 2 36  ? 31.006 4.979   -1.192  1.00 26.19  ? 36  ARG B CA  1 
ATOM   1845 C C   . ARG B 2 36  ? 31.573 3.911   -0.251  1.00 26.49  ? 36  ARG B C   1 
ATOM   1846 O O   . ARG B 2 36  ? 32.773 3.614   -0.285  1.00 29.96  ? 36  ARG B O   1 
ATOM   1847 C CB  . ARG B 2 36  ? 30.600 4.401   -2.568  1.00 19.47  ? 36  ARG B CB  1 
ATOM   1848 C CG  . ARG B 2 36  ? 31.721 3.906   -3.442  1.00 20.49  ? 36  ARG B CG  1 
ATOM   1849 C CD  . ARG B 2 36  ? 31.168 3.238   -4.697  1.00 15.04  ? 36  ARG B CD  1 
ATOM   1850 N NE  . ARG B 2 36  ? 30.492 1.985   -4.372  1.00 23.14  ? 36  ARG B NE  1 
ATOM   1851 C CZ  . ARG B 2 36  ? 29.819 1.230   -5.237  1.00 24.08  ? 36  ARG B CZ  1 
ATOM   1852 N NH1 . ARG B 2 36  ? 29.702 1.584   -6.509  1.00 20.34  ? 36  ARG B NH1 1 
ATOM   1853 N NH2 . ARG B 2 36  ? 29.268 0.101   -4.827  1.00 24.29  ? 36  ARG B NH2 1 
ATOM   1854 N N   . GLN B 2 37  ? 30.751 3.469   0.689   1.00 24.04  ? 37  GLN B N   1 
ATOM   1855 C CA  . GLN B 2 37  ? 31.154 2.458   1.641   1.00 25.73  ? 37  GLN B CA  1 
ATOM   1856 C C   . GLN B 2 37  ? 30.593 1.121   1.184   1.00 30.80  ? 37  GLN B C   1 
ATOM   1857 O O   . GLN B 2 37  ? 29.398 1.002   0.852   1.00 32.77  ? 37  GLN B O   1 
ATOM   1858 C CB  . GLN B 2 37  ? 30.632 2.793   3.025   1.00 22.85  ? 37  GLN B CB  1 
ATOM   1859 C CG  . GLN B 2 37  ? 31.199 1.902   4.086   1.00 22.33  ? 37  GLN B CG  1 
ATOM   1860 C CD  . GLN B 2 37  ? 30.692 2.250   5.450   1.00 27.14  ? 37  GLN B CD  1 
ATOM   1861 O OE1 . GLN B 2 37  ? 29.685 2.928   5.600   1.00 29.07  ? 37  GLN B OE1 1 
ATOM   1862 N NE2 . GLN B 2 37  ? 31.386 1.787   6.463   1.00 32.00  ? 37  GLN B NE2 1 
ATOM   1863 N N   . ASP B 2 38  ? 31.455 0.116   1.139   1.00 31.39  ? 38  ASP B N   1 
ATOM   1864 C CA  . ASP B 2 38  ? 31.041 -1.202  0.703   1.00 32.17  ? 38  ASP B CA  1 
ATOM   1865 C C   . ASP B 2 38  ? 31.719 -2.247  1.522   1.00 34.62  ? 38  ASP B C   1 
ATOM   1866 O O   . ASP B 2 38  ? 32.898 -2.136  1.830   1.00 37.85  ? 38  ASP B O   1 
ATOM   1867 C CB  . ASP B 2 38  ? 31.400 -1.440  -0.766  1.00 31.59  ? 38  ASP B CB  1 
ATOM   1868 C CG  . ASP B 2 38  ? 30.570 -0.612  -1.709  1.00 32.35  ? 38  ASP B CG  1 
ATOM   1869 O OD1 . ASP B 2 38  ? 29.333 -0.709  -1.660  1.00 36.72  ? 38  ASP B OD1 1 
ATOM   1870 O OD2 . ASP B 2 38  ? 31.152 0.130   -2.509  1.00 33.03  ? 38  ASP B OD2 1 
ATOM   1871 N N   . THR B 2 39  ? 30.961 -3.271  1.871   1.00 39.00  ? 39  THR B N   1 
ATOM   1872 C CA  . THR B 2 39  ? 31.483 -4.383  2.644   1.00 41.38  ? 39  THR B CA  1 
ATOM   1873 C C   . THR B 2 39  ? 32.718 -4.945  1.914   1.00 41.62  ? 39  THR B C   1 
ATOM   1874 O O   . THR B 2 39  ? 32.672 -5.206  0.700   1.00 40.86  ? 39  THR B O   1 
ATOM   1875 C CB  . THR B 2 39  ? 30.389 -5.446  2.840   1.00 42.03  ? 39  THR B CB  1 
ATOM   1876 O OG1 . THR B 2 39  ? 30.908 -6.524  3.612   1.00 45.45  ? 39  THR B OG1 1 
ATOM   1877 C CG2 . THR B 2 39  ? 29.893 -5.961  1.517   1.00 42.70  ? 39  THR B CG2 1 
ATOM   1878 N N   . GLY B 2 40  ? 33.838 -5.000  2.642   1.00 42.72  ? 40  GLY B N   1 
ATOM   1879 C CA  . GLY B 2 40  ? 35.101 -5.470  2.090   1.00 37.59  ? 40  GLY B CA  1 
ATOM   1880 C C   . GLY B 2 40  ? 36.026 -4.392  1.507   1.00 38.45  ? 40  GLY B C   1 
ATOM   1881 O O   . GLY B 2 40  ? 37.167 -4.693  1.139   1.00 36.77  ? 40  GLY B O   1 
ATOM   1882 N N   . HIS B 2 41  ? 35.572 -3.137  1.450   1.00 36.85  ? 41  HIS B N   1 
ATOM   1883 C CA  . HIS B 2 41  ? 36.365 -2.036  0.896   1.00 35.15  ? 41  HIS B CA  1 
ATOM   1884 C C   . HIS B 2 41  ? 36.439 -0.782  1.747   1.00 38.07  ? 41  HIS B C   1 
ATOM   1885 O O   . HIS B 2 41  ? 37.058 0.201   1.306   1.00 37.66  ? 41  HIS B O   1 
ATOM   1886 C CB  . HIS B 2 41  ? 35.767 -1.563  -0.407  1.00 35.80  ? 41  HIS B CB  1 
ATOM   1887 C CG  . HIS B 2 41  ? 36.114 -2.401  -1.582  1.00 42.14  ? 41  HIS B CG  1 
ATOM   1888 N ND1 . HIS B 2 41  ? 35.155 -3.003  -2.367  1.00 45.08  ? 41  HIS B ND1 1 
ATOM   1889 C CD2 . HIS B 2 41  ? 37.304 -2.663  -2.171  1.00 49.22  ? 41  HIS B CD2 1 
ATOM   1890 C CE1 . HIS B 2 41  ? 35.735 -3.590  -3.397  1.00 45.76  ? 41  HIS B CE1 1 
ATOM   1891 N NE2 . HIS B 2 41  ? 37.039 -3.399  -3.302  1.00 47.91  ? 41  HIS B NE2 1 
ATOM   1892 N N   . GLY B 2 42  ? 35.786 -0.774  2.914   1.00 37.40  ? 42  GLY B N   1 
ATOM   1893 C CA  . GLY B 2 42  ? 35.781 0.426   3.732   1.00 34.54  ? 42  GLY B CA  1 
ATOM   1894 C C   . GLY B 2 42  ? 35.109 1.520   2.874   1.00 34.30  ? 42  GLY B C   1 
ATOM   1895 O O   . GLY B 2 42  ? 34.080 1.270   2.227   1.00 33.26  ? 42  GLY B O   1 
ATOM   1896 N N   . LEU B 2 43  ? 35.699 2.714   2.873   1.00 34.67  ? 43  LEU B N   1 
ATOM   1897 C CA  . LEU B 2 43  ? 35.247 3.834   2.036   1.00 31.05  ? 43  LEU B CA  1 
ATOM   1898 C C   . LEU B 2 43  ? 36.202 4.022   0.853   1.00 29.76  ? 43  LEU B C   1 
ATOM   1899 O O   . LEU B 2 43  ? 37.423 4.086   1.041   1.00 33.35  ? 43  LEU B O   1 
ATOM   1900 C CB  . LEU B 2 43  ? 35.206 5.120   2.862   1.00 25.13  ? 43  LEU B CB  1 
ATOM   1901 C CG  . LEU B 2 43  ? 34.262 5.029   4.061   1.00 22.52  ? 43  LEU B CG  1 
ATOM   1902 C CD1 . LEU B 2 43  ? 34.226 6.315   4.889   1.00 21.57  ? 43  LEU B CD1 1 
ATOM   1903 C CD2 . LEU B 2 43  ? 32.812 4.751   3.661   1.00 15.32  ? 43  LEU B CD2 1 
ATOM   1904 N N   . ARG B 2 44  ? 35.673 4.116   -0.349  1.00 28.19  ? 44  ARG B N   1 
ATOM   1905 C CA  . ARG B 2 44  ? 36.514 4.325   -1.549  1.00 33.65  ? 44  ARG B CA  1 
ATOM   1906 C C   . ARG B 2 44  ? 36.165 5.677   -2.190  1.00 36.64  ? 44  ARG B C   1 
ATOM   1907 O O   . ARG B 2 44  ? 34.984 5.972   -2.404  1.00 42.52  ? 44  ARG B O   1 
ATOM   1908 C CB  . ARG B 2 44  ? 36.271 3.215   -2.563  1.00 35.22  ? 44  ARG B CB  1 
ATOM   1909 C CG  . ARG B 2 44  ? 36.907 1.890   -2.155  1.00 36.72  ? 44  ARG B CG  1 
ATOM   1910 C CD  . ARG B 2 44  ? 36.661 0.789   -3.179  1.00 32.38  ? 44  ARG B CD  1 
ATOM   1911 N NE  . ARG B 2 44  ? 35.237 0.528   -3.395  1.00 35.77  ? 44  ARG B NE  1 
ATOM   1912 C CZ  . ARG B 2 44  ? 34.756 -0.203  -4.401  1.00 35.06  ? 44  ARG B CZ  1 
ATOM   1913 N NH1 . ARG B 2 44  ? 35.577 -0.753  -5.304  1.00 37.07  ? 44  ARG B NH1 1 
ATOM   1914 N NH2 . ARG B 2 44  ? 33.453 -0.446  -4.584  1.00 29.56  ? 44  ARG B NH2 1 
ATOM   1915 N N   . LEU B 2 45  ? 37.179 6.494   -2.486  1.00 34.64  ? 45  LEU B N   1 
ATOM   1916 C CA  . LEU B 2 45  ? 36.971 7.815   -3.071  1.00 28.91  ? 45  LEU B CA  1 
ATOM   1917 C C   . LEU B 2 45  ? 36.514 7.726   -4.512  1.00 27.41  ? 45  LEU B C   1 
ATOM   1918 O O   . LEU B 2 45  ? 37.118 7.012   -5.309  1.00 27.58  ? 45  LEU B O   1 
ATOM   1919 C CB  . LEU B 2 45  ? 38.263 8.640   -2.954  1.00 26.03  ? 45  LEU B CB  1 
ATOM   1920 C CG  . LEU B 2 45  ? 38.407 10.081  -3.475  1.00 27.53  ? 45  LEU B CG  1 
ATOM   1921 C CD1 . LEU B 2 45  ? 37.365 11.045  -2.911  1.00 25.16  ? 45  LEU B CD1 1 
ATOM   1922 C CD2 . LEU B 2 45  ? 39.785 10.546  -3.116  1.00 27.48  ? 45  LEU B CD2 1 
ATOM   1923 N N   . ILE B 2 46  ? 35.446 8.444   -4.851  1.00 27.36  ? 46  ILE B N   1 
ATOM   1924 C CA  . ILE B 2 46  ? 34.940 8.457   -6.231  1.00 29.42  ? 46  ILE B CA  1 
ATOM   1925 C C   . ILE B 2 46  ? 35.405 9.703   -7.051  1.00 30.95  ? 46  ILE B C   1 
ATOM   1926 O O   . ILE B 2 46  ? 35.982 9.582   -8.152  1.00 28.22  ? 46  ILE B O   1 
ATOM   1927 C CB  . ILE B 2 46  ? 33.391 8.356   -6.247  1.00 27.03  ? 46  ILE B CB  1 
ATOM   1928 C CG1 . ILE B 2 46  ? 32.935 7.233   -5.317  1.00 19.67  ? 46  ILE B CG1 1 
ATOM   1929 C CG2 . ILE B 2 46  ? 32.874 8.087   -7.685  1.00 23.13  ? 46  ILE B CG2 1 
ATOM   1930 C CD1 . ILE B 2 46  ? 31.451 7.100   -5.249  1.00 17.48  ? 46  ILE B CD1 1 
ATOM   1931 N N   . HIS B 2 47  ? 35.138 10.885  -6.486  1.00 33.07  ? 47  HIS B N   1 
ATOM   1932 C CA  . HIS B 2 47  ? 35.472 12.205  -7.052  1.00 33.87  ? 47  HIS B CA  1 
ATOM   1933 C C   . HIS B 2 47  ? 35.678 13.162  -5.875  1.00 33.69  ? 47  HIS B C   1 
ATOM   1934 O O   . HIS B 2 47  ? 35.342 12.844  -4.728  1.00 37.27  ? 47  HIS B O   1 
ATOM   1935 C CB  . HIS B 2 47  ? 34.321 12.778  -7.917  1.00 33.62  ? 47  HIS B CB  1 
ATOM   1936 C CG  . HIS B 2 47  ? 34.104 12.076  -9.230  1.00 40.13  ? 47  HIS B CG  1 
ATOM   1937 N ND1 . HIS B 2 47  ? 34.900 12.293  -10.336 1.00 46.20  ? 47  HIS B ND1 1 
ATOM   1938 C CD2 . HIS B 2 47  ? 33.158 11.187  -9.624  1.00 42.25  ? 47  HIS B CD2 1 
ATOM   1939 C CE1 . HIS B 2 47  ? 34.458 11.571  -11.352 1.00 42.78  ? 47  HIS B CE1 1 
ATOM   1940 N NE2 . HIS B 2 47  ? 33.401 10.891  -10.946 1.00 43.40  ? 47  HIS B NE2 1 
ATOM   1941 N N   . TYR B 2 48  ? 36.269 14.314  -6.162  1.00 35.89  ? 48  TYR B N   1 
ATOM   1942 C CA  . TYR B 2 48  ? 36.501 15.356  -5.164  1.00 38.20  ? 48  TYR B CA  1 
ATOM   1943 C C   . TYR B 2 48  ? 36.763 16.692  -5.876  1.00 38.79  ? 48  TYR B C   1 
ATOM   1944 O O   . TYR B 2 48  ? 36.905 16.756  -7.100  1.00 35.17  ? 48  TYR B O   1 
ATOM   1945 C CB  . TYR B 2 48  ? 37.650 14.987  -4.207  1.00 38.82  ? 48  TYR B CB  1 
ATOM   1946 C CG  . TYR B 2 48  ? 39.019 14.892  -4.851  1.00 43.06  ? 48  TYR B CG  1 
ATOM   1947 C CD1 . TYR B 2 48  ? 39.382 13.780  -5.614  1.00 44.27  ? 48  TYR B CD1 1 
ATOM   1948 C CD2 . TYR B 2 48  ? 39.948 15.925  -4.713  1.00 43.51  ? 48  TYR B CD2 1 
ATOM   1949 C CE1 . TYR B 2 48  ? 40.634 13.698  -6.224  1.00 46.17  ? 48  TYR B CE1 1 
ATOM   1950 C CE2 . TYR B 2 48  ? 41.195 15.853  -5.319  1.00 42.39  ? 48  TYR B CE2 1 
ATOM   1951 C CZ  . TYR B 2 48  ? 41.537 14.740  -6.071  1.00 43.90  ? 48  TYR B CZ  1 
ATOM   1952 O OH  . TYR B 2 48  ? 42.783 14.665  -6.660  1.00 42.63  ? 48  TYR B OH  1 
ATOM   1953 N N   . SER B 2 49  ? 36.819 17.766  -5.114  1.00 42.56  ? 49  SER B N   1 
ATOM   1954 C CA  . SER B 2 49  ? 37.039 19.063  -5.708  1.00 46.78  ? 49  SER B CA  1 
ATOM   1955 C C   . SER B 2 49  ? 37.897 19.864  -4.767  1.00 49.27  ? 49  SER B C   1 
ATOM   1956 O O   . SER B 2 49  ? 37.742 19.748  -3.544  1.00 45.50  ? 49  SER B O   1 
ATOM   1957 C CB  . SER B 2 49  ? 35.694 19.769  -5.916  1.00 49.18  ? 49  SER B CB  1 
ATOM   1958 O OG  . SER B 2 49  ? 35.853 21.084  -6.425  1.00 50.87  ? 49  SER B OG  1 
ATOM   1959 N N   . TYR B 2 50  ? 38.822 20.633  -5.350  1.00 53.98  ? 50  TYR B N   1 
ATOM   1960 C CA  . TYR B 2 50  ? 39.728 21.503  -4.604  1.00 57.72  ? 50  TYR B CA  1 
ATOM   1961 C C   . TYR B 2 50  ? 39.170 22.931  -4.560  1.00 57.39  ? 50  TYR B C   1 
ATOM   1962 O O   . TYR B 2 50  ? 39.699 23.815  -3.865  1.00 60.04  ? 50  TYR B O   1 
ATOM   1963 C CB  . TYR B 2 50  ? 41.132 21.483  -5.223  1.00 62.47  ? 50  TYR B CB  1 
ATOM   1964 C CG  . TYR B 2 50  ? 42.031 20.367  -4.707  1.00 67.76  ? 50  TYR B CG  1 
ATOM   1965 C CD1 . TYR B 2 50  ? 42.440 20.332  -3.368  1.00 70.15  ? 50  TYR B CD1 1 
ATOM   1966 C CD2 . TYR B 2 50  ? 42.450 19.337  -5.547  1.00 70.34  ? 50  TYR B CD2 1 
ATOM   1967 C CE1 . TYR B 2 50  ? 43.228 19.298  -2.879  1.00 70.15  ? 50  TYR B CE1 1 
ATOM   1968 C CE2 . TYR B 2 50  ? 43.244 18.303  -5.071  1.00 71.79  ? 50  TYR B CE2 1 
ATOM   1969 C CZ  . TYR B 2 50  ? 43.618 18.286  -3.738  1.00 72.61  ? 50  TYR B CZ  1 
ATOM   1970 O OH  . TYR B 2 50  ? 44.323 17.214  -3.256  1.00 76.13  ? 50  TYR B OH  1 
ATOM   1971 N N   . GLY B 2 51  ? 38.077 23.149  -5.283  1.00 55.73  ? 51  GLY B N   1 
ATOM   1972 C CA  . GLY B 2 51  ? 37.467 24.463  -5.296  1.00 51.83  ? 51  GLY B CA  1 
ATOM   1973 C C   . GLY B 2 51  ? 36.296 24.599  -6.250  1.00 49.76  ? 51  GLY B C   1 
ATOM   1974 O O   . GLY B 2 51  ? 36.235 23.935  -7.310  1.00 42.80  ? 51  GLY B O   1 
ATOM   1975 N N   . ALA B 2 52  ? 35.384 25.498  -5.877  1.00 50.31  ? 52  ALA B N   1 
ATOM   1976 C CA  . ALA B 2 52  ? 34.181 25.782  -6.662  1.00 51.73  ? 52  ALA B CA  1 
ATOM   1977 C C   . ALA B 2 52  ? 34.520 25.924  -8.138  1.00 50.76  ? 52  ALA B C   1 
ATOM   1978 O O   . ALA B 2 52  ? 35.433 26.654  -8.500  1.00 53.75  ? 52  ALA B O   1 
ATOM   1979 C CB  . ALA B 2 52  ? 33.504 27.051  -6.139  1.00 51.32  ? 52  ALA B CB  1 
ATOM   1980 N N   . GLY B 2 53  ? 33.815 25.196  -8.988  1.00 49.82  ? 53  GLY B N   1 
ATOM   1981 C CA  . GLY B 2 53  ? 34.097 25.283  -10.405 1.00 49.78  ? 53  GLY B CA  1 
ATOM   1982 C C   . GLY B 2 53  ? 34.923 24.141  -10.969 1.00 51.87  ? 53  GLY B C   1 
ATOM   1983 O O   . GLY B 2 53  ? 34.792 23.844  -12.163 1.00 48.59  ? 53  GLY B O   1 
ATOM   1984 N N   . SER B 2 54  ? 35.753 23.495  -10.136 1.00 57.30  ? 54  SER B N   1 
ATOM   1985 C CA  . SER B 2 54  ? 36.601 22.362  -10.582 1.00 59.14  ? 54  SER B CA  1 
ATOM   1986 C C   . SER B 2 54  ? 36.283 20.952  -9.986  1.00 60.23  ? 54  SER B C   1 
ATOM   1987 O O   . SER B 2 54  ? 35.786 20.810  -8.854  1.00 51.88  ? 54  SER B O   1 
ATOM   1988 C CB  . SER B 2 54  ? 38.092 22.703  -10.398 1.00 58.99  ? 54  SER B CB  1 
ATOM   1989 O OG  . SER B 2 54  ? 38.393 23.043  -9.051  1.00 59.24  ? 54  SER B OG  1 
ATOM   1990 N N   . THR B 2 55  ? 36.562 19.917  -10.781 1.00 61.64  ? 55  THR B N   1 
ATOM   1991 C CA  . THR B 2 55  ? 36.321 18.534  -10.383 1.00 60.79  ? 55  THR B CA  1 
ATOM   1992 C C   . THR B 2 55  ? 37.546 17.676  -10.704 1.00 59.88  ? 55  THR B C   1 
ATOM   1993 O O   . THR B 2 55  ? 38.146 17.792  -11.783 1.00 59.79  ? 55  THR B O   1 
ATOM   1994 C CB  . THR B 2 55  ? 35.008 17.953  -11.057 1.00 61.98  ? 55  THR B CB  1 
ATOM   1995 O OG1 . THR B 2 55  ? 35.023 16.517  -11.028 1.00 60.67  ? 55  THR B OG1 1 
ATOM   1996 C CG2 . THR B 2 55  ? 34.857 18.430  -12.522 1.00 65.74  ? 55  THR B CG2 1 
ATOM   1997 N N   . GLU B 2 56  ? 37.905 16.830  -9.742  1.00 58.91  ? 56  GLU B N   1 
ATOM   1998 C CA  . GLU B 2 56  ? 39.044 15.914  -9.827  1.00 56.56  ? 56  GLU B CA  1 
ATOM   1999 C C   . GLU B 2 56  ? 38.578 14.471  -9.585  1.00 51.51  ? 56  GLU B C   1 
ATOM   2000 O O   . GLU B 2 56  ? 37.847 14.206  -8.635  1.00 52.68  ? 56  GLU B O   1 
ATOM   2001 C CB  . GLU B 2 56  ? 40.058 16.284  -8.746  1.00 61.44  ? 56  GLU B CB  1 
ATOM   2002 C CG  . GLU B 2 56  ? 40.387 17.772  -8.669  1.00 70.81  ? 56  GLU B CG  1 
ATOM   2003 C CD  . GLU B 2 56  ? 41.020 18.310  -9.953  1.00 77.48  ? 56  GLU B CD  1 
ATOM   2004 O OE1 . GLU B 2 56  ? 41.574 17.509  -10.755 1.00 77.54  ? 56  GLU B OE1 1 
ATOM   2005 O OE2 . GLU B 2 56  ? 40.953 19.546  -10.157 1.00 79.46  ? 56  GLU B OE2 1 
ATOM   2006 N N   . LYS B 2 57  ? 38.993 13.533  -10.424 1.00 45.11  ? 57  LYS B N   1 
ATOM   2007 C CA  . LYS B 2 57  ? 38.580 12.144  -10.242 1.00 40.43  ? 57  LYS B CA  1 
ATOM   2008 C C   . LYS B 2 57  ? 39.213 11.433  -9.032  1.00 41.12  ? 57  LYS B C   1 
ATOM   2009 O O   . LYS B 2 57  ? 40.325 11.759  -8.619  1.00 41.46  ? 57  LYS B O   1 
ATOM   2010 C CB  . LYS B 2 57  ? 38.816 11.359  -11.523 1.00 37.68  ? 57  LYS B CB  1 
ATOM   2011 C CG  . LYS B 2 57  ? 38.164 12.004  -12.731 1.00 35.69  ? 57  LYS B CG  1 
ATOM   2012 C CD  . LYS B 2 57  ? 37.737 10.949  -13.735 1.00 37.79  ? 57  LYS B CD  1 
ATOM   2013 C CE  . LYS B 2 57  ? 38.924 10.206  -14.338 1.00 33.69  ? 57  LYS B CE  1 
ATOM   2014 N NZ  . LYS B 2 57  ? 39.187 10.729  -15.706 1.00 36.89  ? 57  LYS B NZ  1 
ATOM   2015 N N   . GLY B 2 58  ? 38.455 10.530  -8.415  1.00 38.09  ? 58  GLY B N   1 
ATOM   2016 C CA  . GLY B 2 58  ? 38.958 9.790   -7.272  1.00 38.12  ? 58  GLY B CA  1 
ATOM   2017 C C   . GLY B 2 58  ? 39.488 8.479   -7.802  1.00 41.57  ? 58  GLY B C   1 
ATOM   2018 O O   . GLY B 2 58  ? 39.818 8.413   -8.983  1.00 47.36  ? 58  GLY B O   1 
ATOM   2019 N N   . ASP B 2 59  ? 39.464 7.416   -6.995  1.00 40.29  ? 59  ASP B N   1 
ATOM   2020 C CA  . ASP B 2 59  ? 39.966 6.099   -7.415  1.00 38.45  ? 59  ASP B CA  1 
ATOM   2021 C C   . ASP B 2 59  ? 39.039 5.261   -8.290  1.00 37.97  ? 59  ASP B C   1 
ATOM   2022 O O   . ASP B 2 59  ? 39.479 4.505   -9.149  1.00 38.63  ? 59  ASP B O   1 
ATOM   2023 C CB  . ASP B 2 59  ? 40.382 5.283   -6.194  1.00 39.74  ? 59  ASP B CB  1 
ATOM   2024 C CG  . ASP B 2 59  ? 41.395 6.012   -5.333  1.00 45.90  ? 59  ASP B CG  1 
ATOM   2025 O OD1 . ASP B 2 59  ? 42.425 6.473   -5.884  1.00 50.35  ? 59  ASP B OD1 1 
ATOM   2026 O OD2 . ASP B 2 59  ? 41.160 6.154   -4.107  1.00 50.23  ? 59  ASP B OD2 1 
ATOM   2027 N N   . ILE B 2 60  ? 37.748 5.382   -8.076  1.00 37.33  ? 60  ILE B N   1 
ATOM   2028 C CA  . ILE B 2 60  ? 36.809 4.608   -8.865  1.00 37.97  ? 60  ILE B CA  1 
ATOM   2029 C C   . ILE B 2 60  ? 35.791 5.571   -9.475  1.00 39.52  ? 60  ILE B C   1 
ATOM   2030 O O   . ILE B 2 60  ? 34.589 5.466   -9.219  1.00 40.36  ? 60  ILE B O   1 
ATOM   2031 C CB  . ILE B 2 60  ? 36.117 3.559   -7.960  1.00 37.89  ? 60  ILE B CB  1 
ATOM   2032 C CG1 . ILE B 2 60  ? 35.723 4.199   -6.619  1.00 33.53  ? 60  ILE B CG1 1 
ATOM   2033 C CG2 . ILE B 2 60  ? 37.047 2.387   -7.725  1.00 36.06  ? 60  ILE B CG2 1 
ATOM   2034 C CD1 . ILE B 2 60  ? 34.836 3.350   -5.736  1.00 27.75  ? 60  ILE B CD1 1 
ATOM   2035 N N   . PRO B 2 61  ? 36.248 6.472   -10.363 1.00 40.29  ? 61  PRO B N   1 
ATOM   2036 C CA  . PRO B 2 61  ? 35.363 7.456   -10.996 1.00 41.59  ? 61  PRO B CA  1 
ATOM   2037 C C   . PRO B 2 61  ? 34.448 7.002   -12.157 1.00 42.40  ? 61  PRO B C   1 
ATOM   2038 O O   . PRO B 2 61  ? 33.611 7.777   -12.635 1.00 44.93  ? 61  PRO B O   1 
ATOM   2039 C CB  . PRO B 2 61  ? 36.350 8.541   -11.422 1.00 39.04  ? 61  PRO B CB  1 
ATOM   2040 C CG  . PRO B 2 61  ? 37.480 7.733   -11.902 1.00 37.34  ? 61  PRO B CG  1 
ATOM   2041 C CD  . PRO B 2 61  ? 37.621 6.614   -10.877 1.00 40.63  ? 61  PRO B CD  1 
ATOM   2042 N N   . ASP B 2 62  ? 34.566 5.751   -12.580 1.00 42.94  ? 62  ASP B N   1 
ATOM   2043 C CA  . ASP B 2 62  ? 33.754 5.243   -13.689 1.00 43.43  ? 62  ASP B CA  1 
ATOM   2044 C C   . ASP B 2 62  ? 32.286 5.082   -13.296 1.00 40.78  ? 62  ASP B C   1 
ATOM   2045 O O   . ASP B 2 62  ? 31.969 4.549   -12.229 1.00 44.89  ? 62  ASP B O   1 
ATOM   2046 C CB  . ASP B 2 62  ? 34.301 3.898   -14.192 1.00 47.11  ? 62  ASP B CB  1 
ATOM   2047 C CG  . ASP B 2 62  ? 35.832 3.872   -14.281 1.00 57.45  ? 62  ASP B CG  1 
ATOM   2048 O OD1 . ASP B 2 62  ? 36.504 3.875   -13.201 1.00 60.49  ? 62  ASP B OD1 1 
ATOM   2049 O OD2 . ASP B 2 62  ? 36.356 3.826   -15.428 1.00 55.67  ? 62  ASP B OD2 1 
ATOM   2050 N N   . GLY B 2 63  ? 31.394 5.543   -14.164 1.00 37.45  ? 63  GLY B N   1 
ATOM   2051 C CA  . GLY B 2 63  ? 29.977 5.431   -13.894 1.00 34.61  ? 63  GLY B CA  1 
ATOM   2052 C C   . GLY B 2 63  ? 29.389 6.650   -13.218 1.00 35.22  ? 63  GLY B C   1 
ATOM   2053 O O   . GLY B 2 63  ? 28.162 6.829   -13.230 1.00 35.67  ? 63  GLY B O   1 
ATOM   2054 N N   . TYR B 2 64  ? 30.257 7.516   -12.688 1.00 34.37  ? 65  TYR B N   1 
ATOM   2055 C CA  . TYR B 2 64  ? 29.830 8.717   -11.986 1.00 33.62  ? 65  TYR B CA  1 
ATOM   2056 C C   . TYR B 2 64  ? 30.418 9.984   -12.559 1.00 34.37  ? 65  TYR B C   1 
ATOM   2057 O O   . TYR B 2 64  ? 31.558 9.990   -12.990 1.00 35.94  ? 65  TYR B O   1 
ATOM   2058 C CB  . TYR B 2 64  ? 30.284 8.666   -10.532 1.00 33.48  ? 65  TYR B CB  1 
ATOM   2059 C CG  . TYR B 2 64  ? 29.902 7.426   -9.774  1.00 37.05  ? 65  TYR B CG  1 
ATOM   2060 C CD1 . TYR B 2 64  ? 28.709 7.358   -9.057  1.00 38.83  ? 65  TYR B CD1 1 
ATOM   2061 C CD2 . TYR B 2 64  ? 30.776 6.348   -9.695  1.00 40.90  ? 65  TYR B CD2 1 
ATOM   2062 C CE1 . TYR B 2 64  ? 28.407 6.245   -8.265  1.00 39.94  ? 65  TYR B CE1 1 
ATOM   2063 C CE2 . TYR B 2 64  ? 30.485 5.241   -8.916  1.00 40.65  ? 65  TYR B CE2 1 
ATOM   2064 C CZ  . TYR B 2 64  ? 29.306 5.196   -8.198  1.00 38.47  ? 65  TYR B CZ  1 
ATOM   2065 O OH  . TYR B 2 64  ? 29.075 4.114   -7.388  1.00 35.68  ? 65  TYR B OH  1 
ATOM   2066 N N   . LYS B 2 65  ? 29.653 11.071  -12.482 1.00 38.86  ? 66  LYS B N   1 
ATOM   2067 C CA  . LYS B 2 65  ? 30.071 12.418  -12.908 1.00 40.72  ? 66  LYS B CA  1 
ATOM   2068 C C   . LYS B 2 65  ? 29.934 13.301  -11.662 1.00 41.28  ? 66  LYS B C   1 
ATOM   2069 O O   . LYS B 2 65  ? 29.119 13.026  -10.783 1.00 42.92  ? 66  LYS B O   1 
ATOM   2070 C CB  . LYS B 2 65  ? 29.171 12.987  -14.015 1.00 43.22  ? 66  LYS B CB  1 
ATOM   2071 C CG  . LYS B 2 65  ? 29.621 12.693  -15.427 1.00 48.45  ? 66  LYS B CG  1 
ATOM   2072 C CD  . LYS B 2 65  ? 28.844 13.535  -16.439 1.00 57.64  ? 66  LYS B CD  1 
ATOM   2073 C CE  . LYS B 2 65  ? 29.633 13.684  -17.750 1.00 62.28  ? 66  LYS B CE  1 
ATOM   2074 N NZ  . LYS B 2 65  ? 30.013 12.355  -18.331 1.00 64.35  ? 66  LYS B NZ  1 
ATOM   2075 N N   . ALA B 2 66  ? 30.774 14.310  -11.535 1.00 38.61  ? 67  ALA B N   1 
ATOM   2076 C CA  . ALA B 2 66  ? 30.671 15.180  -10.387 1.00 36.96  ? 67  ALA B CA  1 
ATOM   2077 C C   . ALA B 2 66  ? 30.552 16.594  -10.901 1.00 38.41  ? 67  ALA B C   1 
ATOM   2078 O O   . ALA B 2 66  ? 30.860 16.892  -12.060 1.00 38.17  ? 67  ALA B O   1 
ATOM   2079 C CB  . ALA B 2 66  ? 31.851 15.028  -9.476  1.00 36.67  ? 67  ALA B CB  1 
ATOM   2080 N N   . SER B 2 67  ? 30.063 17.463  -10.046 1.00 37.85  ? 68  SER B N   1 
ATOM   2081 C CA  . SER B 2 67  ? 29.858 18.825  -10.438 1.00 41.40  ? 68  SER B CA  1 
ATOM   2082 C C   . SER B 2 67  ? 29.820 19.679  -9.190  1.00 42.99  ? 68  SER B C   1 
ATOM   2083 O O   . SER B 2 67  ? 28.982 19.479  -8.319  1.00 41.93  ? 68  SER B O   1 
ATOM   2084 C CB  . SER B 2 67  ? 28.537 18.905  -11.212 1.00 41.63  ? 68  SER B CB  1 
ATOM   2085 O OG  . SER B 2 67  ? 27.995 20.210  -11.229 1.00 41.60  ? 68  SER B OG  1 
ATOM   2086 N N   . ARG B 2 68  ? 30.804 20.561  -9.067  1.00 46.53  ? 69  ARG B N   1 
ATOM   2087 C CA  . ARG B 2 68  ? 30.893 21.476  -7.932  1.00 46.22  ? 69  ARG B CA  1 
ATOM   2088 C C   . ARG B 2 68  ? 30.432 22.814  -8.490  1.00 48.55  ? 69  ARG B C   1 
ATOM   2089 O O   . ARG B 2 68  ? 31.215 23.505  -9.141  1.00 48.01  ? 69  ARG B O   1 
ATOM   2090 C CB  . ARG B 2 68  ? 32.348 21.591  -7.457  1.00 39.64  ? 69  ARG B CB  1 
ATOM   2091 C CG  . ARG B 2 68  ? 32.575 22.558  -6.324  1.00 29.55  ? 69  ARG B CG  1 
ATOM   2092 C CD  . ARG B 2 68  ? 32.266 21.923  -5.025  1.00 29.48  ? 69  ARG B CD  1 
ATOM   2093 N NE  . ARG B 2 68  ? 32.719 22.722  -3.888  1.00 31.94  ? 69  ARG B NE  1 
ATOM   2094 C CZ  . ARG B 2 68  ? 33.991 22.858  -3.511  1.00 29.10  ? 69  ARG B CZ  1 
ATOM   2095 N NH1 . ARG B 2 68  ? 34.973 22.259  -4.178  1.00 27.38  ? 69  ARG B NH1 1 
ATOM   2096 N NH2 . ARG B 2 68  ? 34.279 23.553  -2.425  1.00 27.93  ? 69  ARG B NH2 1 
ATOM   2097 N N   . PRO B 2 69  ? 29.136 23.156  -8.315  1.00 52.21  ? 70  PRO B N   1 
ATOM   2098 C CA  . PRO B 2 69  ? 28.585 24.425  -8.817  1.00 52.44  ? 70  PRO B CA  1 
ATOM   2099 C C   . PRO B 2 69  ? 29.032 25.688  -8.057  1.00 51.50  ? 70  PRO B C   1 
ATOM   2100 O O   . PRO B 2 69  ? 29.254 26.746  -8.661  1.00 53.93  ? 70  PRO B O   1 
ATOM   2101 C CB  . PRO B 2 69  ? 27.070 24.195  -8.732  1.00 50.98  ? 70  PRO B CB  1 
ATOM   2102 C CG  . PRO B 2 69  ? 26.931 23.275  -7.557  1.00 49.87  ? 70  PRO B CG  1 
ATOM   2103 C CD  . PRO B 2 69  ? 28.058 22.297  -7.782  1.00 52.98  ? 70  PRO B CD  1 
ATOM   2104 N N   . SER B 2 70  ? 29.175 25.566  -6.745  1.00 47.47  ? 71  SER B N   1 
ATOM   2105 C CA  . SER B 2 70  ? 29.579 26.677  -5.914  1.00 47.00  ? 71  SER B CA  1 
ATOM   2106 C C   . SER B 2 70  ? 30.444 26.104  -4.801  1.00 48.36  ? 71  SER B C   1 
ATOM   2107 O O   . SER B 2 70  ? 30.726 24.902  -4.790  1.00 50.79  ? 71  SER B O   1 
ATOM   2108 C CB  . SER B 2 70  ? 28.348 27.366  -5.320  1.00 49.22  ? 71  SER B CB  1 
ATOM   2109 O OG  . SER B 2 70  ? 27.789 26.617  -4.243  1.00 49.67  ? 71  SER B OG  1 
ATOM   2110 N N   . GLN B 2 71  ? 30.829 26.949  -3.847  1.00 47.38  ? 72  GLN B N   1 
ATOM   2111 C CA  . GLN B 2 71  ? 31.663 26.520  -2.733  1.00 44.42  ? 72  GLN B CA  1 
ATOM   2112 C C   . GLN B 2 71  ? 31.029 25.489  -1.798  1.00 43.55  ? 72  GLN B C   1 
ATOM   2113 O O   . GLN B 2 71  ? 31.699 24.572  -1.330  1.00 44.51  ? 72  GLN B O   1 
ATOM   2114 C CB  . GLN B 2 71  ? 32.098 27.713  -1.908  1.00 39.59  ? 72  GLN B CB  1 
ATOM   2115 C CG  . GLN B 2 71  ? 33.125 27.355  -0.846  1.00 40.91  ? 72  GLN B CG  1 
ATOM   2116 C CD  . GLN B 2 71  ? 34.567 27.251  -1.381  1.00 40.55  ? 72  GLN B CD  1 
ATOM   2117 O OE1 . GLN B 2 71  ? 34.816 27.036  -2.581  1.00 38.25  ? 72  GLN B OE1 1 
ATOM   2118 N NE2 . GLN B 2 71  ? 35.519 27.432  -0.482  1.00 37.23  ? 72  GLN B NE2 1 
ATOM   2119 N N   . GLU B 2 72  ? 29.746 25.642  -1.510  1.00 42.37  ? 73  GLU B N   1 
ATOM   2120 C CA  . GLU B 2 72  ? 29.092 24.723  -0.601  1.00 41.41  ? 73  GLU B CA  1 
ATOM   2121 C C   . GLU B 2 72  ? 28.311 23.565  -1.228  1.00 37.89  ? 73  GLU B C   1 
ATOM   2122 O O   . GLU B 2 72  ? 27.759 22.750  -0.511  1.00 36.99  ? 73  GLU B O   1 
ATOM   2123 C CB  . GLU B 2 72  ? 28.253 25.500  0.427   1.00 44.78  ? 73  GLU B CB  1 
ATOM   2124 C CG  . GLU B 2 72  ? 27.224 26.501  -0.128  1.00 54.15  ? 73  GLU B CG  1 
ATOM   2125 C CD  . GLU B 2 72  ? 27.826 27.856  -0.556  1.00 57.95  ? 73  GLU B CD  1 
ATOM   2126 O OE1 . GLU B 2 72  ? 28.391 28.577  0.300   1.00 59.59  ? 73  GLU B OE1 1 
ATOM   2127 O OE2 . GLU B 2 72  ? 27.714 28.215  -1.752  1.00 58.32  ? 73  GLU B OE2 1 
ATOM   2128 N N   . ASN B 2 73  ? 28.346 23.427  -2.547  1.00 37.56  ? 74  ASN B N   1 
ATOM   2129 C CA  . ASN B 2 73  ? 27.611 22.343  -3.210  1.00 40.74  ? 74  ASN B CA  1 
ATOM   2130 C C   . ASN B 2 73  ? 28.471 21.399  -4.069  1.00 38.87  ? 74  ASN B C   1 
ATOM   2131 O O   . ASN B 2 73  ? 29.256 21.835  -4.911  1.00 35.38  ? 74  ASN B O   1 
ATOM   2132 C CB  . ASN B 2 73  ? 26.443 22.892  -4.053  1.00 46.83  ? 74  ASN B CB  1 
ATOM   2133 C CG  . ASN B 2 73  ? 25.392 23.619  -3.213  1.00 51.92  ? 74  ASN B CG  1 
ATOM   2134 O OD1 . ASN B 2 73  ? 25.154 24.821  -3.384  1.00 53.71  ? 74  ASN B OD1 1 
ATOM   2135 N ND2 . ASN B 2 73  ? 24.766 22.893  -2.295  1.00 53.87  ? 74  ASN B ND2 1 
ATOM   2136 N N   . PHE B 2 74  ? 28.287 20.098  -3.863  1.00 35.64  ? 75  PHE B N   1 
ATOM   2137 C CA  . PHE B 2 74  ? 29.023 19.080  -4.590  1.00 32.29  ? 75  PHE B CA  1 
ATOM   2138 C C   . PHE B 2 74  ? 28.070 17.913  -4.888  1.00 34.96  ? 75  PHE B C   1 
ATOM   2139 O O   . PHE B 2 74  ? 27.573 17.240  -3.972  1.00 37.33  ? 75  PHE B O   1 
ATOM   2140 C CB  . PHE B 2 74  ? 30.225 18.621  -3.752  1.00 29.47  ? 75  PHE B CB  1 
ATOM   2141 C CG  . PHE B 2 74  ? 31.230 17.814  -4.519  1.00 25.47  ? 75  PHE B CG  1 
ATOM   2142 C CD1 . PHE B 2 74  ? 31.434 18.032  -5.870  1.00 27.03  ? 75  PHE B CD1 1 
ATOM   2143 C CD2 . PHE B 2 74  ? 31.935 16.801  -3.905  1.00 28.20  ? 75  PHE B CD2 1 
ATOM   2144 C CE1 . PHE B 2 74  ? 32.310 17.255  -6.593  1.00 25.14  ? 75  PHE B CE1 1 
ATOM   2145 C CE2 . PHE B 2 74  ? 32.821 16.014  -4.631  1.00 26.24  ? 75  PHE B CE2 1 
ATOM   2146 C CZ  . PHE B 2 74  ? 32.999 16.246  -5.970  1.00 24.91  ? 75  PHE B CZ  1 
ATOM   2147 N N   . SER B 2 75  ? 27.830 17.682  -6.174  1.00 35.75  ? 76  SER B N   1 
ATOM   2148 C CA  . SER B 2 75  ? 26.914 16.639  -6.644  1.00 38.85  ? 76  SER B CA  1 
ATOM   2149 C C   . SER B 2 75  ? 27.556 15.479  -7.410  1.00 38.29  ? 76  SER B C   1 
ATOM   2150 O O   . SER B 2 75  ? 28.501 15.650  -8.198  1.00 39.37  ? 76  SER B O   1 
ATOM   2151 C CB  . SER B 2 75  ? 25.811 17.255  -7.532  1.00 40.30  ? 76  SER B CB  1 
ATOM   2152 O OG  . SER B 2 75  ? 25.212 18.380  -6.903  1.00 47.40  ? 76  SER B OG  1 
ATOM   2153 N N   . LEU B 2 76  ? 26.976 14.304  -7.210  1.00 37.27  ? 77  LEU B N   1 
ATOM   2154 C CA  . LEU B 2 76  ? 27.422 13.090  -7.857  1.00 34.72  ? 77  LEU B CA  1 
ATOM   2155 C C   . LEU B 2 76  ? 26.249 12.750  -8.776  1.00 33.13  ? 77  LEU B C   1 
ATOM   2156 O O   . LEU B 2 76  ? 25.084 12.766  -8.363  1.00 31.00  ? 77  LEU B O   1 
ATOM   2157 C CB  . LEU B 2 76  ? 27.666 12.017  -6.794  1.00 30.26  ? 77  LEU B CB  1 
ATOM   2158 C CG  . LEU B 2 76  ? 28.363 10.699  -7.121  1.00 33.06  ? 77  LEU B CG  1 
ATOM   2159 C CD1 . LEU B 2 76  ? 29.763 10.946  -7.593  1.00 28.83  ? 77  LEU B CD1 1 
ATOM   2160 C CD2 . LEU B 2 76  ? 28.356 9.819   -5.883  1.00 27.82  ? 77  LEU B CD2 1 
ATOM   2161 N N   . ILE B 2 77  ? 26.558 12.528  -10.043 1.00 32.37  ? 78  ILE B N   1 
ATOM   2162 C CA  . ILE B 2 77  ? 25.543 12.240  -11.028 1.00 32.16  ? 78  ILE B CA  1 
ATOM   2163 C C   . ILE B 2 77  ? 25.749 10.892  -11.683 1.00 35.08  ? 78  ILE B C   1 
ATOM   2164 O O   . ILE B 2 77  ? 26.697 10.702  -12.446 1.00 39.52  ? 78  ILE B O   1 
ATOM   2165 C CB  . ILE B 2 77  ? 25.536 13.319  -12.125 1.00 28.17  ? 78  ILE B CB  1 
ATOM   2166 C CG1 . ILE B 2 77  ? 25.388 14.696  -11.493 1.00 27.24  ? 78  ILE B CG1 1 
ATOM   2167 C CG2 . ILE B 2 77  ? 24.401 13.077  -13.120 1.00 25.45  ? 78  ILE B CG2 1 
ATOM   2168 C CD1 . ILE B 2 77  ? 26.431 15.657  -11.973 1.00 28.14  ? 78  ILE B CD1 1 
ATOM   2169 N N   . LEU B 2 78  ? 24.888 9.934   -11.377 1.00 36.06  ? 79  LEU B N   1 
ATOM   2170 C CA  . LEU B 2 78  ? 25.025 8.651   -12.022 1.00 37.38  ? 79  LEU B CA  1 
ATOM   2171 C C   . LEU B 2 78  ? 24.079 8.766   -13.225 1.00 40.76  ? 79  LEU B C   1 
ATOM   2172 O O   . LEU B 2 78  ? 22.848 8.810   -13.078 1.00 37.58  ? 79  LEU B O   1 
ATOM   2173 C CB  . LEU B 2 78  ? 24.684 7.481   -11.086 1.00 33.35  ? 79  LEU B CB  1 
ATOM   2174 C CG  . LEU B 2 78  ? 24.564 7.563   -9.548  1.00 34.35  ? 79  LEU B CG  1 
ATOM   2175 C CD1 . LEU B 2 78  ? 24.685 6.135   -9.027  1.00 33.32  ? 79  LEU B CD1 1 
ATOM   2176 C CD2 . LEU B 2 78  ? 25.576 8.475   -8.840  1.00 26.68  ? 79  LEU B CD2 1 
ATOM   2177 N N   . GLU B 2 79  ? 24.701 8.989   -14.387 1.00 45.69  ? 80  GLU B N   1 
ATOM   2178 C CA  . GLU B 2 79  ? 24.027 9.160   -15.674 1.00 46.42  ? 80  GLU B CA  1 
ATOM   2179 C C   . GLU B 2 79  ? 23.190 7.943   -16.040 1.00 45.63  ? 80  GLU B C   1 
ATOM   2180 O O   . GLU B 2 79  ? 22.013 8.059   -16.340 1.00 46.43  ? 80  GLU B O   1 
ATOM   2181 C CB  . GLU B 2 79  ? 25.077 9.438   -16.752 1.00 53.04  ? 80  GLU B CB  1 
ATOM   2182 C CG  . GLU B 2 79  ? 25.845 10.755  -16.568 1.00 60.13  ? 80  GLU B CG  1 
ATOM   2183 C CD  . GLU B 2 79  ? 25.159 11.956  -17.243 1.00 63.93  ? 80  GLU B CD  1 
ATOM   2184 O OE1 . GLU B 2 79  ? 23.956 12.210  -16.999 1.00 65.59  ? 80  GLU B OE1 1 
ATOM   2185 O OE2 . GLU B 2 79  ? 25.837 12.659  -18.023 1.00 66.51  ? 80  GLU B OE2 1 
ATOM   2186 N N   . LEU B 2 80  ? 23.818 6.778   -16.065 1.00 45.03  ? 81  LEU B N   1 
ATOM   2187 C CA  . LEU B 2 80  ? 23.105 5.552   -16.356 1.00 42.40  ? 81  LEU B CA  1 
ATOM   2188 C C   . LEU B 2 80  ? 23.382 4.611   -15.186 1.00 44.00  ? 81  LEU B C   1 
ATOM   2189 O O   . LEU B 2 80  ? 24.447 3.966   -15.102 1.00 42.71  ? 81  LEU B O   1 
ATOM   2190 C CB  . LEU B 2 80  ? 23.570 4.955   -17.684 1.00 42.24  ? 81  LEU B CB  1 
ATOM   2191 C CG  . LEU B 2 80  ? 23.170 5.733   -18.941 1.00 42.81  ? 81  LEU B CG  1 
ATOM   2192 C CD1 . LEU B 2 80  ? 23.739 5.044   -20.169 1.00 39.75  ? 81  LEU B CD1 1 
ATOM   2193 C CD2 . LEU B 2 80  ? 21.652 5.865   -19.045 1.00 38.74  ? 81  LEU B CD2 1 
ATOM   2194 N N   . ALA B 2 81  ? 22.449 4.608   -14.236 1.00 41.61  ? 82  ALA B N   1 
ATOM   2195 C CA  . ALA B 2 81  ? 22.568 3.782   -13.046 1.00 39.38  ? 82  ALA B CA  1 
ATOM   2196 C C   . ALA B 2 81  ? 22.626 2.296   -13.375 1.00 37.48  ? 82  ALA B C   1 
ATOM   2197 O O   . ALA B 2 81  ? 21.941 1.805   -14.265 1.00 36.89  ? 82  ALA B O   1 
ATOM   2198 C CB  . ALA B 2 81  ? 21.437 4.072   -12.084 1.00 39.32  ? 82  ALA B CB  1 
ATOM   2199 N N   . THR B 2 82  ? 23.487 1.603   -12.654 1.00 35.42  ? 83  THR B N   1 
ATOM   2200 C CA  . THR B 2 82  ? 23.689 0.187   -12.817 1.00 34.39  ? 83  THR B CA  1 
ATOM   2201 C C   . THR B 2 82  ? 23.617 -0.407  -11.429 1.00 35.53  ? 83  THR B C   1 
ATOM   2202 O O   . THR B 2 82  ? 23.957 0.257   -10.451 1.00 34.79  ? 83  THR B O   1 
ATOM   2203 C CB  . THR B 2 82  ? 25.104 -0.113  -13.410 1.00 38.35  ? 83  THR B CB  1 
ATOM   2204 O OG1 . THR B 2 82  ? 26.123 0.531   -12.630 1.00 34.33  ? 83  THR B OG1 1 
ATOM   2205 C CG2 . THR B 2 82  ? 25.196 0.388   -14.843 1.00 41.07  ? 83  THR B CG2 1 
ATOM   2206 N N   . PRO B 2 83  ? 23.136 -1.657  -11.314 1.00 37.66  ? 84  PRO B N   1 
ATOM   2207 C CA  . PRO B 2 83  ? 23.009 -2.386  -10.040 1.00 36.54  ? 84  PRO B CA  1 
ATOM   2208 C C   . PRO B 2 83  ? 24.274 -2.359  -9.155  1.00 36.36  ? 84  PRO B C   1 
ATOM   2209 O O   . PRO B 2 83  ? 24.199 -2.335  -7.935  1.00 37.48  ? 84  PRO B O   1 
ATOM   2210 C CB  . PRO B 2 83  ? 22.664 -3.795  -10.513 1.00 32.77  ? 84  PRO B CB  1 
ATOM   2211 C CG  . PRO B 2 83  ? 21.753 -3.491  -11.671 1.00 34.87  ? 84  PRO B CG  1 
ATOM   2212 C CD  . PRO B 2 83  ? 22.485 -2.403  -12.412 1.00 34.86  ? 84  PRO B CD  1 
ATOM   2213 N N   . SER B 2 84  ? 25.439 -2.347  -9.775  1.00 36.40  ? 85  SER B N   1 
ATOM   2214 C CA  . SER B 2 84  ? 26.679 -2.289  -9.028  1.00 34.16  ? 85  SER B CA  1 
ATOM   2215 C C   . SER B 2 84  ? 26.778 -0.995  -8.214  1.00 30.99  ? 85  SER B C   1 
ATOM   2216 O O   . SER B 2 84  ? 27.542 -0.923  -7.262  1.00 34.76  ? 85  SER B O   1 
ATOM   2217 C CB  . SER B 2 84  ? 27.864 -2.414  -9.996  1.00 37.56  ? 85  SER B CB  1 
ATOM   2218 O OG  . SER B 2 84  ? 27.661 -1.625  -11.166 1.00 46.21  ? 85  SER B OG  1 
ATOM   2219 N N   . GLN B 2 85  ? 26.012 0.027   -8.586  1.00 28.11  ? 86  GLN B N   1 
ATOM   2220 C CA  . GLN B 2 85  ? 26.037 1.294   -7.874  1.00 25.73  ? 86  GLN B CA  1 
ATOM   2221 C C   . GLN B 2 85  ? 25.167 1.337   -6.608  1.00 27.58  ? 86  GLN B C   1 
ATOM   2222 O O   . GLN B 2 85  ? 25.151 2.335   -5.877  1.00 23.16  ? 86  GLN B O   1 
ATOM   2223 C CB  . GLN B 2 85  ? 25.704 2.454   -8.824  1.00 27.08  ? 86  GLN B CB  1 
ATOM   2224 C CG  . GLN B 2 85  ? 26.803 2.687   -9.874  1.00 30.33  ? 86  GLN B CG  1 
ATOM   2225 C CD  . GLN B 2 85  ? 26.434 3.725   -10.945 1.00 34.70  ? 86  GLN B CD  1 
ATOM   2226 O OE1 . GLN B 2 85  ? 27.235 4.613   -11.246 1.00 35.76  ? 86  GLN B OE1 1 
ATOM   2227 N NE2 . GLN B 2 85  ? 25.263 3.665   -11.550 1.00 31.66  ? 86  GLN B NE2 1 
ATOM   2228 N N   . THR B 2 86  ? 24.431 0.284   -6.287  1.00 26.90  ? 87  THR B N   1 
ATOM   2229 C CA  . THR B 2 86  ? 23.698 0.320   -5.006  1.00 25.33  ? 87  THR B CA  1 
ATOM   2230 C C   . THR B 2 86  ? 24.772 0.272   -3.915  1.00 26.65  ? 87  THR B C   1 
ATOM   2231 O O   . THR B 2 86  ? 25.616 -0.634  -3.883  1.00 32.57  ? 87  THR B O   1 
ATOM   2232 C CB  . THR B 2 86  ? 22.661 -0.818  -4.877  1.00 24.14  ? 87  THR B CB  1 
ATOM   2233 O OG1 . THR B 2 86  ? 23.025 -1.714  -3.834  1.00 19.12  ? 87  THR B OG1 1 
ATOM   2234 C CG2 . THR B 2 86  ? 22.483 -1.641  -6.150  1.00 13.26  ? 87  THR B CG2 1 
ATOM   2235 N N   . SER B 2 87  ? 24.747 1.273   -3.056  1.00 23.11  ? 88  SER B N   1 
ATOM   2236 C CA  . SER B 2 87  ? 25.748 1.407   -1.988  1.00 23.55  ? 88  SER B CA  1 
ATOM   2237 C C   . SER B 2 87  ? 25.294 2.457   -0.967  1.00 22.93  ? 88  SER B C   1 
ATOM   2238 O O   . SER B 2 87  ? 24.140 2.896   -0.998  1.00 26.78  ? 88  SER B O   1 
ATOM   2239 C CB  . SER B 2 87  ? 27.078 1.844   -2.613  1.00 20.88  ? 88  SER B CB  1 
ATOM   2240 O OG  . SER B 2 87  ? 28.101 1.872   -1.635  1.00 22.62  ? 88  SER B OG  1 
ATOM   2241 N N   . VAL B 2 88  ? 26.158 2.784   -0.008  1.00 22.96  ? 89  VAL B N   1 
ATOM   2242 C CA  . VAL B 2 88  ? 25.865 3.831   0.977   1.00 21.56  ? 89  VAL B CA  1 
ATOM   2243 C C   . VAL B 2 88  ? 26.872 4.908   0.650   1.00 21.77  ? 89  VAL B C   1 
ATOM   2244 O O   . VAL B 2 88  ? 28.056 4.653   0.755   1.00 24.31  ? 89  VAL B O   1 
ATOM   2245 C CB  . VAL B 2 88  ? 26.121 3.404   2.416   1.00 22.43  ? 89  VAL B CB  1 
ATOM   2246 C CG1 . VAL B 2 88  ? 25.618 4.497   3.344   1.00 22.00  ? 89  VAL B CG1 1 
ATOM   2247 C CG2 . VAL B 2 88  ? 25.415 2.096   2.728   1.00 21.07  ? 89  VAL B CG2 1 
ATOM   2248 N N   . TYR B 2 89  ? 26.415 6.082   0.222   1.00 22.64  ? 90  TYR B N   1 
ATOM   2249 C CA  . TYR B 2 89  ? 27.307 7.169   -0.155  1.00 21.80  ? 90  TYR B CA  1 
ATOM   2250 C C   . TYR B 2 89  ? 27.519 8.202   0.932   1.00 22.09  ? 90  TYR B C   1 
ATOM   2251 O O   . TYR B 2 89  ? 26.578 8.594   1.616   1.00 31.03  ? 90  TYR B O   1 
ATOM   2252 C CB  . TYR B 2 89  ? 26.816 7.842   -1.435  1.00 15.71  ? 90  TYR B CB  1 
ATOM   2253 C CG  . TYR B 2 89  ? 26.771 6.905   -2.620  1.00 17.46  ? 90  TYR B CG  1 
ATOM   2254 C CD1 . TYR B 2 89  ? 25.729 5.970   -2.767  1.00 18.98  ? 90  TYR B CD1 1 
ATOM   2255 C CD2 . TYR B 2 89  ? 27.762 6.947   -3.597  1.00 17.75  ? 90  TYR B CD2 1 
ATOM   2256 C CE1 . TYR B 2 89  ? 25.680 5.105   -3.860  1.00 13.94  ? 90  TYR B CE1 1 
ATOM   2257 C CE2 . TYR B 2 89  ? 27.727 6.092   -4.694  1.00 15.22  ? 90  TYR B CE2 1 
ATOM   2258 C CZ  . TYR B 2 89  ? 26.681 5.175   -4.816  1.00 18.13  ? 90  TYR B CZ  1 
ATOM   2259 O OH  . TYR B 2 89  ? 26.652 4.341   -5.912  1.00 19.31  ? 90  TYR B OH  1 
ATOM   2260 N N   . PHE B 2 90  ? 28.767 8.621   1.107   1.00 23.08  ? 91  PHE B N   1 
ATOM   2261 C CA  . PHE B 2 90  ? 29.117 9.616   2.118   1.00 22.85  ? 91  PHE B CA  1 
ATOM   2262 C C   . PHE B 2 90  ? 29.777 10.824  1.522   1.00 23.86  ? 91  PHE B C   1 
ATOM   2263 O O   . PHE B 2 90  ? 30.648 10.725  0.655   1.00 23.74  ? 91  PHE B O   1 
ATOM   2264 C CB  . PHE B 2 90  ? 30.062 9.038   3.159   1.00 20.26  ? 91  PHE B CB  1 
ATOM   2265 C CG  . PHE B 2 90  ? 29.389 8.180   4.186   1.00 20.09  ? 91  PHE B CG  1 
ATOM   2266 C CD1 . PHE B 2 90  ? 29.219 6.812   3.970   1.00 22.78  ? 91  PHE B CD1 1 
ATOM   2267 C CD2 . PHE B 2 90  ? 28.946 8.732   5.380   1.00 15.26  ? 91  PHE B CD2 1 
ATOM   2268 C CE1 . PHE B 2 90  ? 28.611 6.007   4.940   1.00 22.49  ? 91  PHE B CE1 1 
ATOM   2269 C CE2 . PHE B 2 90  ? 28.351 7.947   6.339   1.00 22.08  ? 91  PHE B CE2 1 
ATOM   2270 C CZ  . PHE B 2 90  ? 28.179 6.577   6.122   1.00 21.34  ? 91  PHE B CZ  1 
ATOM   2271 N N   . CYS B 2 91  ? 29.337 11.980  1.975   1.00 25.68  ? 92  CYS B N   1 
ATOM   2272 C CA  . CYS B 2 91  ? 29.919 13.209  1.504   1.00 28.31  ? 92  CYS B CA  1 
ATOM   2273 C C   . CYS B 2 91  ? 30.732 13.831  2.629   1.00 30.89  ? 92  CYS B C   1 
ATOM   2274 O O   . CYS B 2 91  ? 30.369 13.728  3.814   1.00 31.50  ? 92  CYS B O   1 
ATOM   2275 C CB  . CYS B 2 91  ? 28.840 14.180  1.089   1.00 30.50  ? 92  CYS B CB  1 
ATOM   2276 S SG  . CYS B 2 91  ? 29.551 15.692  0.452   1.00 40.67  ? 92  CYS B SG  1 
ATOM   2277 N N   . ALA B 2 92  ? 31.823 14.490  2.269   1.00 31.57  ? 93  ALA B N   1 
ATOM   2278 C CA  . ALA B 2 92  ? 32.646 15.148  3.263   1.00 31.38  ? 93  ALA B CA  1 
ATOM   2279 C C   . ALA B 2 92  ? 33.228 16.439  2.710   1.00 35.03  ? 93  ALA B C   1 
ATOM   2280 O O   . ALA B 2 92  ? 33.411 16.600  1.494   1.00 34.09  ? 93  ALA B O   1 
ATOM   2281 C CB  . ALA B 2 92  ? 33.766 14.221  3.730   1.00 27.30  ? 93  ALA B CB  1 
ATOM   2282 N N   . SER B 2 93  ? 33.489 17.373  3.618   1.00 41.61  ? 94  SER B N   1 
ATOM   2283 C CA  . SER B 2 93  ? 34.103 18.660  3.280   1.00 40.99  ? 94  SER B CA  1 
ATOM   2284 C C   . SER B 2 93  ? 35.368 18.663  4.126   1.00 40.72  ? 94  SER B C   1 
ATOM   2285 O O   . SER B 2 93  ? 35.399 18.052  5.203   1.00 36.70  ? 94  SER B O   1 
ATOM   2286 C CB  . SER B 2 93  ? 33.204 19.848  3.669   1.00 35.64  ? 94  SER B CB  1 
ATOM   2287 O OG  . SER B 2 93  ? 33.162 20.052  5.075   1.00 34.26  ? 94  SER B OG  1 
ATOM   2288 N N   . GLY B 2 94  ? 36.401 19.348  3.656   1.00 43.75  ? 95  GLY B N   1 
ATOM   2289 C CA  . GLY B 2 94  ? 37.638 19.385  4.415   1.00 47.05  ? 95  GLY B CA  1 
ATOM   2290 C C   . GLY B 2 94  ? 38.542 20.578  4.201   1.00 49.18  ? 95  GLY B C   1 
ATOM   2291 O O   . GLY B 2 94  ? 38.681 21.101  3.081   1.00 41.80  ? 95  GLY B O   1 
ATOM   2292 N N   . GLY B 2 95  ? 39.164 21.001  5.299   1.00 55.60  ? 96  GLY B N   1 
ATOM   2293 C CA  . GLY B 2 95  ? 40.076 22.132  5.255   1.00 66.09  ? 96  GLY B CA  1 
ATOM   2294 C C   . GLY B 2 95  ? 41.546 21.686  5.268   1.00 69.78  ? 96  GLY B C   1 
ATOM   2295 O O   . GLY B 2 95  ? 42.278 21.930  6.236   1.00 72.06  ? 96  GLY B O   1 
ATOM   2296 N N   . GLY B 2 96  ? 41.941 21.047  4.182   1.00 68.55  ? 97  GLY B N   1 
ATOM   2297 C CA  . GLY B 2 96  ? 43.328 20.583  3.980   1.00 63.80  ? 97  GLY B CA  1 
ATOM   2298 C C   . GLY B 2 96  ? 43.686 19.391  4.890   1.00 60.38  ? 97  GLY B C   1 
ATOM   2299 O O   . GLY B 2 96  ? 44.481 18.519  4.506   1.00 59.64  ? 97  GLY B O   1 
ATOM   2300 N N   . GLY B 2 97  ? 43.090 19.364  6.078   1.00 56.51  ? 98  GLY B N   1 
ATOM   2301 C CA  . GLY B 2 97  ? 43.378 18.318  7.094   1.00 53.40  ? 98  GLY B CA  1 
ATOM   2302 C C   . GLY B 2 97  ? 42.215 17.321  7.268   1.00 51.70  ? 98  GLY B C   1 
ATOM   2303 O O   . GLY B 2 97  ? 41.833 16.600  6.339   1.00 51.07  ? 98  GLY B O   1 
ATOM   2304 N N   . THR B 2 98  ? 41.680 17.299  8.487   1.00 49.88  ? 105 THR B N   1 
ATOM   2305 C CA  . THR B 2 98  ? 40.590 16.370  8.863   1.00 47.89  ? 105 THR B CA  1 
ATOM   2306 C C   . THR B 2 98  ? 39.332 16.650  8.007   1.00 49.43  ? 105 THR B C   1 
ATOM   2307 O O   . THR B 2 98  ? 39.071 17.788  7.593   1.00 53.88  ? 105 THR B O   1 
ATOM   2308 C CB  . THR B 2 98  ? 40.306 16.476  10.380  1.00 44.98  ? 105 THR B CB  1 
ATOM   2309 O OG1 . THR B 2 98  ? 38.912 16.402  10.640  1.00 45.23  ? 105 THR B OG1 1 
ATOM   2310 C CG2 . THR B 2 98  ? 40.825 17.770  11.016  1.00 36.84  ? 105 THR B CG2 1 
ATOM   2311 N N   . LEU B 2 99  ? 38.590 15.573  7.741   1.00 43.49  ? 106 LEU B N   1 
ATOM   2312 C CA  . LEU B 2 99  ? 37.349 15.625  6.934   1.00 35.46  ? 106 LEU B CA  1 
ATOM   2313 C C   . LEU B 2 99  ? 36.105 15.597  7.833   1.00 33.42  ? 106 LEU B C   1 
ATOM   2314 O O   . LEU B 2 99  ? 36.082 14.929  8.869   1.00 31.54  ? 106 LEU B O   1 
ATOM   2315 C CB  . LEU B 2 99  ? 37.208 14.387  6.018   1.00 33.48  ? 106 LEU B CB  1 
ATOM   2316 C CG  . LEU B 2 99  ? 38.237 14.261  4.877   1.00 35.02  ? 106 LEU B CG  1 
ATOM   2317 C CD1 . LEU B 2 99  ? 37.700 13.440  3.690   1.00 28.68  ? 106 LEU B CD1 1 
ATOM   2318 C CD2 . LEU B 2 99  ? 38.682 15.595  4.285   1.00 34.56  ? 106 LEU B CD2 1 
ATOM   2319 N N   . TYR B 2 100 ? 35.087 16.366  7.448   1.00 34.01  ? 107 TYR B N   1 
ATOM   2320 C CA  . TYR B 2 100 ? 33.822 16.427  8.180   1.00 31.65  ? 107 TYR B CA  1 
ATOM   2321 C C   . TYR B 2 100 ? 32.815 15.747  7.263   1.00 30.93  ? 107 TYR B C   1 
ATOM   2322 O O   . TYR B 2 100 ? 32.708 16.079  6.078   1.00 29.17  ? 107 TYR B O   1 
ATOM   2323 C CB  . TYR B 2 100 ? 33.465 17.881  8.505   1.00 32.36  ? 107 TYR B CB  1 
ATOM   2324 C CG  . TYR B 2 100 ? 34.475 18.500  9.448   1.00 30.34  ? 107 TYR B CG  1 
ATOM   2325 C CD1 . TYR B 2 100 ? 35.733 18.909  8.986   1.00 29.44  ? 107 TYR B CD1 1 
ATOM   2326 C CD2 . TYR B 2 100 ? 34.222 18.572  10.810  1.00 31.67  ? 107 TYR B CD2 1 
ATOM   2327 C CE1 . TYR B 2 100 ? 36.719 19.357  9.859   1.00 30.70  ? 107 TYR B CE1 1 
ATOM   2328 C CE2 . TYR B 2 100 ? 35.203 19.027  11.709  1.00 38.36  ? 107 TYR B CE2 1 
ATOM   2329 C CZ  . TYR B 2 100 ? 36.453 19.411  11.225  1.00 39.90  ? 107 TYR B CZ  1 
ATOM   2330 O OH  . TYR B 2 100 ? 37.445 19.808  12.111  1.00 44.59  ? 107 TYR B OH  1 
ATOM   2331 N N   . PHE B 2 101 ? 32.151 14.733  7.801   1.00 31.10  ? 108 PHE B N   1 
ATOM   2332 C CA  . PHE B 2 101 ? 31.220 13.919  7.024   1.00 31.46  ? 108 PHE B CA  1 
ATOM   2333 C C   . PHE B 2 101 ? 29.741 14.185  7.134   1.00 29.44  ? 108 PHE B C   1 
ATOM   2334 O O   . PHE B 2 101 ? 29.275 14.910  8.020   1.00 29.20  ? 108 PHE B O   1 
ATOM   2335 C CB  . PHE B 2 101 ? 31.461 12.418  7.321   1.00 29.62  ? 108 PHE B CB  1 
ATOM   2336 C CG  . PHE B 2 101 ? 32.688 11.845  6.648   1.00 29.39  ? 108 PHE B CG  1 
ATOM   2337 C CD1 . PHE B 2 101 ? 33.958 12.003  7.219   1.00 27.29  ? 108 PHE B CD1 1 
ATOM   2338 C CD2 . PHE B 2 101 ? 32.572 11.136  5.445   1.00 28.26  ? 108 PHE B CD2 1 
ATOM   2339 C CE1 . PHE B 2 101 ? 35.092 11.470  6.610   1.00 25.81  ? 108 PHE B CE1 1 
ATOM   2340 C CE2 . PHE B 2 101 ? 33.705 10.591  4.821   1.00 29.27  ? 108 PHE B CE2 1 
ATOM   2341 C CZ  . PHE B 2 101 ? 34.970 10.762  5.410   1.00 29.54  ? 108 PHE B CZ  1 
ATOM   2342 N N   . GLY B 2 102 ? 29.030 13.612  6.169   1.00 27.30  ? 109 GLY B N   1 
ATOM   2343 C CA  . GLY B 2 102 ? 27.585 13.667  6.138   1.00 29.51  ? 109 GLY B CA  1 
ATOM   2344 C C   . GLY B 2 102 ? 27.073 12.431  6.878   1.00 31.16  ? 109 GLY B C   1 
ATOM   2345 O O   . GLY B 2 102 ? 27.869 11.678  7.472   1.00 33.81  ? 109 GLY B O   1 
ATOM   2346 N N   . ALA B 2 103 ? 25.755 12.216  6.853   1.00 29.73  ? 110 ALA B N   1 
ATOM   2347 C CA  . ALA B 2 103 ? 25.144 11.061  7.518   1.00 27.06  ? 110 ALA B CA  1 
ATOM   2348 C C   . ALA B 2 103 ? 25.017 9.847   6.593   1.00 24.27  ? 110 ALA B C   1 
ATOM   2349 O O   . ALA B 2 103 ? 24.868 8.734   7.075   1.00 25.08  ? 110 ALA B O   1 
ATOM   2350 C CB  . ALA B 2 103 ? 23.783 11.428  8.132   1.00 24.68  ? 110 ALA B CB  1 
ATOM   2351 N N   . GLY B 2 104 ? 25.089 10.055  5.280   1.00 18.29  ? 111 GLY B N   1 
ATOM   2352 C CA  . GLY B 2 104 ? 25.023 8.943   4.360   1.00 16.38  ? 111 GLY B CA  1 
ATOM   2353 C C   . GLY B 2 104 ? 23.775 8.937   3.535   1.00 20.89  ? 111 GLY B C   1 
ATOM   2354 O O   . GLY B 2 104 ? 22.765 9.501   3.927   1.00 22.87  ? 111 GLY B O   1 
ATOM   2355 N N   . THR B 2 105 ? 23.854 8.330   2.359   1.00 21.70  ? 112 THR B N   1 
ATOM   2356 C CA  . THR B 2 105 ? 22.705 8.241   1.464   1.00 19.13  ? 112 THR B CA  1 
ATOM   2357 C C   . THR B 2 105 ? 22.633 6.781   1.065   1.00 23.29  ? 112 THR B C   1 
ATOM   2358 O O   . THR B 2 105 ? 23.620 6.242   0.569   1.00 23.85  ? 112 THR B O   1 
ATOM   2359 C CB  . THR B 2 105 ? 22.895 9.074   0.173   1.00 19.59  ? 112 THR B CB  1 
ATOM   2360 O OG1 . THR B 2 105 ? 22.742 10.472  0.447   1.00 19.08  ? 112 THR B OG1 1 
ATOM   2361 C CG2 . THR B 2 105 ? 21.894 8.657   -0.896  1.00 15.61  ? 112 THR B CG2 1 
ATOM   2362 N N   . ARG B 2 106 ? 21.509 6.122   1.341   1.00 23.42  ? 113 ARG B N   1 
ATOM   2363 C CA  . ARG B 2 106 ? 21.358 4.726   0.973   1.00 22.38  ? 113 ARG B CA  1 
ATOM   2364 C C   . ARG B 2 106 ? 20.773 4.711   -0.423  1.00 21.66  ? 113 ARG B C   1 
ATOM   2365 O O   . ARG B 2 106 ? 19.695 5.263   -0.649  1.00 24.01  ? 113 ARG B O   1 
ATOM   2366 C CB  . ARG B 2 106 ? 20.456 3.981   1.972   1.00 23.03  ? 113 ARG B CB  1 
ATOM   2367 C CG  . ARG B 2 106 ? 21.065 3.818   3.347   1.00 27.24  ? 113 ARG B CG  1 
ATOM   2368 C CD  . ARG B 2 106 ? 20.260 2.911   4.289   1.00 30.27  ? 113 ARG B CD  1 
ATOM   2369 N NE  . ARG B 2 106 ? 19.001 3.510   4.747   1.00 34.95  ? 113 ARG B NE  1 
ATOM   2370 C CZ  . ARG B 2 106 ? 18.504 3.392   5.982   1.00 34.00  ? 113 ARG B CZ  1 
ATOM   2371 N NH1 . ARG B 2 106 ? 19.152 2.703   6.918   1.00 31.67  ? 113 ARG B NH1 1 
ATOM   2372 N NH2 . ARG B 2 106 ? 17.334 3.935   6.270   1.00 21.76  ? 113 ARG B NH2 1 
ATOM   2373 N N   . LEU B 2 107 ? 21.488 4.093   -1.355  1.00 21.77  ? 114 LEU B N   1 
ATOM   2374 C CA  . LEU B 2 107 ? 21.046 4.014   -2.735  1.00 22.06  ? 114 LEU B CA  1 
ATOM   2375 C C   . LEU B 2 107 ? 20.917 2.570   -3.259  1.00 23.53  ? 114 LEU B C   1 
ATOM   2376 O O   . LEU B 2 107 ? 21.844 1.788   -3.118  1.00 23.11  ? 114 LEU B O   1 
ATOM   2377 C CB  . LEU B 2 107 ? 22.020 4.788   -3.623  1.00 14.50  ? 114 LEU B CB  1 
ATOM   2378 C CG  . LEU B 2 107 ? 21.806 4.578   -5.113  1.00 12.28  ? 114 LEU B CG  1 
ATOM   2379 C CD1 . LEU B 2 107 ? 20.496 5.169   -5.535  1.00 12.43  ? 114 LEU B CD1 1 
ATOM   2380 C CD2 . LEU B 2 107 ? 22.942 5.176   -5.879  1.00 15.66  ? 114 LEU B CD2 1 
ATOM   2381 N N   . SER B 2 108 ? 19.771 2.233   -3.857  1.00 24.93  ? 115 SER B N   1 
ATOM   2382 C CA  . SER B 2 108 ? 19.541 0.905   -4.446  1.00 28.42  ? 115 SER B CA  1 
ATOM   2383 C C   . SER B 2 108 ? 19.188 1.123   -5.909  1.00 28.76  ? 115 SER B C   1 
ATOM   2384 O O   . SER B 2 108 ? 18.323 1.939   -6.212  1.00 29.02  ? 115 SER B O   1 
ATOM   2385 C CB  . SER B 2 108 ? 18.347 0.170   -3.810  1.00 30.13  ? 115 SER B CB  1 
ATOM   2386 O OG  . SER B 2 108 ? 18.505 -0.063  -2.423  1.00 42.83  ? 115 SER B OG  1 
ATOM   2387 N N   . VAL B 2 109 ? 19.901 0.454   -6.809  1.00 29.37  ? 116 VAL B N   1 
ATOM   2388 C CA  . VAL B 2 109 ? 19.618 0.546   -8.241  1.00 27.28  ? 116 VAL B CA  1 
ATOM   2389 C C   . VAL B 2 109 ? 19.188 -0.878  -8.633  1.00 28.51  ? 116 VAL B C   1 
ATOM   2390 O O   . VAL B 2 109 ? 19.952 -1.835  -8.500  1.00 29.62  ? 116 VAL B O   1 
ATOM   2391 C CB  . VAL B 2 109 ? 20.846 1.023   -9.051  1.00 28.90  ? 116 VAL B CB  1 
ATOM   2392 C CG1 . VAL B 2 109 ? 20.472 1.215   -10.513 1.00 25.94  ? 116 VAL B CG1 1 
ATOM   2393 C CG2 . VAL B 2 109 ? 21.412 2.320   -8.456  1.00 20.42  ? 116 VAL B CG2 1 
ATOM   2394 N N   . LEU B 2 110 A 17.903 -1.004  -8.950  1.00 28.27  ? 116 LEU B N   1 
ATOM   2395 C CA  . LEU B 2 110 A 17.258 -2.262  -9.300  1.00 28.67  ? 116 LEU B CA  1 
ATOM   2396 C C   . LEU B 2 110 A 17.072 -2.563  -10.779 1.00 27.19  ? 116 LEU B C   1 
ATOM   2397 O O   . LEU B 2 110 A 16.900 -1.672  -11.602 1.00 26.51  ? 116 LEU B O   1 
ATOM   2398 C CB  . LEU B 2 110 A 15.896 -2.321  -8.612  1.00 25.75  ? 116 LEU B CB  1 
ATOM   2399 C CG  . LEU B 2 110 A 15.928 -2.198  -7.097  1.00 26.23  ? 116 LEU B CG  1 
ATOM   2400 C CD1 . LEU B 2 110 A 14.527 -2.140  -6.509  1.00 29.13  ? 116 LEU B CD1 1 
ATOM   2401 C CD2 . LEU B 2 110 A 16.681 -3.394  -6.576  1.00 28.51  ? 116 LEU B CD2 1 
ATOM   2402 N N   . GLU B 2 111 ? 17.103 -3.845  -11.102 1.00 31.95  ? 117 GLU B N   1 
ATOM   2403 C CA  . GLU B 2 111 ? 16.904 -4.265  -12.470 1.00 37.80  ? 117 GLU B CA  1 
ATOM   2404 C C   . GLU B 2 111 ? 15.394 -4.328  -12.661 1.00 39.67  ? 117 GLU B C   1 
ATOM   2405 O O   . GLU B 2 111 ? 14.888 -4.083  -13.749 1.00 42.21  ? 117 GLU B O   1 
ATOM   2406 C CB  . GLU B 2 111 ? 17.537 -5.640  -12.714 1.00 41.88  ? 117 GLU B CB  1 
ATOM   2407 C CG  . GLU B 2 111 ? 17.647 -6.027  -14.188 1.00 47.29  ? 117 GLU B CG  1 
ATOM   2408 C CD  . GLU B 2 111 ? 18.531 -5.069  -14.990 1.00 54.59  ? 117 GLU B CD  1 
ATOM   2409 O OE1 . GLU B 2 111 ? 19.645 -4.736  -14.514 1.00 54.65  ? 117 GLU B OE1 1 
ATOM   2410 O OE2 . GLU B 2 111 ? 18.114 -4.654  -16.103 1.00 57.25  ? 117 GLU B OE2 1 
ATOM   2411 N N   . ASP B 2 112 ? 14.678 -4.630  -11.580 1.00 40.37  ? 118 ASP B N   1 
ATOM   2412 C CA  . ASP B 2 112 ? 13.221 -4.718  -11.619 1.00 40.23  ? 118 ASP B CA  1 
ATOM   2413 C C   . ASP B 2 112 ? 12.623 -3.975  -10.398 1.00 39.32  ? 118 ASP B C   1 
ATOM   2414 O O   . ASP B 2 112 ? 12.706 -4.421  -9.242  1.00 40.62  ? 118 ASP B O   1 
ATOM   2415 C CB  . ASP B 2 112 ? 12.778 -6.207  -11.682 1.00 42.44  ? 118 ASP B CB  1 
ATOM   2416 C CG  . ASP B 2 112 ? 11.242 -6.399  -11.862 1.00 43.87  ? 118 ASP B CG  1 
ATOM   2417 O OD1 . ASP B 2 112 ? 10.491 -5.408  -12.004 1.00 40.45  ? 118 ASP B OD1 1 
ATOM   2418 O OD2 . ASP B 2 112 ? 10.785 -7.569  -11.857 1.00 44.17  ? 118 ASP B OD2 1 
ATOM   2419 N N   . LEU B 2 113 ? 12.035 -2.825  -10.679 1.00 36.53  ? 119 LEU B N   1 
ATOM   2420 C CA  . LEU B 2 113 ? 11.410 -1.984  -9.668  1.00 35.71  ? 119 LEU B CA  1 
ATOM   2421 C C   . LEU B 2 113 ? 10.331 -2.684  -8.816  1.00 34.67  ? 119 LEU B C   1 
ATOM   2422 O O   . LEU B 2 113 ? 10.137 -2.346  -7.656  1.00 36.42  ? 119 LEU B O   1 
ATOM   2423 C CB  . LEU B 2 113 ? 10.799 -0.778  -10.372 1.00 33.65  ? 119 LEU B CB  1 
ATOM   2424 C CG  . LEU B 2 113 ? 10.591 0.511   -9.607  1.00 32.06  ? 119 LEU B CG  1 
ATOM   2425 C CD1 . LEU B 2 113 ? 11.845 0.896   -8.860  1.00 33.58  ? 119 LEU B CD1 1 
ATOM   2426 C CD2 . LEU B 2 113 ? 10.248 1.566   -10.617 1.00 36.93  ? 119 LEU B CD2 1 
ATOM   2427 N N   . ARG B 2 114 ? 9.652  -3.680  -9.369  1.00 34.74  ? 120 ARG B N   1 
ATOM   2428 C CA  . ARG B 2 114 ? 8.597  -4.386  -8.647  1.00 35.90  ? 120 ARG B CA  1 
ATOM   2429 C C   . ARG B 2 114 ? 9.016  -5.234  -7.431  1.00 37.40  ? 120 ARG B C   1 
ATOM   2430 O O   . ARG B 2 114 ? 8.185  -5.898  -6.817  1.00 37.76  ? 120 ARG B O   1 
ATOM   2431 C CB  . ARG B 2 114 ? 7.782  -5.216  -9.627  1.00 34.34  ? 120 ARG B CB  1 
ATOM   2432 C CG  . ARG B 2 114 ? 6.996  -4.369  -10.612 1.00 37.73  ? 120 ARG B CG  1 
ATOM   2433 C CD  . ARG B 2 114 ? 6.310  -5.247  -11.656 1.00 44.45  ? 120 ARG B CD  1 
ATOM   2434 N NE  . ARG B 2 114 ? 7.275  -6.135  -12.311 1.00 52.10  ? 120 ARG B NE  1 
ATOM   2435 C CZ  . ARG B 2 114 ? 6.976  -7.303  -12.878 1.00 51.39  ? 120 ARG B CZ  1 
ATOM   2436 N NH1 . ARG B 2 114 ? 5.718  -7.740  -12.883 1.00 55.59  ? 120 ARG B NH1 1 
ATOM   2437 N NH2 . ARG B 2 114 ? 7.947  -8.051  -13.396 1.00 45.46  ? 120 ARG B NH2 1 
ATOM   2438 N N   . ASN B 2 115 ? 10.295 -5.199  -7.070  1.00 35.78  ? 121 ASN B N   1 
ATOM   2439 C CA  . ASN B 2 115 ? 10.784 -5.956  -5.919  1.00 28.17  ? 121 ASN B CA  1 
ATOM   2440 C C   . ASN B 2 115 ? 10.652 -5.120  -4.678  1.00 25.20  ? 121 ASN B C   1 
ATOM   2441 O O   . ASN B 2 115 ? 10.875 -5.621  -3.594  1.00 27.73  ? 121 ASN B O   1 
ATOM   2442 C CB  . ASN B 2 115 ? 12.252 -6.283  -6.089  1.00 33.14  ? 121 ASN B CB  1 
ATOM   2443 C CG  . ASN B 2 115 ? 12.492 -7.287  -7.165  1.00 31.73  ? 121 ASN B CG  1 
ATOM   2444 O OD1 . ASN B 2 115 ? 11.922 -8.378  -7.139  1.00 30.68  ? 121 ASN B OD1 1 
ATOM   2445 N ND2 . ASN B 2 115 ? 13.342 -6.939  -8.117  1.00 29.39  ? 121 ASN B ND2 1 
ATOM   2446 N N   . VAL B 2 116 ? 10.347 -3.836  -4.858  1.00 20.20  ? 122 VAL B N   1 
ATOM   2447 C CA  . VAL B 2 116 ? 10.188 -2.889  -3.763  1.00 22.27  ? 122 VAL B CA  1 
ATOM   2448 C C   . VAL B 2 116 ? 8.911  -3.222  -3.036  1.00 23.14  ? 122 VAL B C   1 
ATOM   2449 O O   . VAL B 2 116 ? 7.841  -3.243  -3.641  1.00 28.02  ? 122 VAL B O   1 
ATOM   2450 C CB  . VAL B 2 116 ? 10.081 -1.430  -4.268  1.00 23.02  ? 122 VAL B CB  1 
ATOM   2451 C CG1 . VAL B 2 116 ? 10.113 -0.477  -3.102  1.00 30.99  ? 122 VAL B CG1 1 
ATOM   2452 C CG2 . VAL B 2 116 ? 11.222 -1.094  -5.199  1.00 26.15  ? 122 VAL B CG2 1 
ATOM   2453 N N   . THR B 2 117 ? 9.013  -3.511  -1.746  1.00 22.35  ? 123 THR B N   1 
ATOM   2454 C CA  . THR B 2 117 ? 7.840  -3.857  -0.976  1.00 20.48  ? 123 THR B CA  1 
ATOM   2455 C C   . THR B 2 117 ? 8.001  -3.271  0.427   1.00 25.24  ? 123 THR B C   1 
ATOM   2456 O O   . THR B 2 117 ? 9.122  -3.198  0.932   1.00 27.93  ? 123 THR B O   1 
ATOM   2457 C CB  . THR B 2 117 ? 7.691  -5.386  -0.874  1.00 16.68  ? 123 THR B CB  1 
ATOM   2458 O OG1 . THR B 2 117 ? 8.890  -5.921  -0.335  1.00 25.29  ? 123 THR B OG1 1 
ATOM   2459 C CG2 . THR B 2 117 ? 7.540  -6.009  -2.227  1.00 15.84  ? 123 THR B CG2 1 
ATOM   2460 N N   . PRO B 2 118 ? 6.913  -2.738  1.021   1.00 24.67  ? 124 PRO B N   1 
ATOM   2461 C CA  . PRO B 2 118 ? 6.999  -2.169  2.358   1.00 21.14  ? 124 PRO B CA  1 
ATOM   2462 C C   . PRO B 2 118 ? 6.971  -3.314  3.331   1.00 19.23  ? 124 PRO B C   1 
ATOM   2463 O O   . PRO B 2 118 ? 6.639  -4.426  2.973   1.00 24.11  ? 124 PRO B O   1 
ATOM   2464 C CB  . PRO B 2 118 ? 5.723  -1.331  2.465   1.00 22.13  ? 124 PRO B CB  1 
ATOM   2465 C CG  . PRO B 2 118 ? 5.310  -1.127  1.062   1.00 24.27  ? 124 PRO B CG  1 
ATOM   2466 C CD  . PRO B 2 118 ? 5.592  -2.445  0.445   1.00 23.07  ? 124 PRO B CD  1 
ATOM   2467 N N   . PRO B 2 119 ? 7.233  -3.034  4.597   1.00 17.89  ? 125 PRO B N   1 
ATOM   2468 C CA  . PRO B 2 119 ? 7.220  -4.117  5.569   1.00 19.52  ? 125 PRO B CA  1 
ATOM   2469 C C   . PRO B 2 119 ? 5.856  -4.429  6.171   1.00 22.16  ? 125 PRO B C   1 
ATOM   2470 O O   . PRO B 2 119 ? 4.874  -3.731  5.915   1.00 22.75  ? 125 PRO B O   1 
ATOM   2471 C CB  . PRO B 2 119 ? 8.148  -3.551  6.654   1.00 18.54  ? 125 PRO B CB  1 
ATOM   2472 C CG  . PRO B 2 119 ? 7.760  -2.090  6.676   1.00 14.25  ? 125 PRO B CG  1 
ATOM   2473 C CD  . PRO B 2 119 ? 7.651  -1.757  5.208   1.00 16.70  ? 125 PRO B CD  1 
ATOM   2474 N N   . LYS B 2 120 ? 5.825  -5.493  6.979   1.00 22.27  ? 126 LYS B N   1 
ATOM   2475 C CA  . LYS B 2 120 ? 4.662  -5.889  7.761   1.00 24.65  ? 126 LYS B CA  1 
ATOM   2476 C C   . LYS B 2 120 ? 5.271  -5.813  9.165   1.00 25.18  ? 126 LYS B C   1 
ATOM   2477 O O   . LYS B 2 120 ? 6.251  -6.512  9.436   1.00 22.11  ? 126 LYS B O   1 
ATOM   2478 C CB  . LYS B 2 120 ? 4.257  -7.347  7.519   1.00 29.18  ? 126 LYS B CB  1 
ATOM   2479 C CG  . LYS B 2 120 ? 3.791  -7.622  6.080   1.00 45.02  ? 126 LYS B CG  1 
ATOM   2480 C CD  . LYS B 2 120 ? 2.275  -7.466  5.885   1.00 48.17  ? 126 LYS B CD  1 
ATOM   2481 C CE  . LYS B 2 120 ? 1.767  -8.094  4.578   1.00 53.02  ? 126 LYS B CE  1 
ATOM   2482 N NZ  . LYS B 2 120 ? 1.588  -9.553  4.670   1.00 53.84  ? 126 LYS B NZ  1 
ATOM   2483 N N   . VAL B 2 121 ? 4.798  -4.921  10.033  1.00 28.09  ? 127 VAL B N   1 
ATOM   2484 C CA  . VAL B 2 121 ? 5.386  -4.894  11.377  1.00 29.33  ? 127 VAL B CA  1 
ATOM   2485 C C   . VAL B 2 121 ? 4.510  -5.492  12.497  1.00 30.63  ? 127 VAL B C   1 
ATOM   2486 O O   . VAL B 2 121 ? 3.343  -5.119  12.670  1.00 30.59  ? 127 VAL B O   1 
ATOM   2487 C CB  . VAL B 2 121 ? 6.055  -3.516  11.740  1.00 27.22  ? 127 VAL B CB  1 
ATOM   2488 C CG1 . VAL B 2 121 ? 6.080  -2.582  10.522  1.00 21.84  ? 127 VAL B CG1 1 
ATOM   2489 C CG2 . VAL B 2 121 ? 5.467  -2.899  12.994  1.00 17.20  ? 127 VAL B CG2 1 
ATOM   2490 N N   . SER B 2 122 ? 5.084  -6.468  13.204  1.00 28.56  ? 128 SER B N   1 
ATOM   2491 C CA  . SER B 2 122 ? 4.418  -7.189  14.285  1.00 30.17  ? 128 SER B CA  1 
ATOM   2492 C C   . SER B 2 122 ? 4.971  -6.861  15.658  1.00 29.64  ? 128 SER B C   1 
ATOM   2493 O O   . SER B 2 122 ? 6.179  -6.788  15.829  1.00 31.32  ? 128 SER B O   1 
ATOM   2494 C CB  . SER B 2 122 ? 4.591  -8.685  14.064  1.00 30.65  ? 128 SER B CB  1 
ATOM   2495 O OG  . SER B 2 122 ? 4.133  -9.063  12.780  1.00 39.20  ? 128 SER B OG  1 
ATOM   2496 N N   . LEU B 2 123 ? 4.088  -6.689  16.639  1.00 32.40  ? 129 LEU B N   1 
ATOM   2497 C CA  . LEU B 2 123 ? 4.496  -6.403  18.017  1.00 32.36  ? 129 LEU B CA  1 
ATOM   2498 C C   . LEU B 2 123 ? 4.239  -7.619  18.918  1.00 32.69  ? 129 LEU B C   1 
ATOM   2499 O O   . LEU B 2 123 ? 3.090  -7.985  19.169  1.00 35.40  ? 129 LEU B O   1 
ATOM   2500 C CB  . LEU B 2 123 ? 3.783  -5.148  18.562  1.00 26.98  ? 129 LEU B CB  1 
ATOM   2501 C CG  . LEU B 2 123 ? 4.345  -4.572  19.880  1.00 31.51  ? 129 LEU B CG  1 
ATOM   2502 C CD1 . LEU B 2 123 ? 5.871  -4.495  19.770  1.00 33.61  ? 129 LEU B CD1 1 
ATOM   2503 C CD2 . LEU B 2 123 ? 3.769  -3.199  20.247  1.00 25.61  ? 129 LEU B CD2 1 
ATOM   2504 N N   . PHE B 2 124 ? 5.305  -8.289  19.342  1.00 30.61  ? 130 PHE B N   1 
ATOM   2505 C CA  . PHE B 2 124 ? 5.156  -9.443  20.215  1.00 30.33  ? 130 PHE B CA  1 
ATOM   2506 C C   . PHE B 2 124 ? 5.151  -8.974  21.669  1.00 33.24  ? 130 PHE B C   1 
ATOM   2507 O O   . PHE B 2 124 ? 5.968  -8.143  22.081  1.00 31.67  ? 130 PHE B O   1 
ATOM   2508 C CB  . PHE B 2 124 ? 6.258  -10.475 19.961  1.00 30.39  ? 130 PHE B CB  1 
ATOM   2509 C CG  . PHE B 2 124 ? 6.207  -11.086 18.584  1.00 31.91  ? 130 PHE B CG  1 
ATOM   2510 C CD1 . PHE B 2 124 ? 6.463  -10.316 17.455  1.00 32.46  ? 130 PHE B CD1 1 
ATOM   2511 C CD2 . PHE B 2 124 ? 5.865  -12.421 18.413  1.00 30.38  ? 130 PHE B CD2 1 
ATOM   2512 C CE1 . PHE B 2 124 ? 6.369  -10.876 16.173  1.00 34.22  ? 130 PHE B CE1 1 
ATOM   2513 C CE2 . PHE B 2 124 ? 5.771  -12.982 17.147  1.00 28.72  ? 130 PHE B CE2 1 
ATOM   2514 C CZ  . PHE B 2 124 ? 6.022  -12.213 16.025  1.00 29.82  ? 130 PHE B CZ  1 
ATOM   2515 N N   . GLU B 2 125 ? 4.203  -9.491  22.442  1.00 39.39  ? 131 GLU B N   1 
ATOM   2516 C CA  . GLU B 2 125 ? 4.059  -9.112  23.846  1.00 37.49  ? 131 GLU B CA  1 
ATOM   2517 C C   . GLU B 2 125 ? 5.040  -9.791  24.819  1.00 34.29  ? 131 GLU B C   1 
ATOM   2518 O O   . GLU B 2 125 ? 5.535  -10.905 24.551  1.00 30.62  ? 131 GLU B O   1 
ATOM   2519 C CB  . GLU B 2 125 ? 2.605  -9.283  24.267  1.00 38.67  ? 131 GLU B CB  1 
ATOM   2520 C CG  . GLU B 2 125 ? 1.659  -8.502  23.368  1.00 40.86  ? 131 GLU B CG  1 
ATOM   2521 C CD  . GLU B 2 125 ? 0.370  -8.112  24.059  1.00 48.34  ? 131 GLU B CD  1 
ATOM   2522 O OE1 . GLU B 2 125 ? -0.153 -8.900  24.884  1.00 49.28  ? 131 GLU B OE1 1 
ATOM   2523 O OE2 . GLU B 2 125 ? -0.117 -6.998  23.778  1.00 49.28  ? 131 GLU B OE2 1 
ATOM   2524 N N   . PRO B 2 126 ? 5.321  -9.118  25.966  1.00 32.62  ? 132 PRO B N   1 
ATOM   2525 C CA  . PRO B 2 126 ? 6.233  -9.571  27.020  1.00 32.63  ? 132 PRO B CA  1 
ATOM   2526 C C   . PRO B 2 126 ? 5.851  -10.913 27.600  1.00 36.01  ? 132 PRO B C   1 
ATOM   2527 O O   . PRO B 2 126 ? 4.686  -11.159 27.889  1.00 38.96  ? 132 PRO B O   1 
ATOM   2528 C CB  . PRO B 2 126 ? 6.081  -8.485  28.093  1.00 27.03  ? 132 PRO B CB  1 
ATOM   2529 C CG  . PRO B 2 126 ? 5.624  -7.311  27.352  1.00 23.69  ? 132 PRO B CG  1 
ATOM   2530 C CD  . PRO B 2 126 ? 4.633  -7.888  26.402  1.00 24.44  ? 132 PRO B CD  1 
ATOM   2531 N N   . SER B 2 127 ? 6.832  -11.777 27.812  1.00 38.72  ? 133 SER B N   1 
ATOM   2532 C CA  . SER B 2 127 ? 6.552  -13.075 28.410  1.00 37.11  ? 133 SER B CA  1 
ATOM   2533 C C   . SER B 2 127 ? 6.113  -12.873 29.851  1.00 39.16  ? 133 SER B C   1 
ATOM   2534 O O   . SER B 2 127 ? 6.758  -12.124 30.596  1.00 39.95  ? 133 SER B O   1 
ATOM   2535 C CB  . SER B 2 127 ? 7.813  -13.934 28.415  1.00 34.96  ? 133 SER B CB  1 
ATOM   2536 O OG  . SER B 2 127 ? 7.602  -15.135 29.130  1.00 35.78  ? 133 SER B OG  1 
ATOM   2537 N N   . LYS B 2 128 ? 5.034  -13.544 30.250  1.00 40.65  ? 134 LYS B N   1 
ATOM   2538 C CA  . LYS B 2 128 ? 4.559  -13.467 31.636  1.00 41.31  ? 134 LYS B CA  1 
ATOM   2539 C C   . LYS B 2 128 ? 5.591  -14.115 32.558  1.00 39.12  ? 134 LYS B C   1 
ATOM   2540 O O   . LYS B 2 128 ? 5.781  -13.657 33.681  1.00 40.85  ? 134 LYS B O   1 
ATOM   2541 C CB  . LYS B 2 128 ? 3.208  -14.157 31.808  1.00 45.60  ? 134 LYS B CB  1 
ATOM   2542 C CG  . LYS B 2 128 ? 2.046  -13.376 31.236  1.00 51.00  ? 134 LYS B CG  1 
ATOM   2543 C CD  . LYS B 2 128 ? 0.731  -14.095 31.480  1.00 55.22  ? 134 LYS B CD  1 
ATOM   2544 C CE  . LYS B 2 128 ? -0.400 -13.556 30.570  1.00 61.52  ? 134 LYS B CE  1 
ATOM   2545 N NZ  . LYS B 2 128 ? -0.302 -13.962 29.112  1.00 62.00  ? 134 LYS B NZ  1 
ATOM   2546 N N   . ALA B 2 129 ? 6.277  -15.144 32.050  1.00 36.70  ? 135 ALA B N   1 
ATOM   2547 C CA  . ALA B 2 129 ? 7.322  -15.853 32.784  1.00 32.92  ? 135 ALA B CA  1 
ATOM   2548 C C   . ALA B 2 129 ? 8.386  -14.842 33.113  1.00 36.08  ? 135 ALA B C   1 
ATOM   2549 O O   . ALA B 2 129 ? 8.649  -14.581 34.285  1.00 38.80  ? 135 ALA B O   1 
ATOM   2550 C CB  . ALA B 2 129 ? 7.919  -16.946 31.944  1.00 30.65  ? 135 ALA B CB  1 
ATOM   2551 N N   . GLU B 2 130 ? 8.993  -14.262 32.080  1.00 37.06  ? 136 GLU B N   1 
ATOM   2552 C CA  . GLU B 2 130 ? 10.022 -13.245 32.280  1.00 37.52  ? 136 GLU B CA  1 
ATOM   2553 C C   . GLU B 2 130 ? 9.547  -12.198 33.287  1.00 41.13  ? 136 GLU B C   1 
ATOM   2554 O O   . GLU B 2 130 ? 10.286 -11.809 34.196  1.00 40.86  ? 136 GLU B O   1 
ATOM   2555 C CB  . GLU B 2 130 ? 10.328 -12.540 30.963  1.00 37.87  ? 136 GLU B CB  1 
ATOM   2556 C CG  . GLU B 2 130 ? 11.189 -11.295 31.129  1.00 36.02  ? 136 GLU B CG  1 
ATOM   2557 C CD  . GLU B 2 130 ? 11.022 -10.304 29.994  1.00 38.98  ? 136 GLU B CD  1 
ATOM   2558 O OE1 . GLU B 2 130 ? 10.204 -10.533 29.068  1.00 38.48  ? 136 GLU B OE1 1 
ATOM   2559 O OE2 . GLU B 2 130 ? 11.709 -9.270  30.037  1.00 38.44  ? 136 GLU B OE2 1 
ATOM   2560 N N   . ILE B 2 131 ? 8.308  -11.750 33.114  1.00 42.71  ? 137 ILE B N   1 
ATOM   2561 C CA  . ILE B 2 131 ? 7.736  -10.749 33.994  1.00 42.93  ? 137 ILE B CA  1 
ATOM   2562 C C   . ILE B 2 131 ? 7.725  -11.180 35.458  1.00 47.34  ? 137 ILE B C   1 
ATOM   2563 O O   . ILE B 2 131 ? 8.140  -10.426 36.348  1.00 48.58  ? 137 ILE B O   1 
ATOM   2564 C CB  . ILE B 2 131 ? 6.330  -10.375 33.544  1.00 40.30  ? 137 ILE B CB  1 
ATOM   2565 C CG1 . ILE B 2 131 ? 6.401  -9.772  32.137  1.00 40.47  ? 137 ILE B CG1 1 
ATOM   2566 C CG2 . ILE B 2 131 ? 5.730  -9.365  34.505  1.00 43.78  ? 137 ILE B CG2 1 
ATOM   2567 C CD1 . ILE B 2 131 ? 5.085  -9.330  31.545  1.00 31.28  ? 137 ILE B CD1 1 
ATOM   2568 N N   . ALA B 2 132 ? 7.309  -12.415 35.699  1.00 50.25  ? 138 ALA B N   1 
ATOM   2569 C CA  . ALA B 2 132 ? 7.237  -12.958 37.051  1.00 49.71  ? 138 ALA B CA  1 
ATOM   2570 C C   . ALA B 2 132 ? 8.578  -13.029 37.757  1.00 51.27  ? 138 ALA B C   1 
ATOM   2571 O O   . ALA B 2 132 ? 8.753  -12.428 38.813  1.00 54.34  ? 138 ALA B O   1 
ATOM   2572 C CB  . ALA B 2 132 ? 6.606  -14.339 37.022  1.00 47.07  ? 138 ALA B CB  1 
ATOM   2573 N N   . ASN B 2 133 ? 9.527  -13.731 37.141  1.00 52.59  ? 139 ASN B N   1 
ATOM   2574 C CA  . ASN B 2 133 ? 10.864 -13.959 37.692  1.00 49.37  ? 139 ASN B CA  1 
ATOM   2575 C C   . ASN B 2 133 ? 11.811 -12.781 37.698  1.00 48.99  ? 139 ASN B C   1 
ATOM   2576 O O   . ASN B 2 133 ? 12.611 -12.625 38.625  1.00 50.63  ? 139 ASN B O   1 
ATOM   2577 C CB  . ASN B 2 133 ? 11.529 -15.108 36.945  1.00 52.60  ? 139 ASN B CB  1 
ATOM   2578 C CG  . ASN B 2 133 ? 10.583 -16.276 36.728  1.00 57.95  ? 139 ASN B CG  1 
ATOM   2579 O OD1 . ASN B 2 133 ? 9.732  -16.558 37.573  1.00 60.21  ? 139 ASN B OD1 1 
ATOM   2580 N ND2 . ASN B 2 133 ? 10.692 -16.933 35.577  1.00 58.00  ? 139 ASN B ND2 1 
ATOM   2581 N N   . LYS B 2 134 ? 11.746 -11.955 36.664  1.00 45.74  ? 140 LYS B N   1 
ATOM   2582 C CA  . LYS B 2 134 ? 12.650 -10.822 36.584  1.00 41.10  ? 140 LYS B CA  1 
ATOM   2583 C C   . LYS B 2 134 ? 12.066 -9.441  36.859  1.00 41.18  ? 140 LYS B C   1 
ATOM   2584 O O   . LYS B 2 134 ? 12.828 -8.500  37.134  1.00 40.34  ? 140 LYS B O   1 
ATOM   2585 C CB  . LYS B 2 134 ? 13.375 -10.854 35.246  1.00 41.23  ? 140 LYS B CB  1 
ATOM   2586 C CG  . LYS B 2 134 ? 14.315 -12.024 35.165  1.00 44.14  ? 140 LYS B CG  1 
ATOM   2587 C CD  . LYS B 2 134 ? 14.829 -12.249 33.771  1.00 44.48  ? 140 LYS B CD  1 
ATOM   2588 C CE  . LYS B 2 134 ? 15.717 -13.485 33.742  1.00 41.45  ? 140 LYS B CE  1 
ATOM   2589 N NZ  . LYS B 2 134 ? 15.887 -14.002 32.357  1.00 35.70  ? 140 LYS B NZ  1 
ATOM   2590 N N   . GLN B 2 135 ? 10.731 -9.323  36.817  1.00 37.27  ? 141 GLN B N   1 
ATOM   2591 C CA  . GLN B 2 135 ? 10.039 -8.052  37.044  1.00 34.03  ? 141 GLN B CA  1 
ATOM   2592 C C   . GLN B 2 135 ? 10.431 -7.032  35.973  1.00 33.36  ? 141 GLN B C   1 
ATOM   2593 O O   . GLN B 2 135 ? 10.472 -5.832  36.210  1.00 32.12  ? 141 GLN B O   1 
ATOM   2594 C CB  . GLN B 2 135 ? 10.313 -7.505  38.453  1.00 35.27  ? 141 GLN B CB  1 
ATOM   2595 C CG  . GLN B 2 135 ? 9.675  -8.325  39.597  1.00 41.74  ? 141 GLN B CG  1 
ATOM   2596 C CD  . GLN B 2 135 ? 10.638 -9.319  40.253  1.00 46.35  ? 141 GLN B CD  1 
ATOM   2597 O OE1 . GLN B 2 135 ? 11.722 -8.939  40.710  1.00 49.96  ? 141 GLN B OE1 1 
ATOM   2598 N NE2 . GLN B 2 135 ? 10.236 -10.592 40.324  1.00 42.82  ? 141 GLN B NE2 1 
ATOM   2599 N N   . LYS B 2 136 ? 10.684 -7.550  34.778  1.00 34.50  ? 142 LYS B N   1 
ATOM   2600 C CA  . LYS B 2 136 ? 11.074 -6.784  33.603  1.00 34.83  ? 142 LYS B CA  1 
ATOM   2601 C C   . LYS B 2 136 ? 10.221 -7.346  32.458  1.00 34.88  ? 142 LYS B C   1 
ATOM   2602 O O   . LYS B 2 136 ? 9.883  -8.538  32.461  1.00 35.87  ? 142 LYS B O   1 
ATOM   2603 C CB  . LYS B 2 136 ? 12.564 -7.006  33.284  1.00 35.55  ? 142 LYS B CB  1 
ATOM   2604 C CG  . LYS B 2 136 ? 13.543 -6.438  34.299  1.00 36.11  ? 142 LYS B CG  1 
ATOM   2605 C CD  . LYS B 2 136 ? 14.516 -5.441  33.656  1.00 39.00  ? 142 LYS B CD  1 
ATOM   2606 C CE  . LYS B 2 136 ? 15.685 -5.099  34.588  1.00 40.57  ? 142 LYS B CE  1 
ATOM   2607 N NZ  . LYS B 2 136 ? 16.727 -6.167  34.647  1.00 41.65  ? 142 LYS B NZ  1 
ATOM   2608 N N   . ALA B 2 137 ? 9.935  -6.516  31.459  1.00 33.60  ? 143 ALA B N   1 
ATOM   2609 C CA  . ALA B 2 137 ? 9.121  -6.914  30.317  1.00 30.37  ? 143 ALA B CA  1 
ATOM   2610 C C   . ALA B 2 137 ? 9.756  -6.525  28.974  1.00 28.22  ? 143 ALA B C   1 
ATOM   2611 O O   . ALA B 2 137 ? 9.911  -5.340  28.653  1.00 26.69  ? 143 ALA B O   1 
ATOM   2612 C CB  . ALA B 2 137 ? 7.700  -6.281  30.443  1.00 30.25  ? 143 ALA B CB  1 
ATOM   2613 N N   . THR B 2 138 ? 10.150 -7.522  28.198  1.00 29.52  ? 144 THR B N   1 
ATOM   2614 C CA  . THR B 2 138 ? 10.740 -7.259  26.885  1.00 29.99  ? 144 THR B CA  1 
ATOM   2615 C C   . THR B 2 138 ? 9.677  -7.366  25.779  1.00 30.66  ? 144 THR B C   1 
ATOM   2616 O O   . THR B 2 138 ? 9.085  -8.439  25.561  1.00 31.01  ? 144 THR B O   1 
ATOM   2617 C CB  . THR B 2 138 ? 11.902 -8.268  26.519  1.00 28.53  ? 144 THR B CB  1 
ATOM   2618 O OG1 . THR B 2 138 ? 12.906 -8.284  27.540  1.00 25.62  ? 144 THR B OG1 1 
ATOM   2619 C CG2 . THR B 2 138 ? 12.550 -7.870  25.213  1.00 25.11  ? 144 THR B CG2 1 
ATOM   2620 N N   . LEU B 2 139 ? 9.382  -6.241  25.141  1.00 28.65  ? 145 LEU B N   1 
ATOM   2621 C CA  . LEU B 2 139 ? 8.456  -6.222  24.026  1.00 26.89  ? 145 LEU B CA  1 
ATOM   2622 C C   . LEU B 2 139 ? 9.385  -6.336  22.808  1.00 25.70  ? 145 LEU B C   1 
ATOM   2623 O O   . LEU B 2 139 ? 10.356 -5.581  22.679  1.00 27.39  ? 145 LEU B O   1 
ATOM   2624 C CB  . LEU B 2 139 ? 7.733  -4.864  23.935  1.00 23.13  ? 145 LEU B CB  1 
ATOM   2625 C CG  . LEU B 2 139 ? 6.681  -4.464  24.961  1.00 18.17  ? 145 LEU B CG  1 
ATOM   2626 C CD1 . LEU B 2 139 ? 7.272  -4.067  26.309  1.00 13.69  ? 145 LEU B CD1 1 
ATOM   2627 C CD2 . LEU B 2 139 ? 5.896  -3.215  24.489  1.00 22.82  ? 145 LEU B CD2 1 
ATOM   2628 N N   . VAL B 2 140 ? 9.173  -7.283  21.916  1.00 23.41  ? 146 VAL B N   1 
ATOM   2629 C CA  . VAL B 2 140 ? 10.044 -7.344  20.720  1.00 24.89  ? 146 VAL B CA  1 
ATOM   2630 C C   . VAL B 2 140 ? 9.222  -7.050  19.476  1.00 23.64  ? 146 VAL B C   1 
ATOM   2631 O O   . VAL B 2 140 ? 8.138  -7.612  19.271  1.00 28.37  ? 146 VAL B O   1 
ATOM   2632 C CB  . VAL B 2 140 ? 10.780 -8.693  20.569  1.00 24.46  ? 146 VAL B CB  1 
ATOM   2633 C CG1 . VAL B 2 140 ? 10.324 -9.766  21.550  1.00 19.18  ? 146 VAL B CG1 1 
ATOM   2634 C CG2 . VAL B 2 140 ? 10.634 -9.316  19.173  1.00 16.70  ? 146 VAL B CG2 1 
ATOM   2635 N N   . CYS B 2 141 ? 9.762  -6.149  18.691  1.00 25.40  ? 147 CYS B N   1 
ATOM   2636 C CA  . CYS B 2 141 ? 9.137  -5.738  17.446  1.00 22.12  ? 147 CYS B CA  1 
ATOM   2637 C C   . CYS B 2 141 ? 9.871  -6.352  16.296  1.00 23.77  ? 147 CYS B C   1 
ATOM   2638 O O   . CYS B 2 141 ? 11.096 -6.322  16.245  1.00 21.28  ? 147 CYS B O   1 
ATOM   2639 C CB  . CYS B 2 141 ? 9.165  -4.222  17.305  1.00 21.68  ? 147 CYS B CB  1 
ATOM   2640 S SG  . CYS B 2 141 ? 8.392  -3.652  15.716  1.00 24.82  ? 147 CYS B SG  1 
ATOM   2641 N N   . LEU B 2 142 ? 9.105  -6.884  15.351  1.00 25.62  ? 148 LEU B N   1 
ATOM   2642 C CA  . LEU B 2 142 ? 9.654  -7.567  14.183  1.00 26.87  ? 148 LEU B CA  1 
ATOM   2643 C C   . LEU B 2 142 ? 9.049  -7.056  12.878  1.00 25.54  ? 148 LEU B C   1 
ATOM   2644 O O   . LEU B 2 142 ? 7.835  -7.065  12.708  1.00 31.74  ? 148 LEU B O   1 
ATOM   2645 C CB  . LEU B 2 142 ? 9.378  -9.064  14.340  1.00 25.99  ? 148 LEU B CB  1 
ATOM   2646 C CG  . LEU B 2 142 ? 9.802  -10.063 13.277  1.00 28.83  ? 148 LEU B CG  1 
ATOM   2647 C CD1 . LEU B 2 142 ? 11.309 -9.946  12.991  1.00 26.46  ? 148 LEU B CD1 1 
ATOM   2648 C CD2 . LEU B 2 142 ? 9.452  -11.453 13.798  1.00 24.16  ? 148 LEU B CD2 1 
ATOM   2649 N N   . ALA B 2 143 ? 9.886  -6.544  11.988  1.00 27.07  ? 149 ALA B N   1 
ATOM   2650 C CA  . ALA B 2 143 ? 9.426  -6.052  10.682  1.00 26.66  ? 149 ALA B CA  1 
ATOM   2651 C C   . ALA B 2 143 ? 9.927  -7.031  9.599   1.00 26.44  ? 149 ALA B C   1 
ATOM   2652 O O   . ALA B 2 143 ? 11.082 -7.487  9.641   1.00 28.43  ? 149 ALA B O   1 
ATOM   2653 C CB  . ALA B 2 143 ? 9.956  -4.640  10.417  1.00 22.45  ? 149 ALA B CB  1 
ATOM   2654 N N   . ARG B 2 144 ? 9.057  -7.382  8.657   1.00 22.86  ? 150 ARG B N   1 
ATOM   2655 C CA  . ARG B 2 144 ? 9.444  -8.316  7.619   1.00 21.81  ? 150 ARG B CA  1 
ATOM   2656 C C   . ARG B 2 144 ? 8.857  -7.991  6.273   1.00 20.65  ? 150 ARG B C   1 
ATOM   2657 O O   . ARG B 2 144 ? 7.972  -7.138  6.140   1.00 21.25  ? 150 ARG B O   1 
ATOM   2658 C CB  . ARG B 2 144 ? 9.028  -9.726  7.998   1.00 20.54  ? 150 ARG B CB  1 
ATOM   2659 C CG  . ARG B 2 144 ? 9.598  -10.204 9.289   1.00 30.55  ? 150 ARG B CG  1 
ATOM   2660 C CD  . ARG B 2 144 ? 8.999  -11.525 9.647   1.00 34.74  ? 150 ARG B CD  1 
ATOM   2661 N NE  . ARG B 2 144 ? 9.185  -12.497 8.581   1.00 38.18  ? 150 ARG B NE  1 
ATOM   2662 C CZ  . ARG B 2 144 ? 8.776  -13.755 8.661   1.00 41.25  ? 150 ARG B CZ  1 
ATOM   2663 N NH1 . ARG B 2 144 ? 8.170  -14.188 9.761   1.00 42.70  ? 150 ARG B NH1 1 
ATOM   2664 N NH2 . ARG B 2 144 ? 8.909  -14.565 7.620   1.00 47.58  ? 150 ARG B NH2 1 
ATOM   2665 N N   . GLY B 2 145 ? 9.374  -8.704  5.282   1.00 21.23  ? 151 GLY B N   1 
ATOM   2666 C CA  . GLY B 2 145 ? 8.937  -8.562  3.913   1.00 21.66  ? 151 GLY B CA  1 
ATOM   2667 C C   . GLY B 2 145 ? 9.261  -7.274  3.195   1.00 23.66  ? 151 GLY B C   1 
ATOM   2668 O O   . GLY B 2 145 ? 8.671  -6.957  2.151   1.00 26.04  ? 151 GLY B O   1 
ATOM   2669 N N   . PHE B 2 146 ? 10.182 -6.507  3.672   1.00 21.80  ? 152 PHE B N   1 
ATOM   2670 C CA  . PHE B 2 146 ? 10.469 -5.288  2.945   1.00 20.33  ? 152 PHE B CA  1 
ATOM   2671 C C   . PHE B 2 146 ? 11.659 -5.408  2.053   1.00 22.54  ? 152 PHE B C   1 
ATOM   2672 O O   . PHE B 2 146 ? 12.768 -5.728  2.515   1.00 22.30  ? 152 PHE B O   1 
ATOM   2673 C CB  . PHE B 2 146 ? 10.694 -4.085  3.882   1.00 19.82  ? 152 PHE B CB  1 
ATOM   2674 C CG  . PHE B 2 146 ? 11.765 -4.270  4.965   1.00 18.37  ? 152 PHE B CG  1 
ATOM   2675 C CD1 . PHE B 2 146 ? 11.463 -4.969  6.140   1.00 15.71  ? 152 PHE B CD1 1 
ATOM   2676 C CD2 . PHE B 2 146 ? 13.044 -3.719  4.792   1.00 17.40  ? 152 PHE B CD2 1 
ATOM   2677 C CE1 . PHE B 2 146 ? 12.435 -5.118  7.138   1.00 14.34  ? 152 PHE B CE1 1 
ATOM   2678 C CE2 . PHE B 2 146 ? 14.015 -3.868  5.791   1.00 18.00  ? 152 PHE B CE2 1 
ATOM   2679 C CZ  . PHE B 2 146 ? 13.711 -4.567  6.964   1.00 15.31  ? 152 PHE B CZ  1 
ATOM   2680 N N   . PHE B 2 147 ? 11.419 -5.164  0.760   1.00 25.47  ? 153 PHE B N   1 
ATOM   2681 C CA  . PHE B 2 147 ? 12.570 -5.080  -0.086  1.00 30.45  ? 153 PHE B CA  1 
ATOM   2682 C C   . PHE B 2 147 ? 13.187 -3.740  0.208   1.00 39.42  ? 153 PHE B C   1 
ATOM   2683 O O   . PHE B 2 147 ? 13.330 -3.338  1.350   1.00 54.11  ? 153 PHE B O   1 
ATOM   2684 C CB  . PHE B 2 147 ? 12.437 -5.389  -1.551  1.00 30.81  ? 153 PHE B CB  1 
ATOM   2685 C CG  . PHE B 2 147 ? 13.877 -5.537  -2.141  1.00 33.01  ? 153 PHE B CG  1 
ATOM   2686 C CD1 . PHE B 2 147 ? 14.986 -5.931  -1.331  1.00 31.99  ? 153 PHE B CD1 1 
ATOM   2687 C CD2 . PHE B 2 147 ? 14.112 -5.247  -3.481  1.00 37.48  ? 153 PHE B CD2 1 
ATOM   2688 C CE1 . PHE B 2 147 ? 16.292 -5.991  -1.882  1.00 31.29  ? 153 PHE B CE1 1 
ATOM   2689 C CE2 . PHE B 2 147 ? 15.408 -5.294  -4.022  1.00 34.60  ? 153 PHE B CE2 1 
ATOM   2690 C CZ  . PHE B 2 147 ? 16.498 -5.662  -3.227  1.00 35.02  ? 153 PHE B CZ  1 
ATOM   2691 N N   . PRO B 2 148 ? 13.469 -2.666  -0.518  1.00 32.90  ? 154 PRO B N   1 
ATOM   2692 C CA  . PRO B 2 148 ? 14.636 -1.917  -0.028  1.00 26.29  ? 154 PRO B CA  1 
ATOM   2693 C C   . PRO B 2 148 ? 14.744 -1.951  1.467   1.00 26.60  ? 154 PRO B C   1 
ATOM   2694 O O   . PRO B 2 148 ? 13.703 -1.874  2.163   1.00 29.65  ? 154 PRO B O   1 
ATOM   2695 C CB  . PRO B 2 148 ? 14.572 -0.623  -0.716  1.00 26.55  ? 154 PRO B CB  1 
ATOM   2696 C CG  . PRO B 2 148 ? 13.437 -0.716  -1.712  1.00 31.48  ? 154 PRO B CG  1 
ATOM   2697 C CD  . PRO B 2 148 ? 12.775 -2.098  -1.651  1.00 25.27  ? 154 PRO B CD  1 
ATOM   2698 N N   . ASP B 2 149 ? 15.988 -2.077  1.936   1.00 25.28  ? 155 ASP B N   1 
ATOM   2699 C CA  . ASP B 2 149 ? 16.248 -2.129  3.381   1.00 28.34  ? 155 ASP B CA  1 
ATOM   2700 C C   . ASP B 2 149 ? 16.500 -0.719  3.937   1.00 29.64  ? 155 ASP B C   1 
ATOM   2701 O O   . ASP B 2 149 ? 17.112 -0.549  4.997   1.00 33.70  ? 155 ASP B O   1 
ATOM   2702 C CB  . ASP B 2 149 ? 17.424 -3.068  3.707   1.00 29.73  ? 155 ASP B CB  1 
ATOM   2703 C CG  . ASP B 2 149 ? 18.807 -2.510  3.360   1.00 33.67  ? 155 ASP B CG  1 
ATOM   2704 O OD1 . ASP B 2 149 ? 18.918 -1.518  2.548   1.00 37.78  ? 155 ASP B OD1 1 
ATOM   2705 O OD2 . ASP B 2 149 ? 19.866 -3.047  3.874   1.00 43.13  ? 155 ASP B OD2 1 
ATOM   2706 N N   . HIS B 2 150 ? 16.014 0.281   3.212   1.00 26.66  ? 156 HIS B N   1 
ATOM   2707 C CA  . HIS B 2 150 ? 16.119 1.683   3.665   1.00 24.33  ? 156 HIS B CA  1 
ATOM   2708 C C   . HIS B 2 150 ? 15.008 1.966   4.655   1.00 25.56  ? 156 HIS B C   1 
ATOM   2709 O O   . HIS B 2 150 ? 13.989 2.538   4.279   1.00 31.75  ? 156 HIS B O   1 
ATOM   2710 C CB  . HIS B 2 150 ? 15.946 2.673   2.510   1.00 19.26  ? 156 HIS B CB  1 
ATOM   2711 C CG  . HIS B 2 150 ? 16.803 2.370   1.286   1.00 12.65  ? 156 HIS B CG  1 
ATOM   2712 N ND1 . HIS B 2 150 ? 17.885 1.497   1.333   1.00 12.70  ? 156 HIS B ND1 1 
ATOM   2713 C CD2 . HIS B 2 150 ? 16.727 2.820   0.007   1.00 11.92  ? 156 HIS B CD2 1 
ATOM   2714 C CE1 . HIS B 2 150 ? 18.415 1.439   0.123   1.00 14.18  ? 156 HIS B CE1 1 
ATOM   2715 N NE2 . HIS B 2 150 ? 17.735 2.222   -0.679  1.00 12.51  ? 156 HIS B NE2 1 
ATOM   2716 N N   . VAL B 2 151 ? 15.200 1.597   5.915   1.00 25.10  ? 157 VAL B N   1 
ATOM   2717 C CA  . VAL B 2 151 ? 14.185 1.832   6.943   1.00 20.37  ? 157 VAL B CA  1 
ATOM   2718 C C   . VAL B 2 151 ? 14.815 2.231   8.266   1.00 24.94  ? 157 VAL B C   1 
ATOM   2719 O O   . VAL B 2 151 ? 16.039 2.116   8.454   1.00 23.99  ? 157 VAL B O   1 
ATOM   2720 C CB  . VAL B 2 151 ? 13.308 0.571   7.197   1.00 19.58  ? 157 VAL B CB  1 
ATOM   2721 C CG1 . VAL B 2 151 ? 12.654 0.102   5.908   1.00 22.28  ? 157 VAL B CG1 1 
ATOM   2722 C CG2 . VAL B 2 151 ? 14.128 -0.553  7.800   1.00 12.79  ? 157 VAL B CG2 1 
ATOM   2723 N N   . GLU B 2 152 ? 13.970 2.739   9.163   1.00 25.04  ? 158 GLU B N   1 
ATOM   2724 C CA  . GLU B 2 152 ? 14.364 3.138   10.519  1.00 26.47  ? 158 GLU B CA  1 
ATOM   2725 C C   . GLU B 2 152 ? 13.237 2.669   11.404  1.00 22.99  ? 158 GLU B C   1 
ATOM   2726 O O   . GLU B 2 152 ? 12.084 3.062   11.182  1.00 24.79  ? 158 GLU B O   1 
ATOM   2727 C CB  . GLU B 2 152 ? 14.464 4.668   10.703  1.00 31.90  ? 158 GLU B CB  1 
ATOM   2728 C CG  . GLU B 2 152 ? 15.673 5.355   10.131  1.00 34.64  ? 158 GLU B CG  1 
ATOM   2729 C CD  . GLU B 2 152 ? 15.439 5.815   8.710   1.00 43.52  ? 158 GLU B CD  1 
ATOM   2730 O OE1 . GLU B 2 152 ? 14.336 6.371   8.432   1.00 44.26  ? 158 GLU B OE1 1 
ATOM   2731 O OE2 . GLU B 2 152 ? 16.367 5.628   7.880   1.00 46.09  ? 158 GLU B OE2 1 
ATOM   2732 N N   . LEU B 2 153 ? 13.575 1.904   12.437  1.00 18.37  ? 159 LEU B N   1 
ATOM   2733 C CA  . LEU B 2 153 ? 12.583 1.395   13.364  1.00 23.14  ? 159 LEU B CA  1 
ATOM   2734 C C   . LEU B 2 153 ? 12.662 2.263   14.613  1.00 27.37  ? 159 LEU B C   1 
ATOM   2735 O O   . LEU B 2 153 ? 13.767 2.552   15.066  1.00 32.00  ? 159 LEU B O   1 
ATOM   2736 C CB  . LEU B 2 153 ? 12.864 -0.083  13.706  1.00 18.22  ? 159 LEU B CB  1 
ATOM   2737 C CG  . LEU B 2 153 ? 11.901 -0.847  14.631  1.00 16.41  ? 159 LEU B CG  1 
ATOM   2738 C CD1 . LEU B 2 153 ? 12.014 -2.370  14.446  1.00 11.86  ? 159 LEU B CD1 1 
ATOM   2739 C CD2 . LEU B 2 153 ? 12.128 -0.452  16.075  1.00 11.44  ? 159 LEU B CD2 1 
ATOM   2740 N N   . SER B 2 154 ? 11.519 2.734   15.124  1.00 25.80  ? 160 SER B N   1 
ATOM   2741 C CA  . SER B 2 154 ? 11.475 3.547   16.336  1.00 22.13  ? 160 SER B CA  1 
ATOM   2742 C C   . SER B 2 154 ? 10.428 3.033   17.317  1.00 24.80  ? 160 SER B C   1 
ATOM   2743 O O   . SER B 2 154 ? 9.567  2.230   16.963  1.00 27.74  ? 160 SER B O   1 
ATOM   2744 C CB  . SER B 2 154 ? 11.249 5.043   16.023  1.00 22.28  ? 160 SER B CB  1 
ATOM   2745 O OG  . SER B 2 154 ? 10.292 5.293   15.000  1.00 28.90  ? 160 SER B OG  1 
ATOM   2746 N N   . TRP B 2 155 ? 10.548 3.464   18.563  1.00 23.98  ? 161 TRP B N   1 
ATOM   2747 C CA  . TRP B 2 155 ? 9.615  3.091   19.609  1.00 25.08  ? 161 TRP B CA  1 
ATOM   2748 C C   . TRP B 2 155 ? 9.033  4.373   20.206  1.00 26.05  ? 161 TRP B C   1 
ATOM   2749 O O   . TRP B 2 155 ? 9.737  5.367   20.399  1.00 23.41  ? 161 TRP B O   1 
ATOM   2750 C CB  . TRP B 2 155 ? 10.313 2.301   20.712  1.00 26.61  ? 161 TRP B CB  1 
ATOM   2751 C CG  . TRP B 2 155 ? 10.662 0.895   20.361  1.00 23.47  ? 161 TRP B CG  1 
ATOM   2752 C CD1 . TRP B 2 155 ? 11.877 0.436   19.911  1.00 21.85  ? 161 TRP B CD1 1 
ATOM   2753 C CD2 . TRP B 2 155 ? 9.832  -0.270  20.538  1.00 20.89  ? 161 TRP B CD2 1 
ATOM   2754 N NE1 . TRP B 2 155 ? 11.853 -0.941  19.807  1.00 20.19  ? 161 TRP B NE1 1 
ATOM   2755 C CE2 . TRP B 2 155 ? 10.614 -1.399  20.197  1.00 21.31  ? 161 TRP B CE2 1 
ATOM   2756 C CE3 . TRP B 2 155 ? 8.515  -0.467  20.976  1.00 20.11  ? 161 TRP B CE3 1 
ATOM   2757 C CZ2 . TRP B 2 155 ? 10.121 -2.698  20.287  1.00 18.64  ? 161 TRP B CZ2 1 
ATOM   2758 C CZ3 . TRP B 2 155 ? 8.039  -1.737  21.066  1.00 20.02  ? 161 TRP B CZ3 1 
ATOM   2759 C CH2 . TRP B 2 155 ? 8.842  -2.848  20.725  1.00 19.78  ? 161 TRP B CH2 1 
ATOM   2760 N N   . TRP B 2 156 ? 7.739  4.340   20.492  1.00 27.09  ? 162 TRP B N   1 
ATOM   2761 C CA  . TRP B 2 156 ? 7.030  5.483   21.040  1.00 25.49  ? 162 TRP B CA  1 
ATOM   2762 C C   . TRP B 2 156 ? 6.156  5.025   22.194  1.00 29.80  ? 162 TRP B C   1 
ATOM   2763 O O   . TRP B 2 156 ? 5.362  4.092   22.041  1.00 30.97  ? 162 TRP B O   1 
ATOM   2764 C CB  . TRP B 2 156 ? 6.177  6.094   19.947  1.00 20.42  ? 162 TRP B CB  1 
ATOM   2765 C CG  . TRP B 2 156 ? 6.985  6.549   18.775  1.00 22.17  ? 162 TRP B CG  1 
ATOM   2766 C CD1 . TRP B 2 156 ? 7.576  5.763   17.828  1.00 22.14  ? 162 TRP B CD1 1 
ATOM   2767 C CD2 . TRP B 2 156 ? 7.335  7.899   18.458  1.00 21.91  ? 162 TRP B CD2 1 
ATOM   2768 N NE1 . TRP B 2 156 ? 8.286  6.544   16.947  1.00 24.56  ? 162 TRP B NE1 1 
ATOM   2769 C CE2 . TRP B 2 156 ? 8.153  7.858   17.309  1.00 21.77  ? 162 TRP B CE2 1 
ATOM   2770 C CE3 . TRP B 2 156 ? 7.036  9.138   19.036  1.00 20.50  ? 162 TRP B CE3 1 
ATOM   2771 C CZ2 . TRP B 2 156 ? 8.676  9.010   16.727  1.00 25.35  ? 162 TRP B CZ2 1 
ATOM   2772 C CZ3 . TRP B 2 156 ? 7.554  10.283  18.460  1.00 21.61  ? 162 TRP B CZ3 1 
ATOM   2773 C CH2 . TRP B 2 156 ? 8.368  10.210  17.315  1.00 27.55  ? 162 TRP B CH2 1 
ATOM   2774 N N   . VAL B 2 157 ? 6.365  5.623   23.364  1.00 30.68  ? 163 VAL B N   1 
ATOM   2775 C CA  . VAL B 2 157 ? 5.586  5.294   24.554  1.00 31.89  ? 163 VAL B CA  1 
ATOM   2776 C C   . VAL B 2 157 ? 4.817  6.546   25.018  1.00 36.79  ? 163 VAL B C   1 
ATOM   2777 O O   . VAL B 2 157 ? 5.414  7.568   25.394  1.00 40.01  ? 163 VAL B O   1 
ATOM   2778 C CB  . VAL B 2 157 ? 6.474  4.740   25.682  1.00 26.19  ? 163 VAL B CB  1 
ATOM   2779 C CG1 . VAL B 2 157 ? 5.683  4.599   26.950  1.00 25.68  ? 163 VAL B CG1 1 
ATOM   2780 C CG2 . VAL B 2 157 ? 7.020  3.391   25.283  1.00 27.09  ? 163 VAL B CG2 1 
ATOM   2781 N N   . ASN B 2 158 ? 3.489  6.461   24.928  1.00 37.18  ? 164 ASN B N   1 
ATOM   2782 C CA  . ASN B 2 158 ? 2.586  7.539   25.293  1.00 36.33  ? 164 ASN B CA  1 
ATOM   2783 C C   . ASN B 2 158 ? 2.887  8.754   24.426  1.00 40.57  ? 164 ASN B C   1 
ATOM   2784 O O   . ASN B 2 158 ? 2.960  9.883   24.925  1.00 42.54  ? 164 ASN B O   1 
ATOM   2785 C CB  . ASN B 2 158 ? 2.712  7.895   26.778  1.00 33.05  ? 164 ASN B CB  1 
ATOM   2786 C CG  . ASN B 2 158 ? 2.391  6.740   27.687  1.00 31.09  ? 164 ASN B CG  1 
ATOM   2787 O OD1 . ASN B 2 158 ? 1.658  5.823   27.317  1.00 35.74  ? 164 ASN B OD1 1 
ATOM   2788 N ND2 . ASN B 2 158 ? 2.959  6.760   28.881  1.00 25.72  ? 164 ASN B ND2 1 
ATOM   2789 N N   . GLY B 2 159 ? 3.078  8.506   23.129  1.00 43.09  ? 165 GLY B N   1 
ATOM   2790 C CA  . GLY B 2 159 ? 3.363  9.559   22.158  1.00 42.81  ? 165 GLY B CA  1 
ATOM   2791 C C   . GLY B 2 159 ? 4.779  10.124  22.078  1.00 43.99  ? 165 GLY B C   1 
ATOM   2792 O O   . GLY B 2 159 ? 5.094  10.866  21.145  1.00 45.69  ? 165 GLY B O   1 
ATOM   2793 N N   . LYS B 2 160 ? 5.644  9.793   23.033  1.00 43.38  ? 166 LYS B N   1 
ATOM   2794 C CA  . LYS B 2 160 ? 7.007  10.319  23.022  1.00 43.53  ? 166 LYS B CA  1 
ATOM   2795 C C   . LYS B 2 160 ? 8.010  9.262   22.607  1.00 40.13  ? 166 LYS B C   1 
ATOM   2796 O O   . LYS B 2 160 ? 7.902  8.117   23.041  1.00 38.43  ? 166 LYS B O   1 
ATOM   2797 C CB  . LYS B 2 160 ? 7.369  10.871  24.410  1.00 49.70  ? 166 LYS B CB  1 
ATOM   2798 C CG  . LYS B 2 160 ? 7.286  12.390  24.508  1.00 57.14  ? 166 LYS B CG  1 
ATOM   2799 C CD  . LYS B 2 160 ? 7.237  12.874  25.949  1.00 60.31  ? 166 LYS B CD  1 
ATOM   2800 C CE  . LYS B 2 160 ? 5.961  12.411  26.630  1.00 64.18  ? 166 LYS B CE  1 
ATOM   2801 N NZ  . LYS B 2 160 ? 4.753  12.889  25.899  1.00 66.15  ? 166 LYS B NZ  1 
ATOM   2802 N N   . GLU B 2 161 ? 8.957  9.628   21.741  1.00 38.53  ? 167 GLU B N   1 
ATOM   2803 C CA  . GLU B 2 161 ? 9.979  8.678   21.308  1.00 35.72  ? 167 GLU B CA  1 
ATOM   2804 C C   . GLU B 2 161 ? 10.892 8.284   22.459  1.00 35.49  ? 167 GLU B C   1 
ATOM   2805 O O   . GLU B 2 161 ? 11.460 9.138   23.141  1.00 32.72  ? 167 GLU B O   1 
ATOM   2806 C CB  . GLU B 2 161 ? 10.817 9.184   20.142  1.00 34.38  ? 167 GLU B CB  1 
ATOM   2807 C CG  . GLU B 2 161 ? 11.677 8.048   19.578  1.00 31.63  ? 167 GLU B CG  1 
ATOM   2808 C CD  . GLU B 2 161 ? 12.315 8.341   18.235  1.00 35.90  ? 167 GLU B CD  1 
ATOM   2809 O OE1 . GLU B 2 161 ? 12.037 9.409   17.647  1.00 42.00  ? 167 GLU B OE1 1 
ATOM   2810 O OE2 . GLU B 2 161 ? 13.095 7.482   17.759  1.00 37.00  ? 167 GLU B OE2 1 
ATOM   2811 N N   . VAL B 2 162 ? 11.085 6.972   22.560  1.00 34.23  ? 168 VAL B N   1 
ATOM   2812 C CA  . VAL B 2 162 ? 11.825 6.278   23.603  1.00 33.07  ? 168 VAL B CA  1 
ATOM   2813 C C   . VAL B 2 162 ? 13.188 5.739   23.146  1.00 34.96  ? 168 VAL B C   1 
ATOM   2814 O O   . VAL B 2 162 ? 13.312 5.245   22.019  1.00 34.06  ? 168 VAL B O   1 
ATOM   2815 C CB  . VAL B 2 162 ? 10.897 5.116   24.092  1.00 33.82  ? 168 VAL B CB  1 
ATOM   2816 C CG1 . VAL B 2 162 ? 11.627 4.042   24.851  1.00 35.42  ? 168 VAL B CG1 1 
ATOM   2817 C CG2 . VAL B 2 162 ? 9.823  5.686   24.928  1.00 31.37  ? 168 VAL B CG2 1 
ATOM   2818 N N   . HIS B 2 163 ? 14.208 5.876   24.002  1.00 34.87  ? 169 HIS B N   1 
ATOM   2819 C CA  . HIS B 2 163 ? 15.572 5.380   23.729  1.00 34.75  ? 169 HIS B CA  1 
ATOM   2820 C C   . HIS B 2 163 ? 16.107 4.477   24.834  1.00 35.93  ? 169 HIS B C   1 
ATOM   2821 O O   . HIS B 2 163 ? 16.656 3.428   24.547  1.00 36.90  ? 169 HIS B O   1 
ATOM   2822 C CB  . HIS B 2 163 ? 16.571 6.516   23.483  1.00 35.44  ? 169 HIS B CB  1 
ATOM   2823 C CG  . HIS B 2 163 ? 16.324 7.264   22.213  1.00 34.88  ? 169 HIS B CG  1 
ATOM   2824 N ND1 . HIS B 2 163 ? 16.406 6.666   20.974  1.00 34.69  ? 169 HIS B ND1 1 
ATOM   2825 C CD2 . HIS B 2 163 ? 15.899 8.531   21.992  1.00 37.88  ? 169 HIS B CD2 1 
ATOM   2826 C CE1 . HIS B 2 163 ? 16.030 7.527   20.044  1.00 35.56  ? 169 HIS B CE1 1 
ATOM   2827 N NE2 . HIS B 2 163 ? 15.715 8.666   20.635  1.00 35.12  ? 169 HIS B NE2 1 
ATOM   2828 N N   . SER B 2 164 ? 15.992 4.894   26.087  1.00 35.42  ? 170 SER B N   1 
ATOM   2829 C CA  . SER B 2 164 ? 16.446 4.071   27.200  1.00 35.58  ? 170 SER B CA  1 
ATOM   2830 C C   . SER B 2 164 ? 15.792 2.708   27.041  1.00 36.88  ? 170 SER B C   1 
ATOM   2831 O O   . SER B 2 164 ? 14.619 2.637   26.656  1.00 39.65  ? 170 SER B O   1 
ATOM   2832 C CB  . SER B 2 164 ? 16.000 4.693   28.535  1.00 36.46  ? 170 SER B CB  1 
ATOM   2833 O OG  . SER B 2 164 ? 16.221 3.809   29.634  1.00 38.58  ? 170 SER B OG  1 
ATOM   2834 N N   . GLY B 2 165 ? 16.548 1.632   27.262  1.00 34.24  ? 171 GLY B N   1 
ATOM   2835 C CA  . GLY B 2 165 ? 15.961 0.304   27.158  1.00 26.62  ? 171 GLY B CA  1 
ATOM   2836 C C   . GLY B 2 165 ? 15.698 -0.304  25.790  1.00 26.24  ? 171 GLY B C   1 
ATOM   2837 O O   . GLY B 2 165 ? 15.205 -1.423  25.735  1.00 26.21  ? 171 GLY B O   1 
ATOM   2838 N N   . VAL B 2 166 ? 15.969 0.406   24.694  1.00 26.36  ? 172 VAL B N   1 
ATOM   2839 C CA  . VAL B 2 166 ? 15.776 -0.182  23.360  1.00 25.66  ? 172 VAL B CA  1 
ATOM   2840 C C   . VAL B 2 166 ? 17.093 -0.678  22.742  1.00 25.44  ? 172 VAL B C   1 
ATOM   2841 O O   . VAL B 2 166 ? 18.162 -0.169  23.042  1.00 27.24  ? 172 VAL B O   1 
ATOM   2842 C CB  . VAL B 2 166 ? 14.990 0.748   22.348  1.00 21.69  ? 172 VAL B CB  1 
ATOM   2843 C CG1 . VAL B 2 166 ? 14.590 2.050   22.976  1.00 20.80  ? 172 VAL B CG1 1 
ATOM   2844 C CG2 . VAL B 2 166 ? 15.766 0.983   21.104  1.00 15.79  ? 172 VAL B CG2 1 
ATOM   2845 N N   . SER B 2 167 ? 16.994 -1.756  21.973  1.00 26.75  ? 173 SER B N   1 
ATOM   2846 C CA  . SER B 2 167 ? 18.115 -2.363  21.277  1.00 24.35  ? 173 SER B CA  1 
ATOM   2847 C C   . SER B 2 167 ? 17.600 -3.041  20.014  1.00 26.70  ? 173 SER B C   1 
ATOM   2848 O O   . SER B 2 167 ? 17.053 -4.167  20.056  1.00 29.05  ? 173 SER B O   1 
ATOM   2849 C CB  . SER B 2 167 ? 18.828 -3.395  22.144  1.00 20.39  ? 173 SER B CB  1 
ATOM   2850 O OG  . SER B 2 167 ? 19.770 -4.135  21.375  1.00 27.22  ? 173 SER B OG  1 
ATOM   2851 N N   . THR B 2 168 ? 17.748 -2.350  18.892  1.00 24.93  ? 174 THR B N   1 
ATOM   2852 C CA  . THR B 2 168 ? 17.309 -2.911  17.636  1.00 27.91  ? 174 THR B CA  1 
ATOM   2853 C C   . THR B 2 168 ? 18.533 -3.380  16.831  1.00 27.15  ? 174 THR B C   1 
ATOM   2854 O O   . THR B 2 168 ? 19.659 -2.991  17.148  1.00 29.65  ? 174 THR B O   1 
ATOM   2855 C CB  . THR B 2 168 ? 16.340 -1.923  16.893  1.00 25.31  ? 174 THR B CB  1 
ATOM   2856 O OG1 . THR B 2 168 ? 16.658 -1.834  15.509  1.00 23.96  ? 174 THR B OG1 1 
ATOM   2857 C CG2 . THR B 2 168 ? 16.343 -0.552  17.512  1.00 18.76  ? 174 THR B CG2 1 
ATOM   2858 N N   . ASP B 2 169 ? 18.328 -4.312  15.897  1.00 26.57  ? 175 ASP B N   1 
ATOM   2859 C CA  . ASP B 2 169 ? 19.403 -4.845  15.067  1.00 24.09  ? 175 ASP B CA  1 
ATOM   2860 C C   . ASP B 2 169 ? 20.056 -3.721  14.273  1.00 30.78  ? 175 ASP B C   1 
ATOM   2861 O O   . ASP B 2 169 ? 19.349 -2.931  13.636  1.00 30.76  ? 175 ASP B O   1 
ATOM   2862 C CB  . ASP B 2 169 ? 18.855 -5.851  14.070  1.00 22.19  ? 175 ASP B CB  1 
ATOM   2863 C CG  . ASP B 2 169 ? 18.374 -7.123  14.720  1.00 26.01  ? 175 ASP B CG  1 
ATOM   2864 O OD1 . ASP B 2 169 ? 18.825 -7.439  15.841  1.00 26.74  ? 175 ASP B OD1 1 
ATOM   2865 O OD2 . ASP B 2 169 ? 17.553 -7.830  14.082  1.00 28.93  ? 175 ASP B OD2 1 
ATOM   2866 N N   . PRO B 2 170 ? 21.417 -3.671  14.248  1.00 32.62  ? 176 PRO B N   1 
ATOM   2867 C CA  . PRO B 2 170 ? 22.178 -2.637  13.525  1.00 32.54  ? 176 PRO B CA  1 
ATOM   2868 C C   . PRO B 2 170 ? 22.102 -2.723  12.008  1.00 35.45  ? 176 PRO B C   1 
ATOM   2869 O O   . PRO B 2 170 ? 22.336 -1.733  11.309  1.00 37.80  ? 176 PRO B O   1 
ATOM   2870 C CB  . PRO B 2 170 ? 23.616 -2.883  14.004  1.00 27.46  ? 176 PRO B CB  1 
ATOM   2871 C CG  . PRO B 2 170 ? 23.650 -4.343  14.229  1.00 26.09  ? 176 PRO B CG  1 
ATOM   2872 C CD  . PRO B 2 170 ? 22.345 -4.584  14.949  1.00 31.65  ? 176 PRO B CD  1 
ATOM   2873 N N   . GLN B 2 171 ? 21.701 -3.893  11.514  1.00 38.97  ? 177 GLN B N   1 
ATOM   2874 C CA  . GLN B 2 171 ? 21.660 -4.189  10.090  1.00 37.83  ? 177 GLN B CA  1 
ATOM   2875 C C   . GLN B 2 171 ? 20.482 -5.114  9.794   1.00 34.93  ? 177 GLN B C   1 
ATOM   2876 O O   . GLN B 2 171 ? 20.281 -6.108  10.486  1.00 38.95  ? 177 GLN B O   1 
ATOM   2877 C CB  . GLN B 2 171 ? 22.957 -4.943  9.764   1.00 42.92  ? 177 GLN B CB  1 
ATOM   2878 C CG  . GLN B 2 171 ? 23.319 -5.044  8.324   1.00 53.82  ? 177 GLN B CG  1 
ATOM   2879 C CD  . GLN B 2 171 ? 23.849 -3.733  7.799   1.00 63.39  ? 177 GLN B CD  1 
ATOM   2880 O OE1 . GLN B 2 171 ? 25.014 -3.378  8.034   1.00 68.20  ? 177 GLN B OE1 1 
ATOM   2881 N NE2 . GLN B 2 171 ? 22.999 -2.996  7.081   1.00 66.59  ? 177 GLN B NE2 1 
ATOM   2882 N N   . ALA B 2 172 ? 19.706 -4.800  8.771   1.00 31.16  ? 178 ALA B N   1 
ATOM   2883 C CA  . ALA B 2 172 ? 18.600 -5.663  8.401   1.00 27.09  ? 178 ALA B CA  1 
ATOM   2884 C C   . ALA B 2 172 ? 19.211 -6.925  7.794   1.00 27.56  ? 178 ALA B C   1 
ATOM   2885 O O   . ALA B 2 172 ? 20.255 -6.860  7.144   1.00 28.59  ? 178 ALA B O   1 
ATOM   2886 C CB  . ALA B 2 172 ? 17.685 -4.956  7.387   1.00 23.04  ? 178 ALA B CB  1 
ATOM   2887 N N   . TYR B 2 173 ? 18.601 -8.072  8.064   1.00 27.89  ? 179 TYR B N   1 
ATOM   2888 C CA  . TYR B 2 173 ? 19.074 -9.343  7.526   1.00 30.56  ? 179 TYR B CA  1 
ATOM   2889 C C   . TYR B 2 173 ? 18.205 -9.671  6.326   1.00 28.72  ? 179 TYR B C   1 
ATOM   2890 O O   . TYR B 2 173 ? 17.044 -9.319  6.308   1.00 28.69  ? 179 TYR B O   1 
ATOM   2891 C CB  . TYR B 2 173 ? 18.906 -10.463 8.551   1.00 34.67  ? 179 TYR B CB  1 
ATOM   2892 C CG  . TYR B 2 173 ? 19.542 -10.218 9.903   1.00 41.90  ? 179 TYR B CG  1 
ATOM   2893 C CD1 . TYR B 2 173 ? 20.897 -10.469 10.110  1.00 42.42  ? 179 TYR B CD1 1 
ATOM   2894 C CD2 . TYR B 2 173 ? 18.780 -9.796  10.992  1.00 42.33  ? 179 TYR B CD2 1 
ATOM   2895 C CE1 . TYR B 2 173 ? 21.479 -10.312 11.367  1.00 43.21  ? 179 TYR B CE1 1 
ATOM   2896 C CE2 . TYR B 2 173 ? 19.357 -9.643  12.253  1.00 44.80  ? 179 TYR B CE2 1 
ATOM   2897 C CZ  . TYR B 2 173 ? 20.712 -9.905  12.435  1.00 44.60  ? 179 TYR B CZ  1 
ATOM   2898 O OH  . TYR B 2 173 ? 21.300 -9.772  13.679  1.00 44.06  ? 179 TYR B OH  1 
ATOM   2899 N N   . LYS B 2 174 ? 18.753 -10.352 5.333   1.00 28.81  ? 180 LYS B N   1 
ATOM   2900 C CA  . LYS B 2 174 ? 18.000 -10.732 4.140   1.00 29.17  ? 180 LYS B CA  1 
ATOM   2901 C C   . LYS B 2 174 ? 17.382 -12.098 4.458   1.00 31.01  ? 180 LYS B C   1 
ATOM   2902 O O   . LYS B 2 174 ? 18.079 -13.037 4.848   1.00 33.90  ? 180 LYS B O   1 
ATOM   2903 C CB  . LYS B 2 174 ? 18.968 -10.912 2.974   1.00 28.73  ? 180 LYS B CB  1 
ATOM   2904 C CG  . LYS B 2 174 ? 18.525 -10.278 1.675   1.00 35.79  ? 180 LYS B CG  1 
ATOM   2905 C CD  . LYS B 2 174 ? 19.474 -10.645 0.544   1.00 43.80  ? 180 LYS B CD  1 
ATOM   2906 C CE  . LYS B 2 174 ? 19.372 -9.711  -0.648  1.00 50.35  ? 180 LYS B CE  1 
ATOM   2907 N NZ  . LYS B 2 174 ? 20.018 -10.264 -1.844  1.00 54.01  ? 180 LYS B NZ  1 
ATOM   2908 N N   . GLU B 2 175 ? 16.077 -12.260 4.325   1.00 31.46  ? 181 GLU B N   1 
ATOM   2909 C CA  . GLU B 2 175 ? 15.488 -13.577 4.656   1.00 32.86  ? 181 GLU B CA  1 
ATOM   2910 C C   . GLU B 2 175 ? 15.099 -14.351 3.396   1.00 31.53  ? 181 GLU B C   1 
ATOM   2911 O O   . GLU B 2 175 ? 14.672 -15.511 3.467   1.00 34.71  ? 181 GLU B O   1 
ATOM   2912 C CB  . GLU B 2 175 ? 14.288 -13.445 5.589   1.00 33.98  ? 181 GLU B CB  1 
ATOM   2913 C CG  . GLU B 2 175 ? 13.210 -12.475 5.126   1.00 41.16  ? 181 GLU B CG  1 
ATOM   2914 C CD  . GLU B 2 175 ? 12.084 -12.371 6.155   1.00 47.82  ? 181 GLU B CD  1 
ATOM   2915 O OE1 . GLU B 2 175 ? 12.084 -13.151 7.186   1.00 47.68  ? 181 GLU B OE1 1 
ATOM   2916 O OE2 . GLU B 2 175 ? 11.145 -11.509 5.997   1.00 49.37  ? 181 GLU B OE2 1 
ATOM   2917 N N   . SER B 2 176 ? 15.277 -13.678 2.300   1.00 29.84  ? 182 SER B N   1 
ATOM   2918 C CA  . SER B 2 176 ? 15.034 -14.203 0.958   1.00 32.98  ? 182 SER B CA  1 
ATOM   2919 C C   . SER B 2 176 ? 15.861 -13.323 0.053   1.00 34.11  ? 182 SER B C   1 
ATOM   2920 O O   . SER B 2 176 ? 16.567 -12.422 0.521   1.00 38.77  ? 182 SER B O   1 
ATOM   2921 C CB  . SER B 2 176 ? 13.535 -14.165 0.652   1.00 33.36  ? 182 SER B CB  1 
ATOM   2922 O OG  . SER B 2 176 ? 13.299 -13.530 -0.593  1.00 41.34  ? 182 SER B OG  1 
ATOM   2923 N N   . ASN B 2 177 ? 15.788 -13.535 -1.225  1.00 38.87  ? 186 ASN B N   1 
ATOM   2924 C CA  . ASN B 2 177 ? 16.641 -12.759 -2.114  1.00 44.59  ? 186 ASN B CA  1 
ATOM   2925 C C   . ASN B 2 177 ? 16.203 -11.309 -2.265  1.00 43.00  ? 186 ASN B C   1 
ATOM   2926 O O   . ASN B 2 177 ? 17.040 -10.431 -2.537  1.00 40.42  ? 186 ASN B O   1 
ATOM   2927 C CB  . ASN B 2 177 ? 16.741 -13.388 -3.492  1.00 50.83  ? 186 ASN B CB  1 
ATOM   2928 C CG  . ASN B 2 177 ? 18.197 -13.465 -3.951  1.00 56.54  ? 186 ASN B CG  1 
ATOM   2929 O OD1 . ASN B 2 177 ? 18.790 -14.542 -3.930  1.00 59.50  ? 186 ASN B OD1 1 
ATOM   2930 N ND2 . ASN B 2 177 ? 18.819 -12.370 -4.350  1.00 55.31  ? 186 ASN B ND2 1 
ATOM   2931 N N   . TYR B 2 178 ? 14.899 -11.069 -2.109  1.00 41.79  ? 187 TYR B N   1 
ATOM   2932 C CA  . TYR B 2 178 ? 14.338 -9.732  -2.265  1.00 40.69  ? 187 TYR B CA  1 
ATOM   2933 C C   . TYR B 2 178 ? 13.413 -9.418  -1.099  1.00 37.95  ? 187 TYR B C   1 
ATOM   2934 O O   . TYR B 2 178 ? 12.325 -8.878  -1.277  1.00 43.16  ? 187 TYR B O   1 
ATOM   2935 C CB  . TYR B 2 178 ? 13.581 -9.639  -3.607  1.00 43.55  ? 187 TYR B CB  1 
ATOM   2936 C CG  . TYR B 2 178 ? 14.441 -9.953  -4.844  1.00 48.88  ? 187 TYR B CG  1 
ATOM   2937 C CD1 . TYR B 2 178 ? 15.410 -9.036  -5.304  1.00 49.79  ? 187 TYR B CD1 1 
ATOM   2938 C CD2 . TYR B 2 178 ? 14.311 -11.175 -5.529  1.00 47.48  ? 187 TYR B CD2 1 
ATOM   2939 C CE1 . TYR B 2 178 ? 16.224 -9.326  -6.395  1.00 48.08  ? 187 TYR B CE1 1 
ATOM   2940 C CE2 . TYR B 2 178 ? 15.119 -11.472 -6.625  1.00 48.70  ? 187 TYR B CE2 1 
ATOM   2941 C CZ  . TYR B 2 178 ? 16.073 -10.542 -7.046  1.00 51.48  ? 187 TYR B CZ  1 
ATOM   2942 O OH  . TYR B 2 178 ? 16.892 -10.835 -8.104  1.00 56.27  ? 187 TYR B OH  1 
ATOM   2943 N N   . SER B 2 179 ? 13.868 -9.717  0.108   1.00 33.51  ? 189 SER B N   1 
ATOM   2944 C CA  . SER B 2 179 ? 13.056 -9.495  1.287   1.00 27.77  ? 189 SER B CA  1 
ATOM   2945 C C   . SER B 2 179 ? 13.975 -9.435  2.496   1.00 24.64  ? 189 SER B C   1 
ATOM   2946 O O   . SER B 2 179 ? 14.827 -10.301 2.664   1.00 28.17  ? 189 SER B O   1 
ATOM   2947 C CB  . SER B 2 179 ? 12.054 -10.653 1.397   1.00 29.36  ? 189 SER B CB  1 
ATOM   2948 O OG  . SER B 2 179 ? 11.263 -10.623 2.575   1.00 33.08  ? 189 SER B OG  1 
ATOM   2949 N N   . TYR B 2 180 ? 13.792 -8.420  3.334   1.00 18.56  ? 190 TYR B N   1 
ATOM   2950 C CA  . TYR B 2 180 ? 14.603 -8.218  4.535   1.00 18.67  ? 190 TYR B CA  1 
ATOM   2951 C C   . TYR B 2 180 ? 13.796 -8.364  5.836   1.00 18.57  ? 190 TYR B C   1 
ATOM   2952 O O   . TYR B 2 180 ? 12.567 -8.379  5.832   1.00 20.14  ? 190 TYR B O   1 
ATOM   2953 C CB  . TYR B 2 180 ? 15.207 -6.796  4.532   1.00 22.63  ? 190 TYR B CB  1 
ATOM   2954 C CG  . TYR B 2 180 ? 16.431 -6.607  3.683   1.00 23.71  ? 190 TYR B CG  1 
ATOM   2955 C CD1 . TYR B 2 180 ? 16.324 -6.269  2.346   1.00 24.58  ? 190 TYR B CD1 1 
ATOM   2956 C CD2 . TYR B 2 180 ? 17.701 -6.802  4.209   1.00 23.41  ? 190 TYR B CD2 1 
ATOM   2957 C CE1 . TYR B 2 180 ? 17.452 -6.140  1.549   1.00 24.96  ? 190 TYR B CE1 1 
ATOM   2958 C CE2 . TYR B 2 180 ? 18.818 -6.670  3.432   1.00 21.98  ? 190 TYR B CE2 1 
ATOM   2959 C CZ  . TYR B 2 180 ? 18.689 -6.338  2.103   1.00 28.32  ? 190 TYR B CZ  1 
ATOM   2960 O OH  . TYR B 2 180 ? 19.808 -6.180  1.326   1.00 31.64  ? 190 TYR B OH  1 
ATOM   2961 N N   . CYS B 2 181 ? 14.500 -8.425  6.958   1.00 23.46  ? 191 CYS B N   1 
ATOM   2962 C CA  . CYS B 2 181 ? 13.864 -8.499  8.268   1.00 26.44  ? 191 CYS B CA  1 
ATOM   2963 C C   . CYS B 2 181 ? 14.681 -7.685  9.297   1.00 24.14  ? 191 CYS B C   1 
ATOM   2964 O O   . CYS B 2 181 ? 15.846 -7.369  9.069   1.00 25.03  ? 191 CYS B O   1 
ATOM   2965 C CB  . CYS B 2 181 ? 13.640 -9.959  8.689   1.00 29.31  ? 191 CYS B CB  1 
ATOM   2966 S SG  . CYS B 2 181 ? 15.089 -10.894 9.146   1.00 32.08  ? 191 CYS B SG  1 
ATOM   2967 N N   . LEU B 2 182 ? 14.045 -7.253  10.369  1.00 23.90  ? 192 LEU B N   1 
ATOM   2968 C CA  . LEU B 2 182 ? 14.728 -6.451  11.372  1.00 24.43  ? 192 LEU B CA  1 
ATOM   2969 C C   . LEU B 2 182 ? 13.932 -6.581  12.669  1.00 25.39  ? 192 LEU B C   1 
ATOM   2970 O O   . LEU B 2 182 ? 12.708 -6.613  12.632  1.00 28.09  ? 192 LEU B O   1 
ATOM   2971 C CB  . LEU B 2 182 ? 14.735 -4.982  10.921  1.00 21.51  ? 192 LEU B CB  1 
ATOM   2972 C CG  . LEU B 2 182 ? 15.538 -3.954  11.733  1.00 20.72  ? 192 LEU B CG  1 
ATOM   2973 C CD1 . LEU B 2 182 ? 17.005 -4.112  11.395  1.00 17.88  ? 192 LEU B CD1 1 
ATOM   2974 C CD2 . LEU B 2 182 ? 15.088 -2.543  11.414  1.00 8.78   ? 192 LEU B CD2 1 
ATOM   2975 N N   . SER B 2 183 ? 14.610 -6.625  13.807  1.00 25.76  ? 193 SER B N   1 
ATOM   2976 C CA  . SER B 2 183 ? 13.921 -6.742  15.085  1.00 23.11  ? 193 SER B CA  1 
ATOM   2977 C C   . SER B 2 183 ? 14.423 -5.732  16.092  1.00 20.20  ? 193 SER B C   1 
ATOM   2978 O O   . SER B 2 183 ? 15.392 -5.006  15.849  1.00 19.91  ? 193 SER B O   1 
ATOM   2979 C CB  . SER B 2 183 ? 14.033 -8.165  15.636  1.00 26.71  ? 193 SER B CB  1 
ATOM   2980 O OG  . SER B 2 183 ? 15.372 -8.633  15.624  1.00 35.63  ? 193 SER B OG  1 
ATOM   2981 N N   . SER B 2 184 ? 13.734 -5.646  17.213  1.00 17.80  ? 194 SER B N   1 
ATOM   2982 C CA  . SER B 2 184 ? 14.120 -4.701  18.213  1.00 17.98  ? 194 SER B CA  1 
ATOM   2983 C C   . SER B 2 184 ? 13.496 -5.073  19.518  1.00 20.03  ? 194 SER B C   1 
ATOM   2984 O O   . SER B 2 184 ? 12.419 -5.675  19.563  1.00 22.93  ? 194 SER B O   1 
ATOM   2985 C CB  . SER B 2 184 ? 13.628 -3.331  17.823  1.00 18.35  ? 194 SER B CB  1 
ATOM   2986 O OG  . SER B 2 184 ? 13.953 -2.388  18.820  1.00 21.51  ? 194 SER B OG  1 
ATOM   2987 N N   . ARG B 2 185 ? 14.185 -4.743  20.591  1.00 14.86  ? 195 ARG B N   1 
ATOM   2988 C CA  . ARG B 2 185 ? 13.652 -5.021  21.882  1.00 16.66  ? 195 ARG B CA  1 
ATOM   2989 C C   . ARG B 2 185 ? 13.446 -3.701  22.620  1.00 19.12  ? 195 ARG B C   1 
ATOM   2990 O O   . ARG B 2 185 ? 14.175 -2.723  22.398  1.00 19.34  ? 195 ARG B O   1 
ATOM   2991 C CB  . ARG B 2 185 ? 14.626 -5.882  22.696  1.00 19.27  ? 195 ARG B CB  1 
ATOM   2992 C CG  . ARG B 2 185 ? 14.714 -7.342  22.278  1.00 19.34  ? 195 ARG B CG  1 
ATOM   2993 C CD  . ARG B 2 185 ? 15.735 -8.111  23.126  1.00 24.07  ? 195 ARG B CD  1 
ATOM   2994 N NE  . ARG B 2 185 ? 17.109 -7.610  22.960  1.00 28.27  ? 195 ARG B NE  1 
ATOM   2995 C CZ  . ARG B 2 185 ? 18.054 -7.634  23.913  1.00 30.61  ? 195 ARG B CZ  1 
ATOM   2996 N NH1 . ARG B 2 185 ? 17.798 -8.125  25.133  1.00 33.73  ? 195 ARG B NH1 1 
ATOM   2997 N NH2 . ARG B 2 185 ? 19.307 -7.192  23.728  1.00 31.28  ? 195 ARG B NH2 1 
ATOM   2998 N N   . LEU B 2 186 ? 12.444 -3.726  23.449  1.00 20.19  ? 196 LEU B N   1 
ATOM   2999 C CA  . LEU B 2 186 ? 12.102 -2.633  24.355  1.00 21.73  ? 196 LEU B CA  1 
ATOM   3000 C C   . LEU B 2 186 ? 11.777 -3.310  25.670  1.00 25.19  ? 196 LEU B C   1 
ATOM   3001 O O   . LEU B 2 186 ? 10.719 -3.926  25.820  1.00 26.45  ? 196 LEU B O   1 
ATOM   3002 C CB  . LEU B 2 186 ? 10.911 -1.828  23.810  1.00 20.01  ? 196 LEU B CB  1 
ATOM   3003 C CG  . LEU B 2 186 ? 10.384 -0.753  24.781  1.00 15.42  ? 196 LEU B CG  1 
ATOM   3004 C CD1 . LEU B 2 186 ? 11.409 0.341   25.092  1.00 15.46  ? 196 LEU B CD1 1 
ATOM   3005 C CD2 . LEU B 2 186 ? 9.151  -0.018  24.241  1.00 18.25  ? 196 LEU B CD2 1 
ATOM   3006 N N   . ARG B 2 187 ? 12.720 -3.226  26.570  1.00 25.93  ? 197 ARG B N   1 
ATOM   3007 C CA  . ARG B 2 187 ? 12.583 -3.831  27.892  1.00 25.60  ? 197 ARG B CA  1 
ATOM   3008 C C   . ARG B 2 187 ? 12.184 -2.743  28.867  1.00 29.34  ? 197 ARG B C   1 
ATOM   3009 O O   . ARG B 2 187 ? 12.780 -1.652  28.873  1.00 27.08  ? 197 ARG B O   1 
ATOM   3010 C CB  . ARG B 2 187 ? 13.924 -4.477  28.287  1.00 28.02  ? 197 ARG B CB  1 
ATOM   3011 C CG  . ARG B 2 187 ? 13.948 -5.046  29.711  1.00 30.46  ? 197 ARG B CG  1 
ATOM   3012 C CD  . ARG B 2 187 ? 13.935 -6.582  29.759  1.00 28.20  ? 197 ARG B CD  1 
ATOM   3013 N NE  . ARG B 2 187 ? 15.135 -7.161  30.392  1.00 25.39  ? 197 ARG B NE  1 
ATOM   3014 C CZ  . ARG B 2 187 ? 15.271 -8.459  30.713  1.00 28.07  ? 197 ARG B CZ  1 
ATOM   3015 N NH1 . ARG B 2 187 ? 14.287 -9.338  30.478  1.00 30.38  ? 197 ARG B NH1 1 
ATOM   3016 N NH2 . ARG B 2 187 ? 16.375 -8.980  31.268  1.00 26.19  ? 197 ARG B NH2 1 
ATOM   3017 N N   . VAL B 2 188 ? 11.078 -2.979  29.576  1.00 30.30  ? 198 VAL B N   1 
ATOM   3018 C CA  . VAL B 2 188 ? 10.588 -2.032  30.576  1.00 28.26  ? 198 VAL B CA  1 
ATOM   3019 C C   . VAL B 2 188 ? 10.409 -2.774  31.882  1.00 31.87  ? 198 VAL B C   1 
ATOM   3020 O O   . VAL B 2 188 ? 10.739 -3.956  31.959  1.00 32.84  ? 198 VAL B O   1 
ATOM   3021 C CB  . VAL B 2 188 ? 9.287  -1.284  30.147  1.00 23.79  ? 198 VAL B CB  1 
ATOM   3022 C CG1 . VAL B 2 188 ? 9.540  -0.543  28.879  1.00 22.65  ? 198 VAL B CG1 1 
ATOM   3023 C CG2 . VAL B 2 188 ? 8.119  -2.215  29.975  1.00 22.58  ? 198 VAL B CG2 1 
ATOM   3024 N N   . SER B 2 189 ? 10.021 -2.067  32.939  1.00 35.22  ? 199 SER B N   1 
ATOM   3025 C CA  . SER B 2 189 ? 9.812  -2.720  34.235  1.00 36.58  ? 199 SER B CA  1 
ATOM   3026 C C   . SER B 2 189 ? 8.431  -3.366  34.230  1.00 37.43  ? 199 SER B C   1 
ATOM   3027 O O   . SER B 2 189 ? 7.543  -2.910  33.512  1.00 38.64  ? 199 SER B O   1 
ATOM   3028 C CB  . SER B 2 189 ? 9.905  -1.698  35.371  1.00 32.29  ? 199 SER B CB  1 
ATOM   3029 O OG  . SER B 2 189 ? 9.028  -0.614  35.151  1.00 35.73  ? 199 SER B OG  1 
ATOM   3030 N N   . ALA B 2 190 ? 8.243  -4.438  34.992  1.00 38.09  ? 200 ALA B N   1 
ATOM   3031 C CA  . ALA B 2 190 ? 6.929  -5.075  35.040  1.00 38.93  ? 200 ALA B CA  1 
ATOM   3032 C C   . ALA B 2 190 ? 5.887  -4.046  35.484  1.00 39.90  ? 200 ALA B C   1 
ATOM   3033 O O   . ALA B 2 190 ? 4.799  -4.001  34.933  1.00 42.06  ? 200 ALA B O   1 
ATOM   3034 C CB  . ALA B 2 190 ? 6.931  -6.274  35.978  1.00 33.16  ? 200 ALA B CB  1 
ATOM   3035 N N   . THR B 2 191 ? 6.249  -3.182  36.427  1.00 42.05  ? 201 THR B N   1 
ATOM   3036 C CA  . THR B 2 191 ? 5.334  -2.164  36.918  1.00 41.68  ? 201 THR B CA  1 
ATOM   3037 C C   . THR B 2 191 ? 4.804  -1.316  35.776  1.00 42.12  ? 201 THR B C   1 
ATOM   3038 O O   . THR B 2 191 ? 3.599  -1.125  35.667  1.00 44.27  ? 201 THR B O   1 
ATOM   3039 C CB  . THR B 2 191 ? 6.009  -1.270  37.989  1.00 45.80  ? 201 THR B CB  1 
ATOM   3040 O OG1 . THR B 2 191 ? 5.334  -1.439  39.243  1.00 51.44  ? 201 THR B OG1 1 
ATOM   3041 C CG2 . THR B 2 191 ? 5.983  0.211   37.593  1.00 47.46  ? 201 THR B CG2 1 
ATOM   3042 N N   . PHE B 2 192 ? 5.706  -0.852  34.912  1.00 41.08  ? 202 PHE B N   1 
ATOM   3043 C CA  . PHE B 2 192 ? 5.366  -0.013  33.763  1.00 37.43  ? 202 PHE B CA  1 
ATOM   3044 C C   . PHE B 2 192 ? 4.497  -0.734  32.716  1.00 38.11  ? 202 PHE B C   1 
ATOM   3045 O O   . PHE B 2 192 ? 3.545  -0.156  32.179  1.00 39.74  ? 202 PHE B O   1 
ATOM   3046 C CB  . PHE B 2 192 ? 6.652  0.514   33.121  1.00 36.69  ? 202 PHE B CB  1 
ATOM   3047 C CG  . PHE B 2 192 ? 6.441  1.687   32.202  1.00 34.23  ? 202 PHE B CG  1 
ATOM   3048 C CD1 . PHE B 2 192 ? 6.366  2.978   32.711  1.00 33.34  ? 202 PHE B CD1 1 
ATOM   3049 C CD2 . PHE B 2 192 ? 6.327  1.503   30.825  1.00 35.05  ? 202 PHE B CD2 1 
ATOM   3050 C CE1 . PHE B 2 192 ? 6.182  4.073   31.870  1.00 31.26  ? 202 PHE B CE1 1 
ATOM   3051 C CE2 . PHE B 2 192 ? 6.143  2.586   29.977  1.00 34.88  ? 202 PHE B CE2 1 
ATOM   3052 C CZ  . PHE B 2 192 ? 6.071  3.877   30.509  1.00 35.86  ? 202 PHE B CZ  1 
ATOM   3053 N N   . TRP B 2 193 ? 4.823  -1.991  32.430  1.00 36.21  ? 203 TRP B N   1 
ATOM   3054 C CA  . TRP B 2 193 ? 4.062  -2.795  31.474  1.00 36.26  ? 203 TRP B CA  1 
ATOM   3055 C C   . TRP B 2 193 ? 2.643  -3.076  31.964  1.00 37.12  ? 203 TRP B C   1 
ATOM   3056 O O   . TRP B 2 193 ? 1.705  -3.169  31.165  1.00 36.45  ? 203 TRP B O   1 
ATOM   3057 C CB  . TRP B 2 193 ? 4.765  -4.132  31.203  1.00 33.20  ? 203 TRP B CB  1 
ATOM   3058 C CG  . TRP B 2 193 ? 3.886  -5.135  30.468  1.00 36.84  ? 203 TRP B CG  1 
ATOM   3059 C CD1 . TRP B 2 193 ? 3.426  -6.329  30.950  1.00 36.56  ? 203 TRP B CD1 1 
ATOM   3060 C CD2 . TRP B 2 193 ? 3.358  -5.016  29.137  1.00 37.00  ? 203 TRP B CD2 1 
ATOM   3061 N NE1 . TRP B 2 193 ? 2.653  -6.957  30.012  1.00 33.44  ? 203 TRP B NE1 1 
ATOM   3062 C CE2 . TRP B 2 193 ? 2.588  -6.177  28.890  1.00 35.32  ? 203 TRP B CE2 1 
ATOM   3063 C CE3 . TRP B 2 193 ? 3.466  -4.043  28.127  1.00 39.75  ? 203 TRP B CE3 1 
ATOM   3064 C CZ2 . TRP B 2 193 ? 1.924  -6.396  27.674  1.00 34.85  ? 203 TRP B CZ2 1 
ATOM   3065 C CZ3 . TRP B 2 193 ? 2.808  -4.261  26.913  1.00 37.23  ? 203 TRP B CZ3 1 
ATOM   3066 C CH2 . TRP B 2 193 ? 2.047  -5.431  26.702  1.00 36.22  ? 203 TRP B CH2 1 
ATOM   3067 N N   . HIS B 2 194 ? 2.510  -3.269  33.271  1.00 36.94  ? 204 HIS B N   1 
ATOM   3068 C CA  . HIS B 2 194 ? 1.236  -3.555  33.894  1.00 35.82  ? 204 HIS B CA  1 
ATOM   3069 C C   . HIS B 2 194 ? 0.302  -2.354  34.051  1.00 39.16  ? 204 HIS B C   1 
ATOM   3070 O O   . HIS B 2 194 ? -0.781 -2.480  34.629  1.00 41.44  ? 204 HIS B O   1 
ATOM   3071 C CB  . HIS B 2 194 ? 1.444  -4.233  35.238  1.00 33.62  ? 204 HIS B CB  1 
ATOM   3072 C CG  . HIS B 2 194 ? 1.885  -5.658  35.131  1.00 31.88  ? 204 HIS B CG  1 
ATOM   3073 N ND1 . HIS B 2 194 ? 1.528  -6.469  34.077  1.00 35.35  ? 204 HIS B ND1 1 
ATOM   3074 C CD2 . HIS B 2 194 ? 2.623  -6.430  35.964  1.00 29.42  ? 204 HIS B CD2 1 
ATOM   3075 C CE1 . HIS B 2 194 ? 2.024  -7.681  34.261  1.00 31.77  ? 204 HIS B CE1 1 
ATOM   3076 N NE2 . HIS B 2 194 ? 2.693  -7.683  35.400  1.00 32.08  ? 204 HIS B NE2 1 
ATOM   3077 N N   . ASN B 2 195 ? 0.708  -1.189  33.558  1.00 39.12  ? 205 ASN B N   1 
ATOM   3078 C CA  . ASN B 2 195 ? -0.160 -0.034  33.641  1.00 40.20  ? 205 ASN B CA  1 
ATOM   3079 C C   . ASN B 2 195 ? -0.896 0.124   32.314  1.00 43.85  ? 205 ASN B C   1 
ATOM   3080 O O   . ASN B 2 195 ? -0.286 0.458   31.289  1.00 40.36  ? 205 ASN B O   1 
ATOM   3081 C CB  . ASN B 2 195 ? 0.621  1.231   33.969  1.00 41.47  ? 205 ASN B CB  1 
ATOM   3082 C CG  . ASN B 2 195 ? -0.296 2.411   34.235  1.00 45.81  ? 205 ASN B CG  1 
ATOM   3083 O OD1 . ASN B 2 195 ? -1.518 2.246   34.327  1.00 47.19  ? 205 ASN B OD1 1 
ATOM   3084 N ND2 . ASN B 2 195 ? 0.273  3.615   34.311  1.00 45.64  ? 205 ASN B ND2 1 
ATOM   3085 N N   . PRO B 2 196 ? -2.231 -0.082  32.326  1.00 47.81  ? 206 PRO B N   1 
ATOM   3086 C CA  . PRO B 2 196 ? -3.142 0.008   31.175  1.00 45.14  ? 206 PRO B CA  1 
ATOM   3087 C C   . PRO B 2 196 ? -3.207 1.375   30.486  1.00 43.98  ? 206 PRO B C   1 
ATOM   3088 O O   . PRO B 2 196 ? -3.757 1.502   29.385  1.00 45.78  ? 206 PRO B O   1 
ATOM   3089 C CB  . PRO B 2 196 ? -4.494 -0.376  31.780  1.00 47.26  ? 206 PRO B CB  1 
ATOM   3090 C CG  . PRO B 2 196 ? -4.133 -1.242  32.938  1.00 48.56  ? 206 PRO B CG  1 
ATOM   3091 C CD  . PRO B 2 196 ? -2.974 -0.502  33.531  1.00 47.26  ? 206 PRO B CD  1 
ATOM   3092 N N   . ARG B 2 197 ? -2.707 2.407   31.146  1.00 40.92  ? 207 ARG B N   1 
ATOM   3093 C CA  . ARG B 2 197 ? -2.703 3.734   30.541  1.00 43.44  ? 207 ARG B CA  1 
ATOM   3094 C C   . ARG B 2 197 ? -1.473 3.919   29.622  1.00 39.97  ? 207 ARG B C   1 
ATOM   3095 O O   . ARG B 2 197 ? -1.454 4.814   28.754  1.00 35.32  ? 207 ARG B O   1 
ATOM   3096 C CB  . ARG B 2 197 ? -2.711 4.801   31.634  1.00 48.92  ? 207 ARG B CB  1 
ATOM   3097 C CG  . ARG B 2 197 ? -3.940 4.765   32.541  1.00 55.38  ? 207 ARG B CG  1 
ATOM   3098 C CD  . ARG B 2 197 ? -3.777 5.726   33.733  1.00 58.05  ? 207 ARG B CD  1 
ATOM   3099 N NE  . ARG B 2 197 ? -5.000 5.847   34.530  1.00 60.49  ? 207 ARG B NE  1 
ATOM   3100 C CZ  . ARG B 2 197 ? -5.352 5.016   35.508  1.00 61.68  ? 207 ARG B CZ  1 
ATOM   3101 N NH1 . ARG B 2 197 ? -4.573 3.987   35.827  1.00 62.93  ? 207 ARG B NH1 1 
ATOM   3102 N NH2 . ARG B 2 197 ? -6.507 5.193   36.146  1.00 60.76  ? 207 ARG B NH2 1 
ATOM   3103 N N   . ASN B 2 198 ? -0.460 3.062   29.821  1.00 38.62  ? 208 ASN B N   1 
ATOM   3104 C CA  . ASN B 2 198 ? 0.789  3.096   29.042  1.00 36.39  ? 208 ASN B CA  1 
ATOM   3105 C C   . ASN B 2 198 ? 0.552  2.518   27.679  1.00 32.60  ? 208 ASN B C   1 
ATOM   3106 O O   . ASN B 2 198 ? 0.152  1.362   27.539  1.00 34.63  ? 208 ASN B O   1 
ATOM   3107 C CB  . ASN B 2 198 ? 1.896  2.328   29.739  1.00 35.47  ? 208 ASN B CB  1 
ATOM   3108 C CG  . ASN B 2 198 ? 2.404  3.047   30.964  1.00 40.22  ? 208 ASN B CG  1 
ATOM   3109 O OD1 . ASN B 2 198 ? 2.569  4.273   30.962  1.00 38.80  ? 208 ASN B OD1 1 
ATOM   3110 N ND2 . ASN B 2 198 ? 2.655  2.293   32.026  1.00 39.13  ? 208 ASN B ND2 1 
ATOM   3111 N N   . HIS B 2 199 ? 0.835  3.327   26.679  1.00 26.54  ? 209 HIS B N   1 
ATOM   3112 C CA  . HIS B 2 199 ? 0.611  2.960   25.297  1.00 31.60  ? 209 HIS B CA  1 
ATOM   3113 C C   . HIS B 2 199 ? 1.944  2.767   24.554  1.00 30.80  ? 209 HIS B C   1 
ATOM   3114 O O   . HIS B 2 199 ? 2.701  3.720   24.399  1.00 35.35  ? 209 HIS B O   1 
ATOM   3115 C CB  . HIS B 2 199 ? -0.215 4.075   24.655  1.00 30.23  ? 209 HIS B CB  1 
ATOM   3116 C CG  . HIS B 2 199 ? -0.414 3.904   23.196  1.00 30.94  ? 209 HIS B CG  1 
ATOM   3117 N ND1 . HIS B 2 199 ? -0.355 4.955   22.309  1.00 35.76  ? 209 HIS B ND1 1 
ATOM   3118 C CD2 . HIS B 2 199 ? -0.669 2.800   22.459  1.00 34.39  ? 209 HIS B CD2 1 
ATOM   3119 C CE1 . HIS B 2 199 ? -0.571 4.506   21.085  1.00 37.19  ? 209 HIS B CE1 1 
ATOM   3120 N NE2 . HIS B 2 199 ? -0.763 3.201   21.150  1.00 34.06  ? 209 HIS B NE2 1 
ATOM   3121 N N   . PHE B 2 200 ? 2.201  1.554   24.072  1.00 25.60  ? 210 PHE B N   1 
ATOM   3122 C CA  . PHE B 2 200 ? 3.449  1.227   23.368  1.00 25.51  ? 210 PHE B CA  1 
ATOM   3123 C C   . PHE B 2 200 ? 3.288  1.162   21.833  1.00 27.03  ? 210 PHE B C   1 
ATOM   3124 O O   . PHE B 2 200 ? 2.337  0.572   21.324  1.00 29.98  ? 210 PHE B O   1 
ATOM   3125 C CB  . PHE B 2 200 ? 4.003  -0.115  23.876  1.00 20.41  ? 210 PHE B CB  1 
ATOM   3126 C CG  . PHE B 2 200 ? 4.125  -0.204  25.376  1.00 16.51  ? 210 PHE B CG  1 
ATOM   3127 C CD1 . PHE B 2 200 ? 5.291  0.202   26.020  1.00 17.44  ? 210 PHE B CD1 1 
ATOM   3128 C CD2 . PHE B 2 200 ? 3.082  -0.715  26.146  1.00 16.52  ? 210 PHE B CD2 1 
ATOM   3129 C CE1 . PHE B 2 200 ? 5.421  0.097   27.415  1.00 16.15  ? 210 PHE B CE1 1 
ATOM   3130 C CE2 . PHE B 2 200 ? 3.200  -0.826  27.538  1.00 18.04  ? 210 PHE B CE2 1 
ATOM   3131 C CZ  . PHE B 2 200 ? 4.369  -0.417  28.169  1.00 18.04  ? 210 PHE B CZ  1 
ATOM   3132 N N   . ARG B 2 201 ? 4.221  1.734   21.086  1.00 28.00  ? 211 ARG B N   1 
ATOM   3133 C CA  . ARG B 2 201 ? 4.103  1.703   19.638  1.00 28.75  ? 211 ARG B CA  1 
ATOM   3134 C C   . ARG B 2 201 ? 5.445  1.547   18.903  1.00 29.98  ? 211 ARG B C   1 
ATOM   3135 O O   . ARG B 2 201 ? 6.391  2.308   19.100  1.00 31.21  ? 211 ARG B O   1 
ATOM   3136 C CB  . ARG B 2 201 ? 3.350  2.952   19.175  1.00 27.96  ? 211 ARG B CB  1 
ATOM   3137 C CG  . ARG B 2 201 ? 3.231  3.126   17.682  1.00 24.72  ? 211 ARG B CG  1 
ATOM   3138 C CD  . ARG B 2 201 ? 2.441  4.383   17.368  1.00 23.11  ? 211 ARG B CD  1 
ATOM   3139 N NE  . ARG B 2 201 ? 3.040  5.163   16.282  1.00 28.13  ? 211 ARG B NE  1 
ATOM   3140 C CZ  . ARG B 2 201 ? 3.662  6.327   16.442  1.00 26.88  ? 211 ARG B CZ  1 
ATOM   3141 N NH1 . ARG B 2 201 ? 3.797  6.874   17.636  1.00 34.15  ? 211 ARG B NH1 1 
ATOM   3142 N NH2 . ARG B 2 201 ? 4.102  6.978   15.399  1.00 29.49  ? 211 ARG B NH2 1 
ATOM   3143 N N   . CYS B 2 202 ? 5.519  0.540   18.052  1.00 29.57  ? 212 CYS B N   1 
ATOM   3144 C CA  . CYS B 2 202 ? 6.711  0.277   17.289  1.00 27.83  ? 212 CYS B CA  1 
ATOM   3145 C C   . CYS B 2 202 ? 6.517  0.781   15.851  1.00 28.80  ? 212 CYS B C   1 
ATOM   3146 O O   . CYS B 2 202 ? 5.705  0.254   15.091  1.00 29.37  ? 212 CYS B O   1 
ATOM   3147 C CB  . CYS B 2 202 ? 6.989  -1.220  17.301  1.00 28.06  ? 212 CYS B CB  1 
ATOM   3148 S SG  . CYS B 2 202 ? 8.313  -1.660  16.193  1.00 29.67  ? 212 CYS B SG  1 
ATOM   3149 N N   . GLN B 2 203 ? 7.243  1.827   15.494  1.00 25.62  ? 213 GLN B N   1 
ATOM   3150 C CA  . GLN B 2 203 ? 7.125  2.388   14.171  1.00 22.15  ? 213 GLN B CA  1 
ATOM   3151 C C   . GLN B 2 203 ? 8.285  2.000   13.265  1.00 23.87  ? 213 GLN B C   1 
ATOM   3152 O O   . GLN B 2 203 ? 9.406  1.806   13.726  1.00 27.76  ? 213 GLN B O   1 
ATOM   3153 C CB  . GLN B 2 203 ? 7.058  3.895   14.248  1.00 20.86  ? 213 GLN B CB  1 
ATOM   3154 C CG  . GLN B 2 203 ? 6.838  4.500   12.906  1.00 23.91  ? 213 GLN B CG  1 
ATOM   3155 C CD  . GLN B 2 203 ? 6.843  5.981   12.950  1.00 26.78  ? 213 GLN B CD  1 
ATOM   3156 O OE1 . GLN B 2 203 ? 5.841  6.580   13.279  1.00 27.90  ? 213 GLN B OE1 1 
ATOM   3157 N NE2 . GLN B 2 203 ? 7.981  6.597   12.622  1.00 28.59  ? 213 GLN B NE2 1 
ATOM   3158 N N   . VAL B 2 204 ? 8.029  1.920   11.968  1.00 19.11  ? 214 VAL B N   1 
ATOM   3159 C CA  . VAL B 2 204 ? 9.060  1.571   11.045  1.00 17.08  ? 214 VAL B CA  1 
ATOM   3160 C C   . VAL B 2 204 ? 8.813  2.452   9.873   1.00 19.71  ? 214 VAL B C   1 
ATOM   3161 O O   . VAL B 2 204 ? 7.793  2.325   9.227   1.00 21.63  ? 214 VAL B O   1 
ATOM   3162 C CB  . VAL B 2 204 ? 8.961  0.109   10.597  1.00 15.24  ? 214 VAL B CB  1 
ATOM   3163 C CG1 . VAL B 2 204 ? 9.921  -0.134  9.463   1.00 10.76  ? 214 VAL B CG1 1 
ATOM   3164 C CG2 . VAL B 2 204 ? 9.282  -0.836  11.760  1.00 8.85   ? 214 VAL B CG2 1 
ATOM   3165 N N   . GLN B 2 205 ? 9.698  3.421   9.667   1.00 22.54  ? 215 GLN B N   1 
ATOM   3166 C CA  . GLN B 2 205 ? 9.576  4.324   8.536   1.00 22.43  ? 215 GLN B CA  1 
ATOM   3167 C C   . GLN B 2 205 ? 10.253 3.713   7.329   1.00 24.03  ? 215 GLN B C   1 
ATOM   3168 O O   . GLN B 2 205 ? 11.483 3.577   7.315   1.00 22.52  ? 215 GLN B O   1 
ATOM   3169 C CB  . GLN B 2 205 ? 10.234 5.660   8.824   1.00 20.21  ? 215 GLN B CB  1 
ATOM   3170 C CG  . GLN B 2 205 ? 10.112 6.622   7.663   1.00 24.41  ? 215 GLN B CG  1 
ATOM   3171 C CD  . GLN B 2 205 ? 10.488 8.033   8.026   1.00 30.52  ? 215 GLN B CD  1 
ATOM   3172 O OE1 . GLN B 2 205 ? 9.986  8.984   7.433   1.00 37.15  ? 215 GLN B OE1 1 
ATOM   3173 N NE2 . GLN B 2 205 ? 11.399 8.186   8.979   1.00 34.37  ? 215 GLN B NE2 1 
ATOM   3174 N N   . PHE B 2 206 ? 9.454  3.370   6.321   1.00 22.13  ? 216 PHE B N   1 
ATOM   3175 C CA  . PHE B 2 206 ? 9.956  2.775   5.086   1.00 20.02  ? 216 PHE B CA  1 
ATOM   3176 C C   . PHE B 2 206 ? 10.212 3.836   4.005   1.00 18.41  ? 216 PHE B C   1 
ATOM   3177 O O   . PHE B 2 206 ? 9.380  4.692   3.746   1.00 18.69  ? 216 PHE B O   1 
ATOM   3178 C CB  . PHE B 2 206 ? 8.923  1.742   4.560   1.00 20.05  ? 216 PHE B CB  1 
ATOM   3179 C CG  . PHE B 2 206 ? 9.284  1.124   3.204   1.00 19.57  ? 216 PHE B CG  1 
ATOM   3180 C CD1 . PHE B 2 206 ? 10.271 0.140   3.097   1.00 16.73  ? 216 PHE B CD1 1 
ATOM   3181 C CD2 . PHE B 2 206 ? 8.604  1.499   2.047   1.00 15.00  ? 216 PHE B CD2 1 
ATOM   3182 C CE1 . PHE B 2 206 ? 10.555 -0.452  1.874   1.00 11.83  ? 216 PHE B CE1 1 
ATOM   3183 C CE2 . PHE B 2 206 ? 8.892  0.909   0.823   1.00 12.81  ? 216 PHE B CE2 1 
ATOM   3184 C CZ  . PHE B 2 206 ? 9.862  -0.064  0.742   1.00 16.92  ? 216 PHE B CZ  1 
ATOM   3185 N N   . HIS B 2 207 ? 11.348 3.759   3.336   1.00 19.24  ? 217 HIS B N   1 
ATOM   3186 C CA  . HIS B 2 207 ? 11.651 4.697   2.261   1.00 20.23  ? 217 HIS B CA  1 
ATOM   3187 C C   . HIS B 2 207 ? 11.527 3.949   0.937   1.00 18.93  ? 217 HIS B C   1 
ATOM   3188 O O   . HIS B 2 207 ? 12.354 3.081   0.642   1.00 23.88  ? 217 HIS B O   1 
ATOM   3189 C CB  . HIS B 2 207 ? 13.055 5.283   2.445   1.00 21.87  ? 217 HIS B CB  1 
ATOM   3190 C CG  . HIS B 2 207 ? 13.215 6.067   3.707   1.00 19.48  ? 217 HIS B CG  1 
ATOM   3191 N ND1 . HIS B 2 207 ? 13.037 7.432   3.761   1.00 15.51  ? 217 HIS B ND1 1 
ATOM   3192 C CD2 . HIS B 2 207 ? 13.504 5.669   4.975   1.00 16.67  ? 217 HIS B CD2 1 
ATOM   3193 C CE1 . HIS B 2 207 ? 13.216 7.844   5.002   1.00 15.79  ? 217 HIS B CE1 1 
ATOM   3194 N NE2 . HIS B 2 207 ? 13.484 6.796   5.763   1.00 14.28  ? 217 HIS B NE2 1 
ATOM   3195 N N   . GLY B 2 208 ? 10.551 4.335   0.122   1.00 14.52  ? 218 GLY B N   1 
ATOM   3196 C CA  . GLY B 2 208 ? 10.325 3.636   -1.118  1.00 15.71  ? 218 GLY B CA  1 
ATOM   3197 C C   . GLY B 2 208 ? 10.137 4.645   -2.213  1.00 20.69  ? 218 GLY B C   1 
ATOM   3198 O O   . GLY B 2 208 ? 10.771 5.680   -2.151  1.00 22.49  ? 218 GLY B O   1 
ATOM   3199 N N   . LEU B 2 209 ? 9.229  4.391   -3.159  1.00 25.67  ? 219 LEU B N   1 
ATOM   3200 C CA  . LEU B 2 209 ? 8.999  5.304   -4.288  1.00 29.22  ? 219 LEU B CA  1 
ATOM   3201 C C   . LEU B 2 209 ? 8.459  6.691   -3.951  1.00 30.10  ? 219 LEU B C   1 
ATOM   3202 O O   . LEU B 2 209 ? 7.810  6.912   -2.937  1.00 33.86  ? 219 LEU B O   1 
ATOM   3203 C CB  . LEU B 2 209 ? 8.112  4.660   -5.368  1.00 21.51  ? 219 LEU B CB  1 
ATOM   3204 C CG  . LEU B 2 209 ? 8.401  3.250   -5.902  1.00 21.42  ? 219 LEU B CG  1 
ATOM   3205 C CD1 . LEU B 2 209 ? 7.912  3.123   -7.347  1.00 23.12  ? 219 LEU B CD1 1 
ATOM   3206 C CD2 . LEU B 2 209 ? 9.865  2.927   -5.829  1.00 18.94  ? 219 LEU B CD2 1 
ATOM   3207 N N   . SER B 2 210 ? 8.767  7.630   -4.829  1.00 39.08  ? 220 SER B N   1 
ATOM   3208 C CA  . SER B 2 210 ? 8.341  9.020   -4.729  1.00 45.82  ? 220 SER B CA  1 
ATOM   3209 C C   . SER B 2 210 ? 6.996  9.107   -5.450  1.00 47.13  ? 220 SER B C   1 
ATOM   3210 O O   . SER B 2 210 ? 6.666  8.224   -6.239  1.00 49.40  ? 220 SER B O   1 
ATOM   3211 C CB  . SER B 2 210 ? 9.387  9.906   -5.422  1.00 47.85  ? 220 SER B CB  1 
ATOM   3212 O OG  . SER B 2 210 ? 8.940  11.238  -5.597  1.00 59.12  ? 220 SER B OG  1 
ATOM   3213 N N   . GLU B 2 211 ? 6.212  10.144  -5.170  1.00 49.21  ? 221 GLU B N   1 
ATOM   3214 C CA  . GLU B 2 211 ? 4.914  10.308  -5.824  1.00 49.89  ? 221 GLU B CA  1 
ATOM   3215 C C   . GLU B 2 211 ? 5.072  10.436  -7.326  1.00 48.04  ? 221 GLU B C   1 
ATOM   3216 O O   . GLU B 2 211 ? 4.195  10.045  -8.067  1.00 49.14  ? 221 GLU B O   1 
ATOM   3217 C CB  . GLU B 2 211 ? 4.201  11.545  -5.291  1.00 57.43  ? 221 GLU B CB  1 
ATOM   3218 C CG  . GLU B 2 211 ? 3.611  11.365  -3.904  1.00 71.29  ? 221 GLU B CG  1 
ATOM   3219 C CD  . GLU B 2 211 ? 2.203  10.768  -3.929  1.00 78.75  ? 221 GLU B CD  1 
ATOM   3220 O OE1 . GLU B 2 211 ? 1.982  9.752   -4.636  1.00 80.68  ? 221 GLU B OE1 1 
ATOM   3221 O OE2 . GLU B 2 211 ? 1.313  11.328  -3.241  1.00 85.08  ? 221 GLU B OE2 1 
ATOM   3222 N N   . GLU B 2 212 ? 6.198  10.999  -7.757  1.00 48.90  ? 222 GLU B N   1 
ATOM   3223 C CA  . GLU B 2 212 ? 6.516  11.209  -9.170  1.00 47.49  ? 222 GLU B CA  1 
ATOM   3224 C C   . GLU B 2 212 ? 6.640  9.890   -9.859  1.00 41.73  ? 222 GLU B C   1 
ATOM   3225 O O   . GLU B 2 212 ? 6.011  9.645   -10.878 1.00 42.15  ? 222 GLU B O   1 
ATOM   3226 C CB  . GLU B 2 212 ? 7.888  11.877  -9.320  1.00 55.05  ? 222 GLU B CB  1 
ATOM   3227 C CG  . GLU B 2 212 ? 8.105  13.137  -8.507  1.00 66.71  ? 222 GLU B CG  1 
ATOM   3228 C CD  . GLU B 2 212 ? 7.506  14.353  -9.173  1.00 75.71  ? 222 GLU B CD  1 
ATOM   3229 O OE1 . GLU B 2 212 ? 6.283  14.596  -8.972  1.00 78.18  ? 222 GLU B OE1 1 
ATOM   3230 O OE2 . GLU B 2 212 ? 8.265  15.053  -9.896  1.00 78.46  ? 222 GLU B OE2 1 
ATOM   3231 N N   . ASP B 2 213 ? 7.542  9.088   -9.311  1.00 39.17  ? 223 ASP B N   1 
ATOM   3232 C CA  . ASP B 2 213 ? 7.888  7.764   -9.810  1.00 39.27  ? 223 ASP B CA  1 
ATOM   3233 C C   . ASP B 2 213 ? 6.776  6.906   -10.370 1.00 38.02  ? 223 ASP B C   1 
ATOM   3234 O O   . ASP B 2 213 ? 5.710  6.763   -9.769  1.00 40.95  ? 223 ASP B O   1 
ATOM   3235 C CB  . ASP B 2 213 ? 8.632  6.974   -8.733  1.00 40.40  ? 223 ASP B CB  1 
ATOM   3236 C CG  . ASP B 2 213 ? 9.884  7.679   -8.254  1.00 43.74  ? 223 ASP B CG  1 
ATOM   3237 O OD1 . ASP B 2 213 ? 10.295 8.680   -8.882  1.00 48.70  ? 223 ASP B OD1 1 
ATOM   3238 O OD2 . ASP B 2 213 ? 10.462 7.233   -7.244  1.00 48.95  ? 223 ASP B OD2 1 
ATOM   3239 N N   . LYS B 2 214 ? 7.052  6.312   -11.526 1.00 37.93  ? 224 LYS B N   1 
ATOM   3240 C CA  . LYS B 2 214 ? 6.102  5.426   -12.186 1.00 40.50  ? 224 LYS B CA  1 
ATOM   3241 C C   . LYS B 2 214 ? 6.182  4.057   -11.504 1.00 36.89  ? 224 LYS B C   1 
ATOM   3242 O O   . LYS B 2 214 ? 7.256  3.627   -11.113 1.00 37.26  ? 224 LYS B O   1 
ATOM   3243 C CB  . LYS B 2 214 ? 6.441  5.268   -13.686 1.00 41.02  ? 224 LYS B CB  1 
ATOM   3244 C CG  . LYS B 2 214 ? 6.339  6.544   -14.527 1.00 46.90  ? 224 LYS B CG  1 
ATOM   3245 C CD  . LYS B 2 214 ? 6.408  6.281   -16.066 1.00 53.94  ? 224 LYS B CD  1 
ATOM   3246 C CE  . LYS B 2 214 ? 7.825  5.982   -16.586 1.00 52.99  ? 224 LYS B CE  1 
ATOM   3247 N NZ  . LYS B 2 214 ? 7.893  5.980   -18.075 1.00 51.19  ? 224 LYS B NZ  1 
ATOM   3248 N N   . TRP B 2 215 ? 5.042  3.416   -11.298 1.00 32.95  ? 225 TRP B N   1 
ATOM   3249 C CA  . TRP B 2 215 ? 5.017  2.093   -10.703 1.00 30.95  ? 225 TRP B CA  1 
ATOM   3250 C C   . TRP B 2 215 ? 4.476  1.195   -11.822 1.00 31.21  ? 225 TRP B C   1 
ATOM   3251 O O   . TRP B 2 215 ? 3.342  1.350   -12.249 1.00 32.44  ? 225 TRP B O   1 
ATOM   3252 C CB  . TRP B 2 215 ? 4.117  2.091   -9.458  1.00 26.62  ? 225 TRP B CB  1 
ATOM   3253 C CG  . TRP B 2 215 ? 3.984  0.762   -8.743  1.00 24.83  ? 225 TRP B CG  1 
ATOM   3254 C CD1 . TRP B 2 215 ? 2.830  0.084   -8.503  1.00 26.18  ? 225 TRP B CD1 1 
ATOM   3255 C CD2 . TRP B 2 215 ? 5.030  -0.024  -8.164  1.00 27.13  ? 225 TRP B CD2 1 
ATOM   3256 N NE1 . TRP B 2 215 ? 3.083  -1.072  -7.814  1.00 28.26  ? 225 TRP B NE1 1 
ATOM   3257 C CE2 . TRP B 2 215 ? 4.425  -1.168  -7.593  1.00 27.53  ? 225 TRP B CE2 1 
ATOM   3258 C CE3 . TRP B 2 215 ? 6.415  0.124   -8.072  1.00 28.43  ? 225 TRP B CE3 1 
ATOM   3259 C CZ2 . TRP B 2 215 ? 5.156  -2.158  -6.938  1.00 28.06  ? 225 TRP B CZ2 1 
ATOM   3260 C CZ3 . TRP B 2 215 ? 7.142  -0.865  -7.418  1.00 29.54  ? 225 TRP B CZ3 1 
ATOM   3261 C CH2 . TRP B 2 215 ? 6.507  -1.993  -6.859  1.00 27.02  ? 225 TRP B CH2 1 
ATOM   3262 N N   . PRO B 2 216 ? 5.304  0.269   -12.344 1.00 33.98  ? 226 PRO B N   1 
ATOM   3263 C CA  . PRO B 2 216 ? 4.915  -0.647  -13.426 1.00 30.14  ? 226 PRO B CA  1 
ATOM   3264 C C   . PRO B 2 216 ? 4.159  -1.918  -12.971 1.00 30.13  ? 226 PRO B C   1 
ATOM   3265 O O   . PRO B 2 216 ? 4.473  -3.027  -13.385 1.00 31.45  ? 226 PRO B O   1 
ATOM   3266 C CB  . PRO B 2 216 ? 6.263  -0.991  -14.035 1.00 24.82  ? 226 PRO B CB  1 
ATOM   3267 C CG  . PRO B 2 216 ? 7.102  -1.176  -12.828 1.00 26.65  ? 226 PRO B CG  1 
ATOM   3268 C CD  . PRO B 2 216 ? 6.692  -0.018  -11.911 1.00 32.95  ? 226 PRO B CD  1 
ATOM   3269 N N   . GLU B 2 217 ? 3.145  -1.758  -12.148 1.00 25.79  ? 227 GLU B N   1 
ATOM   3270 C CA  . GLU B 2 217 ? 2.434  -2.911  -11.691 1.00 26.44  ? 227 GLU B CA  1 
ATOM   3271 C C   . GLU B 2 217 ? 1.058  -2.488  -11.179 1.00 30.25  ? 227 GLU B C   1 
ATOM   3272 O O   . GLU B 2 217 ? 0.881  -1.343  -10.718 1.00 34.68  ? 227 GLU B O   1 
ATOM   3273 C CB  . GLU B 2 217 ? 3.254  -3.580  -10.598 1.00 30.12  ? 227 GLU B CB  1 
ATOM   3274 C CG  . GLU B 2 217 ? 2.574  -4.746  -9.940  1.00 36.66  ? 227 GLU B CG  1 
ATOM   3275 C CD  . GLU B 2 217 ? 3.501  -5.533  -9.059  1.00 36.70  ? 227 GLU B CD  1 
ATOM   3276 O OE1 . GLU B 2 217 ? 3.679  -5.176  -7.871  1.00 40.03  ? 227 GLU B OE1 1 
ATOM   3277 O OE2 . GLU B 2 217 ? 4.054  -6.521  -9.574  1.00 39.80  ? 227 GLU B OE2 1 
ATOM   3278 N N   . GLY B 2 218 ? 0.074  -3.381  -11.316 1.00 24.66  ? 228 GLY B N   1 
ATOM   3279 C CA  . GLY B 2 218 ? -1.255 -3.076  -10.835 1.00 21.52  ? 228 GLY B CA  1 
ATOM   3280 C C   . GLY B 2 218 ? -1.386 -3.411  -9.365  1.00 22.03  ? 228 GLY B C   1 
ATOM   3281 O O   . GLY B 2 218 ? -2.117 -4.316  -9.009  1.00 27.47  ? 228 GLY B O   1 
ATOM   3282 N N   . SER B 2 219 ? -0.647 -2.712  -8.515  1.00 22.31  ? 229 SER B N   1 
ATOM   3283 C CA  . SER B 2 219 ? -0.683 -2.915  -7.069  1.00 19.76  ? 229 SER B CA  1 
ATOM   3284 C C   . SER B 2 219 ? -0.354 -1.531  -6.500  1.00 19.15  ? 229 SER B C   1 
ATOM   3285 O O   . SER B 2 219 ? 0.085  -0.634  -7.231  1.00 20.42  ? 229 SER B O   1 
ATOM   3286 C CB  . SER B 2 219 ? 0.384  -3.926  -6.642  1.00 20.37  ? 229 SER B CB  1 
ATOM   3287 O OG  . SER B 2 219 ? 1.703  -3.445  -6.940  1.00 19.39  ? 229 SER B OG  1 
ATOM   3288 N N   . PRO B 2 220 ? -0.660 -1.308  -5.226  1.00 15.80  ? 230 PRO B N   1 
ATOM   3289 C CA  . PRO B 2 220 ? -0.392 -0.041  -4.546  1.00 18.57  ? 230 PRO B CA  1 
ATOM   3290 C C   . PRO B 2 220 ? 1.059  0.409   -4.746  1.00 22.17  ? 230 PRO B C   1 
ATOM   3291 O O   . PRO B 2 220 ? 1.979  -0.400  -4.606  1.00 26.99  ? 230 PRO B O   1 
ATOM   3292 C CB  . PRO B 2 220 ? -0.615 -0.407  -3.077  1.00 11.15  ? 230 PRO B CB  1 
ATOM   3293 C CG  . PRO B 2 220 ? -1.744 -1.331  -3.141  1.00 12.60  ? 230 PRO B CG  1 
ATOM   3294 C CD  . PRO B 2 220 ? -1.452 -2.205  -4.370  1.00 16.73  ? 230 PRO B CD  1 
ATOM   3295 N N   . LYS B 2 221 ? 1.280  1.676   -5.080  1.00 23.05  ? 231 LYS B N   1 
ATOM   3296 C CA  . LYS B 2 221 ? 2.649  2.149   -5.231  1.00 21.85  ? 231 LYS B CA  1 
ATOM   3297 C C   . LYS B 2 221 ? 3.337  2.081   -3.857  1.00 23.87  ? 231 LYS B C   1 
ATOM   3298 O O   . LYS B 2 221 ? 2.848  2.668   -2.893  1.00 29.60  ? 231 LYS B O   1 
ATOM   3299 C CB  . LYS B 2 221 ? 2.692  3.585   -5.768  1.00 16.02  ? 231 LYS B CB  1 
ATOM   3300 C CG  . LYS B 2 221 ? 4.118  4.075   -6.038  1.00 22.43  ? 231 LYS B CG  1 
ATOM   3301 C CD  . LYS B 2 221 ? 4.180  5.510   -6.505  1.00 25.76  ? 231 LYS B CD  1 
ATOM   3302 C CE  . LYS B 2 221 ? 3.369  5.709   -7.764  1.00 30.60  ? 231 LYS B CE  1 
ATOM   3303 N NZ  . LYS B 2 221 ? 3.156  7.164   -8.078  1.00 30.86  ? 231 LYS B NZ  1 
ATOM   3304 N N   . PRO B 2 222 ? 4.457  1.339   -3.741  1.00 21.25  ? 232 PRO B N   1 
ATOM   3305 C CA  . PRO B 2 222 ? 5.135  1.255   -2.446  1.00 21.14  ? 232 PRO B CA  1 
ATOM   3306 C C   . PRO B 2 222 ? 5.853  2.556   -2.160  1.00 20.83  ? 232 PRO B C   1 
ATOM   3307 O O   . PRO B 2 222 ? 7.056  2.649   -2.297  1.00 26.53  ? 232 PRO B O   1 
ATOM   3308 C CB  . PRO B 2 222 ? 6.110  0.096   -2.651  1.00 18.14  ? 232 PRO B CB  1 
ATOM   3309 C CG  . PRO B 2 222 ? 6.465  0.235   -4.069  1.00 18.63  ? 232 PRO B CG  1 
ATOM   3310 C CD  . PRO B 2 222 ? 5.142  0.495   -4.739  1.00 17.43  ? 232 PRO B CD  1 
ATOM   3311 N N   . VAL B 2 223 ? 5.095  3.572   -1.804  1.00 20.30  ? 233 VAL B N   1 
ATOM   3312 C CA  . VAL B 2 223 ? 5.655  4.874   -1.515  1.00 20.42  ? 233 VAL B CA  1 
ATOM   3313 C C   . VAL B 2 223 ? 6.225  4.877   -0.120  1.00 23.24  ? 233 VAL B C   1 
ATOM   3314 O O   . VAL B 2 223 ? 6.015  3.931   0.645   1.00 27.95  ? 233 VAL B O   1 
ATOM   3315 C CB  . VAL B 2 223 ? 4.574  6.021   -1.607  1.00 20.60  ? 233 VAL B CB  1 
ATOM   3316 C CG1 . VAL B 2 223 ? 4.140  6.261   -3.034  1.00 16.00  ? 233 VAL B CG1 1 
ATOM   3317 C CG2 . VAL B 2 223 ? 3.358  5.673   -0.748  1.00 16.80  ? 233 VAL B CG2 1 
ATOM   3318 N N   . THR B 2 224 ? 6.952  5.949   0.199   1.00 24.39  ? 234 THR B N   1 
ATOM   3319 C CA  . THR B 2 224 ? 7.552  6.143   1.515   1.00 23.62  ? 234 THR B CA  1 
ATOM   3320 C C   . THR B 2 224 ? 6.429  6.303   2.539   1.00 21.74  ? 234 THR B C   1 
ATOM   3321 O O   . THR B 2 224 ? 5.528  7.083   2.348   1.00 22.21  ? 234 THR B O   1 
ATOM   3322 C CB  . THR B 2 224 ? 8.451  7.406   1.534   1.00 22.62  ? 234 THR B CB  1 
ATOM   3323 O OG1 . THR B 2 224 ? 9.554  7.215   0.651   1.00 21.64  ? 234 THR B OG1 1 
ATOM   3324 C CG2 . THR B 2 224 ? 8.984  7.673   2.915   1.00 18.91  ? 234 THR B CG2 1 
ATOM   3325 N N   . GLN B 2 225 ? 6.525  5.630   3.665   1.00 21.15  ? 235 GLN B N   1 
ATOM   3326 C CA  . GLN B 2 225 ? 5.465  5.727   4.628   1.00 20.89  ? 235 GLN B CA  1 
ATOM   3327 C C   . GLN B 2 225 ? 5.861  5.131   5.970   1.00 18.75  ? 235 GLN B C   1 
ATOM   3328 O O   . GLN B 2 225 ? 6.784  4.342   6.040   1.00 20.78  ? 235 GLN B O   1 
ATOM   3329 C CB  . GLN B 2 225 ? 4.288  4.937   4.053   1.00 21.48  ? 235 GLN B CB  1 
ATOM   3330 C CG  . GLN B 2 225 ? 4.739  3.575   3.494   1.00 23.04  ? 235 GLN B CG  1 
ATOM   3331 C CD  . GLN B 2 225 ? 3.622  2.803   2.854   1.00 19.96  ? 235 GLN B CD  1 
ATOM   3332 O OE1 . GLN B 2 225 ? 2.567  2.605   3.469   1.00 20.99  ? 235 GLN B OE1 1 
ATOM   3333 N NE2 . GLN B 2 225 ? 3.839  2.349   1.618   1.00 15.01  ? 235 GLN B NE2 1 
ATOM   3334 N N   . ASN B 2 226 ? 5.113  5.473   7.013   1.00 21.94  ? 236 ASN B N   1 
ATOM   3335 C CA  . ASN B 2 226 ? 5.337  4.940   8.347   1.00 24.25  ? 236 ASN B CA  1 
ATOM   3336 C C   . ASN B 2 226 ? 4.349  3.801   8.562   1.00 24.92  ? 236 ASN B C   1 
ATOM   3337 O O   . ASN B 2 226 ? 3.190  3.921   8.212   1.00 28.39  ? 236 ASN B O   1 
ATOM   3338 C CB  . ASN B 2 226 ? 5.114  6.022   9.391   1.00 29.14  ? 236 ASN B CB  1 
ATOM   3339 C CG  . ASN B 2 226 ? 6.290  6.995   9.490   1.00 40.30  ? 236 ASN B CG  1 
ATOM   3340 O OD1 . ASN B 2 226 ? 7.457  6.580   9.582   1.00 40.23  ? 236 ASN B OD1 1 
ATOM   3341 N ND2 . ASN B 2 226 ? 5.987  8.291   9.480   1.00 44.76  ? 236 ASN B ND2 1 
ATOM   3342 N N   . ILE B 2 227 ? 4.804  2.688   9.115   1.00 23.82  ? 237 ILE B N   1 
ATOM   3343 C CA  . ILE B 2 227 ? 3.952  1.532   9.360   1.00 19.10  ? 237 ILE B CA  1 
ATOM   3344 C C   . ILE B 2 227 ? 4.197  1.138   10.800  1.00 21.47  ? 237 ILE B C   1 
ATOM   3345 O O   . ILE B 2 227 ? 5.347  0.951   11.190  1.00 25.31  ? 237 ILE B O   1 
ATOM   3346 C CB  . ILE B 2 227 ? 4.336  0.380   8.380   1.00 20.98  ? 237 ILE B CB  1 
ATOM   3347 C CG1 . ILE B 2 227 ? 3.884  0.745   6.964   1.00 17.67  ? 237 ILE B CG1 1 
ATOM   3348 C CG2 . ILE B 2 227 ? 3.712  -0.944  8.786   1.00 13.24  ? 237 ILE B CG2 1 
ATOM   3349 C CD1 . ILE B 2 227 ? 4.434  -0.174  5.906   1.00 25.77  ? 237 ILE B CD1 1 
ATOM   3350 N N   . SER B 2 228 ? 3.127  1.013   11.588  1.00 24.45  ? 238 SER B N   1 
ATOM   3351 C CA  . SER B 2 228 ? 3.235  0.688   13.014  1.00 22.74  ? 238 SER B CA  1 
ATOM   3352 C C   . SER B 2 228 ? 2.344  -0.436  13.504  1.00 23.12  ? 238 SER B C   1 
ATOM   3353 O O   . SER B 2 228 ? 1.300  -0.731  12.925  1.00 28.71  ? 238 SER B O   1 
ATOM   3354 C CB  . SER B 2 228 ? 2.833  1.889   13.853  1.00 21.93  ? 238 SER B CB  1 
ATOM   3355 O OG  . SER B 2 228 ? 3.399  3.073   13.312  1.00 34.98  ? 238 SER B OG  1 
ATOM   3356 N N   . ALA B 2 229 ? 2.837  -0.989  14.584  1.00 24.25  ? 239 ALA B N   1 
ATOM   3357 C CA  . ALA B 2 229 ? 2.166  -2.016  15.367  1.00 24.44  ? 239 ALA B CA  1 
ATOM   3358 C C   . ALA B 2 229 ? 2.185  -1.487  16.787  1.00 27.97  ? 239 ALA B C   1 
ATOM   3359 O O   . ALA B 2 229 ? 3.199  -0.943  17.247  1.00 25.96  ? 239 ALA B O   1 
ATOM   3360 C CB  . ALA B 2 229 ? 2.925  -3.340  15.244  1.00 18.30  ? 239 ALA B CB  1 
ATOM   3361 N N   . GLU B 2 230 ? 1.080  -1.604  17.491  1.00 32.21  ? 240 GLU B N   1 
ATOM   3362 C CA  . GLU B 2 230 ? 1.048  -1.062  18.850  1.00 34.04  ? 240 GLU B CA  1 
ATOM   3363 C C   . GLU B 2 230 ? 0.360  -1.976  19.863  1.00 32.80  ? 240 GLU B C   1 
ATOM   3364 O O   . GLU B 2 230 ? -0.294 -2.943  19.489  1.00 29.39  ? 240 GLU B O   1 
ATOM   3365 C CB  . GLU B 2 230 ? 0.367  0.305   18.887  1.00 32.12  ? 240 GLU B CB  1 
ATOM   3366 C CG  . GLU B 2 230 ? -0.900 0.382   18.052  1.00 37.67  ? 240 GLU B CG  1 
ATOM   3367 C CD  . GLU B 2 230 ? -1.619 1.719   18.209  1.00 44.28  ? 240 GLU B CD  1 
ATOM   3368 O OE1 . GLU B 2 230 ? -0.938 2.799   18.392  1.00 44.60  ? 240 GLU B OE1 1 
ATOM   3369 O OE2 . GLU B 2 230 ? -2.904 1.764   18.159  1.00 50.62  ? 240 GLU B OE2 1 
ATOM   3370 N N   . ALA B 2 231 ? 0.545  -1.671  21.143  1.00 31.65  ? 241 ALA B N   1 
ATOM   3371 C CA  . ALA B 2 231 ? -0.048 -2.430  22.225  1.00 28.62  ? 241 ALA B CA  1 
ATOM   3372 C C   . ALA B 2 231 ? -0.214 -1.496  23.451  1.00 33.61  ? 241 ALA B C   1 
ATOM   3373 O O   . ALA B 2 231 ? 0.329  -0.378  23.478  1.00 35.43  ? 241 ALA B O   1 
ATOM   3374 C CB  . ALA B 2 231 ? 0.835  -3.615  22.556  1.00 27.75  ? 241 ALA B CB  1 
ATOM   3375 N N   . TRP B 2 232 ? -1.023 -1.914  24.424  1.00 34.97  ? 242 TRP B N   1 
ATOM   3376 C CA  . TRP B 2 232 ? -1.273 -1.139  25.639  1.00 36.12  ? 242 TRP B CA  1 
ATOM   3377 C C   . TRP B 2 232 ? -0.889 -2.041  26.800  1.00 37.56  ? 242 TRP B C   1 
ATOM   3378 O O   . TRP B 2 232 ? -0.996 -3.269  26.689  1.00 35.58  ? 242 TRP B O   1 
ATOM   3379 C CB  . TRP B 2 232 ? -2.759 -0.750  25.742  1.00 34.03  ? 242 TRP B CB  1 
ATOM   3380 C CG  . TRP B 2 232 ? -3.073 0.618   25.230  1.00 34.25  ? 242 TRP B CG  1 
ATOM   3381 C CD1 . TRP B 2 232 ? -3.095 1.786   25.949  1.00 37.66  ? 242 TRP B CD1 1 
ATOM   3382 C CD2 . TRP B 2 232 ? -3.415 0.967   23.892  1.00 31.23  ? 242 TRP B CD2 1 
ATOM   3383 N NE1 . TRP B 2 232 ? -3.433 2.842   25.129  1.00 36.19  ? 242 TRP B NE1 1 
ATOM   3384 C CE2 . TRP B 2 232 ? -3.631 2.364   23.863  1.00 31.10  ? 242 TRP B CE2 1 
ATOM   3385 C CE3 . TRP B 2 232 ? -3.560 0.233   22.712  1.00 39.11  ? 242 TRP B CE3 1 
ATOM   3386 C CZ2 . TRP B 2 232 ? -3.981 3.036   22.708  1.00 35.59  ? 242 TRP B CZ2 1 
ATOM   3387 C CZ3 . TRP B 2 232 ? -3.911 0.903   21.550  1.00 43.17  ? 242 TRP B CZ3 1 
ATOM   3388 C CH2 . TRP B 2 232 ? -4.118 2.298   21.561  1.00 43.49  ? 242 TRP B CH2 1 
ATOM   3389 N N   . GLY B 2 233 ? -0.423 -1.452  27.895  1.00 39.17  ? 243 GLY B N   1 
ATOM   3390 C CA  . GLY B 2 233 ? -0.037 -2.260  29.040  1.00 42.91  ? 243 GLY B CA  1 
ATOM   3391 C C   . GLY B 2 233 ? -1.198 -3.051  29.618  1.00 43.60  ? 243 GLY B C   1 
ATOM   3392 O O   . GLY B 2 233 ? -2.320 -2.580  29.633  1.00 44.22  ? 243 GLY B O   1 
ATOM   3393 N N   . ARG B 2 234 ? -0.933 -4.238  30.129  1.00 47.39  ? 244 ARG B N   1 
ATOM   3394 C CA  . ARG B 2 234 ? -1.990 -5.057  30.694  1.00 54.20  ? 244 ARG B CA  1 
ATOM   3395 C C   . ARG B 2 234 ? -1.914 -5.165  32.210  1.00 58.33  ? 244 ARG B C   1 
ATOM   3396 O O   . ARG B 2 234 ? -0.826 -5.262  32.783  1.00 59.14  ? 244 ARG B O   1 
ATOM   3397 C CB  . ARG B 2 234 ? -1.916 -6.472  30.136  1.00 57.01  ? 244 ARG B CB  1 
ATOM   3398 C CG  . ARG B 2 234 ? -2.587 -6.701  28.817  1.00 63.53  ? 244 ARG B CG  1 
ATOM   3399 C CD  . ARG B 2 234 ? -2.654 -8.205  28.593  1.00 72.18  ? 244 ARG B CD  1 
ATOM   3400 N NE  . ARG B 2 234 ? -3.320 -8.577  27.345  1.00 79.74  ? 244 ARG B NE  1 
ATOM   3401 C CZ  . ARG B 2 234 ? -3.717 -9.815  27.046  1.00 82.75  ? 244 ARG B CZ  1 
ATOM   3402 N NH1 . ARG B 2 234 ? -3.523 -10.815 27.907  1.00 81.55  ? 244 ARG B NH1 1 
ATOM   3403 N NH2 . ARG B 2 234 ? -4.290 -10.056 25.870  1.00 84.00  ? 244 ARG B NH2 1 
ATOM   3404 N N   . ALA B 2 235 ? -3.078 -5.205  32.852  1.00 62.41  ? 245 ALA B N   1 
ATOM   3405 C CA  . ALA B 2 235 ? -3.152 -5.372  34.297  1.00 67.30  ? 245 ALA B CA  1 
ATOM   3406 C C   . ALA B 2 235 ? -2.750 -6.838  34.537  1.00 72.50  ? 245 ALA B C   1 
ATOM   3407 O O   . ALA B 2 235 ? -2.303 -7.506  33.606  1.00 75.25  ? 245 ALA B O   1 
ATOM   3408 C CB  . ALA B 2 235 ? -4.564 -5.101  34.781  1.00 63.57  ? 245 ALA B CB  1 
ATOM   3409 N N   . ASP B 2 236 ? -2.930 -7.371  35.740  1.00 77.49  ? 246 ASP B N   1 
ATOM   3410 C CA  . ASP B 2 236 ? -2.514 -8.751  35.967  1.00 82.46  ? 246 ASP B CA  1 
ATOM   3411 C C   . ASP B 2 236 ? -3.189 -9.477  37.125  1.00 85.83  ? 246 ASP B C   1 
ATOM   3412 O O   . ASP B 2 236 ? -3.819 -8.846  37.984  1.00 88.30  ? 246 ASP B O   1 
ATOM   3413 C CB  . ASP B 2 236 ? -0.995 -8.771  36.180  1.00 85.40  ? 246 ASP B CB  1 
ATOM   3414 C CG  . ASP B 2 236 ? -0.463 -10.147 36.547  1.00 87.77  ? 246 ASP B CG  1 
ATOM   3415 O OD1 . ASP B 2 236 ? -0.577 -11.077 35.714  1.00 88.00  ? 246 ASP B OD1 1 
ATOM   3416 O OD2 . ASP B 2 236 ? 0.055  -10.292 37.678  1.00 87.08  ? 246 ASP B OD2 1 
ATOM   3417 N N   . CYS B 2 237 ? -3.039 -10.805 37.096  1.00 86.06  ? 247 CYS B N   1 
ATOM   3418 C CA  . CYS B 2 237 ? -3.511 -11.775 38.087  1.00 87.61  ? 247 CYS B CA  1 
ATOM   3419 C C   . CYS B 2 237 ? -4.312 -12.889 37.423  1.00 88.39  ? 247 CYS B C   1 
ATOM   3420 O O   . CYS B 2 237 ? -4.967 -13.647 38.171  1.00 87.92  ? 247 CYS B O   1 
ATOM   3421 C CB  . CYS B 2 237 ? -4.310 -11.131 39.226  1.00 88.56  ? 247 CYS B CB  1 
ATOM   3422 S SG  . CYS B 2 237 ? -4.220 -12.046 40.778  1.00 93.70  ? 247 CYS B SG  1 
ATOM   3423 O OXT . CYS B 2 237 ? -4.243 -13.011 36.173  1.00 87.72  ? 247 CYS B OXT 1 
HETATM 3424 C C1  . NAG C 3 .   ? 8.436  -21.365 5.056   1.00 91.98  ? 1   NAG C C1  1 
HETATM 3425 C C2  . NAG C 3 .   ? 7.703  -22.180 3.963   1.00 93.10  ? 1   NAG C C2  1 
HETATM 3426 C C3  . NAG C 3 .   ? 8.626  -22.428 2.749   1.00 93.65  ? 1   NAG C C3  1 
HETATM 3427 C C4  . NAG C 3 .   ? 9.212  -21.101 2.260   1.00 93.06  ? 1   NAG C C4  1 
HETATM 3428 C C5  . NAG C 3 .   ? 9.961  -20.471 3.425   1.00 89.50  ? 1   NAG C C5  1 
HETATM 3429 C C6  . NAG C 3 .   ? 10.706 -19.195 3.057   1.00 84.03  ? 1   NAG C C6  1 
HETATM 3430 C C7  . NAG C 3 .   ? 6.044  -23.623 4.988   1.00 91.11  ? 1   NAG C C7  1 
HETATM 3431 C C8  . NAG C 3 .   ? 5.732  -25.020 5.496   1.00 90.13  ? 1   NAG C C8  1 
HETATM 3432 N N2  . NAG C 3 .   ? 7.268  -23.464 4.493   1.00 92.89  ? 1   NAG C N2  1 
HETATM 3433 O O3  . NAG C 3 .   ? 7.905  -23.061 1.700   1.00 93.51  ? 1   NAG C O3  1 
HETATM 3434 O O4  . NAG C 3 .   ? 10.109 -21.302 1.133   1.00 96.58  ? 1   NAG C O4  1 
HETATM 3435 O O5  . NAG C 3 .   ? 9.026  -20.174 4.494   1.00 91.52  ? 1   NAG C O5  1 
HETATM 3436 O O6  . NAG C 3 .   ? 9.858  -18.313 2.276   1.00 81.48  ? 1   NAG C O6  1 
HETATM 3437 O O7  . NAG C 3 .   ? 5.216  -22.708 5.056   1.00 88.47  ? 1   NAG C O7  1 
HETATM 3438 C C1  . NAG C 3 .   ? 9.604  -20.955 -0.111  1.00 91.04  ? 2   NAG C C1  1 
HETATM 3439 C C2  . NAG C 3 .   ? 10.722 -20.668 -1.131  1.00 89.13  ? 2   NAG C C2  1 
HETATM 3440 C C3  . NAG C 3 .   ? 10.036 -20.268 -2.438  1.00 83.33  ? 2   NAG C C3  1 
HETATM 3441 C C4  . NAG C 3 .   ? 9.059  -21.363 -2.842  1.00 83.03  ? 2   NAG C C4  1 
HETATM 3442 C C5  . NAG C 3 .   ? 8.067  -21.682 -1.744  1.00 87.16  ? 2   NAG C C5  1 
HETATM 3443 C C6  . NAG C 3 .   ? 7.148  -22.845 -2.096  1.00 89.83  ? 2   NAG C C6  1 
HETATM 3444 C C7  . NAG C 3 .   ? 12.903 -19.781 -0.487  1.00 95.39  ? 2   NAG C C7  1 
HETATM 3445 C C8  . NAG C 3 .   ? 13.702 -18.568 -0.010  1.00 93.36  ? 2   NAG C C8  1 
HETATM 3446 N N2  . NAG C 3 .   ? 11.592 -19.591 -0.674  1.00 93.20  ? 2   NAG C N2  1 
HETATM 3447 O O3  . NAG C 3 .   ? 10.997 -20.077 -3.467  1.00 81.39  ? 2   NAG C O3  1 
HETATM 3448 O O4  . NAG C 3 .   ? 8.333  -20.969 -4.008  1.00 77.17  ? 2   NAG C O4  1 
HETATM 3449 O O5  . NAG C 3 .   ? 8.787  -22.036 -0.560  1.00 89.99  ? 2   NAG C O5  1 
HETATM 3450 O O6  . NAG C 3 .   ? 7.891  -23.997 -2.466  1.00 92.54  ? 2   NAG C O6  1 
HETATM 3451 O O7  . NAG C 3 .   ? 13.456 -20.873 -0.665  1.00 96.64  ? 2   NAG C O7  1 
HETATM 3452 C C1  . BMA C 3 .   ? 8.729  -21.626 -5.158  1.00 67.38  ? 3   BMA C C1  1 
HETATM 3453 C C2  . BMA C 3 .   ? 7.499  -21.928 -6.091  1.00 64.41  ? 3   BMA C C2  1 
HETATM 3454 C C3  . BMA C 3 .   ? 7.971  -22.471 -7.475  1.00 64.81  ? 3   BMA C C3  1 
HETATM 3455 C C4  . BMA C 3 .   ? 9.143  -21.656 -8.044  1.00 63.51  ? 3   BMA C C4  1 
HETATM 3456 C C5  . BMA C 3 .   ? 10.255 -21.482 -6.998  1.00 62.31  ? 3   BMA C C5  1 
HETATM 3457 C C6  . BMA C 3 .   ? 11.402 -20.643 -7.570  1.00 61.09  ? 3   BMA C C6  1 
HETATM 3458 O O2  . BMA C 3 .   ? 6.675  -20.751 -6.282  1.00 63.53  ? 3   BMA C O2  1 
HETATM 3459 O O3  . BMA C 3 .   ? 6.884  -22.421 -8.443  1.00 67.03  ? 3   BMA C O3  1 
HETATM 3460 O O4  . BMA C 3 .   ? 9.655  -22.359 -9.187  1.00 59.76  ? 3   BMA C O4  1 
HETATM 3461 O O5  . BMA C 3 .   ? 9.715  -20.794 -5.824  1.00 67.78  ? 3   BMA C O5  1 
HETATM 3462 O O6  . BMA C 3 .   ? 11.966 -21.314 -8.711  1.00 56.44  ? 3   BMA C O6  1 
HETATM 3463 C C1  . FUC C 3 .   ? 10.015 -16.978 2.683   1.00 77.26  ? 4   FUC C C1  1 
HETATM 3464 C C2  . FUC C 3 .   ? 9.290  -16.012 1.742   1.00 76.55  ? 4   FUC C C2  1 
HETATM 3465 C C3  . FUC C 3 .   ? 9.666  -14.574 2.157   1.00 76.78  ? 4   FUC C C3  1 
HETATM 3466 C C4  . FUC C 3 .   ? 9.552  -14.306 3.704   1.00 75.26  ? 4   FUC C C4  1 
HETATM 3467 C C5  . FUC C 3 .   ? 9.925  -15.493 4.623   1.00 74.47  ? 4   FUC C C5  1 
HETATM 3468 C C6  . FUC C 3 .   ? 11.318 -15.628 5.254   1.00 68.84  ? 4   FUC C C6  1 
HETATM 3469 O O2  . FUC C 3 .   ? 7.876  -16.203 1.824   1.00 72.65  ? 4   FUC C O2  1 
HETATM 3470 O O3  . FUC C 3 .   ? 10.992 -14.285 1.725   1.00 78.23  ? 4   FUC C O3  1 
HETATM 3471 O O4  . FUC C 3 .   ? 10.365 -13.190 4.069   1.00 74.68  ? 4   FUC C O4  1 
HETATM 3472 O O5  . FUC C 3 .   ? 9.554  -16.765 4.028   1.00 79.17  ? 4   FUC C O5  1 
HETATM 3473 C C1  . NAG D 4 .   ? 59.016 -1.531  14.241  1.00 67.27  ? 1   NAG D C1  1 
HETATM 3474 C C2  . NAG D 4 .   ? 58.452 -1.015  15.600  1.00 65.65  ? 1   NAG D C2  1 
HETATM 3475 C C3  . NAG D 4 .   ? 59.304 -1.453  16.820  1.00 67.22  ? 1   NAG D C3  1 
HETATM 3476 C C4  . NAG D 4 .   ? 59.736 -2.936  16.726  1.00 69.25  ? 1   NAG D C4  1 
HETATM 3477 C C5  . NAG D 4 .   ? 60.322 -3.229  15.349  1.00 69.28  ? 1   NAG D C5  1 
HETATM 3478 C C6  . NAG D 4 .   ? 60.720 -4.689  15.218  1.00 65.54  ? 1   NAG D C6  1 
HETATM 3479 C C7  . NAG D 4 .   ? 57.347 1.069   16.209  1.00 64.34  ? 1   NAG D C7  1 
HETATM 3480 C C8  . NAG D 4 .   ? 57.382 2.594   16.201  1.00 65.30  ? 1   NAG D C8  1 
HETATM 3481 N N2  . NAG D 4 .   ? 58.369 0.442   15.613  1.00 63.96  ? 1   NAG D N2  1 
HETATM 3482 O O3  . NAG D 4 .   ? 58.538 -1.256  18.011  1.00 64.51  ? 1   NAG D O3  1 
HETATM 3483 O O4  . NAG D 4 .   ? 60.737 -3.273  17.732  1.00 76.65  ? 1   NAG D O4  1 
HETATM 3484 O O5  . NAG D 4 .   ? 59.343 -2.936  14.320  1.00 72.35  ? 1   NAG D O5  1 
HETATM 3485 O O6  . NAG D 4 .   ? 59.578 -5.522  15.524  1.00 67.79  ? 1   NAG D O6  1 
HETATM 3486 O O7  . NAG D 4 .   ? 56.387 0.468   16.708  1.00 61.17  ? 1   NAG D O7  1 
HETATM 3487 C C1  . NAG D 4 .   ? 60.504 -2.937  19.064  1.00 77.83  ? 2   NAG D C1  1 
HETATM 3488 C C2  . NAG D 4 .   ? 61.434 -3.761  19.984  1.00 77.92  ? 2   NAG D C2  1 
HETATM 3489 C C3  . NAG D 4 .   ? 61.241 -3.294  21.454  1.00 78.63  ? 2   NAG D C3  1 
HETATM 3490 C C4  . NAG D 4 .   ? 61.439 -1.756  21.539  1.00 78.62  ? 2   NAG D C4  1 
HETATM 3491 C C5  . NAG D 4 .   ? 60.499 -1.054  20.547  1.00 79.71  ? 2   NAG D C5  1 
HETATM 3492 C C6  . NAG D 4 .   ? 60.632 0.473   20.524  1.00 78.83  ? 2   NAG D C6  1 
HETATM 3493 C C7  . NAG D 4 .   ? 62.139 -6.115  19.946  1.00 78.47  ? 2   NAG D C7  1 
HETATM 3494 C C8  . NAG D 4 .   ? 61.721 -7.564  19.734  1.00 73.37  ? 2   NAG D C8  1 
HETATM 3495 N N2  . NAG D 4 .   ? 61.166 -5.194  19.824  1.00 79.08  ? 2   NAG D N2  1 
HETATM 3496 O O3  . NAG D 4 .   ? 62.179 -3.950  22.312  1.00 78.00  ? 2   NAG D O3  1 
HETATM 3497 O O4  . NAG D 4 .   ? 61.202 -1.279  22.863  1.00 78.65  ? 2   NAG D O4  1 
HETATM 3498 O O5  . NAG D 4 .   ? 60.773 -1.531  19.210  1.00 80.21  ? 2   NAG D O5  1 
HETATM 3499 O O6  . NAG D 4 .   ? 59.958 1.040   19.398  1.00 82.26  ? 2   NAG D O6  1 
HETATM 3500 O O7  . NAG D 4 .   ? 63.308 -5.840  20.258  1.00 78.17  ? 2   NAG D O7  1 
HETATM 3501 C C1  . FUC D 4 .   ? 59.657 -6.811  14.960  1.00 71.71  ? 3   FUC D C1  1 
HETATM 3502 C C2  . FUC D 4 .   ? 58.227 -7.333  14.652  1.00 72.32  ? 3   FUC D C2  1 
HETATM 3503 C C3  . FUC D 4 .   ? 58.148 -8.248  13.389  1.00 71.71  ? 3   FUC D C3  1 
HETATM 3504 C C4  . FUC D 4 .   ? 58.820 -7.606  12.147  1.00 68.46  ? 3   FUC D C4  1 
HETATM 3505 C C5  . FUC D 4 .   ? 59.814 -6.497  12.568  1.00 68.57  ? 3   FUC D C5  1 
HETATM 3506 C C6  . FUC D 4 .   ? 60.848 -6.006  11.548  1.00 64.35  ? 3   FUC D C6  1 
HETATM 3507 O O2  . FUC D 4 .   ? 57.335 -6.227  14.496  1.00 74.21  ? 3   FUC D O2  1 
HETATM 3508 O O3  . FUC D 4 .   ? 58.717 -9.540  13.646  1.00 71.50  ? 3   FUC D O3  1 
HETATM 3509 O O4  . FUC D 4 .   ? 59.474 -8.622  11.383  1.00 69.38  ? 3   FUC D O4  1 
HETATM 3510 O O5  . FUC D 4 .   ? 60.488 -6.848  13.792  1.00 71.87  ? 3   FUC D O5  1 
HETATM 3511 C C1  . NAG E 5 .   ? 6.987  9.287   9.824   1.00 50.77  ? 1   NAG E C1  1 
HETATM 3512 C C2  . NAG E 5 .   ? 6.738  10.576  9.030   1.00 53.25  ? 1   NAG E C2  1 
HETATM 3513 C C3  . NAG E 5 .   ? 7.749  11.648  9.461   1.00 58.85  ? 1   NAG E C3  1 
HETATM 3514 C C4  . NAG E 5 .   ? 7.752  11.829  10.993  1.00 61.47  ? 1   NAG E C4  1 
HETATM 3515 C C5  . NAG E 5 .   ? 8.001  10.455  11.634  1.00 58.05  ? 1   NAG E C5  1 
HETATM 3516 C C6  . NAG E 5 .   ? 7.984  10.476  13.139  1.00 58.81  ? 1   NAG E C6  1 
HETATM 3517 C C7  . NAG E 5 .   ? 5.876  9.981   6.812   1.00 52.08  ? 1   NAG E C7  1 
HETATM 3518 C C8  . NAG E 5 .   ? 6.213  9.721   5.355   1.00 44.94  ? 1   NAG E C8  1 
HETATM 3519 N N2  . NAG E 5 .   ? 6.904  10.308  7.602   1.00 56.26  ? 1   NAG E N2  1 
HETATM 3520 O O3  . NAG E 5 .   ? 7.447  12.873  8.807   1.00 57.15  ? 1   NAG E O3  1 
HETATM 3521 O O4  . NAG E 5 .   ? 8.804  12.748  11.400  1.00 73.40  ? 1   NAG E O4  1 
HETATM 3522 O O5  . NAG E 5 .   ? 6.977  9.537   11.232  1.00 53.74  ? 1   NAG E O5  1 
HETATM 3523 O O6  . NAG E 5 .   ? 6.736  10.959  13.614  1.00 63.09  ? 1   NAG E O6  1 
HETATM 3524 O O7  . NAG E 5 .   ? 4.713  9.892   7.214   1.00 55.16  ? 1   NAG E O7  1 
HETATM 3525 C C1  . NAG E 5 .   ? 8.579  14.125  11.378  1.00 79.40  ? 2   NAG E C1  1 
HETATM 3526 C C2  . NAG E 5 .   ? 9.458  14.801  12.437  1.00 82.70  ? 2   NAG E C2  1 
HETATM 3527 C C3  . NAG E 5 .   ? 9.267  16.319  12.361  1.00 87.85  ? 2   NAG E C3  1 
HETATM 3528 C C4  . NAG E 5 .   ? 9.647  16.804  10.965  1.00 91.74  ? 2   NAG E C4  1 
HETATM 3529 C C5  . NAG E 5 .   ? 8.827  16.029  9.904   1.00 90.51  ? 2   NAG E C5  1 
HETATM 3530 C C6  . NAG E 5 .   ? 9.291  16.320  8.478   1.00 91.88  ? 2   NAG E C6  1 
HETATM 3531 C C7  . NAG E 5 .   ? 9.930  13.492  14.409  1.00 74.87  ? 2   NAG E C7  1 
HETATM 3532 C C8  . NAG E 5 .   ? 9.481  13.079  15.806  1.00 71.19  ? 2   NAG E C8  1 
HETATM 3533 N N2  . NAG E 5 .   ? 9.123  14.329  13.767  1.00 80.06  ? 2   NAG E N2  1 
HETATM 3534 O O3  . NAG E 5 .   ? 10.067 16.978  13.341  1.00 88.90  ? 2   NAG E O3  1 
HETATM 3535 O O4  . NAG E 5 .   ? 9.406  18.210  10.868  1.00 91.91  ? 2   NAG E O4  1 
HETATM 3536 O O5  . NAG E 5 .   ? 8.964  14.594  10.081  1.00 85.82  ? 2   NAG E O5  1 
HETATM 3537 O O6  . NAG E 5 .   ? 10.280 15.383  8.054   1.00 92.90  ? 2   NAG E O6  1 
HETATM 3538 O O7  . NAG E 5 .   ? 10.962 13.042  13.902  1.00 69.40  ? 2   NAG E O7  1 
HETATM 3539 C C1  . NAG F 6 .   ? 25.120 -23.768 30.618  1.00 101.96 ? 200 NAG A C1  1 
HETATM 3540 C C2  . NAG F 6 .   ? 26.048 -24.241 31.788  1.00 105.66 ? 200 NAG A C2  1 
HETATM 3541 C C3  . NAG F 6 .   ? 27.523 -24.441 31.272  1.00 105.47 ? 200 NAG A C3  1 
HETATM 3542 C C4  . NAG F 6 .   ? 27.610 -25.095 29.877  1.00 103.26 ? 200 NAG A C4  1 
HETATM 3543 C C5  . NAG F 6 .   ? 26.607 -24.477 28.908  1.00 101.79 ? 200 NAG A C5  1 
HETATM 3544 C C6  . NAG F 6 .   ? 26.609 -25.110 27.521  1.00 99.46  ? 200 NAG A C6  1 
HETATM 3545 C C7  . NAG F 6 .   ? 26.758 -23.289 33.963  1.00 110.08 ? 200 NAG A C7  1 
HETATM 3546 C C8  . NAG F 6 .   ? 26.584 -22.130 34.934  1.00 107.78 ? 200 NAG A C8  1 
HETATM 3547 N N2  . NAG F 6 .   ? 26.014 -23.226 32.847  1.00 108.32 ? 200 NAG A N2  1 
HETATM 3548 O O3  . NAG F 6 .   ? 28.272 -25.257 32.172  1.00 102.93 ? 200 NAG A O3  1 
HETATM 3549 O O4  . NAG F 6 .   ? 28.929 -24.942 29.360  1.00 102.59 ? 200 NAG A O4  1 
HETATM 3550 O O5  . NAG F 6 .   ? 25.281 -24.600 29.459  1.00 101.34 ? 200 NAG A O5  1 
HETATM 3551 O O6  . NAG F 6 .   ? 26.537 -26.526 27.588  1.00 97.02  ? 200 NAG A O6  1 
HETATM 3552 O O7  . NAG F 6 .   ? 27.532 -24.209 34.227  1.00 111.35 ? 200 NAG A O7  1 
HETATM 3553 S S   . SO4 G 7 .   ? 15.041 11.064  2.314   1.00 44.06  ? 250 SO4 B S   1 
HETATM 3554 O O1  . SO4 G 7 .   ? 15.357 9.879   1.522   1.00 44.08  ? 250 SO4 B O1  1 
HETATM 3555 O O2  . SO4 G 7 .   ? 13.772 11.404  1.851   1.00 45.90  ? 250 SO4 B O2  1 
HETATM 3556 O O3  . SO4 G 7 .   ? 14.971 10.778  3.728   1.00 37.69  ? 250 SO4 B O3  1 
HETATM 3557 O O4  . SO4 G 7 .   ? 15.904 12.210  2.121   1.00 44.16  ? 250 SO4 B O4  1 
HETATM 3558 S S   . SO4 H 7 .   ? 1.094  7.589   19.671  1.00 78.77  ? 251 SO4 B S   1 
HETATM 3559 O O1  . SO4 H 7 .   ? -0.032 7.322   18.818  1.00 78.89  ? 251 SO4 B O1  1 
HETATM 3560 O O2  . SO4 H 7 .   ? 1.805  8.767   19.247  1.00 78.13  ? 251 SO4 B O2  1 
HETATM 3561 O O3  . SO4 H 7 .   ? 1.970  6.459   19.700  1.00 78.70  ? 251 SO4 B O3  1 
HETATM 3562 O O4  . SO4 H 7 .   ? 0.604  7.710   21.026  1.00 81.79  ? 251 SO4 B O4  1 
HETATM 3563 S S   . SO4 I 7 .   ? 14.571 8.076   26.704  1.00 58.32  ? 252 SO4 B S   1 
HETATM 3564 O O1  . SO4 I 7 .   ? 15.887 7.992   27.263  1.00 60.68  ? 252 SO4 B O1  1 
HETATM 3565 O O2  . SO4 I 7 .   ? 14.790 8.634   25.378  1.00 56.87  ? 252 SO4 B O2  1 
HETATM 3566 O O3  . SO4 I 7 .   ? 13.680 8.853   27.515  1.00 61.12  ? 252 SO4 B O3  1 
HETATM 3567 O O4  . SO4 I 7 .   ? 13.954 6.754   26.720  1.00 59.40  ? 252 SO4 B O4  1 
HETATM 3568 O O   . HOH J 8 .   ? 49.369 -0.898  2.680   1.00 36.73  ? 221 HOH A O   1 
HETATM 3569 O O   . HOH J 8 .   ? 39.410 5.841   0.752   1.00 31.75  ? 222 HOH A O   1 
HETATM 3570 O O   . HOH J 8 .   ? 1.329  -7.154  16.240  1.00 31.99  ? 223 HOH A O   1 
HETATM 3571 O O   . HOH J 8 .   ? 6.546  -15.709 12.887  1.00 38.59  ? 224 HOH A O   1 
HETATM 3572 O O   . HOH J 8 .   ? 15.702 -8.934  26.976  1.00 24.57  ? 225 HOH A O   1 
HETATM 3573 O O   . HOH J 8 .   ? 43.085 8.699   29.910  1.00 59.06  ? 226 HOH A O   1 
HETATM 3574 O O   . HOH J 8 .   ? 54.005 -4.630  12.458  1.00 24.99  ? 227 HOH A O   1 
HETATM 3575 O O   . HOH J 8 .   ? 42.349 -2.469  5.010   1.00 37.90  ? 228 HOH A O   1 
HETATM 3576 O O   . HOH J 8 .   ? 55.141 10.817  23.817  1.00 51.66  ? 229 HOH A O   1 
HETATM 3577 O O   . HOH K 8 .   ? 43.302 14.933  4.431   1.00 33.97  ? 253 HOH B O   1 
HETATM 3578 O O   . HOH K 8 .   ? 35.683 14.358  11.528  1.00 22.47  ? 254 HOH B O   1 
HETATM 3579 O O   . HOH K 8 .   ? 14.740 11.392  20.699  1.00 44.87  ? 255 HOH B O   1 
HETATM 3580 O O   . HOH K 8 .   ? 33.164 -0.704  5.458   1.00 41.71  ? 256 HOH B O   1 
HETATM 3581 O O   . HOH K 8 .   ? 39.061 -5.998  2.816   1.00 29.54  ? 257 HOH B O   1 
HETATM 3582 O O   . HOH K 8 .   ? 37.548 20.385  -13.815 1.00 37.53  ? 258 HOH B O   1 
HETATM 3583 O O   . HOH K 8 .   ? 3.079  5.889   22.055  1.00 23.96  ? 259 HOH B O   1 
HETATM 3584 O O   . HOH K 8 .   ? 9.283  -10.924 26.597  1.00 24.56  ? 260 HOH B O   1 
HETATM 3585 O O   . HOH K 8 .   ? 4.973  9.411   15.212  1.00 29.23  ? 261 HOH B O   1 
HETATM 3586 O O   . HOH K 8 .   ? 27.744 1.145   5.580   1.00 41.31  ? 262 HOH B O   1 
HETATM 3587 O O   . HOH K 8 .   ? 10.698 12.294  18.953  1.00 41.78  ? 263 HOH B O   1 
HETATM 3588 O O   . HOH K 8 .   ? 40.989 6.784   -14.255 1.00 53.47  ? 264 HOH B O   1 
HETATM 3589 O O   . HOH K 8 .   ? 26.561 -3.015  -4.685  1.00 28.61  ? 265 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   1   1   GLN GLN A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ARG 9   9   9   ARG ARG A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  TYR 26  26  26  TYR TYR A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  TYR 31  31  31  TYR TYR A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  TRP 34  34  34  TRP TRP A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  CYS 90  90  90  CYS CYS A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLY 94  99  99  GLY GLY A . n 
A 1 95  PHE 95  100 100 PHE PHE A . n 
A 1 96  ALA 96  101 101 ALA ALA A . n 
A 1 97  SER 97  102 102 SER SER A . n 
A 1 98  ALA 98  103 103 ALA ALA A . n 
A 1 99  LEU 99  104 104 LEU LEU A . n 
A 1 100 THR 100 105 105 THR THR A . n 
A 1 101 PHE 101 106 106 PHE PHE A . n 
A 1 102 GLY 102 107 107 GLY GLY A . n 
A 1 103 SER 103 108 108 SER SER A . n 
A 1 104 GLY 104 109 109 GLY GLY A . n 
A 1 105 THR 105 110 110 THR THR A . n 
A 1 106 LYS 106 111 111 LYS LYS A . n 
A 1 107 VAL 107 112 112 VAL VAL A . n 
A 1 108 ILE 108 113 113 ILE ILE A . n 
A 1 109 VAL 109 114 114 VAL VAL A . n 
A 1 110 LEU 110 115 115 LEU LEU A . n 
A 1 111 PRO 111 116 116 PRO PRO A . n 
A 1 112 TYR 112 117 117 TYR TYR A . n 
A 1 113 ILE 113 118 118 ILE ILE A . n 
A 1 114 GLN 114 119 119 GLN GLN A . n 
A 1 115 ASN 115 120 120 ASN ASN A . n 
A 1 116 PRO 116 121 121 PRO PRO A . n 
A 1 117 GLU 117 122 122 GLU GLU A . n 
A 1 118 PRO 118 123 123 PRO PRO A . n 
A 1 119 ALA 119 124 124 ALA ALA A . n 
A 1 120 VAL 120 125 125 VAL VAL A . n 
A 1 121 TYR 121 126 126 TYR TYR A . n 
A 1 122 ALA 122 127 127 ALA ALA A . n 
A 1 123 LEU 123 128 128 LEU LEU A . n 
A 1 124 LYS 124 129 129 LYS LYS A . n 
A 1 125 ASP 125 132 132 ASP ASP A . n 
A 1 126 PRO 126 133 133 PRO PRO A . n 
A 1 127 ARG 127 134 134 ARG ARG A . n 
A 1 128 SER 128 135 135 SER SER A . n 
A 1 129 GLN 129 136 136 GLN GLN A . n 
A 1 130 ASP 130 137 137 ASP ASP A . n 
A 1 131 SER 131 138 138 SER SER A . n 
A 1 132 THR 132 139 139 THR THR A . n 
A 1 133 LEU 133 140 140 LEU LEU A . n 
A 1 134 CYS 134 141 141 CYS CYS A . n 
A 1 135 LEU 135 142 142 LEU LEU A . n 
A 1 136 PHE 136 143 143 PHE PHE A . n 
A 1 137 THR 137 144 144 THR THR A . n 
A 1 138 ASP 138 145 145 ASP ASP A . n 
A 1 139 PHE 139 146 146 PHE PHE A . n 
A 1 140 ASP 140 147 147 ASP ASP A . n 
A 1 141 SER 141 148 148 SER SER A . n 
A 1 142 GLN 142 149 149 GLN GLN A . n 
A 1 143 ILE 143 150 150 ILE ILE A . n 
A 1 144 ASN 144 151 151 ASN ASN A . n 
A 1 145 VAL 145 152 152 VAL VAL A . n 
A 1 146 PRO 146 153 153 PRO PRO A . n 
A 1 147 LYS 147 154 154 LYS LYS A . n 
A 1 148 THR 148 155 155 THR THR A . n 
A 1 149 MET 149 156 156 MET MET A . n 
A 1 150 GLU 150 157 157 GLU GLU A . n 
A 1 151 SER 151 158 158 SER SER A . n 
A 1 152 GLY 152 159 159 GLY GLY A . n 
A 1 153 THR 153 160 160 THR THR A . n 
A 1 154 PHE 154 161 161 PHE PHE A . n 
A 1 155 ILE 155 162 162 ILE ILE A . n 
A 1 156 THR 156 163 163 THR THR A . n 
A 1 157 ASP 157 164 164 ASP ASP A . n 
A 1 158 ALA 158 165 165 ALA ALA A . n 
A 1 159 THR 159 166 166 THR THR A . n 
A 1 160 VAL 160 167 167 VAL VAL A . n 
A 1 161 LEU 161 168 168 LEU LEU A . n 
A 1 162 ASP 162 169 169 ASP ASP A . n 
A 1 163 MET 163 170 170 MET MET A . n 
A 1 164 LYS 164 171 171 LYS LYS A . n 
A 1 165 ALA 165 172 172 ALA ALA A . n 
A 1 166 MET 166 173 173 MET MET A . n 
A 1 167 ASP 167 174 174 ASP ASP A . n 
A 1 168 SER 168 175 175 SER SER A . n 
A 1 169 LYS 169 176 176 LYS LYS A . n 
A 1 170 SER 170 177 177 SER SER A . n 
A 1 171 ASN 171 178 178 ASN ASN A . n 
A 1 172 GLY 172 179 179 GLY GLY A . n 
A 1 173 ALA 173 180 180 ALA ALA A . n 
A 1 174 ILE 174 181 181 ILE ILE A . n 
A 1 175 ALA 175 182 182 ALA ALA A . n 
A 1 176 TRP 176 183 183 TRP TRP A . n 
A 1 177 SER 177 184 184 SER SER A . n 
A 1 178 ASN 178 185 185 ASN ASN A . n 
A 1 179 GLN 179 186 186 GLN GLN A . n 
A 1 180 THR 180 187 187 THR THR A . n 
A 1 181 SER 181 188 188 SER SER A . n 
A 1 182 PHE 182 189 189 PHE PHE A . n 
A 1 183 THR 183 190 190 THR THR A . n 
A 1 184 CYS 184 191 191 CYS CYS A . n 
A 1 185 GLN 185 192 192 GLN GLN A . n 
A 1 186 ASP 186 193 193 ASP ASP A . n 
A 1 187 ILE 187 194 194 ILE ILE A . n 
A 1 188 PHE 188 195 195 PHE PHE A . n 
A 1 189 LYS 189 196 196 LYS LYS A . n 
A 1 190 GLU 190 197 197 GLU GLU A . n 
A 1 191 THR 191 198 198 THR THR A . n 
A 1 192 ASN 192 203 203 ASN ASN A . n 
A 1 193 ALA 193 204 204 ALA ALA A . n 
A 1 194 THR 194 205 205 THR THR A . n 
A 1 195 TYR 195 206 206 TYR TYR A . n 
A 1 196 PRO 196 207 207 PRO PRO A . n 
A 1 197 SER 197 208 208 SER SER A . n 
A 1 198 SER 198 209 209 SER SER A . n 
A 1 199 ASP 199 210 210 ASP ASP A . n 
A 1 200 VAL 200 211 211 VAL VAL A . n 
A 1 201 PRO 201 212 212 PRO PRO A . n 
A 1 202 CYS 202 213 213 CYS CYS A . n 
B 2 1   GLU 1   1   1   GLU GLU B . n 
B 2 2   ALA 2   2   2   ALA ALA B . n 
B 2 3   ALA 3   3   3   ALA ALA B . n 
B 2 4   VAL 4   4   4   VAL VAL B . n 
B 2 5   THR 5   5   5   THR THR B . n 
B 2 6   GLN 6   6   6   GLN GLN B . n 
B 2 7   SER 7   7   7   SER SER B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   ARG 9   9   9   ARG ARG B . n 
B 2 10  ASN 10  10  10  ASN ASN B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  VAL 12  12  12  VAL VAL B . n 
B 2 13  ALA 13  13  13  ALA ALA B . n 
B 2 14  VAL 14  14  14  VAL VAL B . n 
B 2 15  THR 15  15  15  THR THR B . n 
B 2 16  GLY 16  16  16  GLY GLY B . n 
B 2 17  GLY 17  17  17  GLY GLY B . n 
B 2 18  LYS 18  18  18  LYS LYS B . n 
B 2 19  VAL 19  19  19  VAL VAL B . n 
B 2 20  THR 20  20  20  THR THR B . n 
B 2 21  LEU 21  21  21  LEU LEU B . n 
B 2 22  SER 22  22  22  SER SER B . n 
B 2 23  CYS 23  23  23  CYS CYS B . n 
B 2 24  ASN 24  24  24  ASN ASN B . n 
B 2 25  GLN 25  25  25  GLN GLN B . n 
B 2 26  THR 26  26  26  THR THR B . n 
B 2 27  ASN 27  27  27  ASN ASN B . n 
B 2 28  ASN 28  28  28  ASN ASN B . n 
B 2 29  HIS 29  29  29  HIS HIS B . n 
B 2 30  ASN 30  30  30  ASN ASN B . n 
B 2 31  ASN 31  31  31  ASN ASN B . n 
B 2 32  MET 32  32  32  MET MET B . n 
B 2 33  TYR 33  33  33  TYR TYR B . n 
B 2 34  TRP 34  34  34  TRP TRP B . n 
B 2 35  TYR 35  35  35  TYR TYR B . n 
B 2 36  ARG 36  36  36  ARG ARG B . n 
B 2 37  GLN 37  37  37  GLN GLN B . n 
B 2 38  ASP 38  38  38  ASP ASP B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  GLY 40  40  40  GLY GLY B . n 
B 2 41  HIS 41  41  41  HIS HIS B . n 
B 2 42  GLY 42  42  42  GLY GLY B . n 
B 2 43  LEU 43  43  43  LEU LEU B . n 
B 2 44  ARG 44  44  44  ARG ARG B . n 
B 2 45  LEU 45  45  45  LEU LEU B . n 
B 2 46  ILE 46  46  46  ILE ILE B . n 
B 2 47  HIS 47  47  47  HIS HIS B . n 
B 2 48  TYR 48  48  48  TYR TYR B . n 
B 2 49  SER 49  49  49  SER SER B . n 
B 2 50  TYR 50  50  50  TYR TYR B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  ALA 52  52  52  ALA ALA B . n 
B 2 53  GLY 53  53  53  GLY GLY B . n 
B 2 54  SER 54  54  54  SER SER B . n 
B 2 55  THR 55  55  55  THR THR B . n 
B 2 56  GLU 56  56  56  GLU GLU B . n 
B 2 57  LYS 57  57  57  LYS LYS B . n 
B 2 58  GLY 58  58  58  GLY GLY B . n 
B 2 59  ASP 59  59  59  ASP ASP B . n 
B 2 60  ILE 60  60  60  ILE ILE B . n 
B 2 61  PRO 61  61  61  PRO PRO B . n 
B 2 62  ASP 62  62  62  ASP ASP B . n 
B 2 63  GLY 63  63  63  GLY GLY B . n 
B 2 64  TYR 64  65  65  TYR TYR B . n 
B 2 65  LYS 65  66  66  LYS LYS B . n 
B 2 66  ALA 66  67  67  ALA ALA B . n 
B 2 67  SER 67  68  68  SER SER B . n 
B 2 68  ARG 68  69  69  ARG ARG B . n 
B 2 69  PRO 69  70  70  PRO PRO B . n 
B 2 70  SER 70  71  71  SER SER B . n 
B 2 71  GLN 71  72  72  GLN GLN B . n 
B 2 72  GLU 72  73  73  GLU GLU B . n 
B 2 73  ASN 73  74  74  ASN ASN B . n 
B 2 74  PHE 74  75  75  PHE PHE B . n 
B 2 75  SER 75  76  76  SER SER B . n 
B 2 76  LEU 76  77  77  LEU LEU B . n 
B 2 77  ILE 77  78  78  ILE ILE B . n 
B 2 78  LEU 78  79  79  LEU LEU B . n 
B 2 79  GLU 79  80  80  GLU GLU B . n 
B 2 80  LEU 80  81  81  LEU LEU B . n 
B 2 81  ALA 81  82  82  ALA ALA B . n 
B 2 82  THR 82  83  83  THR THR B . n 
B 2 83  PRO 83  84  84  PRO PRO B . n 
B 2 84  SER 84  85  85  SER SER B . n 
B 2 85  GLN 85  86  86  GLN GLN B . n 
B 2 86  THR 86  87  87  THR THR B . n 
B 2 87  SER 87  88  88  SER SER B . n 
B 2 88  VAL 88  89  89  VAL VAL B . n 
B 2 89  TYR 89  90  90  TYR TYR B . n 
B 2 90  PHE 90  91  91  PHE PHE B . n 
B 2 91  CYS 91  92  92  CYS CYS B . n 
B 2 92  ALA 92  93  93  ALA ALA B . n 
B 2 93  SER 93  94  94  SER SER B . n 
B 2 94  GLY 94  95  95  GLY GLY B . n 
B 2 95  GLY 95  96  96  GLY GLY B . n 
B 2 96  GLY 96  97  97  GLY GLY B . n 
B 2 97  GLY 97  98  98  GLY GLY B . n 
B 2 98  THR 98  105 105 THR THR B . n 
B 2 99  LEU 99  106 106 LEU LEU B . n 
B 2 100 TYR 100 107 107 TYR TYR B . n 
B 2 101 PHE 101 108 108 PHE PHE B . n 
B 2 102 GLY 102 109 109 GLY GLY B . n 
B 2 103 ALA 103 110 110 ALA ALA B . n 
B 2 104 GLY 104 111 111 GLY GLY B . n 
B 2 105 THR 105 112 112 THR THR B . n 
B 2 106 ARG 106 113 113 ARG ARG B . n 
B 2 107 LEU 107 114 114 LEU LEU B . n 
B 2 108 SER 108 115 115 SER SER B . n 
B 2 109 VAL 109 116 116 VAL VAL B . n 
B 2 110 LEU 110 116 116 LEU LEU B A n 
B 2 111 GLU 111 117 117 GLU GLU B . n 
B 2 112 ASP 112 118 118 ASP ASP B . n 
B 2 113 LEU 113 119 119 LEU LEU B . n 
B 2 114 ARG 114 120 120 ARG ARG B . n 
B 2 115 ASN 115 121 121 ASN ASN B . n 
B 2 116 VAL 116 122 122 VAL VAL B . n 
B 2 117 THR 117 123 123 THR THR B . n 
B 2 118 PRO 118 124 124 PRO PRO B . n 
B 2 119 PRO 119 125 125 PRO PRO B . n 
B 2 120 LYS 120 126 126 LYS LYS B . n 
B 2 121 VAL 121 127 127 VAL VAL B . n 
B 2 122 SER 122 128 128 SER SER B . n 
B 2 123 LEU 123 129 129 LEU LEU B . n 
B 2 124 PHE 124 130 130 PHE PHE B . n 
B 2 125 GLU 125 131 131 GLU GLU B . n 
B 2 126 PRO 126 132 132 PRO PRO B . n 
B 2 127 SER 127 133 133 SER SER B . n 
B 2 128 LYS 128 134 134 LYS LYS B . n 
B 2 129 ALA 129 135 135 ALA ALA B . n 
B 2 130 GLU 130 136 136 GLU GLU B . n 
B 2 131 ILE 131 137 137 ILE ILE B . n 
B 2 132 ALA 132 138 138 ALA ALA B . n 
B 2 133 ASN 133 139 139 ASN ASN B . n 
B 2 134 LYS 134 140 140 LYS LYS B . n 
B 2 135 GLN 135 141 141 GLN GLN B . n 
B 2 136 LYS 136 142 142 LYS LYS B . n 
B 2 137 ALA 137 143 143 ALA ALA B . n 
B 2 138 THR 138 144 144 THR THR B . n 
B 2 139 LEU 139 145 145 LEU LEU B . n 
B 2 140 VAL 140 146 146 VAL VAL B . n 
B 2 141 CYS 141 147 147 CYS CYS B . n 
B 2 142 LEU 142 148 148 LEU LEU B . n 
B 2 143 ALA 143 149 149 ALA ALA B . n 
B 2 144 ARG 144 150 150 ARG ARG B . n 
B 2 145 GLY 145 151 151 GLY GLY B . n 
B 2 146 PHE 146 152 152 PHE PHE B . n 
B 2 147 PHE 147 153 153 PHE PHE B . n 
B 2 148 PRO 148 154 154 PRO PRO B . n 
B 2 149 ASP 149 155 155 ASP ASP B . n 
B 2 150 HIS 150 156 156 HIS HIS B . n 
B 2 151 VAL 151 157 157 VAL VAL B . n 
B 2 152 GLU 152 158 158 GLU GLU B . n 
B 2 153 LEU 153 159 159 LEU LEU B . n 
B 2 154 SER 154 160 160 SER SER B . n 
B 2 155 TRP 155 161 161 TRP TRP B . n 
B 2 156 TRP 156 162 162 TRP TRP B . n 
B 2 157 VAL 157 163 163 VAL VAL B . n 
B 2 158 ASN 158 164 164 ASN ASN B . n 
B 2 159 GLY 159 165 165 GLY GLY B . n 
B 2 160 LYS 160 166 166 LYS LYS B . n 
B 2 161 GLU 161 167 167 GLU GLU B . n 
B 2 162 VAL 162 168 168 VAL VAL B . n 
B 2 163 HIS 163 169 169 HIS HIS B . n 
B 2 164 SER 164 170 170 SER SER B . n 
B 2 165 GLY 165 171 171 GLY GLY B . n 
B 2 166 VAL 166 172 172 VAL VAL B . n 
B 2 167 SER 167 173 173 SER SER B . n 
B 2 168 THR 168 174 174 THR THR B . n 
B 2 169 ASP 169 175 175 ASP ASP B . n 
B 2 170 PRO 170 176 176 PRO PRO B . n 
B 2 171 GLN 171 177 177 GLN GLN B . n 
B 2 172 ALA 172 178 178 ALA ALA B . n 
B 2 173 TYR 173 179 179 TYR TYR B . n 
B 2 174 LYS 174 180 180 LYS LYS B . n 
B 2 175 GLU 175 181 181 GLU GLU B . n 
B 2 176 SER 176 182 182 SER SER B . n 
B 2 177 ASN 177 186 186 ASN ASN B . n 
B 2 178 TYR 178 187 187 TYR TYR B . n 
B 2 179 SER 179 189 189 SER SER B . n 
B 2 180 TYR 180 190 190 TYR TYR B . n 
B 2 181 CYS 181 191 191 CYS CYS B . n 
B 2 182 LEU 182 192 192 LEU LEU B . n 
B 2 183 SER 183 193 193 SER SER B . n 
B 2 184 SER 184 194 194 SER SER B . n 
B 2 185 ARG 185 195 195 ARG ARG B . n 
B 2 186 LEU 186 196 196 LEU LEU B . n 
B 2 187 ARG 187 197 197 ARG ARG B . n 
B 2 188 VAL 188 198 198 VAL VAL B . n 
B 2 189 SER 189 199 199 SER SER B . n 
B 2 190 ALA 190 200 200 ALA ALA B . n 
B 2 191 THR 191 201 201 THR THR B . n 
B 2 192 PHE 192 202 202 PHE PHE B . n 
B 2 193 TRP 193 203 203 TRP TRP B . n 
B 2 194 HIS 194 204 204 HIS HIS B . n 
B 2 195 ASN 195 205 205 ASN ASN B . n 
B 2 196 PRO 196 206 206 PRO PRO B . n 
B 2 197 ARG 197 207 207 ARG ARG B . n 
B 2 198 ASN 198 208 208 ASN ASN B . n 
B 2 199 HIS 199 209 209 HIS HIS B . n 
B 2 200 PHE 200 210 210 PHE PHE B . n 
B 2 201 ARG 201 211 211 ARG ARG B . n 
B 2 202 CYS 202 212 212 CYS CYS B . n 
B 2 203 GLN 203 213 213 GLN GLN B . n 
B 2 204 VAL 204 214 214 VAL VAL B . n 
B 2 205 GLN 205 215 215 GLN GLN B . n 
B 2 206 PHE 206 216 216 PHE PHE B . n 
B 2 207 HIS 207 217 217 HIS HIS B . n 
B 2 208 GLY 208 218 218 GLY GLY B . n 
B 2 209 LEU 209 219 219 LEU LEU B . n 
B 2 210 SER 210 220 220 SER SER B . n 
B 2 211 GLU 211 221 221 GLU GLU B . n 
B 2 212 GLU 212 222 222 GLU GLU B . n 
B 2 213 ASP 213 223 223 ASP ASP B . n 
B 2 214 LYS 214 224 224 LYS LYS B . n 
B 2 215 TRP 215 225 225 TRP TRP B . n 
B 2 216 PRO 216 226 226 PRO PRO B . n 
B 2 217 GLU 217 227 227 GLU GLU B . n 
B 2 218 GLY 218 228 228 GLY GLY B . n 
B 2 219 SER 219 229 229 SER SER B . n 
B 2 220 PRO 220 230 230 PRO PRO B . n 
B 2 221 LYS 221 231 231 LYS LYS B . n 
B 2 222 PRO 222 232 232 PRO PRO B . n 
B 2 223 VAL 223 233 233 VAL VAL B . n 
B 2 224 THR 224 234 234 THR THR B . n 
B 2 225 GLN 225 235 235 GLN GLN B . n 
B 2 226 ASN 226 236 236 ASN ASN B . n 
B 2 227 ILE 227 237 237 ILE ILE B . n 
B 2 228 SER 228 238 238 SER SER B . n 
B 2 229 ALA 229 239 239 ALA ALA B . n 
B 2 230 GLU 230 240 240 GLU GLU B . n 
B 2 231 ALA 231 241 241 ALA ALA B . n 
B 2 232 TRP 232 242 242 TRP TRP B . n 
B 2 233 GLY 233 243 243 GLY GLY B . n 
B 2 234 ARG 234 244 244 ARG ARG B . n 
B 2 235 ALA 235 245 245 ALA ALA B . n 
B 2 236 ASP 236 246 246 ASP ASP B . n 
B 2 237 CYS 237 247 247 CYS CYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 6 NAG 1  200 200 NAG NAG A . 
G 7 SO4 1  250 31  SO4 SO4 B . 
H 7 SO4 1  251 32  SO4 SO4 B . 
I 7 SO4 1  252 33  SO4 SO4 B . 
J 8 HOH 1  221 1   HOH HOH A . 
J 8 HOH 2  222 2   HOH HOH A . 
J 8 HOH 3  223 11  HOH HOH A . 
J 8 HOH 4  224 12  HOH HOH A . 
J 8 HOH 5  225 15  HOH HOH A . 
J 8 HOH 6  226 24  HOH HOH A . 
J 8 HOH 7  227 25  HOH HOH A . 
J 8 HOH 8  228 28  HOH HOH A . 
J 8 HOH 9  229 30  HOH HOH A . 
K 8 HOH 1  253 3   HOH HOH B . 
K 8 HOH 2  254 4   HOH HOH B . 
K 8 HOH 3  255 5   HOH HOH B . 
K 8 HOH 4  256 7   HOH HOH B . 
K 8 HOH 5  257 8   HOH HOH B . 
K 8 HOH 6  258 10  HOH HOH B . 
K 8 HOH 7  259 13  HOH HOH B . 
K 8 HOH 8  260 16  HOH HOH B . 
K 8 HOH 9  261 17  HOH HOH B . 
K 8 HOH 10 262 19  HOH HOH B . 
K 8 HOH 11 263 20  HOH HOH B . 
K 8 HOH 12 264 23  HOH HOH B . 
K 8 HOH 13 265 27  HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 192 A ASN 203 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 178 A ASN 185 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 226 B ASN 236 ? ASN 'GLYCOSYLATION SITE' 
4 A ASN 70  A ASN 70  ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6980  ? 
1 MORE         -33   ? 
1 'SSA (A^2)'  22550 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-03-12 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-07 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 5 'Structure model' 'Atomic model'              
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Database references'       
8 5 'Structure model' 'Derived calculations'      
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' diffrn_source                 
2  5 'Structure model' atom_site                     
3  5 'Structure model' chem_comp                     
4  5 'Structure model' entity                        
5  5 'Structure model' pdbx_branch_scheme            
6  5 'Structure model' pdbx_chem_comp_identifier     
7  5 'Structure model' pdbx_entity_branch            
8  5 'Structure model' pdbx_entity_branch_descriptor 
9  5 'Structure model' pdbx_entity_branch_link       
10 5 'Structure model' pdbx_entity_branch_list       
11 5 'Structure model' pdbx_entity_nonpoly           
12 5 'Structure model' pdbx_nonpoly_scheme           
13 5 'Structure model' pdbx_struct_assembly_gen      
14 5 'Structure model' struct_asym                   
15 5 'Structure model' struct_conn                   
16 5 'Structure model' struct_ref_seq_dif            
17 5 'Structure model' struct_site                   
18 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_diffrn_source.source'                  
2  5 'Structure model' '_atom_site.B_iso_or_equiv'              
3  5 'Structure model' '_atom_site.Cartn_x'                     
4  5 'Structure model' '_atom_site.Cartn_y'                     
5  5 'Structure model' '_atom_site.Cartn_z'                     
6  5 'Structure model' '_atom_site.auth_asym_id'                
7  5 'Structure model' '_atom_site.auth_atom_id'                
8  5 'Structure model' '_atom_site.auth_comp_id'                
9  5 'Structure model' '_atom_site.auth_seq_id'                 
10 5 'Structure model' '_atom_site.label_asym_id'               
11 5 'Structure model' '_atom_site.label_atom_id'               
12 5 'Structure model' '_atom_site.label_comp_id'               
13 5 'Structure model' '_atom_site.label_entity_id'             
14 5 'Structure model' '_atom_site.type_symbol'                 
15 5 'Structure model' '_chem_comp.name'                        
16 5 'Structure model' '_chem_comp.type'                        
17 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
18 5 'Structure model' '_struct_conn.pdbx_dist_value'           
19 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
20 5 'Structure model' '_struct_conn.pdbx_role'                 
21 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
22 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
23 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
24 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
25 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
26 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
27 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
28 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
29 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
30 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
31 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
32 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
33 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
34 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'        
35 5 'Structure model' '_struct_ref_seq_dif.details'            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
PHASES    phasing          .   ? 3 
X-PLOR    'model building' 3.1 ? 4 
X-PLOR    refinement       3.1 ? 5 
X-PLOR    phasing          3.1 ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   PHE 
_pdbx_validate_close_contact.auth_seq_id_1    153 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   PRO 
_pdbx_validate_close_contact.auth_seq_id_2    154 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.72 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C A ALA 28 ? ? N  A THR 29 ? ? 1.168 1.336 -0.168 0.023 Y 
2 1 N A THR 29 ? ? CA A THR 29 ? ? 1.318 1.459 -0.141 0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A GLN 5   ? ? N  A PRO 6   ? ? CA  A PRO 6   ? ? 129.02 119.30 9.72   1.50 Y 
2 1 NE A ARG 21  ? ? CZ A ARG 21  ? ? NH2 A ARG 21  ? ? 123.68 120.30 3.38   0.50 N 
3 1 NE A ARG 40  ? ? CZ A ARG 40  ? ? NH2 A ARG 40  ? ? 124.59 120.30 4.29   0.50 N 
4 1 NE B ARG 44  ? ? CZ B ARG 44  ? ? NH2 B ARG 44  ? ? 123.65 120.30 3.35   0.50 N 
5 1 CA B PHE 153 ? ? C  B PHE 153 ? ? N   B PRO 154 ? ? 134.54 117.10 17.44  2.80 Y 
6 1 O  B PHE 153 ? ? C  B PHE 153 ? ? N   B PRO 154 ? ? 102.75 121.10 -18.35 1.90 Y 
7 1 NE B ARG 195 ? ? CZ B ARG 195 ? ? NH2 B ARG 195 ? ? 123.63 120.30 3.33   0.50 N 
8 1 NE B ARG 197 ? ? CZ B ARG 197 ? ? NH2 B ARG 197 ? ? 123.87 120.30 3.57   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 28  ? ? 142.51  -169.80 
2  1 TYR A 50  ? ? -120.17 -50.49  
3  1 ASN A 60  ? ? 76.90   30.47   
4  1 SER A 71  ? ? 38.49   71.41   
5  1 PHE A 73  ? ? -158.64 65.43   
6  1 ALA A 86  ? ? -170.46 -171.32 
7  1 SER A 93  ? ? -139.80 -153.44 
8  1 ARG A 134 ? ? -73.47  42.05   
9  1 SER A 135 ? ? -179.86 103.99  
10 1 ASP A 137 ? ? 83.10   -27.89  
11 1 SER A 148 ? ? -47.21  -18.20  
12 1 MET A 156 ? ? -132.07 -60.15  
13 1 LYS A 171 ? ? -97.45  45.89   
14 1 ASP A 174 ? ? -85.12  -87.03  
15 1 SER A 175 ? ? 26.32   30.22   
16 1 SER A 188 ? ? -168.54 82.56   
17 1 PHE A 195 ? ? -117.28 52.18   
18 1 THR A 198 ? ? -165.41 -164.15 
19 1 ALA A 204 ? ? 70.48   70.05   
20 1 ALA B 2   ? ? -164.82 95.13   
21 1 ALA B 3   ? ? -175.72 139.28  
22 1 THR B 26  ? ? -118.09 50.46   
23 1 ARG B 120 ? ? -66.81  4.14    
24 1 PHE B 153 ? ? -75.51  -121.11 
25 1 PRO B 154 ? ? -34.56  140.62  
26 1 ASP B 223 ? ? -37.39  133.95  
27 1 PRO B 226 ? ? -83.65  48.94   
28 1 ALA B 245 ? ? -71.82  -168.95 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   PHE 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    153 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    154 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -149.75 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   ALA 
_pdbx_validate_polymer_linkage.auth_seq_id_1    28 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   THR 
_pdbx_validate_polymer_linkage.auth_seq_id_2    29 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.17 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 3 NAG 1 C NAG 1 ? NAG 201 n 
C 3 NAG 2 C NAG 2 ? NAG 202 n 
C 3 BMA 3 C BMA 3 ? MAN 203 n 
C 3 FUC 4 C FUC 4 ? FUC 210 n 
D 4 NAG 1 D NAG 1 ? NAG 206 n 
D 4 NAG 2 D NAG 2 ? NAG 207 n 
D 4 FUC 3 D FUC 3 ? FUC 208 n 
E 5 NAG 1 E NAG 1 ? NAG 204 n 
E 5 NAG 2 E NAG 2 ? NAG 205 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
3 oligosaccharide 
4 oligosaccharide 
5 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 'DManpb1-4DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                                       
'Glycam Condensed Sequence' GMML       1.0   
2 3 'WURCS=2.0/3,4,3/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5][a1221m-1a_1-5]/1-1-2-3/a4-b1_a6-d1_b4-c1' WURCS PDB2Glycan 1.1.0 
3 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}[(6+1)][a-L-Fucp]{}}}'            LINUCS PDB-CARE   ?     
4 4 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                                                
'Glycam Condensed Sequence' GMML       1.0   
5 4 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1'                        WURCS PDB2Glycan 1.1.0 
6 4 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'                               LINUCS PDB-CARE   ?     
7 5 DGlcpNAcb1-4DGlcpNAcb1-                                                                             
'Glycam Condensed Sequence' GMML       1.0   
8 5 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1'                                               WURCS PDB2Glycan 1.1.0 
9 5 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'                                                  LINUCS PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 3 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 3 4 FUC C1 O1 1 NAG O6 HO6 sing ? 
4 4 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
5 4 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
6 5 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 NAG 1 n 
3 NAG 2 n 
3 BMA 3 n 
3 FUC 4 n 
4 NAG 1 n 
4 NAG 2 n 
4 FUC 3 n 
5 NAG 1 n 
5 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
6 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
7 'SULFATE ION'                            SO4 
8 water                                    HOH 
#