data_1TF6
# 
_entry.id   1TF6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TF6         
RCSB  PDT065       
WWPDB D_1000176651 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TF6 
_pdbx_database_status.recvd_initial_deposition_date   1998-03-02 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nolte, R.T.'    1 
'Conlin, R.M.'   2 
'Harrison, S.C.' 3 
'Brown, R.S.'    4 
# 
_citation.id                        primary 
_citation.title                     
'Differing roles for zinc fingers in DNA recognition: structure of a six-finger transcription factor IIIA complex.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            95 
_citation.page_first                2938 
_citation.page_last                 2943 
_citation.year                      1998 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9501194 
_citation.pdbx_database_id_DOI      10.1073/pnas.95.6.2938 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nolte, R.T.'    1 
primary 'Conlin, R.M.'   2 
primary 'Harrison, S.C.' 3 
primary 'Brown, R.S.'    4 
# 
_cell.entry_id           1TF6 
_cell.length_a           64.180 
_cell.length_b           64.712 
_cell.length_c           78.035 
_cell.angle_alpha        90.07 
_cell.angle_beta         92.98 
_cell.angle_gamma        102.95 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TF6 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*AP*CP*GP*GP*GP*CP*CP*TP*GP*GP*TP*TP*AP*GP*TP*AP*C P*CP*TP*GP*GP*AP* TP*GP*GP*GP*AP*GP*AP*CP*C)-3')
;
9634.182  2  ? ? 'INTERNAL PROMOTER REGION'                ? 
2 polymer     syn 
;DNA (5'-D(*TP*GP*GP*TP*CP*TP*CP*CP*CP*AP*TP*CP*CP*AP*GP*GP*T P*AP*CP*TP*AP*AP* CP*CP*AP*GP*GP*CP*CP*CP*G)-3')
;
9434.062  2  ? ? 'INTERNAL PROMOTER REGION'                ? 
3 polymer     man 'PROTEIN (TRANSCRIPTION FACTOR IIIA)'                                                                           
22126.504 2  ? ? 'NH2-TERMINAL SIX FINGERS, RESIDUE 1-190' ? 
4 non-polymer syn 'ZINC ION'                                                                                                      
65.409    12 ? ? ?                                         ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 '5S RIBOSOMAL RNA GENE'     
2 '5S RIBOSOMAL RNA GENE'     
3 'TRANSCRIPTION FACTOR IIIA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DC)(DG)(DG)(DG)(DC)(DC)(DT)(DG)(DG)(DT)(DT)(DA)(DG)(DT)(DA)(DC)(DC)(DT)(DG)
(DG)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DA)(DC)(DC)
;
ACGGGCCTGGTTAGTACCTGGATGGGAGACC B,E ? 
2 polydeoxyribonucleotide no no 
;(DT)(DG)(DG)(DT)(DC)(DT)(DC)(DC)(DC)(DA)(DT)(DC)(DC)(DA)(DG)(DG)(DT)(DA)(DC)(DT)
(DA)(DA)(DC)(DC)(DA)(DG)(DG)(DC)(DC)(DC)(DG)
;
TGGTCTCCCATCCAGGTACTAACCAGGCCCG C,F ? 
3 'polypeptide(L)'        no no 
;MGEKALPVVYKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGC
DLRFTTKANMKKHFNRFHNIKICVYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHA
GYPCKKDDSCSFVGKTWTLYLKHVAECHQD
;
;MGEKALPVVYKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGC
DLRFTTKANMKKHFNRFHNIKICVYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHA
GYPCKKDDSCSFVGKTWTLYLKHVAECHQD
;
A,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DC  n 
1 3   DG  n 
1 4   DG  n 
1 5   DG  n 
1 6   DC  n 
1 7   DC  n 
1 8   DT  n 
1 9   DG  n 
1 10  DG  n 
1 11  DT  n 
1 12  DT  n 
1 13  DA  n 
1 14  DG  n 
1 15  DT  n 
1 16  DA  n 
1 17  DC  n 
1 18  DC  n 
1 19  DT  n 
1 20  DG  n 
1 21  DG  n 
1 22  DA  n 
1 23  DT  n 
1 24  DG  n 
1 25  DG  n 
1 26  DG  n 
1 27  DA  n 
1 28  DG  n 
1 29  DA  n 
1 30  DC  n 
1 31  DC  n 
2 1   DT  n 
2 2   DG  n 
2 3   DG  n 
2 4   DT  n 
2 5   DC  n 
2 6   DT  n 
2 7   DC  n 
2 8   DC  n 
2 9   DC  n 
2 10  DA  n 
2 11  DT  n 
2 12  DC  n 
2 13  DC  n 
2 14  DA  n 
2 15  DG  n 
2 16  DG  n 
2 17  DT  n 
2 18  DA  n 
2 19  DC  n 
2 20  DT  n 
2 21  DA  n 
2 22  DA  n 
2 23  DC  n 
2 24  DC  n 
2 25  DA  n 
2 26  DG  n 
2 27  DG  n 
2 28  DC  n 
2 29  DC  n 
2 30  DC  n 
2 31  DG  n 
3 1   MET n 
3 2   GLY n 
3 3   GLU n 
3 4   LYS n 
3 5   ALA n 
3 6   LEU n 
3 7   PRO n 
3 8   VAL n 
3 9   VAL n 
3 10  TYR n 
3 11  LYS n 
3 12  ARG n 
3 13  TYR n 
3 14  ILE n 
3 15  CYS n 
3 16  SER n 
3 17  PHE n 
3 18  ALA n 
3 19  ASP n 
3 20  CYS n 
3 21  GLY n 
3 22  ALA n 
3 23  ALA n 
3 24  TYR n 
3 25  ASN n 
3 26  LYS n 
3 27  ASN n 
3 28  TRP n 
3 29  LYS n 
3 30  LEU n 
3 31  GLN n 
3 32  ALA n 
3 33  HIS n 
3 34  LEU n 
3 35  CYS n 
3 36  LYS n 
3 37  HIS n 
3 38  THR n 
3 39  GLY n 
3 40  GLU n 
3 41  LYS n 
3 42  PRO n 
3 43  PHE n 
3 44  PRO n 
3 45  CYS n 
3 46  LYS n 
3 47  GLU n 
3 48  GLU n 
3 49  GLY n 
3 50  CYS n 
3 51  GLU n 
3 52  LYS n 
3 53  GLY n 
3 54  PHE n 
3 55  THR n 
3 56  SER n 
3 57  LEU n 
3 58  HIS n 
3 59  HIS n 
3 60  LEU n 
3 61  THR n 
3 62  ARG n 
3 63  HIS n 
3 64  SER n 
3 65  LEU n 
3 66  THR n 
3 67  HIS n 
3 68  THR n 
3 69  GLY n 
3 70  GLU n 
3 71  LYS n 
3 72  ASN n 
3 73  PHE n 
3 74  THR n 
3 75  CYS n 
3 76  ASP n 
3 77  SER n 
3 78  ASP n 
3 79  GLY n 
3 80  CYS n 
3 81  ASP n 
3 82  LEU n 
3 83  ARG n 
3 84  PHE n 
3 85  THR n 
3 86  THR n 
3 87  LYS n 
3 88  ALA n 
3 89  ASN n 
3 90  MET n 
3 91  LYS n 
3 92  LYS n 
3 93  HIS n 
3 94  PHE n 
3 95  ASN n 
3 96  ARG n 
3 97  PHE n 
3 98  HIS n 
3 99  ASN n 
3 100 ILE n 
3 101 LYS n 
3 102 ILE n 
3 103 CYS n 
3 104 VAL n 
3 105 TYR n 
3 106 VAL n 
3 107 CYS n 
3 108 HIS n 
3 109 PHE n 
3 110 GLU n 
3 111 ASN n 
3 112 CYS n 
3 113 GLY n 
3 114 LYS n 
3 115 ALA n 
3 116 PHE n 
3 117 LYS n 
3 118 LYS n 
3 119 HIS n 
3 120 ASN n 
3 121 GLN n 
3 122 LEU n 
3 123 LYS n 
3 124 VAL n 
3 125 HIS n 
3 126 GLN n 
3 127 PHE n 
3 128 SER n 
3 129 HIS n 
3 130 THR n 
3 131 GLN n 
3 132 GLN n 
3 133 LEU n 
3 134 PRO n 
3 135 TYR n 
3 136 GLU n 
3 137 CYS n 
3 138 PRO n 
3 139 HIS n 
3 140 GLU n 
3 141 GLY n 
3 142 CYS n 
3 143 ASP n 
3 144 LYS n 
3 145 ARG n 
3 146 PHE n 
3 147 SER n 
3 148 LEU n 
3 149 PRO n 
3 150 SER n 
3 151 ARG n 
3 152 LEU n 
3 153 LYS n 
3 154 ARG n 
3 155 HIS n 
3 156 GLU n 
3 157 LYS n 
3 158 VAL n 
3 159 HIS n 
3 160 ALA n 
3 161 GLY n 
3 162 TYR n 
3 163 PRO n 
3 164 CYS n 
3 165 LYS n 
3 166 LYS n 
3 167 ASP n 
3 168 ASP n 
3 169 SER n 
3 170 CYS n 
3 171 SER n 
3 172 PHE n 
3 173 VAL n 
3 174 GLY n 
3 175 LYS n 
3 176 THR n 
3 177 TRP n 
3 178 THR n 
3 179 LEU n 
3 180 TYR n 
3 181 LEU n 
3 182 LYS n 
3 183 HIS n 
3 184 VAL n 
3 185 ALA n 
3 186 GLU n 
3 187 CYS n 
3 188 HIS n 
3 189 GLN n 
3 190 ASP n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'African clawed frog' 
_entity_src_gen.gene_src_genus                     Xenopus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Xenopus laevis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     8355 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                OVARY 
_entity_src_gen.pdbx_gene_src_organelle            NUCLEUS 
_entity_src_gen.pdbx_gene_src_cell                 OOCYTE 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    'INCLUSION BODY' 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PRSET B' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   CDNA; 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TF3A_XENLA 3 ? ? P03001 ? 
2 PDB 1TF6       1 ? ? 1TF6   ? 
3 PDB 1TF6       2 ? ? 1TF6   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TF6 A 1 ? 190 ? P03001 23 ? 212 ? 1  190 
2 1 1TF6 D 1 ? 190 ? P03001 23 ? 212 ? 1  190 
3 2 1TF6 B 1 ? 31  ? 1TF6   1  ? 31  ? 1  31  
4 3 1TF6 C 1 ? 31  ? 1TF6   33 ? 63  ? 33 63  
5 2 1TF6 E 1 ? 31  ? 1TF6   1  ? 31  ? 1  31  
6 3 1TF6 F 1 ? 31  ? 1TF6   33 ? 63  ? 33 63  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          1TF6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.80 
_exptl_crystal.density_percent_sol   70.0000 
_exptl_crystal.description           
'DATA WERE FILTERED LOCALLY WITH AN I/SIGMA(I) CUTOFF OF 1.0 - ELIMINATION OF UNRELIABLE MEASUREMENTS.' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291.00 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;COMPLEX WAS CRYSTALLIZED FROM 22.5% PEG 4000, 165 MM NACL, 35 MM SODIUM ACETATE, 3.2 MM DTT, 9.2% (VOL/VOL) GLYCEROL, 1.8 MM NAN3, 1.8 MM CADAVERINE-2HCL, 5.5 MM TRIS-HCL, PH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291.00K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 WATER            ? ? ? 
1 2  1 NACL             ? ? ? 
1 3  1 'SODIUM ACETATE' ? ? ? 
1 4  1 DTT              ? ? ? 
1 5  1 GLYCEROL         ? ? ? 
1 6  1 NAN3             ? ? ? 
1 7  1 CADAVERINE-2HCL  ? ? ? 
1 8  1 TRIS-HCL         ? ? ? 
1 9  1 'PEG 4000'       ? ? ? 
1 10 2 WATER            ? ? ? 
1 11 2 'PEG 4000'       ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-10 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1TF6 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.000 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   19034 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         77.400 
_reflns.pdbx_Rmerge_I_obs            0.1280000 
_reflns.pdbx_Rsym_value              0.0600000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        39.70 
_reflns.pdbx_redundancy              6.700 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1TF6 
_refine.ls_number_reflns_obs                     17014 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               1000000.000 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.000 
_refine.ls_d_res_high                            3.100 
_refine.ls_percent_reflns_obs                    81.400 
_refine.ls_R_factor_obs                          0.3080000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.3080000 
_refine.ls_R_factor_R_free                       0.3630000 
_refine.ls_R_factor_R_free_error                 0.016 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.900 
_refine.ls_number_reflns_R_free                  497 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               65.00 
_refine.aniso_B[1][1]                            17.260 
_refine.aniso_B[2][2]                            -5.820 
_refine.aniso_B[3][3]                            -11.40 
_refine.aniso_B[1][2]                            4.5200 
_refine.aniso_B[1][3]                            -0.720 
_refine.aniso_B[2][3]                            1.0200 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;ISOTROPIC B FACTORS WERE REFINED AGAINST UNSHARPENED NATIVE DATA WHICH HAS AN INHERENT B FACTOR OF 65.0, AND R-FACTORS WERE CALCULATED USING ANISOTROPICALLY SHARPENED DATA.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1TF6 
_refine_analyze.Luzzati_coordinate_error_obs    0.55 
_refine_analyze.Luzzati_sigma_a_obs             0.43 
_refine_analyze.Luzzati_d_res_low_obs           8.00 
_refine_analyze.Luzzati_coordinate_error_free   0.64 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2953 
_refine_hist.pdbx_number_atoms_nucleic_acid   2530 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               5495 
_refine_hist.d_res_high                       3.100 
_refine_hist.d_res_low                        8.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.005 ?     ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             0.90  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.9  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.94  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             2.470 2.000 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            4.450 4.000 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.490 2.000 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            4.480 4.000 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   NONE 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM_NDBX.DNA    TOP_NBDX.DNA 'X-RAY DIFFRACTION' 
3 PARAM19.ION       TOPH19.ION   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.900690 -0.434470 0.002040  -0.434440 0.900670 0.007820 -0.005240 0.006160 -0.999970 78.54161 18.46218 82.12378 
2 given ? -0.896830 -0.442290 -0.008730 -0.442350 0.896810 0.007720 0.004420  0.010790 -0.999930 78.89021 18.84468 81.35723 
3 given ? -0.892870 -0.450310 -0.000280 -0.450310 0.892860 0.005100 -0.002050 0.004670 -0.999990 78.95392 19.75191 82.60930 
4 given ? -0.892420 -0.451200 -0.002400 -0.451210 0.892410 0.004520 0.000100  0.005110 -0.999990 79.06322 19.84412 82.49853 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1TF6 
_struct.title                     
'CO-CRYSTAL STRUCTURE OF XENOPUS TFIIIA ZINC FINGER DOMAIN BOUND TO THE 5S RIBOSOMAL RNA GENE INTERNAL CONTROL REGION' 
_struct.pdbx_descriptor           'SIX-FINGER TRANSCRIPTION FACTOR IIIA/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TF6 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
;COMPLEX (TRANSCRIPTION REGULATION-DNA), RNA POLYMERASE III, TRANSCRIPTION INITIATION, ZINC FINGER PROTEIN, TRANSCRIPTION-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AH1 ASN E 27  ? THR E 38  ? ASN A 27  THR A 38  1 ? 12 
HELX_P HELX_P2  AH2 LEU E 57  ? THR E 68  ? LEU A 57  THR A 68  1 ? 12 
HELX_P HELX_P3  AH3 LYS E 87  ? HIS E 98  ? LYS A 87  HIS A 98  1 ? 12 
HELX_P HELX_P4  AH4 HIS E 119 ? THR E 130 ? HIS A 119 THR A 130 1 ? 12 
HELX_P HELX_P5  AH5 PRO E 149 ? ALA E 160 ? PRO A 149 ALA A 160 1 ? 12 
HELX_P HELX_P6  AH6 TRP E 177 ? HIS E 188 ? TRP A 177 HIS A 188 1 ? 12 
HELX_P HELX_P7  DH1 ASN F 27  ? THR F 38  ? ASN D 27  THR D 38  1 ? 12 
HELX_P HELX_P8  DH2 LEU F 57  ? THR F 68  ? LEU D 57  THR D 68  1 ? 12 
HELX_P HELX_P9  DH3 LYS F 87  ? HIS F 98  ? LYS D 87  HIS D 98  1 ? 12 
HELX_P HELX_P10 DH4 HIS F 119 ? THR F 130 ? HIS D 119 THR D 130 1 ? 12 
HELX_P HELX_P11 DH5 PRO F 149 ? ALA F 160 ? PRO D 149 ALA D 160 1 ? 12 
HELX_P HELX_P12 DH6 TRP F 177 ? HIS F 188 ? TRP D 177 HIS D 188 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? G ZN .  ZN ? ? ? 1_555 E CYS 15  SG  ? ? A ZN 201 A CYS 15  1_555 ? ? ? ? ? ? ?               2.228 ? 
metalc2   metalc ? ? G ZN .  ZN ? ? ? 1_555 E CYS 20  SG  ? ? A ZN 201 A CYS 20  1_555 ? ? ? ? ? ? ?               2.118 ? 
metalc3   metalc ? ? G ZN .  ZN ? ? ? 1_555 E HIS 33  NE2 ? ? A ZN 201 A HIS 33  1_555 ? ? ? ? ? ? ?               1.970 ? 
metalc4   metalc ? ? G ZN .  ZN ? ? ? 1_555 E HIS 37  NE2 ? ? A ZN 201 A HIS 37  1_555 ? ? ? ? ? ? ?               1.819 ? 
metalc5   metalc ? ? H ZN .  ZN ? ? ? 1_555 E CYS 45  SG  ? ? A ZN 202 A CYS 45  1_555 ? ? ? ? ? ? ?               2.339 ? 
metalc6   metalc ? ? H ZN .  ZN ? ? ? 1_555 E CYS 50  SG  ? ? A ZN 202 A CYS 50  1_555 ? ? ? ? ? ? ?               2.148 ? 
metalc7   metalc ? ? H ZN .  ZN ? ? ? 1_555 E HIS 63  NE2 ? ? A ZN 202 A HIS 63  1_555 ? ? ? ? ? ? ?               2.123 ? 
metalc8   metalc ? ? H ZN .  ZN ? ? ? 1_555 E HIS 67  NE2 ? ? A ZN 202 A HIS 67  1_555 ? ? ? ? ? ? ?               2.110 ? 
metalc9   metalc ? ? I ZN .  ZN ? ? ? 1_555 E CYS 75  SG  ? ? A ZN 203 A CYS 75  1_555 ? ? ? ? ? ? ?               2.348 ? 
metalc10  metalc ? ? I ZN .  ZN ? ? ? 1_555 E CYS 80  SG  ? ? A ZN 203 A CYS 80  1_555 ? ? ? ? ? ? ?               2.486 ? 
metalc11  metalc ? ? I ZN .  ZN ? ? ? 1_555 E HIS 93  NE2 ? ? A ZN 203 A HIS 93  1_555 ? ? ? ? ? ? ?               2.011 ? 
metalc12  metalc ? ? I ZN .  ZN ? ? ? 1_555 E HIS 98  NE2 ? ? A ZN 203 A HIS 98  1_555 ? ? ? ? ? ? ?               1.951 ? 
metalc13  metalc ? ? J ZN .  ZN ? ? ? 1_555 E CYS 107 SG  ? ? A ZN 204 A CYS 107 1_555 ? ? ? ? ? ? ?               2.173 ? 
metalc14  metalc ? ? J ZN .  ZN ? ? ? 1_555 E CYS 112 SG  ? ? A ZN 204 A CYS 112 1_555 ? ? ? ? ? ? ?               2.229 ? 
metalc15  metalc ? ? J ZN .  ZN ? ? ? 1_555 E HIS 125 NE2 ? ? A ZN 204 A HIS 125 1_555 ? ? ? ? ? ? ?               1.936 ? 
metalc16  metalc ? ? J ZN .  ZN ? ? ? 1_555 E HIS 129 NE2 ? ? A ZN 204 A HIS 129 1_555 ? ? ? ? ? ? ?               2.113 ? 
metalc17  metalc ? ? K ZN .  ZN ? ? ? 1_555 E CYS 137 SG  ? ? A ZN 205 A CYS 137 1_555 ? ? ? ? ? ? ?               2.242 ? 
metalc18  metalc ? ? K ZN .  ZN ? ? ? 1_555 E CYS 142 SG  ? ? A ZN 205 A CYS 142 1_555 ? ? ? ? ? ? ?               2.101 ? 
metalc19  metalc ? ? K ZN .  ZN ? ? ? 1_555 E HIS 155 NE2 ? ? A ZN 205 A HIS 155 1_555 ? ? ? ? ? ? ?               1.994 ? 
metalc20  metalc ? ? K ZN .  ZN ? ? ? 1_555 E HIS 159 NE2 ? ? A ZN 205 A HIS 159 1_555 ? ? ? ? ? ? ?               1.884 ? 
metalc21  metalc ? ? L ZN .  ZN ? ? ? 1_555 E CYS 164 SG  ? ? A ZN 206 A CYS 164 1_555 ? ? ? ? ? ? ?               2.331 ? 
metalc22  metalc ? ? L ZN .  ZN ? ? ? 1_555 E CYS 170 SG  ? ? A ZN 206 A CYS 170 1_555 ? ? ? ? ? ? ?               2.426 ? 
metalc23  metalc ? ? L ZN .  ZN ? ? ? 1_555 E HIS 183 NE2 ? ? A ZN 206 A HIS 183 1_555 ? ? ? ? ? ? ?               1.960 ? 
metalc24  metalc ? ? L ZN .  ZN ? ? ? 1_555 E HIS 188 NE2 ? ? A ZN 206 A HIS 188 1_555 ? ? ? ? ? ? ?               2.152 ? 
metalc25  metalc ? ? M ZN .  ZN ? ? ? 1_555 F CYS 15  SG  ? ? D ZN 201 D CYS 15  1_555 ? ? ? ? ? ? ?               2.209 ? 
metalc26  metalc ? ? M ZN .  ZN ? ? ? 1_555 F CYS 20  SG  ? ? D ZN 201 D CYS 20  1_555 ? ? ? ? ? ? ?               2.138 ? 
metalc27  metalc ? ? M ZN .  ZN ? ? ? 1_555 F HIS 33  NE2 ? ? D ZN 201 D HIS 33  1_555 ? ? ? ? ? ? ?               1.942 ? 
metalc28  metalc ? ? M ZN .  ZN ? ? ? 1_555 F HIS 37  NE2 ? ? D ZN 201 D HIS 37  1_555 ? ? ? ? ? ? ?               1.853 ? 
metalc29  metalc ? ? N ZN .  ZN ? ? ? 1_555 F CYS 45  SG  ? ? D ZN 202 D CYS 45  1_555 ? ? ? ? ? ? ?               2.339 ? 
metalc30  metalc ? ? N ZN .  ZN ? ? ? 1_555 F CYS 50  SG  ? ? D ZN 202 D CYS 50  1_555 ? ? ? ? ? ? ?               2.126 ? 
metalc31  metalc ? ? N ZN .  ZN ? ? ? 1_555 F HIS 63  NE2 ? ? D ZN 202 D HIS 63  1_555 ? ? ? ? ? ? ?               2.160 ? 
metalc32  metalc ? ? N ZN .  ZN ? ? ? 1_555 F HIS 67  NE2 ? ? D ZN 202 D HIS 67  1_555 ? ? ? ? ? ? ?               2.116 ? 
metalc33  metalc ? ? O ZN .  ZN ? ? ? 1_555 F CYS 75  SG  ? ? D ZN 203 D CYS 75  1_555 ? ? ? ? ? ? ?               2.314 ? 
metalc34  metalc ? ? O ZN .  ZN ? ? ? 1_555 F CYS 80  SG  ? ? D ZN 203 D CYS 80  1_555 ? ? ? ? ? ? ?               2.473 ? 
metalc35  metalc ? ? O ZN .  ZN ? ? ? 1_555 F HIS 93  NE2 ? ? D ZN 203 D HIS 93  1_555 ? ? ? ? ? ? ?               2.132 ? 
metalc36  metalc ? ? O ZN .  ZN ? ? ? 1_555 F HIS 98  NE2 ? ? D ZN 203 D HIS 98  1_555 ? ? ? ? ? ? ?               2.119 ? 
metalc37  metalc ? ? P ZN .  ZN ? ? ? 1_555 F CYS 107 SG  ? ? D ZN 204 D CYS 107 1_555 ? ? ? ? ? ? ?               2.220 ? 
metalc38  metalc ? ? P ZN .  ZN ? ? ? 1_555 F CYS 112 SG  ? ? D ZN 204 D CYS 112 1_555 ? ? ? ? ? ? ?               2.517 ? 
metalc39  metalc ? ? P ZN .  ZN ? ? ? 1_555 F HIS 125 NE2 ? ? D ZN 204 D HIS 125 1_555 ? ? ? ? ? ? ?               1.911 ? 
metalc40  metalc ? ? P ZN .  ZN ? ? ? 1_555 F HIS 129 NE2 ? ? D ZN 204 D HIS 129 1_555 ? ? ? ? ? ? ?               1.898 ? 
metalc41  metalc ? ? Q ZN .  ZN ? ? ? 1_555 F CYS 137 SG  ? ? D ZN 205 D CYS 137 1_555 ? ? ? ? ? ? ?               2.247 ? 
metalc42  metalc ? ? Q ZN .  ZN ? ? ? 1_555 F CYS 142 SG  ? ? D ZN 205 D CYS 142 1_555 ? ? ? ? ? ? ?               2.349 ? 
metalc43  metalc ? ? Q ZN .  ZN ? ? ? 1_555 F HIS 155 NE2 ? ? D ZN 205 D HIS 155 1_555 ? ? ? ? ? ? ?               1.977 ? 
metalc44  metalc ? ? Q ZN .  ZN ? ? ? 1_555 F HIS 159 NE2 ? ? D ZN 205 D HIS 159 1_555 ? ? ? ? ? ? ?               1.856 ? 
metalc45  metalc ? ? R ZN .  ZN ? ? ? 1_555 F CYS 164 SG  ? ? D ZN 206 D CYS 164 1_555 ? ? ? ? ? ? ?               2.314 ? 
metalc46  metalc ? ? R ZN .  ZN ? ? ? 1_555 F CYS 170 SG  ? ? D ZN 206 D CYS 170 1_555 ? ? ? ? ? ? ?               2.467 ? 
metalc47  metalc ? ? R ZN .  ZN ? ? ? 1_555 F HIS 183 NE2 ? ? D ZN 206 D HIS 183 1_555 ? ? ? ? ? ? ?               2.122 ? 
metalc48  metalc ? ? R ZN .  ZN ? ? ? 1_555 F HIS 188 NE2 ? ? D ZN 206 D HIS 188 1_555 ? ? ? ? ? ? ?               1.854 ? 
hydrog1   hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG  31  N1  ? ? B DC 2   C DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG  31  O6  ? ? B DC 2   C DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG  31  N2  ? ? B DC 2   C DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC  30  N3  ? ? B DG 3   C DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC  30  O2  ? ? B DG 3   C DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC  30  N4  ? ? B DG 3   C DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  29  N3  ? ? B DG 4   C DC  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  29  O2  ? ? B DG 4   C DC  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  29  N4  ? ? B DG 4   C DC  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC  28  N3  ? ? B DG 5   C DC  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC  28  O2  ? ? B DG 5   C DC  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC  28  N4  ? ? B DG 5   C DC  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG  27  N1  ? ? B DC 6   C DG  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG  27  O6  ? ? B DC 6   C DG  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG  27  N2  ? ? B DC 6   C DG  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A DC 7  N3 ? ? ? 1_555 B DG  26  N1  ? ? B DC 7   C DG  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? A DC 7  N4 ? ? ? 1_555 B DG  26  O6  ? ? B DC 7   C DG  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? A DC 7  O2 ? ? ? 1_555 B DG  26  N2  ? ? B DC 7   C DG  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA  25  N1  ? ? B DT 8   C DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA  25  N6  ? ? B DT 8   C DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC  24  N3  ? ? B DG 9   C DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC  24  O2  ? ? B DG 9   C DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC  24  N4  ? ? B DG 9   C DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC  23  N3  ? ? B DG 10  C DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC  23  O2  ? ? B DG 10  C DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC  23  N4  ? ? B DG 10  C DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA  22  N1  ? ? B DT 11  C DA  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA  22  N6  ? ? B DT 11  C DA  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA  21  N1  ? ? B DT 12  C DA  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA  21  N6  ? ? B DT 12  C DA  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT  20  N3  ? ? B DA 13  C DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT  20  O4  ? ? B DA 13  C DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? A DG 14 N1 ? ? ? 1_555 B DC  19  N3  ? ? B DG 14  C DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? A DG 14 N2 ? ? ? 1_555 B DC  19  O2  ? ? B DG 14  C DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? A DG 14 O6 ? ? ? 1_555 B DC  19  N4  ? ? B DG 14  C DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? A DT 15 N3 ? ? ? 1_555 B DA  18  N1  ? ? B DT 15  C DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? A DT 15 O4 ? ? ? 1_555 B DA  18  N6  ? ? B DT 15  C DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT  17  N3  ? ? B DA 16  C DT  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT  17  O4  ? ? B DA 16  C DT  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? A DC 17 N3 ? ? ? 1_555 B DG  16  N1  ? ? B DC 17  C DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? A DC 17 N4 ? ? ? 1_555 B DG  16  O6  ? ? B DC 17  C DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? A DC 17 O2 ? ? ? 1_555 B DG  16  N2  ? ? B DC 17  C DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? A DC 18 N3 ? ? ? 1_555 B DG  15  N1  ? ? B DC 18  C DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? A DC 18 N4 ? ? ? 1_555 B DG  15  O6  ? ? B DC 18  C DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? A DC 18 O2 ? ? ? 1_555 B DG  15  N2  ? ? B DC 18  C DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? A DT 19 N3 ? ? ? 1_555 B DA  14  N1  ? ? B DT 19  C DA  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? A DT 19 O4 ? ? ? 1_555 B DA  14  N6  ? ? B DT 19  C DA  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? A DG 20 N1 ? ? ? 1_555 B DC  13  N3  ? ? B DG 20  C DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? A DG 20 N2 ? ? ? 1_555 B DC  13  O2  ? ? B DG 20  C DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? A DG 20 O6 ? ? ? 1_555 B DC  13  N4  ? ? B DG 20  C DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? A DG 21 N1 ? ? ? 1_555 B DC  12  N3  ? ? B DG 21  C DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? A DG 21 N2 ? ? ? 1_555 B DC  12  O2  ? ? B DG 21  C DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? A DG 21 O6 ? ? ? 1_555 B DC  12  N4  ? ? B DG 21  C DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? A DA 22 N1 ? ? ? 1_555 B DT  11  N3  ? ? B DA 22  C DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? A DA 22 N6 ? ? ? 1_555 B DT  11  O4  ? ? B DA 22  C DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? A DT 23 O4 ? ? ? 1_555 B DC  9   N4  ? ? B DT 23  C DC  41  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog57  hydrog ? ? A DT 23 N3 ? ? ? 1_555 B DA  10  N1  ? ? B DT 23  C DA  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? A DT 23 O4 ? ? ? 1_555 B DA  10  N6  ? ? B DT 23  C DA  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? A DG 24 N1 ? ? ? 1_555 B DC  9   N3  ? ? B DG 24  C DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? A DG 24 N2 ? ? ? 1_555 B DC  9   O2  ? ? B DG 24  C DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? A DG 24 O6 ? ? ? 1_555 B DC  9   N4  ? ? B DG 24  C DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? A DG 25 N1 ? ? ? 1_555 B DC  8   N3  ? ? B DG 25  C DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? A DG 25 N2 ? ? ? 1_555 B DC  8   O2  ? ? B DG 25  C DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? A DG 25 O6 ? ? ? 1_555 B DC  8   N4  ? ? B DG 25  C DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? A DG 26 N1 ? ? ? 1_555 B DC  7   N3  ? ? B DG 26  C DC  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? A DG 26 N2 ? ? ? 1_555 B DC  7   O2  ? ? B DG 26  C DC  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? A DG 26 O6 ? ? ? 1_555 B DC  7   N4  ? ? B DG 26  C DC  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? A DA 27 N1 ? ? ? 1_555 B DT  6   N3  ? ? B DA 27  C DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? A DA 27 N6 ? ? ? 1_555 B DT  6   O4  ? ? B DA 27  C DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? A DG 28 N1 ? ? ? 1_555 B DC  5   N3  ? ? B DG 28  C DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? A DG 28 N2 ? ? ? 1_555 B DC  5   O2  ? ? B DG 28  C DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? A DG 28 O6 ? ? ? 1_555 B DC  5   N4  ? ? B DG 28  C DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? A DA 29 N1 ? ? ? 1_555 B DT  4   N3  ? ? B DA 29  C DT  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? A DA 29 N6 ? ? ? 1_555 B DT  4   O4  ? ? B DA 29  C DT  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? A DC 30 N3 ? ? ? 1_555 B DG  3   N1  ? ? B DC 30  C DG  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? A DC 30 N4 ? ? ? 1_555 B DG  3   O6  ? ? B DC 30  C DG  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? A DC 30 O2 ? ? ? 1_555 B DG  3   N2  ? ? B DC 30  C DG  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? A DC 31 N3 ? ? ? 1_555 B DG  2   N1  ? ? B DC 31  C DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? A DC 31 N4 ? ? ? 1_555 B DG  2   O6  ? ? B DC 31  C DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? A DC 31 O2 ? ? ? 1_555 B DG  2   N2  ? ? B DC 31  C DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? C DC 2  N3 ? ? ? 1_555 D DG  31  N1  ? ? E DC 2   F DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? C DC 2  N4 ? ? ? 1_555 D DG  31  O6  ? ? E DC 2   F DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? C DC 2  O2 ? ? ? 1_555 D DG  31  N2  ? ? E DC 2   F DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? C DG 3  N1 ? ? ? 1_555 D DC  30  N3  ? ? E DG 3   F DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? C DG 3  N2 ? ? ? 1_555 D DC  30  O2  ? ? E DG 3   F DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? C DG 3  O6 ? ? ? 1_555 D DC  30  N4  ? ? E DG 3   F DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? C DG 4  N1 ? ? ? 1_555 D DC  29  N3  ? ? E DG 4   F DC  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? C DG 4  N2 ? ? ? 1_555 D DC  29  O2  ? ? E DG 4   F DC  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? C DG 4  O6 ? ? ? 1_555 D DC  29  N4  ? ? E DG 4   F DC  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? C DG 5  N1 ? ? ? 1_555 D DC  28  N3  ? ? E DG 5   F DC  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? C DG 5  N2 ? ? ? 1_555 D DC  28  O2  ? ? E DG 5   F DC  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? C DG 5  O6 ? ? ? 1_555 D DC  28  N4  ? ? E DG 5   F DC  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? C DC 6  N3 ? ? ? 1_555 D DG  27  N1  ? ? E DC 6   F DG  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? C DC 6  N4 ? ? ? 1_555 D DG  27  O6  ? ? E DC 6   F DG  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? C DC 6  O2 ? ? ? 1_555 D DG  27  N2  ? ? E DC 6   F DG  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? C DC 7  N3 ? ? ? 1_555 D DG  26  N1  ? ? E DC 7   F DG  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? C DC 7  N4 ? ? ? 1_555 D DG  26  O6  ? ? E DC 7   F DG  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? C DC 7  O2 ? ? ? 1_555 D DG  26  N2  ? ? E DC 7   F DG  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? C DT 8  N3 ? ? ? 1_555 D DA  25  N1  ? ? E DT 8   F DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA  25  N6  ? ? E DT 8   F DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? C DG 9  N1 ? ? ? 1_555 D DC  24  N3  ? ? E DG 9   F DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? C DG 9  N2 ? ? ? 1_555 D DC  24  O2  ? ? E DG 9   F DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? C DG 9  O6 ? ? ? 1_555 D DC  24  N4  ? ? E DG 9   F DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? C DG 10 N1 ? ? ? 1_555 D DC  23  N3  ? ? E DG 10  F DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? C DG 10 N2 ? ? ? 1_555 D DC  23  O2  ? ? E DG 10  F DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC  23  N4  ? ? E DG 10  F DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA  22  N1  ? ? E DT 11  F DA  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA  22  N6  ? ? E DT 11  F DA  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA  21  N1  ? ? E DT 12  F DA  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA  21  N6  ? ? E DT 12  F DA  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? C DA 13 N1 ? ? ? 1_555 D DT  20  N3  ? ? E DA 13  F DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? C DA 13 N6 ? ? ? 1_555 D DT  20  O4  ? ? E DA 13  F DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? C DG 14 N1 ? ? ? 1_555 D DC  19  N3  ? ? E DG 14  F DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? C DG 14 N2 ? ? ? 1_555 D DC  19  O2  ? ? E DG 14  F DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? C DG 14 O6 ? ? ? 1_555 D DC  19  N4  ? ? E DG 14  F DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? C DT 15 N3 ? ? ? 1_555 D DA  18  N1  ? ? E DT 15  F DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? C DT 15 O4 ? ? ? 1_555 D DA  18  N6  ? ? E DT 15  F DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? C DA 16 N1 ? ? ? 1_555 D DT  17  N3  ? ? E DA 16  F DT  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? C DA 16 N6 ? ? ? 1_555 D DT  17  O4  ? ? E DA 16  F DT  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? C DC 17 N3 ? ? ? 1_555 D DG  16  N1  ? ? E DC 17  F DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? C DC 17 N4 ? ? ? 1_555 D DG  16  O6  ? ? E DC 17  F DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? C DC 17 O2 ? ? ? 1_555 D DG  16  N2  ? ? E DC 17  F DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? C DC 18 N3 ? ? ? 1_555 D DG  15  N1  ? ? E DC 18  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? C DC 18 N4 ? ? ? 1_555 D DG  15  O6  ? ? E DC 18  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? C DC 18 O2 ? ? ? 1_555 D DG  15  N2  ? ? E DC 18  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? C DT 19 N3 ? ? ? 1_555 D DA  14  N1  ? ? E DT 19  F DA  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? C DT 19 O4 ? ? ? 1_555 D DA  14  N6  ? ? E DT 19  F DA  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? C DG 20 N1 ? ? ? 1_555 D DC  13  N3  ? ? E DG 20  F DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? C DG 20 N2 ? ? ? 1_555 D DC  13  O2  ? ? E DG 20  F DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? C DG 20 O6 ? ? ? 1_555 D DC  13  N4  ? ? E DG 20  F DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? C DG 21 N1 ? ? ? 1_555 D DC  12  N3  ? ? E DG 21  F DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? C DG 21 N2 ? ? ? 1_555 D DC  12  O2  ? ? E DG 21  F DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? C DG 21 O6 ? ? ? 1_555 D DC  12  N4  ? ? E DG 21  F DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? C DA 22 N1 ? ? ? 1_555 D DT  11  N3  ? ? E DA 22  F DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? C DA 22 N6 ? ? ? 1_555 D DT  11  O4  ? ? E DA 22  F DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? C DT 23 N3 ? ? ? 1_555 D DA  10  N1  ? ? E DT 23  F DA  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? C DT 23 O4 ? ? ? 1_555 D DA  10  N6  ? ? E DT 23  F DA  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? C DG 24 N1 ? ? ? 1_555 D DC  9   N3  ? ? E DG 24  F DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? C DG 24 N2 ? ? ? 1_555 D DC  9   O2  ? ? E DG 24  F DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? C DG 24 O6 ? ? ? 1_555 D DC  9   N4  ? ? E DG 24  F DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? C DG 25 N1 ? ? ? 1_555 D DC  8   N3  ? ? E DG 25  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? C DG 25 N2 ? ? ? 1_555 D DC  8   O2  ? ? E DG 25  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? C DG 25 O6 ? ? ? 1_555 D DC  8   N4  ? ? E DG 25  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? C DG 26 N1 ? ? ? 1_555 D DC  7   N3  ? ? E DG 26  F DC  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? C DG 26 N2 ? ? ? 1_555 D DC  7   O2  ? ? E DG 26  F DC  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? C DG 26 O6 ? ? ? 1_555 D DC  7   N4  ? ? E DG 26  F DC  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? C DA 27 N1 ? ? ? 1_555 D DT  6   N3  ? ? E DA 27  F DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? C DA 27 N6 ? ? ? 1_555 D DT  6   O4  ? ? E DA 27  F DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? C DG 28 N1 ? ? ? 1_555 D DC  5   N3  ? ? E DG 28  F DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? C DG 28 N2 ? ? ? 1_555 D DC  5   O2  ? ? E DG 28  F DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? C DG 28 O6 ? ? ? 1_555 D DC  5   N4  ? ? E DG 28  F DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? C DA 29 N1 ? ? ? 1_555 D DT  4   N3  ? ? E DA 29  F DT  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? C DA 29 N6 ? ? ? 1_555 D DT  4   O4  ? ? E DA 29  F DT  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? C DC 30 N3 ? ? ? 1_555 D DG  3   N1  ? ? E DC 30  F DG  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? C DC 30 N4 ? ? ? 1_555 D DG  3   O6  ? ? E DC 30  F DG  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? C DC 30 O2 ? ? ? 1_555 D DG  3   N2  ? ? E DC 30  F DG  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? C DC 31 N3 ? ? ? 1_555 D DG  2   N1  ? ? E DC 31  F DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? C DC 31 N4 ? ? ? 1_555 D DG  2   O6  ? ? E DC 31  F DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? C DC 31 O2 ? ? ? 1_555 D DG  2   N2  ? ? E DC 31  F DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE E 73  ? THR E 74  ? PHE A 73  THR A 74  
A 2 ARG E 83  ? PHE E 84  ? ARG A 83  PHE A 84  
B 1 VAL E 106 ? CYS E 107 ? VAL A 106 CYS A 107 
B 2 LYS E 114 ? ALA E 115 ? LYS A 114 ALA A 115 
C 1 PHE F 73  ? THR F 74  ? PHE D 73  THR D 74  
C 2 ARG F 83  ? PHE F 84  ? ARG D 83  PHE D 84  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE E 73  ? O PHE A 73  N PHE E 84  ? N PHE A 84  
B 1 2 N CYS E 107 ? N CYS A 107 O LYS E 114 ? O LYS A 114 
C 1 2 O PHE F 73  ? O PHE D 73  N PHE F 84  ? N PHE D 84  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AN1 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
AN2 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
AN3 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
AN4 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
AN5 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
AN6 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
DN1 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
DN2 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
DN3 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
DN4 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
DN5 Unknown  ? ? ? ? 4 'ZN-BINDING SITE.'                  
DN6 Unknown  ? ? ? ? 4 "'ZN-BINDING"                       
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 202' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 203' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 204' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 205' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 206' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 201' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 202' 
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN D 203' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 204' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 205' 
BC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 206' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AN1 4 CYS E 15  ? CYS A 15  . ? 1_555 ? 
2  AN1 4 CYS E 20  ? CYS A 20  . ? 1_555 ? 
3  AN1 4 HIS E 33  ? HIS A 33  . ? 1_555 ? 
4  AN1 4 HIS E 37  ? HIS A 37  . ? 1_555 ? 
5  AN2 4 CYS E 45  ? CYS A 45  . ? 1_555 ? 
6  AN2 4 CYS E 50  ? CYS A 50  . ? 1_555 ? 
7  AN2 4 HIS E 63  ? HIS A 63  . ? 1_555 ? 
8  AN2 4 HIS E 67  ? HIS A 67  . ? 1_555 ? 
9  AN3 4 CYS E 75  ? CYS A 75  . ? 1_555 ? 
10 AN3 4 CYS E 80  ? CYS A 80  . ? 1_555 ? 
11 AN3 4 HIS E 93  ? HIS A 93  . ? 1_555 ? 
12 AN3 4 HIS E 98  ? HIS A 98  . ? 1_555 ? 
13 AN4 4 CYS E 107 ? CYS A 107 . ? 1_555 ? 
14 AN4 4 CYS E 112 ? CYS A 112 . ? 1_555 ? 
15 AN4 4 HIS E 125 ? HIS A 125 . ? 1_555 ? 
16 AN4 4 HIS E 129 ? HIS A 129 . ? 1_555 ? 
17 AN5 4 CYS E 137 ? CYS A 137 . ? 1_555 ? 
18 AN5 4 CYS E 142 ? CYS A 142 . ? 1_555 ? 
19 AN5 4 HIS E 155 ? HIS A 155 . ? 1_555 ? 
20 AN5 4 HIS E 159 ? HIS A 159 . ? 1_555 ? 
21 AN6 4 CYS E 164 ? CYS A 164 . ? 1_555 ? 
22 AN6 4 CYS E 170 ? CYS A 170 . ? 1_555 ? 
23 AN6 4 HIS E 183 ? HIS A 183 . ? 1_555 ? 
24 AN6 4 HIS E 188 ? HIS A 188 . ? 1_555 ? 
25 DN1 4 CYS F 15  ? CYS D 15  . ? 1_555 ? 
26 DN1 4 CYS F 20  ? CYS D 20  . ? 1_555 ? 
27 DN1 4 HIS F 33  ? HIS D 33  . ? 1_555 ? 
28 DN1 4 HIS F 37  ? HIS D 37  . ? 1_555 ? 
29 DN2 4 CYS F 45  ? CYS D 45  . ? 1_555 ? 
30 DN2 4 CYS F 50  ? CYS D 50  . ? 1_555 ? 
31 DN2 4 HIS F 63  ? HIS D 63  . ? 1_555 ? 
32 DN2 4 HIS F 67  ? HIS D 67  . ? 1_555 ? 
33 DN3 4 CYS F 75  ? CYS D 75  . ? 1_555 ? 
34 DN3 4 CYS F 80  ? CYS D 80  . ? 1_555 ? 
35 DN3 4 HIS F 93  ? HIS D 93  . ? 1_555 ? 
36 DN3 4 HIS F 98  ? HIS D 98  . ? 1_555 ? 
37 DN4 4 CYS F 107 ? CYS D 107 . ? 1_555 ? 
38 DN4 4 CYS F 112 ? CYS D 112 . ? 1_555 ? 
39 DN4 4 HIS F 125 ? HIS D 125 . ? 1_555 ? 
40 DN4 4 HIS F 129 ? HIS D 129 . ? 1_555 ? 
41 DN5 4 CYS F 137 ? CYS D 137 . ? 1_555 ? 
42 DN5 4 CYS F 142 ? CYS D 142 . ? 1_555 ? 
43 DN5 4 HIS F 155 ? HIS D 155 . ? 1_555 ? 
44 DN5 4 HIS F 159 ? HIS D 159 . ? 1_555 ? 
45 DN6 4 CYS F 164 ? CYS D 164 . ? 1_555 ? 
46 DN6 4 CYS F 170 ? CYS D 170 . ? 1_555 ? 
47 DN6 4 HIS F 183 ? HIS D 183 . ? 1_555 ? 
48 DN6 4 HIS F 188 ? HIS D 188 . ? 1_555 ? 
49 AC1 4 CYS E 15  ? CYS A 15  . ? 1_555 ? 
50 AC1 4 CYS E 20  ? CYS A 20  . ? 1_555 ? 
51 AC1 4 HIS E 33  ? HIS A 33  . ? 1_555 ? 
52 AC1 4 HIS E 37  ? HIS A 37  . ? 1_555 ? 
53 AC2 4 CYS E 45  ? CYS A 45  . ? 1_555 ? 
54 AC2 4 CYS E 50  ? CYS A 50  . ? 1_555 ? 
55 AC2 4 HIS E 63  ? HIS A 63  . ? 1_555 ? 
56 AC2 4 HIS E 67  ? HIS A 67  . ? 1_555 ? 
57 AC3 5 CYS E 75  ? CYS A 75  . ? 1_555 ? 
58 AC3 5 SER E 77  ? SER A 77  . ? 1_555 ? 
59 AC3 5 CYS E 80  ? CYS A 80  . ? 1_555 ? 
60 AC3 5 HIS E 93  ? HIS A 93  . ? 1_555 ? 
61 AC3 5 HIS E 98  ? HIS A 98  . ? 1_555 ? 
62 AC4 4 CYS E 107 ? CYS A 107 . ? 1_555 ? 
63 AC4 4 CYS E 112 ? CYS A 112 . ? 1_555 ? 
64 AC4 4 HIS E 125 ? HIS A 125 . ? 1_555 ? 
65 AC4 4 HIS E 129 ? HIS A 129 . ? 1_555 ? 
66 AC5 4 CYS E 137 ? CYS A 137 . ? 1_555 ? 
67 AC5 4 CYS E 142 ? CYS A 142 . ? 1_555 ? 
68 AC5 4 HIS E 155 ? HIS A 155 . ? 1_555 ? 
69 AC5 4 HIS E 159 ? HIS A 159 . ? 1_555 ? 
70 AC6 4 CYS E 164 ? CYS A 164 . ? 1_555 ? 
71 AC6 4 CYS E 170 ? CYS A 170 . ? 1_555 ? 
72 AC6 4 HIS E 183 ? HIS A 183 . ? 1_555 ? 
73 AC6 4 HIS E 188 ? HIS A 188 . ? 1_555 ? 
74 AC7 4 CYS F 15  ? CYS D 15  . ? 1_555 ? 
75 AC7 4 CYS F 20  ? CYS D 20  . ? 1_555 ? 
76 AC7 4 HIS F 33  ? HIS D 33  . ? 1_555 ? 
77 AC7 4 HIS F 37  ? HIS D 37  . ? 1_555 ? 
78 AC8 4 CYS F 45  ? CYS D 45  . ? 1_555 ? 
79 AC8 4 CYS F 50  ? CYS D 50  . ? 1_555 ? 
80 AC8 4 HIS F 63  ? HIS D 63  . ? 1_555 ? 
81 AC8 4 HIS F 67  ? HIS D 67  . ? 1_555 ? 
82 AC9 5 CYS F 75  ? CYS D 75  . ? 1_555 ? 
83 AC9 5 SER F 77  ? SER D 77  . ? 1_555 ? 
84 AC9 5 CYS F 80  ? CYS D 80  . ? 1_555 ? 
85 AC9 5 HIS F 93  ? HIS D 93  . ? 1_555 ? 
86 AC9 5 HIS F 98  ? HIS D 98  . ? 1_555 ? 
87 BC1 4 CYS F 107 ? CYS D 107 . ? 1_555 ? 
88 BC1 4 CYS F 112 ? CYS D 112 . ? 1_555 ? 
89 BC1 4 HIS F 125 ? HIS D 125 . ? 1_555 ? 
90 BC1 4 HIS F 129 ? HIS D 129 . ? 1_555 ? 
91 BC2 4 CYS F 137 ? CYS D 137 . ? 1_555 ? 
92 BC2 4 CYS F 142 ? CYS D 142 . ? 1_555 ? 
93 BC2 4 HIS F 155 ? HIS D 155 . ? 1_555 ? 
94 BC2 4 HIS F 159 ? HIS D 159 . ? 1_555 ? 
95 BC3 4 CYS F 164 ? CYS D 164 . ? 1_555 ? 
96 BC3 4 CYS F 170 ? CYS D 170 . ? 1_555 ? 
97 BC3 4 HIS F 183 ? HIS D 183 . ? 1_555 ? 
98 BC3 4 HIS F 188 ? HIS D 188 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1TF6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TF6 
_atom_sites.fract_transf_matrix[1][1]   0.015581 
_atom_sites.fract_transf_matrix[1][2]   0.003583 
_atom_sites.fract_transf_matrix[1][3]   0.000859 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015856 
_atom_sites.fract_transf_matrix[2][3]   0.000210 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012833 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DA  A 1 1   ? 42.545 -2.878  76.210 1.00 77.78  ? 1   DA  B "O5'" 1 
ATOM   2    C  "C5'" . DA  A 1 1   ? 43.849 -3.280  76.637 1.00 76.71  ? 1   DA  B "C5'" 1 
ATOM   3    C  "C4'" . DA  A 1 1   ? 44.491 -2.249  77.536 1.00 74.53  ? 1   DA  B "C4'" 1 
ATOM   4    O  "O4'" . DA  A 1 1   ? 45.851 -2.648  77.832 1.00 70.89  ? 1   DA  B "O4'" 1 
ATOM   5    C  "C3'" . DA  A 1 1   ? 44.594 -0.855  76.921 1.00 73.69  ? 1   DA  B "C3'" 1 
ATOM   6    O  "O3'" . DA  A 1 1   ? 44.459 0.138   77.942 1.00 80.10  ? 1   DA  B "O3'" 1 
ATOM   7    C  "C2'" . DA  A 1 1   ? 45.998 -0.835  76.357 1.00 68.26  ? 1   DA  B "C2'" 1 
ATOM   8    C  "C1'" . DA  A 1 1   ? 46.754 -1.650  77.381 1.00 64.91  ? 1   DA  B "C1'" 1 
ATOM   9    N  N9    . DA  A 1 1   ? 47.915 -2.323  76.812 1.00 59.14  ? 1   DA  B N9    1 
ATOM   10   C  C8    . DA  A 1 1   ? 47.962 -3.473  76.060 1.00 57.70  ? 1   DA  B C8    1 
ATOM   11   N  N7    . DA  A 1 1   ? 49.170 -3.801  75.675 1.00 55.85  ? 1   DA  B N7    1 
ATOM   12   C  C5    . DA  A 1 1   ? 49.971 -2.804  76.213 1.00 53.85  ? 1   DA  B C5    1 
ATOM   13   C  C6    . DA  A 1 1   ? 51.350 -2.574  76.162 1.00 52.53  ? 1   DA  B C6    1 
ATOM   14   N  N6    . DA  A 1 1   ? 52.214 -3.366  75.515 1.00 51.86  ? 1   DA  B N6    1 
ATOM   15   N  N1    . DA  A 1 1   ? 51.822 -1.488  76.807 1.00 51.78  ? 1   DA  B N1    1 
ATOM   16   C  C2    . DA  A 1 1   ? 50.955 -0.699  77.456 1.00 51.02  ? 1   DA  B C2    1 
ATOM   17   N  N3    . DA  A 1 1   ? 49.645 -0.810  77.575 1.00 50.54  ? 1   DA  B N3    1 
ATOM   18   C  C4    . DA  A 1 1   ? 49.209 -1.894  76.922 1.00 54.01  ? 1   DA  B C4    1 
ATOM   19   P  P     . DC  A 1 2   ? 43.764 1.550   77.602 1.00 86.63  ? 2   DC  B P     1 
ATOM   20   O  OP1   . DC  A 1 2   ? 43.343 2.177   78.882 1.00 87.49  ? 2   DC  B OP1   1 
ATOM   21   O  OP2   . DC  A 1 2   ? 42.752 1.315   76.533 1.00 88.22  ? 2   DC  B OP2   1 
ATOM   22   O  "O5'" . DC  A 1 2   ? 44.937 2.439   76.992 1.00 84.94  ? 2   DC  B "O5'" 1 
ATOM   23   C  "C5'" . DC  A 1 2   ? 46.292 1.963   76.961 1.00 82.42  ? 2   DC  B "C5'" 1 
ATOM   24   C  "C4'" . DC  A 1 2   ? 47.212 2.973   77.601 1.00 81.26  ? 2   DC  B "C4'" 1 
ATOM   25   O  "O4'" . DC  A 1 2   ? 48.564 2.456   77.529 1.00 80.19  ? 2   DC  B "O4'" 1 
ATOM   26   C  "C3'" . DC  A 1 2   ? 47.251 4.289   76.834 1.00 81.83  ? 2   DC  B "C3'" 1 
ATOM   27   O  "O3'" . DC  A 1 2   ? 47.521 5.386   77.704 1.00 85.10  ? 2   DC  B "O3'" 1 
ATOM   28   C  "C2'" . DC  A 1 2   ? 48.345 4.060   75.808 1.00 79.50  ? 2   DC  B "C2'" 1 
ATOM   29   C  "C1'" . DC  A 1 2   ? 49.330 3.172   76.561 1.00 76.67  ? 2   DC  B "C1'" 1 
ATOM   30   N  N1    . DC  A 1 2   ? 50.026 2.184   75.708 1.00 71.24  ? 2   DC  B N1    1 
ATOM   31   C  C2    . DC  A 1 2   ? 51.429 2.217   75.627 1.00 66.76  ? 2   DC  B C2    1 
ATOM   32   O  O2    . DC  A 1 2   ? 52.053 3.069   76.277 1.00 65.81  ? 2   DC  B O2    1 
ATOM   33   N  N3    . DC  A 1 2   ? 52.066 1.318   74.841 1.00 63.73  ? 2   DC  B N3    1 
ATOM   34   C  C4    . DC  A 1 2   ? 51.361 0.415   74.157 1.00 65.42  ? 2   DC  B C4    1 
ATOM   35   N  N4    . DC  A 1 2   ? 52.026 -0.452  73.396 1.00 66.16  ? 2   DC  B N4    1 
ATOM   36   C  C5    . DC  A 1 2   ? 49.939 0.359   74.223 1.00 67.67  ? 2   DC  B C5    1 
ATOM   37   C  C6    . DC  A 1 2   ? 49.319 1.251   75.002 1.00 69.48  ? 2   DC  B C6    1 
ATOM   38   P  P     . DG  A 1 3   ? 47.342 6.889   77.165 1.00 88.18  ? 3   DG  B P     1 
ATOM   39   O  OP1   . DG  A 1 3   ? 46.867 7.731   78.291 1.00 89.87  ? 3   DG  B OP1   1 
ATOM   40   O  OP2   . DG  A 1 3   ? 46.563 6.855   75.899 1.00 88.13  ? 3   DG  B OP2   1 
ATOM   41   O  "O5'" . DG  A 1 3   ? 48.830 7.324   76.819 1.00 86.41  ? 3   DG  B "O5'" 1 
ATOM   42   C  "C5'" . DG  A 1 3   ? 49.776 7.587   77.868 1.00 84.78  ? 3   DG  B "C5'" 1 
ATOM   43   C  "C4'" . DG  A 1 3   ? 50.904 8.447   77.348 1.00 82.57  ? 3   DG  B "C4'" 1 
ATOM   44   O  "O4'" . DG  A 1 3   ? 51.705 7.654   76.438 1.00 79.18  ? 3   DG  B "O4'" 1 
ATOM   45   C  "C3'" . DG  A 1 3   ? 50.436 9.639   76.522 1.00 83.23  ? 3   DG  B "C3'" 1 
ATOM   46   O  "O3'" . DG  A 1 3   ? 51.349 10.731  76.668 1.00 89.05  ? 3   DG  B "O3'" 1 
ATOM   47   C  "C2'" . DG  A 1 3   ? 50.344 9.063   75.120 1.00 79.02  ? 3   DG  B "C2'" 1 
ATOM   48   C  "C1'" . DG  A 1 3   ? 51.483 8.050   75.088 1.00 75.29  ? 3   DG  B "C1'" 1 
ATOM   49   N  N9    . DG  A 1 3   ? 51.160 6.846   74.324 1.00 70.59  ? 3   DG  B N9    1 
ATOM   50   C  C8    . DG  A 1 3   ? 49.903 6.362   74.042 1.00 69.63  ? 3   DG  B C8    1 
ATOM   51   N  N7    . DG  A 1 3   ? 49.920 5.263   73.340 1.00 68.14  ? 3   DG  B N7    1 
ATOM   52   C  C5    . DG  A 1 3   ? 51.269 4.999   73.144 1.00 66.42  ? 3   DG  B C5    1 
ATOM   53   C  C6    . DG  A 1 3   ? 51.902 3.933   72.454 1.00 63.70  ? 3   DG  B C6    1 
ATOM   54   O  O6    . DG  A 1 3   ? 51.379 2.982   71.858 1.00 62.30  ? 3   DG  B O6    1 
ATOM   55   N  N1    . DG  A 1 3   ? 53.286 4.048   72.500 1.00 62.82  ? 3   DG  B N1    1 
ATOM   56   C  C2    . DG  A 1 3   ? 53.973 5.060   73.130 1.00 64.49  ? 3   DG  B C2    1 
ATOM   57   N  N2    . DG  A 1 3   ? 55.310 5.000   73.064 1.00 65.29  ? 3   DG  B N2    1 
ATOM   58   N  N3    . DG  A 1 3   ? 53.394 6.060   73.777 1.00 65.17  ? 3   DG  B N3    1 
ATOM   59   C  C4    . DG  A 1 3   ? 52.050 5.967   73.745 1.00 67.38  ? 3   DG  B C4    1 
ATOM   60   P  P     . DG  A 1 4   ? 51.468 11.854  75.519 1.00 93.15  ? 4   DG  B P     1 
ATOM   61   O  OP1   . DG  A 1 4   ? 51.776 13.150  76.177 1.00 93.50  ? 4   DG  B OP1   1 
ATOM   62   O  OP2   . DG  A 1 4   ? 50.287 11.757  74.618 1.00 94.19  ? 4   DG  B OP2   1 
ATOM   63   O  "O5'" . DG  A 1 4   ? 52.768 11.386  74.726 1.00 90.51  ? 4   DG  B "O5'" 1 
ATOM   64   C  "C5'" . DG  A 1 4   ? 53.943 10.972  75.453 1.00 86.72  ? 4   DG  B "C5'" 1 
ATOM   65   C  "C4'" . DG  A 1 4   ? 55.156 10.944  74.552 1.00 83.29  ? 4   DG  B "C4'" 1 
ATOM   66   O  "O4'" . DG  A 1 4   ? 55.036 9.830   73.635 1.00 80.40  ? 4   DG  B "O4'" 1 
ATOM   67   C  "C3'" . DG  A 1 4   ? 55.279 12.179  73.663 1.00 82.63  ? 4   DG  B "C3'" 1 
ATOM   68   O  "O3'" . DG  A 1 4   ? 56.654 12.452  73.373 1.00 83.02  ? 4   DG  B "O3'" 1 
ATOM   69   C  "C2'" . DG  A 1 4   ? 54.473 11.793  72.434 1.00 80.67  ? 4   DG  B "C2'" 1 
ATOM   70   C  "C1'" . DG  A 1 4   ? 54.754 10.295  72.319 1.00 77.99  ? 4   DG  B "C1'" 1 
ATOM   71   N  N9    . DG  A 1 4   ? 53.688 9.458   71.763 1.00 73.64  ? 4   DG  B N9    1 
ATOM   72   C  C8    . DG  A 1 4   ? 52.331 9.686   71.805 1.00 72.65  ? 4   DG  B C8    1 
ATOM   73   N  N7    . DG  A 1 4   ? 51.634 8.752   71.214 1.00 69.98  ? 4   DG  B N7    1 
ATOM   74   C  C5    . DG  A 1 4   ? 52.585 7.849   70.756 1.00 67.96  ? 4   DG  B C5    1 
ATOM   75   C  C6    . DG  A 1 4   ? 52.429 6.627   70.038 1.00 65.10  ? 4   DG  B C6    1 
ATOM   76   O  O6    . DG  A 1 4   ? 51.382 6.081   69.650 1.00 63.38  ? 4   DG  B O6    1 
ATOM   77   N  N1    . DG  A 1 4   ? 53.658 6.031   69.776 1.00 64.23  ? 4   DG  B N1    1 
ATOM   78   C  C2    . DG  A 1 4   ? 54.881 6.541   70.152 1.00 65.71  ? 4   DG  B C2    1 
ATOM   79   N  N2    . DG  A 1 4   ? 55.960 5.820   69.806 1.00 65.04  ? 4   DG  B N2    1 
ATOM   80   N  N3    . DG  A 1 4   ? 55.038 7.673   70.818 1.00 67.30  ? 4   DG  B N3    1 
ATOM   81   C  C4    . DG  A 1 4   ? 53.858 8.270   71.086 1.00 69.53  ? 4   DG  B C4    1 
ATOM   82   P  P     . DG  A 1 5   ? 57.097 13.927  72.903 1.00 82.21  ? 5   DG  B P     1 
ATOM   83   O  OP1   . DG  A 1 5   ? 58.163 14.408  73.817 1.00 83.78  ? 5   DG  B OP1   1 
ATOM   84   O  OP2   . DG  A 1 5   ? 55.866 14.743  72.709 1.00 83.62  ? 5   DG  B OP2   1 
ATOM   85   O  "O5'" . DG  A 1 5   ? 57.741 13.672  71.471 1.00 78.09  ? 5   DG  B "O5'" 1 
ATOM   86   C  "C5'" . DG  A 1 5   ? 57.113 12.757  70.573 1.00 72.38  ? 5   DG  B "C5'" 1 
ATOM   87   C  "C4'" . DG  A 1 5   ? 58.134 11.991  69.762 1.00 67.92  ? 5   DG  B "C4'" 1 
ATOM   88   O  "O4'" . DG  A 1 5   ? 57.571 10.696  69.477 1.00 64.79  ? 5   DG  B "O4'" 1 
ATOM   89   C  "C3'" . DG  A 1 5   ? 58.488 12.584  68.400 1.00 65.85  ? 5   DG  B "C3'" 1 
ATOM   90   O  "O3'" . DG  A 1 5   ? 59.789 12.151  67.971 1.00 63.05  ? 5   DG  B "O3'" 1 
ATOM   91   C  "C2'" . DG  A 1 5   ? 57.411 12.001  67.509 1.00 63.87  ? 5   DG  B "C2'" 1 
ATOM   92   C  "C1'" . DG  A 1 5   ? 57.163 10.628  68.120 1.00 59.33  ? 5   DG  B "C1'" 1 
ATOM   93   N  N9    . DG  A 1 5   ? 55.744 10.310  68.128 1.00 51.06  ? 5   DG  B N9    1 
ATOM   94   C  C8    . DG  A 1 5   ? 54.738 11.019  68.742 1.00 48.96  ? 5   DG  B C8    1 
ATOM   95   N  N7    . DG  A 1 5   ? 53.563 10.486  68.573 1.00 47.32  ? 5   DG  B N7    1 
ATOM   96   C  C5    . DG  A 1 5   ? 53.810 9.359   67.806 1.00 47.05  ? 5   DG  B C5    1 
ATOM   97   C  C6    . DG  A 1 5   ? 52.920 8.383   67.307 1.00 47.80  ? 5   DG  B C6    1 
ATOM   98   O  O6    . DG  A 1 5   ? 51.688 8.316   67.451 1.00 49.91  ? 5   DG  B O6    1 
ATOM   99   N  N1    . DG  A 1 5   ? 53.592 7.409   66.574 1.00 47.47  ? 5   DG  B N1    1 
ATOM   100  C  C2    . DG  A 1 5   ? 54.950 7.384   66.352 1.00 46.61  ? 5   DG  B C2    1 
ATOM   101  N  N2    . DG  A 1 5   ? 55.422 6.361   65.617 1.00 46.30  ? 5   DG  B N2    1 
ATOM   102  N  N3    . DG  A 1 5   ? 55.788 8.294   66.814 1.00 44.92  ? 5   DG  B N3    1 
ATOM   103  C  C4    . DG  A 1 5   ? 55.153 9.242   67.526 1.00 46.80  ? 5   DG  B C4    1 
ATOM   104  P  P     . DC  A 1 6   ? 60.316 12.522  66.493 1.00 60.96  ? 6   DC  B P     1 
ATOM   105  O  OP1   . DC  A 1 6   ? 61.769 12.226  66.475 1.00 60.59  ? 6   DC  B OP1   1 
ATOM   106  O  OP2   . DC  A 1 6   ? 59.836 13.891  66.142 1.00 59.74  ? 6   DC  B OP2   1 
ATOM   107  O  "O5'" . DC  A 1 6   ? 59.580 11.480  65.536 1.00 56.03  ? 6   DC  B "O5'" 1 
ATOM   108  C  "C5'" . DC  A 1 6   ? 60.015 10.109  65.486 1.00 51.18  ? 6   DC  B "C5'" 1 
ATOM   109  C  "C4'" . DC  A 1 6   ? 59.723 9.486   64.136 1.00 45.40  ? 6   DC  B "C4'" 1 
ATOM   110  O  "O4'" . DC  A 1 6   ? 58.331 9.106   64.062 1.00 42.38  ? 6   DC  B "O4'" 1 
ATOM   111  C  "C3'" . DC  A 1 6   ? 59.940 10.432  62.957 1.00 43.26  ? 6   DC  B "C3'" 1 
ATOM   112  O  "O3'" . DC  A 1 6   ? 60.263 9.665   61.782 1.00 44.67  ? 6   DC  B "O3'" 1 
ATOM   113  C  "C2'" . DC  A 1 6   ? 58.588 11.113  62.833 1.00 41.90  ? 6   DC  B "C2'" 1 
ATOM   114  C  "C1'" . DC  A 1 6   ? 57.640 9.970   63.176 1.00 40.22  ? 6   DC  B "C1'" 1 
ATOM   115  N  N1    . DC  A 1 6   ? 56.320 10.285  63.758 1.00 36.65  ? 6   DC  B N1    1 
ATOM   116  C  C2    . DC  A 1 6   ? 55.242 9.432   63.473 1.00 35.13  ? 6   DC  B C2    1 
ATOM   117  O  O2    . DC  A 1 6   ? 55.431 8.440   62.752 1.00 36.78  ? 6   DC  B O2    1 
ATOM   118  N  N3    . DC  A 1 6   ? 54.026 9.705   63.985 1.00 33.46  ? 6   DC  B N3    1 
ATOM   119  C  C4    . DC  A 1 6   ? 53.858 10.777  64.759 1.00 35.44  ? 6   DC  B C4    1 
ATOM   120  N  N4    . DC  A 1 6   ? 52.634 11.008  65.246 1.00 36.33  ? 6   DC  B N4    1 
ATOM   121  C  C5    . DC  A 1 6   ? 54.935 11.662  65.068 1.00 36.52  ? 6   DC  B C5    1 
ATOM   122  C  C6    . DC  A 1 6   ? 56.137 11.380  64.553 1.00 35.50  ? 6   DC  B C6    1 
ATOM   123  P  P     . DC  A 1 7   ? 60.971 10.373  60.511 1.00 44.95  ? 7   DC  B P     1 
ATOM   124  O  OP1   . DC  A 1 7   ? 61.884 9.388   59.868 1.00 43.86  ? 7   DC  B OP1   1 
ATOM   125  O  OP2   . DC  A 1 7   ? 61.502 11.700  60.939 1.00 47.35  ? 7   DC  B OP2   1 
ATOM   126  O  "O5'" . DC  A 1 7   ? 59.775 10.632  59.498 1.00 40.17  ? 7   DC  B "O5'" 1 
ATOM   127  C  "C5'" . DC  A 1 7   ? 58.423 10.520  59.935 1.00 34.94  ? 7   DC  B "C5'" 1 
ATOM   128  C  "C4'" . DC  A 1 7   ? 57.640 9.649   58.987 1.00 31.95  ? 7   DC  B "C4'" 1 
ATOM   129  O  "O4'" . DC  A 1 7   ? 56.365 9.380   59.608 1.00 32.01  ? 7   DC  B "O4'" 1 
ATOM   130  C  "C3'" . DC  A 1 7   ? 57.313 10.332  57.667 1.00 30.35  ? 7   DC  B "C3'" 1 
ATOM   131  O  "O3'" . DC  A 1 7   ? 57.208 9.391   56.599 1.00 29.10  ? 7   DC  B "O3'" 1 
ATOM   132  C  "C2'" . DC  A 1 7   ? 56.018 11.051  57.977 1.00 32.20  ? 7   DC  B "C2'" 1 
ATOM   133  C  "C1'" . DC  A 1 7   ? 55.329 10.123  58.977 1.00 31.03  ? 7   DC  B "C1'" 1 
ATOM   134  N  N1    . DC  A 1 7   ? 54.592 10.849  60.034 1.00 26.35  ? 7   DC  B N1    1 
ATOM   135  C  C2    . DC  A 1 7   ? 53.257 10.507  60.290 1.00 26.17  ? 7   DC  B C2    1 
ATOM   136  O  O2    . DC  A 1 7   ? 52.729 9.598   59.633 1.00 29.36  ? 7   DC  B O2    1 
ATOM   137  N  N3    . DC  A 1 7   ? 52.575 11.173  61.248 1.00 24.74  ? 7   DC  B N3    1 
ATOM   138  C  C4    . DC  A 1 7   ? 53.174 12.144  61.938 1.00 26.26  ? 7   DC  B C4    1 
ATOM   139  N  N4    . DC  A 1 7   ? 52.460 12.773  62.877 1.00 26.37  ? 7   DC  B N4    1 
ATOM   140  C  C5    . DC  A 1 7   ? 54.532 12.513  61.701 1.00 25.54  ? 7   DC  B C5    1 
ATOM   141  C  C6    . DC  A 1 7   ? 55.196 11.846  60.752 1.00 24.04  ? 7   DC  B C6    1 
ATOM   142  P  P     . DT  A 1 8   ? 56.809 9.899   55.126 1.00 29.43  ? 8   DT  B P     1 
ATOM   143  O  OP1   . DT  A 1 8   ? 57.185 8.874   54.111 1.00 26.02  ? 8   DT  B OP1   1 
ATOM   144  O  OP2   . DT  A 1 8   ? 57.284 11.295  54.968 1.00 27.72  ? 8   DT  B OP2   1 
ATOM   145  O  "O5'" . DT  A 1 8   ? 55.226 9.920   55.205 1.00 36.85  ? 8   DT  B "O5'" 1 
ATOM   146  C  "C5'" . DT  A 1 8   ? 54.502 8.709   55.483 1.00 42.90  ? 8   DT  B "C5'" 1 
ATOM   147  C  "C4'" . DT  A 1 8   ? 53.035 8.882   55.164 1.00 46.42  ? 8   DT  B "C4'" 1 
ATOM   148  O  "O4'" . DT  A 1 8   ? 52.403 9.654   56.215 1.00 44.48  ? 8   DT  B "O4'" 1 
ATOM   149  C  "C3'" . DT  A 1 8   ? 52.836 9.703   53.892 1.00 48.87  ? 8   DT  B "C3'" 1 
ATOM   150  O  "O3'" . DT  A 1 8   ? 51.612 9.345   53.254 1.00 51.22  ? 8   DT  B "O3'" 1 
ATOM   151  C  "C2'" . DT  A 1 8   ? 52.806 11.133  54.408 1.00 47.55  ? 8   DT  B "C2'" 1 
ATOM   152  C  "C1'" . DT  A 1 8   ? 52.086 10.951  55.737 1.00 42.81  ? 8   DT  B "C1'" 1 
ATOM   153  N  N1    . DT  A 1 8   ? 52.302 11.928  56.835 1.00 37.49  ? 8   DT  B N1    1 
ATOM   154  C  C2    . DT  A 1 8   ? 51.251 12.131  57.699 1.00 36.89  ? 8   DT  B C2    1 
ATOM   155  O  O2    . DT  A 1 8   ? 50.181 11.550  57.598 1.00 37.17  ? 8   DT  B O2    1 
ATOM   156  N  N3    . DT  A 1 8   ? 51.496 13.047  58.693 1.00 35.29  ? 8   DT  B N3    1 
ATOM   157  C  C4    . DT  A 1 8   ? 52.654 13.763  58.907 1.00 33.33  ? 8   DT  B C4    1 
ATOM   158  O  O4    . DT  A 1 8   ? 52.721 14.551  59.843 1.00 33.38  ? 8   DT  B O4    1 
ATOM   159  C  C5    . DT  A 1 8   ? 53.714 13.503  57.970 1.00 34.30  ? 8   DT  B C5    1 
ATOM   160  C  C7    . DT  A 1 8   ? 55.011 14.235  58.127 1.00 34.59  ? 8   DT  B C7    1 
ATOM   161  C  C6    . DT  A 1 8   ? 53.490 12.610  56.992 1.00 36.52  ? 8   DT  B C6    1 
ATOM   162  P  P     . DG  A 1 9   ? 51.434 9.603   51.683 1.00 53.68  ? 9   DG  B P     1 
ATOM   163  O  OP1   . DG  A 1 9   ? 51.754 8.365   50.970 1.00 51.85  ? 9   DG  B OP1   1 
ATOM   164  O  OP2   . DG  A 1 9   ? 52.140 10.838  51.318 1.00 55.39  ? 9   DG  B OP2   1 
ATOM   165  O  "O5'" . DG  A 1 9   ? 49.881 9.877   51.546 1.00 54.23  ? 9   DG  B "O5'" 1 
ATOM   166  C  "C5'" . DG  A 1 9   ? 48.942 8.866   51.896 1.00 56.47  ? 9   DG  B "C5'" 1 
ATOM   167  C  "C4'" . DG  A 1 9   ? 47.581 9.476   52.121 1.00 58.06  ? 9   DG  B "C4'" 1 
ATOM   168  O  "O4'" . DG  A 1 9   ? 47.668 10.373  53.257 1.00 56.65  ? 9   DG  B "O4'" 1 
ATOM   169  C  "C3'" . DG  A 1 9   ? 47.146 10.360  50.954 1.00 60.60  ? 9   DG  B "C3'" 1 
ATOM   170  O  "O3'" . DG  A 1 9   ? 45.721 10.350  50.809 1.00 65.32  ? 9   DG  B "O3'" 1 
ATOM   171  C  "C2'" . DG  A 1 9   ? 47.720 11.720  51.319 1.00 58.55  ? 9   DG  B "C2'" 1 
ATOM   172  C  "C1'" . DG  A 1 9   ? 47.585 11.728  52.833 1.00 54.94  ? 9   DG  B "C1'" 1 
ATOM   173  N  N9    . DG  A 1 9   ? 48.586 12.503  53.562 1.00 51.57  ? 9   DG  B N9    1 
ATOM   174  C  C8    . DG  A 1 9   ? 49.915 12.647  53.254 1.00 50.48  ? 9   DG  B C8    1 
ATOM   175  N  N7    . DG  A 1 9   ? 50.554 13.419  54.091 1.00 51.13  ? 9   DG  B N7    1 
ATOM   176  C  C5    . DG  A 1 9   ? 49.590 13.804  55.012 1.00 50.82  ? 9   DG  B C5    1 
ATOM   177  C  C6    . DG  A 1 9   ? 49.692 14.643  56.159 1.00 51.70  ? 9   DG  B C6    1 
ATOM   178  O  O6    . DG  A 1 9   ? 50.687 15.229  56.602 1.00 53.37  ? 9   DG  B O6    1 
ATOM   179  N  N1    . DG  A 1 9   ? 48.470 14.770  56.813 1.00 52.02  ? 9   DG  B N1    1 
ATOM   180  C  C2    . DG  A 1 9   ? 47.301 14.170  56.418 1.00 52.91  ? 9   DG  B C2    1 
ATOM   181  N  N2    . DG  A 1 9   ? 46.222 14.416  57.185 1.00 52.34  ? 9   DG  B N2    1 
ATOM   182  N  N3    . DG  A 1 9   ? 47.193 13.386  55.352 1.00 53.16  ? 9   DG  B N3    1 
ATOM   183  C  C4    . DG  A 1 9   ? 48.369 13.248  54.702 1.00 51.69  ? 9   DG  B C4    1 
ATOM   184  P  P     . DG  A 1 10  ? 44.996 11.486  49.936 1.00 70.44  ? 10  DG  B P     1 
ATOM   185  O  OP1   . DG  A 1 10  ? 43.681 10.997  49.522 1.00 72.03  ? 10  DG  B OP1   1 
ATOM   186  O  OP2   . DG  A 1 10  ? 45.946 11.940  48.906 1.00 72.43  ? 10  DG  B OP2   1 
ATOM   187  O  "O5'" . DG  A 1 10  ? 44.753 12.643  50.998 1.00 70.94  ? 10  DG  B "O5'" 1 
ATOM   188  C  "C5'" . DG  A 1 10  ? 44.096 12.342  52.239 1.00 73.84  ? 10  DG  B "C5'" 1 
ATOM   189  C  "C4'" . DG  A 1 10  ? 43.377 13.555  52.784 1.00 77.16  ? 10  DG  B "C4'" 1 
ATOM   190  O  "O4'" . DG  A 1 10  ? 44.281 14.335  53.602 1.00 77.05  ? 10  DG  B "O4'" 1 
ATOM   191  C  "C3'" . DG  A 1 10  ? 42.910 14.513  51.689 1.00 80.20  ? 10  DG  B "C3'" 1 
ATOM   192  O  "O3'" . DG  A 1 10  ? 41.755 15.228  52.154 1.00 85.51  ? 10  DG  B "O3'" 1 
ATOM   193  C  "C2'" . DG  A 1 10  ? 44.114 15.425  51.505 1.00 77.83  ? 10  DG  B "C2'" 1 
ATOM   194  C  "C1'" . DG  A 1 10  ? 44.616 15.547  52.938 1.00 74.59  ? 10  DG  B "C1'" 1 
ATOM   195  N  N9    . DG  A 1 10  ? 46.025 15.841  53.185 1.00 69.19  ? 10  DG  B N9    1 
ATOM   196  C  C8    . DG  A 1 10  ? 47.125 15.316  52.548 1.00 68.55  ? 10  DG  B C8    1 
ATOM   197  N  N7    . DG  A 1 10  ? 48.254 15.787  53.006 1.00 66.66  ? 10  DG  B N7    1 
ATOM   198  C  C5    . DG  A 1 10  ? 47.877 16.675  54.005 1.00 65.78  ? 10  DG  B C5    1 
ATOM   199  C  C6    . DG  A 1 10  ? 48.665 17.489  54.859 1.00 64.69  ? 10  DG  B C6    1 
ATOM   200  O  O6    . DG  A 1 10  ? 49.895 17.593  54.904 1.00 64.32  ? 10  DG  B O6    1 
ATOM   201  N  N1    . DG  A 1 10  ? 47.877 18.235  55.727 1.00 63.39  ? 10  DG  B N1    1 
ATOM   202  C  C2    . DG  A 1 10  ? 46.505 18.205  55.769 1.00 62.66  ? 10  DG  B C2    1 
ATOM   203  N  N2    . DG  A 1 10  ? 45.922 19.001  56.680 1.00 62.05  ? 10  DG  B N2    1 
ATOM   204  N  N3    . DG  A 1 10  ? 45.759 17.453  54.978 1.00 62.93  ? 10  DG  B N3    1 
ATOM   205  C  C4    . DG  A 1 10  ? 46.506 16.719  54.128 1.00 65.54  ? 10  DG  B C4    1 
ATOM   206  P  P     . DT  A 1 11  ? 40.923 16.164  51.144 1.00 89.42  ? 11  DT  B P     1 
ATOM   207  O  OP1   . DT  A 1 11  ? 39.505 15.857  51.353 1.00 89.81  ? 11  DT  B OP1   1 
ATOM   208  O  OP2   . DT  A 1 11  ? 41.483 16.034  49.785 1.00 90.24  ? 11  DT  B OP2   1 
ATOM   209  O  "O5'" . DT  A 1 11  ? 41.200 17.648  51.665 1.00 86.25  ? 11  DT  B "O5'" 1 
ATOM   210  C  "C5'" . DT  A 1 11  ? 42.480 18.028  52.225 1.00 82.08  ? 11  DT  B "C5'" 1 
ATOM   211  C  "C4'" . DT  A 1 11  ? 42.290 19.136  53.234 1.00 79.83  ? 11  DT  B "C4'" 1 
ATOM   212  O  "O4'" . DT  A 1 11  ? 43.553 19.395  53.900 1.00 77.00  ? 11  DT  B "O4'" 1 
ATOM   213  C  "C3'" . DT  A 1 11  ? 41.916 20.460  52.578 1.00 81.06  ? 11  DT  B "C3'" 1 
ATOM   214  O  "O3'" . DT  A 1 11  ? 41.093 21.243  53.448 1.00 84.13  ? 11  DT  B "O3'" 1 
ATOM   215  C  "C2'" . DT  A 1 11  ? 43.265 21.093  52.280 1.00 78.74  ? 11  DT  B "C2'" 1 
ATOM   216  C  "C1'" . DT  A 1 11  ? 44.110 20.637  53.464 1.00 75.10  ? 11  DT  B "C1'" 1 
ATOM   217  N  N1    . DT  A 1 11  ? 45.537 20.416  53.152 1.00 69.79  ? 11  DT  B N1    1 
ATOM   218  C  C2    . DT  A 1 11  ? 46.478 21.187  53.804 1.00 66.84  ? 11  DT  B C2    1 
ATOM   219  O  O2    . DT  A 1 11  ? 46.197 22.046  54.626 1.00 64.97  ? 11  DT  B O2    1 
ATOM   220  N  N3    . DT  A 1 11  ? 47.775 20.914  53.453 1.00 65.80  ? 11  DT  B N3    1 
ATOM   221  C  C4    . DT  A 1 11  ? 48.215 19.976  52.540 1.00 65.79  ? 11  DT  B C4    1 
ATOM   222  O  O4    . DT  A 1 11  ? 49.417 19.846  52.332 1.00 67.79  ? 11  DT  B O4    1 
ATOM   223  C  C5    . DT  A 1 11  ? 47.176 19.208  51.894 1.00 65.05  ? 11  DT  B C5    1 
ATOM   224  C  C7    . DT  A 1 11  ? 47.556 18.170  50.886 1.00 63.85  ? 11  DT  B C7    1 
ATOM   225  C  C6    . DT  A 1 11  ? 45.909 19.461  52.228 1.00 66.67  ? 11  DT  B C6    1 
ATOM   226  P  P     . DT  A 1 12  ? 40.747 22.764  53.064 1.00 86.36  ? 12  DT  B P     1 
ATOM   227  O  OP1   . DT  A 1 12  ? 39.587 23.197  53.883 1.00 86.73  ? 12  DT  B OP1   1 
ATOM   228  O  OP2   . DT  A 1 12  ? 40.679 22.870  51.583 1.00 86.34  ? 12  DT  B OP2   1 
ATOM   229  O  "O5'" . DT  A 1 12  ? 42.032 23.554  53.566 1.00 85.49  ? 12  DT  B "O5'" 1 
ATOM   230  C  "C5'" . DT  A 1 12  ? 42.453 23.441  54.936 1.00 85.45  ? 12  DT  B "C5'" 1 
ATOM   231  C  "C4'" . DT  A 1 12  ? 43.257 24.651  55.354 1.00 85.42  ? 12  DT  B "C4'" 1 
ATOM   232  O  "O4'" . DT  A 1 12  ? 44.642 24.487  54.962 1.00 84.83  ? 12  DT  B "O4'" 1 
ATOM   233  C  "C3'" . DT  A 1 12  ? 42.791 25.916  54.637 1.00 85.61  ? 12  DT  B "C3'" 1 
ATOM   234  O  "O3'" . DT  A 1 12  ? 43.094 27.052  55.442 1.00 89.70  ? 12  DT  B "O3'" 1 
ATOM   235  C  "C2'" . DT  A 1 12  ? 43.627 25.915  53.367 1.00 83.59  ? 12  DT  B "C2'" 1 
ATOM   236  C  "C1'" . DT  A 1 12  ? 44.945 25.373  53.895 1.00 81.03  ? 12  DT  B "C1'" 1 
ATOM   237  N  N1    . DT  A 1 12  ? 45.891 24.707  52.973 1.00 75.09  ? 12  DT  B N1    1 
ATOM   238  C  C2    . DT  A 1 12  ? 47.223 25.015  53.130 1.00 72.12  ? 12  DT  B C2    1 
ATOM   239  O  O2    . DT  A 1 12  ? 47.634 25.789  53.979 1.00 69.81  ? 12  DT  B O2    1 
ATOM   240  N  N3    . DT  A 1 12  ? 48.065 24.384  52.254 1.00 72.40  ? 12  DT  B N3    1 
ATOM   241  C  C4    . DT  A 1 12  ? 47.720 23.494  51.258 1.00 72.86  ? 12  DT  B C4    1 
ATOM   242  O  O4    . DT  A 1 12  ? 48.599 23.005  50.546 1.00 74.43  ? 12  DT  B O4    1 
ATOM   243  C  C5    . DT  A 1 12  ? 46.306 23.214  51.145 1.00 71.91  ? 12  DT  B C5    1 
ATOM   244  C  C7    . DT  A 1 12  ? 45.834 22.260  50.091 1.00 70.46  ? 12  DT  B C7    1 
ATOM   245  C  C6    . DT  A 1 12  ? 45.472 23.826  51.998 1.00 73.08  ? 12  DT  B C6    1 
ATOM   246  P  P     . DA  A 1 13  ? 42.459 28.476  55.077 1.00 94.67  ? 13  DA  B P     1 
ATOM   247  O  OP1   . DA  A 1 13  ? 41.062 28.509  55.584 1.00 96.50  ? 13  DA  B OP1   1 
ATOM   248  O  OP2   . DA  A 1 13  ? 42.718 28.740  53.635 1.00 96.36  ? 13  DA  B OP2   1 
ATOM   249  O  "O5'" . DA  A 1 13  ? 43.336 29.487  55.934 1.00 92.57  ? 13  DA  B "O5'" 1 
ATOM   250  C  "C5'" . DA  A 1 13  ? 43.949 30.620  55.319 1.00 92.91  ? 13  DA  B "C5'" 1 
ATOM   251  C  "C4'" . DA  A 1 13  ? 45.354 30.786  55.840 1.00 94.34  ? 13  DA  B "C4'" 1 
ATOM   252  O  "O4'" . DA  A 1 13  ? 46.166 29.683  55.352 1.00 95.00  ? 13  DA  B "O4'" 1 
ATOM   253  C  "C3'" . DA  A 1 13  ? 46.013 32.037  55.272 1.00 95.91  ? 13  DA  B "C3'" 1 
ATOM   254  O  "O3'" . DA  A 1 13  ? 46.953 32.559  56.215 1.00 97.55  ? 13  DA  B "O3'" 1 
ATOM   255  C  "C2'" . DA  A 1 13  ? 46.642 31.546  53.978 1.00 96.04  ? 13  DA  B "C2'" 1 
ATOM   256  C  "C1'" . DA  A 1 13  ? 47.080 30.138  54.348 1.00 96.19  ? 13  DA  B "C1'" 1 
ATOM   257  N  N9    . DA  A 1 13  ? 47.081 29.175  53.239 1.00 96.86  ? 13  DA  B N9    1 
ATOM   258  C  C8    . DA  A 1 13  ? 46.007 28.515  52.690 1.00 97.57  ? 13  DA  B C8    1 
ATOM   259  N  N7    . DA  A 1 13  ? 46.325 27.715  51.701 1.00 96.35  ? 13  DA  B N7    1 
ATOM   260  C  C5    . DA  A 1 13  ? 47.700 27.854  51.588 1.00 94.96  ? 13  DA  B C5    1 
ATOM   261  C  C6    . DA  A 1 13  ? 48.635 27.265  50.727 1.00 93.79  ? 13  DA  B C6    1 
ATOM   262  N  N6    . DA  A 1 13  ? 48.312 26.387  49.779 1.00 95.52  ? 13  DA  B N6    1 
ATOM   263  N  N1    . DA  A 1 13  ? 49.931 27.611  50.874 1.00 92.43  ? 13  DA  B N1    1 
ATOM   264  C  C2    . DA  A 1 13  ? 50.253 28.491  51.827 1.00 92.81  ? 13  DA  B C2    1 
ATOM   265  N  N3    . DA  A 1 13  ? 49.466 29.115  52.697 1.00 94.11  ? 13  DA  B N3    1 
ATOM   266  C  C4    . DA  A 1 13  ? 48.182 28.748  52.527 1.00 95.49  ? 13  DA  B C4    1 
ATOM   267  P  P     . DG  A 1 14  ? 48.002 33.680  55.755 1.00 99.25  ? 14  DG  B P     1 
ATOM   268  O  OP1   . DG  A 1 14  ? 48.695 34.186  56.972 1.00 99.86  ? 14  DG  B OP1   1 
ATOM   269  O  OP2   . DG  A 1 14  ? 47.307 34.640  54.855 1.00 100.00 ? 14  DG  B OP2   1 
ATOM   270  O  "O5'" . DG  A 1 14  ? 49.029 32.849  54.866 1.00 96.41  ? 14  DG  B "O5'" 1 
ATOM   271  C  "C5'" . DG  A 1 14  ? 50.206 32.271  55.445 1.00 92.95  ? 14  DG  B "C5'" 1 
ATOM   272  C  "C4'" . DG  A 1 14  ? 51.412 32.621  54.607 1.00 89.69  ? 14  DG  B "C4'" 1 
ATOM   273  O  "O4'" . DG  A 1 14  ? 51.357 31.870  53.374 1.00 87.50  ? 14  DG  B "O4'" 1 
ATOM   274  C  "C3'" . DG  A 1 14  ? 51.401 34.087  54.178 1.00 88.94  ? 14  DG  B "C3'" 1 
ATOM   275  O  "O3'" . DG  A 1 14  ? 52.742 34.540  53.979 1.00 92.20  ? 14  DG  B "O3'" 1 
ATOM   276  C  "C2'" . DG  A 1 14  ? 50.599 34.060  52.884 1.00 85.56  ? 14  DG  B "C2'" 1 
ATOM   277  C  "C1'" . DG  A 1 14  ? 51.039 32.733  52.289 1.00 84.06  ? 14  DG  B "C1'" 1 
ATOM   278  N  N9    . DG  A 1 14  ? 50.143 32.014  51.384 1.00 79.40  ? 14  DG  B N9    1 
ATOM   279  C  C8    . DG  A 1 14  ? 48.769 31.953  51.409 1.00 77.43  ? 14  DG  B C8    1 
ATOM   280  N  N7    . DG  A 1 14  ? 48.272 31.211  50.454 1.00 74.20  ? 14  DG  B N7    1 
ATOM   281  C  C5    . DG  A 1 14  ? 49.383 30.757  49.758 1.00 72.11  ? 14  DG  B C5    1 
ATOM   282  C  C6    . DG  A 1 14  ? 49.477 29.914  48.622 1.00 69.78  ? 14  DG  B C6    1 
ATOM   283  O  O6    . DG  A 1 14  ? 48.568 29.379  47.978 1.00 68.77  ? 14  DG  B O6    1 
ATOM   284  N  N1    . DG  A 1 14  ? 50.802 29.710  48.246 1.00 69.50  ? 14  DG  B N1    1 
ATOM   285  C  C2    . DG  A 1 14  ? 51.896 30.247  48.881 1.00 69.03  ? 14  DG  B C2    1 
ATOM   286  N  N2    . DG  A 1 14  ? 53.102 29.938  48.373 1.00 68.34  ? 14  DG  B N2    1 
ATOM   287  N  N3    . DG  A 1 14  ? 51.820 31.031  49.937 1.00 71.06  ? 14  DG  B N3    1 
ATOM   288  C  C4    . DG  A 1 14  ? 50.544 31.244  50.318 1.00 74.55  ? 14  DG  B C4    1 
ATOM   289  P  P     . DT  A 1 15  ? 53.019 36.079  53.614 1.00 96.69  ? 15  DT  B P     1 
ATOM   290  O  OP1   . DT  A 1 15  ? 54.107 36.579  54.491 1.00 98.71  ? 15  DT  B OP1   1 
ATOM   291  O  OP2   . DT  A 1 15  ? 51.715 36.790  53.586 1.00 98.02  ? 15  DT  B OP2   1 
ATOM   292  O  "O5'" . DT  A 1 15  ? 53.576 36.017  52.123 1.00 96.39  ? 15  DT  B "O5'" 1 
ATOM   293  C  "C5'" . DT  A 1 15  ? 53.026 35.090  51.168 1.00 93.54  ? 15  DT  B "C5'" 1 
ATOM   294  C  "C4'" . DT  A 1 15  ? 54.003 34.866  50.039 1.00 90.84  ? 15  DT  B "C4'" 1 
ATOM   295  O  "O4'" . DT  A 1 15  ? 53.468 33.866  49.144 1.00 89.55  ? 15  DT  B "O4'" 1 
ATOM   296  C  "C3'" . DT  A 1 15  ? 54.182 36.110  49.177 1.00 89.24  ? 15  DT  B "C3'" 1 
ATOM   297  O  "O3'" . DT  A 1 15  ? 55.457 36.043  48.543 1.00 90.85  ? 15  DT  B "O3'" 1 
ATOM   298  C  "C2'" . DT  A 1 15  ? 53.072 35.973  48.152 1.00 87.13  ? 15  DT  B "C2'" 1 
ATOM   299  C  "C1'" . DT  A 1 15  ? 53.046 34.470  47.930 1.00 86.80  ? 15  DT  B "C1'" 1 
ATOM   300  N  N1    . DT  A 1 15  ? 51.766 33.849  47.528 1.00 85.26  ? 15  DT  B N1    1 
ATOM   301  C  C2    . DT  A 1 15  ? 51.800 32.937  46.496 1.00 85.51  ? 15  DT  B C2    1 
ATOM   302  O  O2    . DT  A 1 15  ? 52.825 32.626  45.905 1.00 86.26  ? 15  DT  B O2    1 
ATOM   303  N  N3    . DT  A 1 15  ? 50.585 32.396  46.174 1.00 85.20  ? 15  DT  B N3    1 
ATOM   304  C  C4    . DT  A 1 15  ? 49.367 32.662  46.759 1.00 85.29  ? 15  DT  B C4    1 
ATOM   305  O  O4    . DT  A 1 15  ? 48.359 32.089  46.356 1.00 86.77  ? 15  DT  B O4    1 
ATOM   306  C  C5    . DT  A 1 15  ? 49.399 33.626  47.833 1.00 84.39  ? 15  DT  B C5    1 
ATOM   307  C  C7    . DT  A 1 15  ? 48.122 33.979  48.529 1.00 84.52  ? 15  DT  B C7    1 
ATOM   308  C  C6    . DT  A 1 15  ? 50.581 34.165  48.160 1.00 84.37  ? 15  DT  B C6    1 
ATOM   309  P  P     . DA  A 1 16  ? 56.319 37.378  48.335 1.00 92.69  ? 16  DA  B P     1 
ATOM   310  O  OP1   . DA  A 1 16  ? 57.405 37.344  49.320 1.00 92.59  ? 16  DA  B OP1   1 
ATOM   311  O  OP2   . DA  A 1 16  ? 55.410 38.534  48.321 1.00 94.04  ? 16  DA  B OP2   1 
ATOM   312  O  "O5'" . DA  A 1 16  ? 56.940 37.186  46.877 1.00 92.48  ? 16  DA  B "O5'" 1 
ATOM   313  C  "C5'" . DA  A 1 16  ? 57.939 36.170  46.636 1.00 91.81  ? 16  DA  B "C5'" 1 
ATOM   314  C  "C4'" . DA  A 1 16  ? 58.025 35.808  45.166 1.00 89.36  ? 16  DA  B "C4'" 1 
ATOM   315  O  "O4'" . DA  A 1 16  ? 56.799 35.156  44.742 1.00 88.30  ? 16  DA  B "O4'" 1 
ATOM   316  C  "C3'" . DA  A 1 16  ? 58.152 37.025  44.251 1.00 87.30  ? 16  DA  B "C3'" 1 
ATOM   317  O  "O3'" . DA  A 1 16  ? 58.873 36.651  43.068 1.00 87.95  ? 16  DA  B "O3'" 1 
ATOM   318  C  "C2'" . DA  A 1 16  ? 56.706 37.393  43.973 1.00 86.55  ? 16  DA  B "C2'" 1 
ATOM   319  C  "C1'" . DA  A 1 16  ? 56.054 36.021  43.890 1.00 85.95  ? 16  DA  B "C1'" 1 
ATOM   320  N  N9    . DA  A 1 16  ? 54.641 35.946  44.253 1.00 83.89  ? 16  DA  B N9    1 
ATOM   321  C  C8    . DA  A 1 16  ? 53.951 36.699  45.170 1.00 84.73  ? 16  DA  B C8    1 
ATOM   322  N  N7    . DA  A 1 16  ? 52.679 36.397  45.251 1.00 83.71  ? 16  DA  B N7    1 
ATOM   323  C  C5    . DA  A 1 16  ? 52.520 35.373  44.324 1.00 80.39  ? 16  DA  B C5    1 
ATOM   324  C  C6    . DA  A 1 16  ? 51.405 34.614  43.927 1.00 77.20  ? 16  DA  B C6    1 
ATOM   325  N  N6    . DA  A 1 16  ? 50.181 34.768  44.431 1.00 76.34  ? 16  DA  B N6    1 
ATOM   326  N  N1    . DA  A 1 16  ? 51.593 33.674  42.980 1.00 75.62  ? 16  DA  B N1    1 
ATOM   327  C  C2    . DA  A 1 16  ? 52.818 33.514  42.471 1.00 77.65  ? 16  DA  B C2    1 
ATOM   328  N  N3    . DA  A 1 16  ? 53.939 34.161  42.758 1.00 79.12  ? 16  DA  B N3    1 
ATOM   329  C  C4    . DA  A 1 16  ? 53.722 35.087  43.705 1.00 80.82  ? 16  DA  B C4    1 
ATOM   330  P  P     . DC  A 1 17  ? 58.380 37.162  41.623 1.00 90.15  ? 17  DC  B P     1 
ATOM   331  O  OP1   . DC  A 1 17  ? 59.443 36.858  40.628 1.00 91.70  ? 17  DC  B OP1   1 
ATOM   332  O  OP2   . DC  A 1 17  ? 57.897 38.558  41.774 1.00 92.38  ? 17  DC  B OP2   1 
ATOM   333  O  "O5'" . DC  A 1 17  ? 57.133 36.228  41.296 1.00 87.45  ? 17  DC  B "O5'" 1 
ATOM   334  C  "C5'" . DC  A 1 17  ? 57.307 34.808  41.182 1.00 85.97  ? 17  DC  B "C5'" 1 
ATOM   335  C  "C4'" . DC  A 1 17  ? 56.723 34.301  39.884 1.00 84.71  ? 17  DC  B "C4'" 1 
ATOM   336  O  "O4'" . DC  A 1 17  ? 55.282 34.278  39.990 1.00 82.90  ? 17  DC  B "O4'" 1 
ATOM   337  C  "C3'" . DC  A 1 17  ? 57.018 35.211  38.693 1.00 85.22  ? 17  DC  B "C3'" 1 
ATOM   338  O  "O3'" . DC  A 1 17  ? 57.024 34.437  37.484 1.00 90.05  ? 17  DC  B "O3'" 1 
ATOM   339  C  "C2'" . DC  A 1 17  ? 55.864 36.197  38.730 1.00 82.10  ? 17  DC  B "C2'" 1 
ATOM   340  C  "C1'" . DC  A 1 17  ? 54.713 35.310  39.197 1.00 80.09  ? 17  DC  B "C1'" 1 
ATOM   341  N  N1    . DC  A 1 17  ? 53.635 35.943  39.978 1.00 75.67  ? 17  DC  B N1    1 
ATOM   342  C  C2    . DC  A 1 17  ? 52.300 35.613  39.679 1.00 73.04  ? 17  DC  B C2    1 
ATOM   343  O  O2    . DC  A 1 17  ? 52.065 34.799  38.769 1.00 71.63  ? 17  DC  B O2    1 
ATOM   344  N  N3    . DC  A 1 17  ? 51.304 36.188  40.390 1.00 72.60  ? 17  DC  B N3    1 
ATOM   345  C  C4    . DC  A 1 17  ? 51.595 37.056  41.361 1.00 74.83  ? 17  DC  B C4    1 
ATOM   346  N  N4    . DC  A 1 17  ? 50.579 37.599  42.037 1.00 76.14  ? 17  DC  B N4    1 
ATOM   347  C  C5    . DC  A 1 17  ? 52.939 37.408  41.683 1.00 75.69  ? 17  DC  B C5    1 
ATOM   348  C  C6    . DC  A 1 17  ? 53.917 36.833  40.975 1.00 75.04  ? 17  DC  B C6    1 
ATOM   349  P  P     . DC  A 1 18  ? 57.536 35.093  36.104 1.00 91.63  ? 18  DC  B P     1 
ATOM   350  O  OP1   . DC  A 1 18  ? 58.491 34.158  35.484 1.00 93.29  ? 18  DC  B OP1   1 
ATOM   351  O  OP2   . DC  A 1 18  ? 57.961 36.474  36.363 1.00 91.08  ? 18  DC  B OP2   1 
ATOM   352  O  "O5'" . DC  A 1 18  ? 56.226 35.146  35.200 1.00 87.07  ? 18  DC  B "O5'" 1 
ATOM   353  C  "C5'" . DC  A 1 18  ? 54.945 35.425  35.786 1.00 83.17  ? 18  DC  B "C5'" 1 
ATOM   354  C  "C4'" . DC  A 1 18  ? 53.862 34.667  35.055 1.00 80.28  ? 18  DC  B "C4'" 1 
ATOM   355  O  "O4'" . DC  A 1 18  ? 52.619 34.844  35.781 1.00 79.68  ? 18  DC  B "O4'" 1 
ATOM   356  C  "C3'" . DC  A 1 18  ? 53.583 35.204  33.656 1.00 80.02  ? 18  DC  B "C3'" 1 
ATOM   357  O  "O3'" . DC  A 1 18  ? 53.149 34.157  32.778 1.00 79.95  ? 18  DC  B "O3'" 1 
ATOM   358  C  "C2'" . DC  A 1 18  ? 52.544 36.285  33.909 1.00 79.48  ? 18  DC  B "C2'" 1 
ATOM   359  C  "C1'" . DC  A 1 18  ? 51.738 35.727  35.081 1.00 76.74  ? 18  DC  B "C1'" 1 
ATOM   360  N  N1    . DC  A 1 18  ? 51.287 36.756  36.038 1.00 71.80  ? 18  DC  B N1    1 
ATOM   361  C  C2    . DC  A 1 18  ? 49.929 36.821  36.383 1.00 69.16  ? 18  DC  B C2    1 
ATOM   362  O  O2    . DC  A 1 18  ? 49.135 36.012  35.875 1.00 68.06  ? 18  DC  B O2    1 
ATOM   363  N  N3    . DC  A 1 18  ? 49.519 37.763  37.264 1.00 67.19  ? 18  DC  B N3    1 
ATOM   364  C  C4    . DC  A 1 18  ? 50.403 38.615  37.792 1.00 67.54  ? 18  DC  B C4    1 
ATOM   365  N  N4    . DC  A 1 18  ? 49.956 39.525  38.655 1.00 67.48  ? 18  DC  B N4    1 
ATOM   366  C  C5    . DC  A 1 18  ? 51.786 38.571  37.458 1.00 68.01  ? 18  DC  B C5    1 
ATOM   367  C  C6    . DC  A 1 18  ? 52.180 37.638  36.587 1.00 69.89  ? 18  DC  B C6    1 
ATOM   368  P  P     . DT  A 1 19  ? 52.497 34.524  31.353 1.00 80.46  ? 19  DT  B P     1 
ATOM   369  O  OP1   . DT  A 1 19  ? 52.462 33.318  30.522 1.00 80.45  ? 19  DT  B OP1   1 
ATOM   370  O  OP2   . DT  A 1 19  ? 53.162 35.721  30.829 1.00 80.51  ? 19  DT  B OP2   1 
ATOM   371  O  "O5'" . DT  A 1 19  ? 51.001 34.903  31.744 1.00 82.32  ? 19  DT  B "O5'" 1 
ATOM   372  C  "C5'" . DT  A 1 19  ? 50.169 33.954  32.443 1.00 83.18  ? 19  DT  B "C5'" 1 
ATOM   373  C  "C4'" . DT  A 1 19  ? 48.707 34.204  32.150 1.00 82.88  ? 19  DT  B "C4'" 1 
ATOM   374  O  "O4'" . DT  A 1 19  ? 48.219 35.258  33.017 1.00 82.25  ? 19  DT  B "O4'" 1 
ATOM   375  C  "C3'" . DT  A 1 19  ? 48.484 34.721  30.733 1.00 83.30  ? 19  DT  B "C3'" 1 
ATOM   376  O  "O3'" . DT  A 1 19  ? 47.222 34.323  30.208 1.00 85.33  ? 19  DT  B "O3'" 1 
ATOM   377  C  "C2'" . DT  A 1 19  ? 48.605 36.224  30.891 1.00 82.58  ? 19  DT  B "C2'" 1 
ATOM   378  C  "C1'" . DT  A 1 19  ? 47.998 36.451  32.273 1.00 79.58  ? 19  DT  B "C1'" 1 
ATOM   379  N  N1    . DT  A 1 19  ? 48.537 37.587  33.053 1.00 75.64  ? 19  DT  B N1    1 
ATOM   380  C  C2    . DT  A 1 19  ? 47.684 38.215  33.931 1.00 75.19  ? 19  DT  B C2    1 
ATOM   381  O  O2    . DT  A 1 19  ? 46.520 37.877  34.094 1.00 75.17  ? 19  DT  B O2    1 
ATOM   382  N  N3    . DT  A 1 19  ? 48.244 39.262  34.617 1.00 73.99  ? 19  DT  B N3    1 
ATOM   383  C  C4    . DT  A 1 19  ? 49.536 39.734  34.516 1.00 72.43  ? 19  DT  B C4    1 
ATOM   384  O  O4    . DT  A 1 19  ? 49.890 40.688  35.199 1.00 73.23  ? 19  DT  B O4    1 
ATOM   385  C  C5    . DT  A 1 19  ? 50.377 39.031  33.580 1.00 70.93  ? 19  DT  B C5    1 
ATOM   386  C  C7    . DT  A 1 19  ? 51.796 39.474  33.403 1.00 69.42  ? 19  DT  B C7    1 
ATOM   387  C  C6    . DT  A 1 19  ? 49.845 38.006  32.905 1.00 72.42  ? 19  DT  B C6    1 
ATOM   388  P  P     . DG  A 1 20  ? 47.156 33.682  28.740 1.00 89.37  ? 20  DG  B P     1 
ATOM   389  O  OP1   . DG  A 1 20  ? 47.134 32.204  28.890 1.00 91.00  ? 20  DG  B OP1   1 
ATOM   390  O  OP2   . DG  A 1 20  ? 48.209 34.323  27.906 1.00 90.15  ? 20  DG  B OP2   1 
ATOM   391  O  "O5'" . DG  A 1 20  ? 45.746 34.152  28.184 1.00 87.43  ? 20  DG  B "O5'" 1 
ATOM   392  C  "C5'" . DG  A 1 20  ? 45.437 35.544  28.061 1.00 85.82  ? 20  DG  B "C5'" 1 
ATOM   393  C  "C4'" . DG  A 1 20  ? 44.278 35.887  28.965 1.00 84.55  ? 20  DG  B "C4'" 1 
ATOM   394  O  "O4'" . DG  A 1 20  ? 44.778 36.653  30.086 1.00 82.59  ? 20  DG  B "O4'" 1 
ATOM   395  C  "C3'" . DG  A 1 20  ? 43.241 36.788  28.309 1.00 84.04  ? 20  DG  B "C3'" 1 
ATOM   396  O  "O3'" . DG  A 1 20  ? 41.955 36.527  28.877 1.00 85.53  ? 20  DG  B "O3'" 1 
ATOM   397  C  "C2'" . DG  A 1 20  ? 43.770 38.181  28.595 1.00 81.43  ? 20  DG  B "C2'" 1 
ATOM   398  C  "C1'" . DG  A 1 20  ? 44.396 38.022  29.970 1.00 79.86  ? 20  DG  B "C1'" 1 
ATOM   399  N  N9    . DG  A 1 20  ? 45.587 38.835  30.205 1.00 77.67  ? 20  DG  B N9    1 
ATOM   400  C  C8    . DG  A 1 20  ? 46.819 38.684  29.612 1.00 77.16  ? 20  DG  B C8    1 
ATOM   401  N  N7    . DG  A 1 20  ? 47.700 39.552  30.030 1.00 75.66  ? 20  DG  B N7    1 
ATOM   402  C  C5    . DG  A 1 20  ? 47.011 40.326  30.953 1.00 75.10  ? 20  DG  B C5    1 
ATOM   403  C  C6    . DG  A 1 20  ? 47.449 41.427  31.737 1.00 74.02  ? 20  DG  B C6    1 
ATOM   404  O  O6    . DG  A 1 20  ? 48.572 41.953  31.774 1.00 72.64  ? 20  DG  B O6    1 
ATOM   405  N  N1    . DG  A 1 20  ? 46.427 41.921  32.541 1.00 74.39  ? 20  DG  B N1    1 
ATOM   406  C  C2    . DG  A 1 20  ? 45.146 41.419  32.586 1.00 75.77  ? 20  DG  B C2    1 
ATOM   407  N  N2    . DG  A 1 20  ? 44.295 42.033  33.429 1.00 76.17  ? 20  DG  B N2    1 
ATOM   408  N  N3    . DG  A 1 20  ? 44.726 40.392  31.860 1.00 75.79  ? 20  DG  B N3    1 
ATOM   409  C  C4    . DG  A 1 20  ? 45.704 39.898  31.072 1.00 76.06  ? 20  DG  B C4    1 
ATOM   410  P  P     . DG  A 1 21  ? 40.646 37.199  28.237 1.00 87.29  ? 21  DG  B P     1 
ATOM   411  O  OP1   . DG  A 1 21  ? 39.465 36.410  28.667 1.00 89.19  ? 21  DG  B OP1   1 
ATOM   412  O  OP2   . DG  A 1 21  ? 40.881 37.430  26.788 1.00 86.22  ? 21  DG  B OP2   1 
ATOM   413  O  "O5'" . DG  A 1 21  ? 40.592 38.601  28.986 1.00 86.27  ? 21  DG  B "O5'" 1 
ATOM   414  C  "C5'" . DG  A 1 21  ? 40.333 38.661  30.403 1.00 82.63  ? 21  DG  B "C5'" 1 
ATOM   415  C  "C4'" . DG  A 1 21  ? 39.818 40.029  30.791 1.00 79.79  ? 21  DG  B "C4'" 1 
ATOM   416  O  "O4'" . DG  A 1 21  ? 40.935 40.937  30.971 1.00 77.80  ? 21  DG  B "O4'" 1 
ATOM   417  C  "C3'" . DG  A 1 21  ? 38.959 40.674  29.706 1.00 77.65  ? 21  DG  B "C3'" 1 
ATOM   418  O  "O3'" . DG  A 1 21  ? 37.958 41.515  30.296 1.00 75.47  ? 21  DG  B "O3'" 1 
ATOM   419  C  "C2'" . DG  A 1 21  ? 39.984 41.409  28.853 1.00 76.54  ? 21  DG  B "C2'" 1 
ATOM   420  C  "C1'" . DG  A 1 21  ? 40.999 41.872  29.896 1.00 74.07  ? 21  DG  B "C1'" 1 
ATOM   421  N  N9    . DG  A 1 21  ? 42.401 41.992  29.489 1.00 67.29  ? 21  DG  B N9    1 
ATOM   422  C  C8    . DG  A 1 21  ? 43.092 41.207  28.599 1.00 64.78  ? 21  DG  B C8    1 
ATOM   423  N  N7    . DG  A 1 21  ? 44.339 41.562  28.460 1.00 61.57  ? 21  DG  B N7    1 
ATOM   424  C  C5    . DG  A 1 21  ? 44.481 42.650  29.307 1.00 60.68  ? 21  DG  B C5    1 
ATOM   425  C  C6    . DG  A 1 21  ? 45.613 43.460  29.581 1.00 59.00  ? 21  DG  B C6    1 
ATOM   426  O  O6    . DG  A 1 21  ? 46.757 43.377  29.114 1.00 58.23  ? 21  DG  B O6    1 
ATOM   427  N  N1    . DG  A 1 21  ? 45.315 44.458  30.503 1.00 59.26  ? 21  DG  B N1    1 
ATOM   428  C  C2    . DG  A 1 21  ? 44.085 44.650  31.087 1.00 62.24  ? 21  DG  B C2    1 
ATOM   429  N  N2    . DG  A 1 21  ? 43.983 45.669  31.958 1.00 63.33  ? 21  DG  B N2    1 
ATOM   430  N  N3    . DG  A 1 21  ? 43.026 43.901  30.838 1.00 63.85  ? 21  DG  B N3    1 
ATOM   431  C  C4    . DG  A 1 21  ? 43.293 42.929  29.947 1.00 63.55  ? 21  DG  B C4    1 
ATOM   432  P  P     . DA  A 1 22  ? 37.248 42.655  29.415 1.00 73.49  ? 22  DA  B P     1 
ATOM   433  O  OP1   . DA  A 1 22  ? 36.033 43.098  30.143 1.00 73.71  ? 22  DA  B OP1   1 
ATOM   434  O  OP2   . DA  A 1 22  ? 37.129 42.172  28.014 1.00 71.40  ? 22  DA  B OP2   1 
ATOM   435  O  "O5'" . DA  A 1 22  ? 38.314 43.836  29.460 1.00 68.66  ? 22  DA  B "O5'" 1 
ATOM   436  C  "C5'" . DA  A 1 22  ? 38.749 44.367  30.729 1.00 59.50  ? 22  DA  B "C5'" 1 
ATOM   437  C  "C4'" . DA  A 1 22  ? 39.082 45.836  30.611 1.00 50.82  ? 22  DA  B "C4'" 1 
ATOM   438  O  "O4'" . DA  A 1 22  ? 40.436 45.975  30.122 1.00 45.55  ? 22  DA  B "O4'" 1 
ATOM   439  C  "C3'" . DA  A 1 22  ? 38.209 46.549  29.576 1.00 46.77  ? 22  DA  B "C3'" 1 
ATOM   440  O  "O3'" . DA  A 1 22  ? 38.037 47.929  29.921 1.00 46.65  ? 22  DA  B "O3'" 1 
ATOM   441  C  "C2'" . DA  A 1 22  ? 38.990 46.360  28.287 1.00 41.23  ? 22  DA  B "C2'" 1 
ATOM   442  C  "C1'" . DA  A 1 22  ? 40.422 46.455  28.786 1.00 37.95  ? 22  DA  B "C1'" 1 
ATOM   443  N  N9    . DA  A 1 22  ? 41.454 45.755  28.026 1.00 28.99  ? 22  DA  B N9    1 
ATOM   444  C  C8    . DA  A 1 22  ? 41.343 44.709  27.144 1.00 25.83  ? 22  DA  B C8    1 
ATOM   445  N  N7    . DA  A 1 22  ? 42.486 44.336  26.617 1.00 23.88  ? 22  DA  B N7    1 
ATOM   446  C  C5    . DA  A 1 22  ? 43.412 45.192  27.197 1.00 22.11  ? 22  DA  B C5    1 
ATOM   447  C  C6    . DA  A 1 22  ? 44.804 45.316  27.059 1.00 17.38  ? 22  DA  B C6    1 
ATOM   448  N  N6    . DA  A 1 22  ? 45.545 44.543  26.264 1.00 15.28  ? 22  DA  B N6    1 
ATOM   449  N  N1    . DA  A 1 22  ? 45.421 46.276  27.783 1.00 16.75  ? 22  DA  B N1    1 
ATOM   450  C  C2    . DA  A 1 22  ? 44.682 47.053  28.588 1.00 19.37  ? 22  DA  B C2    1 
ATOM   451  N  N3    . DA  A 1 22  ? 43.374 47.034  28.802 1.00 21.98  ? 22  DA  B N3    1 
ATOM   452  C  C4    . DA  A 1 22  ? 42.789 46.069  28.068 1.00 25.02  ? 22  DA  B C4    1 
ATOM   453  P  P     . DT  A 1 23  ? 37.153 48.893  28.980 1.00 44.38  ? 23  DT  B P     1 
ATOM   454  O  OP1   . DT  A 1 23  ? 36.161 49.589  29.807 1.00 46.31  ? 23  DT  B OP1   1 
ATOM   455  O  OP2   . DT  A 1 23  ? 36.697 48.143  27.810 1.00 45.58  ? 23  DT  B OP2   1 
ATOM   456  O  "O5'" . DT  A 1 23  ? 38.211 49.951  28.465 1.00 38.74  ? 23  DT  B "O5'" 1 
ATOM   457  C  "C5'" . DT  A 1 23  ? 39.542 49.537  28.189 1.00 37.01  ? 23  DT  B "C5'" 1 
ATOM   458  C  "C4'" . DT  A 1 23  ? 40.514 50.573  28.693 1.00 34.93  ? 23  DT  B "C4'" 1 
ATOM   459  O  "O4'" . DT  A 1 23  ? 41.851 50.079  28.456 1.00 32.18  ? 23  DT  B "O4'" 1 
ATOM   460  C  "C3'" . DT  A 1 23  ? 40.425 51.877  27.920 1.00 33.55  ? 23  DT  B "C3'" 1 
ATOM   461  O  "O3'" . DT  A 1 23  ? 40.794 52.985  28.731 1.00 33.44  ? 23  DT  B "O3'" 1 
ATOM   462  C  "C2'" . DT  A 1 23  ? 41.369 51.644  26.760 1.00 31.29  ? 23  DT  B "C2'" 1 
ATOM   463  C  "C1'" . DT  A 1 23  ? 42.455 50.771  27.372 1.00 26.09  ? 23  DT  B "C1'" 1 
ATOM   464  N  N1    . DT  A 1 23  ? 42.984 49.752  26.448 1.00 17.74  ? 23  DT  B N1    1 
ATOM   465  C  C2    . DT  A 1 23  ? 44.331 49.765  26.136 1.00 17.51  ? 23  DT  B C2    1 
ATOM   466  O  O2    . DT  A 1 23  ? 45.123 50.588  26.581 1.00 17.56  ? 23  DT  B O2    1 
ATOM   467  N  N3    . DT  A 1 23  ? 44.723 48.770  25.276 1.00 15.68  ? 23  DT  B N3    1 
ATOM   468  C  C4    . DT  A 1 23  ? 43.932 47.791  24.713 1.00 16.11  ? 23  DT  B C4    1 
ATOM   469  O  O4    . DT  A 1 23  ? 44.434 46.958  23.963 1.00 14.84  ? 23  DT  B O4    1 
ATOM   470  C  C5    . DT  A 1 23  ? 42.534 47.842  25.080 1.00 17.54  ? 23  DT  B C5    1 
ATOM   471  C  C7    . DT  A 1 23  ? 41.599 46.824  24.514 1.00 19.86  ? 23  DT  B C7    1 
ATOM   472  C  C6    . DT  A 1 23  ? 42.136 48.805  25.917 1.00 15.58  ? 23  DT  B C6    1 
ATOM   473  P  P     . DG  A 1 24  ? 40.578 54.475  28.176 1.00 35.81  ? 24  DG  B P     1 
ATOM   474  O  OP1   . DG  A 1 24  ? 40.108 55.315  29.290 1.00 32.28  ? 24  DG  B OP1   1 
ATOM   475  O  OP2   . DG  A 1 24  ? 39.778 54.414  26.946 1.00 33.17  ? 24  DG  B OP2   1 
ATOM   476  O  "O5'" . DG  A 1 24  ? 42.057 54.916  27.788 1.00 33.91  ? 24  DG  B "O5'" 1 
ATOM   477  C  "C5'" . DG  A 1 24  ? 43.043 55.089  28.815 1.00 27.83  ? 24  DG  B "C5'" 1 
ATOM   478  C  "C4'" . DG  A 1 24  ? 44.351 55.559  28.229 1.00 20.59  ? 24  DG  B "C4'" 1 
ATOM   479  O  "O4'" . DG  A 1 24  ? 44.844 54.535  27.334 1.00 12.91  ? 24  DG  B "O4'" 1 
ATOM   480  C  "C3'" . DG  A 1 24  ? 44.184 56.803  27.355 1.00 20.12  ? 24  DG  B "C3'" 1 
ATOM   481  O  "O3'" . DG  A 1 24  ? 45.405 57.551  27.336 1.00 25.00  ? 24  DG  B "O3'" 1 
ATOM   482  C  "C2'" . DG  A 1 24  ? 43.878 56.217  25.992 1.00 13.48  ? 24  DG  B "C2'" 1 
ATOM   483  C  "C1'" . DG  A 1 24  ? 44.743 54.975  25.997 1.00 7.83   ? 24  DG  B "C1'" 1 
ATOM   484  N  N9    . DG  A 1 24  ? 44.289 53.863  25.182 1.00 2.00   ? 24  DG  B N9    1 
ATOM   485  C  C8    . DG  A 1 24  ? 43.002 53.458  24.968 1.00 4.76   ? 24  DG  B C8    1 
ATOM   486  N  N7    . DG  A 1 24  ? 42.915 52.431  24.164 1.00 6.51   ? 24  DG  B N7    1 
ATOM   487  C  C5    . DG  A 1 24  ? 44.229 52.138  23.838 1.00 3.75   ? 24  DG  B C5    1 
ATOM   488  C  C6    . DG  A 1 24  ? 44.767 51.119  23.006 1.00 3.85   ? 24  DG  B C6    1 
ATOM   489  O  O6    . DG  A 1 24  ? 44.173 50.244  22.380 1.00 2.00   ? 24  DG  B O6    1 
ATOM   490  N  N1    . DG  A 1 24  ? 46.150 51.185  22.945 1.00 7.62   ? 24  DG  B N1    1 
ATOM   491  C  C2    . DG  A 1 24  ? 46.922 52.113  23.602 1.00 11.76  ? 24  DG  B C2    1 
ATOM   492  N  N2    . DG  A 1 24  ? 48.252 52.021  23.419 1.00 16.07  ? 24  DG  B N2    1 
ATOM   493  N  N3    . DG  A 1 24  ? 46.431 53.065  24.385 1.00 8.55   ? 24  DG  B N3    1 
ATOM   494  C  C4    . DG  A 1 24  ? 45.089 53.016  24.456 1.00 4.33   ? 24  DG  B C4    1 
ATOM   495  P  P     . DG  A 1 25  ? 45.462 59.004  26.643 1.00 26.76  ? 25  DG  B P     1 
ATOM   496  O  OP1   . DG  A 1 25  ? 45.884 59.972  27.696 1.00 26.82  ? 25  DG  B OP1   1 
ATOM   497  O  OP2   . DG  A 1 25  ? 44.226 59.270  25.854 1.00 25.75  ? 25  DG  B OP2   1 
ATOM   498  O  "O5'" . DG  A 1 25  ? 46.655 58.841  25.608 1.00 25.75  ? 25  DG  B "O5'" 1 
ATOM   499  C  "C5'" . DG  A 1 25  ? 46.764 57.656  24.828 1.00 28.02  ? 25  DG  B "C5'" 1 
ATOM   500  C  "C4'" . DG  A 1 25  ? 47.564 57.924  23.578 1.00 34.67  ? 25  DG  B "C4'" 1 
ATOM   501  O  "O4'" . DG  A 1 25  ? 47.432 56.753  22.741 1.00 38.54  ? 25  DG  B "O4'" 1 
ATOM   502  C  "C3'" . DG  A 1 25  ? 47.020 59.087  22.742 1.00 37.14  ? 25  DG  B "C3'" 1 
ATOM   503  O  "O3'" . DG  A 1 25  ? 48.079 59.668  21.948 1.00 37.24  ? 25  DG  B "O3'" 1 
ATOM   504  C  "C2'" . DG  A 1 25  ? 45.972 58.408  21.884 1.00 39.11  ? 25  DG  B "C2'" 1 
ATOM   505  C  "C1'" . DG  A 1 25  ? 46.591 57.037  21.633 1.00 40.58  ? 25  DG  B "C1'" 1 
ATOM   506  N  N9    . DG  A 1 25  ? 45.636 55.940  21.489 1.00 41.44  ? 25  DG  B N9    1 
ATOM   507  C  C8    . DG  A 1 25  ? 44.355 55.879  21.986 1.00 40.90  ? 25  DG  B C8    1 
ATOM   508  N  N7    . DG  A 1 25  ? 43.740 54.772  21.676 1.00 41.26  ? 25  DG  B N7    1 
ATOM   509  C  C5    . DG  A 1 25  ? 44.668 54.058  20.932 1.00 40.72  ? 25  DG  B C5    1 
ATOM   510  C  C6    . DG  A 1 25  ? 44.568 52.789  20.326 1.00 39.76  ? 25  DG  B C6    1 
ATOM   511  O  O6    . DG  A 1 25  ? 43.611 52.014  20.326 1.00 43.08  ? 25  DG  B O6    1 
ATOM   512  N  N1    . DG  A 1 25  ? 45.737 52.441  19.668 1.00 36.93  ? 25  DG  B N1    1 
ATOM   513  C  C2    . DG  A 1 25  ? 46.861 53.218  19.604 1.00 38.21  ? 25  DG  B C2    1 
ATOM   514  N  N2    . DG  A 1 25  ? 47.893 52.711  18.921 1.00 42.43  ? 25  DG  B N2    1 
ATOM   515  N  N3    . DG  A 1 25  ? 46.970 54.407  20.167 1.00 38.20  ? 25  DG  B N3    1 
ATOM   516  C  C4    . DG  A 1 25  ? 45.844 54.762  20.810 1.00 40.15  ? 25  DG  B C4    1 
ATOM   517  P  P     . DG  A 1 26  ? 47.916 61.148  21.319 1.00 35.97  ? 26  DG  B P     1 
ATOM   518  O  OP1   . DG  A 1 26  ? 49.249 61.801  21.341 1.00 36.47  ? 26  DG  B OP1   1 
ATOM   519  O  OP2   . DG  A 1 26  ? 46.747 61.835  21.935 1.00 34.41  ? 26  DG  B OP2   1 
ATOM   520  O  "O5'" . DG  A 1 26  ? 47.579 60.879  19.791 1.00 35.46  ? 26  DG  B "O5'" 1 
ATOM   521  C  "C5'" . DG  A 1 26  ? 46.955 59.661  19.400 1.00 35.17  ? 26  DG  B "C5'" 1 
ATOM   522  C  "C4'" . DG  A 1 26  ? 47.952 58.765  18.707 1.00 33.89  ? 26  DG  B "C4'" 1 
ATOM   523  O  "O4'" . DG  A 1 26  ? 47.446 57.415  18.767 1.00 33.79  ? 26  DG  B "O4'" 1 
ATOM   524  C  "C3'" . DG  A 1 26  ? 48.085 59.085  17.221 1.00 36.36  ? 26  DG  B "C3'" 1 
ATOM   525  O  "O3'" . DG  A 1 26  ? 49.377 58.709  16.729 1.00 35.39  ? 26  DG  B "O3'" 1 
ATOM   526  C  "C2'" . DG  A 1 26  ? 46.984 58.246  16.599 1.00 35.14  ? 26  DG  B "C2'" 1 
ATOM   527  C  "C1'" . DG  A 1 26  ? 46.994 57.009  17.484 1.00 34.63  ? 26  DG  B "C1'" 1 
ATOM   528  N  N9    . DG  A 1 26  ? 45.711 56.330  17.641 1.00 30.64  ? 26  DG  B N9    1 
ATOM   529  C  C8    . DG  A 1 26  ? 44.558 56.803  18.214 1.00 26.94  ? 26  DG  B C8    1 
ATOM   530  N  N7    . DG  A 1 26  ? 43.582 55.938  18.181 1.00 26.42  ? 26  DG  B N7    1 
ATOM   531  C  C5    . DG  A 1 26  ? 44.127 54.830  17.548 1.00 29.61  ? 26  DG  B C5    1 
ATOM   532  C  C6    . DG  A 1 26  ? 43.549 53.570  17.216 1.00 36.46  ? 26  DG  B C6    1 
ATOM   533  O  O6    . DG  A 1 26  ? 42.398 53.166  17.422 1.00 41.33  ? 26  DG  B O6    1 
ATOM   534  N  N1    . DG  A 1 26  ? 44.460 52.738  16.574 1.00 38.90  ? 26  DG  B N1    1 
ATOM   535  C  C2    . DG  A 1 26  ? 45.757 53.073  16.287 1.00 39.80  ? 26  DG  B C2    1 
ATOM   536  N  N2    . DG  A 1 26  ? 46.493 52.140  15.658 1.00 43.86  ? 26  DG  B N2    1 
ATOM   537  N  N3    . DG  A 1 26  ? 46.302 54.236  16.590 1.00 34.96  ? 26  DG  B N3    1 
ATOM   538  C  C4    . DG  A 1 26  ? 45.437 55.057  17.213 1.00 30.07  ? 26  DG  B C4    1 
ATOM   539  P  P     . DA  A 1 27  ? 49.889 59.276  15.317 1.00 29.88  ? 27  DA  B P     1 
ATOM   540  O  OP1   . DA  A 1 27  ? 50.736 60.446  15.524 1.00 31.71  ? 27  DA  B OP1   1 
ATOM   541  O  OP2   . DA  A 1 27  ? 48.739 59.388  14.427 1.00 29.31  ? 27  DA  B OP2   1 
ATOM   542  O  "O5'" . DA  A 1 27  ? 50.825 58.118  14.782 1.00 33.68  ? 27  DA  B "O5'" 1 
ATOM   543  C  "C5'" . DA  A 1 27  ? 51.051 57.967  13.392 1.00 39.47  ? 27  DA  B "C5'" 1 
ATOM   544  C  "C4'" . DA  A 1 27  ? 51.231 56.507  13.059 1.00 43.11  ? 27  DA  B "C4'" 1 
ATOM   545  O  "O4'" . DA  A 1 27  ? 50.146 55.761  13.666 1.00 41.21  ? 27  DA  B "O4'" 1 
ATOM   546  C  "C3'" . DA  A 1 27  ? 51.105 56.251  11.566 1.00 47.07  ? 27  DA  B "C3'" 1 
ATOM   547  O  "O3'" . DA  A 1 27  ? 51.927 55.159  11.153 1.00 49.70  ? 27  DA  B "O3'" 1 
ATOM   548  C  "C2'" . DA  A 1 27  ? 49.612 56.026  11.383 1.00 46.04  ? 27  DA  B "C2'" 1 
ATOM   549  C  "C1'" . DA  A 1 27  ? 49.213 55.327  12.677 1.00 39.91  ? 27  DA  B "C1'" 1 
ATOM   550  N  N9    . DA  A 1 27  ? 47.868 55.679  13.144 1.00 34.26  ? 27  DA  B N9    1 
ATOM   551  C  C8    . DA  A 1 27  ? 47.461 56.845  13.749 1.00 33.48  ? 27  DA  B C8    1 
ATOM   552  N  N7    . DA  A 1 27  ? 46.187 56.868  14.051 1.00 31.02  ? 27  DA  B N7    1 
ATOM   553  C  C5    . DA  A 1 27  ? 45.722 55.635  13.618 1.00 29.46  ? 27  DA  B C5    1 
ATOM   554  C  C6    . DA  A 1 27  ? 44.452 55.043  13.653 1.00 27.64  ? 27  DA  B C6    1 
ATOM   555  N  N6    . DA  A 1 27  ? 43.377 55.637  14.159 1.00 27.74  ? 27  DA  B N6    1 
ATOM   556  N  N1    . DA  A 1 27  ? 44.321 53.802  13.142 1.00 28.36  ? 27  DA  B N1    1 
ATOM   557  C  C2    . DA  A 1 27  ? 45.406 53.205  12.632 1.00 32.02  ? 27  DA  B C2    1 
ATOM   558  N  N3    . DA  A 1 27  ? 46.654 53.659  12.542 1.00 32.43  ? 27  DA  B N3    1 
ATOM   559  C  C4    . DA  A 1 27  ? 46.746 54.894  13.059 1.00 31.23  ? 27  DA  B C4    1 
ATOM   560  P  P     . DG  A 1 28  ? 52.168 54.899  9.588  1.00 53.02  ? 28  DG  B P     1 
ATOM   561  O  OP1   . DG  A 1 28  ? 53.584 54.594  9.375  1.00 54.96  ? 28  DG  B OP1   1 
ATOM   562  O  OP2   . DG  A 1 28  ? 51.566 55.996  8.829  1.00 54.48  ? 28  DG  B OP2   1 
ATOM   563  O  "O5'" . DG  A 1 28  ? 51.289 53.602  9.311  1.00 55.59  ? 28  DG  B "O5'" 1 
ATOM   564  C  "C5'" . DG  A 1 28  ? 49.956 53.504  9.844  1.00 58.01  ? 28  DG  B "C5'" 1 
ATOM   565  C  "C4'" . DG  A 1 28  ? 49.086 52.663  8.943  1.00 60.99  ? 28  DG  B "C4'" 1 
ATOM   566  O  "O4'" . DG  A 1 28  ? 47.711 52.801  9.380  1.00 61.23  ? 28  DG  B "O4'" 1 
ATOM   567  C  "C3'" . DG  A 1 28  ? 49.090 53.164  7.503  1.00 63.10  ? 28  DG  B "C3'" 1 
ATOM   568  O  "O3'" . DG  A 1 28  ? 48.789 52.059  6.647  1.00 67.32  ? 28  DG  B "O3'" 1 
ATOM   569  C  "C2'" . DG  A 1 28  ? 47.982 54.206  7.499  1.00 60.36  ? 28  DG  B "C2'" 1 
ATOM   570  C  "C1'" . DG  A 1 28  ? 46.972 53.591  8.452  1.00 57.51  ? 28  DG  B "C1'" 1 
ATOM   571  N  N9    . DG  A 1 28  ? 46.121 54.506  9.208  1.00 51.92  ? 28  DG  B N9    1 
ATOM   572  C  C8    . DG  A 1 28  ? 46.508 55.605  9.936  1.00 50.67  ? 28  DG  B C8    1 
ATOM   573  N  N7    . DG  A 1 28  ? 45.507 56.218  10.509 1.00 50.42  ? 28  DG  B N7    1 
ATOM   574  C  C5    . DG  A 1 28  ? 44.392 55.482  10.134 1.00 50.70  ? 28  DG  B C5    1 
ATOM   575  C  C6    . DG  A 1 28  ? 43.012 55.666  10.451 1.00 51.73  ? 28  DG  B C6    1 
ATOM   576  O  O6    . DG  A 1 28  ? 42.485 56.548  11.152 1.00 54.27  ? 28  DG  B O6    1 
ATOM   577  N  N1    . DG  A 1 28  ? 42.218 54.687  9.859  1.00 50.16  ? 28  DG  B N1    1 
ATOM   578  C  C2    . DG  A 1 28  ? 42.686 53.666  9.068  1.00 49.93  ? 28  DG  B C2    1 
ATOM   579  N  N2    . DG  A 1 28  ? 41.767 52.816  8.587  1.00 49.24  ? 28  DG  B N2    1 
ATOM   580  N  N3    . DG  A 1 28  ? 43.963 53.486  8.767  1.00 50.56  ? 28  DG  B N3    1 
ATOM   581  C  C4    . DG  A 1 28  ? 44.753 54.424  9.330  1.00 50.52  ? 28  DG  B C4    1 
ATOM   582  P  P     . DA  A 1 29  ? 49.114 52.138  5.075  1.00 71.21  ? 29  DA  B P     1 
ATOM   583  O  OP1   . DA  A 1 29  ? 50.347 51.352  4.835  1.00 72.66  ? 29  DA  B OP1   1 
ATOM   584  O  OP2   . DA  A 1 29  ? 49.039 53.548  4.610  1.00 73.78  ? 29  DA  B OP2   1 
ATOM   585  O  "O5'" . DA  A 1 29  ? 47.882 51.377  4.423  1.00 69.36  ? 29  DA  B "O5'" 1 
ATOM   586  C  "C5'" . DA  A 1 29  ? 47.357 50.185  5.028  1.00 69.40  ? 29  DA  B "C5'" 1 
ATOM   587  C  "C4'" . DA  A 1 29  ? 45.936 49.941  4.573  1.00 69.49  ? 29  DA  B "C4'" 1 
ATOM   588  O  "O4'" . DA  A 1 29  ? 45.060 50.912  5.197  1.00 66.70  ? 29  DA  B "O4'" 1 
ATOM   589  C  "C3'" . DA  A 1 29  ? 45.769 50.163  3.072  1.00 71.00  ? 29  DA  B "C3'" 1 
ATOM   590  O  "O3'" . DA  A 1 29  ? 44.723 49.326  2.556  1.00 73.72  ? 29  DA  B "O3'" 1 
ATOM   591  C  "C2'" . DA  A 1 29  ? 45.451 51.647  2.986  1.00 68.13  ? 29  DA  B "C2'" 1 
ATOM   592  C  "C1'" . DA  A 1 29  ? 44.612 51.862  4.238  1.00 64.34  ? 29  DA  B "C1'" 1 
ATOM   593  N  N9    . DA  A 1 29  ? 44.650 53.190  4.852  1.00 58.85  ? 29  DA  B N9    1 
ATOM   594  C  C8    . DA  A 1 29  ? 45.726 54.006  5.094  1.00 57.34  ? 29  DA  B C8    1 
ATOM   595  N  N7    . DA  A 1 29  ? 45.408 55.142  5.667  1.00 54.33  ? 29  DA  B N7    1 
ATOM   596  C  C5    . DA  A 1 29  ? 44.031 55.067  5.810  1.00 52.51  ? 29  DA  B C5    1 
ATOM   597  C  C6    . DA  A 1 29  ? 43.088 55.953  6.345  1.00 51.50  ? 29  DA  B C6    1 
ATOM   598  N  N6    . DA  A 1 29  ? 43.397 57.140  6.860  1.00 53.81  ? 29  DA  B N6    1 
ATOM   599  N  N1    . DA  A 1 29  ? 41.793 55.576  6.335  1.00 50.94  ? 29  DA  B N1    1 
ATOM   600  C  C2    . DA  A 1 29  ? 41.481 54.386  5.817  1.00 52.55  ? 29  DA  B C2    1 
ATOM   601  N  N3    . DA  A 1 29  ? 42.275 53.467  5.286  1.00 54.10  ? 29  DA  B N3    1 
ATOM   602  C  C4    . DA  A 1 29  ? 43.553 53.873  5.313  1.00 54.58  ? 29  DA  B C4    1 
ATOM   603  P  P     . DC  A 1 30  ? 44.674 48.975  0.986  1.00 73.60  ? 30  DC  B P     1 
ATOM   604  O  OP1   . DC  A 1 30  ? 44.156 47.613  0.845  1.00 74.10  ? 30  DC  B OP1   1 
ATOM   605  O  OP2   . DC  A 1 30  ? 45.971 49.306  0.383  1.00 74.95  ? 30  DC  B OP2   1 
ATOM   606  O  "O5'" . DC  A 1 30  ? 43.594 49.991  0.412  1.00 71.49  ? 30  DC  B "O5'" 1 
ATOM   607  C  "C5'" . DC  A 1 30  ? 43.267 51.188  1.135  1.00 69.26  ? 30  DC  B "C5'" 1 
ATOM   608  C  "C4'" . DC  A 1 30  ? 41.820 51.556  0.922  1.00 68.46  ? 30  DC  B "C4'" 1 
ATOM   609  O  "O4'" . DC  A 1 30  ? 41.503 52.651  1.819  1.00 66.27  ? 30  DC  B "O4'" 1 
ATOM   610  C  "C3'" . DC  A 1 30  ? 41.564 52.099  -0.480 1.00 68.73  ? 30  DC  B "C3'" 1 
ATOM   611  O  "O3'" . DC  A 1 30  ? 40.237 51.812  -0.928 1.00 66.55  ? 30  DC  B "O3'" 1 
ATOM   612  C  "C2'" . DC  A 1 30  ? 41.842 53.583  -0.330 1.00 68.78  ? 30  DC  B "C2'" 1 
ATOM   613  C  "C1'" . DC  A 1 30  ? 41.366 53.869  1.091  1.00 64.51  ? 30  DC  B "C1'" 1 
ATOM   614  N  N1    . DC  A 1 30  ? 42.132 54.918  1.798  1.00 58.97  ? 30  DC  B N1    1 
ATOM   615  C  C2    . DC  A 1 30  ? 41.436 55.873  2.541  1.00 58.31  ? 30  DC  B C2    1 
ATOM   616  O  O2    . DC  A 1 30  ? 40.200 55.811  2.591  1.00 60.24  ? 30  DC  B O2    1 
ATOM   617  N  N3    . DC  A 1 30  ? 42.125 56.842  3.187  1.00 57.46  ? 30  DC  B N3    1 
ATOM   618  C  C4    . DC  A 1 30  ? 43.457 56.878  3.108  1.00 57.56  ? 30  DC  B C4    1 
ATOM   619  N  N4    . DC  A 1 30  ? 44.095 57.851  3.761  1.00 56.91  ? 30  DC  B N4    1 
ATOM   620  C  C5    . DC  A 1 30  ? 44.193 55.918  2.358  1.00 56.60  ? 30  DC  B C5    1 
ATOM   621  C  C6    . DC  A 1 30  ? 43.499 54.964  1.728  1.00 57.05  ? 30  DC  B C6    1 
ATOM   622  P  P     . DC  A 1 31  ? 39.738 52.377  -2.344 1.00 61.73  ? 31  DC  B P     1 
ATOM   623  O  OP1   . DC  A 1 31  ? 38.654 51.516  -2.808 1.00 64.38  ? 31  DC  B OP1   1 
ATOM   624  O  OP2   . DC  A 1 31  ? 40.920 52.551  -3.200 1.00 61.22  ? 31  DC  B OP2   1 
ATOM   625  O  "O5'" . DC  A 1 31  ? 39.123 53.795  -1.961 1.00 61.58  ? 31  DC  B "O5'" 1 
ATOM   626  C  "C5'" . DC  A 1 31  ? 38.252 53.913  -0.818 1.00 64.84  ? 31  DC  B "C5'" 1 
ATOM   627  C  "C4'" . DC  A 1 31  ? 37.414 55.170  -0.891 1.00 68.03  ? 31  DC  B "C4'" 1 
ATOM   628  O  "O4'" . DC  A 1 31  ? 38.072 56.241  -0.173 1.00 67.76  ? 31  DC  B "O4'" 1 
ATOM   629  C  "C3'" . DC  A 1 31  ? 37.209 55.703  -2.307 1.00 70.37  ? 31  DC  B "C3'" 1 
ATOM   630  O  "O3'" . DC  A 1 31  ? 36.052 56.539  -2.337 1.00 73.17  ? 31  DC  B "O3'" 1 
ATOM   631  C  "C2'" . DC  A 1 31  ? 38.420 56.602  -2.492 1.00 70.14  ? 31  DC  B "C2'" 1 
ATOM   632  C  "C1'" . DC  A 1 31  ? 38.588 57.197  -1.090 1.00 67.09  ? 31  DC  B "C1'" 1 
ATOM   633  N  N1    . DC  A 1 31  ? 39.955 57.555  -0.666 1.00 63.76  ? 31  DC  B N1    1 
ATOM   634  C  C2    . DC  A 1 31  ? 40.130 58.621  0.227  1.00 62.51  ? 31  DC  B C2    1 
ATOM   635  O  O2    . DC  A 1 31  ? 39.131 59.234  0.644  1.00 60.39  ? 31  DC  B O2    1 
ATOM   636  N  N3    . DC  A 1 31  ? 41.383 58.956  0.613  1.00 62.75  ? 31  DC  B N3    1 
ATOM   637  C  C4    . DC  A 1 31  ? 42.433 58.273  0.146  1.00 62.13  ? 31  DC  B C4    1 
ATOM   638  N  N4    . DC  A 1 31  ? 43.646 58.634  0.555  1.00 62.02  ? 31  DC  B N4    1 
ATOM   639  C  C5    . DC  A 1 31  ? 42.282 57.189  -0.759 1.00 62.72  ? 31  DC  B C5    1 
ATOM   640  C  C6    . DC  A 1 31  ? 41.040 56.866  -1.135 1.00 63.78  ? 31  DC  B C6    1 
ATOM   641  O  "O5'" . DT  B 2 1   ? 48.592 65.694  3.661  1.00 92.62  ? 33  DT  C "O5'" 1 
ATOM   642  C  "C5'" . DT  B 2 1   ? 48.908 67.023  3.219  1.00 92.23  ? 33  DT  C "C5'" 1 
ATOM   643  C  "C4'" . DT  B 2 1   ? 47.685 67.905  3.116  1.00 90.69  ? 33  DT  C "C4'" 1 
ATOM   644  O  "O4'" . DT  B 2 1   ? 46.911 67.558  1.941  1.00 90.14  ? 33  DT  C "O4'" 1 
ATOM   645  C  "C3'" . DT  B 2 1   ? 46.729 67.773  4.298  1.00 87.95  ? 33  DT  C "C3'" 1 
ATOM   646  O  "O3'" . DT  B 2 1   ? 46.119 69.032  4.574  1.00 85.26  ? 33  DT  C "O3'" 1 
ATOM   647  C  "C2'" . DT  B 2 1   ? 45.690 66.788  3.798  1.00 88.01  ? 33  DT  C "C2'" 1 
ATOM   648  C  "C1'" . DT  B 2 1   ? 45.603 67.148  2.326  1.00 88.10  ? 33  DT  C "C1'" 1 
ATOM   649  N  N1    . DT  B 2 1   ? 45.204 66.019  1.466  1.00 85.79  ? 33  DT  C N1    1 
ATOM   650  C  C2    . DT  B 2 1   ? 43.867 65.852  1.195  1.00 84.81  ? 33  DT  C C2    1 
ATOM   651  O  O2    . DT  B 2 1   ? 42.992 66.584  1.632  1.00 83.43  ? 33  DT  C O2    1 
ATOM   652  N  N3    . DT  B 2 1   ? 43.583 64.785  0.390  1.00 86.31  ? 33  DT  C N3    1 
ATOM   653  C  C4    . DT  B 2 1   ? 44.476 63.882  -0.157 1.00 87.40  ? 33  DT  C C4    1 
ATOM   654  O  O4    . DT  B 2 1   ? 44.066 62.968  -0.868 1.00 88.81  ? 33  DT  C O4    1 
ATOM   655  C  C5    . DT  B 2 1   ? 45.859 64.113  0.173  1.00 86.52  ? 33  DT  C C5    1 
ATOM   656  C  C7    . DT  B 2 1   ? 46.899 63.182  -0.364 1.00 87.01  ? 33  DT  C C7    1 
ATOM   657  C  C6    . DT  B 2 1   ? 46.150 65.157  0.953  1.00 85.76  ? 33  DT  C C6    1 
ATOM   658  P  P     . DG  B 2 2   ? 45.215 69.192  5.883  1.00 81.63  ? 34  DG  C P     1 
ATOM   659  O  OP1   . DG  B 2 2   ? 44.628 70.555  5.923  1.00 82.82  ? 34  DG  C OP1   1 
ATOM   660  O  OP2   . DG  B 2 2   ? 46.034 68.711  7.018  1.00 83.41  ? 34  DG  C OP2   1 
ATOM   661  O  "O5'" . DG  B 2 2   ? 44.043 68.152  5.638  1.00 77.52  ? 34  DG  C "O5'" 1 
ATOM   662  C  "C5'" . DG  B 2 2   ? 43.354 67.571  6.737  1.00 73.90  ? 34  DG  C "C5'" 1 
ATOM   663  C  "C4'" . DG  B 2 2   ? 41.899 67.389  6.388  1.00 70.37  ? 34  DG  C "C4'" 1 
ATOM   664  O  "O4'" . DG  B 2 2   ? 41.818 66.543  5.220  1.00 66.83  ? 34  DG  C "O4'" 1 
ATOM   665  C  "C3'" . DG  B 2 2   ? 41.114 66.658  7.464  1.00 69.73  ? 34  DG  C "C3'" 1 
ATOM   666  O  "O3'" . DG  B 2 2   ? 39.751 67.077  7.435  1.00 72.61  ? 34  DG  C "O3'" 1 
ATOM   667  C  "C2'" . DG  B 2 2   ? 41.308 65.199  7.096  1.00 66.15  ? 34  DG  C "C2'" 1 
ATOM   668  C  "C1'" . DG  B 2 2   ? 41.353 65.245  5.576  1.00 63.25  ? 34  DG  C "C1'" 1 
ATOM   669  N  N9    . DG  B 2 2   ? 42.259 64.274  4.969  1.00 58.70  ? 34  DG  C N9    1 
ATOM   670  C  C8    . DG  B 2 2   ? 43.628 64.221  5.089  1.00 55.81  ? 34  DG  C C8    1 
ATOM   671  N  N7    . DG  B 2 2   ? 44.163 63.236  4.422  1.00 53.51  ? 34  DG  C N7    1 
ATOM   672  C  C5    . DG  B 2 2   ? 43.084 62.600  3.825  1.00 54.39  ? 34  DG  C C5    1 
ATOM   673  C  C6    . DG  B 2 2   ? 43.043 61.463  2.979  1.00 53.28  ? 34  DG  C C6    1 
ATOM   674  O  O6    . DG  B 2 2   ? 43.985 60.769  2.576  1.00 51.04  ? 34  DG  C O6    1 
ATOM   675  N  N1    . DG  B 2 2   ? 41.738 61.156  2.599  1.00 54.74  ? 34  DG  C N1    1 
ATOM   676  C  C2    . DG  B 2 2   ? 40.615 61.858  2.985  1.00 56.57  ? 34  DG  C C2    1 
ATOM   677  N  N2    . DG  B 2 2   ? 39.432 61.415  2.515  1.00 57.22  ? 34  DG  C N2    1 
ATOM   678  N  N3    . DG  B 2 2   ? 40.644 62.918  3.775  1.00 56.53  ? 34  DG  C N3    1 
ATOM   679  C  C4    . DG  B 2 2   ? 41.901 63.230  4.154  1.00 56.58  ? 34  DG  C C4    1 
ATOM   680  P  P     . DG  B 2 3   ? 38.770 66.661  8.628  1.00 73.23  ? 35  DG  C P     1 
ATOM   681  O  OP1   . DG  B 2 3   ? 37.598 67.535  8.617  1.00 75.82  ? 35  DG  C OP1   1 
ATOM   682  O  OP2   . DG  B 2 3   ? 39.562 66.544  9.861  1.00 73.91  ? 35  DG  C OP2   1 
ATOM   683  O  "O5'" . DG  B 2 3   ? 38.289 65.220  8.182  1.00 70.28  ? 35  DG  C "O5'" 1 
ATOM   684  C  "C5'" . DG  B 2 3   ? 37.423 64.454  9.003  1.00 66.73  ? 35  DG  C "C5'" 1 
ATOM   685  C  "C4'" . DG  B 2 3   ? 36.391 63.775  8.142  1.00 63.54  ? 35  DG  C "C4'" 1 
ATOM   686  O  "O4'" . DG  B 2 3   ? 37.031 63.304  6.935  1.00 59.37  ? 35  DG  C "O4'" 1 
ATOM   687  C  "C3'" . DG  B 2 3   ? 35.782 62.543  8.781  1.00 64.43  ? 35  DG  C "C3'" 1 
ATOM   688  O  "O3'" . DG  B 2 3   ? 34.464 62.369  8.276  1.00 71.23  ? 35  DG  C "O3'" 1 
ATOM   689  C  "C2'" . DG  B 2 3   ? 36.742 61.447  8.361  1.00 60.36  ? 35  DG  C "C2'" 1 
ATOM   690  C  "C1'" . DG  B 2 3   ? 37.189 61.891  6.969  1.00 56.66  ? 35  DG  C "C1'" 1 
ATOM   691  N  N9    . DG  B 2 3   ? 38.599 61.611  6.701  1.00 52.22  ? 35  DG  C N9    1 
ATOM   692  C  C8    . DG  B 2 3   ? 39.668 62.374  7.102  1.00 50.68  ? 35  DG  C C8    1 
ATOM   693  N  N7    . DG  B 2 3   ? 40.817 61.885  6.729  1.00 47.62  ? 35  DG  C N7    1 
ATOM   694  C  C5    . DG  B 2 3   ? 40.492 60.730  6.039  1.00 46.73  ? 35  DG  C C5    1 
ATOM   695  C  C6    . DG  B 2 3   ? 41.328 59.786  5.404  1.00 46.33  ? 35  DG  C C6    1 
ATOM   696  O  O6    . DG  B 2 3   ? 42.557 59.786  5.326  1.00 46.90  ? 35  DG  C O6    1 
ATOM   697  N  N1    . DG  B 2 3   ? 40.594 58.763  4.817  1.00 47.05  ? 35  DG  C N1    1 
ATOM   698  C  C2    . DG  B 2 3   ? 39.223 58.664  4.841  1.00 50.31  ? 35  DG  C C2    1 
ATOM   699  N  N2    . DG  B 2 3   ? 38.687 57.598  4.216  1.00 51.23  ? 35  DG  C N2    1 
ATOM   700  N  N3    . DG  B 2 3   ? 38.429 59.545  5.434  1.00 51.14  ? 35  DG  C N3    1 
ATOM   701  C  C4    . DG  B 2 3   ? 39.126 60.544  6.008  1.00 49.54  ? 35  DG  C C4    1 
ATOM   702  P  P     . DT  B 2 4   ? 33.405 61.501  9.103  1.00 76.15  ? 36  DT  C P     1 
ATOM   703  O  OP1   . DT  B 2 4   ? 32.093 62.203  9.073  1.00 78.57  ? 36  DT  C OP1   1 
ATOM   704  O  OP2   . DT  B 2 4   ? 34.023 61.157  10.410 1.00 78.02  ? 36  DT  C OP2   1 
ATOM   705  O  "O5'" . DT  B 2 4   ? 33.292 60.176  8.232  1.00 75.31  ? 36  DT  C "O5'" 1 
ATOM   706  C  "C5'" . DT  B 2 4   ? 34.460 59.601  7.624  1.00 73.72  ? 36  DT  C "C5'" 1 
ATOM   707  C  "C4'" . DT  B 2 4   ? 34.245 58.126  7.412  1.00 73.59  ? 36  DT  C "C4'" 1 
ATOM   708  O  "O4'" . DT  B 2 4   ? 35.508 57.539  7.007  1.00 72.31  ? 36  DT  C "O4'" 1 
ATOM   709  C  "C3'" . DT  B 2 4   ? 33.883 57.425  8.711  1.00 74.69  ? 36  DT  C "C3'" 1 
ATOM   710  O  "O3'" . DT  B 2 4   ? 33.002 56.335  8.482  1.00 76.50  ? 36  DT  C "O3'" 1 
ATOM   711  C  "C2'" . DT  B 2 4   ? 35.230 57.055  9.299  1.00 74.14  ? 36  DT  C "C2'" 1 
ATOM   712  C  "C1'" . DT  B 2 4   ? 36.079 56.769  8.063  1.00 71.06  ? 36  DT  C "C1'" 1 
ATOM   713  N  N1    . DT  B 2 4   ? 37.497 57.190  8.220  1.00 67.54  ? 36  DT  C N1    1 
ATOM   714  C  C2    . DT  B 2 4   ? 38.495 56.374  7.728  1.00 66.79  ? 36  DT  C C2    1 
ATOM   715  O  O2    . DT  B 2 4   ? 38.278 55.315  7.158  1.00 67.94  ? 36  DT  C O2    1 
ATOM   716  N  N3    . DT  B 2 4   ? 39.772 56.847  7.930  1.00 65.53  ? 36  DT  C N3    1 
ATOM   717  C  C4    . DT  B 2 4   ? 40.141 58.020  8.558  1.00 64.57  ? 36  DT  C C4    1 
ATOM   718  O  O4    . DT  B 2 4   ? 41.331 58.310  8.664  1.00 62.87  ? 36  DT  C O4    1 
ATOM   719  C  C5    . DT  B 2 4   ? 39.047 58.825  9.047  1.00 65.11  ? 36  DT  C C5    1 
ATOM   720  C  C7    . DT  B 2 4   ? 39.346 60.113  9.745  1.00 65.24  ? 36  DT  C C7    1 
ATOM   721  C  C6    . DT  B 2 4   ? 37.801 58.378  8.855  1.00 65.72  ? 36  DT  C C6    1 
ATOM   722  P  P     . DC  B 2 5   ? 32.520 55.432  9.714  1.00 78.18  ? 37  DC  C P     1 
ATOM   723  O  OP1   . DC  B 2 5   ? 31.092 55.092  9.493  1.00 79.40  ? 37  DC  C OP1   1 
ATOM   724  O  OP2   . DC  B 2 5   ? 32.930 56.081  10.990 1.00 80.47  ? 37  DC  C OP2   1 
ATOM   725  O  "O5'" . DC  B 2 5   ? 33.393 54.124  9.501  1.00 72.45  ? 37  DC  C "O5'" 1 
ATOM   726  C  "C5'" . DC  B 2 5   ? 33.506 53.569  8.190  1.00 68.13  ? 37  DC  C "C5'" 1 
ATOM   727  C  "C4'" . DC  B 2 5   ? 34.566 52.495  8.143  1.00 67.04  ? 37  DC  C "C4'" 1 
ATOM   728  O  "O4'" . DC  B 2 5   ? 35.867 53.095  8.363  1.00 62.93  ? 37  DC  C "O4'" 1 
ATOM   729  C  "C3'" . DC  B 2 5   ? 34.397 51.488  9.282  1.00 67.66  ? 37  DC  C "C3'" 1 
ATOM   730  O  "O3'" . DC  B 2 5   ? 34.911 50.216  8.883  1.00 71.38  ? 37  DC  C "O3'" 1 
ATOM   731  C  "C2'" . DC  B 2 5   ? 35.207 52.103  10.412 1.00 64.60  ? 37  DC  C "C2'" 1 
ATOM   732  C  "C1'" . DC  B 2 5   ? 36.364 52.705  9.634  1.00 59.03  ? 37  DC  C "C1'" 1 
ATOM   733  N  N1    . DC  B 2 5   ? 37.172 53.805  10.203 1.00 50.73  ? 37  DC  C N1    1 
ATOM   734  C  C2    . DC  B 2 5   ? 38.547 53.831  9.910  1.00 45.68  ? 37  DC  C C2    1 
ATOM   735  O  O2    . DC  B 2 5   ? 39.026 52.943  9.186  1.00 44.23  ? 37  DC  C O2    1 
ATOM   736  N  N3    . DC  B 2 5   ? 39.318 54.814  10.422 1.00 40.52  ? 37  DC  C N3    1 
ATOM   737  C  C4    . DC  B 2 5   ? 38.773 55.747  11.200 1.00 40.04  ? 37  DC  C C4    1 
ATOM   738  N  N4    . DC  B 2 5   ? 39.575 56.694  11.683 1.00 38.65  ? 37  DC  C N4    1 
ATOM   739  C  C5    . DC  B 2 5   ? 37.382 55.749  11.518 1.00 42.55  ? 37  DC  C C5    1 
ATOM   740  C  C6    . DC  B 2 5   ? 36.623 54.770  11.001 1.00 45.68  ? 37  DC  C C6    1 
ATOM   741  P  P     . DT  B 2 6   ? 34.767 48.950  9.859  1.00 75.72  ? 38  DT  C P     1 
ATOM   742  O  OP1   . DT  B 2 6   ? 34.001 47.918  9.146  1.00 77.29  ? 38  DT  C OP1   1 
ATOM   743  O  OP2   . DT  B 2 6   ? 34.295 49.408  11.176 1.00 75.14  ? 38  DT  C OP2   1 
ATOM   744  O  "O5'" . DT  B 2 6   ? 36.265 48.448  10.024 1.00 73.71  ? 38  DT  C "O5'" 1 
ATOM   745  C  "C5'" . DT  B 2 6   ? 37.318 49.397  10.184 1.00 71.02  ? 38  DT  C "C5'" 1 
ATOM   746  C  "C4'" . DT  B 2 6   ? 38.613 48.840  9.649  1.00 70.65  ? 38  DT  C "C4'" 1 
ATOM   747  O  "O4'" . DT  B 2 6   ? 39.602 49.890  9.738  1.00 70.47  ? 38  DT  C "O4'" 1 
ATOM   748  C  "C3'" . DT  B 2 6   ? 39.173 47.689  10.474 1.00 71.76  ? 38  DT  C "C3'" 1 
ATOM   749  O  "O3'" . DT  B 2 6   ? 39.972 46.815  9.669  1.00 74.29  ? 38  DT  C "O3'" 1 
ATOM   750  C  "C2'" . DT  B 2 6   ? 39.986 48.407  11.534 1.00 71.50  ? 38  DT  C "C2'" 1 
ATOM   751  C  "C1'" . DT  B 2 6   ? 40.522 49.629  10.794 1.00 67.85  ? 38  DT  C "C1'" 1 
ATOM   752  N  N1    . DT  B 2 6   ? 40.594 50.847  11.635 1.00 61.12  ? 38  DT  C N1    1 
ATOM   753  C  C2    . DT  B 2 6   ? 41.822 51.430  11.851 1.00 58.60  ? 38  DT  C C2    1 
ATOM   754  O  O2    . DT  B 2 6   ? 42.862 50.998  11.387 1.00 57.73  ? 38  DT  C O2    1 
ATOM   755  N  N3    . DT  B 2 6   ? 41.789 52.549  12.639 1.00 58.66  ? 38  DT  C N3    1 
ATOM   756  C  C4    . DT  B 2 6   ? 40.684 53.132  13.222 1.00 59.20  ? 38  DT  C C4    1 
ATOM   757  O  O4    . DT  B 2 6   ? 40.819 54.141  13.907 1.00 59.93  ? 38  DT  C O4    1 
ATOM   758  C  C5    . DT  B 2 6   ? 39.428 52.470  12.956 1.00 59.16  ? 38  DT  C C5    1 
ATOM   759  C  C7    . DT  B 2 6   ? 38.171 53.029  13.547 1.00 59.79  ? 38  DT  C C7    1 
ATOM   760  C  C6    . DT  B 2 6   ? 39.446 51.377  12.187 1.00 58.86  ? 38  DT  C C6    1 
ATOM   761  P  P     . DC  B 2 7   ? 40.743 45.577  10.356 1.00 78.39  ? 39  DC  C P     1 
ATOM   762  O  OP1   . DC  B 2 7   ? 41.125 44.607  9.295  1.00 77.66  ? 39  DC  C OP1   1 
ATOM   763  O  OP2   . DC  B 2 7   ? 39.914 45.116  11.502 1.00 77.35  ? 39  DC  C OP2   1 
ATOM   764  O  "O5'" . DC  B 2 7   ? 42.072 46.239  10.950 1.00 77.65  ? 39  DC  C "O5'" 1 
ATOM   765  C  "C5'" . DC  B 2 7   ? 43.063 46.838  10.072 1.00 72.74  ? 39  DC  C "C5'" 1 
ATOM   766  C  "C4'" . DC  B 2 7   ? 44.437 46.855  10.715 1.00 66.88  ? 39  DC  C "C4'" 1 
ATOM   767  O  "O4'" . DC  B 2 7   ? 44.548 48.005  11.594 1.00 61.51  ? 39  DC  C "O4'" 1 
ATOM   768  C  "C3'" . DC  B 2 7   ? 44.702 45.646  11.614 1.00 66.71  ? 39  DC  C "C3'" 1 
ATOM   769  O  "O3'" . DC  B 2 7   ? 46.087 45.284  11.659 1.00 69.16  ? 39  DC  C "O3'" 1 
ATOM   770  C  "C2'" . DC  B 2 7   ? 44.184 46.106  12.964 1.00 63.65  ? 39  DC  C "C2'" 1 
ATOM   771  C  "C1'" . DC  B 2 7   ? 44.538 47.592  12.957 1.00 58.62  ? 39  DC  C "C1'" 1 
ATOM   772  N  N1    . DC  B 2 7   ? 43.625 48.479  13.710 1.00 52.71  ? 39  DC  C N1    1 
ATOM   773  C  C2    . DC  B 2 7   ? 44.159 49.574  14.411 1.00 51.39  ? 39  DC  C C2    1 
ATOM   774  O  O2    . DC  B 2 7   ? 45.381 49.776  14.377 1.00 52.91  ? 39  DC  C O2    1 
ATOM   775  N  N3    . DC  B 2 7   ? 43.324 50.385  15.112 1.00 48.10  ? 39  DC  C N3    1 
ATOM   776  C  C4    . DC  B 2 7   ? 42.014 50.135  15.130 1.00 45.75  ? 39  DC  C C4    1 
ATOM   777  N  N4    . DC  B 2 7   ? 41.233 50.956  15.832 1.00 40.40  ? 39  DC  C N4    1 
ATOM   778  C  C5    . DC  B 2 7   ? 41.445 49.028  14.426 1.00 48.33  ? 39  DC  C C5    1 
ATOM   779  C  C6    . DC  B 2 7   ? 42.279 48.239  13.736 1.00 50.85  ? 39  DC  C C6    1 
ATOM   780  P  P     . DC  B 2 8   ? 46.523 43.887  12.337 1.00 71.10  ? 40  DC  C P     1 
ATOM   781  O  OP1   . DC  B 2 8   ? 47.384 43.154  11.410 1.00 72.90  ? 40  DC  C OP1   1 
ATOM   782  O  OP2   . DC  B 2 8   ? 45.329 43.224  12.872 1.00 71.14  ? 40  DC  C OP2   1 
ATOM   783  O  "O5'" . DC  B 2 8   ? 47.409 44.326  13.576 1.00 71.99  ? 40  DC  C "O5'" 1 
ATOM   784  C  "C5'" . DC  B 2 8   ? 47.108 45.528  14.272 1.00 71.89  ? 40  DC  C "C5'" 1 
ATOM   785  C  "C4'" . DC  B 2 8   ? 48.354 46.365  14.436 1.00 72.38  ? 40  DC  C "C4'" 1 
ATOM   786  O  "O4'" . DC  B 2 8   ? 47.933 47.683  14.851 1.00 71.64  ? 40  DC  C "O4'" 1 
ATOM   787  C  "C3'" . DC  B 2 8   ? 49.314 45.878  15.520 1.00 71.65  ? 40  DC  C "C3'" 1 
ATOM   788  O  "O3'" . DC  B 2 8   ? 50.683 46.236  15.225 1.00 68.71  ? 40  DC  C "O3'" 1 
ATOM   789  C  "C2'" . DC  B 2 8   ? 48.761 46.557  16.760 1.00 71.03  ? 40  DC  C "C2'" 1 
ATOM   790  C  "C1'" . DC  B 2 8   ? 48.221 47.886  16.228 1.00 69.65  ? 40  DC  C "C1'" 1 
ATOM   791  N  N1    . DC  B 2 8   ? 46.965 48.306  16.877 1.00 66.49  ? 40  DC  C N1    1 
ATOM   792  C  C2    . DC  B 2 8   ? 46.942 49.496  17.605 1.00 65.07  ? 40  DC  C C2    1 
ATOM   793  O  O2    . DC  B 2 8   ? 47.982 50.175  17.687 1.00 63.30  ? 40  DC  C O2    1 
ATOM   794  N  N3    . DC  B 2 8   ? 45.788 49.880  18.204 1.00 64.47  ? 40  DC  C N3    1 
ATOM   795  C  C4    . DC  B 2 8   ? 44.693 49.123  18.094 1.00 64.09  ? 40  DC  C C4    1 
ATOM   796  N  N4    . DC  B 2 8   ? 43.584 49.539  18.701 1.00 64.74  ? 40  DC  C N4    1 
ATOM   797  C  C5    . DC  B 2 8   ? 44.689 47.909  17.358 1.00 64.39  ? 40  DC  C C5    1 
ATOM   798  C  C6    . DC  B 2 8   ? 45.833 47.541  16.770 1.00 65.79  ? 40  DC  C C6    1 
ATOM   799  P  P     . DC  B 2 9   ? 51.888 45.207  15.574 1.00 63.03  ? 41  DC  C P     1 
ATOM   800  O  OP1   . DC  B 2 9   ? 52.987 45.426  14.600 1.00 64.90  ? 41  DC  C OP1   1 
ATOM   801  O  OP2   . DC  B 2 9   ? 51.330 43.842  15.754 1.00 63.04  ? 41  DC  C OP2   1 
ATOM   802  O  "O5'" . DC  B 2 9   ? 52.404 45.690  16.993 1.00 55.11  ? 41  DC  C "O5'" 1 
ATOM   803  C  "C5'" . DC  B 2 9   ? 51.514 46.350  17.874 1.00 49.09  ? 41  DC  C "C5'" 1 
ATOM   804  C  "C4'" . DC  B 2 9   ? 52.233 47.433  18.636 1.00 44.39  ? 41  DC  C "C4'" 1 
ATOM   805  O  "O4'" . DC  B 2 9   ? 51.260 48.398  19.084 1.00 41.13  ? 41  DC  C "O4'" 1 
ATOM   806  C  "C3'" . DC  B 2 9   ? 52.929 46.950  19.895 1.00 42.51  ? 41  DC  C "C3'" 1 
ATOM   807  O  "O3'" . DC  B 2 9   ? 54.041 47.804  20.162 1.00 45.44  ? 41  DC  C "O3'" 1 
ATOM   808  C  "C2'" . DC  B 2 9   ? 51.824 47.042  20.931 1.00 39.57  ? 41  DC  C "C2'" 1 
ATOM   809  C  "C1'" . DC  B 2 9   ? 51.028 48.263  20.480 1.00 36.37  ? 41  DC  C "C1'" 1 
ATOM   810  N  N1    . DC  B 2 9   ? 49.571 48.146  20.659 1.00 30.73  ? 41  DC  C N1    1 
ATOM   811  C  C2    . DC  B 2 9   ? 48.925 48.978  21.569 1.00 30.69  ? 41  DC  C C2    1 
ATOM   812  O  O2    . DC  B 2 9   ? 49.591 49.783  22.218 1.00 32.71  ? 41  DC  C O2    1 
ATOM   813  N  N3    . DC  B 2 9   ? 47.585 48.883  21.722 1.00 30.83  ? 41  DC  C N3    1 
ATOM   814  C  C4    . DC  B 2 9   ? 46.897 47.994  21.004 1.00 32.87  ? 41  DC  C C4    1 
ATOM   815  N  N4    . DC  B 2 9   ? 45.574 47.927  21.184 1.00 35.72  ? 41  DC  C N4    1 
ATOM   816  C  C5    . DC  B 2 9   ? 47.532 47.130  20.069 1.00 30.68  ? 41  DC  C C5    1 
ATOM   817  C  C6    . DC  B 2 9   ? 48.856 47.238  19.931 1.00 30.98  ? 41  DC  C C6    1 
ATOM   818  P  P     . DA  B 2 10  ? 55.013 47.493  21.400 1.00 47.15  ? 42  DA  C P     1 
ATOM   819  O  OP1   . DA  B 2 10  ? 56.358 48.024  21.065 1.00 48.99  ? 42  DA  C OP1   1 
ATOM   820  O  OP2   . DA  B 2 10  ? 54.865 46.070  21.781 1.00 50.59  ? 42  DA  C OP2   1 
ATOM   821  O  "O5'" . DA  B 2 10  ? 54.401 48.387  22.559 1.00 43.90  ? 42  DA  C "O5'" 1 
ATOM   822  C  "C5'" . DA  B 2 10  ? 54.463 49.817  22.476 1.00 47.66  ? 42  DA  C "C5'" 1 
ATOM   823  C  "C4'" . DA  B 2 10  ? 54.194 50.431  23.829 1.00 48.26  ? 42  DA  C "C4'" 1 
ATOM   824  O  "O4'" . DA  B 2 10  ? 52.790 50.262  24.143 1.00 45.14  ? 42  DA  C "O4'" 1 
ATOM   825  C  "C3'" . DA  B 2 10  ? 54.944 49.733  24.960 1.00 47.83  ? 42  DA  C "C3'" 1 
ATOM   826  O  "O3'" . DA  B 2 10  ? 55.239 50.663  26.015 1.00 52.10  ? 42  DA  C "O3'" 1 
ATOM   827  C  "C2'" . DA  B 2 10  ? 53.984 48.623  25.357 1.00 42.97  ? 42  DA  C "C2'" 1 
ATOM   828  C  "C1'" . DA  B 2 10  ? 52.616 49.277  25.151 1.00 37.23  ? 42  DA  C "C1'" 1 
ATOM   829  N  N9    . DA  B 2 10  ? 51.532 48.393  24.719 1.00 27.42  ? 42  DA  C N9    1 
ATOM   830  C  C8    . DA  B 2 10  ? 51.623 47.191  24.063 1.00 26.95  ? 42  DA  C C8    1 
ATOM   831  N  N7    . DA  B 2 10  ? 50.464 46.637  23.810 1.00 22.30  ? 42  DA  C N7    1 
ATOM   832  C  C5    . DA  B 2 10  ? 49.547 47.535  24.334 1.00 16.06  ? 42  DA  C C5    1 
ATOM   833  C  C6    . DA  B 2 10  ? 48.151 47.529  24.386 1.00 8.47   ? 42  DA  C C6    1 
ATOM   834  N  N6    . DA  B 2 10  ? 47.400 46.554  23.889 1.00 9.54   ? 42  DA  C N6    1 
ATOM   835  N  N1    . DA  B 2 10  ? 47.542 48.571  24.971 1.00 3.97   ? 42  DA  C N1    1 
ATOM   836  C  C2    . DA  B 2 10  ? 48.294 49.547  25.470 1.00 9.23   ? 42  DA  C C2    1 
ATOM   837  N  N3    . DA  B 2 10  ? 49.613 49.669  25.486 1.00 14.75  ? 42  DA  C N3    1 
ATOM   838  C  C4    . DA  B 2 10  ? 50.189 48.618  24.895 1.00 18.83  ? 42  DA  C C4    1 
ATOM   839  P  P     . DT  B 2 11  ? 56.120 50.194  27.278 1.00 55.83  ? 43  DT  C P     1 
ATOM   840  O  OP1   . DT  B 2 11  ? 57.054 51.270  27.642 1.00 54.91  ? 43  DT  C OP1   1 
ATOM   841  O  OP2   . DT  B 2 11  ? 56.659 48.866  26.980 1.00 56.07  ? 43  DT  C OP2   1 
ATOM   842  O  "O5'" . DT  B 2 11  ? 55.031 50.032  28.430 1.00 57.48  ? 43  DT  C "O5'" 1 
ATOM   843  C  "C5'" . DT  B 2 11  ? 53.719 49.532  28.118 1.00 57.16  ? 43  DT  C "C5'" 1 
ATOM   844  C  "C4'" . DT  B 2 11  ? 52.661 50.351  28.814 1.00 56.57  ? 43  DT  C "C4'" 1 
ATOM   845  O  "O4'" . DT  B 2 11  ? 51.371 49.990  28.252 1.00 56.37  ? 43  DT  C "O4'" 1 
ATOM   846  C  "C3'" . DT  B 2 11  ? 52.569 49.986  30.289 1.00 57.75  ? 43  DT  C "C3'" 1 
ATOM   847  O  "O3'" . DT  B 2 11  ? 52.159 51.089  31.095 1.00 59.77  ? 43  DT  C "O3'" 1 
ATOM   848  C  "C2'" . DT  B 2 11  ? 51.577 48.838  30.299 1.00 57.48  ? 43  DT  C "C2'" 1 
ATOM   849  C  "C1'" . DT  B 2 11  ? 50.611 49.209  29.179 1.00 53.89  ? 43  DT  C "C1'" 1 
ATOM   850  N  N1    . DT  B 2 11  ? 50.037 48.042  28.451 1.00 48.58  ? 43  DT  C N1    1 
ATOM   851  C  C2    . DT  B 2 11  ? 48.664 47.899  28.389 1.00 45.13  ? 43  DT  C C2    1 
ATOM   852  O  O2    . DT  B 2 11  ? 47.881 48.686  28.895 1.00 43.99  ? 43  DT  C O2    1 
ATOM   853  N  N3    . DT  B 2 11  ? 48.237 46.790  27.705 1.00 42.64  ? 43  DT  C N3    1 
ATOM   854  C  C4    . DT  B 2 11  ? 49.013 45.833  27.094 1.00 44.49  ? 43  DT  C C4    1 
ATOM   855  O  O4    . DT  B 2 11  ? 48.478 44.890  26.515 1.00 43.83  ? 43  DT  C O4    1 
ATOM   856  C  C5    . DT  B 2 11  ? 50.437 46.040  27.195 1.00 47.44  ? 43  DT  C C5    1 
ATOM   857  C  C7    . DT  B 2 11  ? 51.362 45.048  26.560 1.00 49.57  ? 43  DT  C C7    1 
ATOM   858  C  C6    . DT  B 2 11  ? 50.871 47.119  27.858 1.00 47.22  ? 43  DT  C C6    1 
ATOM   859  P  P     . DC  B 2 12  ? 52.168 50.944  32.699 1.00 62.50  ? 44  DC  C P     1 
ATOM   860  O  OP1   . DC  B 2 12  ? 52.531 52.243  33.281 1.00 64.10  ? 44  DC  C OP1   1 
ATOM   861  O  OP2   . DC  B 2 12  ? 52.938 49.757  33.081 1.00 63.09  ? 44  DC  C OP2   1 
ATOM   862  O  "O5'" . DC  B 2 12  ? 50.652 50.640  33.049 1.00 61.29  ? 44  DC  C "O5'" 1 
ATOM   863  C  "C5'" . DC  B 2 12  ? 49.662 51.658  32.894 1.00 63.66  ? 44  DC  C "C5'" 1 
ATOM   864  C  "C4'" . DC  B 2 12  ? 48.423 51.301  33.677 1.00 64.74  ? 44  DC  C "C4'" 1 
ATOM   865  O  "O4'" . DC  B 2 12  ? 47.783 50.169  33.047 1.00 61.94  ? 44  DC  C "O4'" 1 
ATOM   866  C  "C3'" . DC  B 2 12  ? 48.724 50.841  35.099 1.00 66.33  ? 44  DC  C "C3'" 1 
ATOM   867  O  "O3'" . DC  B 2 12  ? 47.607 51.168  35.933 1.00 72.82  ? 44  DC  C "O3'" 1 
ATOM   868  C  "C2'" . DC  B 2 12  ? 48.952 49.347  34.930 1.00 62.29  ? 44  DC  C "C2'" 1 
ATOM   869  C  "C1'" . DC  B 2 12  ? 47.958 48.998  33.832 1.00 57.45  ? 44  DC  C "C1'" 1 
ATOM   870  N  N1    . DC  B 2 12  ? 48.292 47.893  32.914 1.00 51.17  ? 44  DC  C N1    1 
ATOM   871  C  C2    . DC  B 2 12  ? 47.244 47.134  32.378 1.00 48.71  ? 44  DC  C C2    1 
ATOM   872  O  O2    . DC  B 2 12  ? 46.075 47.408  32.701 1.00 47.24  ? 44  DC  C O2    1 
ATOM   873  N  N3    . DC  B 2 12  ? 47.526 46.121  31.522 1.00 47.56  ? 44  DC  C N3    1 
ATOM   874  C  C4    . DC  B 2 12  ? 48.791 45.854  31.198 1.00 47.44  ? 44  DC  C C4    1 
ATOM   875  N  N4    . DC  B 2 12  ? 49.016 44.845  30.345 1.00 45.72  ? 44  DC  C N4    1 
ATOM   876  C  C5    . DC  B 2 12  ? 49.880 46.607  31.731 1.00 49.30  ? 44  DC  C C5    1 
ATOM   877  C  C6    . DC  B 2 12  ? 49.588 47.609  32.577 1.00 50.00  ? 44  DC  C C6    1 
ATOM   878  P  P     . DC  B 2 13  ? 47.478 50.530  37.400 1.00 79.67  ? 45  DC  C P     1 
ATOM   879  O  OP1   . DC  B 2 13  ? 46.757 51.493  38.233 1.00 80.54  ? 45  DC  C OP1   1 
ATOM   880  O  OP2   . DC  B 2 13  ? 48.795 50.053  37.847 1.00 82.88  ? 45  DC  C OP2   1 
ATOM   881  O  "O5'" . DC  B 2 13  ? 46.535 49.271  37.162 1.00 78.99  ? 45  DC  C "O5'" 1 
ATOM   882  C  "C5'" . DC  B 2 13  ? 45.181 49.464  36.738 1.00 79.81  ? 45  DC  C "C5'" 1 
ATOM   883  C  "C4'" . DC  B 2 13  ? 44.332 48.265  37.093 1.00 80.87  ? 45  DC  C "C4'" 1 
ATOM   884  O  "O4'" . DC  B 2 13  ? 44.685 47.160  36.229 1.00 77.97  ? 45  DC  C "O4'" 1 
ATOM   885  C  "C3'" . DC  B 2 13  ? 44.575 47.751  38.514 1.00 82.29  ? 45  DC  C "C3'" 1 
ATOM   886  O  "O3'" . DC  B 2 13  ? 43.395 47.081  38.968 1.00 87.15  ? 45  DC  C "O3'" 1 
ATOM   887  C  "C2'" . DC  B 2 13  ? 45.724 46.776  38.325 1.00 78.56  ? 45  DC  C "C2'" 1 
ATOM   888  C  "C1'" . DC  B 2 13  ? 45.384 46.173  36.970 1.00 74.50  ? 45  DC  C "C1'" 1 
ATOM   889  N  N1    . DC  B 2 13  ? 46.466 45.643  36.128 1.00 68.58  ? 45  DC  C N1    1 
ATOM   890  C  C2    . DC  B 2 13  ? 46.154 44.628  35.216 1.00 66.69  ? 45  DC  C C2    1 
ATOM   891  O  O2    . DC  B 2 13  ? 44.984 44.218  35.146 1.00 65.13  ? 45  DC  C O2    1 
ATOM   892  N  N3    . DC  B 2 13  ? 47.128 44.119  34.435 1.00 66.17  ? 45  DC  C N3    1 
ATOM   893  C  C4    . DC  B 2 13  ? 48.374 44.584  34.534 1.00 65.85  ? 45  DC  C C4    1 
ATOM   894  N  N4    . DC  B 2 13  ? 49.299 44.048  33.737 1.00 65.81  ? 45  DC  C N4    1 
ATOM   895  C  C5    . DC  B 2 13  ? 48.723 45.619  35.452 1.00 66.07  ? 45  DC  C C5    1 
ATOM   896  C  C6    . DC  B 2 13  ? 47.746 46.115  36.223 1.00 66.94  ? 45  DC  C C6    1 
ATOM   897  P  P     . DA  B 2 14  ? 43.255 46.628  40.505 1.00 91.20  ? 46  DA  C P     1 
ATOM   898  O  OP1   . DA  B 2 14  ? 42.570 47.695  41.247 1.00 91.41  ? 46  DA  C OP1   1 
ATOM   899  O  OP2   . DA  B 2 14  ? 44.552 46.148  40.992 1.00 92.00  ? 46  DA  C OP2   1 
ATOM   900  O  "O5'" . DA  B 2 14  ? 42.269 45.384  40.401 1.00 92.19  ? 46  DA  C "O5'" 1 
ATOM   901  C  "C5'" . DA  B 2 14  ? 41.074 45.481  39.607 1.00 91.95  ? 46  DA  C "C5'" 1 
ATOM   902  C  "C4'" . DA  B 2 14  ? 40.652 44.125  39.087 1.00 91.83  ? 46  DA  C "C4'" 1 
ATOM   903  O  "O4'" . DA  B 2 14  ? 41.678 43.599  38.206 1.00 90.35  ? 46  DA  C "O4'" 1 
ATOM   904  C  "C3'" . DA  B 2 14  ? 40.518 43.082  40.193 1.00 93.05  ? 46  DA  C "C3'" 1 
ATOM   905  O  "O3'" . DA  B 2 14  ? 39.542 42.108  39.810 1.00 96.91  ? 46  DA  C "O3'" 1 
ATOM   906  C  "C2'" . DA  B 2 14  ? 41.917 42.497  40.288 1.00 90.44  ? 46  DA  C "C2'" 1 
ATOM   907  C  "C1'" . DA  B 2 14  ? 42.360 42.513  38.831 1.00 89.06  ? 46  DA  C "C1'" 1 
ATOM   908  N  N9    . DA  B 2 14  ? 43.795 42.664  38.591 1.00 87.24  ? 46  DA  C N9    1 
ATOM   909  C  C8    . DA  B 2 14  ? 44.680 43.534  39.186 1.00 87.08  ? 46  DA  C C8    1 
ATOM   910  N  N7    . DA  B 2 14  ? 45.912 43.415  38.751 1.00 85.26  ? 46  DA  C N7    1 
ATOM   911  C  C5    . DA  B 2 14  ? 45.836 42.401  37.807 1.00 83.30  ? 46  DA  C C5    1 
ATOM   912  C  C6    . DA  B 2 14  ? 46.804 41.805  36.984 1.00 80.27  ? 46  DA  C C6    1 
ATOM   913  N  N6    . DA  B 2 14  ? 48.089 42.156  36.980 1.00 79.08  ? 46  DA  C N6    1 
ATOM   914  N  N1    . DA  B 2 14  ? 46.400 40.820  36.152 1.00 79.41  ? 46  DA  C N1    1 
ATOM   915  C  C2    . DA  B 2 14  ? 45.107 40.465  36.156 1.00 80.59  ? 46  DA  C C2    1 
ATOM   916  N  N3    . DA  B 2 14  ? 44.104 40.949  36.881 1.00 82.08  ? 46  DA  C N3    1 
ATOM   917  C  C4    . DA  B 2 14  ? 44.539 41.928  37.697 1.00 84.65  ? 46  DA  C C4    1 
ATOM   918  P  P     . DG  B 2 15  ? 39.162 40.910  40.812 1.00 99.38  ? 47  DG  C P     1 
ATOM   919  O  OP1   . DG  B 2 15  ? 37.699 40.893  40.935 1.00 98.91  ? 47  DG  C OP1   1 
ATOM   920  O  OP2   . DG  B 2 15  ? 39.972 41.037  42.034 1.00 100.00 ? 47  DG  C OP2   1 
ATOM   921  O  "O5'" . DG  B 2 15  ? 39.634 39.604  40.021 1.00 97.93  ? 47  DG  C "O5'" 1 
ATOM   922  C  "C5'" . DG  B 2 15  ? 39.126 39.328  38.696 1.00 95.46  ? 47  DG  C "C5'" 1 
ATOM   923  C  "C4'" . DG  B 2 15  ? 39.555 37.959  38.210 1.00 93.64  ? 47  DG  C "C4'" 1 
ATOM   924  O  "O4'" . DG  B 2 15  ? 40.968 37.978  37.877 1.00 92.11  ? 47  DG  C "O4'" 1 
ATOM   925  C  "C3'" . DG  B 2 15  ? 39.419 36.862  39.267 1.00 93.22  ? 47  DG  C "C3'" 1 
ATOM   926  O  "O3'" . DG  B 2 15  ? 39.155 35.597  38.641 1.00 94.41  ? 47  DG  C "O3'" 1 
ATOM   927  C  "C2'" . DG  B 2 15  ? 40.758 36.909  39.980 1.00 91.93  ? 47  DG  C "C2'" 1 
ATOM   928  C  "C1'" . DG  B 2 15  ? 41.712 37.233  38.837 1.00 90.18  ? 47  DG  C "C1'" 1 
ATOM   929  N  N9    . DG  B 2 15  ? 42.896 37.999  39.212 1.00 86.99  ? 47  DG  C N9    1 
ATOM   930  C  C8    . DG  B 2 15  ? 42.982 39.007  40.143 1.00 84.87  ? 47  DG  C C8    1 
ATOM   931  N  N7    . DG  B 2 15  ? 44.187 39.488  40.265 1.00 84.32  ? 47  DG  C N7    1 
ATOM   932  C  C5    . DG  B 2 15  ? 44.942 38.757  39.358 1.00 84.50  ? 47  DG  C C5    1 
ATOM   933  C  C6    . DG  B 2 15  ? 46.321 38.833  39.044 1.00 84.84  ? 47  DG  C C6    1 
ATOM   934  O  O6    . DG  B 2 15  ? 47.176 39.588  39.521 1.00 86.35  ? 47  DG  C O6    1 
ATOM   935  N  N1    . DG  B 2 15  ? 46.676 37.909  38.065 1.00 83.66  ? 47  DG  C N1    1 
ATOM   936  C  C2    . DG  B 2 15  ? 45.810 37.022  37.466 1.00 83.97  ? 47  DG  C C2    1 
ATOM   937  N  N2    . DG  B 2 15  ? 46.336 36.202  36.539 1.00 84.16  ? 47  DG  C N2    1 
ATOM   938  N  N3    . DG  B 2 15  ? 44.521 36.944  37.753 1.00 84.27  ? 47  DG  C N3    1 
ATOM   939  C  C4    . DG  B 2 15  ? 44.160 37.835  38.700 1.00 85.10  ? 47  DG  C C4    1 
ATOM   940  P  P     . DG  B 2 16  ? 39.570 34.224  39.378 1.00 93.49  ? 48  DG  C P     1 
ATOM   941  O  OP1   . DG  B 2 16  ? 38.709 33.160  38.844 1.00 94.36  ? 48  DG  C OP1   1 
ATOM   942  O  OP2   . DG  B 2 16  ? 39.599 34.448  40.829 1.00 92.87  ? 48  DG  C OP2   1 
ATOM   943  O  "O5'" . DG  B 2 16  ? 41.056 33.965  38.860 1.00 91.55  ? 48  DG  C "O5'" 1 
ATOM   944  C  "C5'" . DG  B 2 16  ? 41.335 33.980  37.448 1.00 88.86  ? 48  DG  C "C5'" 1 
ATOM   945  C  "C4'" . DG  B 2 16  ? 42.449 33.019  37.092 1.00 87.49  ? 48  DG  C "C4'" 1 
ATOM   946  O  "O4'" . DG  B 2 16  ? 43.722 33.585  37.479 1.00 84.07  ? 48  DG  C "O4'" 1 
ATOM   947  C  "C3'" . DG  B 2 16  ? 42.378 31.675  37.820 1.00 88.55  ? 48  DG  C "C3'" 1 
ATOM   948  O  "O3'" . DG  B 2 16  ? 43.000 30.673  36.996 1.00 92.36  ? 48  DG  C "O3'" 1 
ATOM   949  C  "C2'" . DG  B 2 16  ? 43.154 31.949  39.100 1.00 85.17  ? 48  DG  C "C2'" 1 
ATOM   950  C  "C1'" . DG  B 2 16  ? 44.247 32.881  38.595 1.00 82.00  ? 48  DG  C "C1'" 1 
ATOM   951  N  N9    . DG  B 2 16  ? 44.834 33.849  39.515 1.00 77.39  ? 48  DG  C N9    1 
ATOM   952  C  C8    . DG  B 2 16  ? 44.208 34.575  40.499 1.00 75.56  ? 48  DG  C C8    1 
ATOM   953  N  N7    . DG  B 2 16  ? 45.023 35.362  41.150 1.00 74.66  ? 48  DG  C N7    1 
ATOM   954  C  C5    . DG  B 2 16  ? 46.260 35.142  40.560 1.00 74.76  ? 48  DG  C C5    1 
ATOM   955  C  C6    . DG  B 2 16  ? 47.534 35.714  40.840 1.00 74.45  ? 48  DG  C C6    1 
ATOM   956  O  O6    . DG  B 2 16  ? 47.829 36.556  41.698 1.00 76.72  ? 48  DG  C O6    1 
ATOM   957  N  N1    . DG  B 2 16  ? 48.521 35.208  39.998 1.00 72.10  ? 48  DG  C N1    1 
ATOM   958  C  C2    . DG  B 2 16  ? 48.314 34.273  39.011 1.00 72.35  ? 48  DG  C C2    1 
ATOM   959  N  N2    . DG  B 2 16  ? 49.394 33.905  38.296 1.00 70.17  ? 48  DG  C N2    1 
ATOM   960  N  N3    . DG  B 2 16  ? 47.134 33.734  38.742 1.00 74.48  ? 48  DG  C N3    1 
ATOM   961  C  C4    . DG  B 2 16  ? 46.160 34.212  39.549 1.00 75.46  ? 48  DG  C C4    1 
ATOM   962  P  P     . DT  B 2 17  ? 43.193 29.169  37.540 1.00 93.84  ? 49  DT  C P     1 
ATOM   963  O  OP1   . DT  B 2 17  ? 42.497 28.275  36.618 1.00 94.10  ? 49  DT  C OP1   1 
ATOM   964  O  OP2   . DT  B 2 17  ? 42.859 29.114  38.972 1.00 94.70  ? 49  DT  C OP2   1 
ATOM   965  O  "O5'" . DT  B 2 17  ? 44.760 28.922  37.379 1.00 93.64  ? 49  DT  C "O5'" 1 
ATOM   966  C  "C5'" . DT  B 2 17  ? 45.698 29.863  37.930 1.00 91.73  ? 49  DT  C "C5'" 1 
ATOM   967  C  "C4'" . DT  B 2 17  ? 47.052 29.748  37.263 1.00 88.76  ? 49  DT  C "C4'" 1 
ATOM   968  O  "O4'" . DT  B 2 17  ? 47.877 30.816  37.783 1.00 86.97  ? 49  DT  C "O4'" 1 
ATOM   969  C  "C3'" . DT  B 2 17  ? 47.833 28.470  37.555 1.00 87.56  ? 49  DT  C "C3'" 1 
ATOM   970  O  "O3'" . DT  B 2 17  ? 48.755 28.175  36.497 1.00 86.20  ? 49  DT  C "O3'" 1 
ATOM   971  C  "C2'" . DT  B 2 17  ? 48.561 28.814  38.839 1.00 86.43  ? 49  DT  C "C2'" 1 
ATOM   972  C  "C1'" . DT  B 2 17  ? 48.845 30.307  38.702 1.00 83.70  ? 49  DT  C "C1'" 1 
ATOM   973  N  N1    . DT  B 2 17  ? 48.646 31.016  39.981 1.00 77.64  ? 49  DT  C N1    1 
ATOM   974  C  C2    . DT  B 2 17  ? 49.737 31.580  40.611 1.00 75.07  ? 49  DT  C C2    1 
ATOM   975  O  O2    . DT  B 2 17  ? 50.877 31.526  40.166 1.00 74.35  ? 49  DT  C O2    1 
ATOM   976  N  N3    . DT  B 2 17  ? 49.443 32.217  41.791 1.00 72.20  ? 49  DT  C N3    1 
ATOM   977  C  C4    . DT  B 2 17  ? 48.207 32.346  42.390 1.00 70.50  ? 49  DT  C C4    1 
ATOM   978  O  O4    . DT  B 2 17  ? 48.109 32.951  43.451 1.00 68.46  ? 49  DT  C O4    1 
ATOM   979  C  C5    . DT  B 2 17  ? 47.107 31.729  41.676 1.00 71.18  ? 49  DT  C C5    1 
ATOM   980  C  C7    . DT  B 2 17  ? 45.726 31.813  42.246 1.00 70.07  ? 49  DT  C C7    1 
ATOM   981  C  C6    . DT  B 2 17  ? 47.377 31.104  40.526 1.00 73.47  ? 49  DT  C C6    1 
ATOM   982  P  P     . DA  B 2 18  ? 49.610 26.813  36.541 1.00 84.09  ? 50  DA  C P     1 
ATOM   983  O  OP1   . DA  B 2 18  ? 50.286 26.654  35.223 1.00 83.93  ? 50  DA  C OP1   1 
ATOM   984  O  OP2   . DA  B 2 18  ? 48.715 25.733  37.043 1.00 85.39  ? 50  DA  C OP2   1 
ATOM   985  O  "O5'" . DA  B 2 18  ? 50.712 27.082  37.662 1.00 79.44  ? 50  DA  C "O5'" 1 
ATOM   986  C  "C5'" . DA  B 2 18  ? 51.978 27.688  37.327 1.00 72.42  ? 50  DA  C "C5'" 1 
ATOM   987  C  "C4'" . DA  B 2 18  ? 53.035 27.337  38.353 1.00 66.73  ? 50  DA  C "C4'" 1 
ATOM   988  O  "O4'" . DA  B 2 18  ? 52.723 28.004  39.601 1.00 62.38  ? 50  DA  C "O4'" 1 
ATOM   989  C  "C3'" . DA  B 2 18  ? 53.071 25.845  38.700 1.00 63.39  ? 50  DA  C "C3'" 1 
ATOM   990  O  "O3'" . DA  B 2 18  ? 54.383 25.436  39.113 1.00 62.33  ? 50  DA  C "O3'" 1 
ATOM   991  C  "C2'" . DA  B 2 18  ? 52.067 25.734  39.832 1.00 60.45  ? 50  DA  C "C2'" 1 
ATOM   992  C  "C1'" . DA  B 2 18  ? 52.282 27.054  40.564 1.00 58.19  ? 50  DA  C "C1'" 1 
ATOM   993  N  N9    . DA  B 2 18  ? 51.134 27.614  41.284 1.00 52.88  ? 50  DA  C N9    1 
ATOM   994  C  C8    . DA  B 2 18  ? 49.799 27.311  41.140 1.00 51.63  ? 50  DA  C C8    1 
ATOM   995  N  N7    . DA  B 2 18  ? 49.013 27.979  41.951 1.00 48.88  ? 50  DA  C N7    1 
ATOM   996  C  C5    . DA  B 2 18  ? 49.887 28.776  42.677 1.00 46.95  ? 50  DA  C C5    1 
ATOM   997  C  C6    . DA  B 2 18  ? 49.678 29.712  43.699 1.00 44.57  ? 50  DA  C C6    1 
ATOM   998  N  N6    . DA  B 2 18  ? 48.476 30.020  44.185 1.00 42.91  ? 50  DA  C N6    1 
ATOM   999  N  N1    . DA  B 2 18  ? 50.761 30.332  44.212 1.00 43.30  ? 50  DA  C N1    1 
ATOM   1000 C  C2    . DA  B 2 18  ? 51.967 30.021  43.725 1.00 44.71  ? 50  DA  C C2    1 
ATOM   1001 N  N3    . DA  B 2 18  ? 52.293 29.160  42.768 1.00 45.72  ? 50  DA  C N3    1 
ATOM   1002 C  C4    . DA  B 2 18  ? 51.195 28.563  42.277 1.00 48.05  ? 50  DA  C C4    1 
ATOM   1003 P  P     . DC  B 2 19  ? 54.727 23.869  39.257 1.00 62.80  ? 51  DC  C P     1 
ATOM   1004 O  OP1   . DC  B 2 19  ? 56.042 23.605  38.620 1.00 65.41  ? 51  DC  C OP1   1 
ATOM   1005 O  OP2   . DC  B 2 19  ? 53.537 23.082  38.839 1.00 64.76  ? 51  DC  C OP2   1 
ATOM   1006 O  "O5'" . DC  B 2 19  ? 54.913 23.658  40.820 1.00 57.78  ? 51  DC  C "O5'" 1 
ATOM   1007 C  "C5'" . DC  B 2 19  ? 54.216 24.487  41.747 1.00 52.29  ? 51  DC  C "C5'" 1 
ATOM   1008 C  "C4'" . DC  B 2 19  ? 55.195 25.126  42.702 1.00 48.79  ? 51  DC  C "C4'" 1 
ATOM   1009 O  "O4'" . DC  B 2 19  ? 54.520 26.216  43.364 1.00 46.81  ? 51  DC  C "O4'" 1 
ATOM   1010 C  "C3'" . DC  B 2 19  ? 55.651 24.195  43.823 1.00 46.26  ? 51  DC  C "C3'" 1 
ATOM   1011 O  "O3'" . DC  B 2 19  ? 56.958 24.564  44.291 1.00 40.48  ? 51  DC  C "O3'" 1 
ATOM   1012 C  "C2'" . DC  B 2 19  ? 54.581 24.400  44.878 1.00 45.94  ? 51  DC  C "C2'" 1 
ATOM   1013 C  "C1'" . DC  B 2 19  ? 54.241 25.876  44.712 1.00 45.33  ? 51  DC  C "C1'" 1 
ATOM   1014 N  N1    . DC  B 2 19  ? 52.844 26.254  44.989 1.00 43.39  ? 51  DC  C N1    1 
ATOM   1015 C  C2    . DC  B 2 19  ? 52.596 27.352  45.824 1.00 43.23  ? 51  DC  C C2    1 
ATOM   1016 O  O2    . DC  B 2 19  ? 53.558 27.972  46.306 1.00 44.25  ? 51  DC  C O2    1 
ATOM   1017 N  N3    . DC  B 2 19  ? 51.316 27.709  46.083 1.00 42.41  ? 51  DC  C N3    1 
ATOM   1018 C  C4    . DC  B 2 19  ? 50.311 27.016  45.546 1.00 42.68  ? 51  DC  C C4    1 
ATOM   1019 N  N4    . DC  B 2 19  ? 49.069 27.405  45.828 1.00 44.82  ? 51  DC  C N4    1 
ATOM   1020 C  C5    . DC  B 2 19  ? 50.534 25.894  44.695 1.00 42.19  ? 51  DC  C C5    1 
ATOM   1021 C  C6    . DC  B 2 19  ? 51.803 25.552  44.444 1.00 42.29  ? 51  DC  C C6    1 
ATOM   1022 P  P     . DT  B 2 20  ? 57.515 23.960  45.671 1.00 35.50  ? 52  DT  C P     1 
ATOM   1023 O  OP1   . DT  B 2 20  ? 58.968 24.069  45.638 1.00 38.23  ? 52  DT  C OP1   1 
ATOM   1024 O  OP2   . DT  B 2 20  ? 56.911 22.640  45.881 1.00 37.83  ? 52  DT  C OP2   1 
ATOM   1025 O  "O5'" . DT  B 2 20  ? 56.982 24.981  46.765 1.00 31.72  ? 52  DT  C "O5'" 1 
ATOM   1026 C  "C5'" . DT  B 2 20  ? 57.432 26.341  46.729 1.00 36.35  ? 52  DT  C "C5'" 1 
ATOM   1027 C  "C4'" . DT  B 2 20  ? 57.503 26.930  48.120 1.00 39.43  ? 52  DT  C "C4'" 1 
ATOM   1028 O  "O4'" . DT  B 2 20  ? 56.168 27.293  48.546 1.00 37.68  ? 52  DT  C "O4'" 1 
ATOM   1029 C  "C3'" . DT  B 2 20  ? 58.016 25.964  49.186 1.00 40.08  ? 52  DT  C "C3'" 1 
ATOM   1030 O  "O3'" . DT  B 2 20  ? 58.684 26.686  50.230 1.00 43.19  ? 52  DT  C "O3'" 1 
ATOM   1031 C  "C2'" . DT  B 2 20  ? 56.743 25.276  49.646 1.00 38.09  ? 52  DT  C "C2'" 1 
ATOM   1032 C  "C1'" . DT  B 2 20  ? 55.714 26.400  49.551 1.00 35.20  ? 52  DT  C "C1'" 1 
ATOM   1033 N  N1    . DT  B 2 20  ? 54.327 25.997  49.222 1.00 31.48  ? 52  DT  C N1    1 
ATOM   1034 C  C2    . DT  B 2 20  ? 53.300 26.619  49.902 1.00 31.52  ? 52  DT  C C2    1 
ATOM   1035 O  O2    . DT  B 2 20  ? 53.477 27.485  50.752 1.00 33.16  ? 52  DT  C O2    1 
ATOM   1036 N  N3    . DT  B 2 20  ? 52.046 26.186  49.554 1.00 27.31  ? 52  DT  C N3    1 
ATOM   1037 C  C4    . DT  B 2 20  ? 51.726 25.221  48.623 1.00 25.83  ? 52  DT  C C4    1 
ATOM   1038 O  O4    . DT  B 2 20  ? 50.556 24.936  48.416 1.00 30.87  ? 52  DT  C O4    1 
ATOM   1039 C  C5    . DT  B 2 20  ? 52.837 24.616  47.955 1.00 23.07  ? 52  DT  C C5    1 
ATOM   1040 C  C7    . DT  B 2 20  ? 52.564 23.557  46.940 1.00 20.90  ? 52  DT  C C7    1 
ATOM   1041 C  C6    . DT  B 2 20  ? 54.069 25.027  48.275 1.00 25.86  ? 52  DT  C C6    1 
ATOM   1042 P  P     . DA  B 2 21  ? 59.201 25.919  51.550 1.00 49.54  ? 53  DA  C P     1 
ATOM   1043 O  OP1   . DA  B 2 21  ? 60.537 26.419  51.882 1.00 50.93  ? 53  DA  C OP1   1 
ATOM   1044 O  OP2   . DA  B 2 21  ? 59.015 24.470  51.398 1.00 50.84  ? 53  DA  C OP2   1 
ATOM   1045 O  "O5'" . DA  B 2 21  ? 58.195 26.444  52.662 1.00 47.98  ? 53  DA  C "O5'" 1 
ATOM   1046 C  "C5'" . DA  B 2 21  ? 58.008 27.851  52.851 1.00 49.09  ? 53  DA  C "C5'" 1 
ATOM   1047 C  "C4'" . DA  B 2 21  ? 57.126 28.117  54.048 1.00 51.49  ? 53  DA  C "C4'" 1 
ATOM   1048 O  "O4'" . DA  B 2 21  ? 55.763 27.740  53.728 1.00 49.12  ? 53  DA  C "O4'" 1 
ATOM   1049 C  "C3'" . DA  B 2 21  ? 57.499 27.255  55.252 1.00 53.84  ? 53  DA  C "C3'" 1 
ATOM   1050 O  "O3'" . DA  B 2 21  ? 57.188 27.944  56.468 1.00 61.60  ? 53  DA  C "O3'" 1 
ATOM   1051 C  "C2'" . DA  B 2 21  ? 56.672 25.999  55.042 1.00 49.42  ? 53  DA  C "C2'" 1 
ATOM   1052 C  "C1'" . DA  B 2 21  ? 55.396 26.557  54.431 1.00 43.97  ? 53  DA  C "C1'" 1 
ATOM   1053 N  N9    . DA  B 2 21  ? 54.703 25.668  53.502 1.00 35.66  ? 53  DA  C N9    1 
ATOM   1054 C  C8    . DA  B 2 21  ? 55.260 24.814  52.590 1.00 34.89  ? 53  DA  C C8    1 
ATOM   1055 N  N7    . DA  B 2 21  ? 54.383 24.137  51.896 1.00 34.89  ? 53  DA  C N7    1 
ATOM   1056 C  C5    . DA  B 2 21  ? 53.165 24.576  52.381 1.00 31.85  ? 53  DA  C C5    1 
ATOM   1057 C  C6    . DA  B 2 21  ? 51.848 24.243  52.047 1.00 32.35  ? 53  DA  C C6    1 
ATOM   1058 N  N6    . DA  B 2 21  ? 51.527 23.351  51.108 1.00 33.42  ? 53  DA  C N6    1 
ATOM   1059 N  N1    . DA  B 2 21  ? 50.856 24.864  52.718 1.00 34.73  ? 53  DA  C N1    1 
ATOM   1060 C  C2    . DA  B 2 21  ? 51.185 25.759  53.660 1.00 36.83  ? 53  DA  C C2    1 
ATOM   1061 N  N3    . DA  B 2 21  ? 52.388 26.155  54.062 1.00 34.63  ? 53  DA  C N3    1 
ATOM   1062 C  C4    . DA  B 2 21  ? 53.346 25.520  53.373 1.00 32.59  ? 53  DA  C C4    1 
ATOM   1063 P  P     . DA  B 2 22  ? 56.979 27.121  57.835 1.00 66.26  ? 54  DA  C P     1 
ATOM   1064 O  OP1   . DA  B 2 22  ? 57.309 28.058  58.940 1.00 67.51  ? 54  DA  C OP1   1 
ATOM   1065 O  OP2   . DA  B 2 22  ? 57.707 25.825  57.729 1.00 66.23  ? 54  DA  C OP2   1 
ATOM   1066 O  "O5'" . DA  B 2 22  ? 55.407 26.847  57.857 1.00 64.67  ? 54  DA  C "O5'" 1 
ATOM   1067 C  "C5'" . DA  B 2 22  ? 54.487 27.945  57.692 1.00 66.34  ? 54  DA  C "C5'" 1 
ATOM   1068 C  "C4'" . DA  B 2 22  ? 53.169 27.665  58.377 1.00 67.69  ? 54  DA  C "C4'" 1 
ATOM   1069 O  "O4'" . DA  B 2 22  ? 52.353 26.819  57.535 1.00 68.73  ? 54  DA  C "O4'" 1 
ATOM   1070 C  "C3'" . DA  B 2 22  ? 53.303 26.900  59.691 1.00 67.80  ? 54  DA  C "C3'" 1 
ATOM   1071 O  "O3'" . DA  B 2 22  ? 52.198 27.236  60.542 1.00 71.28  ? 54  DA  C "O3'" 1 
ATOM   1072 C  "C2'" . DA  B 2 22  ? 53.263 25.450  59.235 1.00 66.64  ? 54  DA  C "C2'" 1 
ATOM   1073 C  "C1'" . DA  B 2 22  ? 52.263 25.511  58.084 1.00 66.33  ? 54  DA  C "C1'" 1 
ATOM   1074 N  N9    . DA  B 2 22  ? 52.416 24.553  56.994 1.00 64.03  ? 54  DA  C N9    1 
ATOM   1075 C  C8    . DA  B 2 22  ? 53.559 24.082  56.403 1.00 63.97  ? 54  DA  C C8    1 
ATOM   1076 N  N7    . DA  B 2 22  ? 53.338 23.226  55.436 1.00 64.84  ? 54  DA  C N7    1 
ATOM   1077 C  C5    . DA  B 2 22  ? 51.954 23.127  55.388 1.00 63.54  ? 54  DA  C C5    1 
ATOM   1078 C  C6    . DA  B 2 22  ? 51.085 22.380  54.575 1.00 63.30  ? 54  DA  C C6    1 
ATOM   1079 N  N6    . DA  B 2 22  ? 51.500 21.554  53.612 1.00 64.39  ? 54  DA  C N6    1 
ATOM   1080 N  N1    . DA  B 2 22  ? 49.754 22.512  54.787 1.00 62.80  ? 54  DA  C N1    1 
ATOM   1081 C  C2    . DA  B 2 22  ? 49.341 23.343  55.753 1.00 62.30  ? 54  DA  C C2    1 
ATOM   1082 N  N3    . DA  B 2 22  ? 50.059 24.095  56.579 1.00 62.63  ? 54  DA  C N3    1 
ATOM   1083 C  C4    . DA  B 2 22  ? 51.375 23.939  56.342 1.00 63.41  ? 54  DA  C C4    1 
ATOM   1084 P  P     . DC  B 2 23  ? 52.163 26.723  62.068 1.00 74.90  ? 55  DC  C P     1 
ATOM   1085 O  OP1   . DC  B 2 23  ? 51.973 27.911  62.935 1.00 75.61  ? 55  DC  C OP1   1 
ATOM   1086 O  OP2   . DC  B 2 23  ? 53.328 25.826  62.297 1.00 76.23  ? 55  DC  C OP2   1 
ATOM   1087 O  "O5'" . DC  B 2 23  ? 50.837 25.841  62.129 1.00 73.15  ? 55  DC  C "O5'" 1 
ATOM   1088 C  "C5'" . DC  B 2 23  ? 50.454 25.043  61.003 1.00 74.64  ? 55  DC  C "C5'" 1 
ATOM   1089 C  "C4'" . DC  B 2 23  ? 48.961 24.816  60.997 1.00 77.58  ? 55  DC  C "C4'" 1 
ATOM   1090 O  "O4'" . DC  B 2 23  ? 48.625 24.167  59.747 1.00 78.18  ? 55  DC  C "O4'" 1 
ATOM   1091 C  "C3'" . DC  B 2 23  ? 48.481 23.863  62.088 1.00 80.82  ? 55  DC  C "C3'" 1 
ATOM   1092 O  "O3'" . DC  B 2 23  ? 47.126 24.153  62.470 1.00 85.17  ? 55  DC  C "O3'" 1 
ATOM   1093 C  "C2'" . DC  B 2 23  ? 48.625 22.503  61.429 1.00 80.11  ? 55  DC  C "C2'" 1 
ATOM   1094 C  "C1'" . DC  B 2 23  ? 48.304 22.793  59.965 1.00 78.40  ? 55  DC  C "C1'" 1 
ATOM   1095 N  N1    . DC  B 2 23  ? 49.102 21.987  59.018 1.00 76.20  ? 55  DC  C N1    1 
ATOM   1096 C  C2    . DC  B 2 23  ? 48.448 21.191  58.057 1.00 72.91  ? 55  DC  C C2    1 
ATOM   1097 O  O2    . DC  B 2 23  ? 47.210 21.183  58.016 1.00 67.63  ? 55  DC  C O2    1 
ATOM   1098 N  N3    . DC  B 2 23  ? 49.192 20.452  57.199 1.00 74.85  ? 55  DC  C N3    1 
ATOM   1099 C  C4    . DC  B 2 23  ? 50.528 20.485  57.274 1.00 76.93  ? 55  DC  C C4    1 
ATOM   1100 N  N4    . DC  B 2 23  ? 51.225 19.743  56.411 1.00 78.78  ? 55  DC  C N4    1 
ATOM   1101 C  C5    . DC  B 2 23  ? 51.211 21.281  58.236 1.00 76.42  ? 55  DC  C C5    1 
ATOM   1102 C  C6    . DC  B 2 23  ? 50.470 22.008  59.077 1.00 76.45  ? 55  DC  C C6    1 
ATOM   1103 P  P     . DC  B 2 24  ? 46.418 23.307  63.653 1.00 88.26  ? 56  DC  C P     1 
ATOM   1104 O  OP1   . DC  B 2 24  ? 45.739 24.254  64.575 1.00 88.68  ? 56  DC  C OP1   1 
ATOM   1105 O  OP2   . DC  B 2 24  ? 47.402 22.335  64.202 1.00 87.42  ? 56  DC  C OP2   1 
ATOM   1106 O  "O5'" . DC  B 2 24  ? 45.291 22.477  62.892 1.00 85.64  ? 56  DC  C "O5'" 1 
ATOM   1107 C  "C5'" . DC  B 2 24  ? 45.618 21.688  61.737 1.00 84.20  ? 56  DC  C "C5'" 1 
ATOM   1108 C  "C4'" . DC  B 2 24  ? 44.654 20.535  61.606 1.00 84.72  ? 56  DC  C "C4'" 1 
ATOM   1109 O  "O4'" . DC  B 2 24  ? 45.130 19.669  60.544 1.00 85.16  ? 56  DC  C "O4'" 1 
ATOM   1110 C  "C3'" . DC  B 2 24  ? 44.634 19.654  62.849 1.00 86.45  ? 56  DC  C "C3'" 1 
ATOM   1111 O  "O3'" . DC  B 2 24  ? 43.354 19.043  63.007 1.00 90.49  ? 56  DC  C "O3'" 1 
ATOM   1112 C  "C2'" . DC  B 2 24  ? 45.746 18.652  62.586 1.00 85.72  ? 56  DC  C "C2'" 1 
ATOM   1113 C  "C1'" . DC  B 2 24  ? 45.670 18.456  61.076 1.00 83.00  ? 56  DC  C "C1'" 1 
ATOM   1114 N  N1    . DC  B 2 24  ? 46.973 18.205  60.417 1.00 78.22  ? 56  DC  C N1    1 
ATOM   1115 C  C2    . DC  B 2 24  ? 47.048 17.255  59.375 1.00 76.03  ? 56  DC  C C2    1 
ATOM   1116 O  O2    . DC  B 2 24  ? 46.018 16.646  59.029 1.00 72.66  ? 56  DC  C O2    1 
ATOM   1117 N  N3    . DC  B 2 24  ? 48.245 17.029  58.775 1.00 76.16  ? 56  DC  C N3    1 
ATOM   1118 C  C4    . DC  B 2 24  ? 49.331 17.701  59.173 1.00 75.59  ? 56  DC  C C4    1 
ATOM   1119 N  N4    . DC  B 2 24  ? 50.487 17.446  58.554 1.00 74.81  ? 56  DC  C N4    1 
ATOM   1120 C  C5    . DC  B 2 24  ? 49.280 18.664  60.224 1.00 74.53  ? 56  DC  C C5    1 
ATOM   1121 C  C6    . DC  B 2 24  ? 48.097 18.882  60.810 1.00 75.62  ? 56  DC  C C6    1 
ATOM   1122 P  P     . DA  B 2 25  ? 43.105 18.013  64.217 1.00 94.78  ? 57  DA  C P     1 
ATOM   1123 O  OP1   . DA  B 2 25  ? 41.742 18.219  64.724 1.00 95.81  ? 57  DA  C OP1   1 
ATOM   1124 O  OP2   . DA  B 2 25  ? 44.230 18.097  65.156 1.00 95.15  ? 57  DA  C OP2   1 
ATOM   1125 O  "O5'" . DA  B 2 25  ? 43.165 16.592  63.506 1.00 93.16  ? 57  DA  C "O5'" 1 
ATOM   1126 C  "C5'" . DA  B 2 25  ? 42.242 16.266  62.455 1.00 92.19  ? 57  DA  C "C5'" 1 
ATOM   1127 C  "C4'" . DA  B 2 25  ? 42.416 14.828  62.025 1.00 91.18  ? 57  DA  C "C4'" 1 
ATOM   1128 O  "O4'" . DA  B 2 25  ? 43.741 14.665  61.469 1.00 89.83  ? 57  DA  C "O4'" 1 
ATOM   1129 C  "C3'" . DA  B 2 25  ? 42.355 13.843  63.193 1.00 91.11  ? 57  DA  C "C3'" 1 
ATOM   1130 O  "O3'" . DA  B 2 25  ? 41.924 12.567  62.706 1.00 92.06  ? 57  DA  C "O3'" 1 
ATOM   1131 C  "C2'" . DA  B 2 25  ? 43.796 13.795  63.670 1.00 90.10  ? 57  DA  C "C2'" 1 
ATOM   1132 C  "C1'" . DA  B 2 25  ? 44.552 13.914  62.360 1.00 88.56  ? 57  DA  C "C1'" 1 
ATOM   1133 N  N9    . DA  B 2 25  ? 45.888 14.513  62.382 1.00 87.34  ? 57  DA  C N9    1 
ATOM   1134 C  C8    . DA  B 2 25  ? 46.407 15.484  63.206 1.00 86.06  ? 57  DA  C C8    1 
ATOM   1135 N  N7    . DA  B 2 25  ? 47.658 15.783  62.944 1.00 85.28  ? 57  DA  C N7    1 
ATOM   1136 C  C5    . DA  B 2 25  ? 47.983 14.955  61.877 1.00 87.18  ? 57  DA  C C5    1 
ATOM   1137 C  C6    . DA  B 2 25  ? 49.165 14.785  61.129 1.00 88.66  ? 57  DA  C C6    1 
ATOM   1138 N  N6    . DA  B 2 25  ? 50.293 15.469  61.350 1.00 90.41  ? 57  DA  C N6    1 
ATOM   1139 N  N1    . DA  B 2 25  ? 49.149 13.872  60.128 1.00 87.90  ? 57  DA  C N1    1 
ATOM   1140 C  C2    . DA  B 2 25  ? 48.021 13.186  59.903 1.00 86.85  ? 57  DA  C C2    1 
ATOM   1141 N  N3    . DA  B 2 25  ? 46.855 13.256  60.536 1.00 86.90  ? 57  DA  C N3    1 
ATOM   1142 C  C4    . DA  B 2 25  ? 46.902 14.169  61.522 1.00 87.29  ? 57  DA  C C4    1 
ATOM   1143 P  P     . DG  B 2 26  ? 41.628 11.363  63.733 1.00 92.39  ? 58  DG  C P     1 
ATOM   1144 O  OP1   . DG  B 2 26  ? 40.175 11.167  63.818 1.00 93.60  ? 58  DG  C OP1   1 
ATOM   1145 O  OP2   . DG  B 2 26  ? 42.386 11.569  64.972 1.00 91.61  ? 58  DG  C OP2   1 
ATOM   1146 O  "O5'" . DG  B 2 26  ? 42.243 10.112  62.975 1.00 87.94  ? 58  DG  C "O5'" 1 
ATOM   1147 C  "C5'" . DG  B 2 26  ? 41.835 9.819   61.637 1.00 85.34  ? 58  DG  C "C5'" 1 
ATOM   1148 C  "C4'" . DG  B 2 26  ? 42.711 8.745   61.039 1.00 85.49  ? 58  DG  C "C4'" 1 
ATOM   1149 O  "O4'" . DG  B 2 26  ? 44.040 9.284   60.812 1.00 84.88  ? 58  DG  C "O4'" 1 
ATOM   1150 C  "C3'" . DG  B 2 26  ? 42.921 7.576   62.000 1.00 85.15  ? 58  DG  C "C3'" 1 
ATOM   1151 O  "O3'" . DG  B 2 26  ? 43.088 6.362   61.259 1.00 87.31  ? 58  DG  C "O3'" 1 
ATOM   1152 C  "C2'" . DG  B 2 26  ? 44.150 7.996   62.790 1.00 82.98  ? 58  DG  C "C2'" 1 
ATOM   1153 C  "C1'" . DG  B 2 26  ? 44.969 8.720   61.734 1.00 82.39  ? 58  DG  C "C1'" 1 
ATOM   1154 N  N9    . DG  B 2 26  ? 45.859 9.776   62.215 1.00 80.45  ? 58  DG  C N9    1 
ATOM   1155 C  C8    . DG  B 2 26  ? 45.564 10.777  63.110 1.00 79.26  ? 58  DG  C C8    1 
ATOM   1156 N  N7    . DG  B 2 26  ? 46.581 11.561  63.356 1.00 77.92  ? 58  DG  C N7    1 
ATOM   1157 C  C5    . DG  B 2 26  ? 47.610 11.049  62.575 1.00 76.13  ? 58  DG  C C5    1 
ATOM   1158 C  C6    . DG  B 2 26  ? 48.954 11.484  62.424 1.00 72.72  ? 58  DG  C C6    1 
ATOM   1159 O  O6    . DG  B 2 26  ? 49.519 12.437  62.970 1.00 71.95  ? 58  DG  C O6    1 
ATOM   1160 N  N1    . DG  B 2 26  ? 49.656 10.682  61.529 1.00 70.76  ? 58  DG  C N1    1 
ATOM   1161 C  C2    . DG  B 2 26  ? 49.134 9.598   60.866 1.00 72.43  ? 58  DG  C C2    1 
ATOM   1162 N  N2    . DG  B 2 26  ? 49.966 8.942   60.043 1.00 71.78  ? 58  DG  C N2    1 
ATOM   1163 N  N3    . DG  B 2 26  ? 47.885 9.182   60.999 1.00 76.06  ? 58  DG  C N3    1 
ATOM   1164 C  C4    . DG  B 2 26  ? 47.183 9.949   61.863 1.00 78.35  ? 58  DG  C C4    1 
ATOM   1165 P  P     . DG  B 2 27  ? 43.831 5.101   61.926 1.00 89.09  ? 59  DG  C P     1 
ATOM   1166 O  OP1   . DG  B 2 27  ? 43.190 3.871   61.385 1.00 89.47  ? 59  DG  C OP1   1 
ATOM   1167 O  OP2   . DG  B 2 27  ? 43.921 5.292   63.400 1.00 89.86  ? 59  DG  C OP2   1 
ATOM   1168 O  "O5'" . DG  B 2 27  ? 45.295 5.202   61.314 1.00 85.74  ? 59  DG  C "O5'" 1 
ATOM   1169 C  "C5'" . DG  B 2 27  ? 45.492 5.087   59.894 1.00 83.24  ? 59  DG  C "C5'" 1 
ATOM   1170 C  "C4'" . DG  B 2 27  ? 46.765 4.327   59.604 1.00 80.51  ? 59  DG  C "C4'" 1 
ATOM   1171 O  "O4'" . DG  B 2 27  ? 47.883 5.135   60.033 1.00 79.82  ? 59  DG  C "O4'" 1 
ATOM   1172 C  "C3'" . DG  B 2 27  ? 46.895 3.024   60.387 1.00 78.56  ? 59  DG  C "C3'" 1 
ATOM   1173 O  "O3'" . DG  B 2 27  ? 47.684 2.084   59.649 1.00 78.07  ? 59  DG  C "O3'" 1 
ATOM   1174 C  "C2'" . DG  B 2 27  ? 47.549 3.471   61.684 1.00 76.52  ? 59  DG  C "C2'" 1 
ATOM   1175 C  "C1'" . DG  B 2 27  ? 48.466 4.599   61.216 1.00 76.84  ? 59  DG  C "C1'" 1 
ATOM   1176 N  N9    . DG  B 2 27  ? 48.650 5.706   62.152 1.00 73.56  ? 59  DG  C N9    1 
ATOM   1177 C  C8    . DG  B 2 27  ? 47.696 6.285   62.953 1.00 71.27  ? 59  DG  C C8    1 
ATOM   1178 N  N7    . DG  B 2 27  ? 48.164 7.259   63.684 1.00 71.02  ? 59  DG  C N7    1 
ATOM   1179 C  C5    . DG  B 2 27  ? 49.509 7.330   63.344 1.00 70.98  ? 59  DG  C C5    1 
ATOM   1180 C  C6    . DG  B 2 27  ? 50.529 8.197   63.812 1.00 70.83  ? 59  DG  C C6    1 
ATOM   1181 O  O6    . DG  B 2 27  ? 50.446 9.106   64.648 1.00 74.31  ? 59  DG  C O6    1 
ATOM   1182 N  N1    . DG  B 2 27  ? 51.751 7.927   63.204 1.00 67.69  ? 59  DG  C N1    1 
ATOM   1183 C  C2    . DG  B 2 27  ? 51.962 6.949   62.265 1.00 68.88  ? 59  DG  C C2    1 
ATOM   1184 N  N2    . DG  B 2 27  ? 53.211 6.838   61.790 1.00 68.99  ? 59  DG  C N2    1 
ATOM   1185 N  N3    . DG  B 2 27  ? 51.019 6.136   61.821 1.00 70.82  ? 59  DG  C N3    1 
ATOM   1186 C  C4    . DG  B 2 27  ? 49.824 6.380   62.399 1.00 71.68  ? 59  DG  C C4    1 
ATOM   1187 P  P     . DC  B 2 28  ? 47.713 0.537   60.090 1.00 78.50  ? 60  DC  C P     1 
ATOM   1188 O  OP1   . DC  B 2 28  ? 47.566 -0.306  58.873 1.00 79.40  ? 60  DC  C OP1   1 
ATOM   1189 O  OP2   . DC  B 2 28  ? 46.760 0.366   61.220 1.00 78.55  ? 60  DC  C OP2   1 
ATOM   1190 O  "O5'" . DC  B 2 28  ? 49.192 0.354   60.652 1.00 75.73  ? 60  DC  C "O5'" 1 
ATOM   1191 C  "C5'" . DC  B 2 28  ? 49.803 1.408   61.401 1.00 70.97  ? 60  DC  C "C5'" 1 
ATOM   1192 C  "C4'" . DC  B 2 28  ? 51.306 1.387   61.251 1.00 68.76  ? 60  DC  C "C4'" 1 
ATOM   1193 O  "O4'" . DC  B 2 28  ? 51.800 2.655   61.729 1.00 65.70  ? 60  DC  C "O4'" 1 
ATOM   1194 C  "C3'" . DC  B 2 28  ? 52.040 0.337   62.077 1.00 69.66  ? 60  DC  C "C3'" 1 
ATOM   1195 O  "O3'" . DC  B 2 28  ? 53.290 -0.004  61.460 1.00 73.85  ? 60  DC  C "O3'" 1 
ATOM   1196 C  "C2'" . DC  B 2 28  ? 52.236 1.043   63.406 1.00 65.25  ? 60  DC  C "C2'" 1 
ATOM   1197 C  "C1'" . DC  B 2 28  ? 52.423 2.502   63.000 1.00 61.23  ? 60  DC  C "C1'" 1 
ATOM   1198 N  N1    . DC  B 2 28  ? 51.757 3.440   63.923 1.00 54.15  ? 60  DC  C N1    1 
ATOM   1199 C  C2    . DC  B 2 28  ? 52.536 4.287   64.719 1.00 48.57  ? 60  DC  C C2    1 
ATOM   1200 O  O2    . DC  B 2 28  ? 53.770 4.232   64.636 1.00 49.10  ? 60  DC  C O2    1 
ATOM   1201 N  N3    . DC  B 2 28  ? 51.928 5.145   65.559 1.00 44.33  ? 60  DC  C N3    1 
ATOM   1202 C  C4    . DC  B 2 28  ? 50.599 5.181   65.630 1.00 45.82  ? 60  DC  C C4    1 
ATOM   1203 N  N4    . DC  B 2 28  ? 50.049 6.048   66.479 1.00 48.22  ? 60  DC  C N4    1 
ATOM   1204 C  C5    . DC  B 2 28  ? 49.778 4.333   64.837 1.00 48.30  ? 60  DC  C C5    1 
ATOM   1205 C  C6    . DC  B 2 28  ? 50.389 3.485   64.003 1.00 51.48  ? 60  DC  C C6    1 
ATOM   1206 P  P     . DC  B 2 29  ? 54.317 -0.989  62.217 1.00 77.64  ? 61  DC  C P     1 
ATOM   1207 O  OP1   . DC  B 2 29  ? 55.366 -1.375  61.265 1.00 78.21  ? 61  DC  C OP1   1 
ATOM   1208 O  OP2   . DC  B 2 29  ? 53.537 -2.045  62.870 1.00 79.03  ? 61  DC  C OP2   1 
ATOM   1209 O  "O5'" . DC  B 2 29  ? 54.964 -0.069  63.353 1.00 77.55  ? 61  DC  C "O5'" 1 
ATOM   1210 C  "C5'" . DC  B 2 29  ? 55.878 0.996   63.004 1.00 75.70  ? 61  DC  C "C5'" 1 
ATOM   1211 C  "C4'" . DC  B 2 29  ? 56.905 1.225   64.096 1.00 72.15  ? 61  DC  C "C4'" 1 
ATOM   1212 O  "O4'" . DC  B 2 29  ? 56.384 2.146   65.083 1.00 68.31  ? 61  DC  C "O4'" 1 
ATOM   1213 C  "C3'" . DC  B 2 29  ? 57.281 -0.025  64.890 1.00 70.85  ? 61  DC  C "C3'" 1 
ATOM   1214 O  "O3'" . DC  B 2 29  ? 58.627 0.106   65.374 1.00 74.42  ? 61  DC  C "O3'" 1 
ATOM   1215 C  "C2'" . DC  B 2 29  ? 56.249 -0.032  66.008 1.00 65.99  ? 61  DC  C "C2'" 1 
ATOM   1216 C  "C1'" . DC  B 2 29  ? 56.091 1.456   66.292 1.00 61.03  ? 61  DC  C "C1'" 1 
ATOM   1217 N  N1    . DC  B 2 29  ? 54.799 1.949   66.800 1.00 51.62  ? 61  DC  C N1    1 
ATOM   1218 C  C2    . DC  B 2 29  ? 54.803 3.052   67.654 1.00 48.08  ? 61  DC  C C2    1 
ATOM   1219 O  O2    . DC  B 2 29  ? 55.885 3.575   67.955 1.00 46.85  ? 61  DC  C O2    1 
ATOM   1220 N  N3    . DC  B 2 29  ? 53.635 3.525   68.132 1.00 47.08  ? 61  DC  C N3    1 
ATOM   1221 C  C4    . DC  B 2 29  ? 52.490 2.941   67.787 1.00 47.29  ? 61  DC  C C4    1 
ATOM   1222 N  N4    . DC  B 2 29  ? 51.360 3.451   68.287 1.00 48.94  ? 61  DC  C N4    1 
ATOM   1223 C  C5    . DC  B 2 29  ? 52.451 1.814   66.918 1.00 47.79  ? 61  DC  C C5    1 
ATOM   1224 C  C6    . DC  B 2 29  ? 53.618 1.355   66.451 1.00 49.42  ? 61  DC  C C6    1 
ATOM   1225 P  P     . DC  B 2 30  ? 59.213 -0.946  66.444 1.00 77.20  ? 62  DC  C P     1 
ATOM   1226 O  OP1   . DC  B 2 30  ? 60.603 -1.237  66.085 1.00 78.82  ? 62  DC  C OP1   1 
ATOM   1227 O  OP2   . DC  B 2 30  ? 58.276 -2.064  66.588 1.00 80.70  ? 62  DC  C OP2   1 
ATOM   1228 O  "O5'" . DC  B 2 30  ? 59.218 -0.118  67.801 1.00 74.13  ? 62  DC  C "O5'" 1 
ATOM   1229 C  "C5'" . DC  B 2 30  ? 60.036 1.053   67.927 1.00 74.35  ? 62  DC  C "C5'" 1 
ATOM   1230 C  "C4'" . DC  B 2 30  ? 60.222 1.416   69.382 1.00 75.53  ? 62  DC  C "C4'" 1 
ATOM   1231 O  "O4'" . DC  B 2 30  ? 58.970 1.915   69.913 1.00 73.78  ? 62  DC  C "O4'" 1 
ATOM   1232 C  "C3'" . DC  B 2 30  ? 60.561 0.198   70.242 1.00 78.23  ? 62  DC  C "C3'" 1 
ATOM   1233 O  "O3'" . DC  B 2 30  ? 61.281 0.628   71.399 1.00 83.44  ? 62  DC  C "O3'" 1 
ATOM   1234 C  "C2'" . DC  B 2 30  ? 59.192 -0.332  70.632 1.00 75.81  ? 62  DC  C "C2'" 1 
ATOM   1235 C  "C1'" . DC  B 2 30  ? 58.409 0.964   70.807 1.00 71.20  ? 62  DC  C "C1'" 1 
ATOM   1236 N  N1    . DC  B 2 30  ? 56.942 0.943   70.623 1.00 65.18  ? 62  DC  C N1    1 
ATOM   1237 C  C2    . DC  B 2 30  ? 56.164 1.846   71.367 1.00 62.21  ? 62  DC  C C2    1 
ATOM   1238 O  O2    . DC  B 2 30  ? 56.730 2.634   72.145 1.00 61.23  ? 62  DC  C O2    1 
ATOM   1239 N  N3    . DC  B 2 30  ? 54.818 1.837   71.221 1.00 60.80  ? 62  DC  C N3    1 
ATOM   1240 C  C4    . DC  B 2 30  ? 54.243 0.977   70.377 1.00 60.26  ? 62  DC  C C4    1 
ATOM   1241 N  N4    . DC  B 2 30  ? 52.910 1.010   70.266 1.00 59.02  ? 62  DC  C N4    1 
ATOM   1242 C  C5    . DC  B 2 30  ? 55.007 0.048   69.609 1.00 61.30  ? 62  DC  C C5    1 
ATOM   1243 C  C6    . DC  B 2 30  ? 56.341 0.066   69.759 1.00 62.99  ? 62  DC  C C6    1 
ATOM   1244 P  P     . DG  B 2 31  ? 62.020 -0.448  72.335 1.00 87.39  ? 63  DG  C P     1 
ATOM   1245 O  OP1   . DG  B 2 31  ? 63.367 -0.626  71.785 1.00 87.43  ? 63  DG  C OP1   1 
ATOM   1246 O  OP2   . DG  B 2 31  ? 61.160 -1.631  72.499 1.00 88.59  ? 63  DG  C OP2   1 
ATOM   1247 O  "O5'" . DG  B 2 31  ? 62.123 0.312   73.735 1.00 82.76  ? 63  DG  C "O5'" 1 
ATOM   1248 C  "C5'" . DG  B 2 31  ? 62.754 1.606   73.813 1.00 76.76  ? 63  DG  C "C5'" 1 
ATOM   1249 C  "C4'" . DG  B 2 31  ? 62.163 2.444   74.927 1.00 71.02  ? 63  DG  C "C4'" 1 
ATOM   1250 O  "O4'" . DG  B 2 31  ? 60.734 2.576   74.714 1.00 66.78  ? 63  DG  C "O4'" 1 
ATOM   1251 C  "C3'" . DG  B 2 31  ? 62.298 1.819   76.316 1.00 68.50  ? 63  DG  C "C3'" 1 
ATOM   1252 O  "O3'" . DG  B 2 31  ? 62.228 2.833   77.321 1.00 69.72  ? 63  DG  C "O3'" 1 
ATOM   1253 C  "C2'" . DG  B 2 31  ? 61.050 0.961   76.420 1.00 64.32  ? 63  DG  C "C2'" 1 
ATOM   1254 C  "C1'" . DG  B 2 31  ? 60.017 1.803   75.674 1.00 59.55  ? 63  DG  C "C1'" 1 
ATOM   1255 N  N9    . DG  B 2 31  ? 58.983 1.041   74.980 1.00 48.13  ? 63  DG  C N9    1 
ATOM   1256 C  C8    . DG  B 2 31  ? 59.161 -0.061  74.182 1.00 44.07  ? 63  DG  C C8    1 
ATOM   1257 N  N7    . DG  B 2 31  ? 58.042 -0.541  73.716 1.00 41.59  ? 63  DG  C N7    1 
ATOM   1258 C  C5    . DG  B 2 31  ? 57.066 0.298   74.233 1.00 39.06  ? 63  DG  C C5    1 
ATOM   1259 C  C6    . DG  B 2 31  ? 55.666 0.273   74.072 1.00 35.81  ? 63  DG  C C6    1 
ATOM   1260 O  O6    . DG  B 2 31  ? 54.985 -0.520  73.420 1.00 38.87  ? 63  DG  C O6    1 
ATOM   1261 N  N1    . DG  B 2 31  ? 55.051 1.303   74.767 1.00 31.26  ? 63  DG  C N1    1 
ATOM   1262 C  C2    . DG  B 2 31  ? 55.704 2.237   75.523 1.00 32.96  ? 63  DG  C C2    1 
ATOM   1263 N  N2    . DG  B 2 31  ? 54.934 3.157   76.123 1.00 35.89  ? 63  DG  C N2    1 
ATOM   1264 N  N3    . DG  B 2 31  ? 57.014 2.272   75.683 1.00 35.64  ? 63  DG  C N3    1 
ATOM   1265 C  C4    . DG  B 2 31  ? 57.629 1.280   75.013 1.00 40.83  ? 63  DG  C C4    1 
ATOM   1266 O  "O5'" . DA  C 1 1   ? 42.266 -1.719  6.218  1.00 78.67  ? 1   DA  E "O5'" 1 
ATOM   1267 C  "C5'" . DA  C 1 1   ? 41.210 -2.621  5.869  1.00 76.02  ? 1   DA  E "C5'" 1 
ATOM   1268 C  "C4'" . DA  C 1 1   ? 40.198 -1.994  4.937  1.00 74.56  ? 1   DA  E "C4'" 1 
ATOM   1269 O  "O4'" . DA  C 1 1   ? 39.180 -2.973  4.613  1.00 71.40  ? 1   DA  E "O4'" 1 
ATOM   1270 C  "C3'" . DA  C 1 1   ? 39.453 -0.793  5.519  1.00 74.67  ? 1   DA  E "C3'" 1 
ATOM   1271 O  "O3'" . DA  C 1 1   ? 39.190 0.178   4.496  1.00 80.50  ? 1   DA  E "O3'" 1 
ATOM   1272 C  "C2'" . DA  C 1 1   ? 38.160 -1.405  6.019  1.00 70.05  ? 1   DA  E "C2'" 1 
ATOM   1273 C  "C1'" . DA  C 1 1   ? 37.901 -2.501  5.001  1.00 64.89  ? 1   DA  E "C1'" 1 
ATOM   1274 N  N9    . DA  C 1 1   ? 37.160 -3.625  5.569  1.00 57.27  ? 1   DA  E N9    1 
ATOM   1275 C  C8    . DA  C 1 1   ? 37.635 -4.635  6.370  1.00 56.12  ? 1   DA  E C8    1 
ATOM   1276 N  N7    . DA  C 1 1   ? 36.709 -5.462  6.786  1.00 53.51  ? 1   DA  E N7    1 
ATOM   1277 C  C5    . DA  C 1 1   ? 35.547 -4.973  6.209  1.00 53.15  ? 1   DA  E C5    1 
ATOM   1278 C  C6    . DA  C 1 1   ? 34.210 -5.399  6.275  1.00 52.92  ? 1   DA  E C6    1 
ATOM   1279 N  N6    . DA  C 1 1   ? 33.802 -6.447  7.001  1.00 51.02  ? 1   DA  E N6    1 
ATOM   1280 N  N1    . DA  C 1 1   ? 33.293 -4.698  5.569  1.00 53.20  ? 1   DA  E N1    1 
ATOM   1281 C  C2    . DA  C 1 1   ? 33.704 -3.636  4.857  1.00 52.43  ? 1   DA  E C2    1 
ATOM   1282 N  N3    . DA  C 1 1   ? 34.932 -3.133  4.726  1.00 52.26  ? 1   DA  E N3    1 
ATOM   1283 C  C4    . DA  C 1 1   ? 35.815 -3.855  5.437  1.00 53.49  ? 1   DA  E C4    1 
ATOM   1284 P  P     . DC  C 1 2   ? 39.235 1.751   4.849  1.00 87.10  ? 2   DC  E P     1 
ATOM   1285 O  OP1   . DC  C 1 2   ? 39.400 2.513   3.581  1.00 86.86  ? 2   DC  E OP1   1 
ATOM   1286 O  OP2   . DC  C 1 2   ? 40.215 1.945   5.949  1.00 89.01  ? 2   DC  E OP2   1 
ATOM   1287 O  "O5'" . DC  C 1 2   ? 37.790 2.088   5.438  1.00 85.46  ? 2   DC  E "O5'" 1 
ATOM   1288 C  "C5'" . DC  C 1 2   ? 36.774 1.077   5.556  1.00 82.95  ? 2   DC  E "C5'" 1 
ATOM   1289 C  "C4'" . DC  C 1 2   ? 35.483 1.562   4.942  1.00 81.43  ? 2   DC  E "C4'" 1 
ATOM   1290 O  "O4'" . DC  C 1 2   ? 34.502 0.503   5.044  1.00 79.63  ? 2   DC  E "O4'" 1 
ATOM   1291 C  "C3'" . DC  C 1 2   ? 34.877 2.736   5.698  1.00 82.58  ? 2   DC  E "C3'" 1 
ATOM   1292 O  "O3'" . DC  C 1 2   ? 34.118 3.561   4.808  1.00 86.14  ? 2   DC  E "O3'" 1 
ATOM   1293 C  "C2'" . DC  C 1 2   ? 34.030 2.058   6.759  1.00 79.82  ? 2   DC  E "C2'" 1 
ATOM   1294 C  "C1'" . DC  C 1 2   ? 33.527 0.816   6.035  1.00 76.54  ? 2   DC  E "C1'" 1 
ATOM   1295 N  N1    . DC  C 1 2   ? 33.345 -0.378  6.885  1.00 71.11  ? 2   DC  E N1    1 
ATOM   1296 C  C2    . DC  C 1 2   ? 32.071 -0.968  6.972  1.00 68.02  ? 2   DC  E C2    1 
ATOM   1297 O  O2    . DC  C 1 2   ? 31.127 -0.472  6.335  1.00 67.38  ? 2   DC  E O2    1 
ATOM   1298 N  N3    . DC  C 1 2   ? 31.904 -2.067  7.748  1.00 65.93  ? 2   DC  E N3    1 
ATOM   1299 C  C4    . DC  C 1 2   ? 32.942 -2.574  8.418  1.00 65.82  ? 2   DC  E C4    1 
ATOM   1300 N  N4    . DC  C 1 2   ? 32.732 -3.657  9.170  1.00 64.67  ? 2   DC  E N4    1 
ATOM   1301 C  C5    . DC  C 1 2   ? 34.243 -1.994  8.348  1.00 67.31  ? 2   DC  E C5    1 
ATOM   1302 C  C6    . DC  C 1 2   ? 34.398 -0.909  7.579  1.00 68.89  ? 2   DC  E C6    1 
ATOM   1303 P  P     . DG  C 1 3   ? 33.628 5.016   5.287  1.00 88.63  ? 3   DG  E P     1 
ATOM   1304 O  OP1   . DG  C 1 3   ? 33.686 5.936   4.121  1.00 89.79  ? 3   DG  E OP1   1 
ATOM   1305 O  OP2   . DG  C 1 3   ? 34.340 5.378   6.541  1.00 88.46  ? 3   DG  E OP2   1 
ATOM   1306 O  "O5'" . DG  C 1 3   ? 32.101 4.771   5.648  1.00 86.75  ? 3   DG  E "O5'" 1 
ATOM   1307 C  "C5'" . DG  C 1 3   ? 31.136 4.541   4.611  1.00 85.14  ? 3   DG  E "C5'" 1 
ATOM   1308 C  "C4'" . DG  C 1 3   ? 29.742 4.759   5.147  1.00 83.31  ? 3   DG  E "C4'" 1 
ATOM   1309 O  "O4'" . DG  C 1 3   ? 29.414 3.657   6.027  1.00 80.11  ? 3   DG  E "O4'" 1 
ATOM   1310 C  "C3'" . DG  C 1 3   ? 29.608 6.010   6.007  1.00 83.78  ? 3   DG  E "C3'" 1 
ATOM   1311 O  "O3'" . DG  C 1 3   ? 28.292 6.554   5.884  1.00 88.59  ? 3   DG  E "O3'" 1 
ATOM   1312 C  "C2'" . DG  C 1 3   ? 29.970 5.507   7.394  1.00 80.20  ? 3   DG  E "C2'" 1 
ATOM   1313 C  "C1'" . DG  C 1 3   ? 29.434 4.076   7.391  1.00 77.25  ? 3   DG  E "C1'" 1 
ATOM   1314 N  N9    . DG  C 1 3   ? 30.271 3.127   8.125  1.00 72.25  ? 3   DG  E N9    1 
ATOM   1315 C  C8    . DG  C 1 3   ? 31.623 3.225   8.353  1.00 71.09  ? 3   DG  E C8    1 
ATOM   1316 N  N7    . DG  C 1 3   ? 32.103 2.225   9.039  1.00 68.64  ? 3   DG  E N7    1 
ATOM   1317 C  C5    . DG  C 1 3   ? 31.005 1.416   9.279  1.00 67.04  ? 3   DG  E C5    1 
ATOM   1318 C  C6    . DG  C 1 3   ? 30.913 0.188   9.976  1.00 65.25  ? 3   DG  E C6    1 
ATOM   1319 O  O6    . DG  C 1 3   ? 31.817 -0.449  10.537 1.00 63.52  ? 3   DG  E O6    1 
ATOM   1320 N  N1    . DG  C 1 3   ? 29.608 -0.296  9.985  1.00 65.92  ? 3   DG  E N1    1 
ATOM   1321 C  C2    . DG  C 1 3   ? 28.529 0.324   9.396  1.00 67.52  ? 3   DG  E C2    1 
ATOM   1322 N  N2    . DG  C 1 3   ? 27.339 -0.300  9.511  1.00 67.54  ? 3   DG  E N2    1 
ATOM   1323 N  N3    . DG  C 1 3   ? 28.606 1.473   8.742  1.00 68.65  ? 3   DG  E N3    1 
ATOM   1324 C  C4    . DG  C 1 3   ? 29.864 1.958   8.723  1.00 68.96  ? 3   DG  E C4    1 
ATOM   1325 P  P     . DG  C 1 4   ? 27.702 7.515   7.027  1.00 92.80  ? 4   DG  E P     1 
ATOM   1326 O  OP1   . DG  C 1 4   ? 26.881 8.552   6.352  1.00 93.85  ? 4   DG  E OP1   1 
ATOM   1327 O  OP2   . DG  C 1 4   ? 28.800 7.932   7.941  1.00 93.86  ? 4   DG  E OP2   1 
ATOM   1328 O  "O5'" . DG  C 1 4   ? 26.723 6.537   7.814  1.00 90.92  ? 4   DG  E "O5'" 1 
ATOM   1329 C  "C5'" . DG  C 1 4   ? 25.842 5.659   7.082  1.00 87.67  ? 4   DG  E "C5'" 1 
ATOM   1330 C  "C4'" . DG  C 1 4   ? 24.763 5.106   7.985  1.00 84.22  ? 4   DG  E "C4'" 1 
ATOM   1331 O  "O4'" . DG  C 1 4   ? 25.361 4.149   8.894  1.00 80.82  ? 4   DG  E "O4'" 1 
ATOM   1332 C  "C3'" . DG  C 1 4   ? 24.122 6.164   8.881  1.00 83.82  ? 4   DG  E "C3'" 1 
ATOM   1333 O  "O3'" . DG  C 1 4   ? 22.752 5.836   9.159  1.00 84.88  ? 4   DG  E "O3'" 1 
ATOM   1334 C  "C2'" . DG  C 1 4   ? 25.023 6.158   10.106 1.00 81.62  ? 4   DG  E "C2'" 1 
ATOM   1335 C  "C1'" . DG  C 1 4   ? 25.428 4.685   10.211 1.00 78.71  ? 4   DG  E "C1'" 1 
ATOM   1336 N  N9    . DG  C 1 4   ? 26.762 4.405   10.743 1.00 73.58  ? 4   DG  E N9    1 
ATOM   1337 C  C8    . DG  C 1 4   ? 27.871 5.220   10.701 1.00 72.24  ? 4   DG  E C8    1 
ATOM   1338 N  N7    . DG  C 1 4   ? 28.920 4.689   11.269 1.00 69.64  ? 4   DG  E N7    1 
ATOM   1339 C  C5    . DG  C 1 4   ? 28.483 3.449   11.710 1.00 67.95  ? 4   DG  E C5    1 
ATOM   1340 C  C6    . DG  C 1 4   ? 29.182 2.420   12.400 1.00 66.27  ? 4   DG  E C6    1 
ATOM   1341 O  O6    . DG  C 1 4   ? 30.372 2.402   12.770 1.00 64.82  ? 4   DG  E O6    1 
ATOM   1342 N  N1    . DG  C 1 4   ? 28.357 1.325   12.656 1.00 65.67  ? 4   DG  E N1    1 
ATOM   1343 C  C2    . DG  C 1 4   ? 27.031 1.233   12.294 1.00 66.31  ? 4   DG  E C2    1 
ATOM   1344 N  N2    . DG  C 1 4   ? 26.395 0.094   12.628 1.00 65.89  ? 4   DG  E N2    1 
ATOM   1345 N  N3    . DG  C 1 4   ? 26.372 2.186   11.652 1.00 67.38  ? 4   DG  E N3    1 
ATOM   1346 C  C4    . DG  C 1 4   ? 27.154 3.256   11.394 1.00 69.39  ? 4   DG  E C4    1 
ATOM   1347 P  P     . DG  C 1 5   ? 21.733 6.982   9.662  1.00 84.45  ? 5   DG  E P     1 
ATOM   1348 O  OP1   . DG  C 1 5   ? 20.523 6.955   8.796  1.00 86.03  ? 5   DG  E OP1   1 
ATOM   1349 O  OP2   . DG  C 1 5   ? 22.498 8.251   9.817  1.00 84.22  ? 5   DG  E OP2   1 
ATOM   1350 O  "O5'" . DG  C 1 5   ? 21.319 6.477   11.112 1.00 78.54  ? 5   DG  E "O5'" 1 
ATOM   1351 C  "C5'" . DG  C 1 5   ? 22.296 5.837   11.928 1.00 71.65  ? 5   DG  E "C5'" 1 
ATOM   1352 C  "C4'" . DG  C 1 5   ? 21.683 4.728   12.748 1.00 67.20  ? 5   DG  E "C4'" 1 
ATOM   1353 O  "O4'" . DG  C 1 5   ? 22.732 3.783   13.045 1.00 64.25  ? 5   DG  E "O4'" 1 
ATOM   1354 C  "C3'" . DG  C 1 5   ? 21.120 5.147   14.098 1.00 64.95  ? 5   DG  E "C3'" 1 
ATOM   1355 O  "O3'" . DG  C 1 5   ? 20.115 4.228   14.527 1.00 63.73  ? 5   DG  E "O3'" 1 
ATOM   1356 C  "C2'" . DG  C 1 5   ? 22.340 5.070   14.993 1.00 63.58  ? 5   DG  E "C2'" 1 
ATOM   1357 C  "C1'" . DG  C 1 5   ? 23.136 3.907   14.401 1.00 60.45  ? 5   DG  E "C1'" 1 
ATOM   1358 N  N9    . DG  C 1 5   ? 24.559 4.220   14.382 1.00 54.85  ? 5   DG  E N9    1 
ATOM   1359 C  C8    . DG  C 1 5   ? 25.161 5.283   13.744 1.00 53.02  ? 5   DG  E C8    1 
ATOM   1360 N  N7    . DG  C 1 5   ? 26.453 5.312   13.905 1.00 50.30  ? 5   DG  E N7    1 
ATOM   1361 C  C5    . DG  C 1 5   ? 26.722 4.204   14.695 1.00 49.75  ? 5   DG  E C5    1 
ATOM   1362 C  C6    . DG  C 1 5   ? 27.949 3.721   15.196 1.00 49.37  ? 5   DG  E C6    1 
ATOM   1363 O  O6    . DG  C 1 5   ? 29.082 4.192   15.033 1.00 50.79  ? 5   DG  E O6    1 
ATOM   1364 N  N1    . DG  C 1 5   ? 27.773 2.567   15.955 1.00 47.54  ? 5   DG  E N1    1 
ATOM   1365 C  C2    . DG  C 1 5   ? 26.562 1.958   16.198 1.00 47.82  ? 5   DG  E C2    1 
ATOM   1366 N  N2    . DG  C 1 5   ? 26.583 0.848   16.956 1.00 48.39  ? 5   DG  E N2    1 
ATOM   1367 N  N3    . DG  C 1 5   ? 25.409 2.404   15.733 1.00 48.50  ? 5   DG  E N3    1 
ATOM   1368 C  C4    . DG  C 1 5   ? 25.563 3.520   14.996 1.00 50.39  ? 5   DG  E C4    1 
ATOM   1369 P  P     . DC  C 1 6   ? 19.529 4.336   16.018 1.00 63.59  ? 6   DC  E P     1 
ATOM   1370 O  OP1   . DC  C 1 6   ? 18.305 3.486   16.082 1.00 63.61  ? 6   DC  E OP1   1 
ATOM   1371 O  OP2   . DC  C 1 6   ? 19.434 5.789   16.323 1.00 61.87  ? 6   DC  E OP2   1 
ATOM   1372 O  "O5'" . DC  C 1 6   ? 20.663 3.684   16.943 1.00 57.93  ? 6   DC  E "O5'" 1 
ATOM   1373 C  "C5'" . DC  C 1 6   ? 20.854 2.251   16.975 1.00 51.77  ? 6   DC  E "C5'" 1 
ATOM   1374 C  "C4'" . DC  C 1 6   ? 21.351 1.780   18.328 1.00 47.61  ? 6   DC  E "C4'" 1 
ATOM   1375 O  "O4'" . DC  C 1 6   ? 22.775 2.011   18.449 1.00 45.64  ? 6   DC  E "O4'" 1 
ATOM   1376 C  "C3'" . DC  C 1 6   ? 20.738 2.497   19.529 1.00 44.16  ? 6   DC  E "C3'" 1 
ATOM   1377 O  "O3'" . DC  C 1 6   ? 20.747 1.612   20.661 1.00 43.45  ? 6   DC  E "O3'" 1 
ATOM   1378 C  "C2'" . DC  C 1 6   ? 21.672 3.682   19.717 1.00 42.01  ? 6   DC  E "C2'" 1 
ATOM   1379 C  "C1'" . DC  C 1 6   ? 23.027 3.069   19.364 1.00 42.17  ? 6   DC  E "C1'" 1 
ATOM   1380 N  N1    . DC  C 1 6   ? 24.073 3.939   18.784 1.00 39.20  ? 6   DC  E N1    1 
ATOM   1381 C  C2    . DC  C 1 6   ? 25.411 3.736   19.169 1.00 35.27  ? 6   DC  E C2    1 
ATOM   1382 O  O2    . DC  C 1 6   ? 25.679 2.838   19.982 1.00 33.68  ? 6   DC  E O2    1 
ATOM   1383 N  N3    . DC  C 1 6   ? 26.375 4.523   18.642 1.00 33.11  ? 6   DC  E N3    1 
ATOM   1384 C  C4    . DC  C 1 6   ? 26.054 5.479   17.765 1.00 33.29  ? 6   DC  E C4    1 
ATOM   1385 N  N4    . DC  C 1 6   ? 27.038 6.229   17.271 1.00 32.71  ? 6   DC  E N4    1 
ATOM   1386 C  C5    . DC  C 1 6   ? 24.709 5.708   17.357 1.00 34.97  ? 6   DC  E C5    1 
ATOM   1387 C  C6    . DC  C 1 6   ? 23.758 4.923   17.886 1.00 37.48  ? 6   DC  E C6    1 
ATOM   1388 P  P     . DC  C 1 7   ? 19.784 1.898   21.920 1.00 46.30  ? 7   DC  E P     1 
ATOM   1389 O  OP1   . DC  C 1 7   ? 19.382 0.600   22.526 1.00 46.56  ? 7   DC  E OP1   1 
ATOM   1390 O  OP2   . DC  C 1 7   ? 18.735 2.854   21.478 1.00 47.68  ? 7   DC  E OP2   1 
ATOM   1391 O  "O5'" . DC  C 1 7   ? 20.729 2.628   22.976 1.00 43.27  ? 7   DC  E "O5'" 1 
ATOM   1392 C  "C5'" . DC  C 1 7   ? 21.993 3.185   22.571 1.00 38.93  ? 7   DC  E "C5'" 1 
ATOM   1393 C  "C4'" . DC  C 1 7   ? 23.090 2.749   23.513 1.00 37.25  ? 7   DC  E "C4'" 1 
ATOM   1394 O  "O4'" . DC  C 1 7   ? 24.359 3.069   22.888 1.00 36.02  ? 7   DC  E "O4'" 1 
ATOM   1395 C  "C3'" . DC  C 1 7   ? 23.101 3.487   24.849 1.00 35.50  ? 7   DC  E "C3'" 1 
ATOM   1396 O  "O3'" . DC  C 1 7   ? 23.593 2.661   25.917 1.00 32.80  ? 7   DC  E "O3'" 1 
ATOM   1397 C  "C2'" . DC  C 1 7   ? 23.951 4.709   24.550 1.00 34.56  ? 7   DC  E "C2'" 1 
ATOM   1398 C  "C1'" . DC  C 1 7   ? 24.970 4.190   23.527 1.00 34.56  ? 7   DC  E "C1'" 1 
ATOM   1399 N  N1    . DC  C 1 7   ? 25.311 5.173   22.472 1.00 30.29  ? 7   DC  E N1    1 
ATOM   1400 C  C2    . DC  C 1 7   ? 26.657 5.482   22.237 1.00 28.21  ? 7   DC  E C2    1 
ATOM   1401 O  O2    . DC  C 1 7   ? 27.536 4.921   22.911 1.00 31.22  ? 7   DC  E O2    1 
ATOM   1402 N  N3    . DC  C 1 7   ? 26.970 6.381   21.283 1.00 25.28  ? 7   DC  E N3    1 
ATOM   1403 C  C4    . DC  C 1 7   ? 26.007 6.965   20.573 1.00 25.98  ? 7   DC  E C4    1 
ATOM   1404 N  N4    . DC  C 1 7   ? 26.372 7.851   19.638 1.00 26.57  ? 7   DC  E N4    1 
ATOM   1405 C  C5    . DC  C 1 7   ? 24.631 6.671   20.786 1.00 26.96  ? 7   DC  E C5    1 
ATOM   1406 C  C6    . DC  C 1 7   ? 24.330 5.778   21.734 1.00 27.06  ? 7   DC  E C6    1 
ATOM   1407 P  P     . DT  C 1 8   ? 23.753 3.278   27.393 1.00 30.85  ? 8   DT  E P     1 
ATOM   1408 O  OP1   . DT  C 1 8   ? 23.901 2.177   28.367 1.00 26.57  ? 8   DT  E OP1   1 
ATOM   1409 O  OP2   . DT  C 1 8   ? 22.692 4.292   27.593 1.00 30.62  ? 8   DT  E OP2   1 
ATOM   1410 O  "O5'" . DT  C 1 8   ? 25.145 4.032   27.288 1.00 37.65  ? 8   DT  E "O5'" 1 
ATOM   1411 C  "C5'" . DT  C 1 8   ? 26.349 3.290   27.026 1.00 44.14  ? 8   DT  E "C5'" 1 
ATOM   1412 C  "C4'" . DT  C 1 8   ? 27.564 4.096   27.421 1.00 46.76  ? 8   DT  E "C4'" 1 
ATOM   1413 O  "O4'" . DT  C 1 8   ? 27.827 5.082   26.395 1.00 44.24  ? 8   DT  E "O4'" 1 
ATOM   1414 C  "C3'" . DT  C 1 8   ? 27.310 4.899   28.696 1.00 49.41  ? 8   DT  E "C3'" 1 
ATOM   1415 O  "O3'" . DT  C 1 8   ? 28.527 5.126   29.403 1.00 52.67  ? 8   DT  E "O3'" 1 
ATOM   1416 C  "C2'" . DT  C 1 8   ? 26.720 6.196   28.170 1.00 47.98  ? 8   DT  E "C2'" 1 
ATOM   1417 C  "C1'" . DT  C 1 8   ? 27.500 6.378   26.875 1.00 44.43  ? 8   DT  E "C1'" 1 
ATOM   1418 N  N1    . DT  C 1 8   ? 26.876 7.144   25.768 1.00 41.24  ? 8   DT  E N1    1 
ATOM   1419 C  C2    . DT  C 1 8   ? 27.725 7.795   24.887 1.00 39.96  ? 8   DT  E C2    1 
ATOM   1420 O  O2    . DT  C 1 8   ? 28.948 7.764   24.977 1.00 38.73  ? 8   DT  E O2    1 
ATOM   1421 N  N3    . DT  C 1 8   ? 27.086 8.489   23.888 1.00 37.63  ? 8   DT  E N3    1 
ATOM   1422 C  C4    . DT  C 1 8   ? 25.725 8.600   23.683 1.00 36.44  ? 8   DT  E C4    1 
ATOM   1423 O  O4    . DT  C 1 8   ? 25.303 9.263   22.739 1.00 38.71  ? 8   DT  E O4    1 
ATOM   1424 C  C5    . DT  C 1 8   ? 24.896 7.901   24.639 1.00 36.82  ? 8   DT  E C5    1 
ATOM   1425 C  C7    . DT  C 1 8   ? 23.408 7.972   24.495 1.00 36.75  ? 8   DT  E C7    1 
ATOM   1426 C  C6    . DT  C 1 8   ? 25.504 7.215   25.619 1.00 38.16  ? 8   DT  E C6    1 
ATOM   1427 P  P     . DG  C 1 9   ? 28.481 5.502   30.964 1.00 56.36  ? 9   DG  E P     1 
ATOM   1428 O  OP1   . DG  C 1 9   ? 28.665 4.255   31.729 1.00 54.47  ? 9   DG  E OP1   1 
ATOM   1429 O  OP2   . DG  C 1 9   ? 27.303 6.331   31.234 1.00 55.35  ? 9   DG  E OP2   1 
ATOM   1430 O  "O5'" . DG  C 1 9   ? 29.775 6.411   31.146 1.00 57.33  ? 9   DG  E "O5'" 1 
ATOM   1431 C  "C5'" . DG  C 1 9   ? 31.072 5.891   30.821 1.00 59.62  ? 9   DG  E "C5'" 1 
ATOM   1432 C  "C4'" . DG  C 1 9   ? 32.050 7.010   30.549 1.00 59.85  ? 9   DG  E "C4'" 1 
ATOM   1433 O  "O4'" . DG  C 1 9   ? 31.619 7.745   29.373 1.00 58.25  ? 9   DG  E "O4'" 1 
ATOM   1434 C  "C3'" . DG  C 1 9   ? 32.092 8.047   31.666 1.00 61.55  ? 9   DG  E "C3'" 1 
ATOM   1435 O  "O3'" . DG  C 1 9   ? 33.399 8.621   31.731 1.00 67.34  ? 9   DG  E "O3'" 1 
ATOM   1436 C  "C2'" . DG  C 1 9   ? 31.008 9.033   31.257 1.00 59.63  ? 9   DG  E "C2'" 1 
ATOM   1437 C  "C1'" . DG  C 1 9   ? 31.123 9.028   29.738 1.00 56.60  ? 9   DG  E "C1'" 1 
ATOM   1438 N  N9    . DG  C 1 9   ? 29.891 9.278   28.989 1.00 53.57  ? 9   DG  E N9    1 
ATOM   1439 C  C8    . DG  C 1 9   ? 28.634 8.797   29.269 1.00 50.93  ? 9   DG  E C8    1 
ATOM   1440 N  N7    . DG  C 1 9   ? 27.728 9.205   28.421 1.00 50.35  ? 9   DG  E N7    1 
ATOM   1441 C  C5    . DG  C 1 9   ? 28.426 9.998   27.521 1.00 51.37  ? 9   DG  E C5    1 
ATOM   1442 C  C6    . DG  C 1 9   ? 27.971 10.710  26.378 1.00 51.65  ? 9   DG  E C6    1 
ATOM   1443 O  O6    . DG  C 1 9   ? 26.828 10.778  25.925 1.00 53.08  ? 9   DG  E O6    1 
ATOM   1444 N  N1    . DG  C 1 9   ? 29.007 11.392  25.745 1.00 51.90  ? 9   DG  E N1    1 
ATOM   1445 C  C2    . DG  C 1 9   ? 30.318 11.391  26.159 1.00 53.47  ? 9   DG  E C2    1 
ATOM   1446 N  N2    . DG  C 1 9   ? 31.181 12.115  25.415 1.00 51.85  ? 9   DG  E N2    1 
ATOM   1447 N  N3    . DG  C 1 9   ? 30.757 10.728  27.225 1.00 54.77  ? 9   DG  E N3    1 
ATOM   1448 C  C4    . DG  C 1 9   ? 29.762 10.057  27.853 1.00 53.63  ? 9   DG  E C4    1 
ATOM   1449 P  P     . DG  C 1 10  ? 33.698 9.836   32.738 1.00 74.34  ? 10  DG  E P     1 
ATOM   1450 O  OP1   . DG  C 1 10  ? 34.720 9.355   33.682 1.00 75.31  ? 10  DG  E OP1   1 
ATOM   1451 O  OP2   . DG  C 1 10  ? 32.449 10.401  33.268 1.00 74.50  ? 10  DG  E OP2   1 
ATOM   1452 O  "O5'" . DG  C 1 10  ? 34.311 10.941  31.772 1.00 73.52  ? 10  DG  E "O5'" 1 
ATOM   1453 C  "C5'" . DG  C 1 10  ? 33.690 11.187  30.507 1.00 75.17  ? 10  DG  E "C5'" 1 
ATOM   1454 C  "C4'" . DG  C 1 10  ? 33.971 12.589  30.027 1.00 77.90  ? 10  DG  E "C4'" 1 
ATOM   1455 O  "O4'" . DG  C 1 10  ? 32.923 12.936  29.098 1.00 77.14  ? 10  DG  E "O4'" 1 
ATOM   1456 C  "C3'" . DG  C 1 10  ? 33.903 13.658  31.116 1.00 79.95  ? 10  DG  E "C3'" 1 
ATOM   1457 O  "O3'" . DG  C 1 10  ? 34.678 14.788  30.679 1.00 85.37  ? 10  DG  E "O3'" 1 
ATOM   1458 C  "C2'" . DG  C 1 10  ? 32.427 14.002  31.152 1.00 77.18  ? 10  DG  E "C2'" 1 
ATOM   1459 C  "C1'" . DG  C 1 10  ? 32.044 13.880  29.689 1.00 74.65  ? 10  DG  E "C1'" 1 
ATOM   1460 N  N9    . DG  C 1 10  ? 30.676 13.463  29.402 1.00 70.31  ? 10  DG  E N9    1 
ATOM   1461 C  C8    . DG  C 1 10  ? 29.949 12.461  30.003 1.00 69.35  ? 10  DG  E C8    1 
ATOM   1462 N  N7    . DG  C 1 10  ? 28.743 12.338  29.512 1.00 67.90  ? 10  DG  E N7    1 
ATOM   1463 C  C5    . DG  C 1 10  ? 28.670 13.317  28.526 1.00 67.25  ? 10  DG  E C5    1 
ATOM   1464 C  C6    . DG  C 1 10  ? 27.605 13.671  27.644 1.00 66.06  ? 10  DG  E C6    1 
ATOM   1465 O  O6    . DG  C 1 10  ? 26.475 13.173  27.553 1.00 65.24  ? 10  DG  E O6    1 
ATOM   1466 N  N1    . DG  C 1 10  ? 27.962 14.725  26.807 1.00 64.44  ? 10  DG  E N1    1 
ATOM   1467 C  C2    . DG  C 1 10  ? 29.179 15.359  26.811 1.00 63.51  ? 10  DG  E C2    1 
ATOM   1468 N  N2    . DG  C 1 10  ? 29.333 16.358  25.925 1.00 63.16  ? 10  DG  E N2    1 
ATOM   1469 N  N3    . DG  C 1 10  ? 30.176 15.041  27.622 1.00 64.05  ? 10  DG  E N3    1 
ATOM   1470 C  C4    . DG  C 1 10  ? 29.855 14.018  28.447 1.00 67.03  ? 10  DG  E C4    1 
ATOM   1471 P  P     . DT  C 1 11  ? 34.978 16.006  31.688 1.00 88.56  ? 11  DT  E P     1 
ATOM   1472 O  OP1   . DT  C 1 11  ? 36.389 16.355  31.487 1.00 89.78  ? 11  DT  E OP1   1 
ATOM   1473 O  OP2   . DT  C 1 11  ? 34.526 15.645  33.034 1.00 89.52  ? 11  DT  E OP2   1 
ATOM   1474 O  "O5'" . DT  C 1 11  ? 34.090 17.223  31.151 1.00 85.23  ? 11  DT  E "O5'" 1 
ATOM   1475 C  "C5'" . DT  C 1 11  ? 32.803 17.008  30.525 1.00 81.99  ? 11  DT  E "C5'" 1 
ATOM   1476 C  "C4'" . DT  C 1 11  ? 32.541 18.085  29.497 1.00 80.57  ? 11  DT  E "C4'" 1 
ATOM   1477 O  "O4'" . DT  C 1 11  ? 31.330 17.760  28.764 1.00 78.05  ? 11  DT  E "O4'" 1 
ATOM   1478 C  "C3'" . DT  C 1 11  ? 32.260 19.443  30.130 1.00 81.99  ? 11  DT  E "C3'" 1 
ATOM   1479 O  "O3'" . DT  C 1 11  ? 32.711 20.512  29.293 1.00 85.28  ? 11  DT  E "O3'" 1 
ATOM   1480 C  "C2'" . DT  C 1 11  ? 30.754 19.422  30.342 1.00 79.59  ? 11  DT  E "C2'" 1 
ATOM   1481 C  "C1'" . DT  C 1 11  ? 30.253 18.625  29.139 1.00 75.36  ? 11  DT  E "C1'" 1 
ATOM   1482 N  N1    . DT  C 1 11  ? 29.069 17.784  29.430 1.00 70.53  ? 11  DT  E N1    1 
ATOM   1483 C  C2    . DT  C 1 11  ? 27.879 18.052  28.779 1.00 67.17  ? 11  DT  E C2    1 
ATOM   1484 O  O2    . DT  C 1 11  ? 27.741 18.951  27.964 1.00 64.31  ? 11  DT  E O2    1 
ATOM   1485 N  N3    . DT  C 1 11  ? 26.845 17.219  29.123 1.00 66.55  ? 11  DT  E N3    1 
ATOM   1486 C  C4    . DT  C 1 11  ? 26.871 16.174  30.027 1.00 67.58  ? 11  DT  E C4    1 
ATOM   1487 O  O4    . DT  C 1 11  ? 25.849 15.514  30.228 1.00 68.67  ? 11  DT  E O4    1 
ATOM   1488 C  C5    . DT  C 1 11  ? 28.148 15.950  30.673 1.00 67.00  ? 11  DT  E C5    1 
ATOM   1489 C  C7    . DT  C 1 11  ? 28.280 14.842  31.670 1.00 65.43  ? 11  DT  E C7    1 
ATOM   1490 C  C6    . DT  C 1 11  ? 29.166 16.754  30.345 1.00 68.37  ? 11  DT  E C6    1 
ATOM   1491 P  P     . DT  C 1 12  ? 32.360 22.031  29.685 1.00 87.05  ? 12  DT  E P     1 
ATOM   1492 O  OP1   . DT  C 1 12  ? 33.230 22.930  28.883 1.00 86.95  ? 12  DT  E OP1   1 
ATOM   1493 O  OP2   . DT  C 1 12  ? 32.372 22.131  31.165 1.00 86.62  ? 12  DT  E OP2   1 
ATOM   1494 O  "O5'" . DT  C 1 12  ? 30.856 22.190  29.183 1.00 86.27  ? 12  DT  E "O5'" 1 
ATOM   1495 C  "C5'" . DT  C 1 12  ? 30.520 21.917  27.808 1.00 86.69  ? 12  DT  E "C5'" 1 
ATOM   1496 C  "C4'" . DT  C 1 12  ? 29.253 22.637  27.403 1.00 86.71  ? 12  DT  E "C4'" 1 
ATOM   1497 O  "O4'" . DT  C 1 12  ? 28.096 21.836  27.751 1.00 86.55  ? 12  DT  E "O4'" 1 
ATOM   1498 C  "C3'" . DT  C 1 12  ? 29.065 23.952  28.160 1.00 86.44  ? 12  DT  E "C3'" 1 
ATOM   1499 O  "O3'" . DT  C 1 12  ? 28.283 24.848  27.370 1.00 90.61  ? 12  DT  E "O3'" 1 
ATOM   1500 C  "C2'" . DT  C 1 12  ? 28.309 23.522  29.407 1.00 84.18  ? 12  DT  E "C2'" 1 
ATOM   1501 C  "C1'" . DT  C 1 12  ? 27.404 22.439  28.836 1.00 82.73  ? 12  DT  E "C1'" 1 
ATOM   1502 N  N1    . DT  C 1 12  ? 26.863 21.372  29.713 1.00 77.25  ? 12  DT  E N1    1 
ATOM   1503 C  C2    . DT  C 1 12  ? 25.548 21.007  29.507 1.00 74.21  ? 12  DT  E C2    1 
ATOM   1504 O  O2    . DT  C 1 12  ? 24.836 21.514  28.652 1.00 72.83  ? 12  DT  E O2    1 
ATOM   1505 N  N3    . DT  C 1 12  ? 25.090 20.022  30.342 1.00 73.29  ? 12  DT  E N3    1 
ATOM   1506 C  C4    . DT  C 1 12  ? 25.789 19.376  31.340 1.00 72.44  ? 12  DT  E C4    1 
ATOM   1507 O  O4    . DT  C 1 12  ? 25.237 18.506  32.010 1.00 72.10  ? 12  DT  E O4    1 
ATOM   1508 C  C5    . DT  C 1 12  ? 27.157 19.803  31.503 1.00 72.01  ? 12  DT  E C5    1 
ATOM   1509 C  C7    . DT  C 1 12  ? 27.996 19.159  32.562 1.00 69.55  ? 12  DT  E C7    1 
ATOM   1510 C  C6    . DT  C 1 12  ? 27.623 20.767  30.693 1.00 74.20  ? 12  DT  E C6    1 
ATOM   1511 P  P     . DA  C 1 13  ? 28.197 26.398  27.773 1.00 94.42  ? 13  DA  E P     1 
ATOM   1512 O  OP1   . DA  C 1 13  ? 29.437 27.076  27.305 1.00 95.79  ? 13  DA  E OP1   1 
ATOM   1513 O  OP2   . DA  C 1 13  ? 27.819 26.460  29.207 1.00 95.27  ? 13  DA  E OP2   1 
ATOM   1514 O  "O5'" . DA  C 1 13  ? 26.976 26.939  26.912 1.00 92.89  ? 13  DA  E "O5'" 1 
ATOM   1515 C  "C5'" . DA  C 1 13  ? 25.899 27.645  27.533 1.00 92.71  ? 13  DA  E "C5'" 1 
ATOM   1516 C  "C4'" . DA  C 1 13  ? 24.583 27.165  26.971 1.00 94.27  ? 13  DA  E "C4'" 1 
ATOM   1517 O  "O4'" . DA  C 1 13  ? 24.368 25.794  27.404 1.00 94.69  ? 13  DA  E "O4'" 1 
ATOM   1518 C  "C3'" . DA  C 1 13  ? 23.412 27.948  27.552 1.00 96.03  ? 13  DA  E "C3'" 1 
ATOM   1519 O  "O3'" . DA  C 1 13  ? 22.342 28.024  26.601 1.00 98.80  ? 13  DA  E "O3'" 1 
ATOM   1520 C  "C2'" . DA  C 1 13  ? 23.064 27.172  28.810 1.00 95.74  ? 13  DA  E "C2'" 1 
ATOM   1521 C  "C1'" . DA  C 1 13  ? 23.335 25.734  28.392 1.00 96.12  ? 13  DA  E "C1'" 1 
ATOM   1522 N  N9    . DA  C 1 13  ? 23.781 24.861  29.483 1.00 96.60  ? 13  DA  E N9    1 
ATOM   1523 C  C8    . DA  C 1 13  ? 25.034 24.765  30.038 1.00 96.72  ? 13  DA  E C8    1 
ATOM   1524 N  N7    . DA  C 1 13  ? 25.114 23.893  31.015 1.00 95.70  ? 13  DA  E N7    1 
ATOM   1525 C  C5    . DA  C 1 13  ? 23.827 23.378  31.111 1.00 94.96  ? 13  DA  E C5    1 
ATOM   1526 C  C6    . DA  C 1 13  ? 23.256 22.409  31.957 1.00 93.98  ? 13  DA  E C6    1 
ATOM   1527 N  N6    . DA  C 1 13  ? 23.934 21.760  32.903 1.00 94.96  ? 13  DA  E N6    1 
ATOM   1528 N  N1    . DA  C 1 13  ? 21.945 22.123  31.794 1.00 92.64  ? 13  DA  E N1    1 
ATOM   1529 C  C2    . DA  C 1 13  ? 21.266 22.772  30.841 1.00 93.87  ? 13  DA  E C2    1 
ATOM   1530 N  N3    . DA  C 1 13  ? 21.689 23.700  29.987 1.00 95.22  ? 13  DA  E N3    1 
ATOM   1531 C  C4    . DA  C 1 13  ? 22.996 23.963  30.174 1.00 95.62  ? 13  DA  E C4    1 
ATOM   1532 P  P     . DG  C 1 14  ? 20.888 28.521  27.072 1.00 100.00 ? 14  DG  E P     1 
ATOM   1533 O  OP1   . DG  C 1 14  ? 20.036 28.710  25.863 1.00 100.00 ? 14  DG  E OP1   1 
ATOM   1534 O  OP2   . DG  C 1 14  ? 21.055 29.644  28.031 1.00 100.00 ? 14  DG  E OP2   1 
ATOM   1535 O  "O5'" . DG  C 1 14  ? 20.351 27.269  27.889 1.00 96.22  ? 14  DG  E "O5'" 1 
ATOM   1536 C  "C5'" . DG  C 1 14  ? 19.537 26.279  27.256 1.00 92.86  ? 14  DG  E "C5'" 1 
ATOM   1537 C  "C4'" . DG  C 1 14  ? 18.296 26.050  28.081 1.00 89.74  ? 14  DG  E "C4'" 1 
ATOM   1538 O  "O4'" . DG  C 1 14  ? 18.677 25.367  29.295 1.00 86.63  ? 14  DG  E "O4'" 1 
ATOM   1539 C  "C3'" . DG  C 1 14  ? 17.676 27.367  28.542 1.00 89.62  ? 14  DG  E "C3'" 1 
ATOM   1540 O  "O3'" . DG  C 1 14  ? 16.270 27.186  28.743 1.00 94.32  ? 14  DG  E "O3'" 1 
ATOM   1541 C  "C2'" . DG  C 1 14  ? 18.414 27.656  29.840 1.00 85.35  ? 14  DG  E "C2'" 1 
ATOM   1542 C  "C1'" . DG  C 1 14  ? 18.592 26.254  30.398 1.00 83.09  ? 14  DG  E "C1'" 1 
ATOM   1543 N  N9    . DG  C 1 14  ? 19.721 25.981  31.289 1.00 79.42  ? 14  DG  E N9    1 
ATOM   1544 C  C8    . DG  C 1 14  ? 20.982 26.532  31.255 1.00 77.91  ? 14  DG  E C8    1 
ATOM   1545 N  N7    . DG  C 1 14  ? 21.768 26.074  32.197 1.00 75.42  ? 14  DG  E N7    1 
ATOM   1546 C  C5    . DG  C 1 14  ? 20.980 25.167  32.898 1.00 73.49  ? 14  DG  E C5    1 
ATOM   1547 C  C6    . DG  C 1 14  ? 21.284 24.352  34.033 1.00 70.00  ? 14  DG  E C6    1 
ATOM   1548 O  O6    . DG  C 1 14  ? 22.344 24.269  34.670 1.00 67.89  ? 14  DG  E O6    1 
ATOM   1549 N  N1    . DG  C 1 14  ? 20.192 23.580  34.413 1.00 68.60  ? 14  DG  E N1    1 
ATOM   1550 C  C2    . DG  C 1 14  ? 18.966 23.585  33.790 1.00 69.27  ? 14  DG  E C2    1 
ATOM   1551 N  N2    . DG  C 1 14  ? 18.033 22.770  34.302 1.00 68.00  ? 14  DG  E N2    1 
ATOM   1552 N  N3    . DG  C 1 14  ? 18.671 24.333  32.741 1.00 71.72  ? 14  DG  E N3    1 
ATOM   1553 C  C4    . DG  C 1 14  ? 19.715 25.095  32.350 1.00 75.34  ? 14  DG  E C4    1 
ATOM   1554 P  P     . DT  C 1 15  ? 15.345 28.443  29.131 1.00 98.33  ? 15  DT  E P     1 
ATOM   1555 O  OP1   . DT  C 1 15  ? 14.138 28.412  28.263 1.00 99.14  ? 15  DT  E OP1   1 
ATOM   1556 O  OP2   . DT  C 1 15  ? 16.199 29.663  29.157 1.00 99.75  ? 15  DT  E OP2   1 
ATOM   1557 O  "O5'" . DT  C 1 15  ? 14.886 28.124  30.622 1.00 96.17  ? 15  DT  E "O5'" 1 
ATOM   1558 C  "C5'" . DT  C 1 15  ? 15.784 27.493  31.550 1.00 93.10  ? 15  DT  E "C5'" 1 
ATOM   1559 C  "C4'" . DT  C 1 15  ? 15.002 26.836  32.663 1.00 92.04  ? 15  DT  E "C4'" 1 
ATOM   1560 O  "O4'" . DT  C 1 15  ? 15.926 26.163  33.550 1.00 90.77  ? 15  DT  E "O4'" 1 
ATOM   1561 C  "C3'" . DT  C 1 15  ? 14.281 27.856  33.539 1.00 91.13  ? 15  DT  E "C3'" 1 
ATOM   1562 O  "O3'" . DT  C 1 15  ? 13.147 27.236  34.157 1.00 92.19  ? 15  DT  E "O3'" 1 
ATOM   1563 C  "C2'" . DT  C 1 15  ? 15.333 28.211  34.573 1.00 89.43  ? 15  DT  E "C2'" 1 
ATOM   1564 C  "C1'" . DT  C 1 15  ? 16.030 26.873  34.776 1.00 88.34  ? 15  DT  E "C1'" 1 
ATOM   1565 N  N1    . DT  C 1 15  ? 17.454 26.891  35.175 1.00 86.39  ? 15  DT  E N1    1 
ATOM   1566 C  C2    . DT  C 1 15  ? 17.837 26.010  36.160 1.00 86.15  ? 15  DT  E C2    1 
ATOM   1567 O  O2    . DT  C 1 15  ? 17.061 25.240  36.704 1.00 86.45  ? 15  DT  E O2    1 
ATOM   1568 N  N3    . DT  C 1 15  ? 19.168 26.064  36.489 1.00 85.92  ? 15  DT  E N3    1 
ATOM   1569 C  C4    . DT  C 1 15  ? 20.132 26.887  35.949 1.00 86.15  ? 15  DT  E C4    1 
ATOM   1570 O  O4    . DT  C 1 15  ? 21.292 26.814  36.351 1.00 87.51  ? 15  DT  E O4    1 
ATOM   1571 C  C5    . DT  C 1 15  ? 19.663 27.790  34.920 1.00 84.95  ? 15  DT  E C5    1 
ATOM   1572 C  C7    . DT  C 1 15  ? 20.636 28.725  34.274 1.00 84.48  ? 15  DT  E C7    1 
ATOM   1573 C  C6    . DT  C 1 15  ? 18.364 27.748  34.589 1.00 85.17  ? 15  DT  E C6    1 
ATOM   1574 P  P     . DA  C 1 16  ? 11.815 28.091  34.431 1.00 92.58  ? 16  DA  E P     1 
ATOM   1575 O  OP1   . DA  C 1 16  ? 10.819 27.701  33.424 1.00 93.77  ? 16  DA  E OP1   1 
ATOM   1576 O  OP2   . DA  C 1 16  ? 12.167 29.506  34.560 1.00 92.78  ? 16  DA  E OP2   1 
ATOM   1577 O  "O5'" . DA  C 1 16  ? 11.330 27.564  35.853 1.00 92.04  ? 16  DA  E "O5'" 1 
ATOM   1578 C  "C5'" . DA  C 1 16  ? 10.914 26.197  36.027 1.00 91.14  ? 16  DA  E "C5'" 1 
ATOM   1579 C  "C4'" . DA  C 1 16  ? 11.002 25.787  37.481 1.00 90.13  ? 16  DA  E "C4'" 1 
ATOM   1580 O  "O4'" . DA  C 1 16  ? 12.393 25.758  37.894 1.00 89.66  ? 16  DA  E "O4'" 1 
ATOM   1581 C  "C3'" . DA  C 1 16  ? 10.336 26.788  38.425 1.00 88.65  ? 16  DA  E "C3'" 1 
ATOM   1582 O  "O3'" . DA  C 1 16  ? 9.867  26.097  39.595 1.00 89.67  ? 16  DA  E "O3'" 1 
ATOM   1583 C  "C2'" . DA  C 1 16  ? 11.457 27.768  38.725 1.00 88.01  ? 16  DA  E "C2'" 1 
ATOM   1584 C  "C1'" . DA  C 1 16  ? 12.663 26.842  38.775 1.00 87.10  ? 16  DA  E "C1'" 1 
ATOM   1585 N  N9    . DA  C 1 16  ? 13.957 27.424  38.424 1.00 85.03  ? 16  DA  E N9    1 
ATOM   1586 C  C8    . DA  C 1 16  ? 14.237 28.418  37.517 1.00 85.54  ? 16  DA  E C8    1 
ATOM   1587 N  N7    . DA  C 1 16  ? 15.508 28.724  37.444 1.00 84.10  ? 16  DA  E N7    1 
ATOM   1588 C  C5    . DA  C 1 16  ? 16.108 27.874  38.364 1.00 81.03  ? 16  DA  E C5    1 
ATOM   1589 C  C6    . DA  C 1 16  ? 17.444 27.701  38.762 1.00 77.76  ? 16  DA  E C6    1 
ATOM   1590 N  N6    . DA  C 1 16  ? 18.465 28.400  38.260 1.00 76.35  ? 16  DA  E N6    1 
ATOM   1591 N  N1    . DA  C 1 16  ? 17.700 26.770  39.705 1.00 76.70  ? 16  DA  E N1    1 
ATOM   1592 C  C2    . DA  C 1 16  ? 16.675 26.067  40.209 1.00 78.06  ? 16  DA  E C2    1 
ATOM   1593 N  N3    . DA  C 1 16  ? 15.383 26.136  39.916 1.00 79.03  ? 16  DA  E N3    1 
ATOM   1594 C  C4    . DA  C 1 16  ? 15.163 27.069  38.974 1.00 81.70  ? 16  DA  E C4    1 
ATOM   1595 P  P     . DC  C 1 17  ? 10.063 26.749  41.056 1.00 92.28  ? 17  DC  E P     1 
ATOM   1596 O  OP1   . DC  C 1 17  ? 9.264  25.951  42.026 1.00 93.00  ? 17  DC  E OP1   1 
ATOM   1597 O  OP2   . DC  C 1 17  ? 9.832  28.215  40.946 1.00 93.45  ? 17  DC  E OP2   1 
ATOM   1598 O  "O5'" . DC  C 1 17  ? 11.609 26.517  41.376 1.00 89.73  ? 17  DC  E "O5'" 1 
ATOM   1599 C  "C5'" . DC  C 1 17  ? 12.147 25.182  41.464 1.00 87.20  ? 17  DC  E "C5'" 1 
ATOM   1600 C  "C4'" . DC  C 1 17  ? 12.910 24.993  42.757 1.00 86.25  ? 17  DC  E "C4'" 1 
ATOM   1601 O  "O4'" . DC  C 1 17  ? 14.202 25.638  42.655 1.00 83.56  ? 17  DC  E "O4'" 1 
ATOM   1602 C  "C3'" . DC  C 1 17  ? 12.236 25.651  43.962 1.00 86.39  ? 17  DC  E "C3'" 1 
ATOM   1603 O  "O3'" . DC  C 1 17  ? 12.566 24.945  45.169 1.00 89.52  ? 17  DC  E "O3'" 1 
ATOM   1604 C  "C2'" . DC  C 1 17  ? 12.808 27.060  43.940 1.00 82.74  ? 17  DC  E "C2'" 1 
ATOM   1605 C  "C1'" . DC  C 1 17  ? 14.234 26.807  43.463 1.00 79.69  ? 17  DC  E "C1'" 1 
ATOM   1606 N  N1    . DC  C 1 17  ? 14.901 27.873  42.696 1.00 75.42  ? 17  DC  E N1    1 
ATOM   1607 C  C2    . DC  C 1 17  ? 16.240 28.166  42.980 1.00 72.95  ? 17  DC  E C2    1 
ATOM   1608 O  O2    . DC  C 1 17  ? 16.823 27.524  43.866 1.00 71.97  ? 17  DC  E O2    1 
ATOM   1609 N  N3    . DC  C 1 17  ? 16.868 29.139  42.283 1.00 73.07  ? 17  DC  E N3    1 
ATOM   1610 C  C4    . DC  C 1 17  ? 16.210 29.810  41.335 1.00 75.65  ? 17  DC  E C4    1 
ATOM   1611 N  N4    . DC  C 1 17  ? 16.871 30.765  40.670 1.00 76.99  ? 17  DC  E N4    1 
ATOM   1612 C  C5    . DC  C 1 17  ? 14.846 29.533  41.025 1.00 76.33  ? 17  DC  E C5    1 
ATOM   1613 C  C6    . DC  C 1 17  ? 14.236 28.566  41.723 1.00 75.94  ? 17  DC  E C6    1 
ATOM   1614 P  P     . DC  C 1 18  ? 11.765 25.258  46.533 1.00 92.00  ? 18  DC  E P     1 
ATOM   1615 O  OP1   . DC  C 1 18  ? 11.473 23.972  47.178 1.00 91.49  ? 18  DC  E OP1   1 
ATOM   1616 O  OP2   . DC  C 1 18  ? 10.647 26.173  46.247 1.00 93.37  ? 18  DC  E OP2   1 
ATOM   1617 O  "O5'" . DC  C 1 18  ? 12.835 26.022  47.441 1.00 89.22  ? 18  DC  E "O5'" 1 
ATOM   1618 C  "C5'" . DC  C 1 18  ? 13.860 26.855  46.854 1.00 84.56  ? 18  DC  E "C5'" 1 
ATOM   1619 C  "C4'" . DC  C 1 18  ? 15.172 26.658  47.578 1.00 81.60  ? 18  DC  E "C4'" 1 
ATOM   1620 O  "O4'" . DC  C 1 18  ? 16.213 27.351  46.844 1.00 80.88  ? 18  DC  E "O4'" 1 
ATOM   1621 C  "C3'" . DC  C 1 18  ? 15.199 27.275  48.971 1.00 80.36  ? 18  DC  E "C3'" 1 
ATOM   1622 O  "O3'" . DC  C 1 18  ? 16.073 26.544  49.836 1.00 81.44  ? 18  DC  E "O3'" 1 
ATOM   1623 C  "C2'" . DC  C 1 18  ? 15.659 28.698  48.704 1.00 79.18  ? 18  DC  E "C2'" 1 
ATOM   1624 C  "C1'" . DC  C 1 18  ? 16.625 28.533  47.532 1.00 77.14  ? 18  DC  E "C1'" 1 
ATOM   1625 N  N1    . DC  C 1 18  ? 16.591 29.653  46.567 1.00 73.15  ? 18  DC  E N1    1 
ATOM   1626 C  C2    . DC  C 1 18  ? 17.800 30.272  46.176 1.00 70.10  ? 18  DC  E C2    1 
ATOM   1627 O  O2    . DC  C 1 18  ? 18.878 29.865  46.648 1.00 69.11  ? 18  DC  E O2    1 
ATOM   1628 N  N3    . DC  C 1 18  ? 17.756 31.297  45.294 1.00 67.04  ? 18  DC  E N3    1 
ATOM   1629 C  C4    . DC  C 1 18  ? 16.583 31.708  44.805 1.00 67.23  ? 18  DC  E C4    1 
ATOM   1630 N  N4    . DC  C 1 18  ? 16.587 32.719  43.940 1.00 67.01  ? 18  DC  E N4    1 
ATOM   1631 C  C5    . DC  C 1 18  ? 15.350 31.101  45.182 1.00 68.42  ? 18  DC  E C5    1 
ATOM   1632 C  C6    . DC  C 1 18  ? 15.399 30.089  46.054 1.00 70.60  ? 18  DC  E C6    1 
ATOM   1633 P  P     . DT  C 1 19  ? 16.508 27.176  51.248 1.00 83.85  ? 19  DT  E P     1 
ATOM   1634 O  OP1   . DT  C 1 19  ? 17.081 26.104  52.068 1.00 84.13  ? 19  DT  E OP1   1 
ATOM   1635 O  OP2   . DT  C 1 19  ? 15.391 27.959  51.794 1.00 82.83  ? 19  DT  E OP2   1 
ATOM   1636 O  "O5'" . DT  C 1 19  ? 17.681 28.171  50.838 1.00 83.92  ? 19  DT  E "O5'" 1 
ATOM   1637 C  "C5'" . DT  C 1 19  ? 18.874 27.671  50.193 1.00 83.98  ? 19  DT  E "C5'" 1 
ATOM   1638 C  "C4'" . DT  C 1 19  ? 20.062 28.547  50.523 1.00 84.17  ? 19  DT  E "C4'" 1 
ATOM   1639 O  "O4'" . DT  C 1 19  ? 20.047 29.723  49.678 1.00 83.65  ? 19  DT  E "O4'" 1 
ATOM   1640 C  "C3'" . DT  C 1 19  ? 20.024 29.085  51.949 1.00 84.25  ? 19  DT  E "C3'" 1 
ATOM   1641 O  "O3'" . DT  C 1 19  ? 21.337 29.296  52.453 1.00 86.49  ? 19  DT  E "O3'" 1 
ATOM   1642 C  "C2'" . DT  C 1 19  ? 19.238 30.376  51.807 1.00 82.96  ? 19  DT  E "C2'" 1 
ATOM   1643 C  "C1'" . DT  C 1 19  ? 19.680 30.877  50.432 1.00 81.41  ? 19  DT  E "C1'" 1 
ATOM   1644 N  N1    . DT  C 1 19  ? 18.677 31.644  49.638 1.00 78.40  ? 19  DT  E N1    1 
ATOM   1645 C  C2    . DT  C 1 19  ? 19.151 32.575  48.727 1.00 77.09  ? 19  DT  E C2    1 
ATOM   1646 O  O2    . DT  C 1 19  ? 20.341 32.799  48.547 1.00 77.65  ? 19  DT  E O2    1 
ATOM   1647 N  N3    . DT  C 1 19  ? 18.174 33.241  48.030 1.00 74.04  ? 19  DT  E N3    1 
ATOM   1648 C  C4    . DT  C 1 19  ? 16.807 33.081  48.141 1.00 72.52  ? 19  DT  E C4    1 
ATOM   1649 O  O4    . DT  C 1 19  ? 16.060 33.757  47.439 1.00 72.68  ? 19  DT  E O4    1 
ATOM   1650 C  C5    . DT  C 1 19  ? 16.375 32.092  49.111 1.00 71.33  ? 19  DT  E C5    1 
ATOM   1651 C  C7    . DT  C 1 19  ? 14.911 31.850  49.303 1.00 68.81  ? 19  DT  E C7    1 
ATOM   1652 C  C6    . DT  C 1 19  ? 17.318 31.434  49.800 1.00 73.42  ? 19  DT  E C6    1 
ATOM   1653 P  P     . DG  C 1 20  ? 21.741 28.676  53.878 1.00 91.07  ? 20  DG  E P     1 
ATOM   1654 O  OP1   . DG  C 1 20  ? 22.447 27.389  53.640 1.00 90.51  ? 20  DG  E OP1   1 
ATOM   1655 O  OP2   . DG  C 1 20  ? 20.535 28.704  54.756 1.00 91.40  ? 20  DG  E OP2   1 
ATOM   1656 O  "O5'" . DG  C 1 20  ? 22.786 29.732  54.450 1.00 89.98  ? 20  DG  E "O5'" 1 
ATOM   1657 C  "C5'" . DG  C 1 20  ? 22.432 31.123  54.566 1.00 88.59  ? 20  DG  E "C5'" 1 
ATOM   1658 C  "C4'" . DG  C 1 20  ? 23.295 31.955  53.645 1.00 86.26  ? 20  DG  E "C4'" 1 
ATOM   1659 O  "O4'" . DG  C 1 20  ? 22.490 32.410  52.528 1.00 82.96  ? 20  DG  E "O4'" 1 
ATOM   1660 C  "C3'" . DG  C 1 20  ? 23.808 33.232  54.299 1.00 85.98  ? 20  DG  E "C3'" 1 
ATOM   1661 O  "O3'" . DG  C 1 20  ? 25.073 33.587  53.733 1.00 87.99  ? 20  DG  E "O3'" 1 
ATOM   1662 C  "C2'" . DG  C 1 20  ? 22.700 34.234  54.022 1.00 82.64  ? 20  DG  E "C2'" 1 
ATOM   1663 C  "C1'" . DG  C 1 20  ? 22.206 33.807  52.647 1.00 80.41  ? 20  DG  E "C1'" 1 
ATOM   1664 N  N9    . DG  C 1 20  ? 20.774 33.990  52.413 1.00 77.81  ? 20  DG  E N9    1 
ATOM   1665 C  C8    . DG  C 1 20  ? 19.745 33.282  52.992 1.00 76.13  ? 20  DG  E C8    1 
ATOM   1666 N  N7    . DG  C 1 20  ? 18.565 33.657  52.577 1.00 73.93  ? 20  DG  E N7    1 
ATOM   1667 C  C5    . DG  C 1 20  ? 18.826 34.678  51.672 1.00 74.18  ? 20  DG  E C5    1 
ATOM   1668 C  C6    . DG  C 1 20  ? 17.933 35.470  50.897 1.00 72.72  ? 20  DG  E C6    1 
ATOM   1669 O  O6    . DG  C 1 20  ? 16.698 35.421  50.856 1.00 70.64  ? 20  DG  E O6    1 
ATOM   1670 N  N1    . DG  C 1 20  ? 18.617 36.393  50.112 1.00 72.63  ? 20  DG  E N1    1 
ATOM   1671 C  C2    . DG  C 1 20  ? 19.984 36.536  50.074 1.00 74.07  ? 20  DG  E C2    1 
ATOM   1672 N  N2    . DG  C 1 20  ? 20.460 37.486  49.253 1.00 74.75  ? 20  DG  E N2    1 
ATOM   1673 N  N3    . DG  C 1 20  ? 20.827 35.803  50.789 1.00 75.03  ? 20  DG  E N3    1 
ATOM   1674 C  C4    . DG  C 1 20  ? 20.184 34.900  51.560 1.00 75.90  ? 20  DG  E C4    1 
ATOM   1675 P  P     . DG  C 1 21  ? 25.900 34.822  54.337 1.00 89.92  ? 21  DG  E P     1 
ATOM   1676 O  OP1   . DG  C 1 21  ? 27.318 34.694  53.897 1.00 89.36  ? 21  DG  E OP1   1 
ATOM   1677 O  OP2   . DG  C 1 21  ? 25.590 34.941  55.789 1.00 89.85  ? 21  DG  E OP2   1 
ATOM   1678 O  "O5'" . DG  C 1 21  ? 25.248 36.061  53.588 1.00 86.89  ? 21  DG  E "O5'" 1 
ATOM   1679 C  "C5'" . DG  C 1 21  ? 25.443 36.237  52.176 1.00 82.94  ? 21  DG  E "C5'" 1 
ATOM   1680 C  "C4'" . DG  C 1 21  ? 25.298 37.693  51.805 1.00 80.11  ? 21  DG  E "C4'" 1 
ATOM   1681 O  "O4'" . DG  C 1 21  ? 23.893 38.014  51.676 1.00 77.89  ? 21  DG  E "O4'" 1 
ATOM   1682 C  "C3'" . DG  C 1 21  ? 25.822 38.635  52.886 1.00 78.55  ? 21  DG  E "C3'" 1 
ATOM   1683 O  "O3'" . DG  C 1 21  ? 26.316 39.837  52.283 1.00 76.70  ? 21  DG  E "O3'" 1 
ATOM   1684 C  "C2'" . DG  C 1 21  ? 24.607 38.832  53.783 1.00 76.81  ? 21  DG  E "C2'" 1 
ATOM   1685 C  "C1'" . DG  C 1 21  ? 23.464 38.818  52.771 1.00 75.38  ? 21  DG  E "C1'" 1 
ATOM   1686 N  N9    . DG  C 1 21  ? 22.167 38.312  53.217 1.00 71.06  ? 21  DG  E N9    1 
ATOM   1687 C  C8    . DG  C 1 21  ? 21.914 37.320  54.138 1.00 68.82  ? 21  DG  E C8    1 
ATOM   1688 N  N7    . DG  C 1 21  ? 20.637 37.093  54.311 1.00 66.25  ? 21  DG  E N7    1 
ATOM   1689 C  C5    . DG  C 1 21  ? 20.008 37.989  53.455 1.00 64.80  ? 21  DG  E C5    1 
ATOM   1690 C  C6    . DG  C 1 21  ? 18.623 38.213  53.204 1.00 61.12  ? 21  DG  E C6    1 
ATOM   1691 O  O6    . DG  C 1 21  ? 17.643 37.646  53.710 1.00 57.63  ? 21  DG  E O6    1 
ATOM   1692 N  N1    . DG  C 1 21  ? 18.431 39.218  52.258 1.00 61.32  ? 21  DG  E N1    1 
ATOM   1693 C  C2    . DG  C 1 21  ? 19.439 39.920  51.634 1.00 64.01  ? 21  DG  E C2    1 
ATOM   1694 N  N2    . DG  C 1 21  ? 19.062 40.857  50.746 1.00 64.17  ? 21  DG  E N2    1 
ATOM   1695 N  N3    . DG  C 1 21  ? 20.727 39.721  51.860 1.00 65.98  ? 21  DG  E N3    1 
ATOM   1696 C  C4    . DG  C 1 21  ? 20.938 38.750  52.773 1.00 67.57  ? 21  DG  E C4    1 
ATOM   1697 P  P     . DA  C 1 22  ? 26.433 41.184  53.150 1.00 75.38  ? 22  DA  E P     1 
ATOM   1698 O  OP1   . DA  C 1 22  ? 27.280 42.124  52.366 1.00 74.87  ? 22  DA  E OP1   1 
ATOM   1699 O  OP2   . DA  C 1 22  ? 26.806 40.838  54.555 1.00 73.42  ? 22  DA  E OP2   1 
ATOM   1700 O  "O5'" . DA  C 1 22  ? 24.941 41.735  53.140 1.00 70.29  ? 22  DA  E "O5'" 1 
ATOM   1701 C  "C5'" . DA  C 1 22  ? 24.297 42.028  51.889 1.00 60.99  ? 22  DA  E "C5'" 1 
ATOM   1702 C  "C4'" . DA  C 1 22  ? 23.326 43.177  52.037 1.00 53.36  ? 22  DA  E "C4'" 1 
ATOM   1703 O  "O4'" . DA  C 1 22  ? 22.072 42.675  52.560 1.00 47.90  ? 22  DA  E "O4'" 1 
ATOM   1704 C  "C3'" . DA  C 1 22  ? 23.787 44.221  53.056 1.00 49.05  ? 22  DA  E "C3'" 1 
ATOM   1705 O  "O3'" . DA  C 1 22  ? 23.290 45.517  52.693 1.00 49.08  ? 22  DA  E "O3'" 1 
ATOM   1706 C  "C2'" . DA  C 1 22  ? 23.215 43.699  54.367 1.00 42.16  ? 22  DA  E "C2'" 1 
ATOM   1707 C  "C1'" . DA  C 1 22  ? 21.894 43.106  53.900 1.00 38.74  ? 22  DA  E "C1'" 1 
ATOM   1708 N  N9    . DA  C 1 22  ? 21.302 42.010  54.660 1.00 29.04  ? 22  DA  E N9    1 
ATOM   1709 C  C8    . DA  C 1 22  ? 21.885 41.086  55.482 1.00 24.56  ? 22  DA  E C8    1 
ATOM   1710 N  N7    . DA  C 1 22  ? 21.035 40.245  56.019 1.00 22.32  ? 22  DA  E N7    1 
ATOM   1711 C  C5    . DA  C 1 22  ? 19.808 40.643  55.512 1.00 19.37  ? 22  DA  E C5    1 
ATOM   1712 C  C6    . DA  C 1 22  ? 18.502 40.159  55.697 1.00 14.34  ? 22  DA  E C6    1 
ATOM   1713 N  N6    . DA  C 1 22  ? 18.197 39.126  56.474 1.00 13.29  ? 22  DA  E N6    1 
ATOM   1714 N  N1    . DA  C 1 22  ? 17.503 40.783  55.042 1.00 15.54  ? 22  DA  E N1    1 
ATOM   1715 C  C2    . DA  C 1 22  ? 17.803 41.825  54.256 1.00 19.90  ? 22  DA  E C2    1 
ATOM   1716 N  N3    . DA  C 1 22  ? 18.987 42.374  54.003 1.00 23.86  ? 22  DA  E N3    1 
ATOM   1717 C  C4    . DA  C 1 22  ? 19.959 41.727  54.671 1.00 25.02  ? 22  DA  E C4    1 
ATOM   1718 P  P     . DT  C 1 23  ? 23.645 46.798  53.600 1.00 51.08  ? 23  DT  E P     1 
ATOM   1719 O  OP1   . DT  C 1 23  ? 24.047 47.895  52.701 1.00 48.63  ? 23  DT  E OP1   1 
ATOM   1720 O  OP2   . DT  C 1 23  ? 24.542 46.412  54.707 1.00 51.21  ? 23  DT  E OP2   1 
ATOM   1721 O  "O5'" . DT  C 1 23  ? 22.245 47.184  54.239 1.00 45.40  ? 23  DT  E "O5'" 1 
ATOM   1722 C  "C5'" . DT  C 1 23  ? 21.235 46.192  54.432 1.00 39.25  ? 23  DT  E "C5'" 1 
ATOM   1723 C  "C4'" . DT  C 1 23  ? 19.904 46.714  53.945 1.00 37.54  ? 23  DT  E "C4'" 1 
ATOM   1724 O  "O4'" . DT  C 1 23  ? 18.926 45.677  54.155 1.00 33.33  ? 23  DT  E "O4'" 1 
ATOM   1725 C  "C3'" . DT  C 1 23  ? 19.394 47.908  54.742 1.00 37.02  ? 23  DT  E "C3'" 1 
ATOM   1726 O  "O3'" . DT  C 1 23  ? 18.540 48.753  53.976 1.00 37.09  ? 23  DT  E "O3'" 1 
ATOM   1727 C  "C2'" . DT  C 1 23  ? 18.652 47.262  55.889 1.00 32.38  ? 23  DT  E "C2'" 1 
ATOM   1728 C  "C1'" . DT  C 1 23  ? 18.082 46.011  55.245 1.00 28.16  ? 23  DT  E "C1'" 1 
ATOM   1729 N  N1    . DT  C 1 23  ? 18.097 44.866  56.165 1.00 23.17  ? 23  DT  E N1    1 
ATOM   1730 C  C2    . DT  C 1 23  ? 16.905 44.257  56.486 1.00 21.06  ? 23  DT  E C2    1 
ATOM   1731 O  O2    . DT  C 1 23  ? 15.829 44.620  56.034 1.00 21.72  ? 23  DT  E O2    1 
ATOM   1732 N  N3    . DT  C 1 23  ? 17.019 43.200  57.356 1.00 18.23  ? 23  DT  E N3    1 
ATOM   1733 C  C4    . DT  C 1 23  ? 18.178 42.701  57.920 1.00 19.66  ? 23  DT  E C4    1 
ATOM   1734 O  O4    . DT  C 1 23  ? 18.119 41.736  58.683 1.00 17.82  ? 23  DT  E O4    1 
ATOM   1735 C  C5    . DT  C 1 23  ? 19.399 43.395  57.533 1.00 22.35  ? 23  DT  E C5    1 
ATOM   1736 C  C7    . DT  C 1 23  ? 20.713 42.940  58.087 1.00 23.70  ? 23  DT  E C7    1 
ATOM   1737 C  C6    . DT  C 1 23  ? 19.294 44.424  56.689 1.00 21.51  ? 23  DT  E C6    1 
ATOM   1738 P  P     . DG  C 1 24  ? 18.047 50.145  54.609 1.00 41.81  ? 24  DG  E P     1 
ATOM   1739 O  OP1   . DG  C 1 24  ? 18.122 51.162  53.544 1.00 38.63  ? 24  DG  E OP1   1 
ATOM   1740 O  OP2   . DG  C 1 24  ? 18.768 50.383  55.876 1.00 37.74  ? 24  DG  E OP2   1 
ATOM   1741 O  "O5'" . DG  C 1 24  ? 16.520 49.872  54.966 1.00 36.33  ? 24  DG  E "O5'" 1 
ATOM   1742 C  "C5'" . DG  C 1 24  ? 15.549 49.726  53.924 1.00 28.61  ? 24  DG  E "C5'" 1 
ATOM   1743 C  "C4'" . DG  C 1 24  ? 14.176 49.485  54.507 1.00 22.74  ? 24  DG  E "C4'" 1 
ATOM   1744 O  "O4'" . DG  C 1 24  ? 14.258 48.335  55.385 1.00 16.35  ? 24  DG  E "O4'" 1 
ATOM   1745 C  "C3'" . DG  C 1 24  ? 13.682 50.630  55.400 1.00 22.32  ? 24  DG  E "C3'" 1 
ATOM   1746 O  "O3'" . DG  C 1 24  ? 12.239 50.664  55.413 1.00 25.63  ? 24  DG  E "O3'" 1 
ATOM   1747 C  "C2'" . DG  C 1 24  ? 14.243 50.257  56.761 1.00 18.66  ? 24  DG  E "C2'" 1 
ATOM   1748 C  "C1'" . DG  C 1 24  ? 14.136 48.744  56.735 1.00 11.37  ? 24  DG  E "C1'" 1 
ATOM   1749 N  N9    . DG  C 1 24  ? 15.080 47.977  57.539 1.00 8.25   ? 24  DG  E N9    1 
ATOM   1750 C  C8    . DG  C 1 24  ? 16.434 48.174  57.676 1.00 8.79   ? 24  DG  E C8    1 
ATOM   1751 N  N7    . DG  C 1 24  ? 17.000 47.310  58.483 1.00 8.41   ? 24  DG  E N7    1 
ATOM   1752 C  C5    . DG  C 1 24  ? 15.956 46.494  58.900 1.00 6.25   ? 24  DG  E C5    1 
ATOM   1753 C  C6    . DG  C 1 24  ? 15.952 45.375  59.778 1.00 6.30   ? 24  DG  E C6    1 
ATOM   1754 O  O6    . DG  C 1 24  ? 16.904 44.868  60.390 1.00 6.07   ? 24  DG  E O6    1 
ATOM   1755 N  N1    . DG  C 1 24  ? 14.673 44.839  59.919 1.00 6.72   ? 24  DG  E N1    1 
ATOM   1756 C  C2    . DG  C 1 24  ? 13.541 45.319  59.299 1.00 8.79   ? 24  DG  E C2    1 
ATOM   1757 N  N2    . DG  C 1 24  ? 12.394 44.672  59.557 1.00 10.78  ? 24  DG  E N2    1 
ATOM   1758 N  N3    . DG  C 1 24  ? 13.533 46.359  58.481 1.00 7.26   ? 24  DG  E N3    1 
ATOM   1759 C  C4    . DG  C 1 24  ? 14.764 46.893  58.327 1.00 7.51   ? 24  DG  E C4    1 
ATOM   1760 P  P     . DG  C 1 25  ? 11.451 51.927  56.045 1.00 26.61  ? 25  DG  E P     1 
ATOM   1761 O  OP1   . DG  C 1 25  ? 10.542 52.455  55.003 1.00 27.56  ? 25  DG  E OP1   1 
ATOM   1762 O  OP2   . DG  C 1 25  ? 12.409 52.847  56.718 1.00 28.32  ? 25  DG  E OP2   1 
ATOM   1763 O  "O5'" . DG  C 1 25  ? 10.559 51.274  57.184 1.00 24.02  ? 25  DG  E "O5'" 1 
ATOM   1764 C  "C5'" . DG  C 1 25  ? 11.116 50.275  58.035 1.00 29.80  ? 25  DG  E "C5'" 1 
ATOM   1765 C  "C4'" . DG  C 1 25  ? 10.328 50.169  59.318 1.00 36.55  ? 25  DG  E "C4'" 1 
ATOM   1766 O  "O4'" . DG  C 1 25  ? 11.002 49.197  60.159 1.00 40.26  ? 25  DG  E "O4'" 1 
ATOM   1767 C  "C3'" . DG  C 1 25  ? 10.315 51.465  60.129 1.00 39.31  ? 25  DG  E "C3'" 1 
ATOM   1768 O  "O3'" . DG  C 1 25  ? 9.125  51.541  60.946 1.00 40.68  ? 25  DG  E "O3'" 1 
ATOM   1769 C  "C2'" . DG  C 1 25  ? 11.582 51.344  60.957 1.00 41.46  ? 25  DG  E "C2'" 1 
ATOM   1770 C  "C1'" . DG  C 1 25  ? 11.657 49.849  61.238 1.00 41.12  ? 25  DG  E "C1'" 1 
ATOM   1771 N  N9    . DG  C 1 25  ? 13.009 49.295  61.359 1.00 42.50  ? 25  DG  E N9    1 
ATOM   1772 C  C8    . DG  C 1 25  ? 14.178 49.807  60.839 1.00 41.75  ? 25  DG  E C8    1 
ATOM   1773 N  N7    . DG  C 1 25  ? 15.228 49.092  61.138 1.00 40.93  ? 25  DG  E N7    1 
ATOM   1774 C  C5    . DG  C 1 25  ? 14.724 48.043  61.896 1.00 40.97  ? 25  DG  E C5    1 
ATOM   1775 C  C6    . DG  C 1 25  ? 15.388 46.946  62.502 1.00 40.52  ? 25  DG  E C6    1 
ATOM   1776 O  O6    . DG  C 1 25  ? 16.594 46.671  62.485 1.00 43.23  ? 25  DG  E O6    1 
ATOM   1777 N  N1    . DG  C 1 25  ? 14.499 46.120  63.178 1.00 38.04  ? 25  DG  E N1    1 
ATOM   1778 C  C2    . DG  C 1 25  ? 13.142 46.320  63.259 1.00 38.28  ? 25  DG  E C2    1 
ATOM   1779 N  N2    . DG  C 1 25  ? 12.442 45.412  63.956 1.00 40.61  ? 25  DG  E N2    1 
ATOM   1780 N  N3    . DG  C 1 25  ? 12.511 47.335  62.699 1.00 38.86  ? 25  DG  E N3    1 
ATOM   1781 C  C4    . DG  C 1 25  ? 13.358 48.150  62.039 1.00 40.86  ? 25  DG  E C4    1 
ATOM   1782 P  P     . DG  C 1 26  ? 8.663  52.954  61.591 1.00 40.79  ? 26  DG  E P     1 
ATOM   1783 O  OP1   . DG  C 1 26  ? 7.179  52.987  61.603 1.00 40.23  ? 26  DG  E OP1   1 
ATOM   1784 O  OP2   . DG  C 1 26  ? 9.420  54.073  60.950 1.00 38.59  ? 26  DG  E OP2   1 
ATOM   1785 O  "O5'" . DG  C 1 26  ? 9.140  52.850  63.104 1.00 37.22  ? 26  DG  E "O5'" 1 
ATOM   1786 C  "C5'" . DG  C 1 26  ? 10.230 51.997  63.455 1.00 36.09  ? 26  DG  E "C5'" 1 
ATOM   1787 C  "C4'" . DG  C 1 26  ? 9.715  50.771  64.165 1.00 36.80  ? 26  DG  E "C4'" 1 
ATOM   1788 O  "O4'" . DG  C 1 26  ? 10.745 49.756  64.140 1.00 36.20  ? 26  DG  E "O4'" 1 
ATOM   1789 C  "C3'" . DG  C 1 26  ? 9.452  51.044  65.641 1.00 38.40  ? 26  DG  E "C3'" 1 
ATOM   1790 O  "O3'" . DG  C 1 26  ? 8.439  50.171  66.145 1.00 38.85  ? 26  DG  E "O3'" 1 
ATOM   1791 C  "C2'" . DG  C 1 26  ? 10.801 50.767  66.277 1.00 36.28  ? 26  DG  E "C2'" 1 
ATOM   1792 C  "C1'" . DG  C 1 26  ? 11.322 49.611  65.432 1.00 35.58  ? 26  DG  E "C1'" 1 
ATOM   1793 N  N9    . DG  C 1 26  ? 12.775 49.566  65.279 1.00 35.72  ? 26  DG  E N9    1 
ATOM   1794 C  C8    . DG  C 1 26  ? 13.595 50.509  64.696 1.00 34.07  ? 26  DG  E C8    1 
ATOM   1795 N  N7    . DG  C 1 26  ? 14.858 50.174  64.716 1.00 31.80  ? 26  DG  E N7    1 
ATOM   1796 C  C5    . DG  C 1 26  ? 14.875 48.939  65.351 1.00 33.75  ? 26  DG  E C5    1 
ATOM   1797 C  C6    . DG  C 1 26  ? 15.962 48.082  65.665 1.00 36.83  ? 26  DG  E C6    1 
ATOM   1798 O  O6    . DG  C 1 26  ? 17.163 48.248  65.441 1.00 37.74  ? 26  DG  E O6    1 
ATOM   1799 N  N1    . DG  C 1 26  ? 15.533 46.924  66.310 1.00 41.89  ? 26  DG  E N1    1 
ATOM   1800 C  C2    . DG  C 1 26  ? 14.221 46.630  66.615 1.00 42.83  ? 26  DG  E C2    1 
ATOM   1801 N  N2    . DG  C 1 26  ? 13.999 45.459  67.240 1.00 44.84  ? 26  DG  E N2    1 
ATOM   1802 N  N3    . DG  C 1 26  ? 13.200 47.424  66.330 1.00 38.43  ? 26  DG  E N3    1 
ATOM   1803 C  C4    . DG  C 1 26  ? 13.598 48.551  65.703 1.00 35.26  ? 26  DG  E C4    1 
ATOM   1804 P  P     . DA  C 1 27  ? 7.723  50.507  67.544 1.00 37.83  ? 27  DA  E P     1 
ATOM   1805 O  OP1   . DA  C 1 27  ? 6.476  51.233  67.255 1.00 33.91  ? 27  DA  E OP1   1 
ATOM   1806 O  OP2   . DA  C 1 27  ? 8.707  51.122  68.441 1.00 36.94  ? 27  DA  E OP2   1 
ATOM   1807 O  "O5'" . DA  C 1 27  ? 7.359  49.068  68.121 1.00 39.28  ? 27  DA  E "O5'" 1 
ATOM   1808 C  "C5'" . DA  C 1 27  ? 7.342  48.830  69.534 1.00 42.61  ? 27  DA  E "C5'" 1 
ATOM   1809 C  "C4'" . DA  C 1 27  ? 7.801  47.423  69.835 1.00 45.64  ? 27  DA  E "C4'" 1 
ATOM   1810 O  "O4'" . DA  C 1 27  ? 9.081  47.197  69.191 1.00 45.83  ? 27  DA  E "O4'" 1 
ATOM   1811 C  "C3'" . DA  C 1 27  ? 8.065  47.196  71.318 1.00 48.45  ? 27  DA  E "C3'" 1 
ATOM   1812 O  "O3'" . DA  C 1 27  ? 7.821  45.828  71.651 1.00 52.09  ? 27  DA  E "O3'" 1 
ATOM   1813 C  "C2'" . DA  C 1 27  ? 9.520  47.613  71.476 1.00 47.13  ? 27  DA  E "C2'" 1 
ATOM   1814 C  "C1'" . DA  C 1 27  ? 10.144 47.174  70.151 1.00 43.72  ? 27  DA  E "C1'" 1 
ATOM   1815 N  N9    . DA  C 1 27  ? 11.206 48.041  69.641 1.00 39.12  ? 27  DA  E N9    1 
ATOM   1816 C  C8    . DA  C 1 27  ? 11.049 49.229  68.970 1.00 37.62  ? 27  DA  E C8    1 
ATOM   1817 N  N7    . DA  C 1 27  ? 12.178 49.793  68.621 1.00 36.08  ? 27  DA  E N7    1 
ATOM   1818 C  C5    . DA  C 1 27  ? 13.146 48.920  69.093 1.00 32.91  ? 27  DA  E C5    1 
ATOM   1819 C  C6    . DA  C 1 27  ? 14.543 48.952  69.039 1.00 29.95  ? 27  DA  E C6    1 
ATOM   1820 N  N6    . DA  C 1 27  ? 15.234 49.934  68.465 1.00 29.11  ? 27  DA  E N6    1 
ATOM   1821 N  N1    . DA  C 1 27  ? 15.217 47.929  69.604 1.00 31.07  ? 27  DA  E N1    1 
ATOM   1822 C  C2    . DA  C 1 27  ? 14.515 46.944  70.183 1.00 34.00  ? 27  DA  E C2    1 
ATOM   1823 N  N3    . DA  C 1 27  ? 13.197 46.803  70.298 1.00 35.34  ? 27  DA  E N3    1 
ATOM   1824 C  C4    . DA  C 1 27  ? 12.562 47.836  69.724 1.00 35.40  ? 27  DA  E C4    1 
ATOM   1825 P  P     . DG  C 1 28  ? 7.707  45.392  73.191 1.00 55.48  ? 28  DG  E P     1 
ATOM   1826 O  OP1   . DG  C 1 28  ? 6.589  44.450  73.298 1.00 55.10  ? 28  DG  E OP1   1 
ATOM   1827 O  OP2   . DG  C 1 28  ? 7.708  46.587  74.033 1.00 56.42  ? 28  DG  E OP2   1 
ATOM   1828 O  "O5'" . DG  C 1 28  ? 9.072  44.620  73.451 1.00 56.09  ? 28  DG  E "O5'" 1 
ATOM   1829 C  "C5'" . DG  C 1 28  ? 10.303 45.151  72.948 1.00 58.49  ? 28  DG  E "C5'" 1 
ATOM   1830 C  "C4'" . DG  C 1 28  ? 11.437 44.817  73.883 1.00 62.17  ? 28  DG  E "C4'" 1 
ATOM   1831 O  "O4'" . DG  C 1 28  ? 12.614 45.534  73.444 1.00 62.76  ? 28  DG  E "O4'" 1 
ATOM   1832 C  "C3'" . DG  C 1 28  ? 11.189 45.305  75.306 1.00 63.82  ? 28  DG  E "C3'" 1 
ATOM   1833 O  "O3'" . DG  C 1 28  ? 11.974 44.491  76.183 1.00 69.42  ? 28  DG  E "O3'" 1 
ATOM   1834 C  "C2'" . DG  C 1 28  ? 11.714 46.730  75.272 1.00 60.28  ? 28  DG  E "C2'" 1 
ATOM   1835 C  "C1'" . DG  C 1 28  ? 12.908 46.595  74.342 1.00 58.21  ? 28  DG  E "C1'" 1 
ATOM   1836 N  N9    . DG  C 1 28  ? 13.275 47.766  73.552 1.00 53.64  ? 28  DG  E N9    1 
ATOM   1837 C  C8    . DG  C 1 28  ? 12.444 48.569  72.813 1.00 51.05  ? 28  DG  E C8    1 
ATOM   1838 N  N7    . DG  C 1 28  ? 13.077 49.539  72.208 1.00 50.82  ? 28  DG  E N7    1 
ATOM   1839 C  C5    . DG  C 1 28  ? 14.406 49.366  72.572 1.00 50.35  ? 28  DG  E C5    1 
ATOM   1840 C  C6    . DG  C 1 28  ? 15.564 50.114  72.223 1.00 49.66  ? 28  DG  E C6    1 
ATOM   1841 O  O6    . DG  C 1 28  ? 15.648 51.111  71.502 1.00 52.59  ? 28  DG  E O6    1 
ATOM   1842 N  N1    . DG  C 1 28  ? 16.708 49.592  72.810 1.00 48.04  ? 28  DG  E N1    1 
ATOM   1843 C  C2    . DG  C 1 28  ? 16.739 48.492  73.628 1.00 49.33  ? 28  DG  E C2    1 
ATOM   1844 N  N2    . DG  C 1 28  ? 17.940 48.138  74.103 1.00 49.73  ? 28  DG  E N2    1 
ATOM   1845 N  N3    . DG  C 1 28  ? 15.671 47.786  73.960 1.00 50.31  ? 28  DG  E N3    1 
ATOM   1846 C  C4    . DG  C 1 28  ? 14.546 48.277  73.400 1.00 51.41  ? 28  DG  E C4    1 
ATOM   1847 P  P     . DA  C 1 29  ? 11.618 44.399  77.748 1.00 73.24  ? 29  DA  E P     1 
ATOM   1848 O  OP1   . DA  C 1 29  ? 10.791 43.182  77.977 1.00 74.35  ? 29  DA  E OP1   1 
ATOM   1849 O  OP2   . DA  C 1 29  ? 11.123 45.724  78.207 1.00 73.82  ? 29  DA  E OP2   1 
ATOM   1850 O  "O5'" . DA  C 1 29  ? 13.041 44.151  78.410 1.00 71.44  ? 29  DA  E "O5'" 1 
ATOM   1851 C  "C5'" . DA  C 1 29  ? 14.002 43.285  77.777 1.00 70.88  ? 29  DA  E "C5'" 1 
ATOM   1852 C  "C4'" . DA  C 1 29  ? 15.405 43.662  78.194 1.00 70.81  ? 29  DA  E "C4'" 1 
ATOM   1853 O  "O4'" . DA  C 1 29  ? 15.785 44.904  77.543 1.00 67.99  ? 29  DA  E "O4'" 1 
ATOM   1854 C  "C3'" . DA  C 1 29  ? 15.480 43.960  79.689 1.00 72.46  ? 29  DA  E "C3'" 1 
ATOM   1855 O  "O3'" . DA  C 1 29  ? 16.773 43.631  80.209 1.00 77.18  ? 29  DA  E "O3'" 1 
ATOM   1856 C  "C2'" . DA  C 1 29  ? 15.159 45.444  79.758 1.00 69.02  ? 29  DA  E "C2'" 1 
ATOM   1857 C  "C1'" . DA  C 1 29  ? 15.817 45.972  78.487 1.00 65.88  ? 29  DA  E "C1'" 1 
ATOM   1858 N  N9    . DA  C 1 29  ? 15.190 47.145  77.875 1.00 61.15  ? 29  DA  E N9    1 
ATOM   1859 C  C8    . DA  C 1 29  ? 13.862 47.364  77.591 1.00 58.90  ? 29  DA  E C8    1 
ATOM   1860 N  N7    . DA  C 1 29  ? 13.627 48.530  77.035 1.00 55.94  ? 29  DA  E N7    1 
ATOM   1861 C  C5    . DA  C 1 29  ? 14.882 49.118  76.947 1.00 55.04  ? 29  DA  E C5    1 
ATOM   1862 C  C6    . DA  C 1 29  ? 15.316 50.362  76.448 1.00 53.59  ? 29  DA  E C6    1 
ATOM   1863 N  N6    . DA  C 1 29  ? 14.498 51.274  75.923 1.00 54.33  ? 29  DA  E N6    1 
ATOM   1864 N  N1    . DA  C 1 29  ? 16.639 50.641  76.509 1.00 53.11  ? 29  DA  E N1    1 
ATOM   1865 C  C2    . DA  C 1 29  ? 17.459 49.723  77.039 1.00 53.84  ? 29  DA  E C2    1 
ATOM   1866 N  N3    . DA  C 1 29  ? 17.173 48.523  77.540 1.00 56.06  ? 29  DA  E N3    1 
ATOM   1867 C  C4    . DA  C 1 29  ? 15.852 48.278  77.462 1.00 57.42  ? 29  DA  E C4    1 
ATOM   1868 P  P     . DC  C 1 30  ? 16.959 43.382  81.789 1.00 79.31  ? 30  DC  E P     1 
ATOM   1869 O  OP1   . DC  C 1 30  ? 17.962 42.314  81.946 1.00 78.58  ? 30  DC  E OP1   1 
ATOM   1870 O  OP2   . DC  C 1 30  ? 15.639 43.216  82.420 1.00 78.47  ? 30  DC  E OP2   1 
ATOM   1871 O  "O5'" . DC  C 1 30  ? 17.580 44.754  82.305 1.00 74.40  ? 30  DC  E "O5'" 1 
ATOM   1872 C  "C5'" . DC  C 1 30  ? 17.320 45.971  81.599 1.00 70.31  ? 30  DC  E "C5'" 1 
ATOM   1873 C  "C4'" . DC  C 1 30  ? 18.446 46.948  81.810 1.00 69.50  ? 30  DC  E "C4'" 1 
ATOM   1874 O  "O4'" . DC  C 1 30  ? 18.225 48.076  80.923 1.00 67.76  ? 30  DC  E "O4'" 1 
ATOM   1875 C  "C3'" . DC  C 1 30  ? 18.445 47.532  83.220 1.00 70.14  ? 30  DC  E "C3'" 1 
ATOM   1876 O  "O3'" . DC  C 1 30  ? 19.778 47.838  83.646 1.00 68.75  ? 30  DC  E "O3'" 1 
ATOM   1877 C  "C2'" . DC  C 1 30  ? 17.526 48.737  83.089 1.00 69.64  ? 30  DC  E "C2'" 1 
ATOM   1878 C  "C1'" . DC  C 1 30  ? 17.802 49.220  81.664 1.00 65.60  ? 30  DC  E "C1'" 1 
ATOM   1879 N  N1    . DC  C 1 30  ? 16.645 49.820  80.961 1.00 59.76  ? 30  DC  E N1    1 
ATOM   1880 C  C2    . DC  C 1 30  ? 16.852 50.961  80.178 1.00 58.92  ? 30  DC  E C2    1 
ATOM   1881 O  O2    . DC  C 1 30  ? 17.993 51.432  80.092 1.00 61.32  ? 30  DC  E O2    1 
ATOM   1882 N  N3    . DC  C 1 30  ? 15.806 51.522  79.535 1.00 56.94  ? 30  DC  E N3    1 
ATOM   1883 C  C4    . DC  C 1 30  ? 14.589 50.989  79.648 1.00 56.81  ? 30  DC  E C4    1 
ATOM   1884 N  N4    . DC  C 1 30  ? 13.588 51.582  78.991 1.00 57.70  ? 30  DC  E N4    1 
ATOM   1885 C  C5    . DC  C 1 30  ? 14.346 49.830  80.437 1.00 55.89  ? 30  DC  E C5    1 
ATOM   1886 C  C6    . DC  C 1 30  ? 15.391 49.282  81.068 1.00 56.62  ? 30  DC  E C6    1 
ATOM   1887 P  P     . DC  C 1 31  ? 20.039 48.434  85.118 1.00 65.77  ? 31  DC  E P     1 
ATOM   1888 O  OP1   . DC  C 1 31  ? 20.997 47.533  85.776 1.00 62.73  ? 31  DC  E OP1   1 
ATOM   1889 O  OP2   . DC  C 1 31  ? 18.764 48.721  85.788 1.00 66.66  ? 31  DC  E OP2   1 
ATOM   1890 O  "O5'" . DC  C 1 31  ? 20.719 49.838  84.794 1.00 65.59  ? 31  DC  E "O5'" 1 
ATOM   1891 C  "C5'" . DC  C 1 31  ? 20.230 50.627  83.696 1.00 66.32  ? 31  DC  E "C5'" 1 
ATOM   1892 C  "C4'" . DC  C 1 31  ? 20.642 52.074  83.836 1.00 69.79  ? 31  DC  E "C4'" 1 
ATOM   1893 O  "O4'" . DC  C 1 31  ? 19.707 52.845  83.044 1.00 70.27  ? 31  DC  E "O4'" 1 
ATOM   1894 C  "C3'" . DC  C 1 31  ? 20.555 52.665  85.243 1.00 70.65  ? 31  DC  E "C3'" 1 
ATOM   1895 O  "O3'" . DC  C 1 31  ? 21.371 53.843  85.330 1.00 71.37  ? 31  DC  E "O3'" 1 
ATOM   1896 C  "C2'" . DC  C 1 31  ? 19.107 53.111  85.324 1.00 70.91  ? 31  DC  E "C2'" 1 
ATOM   1897 C  "C1'" . DC  C 1 31  ? 18.796 53.547  83.889 1.00 68.88  ? 31  DC  E "C1'" 1 
ATOM   1898 N  N1    . DC  C 1 31  ? 17.424 53.227  83.433 1.00 65.21  ? 31  DC  E N1    1 
ATOM   1899 C  C2    . DC  C 1 31  ? 16.812 54.059  82.489 1.00 62.86  ? 31  DC  E C2    1 
ATOM   1900 O  O2    . DC  C 1 31  ? 17.437 55.041  82.054 1.00 62.02  ? 31  DC  E O2    1 
ATOM   1901 N  N3    . DC  C 1 31  ? 15.553 53.770  82.071 1.00 61.85  ? 31  DC  E N3    1 
ATOM   1902 C  C4    . DC  C 1 31  ? 14.915 52.703  82.559 1.00 61.63  ? 31  DC  E C4    1 
ATOM   1903 N  N4    . DC  C 1 31  ? 13.679 52.459  82.119 1.00 61.64  ? 31  DC  E N4    1 
ATOM   1904 C  C5    . DC  C 1 31  ? 15.515 51.839  83.518 1.00 62.97  ? 31  DC  E C5    1 
ATOM   1905 C  C6    . DC  C 1 31  ? 16.756 52.134  83.923 1.00 64.70  ? 31  DC  E C6    1 
ATOM   1906 O  "O5'" . DT  D 2 1   ? 6.121  56.526  79.275 1.00 91.29  ? 33  DT  F "O5'" 1 
ATOM   1907 C  "C5'" . DT  D 2 1   ? 5.246  57.613  79.615 1.00 92.08  ? 33  DT  F "C5'" 1 
ATOM   1908 C  "C4'" . DT  D 2 1   ? 5.947  58.949  79.722 1.00 91.26  ? 33  DT  F "C4'" 1 
ATOM   1909 O  "O4'" . DT  D 2 1   ? 6.810  58.971  80.887 1.00 91.53  ? 33  DT  F "O4'" 1 
ATOM   1910 C  "C3'" . DT  D 2 1   ? 6.841  59.300  78.531 1.00 88.93  ? 33  DT  F "C3'" 1 
ATOM   1911 O  "O3'" . DT  D 2 1   ? 6.782  60.704  78.256 1.00 86.69  ? 33  DT  F "O3'" 1 
ATOM   1912 C  "C2'" . DT  D 2 1   ? 8.227  58.915  79.012 1.00 89.09  ? 33  DT  F "C2'" 1 
ATOM   1913 C  "C1'" . DT  D 2 1   ? 8.156  59.231  80.495 1.00 89.28  ? 33  DT  F "C1'" 1 
ATOM   1914 N  N1    . DT  D 2 1   ? 9.049  58.387  81.321 1.00 87.81  ? 33  DT  F N1    1 
ATOM   1915 C  C2    . DT  D 2 1   ? 10.343 58.821  81.546 1.00 85.80  ? 33  DT  F C2    1 
ATOM   1916 O  O2    . DT  D 2 1   ? 10.788 59.871  81.100 1.00 83.19  ? 33  DT  F O2    1 
ATOM   1917 N  N3    . DT  D 2 1   ? 11.103 57.972  82.316 1.00 86.28  ? 33  DT  F N3    1 
ATOM   1918 C  C4    . DT  D 2 1   ? 10.715 56.761  82.867 1.00 87.55  ? 33  DT  F C4    1 
ATOM   1919 O  O4    . DT  D 2 1   ? 11.518 56.105  83.534 1.00 87.34  ? 33  DT  F O4    1 
ATOM   1920 C  C5    . DT  D 2 1   ? 9.345  56.371  82.591 1.00 88.07  ? 33  DT  F C5    1 
ATOM   1921 C  C7    . DT  D 2 1   ? 8.826  55.079  83.145 1.00 88.25  ? 33  DT  F C7    1 
ATOM   1922 C  C6    . DT  D 2 1   ? 8.595  57.192  81.846 1.00 87.87  ? 33  DT  F C6    1 
ATOM   1923 P  P     . DG  D 2 2   ? 7.485  61.284  76.933 1.00 85.42  ? 34  DG  F P     1 
ATOM   1924 O  OP1   . DG  D 2 2   ? 7.323  62.761  76.898 1.00 84.36  ? 34  DG  F OP1   1 
ATOM   1925 O  OP2   . DG  D 2 2   ? 7.016  60.463  75.782 1.00 85.63  ? 34  DG  F OP2   1 
ATOM   1926 O  "O5'" . DG  D 2 2   ? 9.025  60.972  77.176 1.00 81.16  ? 34  DG  F "O5'" 1 
ATOM   1927 C  "C5'" . DG  D 2 2   ? 9.907  60.748  76.077 1.00 75.79  ? 34  DG  F "C5'" 1 
ATOM   1928 C  "C4'" . DG  D 2 2   ? 11.304 61.180  76.449 1.00 72.62  ? 34  DG  F "C4'" 1 
ATOM   1929 O  "O4'" . DG  D 2 2   ? 11.742 60.382  77.577 1.00 69.32  ? 34  DG  F "O4'" 1 
ATOM   1930 C  "C3'" . DG  D 2 2   ? 12.319 60.892  75.349 1.00 72.69  ? 34  DG  F "C3'" 1 
ATOM   1931 O  "O3'" . DG  D 2 2   ? 13.381 61.847  75.375 1.00 76.16  ? 34  DG  F "O3'" 1 
ATOM   1932 C  "C2'" . DG  D 2 2   ? 12.770 59.475  75.651 1.00 68.60  ? 34  DG  F "C2'" 1 
ATOM   1933 C  "C1'" . DG  D 2 2   ? 12.728 59.431  77.169 1.00 64.16  ? 34  DG  F "C1'" 1 
ATOM   1934 N  N9    . DG  D 2 2   ? 12.368 58.133  77.737 1.00 58.17  ? 34  DG  F N9    1 
ATOM   1935 C  C8    . DG  D 2 2   ? 11.185 57.442  77.576 1.00 56.33  ? 34  DG  F C8    1 
ATOM   1936 N  N7    . DG  D 2 2   ? 11.163 56.304  78.217 1.00 54.17  ? 34  DG  F N7    1 
ATOM   1937 C  C5    . DG  D 2 2   ? 12.404 56.237  78.838 1.00 53.87  ? 34  DG  F C5    1 
ATOM   1938 C  C6    . DG  D 2 2   ? 12.958 55.238  79.673 1.00 51.82  ? 34  DG  F C6    1 
ATOM   1939 O  O6    . DG  D 2 2   ? 12.447 54.174  80.043 1.00 50.42  ? 34  DG  F O6    1 
ATOM   1940 N  N1    . DG  D 2 2   ? 14.245 55.573  80.087 1.00 52.30  ? 34  DG  F N1    1 
ATOM   1941 C  C2    . DG  D 2 2   ? 14.914 56.726  79.739 1.00 53.26  ? 34  DG  F C2    1 
ATOM   1942 N  N2    . DG  D 2 2   ? 16.155 56.876  80.235 1.00 53.36  ? 34  DG  F N2    1 
ATOM   1943 N  N3    . DG  D 2 2   ? 14.407 57.664  78.961 1.00 53.65  ? 34  DG  F N3    1 
ATOM   1944 C  C4    . DG  D 2 2   ? 13.159 57.358  78.550 1.00 55.22  ? 34  DG  F C4    1 
ATOM   1945 P  P     . DG  D 2 3   ? 14.416 61.921  74.146 1.00 78.16  ? 35  DG  F P     1 
ATOM   1946 O  OP1   . DG  D 2 3   ? 14.666 63.339  73.823 1.00 77.96  ? 35  DG  F OP1   1 
ATOM   1947 O  OP2   . DG  D 2 3   ? 13.979 61.013  73.070 1.00 77.78  ? 35  DG  F OP2   1 
ATOM   1948 O  "O5'" . DG  D 2 3   ? 15.736 61.313  74.778 1.00 72.29  ? 35  DG  F "O5'" 1 
ATOM   1949 C  "C5'" . DG  D 2 3   ? 16.714 60.705  73.955 1.00 67.91  ? 35  DG  F "C5'" 1 
ATOM   1950 C  "C4'" . DG  D 2 3   ? 17.939 60.404  74.776 1.00 64.96  ? 35  DG  F "C4'" 1 
ATOM   1951 O  "O4'" . DG  D 2 3   ? 17.561 59.543  75.877 1.00 61.82  ? 35  DG  F "O4'" 1 
ATOM   1952 C  "C3'" . DG  D 2 3   ? 18.985 59.619  74.007 1.00 66.52  ? 35  DG  F "C3'" 1 
ATOM   1953 O  "O3'" . DG  D 2 3   ? 20.273 59.965  74.507 1.00 71.84  ? 35  DG  F "O3'" 1 
ATOM   1954 C  "C2'" . DG  D 2 3   ? 18.577 58.174  74.246 1.00 61.53  ? 35  DG  F "C2'" 1 
ATOM   1955 C  "C1'" . DG  D 2 3   ? 18.024 58.207  75.664 1.00 57.23  ? 35  DG  F "C1'" 1 
ATOM   1956 N  N9    . DG  D 2 3   ? 16.893 57.313  75.880 1.00 51.81  ? 35  DG  F N9    1 
ATOM   1957 C  C8    . DG  D 2 3   ? 15.607 57.503  75.436 1.00 51.68  ? 35  DG  F C8    1 
ATOM   1958 N  N7    . DG  D 2 3   ? 14.797 56.544  75.783 1.00 48.87  ? 35  DG  F N7    1 
ATOM   1959 C  C5    . DG  D 2 3   ? 15.590 55.662  76.498 1.00 47.90  ? 35  DG  F C5    1 
ATOM   1960 C  C6    . DG  D 2 3   ? 15.257 54.429  77.127 1.00 48.65  ? 35  DG  F C6    1 
ATOM   1961 O  O6    . DG  D 2 3   ? 14.151 53.855  77.176 1.00 48.00  ? 35  DG  F O6    1 
ATOM   1962 N  N1    . DG  D 2 3   ? 16.366 53.857  77.746 1.00 49.32  ? 35  DG  F N1    1 
ATOM   1963 C  C2    . DG  D 2 3   ? 17.632 54.402  77.758 1.00 50.40  ? 35  DG  F C2    1 
ATOM   1964 N  N2    . DG  D 2 3   ? 18.575 53.702  78.411 1.00 49.52  ? 35  DG  F N2    1 
ATOM   1965 N  N3    . DG  D 2 3   ? 17.952 55.552  77.172 1.00 50.51  ? 35  DG  F N3    1 
ATOM   1966 C  C4    . DG  D 2 3   ? 16.890 56.121  76.567 1.00 49.10  ? 35  DG  F C4    1 
ATOM   1967 P  P     . DT  D 2 4   ? 21.581 59.650  73.635 1.00 75.55  ? 36  DT  F P     1 
ATOM   1968 O  OP1   . DT  D 2 4   ? 22.467 60.838  73.693 1.00 78.00  ? 36  DT  F OP1   1 
ATOM   1969 O  OP2   . DT  D 2 4   ? 21.167 59.107  72.310 1.00 76.59  ? 36  DT  F OP2   1 
ATOM   1970 O  "O5'" . DT  D 2 4   ? 22.257 58.481  74.473 1.00 76.44  ? 36  DT  F "O5'" 1 
ATOM   1971 C  "C5'" . DT  D 2 4   ? 21.448 57.452  75.080 1.00 76.12  ? 36  DT  F "C5'" 1 
ATOM   1972 C  "C4'" . DT  D 2 4   ? 22.274 56.206  75.277 1.00 75.56  ? 36  DT  F "C4'" 1 
ATOM   1973 O  "O4'" . DT  D 2 4   ? 21.382 55.133  75.682 1.00 73.38  ? 36  DT  F "O4'" 1 
ATOM   1974 C  "C3'" . DT  D 2 4   ? 22.883 55.741  73.958 1.00 75.38  ? 36  DT  F "C3'" 1 
ATOM   1975 O  "O3'" . DT  D 2 4   ? 24.163 55.135  74.142 1.00 77.72  ? 36  DT  F "O3'" 1 
ATOM   1976 C  "C2'" . DT  D 2 4   ? 21.814 54.836  73.379 1.00 73.11  ? 36  DT  F "C2'" 1 
ATOM   1977 C  "C1'" . DT  D 2 4   ? 21.198 54.196  74.620 1.00 70.46  ? 36  DT  F "C1'" 1 
ATOM   1978 N  N1    . DT  D 2 4   ? 19.748 53.936  74.480 1.00 66.39  ? 36  DT  F N1    1 
ATOM   1979 C  C2    . DT  D 2 4   ? 19.222 52.772  75.016 1.00 65.95  ? 36  DT  F C2    1 
ATOM   1980 O  O2    . DT  D 2 4   ? 19.893 51.939  75.613 1.00 66.02  ? 36  DT  F O2    1 
ATOM   1981 N  N3    . DT  D 2 4   ? 17.869 52.616  74.824 1.00 64.70  ? 36  DT  F N3    1 
ATOM   1982 C  C4    . DT  D 2 4   ? 17.013 53.481  74.169 1.00 64.49  ? 36  DT  F C4    1 
ATOM   1983 O  O4    . DT  D 2 4   ? 15.818 53.204  74.076 1.00 62.85  ? 36  DT  F O4    1 
ATOM   1984 C  C5    . DT  D 2 4   ? 17.633 54.678  73.636 1.00 65.35  ? 36  DT  F C5    1 
ATOM   1985 C  C7    . DT  D 2 4   ? 16.786 55.675  72.910 1.00 66.05  ? 36  DT  F C7    1 
ATOM   1986 C  C6    . DT  D 2 4   ? 18.947 54.842  73.818 1.00 64.61  ? 36  DT  F C6    1 
ATOM   1987 P  P     . DC  D 2 5   ? 24.993 54.604  72.867 1.00 80.26  ? 37  DC  F P     1 
ATOM   1988 O  OP1   . DC  D 2 5   ? 26.411 55.032  73.029 1.00 80.63  ? 37  DC  F OP1   1 
ATOM   1989 O  OP2   . DC  D 2 5   ? 24.264 54.952  71.619 1.00 81.81  ? 37  DC  F OP2   1 
ATOM   1990 O  "O5'" . DC  D 2 5   ? 24.907 53.031  73.067 1.00 72.65  ? 37  DC  F "O5'" 1 
ATOM   1991 C  "C5'" . DC  D 2 5   ? 25.050 52.487  74.385 1.00 69.53  ? 37  DC  F "C5'" 1 
ATOM   1992 C  "C4'" . DC  D 2 5   ? 24.618 51.042  74.425 1.00 67.53  ? 37  DC  F "C4'" 1 
ATOM   1993 O  "O4'" . DC  D 2 5   ? 23.181 50.964  74.248 1.00 63.71  ? 37  DC  F "O4'" 1 
ATOM   1994 C  "C3'" . DC  D 2 5   ? 25.210 50.262  73.250 1.00 68.12  ? 37  DC  F "C3'" 1 
ATOM   1995 O  "O3'" . DC  D 2 5   ? 25.382 48.888  73.626 1.00 72.90  ? 37  DC  F "O3'" 1 
ATOM   1996 C  "C2'" . DC  D 2 5   ? 24.171 50.450  72.156 1.00 63.49  ? 37  DC  F "C2'" 1 
ATOM   1997 C  "C1'" . DC  D 2 5   ? 22.887 50.414  72.972 1.00 59.21  ? 37  DC  F "C1'" 1 
ATOM   1998 N  N1    . DC  D 2 5   ? 21.653 51.036  72.441 1.00 51.39  ? 37  DC  F N1    1 
ATOM   1999 C  C2    . DC  D 2 5   ? 20.402 50.461  72.785 1.00 46.89  ? 37  DC  F C2    1 
ATOM   2000 O  O2    . DC  D 2 5   ? 20.370 49.463  73.528 1.00 44.67  ? 37  DC  F O2    1 
ATOM   2001 N  N3    . DC  D 2 5   ? 19.266 51.007  72.297 1.00 43.86  ? 37  DC  F N3    1 
ATOM   2002 C  C4    . DC  D 2 5   ? 19.330 52.077  71.502 1.00 44.00  ? 37  DC  F C4    1 
ATOM   2003 N  N4    . DC  D 2 5   ? 18.177 52.582  71.047 1.00 43.87  ? 37  DC  F N4    1 
ATOM   2004 C  C5    . DC  D 2 5   ? 20.576 52.679  71.137 1.00 44.86  ? 37  DC  F C5    1 
ATOM   2005 C  C6    . DC  D 2 5   ? 21.701 52.132  71.626 1.00 46.74  ? 37  DC  F C6    1 
ATOM   2006 P  P     . DT  D 2 6   ? 26.040 47.842  72.595 1.00 74.41  ? 38  DT  F P     1 
ATOM   2007 O  OP1   . DT  D 2 6   ? 27.187 47.226  73.277 1.00 74.58  ? 38  DT  F OP1   1 
ATOM   2008 O  OP2   . DT  D 2 6   ? 26.254 48.504  71.301 1.00 73.97  ? 38  DT  F OP2   1 
ATOM   2009 O  "O5'" . DT  D 2 6   ? 24.903 46.738  72.422 1.00 72.70  ? 38  DT  F "O5'" 1 
ATOM   2010 C  "C5'" . DT  D 2 6   ? 23.525 47.130  72.308 1.00 70.69  ? 38  DT  F "C5'" 1 
ATOM   2011 C  "C4'" . DT  D 2 6   ? 22.624 46.092  72.933 1.00 70.43  ? 38  DT  F "C4'" 1 
ATOM   2012 O  "O4'" . DT  D 2 6   ? 21.271 46.607  72.922 1.00 70.08  ? 38  DT  F "O4'" 1 
ATOM   2013 C  "C3'" . DT  D 2 6   ? 22.556 44.787  72.155 1.00 72.49  ? 38  DT  F "C3'" 1 
ATOM   2014 O  "O3'" . DT  D 2 6   ? 22.260 43.695  73.034 1.00 77.31  ? 38  DT  F "O3'" 1 
ATOM   2015 C  "C2'" . DT  D 2 6   ? 21.445 45.053  71.157 1.00 70.71  ? 38  DT  F "C2'" 1 
ATOM   2016 C  "C1'" . DT  D 2 6   ? 20.482 45.948  71.932 1.00 67.29  ? 38  DT  F "C1'" 1 
ATOM   2017 N  N1    . DT  D 2 6   ? 19.865 46.994  71.097 1.00 61.35  ? 38  DT  F N1    1 
ATOM   2018 C  C2    . DT  D 2 6   ? 18.502 46.975  70.917 1.00 59.65  ? 38  DT  F C2    1 
ATOM   2019 O  O2    . DT  D 2 6   ? 17.769 46.132  71.411 1.00 59.31  ? 38  DT  F O2    1 
ATOM   2020 N  N3    . DT  D 2 6   ? 18.022 47.987  70.130 1.00 59.17  ? 38  DT  F N3    1 
ATOM   2021 C  C4    . DT  D 2 6   ? 18.745 48.990  69.517 1.00 60.05  ? 38  DT  F C4    1 
ATOM   2022 O  O4    . DT  D 2 6   ? 18.165 49.831  68.834 1.00 61.80  ? 38  DT  F O4    1 
ATOM   2023 C  C5    . DT  D 2 6   ? 20.171 48.949  69.747 1.00 58.46  ? 38  DT  F C5    1 
ATOM   2024 C  C7    . DT  D 2 6   ? 21.043 49.994  69.124 1.00 57.85  ? 38  DT  F C7    1 
ATOM   2025 C  C6    . DT  D 2 6   ? 20.650 47.967  70.515 1.00 58.09  ? 38  DT  F C6    1 
ATOM   2026 P  P     . DC  D 2 7   ? 22.085 42.212  72.432 1.00 81.61  ? 39  DC  F P     1 
ATOM   2027 O  OP1   . DC  D 2 7   ? 22.145 41.246  73.565 1.00 80.36  ? 39  DC  F OP1   1 
ATOM   2028 O  OP2   . DC  D 2 7   ? 23.045 42.070  71.293 1.00 78.99  ? 39  DC  F OP2   1 
ATOM   2029 O  "O5'" . DC  D 2 7   ? 20.600 42.224  71.837 1.00 79.41  ? 39  DC  F "O5'" 1 
ATOM   2030 C  "C5'" . DC  D 2 7   ? 19.444 42.300  72.709 1.00 71.99  ? 39  DC  F "C5'" 1 
ATOM   2031 C  "C4'" . DC  D 2 7   ? 18.232 41.662  72.063 1.00 66.34  ? 39  DC  F "C4'" 1 
ATOM   2032 O  "O4'" . DC  D 2 7   ? 17.622 42.614  71.152 1.00 60.42  ? 39  DC  F "O4'" 1 
ATOM   2033 C  "C3'" . DC  D 2 7   ? 18.591 40.455  71.192 1.00 67.17  ? 39  DC  F "C3'" 1 
ATOM   2034 O  "O3'" . DC  D 2 7   ? 17.559 39.459  71.162 1.00 72.36  ? 39  DC  F "O3'" 1 
ATOM   2035 C  "C2'" . DC  D 2 7   ? 18.856 41.079  69.833 1.00 63.13  ? 39  DC  F "C2'" 1 
ATOM   2036 C  "C1'" . DC  D 2 7   ? 17.846 42.223  69.797 1.00 59.05  ? 39  DC  F "C1'" 1 
ATOM   2037 N  N1    . DC  D 2 7   ? 18.248 43.421  69.022 1.00 55.53  ? 39  DC  F N1    1 
ATOM   2038 C  C2    . DC  D 2 7   ? 17.269 44.131  68.290 1.00 53.70  ? 39  DC  F C2    1 
ATOM   2039 O  O2    . DC  D 2 7   ? 16.090 43.742  68.313 1.00 56.10  ? 39  DC  F O2    1 
ATOM   2040 N  N3    . DC  D 2 7   ? 17.640 45.223  67.574 1.00 48.86  ? 39  DC  F N3    1 
ATOM   2041 C  C4    . DC  D 2 7   ? 18.917 45.612  67.567 1.00 46.70  ? 39  DC  F C4    1 
ATOM   2042 N  N4    . DC  D 2 7   ? 19.233 46.689  66.850 1.00 43.63  ? 39  DC  F N4    1 
ATOM   2043 C  C5    . DC  D 2 7   ? 19.927 44.914  68.296 1.00 48.43  ? 39  DC  F C5    1 
ATOM   2044 C  C6    . DC  D 2 7   ? 19.552 43.838  69.002 1.00 52.33  ? 39  DC  F C6    1 
ATOM   2045 P  P     . DC  D 2 8   ? 17.831 38.043  70.424 1.00 76.24  ? 40  DC  F P     1 
ATOM   2046 O  OP1   . DC  D 2 8   ? 17.506 36.949  71.354 1.00 75.45  ? 40  DC  F OP1   1 
ATOM   2047 O  OP2   . DC  D 2 8   ? 19.161 38.072  69.809 1.00 75.85  ? 40  DC  F OP2   1 
ATOM   2048 O  "O5'" . DC  D 2 8   ? 16.766 38.028  69.240 1.00 76.17  ? 40  DC  F "O5'" 1 
ATOM   2049 C  "C5'" . DC  D 2 8   ? 16.501 39.227  68.494 1.00 74.59  ? 40  DC  F "C5'" 1 
ATOM   2050 C  "C4'" . DC  D 2 8   ? 15.011 39.452  68.362 1.00 73.76  ? 40  DC  F "C4'" 1 
ATOM   2051 O  "O4'" . DC  D 2 8   ? 14.807 40.818  67.935 1.00 72.44  ? 40  DC  F "O4'" 1 
ATOM   2052 C  "C3'" . DC  D 2 8   ? 14.328 38.586  67.304 1.00 72.59  ? 40  DC  F "C3'" 1 
ATOM   2053 O  "O3'" . DC  D 2 8   ? 12.941 38.357  67.643 1.00 69.96  ? 40  DC  F "O3'" 1 
ATOM   2054 C  "C2'" . DC  D 2 8   ? 14.506 39.422  66.047 1.00 72.31  ? 40  DC  F "C2'" 1 
ATOM   2055 C  "C1'" . DC  D 2 8   ? 14.415 40.858  66.567 1.00 71.07  ? 40  DC  F "C1'" 1 
ATOM   2056 N  N1    . DC  D 2 8   ? 15.315 41.806  65.885 1.00 67.84  ? 40  DC  F N1    1 
ATOM   2057 C  C2    . DC  D 2 8   ? 14.766 42.856  65.138 1.00 65.85  ? 40  DC  F C2    1 
ATOM   2058 O  O2    . DC  D 2 8   ? 13.528 42.964  65.060 1.00 63.51  ? 40  DC  F O2    1 
ATOM   2059 N  N3    . DC  D 2 8   ? 15.599 43.725  64.518 1.00 66.08  ? 40  DC  F N3    1 
ATOM   2060 C  C4    . DC  D 2 8   ? 16.923 43.575  64.622 1.00 66.41  ? 40  DC  F C4    1 
ATOM   2061 N  N4    . DC  D 2 8   ? 17.707 44.454  63.991 1.00 67.12  ? 40  DC  F N4    1 
ATOM   2062 C  C5    . DC  D 2 8   ? 17.503 42.517  65.375 1.00 65.74  ? 40  DC  F C5    1 
ATOM   2063 C  C6    . DC  D 2 8   ? 16.674 41.666  65.984 1.00 66.57  ? 40  DC  F C6    1 
ATOM   2064 P  P     . DC  D 2 9   ? 12.266 36.909  67.379 1.00 66.23  ? 41  DC  F P     1 
ATOM   2065 O  OP1   . DC  D 2 9   ? 11.178 36.716  68.375 1.00 65.13  ? 41  DC  F OP1   1 
ATOM   2066 O  OP2   . DC  D 2 9   ? 13.355 35.895  67.271 1.00 65.70  ? 41  DC  F OP2   1 
ATOM   2067 O  "O5'" . DC  D 2 9   ? 11.582 37.042  65.944 1.00 60.07  ? 41  DC  F "O5'" 1 
ATOM   2068 C  "C5'" . DC  D 2 9   ? 12.106 37.949  64.967 1.00 52.84  ? 41  DC  F "C5'" 1 
ATOM   2069 C  "C4'" . DC  D 2 9   ? 10.983 38.690  64.280 1.00 47.64  ? 41  DC  F "C4'" 1 
ATOM   2070 O  "O4'" . DC  D 2 9   ? 11.452 39.999  63.894 1.00 44.05  ? 41  DC  F "O4'" 1 
ATOM   2071 C  "C3'" . DC  D 2 9   ? 10.504 38.045  62.990 1.00 45.64  ? 41  DC  F "C3'" 1 
ATOM   2072 O  "O3'" . DC  D 2 9   ? 9.137  38.397  62.776 1.00 47.81  ? 41  DC  F "O3'" 1 
ATOM   2073 C  "C2'" . DC  D 2 9   ? 11.435 38.650  61.954 1.00 41.73  ? 41  DC  F "C2'" 1 
ATOM   2074 C  "C1'" . DC  D 2 9   ? 11.658 40.059  62.490 1.00 39.86  ? 41  DC  F "C1'" 1 
ATOM   2075 N  N1    . DC  D 2 9   ? 13.010 40.611  62.273 1.00 36.84  ? 41  DC  F N1    1 
ATOM   2076 C  C2    . DC  D 2 9   ? 13.182 41.690  61.382 1.00 36.44  ? 41  DC  F C2    1 
ATOM   2077 O  O2    . DC  D 2 9   ? 12.191 42.155  60.788 1.00 34.78  ? 41  DC  F O2    1 
ATOM   2078 N  N3    . DC  D 2 9   ? 14.429 42.195  61.195 1.00 35.64  ? 41  DC  F N3    1 
ATOM   2079 C  C4    . DC  D 2 9   ? 15.470 41.670  61.852 1.00 35.25  ? 41  DC  F C4    1 
ATOM   2080 N  N4    . DC  D 2 9   ? 16.677 42.199  61.637 1.00 37.69  ? 41  DC  F N4    1 
ATOM   2081 C  C5    . DC  D 2 9   ? 15.319 40.580  62.758 1.00 32.65  ? 41  DC  F C5    1 
ATOM   2082 C  C6    . DC  D 2 9   ? 14.088 40.087  62.935 1.00 33.59  ? 41  DC  F C6    1 
ATOM   2083 P  P     . DA  D 2 10  ? 8.362  37.823  61.498 1.00 52.49  ? 42  DA  F P     1 
ATOM   2084 O  OP1   . DA  D 2 10  ? 6.905  37.775  61.819 1.00 51.32  ? 42  DA  F OP1   1 
ATOM   2085 O  OP2   . DA  D 2 10  ? 9.061  36.584  61.047 1.00 55.41  ? 42  DA  F OP2   1 
ATOM   2086 O  "O5'" . DA  D 2 10  ? 8.616  38.935  60.394 1.00 47.65  ? 42  DA  F "O5'" 1 
ATOM   2087 C  "C5'" . DA  D 2 10  ? 7.848  40.144  60.386 1.00 49.04  ? 42  DA  F "C5'" 1 
ATOM   2088 C  "C4'" . DA  D 2 10  ? 7.809  40.717  58.990 1.00 47.90  ? 42  DA  F "C4'" 1 
ATOM   2089 O  "O4'" . DA  D 2 10  ? 9.143  41.136  58.629 1.00 43.88  ? 42  DA  F "O4'" 1 
ATOM   2090 C  "C3'" . DA  D 2 10  ? 7.412  39.699  57.930 1.00 47.42  ? 42  DA  F "C3'" 1 
ATOM   2091 O  "O3'" . DA  D 2 10  ? 6.799  40.382  56.833 1.00 50.86  ? 42  DA  F "O3'" 1 
ATOM   2092 C  "C2'" . DA  D 2 10  ? 8.744  39.064  57.566 1.00 43.19  ? 42  DA  F "C2'" 1 
ATOM   2093 C  "C1'" . DA  D 2 10  ? 9.706  40.241  57.684 1.00 37.31  ? 42  DA  F "C1'" 1 
ATOM   2094 N  N9    . DA  D 2 10  ? 11.065 39.937  58.134 1.00 29.24  ? 42  DA  F N9    1 
ATOM   2095 C  C8    . DA  D 2 10  ? 11.524 38.821  58.792 1.00 28.44  ? 42  DA  F C8    1 
ATOM   2096 N  N7    . DA  D 2 10  ? 12.806 38.859  59.070 1.00 24.96  ? 42  DA  F N7    1 
ATOM   2097 C  C5    . DA  D 2 10  ? 13.223 40.082  58.558 1.00 19.64  ? 42  DA  F C5    1 
ATOM   2098 C  C6    . DA  D 2 10  ? 14.482 40.722  58.529 1.00 10.29  ? 42  DA  F C6    1 
ATOM   2099 N  N6    . DA  D 2 10  ? 15.594 40.198  59.037 1.00 9.43   ? 42  DA  F N6    1 
ATOM   2100 N  N1    . DA  D 2 10  ? 14.555 41.936  57.949 1.00 6.64   ? 42  DA  F N1    1 
ATOM   2101 C  C2    . DA  D 2 10  ? 13.437 42.465  57.432 1.00 13.10  ? 42  DA  F C2    1 
ATOM   2102 N  N3    . DA  D 2 10  ? 12.199 41.964  57.395 1.00 19.12  ? 42  DA  F N3    1 
ATOM   2103 C  C4    . DA  D 2 10  ? 12.160 40.756  57.981 1.00 22.93  ? 42  DA  F C4    1 
ATOM   2104 P  P     . DT  D 2 11  ? 6.170  39.543  55.619 1.00 57.42  ? 43  DT  F P     1 
ATOM   2105 O  OP1   . DT  D 2 11  ? 4.935  40.230  55.233 1.00 58.13  ? 43  DT  F OP1   1 
ATOM   2106 O  OP2   . DT  D 2 11  ? 6.101  38.120  55.990 1.00 56.61  ? 43  DT  F OP2   1 
ATOM   2107 O  "O5'" . DT  D 2 11  ? 7.231  39.728  54.437 1.00 59.92  ? 43  DT  F "O5'" 1 
ATOM   2108 C  "C5'" . DT  D 2 11  ? 8.644  39.875  54.717 1.00 59.52  ? 43  DT  F "C5'" 1 
ATOM   2109 C  "C4'" . DT  D 2 11  ? 9.211  41.064  53.975 1.00 57.85  ? 43  DT  F "C4'" 1 
ATOM   2110 O  "O4'" . DT  D 2 11  ? 10.528 41.364  54.509 1.00 57.59  ? 43  DT  F "O4'" 1 
ATOM   2111 C  "C3'" . DT  D 2 11  ? 9.444  40.773  52.499 1.00 57.50  ? 43  DT  F "C3'" 1 
ATOM   2112 O  "O3'" . DT  D 2 11  ? 9.325  41.959  51.721 1.00 59.89  ? 43  DT  F "O3'" 1 
ATOM   2113 C  "C2'" . DT  D 2 11  ? 10.851 40.204  52.480 1.00 57.55  ? 43  DT  F "C2'" 1 
ATOM   2114 C  "C1'" . DT  D 2 11  ? 11.552 40.988  53.584 1.00 54.21  ? 43  DT  F "C1'" 1 
ATOM   2115 N  N1    . DT  D 2 11  ? 12.592 40.229  54.332 1.00 49.07  ? 43  DT  F N1    1 
ATOM   2116 C  C2    . DT  D 2 11  ? 13.894 40.691  54.330 1.00 46.99  ? 43  DT  F C2    1 
ATOM   2117 O  O2    . DT  D 2 11  ? 14.251 41.700  53.740 1.00 46.18  ? 43  DT  F O2    1 
ATOM   2118 N  N3    . DT  D 2 11  ? 14.774 39.920  55.052 1.00 45.30  ? 43  DT  F N3    1 
ATOM   2119 C  C4    . DT  D 2 11  ? 14.497 38.766  55.755 1.00 44.88  ? 43  DT  F C4    1 
ATOM   2120 O  O4    . DT  D 2 11  ? 15.403 38.186  56.357 1.00 41.88  ? 43  DT  F O4    1 
ATOM   2121 C  C5    . DT  D 2 11  ? 13.109 38.339  55.712 1.00 46.27  ? 43  DT  F C5    1 
ATOM   2122 C  C7    . DT  D 2 11  ? 12.702 37.096  56.440 1.00 47.89  ? 43  DT  F C7    1 
ATOM   2123 C  C6    . DT  D 2 11  ? 12.244 39.082  55.015 1.00 46.11  ? 43  DT  F C6    1 
ATOM   2124 P  P     . DC  D 2 12  ? 9.334  41.861  50.120 1.00 64.29  ? 44  DC  F P     1 
ATOM   2125 O  OP1   . DC  D 2 12  ? 8.414  42.891  49.628 1.00 65.17  ? 44  DC  F OP1   1 
ATOM   2126 O  OP2   . DC  D 2 12  ? 9.119  40.470  49.708 1.00 65.30  ? 44  DC  F OP2   1 
ATOM   2127 O  "O5'" . DC  D 2 12  ? 10.822 42.276  49.734 1.00 63.28  ? 44  DC  F "O5'" 1 
ATOM   2128 C  "C5'" . DC  D 2 12  ? 11.243 43.645  49.839 1.00 64.49  ? 44  DC  F "C5'" 1 
ATOM   2129 C  "C4'" . DC  D 2 12  ? 12.508 43.871  49.045 1.00 65.38  ? 44  DC  F "C4'" 1 
ATOM   2130 O  "O4'" . DC  D 2 12  ? 13.602 43.192  49.705 1.00 62.50  ? 44  DC  F "O4'" 1 
ATOM   2131 C  "C3'" . DC  D 2 12  ? 12.461 43.274  47.640 1.00 67.41  ? 44  DC  F "C3'" 1 
ATOM   2132 O  "O3'" . DC  D 2 12  ? 13.300 44.042  46.764 1.00 75.20  ? 44  DC  F "O3'" 1 
ATOM   2133 C  "C2'" . DC  D 2 12  ? 12.954 41.852  47.861 1.00 62.44  ? 44  DC  F "C2'" 1 
ATOM   2134 C  "C1'" . DC  D 2 12  ? 13.992 42.045  48.959 1.00 58.00  ? 44  DC  F "C1'" 1 
ATOM   2135 N  N1    . DC  D 2 12  ? 14.194 40.939  49.908 1.00 51.83  ? 44  DC  F N1    1 
ATOM   2136 C  C2    . DC  D 2 12  ? 15.478 40.745  50.436 1.00 50.29  ? 44  DC  F C2    1 
ATOM   2137 O  O2    . DC  D 2 12  ? 16.395 41.507  50.085 1.00 49.51  ? 44  DC  F O2    1 
ATOM   2138 N  N3    . DC  D 2 12  ? 15.689 39.737  51.316 1.00 48.63  ? 44  DC  F N3    1 
ATOM   2139 C  C4    . DC  D 2 12  ? 14.679 38.940  51.671 1.00 47.42  ? 44  DC  F C4    1 
ATOM   2140 N  N4    . DC  D 2 12  ? 14.939 37.959  52.542 1.00 45.34  ? 44  DC  F N4    1 
ATOM   2141 C  C5    . DC  D 2 12  ? 13.363 39.112  51.148 1.00 47.98  ? 44  DC  F C5    1 
ATOM   2142 C  C6    . DC  D 2 12  ? 13.167 40.116  50.278 1.00 48.98  ? 44  DC  F C6    1 
ATOM   2143 P  P     . DC  D 2 13  ? 13.714 43.463  45.319 1.00 81.43  ? 45  DC  F P     1 
ATOM   2144 O  OP1   . DC  D 2 13  ? 13.814 44.616  44.406 1.00 82.33  ? 45  DC  F OP1   1 
ATOM   2145 O  OP2   . DC  D 2 13  ? 12.840 42.341  44.949 1.00 81.83  ? 45  DC  F OP2   1 
ATOM   2146 O  "O5'" . DC  D 2 13  ? 15.174 42.878  45.564 1.00 81.28  ? 45  DC  F "O5'" 1 
ATOM   2147 C  "C5'" . DC  D 2 13  ? 16.260 43.749  45.933 1.00 82.23  ? 45  DC  F "C5'" 1 
ATOM   2148 C  "C4'" . DC  D 2 13  ? 17.590 43.105  45.608 1.00 82.62  ? 45  DC  F "C4'" 1 
ATOM   2149 O  "O4'" . DC  D 2 13  ? 17.802 41.978  46.493 1.00 80.53  ? 45  DC  F "O4'" 1 
ATOM   2150 C  "C3'" . DC  D 2 13  ? 17.632 42.513  44.199 1.00 83.41  ? 45  DC  F "C3'" 1 
ATOM   2151 O  "O3'" . DC  D 2 13  ? 18.987 42.481  43.745 1.00 88.80  ? 45  DC  F "O3'" 1 
ATOM   2152 C  "C2'" . DC  D 2 13  ? 17.095 41.108  44.405 1.00 79.42  ? 45  DC  F "C2'" 1 
ATOM   2153 C  "C1'" . DC  D 2 13  ? 17.672 40.762  45.771 1.00 75.91  ? 45  DC  F "C1'" 1 
ATOM   2154 N  N1    . DC  D 2 13  ? 16.945 39.795  46.612 1.00 70.33  ? 45  DC  F N1    1 
ATOM   2155 C  C2    . DC  D 2 13  ? 17.681 39.028  47.535 1.00 67.93  ? 45  DC  F C2    1 
ATOM   2156 O  O2    . DC  D 2 13  ? 18.914 39.195  47.621 1.00 65.02  ? 45  DC  F O2    1 
ATOM   2157 N  N3    . DC  D 2 13  ? 17.033 38.125  48.307 1.00 66.94  ? 45  DC  F N3    1 
ATOM   2158 C  C4    . DC  D 2 13  ? 15.711 37.973  48.188 1.00 66.20  ? 45  DC  F C4    1 
ATOM   2159 N  N4    . DC  D 2 13  ? 15.119 37.071  48.973 1.00 64.91  ? 45  DC  F N4    1 
ATOM   2160 C  C5    . DC  D 2 13  ? 14.940 38.741  47.262 1.00 66.67  ? 45  DC  F C5    1 
ATOM   2161 C  C6    . DC  D 2 13  ? 15.591 39.632  46.503 1.00 67.54  ? 45  DC  F C6    1 
ATOM   2162 P  P     . DA  D 2 14  ? 19.319 42.102  42.218 1.00 94.59  ? 46  DA  F P     1 
ATOM   2163 O  OP1   . DA  D 2 14  ? 19.451 43.368  41.482 1.00 94.75  ? 46  DA  F OP1   1 
ATOM   2164 O  OP2   . DA  D 2 14  ? 18.365 41.092  41.730 1.00 94.09  ? 46  DA  F OP2   1 
ATOM   2165 O  "O5'" . DA  D 2 14  ? 20.761 41.431  42.325 1.00 94.00  ? 46  DA  F "O5'" 1 
ATOM   2166 C  "C5'" . DA  D 2 14  ? 21.812 42.083  43.065 1.00 93.11  ? 46  DA  F "C5'" 1 
ATOM   2167 C  "C4'" . DA  D 2 14  ? 22.792 41.073  43.622 1.00 92.65  ? 46  DA  F "C4'" 1 
ATOM   2168 O  "O4'" . DA  D 2 14  ? 22.091 40.175  44.524 1.00 91.66  ? 46  DA  F "O4'" 1 
ATOM   2169 C  "C3'" . DA  D 2 14  ? 23.372 40.165  42.537 1.00 93.68  ? 46  DA  F "C3'" 1 
ATOM   2170 O  "O3'" . DA  D 2 14  ? 24.683 39.719  42.907 1.00 97.71  ? 46  DA  F "O3'" 1 
ATOM   2171 C  "C2'" . DA  D 2 14  ? 22.377 39.020  42.475 1.00 91.65  ? 46  DA  F "C2'" 1 
ATOM   2172 C  "C1'" . DA  D 2 14  ? 21.974 38.880  43.936 1.00 89.88  ? 46  DA  F "C1'" 1 
ATOM   2173 N  N9    . DA  D 2 14  ? 20.625 38.364  44.185 1.00 86.80  ? 46  DA  F N9    1 
ATOM   2174 C  C8    . DA  D 2 14  ? 19.446 38.736  43.584 1.00 86.52  ? 46  DA  F C8    1 
ATOM   2175 N  N7    . DA  D 2 14  ? 18.399 38.071  44.013 1.00 85.66  ? 46  DA  F N7    1 
ATOM   2176 C  C5    . DA  D 2 14  ? 18.920 37.203  44.965 1.00 83.18  ? 46  DA  F C5    1 
ATOM   2177 C  C6    . DA  D 2 14  ? 18.321 36.227  45.790 1.00 79.92  ? 46  DA  F C6    1 
ATOM   2178 N  N6    . DA  D 2 14  ? 17.014 35.952  45.788 1.00 77.53  ? 46  DA  F N6    1 
ATOM   2179 N  N1    . DA  D 2 14  ? 19.123 35.534  46.628 1.00 78.57  ? 46  DA  F N1    1 
ATOM   2180 C  C2    . DA  D 2 14  ? 20.434 35.808  46.629 1.00 80.28  ? 46  DA  F C2    1 
ATOM   2181 N  N3    . DA  D 2 14  ? 21.114 36.698  45.905 1.00 82.32  ? 46  DA  F N3    1 
ATOM   2182 C  C4    . DA  D 2 14  ? 20.290 37.372  45.082 1.00 84.05  ? 46  DA  F C4    1 
ATOM   2183 P  P     . DG  D 2 15  ? 25.516 38.760  41.916 1.00 100.00 ? 47  DG  F P     1 
ATOM   2184 O  OP1   . DG  D 2 15  ? 26.852 39.352  41.753 1.00 100.00 ? 47  DG  F OP1   1 
ATOM   2185 O  OP2   . DG  D 2 15  ? 24.713 38.488  40.715 1.00 99.46  ? 47  DG  F OP2   1 
ATOM   2186 O  "O5'" . DG  D 2 15  ? 25.672 37.407  42.748 1.00 97.78  ? 47  DG  F "O5'" 1 
ATOM   2187 C  "C5'" . DG  D 2 15  ? 26.298 37.415  44.046 1.00 94.99  ? 47  DG  F "C5'" 1 
ATOM   2188 C  "C4'" . DG  D 2 15  ? 26.543 36.007  44.544 1.00 93.73  ? 47  DG  F "C4'" 1 
ATOM   2189 O  "O4'" . DG  D 2 15  ? 25.274 35.380  44.862 1.00 92.11  ? 47  DG  F "O4'" 1 
ATOM   2190 C  "C3'" . DG  D 2 15  ? 27.181 35.091  43.498 1.00 93.99  ? 47  DG  F "C3'" 1 
ATOM   2191 O  "O3'" . DG  D 2 15  ? 27.989 34.090  44.142 1.00 95.66  ? 47  DG  F "O3'" 1 
ATOM   2192 C  "C2'" . DG  D 2 15  ? 25.978 34.517  42.770 1.00 92.40  ? 47  DG  F "C2'" 1 
ATOM   2193 C  "C1'" . DG  D 2 15  ? 24.964 34.376  43.898 1.00 90.25  ? 47  DG  F "C1'" 1 
ATOM   2194 N  N9    . DG  D 2 15  ? 23.569 34.527  43.501 1.00 86.90  ? 47  DG  F N9    1 
ATOM   2195 C  C8    . DG  D 2 15  ? 23.050 35.384  42.557 1.00 84.89  ? 47  DG  F C8    1 
ATOM   2196 N  N7    . DG  D 2 15  ? 21.758 35.272  42.423 1.00 84.58  ? 47  DG  F N7    1 
ATOM   2197 C  C5    . DG  D 2 15  ? 21.402 34.285  43.334 1.00 85.76  ? 47  DG  F C5    1 
ATOM   2198 C  C6    . DG  D 2 15  ? 20.128 33.732  43.645 1.00 86.33  ? 47  DG  F C6    1 
ATOM   2199 O  O6    . DG  D 2 15  ? 19.024 34.016  43.155 1.00 87.78  ? 47  DG  F O6    1 
ATOM   2200 N  N1    . DG  D 2 15  ? 20.221 32.753  44.633 1.00 84.39  ? 47  DG  F N1    1 
ATOM   2201 C  C2    . DG  D 2 15  ? 21.389 32.356  45.244 1.00 83.68  ? 47  DG  F C2    1 
ATOM   2202 N  N2    . DG  D 2 15  ? 21.280 31.394  46.175 1.00 83.43  ? 47  DG  F N2    1 
ATOM   2203 N  N3    . DG  D 2 15  ? 22.578 32.864  44.964 1.00 84.02  ? 47  DG  F N3    1 
ATOM   2204 C  C4    . DG  D 2 15  ? 22.510 33.817  44.007 1.00 85.60  ? 47  DG  F C4    1 
ATOM   2205 P  P     . DG  D 2 16  ? 28.239 32.663  43.431 1.00 95.53  ? 48  DG  F P     1 
ATOM   2206 O  OP1   . DG  D 2 16  ? 29.458 32.096  44.019 1.00 95.16  ? 48  DG  F OP1   1 
ATOM   2207 O  OP2   . DG  D 2 16  ? 28.163 32.813  41.969 1.00 95.53  ? 48  DG  F OP2   1 
ATOM   2208 O  "O5'" . DG  D 2 16  ? 27.012 31.780  43.939 1.00 92.41  ? 48  DG  F "O5'" 1 
ATOM   2209 C  "C5'" . DG  D 2 16  ? 26.783 31.609  45.350 1.00 88.70  ? 48  DG  F "C5'" 1 
ATOM   2210 C  "C4'" . DG  D 2 16  ? 26.209 30.242  45.650 1.00 87.80  ? 48  DG  F "C4'" 1 
ATOM   2211 O  "O4'" . DG  D 2 16  ? 24.817 30.206  45.246 1.00 85.69  ? 48  DG  F "O4'" 1 
ATOM   2212 C  "C3'" . DG  D 2 16  ? 26.881 29.117  44.856 1.00 89.38  ? 48  DG  F "C3'" 1 
ATOM   2213 O  "O3'" . DG  D 2 16  ? 26.798 27.883  45.595 1.00 93.78  ? 48  DG  F "O3'" 1 
ATOM   2214 C  "C2'" . DG  D 2 16  ? 26.064 29.078  43.574 1.00 86.82  ? 48  DG  F "C2'" 1 
ATOM   2215 C  "C1'" . DG  D 2 16  ? 24.668 29.378  44.099 1.00 83.46  ? 48  DG  F "C1'" 1 
ATOM   2216 N  N9    . DG  D 2 16  ? 23.697 29.991  43.194 1.00 78.75  ? 48  DG  F N9    1 
ATOM   2217 C  C8    . DG  D 2 16  ? 23.926 30.926  42.211 1.00 77.35  ? 48  DG  F C8    1 
ATOM   2218 N  N7    . DG  D 2 16  ? 22.843 31.265  41.563 1.00 76.63  ? 48  DG  F N7    1 
ATOM   2219 C  C5    . DG  D 2 16  ? 21.837 30.510  42.156 1.00 75.92  ? 48  DG  F C5    1 
ATOM   2220 C  C6    . DG  D 2 16  ? 20.441 30.450  41.878 1.00 75.00  ? 48  DG  F C6    1 
ATOM   2221 O  O6    . DG  D 2 16  ? 19.794 31.078  41.023 1.00 76.94  ? 48  DG  F O6    1 
ATOM   2222 N  N1    . DG  D 2 16  ? 19.788 29.550  42.720 1.00 72.12  ? 48  DG  F N1    1 
ATOM   2223 C  C2    . DG  D 2 16  ? 20.397 28.803  43.701 1.00 71.65  ? 48  DG  F C2    1 
ATOM   2224 N  N2    . DG  D 2 16  ? 19.602 27.988  44.415 1.00 68.70  ? 48  DG  F N2    1 
ATOM   2225 N  N3    . DG  D 2 16  ? 21.692 28.850  43.967 1.00 74.59  ? 48  DG  F N3    1 
ATOM   2226 C  C4    . DG  D 2 16  ? 22.346 29.719  43.163 1.00 76.26  ? 48  DG  F C4    1 
ATOM   2227 P  P     . DT  D 2 17  ? 27.223 26.480  44.906 1.00 96.99  ? 49  DT  F P     1 
ATOM   2228 O  OP1   . DT  D 2 17  ? 28.360 25.927  45.658 1.00 97.76  ? 49  DT  F OP1   1 
ATOM   2229 O  OP2   . DT  D 2 17  ? 27.360 26.653  43.451 1.00 94.50  ? 49  DT  F OP2   1 
ATOM   2230 O  "O5'" . DT  D 2 17  ? 25.954 25.548  45.172 1.00 96.02  ? 49  DT  F "O5'" 1 
ATOM   2231 C  "C5'" . DT  D 2 17  ? 24.665 25.937  44.669 1.00 92.96  ? 49  DT  F "C5'" 1 
ATOM   2232 C  "C4'" . DT  D 2 17  ? 23.544 25.186  45.354 1.00 90.18  ? 49  DT  F "C4'" 1 
ATOM   2233 O  "O4'" . DT  D 2 17  ? 22.304 25.773  44.895 1.00 87.69  ? 49  DT  F "O4'" 1 
ATOM   2234 C  "C3'" . DT  D 2 17  ? 23.415 23.695  45.044 1.00 88.13  ? 49  DT  F "C3'" 1 
ATOM   2235 O  "O3'" . DT  D 2 17  ? 22.750 23.000  46.119 1.00 87.59  ? 49  DT  F "O3'" 1 
ATOM   2236 C  "C2'" . DT  D 2 17  ? 22.573 23.702  43.784 1.00 85.82  ? 49  DT  F "C2'" 1 
ATOM   2237 C  "C1'" . DT  D 2 17  ? 21.655 24.907  43.965 1.00 82.91  ? 49  DT  F "C1'" 1 
ATOM   2238 N  N1    . DT  D 2 17  ? 21.509 25.662  42.706 1.00 76.74  ? 49  DT  F N1    1 
ATOM   2239 C  C2    . DT  D 2 17  ? 20.290 25.680  42.067 1.00 73.41  ? 49  DT  F C2    1 
ATOM   2240 O  O2    . DT  D 2 17  ? 19.302 25.093  42.483 1.00 71.71  ? 49  DT  F O2    1 
ATOM   2241 N  N3    . DT  D 2 17  ? 20.269 26.415  40.909 1.00 71.78  ? 49  DT  F N3    1 
ATOM   2242 C  C4    . DT  D 2 17  ? 21.314 27.115  40.338 1.00 71.20  ? 49  DT  F C4    1 
ATOM   2243 O  O4    . DT  D 2 17  ? 21.134 27.729  39.288 1.00 70.11  ? 49  DT  F O4    1 
ATOM   2244 C  C5    . DT  D 2 17  ? 22.565 27.050  41.060 1.00 71.84  ? 49  DT  F C5    1 
ATOM   2245 C  C7    . DT  D 2 17  ? 23.761 27.773  40.524 1.00 72.02  ? 49  DT  F C7    1 
ATOM   2246 C  C6    . DT  D 2 17  ? 22.598 26.339  42.190 1.00 73.53  ? 49  DT  F C6    1 
ATOM   2247 P  P     . DA  D 2 18  ? 22.646 21.384  46.104 1.00 85.27  ? 50  DA  F P     1 
ATOM   2248 O  OP1   . DA  D 2 18  ? 22.120 20.935  47.419 1.00 85.25  ? 50  DA  F OP1   1 
ATOM   2249 O  OP2   . DA  D 2 18  ? 23.954 20.860  45.630 1.00 86.29  ? 50  DA  F OP2   1 
ATOM   2250 O  "O5'" . DA  D 2 18  ? 21.542 21.066  44.990 1.00 80.91  ? 50  DA  F "O5'" 1 
ATOM   2251 C  "C5'" . DA  D 2 18  ? 20.127 21.101  45.305 1.00 72.76  ? 50  DA  F "C5'" 1 
ATOM   2252 C  "C4'" . DA  D 2 18  ? 19.310 20.343  44.274 1.00 66.51  ? 50  DA  F "C4'" 1 
ATOM   2253 O  "O4'" . DA  D 2 18  ? 19.262 21.096  43.034 1.00 63.03  ? 50  DA  F "O4'" 1 
ATOM   2254 C  "C3'" . DA  D 2 18  ? 19.912 18.991  43.886 1.00 63.20  ? 50  DA  F "C3'" 1 
ATOM   2255 O  "O3'" . DA  D 2 18  ? 18.889 18.068  43.471 1.00 63.46  ? 50  DA  F "O3'" 1 
ATOM   2256 C  "C2'" . DA  D 2 18  ? 20.839 19.348  42.737 1.00 60.10  ? 50  DA  F "C2'" 1 
ATOM   2257 C  "C1'" . DA  D 2 18  ? 20.053 20.454  42.036 1.00 57.66  ? 50  DA  F "C1'" 1 
ATOM   2258 N  N9    . DA  D 2 18  ? 20.821 21.476  41.315 1.00 50.65  ? 50  DA  F N9    1 
ATOM   2259 C  C8    . DA  D 2 18  ? 22.151 21.789  41.447 1.00 49.16  ? 50  DA  F C8    1 
ATOM   2260 N  N7    . DA  D 2 18  ? 22.549 22.754  40.658 1.00 47.83  ? 50  DA  F N7    1 
ATOM   2261 C  C5    . DA  D 2 18  ? 21.406 23.102  39.953 1.00 46.10  ? 50  DA  F C5    1 
ATOM   2262 C  C6    . DA  D 2 18  ? 21.166 24.065  38.948 1.00 44.65  ? 50  DA  F C6    1 
ATOM   2263 N  N6    . DA  D 2 18  ? 22.101 24.890  38.463 1.00 43.11  ? 50  DA  F N6    1 
ATOM   2264 N  N1    . DA  D 2 18  ? 19.915 24.151  38.452 1.00 43.64  ? 50  DA  F N1    1 
ATOM   2265 C  C2    . DA  D 2 18  ? 18.977 23.324  38.936 1.00 45.47  ? 50  DA  F C2    1 
ATOM   2266 N  N3    . DA  D 2 18  ? 19.080 22.382  39.874 1.00 44.88  ? 50  DA  F N3    1 
ATOM   2267 C  C4    . DA  D 2 18  ? 20.334 22.321  40.347 1.00 46.21  ? 50  DA  F C4    1 
ATOM   2268 P  P     . DC  D 2 19  ? 19.237 16.497  43.308 1.00 64.92  ? 51  DC  F P     1 
ATOM   2269 O  OP1   . DC  D 2 19  ? 18.161 15.700  43.947 1.00 66.52  ? 51  DC  F OP1   1 
ATOM   2270 O  OP2   . DC  D 2 19  ? 20.650 16.291  43.722 1.00 67.71  ? 51  DC  F OP2   1 
ATOM   2271 O  "O5'" . DC  D 2 19  ? 19.156 16.225  41.742 1.00 58.22  ? 51  DC  F "O5'" 1 
ATOM   2272 C  "C5'" . DC  D 2 19  ? 19.421 17.278  40.814 1.00 53.88  ? 51  DC  F "C5'" 1 
ATOM   2273 C  "C4'" . DC  D 2 19  ? 18.270 17.427  39.847 1.00 49.53  ? 51  DC  F "C4'" 1 
ATOM   2274 O  "O4'" . DC  D 2 19  ? 18.375 18.739  39.246 1.00 45.46  ? 51  DC  F "O4'" 1 
ATOM   2275 C  "C3'" . DC  D 2 19  ? 18.339 16.436  38.684 1.00 47.95  ? 51  DC  F "C3'" 1 
ATOM   2276 O  "O3'" . DC  D 2 19  ? 17.037 16.117  38.152 1.00 44.41  ? 51  DC  F "O3'" 1 
ATOM   2277 C  "C2'" . DC  D 2 19  ? 19.204 17.171  37.682 1.00 46.65  ? 51  DC  F "C2'" 1 
ATOM   2278 C  "C1'" . DC  D 2 19  ? 18.802 18.620  37.904 1.00 43.67  ? 51  DC  F "C1'" 1 
ATOM   2279 N  N1    . DC  D 2 19  ? 19.881 19.596  37.670 1.00 42.24  ? 51  DC  F N1    1 
ATOM   2280 C  C2    . DC  D 2 19  ? 19.623 20.689  36.838 1.00 45.23  ? 51  DC  F C2    1 
ATOM   2281 O  O2    . DC  D 2 19  ? 18.491 20.812  36.338 1.00 48.37  ? 51  DC  F O2    1 
ATOM   2282 N  N3    . DC  D 2 19  ? 20.608 21.586  36.595 1.00 45.27  ? 51  DC  F N3    1 
ATOM   2283 C  C4    . DC  D 2 19  ? 21.811 21.421  37.149 1.00 43.45  ? 51  DC  F C4    1 
ATOM   2284 N  N4    . DC  D 2 19  ? 22.746 22.333  36.875 1.00 45.60  ? 51  DC  F N4    1 
ATOM   2285 C  C5    . DC  D 2 19  ? 22.103 20.320  38.005 1.00 41.24  ? 51  DC  F C5    1 
ATOM   2286 C  C6    . DC  D 2 19  ? 21.118 19.441  38.238 1.00 41.70  ? 51  DC  F C6    1 
ATOM   2287 P  P     . DT  D 2 20  ? 16.909 15.296  36.761 1.00 37.76  ? 52  DT  F P     1 
ATOM   2288 O  OP1   . DT  D 2 20  ? 15.651 14.541  36.807 1.00 38.02  ? 52  DT  F OP1   1 
ATOM   2289 O  OP2   . DT  D 2 20  ? 18.153 14.568  36.508 1.00 36.95  ? 52  DT  F OP2   1 
ATOM   2290 O  "O5'" . DT  D 2 20  ? 16.764 16.447  35.672 1.00 32.63  ? 52  DT  F "O5'" 1 
ATOM   2291 C  "C5'" . DT  D 2 20  ? 15.708 17.416  35.790 1.00 36.83  ? 52  DT  F "C5'" 1 
ATOM   2292 C  "C4'" . DT  D 2 20  ? 15.383 18.024  34.446 1.00 38.51  ? 52  DT  F "C4'" 1 
ATOM   2293 O  "O4'" . DT  D 2 20  ? 16.412 18.985  34.104 1.00 38.79  ? 52  DT  F "O4'" 1 
ATOM   2294 C  "C3'" . DT  D 2 20  ? 15.398 17.002  33.316 1.00 39.35  ? 52  DT  F "C3'" 1 
ATOM   2295 O  "O3'" . DT  D 2 20  ? 14.484 17.381  32.280 1.00 43.56  ? 52  DT  F "O3'" 1 
ATOM   2296 C  "C2'" . DT  D 2 20  ? 16.852 17.019  32.877 1.00 38.77  ? 52  DT  F "C2'" 1 
ATOM   2297 C  "C1'" . DT  D 2 20  ? 17.239 18.483  33.064 1.00 35.31  ? 52  DT  F "C1'" 1 
ATOM   2298 N  N1    . DT  D 2 20  ? 18.656 18.752  33.425 1.00 31.50  ? 52  DT  F N1    1 
ATOM   2299 C  C2    . DT  D 2 20  ? 19.264 19.866  32.864 1.00 32.74  ? 52  DT  F C2    1 
ATOM   2300 O  O2    . DT  D 2 20  ? 18.691 20.635  32.098 1.00 34.07  ? 52  DT  F O2    1 
ATOM   2301 N  N3    . DT  D 2 20  ? 20.577 20.048  33.233 1.00 30.53  ? 52  DT  F N3    1 
ATOM   2302 C  C4    . DT  D 2 20  ? 21.325 19.249  34.082 1.00 28.01  ? 52  DT  F C4    1 
ATOM   2303 O  O4    . DT  D 2 20  ? 22.500 19.539  34.322 1.00 31.51  ? 52  DT  F O4    1 
ATOM   2304 C  C5    . DT  D 2 20  ? 20.628 18.105  34.628 1.00 23.22  ? 52  DT  F C5    1 
ATOM   2305 C  C7    . DT  D 2 20  ? 21.366 17.185  35.545 1.00 21.43  ? 52  DT  F C7    1 
ATOM   2306 C  C6    . DT  D 2 20  ? 19.349 17.917  34.283 1.00 24.48  ? 52  DT  F C6    1 
ATOM   2307 P  P     . DA  D 2 21  ? 14.388 16.509  30.921 1.00 50.63  ? 53  DA  F P     1 
ATOM   2308 O  OP1   . DA  D 2 21  ? 12.967 16.332  30.608 1.00 51.27  ? 53  DA  F OP1   1 
ATOM   2309 O  OP2   . DA  D 2 21  ? 15.250 15.317  30.987 1.00 50.58  ? 53  DA  F OP2   1 
ATOM   2310 O  "O5'" . DA  D 2 21  ? 15.003 17.488  29.834 1.00 47.76  ? 53  DA  F "O5'" 1 
ATOM   2311 C  "C5'" . DA  D 2 21  ? 14.525 18.834  29.729 1.00 50.20  ? 53  DA  F "C5'" 1 
ATOM   2312 C  "C4'" . DA  D 2 21  ? 15.218 19.553  28.597 1.00 52.14  ? 53  DA  F "C4'" 1 
ATOM   2313 O  "O4'" . DA  D 2 21  ? 16.589 19.835  28.989 1.00 49.15  ? 53  DA  F "O4'" 1 
ATOM   2314 C  "C3'" . DA  D 2 21  ? 15.331 18.672  27.355 1.00 54.66  ? 53  DA  F "C3'" 1 
ATOM   2315 O  "O3'" . DA  D 2 21  ? 15.289 19.460  26.160 1.00 60.63  ? 53  DA  F "O3'" 1 
ATOM   2316 C  "C2'" . DA  D 2 21  ? 16.644 17.941  27.576 1.00 50.91  ? 53  DA  F "C2'" 1 
ATOM   2317 C  "C1'" . DA  D 2 21  ? 17.490 19.000  28.273 1.00 44.83  ? 53  DA  F "C1'" 1 
ATOM   2318 N  N9    . DA  D 2 21  ? 18.490 18.486  29.209 1.00 35.88  ? 53  DA  F N9    1 
ATOM   2319 C  C8    . DA  D 2 21  ? 18.349 17.480  30.124 1.00 33.65  ? 53  DA  F C8    1 
ATOM   2320 N  N7    . DA  D 2 21  ? 19.432 17.235  30.814 1.00 34.00  ? 53  DA  F N7    1 
ATOM   2321 C  C5    . DA  D 2 21  ? 20.351 18.144  30.320 1.00 32.44  ? 53  DA  F C5    1 
ATOM   2322 C  C6    . DA  D 2 21  ? 21.692 18.395  30.641 1.00 32.78  ? 53  DA  F C6    1 
ATOM   2323 N  N6    . DA  D 2 21  ? 22.372 17.725  31.576 1.00 33.47  ? 53  DA  F N6    1 
ATOM   2324 N  N1    . DA  D 2 21  ? 22.323 19.372  29.962 1.00 34.11  ? 53  DA  F N1    1 
ATOM   2325 C  C2    . DA  D 2 21  ? 21.642 20.043  29.026 1.00 37.13  ? 53  DA  F C2    1 
ATOM   2326 N  N3    . DA  D 2 21  ? 20.381 19.899  28.635 1.00 36.02  ? 53  DA  F N3    1 
ATOM   2327 C  C4    . DA  D 2 21  ? 19.783 18.921  29.331 1.00 33.31  ? 53  DA  F C4    1 
ATOM   2328 P  P     . DA  D 2 22  ? 15.796 18.835  24.768 1.00 65.03  ? 54  DA  F P     1 
ATOM   2329 O  OP1   . DA  D 2 22  ? 15.096 19.553  23.676 1.00 65.49  ? 54  DA  F OP1   1 
ATOM   2330 O  OP2   . DA  D 2 22  ? 15.708 17.351  24.840 1.00 66.38  ? 54  DA  F OP2   1 
ATOM   2331 O  "O5'" . DA  D 2 22  ? 17.336 19.238  24.746 1.00 65.07  ? 54  DA  F "O5'" 1 
ATOM   2332 C  "C5'" . DA  D 2 22  ? 17.723 20.609  24.943 1.00 65.51  ? 54  DA  F "C5'" 1 
ATOM   2333 C  "C4'" . DA  D 2 22  ? 19.043 20.904  24.265 1.00 67.41  ? 54  DA  F "C4'" 1 
ATOM   2334 O  "O4'" . DA  D 2 22  ? 20.129 20.466  25.119 1.00 68.13  ? 54  DA  F "O4'" 1 
ATOM   2335 C  "C3'" . DA  D 2 22  ? 19.231 20.134  22.957 1.00 69.02  ? 54  DA  F "C3'" 1 
ATOM   2336 O  "O3'" . DA  D 2 22  ? 20.065 20.879  22.060 1.00 71.74  ? 54  DA  F "O3'" 1 
ATOM   2337 C  "C2'" . DA  D 2 22  ? 19.873 18.835  23.421 1.00 68.30  ? 54  DA  F "C2'" 1 
ATOM   2338 C  "C1'" . DA  D 2 22  ? 20.757 19.315  24.568 1.00 67.41  ? 54  DA  F "C1'" 1 
ATOM   2339 N  N9    . DA  D 2 22  ? 21.041 18.371  25.651 1.00 65.34  ? 54  DA  F N9    1 
ATOM   2340 C  C8    . DA  D 2 22  ? 20.246 17.396  26.207 1.00 64.15  ? 54  DA  F C8    1 
ATOM   2341 N  N7    . DA  D 2 22  ? 20.834 16.717  27.165 1.00 63.89  ? 54  DA  F N7    1 
ATOM   2342 C  C5    . DA  D 2 22  ? 22.100 17.285  27.248 1.00 63.34  ? 54  DA  F C5    1 
ATOM   2343 C  C6    . DA  D 2 22  ? 23.213 17.015  28.071 1.00 61.81  ? 54  DA  F C6    1 
ATOM   2344 N  N6    . DA  D 2 22  ? 23.236 16.067  29.010 1.00 59.91  ? 54  DA  F N6    1 
ATOM   2345 N  N1    . DA  D 2 22  ? 24.321 17.769  27.891 1.00 62.09  ? 54  DA  F N1    1 
ATOM   2346 C  C2    . DA  D 2 22  ? 24.304 18.725  26.947 1.00 62.52  ? 54  DA  F C2    1 
ATOM   2347 N  N3    . DA  D 2 22  ? 23.327 19.070  26.117 1.00 61.96  ? 54  DA  F N3    1 
ATOM   2348 C  C4    . DA  D 2 22  ? 22.239 18.304  26.321 1.00 63.91  ? 54  DA  F C4    1 
ATOM   2349 P  P     . DC  D 2 23  ? 20.311 20.355  20.555 1.00 74.89  ? 55  DC  F P     1 
ATOM   2350 O  OP1   . DC  D 2 23  ? 19.970 21.466  19.635 1.00 76.53  ? 55  DC  F OP1   1 
ATOM   2351 O  OP2   . DC  D 2 23  ? 19.670 19.025  20.367 1.00 75.19  ? 55  DC  F OP2   1 
ATOM   2352 O  "O5'" . DC  D 2 23  ? 21.887 20.147  20.508 1.00 73.92  ? 55  DC  F "O5'" 1 
ATOM   2353 C  "C5'" . DC  D 2 23  ? 22.579 19.694  21.673 1.00 74.72  ? 55  DC  F "C5'" 1 
ATOM   2354 C  "C4'" . DC  D 2 23  ? 24.004 20.191  21.671 1.00 77.91  ? 55  DC  F "C4'" 1 
ATOM   2355 O  "O4'" . DC  D 2 23  ? 24.605 19.774  22.919 1.00 77.87  ? 55  DC  F "O4'" 1 
ATOM   2356 C  "C3'" . DC  D 2 23  ? 24.872 19.572  20.578 1.00 81.88  ? 55  DC  F "C3'" 1 
ATOM   2357 O  "O3'" . DC  D 2 23  ? 25.938 20.456  20.201 1.00 85.54  ? 55  DC  F "O3'" 1 
ATOM   2358 C  "C2'" . DC  D 2 23  ? 25.375 18.300  21.233 1.00 81.11  ? 55  DC  F "C2'" 1 
ATOM   2359 C  "C1'" . DC  D 2 23  ? 25.518 18.703  22.698 1.00 78.74  ? 55  DC  F "C1'" 1 
ATOM   2360 N  N1    . DC  D 2 23  ? 25.163 17.610  23.630 1.00 76.57  ? 55  DC  F N1    1 
ATOM   2361 C  C2    . DC  D 2 23  ? 26.111 17.166  24.579 1.00 74.01  ? 55  DC  F C2    1 
ATOM   2362 O  O2    . DC  D 2 23  ? 27.231 17.707  24.620 1.00 68.98  ? 55  DC  F O2    1 
ATOM   2363 N  N3    . DC  D 2 23  ? 25.774 16.157  25.423 1.00 75.77  ? 55  DC  F N3    1 
ATOM   2364 C  C4    . DC  D 2 23  ? 24.560 15.599  25.348 1.00 77.17  ? 55  DC  F C4    1 
ATOM   2365 N  N4    . DC  D 2 23  ? 24.271 14.613  26.200 1.00 79.00  ? 55  DC  F N4    1 
ATOM   2366 C  C5    . DC  D 2 23  ? 23.585 16.029  24.397 1.00 75.86  ? 55  DC  F C5    1 
ATOM   2367 C  C6    . DC  D 2 23  ? 23.923 17.026  23.570 1.00 76.31  ? 55  DC  F C6    1 
ATOM   2368 P  P     . DC  D 2 24  ? 26.959 20.032  19.025 1.00 87.60  ? 56  DC  F P     1 
ATOM   2369 O  OP1   . DC  D 2 24  ? 27.115 21.199  18.119 1.00 88.19  ? 56  DC  F OP1   1 
ATOM   2370 O  OP2   . DC  D 2 24  ? 26.556 18.714  18.460 1.00 87.05  ? 56  DC  F OP2   1 
ATOM   2371 O  "O5'" . DC  D 2 24  ? 28.332 19.799  19.794 1.00 86.00  ? 56  DC  F "O5'" 1 
ATOM   2372 C  "C5'" . DC  D 2 24  ? 28.391 18.910  20.915 1.00 83.98  ? 56  DC  F "C5'" 1 
ATOM   2373 C  "C4'" . DC  D 2 24  ? 29.780 18.341  21.059 1.00 84.04  ? 56  DC  F "C4'" 1 
ATOM   2374 O  "O4'" . DC  D 2 24  ? 29.745 17.370  22.134 1.00 83.49  ? 56  DC  F "O4'" 1 
ATOM   2375 C  "C3'" . DC  D 2 24  ? 30.225 17.558  19.828 1.00 86.33  ? 56  DC  F "C3'" 1 
ATOM   2376 O  "O3'" . DC  D 2 24  ? 31.652 17.603  19.691 1.00 91.29  ? 56  DC  F "O3'" 1 
ATOM   2377 C  "C2'" . DC  D 2 24  ? 29.695 16.163  20.100 1.00 85.19  ? 56  DC  F "C2'" 1 
ATOM   2378 C  "C1'" . DC  D 2 24  ? 29.831 16.045  21.616 1.00 82.94  ? 56  DC  F "C1'" 1 
ATOM   2379 N  N1    . DC  D 2 24  ? 28.785 15.228  22.269 1.00 78.97  ? 56  DC  F N1    1 
ATOM   2380 C  C2    . DC  D 2 24  ? 29.146 14.357  23.320 1.00 76.17  ? 56  DC  F C2    1 
ATOM   2381 O  O2    . DC  D 2 24  ? 30.334 14.296  23.685 1.00 73.60  ? 56  DC  F O2    1 
ATOM   2382 N  N3    . DC  D 2 24  ? 28.187 13.604  23.909 1.00 75.70  ? 56  DC  F N3    1 
ATOM   2383 C  C4    . DC  D 2 24  ? 26.920 13.690  23.493 1.00 75.93  ? 56  DC  F C4    1 
ATOM   2384 N  N4    . DC  D 2 24  ? 26.010 12.931  24.103 1.00 75.02  ? 56  DC  F N4    1 
ATOM   2385 C  C5    . DC  D 2 24  ? 26.528 14.562  22.434 1.00 75.98  ? 56  DC  F C5    1 
ATOM   2386 C  C6    . DC  D 2 24  ? 27.480 15.305  21.858 1.00 77.04  ? 56  DC  F C6    1 
ATOM   2387 P  P     . DA  D 2 25  ? 32.368 16.846  18.460 1.00 94.53  ? 57  DA  F P     1 
ATOM   2388 O  OP1   . DA  D 2 25  ? 33.500 17.678  18.031 1.00 94.65  ? 57  DA  F OP1   1 
ATOM   2389 O  OP2   . DA  D 2 25  ? 31.359 16.454  17.462 1.00 95.33  ? 57  DA  F OP2   1 
ATOM   2390 O  "O5'" . DA  D 2 25  ? 32.951 15.522  19.128 1.00 92.74  ? 57  DA  F "O5'" 1 
ATOM   2391 C  "C5'" . DA  D 2 25  ? 33.862 15.608  20.237 1.00 91.36  ? 57  DA  F "C5'" 1 
ATOM   2392 C  "C4'" . DA  D 2 25  ? 34.341 14.234  20.650 1.00 91.16  ? 57  DA  F "C4'" 1 
ATOM   2393 O  "O4'" . DA  D 2 25  ? 33.232 13.469  21.177 1.00 89.34  ? 57  DA  F "O4'" 1 
ATOM   2394 C  "C3'" . DA  D 2 25  ? 34.869 13.401  19.482 1.00 91.66  ? 57  DA  F "C3'" 1 
ATOM   2395 O  "O3'" . DA  D 2 25  ? 35.814 12.455  19.988 1.00 92.14  ? 57  DA  F "O3'" 1 
ATOM   2396 C  "C2'" . DA  D 2 25  ? 33.619 12.708  18.965 1.00 90.53  ? 57  DA  F "C2'" 1 
ATOM   2397 C  "C1'" . DA  D 2 25  ? 32.869 12.444  20.260 1.00 88.73  ? 57  DA  F "C1'" 1 
ATOM   2398 N  N9    . DA  D 2 25  ? 31.408 12.352  20.219 1.00 87.57  ? 57  DA  F N9    1 
ATOM   2399 C  C8    . DA  D 2 25  ? 30.509 12.937  19.357 1.00 86.96  ? 57  DA  F C8    1 
ATOM   2400 N  N7    . DA  D 2 25  ? 29.257 12.632  19.611 1.00 86.45  ? 57  DA  F N7    1 
ATOM   2401 C  C5    . DA  D 2 25  ? 29.335 11.791  20.713 1.00 87.62  ? 57  DA  F C5    1 
ATOM   2402 C  C6    . DA  D 2 25  ? 28.352 11.121  21.475 1.00 88.23  ? 57  DA  F C6    1 
ATOM   2403 N  N6    . DA  D 2 25  ? 27.039 11.193  21.232 1.00 88.49  ? 57  DA  F N6    1 
ATOM   2404 N  N1    . DA  D 2 25  ? 28.773 10.361  22.513 1.00 87.93  ? 57  DA  F N1    1 
ATOM   2405 C  C2    . DA  D 2 25  ? 30.089 10.285  22.761 1.00 87.93  ? 57  DA  F C2    1 
ATOM   2406 N  N3    . DA  D 2 25  ? 31.103 10.863  22.121 1.00 87.95  ? 57  DA  F N3    1 
ATOM   2407 C  C4    . DA  D 2 25  ? 30.654 11.611  21.097 1.00 87.69  ? 57  DA  F C4    1 
ATOM   2408 P  P     . DG  D 2 26  ? 36.670 11.550  18.976 1.00 92.62  ? 58  DG  F P     1 
ATOM   2409 O  OP1   . DG  D 2 26  ? 38.047 12.060  19.008 1.00 91.95  ? 58  DG  F OP1   1 
ATOM   2410 O  OP2   . DG  D 2 26  ? 35.980 11.452  17.680 1.00 93.82  ? 58  DG  F OP2   1 
ATOM   2411 O  "O5'" . DG  D 2 26  ? 36.655 10.122  19.684 1.00 89.45  ? 58  DG  F "O5'" 1 
ATOM   2412 C  "C5'" . DG  D 2 26  ? 37.183 9.973   21.011 1.00 86.09  ? 58  DG  F "C5'" 1 
ATOM   2413 C  "C4'" . DG  D 2 26  ? 36.901 8.593   21.565 1.00 85.36  ? 58  DG  F "C4'" 1 
ATOM   2414 O  "O4'" . DG  D 2 26  ? 35.475 8.451   21.806 1.00 84.72  ? 58  DG  F "O4'" 1 
ATOM   2415 C  "C3'" . DG  D 2 26  ? 37.245 7.465   20.593 1.00 85.03  ? 58  DG  F "C3'" 1 
ATOM   2416 O  "O3'" . DG  D 2 26  ? 37.674 6.301   21.318 1.00 86.20  ? 58  DG  F "O3'" 1 
ATOM   2417 C  "C2'" . DG  D 2 26  ? 35.956 7.286   19.804 1.00 83.20  ? 58  DG  F "C2'" 1 
ATOM   2418 C  "C1'" . DG  D 2 26  ? 34.893 7.554   20.862 1.00 82.08  ? 58  DG  F "C1'" 1 
ATOM   2419 N  N9    . DG  D 2 26  ? 33.629 8.118   20.391 1.00 80.08  ? 58  DG  F N9    1 
ATOM   2420 C  C8    . DG  D 2 26  ? 33.447 9.169   19.521 1.00 79.69  ? 58  DG  F C8    1 
ATOM   2421 N  N7    . DG  D 2 26  ? 32.187 9.426   19.284 1.00 78.74  ? 58  DG  F N7    1 
ATOM   2422 C  C5    . DG  D 2 26  ? 31.494 8.492   20.045 1.00 76.54  ? 58  DG  F C5    1 
ATOM   2423 C  C6    . DG  D 2 26  ? 30.090 8.277   20.198 1.00 72.99  ? 58  DG  F C6    1 
ATOM   2424 O  O6    . DG  D 2 26  ? 29.146 8.890   19.671 1.00 71.86  ? 58  DG  F O6    1 
ATOM   2425 N  N1    . DG  D 2 26  ? 29.829 7.224   21.068 1.00 72.05  ? 58  DG  F N1    1 
ATOM   2426 C  C2    . DG  D 2 26  ? 30.786 6.470   21.708 1.00 73.75  ? 58  DG  F C2    1 
ATOM   2427 N  N2    . DG  D 2 26  ? 30.340 5.491   22.513 1.00 73.65  ? 58  DG  F N2    1 
ATOM   2428 N  N3    . DG  D 2 26  ? 32.089 6.659   21.574 1.00 75.87  ? 58  DG  F N3    1 
ATOM   2429 C  C4    . DG  D 2 26  ? 32.369 7.678   20.735 1.00 77.96  ? 58  DG  F C4    1 
ATOM   2430 P  P     . DG  D 2 27  ? 37.633 4.846   20.625 1.00 87.64  ? 59  DG  F P     1 
ATOM   2431 O  OP1   . DG  D 2 27  ? 38.760 4.037   21.159 1.00 86.81  ? 59  DG  F OP1   1 
ATOM   2432 O  OP2   . DG  D 2 27  ? 37.473 4.993   19.155 1.00 89.11  ? 59  DG  F OP2   1 
ATOM   2433 O  "O5'" . DG  D 2 27  ? 36.287 4.232   21.202 1.00 84.93  ? 59  DG  F "O5'" 1 
ATOM   2434 C  "C5'" . DG  D 2 27  ? 36.125 4.063   22.619 1.00 82.93  ? 59  DG  F "C5'" 1 
ATOM   2435 C  "C4'" . DG  D 2 27  ? 35.315 2.822   22.907 1.00 80.25  ? 59  DG  F "C4'" 1 
ATOM   2436 O  "O4'" . DG  D 2 27  ? 33.948 3.070   22.503 1.00 79.72  ? 59  DG  F "O4'" 1 
ATOM   2437 C  "C3'" . DG  D 2 27  ? 35.758 1.607   22.100 1.00 78.27  ? 59  DG  F "C3'" 1 
ATOM   2438 O  "O3'" . DG  D 2 27  ? 35.505 0.401   22.836 1.00 77.25  ? 59  DG  F "O3'" 1 
ATOM   2439 C  "C2'" . DG  D 2 27  ? 34.949 1.745   20.819 1.00 77.37  ? 59  DG  F "C2'" 1 
ATOM   2440 C  "C1'" . DG  D 2 27  ? 33.636 2.354   21.314 1.00 76.74  ? 59  DG  F "C1'" 1 
ATOM   2441 N  N9    . DG  D 2 27  ? 32.977 3.287   20.401 1.00 72.48  ? 59  DG  F N9    1 
ATOM   2442 C  C8    . DG  D 2 27  ? 33.571 4.254   19.625 1.00 70.31  ? 59  DG  F C8    1 
ATOM   2443 N  N7    . DG  D 2 27  ? 32.716 4.934   18.912 1.00 69.80  ? 59  DG  F N7    1 
ATOM   2444 C  C5    . DG  D 2 27  ? 31.483 4.386   19.235 1.00 70.64  ? 59  DG  F C5    1 
ATOM   2445 C  C6    . DG  D 2 27  ? 30.178 4.714   18.772 1.00 70.99  ? 59  DG  F C6    1 
ATOM   2446 O  O6    . DG  D 2 27  ? 29.845 5.584   17.958 1.00 73.30  ? 59  DG  F O6    1 
ATOM   2447 N  N1    . DG  D 2 27  ? 29.207 3.908   19.357 1.00 69.74  ? 59  DG  F N1    1 
ATOM   2448 C  C2    . DG  D 2 27  ? 29.457 2.912   20.273 1.00 71.35  ? 59  DG  F C2    1 
ATOM   2449 N  N2    . DG  D 2 27  ? 28.386 2.238   20.730 1.00 71.62  ? 59  DG  F N2    1 
ATOM   2450 N  N3    . DG  D 2 27  ? 30.669 2.596   20.711 1.00 71.83  ? 59  DG  F N3    1 
ATOM   2451 C  C4    . DG  D 2 27  ? 31.626 3.369   20.154 1.00 71.16  ? 59  DG  F C4    1 
ATOM   2452 P  P     . DC  D 2 28  ? 36.152 -0.995  22.352 1.00 77.58  ? 60  DC  F P     1 
ATOM   2453 O  OP1   . DC  D 2 28  ? 36.691 -1.708  23.535 1.00 79.62  ? 60  DC  F OP1   1 
ATOM   2454 O  OP2   . DC  D 2 28  ? 37.037 -0.735  21.190 1.00 78.25  ? 60  DC  F OP2   1 
ATOM   2455 O  "O5'" . DC  D 2 28  ? 34.887 -1.798  21.820 1.00 75.71  ? 60  DC  F "O5'" 1 
ATOM   2456 C  "C5'" . DC  D 2 28  ? 33.855 -1.094  21.127 1.00 71.05  ? 60  DC  F "C5'" 1 
ATOM   2457 C  "C4'" . DC  D 2 28  ? 32.520 -1.777  21.289 1.00 68.02  ? 60  DC  F "C4'" 1 
ATOM   2458 O  "O4'" . DC  D 2 28  ? 31.512 -0.857  20.830 1.00 64.57  ? 60  DC  F "O4'" 1 
ATOM   2459 C  "C3'" . DC  D 2 28  ? 32.330 -3.031  20.450 1.00 68.97  ? 60  DC  F "C3'" 1 
ATOM   2460 O  "O3'" . DC  D 2 28  ? 31.364 -3.888  21.063 1.00 73.69  ? 60  DC  F "O3'" 1 
ATOM   2461 C  "C2'" . DC  D 2 28  ? 31.829 -2.472  19.132 1.00 64.73  ? 60  DC  F "C2'" 1 
ATOM   2462 C  "C1'" . DC  D 2 28  ? 31.008 -1.264  19.563 1.00 60.98  ? 60  DC  F "C1'" 1 
ATOM   2463 N  N1    . DC  D 2 28  ? 31.171 -0.122  18.653 1.00 54.29  ? 60  DC  F N1    1 
ATOM   2464 C  C2    . DC  D 2 28  ? 30.076 0.322   17.917 1.00 50.24  ? 60  DC  F C2    1 
ATOM   2465 O  O2    . DC  D 2 28  ? 28.991 -0.262  18.042 1.00 50.37  ? 60  DC  F O2    1 
ATOM   2466 N  N3    . DC  D 2 28  ? 30.224 1.375   17.084 1.00 48.26  ? 60  DC  F N3    1 
ATOM   2467 C  C4    . DC  D 2 28  ? 31.409 1.975   16.970 1.00 48.99  ? 60  DC  F C4    1 
ATOM   2468 N  N4    . DC  D 2 28  ? 31.509 3.010   16.132 1.00 49.09  ? 60  DC  F N4    1 
ATOM   2469 C  C5    . DC  D 2 28  ? 32.546 1.542   17.708 1.00 50.87  ? 60  DC  F C5    1 
ATOM   2470 C  C6    . DC  D 2 28  ? 32.385 0.500   18.532 1.00 53.10  ? 60  DC  F C6    1 
ATOM   2471 P  P     . DC  D 2 29  ? 30.850 -5.192  20.280 1.00 78.98  ? 61  DC  F P     1 
ATOM   2472 O  OP1   . DC  D 2 29  ? 30.103 -6.003  21.252 1.00 80.11  ? 61  DC  F OP1   1 
ATOM   2473 O  OP2   . DC  D 2 29  ? 31.987 -5.798  19.578 1.00 80.76  ? 61  DC  F OP2   1 
ATOM   2474 O  "O5'" . DC  D 2 29  ? 29.838 -4.617  19.187 1.00 77.73  ? 61  DC  F "O5'" 1 
ATOM   2475 C  "C5'" . DC  D 2 29  ? 28.511 -4.195  19.569 1.00 76.31  ? 61  DC  F "C5'" 1 
ATOM   2476 C  "C4'" . DC  D 2 29  ? 27.519 -4.419  18.446 1.00 73.32  ? 61  DC  F "C4'" 1 
ATOM   2477 O  "O4'" . DC  D 2 29  ? 27.595 -3.327  17.497 1.00 68.94  ? 61  DC  F "O4'" 1 
ATOM   2478 C  "C3'" . DC  D 2 29  ? 27.788 -5.677  17.619 1.00 72.13  ? 61  DC  F "C3'" 1 
ATOM   2479 O  "O3'" . DC  D 2 29  ? 26.553 -6.169  17.075 1.00 76.07  ? 61  DC  F "O3'" 1 
ATOM   2480 C  "C2'" . DC  D 2 29  ? 28.740 -5.175  16.545 1.00 67.13  ? 61  DC  F "C2'" 1 
ATOM   2481 C  "C1'" . DC  D 2 29  ? 28.198 -3.772  16.290 1.00 63.39  ? 61  DC  F "C1'" 1 
ATOM   2482 N  N1    . DC  D 2 29  ? 29.127 -2.725  15.817 1.00 56.11  ? 61  DC  F N1    1 
ATOM   2483 C  C2    . DC  D 2 29  ? 28.628 -1.733  14.950 1.00 52.52  ? 61  DC  F C2    1 
ATOM   2484 O  O2    . DC  D 2 29  ? 27.427 -1.765  14.615 1.00 49.93  ? 61  DC  F O2    1 
ATOM   2485 N  N3    . DC  D 2 29  ? 29.464 -0.768  14.500 1.00 50.56  ? 61  DC  F N3    1 
ATOM   2486 C  C4    . DC  D 2 29  ? 30.747 -0.763  14.875 1.00 49.26  ? 61  DC  F C4    1 
ATOM   2487 N  N4    . DC  D 2 29  ? 31.529 0.213   14.398 1.00 47.86  ? 61  DC  F N4    1 
ATOM   2488 C  C5    . DC  D 2 29  ? 31.282 -1.756  15.753 1.00 49.42  ? 61  DC  F C5    1 
ATOM   2489 C  C6    . DC  D 2 29  ? 30.444 -2.708  16.198 1.00 52.05  ? 61  DC  F C6    1 
ATOM   2490 P  P     . DC  D 2 30  ? 26.559 -7.374  16.003 1.00 80.95  ? 62  DC  F P     1 
ATOM   2491 O  OP1   . DC  D 2 30  ? 25.505 -8.325  16.397 1.00 81.90  ? 62  DC  F OP1   1 
ATOM   2492 O  OP2   . DC  D 2 30  ? 27.931 -7.878  15.824 1.00 82.69  ? 62  DC  F OP2   1 
ATOM   2493 O  "O5'" . DC  D 2 30  ? 26.119 -6.658  14.648 1.00 77.49  ? 62  DC  F "O5'" 1 
ATOM   2494 C  "C5'" . DC  D 2 30  ? 24.820 -6.049  14.527 1.00 76.10  ? 62  DC  F "C5'" 1 
ATOM   2495 C  "C4'" . DC  D 2 30  ? 24.507 -5.734  13.080 1.00 75.71  ? 62  DC  F "C4'" 1 
ATOM   2496 O  "O4'" . DC  D 2 30  ? 25.397 -4.688  12.622 1.00 72.74  ? 62  DC  F "O4'" 1 
ATOM   2497 C  "C3'" . DC  D 2 30  ? 24.790 -6.925  12.160 1.00 78.18  ? 62  DC  F "C3'" 1 
ATOM   2498 O  "O3'" . DC  D 2 30  ? 23.986 -6.858  10.977 1.00 83.22  ? 62  DC  F "O3'" 1 
ATOM   2499 C  "C2'" . DC  D 2 30  ? 26.251 -6.739  11.800 1.00 74.65  ? 62  DC  F "C2'" 1 
ATOM   2500 C  "C1'" . DC  D 2 30  ? 26.336 -5.226  11.706 1.00 70.01  ? 62  DC  F "C1'" 1 
ATOM   2501 N  N1    . DC  D 2 30  ? 27.643 -4.586  11.921 1.00 64.75  ? 62  DC  F N1    1 
ATOM   2502 C  C2    . DC  D 2 30  ? 27.917 -3.396  11.235 1.00 61.40  ? 62  DC  F C2    1 
ATOM   2503 O  O2    . DC  D 2 30  ? 27.046 -2.917  10.490 1.00 59.98  ? 62  DC  F O2    1 
ATOM   2504 N  N3    . DC  D 2 30  ? 29.121 -2.801  11.397 1.00 58.86  ? 62  DC  F N3    1 
ATOM   2505 C  C4    . DC  D 2 30  ? 30.033 -3.349  12.203 1.00 59.31  ? 62  DC  F C4    1 
ATOM   2506 N  N4    . DC  D 2 30  ? 31.210 -2.727  12.329 1.00 57.59  ? 62  DC  F N4    1 
ATOM   2507 C  C5    . DC  D 2 30  ? 29.780 -4.557  12.916 1.00 61.83  ? 62  DC  F C5    1 
ATOM   2508 C  C6    . DC  D 2 30  ? 28.582 -5.135  12.750 1.00 63.37  ? 62  DC  F C6    1 
ATOM   2509 P  P     . DG  D 2 31  ? 23.881 -8.140  10.005 1.00 88.17  ? 63  DG  F P     1 
ATOM   2510 O  OP1   . DG  D 2 31  ? 22.816 -9.000  10.545 1.00 90.06  ? 63  DG  F OP1   1 
ATOM   2511 O  OP2   . DG  D 2 31  ? 25.218 -8.717  9.797  1.00 88.70  ? 63  DG  F OP2   1 
ATOM   2512 O  "O5'" . DG  D 2 31  ? 23.391 -7.523  8.618  1.00 83.63  ? 63  DG  F "O5'" 1 
ATOM   2513 C  "C5'" . DG  D 2 31  ? 22.223 -6.682  8.565  1.00 78.34  ? 63  DG  F "C5'" 1 
ATOM   2514 C  "C4'" . DG  D 2 31  ? 22.377 -5.610  7.507  1.00 72.51  ? 63  DG  F "C4'" 1 
ATOM   2515 O  "O4'" . DG  D 2 31  ? 23.576 -4.846  7.780  1.00 68.47  ? 63  DG  F "O4'" 1 
ATOM   2516 C  "C3'" . DG  D 2 31  ? 22.571 -6.153  6.091  1.00 69.37  ? 63  DG  F "C3'" 1 
ATOM   2517 O  "O3'" . DG  D 2 31  ? 22.255 -5.129  5.141  1.00 69.98  ? 63  DG  F "O3'" 1 
ATOM   2518 C  "C2'" . DG  D 2 31  ? 24.073 -6.341  6.008  1.00 64.87  ? 63  DG  F "C2'" 1 
ATOM   2519 C  "C1'" . DG  D 2 31  ? 24.583 -5.159  6.825  1.00 60.45  ? 63  DG  F "C1'" 1 
ATOM   2520 N  N9    . DG  D 2 31  ? 25.832 -5.395  7.537  1.00 50.23  ? 63  DG  F N9    1 
ATOM   2521 C  C8    . DG  D 2 31  ? 26.146 -6.459  8.348  1.00 47.43  ? 63  DG  F C8    1 
ATOM   2522 N  N7    . DG  D 2 31  ? 27.356 -6.397  8.831  1.00 45.57  ? 63  DG  F N7    1 
ATOM   2523 C  C5    . DG  D 2 31  ? 27.872 -5.218  8.309  1.00 43.93  ? 63  DG  F C5    1 
ATOM   2524 C  C6    . DG  D 2 31  ? 29.153 -4.617  8.478  1.00 40.14  ? 63  DG  F C6    1 
ATOM   2525 O  O6    . DG  D 2 31  ? 30.114 -5.025  9.147  1.00 40.02  ? 63  DG  F O6    1 
ATOM   2526 N  N1    . DG  D 2 31  ? 29.255 -3.422  7.769  1.00 34.49  ? 63  DG  F N1    1 
ATOM   2527 C  C2    . DG  D 2 31  ? 28.255 -2.877  6.996  1.00 35.79  ? 63  DG  F C2    1 
ATOM   2528 N  N2    . DG  D 2 31  ? 28.538 -1.719  6.387  1.00 35.06  ? 63  DG  F N2    1 
ATOM   2529 N  N3    . DG  D 2 31  ? 27.060 -3.429  6.832  1.00 39.92  ? 63  DG  F N3    1 
ATOM   2530 C  C4    . DG  D 2 31  ? 26.940 -4.587  7.512  1.00 44.40  ? 63  DG  F C4    1 
ATOM   2531 N  N     . TYR E 3 10  ? 52.772 68.657  6.968  1.00 67.21  ? 10  TYR A N     1 
ATOM   2532 C  CA    . TYR E 3 10  ? 53.211 68.501  8.348  1.00 66.68  ? 10  TYR A CA    1 
ATOM   2533 C  C     . TYR E 3 10  ? 52.058 68.088  9.259  1.00 62.04  ? 10  TYR A C     1 
ATOM   2534 O  O     . TYR E 3 10  ? 51.451 67.037  9.061  1.00 63.02  ? 10  TYR A O     1 
ATOM   2535 C  CB    . TYR E 3 10  ? 53.838 69.804  8.851  1.00 72.36  ? 10  TYR A CB    1 
ATOM   2536 C  CG    . TYR E 3 10  ? 53.076 71.058  8.477  1.00 78.58  ? 10  TYR A CG    1 
ATOM   2537 C  CD1   . TYR E 3 10  ? 53.241 71.654  7.225  1.00 81.43  ? 10  TYR A CD1   1 
ATOM   2538 C  CD2   . TYR E 3 10  ? 52.217 71.672  9.389  1.00 81.84  ? 10  TYR A CD2   1 
ATOM   2539 C  CE1   . TYR E 3 10  ? 52.568 72.835  6.893  1.00 84.20  ? 10  TYR A CE1   1 
ATOM   2540 C  CE2   . TYR E 3 10  ? 51.540 72.850  9.069  1.00 84.12  ? 10  TYR A CE2   1 
ATOM   2541 C  CZ    . TYR E 3 10  ? 51.720 73.427  7.822  1.00 85.47  ? 10  TYR A CZ    1 
ATOM   2542 O  OH    . TYR E 3 10  ? 51.058 74.598  7.513  1.00 86.66  ? 10  TYR A OH    1 
ATOM   2543 N  N     . LYS E 3 11  ? 51.761 68.912  10.259 1.00 56.37  ? 11  LYS A N     1 
ATOM   2544 C  CA    . LYS E 3 11  ? 50.682 68.625  11.197 1.00 50.03  ? 11  LYS A CA    1 
ATOM   2545 C  C     . LYS E 3 11  ? 49.872 69.877  11.490 1.00 46.33  ? 11  LYS A C     1 
ATOM   2546 O  O     . LYS E 3 11  ? 50.127 70.594  12.456 1.00 42.05  ? 11  LYS A O     1 
ATOM   2547 C  CB    . LYS E 3 11  ? 51.248 68.047  12.499 1.00 47.90  ? 11  LYS A CB    1 
ATOM   2548 C  CG    . LYS E 3 11  ? 52.030 66.753  12.296 1.00 47.87  ? 11  LYS A CG    1 
ATOM   2549 C  CD    . LYS E 3 11  ? 51.482 65.609  13.143 1.00 47.47  ? 11  LYS A CD    1 
ATOM   2550 C  CE    . LYS E 3 11  ? 52.257 64.312  12.900 1.00 45.98  ? 11  LYS A CE    1 
ATOM   2551 N  NZ    . LYS E 3 11  ? 53.159 63.963  14.040 1.00 43.20  ? 11  LYS A NZ    1 
ATOM   2552 N  N     . ARG E 3 12  ? 48.890 70.126  10.636 1.00 49.06  ? 12  ARG A N     1 
ATOM   2553 C  CA    . ARG E 3 12  ? 48.023 71.285  10.764 1.00 50.08  ? 12  ARG A CA    1 
ATOM   2554 C  C     . ARG E 3 12  ? 47.398 71.392  12.148 1.00 45.90  ? 12  ARG A C     1 
ATOM   2555 O  O     . ARG E 3 12  ? 47.831 72.199  12.966 1.00 48.10  ? 12  ARG A O     1 
ATOM   2556 C  CB    . ARG E 3 12  ? 46.918 71.222  9.707  1.00 53.89  ? 12  ARG A CB    1 
ATOM   2557 C  CG    . ARG E 3 12  ? 47.185 72.053  8.458  1.00 57.96  ? 12  ARG A CG    1 
ATOM   2558 C  CD    . ARG E 3 12  ? 48.558 71.766  7.847  1.00 60.36  ? 12  ARG A CD    1 
ATOM   2559 N  NE    . ARG E 3 12  ? 48.646 70.430  7.257  1.00 61.46  ? 12  ARG A NE    1 
ATOM   2560 C  CZ    . ARG E 3 12  ? 49.341 70.133  6.161  1.00 61.26  ? 12  ARG A CZ    1 
ATOM   2561 N  NH1   . ARG E 3 12  ? 50.020 71.075  5.518  1.00 61.42  ? 12  ARG A NH1   1 
ATOM   2562 N  NH2   . ARG E 3 12  ? 49.357 68.888  5.707  1.00 60.20  ? 12  ARG A NH2   1 
ATOM   2563 N  N     . TYR E 3 13  ? 46.384 70.569  12.399 1.00 37.07  ? 13  TYR A N     1 
ATOM   2564 C  CA    . TYR E 3 13  ? 45.668 70.572  13.671 1.00 30.45  ? 13  TYR A CA    1 
ATOM   2565 C  C     . TYR E 3 13  ? 46.546 70.571  14.924 1.00 28.64  ? 13  TYR A C     1 
ATOM   2566 O  O     . TYR E 3 13  ? 47.452 69.745  15.073 1.00 29.91  ? 13  TYR A O     1 
ATOM   2567 C  CB    . TYR E 3 13  ? 44.700 69.398  13.691 1.00 23.95  ? 13  TYR A CB    1 
ATOM   2568 C  CG    . TYR E 3 13  ? 43.955 69.307  12.404 1.00 18.31  ? 13  TYR A CG    1 
ATOM   2569 C  CD1   . TYR E 3 13  ? 42.892 70.160  12.140 1.00 18.43  ? 13  TYR A CD1   1 
ATOM   2570 C  CD2   . TYR E 3 13  ? 44.351 68.420  11.415 1.00 18.98  ? 13  TYR A CD2   1 
ATOM   2571 C  CE1   . TYR E 3 13  ? 42.243 70.139  10.921 1.00 17.68  ? 13  TYR A CE1   1 
ATOM   2572 C  CE2   . TYR E 3 13  ? 43.709 68.388  10.191 1.00 19.23  ? 13  TYR A CE2   1 
ATOM   2573 C  CZ    . TYR E 3 13  ? 42.659 69.254  9.952  1.00 18.37  ? 13  TYR A CZ    1 
ATOM   2574 O  OH    . TYR E 3 13  ? 42.043 69.256  8.736  1.00 21.54  ? 13  TYR A OH    1 
ATOM   2575 N  N     . ILE E 3 14  ? 46.254 71.506  15.827 1.00 21.96  ? 14  ILE A N     1 
ATOM   2576 C  CA    . ILE E 3 14  ? 47.006 71.656  17.062 1.00 16.60  ? 14  ILE A CA    1 
ATOM   2577 C  C     . ILE E 3 14  ? 46.135 72.042  18.254 1.00 12.48  ? 14  ILE A C     1 
ATOM   2578 O  O     . ILE E 3 14  ? 45.135 72.760  18.123 1.00 6.31   ? 14  ILE A O     1 
ATOM   2579 C  CB    . ILE E 3 14  ? 48.147 72.728  16.901 1.00 19.17  ? 14  ILE A CB    1 
ATOM   2580 C  CG1   . ILE E 3 14  ? 47.896 73.923  17.822 1.00 18.14  ? 14  ILE A CG1   1 
ATOM   2581 C  CG2   . ILE E 3 14  ? 48.221 73.229  15.466 1.00 18.28  ? 14  ILE A CG2   1 
ATOM   2582 C  CD1   . ILE E 3 14  ? 48.621 73.824  19.152 1.00 21.32  ? 14  ILE A CD1   1 
ATOM   2583 N  N     . CYS E 3 15  ? 46.550 71.573  19.426 1.00 14.16  ? 15  CYS A N     1 
ATOM   2584 C  CA    . CYS E 3 15  ? 45.845 71.851  20.670 1.00 15.35  ? 15  CYS A CA    1 
ATOM   2585 C  C     . CYS E 3 15  ? 45.318 73.277  20.691 1.00 13.41  ? 15  CYS A C     1 
ATOM   2586 O  O     . CYS E 3 15  ? 45.892 74.163  20.077 1.00 11.09  ? 15  CYS A O     1 
ATOM   2587 C  CB    . CYS E 3 15  ? 46.769 71.625  21.871 1.00 14.50  ? 15  CYS A CB    1 
ATOM   2588 S  SG    . CYS E 3 15  ? 45.885 71.422  23.439 1.00 15.86  ? 15  CYS A SG    1 
ATOM   2589 N  N     . SER E 3 16  ? 44.208 73.481  21.392 1.00 17.15  ? 16  SER A N     1 
ATOM   2590 C  CA    . SER E 3 16  ? 43.593 74.797  21.495 1.00 19.46  ? 16  SER A CA    1 
ATOM   2591 C  C     . SER E 3 16  ? 44.065 75.483  22.765 1.00 21.57  ? 16  SER A C     1 
ATOM   2592 O  O     . SER E 3 16  ? 44.039 76.708  22.884 1.00 24.55  ? 16  SER A O     1 
ATOM   2593 C  CB    . SER E 3 16  ? 42.075 74.664  21.509 1.00 17.94  ? 16  SER A CB    1 
ATOM   2594 O  OG    . SER E 3 16  ? 41.638 73.889  20.408 1.00 20.86  ? 16  SER A OG    1 
ATOM   2595 N  N     . PHE E 3 17  ? 44.499 74.682  23.722 1.00 23.19  ? 17  PHE A N     1 
ATOM   2596 C  CA    . PHE E 3 17  ? 44.988 75.230  24.969 1.00 23.40  ? 17  PHE A CA    1 
ATOM   2597 C  C     . PHE E 3 17  ? 46.427 75.679  24.750 1.00 27.83  ? 17  PHE A C     1 
ATOM   2598 O  O     . PHE E 3 17  ? 47.116 75.186  23.851 1.00 29.46  ? 17  PHE A O     1 
ATOM   2599 C  CB    . PHE E 3 17  ? 44.903 74.165  26.066 1.00 15.80  ? 17  PHE A CB    1 
ATOM   2600 C  CG    . PHE E 3 17  ? 43.501 73.858  26.489 1.00 9.16   ? 17  PHE A CG    1 
ATOM   2601 C  CD1   . PHE E 3 17  ? 42.631 73.224  25.623 1.00 8.62   ? 17  PHE A CD1   1 
ATOM   2602 C  CD2   . PHE E 3 17  ? 43.034 74.249  27.735 1.00 9.56   ? 17  PHE A CD2   1 
ATOM   2603 C  CE1   . PHE E 3 17  ? 41.313 72.985  25.986 1.00 9.08   ? 17  PHE A CE1   1 
ATOM   2604 C  CE2   . PHE E 3 17  ? 41.721 74.015  28.107 1.00 9.20   ? 17  PHE A CE2   1 
ATOM   2605 C  CZ    . PHE E 3 17  ? 40.857 73.381  27.227 1.00 9.51   ? 17  PHE A CZ    1 
ATOM   2606 N  N     . ALA E 3 18  ? 46.870 76.636  25.552 1.00 30.81  ? 18  ALA A N     1 
ATOM   2607 C  CA    . ALA E 3 18  ? 48.233 77.124  25.448 1.00 34.93  ? 18  ALA A CA    1 
ATOM   2608 C  C     . ALA E 3 18  ? 49.079 76.326  26.431 1.00 37.36  ? 18  ALA A C     1 
ATOM   2609 O  O     . ALA E 3 18  ? 48.625 76.026  27.535 1.00 35.06  ? 18  ALA A O     1 
ATOM   2610 C  CB    . ALA E 3 18  ? 48.288 78.606  25.786 1.00 35.06  ? 18  ALA A CB    1 
ATOM   2611 N  N     . ASP E 3 19  ? 50.297 75.986  26.009 1.00 41.69  ? 19  ASP A N     1 
ATOM   2612 C  CA    . ASP E 3 19  ? 51.266 75.227  26.808 1.00 46.29  ? 19  ASP A CA    1 
ATOM   2613 C  C     . ASP E 3 19  ? 51.354 73.760  26.389 1.00 48.99  ? 19  ASP A C     1 
ATOM   2614 O  O     . ASP E 3 19  ? 52.428 73.152  26.443 1.00 49.15  ? 19  ASP A O     1 
ATOM   2615 C  CB    . ASP E 3 19  ? 50.935 75.304  28.306 1.00 46.51  ? 19  ASP A CB    1 
ATOM   2616 C  CG    . ASP E 3 19  ? 51.613 76.478  28.999 1.00 47.81  ? 19  ASP A CG    1 
ATOM   2617 O  OD1   . ASP E 3 19  ? 51.499 77.622  28.503 1.00 46.48  ? 19  ASP A OD1   1 
ATOM   2618 O  OD2   . ASP E 3 19  ? 52.260 76.254  30.046 1.00 48.73  ? 19  ASP A OD2   1 
ATOM   2619 N  N     . CYS E 3 20  ? 50.220 73.201  25.972 1.00 49.90  ? 20  CYS A N     1 
ATOM   2620 C  CA    . CYS E 3 20  ? 50.140 71.804  25.552 1.00 46.81  ? 20  CYS A CA    1 
ATOM   2621 C  C     . CYS E 3 20  ? 51.110 71.513  24.413 1.00 44.59  ? 20  CYS A C     1 
ATOM   2622 O  O     . CYS E 3 20  ? 51.961 70.627  24.519 1.00 45.72  ? 20  CYS A O     1 
ATOM   2623 C  CB    . CYS E 3 20  ? 48.714 71.476  25.115 1.00 46.87  ? 20  CYS A CB    1 
ATOM   2624 S  SG    . CYS E 3 20  ? 48.593 70.031  24.070 1.00 48.84  ? 20  CYS A SG    1 
ATOM   2625 N  N     . GLY E 3 21  ? 50.963 72.255  23.321 1.00 40.76  ? 21  GLY A N     1 
ATOM   2626 C  CA    . GLY E 3 21  ? 51.844 72.087  22.177 1.00 37.35  ? 21  GLY A CA    1 
ATOM   2627 C  C     . GLY E 3 21  ? 51.566 70.912  21.262 1.00 32.08  ? 21  GLY A C     1 
ATOM   2628 O  O     . GLY E 3 21  ? 52.192 70.781  20.209 1.00 31.22  ? 21  GLY A O     1 
ATOM   2629 N  N     . ALA E 3 22  ? 50.631 70.056  21.653 1.00 29.54  ? 22  ALA A N     1 
ATOM   2630 C  CA    . ALA E 3 22  ? 50.297 68.890  20.846 1.00 28.09  ? 22  ALA A CA    1 
ATOM   2631 C  C     . ALA E 3 22  ? 49.912 69.335  19.454 1.00 22.55  ? 22  ALA A C     1 
ATOM   2632 O  O     . ALA E 3 22  ? 49.581 70.493  19.240 1.00 22.97  ? 22  ALA A O     1 
ATOM   2633 C  CB    . ALA E 3 22  ? 49.144 68.120  21.480 1.00 31.27  ? 22  ALA A CB    1 
ATOM   2634 N  N     . ALA E 3 23  ? 49.962 68.413  18.506 1.00 16.24  ? 23  ALA A N     1 
ATOM   2635 C  CA    . ALA E 3 23  ? 49.593 68.733  17.139 1.00 15.36  ? 23  ALA A CA    1 
ATOM   2636 C  C     . ALA E 3 23  ? 49.362 67.431  16.398 1.00 14.91  ? 23  ALA A C     1 
ATOM   2637 O  O     . ALA E 3 23  ? 50.095 66.453  16.592 1.00 14.93  ? 23  ALA A O     1 
ATOM   2638 C  CB    . ALA E 3 23  ? 50.682 69.538  16.475 1.00 19.43  ? 23  ALA A CB    1 
ATOM   2639 N  N     . TYR E 3 24  ? 48.337 67.419  15.551 1.00 11.57  ? 24  TYR A N     1 
ATOM   2640 C  CA    . TYR E 3 24  ? 47.976 66.216  14.818 1.00 9.14   ? 24  TYR A CA    1 
ATOM   2641 C  C     . TYR E 3 24  ? 47.735 66.490  13.347 1.00 9.04   ? 24  TYR A C     1 
ATOM   2642 O  O     . TYR E 3 24  ? 47.422 67.623  12.963 1.00 10.47  ? 24  TYR A O     1 
ATOM   2643 C  CB    . TYR E 3 24  ? 46.722 65.598  15.451 1.00 6.53   ? 24  TYR A CB    1 
ATOM   2644 C  CG    . TYR E 3 24  ? 46.875 65.325  16.928 1.00 4.15   ? 24  TYR A CG    1 
ATOM   2645 C  CD1   . TYR E 3 24  ? 47.397 64.115  17.381 1.00 3.97   ? 24  TYR A CD1   1 
ATOM   2646 C  CD2   . TYR E 3 24  ? 46.556 66.299  17.871 1.00 3.69   ? 24  TYR A CD2   1 
ATOM   2647 C  CE1   . TYR E 3 24  ? 47.605 63.884  18.741 1.00 8.45   ? 24  TYR A CE1   1 
ATOM   2648 C  CE2   . TYR E 3 24  ? 46.759 66.083  19.233 1.00 7.30   ? 24  TYR A CE2   1 
ATOM   2649 C  CZ    . TYR E 3 24  ? 47.287 64.873  19.664 1.00 11.91  ? 24  TYR A CZ    1 
ATOM   2650 O  OH    . TYR E 3 24  ? 47.507 64.659  21.012 1.00 14.60  ? 24  TYR A OH    1 
ATOM   2651 N  N     . ASN E 3 25  ? 47.889 65.446  12.531 1.00 6.64   ? 25  ASN A N     1 
ATOM   2652 C  CA    . ASN E 3 25  ? 47.691 65.540  11.086 1.00 7.05   ? 25  ASN A CA    1 
ATOM   2653 C  C     . ASN E 3 25  ? 46.337 64.948  10.730 1.00 7.45   ? 25  ASN A C     1 
ATOM   2654 O  O     . ASN E 3 25  ? 46.197 64.234  9.733  1.00 4.07   ? 25  ASN A O     1 
ATOM   2655 C  CB    . ASN E 3 25  ? 48.769 64.760  10.356 1.00 8.15   ? 25  ASN A CB    1 
ATOM   2656 C  CG    . ASN E 3 25  ? 48.557 63.282  10.460 1.00 11.19  ? 25  ASN A CG    1 
ATOM   2657 O  OD1   . ASN E 3 25  ? 48.875 62.675  11.477 1.00 16.26  ? 25  ASN A OD1   1 
ATOM   2658 N  ND2   . ASN E 3 25  ? 47.999 62.688  9.417  1.00 11.63  ? 25  ASN A ND2   1 
ATOM   2659 N  N     . LYS E 3 26  ? 45.348 65.255  11.560 1.00 6.86   ? 26  LYS A N     1 
ATOM   2660 C  CA    . LYS E 3 26  ? 43.997 64.774  11.381 1.00 6.73   ? 26  LYS A CA    1 
ATOM   2661 C  C     . LYS E 3 26  ? 43.148 65.368  12.488 1.00 12.96  ? 26  LYS A C     1 
ATOM   2662 O  O     . LYS E 3 26  ? 43.231 64.944  13.638 1.00 11.64  ? 26  LYS A O     1 
ATOM   2663 C  CB    . LYS E 3 26  ? 43.984 63.259  11.465 1.00 5.68   ? 26  LYS A CB    1 
ATOM   2664 C  CG    . LYS E 3 26  ? 43.303 62.592  10.292 1.00 8.58   ? 26  LYS A CG    1 
ATOM   2665 C  CD    . LYS E 3 26  ? 43.842 63.075  8.960  1.00 6.97   ? 26  LYS A CD    1 
ATOM   2666 C  CE    . LYS E 3 26  ? 44.473 61.937  8.187  1.00 9.10   ? 26  LYS A CE    1 
ATOM   2667 N  NZ    . LYS E 3 26  ? 43.529 61.295  7.227  1.00 6.76   ? 26  LYS A NZ    1 
ATOM   2668 N  N     . ASN E 3 27  ? 42.336 66.359  12.133 1.00 21.29  ? 27  ASN A N     1 
ATOM   2669 C  CA    . ASN E 3 27  ? 41.476 67.043  13.095 1.00 24.08  ? 27  ASN A CA    1 
ATOM   2670 C  C     . ASN E 3 27  ? 40.960 66.094  14.171 1.00 25.31  ? 27  ASN A C     1 
ATOM   2671 O  O     . ASN E 3 27  ? 40.990 66.428  15.354 1.00 28.64  ? 27  ASN A O     1 
ATOM   2672 C  CB    . ASN E 3 27  ? 40.299 67.723  12.366 1.00 25.34  ? 27  ASN A CB    1 
ATOM   2673 C  CG    . ASN E 3 27  ? 39.375 68.488  13.308 1.00 26.94  ? 27  ASN A CG    1 
ATOM   2674 O  OD1   . ASN E 3 27  ? 39.806 69.391  14.027 1.00 27.12  ? 27  ASN A OD1   1 
ATOM   2675 N  ND2   . ASN E 3 27  ? 38.093 68.127  13.302 1.00 26.95  ? 27  ASN A ND2   1 
ATOM   2676 N  N     . TRP E 3 28  ? 40.514 64.903  13.775 1.00 25.30  ? 28  TRP A N     1 
ATOM   2677 C  CA    . TRP E 3 28  ? 39.981 63.961  14.756 1.00 24.89  ? 28  TRP A CA    1 
ATOM   2678 C  C     . TRP E 3 28  ? 40.980 63.617  15.851 1.00 26.54  ? 28  TRP A C     1 
ATOM   2679 O  O     . TRP E 3 28  ? 40.611 63.485  17.023 1.00 29.45  ? 28  TRP A O     1 
ATOM   2680 C  CB    . TRP E 3 28  ? 39.455 62.688  14.074 1.00 17.72  ? 28  TRP A CB    1 
ATOM   2681 C  CG    . TRP E 3 28  ? 40.470 61.677  13.626 1.00 11.65  ? 28  TRP A CG    1 
ATOM   2682 C  CD1   . TRP E 3 28  ? 40.817 61.399  12.340 1.00 13.86  ? 28  TRP A CD1   1 
ATOM   2683 C  CD2   . TRP E 3 28  ? 41.151 60.714  14.438 1.00 5.45   ? 28  TRP A CD2   1 
ATOM   2684 N  NE1   . TRP E 3 28  ? 41.663 60.317  12.293 1.00 11.41  ? 28  TRP A NE1   1 
ATOM   2685 C  CE2   . TRP E 3 28  ? 41.883 59.878  13.570 1.00 7.79   ? 28  TRP A CE2   1 
ATOM   2686 C  CE3   . TRP E 3 28  ? 41.210 60.474  15.810 1.00 2.19   ? 28  TRP A CE3   1 
ATOM   2687 C  CZ2   . TRP E 3 28  ? 42.663 58.820  14.030 1.00 5.25   ? 28  TRP A CZ2   1 
ATOM   2688 C  CZ3   . TRP E 3 28  ? 41.982 59.424  16.264 1.00 4.64   ? 28  TRP A CZ3   1 
ATOM   2689 C  CH2   . TRP E 3 28  ? 42.699 58.609  15.377 1.00 3.69   ? 28  TRP A CH2   1 
ATOM   2690 N  N     . LYS E 3 29  ? 42.243 63.479  15.471 1.00 20.16  ? 29  LYS A N     1 
ATOM   2691 C  CA    . LYS E 3 29  ? 43.279 63.173  16.432 1.00 13.02  ? 29  LYS A CA    1 
ATOM   2692 C  C     . LYS E 3 29  ? 43.280 64.290  17.469 1.00 8.70   ? 29  LYS A C     1 
ATOM   2693 O  O     . LYS E 3 29  ? 43.206 64.042  18.671 1.00 8.67   ? 29  LYS A O     1 
ATOM   2694 C  CB    . LYS E 3 29  ? 44.634 63.099  15.734 1.00 14.87  ? 29  LYS A CB    1 
ATOM   2695 C  CG    . LYS E 3 29  ? 44.653 62.222  14.496 1.00 15.45  ? 29  LYS A CG    1 
ATOM   2696 C  CD    . LYS E 3 29  ? 45.565 61.029  14.700 1.00 18.31  ? 29  LYS A CD    1 
ATOM   2697 C  CE    . LYS E 3 29  ? 45.982 60.421  13.381 1.00 18.58  ? 29  LYS A CE    1 
ATOM   2698 N  NZ    . LYS E 3 29  ? 47.326 60.907  12.990 1.00 19.43  ? 29  LYS A NZ    1 
ATOM   2699 N  N     . LEU E 3 30  ? 43.363 65.529  17.009 1.00 5.11   ? 30  LEU A N     1 
ATOM   2700 C  CA    . LEU E 3 30  ? 43.357 66.643  17.941 1.00 9.44   ? 30  LEU A CA    1 
ATOM   2701 C  C     . LEU E 3 30  ? 42.098 66.554  18.755 1.00 15.07  ? 30  LEU A C     1 
ATOM   2702 O  O     . LEU E 3 30  ? 42.131 66.681  19.978 1.00 16.54  ? 30  LEU A O     1 
ATOM   2703 C  CB    . LEU E 3 30  ? 43.356 67.984  17.206 1.00 9.48   ? 30  LEU A CB    1 
ATOM   2704 C  CG    . LEU E 3 30  ? 43.681 69.238  18.026 1.00 3.84   ? 30  LEU A CG    1 
ATOM   2705 C  CD1   . LEU E 3 30  ? 43.599 70.445  17.130 1.00 3.26   ? 30  LEU A CD1   1 
ATOM   2706 C  CD2   . LEU E 3 30  ? 42.738 69.381  19.187 1.00 2.00   ? 30  LEU A CD2   1 
ATOM   2707 N  N     . GLN E 3 31  ? 40.987 66.338  18.052 1.00 20.26  ? 31  GLN A N     1 
ATOM   2708 C  CA    . GLN E 3 31  ? 39.666 66.246  18.666 1.00 24.17  ? 31  GLN A CA    1 
ATOM   2709 C  C     . GLN E 3 31  ? 39.582 65.280  19.841 1.00 24.07  ? 31  GLN A C     1 
ATOM   2710 O  O     . GLN E 3 31  ? 38.887 65.542  20.825 1.00 23.61  ? 31  GLN A O     1 
ATOM   2711 C  CB    . GLN E 3 31  ? 38.621 65.889  17.607 1.00 22.91  ? 31  GLN A CB    1 
ATOM   2712 C  CG    . GLN E 3 31  ? 37.880 67.114  17.086 1.00 24.68  ? 31  GLN A CG    1 
ATOM   2713 C  CD    . GLN E 3 31  ? 38.444 68.413  17.654 1.00 25.40  ? 31  GLN A CD    1 
ATOM   2714 O  OE1   . GLN E 3 31  ? 38.177 68.778  18.806 1.00 21.20  ? 31  GLN A OE1   1 
ATOM   2715 N  NE2   . GLN E 3 31  ? 39.236 69.111  16.847 1.00 26.39  ? 31  GLN A NE2   1 
ATOM   2716 N  N     . ALA E 3 32  ? 40.286 64.163  19.737 1.00 20.13  ? 32  ALA A N     1 
ATOM   2717 C  CA    . ALA E 3 32  ? 40.295 63.203  20.816 1.00 19.47  ? 32  ALA A CA    1 
ATOM   2718 C  C     . ALA E 3 32  ? 41.187 63.762  21.914 1.00 19.45  ? 32  ALA A C     1 
ATOM   2719 O  O     . ALA E 3 32  ? 40.882 63.636  23.098 1.00 20.23  ? 32  ALA A O     1 
ATOM   2720 C  CB    . ALA E 3 32  ? 40.832 61.884  20.326 1.00 24.06  ? 32  ALA A CB    1 
ATOM   2721 N  N     . HIS E 3 33  ? 42.293 64.381  21.513 1.00 20.34  ? 33  HIS A N     1 
ATOM   2722 C  CA    . HIS E 3 33  ? 43.227 64.963  22.467 1.00 21.09  ? 33  HIS A CA    1 
ATOM   2723 C  C     . HIS E 3 33  ? 42.503 66.039  23.262 1.00 24.65  ? 33  HIS A C     1 
ATOM   2724 O  O     . HIS E 3 33  ? 42.656 66.137  24.475 1.00 26.01  ? 33  HIS A O     1 
ATOM   2725 C  CB    . HIS E 3 33  ? 44.432 65.570  21.733 1.00 18.67  ? 33  HIS A CB    1 
ATOM   2726 C  CG    . HIS E 3 33  ? 45.179 66.599  22.531 1.00 16.95  ? 33  HIS A CG    1 
ATOM   2727 N  ND1   . HIS E 3 33  ? 46.206 66.309  23.402 1.00 15.72  ? 33  HIS A ND1   1 
ATOM   2728 C  CD2   . HIS E 3 33  ? 45.022 67.948  22.592 1.00 15.61  ? 33  HIS A CD2   1 
ATOM   2729 C  CE1   . HIS E 3 33  ? 46.623 67.468  23.949 1.00 13.33  ? 33  HIS A CE1   1 
ATOM   2730 N  NE2   . HIS E 3 33  ? 45.933 68.492  23.487 1.00 10.75  ? 33  HIS A NE2   1 
ATOM   2731 N  N     . LEU E 3 34  ? 41.707 66.842  22.568 1.00 26.64  ? 34  LEU A N     1 
ATOM   2732 C  CA    . LEU E 3 34  ? 40.971 67.910  23.219 1.00 30.22  ? 34  LEU A CA    1 
ATOM   2733 C  C     . LEU E 3 34  ? 40.146 67.358  24.365 1.00 28.73  ? 34  LEU A C     1 
ATOM   2734 O  O     . LEU E 3 34  ? 40.213 67.849  25.485 1.00 25.46  ? 34  LEU A O     1 
ATOM   2735 C  CB    . LEU E 3 34  ? 40.055 68.602  22.211 1.00 35.81  ? 34  LEU A CB    1 
ATOM   2736 C  CG    . LEU E 3 34  ? 40.625 69.795  21.437 1.00 39.69  ? 34  LEU A CG    1 
ATOM   2737 C  CD1   . LEU E 3 34  ? 39.475 70.558  20.779 1.00 40.37  ? 34  LEU A CD1   1 
ATOM   2738 C  CD2   . LEU E 3 34  ? 41.430 70.706  22.371 1.00 39.33  ? 34  LEU A CD2   1 
ATOM   2739 N  N     . CYS E 3 35  ? 39.368 66.325  24.074 1.00 33.11  ? 35  CYS A N     1 
ATOM   2740 C  CA    . CYS E 3 35  ? 38.517 65.706  25.076 1.00 37.58  ? 35  CYS A CA    1 
ATOM   2741 C  C     . CYS E 3 35  ? 39.314 65.361  26.318 1.00 37.24  ? 35  CYS A C     1 
ATOM   2742 O  O     . CYS E 3 35  ? 38.745 65.176  27.392 1.00 41.98  ? 35  CYS A O     1 
ATOM   2743 C  CB    . CYS E 3 35  ? 37.857 64.451  24.513 1.00 41.77  ? 35  CYS A CB    1 
ATOM   2744 S  SG    . CYS E 3 35  ? 36.984 64.735  22.953 1.00 49.27  ? 35  CYS A SG    1 
ATOM   2745 N  N     . LYS E 3 36  ? 40.631 65.259  26.173 1.00 30.86  ? 36  LYS A N     1 
ATOM   2746 C  CA    . LYS E 3 36  ? 41.471 64.974  27.321 1.00 26.45  ? 36  LYS A CA    1 
ATOM   2747 C  C     . LYS E 3 36  ? 41.388 66.214  28.197 1.00 26.23  ? 36  LYS A C     1 
ATOM   2748 O  O     . LYS E 3 36  ? 41.067 66.125  29.371 1.00 27.71  ? 36  LYS A O     1 
ATOM   2749 C  CB    . LYS E 3 36  ? 42.913 64.737  26.890 1.00 26.99  ? 36  LYS A CB    1 
ATOM   2750 C  CG    . LYS E 3 36  ? 43.799 64.142  27.970 1.00 28.79  ? 36  LYS A CG    1 
ATOM   2751 C  CD    . LYS E 3 36  ? 44.557 62.912  27.463 1.00 29.46  ? 36  LYS A CD    1 
ATOM   2752 C  CE    . LYS E 3 36  ? 46.043 62.981  27.822 1.00 29.62  ? 36  LYS A CE    1 
ATOM   2753 N  NZ    . LYS E 3 36  ? 46.949 62.623  26.683 1.00 28.47  ? 36  LYS A NZ    1 
ATOM   2754 N  N     . HIS E 3 37  ? 41.658 67.375  27.610 1.00 28.52  ? 37  HIS A N     1 
ATOM   2755 C  CA    . HIS E 3 37  ? 41.607 68.638  28.343 1.00 31.25  ? 37  HIS A CA    1 
ATOM   2756 C  C     . HIS E 3 37  ? 40.237 68.837  28.955 1.00 32.84  ? 37  HIS A C     1 
ATOM   2757 O  O     . HIS E 3 37  ? 40.105 69.027  30.160 1.00 30.98  ? 37  HIS A O     1 
ATOM   2758 C  CB    . HIS E 3 37  ? 41.881 69.816  27.410 1.00 32.25  ? 37  HIS A CB    1 
ATOM   2759 C  CG    . HIS E 3 37  ? 43.307 69.929  26.977 1.00 33.20  ? 37  HIS A CG    1 
ATOM   2760 N  ND1   . HIS E 3 37  ? 44.124 70.993  27.286 1.00 33.73  ? 37  HIS A ND1   1 
ATOM   2761 C  CD2   . HIS E 3 37  ? 44.060 69.093  26.219 1.00 33.50  ? 37  HIS A CD2   1 
ATOM   2762 C  CE1   . HIS E 3 37  ? 45.317 70.773  26.717 1.00 33.72  ? 37  HIS A CE1   1 
ATOM   2763 N  NE2   . HIS E 3 37  ? 45.325 69.630  26.060 1.00 33.38  ? 37  HIS A NE2   1 
ATOM   2764 N  N     . THR E 3 38  ? 39.221 68.802  28.100 1.00 39.76  ? 38  THR A N     1 
ATOM   2765 C  CA    . THR E 3 38  ? 37.835 68.991  28.516 1.00 46.16  ? 38  THR A CA    1 
ATOM   2766 C  C     . THR E 3 38  ? 37.367 67.919  29.490 1.00 49.67  ? 38  THR A C     1 
ATOM   2767 O  O     . THR E 3 38  ? 37.219 68.171  30.685 1.00 49.30  ? 38  THR A O     1 
ATOM   2768 C  CB    . THR E 3 38  ? 36.876 68.984  27.299 1.00 45.96  ? 38  THR A CB    1 
ATOM   2769 O  OG1   . THR E 3 38  ? 37.449 68.210  26.235 1.00 44.05  ? 38  THR A OG1   1 
ATOM   2770 C  CG2   . THR E 3 38  ? 36.622 70.403  26.814 1.00 45.28  ? 38  THR A CG2   1 
ATOM   2771 N  N     . GLY E 3 39  ? 37.140 66.720  28.967 1.00 53.19  ? 39  GLY A N     1 
ATOM   2772 C  CA    . GLY E 3 39  ? 36.676 65.626  29.796 1.00 57.36  ? 39  GLY A CA    1 
ATOM   2773 C  C     . GLY E 3 39  ? 35.306 65.216  29.308 1.00 60.65  ? 39  GLY A C     1 
ATOM   2774 O  O     . GLY E 3 39  ? 34.414 64.896  30.093 1.00 60.89  ? 39  GLY A O     1 
ATOM   2775 N  N     . GLU E 3 40  ? 35.150 65.229  27.990 1.00 63.91  ? 40  GLU A N     1 
ATOM   2776 C  CA    . GLU E 3 40  ? 33.890 64.876  27.360 1.00 68.16  ? 40  GLU A CA    1 
ATOM   2777 C  C     . GLU E 3 40  ? 33.736 63.385  27.114 1.00 67.34  ? 40  GLU A C     1 
ATOM   2778 O  O     . GLU E 3 40  ? 34.712 62.636  27.087 1.00 65.43  ? 40  GLU A O     1 
ATOM   2779 C  CB    . GLU E 3 40  ? 33.750 65.622  26.037 1.00 73.61  ? 40  GLU A CB    1 
ATOM   2780 C  CG    . GLU E 3 40  ? 33.480 67.107  26.198 1.00 78.59  ? 40  GLU A CG    1 
ATOM   2781 C  CD    . GLU E 3 40  ? 32.906 67.732  24.940 1.00 81.68  ? 40  GLU A CD    1 
ATOM   2782 O  OE1   . GLU E 3 40  ? 32.033 67.098  24.302 1.00 82.16  ? 40  GLU A OE1   1 
ATOM   2783 O  OE2   . GLU E 3 40  ? 33.329 68.857  24.590 1.00 82.82  ? 40  GLU A OE2   1 
ATOM   2784 N  N     . LYS E 3 41  ? 32.490 62.969  26.924 1.00 68.48  ? 41  LYS A N     1 
ATOM   2785 C  CA    . LYS E 3 41  ? 32.170 61.574  26.670 1.00 70.01  ? 41  LYS A CA    1 
ATOM   2786 C  C     . LYS E 3 41  ? 31.442 61.465  25.332 1.00 66.22  ? 41  LYS A C     1 
ATOM   2787 O  O     . LYS E 3 41  ? 30.290 61.038  25.267 1.00 66.78  ? 41  LYS A O     1 
ATOM   2788 C  CB    . LYS E 3 41  ? 31.288 61.022  27.797 1.00 75.60  ? 41  LYS A CB    1 
ATOM   2789 C  CG    . LYS E 3 41  ? 31.081 61.979  28.973 1.00 80.40  ? 41  LYS A CG    1 
ATOM   2790 C  CD    . LYS E 3 41  ? 30.845 61.222  30.281 1.00 83.56  ? 41  LYS A CD    1 
ATOM   2791 C  CE    . LYS E 3 41  ? 29.414 61.402  30.785 1.00 84.60  ? 41  LYS A CE    1 
ATOM   2792 N  NZ    . LYS E 3 41  ? 28.947 60.248  31.607 1.00 84.48  ? 41  LYS A NZ    1 
ATOM   2793 N  N     . PRO E 3 42  ? 32.113 61.857  24.242 1.00 61.41  ? 42  PRO A N     1 
ATOM   2794 C  CA    . PRO E 3 42  ? 31.511 61.797  22.909 1.00 56.64  ? 42  PRO A CA    1 
ATOM   2795 C  C     . PRO E 3 42  ? 30.989 60.411  22.569 1.00 52.10  ? 42  PRO A C     1 
ATOM   2796 O  O     . PRO E 3 42  ? 30.232 60.236  21.617 1.00 50.57  ? 42  PRO A O     1 
ATOM   2797 C  CB    . PRO E 3 42  ? 32.647 62.222  21.984 1.00 58.14  ? 42  PRO A CB    1 
ATOM   2798 C  CG    . PRO E 3 42  ? 33.558 63.017  22.849 1.00 59.52  ? 42  PRO A CG    1 
ATOM   2799 C  CD    . PRO E 3 42  ? 33.489 62.379  24.197 1.00 61.24  ? 42  PRO A CD    1 
ATOM   2800 N  N     . PHE E 3 43  ? 31.402 59.422  23.348 1.00 50.32  ? 43  PHE A N     1 
ATOM   2801 C  CA    . PHE E 3 43  ? 30.963 58.060  23.104 1.00 51.54  ? 43  PHE A CA    1 
ATOM   2802 C  C     . PHE E 3 43  ? 30.763 57.277  24.397 1.00 54.04  ? 43  PHE A C     1 
ATOM   2803 O  O     . PHE E 3 43  ? 31.654 56.548  24.837 1.00 56.81  ? 43  PHE A O     1 
ATOM   2804 C  CB    . PHE E 3 43  ? 31.976 57.333  22.222 1.00 51.46  ? 43  PHE A CB    1 
ATOM   2805 C  CG    . PHE E 3 43  ? 32.320 58.063  20.954 1.00 52.93  ? 43  PHE A CG    1 
ATOM   2806 C  CD1   . PHE E 3 43  ? 33.359 58.987  20.927 1.00 53.27  ? 43  PHE A CD1   1 
ATOM   2807 C  CD2   . PHE E 3 43  ? 31.627 57.803  19.776 1.00 54.16  ? 43  PHE A CD2   1 
ATOM   2808 C  CE1   . PHE E 3 43  ? 33.709 59.639  19.741 1.00 53.12  ? 43  PHE A CE1   1 
ATOM   2809 C  CE2   . PHE E 3 43  ? 31.968 58.449  18.587 1.00 54.33  ? 43  PHE A CE2   1 
ATOM   2810 C  CZ    . PHE E 3 43  ? 33.013 59.368  18.571 1.00 53.50  ? 43  PHE A CZ    1 
ATOM   2811 N  N     . PRO E 3 44  ? 29.595 57.429  25.036 1.00 54.27  ? 44  PRO A N     1 
ATOM   2812 C  CA    . PRO E 3 44  ? 29.339 56.701  26.277 1.00 56.34  ? 44  PRO A CA    1 
ATOM   2813 C  C     . PRO E 3 44  ? 28.662 55.370  25.962 1.00 60.74  ? 44  PRO A C     1 
ATOM   2814 O  O     . PRO E 3 44  ? 28.249 55.133  24.826 1.00 59.17  ? 44  PRO A O     1 
ATOM   2815 C  CB    . PRO E 3 44  ? 28.430 57.645  27.060 1.00 53.93  ? 44  PRO A CB    1 
ATOM   2816 C  CG    . PRO E 3 44  ? 27.826 58.580  26.016 1.00 51.97  ? 44  PRO A CG    1 
ATOM   2817 C  CD    . PRO E 3 44  ? 28.458 58.287  24.679 1.00 53.14  ? 44  PRO A CD    1 
ATOM   2818 N  N     . CYS E 3 45  ? 28.560 54.501  26.962 1.00 66.55  ? 45  CYS A N     1 
ATOM   2819 C  CA    . CYS E 3 45  ? 27.922 53.201  26.777 1.00 72.03  ? 45  CYS A CA    1 
ATOM   2820 C  C     . CYS E 3 45  ? 26.408 53.349  26.865 1.00 77.10  ? 45  CYS A C     1 
ATOM   2821 O  O     . CYS E 3 45  ? 25.899 54.407  27.232 1.00 77.45  ? 45  CYS A O     1 
ATOM   2822 C  CB    . CYS E 3 45  ? 28.403 52.211  27.843 1.00 71.47  ? 45  CYS A CB    1 
ATOM   2823 S  SG    . CYS E 3 45  ? 28.084 50.471  27.446 1.00 70.53  ? 45  CYS A SG    1 
ATOM   2824 N  N     . LYS E 3 46  ? 25.690 52.284  26.531 1.00 82.47  ? 46  LYS A N     1 
ATOM   2825 C  CA    . LYS E 3 46  ? 24.234 52.310  26.570 1.00 86.35  ? 46  LYS A CA    1 
ATOM   2826 C  C     . LYS E 3 46  ? 23.671 51.275  27.543 1.00 87.69  ? 46  LYS A C     1 
ATOM   2827 O  O     . LYS E 3 46  ? 22.976 50.342  27.143 1.00 89.03  ? 46  LYS A O     1 
ATOM   2828 C  CB    . LYS E 3 46  ? 23.676 52.066  25.164 1.00 87.76  ? 46  LYS A CB    1 
ATOM   2829 C  CG    . LYS E 3 46  ? 23.865 53.234  24.211 1.00 87.95  ? 46  LYS A CG    1 
ATOM   2830 C  CD    . LYS E 3 46  ? 25.152 53.089  23.417 1.00 88.66  ? 46  LYS A CD    1 
ATOM   2831 C  CE    . LYS E 3 46  ? 25.146 53.981  22.184 1.00 89.35  ? 46  LYS A CE    1 
ATOM   2832 N  NZ    . LYS E 3 46  ? 25.685 55.343  22.473 1.00 89.76  ? 46  LYS A NZ    1 
ATOM   2833 N  N     . GLU E 3 47  ? 23.990 51.438  28.821 1.00 88.33  ? 47  GLU A N     1 
ATOM   2834 C  CA    . GLU E 3 47  ? 23.512 50.533  29.861 1.00 90.36  ? 47  GLU A CA    1 
ATOM   2835 C  C     . GLU E 3 47  ? 23.834 51.122  31.228 1.00 91.57  ? 47  GLU A C     1 
ATOM   2836 O  O     . GLU E 3 47  ? 24.906 51.690  31.432 1.00 91.53  ? 47  GLU A O     1 
ATOM   2837 C  CB    . GLU E 3 47  ? 24.157 49.145  29.733 1.00 90.64  ? 47  GLU A CB    1 
ATOM   2838 C  CG    . GLU E 3 47  ? 25.201 49.003  28.634 1.00 91.32  ? 47  GLU A CG    1 
ATOM   2839 C  CD    . GLU E 3 47  ? 24.763 48.055  27.531 1.00 91.42  ? 47  GLU A CD    1 
ATOM   2840 O  OE1   . GLU E 3 47  ? 24.403 46.901  27.847 1.00 90.94  ? 47  GLU A OE1   1 
ATOM   2841 O  OE2   . GLU E 3 47  ? 24.777 48.463  26.350 1.00 91.50  ? 47  GLU A OE2   1 
ATOM   2842 N  N     . GLU E 3 48  ? 22.901 50.987  32.165 1.00 92.59  ? 48  GLU A N     1 
ATOM   2843 C  CA    . GLU E 3 48  ? 23.095 51.521  33.505 1.00 93.45  ? 48  GLU A CA    1 
ATOM   2844 C  C     . GLU E 3 48  ? 24.326 50.940  34.176 1.00 93.50  ? 48  GLU A C     1 
ATOM   2845 O  O     . GLU E 3 48  ? 24.944 50.006  33.664 1.00 92.90  ? 48  GLU A O     1 
ATOM   2846 C  CB    . GLU E 3 48  ? 21.865 51.242  34.365 1.00 95.21  ? 48  GLU A CB    1 
ATOM   2847 C  CG    . GLU E 3 48  ? 20.918 52.420  34.468 1.00 97.54  ? 48  GLU A CG    1 
ATOM   2848 C  CD    . GLU E 3 48  ? 20.268 52.763  33.139 1.00 99.67  ? 48  GLU A CD    1 
ATOM   2849 O  OE1   . GLU E 3 48  ? 21.002 52.955  32.144 1.00 100.00 ? 48  GLU A OE1   1 
ATOM   2850 O  OE2   . GLU E 3 48  ? 19.022 52.841  33.087 1.00 100.00 ? 48  GLU A OE2   1 
ATOM   2851 N  N     . GLY E 3 49  ? 24.677 51.504  35.327 1.00 94.57  ? 49  GLY A N     1 
ATOM   2852 C  CA    . GLY E 3 49  ? 25.833 51.024  36.059 1.00 97.53  ? 49  GLY A CA    1 
ATOM   2853 C  C     . GLY E 3 49  ? 27.158 51.358  35.398 1.00 98.85  ? 49  GLY A C     1 
ATOM   2854 O  O     . GLY E 3 49  ? 28.183 51.458  36.076 1.00 100.00 ? 49  GLY A O     1 
ATOM   2855 N  N     . CYS E 3 50  ? 27.149 51.527  34.078 1.00 97.47  ? 50  CYS A N     1 
ATOM   2856 C  CA    . CYS E 3 50  ? 28.373 51.855  33.355 1.00 94.30  ? 50  CYS A CA    1 
ATOM   2857 C  C     . CYS E 3 50  ? 28.450 53.339  33.029 1.00 94.15  ? 50  CYS A C     1 
ATOM   2858 O  O     . CYS E 3 50  ? 27.545 53.903  32.409 1.00 94.01  ? 50  CYS A O     1 
ATOM   2859 C  CB    . CYS E 3 50  ? 28.472 51.048  32.059 1.00 91.29  ? 50  CYS A CB    1 
ATOM   2860 S  SG    . CYS E 3 50  ? 30.085 51.173  31.249 1.00 85.80  ? 50  CYS A SG    1 
ATOM   2861 N  N     . GLU E 3 51  ? 29.538 53.965  33.458 1.00 93.42  ? 51  GLU A N     1 
ATOM   2862 C  CA    . GLU E 3 51  ? 29.754 55.381  33.214 1.00 92.42  ? 51  GLU A CA    1 
ATOM   2863 C  C     . GLU E 3 51  ? 31.011 55.560  32.369 1.00 89.68  ? 51  GLU A C     1 
ATOM   2864 O  O     . GLU E 3 51  ? 31.587 56.646  32.306 1.00 91.03  ? 51  GLU A O     1 
ATOM   2865 C  CB    . GLU E 3 51  ? 29.899 56.126  34.543 1.00 94.69  ? 51  GLU A CB    1 
ATOM   2866 C  CG    . GLU E 3 51  ? 29.426 57.573  34.498 1.00 97.56  ? 51  GLU A CG    1 
ATOM   2867 C  CD    . GLU E 3 51  ? 27.926 57.713  34.705 1.00 98.63  ? 51  GLU A CD    1 
ATOM   2868 O  OE1   . GLU E 3 51  ? 27.366 56.977  35.546 1.00 98.75  ? 51  GLU A OE1   1 
ATOM   2869 O  OE2   . GLU E 3 51  ? 27.309 58.562  34.025 1.00 99.11  ? 51  GLU A OE2   1 
ATOM   2870 N  N     . LYS E 3 52  ? 31.428 54.485  31.713 1.00 85.19  ? 52  LYS A N     1 
ATOM   2871 C  CA    . LYS E 3 52  ? 32.614 54.521  30.875 1.00 81.44  ? 52  LYS A CA    1 
ATOM   2872 C  C     . LYS E 3 52  ? 32.427 55.443  29.675 1.00 78.47  ? 52  LYS A C     1 
ATOM   2873 O  O     . LYS E 3 52  ? 31.406 55.388  28.987 1.00 78.04  ? 52  LYS A O     1 
ATOM   2874 C  CB    . LYS E 3 52  ? 32.954 53.109  30.400 1.00 82.71  ? 52  LYS A CB    1 
ATOM   2875 C  CG    . LYS E 3 52  ? 33.622 52.253  31.461 1.00 83.91  ? 52  LYS A CG    1 
ATOM   2876 C  CD    . LYS E 3 52  ? 35.014 52.774  31.788 1.00 84.17  ? 52  LYS A CD    1 
ATOM   2877 C  CE    . LYS E 3 52  ? 35.321 52.652  33.271 1.00 83.91  ? 52  LYS A CE    1 
ATOM   2878 N  NZ    . LYS E 3 52  ? 36.677 53.173  33.601 1.00 83.17  ? 52  LYS A NZ    1 
ATOM   2879 N  N     . GLY E 3 53  ? 33.423 56.290  29.432 1.00 74.81  ? 53  GLY A N     1 
ATOM   2880 C  CA    . GLY E 3 53  ? 33.367 57.211  28.310 1.00 68.40  ? 53  GLY A CA    1 
ATOM   2881 C  C     . GLY E 3 53  ? 34.493 56.958  27.327 1.00 60.63  ? 53  GLY A C     1 
ATOM   2882 O  O     . GLY E 3 53  ? 35.433 56.228  27.631 1.00 59.04  ? 53  GLY A O     1 
ATOM   2883 N  N     . PHE E 3 54  ? 34.406 57.559  26.147 1.00 56.31  ? 54  PHE A N     1 
ATOM   2884 C  CA    . PHE E 3 54  ? 35.432 57.374  25.128 1.00 55.12  ? 54  PHE A CA    1 
ATOM   2885 C  C     . PHE E 3 54  ? 35.521 58.550  24.155 1.00 54.54  ? 54  PHE A C     1 
ATOM   2886 O  O     . PHE E 3 54  ? 34.792 59.534  24.286 1.00 55.57  ? 54  PHE A O     1 
ATOM   2887 C  CB    . PHE E 3 54  ? 35.155 56.091  24.346 1.00 55.66  ? 54  PHE A CB    1 
ATOM   2888 C  CG    . PHE E 3 54  ? 35.236 54.846  25.177 1.00 53.52  ? 54  PHE A CG    1 
ATOM   2889 C  CD1   . PHE E 3 54  ? 36.452 54.201  25.369 1.00 53.18  ? 54  PHE A CD1   1 
ATOM   2890 C  CD2   . PHE E 3 54  ? 34.097 54.311  25.759 1.00 51.25  ? 54  PHE A CD2   1 
ATOM   2891 C  CE1   . PHE E 3 54  ? 36.531 53.045  26.125 1.00 52.38  ? 54  PHE A CE1   1 
ATOM   2892 C  CE2   . PHE E 3 54  ? 34.167 53.155  26.518 1.00 51.93  ? 54  PHE A CE2   1 
ATOM   2893 C  CZ    . PHE E 3 54  ? 35.384 52.520  26.701 1.00 52.12  ? 54  PHE A CZ    1 
ATOM   2894 N  N     . THR E 3 55  ? 36.411 58.436  23.172 1.00 52.70  ? 55  THR A N     1 
ATOM   2895 C  CA    . THR E 3 55  ? 36.604 59.492  22.185 1.00 52.11  ? 55  THR A CA    1 
ATOM   2896 C  C     . THR E 3 55  ? 36.769 58.943  20.772 1.00 53.29  ? 55  THR A C     1 
ATOM   2897 O  O     . THR E 3 55  ? 37.568 59.452  19.984 1.00 50.62  ? 55  THR A O     1 
ATOM   2898 C  CB    . THR E 3 55  ? 37.839 60.331  22.526 1.00 52.00  ? 55  THR A CB    1 
ATOM   2899 O  OG1   . THR E 3 55  ? 38.845 59.481  23.086 1.00 54.07  ? 55  THR A OG1   1 
ATOM   2900 C  CG2   . THR E 3 55  ? 37.489 61.405  23.531 1.00 50.37  ? 55  THR A CG2   1 
ATOM   2901 N  N     . SER E 3 56  ? 36.005 57.898  20.469 1.00 56.99  ? 56  SER A N     1 
ATOM   2902 C  CA    . SER E 3 56  ? 36.016 57.251  19.158 1.00 59.83  ? 56  SER A CA    1 
ATOM   2903 C  C     . SER E 3 56  ? 34.867 56.255  19.098 1.00 64.04  ? 56  SER A C     1 
ATOM   2904 O  O     . SER E 3 56  ? 34.695 55.451  20.011 1.00 64.11  ? 56  SER A O     1 
ATOM   2905 C  CB    . SER E 3 56  ? 37.329 56.507  18.931 1.00 57.52  ? 56  SER A CB    1 
ATOM   2906 O  OG    . SER E 3 56  ? 37.152 55.459  17.995 1.00 54.65  ? 56  SER A OG    1 
ATOM   2907 N  N     . LEU E 3 57  ? 34.082 56.303  18.026 1.00 68.87  ? 57  LEU A N     1 
ATOM   2908 C  CA    . LEU E 3 57  ? 32.951 55.389  17.876 1.00 71.57  ? 57  LEU A CA    1 
ATOM   2909 C  C     . LEU E 3 57  ? 33.417 53.934  17.859 1.00 73.00  ? 57  LEU A C     1 
ATOM   2910 O  O     . LEU E 3 57  ? 32.602 53.013  17.845 1.00 73.55  ? 57  LEU A O     1 
ATOM   2911 C  CB    . LEU E 3 57  ? 32.176 55.703  16.591 1.00 72.23  ? 57  LEU A CB    1 
ATOM   2912 C  CG    . LEU E 3 57  ? 32.778 56.762  15.665 1.00 73.87  ? 57  LEU A CG    1 
ATOM   2913 C  CD1   . LEU E 3 57  ? 33.450 56.077  14.485 1.00 75.15  ? 57  LEU A CD1   1 
ATOM   2914 C  CD2   . LEU E 3 57  ? 31.692 57.712  15.185 1.00 73.64  ? 57  LEU A CD2   1 
ATOM   2915 N  N     . HIS E 3 58  ? 34.731 53.736  17.866 1.00 74.03  ? 58  HIS A N     1 
ATOM   2916 C  CA    . HIS E 3 58  ? 35.303 52.398  17.856 1.00 74.52  ? 58  HIS A CA    1 
ATOM   2917 C  C     . HIS E 3 58  ? 35.742 51.976  19.258 1.00 73.35  ? 58  HIS A C     1 
ATOM   2918 O  O     . HIS E 3 58  ? 35.766 50.789  19.577 1.00 74.38  ? 58  HIS A O     1 
ATOM   2919 C  CB    . HIS E 3 58  ? 36.495 52.346  16.903 1.00 77.57  ? 58  HIS A CB    1 
ATOM   2920 C  CG    . HIS E 3 58  ? 37.510 51.312  17.268 1.00 81.06  ? 58  HIS A CG    1 
ATOM   2921 N  ND1   . HIS E 3 58  ? 37.197 49.977  17.395 1.00 83.41  ? 58  HIS A ND1   1 
ATOM   2922 C  CD2   . HIS E 3 58  ? 38.830 51.418  17.547 1.00 82.68  ? 58  HIS A CD2   1 
ATOM   2923 C  CE1   . HIS E 3 58  ? 38.281 49.303  17.736 1.00 84.70  ? 58  HIS A CE1   1 
ATOM   2924 N  NE2   . HIS E 3 58  ? 39.286 50.155  17.835 1.00 84.49  ? 58  HIS A NE2   1 
ATOM   2925 N  N     . HIS E 3 59  ? 36.098 52.950  20.091 1.00 71.31  ? 59  HIS A N     1 
ATOM   2926 C  CA    . HIS E 3 59  ? 36.520 52.665  21.459 1.00 68.26  ? 59  HIS A CA    1 
ATOM   2927 C  C     . HIS E 3 59  ? 35.295 52.370  22.317 1.00 69.95  ? 59  HIS A C     1 
ATOM   2928 O  O     . HIS E 3 59  ? 35.414 52.043  23.498 1.00 72.28  ? 59  HIS A O     1 
ATOM   2929 C  CB    . HIS E 3 59  ? 37.274 53.856  22.048 1.00 64.80  ? 59  HIS A CB    1 
ATOM   2930 C  CG    . HIS E 3 59  ? 38.737 53.862  21.737 1.00 61.68  ? 59  HIS A CG    1 
ATOM   2931 N  ND1   . HIS E 3 59  ? 39.576 54.882  22.132 1.00 60.75  ? 59  HIS A ND1   1 
ATOM   2932 C  CD2   . HIS E 3 59  ? 39.507 52.983  21.056 1.00 60.38  ? 59  HIS A CD2   1 
ATOM   2933 C  CE1   . HIS E 3 59  ? 40.800 54.631  21.707 1.00 60.04  ? 59  HIS A CE1   1 
ATOM   2934 N  NE2   . HIS E 3 59  ? 40.786 53.485  21.051 1.00 60.80  ? 59  HIS A NE2   1 
ATOM   2935 N  N     . LEU E 3 60  ? 34.116 52.505  21.720 1.00 69.54  ? 60  LEU A N     1 
ATOM   2936 C  CA    . LEU E 3 60  ? 32.868 52.236  22.422 1.00 69.04  ? 60  LEU A CA    1 
ATOM   2937 C  C     . LEU E 3 60  ? 32.514 50.796  22.110 1.00 69.96  ? 60  LEU A C     1 
ATOM   2938 O  O     . LEU E 3 60  ? 32.177 50.010  22.993 1.00 70.32  ? 60  LEU A O     1 
ATOM   2939 C  CB    . LEU E 3 60  ? 31.755 53.167  21.922 1.00 66.06  ? 60  LEU A CB    1 
ATOM   2940 C  CG    . LEU E 3 60  ? 30.386 53.135  22.615 1.00 62.87  ? 60  LEU A CG    1 
ATOM   2941 C  CD1   . LEU E 3 60  ? 30.547 52.959  24.115 1.00 61.69  ? 60  LEU A CD1   1 
ATOM   2942 C  CD2   . LEU E 3 60  ? 29.645 54.425  22.322 1.00 62.31  ? 60  LEU A CD2   1 
ATOM   2943 N  N     . THR E 3 61  ? 32.610 50.459  20.832 1.00 71.45  ? 61  THR A N     1 
ATOM   2944 C  CA    . THR E 3 61  ? 32.308 49.116  20.379 1.00 74.07  ? 61  THR A CA    1 
ATOM   2945 C  C     . THR E 3 61  ? 33.160 48.106  21.135 1.00 71.60  ? 61  THR A C     1 
ATOM   2946 O  O     . THR E 3 61  ? 32.635 47.187  21.761 1.00 72.21  ? 61  THR A O     1 
ATOM   2947 C  CB    . THR E 3 61  ? 32.573 48.977  18.872 1.00 77.47  ? 61  THR A CB    1 
ATOM   2948 O  OG1   . THR E 3 61  ? 33.277 50.135  18.403 1.00 79.71  ? 61  THR A OG1   1 
ATOM   2949 C  CG2   . THR E 3 61  ? 31.258 48.849  18.113 1.00 78.48  ? 61  THR A CG2   1 
ATOM   2950 N  N     . ARG E 3 62  ? 34.476 48.286  21.083 1.00 68.55  ? 62  ARG A N     1 
ATOM   2951 C  CA    . ARG E 3 62  ? 35.384 47.378  21.767 1.00 65.92  ? 62  ARG A CA    1 
ATOM   2952 C  C     . ARG E 3 62  ? 34.970 47.206  23.229 1.00 66.30  ? 62  ARG A C     1 
ATOM   2953 O  O     . ARG E 3 62  ? 35.299 46.200  23.855 1.00 69.30  ? 62  ARG A O     1 
ATOM   2954 C  CB    . ARG E 3 62  ? 36.825 47.897  21.673 1.00 62.94  ? 62  ARG A CB    1 
ATOM   2955 C  CG    . ARG E 3 62  ? 37.363 48.509  22.960 1.00 60.61  ? 62  ARG A CG    1 
ATOM   2956 C  CD    . ARG E 3 62  ? 38.554 49.413  22.698 1.00 57.99  ? 62  ARG A CD    1 
ATOM   2957 N  NE    . ARG E 3 62  ? 39.579 48.745  21.902 1.00 56.49  ? 62  ARG A NE    1 
ATOM   2958 C  CZ    . ARG E 3 62  ? 40.881 48.985  22.011 1.00 53.62  ? 62  ARG A CZ    1 
ATOM   2959 N  NH1   . ARG E 3 62  ? 41.315 49.879  22.886 1.00 51.71  ? 62  ARG A NH1   1 
ATOM   2960 N  NH2   . ARG E 3 62  ? 41.746 48.332  21.243 1.00 52.91  ? 62  ARG A NH2   1 
ATOM   2961 N  N     . HIS E 3 63  ? 34.245 48.183  23.768 1.00 63.14  ? 63  HIS A N     1 
ATOM   2962 C  CA    . HIS E 3 63  ? 33.790 48.115  25.153 1.00 62.49  ? 63  HIS A CA    1 
ATOM   2963 C  C     . HIS E 3 63  ? 32.474 47.346  25.217 1.00 65.98  ? 63  HIS A C     1 
ATOM   2964 O  O     . HIS E 3 63  ? 32.122 46.772  26.247 1.00 67.90  ? 63  HIS A O     1 
ATOM   2965 C  CB    . HIS E 3 63  ? 33.602 49.530  25.722 1.00 59.81  ? 63  HIS A CB    1 
ATOM   2966 C  CG    . HIS E 3 63  ? 32.691 49.596  26.913 1.00 57.73  ? 63  HIS A CG    1 
ATOM   2967 N  ND1   . HIS E 3 63  ? 33.125 49.552  28.221 1.00 57.34  ? 63  HIS A ND1   1 
ATOM   2968 C  CD2   . HIS E 3 63  ? 31.340 49.717  26.979 1.00 55.78  ? 63  HIS A CD2   1 
ATOM   2969 C  CE1   . HIS E 3 63  ? 32.049 49.645  29.022 1.00 56.90  ? 63  HIS A CE1   1 
ATOM   2970 N  NE2   . HIS E 3 63  ? 30.938 49.747  28.317 1.00 57.16  ? 63  HIS A NE2   1 
ATOM   2971 N  N     . SER E 3 64  ? 31.749 47.334  24.108 1.00 68.03  ? 64  SER A N     1 
ATOM   2972 C  CA    . SER E 3 64  ? 30.472 46.641  24.052 1.00 71.47  ? 64  SER A CA    1 
ATOM   2973 C  C     . SER E 3 64  ? 30.629 45.160  24.354 1.00 72.11  ? 64  SER A C     1 
ATOM   2974 O  O     . SER E 3 64  ? 30.092 44.654  25.337 1.00 70.22  ? 64  SER A O     1 
ATOM   2975 C  CB    . SER E 3 64  ? 29.840 46.818  22.671 1.00 72.89  ? 64  SER A CB    1 
ATOM   2976 O  OG    . SER E 3 64  ? 30.198 48.068  22.110 1.00 73.71  ? 64  SER A OG    1 
ATOM   2977 N  N     . LEU E 3 65  ? 31.372 44.472  23.498 1.00 75.41  ? 65  LEU A N     1 
ATOM   2978 C  CA    . LEU E 3 65  ? 31.598 43.044  23.653 1.00 80.89  ? 65  LEU A CA    1 
ATOM   2979 C  C     . LEU E 3 65  ? 31.902 42.640  25.092 1.00 83.37  ? 65  LEU A C     1 
ATOM   2980 O  O     . LEU E 3 65  ? 31.828 41.460  25.437 1.00 84.37  ? 65  LEU A O     1 
ATOM   2981 C  CB    . LEU E 3 65  ? 32.743 42.590  22.738 1.00 83.19  ? 65  LEU A CB    1 
ATOM   2982 C  CG    . LEU E 3 65  ? 33.994 43.474  22.637 1.00 83.93  ? 65  LEU A CG    1 
ATOM   2983 C  CD1   . LEU E 3 65  ? 35.169 42.792  23.332 1.00 83.48  ? 65  LEU A CD1   1 
ATOM   2984 C  CD2   . LEU E 3 65  ? 34.326 43.731  21.172 1.00 83.34  ? 65  LEU A CD2   1 
ATOM   2985 N  N     . THR E 3 66  ? 32.243 43.616  25.928 1.00 85.33  ? 66  THR A N     1 
ATOM   2986 C  CA    . THR E 3 66  ? 32.563 43.339  27.323 1.00 89.07  ? 66  THR A CA    1 
ATOM   2987 C  C     . THR E 3 66  ? 31.326 43.326  28.211 1.00 91.09  ? 66  THR A C     1 
ATOM   2988 O  O     . THR E 3 66  ? 31.248 42.543  29.157 1.00 91.44  ? 66  THR A O     1 
ATOM   2989 C  CB    . THR E 3 66  ? 33.554 44.369  27.892 1.00 90.11  ? 66  THR A CB    1 
ATOM   2990 O  OG1   . THR E 3 66  ? 32.831 45.402  28.574 1.00 91.24  ? 66  THR A OG1   1 
ATOM   2991 C  CG2   . THR E 3 66  ? 34.380 44.982  26.778 1.00 91.06  ? 66  THR A CG2   1 
ATOM   2992 N  N     . HIS E 3 67  ? 30.363 44.193  27.912 1.00 92.73  ? 67  HIS A N     1 
ATOM   2993 C  CA    . HIS E 3 67  ? 29.135 44.259  28.698 1.00 93.28  ? 67  HIS A CA    1 
ATOM   2994 C  C     . HIS E 3 67  ? 28.325 42.979  28.517 1.00 91.37  ? 67  HIS A C     1 
ATOM   2995 O  O     . HIS E 3 67  ? 27.195 42.864  28.993 1.00 91.48  ? 67  HIS A O     1 
ATOM   2996 C  CB    . HIS E 3 67  ? 28.298 45.471  28.282 1.00 96.01  ? 67  HIS A CB    1 
ATOM   2997 C  CG    . HIS E 3 67  ? 28.312 46.584  29.285 1.00 98.66  ? 67  HIS A CG    1 
ATOM   2998 N  ND1   . HIS E 3 67  ? 27.854 46.465  30.580 1.00 99.89  ? 67  HIS A ND1   1 
ATOM   2999 C  CD2   . HIS E 3 67  ? 28.751 47.862  29.167 1.00 99.32  ? 67  HIS A CD2   1 
ATOM   3000 C  CE1   . HIS E 3 67  ? 28.027 47.648  31.190 1.00 100.00 ? 67  HIS A CE1   1 
ATOM   3001 N  NE2   . HIS E 3 67  ? 28.570 48.529  30.372 1.00 100.00 ? 67  HIS A NE2   1 
ATOM   3002 N  N     . THR E 3 68  ? 28.924 42.019  27.820 1.00 88.76  ? 68  THR A N     1 
ATOM   3003 C  CA    . THR E 3 68  ? 28.298 40.730  27.567 1.00 85.76  ? 68  THR A CA    1 
ATOM   3004 C  C     . THR E 3 68  ? 29.300 39.626  27.907 1.00 87.56  ? 68  THR A C     1 
ATOM   3005 O  O     . THR E 3 68  ? 29.017 38.739  28.716 1.00 87.58  ? 68  THR A O     1 
ATOM   3006 C  CB    . THR E 3 68  ? 27.871 40.593  26.084 1.00 81.68  ? 68  THR A CB    1 
ATOM   3007 O  OG1   . THR E 3 68  ? 28.543 39.474  25.493 1.00 78.24  ? 68  THR A OG1   1 
ATOM   3008 C  CG2   . THR E 3 68  ? 28.215 41.857  25.306 1.00 80.40  ? 68  THR A CG2   1 
ATOM   3009 N  N     . GLY E 3 69  ? 30.479 39.704  27.296 1.00 88.98  ? 69  GLY A N     1 
ATOM   3010 C  CA    . GLY E 3 69  ? 31.514 38.713  27.530 1.00 89.53  ? 69  GLY A CA    1 
ATOM   3011 C  C     . GLY E 3 69  ? 31.775 37.917  26.267 1.00 89.72  ? 69  GLY A C     1 
ATOM   3012 O  O     . GLY E 3 69  ? 32.130 36.740  26.323 1.00 89.19  ? 69  GLY A O     1 
ATOM   3013 N  N     . GLU E 3 70  ? 31.599 38.567  25.122 1.00 90.19  ? 70  GLU A N     1 
ATOM   3014 C  CA    . GLU E 3 70  ? 31.799 37.917  23.838 1.00 92.08  ? 70  GLU A CA    1 
ATOM   3015 C  C     . GLU E 3 70  ? 33.264 37.647  23.559 1.00 92.65  ? 70  GLU A C     1 
ATOM   3016 O  O     . GLU E 3 70  ? 34.144 38.289  24.129 1.00 92.11  ? 70  GLU A O     1 
ATOM   3017 C  CB    . GLU E 3 70  ? 31.225 38.779  22.713 1.00 94.11  ? 70  GLU A CB    1 
ATOM   3018 C  CG    . GLU E 3 70  ? 30.346 39.924  23.184 1.00 95.44  ? 70  GLU A CG    1 
ATOM   3019 C  CD    . GLU E 3 70  ? 28.895 39.747  22.780 1.00 96.55  ? 70  GLU A CD    1 
ATOM   3020 O  OE1   . GLU E 3 70  ? 28.329 38.668  23.054 1.00 96.87  ? 70  GLU A OE1   1 
ATOM   3021 O  OE2   . GLU E 3 70  ? 28.320 40.687  22.188 1.00 97.07  ? 70  GLU A OE2   1 
ATOM   3022 N  N     . LYS E 3 71  ? 33.508 36.689  22.671 1.00 94.21  ? 71  LYS A N     1 
ATOM   3023 C  CA    . LYS E 3 71  ? 34.858 36.313  22.274 1.00 96.08  ? 71  LYS A CA    1 
ATOM   3024 C  C     . LYS E 3 71  ? 34.860 36.006  20.781 1.00 96.38  ? 71  LYS A C     1 
ATOM   3025 O  O     . LYS E 3 71  ? 34.935 34.849  20.366 1.00 96.30  ? 71  LYS A O     1 
ATOM   3026 C  CB    . LYS E 3 71  ? 35.323 35.086  23.063 1.00 97.50  ? 71  LYS A CB    1 
ATOM   3027 C  CG    . LYS E 3 71  ? 36.744 35.192  23.614 1.00 98.80  ? 71  LYS A CG    1 
ATOM   3028 C  CD    . LYS E 3 71  ? 36.910 36.384  24.548 1.00 99.13  ? 71  LYS A CD    1 
ATOM   3029 C  CE    . LYS E 3 71  ? 36.275 36.124  25.900 1.00 99.43  ? 71  LYS A CE    1 
ATOM   3030 N  NZ    . LYS E 3 71  ? 34.835 36.508  25.901 1.00 100.00 ? 71  LYS A NZ    1 
ATOM   3031 N  N     . ASN E 3 72  ? 34.770 37.060  19.980 1.00 96.94  ? 72  ASN A N     1 
ATOM   3032 C  CA    . ASN E 3 72  ? 34.748 36.927  18.532 1.00 98.44  ? 72  ASN A CA    1 
ATOM   3033 C  C     . ASN E 3 72  ? 36.131 36.646  17.964 1.00 98.26  ? 72  ASN A C     1 
ATOM   3034 O  O     . ASN E 3 72  ? 36.262 36.204  16.823 1.00 98.22  ? 72  ASN A O     1 
ATOM   3035 C  CB    . ASN E 3 72  ? 34.175 38.200  17.906 1.00 100.00 ? 72  ASN A CB    1 
ATOM   3036 C  CG    . ASN E 3 72  ? 32.823 38.572  18.484 1.00 100.00 ? 72  ASN A CG    1 
ATOM   3037 O  OD1   . ASN E 3 72  ? 32.300 37.880  19.359 1.00 100.00 ? 72  ASN A OD1   1 
ATOM   3038 N  ND2   . ASN E 3 72  ? 32.248 39.668  17.996 1.00 100.00 ? 72  ASN A ND2   1 
ATOM   3039 N  N     . PHE E 3 73  ? 37.165 36.904  18.757 1.00 98.35  ? 73  PHE A N     1 
ATOM   3040 C  CA    . PHE E 3 73  ? 38.523 36.660  18.297 1.00 99.14  ? 73  PHE A CA    1 
ATOM   3041 C  C     . PHE E 3 73  ? 39.100 35.392  18.910 1.00 99.83  ? 73  PHE A C     1 
ATOM   3042 O  O     . PHE E 3 73  ? 38.794 35.046  20.049 1.00 98.40  ? 73  PHE A O     1 
ATOM   3043 C  CB    . PHE E 3 73  ? 39.416 37.863  18.602 1.00 98.78  ? 73  PHE A CB    1 
ATOM   3044 C  CG    . PHE E 3 73  ? 39.551 38.807  17.447 1.00 98.46  ? 73  PHE A CG    1 
ATOM   3045 C  CD1   . PHE E 3 73  ? 39.755 38.317  16.161 1.00 98.38  ? 73  PHE A CD1   1 
ATOM   3046 C  CD2   . PHE E 3 73  ? 39.441 40.178  17.632 1.00 99.23  ? 73  PHE A CD2   1 
ATOM   3047 C  CE1   . PHE E 3 73  ? 39.843 39.177  15.075 1.00 99.17  ? 73  PHE A CE1   1 
ATOM   3048 C  CE2   . PHE E 3 73  ? 39.527 41.051  16.550 1.00 100.00 ? 73  PHE A CE2   1 
ATOM   3049 C  CZ    . PHE E 3 73  ? 39.728 40.548  15.268 1.00 100.00 ? 73  PHE A CZ    1 
ATOM   3050 N  N     . THR E 3 74  ? 39.930 34.699  18.138 1.00 100.00 ? 74  THR A N     1 
ATOM   3051 C  CA    . THR E 3 74  ? 40.538 33.450  18.584 1.00 100.00 ? 74  THR A CA    1 
ATOM   3052 C  C     . THR E 3 74  ? 42.059 33.481  18.503 1.00 99.66  ? 74  THR A C     1 
ATOM   3053 O  O     . THR E 3 74  ? 42.646 34.392  17.916 1.00 98.89  ? 74  THR A O     1 
ATOM   3054 C  CB    . THR E 3 74  ? 40.036 32.262  17.736 1.00 100.00 ? 74  THR A CB    1 
ATOM   3055 O  OG1   . THR E 3 74  ? 40.185 32.574  16.343 1.00 100.00 ? 74  THR A OG1   1 
ATOM   3056 C  CG2   . THR E 3 74  ? 38.569 31.970  18.037 1.00 99.28  ? 74  THR A CG2   1 
ATOM   3057 N  N     . CYS E 3 75  ? 42.684 32.466  19.093 1.00 99.10  ? 75  CYS A N     1 
ATOM   3058 C  CA    . CYS E 3 75  ? 44.137 32.338  19.105 1.00 98.68  ? 75  CYS A CA    1 
ATOM   3059 C  C     . CYS E 3 75  ? 44.618 31.636  17.840 1.00 98.77  ? 75  CYS A C     1 
ATOM   3060 O  O     . CYS E 3 75  ? 44.551 30.414  17.735 1.00 98.89  ? 75  CYS A O     1 
ATOM   3061 C  CB    . CYS E 3 75  ? 44.578 31.548  20.346 1.00 97.75  ? 75  CYS A CB    1 
ATOM   3062 S  SG    . CYS E 3 75  ? 45.976 30.416  20.117 1.00 95.54  ? 75  CYS A SG    1 
ATOM   3063 N  N     . ASP E 3 76  ? 45.093 32.418  16.877 1.00 99.45  ? 76  ASP A N     1 
ATOM   3064 C  CA    . ASP E 3 76  ? 45.587 31.864  15.624 1.00 99.37  ? 76  ASP A CA    1 
ATOM   3065 C  C     . ASP E 3 76  ? 46.707 30.880  15.926 1.00 99.60  ? 76  ASP A C     1 
ATOM   3066 O  O     . ASP E 3 76  ? 47.887 31.226  15.847 1.00 99.56  ? 76  ASP A O     1 
ATOM   3067 C  CB    . ASP E 3 76  ? 46.109 32.984  14.720 1.00 99.46  ? 76  ASP A CB    1 
ATOM   3068 C  CG    . ASP E 3 76  ? 45.091 34.093  14.517 1.00 99.64  ? 76  ASP A CG    1 
ATOM   3069 O  OD1   . ASP E 3 76  ? 43.921 33.912  14.919 1.00 99.95  ? 76  ASP A OD1   1 
ATOM   3070 O  OD2   . ASP E 3 76  ? 45.462 35.145  13.954 1.00 98.93  ? 76  ASP A OD2   1 
ATOM   3071 N  N     . SER E 3 77  ? 46.329 29.653  16.276 1.00 99.60  ? 77  SER A N     1 
ATOM   3072 C  CA    . SER E 3 77  ? 47.297 28.613  16.603 1.00 99.70  ? 77  SER A CA    1 
ATOM   3073 C  C     . SER E 3 77  ? 46.721 27.207  16.470 1.00 100.00 ? 77  SER A C     1 
ATOM   3074 O  O     . SER E 3 77  ? 45.503 27.011  16.500 1.00 99.65  ? 77  SER A O     1 
ATOM   3075 C  CB    . SER E 3 77  ? 47.814 28.809  18.029 1.00 99.07  ? 77  SER A CB    1 
ATOM   3076 O  OG    . SER E 3 77  ? 47.098 28.001  18.948 1.00 98.04  ? 77  SER A OG    1 
ATOM   3077 N  N     . ASP E 3 78  ? 47.616 26.233  16.329 1.00 100.00 ? 78  ASP A N     1 
ATOM   3078 C  CA    . ASP E 3 78  ? 47.237 24.831  16.196 1.00 99.66  ? 78  ASP A CA    1 
ATOM   3079 C  C     . ASP E 3 78  ? 47.329 24.135  17.547 1.00 98.41  ? 78  ASP A C     1 
ATOM   3080 O  O     . ASP E 3 78  ? 48.405 24.055  18.142 1.00 97.04  ? 78  ASP A O     1 
ATOM   3081 C  CB    . ASP E 3 78  ? 48.161 24.128  15.199 1.00 100.00 ? 78  ASP A CB    1 
ATOM   3082 C  CG    . ASP E 3 78  ? 47.398 23.405  14.107 1.00 100.00 ? 78  ASP A CG    1 
ATOM   3083 O  OD1   . ASP E 3 78  ? 46.482 24.022  13.521 1.00 100.00 ? 78  ASP A OD1   1 
ATOM   3084 O  OD2   . ASP E 3 78  ? 47.714 22.224  13.835 1.00 99.35  ? 78  ASP A OD2   1 
ATOM   3085 N  N     . GLY E 3 79  ? 46.195 23.633  18.025 1.00 98.02  ? 79  GLY A N     1 
ATOM   3086 C  CA    . GLY E 3 79  ? 46.172 22.953  19.307 1.00 99.58  ? 79  GLY A CA    1 
ATOM   3087 C  C     . GLY E 3 79  ? 45.259 23.636  20.310 1.00 100.00 ? 79  GLY A C     1 
ATOM   3088 O  O     . GLY E 3 79  ? 44.416 22.992  20.937 1.00 100.00 ? 79  GLY A O     1 
ATOM   3089 N  N     . CYS E 3 80  ? 45.432 24.946  20.466 1.00 100.00 ? 80  CYS A N     1 
ATOM   3090 C  CA    . CYS E 3 80  ? 44.617 25.730  21.388 1.00 98.99  ? 80  CYS A CA    1 
ATOM   3091 C  C     . CYS E 3 80  ? 43.487 26.389  20.603 1.00 98.91  ? 80  CYS A C     1 
ATOM   3092 O  O     . CYS E 3 80  ? 43.708 26.948  19.526 1.00 98.46  ? 80  CYS A O     1 
ATOM   3093 C  CB    . CYS E 3 80  ? 45.481 26.794  22.078 1.00 97.97  ? 80  CYS A CB    1 
ATOM   3094 S  SG    . CYS E 3 80  ? 44.630 28.329  22.505 1.00 96.56  ? 80  CYS A SG    1 
ATOM   3095 N  N     . ASP E 3 81  ? 42.274 26.307  21.139 1.00 98.59  ? 81  ASP A N     1 
ATOM   3096 C  CA    . ASP E 3 81  ? 41.112 26.891  20.484 1.00 97.36  ? 81  ASP A CA    1 
ATOM   3097 C  C     . ASP E 3 81  ? 40.610 28.089  21.278 1.00 95.53  ? 81  ASP A C     1 
ATOM   3098 O  O     . ASP E 3 81  ? 39.919 28.959  20.746 1.00 93.91  ? 81  ASP A O     1 
ATOM   3099 C  CB    . ASP E 3 81  ? 40.009 25.840  20.352 1.00 97.69  ? 81  ASP A CB    1 
ATOM   3100 C  CG    . ASP E 3 81  ? 40.490 24.578  19.661 1.00 97.37  ? 81  ASP A CG    1 
ATOM   3101 O  OD1   . ASP E 3 81  ? 41.273 24.688  18.692 1.00 96.80  ? 81  ASP A OD1   1 
ATOM   3102 O  OD2   . ASP E 3 81  ? 40.087 23.477  20.089 1.00 97.50  ? 81  ASP A OD2   1 
ATOM   3103 N  N     . LEU E 3 82  ? 40.973 28.123  22.556 1.00 94.58  ? 82  LEU A N     1 
ATOM   3104 C  CA    . LEU E 3 82  ? 40.585 29.209  23.443 1.00 94.52  ? 82  LEU A CA    1 
ATOM   3105 C  C     . LEU E 3 82  ? 40.600 30.530  22.688 1.00 94.98  ? 82  LEU A C     1 
ATOM   3106 O  O     . LEU E 3 82  ? 41.656 31.005  22.277 1.00 95.06  ? 82  LEU A O     1 
ATOM   3107 C  CB    . LEU E 3 82  ? 41.555 29.284  24.621 1.00 94.95  ? 82  LEU A CB    1 
ATOM   3108 C  CG    . LEU E 3 82  ? 41.037 29.875  25.934 1.00 95.37  ? 82  LEU A CG    1 
ATOM   3109 C  CD1   . LEU E 3 82  ? 42.145 29.840  26.980 1.00 95.39  ? 82  LEU A CD1   1 
ATOM   3110 C  CD2   . LEU E 3 82  ? 40.560 31.299  25.711 1.00 95.62  ? 82  LEU A CD2   1 
ATOM   3111 N  N     . ARG E 3 83  ? 39.426 31.119  22.503 1.00 95.93  ? 83  ARG A N     1 
ATOM   3112 C  CA    . ARG E 3 83  ? 39.324 32.388  21.797 1.00 97.14  ? 83  ARG A CA    1 
ATOM   3113 C  C     . ARG E 3 83  ? 39.619 33.555  22.740 1.00 97.15  ? 83  ARG A C     1 
ATOM   3114 O  O     . ARG E 3 83  ? 39.601 33.403  23.964 1.00 95.21  ? 83  ARG A O     1 
ATOM   3115 C  CB    . ARG E 3 83  ? 37.927 32.544  21.188 1.00 97.62  ? 83  ARG A CB    1 
ATOM   3116 C  CG    . ARG E 3 83  ? 36.829 31.837  21.959 1.00 98.71  ? 83  ARG A CG    1 
ATOM   3117 C  CD    . ARG E 3 83  ? 36.469 30.508  21.314 1.00 99.67  ? 83  ARG A CD    1 
ATOM   3118 N  NE    . ARG E 3 83  ? 37.067 29.379  22.019 1.00 100.00 ? 83  ARG A NE    1 
ATOM   3119 C  CZ    . ARG E 3 83  ? 37.386 28.223  21.444 1.00 100.00 ? 83  ARG A CZ    1 
ATOM   3120 N  NH1   . ARG E 3 83  ? 37.165 28.038  20.148 1.00 100.00 ? 83  ARG A NH1   1 
ATOM   3121 N  NH2   . ARG E 3 83  ? 37.932 27.252  22.164 1.00 100.00 ? 83  ARG A NH2   1 
ATOM   3122 N  N     . PHE E 3 84  ? 39.891 34.720  22.160 1.00 97.19  ? 84  PHE A N     1 
ATOM   3123 C  CA    . PHE E 3 84  ? 40.201 35.915  22.937 1.00 96.23  ? 84  PHE A CA    1 
ATOM   3124 C  C     . PHE E 3 84  ? 39.292 37.097  22.585 1.00 94.08  ? 84  PHE A C     1 
ATOM   3125 O  O     . PHE E 3 84  ? 38.572 37.062  21.585 1.00 94.38  ? 84  PHE A O     1 
ATOM   3126 C  CB    . PHE E 3 84  ? 41.668 36.290  22.725 1.00 96.59  ? 84  PHE A CB    1 
ATOM   3127 C  CG    . PHE E 3 84  ? 42.631 35.271  23.261 1.00 96.14  ? 84  PHE A CG    1 
ATOM   3128 C  CD1   . PHE E 3 84  ? 42.877 34.093  22.566 1.00 95.60  ? 84  PHE A CD1   1 
ATOM   3129 C  CD2   . PHE E 3 84  ? 43.280 35.481  24.471 1.00 96.63  ? 84  PHE A CD2   1 
ATOM   3130 C  CE1   . PHE E 3 84  ? 43.755 33.140  23.068 1.00 95.48  ? 84  PHE A CE1   1 
ATOM   3131 C  CE2   . PHE E 3 84  ? 44.161 34.531  24.981 1.00 96.78  ? 84  PHE A CE2   1 
ATOM   3132 C  CZ    . PHE E 3 84  ? 44.398 33.359  24.277 1.00 96.08  ? 84  PHE A CZ    1 
ATOM   3133 N  N     . THR E 3 85  ? 39.334 38.140  23.412 1.00 90.36  ? 85  THR A N     1 
ATOM   3134 C  CA    . THR E 3 85  ? 38.505 39.326  23.213 1.00 85.13  ? 85  THR A CA    1 
ATOM   3135 C  C     . THR E 3 85  ? 38.982 40.268  22.104 1.00 82.69  ? 85  THR A C     1 
ATOM   3136 O  O     . THR E 3 85  ? 38.173 40.963  21.489 1.00 81.33  ? 85  THR A O     1 
ATOM   3137 C  CB    . THR E 3 85  ? 38.375 40.133  24.525 1.00 82.88  ? 85  THR A CB    1 
ATOM   3138 O  OG1   . THR E 3 85  ? 38.415 41.533  24.233 1.00 83.32  ? 85  THR A OG1   1 
ATOM   3139 C  CG2   . THR E 3 85  ? 39.502 39.787  25.484 1.00 80.66  ? 85  THR A CG2   1 
ATOM   3140 N  N     . THR E 3 86  ? 40.287 40.289  21.850 1.00 80.55  ? 86  THR A N     1 
ATOM   3141 C  CA    . THR E 3 86  ? 40.850 41.153  20.816 1.00 79.43  ? 86  THR A CA    1 
ATOM   3142 C  C     . THR E 3 86  ? 41.957 40.453  20.047 1.00 77.33  ? 86  THR A C     1 
ATOM   3143 O  O     . THR E 3 86  ? 42.528 39.475  20.524 1.00 77.37  ? 86  THR A O     1 
ATOM   3144 C  CB    . THR E 3 86  ? 41.440 42.436  21.420 1.00 81.56  ? 86  THR A CB    1 
ATOM   3145 O  OG1   . THR E 3 86  ? 41.204 42.449  22.835 1.00 82.01  ? 86  THR A OG1   1 
ATOM   3146 C  CG2   . THR E 3 86  ? 40.810 43.666  20.780 1.00 82.26  ? 86  THR A CG2   1 
ATOM   3147 N  N     . LYS E 3 87  ? 42.269 40.964  18.861 1.00 76.55  ? 87  LYS A N     1 
ATOM   3148 C  CA    . LYS E 3 87  ? 43.312 40.369  18.033 1.00 78.36  ? 87  LYS A CA    1 
ATOM   3149 C  C     . LYS E 3 87  ? 44.704 40.695  18.554 1.00 77.43  ? 87  LYS A C     1 
ATOM   3150 O  O     . LYS E 3 87  ? 45.356 39.855  19.174 1.00 78.08  ? 87  LYS A O     1 
ATOM   3151 C  CB    . LYS E 3 87  ? 43.193 40.851  16.586 1.00 80.66  ? 87  LYS A CB    1 
ATOM   3152 C  CG    . LYS E 3 87  ? 44.090 40.087  15.621 1.00 82.71  ? 87  LYS A CG    1 
ATOM   3153 C  CD    . LYS E 3 87  ? 44.507 40.939  14.435 1.00 85.23  ? 87  LYS A CD    1 
ATOM   3154 C  CE    . LYS E 3 87  ? 45.226 40.103  13.382 1.00 87.75  ? 87  LYS A CE    1 
ATOM   3155 N  NZ    . LYS E 3 87  ? 44.468 40.019  12.094 1.00 90.01  ? 87  LYS A NZ    1 
ATOM   3156 N  N     . ALA E 3 88  ? 45.157 41.915  18.288 1.00 76.10  ? 88  ALA A N     1 
ATOM   3157 C  CA    . ALA E 3 88  ? 46.472 42.353  18.733 1.00 74.02  ? 88  ALA A CA    1 
ATOM   3158 C  C     . ALA E 3 88  ? 46.670 41.869  20.157 1.00 71.47  ? 88  ALA A C     1 
ATOM   3159 O  O     . ALA E 3 88  ? 47.787 41.582  20.584 1.00 70.75  ? 88  ALA A O     1 
ATOM   3160 C  CB    . ALA E 3 88  ? 46.563 43.867  18.672 1.00 75.07  ? 88  ALA A CB    1 
ATOM   3161 N  N     . ASN E 3 89  ? 45.563 41.778  20.883 1.00 69.48  ? 89  ASN A N     1 
ATOM   3162 C  CA    . ASN E 3 89  ? 45.576 41.310  22.257 1.00 69.03  ? 89  ASN A CA    1 
ATOM   3163 C  C     . ASN E 3 89  ? 45.992 39.844  22.253 1.00 70.09  ? 89  ASN A C     1 
ATOM   3164 O  O     . ASN E 3 89  ? 47.074 39.492  22.723 1.00 71.69  ? 89  ASN A O     1 
ATOM   3165 C  CB    . ASN E 3 89  ? 44.182 41.456  22.863 1.00 68.42  ? 89  ASN A CB    1 
ATOM   3166 C  CG    . ASN E 3 89  ? 44.149 41.137  24.336 1.00 67.78  ? 89  ASN A CG    1 
ATOM   3167 O  OD1   . ASN E 3 89  ? 44.770 41.822  25.145 1.00 68.67  ? 89  ASN A OD1   1 
ATOM   3168 N  ND2   . ASN E 3 89  ? 43.418 40.093  24.696 1.00 67.23  ? 89  ASN A ND2   1 
ATOM   3169 N  N     . MET E 3 90  ? 45.125 38.996  21.708 1.00 68.80  ? 90  MET A N     1 
ATOM   3170 C  CA    . MET E 3 90  ? 45.381 37.564  21.627 1.00 66.48  ? 90  MET A CA    1 
ATOM   3171 C  C     . MET E 3 90  ? 46.778 37.286  21.080 1.00 65.65  ? 90  MET A C     1 
ATOM   3172 O  O     . MET E 3 90  ? 47.426 36.317  21.470 1.00 65.62  ? 90  MET A O     1 
ATOM   3173 C  CB    . MET E 3 90  ? 44.329 36.904  20.735 1.00 65.88  ? 90  MET A CB    1 
ATOM   3174 C  CG    . MET E 3 90  ? 44.685 35.512  20.271 1.00 64.89  ? 90  MET A CG    1 
ATOM   3175 S  SD    . MET E 3 90  ? 45.911 35.531  18.963 1.00 62.97  ? 90  MET A SD    1 
ATOM   3176 C  CE    . MET E 3 90  ? 44.933 36.055  17.589 1.00 63.08  ? 90  MET A CE    1 
ATOM   3177 N  N     . LYS E 3 91  ? 47.230 38.137  20.166 1.00 65.60  ? 91  LYS A N     1 
ATOM   3178 C  CA    . LYS E 3 91  ? 48.552 37.989  19.573 1.00 66.91  ? 91  LYS A CA    1 
ATOM   3179 C  C     . LYS E 3 91  ? 49.562 37.747  20.684 1.00 66.66  ? 91  LYS A C     1 
ATOM   3180 O  O     . LYS E 3 91  ? 50.568 37.070  20.493 1.00 64.39  ? 91  LYS A O     1 
ATOM   3181 C  CB    . LYS E 3 91  ? 48.924 39.257  18.797 1.00 69.08  ? 91  LYS A CB    1 
ATOM   3182 C  CG    . LYS E 3 91  ? 50.420 39.452  18.570 1.00 70.15  ? 91  LYS A CG    1 
ATOM   3183 C  CD    . LYS E 3 91  ? 50.710 39.933  17.156 1.00 71.28  ? 91  LYS A CD    1 
ATOM   3184 C  CE    . LYS E 3 91  ? 51.821 39.122  16.505 1.00 72.23  ? 91  LYS A CE    1 
ATOM   3185 N  NZ    . LYS E 3 91  ? 51.407 38.550  15.187 1.00 72.61  ? 91  LYS A NZ    1 
ATOM   3186 N  N     . LYS E 3 92  ? 49.279 38.310  21.851 1.00 69.37  ? 92  LYS A N     1 
ATOM   3187 C  CA    . LYS E 3 92  ? 50.152 38.157  23.003 1.00 72.38  ? 92  LYS A CA    1 
ATOM   3188 C  C     . LYS E 3 92  ? 50.290 36.681  23.339 1.00 74.59  ? 92  LYS A C     1 
ATOM   3189 O  O     . LYS E 3 92  ? 51.383 36.119  23.266 1.00 74.51  ? 92  LYS A O     1 
ATOM   3190 C  CB    . LYS E 3 92  ? 49.575 38.908  24.208 1.00 72.13  ? 92  LYS A CB    1 
ATOM   3191 C  CG    . LYS E 3 92  ? 50.121 40.322  24.393 1.00 69.90  ? 92  LYS A CG    1 
ATOM   3192 C  CD    . LYS E 3 92  ? 49.795 40.875  25.776 1.00 66.99  ? 92  LYS A CD    1 
ATOM   3193 C  CE    . LYS E 3 92  ? 48.375 41.414  25.843 1.00 64.32  ? 92  LYS A CE    1 
ATOM   3194 N  NZ    . LYS E 3 92  ? 48.067 42.013  27.170 1.00 61.35  ? 92  LYS A NZ    1 
ATOM   3195 N  N     . HIS E 3 93  ? 49.169 36.064  23.702 1.00 77.80  ? 93  HIS A N     1 
ATOM   3196 C  CA    . HIS E 3 93  ? 49.129 34.649  24.063 1.00 80.55  ? 93  HIS A CA    1 
ATOM   3197 C  C     . HIS E 3 93  ? 50.067 33.820  23.190 1.00 77.50  ? 93  HIS A C     1 
ATOM   3198 O  O     . HIS E 3 93  ? 51.072 33.293  23.672 1.00 77.96  ? 93  HIS A O     1 
ATOM   3199 C  CB    . HIS E 3 93  ? 47.691 34.121  23.947 1.00 85.33  ? 93  HIS A CB    1 
ATOM   3200 C  CG    . HIS E 3 93  ? 47.599 32.646  23.702 1.00 90.23  ? 93  HIS A CG    1 
ATOM   3201 N  ND1   . HIS E 3 93  ? 48.101 31.684  24.553 1.00 92.72  ? 93  HIS A ND1   1 
ATOM   3202 C  CD2   . HIS E 3 93  ? 47.045 31.966  22.667 1.00 91.90  ? 93  HIS A CD2   1 
ATOM   3203 C  CE1   . HIS E 3 93  ? 47.842 30.480  24.017 1.00 93.88  ? 93  HIS A CE1   1 
ATOM   3204 N  NE2   . HIS E 3 93  ? 47.201 30.600  22.870 1.00 93.77  ? 93  HIS A NE2   1 
ATOM   3205 N  N     . PHE E 3 94  ? 49.739 33.714  21.907 1.00 72.70  ? 94  PHE A N     1 
ATOM   3206 C  CA    . PHE E 3 94  ? 50.551 32.951  20.972 1.00 68.33  ? 94  PHE A CA    1 
ATOM   3207 C  C     . PHE E 3 94  ? 52.040 33.135  21.251 1.00 67.25  ? 94  PHE A C     1 
ATOM   3208 O  O     . PHE E 3 94  ? 52.732 32.191  21.617 1.00 69.28  ? 94  PHE A O     1 
ATOM   3209 C  CB    . PHE E 3 94  ? 50.236 33.379  19.541 1.00 66.70  ? 94  PHE A CB    1 
ATOM   3210 C  CG    . PHE E 3 94  ? 50.781 32.450  18.503 1.00 64.91  ? 94  PHE A CG    1 
ATOM   3211 C  CD1   . PHE E 3 94  ? 52.092 32.578  18.061 1.00 63.82  ? 94  PHE A CD1   1 
ATOM   3212 C  CD2   . PHE E 3 94  ? 49.991 31.434  17.980 1.00 64.54  ? 94  PHE A CD2   1 
ATOM   3213 C  CE1   . PHE E 3 94  ? 52.610 31.704  17.114 1.00 64.39  ? 94  PHE A CE1   1 
ATOM   3214 C  CE2   . PHE E 3 94  ? 50.499 30.554  17.032 1.00 64.39  ? 94  PHE A CE2   1 
ATOM   3215 C  CZ    . PHE E 3 94  ? 51.811 30.688  16.599 1.00 64.70  ? 94  PHE A CZ    1 
ATOM   3216 N  N     . ASN E 3 95  ? 52.529 34.355  21.086 1.00 66.10  ? 95  ASN A N     1 
ATOM   3217 C  CA    . ASN E 3 95  ? 53.935 34.641  21.324 1.00 66.47  ? 95  ASN A CA    1 
ATOM   3218 C  C     . ASN E 3 95  ? 54.382 34.174  22.708 1.00 67.37  ? 95  ASN A C     1 
ATOM   3219 O  O     . ASN E 3 95  ? 55.530 33.782  22.893 1.00 67.07  ? 95  ASN A O     1 
ATOM   3220 C  CB    . ASN E 3 95  ? 54.195 36.142  21.176 1.00 65.90  ? 95  ASN A CB    1 
ATOM   3221 C  CG    . ASN E 3 95  ? 53.858 36.659  19.789 1.00 63.32  ? 95  ASN A CG    1 
ATOM   3222 O  OD1   . ASN E 3 95  ? 53.644 35.880  18.861 1.00 62.61  ? 95  ASN A OD1   1 
ATOM   3223 N  ND2   . ASN E 3 95  ? 53.809 37.978  19.642 1.00 61.67  ? 95  ASN A ND2   1 
ATOM   3224 N  N     . ARG E 3 96  ? 53.475 34.221  23.678 1.00 69.31  ? 96  ARG A N     1 
ATOM   3225 C  CA    . ARG E 3 96  ? 53.792 33.798  25.040 1.00 71.93  ? 96  ARG A CA    1 
ATOM   3226 C  C     . ARG E 3 96  ? 53.565 32.297  25.213 1.00 73.37  ? 96  ARG A C     1 
ATOM   3227 O  O     . ARG E 3 96  ? 53.615 31.779  26.327 1.00 72.66  ? 96  ARG A O     1 
ATOM   3228 C  CB    . ARG E 3 96  ? 52.917 34.546  26.055 1.00 72.44  ? 96  ARG A CB    1 
ATOM   3229 C  CG    . ARG E 3 96  ? 53.010 36.071  26.012 1.00 73.06  ? 96  ARG A CG    1 
ATOM   3230 C  CD    . ARG E 3 96  ? 51.711 36.718  26.521 1.00 71.48  ? 96  ARG A CD    1 
ATOM   3231 N  NE    . ARG E 3 96  ? 51.936 37.870  27.400 1.00 66.37  ? 96  ARG A NE    1 
ATOM   3232 C  CZ    . ARG E 3 96  ? 50.973 38.504  28.064 1.00 61.28  ? 96  ARG A CZ    1 
ATOM   3233 N  NH1   . ARG E 3 96  ? 49.710 38.104  27.955 1.00 58.87  ? 96  ARG A NH1   1 
ATOM   3234 N  NH2   . ARG E 3 96  ? 51.271 39.540  28.836 1.00 58.67  ? 96  ARG A NH2   1 
ATOM   3235 N  N     . PHE E 3 97  ? 53.321 31.599  24.111 1.00 76.02  ? 97  PHE A N     1 
ATOM   3236 C  CA    . PHE E 3 97  ? 53.061 30.169  24.185 1.00 79.10  ? 97  PHE A CA    1 
ATOM   3237 C  C     . PHE E 3 97  ? 53.566 29.359  22.996 1.00 78.51  ? 97  PHE A C     1 
ATOM   3238 O  O     . PHE E 3 97  ? 54.513 28.589  23.121 1.00 78.57  ? 97  PHE A O     1 
ATOM   3239 C  CB    . PHE E 3 97  ? 51.560 29.934  24.346 1.00 84.45  ? 97  PHE A CB    1 
ATOM   3240 C  CG    . PHE E 3 97  ? 51.220 28.860  25.330 1.00 90.56  ? 97  PHE A CG    1 
ATOM   3241 C  CD1   . PHE E 3 97  ? 51.509 27.527  25.048 1.00 93.42  ? 97  PHE A CD1   1 
ATOM   3242 C  CD2   . PHE E 3 97  ? 50.621 29.177  26.548 1.00 92.91  ? 97  PHE A CD2   1 
ATOM   3243 C  CE1   . PHE E 3 97  ? 51.208 26.520  25.966 1.00 94.81  ? 97  PHE A CE1   1 
ATOM   3244 C  CE2   . PHE E 3 97  ? 50.314 28.179  27.476 1.00 94.89  ? 97  PHE A CE2   1 
ATOM   3245 C  CZ    . PHE E 3 97  ? 50.609 26.846  27.184 1.00 95.68  ? 97  PHE A CZ    1 
ATOM   3246 N  N     . HIS E 3 98  ? 52.926 29.536  21.845 1.00 78.72  ? 98  HIS A N     1 
ATOM   3247 C  CA    . HIS E 3 98  ? 53.276 28.801  20.629 1.00 78.67  ? 98  HIS A CA    1 
ATOM   3248 C  C     . HIS E 3 98  ? 54.519 29.283  19.873 1.00 78.17  ? 98  HIS A C     1 
ATOM   3249 O  O     . HIS E 3 98  ? 55.494 28.545  19.742 1.00 77.42  ? 98  HIS A O     1 
ATOM   3250 C  CB    . HIS E 3 98  ? 52.067 28.786  19.690 1.00 78.62  ? 98  HIS A CB    1 
ATOM   3251 C  CG    . HIS E 3 98  ? 50.764 28.536  20.390 1.00 78.18  ? 98  HIS A CG    1 
ATOM   3252 N  ND1   . HIS E 3 98  ? 50.239 27.284  20.623 1.00 77.63  ? 98  HIS A ND1   1 
ATOM   3253 C  CD2   . HIS E 3 98  ? 49.879 29.410  20.932 1.00 77.62  ? 98  HIS A CD2   1 
ATOM   3254 C  CE1   . HIS E 3 98  ? 49.082 27.436  21.283 1.00 76.65  ? 98  HIS A CE1   1 
ATOM   3255 N  NE2   . HIS E 3 98  ? 48.819 28.710  21.495 1.00 76.20  ? 98  HIS A NE2   1 
ATOM   3256 N  N     . ASN E 3 99  ? 54.481 30.509  19.364 1.00 79.21  ? 99  ASN A N     1 
ATOM   3257 C  CA    . ASN E 3 99  ? 55.613 31.060  18.624 1.00 80.52  ? 99  ASN A CA    1 
ATOM   3258 C  C     . ASN E 3 99  ? 56.934 30.704  19.297 1.00 78.60  ? 99  ASN A C     1 
ATOM   3259 O  O     . ASN E 3 99  ? 57.228 31.170  20.396 1.00 77.05  ? 99  ASN A O     1 
ATOM   3260 C  CB    . ASN E 3 99  ? 55.486 32.584  18.513 1.00 84.70  ? 99  ASN A CB    1 
ATOM   3261 C  CG    . ASN E 3 99  ? 56.146 33.137  17.257 1.00 88.17  ? 99  ASN A CG    1 
ATOM   3262 O  OD1   . ASN E 3 99  ? 55.471 33.587  16.327 1.00 89.78  ? 99  ASN A OD1   1 
ATOM   3263 N  ND2   . ASN E 3 99  ? 57.475 33.105  17.226 1.00 89.29  ? 99  ASN A ND2   1 
ATOM   3264 N  N     . ILE E 3 100 ? 57.728 29.874  18.628 1.00 78.40  ? 100 ILE A N     1 
ATOM   3265 C  CA    . ILE E 3 100 ? 59.019 29.445  19.156 1.00 78.11  ? 100 ILE A CA    1 
ATOM   3266 C  C     . ILE E 3 100 ? 59.964 30.615  19.414 1.00 78.63  ? 100 ILE A C     1 
ATOM   3267 O  O     . ILE E 3 100 ? 59.551 31.665  19.904 1.00 75.01  ? 100 ILE A O     1 
ATOM   3268 C  CB    . ILE E 3 100 ? 59.728 28.453  18.196 1.00 76.68  ? 100 ILE A CB    1 
ATOM   3269 C  CG1   . ILE E 3 100 ? 58.783 28.021  17.068 1.00 75.57  ? 100 ILE A CG1   1 
ATOM   3270 C  CG2   . ILE E 3 100 ? 60.233 27.258  18.981 1.00 76.75  ? 100 ILE A CG2   1 
ATOM   3271 C  CD1   . ILE E 3 100 ? 57.638 27.123  17.508 1.00 74.64  ? 100 ILE A CD1   1 
ATOM   3272 N  N     . LYS E 3 101 ? 61.237 30.418  19.077 1.00 83.21  ? 101 LYS A N     1 
ATOM   3273 C  CA    . LYS E 3 101 ? 62.271 31.434  19.266 1.00 88.09  ? 101 LYS A CA    1 
ATOM   3274 C  C     . LYS E 3 101 ? 62.518 31.635  20.753 1.00 89.12  ? 101 LYS A C     1 
ATOM   3275 O  O     . LYS E 3 101 ? 63.659 31.789  21.191 1.00 89.19  ? 101 LYS A O     1 
ATOM   3276 C  CB    . LYS E 3 101 ? 61.852 32.763  18.621 1.00 91.04  ? 101 LYS A CB    1 
ATOM   3277 C  CG    . LYS E 3 101 ? 63.005 33.564  18.015 1.00 93.06  ? 101 LYS A CG    1 
ATOM   3278 C  CD    . LYS E 3 101 ? 63.043 34.993  18.549 1.00 94.63  ? 101 LYS A CD    1 
ATOM   3279 C  CE    . LYS E 3 101 ? 63.926 35.104  19.790 1.00 96.27  ? 101 LYS A CE    1 
ATOM   3280 N  NZ    . LYS E 3 101 ? 63.435 36.134  20.758 1.00 96.60  ? 101 LYS A NZ    1 
ATOM   3281 N  N     . ILE E 3 102 ? 61.435 31.626  21.522 1.00 90.36  ? 102 ILE A N     1 
ATOM   3282 C  CA    . ILE E 3 102 ? 61.508 31.799  22.966 1.00 91.89  ? 102 ILE A CA    1 
ATOM   3283 C  C     . ILE E 3 102 ? 61.101 30.497  23.647 1.00 91.09  ? 102 ILE A C     1 
ATOM   3284 O  O     . ILE E 3 102 ? 61.786 30.015  24.548 1.00 92.26  ? 102 ILE A O     1 
ATOM   3285 C  CB    . ILE E 3 102 ? 60.574 32.935  23.440 1.00 93.23  ? 102 ILE A CB    1 
ATOM   3286 C  CG1   . ILE E 3 102 ? 59.936 33.633  22.234 1.00 92.05  ? 102 ILE A CG1   1 
ATOM   3287 C  CG2   . ILE E 3 102 ? 61.365 33.936  24.274 1.00 94.33  ? 102 ILE A CG2   1 
ATOM   3288 C  CD1   . ILE E 3 102 ? 58.468 33.326  22.050 1.00 90.75  ? 102 ILE A CD1   1 
ATOM   3289 N  N     . CYS E 3 103 ? 59.978 29.936  23.208 1.00 88.14  ? 103 CYS A N     1 
ATOM   3290 C  CA    . CYS E 3 103 ? 59.481 28.677  23.751 1.00 83.07  ? 103 CYS A CA    1 
ATOM   3291 C  C     . CYS E 3 103 ? 59.946 27.571  22.809 1.00 79.30  ? 103 CYS A C     1 
ATOM   3292 O  O     . CYS E 3 103 ? 59.149 26.885  22.172 1.00 77.89  ? 103 CYS A O     1 
ATOM   3293 C  CB    . CYS E 3 103 ? 57.958 28.706  23.827 1.00 81.40  ? 103 CYS A CB    1 
ATOM   3294 S  SG    . CYS E 3 103 ? 57.245 30.067  22.899 1.00 80.97  ? 103 CYS A SG    1 
ATOM   3295 N  N     . VAL E 3 104 ? 61.261 27.425  22.726 1.00 76.16  ? 104 VAL A N     1 
ATOM   3296 C  CA    . VAL E 3 104 ? 61.897 26.431  21.876 1.00 74.60  ? 104 VAL A CA    1 
ATOM   3297 C  C     . VAL E 3 104 ? 61.526 25.001  22.272 1.00 73.02  ? 104 VAL A C     1 
ATOM   3298 O  O     . VAL E 3 104 ? 60.914 24.270  21.495 1.00 73.50  ? 104 VAL A O     1 
ATOM   3299 C  CB    . VAL E 3 104 ? 63.436 26.592  21.927 1.00 75.61  ? 104 VAL A CB    1 
ATOM   3300 C  CG1   . VAL E 3 104 ? 63.965 27.013  20.565 1.00 76.47  ? 104 VAL A CG1   1 
ATOM   3301 C  CG2   . VAL E 3 104 ? 63.817 27.634  22.972 1.00 74.81  ? 104 VAL A CG2   1 
ATOM   3302 N  N     . TYR E 3 105 ? 61.914 24.603  23.479 1.00 70.63  ? 105 TYR A N     1 
ATOM   3303 C  CA    . TYR E 3 105 ? 61.618 23.270  23.981 1.00 68.23  ? 105 TYR A CA    1 
ATOM   3304 C  C     . TYR E 3 105 ? 60.143 22.966  23.802 1.00 66.71  ? 105 TYR A C     1 
ATOM   3305 O  O     . TYR E 3 105 ? 59.289 23.642  24.372 1.00 67.54  ? 105 TYR A O     1 
ATOM   3306 C  CB    . TYR E 3 105 ? 61.996 23.193  25.452 1.00 69.68  ? 105 TYR A CB    1 
ATOM   3307 C  CG    . TYR E 3 105 ? 63.440 23.542  25.677 1.00 73.12  ? 105 TYR A CG    1 
ATOM   3308 C  CD1   . TYR E 3 105 ? 64.450 22.716  25.197 1.00 75.38  ? 105 TYR A CD1   1 
ATOM   3309 C  CD2   . TYR E 3 105 ? 63.803 24.712  26.338 1.00 75.21  ? 105 TYR A CD2   1 
ATOM   3310 C  CE1   . TYR E 3 105 ? 65.788 23.043  25.363 1.00 77.24  ? 105 TYR A CE1   1 
ATOM   3311 C  CE2   . TYR E 3 105 ? 65.144 25.052  26.513 1.00 77.38  ? 105 TYR A CE2   1 
ATOM   3312 C  CZ    . TYR E 3 105 ? 66.131 24.212  26.020 1.00 78.17  ? 105 TYR A CZ    1 
ATOM   3313 O  OH    . TYR E 3 105 ? 67.459 24.541  26.168 1.00 79.23  ? 105 TYR A OH    1 
ATOM   3314 N  N     . VAL E 3 106 ? 59.838 21.944  23.012 1.00 64.60  ? 106 VAL A N     1 
ATOM   3315 C  CA    . VAL E 3 106 ? 58.447 21.600  22.765 1.00 64.55  ? 106 VAL A CA    1 
ATOM   3316 C  C     . VAL E 3 106 ? 58.122 20.119  22.903 1.00 63.76  ? 106 VAL A C     1 
ATOM   3317 O  O     . VAL E 3 106 ? 58.935 19.255  22.563 1.00 63.08  ? 106 VAL A O     1 
ATOM   3318 C  CB    . VAL E 3 106 ? 58.020 22.062  21.360 1.00 65.91  ? 106 VAL A CB    1 
ATOM   3319 C  CG1   . VAL E 3 106 ? 56.641 21.514  21.021 1.00 67.23  ? 106 VAL A CG1   1 
ATOM   3320 C  CG2   . VAL E 3 106 ? 58.019 23.577  21.295 1.00 66.80  ? 106 VAL A CG2   1 
ATOM   3321 N  N     . CYS E 3 107 ? 56.922 19.841  23.409 1.00 62.60  ? 107 CYS A N     1 
ATOM   3322 C  CA    . CYS E 3 107 ? 56.459 18.473  23.571 1.00 60.67  ? 107 CYS A CA    1 
ATOM   3323 C  C     . CYS E 3 107 ? 55.886 18.060  22.230 1.00 60.13  ? 107 CYS A C     1 
ATOM   3324 O  O     . CYS E 3 107 ? 54.740 18.372  21.912 1.00 58.83  ? 107 CYS A O     1 
ATOM   3325 C  CB    . CYS E 3 107 ? 55.369 18.377  24.638 1.00 58.73  ? 107 CYS A CB    1 
ATOM   3326 S  SG    . CYS E 3 107 ? 54.665 16.716  24.777 1.00 58.59  ? 107 CYS A SG    1 
ATOM   3327 N  N     . HIS E 3 108 ? 56.695 17.365  21.441 1.00 61.46  ? 108 HIS A N     1 
ATOM   3328 C  CA    . HIS E 3 108 ? 56.267 16.922  20.125 1.00 63.66  ? 108 HIS A CA    1 
ATOM   3329 C  C     . HIS E 3 108 ? 55.513 15.592  20.181 1.00 60.92  ? 108 HIS A C     1 
ATOM   3330 O  O     . HIS E 3 108 ? 55.536 14.823  19.224 1.00 62.49  ? 108 HIS A O     1 
ATOM   3331 C  CB    . HIS E 3 108 ? 57.482 16.797  19.195 1.00 68.18  ? 108 HIS A CB    1 
ATOM   3332 C  CG    . HIS E 3 108 ? 57.953 18.103  18.626 1.00 70.80  ? 108 HIS A CG    1 
ATOM   3333 N  ND1   . HIS E 3 108 ? 57.913 19.286  19.333 1.00 71.91  ? 108 HIS A ND1   1 
ATOM   3334 C  CD2   . HIS E 3 108 ? 58.484 18.408  17.417 1.00 71.47  ? 108 HIS A CD2   1 
ATOM   3335 C  CE1   . HIS E 3 108 ? 58.399 20.261  18.586 1.00 71.94  ? 108 HIS A CE1   1 
ATOM   3336 N  NE2   . HIS E 3 108 ? 58.752 19.755  17.418 1.00 71.96  ? 108 HIS A NE2   1 
ATOM   3337 N  N     . PHE E 3 109 ? 54.847 15.320  21.299 1.00 56.93  ? 109 PHE A N     1 
ATOM   3338 C  CA    . PHE E 3 109 ? 54.086 14.084  21.429 1.00 53.59  ? 109 PHE A CA    1 
ATOM   3339 C  C     . PHE E 3 109 ? 52.851 14.209  20.564 1.00 57.16  ? 109 PHE A C     1 
ATOM   3340 O  O     . PHE E 3 109 ? 52.032 13.296  20.489 1.00 54.81  ? 109 PHE A O     1 
ATOM   3341 C  CB    . PHE E 3 109 ? 53.666 13.848  22.879 1.00 48.66  ? 109 PHE A CB    1 
ATOM   3342 C  CG    . PHE E 3 109 ? 53.164 12.454  23.145 1.00 44.81  ? 109 PHE A CG    1 
ATOM   3343 C  CD1   . PHE E 3 109 ? 53.472 11.409  22.275 1.00 43.15  ? 109 PHE A CD1   1 
ATOM   3344 C  CD2   . PHE E 3 109 ? 52.386 12.184  24.264 1.00 42.22  ? 109 PHE A CD2   1 
ATOM   3345 C  CE1   . PHE E 3 109 ? 53.015 10.119  22.513 1.00 40.57  ? 109 PHE A CE1   1 
ATOM   3346 C  CE2   . PHE E 3 109 ? 51.923 10.899  24.513 1.00 40.89  ? 109 PHE A CE2   1 
ATOM   3347 C  CZ    . PHE E 3 109 ? 52.239 9.863   23.633 1.00 41.68  ? 109 PHE A CZ    1 
ATOM   3348 N  N     . GLU E 3 110 ? 52.728 15.362  19.916 1.00 64.58  ? 110 GLU A N     1 
ATOM   3349 C  CA    . GLU E 3 110 ? 51.606 15.655  19.034 1.00 69.42  ? 110 GLU A CA    1 
ATOM   3350 C  C     . GLU E 3 110 ? 50.263 15.565  19.758 1.00 69.33  ? 110 GLU A C     1 
ATOM   3351 O  O     . GLU E 3 110 ? 50.107 14.809  20.720 1.00 69.08  ? 110 GLU A O     1 
ATOM   3352 C  CB    . GLU E 3 110 ? 51.626 14.711  17.824 1.00 70.29  ? 110 GLU A CB    1 
ATOM   3353 C  CG    . GLU E 3 110 ? 51.401 15.407  16.486 1.00 70.78  ? 110 GLU A CG    1 
ATOM   3354 C  CD    . GLU E 3 110 ? 52.523 16.355  16.115 1.00 70.64  ? 110 GLU A CD    1 
ATOM   3355 O  OE1   . GLU E 3 110 ? 52.789 17.307  16.881 1.00 69.57  ? 110 GLU A OE1   1 
ATOM   3356 O  OE2   . GLU E 3 110 ? 53.138 16.145  15.050 1.00 71.39  ? 110 GLU A OE2   1 
ATOM   3357 N  N     . ASN E 3 111 ? 49.300 16.345  19.277 1.00 67.83  ? 111 ASN A N     1 
ATOM   3358 C  CA    . ASN E 3 111 ? 47.961 16.403  19.852 1.00 67.10  ? 111 ASN A CA    1 
ATOM   3359 C  C     . ASN E 3 111 ? 47.999 17.340  21.055 1.00 65.46  ? 111 ASN A C     1 
ATOM   3360 O  O     . ASN E 3 111 ? 47.268 18.331  21.108 1.00 65.70  ? 111 ASN A O     1 
ATOM   3361 C  CB    . ASN E 3 111 ? 47.483 15.004  20.269 1.00 66.77  ? 111 ASN A CB    1 
ATOM   3362 C  CG    . ASN E 3 111 ? 46.323 14.504  19.419 1.00 65.81  ? 111 ASN A CG    1 
ATOM   3363 O  OD1   . ASN E 3 111 ? 45.164 14.626  19.807 1.00 64.67  ? 111 ASN A OD1   1 
ATOM   3364 N  ND2   . ASN E 3 111 ? 46.634 13.938  18.255 1.00 63.82  ? 111 ASN A ND2   1 
ATOM   3365 N  N     . CYS E 3 112 ? 48.863 17.033  22.014 1.00 63.73  ? 112 CYS A N     1 
ATOM   3366 C  CA    . CYS E 3 112 ? 48.994 17.869  23.200 1.00 63.35  ? 112 CYS A CA    1 
ATOM   3367 C  C     . CYS E 3 112 ? 49.617 19.192  22.784 1.00 62.72  ? 112 CYS A C     1 
ATOM   3368 O  O     . CYS E 3 112 ? 49.293 20.242  23.338 1.00 63.32  ? 112 CYS A O     1 
ATOM   3369 C  CB    . CYS E 3 112 ? 49.879 17.183  24.243 1.00 63.43  ? 112 CYS A CB    1 
ATOM   3370 S  SG    . CYS E 3 112 ? 51.309 18.146  24.802 1.00 65.18  ? 112 CYS A SG    1 
ATOM   3371 N  N     . GLY E 3 113 ? 50.512 19.118  21.802 1.00 60.72  ? 113 GLY A N     1 
ATOM   3372 C  CA    . GLY E 3 113 ? 51.191 20.294  21.289 1.00 57.53  ? 113 GLY A CA    1 
ATOM   3373 C  C     . GLY E 3 113 ? 51.328 21.448  22.259 1.00 57.53  ? 113 GLY A C     1 
ATOM   3374 O  O     . GLY E 3 113 ? 50.409 22.253  22.409 1.00 59.63  ? 113 GLY A O     1 
ATOM   3375 N  N     . LYS E 3 114 ? 52.478 21.533  22.919 1.00 56.89  ? 114 LYS A N     1 
ATOM   3376 C  CA    . LYS E 3 114 ? 52.743 22.608  23.870 1.00 55.29  ? 114 LYS A CA    1 
ATOM   3377 C  C     . LYS E 3 114 ? 54.216 22.997  23.789 1.00 52.43  ? 114 LYS A C     1 
ATOM   3378 O  O     . LYS E 3 114 ? 54.940 22.524  22.920 1.00 48.40  ? 114 LYS A O     1 
ATOM   3379 C  CB    . LYS E 3 114 ? 52.399 22.156  25.291 1.00 55.57  ? 114 LYS A CB    1 
ATOM   3380 C  CG    . LYS E 3 114 ? 50.913 22.011  25.555 1.00 56.90  ? 114 LYS A CG    1 
ATOM   3381 C  CD    . LYS E 3 114 ? 50.307 23.323  26.026 1.00 60.02  ? 114 LYS A CD    1 
ATOM   3382 C  CE    . LYS E 3 114 ? 49.451 23.962  24.937 1.00 61.04  ? 114 LYS A CE    1 
ATOM   3383 N  NZ    . LYS E 3 114 ? 48.573 25.047  25.468 1.00 59.84  ? 114 LYS A NZ    1 
ATOM   3384 N  N     . ALA E 3 115 ? 54.661 23.855  24.695 1.00 53.64  ? 115 ALA A N     1 
ATOM   3385 C  CA    . ALA E 3 115 ? 56.051 24.272  24.694 1.00 56.12  ? 115 ALA A CA    1 
ATOM   3386 C  C     . ALA E 3 115 ? 56.451 24.866  26.033 1.00 59.77  ? 115 ALA A C     1 
ATOM   3387 O  O     . ALA E 3 115 ? 55.609 25.089  26.900 1.00 59.85  ? 115 ALA A O     1 
ATOM   3388 C  CB    . ALA E 3 115 ? 56.281 25.276  23.593 1.00 58.06  ? 115 ALA A CB    1 
ATOM   3389 N  N     . PHE E 3 116 ? 57.747 25.118  26.191 1.00 65.90  ? 116 PHE A N     1 
ATOM   3390 C  CA    . PHE E 3 116 ? 58.288 25.686  27.423 1.00 72.33  ? 116 PHE A CA    1 
ATOM   3391 C  C     . PHE E 3 116 ? 59.587 26.449  27.159 1.00 77.03  ? 116 PHE A C     1 
ATOM   3392 O  O     . PHE E 3 116 ? 60.302 26.170  26.196 1.00 77.49  ? 116 PHE A O     1 
ATOM   3393 C  CB    . PHE E 3 116 ? 58.558 24.578  28.445 1.00 71.10  ? 116 PHE A CB    1 
ATOM   3394 C  CG    . PHE E 3 116 ? 57.318 23.933  28.979 1.00 69.13  ? 116 PHE A CG    1 
ATOM   3395 C  CD1   . PHE E 3 116 ? 56.667 24.463  30.083 1.00 68.94  ? 116 PHE A CD1   1 
ATOM   3396 C  CD2   . PHE E 3 116 ? 56.792 22.802  28.368 1.00 68.98  ? 116 PHE A CD2   1 
ATOM   3397 C  CE1   . PHE E 3 116 ? 55.510 23.878  30.570 1.00 69.63  ? 116 PHE A CE1   1 
ATOM   3398 C  CE2   . PHE E 3 116 ? 55.637 22.210  28.846 1.00 69.66  ? 116 PHE A CE2   1 
ATOM   3399 C  CZ    . PHE E 3 116 ? 54.994 22.749  29.950 1.00 70.63  ? 116 PHE A CZ    1 
ATOM   3400 N  N     . LYS E 3 117 ? 59.891 27.411  28.023 1.00 81.12  ? 117 LYS A N     1 
ATOM   3401 C  CA    . LYS E 3 117 ? 61.106 28.190  27.868 1.00 83.68  ? 117 LYS A CA    1 
ATOM   3402 C  C     . LYS E 3 117 ? 62.328 27.347  28.231 1.00 82.49  ? 117 LYS A C     1 
ATOM   3403 O  O     . LYS E 3 117 ? 63.374 27.465  27.596 1.00 83.44  ? 117 LYS A O     1 
ATOM   3404 C  CB    . LYS E 3 117 ? 61.049 29.451  28.741 1.00 88.50  ? 117 LYS A CB    1 
ATOM   3405 C  CG    . LYS E 3 117 ? 60.775 29.203  30.226 1.00 92.94  ? 117 LYS A CG    1 
ATOM   3406 C  CD    . LYS E 3 117 ? 61.321 30.351  31.087 1.00 95.64  ? 117 LYS A CD    1 
ATOM   3407 C  CE    . LYS E 3 117 ? 60.461 30.610  32.327 1.00 96.72  ? 117 LYS A CE    1 
ATOM   3408 N  NZ    . LYS E 3 117 ? 60.793 31.906  32.998 1.00 96.33  ? 117 LYS A NZ    1 
ATOM   3409 N  N     . LYS E 3 118 ? 62.191 26.492  29.243 1.00 80.60  ? 118 LYS A N     1 
ATOM   3410 C  CA    . LYS E 3 118 ? 63.298 25.640  29.677 1.00 79.04  ? 118 LYS A CA    1 
ATOM   3411 C  C     . LYS E 3 118 ? 63.090 24.193  29.263 1.00 76.36  ? 118 LYS A C     1 
ATOM   3412 O  O     . LYS E 3 118 ? 61.957 23.757  29.067 1.00 74.97  ? 118 LYS A O     1 
ATOM   3413 C  CB    . LYS E 3 118 ? 63.464 25.700  31.199 1.00 80.31  ? 118 LYS A CB    1 
ATOM   3414 C  CG    . LYS E 3 118 ? 62.777 26.877  31.869 1.00 81.18  ? 118 LYS A CG    1 
ATOM   3415 C  CD    . LYS E 3 118 ? 63.664 27.485  32.946 1.00 81.76  ? 118 LYS A CD    1 
ATOM   3416 C  CE    . LYS E 3 118 ? 62.906 27.670  34.252 1.00 81.26  ? 118 LYS A CE    1 
ATOM   3417 N  NZ    . LYS E 3 118 ? 63.173 26.559  35.206 1.00 80.74  ? 118 LYS A NZ    1 
ATOM   3418 N  N     . HIS E 3 119 ? 64.191 23.456  29.130 1.00 74.39  ? 119 HIS A N     1 
ATOM   3419 C  CA    . HIS E 3 119 ? 64.138 22.048  28.743 1.00 72.32  ? 119 HIS A CA    1 
ATOM   3420 C  C     . HIS E 3 119 ? 63.502 21.226  29.851 1.00 71.34  ? 119 HIS A C     1 
ATOM   3421 O  O     . HIS E 3 119 ? 62.599 20.424  29.611 1.00 69.64  ? 119 HIS A O     1 
ATOM   3422 C  CB    . HIS E 3 119 ? 65.544 21.511  28.473 1.00 71.75  ? 119 HIS A CB    1 
ATOM   3423 C  CG    . HIS E 3 119 ? 65.661 20.022  28.620 1.00 72.39  ? 119 HIS A CG    1 
ATOM   3424 N  ND1   . HIS E 3 119 ? 65.610 19.385  29.842 1.00 71.55  ? 119 HIS A ND1   1 
ATOM   3425 C  CD2   . HIS E 3 119 ? 65.826 19.045  27.696 1.00 72.44  ? 119 HIS A CD2   1 
ATOM   3426 C  CE1   . HIS E 3 119 ? 65.739 18.083  29.665 1.00 70.94  ? 119 HIS A CE1   1 
ATOM   3427 N  NE2   . HIS E 3 119 ? 65.871 17.850  28.372 1.00 71.60  ? 119 HIS A NE2   1 
ATOM   3428 N  N     . ASN E 3 120 ? 63.999 21.421  31.066 1.00 71.69  ? 120 ASN A N     1 
ATOM   3429 C  CA    . ASN E 3 120 ? 63.487 20.706  32.223 1.00 73.59  ? 120 ASN A CA    1 
ATOM   3430 C  C     . ASN E 3 120 ? 61.978 20.897  32.312 1.00 71.82  ? 120 ASN A C     1 
ATOM   3431 O  O     . ASN E 3 120 ? 61.233 19.957  32.589 1.00 72.23  ? 120 ASN A O     1 
ATOM   3432 C  CB    . ASN E 3 120 ? 64.157 21.225  33.500 1.00 76.53  ? 120 ASN A CB    1 
ATOM   3433 C  CG    . ASN E 3 120 ? 65.641 20.883  33.567 1.00 77.97  ? 120 ASN A CG    1 
ATOM   3434 O  OD1   . ASN E 3 120 ? 66.135 20.399  34.591 1.00 78.36  ? 120 ASN A OD1   1 
ATOM   3435 N  ND2   . ASN E 3 120 ? 66.357 21.136  32.475 1.00 77.27  ? 120 ASN A ND2   1 
ATOM   3436 N  N     . GLN E 3 121 ? 61.533 22.122  32.065 1.00 69.96  ? 121 GLN A N     1 
ATOM   3437 C  CA    . GLN E 3 121 ? 60.114 22.444  32.115 1.00 69.05  ? 121 GLN A CA    1 
ATOM   3438 C  C     . GLN E 3 121 ? 59.300 21.495  31.237 1.00 63.65  ? 121 GLN A C     1 
ATOM   3439 O  O     . GLN E 3 121 ? 58.211 21.057  31.610 1.00 63.62  ? 121 GLN A O     1 
ATOM   3440 C  CB    . GLN E 3 121 ? 59.899 23.893  31.670 1.00 73.40  ? 121 GLN A CB    1 
ATOM   3441 C  CG    . GLN E 3 121 ? 60.175 24.940  32.760 1.00 77.39  ? 121 GLN A CG    1 
ATOM   3442 C  CD    . GLN E 3 121 ? 60.941 24.380  33.960 1.00 79.87  ? 121 GLN A CD    1 
ATOM   3443 O  OE1   . GLN E 3 121 ? 62.096 23.967  33.836 1.00 80.37  ? 121 GLN A OE1   1 
ATOM   3444 N  NE2   . GLN E 3 121 ? 60.297 24.368  35.125 1.00 80.56  ? 121 GLN A NE2   1 
ATOM   3445 N  N     . LEU E 3 122 ? 59.836 21.179  30.066 1.00 56.87  ? 122 LEU A N     1 
ATOM   3446 C  CA    . LEU E 3 122 ? 59.161 20.274  29.150 1.00 49.53  ? 122 LEU A CA    1 
ATOM   3447 C  C     . LEU E 3 122 ? 59.165 18.892  29.774 1.00 47.47  ? 122 LEU A C     1 
ATOM   3448 O  O     . LEU E 3 122 ? 58.116 18.269  29.932 1.00 46.81  ? 122 LEU A O     1 
ATOM   3449 C  CB    . LEU E 3 122 ? 59.896 20.242  27.811 1.00 46.40  ? 122 LEU A CB    1 
ATOM   3450 C  CG    . LEU E 3 122 ? 59.771 18.985  26.952 1.00 43.73  ? 122 LEU A CG    1 
ATOM   3451 C  CD1   . LEU E 3 122 ? 58.389 18.932  26.321 1.00 41.82  ? 122 LEU A CD1   1 
ATOM   3452 C  CD2   . LEU E 3 122 ? 60.861 18.994  25.884 1.00 42.74  ? 122 LEU A CD2   1 
ATOM   3453 N  N     . LYS E 3 123 ? 60.361 18.430  30.131 1.00 45.87  ? 123 LYS A N     1 
ATOM   3454 C  CA    . LYS E 3 123 ? 60.547 17.120  30.745 1.00 44.84  ? 123 LYS A CA    1 
ATOM   3455 C  C     . LYS E 3 123 ? 59.413 16.838  31.721 1.00 41.17  ? 123 LYS A C     1 
ATOM   3456 O  O     . LYS E 3 123 ? 58.737 15.812  31.631 1.00 39.12  ? 123 LYS A O     1 
ATOM   3457 C  CB    . LYS E 3 123 ? 61.894 17.067  31.479 1.00 46.92  ? 123 LYS A CB    1 
ATOM   3458 C  CG    . LYS E 3 123 ? 63.049 16.507  30.646 1.00 48.49  ? 123 LYS A CG    1 
ATOM   3459 C  CD    . LYS E 3 123 ? 63.291 15.027  30.940 1.00 50.33  ? 123 LYS A CD    1 
ATOM   3460 C  CE    . LYS E 3 123 ? 64.672 14.793  31.543 1.00 52.05  ? 123 LYS A CE    1 
ATOM   3461 N  NZ    . LYS E 3 123 ? 64.613 14.340  32.965 1.00 53.07  ? 123 LYS A NZ    1 
ATOM   3462 N  N     . VAL E 3 124 ? 59.211 17.760  32.654 1.00 38.45  ? 124 VAL A N     1 
ATOM   3463 C  CA    . VAL E 3 124 ? 58.149 17.614  33.629 1.00 36.32  ? 124 VAL A CA    1 
ATOM   3464 C  C     . VAL E 3 124 ? 56.864 17.318  32.865 1.00 38.25  ? 124 VAL A C     1 
ATOM   3465 O  O     . VAL E 3 124 ? 56.407 16.174  32.831 1.00 39.71  ? 124 VAL A O     1 
ATOM   3466 C  CB    . VAL E 3 124 ? 57.971 18.901  34.453 1.00 33.03  ? 124 VAL A CB    1 
ATOM   3467 C  CG1   . VAL E 3 124 ? 56.662 18.852  35.232 1.00 30.18  ? 124 VAL A CG1   1 
ATOM   3468 C  CG2   . VAL E 3 124 ? 59.150 19.069  35.395 1.00 33.32  ? 124 VAL A CG2   1 
ATOM   3469 N  N     . HIS E 3 125 ? 56.303 18.348  32.236 1.00 37.63  ? 125 HIS A N     1 
ATOM   3470 C  CA    . HIS E 3 125 ? 55.070 18.210  31.466 1.00 33.64  ? 125 HIS A CA    1 
ATOM   3471 C  C     . HIS E 3 125 ? 54.937 16.804  30.893 1.00 34.74  ? 125 HIS A C     1 
ATOM   3472 O  O     . HIS E 3 125 ? 54.004 16.076  31.227 1.00 32.93  ? 125 HIS A O     1 
ATOM   3473 C  CB    . HIS E 3 125 ? 55.038 19.223  30.318 1.00 27.80  ? 125 HIS A CB    1 
ATOM   3474 C  CG    . HIS E 3 125 ? 53.987 18.934  29.290 1.00 24.44  ? 125 HIS A CG    1 
ATOM   3475 N  ND1   . HIS E 3 125 ? 52.691 18.573  29.590 1.00 23.73  ? 125 HIS A ND1   1 
ATOM   3476 C  CD2   . HIS E 3 125 ? 54.060 18.940  27.936 1.00 22.41  ? 125 HIS A CD2   1 
ATOM   3477 C  CE1   . HIS E 3 125 ? 52.036 18.378  28.439 1.00 19.48  ? 125 HIS A CE1   1 
ATOM   3478 N  NE2   . HIS E 3 125 ? 52.826 18.589  27.407 1.00 19.46  ? 125 HIS A NE2   1 
ATOM   3479 N  N     . GLN E 3 126 ? 55.888 16.436  30.037 1.00 37.38  ? 126 GLN A N     1 
ATOM   3480 C  CA    . GLN E 3 126 ? 55.904 15.129  29.388 1.00 38.33  ? 126 GLN A CA    1 
ATOM   3481 C  C     . GLN E 3 126 ? 55.377 14.024  30.299 1.00 38.38  ? 126 GLN A C     1 
ATOM   3482 O  O     . GLN E 3 126 ? 54.697 13.103  29.844 1.00 35.93  ? 126 GLN A O     1 
ATOM   3483 C  CB    . GLN E 3 126 ? 57.326 14.799  28.926 1.00 38.80  ? 126 GLN A CB    1 
ATOM   3484 C  CG    . GLN E 3 126 ? 57.866 15.754  27.867 1.00 39.43  ? 126 GLN A CG    1 
ATOM   3485 C  CD    . GLN E 3 126 ? 58.983 15.145  27.036 1.00 40.61  ? 126 GLN A CD    1 
ATOM   3486 O  OE1   . GLN E 3 126 ? 60.041 14.788  27.559 1.00 42.46  ? 126 GLN A OE1   1 
ATOM   3487 N  NE2   . GLN E 3 126 ? 58.753 15.026  25.732 1.00 38.74  ? 126 GLN A NE2   1 
ATOM   3488 N  N     . PHE E 3 127 ? 55.691 14.129  31.587 1.00 40.71  ? 127 PHE A N     1 
ATOM   3489 C  CA    . PHE E 3 127 ? 55.252 13.146  32.570 1.00 43.67  ? 127 PHE A CA    1 
ATOM   3490 C  C     . PHE E 3 127 ? 53.727 13.081  32.644 1.00 45.43  ? 127 PHE A C     1 
ATOM   3491 O  O     . PHE E 3 127 ? 53.155 12.084  33.093 1.00 46.12  ? 127 PHE A O     1 
ATOM   3492 C  CB    . PHE E 3 127 ? 55.830 13.485  33.947 1.00 41.87  ? 127 PHE A CB    1 
ATOM   3493 C  CG    . PHE E 3 127 ? 57.164 12.859  34.209 1.00 39.85  ? 127 PHE A CG    1 
ATOM   3494 C  CD1   . PHE E 3 127 ? 58.159 12.884  33.246 1.00 41.38  ? 127 PHE A CD1   1 
ATOM   3495 C  CD2   . PHE E 3 127 ? 57.425 12.244  35.420 1.00 40.98  ? 127 PHE A CD2   1 
ATOM   3496 C  CE1   . PHE E 3 127 ? 59.403 12.303  33.488 1.00 43.15  ? 127 PHE A CE1   1 
ATOM   3497 C  CE2   . PHE E 3 127 ? 58.663 11.660  35.676 1.00 42.63  ? 127 PHE A CE2   1 
ATOM   3498 C  CZ    . PHE E 3 127 ? 59.655 11.690  34.707 1.00 42.58  ? 127 PHE A CZ    1 
ATOM   3499 N  N     . SER E 3 128 ? 53.073 14.150  32.204 1.00 45.34  ? 128 SER A N     1 
ATOM   3500 C  CA    . SER E 3 128 ? 51.621 14.205  32.201 1.00 46.02  ? 128 SER A CA    1 
ATOM   3501 C  C     . SER E 3 128 ? 51.090 13.201  31.176 1.00 46.93  ? 128 SER A C     1 
ATOM   3502 O  O     . SER E 3 128 ? 49.903 12.868  31.170 1.00 50.94  ? 128 SER A O     1 
ATOM   3503 C  CB    . SER E 3 128 ? 51.145 15.619  31.847 1.00 46.19  ? 128 SER A CB    1 
ATOM   3504 O  OG    . SER E 3 128 ? 51.498 15.967  30.520 1.00 46.24  ? 128 SER A OG    1 
ATOM   3505 N  N     . HIS E 3 129 ? 51.973 12.722  30.306 1.00 42.75  ? 129 HIS A N     1 
ATOM   3506 C  CA    . HIS E 3 129 ? 51.582 11.757  29.290 1.00 39.16  ? 129 HIS A CA    1 
ATOM   3507 C  C     . HIS E 3 129 ? 52.012 10.383  29.750 1.00 38.33  ? 129 HIS A C     1 
ATOM   3508 O  O     . HIS E 3 129 ? 52.211 9.485   28.938 1.00 38.70  ? 129 HIS A O     1 
ATOM   3509 C  CB    . HIS E 3 129 ? 52.255 12.075  27.954 1.00 39.37  ? 129 HIS A CB    1 
ATOM   3510 C  CG    . HIS E 3 129 ? 52.088 13.497  27.510 1.00 38.97  ? 129 HIS A CG    1 
ATOM   3511 N  ND1   . HIS E 3 129 ? 51.362 13.880  26.405 1.00 35.89  ? 129 HIS A ND1   1 
ATOM   3512 C  CD2   . HIS E 3 129 ? 52.604 14.642  28.025 1.00 38.00  ? 129 HIS A CD2   1 
ATOM   3513 C  CE1   . HIS E 3 129 ? 51.462 15.210  26.289 1.00 35.88  ? 129 HIS A CE1   1 
ATOM   3514 N  NE2   . HIS E 3 129 ? 52.207 15.719  27.250 1.00 36.08  ? 129 HIS A NE2   1 
ATOM   3515 N  N     . THR E 3 130 ? 52.159 10.230  31.061 1.00 40.35  ? 130 THR A N     1 
ATOM   3516 C  CA    . THR E 3 130 ? 52.586 8.961   31.643 1.00 43.49  ? 130 THR A CA    1 
ATOM   3517 C  C     . THR E 3 130 ? 51.582 8.391   32.627 1.00 44.70  ? 130 THR A C     1 
ATOM   3518 O  O     . THR E 3 130 ? 50.373 8.510   32.449 1.00 44.71  ? 130 THR A O     1 
ATOM   3519 C  CB    . THR E 3 130 ? 53.931 9.103   32.390 1.00 43.36  ? 130 THR A CB    1 
ATOM   3520 O  OG1   . THR E 3 130 ? 53.693 9.582   33.719 1.00 42.25  ? 130 THR A OG1   1 
ATOM   3521 C  CG2   . THR E 3 130 ? 54.846 10.068  31.661 1.00 45.59  ? 130 THR A CG2   1 
ATOM   3522 N  N     . GLN E 3 131 ? 52.111 7.753   33.662 1.00 46.17  ? 131 GLN A N     1 
ATOM   3523 C  CA    . GLN E 3 131 ? 51.303 7.159   34.703 1.00 49.11  ? 131 GLN A CA    1 
ATOM   3524 C  C     . GLN E 3 131 ? 51.989 7.495   36.006 1.00 49.97  ? 131 GLN A C     1 
ATOM   3525 O  O     . GLN E 3 131 ? 51.418 7.341   37.085 1.00 52.26  ? 131 GLN A O     1 
ATOM   3526 C  CB    . GLN E 3 131 ? 51.243 5.651   34.524 1.00 53.10  ? 131 GLN A CB    1 
ATOM   3527 C  CG    . GLN E 3 131 ? 50.391 5.216   33.361 1.00 56.57  ? 131 GLN A CG    1 
ATOM   3528 C  CD    . GLN E 3 131 ? 49.271 4.301   33.787 1.00 58.75  ? 131 GLN A CD    1 
ATOM   3529 O  OE1   . GLN E 3 131 ? 48.231 4.755   34.271 1.00 61.14  ? 131 GLN A OE1   1 
ATOM   3530 N  NE2   . GLN E 3 131 ? 49.475 2.999   33.613 1.00 58.50  ? 131 GLN A NE2   1 
ATOM   3531 N  N     . GLN E 3 132 ? 53.230 7.955   35.894 1.00 49.36  ? 132 GLN A N     1 
ATOM   3532 C  CA    . GLN E 3 132 ? 54.007 8.332   37.063 1.00 49.92  ? 132 GLN A CA    1 
ATOM   3533 C  C     . GLN E 3 132 ? 54.008 9.845   37.217 1.00 47.31  ? 132 GLN A C     1 
ATOM   3534 O  O     . GLN E 3 132 ? 53.606 10.579  36.311 1.00 44.19  ? 132 GLN A O     1 
ATOM   3535 C  CB    . GLN E 3 132 ? 55.447 7.828   36.935 1.00 51.82  ? 132 GLN A CB    1 
ATOM   3536 C  CG    . GLN E 3 132 ? 55.989 7.854   35.520 1.00 55.39  ? 132 GLN A CG    1 
ATOM   3537 C  CD    . GLN E 3 132 ? 56.919 6.696   35.235 1.00 56.99  ? 132 GLN A CD    1 
ATOM   3538 O  OE1   . GLN E 3 132 ? 57.743 6.328   36.070 1.00 57.55  ? 132 GLN A OE1   1 
ATOM   3539 N  NE2   . GLN E 3 132 ? 56.793 6.112   34.049 1.00 58.63  ? 132 GLN A NE2   1 
ATOM   3540 N  N     . LEU E 3 133 ? 54.452 10.302  38.380 1.00 46.74  ? 133 LEU A N     1 
ATOM   3541 C  CA    . LEU E 3 133 ? 54.522 11.722  38.664 1.00 47.32  ? 133 LEU A CA    1 
ATOM   3542 C  C     . LEU E 3 133 ? 55.927 12.193  38.327 1.00 48.28  ? 133 LEU A C     1 
ATOM   3543 O  O     . LEU E 3 133 ? 56.821 11.380  38.104 1.00 51.13  ? 133 LEU A O     1 
ATOM   3544 C  CB    . LEU E 3 133 ? 54.217 11.976  40.140 1.00 47.37  ? 133 LEU A CB    1 
ATOM   3545 C  CG    . LEU E 3 133 ? 52.818 12.511  40.449 1.00 47.77  ? 133 LEU A CG    1 
ATOM   3546 C  CD1   . LEU E 3 133 ? 51.774 11.614  39.806 1.00 48.27  ? 133 LEU A CD1   1 
ATOM   3547 C  CD2   . LEU E 3 133 ? 52.615 12.577  41.955 1.00 48.11  ? 133 LEU A CD2   1 
ATOM   3548 N  N     . PRO E 3 134 ? 56.146 13.511  38.295 1.00 46.48  ? 134 PRO A N     1 
ATOM   3549 C  CA    . PRO E 3 134 ? 57.470 14.039  37.974 1.00 46.46  ? 134 PRO A CA    1 
ATOM   3550 C  C     . PRO E 3 134 ? 58.458 13.890  39.115 1.00 48.34  ? 134 PRO A C     1 
ATOM   3551 O  O     . PRO E 3 134 ? 59.056 12.832  39.314 1.00 47.51  ? 134 PRO A O     1 
ATOM   3552 C  CB    . PRO E 3 134 ? 57.195 15.498  37.664 1.00 47.72  ? 134 PRO A CB    1 
ATOM   3553 C  CG    . PRO E 3 134 ? 56.043 15.828  38.561 1.00 48.51  ? 134 PRO A CG    1 
ATOM   3554 C  CD    . PRO E 3 134 ? 55.184 14.590  38.575 1.00 47.55  ? 134 PRO A CD    1 
ATOM   3555 N  N     . TYR E 3 135 ? 58.620 14.973  39.862 1.00 50.43  ? 135 TYR A N     1 
ATOM   3556 C  CA    . TYR E 3 135 ? 59.538 15.005  40.982 1.00 54.13  ? 135 TYR A CA    1 
ATOM   3557 C  C     . TYR E 3 135 ? 59.417 13.751  41.845 1.00 56.00  ? 135 TYR A C     1 
ATOM   3558 O  O     . TYR E 3 135 ? 58.524 13.646  42.680 1.00 57.98  ? 135 TYR A O     1 
ATOM   3559 C  CB    . TYR E 3 135 ? 59.267 16.260  41.813 1.00 55.83  ? 135 TYR A CB    1 
ATOM   3560 C  CG    . TYR E 3 135 ? 59.316 17.550  41.019 1.00 56.41  ? 135 TYR A CG    1 
ATOM   3561 C  CD1   . TYR E 3 135 ? 60.532 18.160  40.719 1.00 57.27  ? 135 TYR A CD1   1 
ATOM   3562 C  CD2   . TYR E 3 135 ? 58.147 18.171  40.587 1.00 57.44  ? 135 TYR A CD2   1 
ATOM   3563 C  CE1   . TYR E 3 135 ? 60.582 19.358  40.010 1.00 58.55  ? 135 TYR A CE1   1 
ATOM   3564 C  CE2   . TYR E 3 135 ? 58.183 19.369  39.878 1.00 58.80  ? 135 TYR A CE2   1 
ATOM   3565 C  CZ    . TYR E 3 135 ? 59.404 19.957  39.593 1.00 59.43  ? 135 TYR A CZ    1 
ATOM   3566 O  OH    . TYR E 3 135 ? 59.448 21.140  38.892 1.00 61.10  ? 135 TYR A OH    1 
ATOM   3567 N  N     . GLU E 3 136 ? 60.318 12.796  41.641 1.00 58.20  ? 136 GLU A N     1 
ATOM   3568 C  CA    . GLU E 3 136 ? 60.289 11.557  42.412 1.00 61.53  ? 136 GLU A CA    1 
ATOM   3569 C  C     . GLU E 3 136 ? 61.447 11.483  43.397 1.00 59.88  ? 136 GLU A C     1 
ATOM   3570 O  O     . GLU E 3 136 ? 62.453 12.178  43.246 1.00 58.19  ? 136 GLU A O     1 
ATOM   3571 C  CB    . GLU E 3 136 ? 60.318 10.350  41.473 1.00 66.35  ? 136 GLU A CB    1 
ATOM   3572 C  CG    . GLU E 3 136 ? 61.238 9.229   41.911 1.00 71.41  ? 136 GLU A CG    1 
ATOM   3573 C  CD    . GLU E 3 136 ? 62.661 9.419   41.415 1.00 75.71  ? 136 GLU A CD    1 
ATOM   3574 O  OE1   . GLU E 3 136 ? 63.335 10.366  41.879 1.00 76.44  ? 136 GLU A OE1   1 
ATOM   3575 O  OE2   . GLU E 3 136 ? 63.106 8.619   40.559 1.00 77.50  ? 136 GLU A OE2   1 
ATOM   3576 N  N     . CYS E 3 137 ? 61.298 10.630  44.405 1.00 61.26  ? 137 CYS A N     1 
ATOM   3577 C  CA    . CYS E 3 137 ? 62.320 10.474  45.434 1.00 63.50  ? 137 CYS A CA    1 
ATOM   3578 C  C     . CYS E 3 137 ? 63.620 9.939   44.881 1.00 65.34  ? 137 CYS A C     1 
ATOM   3579 O  O     . CYS E 3 137 ? 63.645 8.919   44.208 1.00 69.20  ? 137 CYS A O     1 
ATOM   3580 C  CB    . CYS E 3 137 ? 61.833 9.540   46.548 1.00 60.73  ? 137 CYS A CB    1 
ATOM   3581 S  SG    . CYS E 3 137 ? 62.927 9.468   47.995 1.00 54.76  ? 137 CYS A SG    1 
ATOM   3582 N  N     . PRO E 3 138 ? 64.725 10.627  45.164 1.00 65.59  ? 138 PRO A N     1 
ATOM   3583 C  CA    . PRO E 3 138 ? 66.045 10.214  44.695 1.00 69.36  ? 138 PRO A CA    1 
ATOM   3584 C  C     . PRO E 3 138 ? 66.736 9.361   45.748 1.00 74.69  ? 138 PRO A C     1 
ATOM   3585 O  O     . PRO E 3 138 ? 67.148 9.873   46.786 1.00 75.69  ? 138 PRO A O     1 
ATOM   3586 C  CB    . PRO E 3 138 ? 66.762 11.534  44.484 1.00 69.98  ? 138 PRO A CB    1 
ATOM   3587 C  CG    . PRO E 3 138 ? 66.088 12.488  45.471 1.00 69.31  ? 138 PRO A CG    1 
ATOM   3588 C  CD    . PRO E 3 138 ? 64.794 11.872  45.939 1.00 66.15  ? 138 PRO A CD    1 
ATOM   3589 N  N     . HIS E 3 139 ? 66.855 8.064   45.478 1.00 79.77  ? 139 HIS A N     1 
ATOM   3590 C  CA    . HIS E 3 139 ? 67.492 7.124   46.403 1.00 84.11  ? 139 HIS A CA    1 
ATOM   3591 C  C     . HIS E 3 139 ? 67.215 5.699   45.933 1.00 86.82  ? 139 HIS A C     1 
ATOM   3592 O  O     . HIS E 3 139 ? 66.395 5.482   45.040 1.00 87.12  ? 139 HIS A O     1 
ATOM   3593 C  CB    . HIS E 3 139 ? 66.928 7.298   47.817 1.00 85.42  ? 139 HIS A CB    1 
ATOM   3594 C  CG    . HIS E 3 139 ? 67.924 7.799   48.819 1.00 86.59  ? 139 HIS A CG    1 
ATOM   3595 N  ND1   . HIS E 3 139 ? 68.002 9.124   49.194 1.00 86.79  ? 139 HIS A ND1   1 
ATOM   3596 C  CD2   . HIS E 3 139 ? 68.853 7.145   49.556 1.00 86.81  ? 139 HIS A CD2   1 
ATOM   3597 C  CE1   . HIS E 3 139 ? 68.934 9.264   50.119 1.00 86.73  ? 139 HIS A CE1   1 
ATOM   3598 N  NE2   . HIS E 3 139 ? 69.466 8.078   50.357 1.00 87.13  ? 139 HIS A NE2   1 
ATOM   3599 N  N     . GLU E 3 140 ? 67.901 4.730   46.534 1.00 88.82  ? 140 GLU A N     1 
ATOM   3600 C  CA    . GLU E 3 140 ? 67.696 3.333   46.175 1.00 90.38  ? 140 GLU A CA    1 
ATOM   3601 C  C     . GLU E 3 140 ? 66.454 2.842   46.905 1.00 87.89  ? 140 GLU A C     1 
ATOM   3602 O  O     . GLU E 3 140 ? 66.186 3.258   48.031 1.00 86.37  ? 140 GLU A O     1 
ATOM   3603 C  CB    . GLU E 3 140 ? 68.910 2.488   46.570 1.00 94.79  ? 140 GLU A CB    1 
ATOM   3604 C  CG    . GLU E 3 140 ? 69.738 1.989   45.382 1.00 98.87  ? 140 GLU A CG    1 
ATOM   3605 C  CD    . GLU E 3 140 ? 68.954 1.081   44.438 1.00 100.00 ? 140 GLU A CD    1 
ATOM   3606 O  OE1   . GLU E 3 140 ? 68.914 -0.149  44.676 1.00 100.00 ? 140 GLU A OE1   1 
ATOM   3607 O  OE2   . GLU E 3 140 ? 68.383 1.599   43.454 1.00 100.00 ? 140 GLU A OE2   1 
ATOM   3608 N  N     . GLY E 3 141 ? 65.703 1.952   46.267 1.00 86.89  ? 141 GLY A N     1 
ATOM   3609 C  CA    . GLY E 3 141 ? 64.484 1.463   46.877 1.00 87.19  ? 141 GLY A CA    1 
ATOM   3610 C  C     . GLY E 3 141 ? 63.479 2.601   46.841 1.00 88.32  ? 141 GLY A C     1 
ATOM   3611 O  O     . GLY E 3 141 ? 63.558 3.470   45.970 1.00 88.39  ? 141 GLY A O     1 
ATOM   3612 N  N     . CYS E 3 142 ? 62.543 2.609   47.785 1.00 88.45  ? 142 CYS A N     1 
ATOM   3613 C  CA    . CYS E 3 142 ? 61.527 3.660   47.856 1.00 86.91  ? 142 CYS A CA    1 
ATOM   3614 C  C     . CYS E 3 142 ? 60.761 3.802   46.547 1.00 85.91  ? 142 CYS A C     1 
ATOM   3615 O  O     . CYS E 3 142 ? 59.662 3.268   46.399 1.00 85.53  ? 142 CYS A O     1 
ATOM   3616 C  CB    . CYS E 3 142 ? 62.172 5.007   48.208 1.00 85.48  ? 142 CYS A CB    1 
ATOM   3617 S  SG    . CYS E 3 142 ? 61.078 6.154   49.080 1.00 82.25  ? 142 CYS A SG    1 
ATOM   3618 N  N     . ASP E 3 143 ? 61.351 4.531   45.606 1.00 84.82  ? 143 ASP A N     1 
ATOM   3619 C  CA    . ASP E 3 143 ? 60.741 4.762   44.304 1.00 83.70  ? 143 ASP A CA    1 
ATOM   3620 C  C     . ASP E 3 143 ? 59.561 5.726   44.417 1.00 79.47  ? 143 ASP A C     1 
ATOM   3621 O  O     . ASP E 3 143 ? 59.059 6.223   43.409 1.00 79.96  ? 143 ASP A O     1 
ATOM   3622 C  CB    . ASP E 3 143 ? 60.297 3.428   43.682 1.00 87.61  ? 143 ASP A CB    1 
ATOM   3623 C  CG    . ASP E 3 143 ? 58.786 3.295   43.581 1.00 90.30  ? 143 ASP A CG    1 
ATOM   3624 O  OD1   . ASP E 3 143 ? 58.203 3.808   42.600 1.00 91.50  ? 143 ASP A OD1   1 
ATOM   3625 O  OD2   . ASP E 3 143 ? 58.183 2.671   44.480 1.00 91.19  ? 143 ASP A OD2   1 
ATOM   3626 N  N     . LYS E 3 144 ? 59.131 5.996   45.648 1.00 73.89  ? 144 LYS A N     1 
ATOM   3627 C  CA    . LYS E 3 144 ? 58.021 6.914   45.887 1.00 68.32  ? 144 LYS A CA    1 
ATOM   3628 C  C     . LYS E 3 144 ? 58.246 8.189   45.075 1.00 63.87  ? 144 LYS A C     1 
ATOM   3629 O  O     . LYS E 3 144 ? 59.289 8.831   45.190 1.00 63.39  ? 144 LYS A O     1 
ATOM   3630 C  CB    . LYS E 3 144 ? 57.926 7.256   47.383 1.00 68.36  ? 144 LYS A CB    1 
ATOM   3631 C  CG    . LYS E 3 144 ? 56.653 6.753   48.080 1.00 67.90  ? 144 LYS A CG    1 
ATOM   3632 C  CD    . LYS E 3 144 ? 56.759 6.829   49.607 1.00 65.72  ? 144 LYS A CD    1 
ATOM   3633 C  CE    . LYS E 3 144 ? 55.693 7.741   50.201 1.00 64.85  ? 144 LYS A CE    1 
ATOM   3634 N  NZ    . LYS E 3 144 ? 55.916 8.004   51.656 1.00 63.75  ? 144 LYS A NZ    1 
ATOM   3635 N  N     . ARG E 3 145 ? 57.273 8.541   44.243 1.00 59.87  ? 145 ARG A N     1 
ATOM   3636 C  CA    . ARG E 3 145 ? 57.375 9.736   43.412 1.00 57.08  ? 145 ARG A CA    1 
ATOM   3637 C  C     . ARG E 3 145 ? 56.472 10.840  43.943 1.00 54.12  ? 145 ARG A C     1 
ATOM   3638 O  O     . ARG E 3 145 ? 55.659 10.610  44.838 1.00 55.33  ? 145 ARG A O     1 
ATOM   3639 C  CB    . ARG E 3 145 ? 57.000 9.400   41.973 1.00 57.80  ? 145 ARG A CB    1 
ATOM   3640 C  CG    . ARG E 3 145 ? 57.628 8.112   41.485 1.00 60.26  ? 145 ARG A CG    1 
ATOM   3641 C  CD    . ARG E 3 145 ? 57.082 7.703   40.136 1.00 62.04  ? 145 ARG A CD    1 
ATOM   3642 N  NE    . ARG E 3 145 ? 58.134 7.675   39.129 1.00 63.06  ? 145 ARG A NE    1 
ATOM   3643 C  CZ    . ARG E 3 145 ? 58.811 8.746   38.733 1.00 64.22  ? 145 ARG A CZ    1 
ATOM   3644 N  NH1   . ARG E 3 145 ? 58.545 9.932   39.259 1.00 64.48  ? 145 ARG A NH1   1 
ATOM   3645 N  NH2   . ARG E 3 145 ? 59.755 8.633   37.810 1.00 65.87  ? 145 ARG A NH2   1 
ATOM   3646 N  N     . PHE E 3 146 ? 56.621 12.043  43.401 1.00 50.74  ? 146 PHE A N     1 
ATOM   3647 C  CA    . PHE E 3 146 ? 55.812 13.173  43.847 1.00 50.26  ? 146 PHE A CA    1 
ATOM   3648 C  C     . PHE E 3 146 ? 55.522 14.195  42.749 1.00 51.78  ? 146 PHE A C     1 
ATOM   3649 O  O     . PHE E 3 146 ? 56.076 14.142  41.647 1.00 52.26  ? 146 PHE A O     1 
ATOM   3650 C  CB    . PHE E 3 146 ? 56.505 13.911  44.998 1.00 48.41  ? 146 PHE A CB    1 
ATOM   3651 C  CG    . PHE E 3 146 ? 56.937 13.027  46.124 1.00 46.79  ? 146 PHE A CG    1 
ATOM   3652 C  CD1   . PHE E 3 146 ? 58.148 12.356  46.069 1.00 45.55  ? 146 PHE A CD1   1 
ATOM   3653 C  CD2   . PHE E 3 146 ? 56.140 12.878  47.252 1.00 47.44  ? 146 PHE A CD2   1 
ATOM   3654 C  CE1   . PHE E 3 146 ? 58.562 11.552  47.116 1.00 45.87  ? 146 PHE A CE1   1 
ATOM   3655 C  CE2   . PHE E 3 146 ? 56.545 12.074  48.309 1.00 46.81  ? 146 PHE A CE2   1 
ATOM   3656 C  CZ    . PHE E 3 146 ? 57.758 11.411  48.240 1.00 47.14  ? 146 PHE A CZ    1 
ATOM   3657 N  N     . SER E 3 147 ? 54.642 15.133  43.077 1.00 50.50  ? 147 SER A N     1 
ATOM   3658 C  CA    . SER E 3 147 ? 54.280 16.201  42.166 1.00 47.55  ? 147 SER A CA    1 
ATOM   3659 C  C     . SER E 3 147 ? 55.034 17.419  42.661 1.00 46.43  ? 147 SER A C     1 
ATOM   3660 O  O     . SER E 3 147 ? 56.084 17.771  42.139 1.00 47.77  ? 147 SER A O     1 
ATOM   3661 C  CB    . SER E 3 147 ? 52.778 16.478  42.228 1.00 47.44  ? 147 SER A CB    1 
ATOM   3662 O  OG    . SER E 3 147 ? 52.031 15.352  41.811 1.00 48.69  ? 147 SER A OG    1 
ATOM   3663 N  N     . LEU E 3 148 ? 54.498 18.038  43.702 1.00 43.53  ? 148 LEU A N     1 
ATOM   3664 C  CA    . LEU E 3 148 ? 55.093 19.226  44.287 1.00 41.08  ? 148 LEU A CA    1 
ATOM   3665 C  C     . LEU E 3 148 ? 56.424 18.911  44.964 1.00 36.42  ? 148 LEU A C     1 
ATOM   3666 O  O     . LEU E 3 148 ? 56.469 18.227  45.988 1.00 33.93  ? 148 LEU A O     1 
ATOM   3667 C  CB    . LEU E 3 148 ? 54.101 19.851  45.274 1.00 43.80  ? 148 LEU A CB    1 
ATOM   3668 C  CG    . LEU E 3 148 ? 52.665 19.911  44.721 1.00 44.97  ? 148 LEU A CG    1 
ATOM   3669 C  CD1   . LEU E 3 148 ? 52.003 18.553  44.859 1.00 47.54  ? 148 LEU A CD1   1 
ATOM   3670 C  CD2   . LEU E 3 148 ? 51.850 20.953  45.454 1.00 46.02  ? 148 LEU A CD2   1 
ATOM   3671 N  N     . PRO E 3 149 ? 57.530 19.416  44.390 1.00 34.03  ? 149 PRO A N     1 
ATOM   3672 C  CA    . PRO E 3 149 ? 58.886 19.210  44.901 1.00 33.04  ? 149 PRO A CA    1 
ATOM   3673 C  C     . PRO E 3 149 ? 58.977 19.421  46.394 1.00 31.80  ? 149 PRO A C     1 
ATOM   3674 O  O     . PRO E 3 149 ? 59.536 18.593  47.114 1.00 31.80  ? 149 PRO A O     1 
ATOM   3675 C  CB    . PRO E 3 149 ? 59.729 20.230  44.133 1.00 32.63  ? 149 PRO A CB    1 
ATOM   3676 C  CG    . PRO E 3 149 ? 58.751 21.111  43.430 1.00 34.78  ? 149 PRO A CG    1 
ATOM   3677 C  CD    . PRO E 3 149 ? 57.546 20.266  43.194 1.00 35.04  ? 149 PRO A CD    1 
ATOM   3678 N  N     . SER E 3 150 ? 58.422 20.533  46.856 1.00 30.49  ? 150 SER A N     1 
ATOM   3679 C  CA    . SER E 3 150 ? 58.447 20.844  48.275 1.00 30.50  ? 150 SER A CA    1 
ATOM   3680 C  C     . SER E 3 150 ? 57.944 19.662  49.098 1.00 30.06  ? 150 SER A C     1 
ATOM   3681 O  O     . SER E 3 150 ? 58.490 19.363  50.161 1.00 27.43  ? 150 SER A O     1 
ATOM   3682 C  CB    . SER E 3 150 ? 57.594 22.077  48.566 1.00 30.20  ? 150 SER A CB    1 
ATOM   3683 O  OG    . SER E 3 150 ? 56.238 21.714  48.726 1.00 33.11  ? 150 SER A OG    1 
ATOM   3684 N  N     . ARG E 3 151 ? 56.909 18.986  48.609 1.00 32.60  ? 151 ARG A N     1 
ATOM   3685 C  CA    . ARG E 3 151 ? 56.365 17.847  49.336 1.00 35.73  ? 151 ARG A CA    1 
ATOM   3686 C  C     . ARG E 3 151 ? 57.364 16.697  49.328 1.00 36.01  ? 151 ARG A C     1 
ATOM   3687 O  O     . ARG E 3 151 ? 57.485 15.965  50.312 1.00 35.24  ? 151 ARG A O     1 
ATOM   3688 C  CB    . ARG E 3 151 ? 55.028 17.397  48.728 1.00 36.42  ? 151 ARG A CB    1 
ATOM   3689 C  CG    . ARG E 3 151 ? 53.797 18.145  49.261 1.00 36.17  ? 151 ARG A CG    1 
ATOM   3690 C  CD    . ARG E 3 151 ? 53.876 18.416  50.760 1.00 37.24  ? 151 ARG A CD    1 
ATOM   3691 N  NE    . ARG E 3 151 ? 52.598 18.235  51.446 1.00 38.21  ? 151 ARG A NE    1 
ATOM   3692 C  CZ    . ARG E 3 151 ? 51.893 17.107  51.432 1.00 40.19  ? 151 ARG A CZ    1 
ATOM   3693 N  NH1   . ARG E 3 151 ? 52.339 16.051  50.765 1.00 41.59  ? 151 ARG A NH1   1 
ATOM   3694 N  NH2   . ARG E 3 151 ? 50.745 17.027  52.095 1.00 40.25  ? 151 ARG A NH2   1 
ATOM   3695 N  N     . LEU E 3 152 ? 58.085 16.543  48.222 1.00 35.85  ? 152 LEU A N     1 
ATOM   3696 C  CA    . LEU E 3 152 ? 59.075 15.480  48.129 1.00 38.23  ? 152 LEU A CA    1 
ATOM   3697 C  C     . LEU E 3 152 ? 60.182 15.748  49.134 1.00 40.25  ? 152 LEU A C     1 
ATOM   3698 O  O     . LEU E 3 152 ? 60.595 14.853  49.869 1.00 42.87  ? 152 LEU A O     1 
ATOM   3699 C  CB    . LEU E 3 152 ? 59.672 15.417  46.727 1.00 38.47  ? 152 LEU A CB    1 
ATOM   3700 C  CG    . LEU E 3 152 ? 60.808 14.411  46.521 1.00 37.76  ? 152 LEU A CG    1 
ATOM   3701 C  CD1   . LEU E 3 152 ? 60.765 13.902  45.097 1.00 37.90  ? 152 LEU A CD1   1 
ATOM   3702 C  CD2   . LEU E 3 152 ? 62.147 15.063  46.797 1.00 37.96  ? 152 LEU A CD2   1 
ATOM   3703 N  N     . LYS E 3 153 ? 60.661 16.986  49.164 1.00 40.32  ? 153 LYS A N     1 
ATOM   3704 C  CA    . LYS E 3 153 ? 61.725 17.358  50.087 1.00 42.05  ? 153 LYS A CA    1 
ATOM   3705 C  C     . LYS E 3 153 ? 61.352 16.998  51.520 1.00 42.23  ? 153 LYS A C     1 
ATOM   3706 O  O     . LYS E 3 153 ? 62.221 16.755  52.356 1.00 45.38  ? 153 LYS A O     1 
ATOM   3707 C  CB    . LYS E 3 153 ? 62.013 18.856  49.994 1.00 44.66  ? 153 LYS A CB    1 
ATOM   3708 C  CG    . LYS E 3 153 ? 63.230 19.299  50.789 1.00 47.10  ? 153 LYS A CG    1 
ATOM   3709 C  CD    . LYS E 3 153 ? 62.944 20.574  51.564 1.00 49.60  ? 153 LYS A CD    1 
ATOM   3710 C  CE    . LYS E 3 153 ? 63.306 21.812  50.747 1.00 51.83  ? 153 LYS A CE    1 
ATOM   3711 N  NZ    . LYS E 3 153 ? 63.246 23.068  51.552 1.00 52.95  ? 153 LYS A NZ    1 
ATOM   3712 N  N     . ARG E 3 154 ? 60.056 16.964  51.803 1.00 38.63  ? 154 ARG A N     1 
ATOM   3713 C  CA    . ARG E 3 154 ? 59.596 16.625  53.137 1.00 32.82  ? 154 ARG A CA    1 
ATOM   3714 C  C     . ARG E 3 154 ? 59.800 15.144  53.387 1.00 30.87  ? 154 ARG A C     1 
ATOM   3715 O  O     . ARG E 3 154 ? 60.321 14.754  54.422 1.00 33.39  ? 154 ARG A O     1 
ATOM   3716 C  CB    . ARG E 3 154 ? 58.117 16.967  53.300 1.00 31.60  ? 154 ARG A CB    1 
ATOM   3717 C  CG    . ARG E 3 154 ? 57.548 16.619  54.665 1.00 28.91  ? 154 ARG A CG    1 
ATOM   3718 C  CD    . ARG E 3 154 ? 56.140 17.168  54.832 1.00 28.86  ? 154 ARG A CD    1 
ATOM   3719 N  NE    . ARG E 3 154 ? 55.131 16.322  54.194 1.00 29.30  ? 154 ARG A NE    1 
ATOM   3720 C  CZ    . ARG E 3 154 ? 53.879 16.194  54.625 1.00 28.18  ? 154 ARG A CZ    1 
ATOM   3721 N  NH1   . ARG E 3 154 ? 53.472 16.858  55.699 1.00 27.82  ? 154 ARG A NH1   1 
ATOM   3722 N  NH2   . ARG E 3 154 ? 53.033 15.401  53.984 1.00 27.07  ? 154 ARG A NH2   1 
ATOM   3723 N  N     . HIS E 3 155 ? 59.391 14.314  52.437 1.00 29.32  ? 155 HIS A N     1 
ATOM   3724 C  CA    . HIS E 3 155 ? 59.537 12.876  52.603 1.00 29.68  ? 155 HIS A CA    1 
ATOM   3725 C  C     . HIS E 3 155 ? 60.996 12.496  52.757 1.00 35.66  ? 155 HIS A C     1 
ATOM   3726 O  O     . HIS E 3 155 ? 61.317 11.562  53.482 1.00 41.03  ? 155 HIS A O     1 
ATOM   3727 C  CB    . HIS E 3 155 ? 58.944 12.132  51.413 1.00 25.50  ? 155 HIS A CB    1 
ATOM   3728 C  CG    . HIS E 3 155 ? 59.548 10.785  51.188 1.00 21.75  ? 155 HIS A CG    1 
ATOM   3729 N  ND1   . HIS E 3 155 ? 59.367 9.712   52.027 1.00 24.26  ? 155 HIS A ND1   1 
ATOM   3730 C  CD2   . HIS E 3 155 ? 60.362 10.343  50.198 1.00 21.85  ? 155 HIS A CD2   1 
ATOM   3731 C  CE1   . HIS E 3 155 ? 60.062 8.678   51.526 1.00 24.37  ? 155 HIS A CE1   1 
ATOM   3732 N  NE2   . HIS E 3 155 ? 60.683 9.014   50.414 1.00 21.47  ? 155 HIS A NE2   1 
ATOM   3733 N  N     . GLU E 3 156 ? 61.877 13.220  52.076 1.00 38.46  ? 156 GLU A N     1 
ATOM   3734 C  CA    . GLU E 3 156 ? 63.307 12.944  52.143 1.00 42.60  ? 156 GLU A CA    1 
ATOM   3735 C  C     . GLU E 3 156 ? 63.811 12.767  53.578 1.00 45.30  ? 156 GLU A C     1 
ATOM   3736 O  O     . GLU E 3 156 ? 64.679 11.935  53.839 1.00 48.57  ? 156 GLU A O     1 
ATOM   3737 C  CB    . GLU E 3 156 ? 64.084 14.069  51.461 1.00 45.31  ? 156 GLU A CB    1 
ATOM   3738 C  CG    . GLU E 3 156 ? 63.573 14.412  50.072 1.00 50.16  ? 156 GLU A CG    1 
ATOM   3739 C  CD    . GLU E 3 156 ? 64.554 14.030  48.980 1.00 54.34  ? 156 GLU A CD    1 
ATOM   3740 O  OE1   . GLU E 3 156 ? 65.278 13.029  49.168 1.00 58.27  ? 156 GLU A OE1   1 
ATOM   3741 O  OE2   . GLU E 3 156 ? 64.607 14.725  47.939 1.00 53.74  ? 156 GLU A OE2   1 
ATOM   3742 N  N     . LYS E 3 157 ? 63.262 13.541  54.506 1.00 43.59  ? 157 LYS A N     1 
ATOM   3743 C  CA    . LYS E 3 157 ? 63.668 13.464  55.902 1.00 42.24  ? 157 LYS A CA    1 
ATOM   3744 C  C     . LYS E 3 157 ? 63.795 12.035  56.421 1.00 41.02  ? 157 LYS A C     1 
ATOM   3745 O  O     . LYS E 3 157 ? 64.358 11.812  57.488 1.00 40.11  ? 157 LYS A O     1 
ATOM   3746 C  CB    . LYS E 3 157 ? 62.681 14.234  56.778 1.00 44.39  ? 157 LYS A CB    1 
ATOM   3747 C  CG    . LYS E 3 157 ? 62.503 15.689  56.385 1.00 46.16  ? 157 LYS A CG    1 
ATOM   3748 C  CD    . LYS E 3 157 ? 61.947 16.519  57.542 1.00 48.98  ? 157 LYS A CD    1 
ATOM   3749 C  CE    . LYS E 3 157 ? 60.511 16.128  57.893 1.00 50.51  ? 157 LYS A CE    1 
ATOM   3750 N  NZ    . LYS E 3 157 ? 59.988 16.889  59.069 1.00 50.63  ? 157 LYS A NZ    1 
ATOM   3751 N  N     . VAL E 3 158 ? 63.269 11.067  55.682 1.00 42.41  ? 158 VAL A N     1 
ATOM   3752 C  CA    . VAL E 3 158 ? 63.362 9.681   56.116 1.00 49.78  ? 158 VAL A CA    1 
ATOM   3753 C  C     . VAL E 3 158 ? 64.740 9.115   55.801 1.00 52.93  ? 158 VAL A C     1 
ATOM   3754 O  O     . VAL E 3 158 ? 65.495 8.780   56.712 1.00 54.29  ? 158 VAL A O     1 
ATOM   3755 C  CB    . VAL E 3 158 ? 62.290 8.803   55.446 1.00 52.04  ? 158 VAL A CB    1 
ATOM   3756 C  CG1   . VAL E 3 158 ? 62.355 7.384   56.004 1.00 53.94  ? 158 VAL A CG1   1 
ATOM   3757 C  CG2   . VAL E 3 158 ? 60.921 9.395   55.687 1.00 51.94  ? 158 VAL A CG2   1 
ATOM   3758 N  N     . HIS E 3 159 ? 65.065 9.003   54.514 1.00 55.86  ? 159 HIS A N     1 
ATOM   3759 C  CA    . HIS E 3 159 ? 66.370 8.488   54.102 1.00 58.24  ? 159 HIS A CA    1 
ATOM   3760 C  C     . HIS E 3 159 ? 67.422 9.562   54.324 1.00 59.84  ? 159 HIS A C     1 
ATOM   3761 O  O     . HIS E 3 159 ? 67.837 10.242  53.380 1.00 58.91  ? 159 HIS A O     1 
ATOM   3762 C  CB    . HIS E 3 159 ? 66.375 8.091   52.623 1.00 59.74  ? 159 HIS A CB    1 
ATOM   3763 C  CG    . HIS E 3 159 ? 65.023 8.098   51.980 1.00 62.25  ? 159 HIS A CG    1 
ATOM   3764 N  ND1   . HIS E 3 159 ? 64.172 7.015   51.957 1.00 62.50  ? 159 HIS A ND1   1 
ATOM   3765 C  CD2   . HIS E 3 159 ? 64.394 9.075   51.278 1.00 62.68  ? 159 HIS A CD2   1 
ATOM   3766 C  CE1   . HIS E 3 159 ? 63.083 7.360   51.257 1.00 62.15  ? 159 HIS A CE1   1 
ATOM   3767 N  NE2   . HIS E 3 159 ? 63.170 8.601   50.823 1.00 62.35  ? 159 HIS A NE2   1 
ATOM   3768 N  N     . ALA E 3 160 ? 67.842 9.709   55.578 1.00 61.32  ? 160 ALA A N     1 
ATOM   3769 C  CA    . ALA E 3 160 ? 68.841 10.701  55.954 1.00 63.35  ? 160 ALA A CA    1 
ATOM   3770 C  C     . ALA E 3 160 ? 69.346 10.436  57.367 1.00 63.24  ? 160 ALA A C     1 
ATOM   3771 O  O     . ALA E 3 160 ? 68.740 10.859  58.345 1.00 61.88  ? 160 ALA A O     1 
ATOM   3772 C  CB    . ALA E 3 160 ? 68.244 12.100  55.867 1.00 64.23  ? 160 ALA A CB    1 
ATOM   3773 N  N     . GLY E 3 161 ? 70.461 9.729   57.470 1.00 64.27  ? 161 GLY A N     1 
ATOM   3774 C  CA    . GLY E 3 161 ? 71.008 9.430   58.775 1.00 66.07  ? 161 GLY A CA    1 
ATOM   3775 C  C     . GLY E 3 161 ? 72.247 8.568   58.669 1.00 68.56  ? 161 GLY A C     1 
ATOM   3776 O  O     . GLY E 3 161 ? 73.268 9.012   58.155 1.00 70.57  ? 161 GLY A O     1 
ATOM   3777 N  N     . TYR E 3 162 ? 72.160 7.334   59.152 1.00 69.19  ? 162 TYR A N     1 
ATOM   3778 C  CA    . TYR E 3 162 ? 73.286 6.413   59.108 1.00 70.37  ? 162 TYR A CA    1 
ATOM   3779 C  C     . TYR E 3 162 ? 72.792 4.997   59.310 1.00 72.44  ? 162 TYR A C     1 
ATOM   3780 O  O     . TYR E 3 162 ? 73.098 4.367   60.317 1.00 73.49  ? 162 TYR A O     1 
ATOM   3781 C  CB    . TYR E 3 162 ? 74.296 6.740   60.207 1.00 71.36  ? 162 TYR A CB    1 
ATOM   3782 C  CG    . TYR E 3 162 ? 75.154 7.942   59.922 1.00 73.89  ? 162 TYR A CG    1 
ATOM   3783 C  CD1   . TYR E 3 162 ? 76.069 7.937   58.874 1.00 75.20  ? 162 TYR A CD1   1 
ATOM   3784 C  CD2   . TYR E 3 162 ? 75.058 9.086   60.708 1.00 75.94  ? 162 TYR A CD2   1 
ATOM   3785 C  CE1   . TYR E 3 162 ? 76.871 9.041   58.618 1.00 76.26  ? 162 TYR A CE1   1 
ATOM   3786 C  CE2   . TYR E 3 162 ? 75.854 10.195  60.462 1.00 77.37  ? 162 TYR A CE2   1 
ATOM   3787 C  CZ    . TYR E 3 162 ? 76.759 10.164  59.418 1.00 77.50  ? 162 TYR A CZ    1 
ATOM   3788 O  OH    . TYR E 3 162 ? 77.567 11.246  59.195 1.00 78.14  ? 162 TYR A OH    1 
ATOM   3789 N  N     . PRO E 3 163 ? 72.011 4.475   58.360 1.00 74.91  ? 163 PRO A N     1 
ATOM   3790 C  CA    . PRO E 3 163 ? 71.503 3.106   58.500 1.00 77.64  ? 163 PRO A CA    1 
ATOM   3791 C  C     . PRO E 3 163 ? 72.634 2.082   58.492 1.00 79.24  ? 163 PRO A C     1 
ATOM   3792 O  O     . PRO E 3 163 ? 73.597 2.219   57.743 1.00 80.32  ? 163 PRO A O     1 
ATOM   3793 C  CB    . PRO E 3 163 ? 70.574 2.940   57.300 1.00 77.84  ? 163 PRO A CB    1 
ATOM   3794 C  CG    . PRO E 3 163 ? 71.054 3.947   56.309 1.00 77.78  ? 163 PRO A CG    1 
ATOM   3795 C  CD    . PRO E 3 163 ? 71.559 5.109   57.112 1.00 76.37  ? 163 PRO A CD    1 
ATOM   3796 N  N     . CYS E 3 164 ? 72.521 1.063   59.334 1.00 81.05  ? 164 CYS A N     1 
ATOM   3797 C  CA    . CYS E 3 164 ? 73.541 0.026   59.396 1.00 84.18  ? 164 CYS A CA    1 
ATOM   3798 C  C     . CYS E 3 164 ? 73.387 -0.913  58.210 1.00 86.57  ? 164 CYS A C     1 
ATOM   3799 O  O     . CYS E 3 164 ? 72.424 -0.824  57.450 1.00 85.33  ? 164 CYS A O     1 
ATOM   3800 C  CB    . CYS E 3 164 ? 73.402 -0.796  60.675 1.00 84.97  ? 164 CYS A CB    1 
ATOM   3801 S  SG    . CYS E 3 164 ? 73.092 -2.564  60.358 1.00 85.81  ? 164 CYS A SG    1 
ATOM   3802 N  N     . LYS E 3 165 ? 74.343 -1.821  58.068 1.00 89.80  ? 165 LYS A N     1 
ATOM   3803 C  CA    . LYS E 3 165 ? 74.308 -2.798  57.000 1.00 92.75  ? 165 LYS A CA    1 
ATOM   3804 C  C     . LYS E 3 165 ? 74.382 -4.185  57.613 1.00 93.91  ? 165 LYS A C     1 
ATOM   3805 O  O     . LYS E 3 165 ? 75.463 -4.676  57.934 1.00 93.38  ? 165 LYS A O     1 
ATOM   3806 C  CB    . LYS E 3 165 ? 75.476 -2.579  56.042 1.00 95.03  ? 165 LYS A CB    1 
ATOM   3807 C  CG    . LYS E 3 165 ? 75.374 -1.286  55.250 1.00 98.04  ? 165 LYS A CG    1 
ATOM   3808 C  CD    . LYS E 3 165 ? 74.030 -1.170  54.539 1.00 99.28  ? 165 LYS A CD    1 
ATOM   3809 C  CE    . LYS E 3 165 ? 73.389 0.191   54.768 1.00 99.65  ? 165 LYS A CE    1 
ATOM   3810 N  NZ    . LYS E 3 165 ? 71.962 0.226   54.335 1.00 99.84  ? 165 LYS A NZ    1 
ATOM   3811 N  N     . LYS E 3 166 ? 73.220 -4.802  57.793 1.00 96.09  ? 166 LYS A N     1 
ATOM   3812 C  CA    . LYS E 3 166 ? 73.139 -6.140  58.362 1.00 98.60  ? 166 LYS A CA    1 
ATOM   3813 C  C     . LYS E 3 166 ? 72.010 -6.935  57.706 1.00 99.30  ? 166 LYS A C     1 
ATOM   3814 O  O     . LYS E 3 166 ? 71.100 -7.423  58.380 1.00 98.46  ? 166 LYS A O     1 
ATOM   3815 C  CB    . LYS E 3 166 ? 72.916 -6.056  59.875 1.00 99.53  ? 166 LYS A CB    1 
ATOM   3816 C  CG    . LYS E 3 166 ? 73.975 -6.779  60.701 1.00 99.74  ? 166 LYS A CG    1 
ATOM   3817 C  CD    . LYS E 3 166 ? 75.355 -6.162  60.515 1.00 99.26  ? 166 LYS A CD    1 
ATOM   3818 C  CE    . LYS E 3 166 ? 76.279 -7.107  59.762 1.00 99.55  ? 166 LYS A CE    1 
ATOM   3819 N  NZ    . LYS E 3 166 ? 75.901 -7.238  58.325 1.00 98.48  ? 166 LYS A NZ    1 
ATOM   3820 N  N     . ASP E 3 167 ? 72.085 -7.058  56.383 1.00 100.00 ? 167 ASP A N     1 
ATOM   3821 C  CA    . ASP E 3 167 ? 71.084 -7.779  55.606 1.00 99.84  ? 167 ASP A CA    1 
ATOM   3822 C  C     . ASP E 3 167 ? 69.722 -7.104  55.733 1.00 99.55  ? 167 ASP A C     1 
ATOM   3823 O  O     . ASP E 3 167 ? 69.441 -6.443  56.734 1.00 98.21  ? 167 ASP A O     1 
ATOM   3824 C  CB    . ASP E 3 167 ? 70.993 -9.229  56.083 1.00 99.80  ? 167 ASP A CB    1 
ATOM   3825 C  CG    . ASP E 3 167 ? 69.751 -9.928  55.578 1.00 100.00 ? 167 ASP A CG    1 
ATOM   3826 O  OD1   . ASP E 3 167 ? 69.486 -9.858  54.357 1.00 100.00 ? 167 ASP A OD1   1 
ATOM   3827 O  OD2   . ASP E 3 167 ? 69.040 -10.545 56.401 1.00 100.00 ? 167 ASP A OD2   1 
ATOM   3828 N  N     . ASP E 3 168 ? 68.881 -7.267  54.714 1.00 100.00 ? 168 ASP A N     1 
ATOM   3829 C  CA    . ASP E 3 168 ? 67.548 -6.672  54.728 1.00 100.00 ? 168 ASP A CA    1 
ATOM   3830 C  C     . ASP E 3 168 ? 66.934 -6.872  56.110 1.00 99.15  ? 168 ASP A C     1 
ATOM   3831 O  O     . ASP E 3 168 ? 66.112 -6.068  56.552 1.00 100.00 ? 168 ASP A O     1 
ATOM   3832 C  CB    . ASP E 3 168 ? 66.658 -7.318  53.655 1.00 100.00 ? 168 ASP A CB    1 
ATOM   3833 C  CG    . ASP E 3 168 ? 65.968 -6.290  52.761 1.00 99.77  ? 168 ASP A CG    1 
ATOM   3834 O  OD1   . ASP E 3 168 ? 65.765 -5.141  53.209 1.00 98.68  ? 168 ASP A OD1   1 
ATOM   3835 O  OD2   . ASP E 3 168 ? 65.627 -6.637  51.608 1.00 99.92  ? 168 ASP A OD2   1 
ATOM   3836 N  N     . SER E 3 169 ? 67.341 -7.947  56.785 1.00 96.79  ? 169 SER A N     1 
ATOM   3837 C  CA    . SER E 3 169 ? 66.849 -8.244  58.124 1.00 95.76  ? 169 SER A CA    1 
ATOM   3838 C  C     . SER E 3 169 ? 66.861 -6.934  58.892 1.00 95.95  ? 169 SER A C     1 
ATOM   3839 O  O     . SER E 3 169 ? 65.812 -6.386  59.233 1.00 95.77  ? 169 SER A O     1 
ATOM   3840 C  CB    . SER E 3 169 ? 67.759 -9.264  58.816 1.00 95.16  ? 169 SER A CB    1 
ATOM   3841 O  OG    . SER E 3 169 ? 69.123 -9.030  58.511 1.00 93.26  ? 169 SER A OG    1 
ATOM   3842 N  N     . CYS E 3 170 ? 68.060 -6.431  59.155 1.00 96.71  ? 170 CYS A N     1 
ATOM   3843 C  CA    . CYS E 3 170 ? 68.206 -5.164  59.850 1.00 97.81  ? 170 CYS A CA    1 
ATOM   3844 C  C     . CYS E 3 170 ? 68.059 -4.099  58.774 1.00 98.15  ? 170 CYS A C     1 
ATOM   3845 O  O     . CYS E 3 170 ? 68.624 -4.231  57.687 1.00 97.58  ? 170 CYS A O     1 
ATOM   3846 C  CB    . CYS E 3 170 ? 69.587 -5.061  60.504 1.00 97.46  ? 170 CYS A CB    1 
ATOM   3847 S  SG    . CYS E 3 170 ? 69.822 -3.585  61.530 1.00 96.31  ? 170 CYS A SG    1 
ATOM   3848 N  N     . SER E 3 171 ? 67.294 -3.054  59.063 1.00 98.86  ? 171 SER A N     1 
ATOM   3849 C  CA    . SER E 3 171 ? 67.102 -1.996  58.084 1.00 99.85  ? 171 SER A CA    1 
ATOM   3850 C  C     . SER E 3 171 ? 66.785 -0.640  58.708 1.00 99.77  ? 171 SER A C     1 
ATOM   3851 O  O     . SER E 3 171 ? 66.202 0.231   58.062 1.00 99.66  ? 171 SER A O     1 
ATOM   3852 C  CB    . SER E 3 171 ? 66.004 -2.398  57.098 1.00 100.00 ? 171 SER A CB    1 
ATOM   3853 O  OG    . SER E 3 171 ? 66.510 -3.298  56.126 1.00 99.66  ? 171 SER A OG    1 
ATOM   3854 N  N     . PHE E 3 172 ? 67.179 -0.461  59.964 1.00 99.30  ? 172 PHE A N     1 
ATOM   3855 C  CA    . PHE E 3 172 ? 66.946 0.804   60.646 1.00 98.02  ? 172 PHE A CA    1 
ATOM   3856 C  C     . PHE E 3 172 ? 67.877 1.867   60.079 1.00 96.08  ? 172 PHE A C     1 
ATOM   3857 O  O     . PHE E 3 172 ? 69.001 1.573   59.676 1.00 95.90  ? 172 PHE A O     1 
ATOM   3858 C  CB    . PHE E 3 172 ? 67.206 0.665   62.147 1.00 99.02  ? 172 PHE A CB    1 
ATOM   3859 C  CG    . PHE E 3 172 ? 67.578 1.961   62.816 1.00 99.60  ? 172 PHE A CG    1 
ATOM   3860 C  CD1   . PHE E 3 172 ? 66.643 2.986   62.943 1.00 100.00 ? 172 PHE A CD1   1 
ATOM   3861 C  CD2   . PHE E 3 172 ? 68.863 2.163   63.307 1.00 99.18  ? 172 PHE A CD2   1 
ATOM   3862 C  CE1   . PHE E 3 172 ? 66.983 4.193   63.547 1.00 100.00 ? 172 PHE A CE1   1 
ATOM   3863 C  CE2   . PHE E 3 172 ? 69.215 3.366   63.913 1.00 99.27  ? 172 PHE A CE2   1 
ATOM   3864 C  CZ    . PHE E 3 172 ? 68.272 4.383   64.034 1.00 99.92  ? 172 PHE A CZ    1 
ATOM   3865 N  N     . VAL E 3 173 ? 67.402 3.106   60.053 1.00 94.22  ? 173 VAL A N     1 
ATOM   3866 C  CA    . VAL E 3 173 ? 68.200 4.214   59.555 1.00 92.13  ? 173 VAL A CA    1 
ATOM   3867 C  C     . VAL E 3 173 ? 69.272 4.540   60.586 1.00 90.34  ? 173 VAL A C     1 
ATOM   3868 O  O     . VAL E 3 173 ? 70.016 3.662   61.013 1.00 90.50  ? 173 VAL A O     1 
ATOM   3869 C  CB    . VAL E 3 173 ? 67.329 5.458   59.328 1.00 92.86  ? 173 VAL A CB    1 
ATOM   3870 C  CG1   . VAL E 3 173 ? 66.557 5.315   58.028 1.00 93.47  ? 173 VAL A CG1   1 
ATOM   3871 C  CG2   . VAL E 3 173 ? 66.371 5.640   60.499 1.00 92.89  ? 173 VAL A CG2   1 
ATOM   3872 N  N     . GLY E 3 174 ? 69.340 5.802   60.989 1.00 89.07  ? 174 GLY A N     1 
ATOM   3873 C  CA    . GLY E 3 174 ? 70.322 6.215   61.973 1.00 89.24  ? 174 GLY A CA    1 
ATOM   3874 C  C     . GLY E 3 174 ? 70.382 7.723   62.102 1.00 89.65  ? 174 GLY A C     1 
ATOM   3875 O  O     . GLY E 3 174 ? 71.115 8.385   61.370 1.00 90.49  ? 174 GLY A O     1 
ATOM   3876 N  N     . LYS E 3 175 ? 69.615 8.272   63.038 1.00 89.74  ? 175 LYS A N     1 
ATOM   3877 C  CA    . LYS E 3 175 ? 69.578 9.715   63.238 1.00 91.48  ? 175 LYS A CA    1 
ATOM   3878 C  C     . LYS E 3 175 ? 70.959 10.359  63.177 1.00 90.10  ? 175 LYS A C     1 
ATOM   3879 O  O     . LYS E 3 175 ? 71.169 11.312  62.427 1.00 88.29  ? 175 LYS A O     1 
ATOM   3880 C  CB    . LYS E 3 175 ? 68.915 10.046  64.575 1.00 94.58  ? 175 LYS A CB    1 
ATOM   3881 C  CG    . LYS E 3 175 ? 67.986 8.964   65.095 1.00 97.39  ? 175 LYS A CG    1 
ATOM   3882 C  CD    . LYS E 3 175 ? 66.555 9.157   64.630 1.00 98.92  ? 175 LYS A CD    1 
ATOM   3883 C  CE    . LYS E 3 175 ? 65.997 7.894   63.990 1.00 99.82  ? 175 LYS A CE    1 
ATOM   3884 N  NZ    . LYS E 3 175 ? 66.998 7.205   63.127 1.00 100.00 ? 175 LYS A NZ    1 
ATOM   3885 N  N     . THR E 3 176 ? 71.896 9.839   63.966 1.00 89.59  ? 176 THR A N     1 
ATOM   3886 C  CA    . THR E 3 176 ? 73.253 10.376  63.988 1.00 89.47  ? 176 THR A CA    1 
ATOM   3887 C  C     . THR E 3 176 ? 74.286 9.322   64.354 1.00 87.05  ? 176 THR A C     1 
ATOM   3888 O  O     . THR E 3 176 ? 73.974 8.351   65.038 1.00 87.26  ? 176 THR A O     1 
ATOM   3889 C  CB    . THR E 3 176 ? 73.377 11.532  64.985 1.00 90.95  ? 176 THR A CB    1 
ATOM   3890 O  OG1   . THR E 3 176 ? 72.144 12.259  65.021 1.00 91.96  ? 176 THR A OG1   1 
ATOM   3891 C  CG2   . THR E 3 176 ? 74.507 12.466  64.575 1.00 91.66  ? 176 THR A CG2   1 
ATOM   3892 N  N     . TRP E 3 177 ? 75.520 9.530   63.901 1.00 83.68  ? 177 TRP A N     1 
ATOM   3893 C  CA    . TRP E 3 177 ? 76.611 8.596   64.162 1.00 81.56  ? 177 TRP A CA    1 
ATOM   3894 C  C     . TRP E 3 177 ? 76.591 8.092   65.596 1.00 81.48  ? 177 TRP A C     1 
ATOM   3895 O  O     . TRP E 3 177 ? 76.448 6.895   65.845 1.00 80.05  ? 177 TRP A O     1 
ATOM   3896 C  CB    . TRP E 3 177 ? 77.963 9.260   63.873 1.00 77.86  ? 177 TRP A CB    1 
ATOM   3897 C  CG    . TRP E 3 177 ? 79.066 8.283   63.559 1.00 73.07  ? 177 TRP A CG    1 
ATOM   3898 C  CD1   . TRP E 3 177 ? 79.816 7.577   64.453 1.00 71.34  ? 177 TRP A CD1   1 
ATOM   3899 C  CD2   . TRP E 3 177 ? 79.532 7.903   62.258 1.00 70.65  ? 177 TRP A CD2   1 
ATOM   3900 N  NE1   . TRP E 3 177 ? 80.720 6.783   63.792 1.00 70.45  ? 177 TRP A NE1   1 
ATOM   3901 C  CE2   . TRP E 3 177 ? 80.567 6.964   62.443 1.00 69.71  ? 177 TRP A CE2   1 
ATOM   3902 C  CE3   . TRP E 3 177 ? 79.175 8.267   60.954 1.00 69.31  ? 177 TRP A CE3   1 
ATOM   3903 C  CZ2   . TRP E 3 177 ? 81.251 6.382   61.372 1.00 69.45  ? 177 TRP A CZ2   1 
ATOM   3904 C  CZ3   . TRP E 3 177 ? 79.855 7.688   59.889 1.00 69.52  ? 177 TRP A CZ3   1 
ATOM   3905 C  CH2   . TRP E 3 177 ? 80.882 6.755   60.106 1.00 69.31  ? 177 TRP A CH2   1 
ATOM   3906 N  N     . THR E 3 178 ? 76.737 9.018   66.535 1.00 82.99  ? 178 THR A N     1 
ATOM   3907 C  CA    . THR E 3 178 ? 76.744 8.681   67.949 1.00 85.53  ? 178 THR A CA    1 
ATOM   3908 C  C     . THR E 3 178 ? 75.644 7.678   68.277 1.00 84.37  ? 178 THR A C     1 
ATOM   3909 O  O     . THR E 3 178 ? 75.873 6.702   68.993 1.00 85.40  ? 178 THR A O     1 
ATOM   3910 C  CB    . THR E 3 178 ? 76.552 9.945   68.811 1.00 88.58  ? 178 THR A CB    1 
ATOM   3911 O  OG1   . THR E 3 178 ? 75.166 10.314  68.826 1.00 90.83  ? 178 THR A OG1   1 
ATOM   3912 C  CG2   . THR E 3 178 ? 77.374 11.098  68.245 1.00 89.20  ? 178 THR A CG2   1 
ATOM   3913 N  N     . LEU E 3 179 ? 74.454 7.922   67.738 1.00 81.96  ? 179 LEU A N     1 
ATOM   3914 C  CA    . LEU E 3 179 ? 73.308 7.050   67.967 1.00 78.38  ? 179 LEU A CA    1 
ATOM   3915 C  C     . LEU E 3 179 ? 73.369 5.860   67.021 1.00 76.86  ? 179 LEU A C     1 
ATOM   3916 O  O     . LEU E 3 179 ? 72.857 4.781   67.321 1.00 75.62  ? 179 LEU A O     1 
ATOM   3917 C  CB    . LEU E 3 179 ? 72.011 7.832   67.744 1.00 76.05  ? 179 LEU A CB    1 
ATOM   3918 C  CG    . LEU E 3 179 ? 72.154 9.349   67.908 1.00 74.57  ? 179 LEU A CG    1 
ATOM   3919 C  CD1   . LEU E 3 179 ? 71.033 10.054  67.184 1.00 73.98  ? 179 LEU A CD1   1 
ATOM   3920 C  CD2   . LEU E 3 179 ? 72.147 9.706   69.387 1.00 74.65  ? 179 LEU A CD2   1 
ATOM   3921 N  N     . TYR E 3 180 ? 74.009 6.072   65.877 1.00 75.39  ? 180 TYR A N     1 
ATOM   3922 C  CA    . TYR E 3 180 ? 74.153 5.037   64.869 1.00 74.50  ? 180 TYR A CA    1 
ATOM   3923 C  C     . TYR E 3 180 ? 75.097 3.959   65.375 1.00 74.36  ? 180 TYR A C     1 
ATOM   3924 O  O     . TYR E 3 180 ? 74.811 2.765   65.262 1.00 74.66  ? 180 TYR A O     1 
ATOM   3925 C  CB    . TYR E 3 180 ? 74.684 5.654   63.570 1.00 74.68  ? 180 TYR A CB    1 
ATOM   3926 C  CG    . TYR E 3 180 ? 75.800 4.884   62.901 1.00 75.91  ? 180 TYR A CG    1 
ATOM   3927 C  CD1   . TYR E 3 180 ? 75.564 3.639   62.318 1.00 77.79  ? 180 TYR A CD1   1 
ATOM   3928 C  CD2   . TYR E 3 180 ? 77.086 5.411   62.828 1.00 75.96  ? 180 TYR A CD2   1 
ATOM   3929 C  CE1   . TYR E 3 180 ? 76.581 2.938   61.677 1.00 78.31  ? 180 TYR A CE1   1 
ATOM   3930 C  CE2   . TYR E 3 180 ? 78.110 4.722   62.191 1.00 77.07  ? 180 TYR A CE2   1 
ATOM   3931 C  CZ    . TYR E 3 180 ? 77.850 3.485   61.615 1.00 78.55  ? 180 TYR A CZ    1 
ATOM   3932 O  OH    . TYR E 3 180 ? 78.848 2.798   60.964 1.00 79.64  ? 180 TYR A OH    1 
ATOM   3933 N  N     . LEU E 3 181 ? 76.223 4.386   65.933 1.00 74.64  ? 181 LEU A N     1 
ATOM   3934 C  CA    . LEU E 3 181 ? 77.202 3.450   66.456 1.00 76.09  ? 181 LEU A CA    1 
ATOM   3935 C  C     . LEU E 3 181 ? 76.499 2.465   67.377 1.00 77.30  ? 181 LEU A C     1 
ATOM   3936 O  O     . LEU E 3 181 ? 76.528 1.256   67.149 1.00 77.39  ? 181 LEU A O     1 
ATOM   3937 C  CB    . LEU E 3 181 ? 78.294 4.199   67.226 1.00 75.87  ? 181 LEU A CB    1 
ATOM   3938 C  CG    . LEU E 3 181 ? 79.362 4.923   66.399 1.00 76.09  ? 181 LEU A CG    1 
ATOM   3939 C  CD1   . LEU E 3 181 ? 80.505 5.345   67.301 1.00 76.67  ? 181 LEU A CD1   1 
ATOM   3940 C  CD2   . LEU E 3 181 ? 79.874 4.017   65.296 1.00 76.61  ? 181 LEU A CD2   1 
ATOM   3941 N  N     . LYS E 3 182 ? 75.851 2.997   68.407 1.00 79.04  ? 182 LYS A N     1 
ATOM   3942 C  CA    . LYS E 3 182 ? 75.133 2.181   69.377 1.00 80.75  ? 182 LYS A CA    1 
ATOM   3943 C  C     . LYS E 3 182 ? 74.333 1.068   68.704 1.00 81.40  ? 182 LYS A C     1 
ATOM   3944 O  O     . LYS E 3 182 ? 74.413 -0.091  69.111 1.00 79.76  ? 182 LYS A O     1 
ATOM   3945 C  CB    . LYS E 3 182 ? 74.204 3.068   70.215 1.00 81.83  ? 182 LYS A CB    1 
ATOM   3946 C  CG    . LYS E 3 182 ? 74.908 4.262   70.859 1.00 82.61  ? 182 LYS A CG    1 
ATOM   3947 C  CD    . LYS E 3 182 ? 73.954 5.115   71.684 1.00 83.05  ? 182 LYS A CD    1 
ATOM   3948 C  CE    . LYS E 3 182 ? 74.010 6.577   71.261 1.00 83.08  ? 182 LYS A CE    1 
ATOM   3949 N  NZ    . LYS E 3 182 ? 73.915 7.513   72.414 1.00 82.93  ? 182 LYS A NZ    1 
ATOM   3950 N  N     . HIS E 3 183 ? 73.571 1.422   67.670 1.00 83.72  ? 183 HIS A N     1 
ATOM   3951 C  CA    . HIS E 3 183 ? 72.761 0.444   66.946 1.00 84.13  ? 183 HIS A CA    1 
ATOM   3952 C  C     . HIS E 3 183 ? 73.595 -0.782  66.611 1.00 83.88  ? 183 HIS A C     1 
ATOM   3953 O  O     . HIS E 3 183 ? 73.102 -1.910  66.635 1.00 83.83  ? 183 HIS A O     1 
ATOM   3954 C  CB    . HIS E 3 183 ? 72.203 1.049   65.654 1.00 83.50  ? 183 HIS A CB    1 
ATOM   3955 C  CG    . HIS E 3 183 ? 71.369 0.094   64.855 1.00 83.96  ? 183 HIS A CG    1 
ATOM   3956 N  ND1   . HIS E 3 183 ? 70.012 -0.077  65.024 1.00 84.23  ? 183 HIS A ND1   1 
ATOM   3957 C  CD2   . HIS E 3 183 ? 71.727 -0.766  63.868 1.00 83.65  ? 183 HIS A CD2   1 
ATOM   3958 C  CE1   . HIS E 3 183 ? 69.600 -1.014  64.155 1.00 83.70  ? 183 HIS A CE1   1 
ATOM   3959 N  NE2   . HIS E 3 183 ? 70.604 -1.463  63.430 1.00 83.17  ? 183 HIS A NE2   1 
ATOM   3960 N  N     . VAL E 3 184 ? 74.863 -0.554  66.296 1.00 83.65  ? 184 VAL A N     1 
ATOM   3961 C  CA    . VAL E 3 184 ? 75.763 -1.645  65.972 1.00 84.16  ? 184 VAL A CA    1 
ATOM   3962 C  C     . VAL E 3 184 ? 76.232 -2.305  67.260 1.00 86.94  ? 184 VAL A C     1 
ATOM   3963 O  O     . VAL E 3 184 ? 76.038 -3.501  67.459 1.00 87.85  ? 184 VAL A O     1 
ATOM   3964 C  CB    . VAL E 3 184 ? 76.986 -1.147  65.203 1.00 82.27  ? 184 VAL A CB    1 
ATOM   3965 C  CG1   . VAL E 3 184 ? 77.639 -2.303  64.484 1.00 81.64  ? 184 VAL A CG1   1 
ATOM   3966 C  CG2   . VAL E 3 184 ? 76.576 -0.065  64.226 1.00 81.71  ? 184 VAL A CG2   1 
ATOM   3967 N  N     . ALA E 3 185 ? 76.843 -1.517  68.138 1.00 89.32  ? 185 ALA A N     1 
ATOM   3968 C  CA    . ALA E 3 185 ? 77.336 -2.033  69.408 1.00 90.80  ? 185 ALA A CA    1 
ATOM   3969 C  C     . ALA E 3 185 ? 76.183 -2.494  70.297 1.00 92.10  ? 185 ALA A C     1 
ATOM   3970 O  O     . ALA E 3 185 ? 75.930 -3.692  70.420 1.00 91.87  ? 185 ALA A O     1 
ATOM   3971 C  CB    . ALA E 3 185 ? 78.156 -0.966  70.123 1.00 91.19  ? 185 ALA A CB    1 
ATOM   3972 N  N     . GLU E 3 186 ? 75.483 -1.541  70.908 1.00 93.24  ? 186 GLU A N     1 
ATOM   3973 C  CA    . GLU E 3 186 ? 74.365 -1.854  71.792 1.00 94.68  ? 186 GLU A CA    1 
ATOM   3974 C  C     . GLU E 3 186 ? 73.508 -3.004  71.276 1.00 96.32  ? 186 GLU A C     1 
ATOM   3975 O  O     . GLU E 3 186 ? 73.015 -3.813  72.059 1.00 97.70  ? 186 GLU A O     1 
ATOM   3976 C  CB    . GLU E 3 186 ? 73.488 -0.618  71.999 1.00 95.12  ? 186 GLU A CB    1 
ATOM   3977 C  CG    . GLU E 3 186 ? 72.423 -0.789  73.079 1.00 96.16  ? 186 GLU A CG    1 
ATOM   3978 C  CD    . GLU E 3 186 ? 72.811 -0.141  74.397 1.00 96.63  ? 186 GLU A CD    1 
ATOM   3979 O  OE1   . GLU E 3 186 ? 73.776 0.651   74.406 1.00 96.90  ? 186 GLU A OE1   1 
ATOM   3980 O  OE2   . GLU E 3 186 ? 72.153 -0.423  75.423 1.00 96.26  ? 186 GLU A OE2   1 
ATOM   3981 N  N     . CYS E 3 187 ? 73.333 -3.078  69.960 1.00 97.75  ? 187 CYS A N     1 
ATOM   3982 C  CA    . CYS E 3 187 ? 72.531 -4.141  69.356 1.00 99.12  ? 187 CYS A CA    1 
ATOM   3983 C  C     . CYS E 3 187 ? 73.358 -4.998  68.398 1.00 98.20  ? 187 CYS A C     1 
ATOM   3984 O  O     . CYS E 3 187 ? 74.504 -5.339  68.690 1.00 97.01  ? 187 CYS A O     1 
ATOM   3985 C  CB    . CYS E 3 187 ? 71.331 -3.542  68.613 1.00 99.80  ? 187 CYS A CB    1 
ATOM   3986 S  SG    . CYS E 3 187 ? 69.737 -4.317  69.001 1.00 100.00 ? 187 CYS A SG    1 
ATOM   3987 N  N     . HIS E 3 188 ? 72.766 -5.346  67.259 1.00 97.45  ? 188 HIS A N     1 
ATOM   3988 C  CA    . HIS E 3 188 ? 73.446 -6.159  66.260 1.00 98.09  ? 188 HIS A CA    1 
ATOM   3989 C  C     . HIS E 3 188 ? 73.792 -7.530  66.827 1.00 98.18  ? 188 HIS A C     1 
ATOM   3990 O  O     . HIS E 3 188 ? 73.682 -8.543  66.136 1.00 97.90  ? 188 HIS A O     1 
ATOM   3991 C  CB    . HIS E 3 188 ? 74.727 -5.460  65.793 1.00 99.61  ? 188 HIS A CB    1 
ATOM   3992 C  CG    . HIS E 3 188 ? 74.538 -4.577  64.597 1.00 100.00 ? 188 HIS A CG    1 
ATOM   3993 N  ND1   . HIS E 3 188 ? 75.469 -4.425  63.591 1.00 99.81  ? 188 HIS A ND1   1 
ATOM   3994 C  CD2   . HIS E 3 188 ? 73.491 -3.786  64.250 1.00 100.00 ? 188 HIS A CD2   1 
ATOM   3995 C  CE1   . HIS E 3 188 ? 74.967 -3.568  62.688 1.00 99.63  ? 188 HIS A CE1   1 
ATOM   3996 N  NE2   . HIS E 3 188 ? 73.766 -3.150  63.043 1.00 100.00 ? 188 HIS A NE2   1 
ATOM   3997 N  N     . PRO F 3 7   ? 6.030  69.321  72.978 1.00 100.00 ? 7   PRO D N     1 
ATOM   3998 C  CA    . PRO F 3 7   ? 4.859  69.087  73.827 1.00 100.00 ? 7   PRO D CA    1 
ATOM   3999 C  C     . PRO F 3 7   ? 3.752  68.324  73.097 1.00 100.00 ? 7   PRO D C     1 
ATOM   4000 O  O     . PRO F 3 7   ? 3.063  68.880  72.236 1.00 100.00 ? 7   PRO D O     1 
ATOM   4001 C  CB    . PRO F 3 7   ? 4.422  70.495  74.222 1.00 100.00 ? 7   PRO D CB    1 
ATOM   4002 C  CG    . PRO F 3 7   ? 4.866  71.365  73.074 1.00 100.00 ? 7   PRO D CG    1 
ATOM   4003 C  CD    . PRO F 3 7   ? 5.989  70.650  72.341 1.00 100.00 ? 7   PRO D CD    1 
ATOM   4004 N  N     . VAL F 3 8   ? 3.593  67.047  73.438 1.00 99.73  ? 8   VAL D N     1 
ATOM   4005 C  CA    . VAL F 3 8   ? 2.572  66.209  72.815 1.00 96.76  ? 8   VAL D CA    1 
ATOM   4006 C  C     . VAL F 3 8   ? 2.026  65.173  73.799 1.00 94.77  ? 8   VAL D C     1 
ATOM   4007 O  O     . VAL F 3 8   ? 2.215  65.295  75.013 1.00 93.80  ? 8   VAL D O     1 
ATOM   4008 C  CB    . VAL F 3 8   ? 3.124  65.470  71.568 1.00 95.34  ? 8   VAL D CB    1 
ATOM   4009 C  CG1   . VAL F 3 8   ? 2.026  65.312  70.533 1.00 96.29  ? 8   VAL D CG1   1 
ATOM   4010 C  CG2   . VAL F 3 8   ? 4.300  66.230  70.973 1.00 93.42  ? 8   VAL D CG2   1 
ATOM   4011 N  N     . VAL F 3 9   ? 1.353  64.156  73.265 1.00 92.09  ? 9   VAL D N     1 
ATOM   4012 C  CA    . VAL F 3 9   ? 0.767  63.089  74.076 1.00 89.72  ? 9   VAL D CA    1 
ATOM   4013 C  C     . VAL F 3 9   ? 1.433  61.751  73.761 1.00 87.21  ? 9   VAL D C     1 
ATOM   4014 O  O     . VAL F 3 9   ? 1.873  61.533  72.631 1.00 85.91  ? 9   VAL D O     1 
ATOM   4015 C  CB    . VAL F 3 9   ? -0.749 62.962  73.811 1.00 90.44  ? 9   VAL D CB    1 
ATOM   4016 C  CG1   . VAL F 3 9   ? -1.472 62.611  75.105 1.00 90.96  ? 9   VAL D CG1   1 
ATOM   4017 C  CG2   . VAL F 3 9   ? -1.291 64.265  73.219 1.00 88.84  ? 9   VAL D CG2   1 
ATOM   4018 N  N     . TYR F 3 10  ? 1.487  60.860  74.757 1.00 85.06  ? 10  TYR D N     1 
ATOM   4019 C  CA    . TYR F 3 10  ? 2.120  59.542  74.613 1.00 81.53  ? 10  TYR D CA    1 
ATOM   4020 C  C     . TYR F 3 10  ? 2.173  59.045  73.178 1.00 75.68  ? 10  TYR D C     1 
ATOM   4021 O  O     . TYR F 3 10  ? 1.322  58.276  72.729 1.00 75.58  ? 10  TYR D O     1 
ATOM   4022 C  CB    . TYR F 3 10  ? 1.430  58.497  75.494 1.00 84.61  ? 10  TYR D CB    1 
ATOM   4023 C  CG    . TYR F 3 10  ? 2.375  57.403  75.950 1.00 87.85  ? 10  TYR D CG    1 
ATOM   4024 C  CD1   . TYR F 3 10  ? 3.729  57.671  76.161 1.00 89.39  ? 10  TYR D CD1   1 
ATOM   4025 C  CD2   . TYR F 3 10  ? 1.925  56.099  76.153 1.00 89.27  ? 10  TYR D CD2   1 
ATOM   4026 C  CE1   . TYR F 3 10  ? 4.614  56.673  76.559 1.00 91.29  ? 10  TYR D CE1   1 
ATOM   4027 C  CE2   . TYR F 3 10  ? 2.804  55.087  76.554 1.00 91.05  ? 10  TYR D CE2   1 
ATOM   4028 C  CZ    . TYR F 3 10  ? 4.148  55.383  76.754 1.00 92.08  ? 10  TYR D CZ    1 
ATOM   4029 O  OH    . TYR F 3 10  ? 5.026  54.394  77.146 1.00 92.98  ? 10  TYR D OH    1 
ATOM   4030 N  N     . LYS F 3 11  ? 3.216  59.496  72.491 1.00 68.57  ? 11  LYS D N     1 
ATOM   4031 C  CA    . LYS F 3 11  ? 3.502  59.216  71.089 1.00 62.19  ? 11  LYS D CA    1 
ATOM   4032 C  C     . LYS F 3 11  ? 4.107  60.548  70.705 1.00 59.34  ? 11  LYS D C     1 
ATOM   4033 O  O     . LYS F 3 11  ? 4.466  60.785  69.555 1.00 60.38  ? 11  LYS D O     1 
ATOM   4034 C  CB    . LYS F 3 11  ? 2.221  58.999  70.278 1.00 60.74  ? 11  LYS D CB    1 
ATOM   4035 C  CG    . LYS F 3 11  ? 2.055  57.589  69.712 1.00 59.53  ? 11  LYS D CG    1 
ATOM   4036 C  CD    . LYS F 3 11  ? 3.084  57.270  68.627 1.00 55.94  ? 11  LYS D CD    1 
ATOM   4037 C  CE    . LYS F 3 11  ? 2.626  56.115  67.731 1.00 52.45  ? 11  LYS D CE    1 
ATOM   4038 N  NZ    . LYS F 3 11  ? 2.691  54.786  68.406 1.00 48.80  ? 11  LYS D NZ    1 
ATOM   4039 N  N     . ARG F 3 12  ? 4.197  61.408  71.717 1.00 54.86  ? 12  ARG D N     1 
ATOM   4040 C  CA    . ARG F 3 12  ? 4.719  62.764  71.609 1.00 52.55  ? 12  ARG D CA    1 
ATOM   4041 C  C     . ARG F 3 12  ? 5.269  63.115  70.234 1.00 47.01  ? 12  ARG D C     1 
ATOM   4042 O  O     . ARG F 3 12  ? 4.589  63.752  69.438 1.00 49.77  ? 12  ARG D O     1 
ATOM   4043 C  CB    . ARG F 3 12  ? 5.790  63.001  72.681 1.00 56.38  ? 12  ARG D CB    1 
ATOM   4044 C  CG    . ARG F 3 12  ? 5.331  63.865  73.863 1.00 59.81  ? 12  ARG D CG    1 
ATOM   4045 C  CD    . ARG F 3 12  ? 4.223  63.197  74.690 1.00 62.85  ? 12  ARG D CD    1 
ATOM   4046 N  NE    . ARG F 3 12  ? 4.646  61.950  75.329 1.00 64.64  ? 12  ARG D NE    1 
ATOM   4047 C  CZ    . ARG F 3 12  ? 4.042  61.404  76.384 1.00 63.78  ? 12  ARG D CZ    1 
ATOM   4048 N  NH1   . ARG F 3 12  ? 2.983  61.990  76.928 1.00 62.71  ? 12  ARG D NH1   1 
ATOM   4049 N  NH2   . ARG F 3 12  ? 4.494  60.264  76.890 1.00 62.73  ? 12  ARG D NH2   1 
ATOM   4050 N  N     . TYR F 3 13  ? 6.494  62.687  69.957 1.00 38.52  ? 13  TYR D N     1 
ATOM   4051 C  CA    . TYR F 3 13  ? 7.157  62.964  68.683 1.00 31.42  ? 13  TYR D CA    1 
ATOM   4052 C  C     . TYR F 3 13  ? 6.349  62.548  67.455 1.00 27.74  ? 13  TYR D C     1 
ATOM   4053 O  O     . TYR F 3 13  ? 5.994  61.381  67.304 1.00 31.65  ? 13  TYR D O     1 
ATOM   4054 C  CB    . TYR F 3 13  ? 8.527  62.285  68.690 1.00 27.66  ? 13  TYR D CB    1 
ATOM   4055 C  CG    . TYR F 3 13  ? 9.242  62.518  69.996 1.00 22.04  ? 13  TYR D CG    1 
ATOM   4056 C  CD1   . TYR F 3 13  ? 9.843  63.745  70.267 1.00 20.95  ? 13  TYR D CD1   1 
ATOM   4057 C  CD2   . TYR F 3 13  ? 9.228  61.555  70.998 1.00 20.32  ? 13  TYR D CD2   1 
ATOM   4058 C  CE1   . TYR F 3 13  ? 10.401 64.012  71.502 1.00 20.82  ? 13  TYR D CE1   1 
ATOM   4059 C  CE2   . TYR F 3 13  ? 9.783  61.811  72.240 1.00 20.76  ? 13  TYR D CE2   1 
ATOM   4060 C  CZ    . TYR F 3 13  ? 10.362 63.042  72.487 1.00 22.12  ? 13  TYR D CZ    1 
ATOM   4061 O  OH    . TYR F 3 13  ? 10.866 63.315  73.735 1.00 25.40  ? 13  TYR D OH    1 
ATOM   4062 N  N     . ILE F 3 14  ? 6.073  63.506  66.574 1.00 18.20  ? 14  ILE D N     1 
ATOM   4063 C  CA    . ILE F 3 14  ? 5.292  63.228  65.382 1.00 14.40  ? 14  ILE D CA    1 
ATOM   4064 C  C     . ILE F 3 14  ? 5.869  63.864  64.132 1.00 12.62  ? 14  ILE D C     1 
ATOM   4065 O  O     . ILE F 3 14  ? 6.435  64.956  64.181 1.00 10.04  ? 14  ILE D O     1 
ATOM   4066 C  CB    . ILE F 3 14  ? 3.837  63.720  65.552 1.00 16.71  ? 14  ILE D CB    1 
ATOM   4067 C  CG1   . ILE F 3 14  ? 3.515  64.812  64.530 1.00 17.72  ? 14  ILE D CG1   1 
ATOM   4068 C  CG2   . ILE F 3 14  ? 3.641  64.290  66.936 1.00 17.00  ? 14  ILE D CG2   1 
ATOM   4069 C  CD1   . ILE F 3 14  ? 2.819  64.289  63.295 1.00 20.94  ? 14  ILE D CD1   1 
ATOM   4070 N  N     . CYS F 3 15  ? 5.697  63.177  63.008 1.00 11.83  ? 15  CYS D N     1 
ATOM   4071 C  CA    . CYS F 3 15  ? 6.178  63.650  61.720 1.00 11.91  ? 15  CYS D CA    1 
ATOM   4072 C  C     . CYS F 3 15  ? 5.945  65.156  61.555 1.00 11.15  ? 15  CYS D C     1 
ATOM   4073 O  O     . CYS F 3 15  ? 4.917  65.682  61.966 1.00 7.88   ? 15  CYS D O     1 
ATOM   4074 C  CB    . CYS F 3 15  ? 5.473  62.875  60.608 1.00 13.99  ? 15  CYS D CB    1 
ATOM   4075 S  SG    . CYS F 3 15  ? 6.247  62.986  58.977 1.00 18.27  ? 15  CYS D SG    1 
ATOM   4076 N  N     . SER F 3 16  ? 6.912  65.839  60.950 1.00 15.81  ? 16  SER D N     1 
ATOM   4077 C  CA    . SER F 3 16  ? 6.843  67.283  60.739 1.00 17.62  ? 16  SER D CA    1 
ATOM   4078 C  C     . SER F 3 16  ? 6.079  67.647  59.480 1.00 20.28  ? 16  SER D C     1 
ATOM   4079 O  O     . SER F 3 16  ? 5.548  68.751  59.368 1.00 23.49  ? 16  SER D O     1 
ATOM   4080 C  CB    . SER F 3 16  ? 8.251  67.881  60.654 1.00 18.45  ? 16  SER D CB    1 
ATOM   4081 O  OG    . SER F 3 16  ? 8.880  67.935  61.926 1.00 19.38  ? 16  SER D OG    1 
ATOM   4082 N  N     . PHE F 3 17  ? 6.038  66.727  58.524 1.00 22.90  ? 17  PHE D N     1 
ATOM   4083 C  CA    . PHE F 3 17  ? 5.314  66.970  57.279 1.00 23.31  ? 17  PHE D CA    1 
ATOM   4084 C  C     . PHE F 3 17  ? 3.826  66.733  57.517 1.00 27.82  ? 17  PHE D C     1 
ATOM   4085 O  O     . PHE F 3 17  ? 3.443  65.828  58.263 1.00 30.24  ? 17  PHE D O     1 
ATOM   4086 C  CB    . PHE F 3 17  ? 5.797  66.020  56.183 1.00 16.74  ? 17  PHE D CB    1 
ATOM   4087 C  CG    . PHE F 3 17  ? 7.203  66.270  55.737 1.00 12.30  ? 17  PHE D CG    1 
ATOM   4088 C  CD1   . PHE F 3 17  ? 8.255  66.205  56.637 1.00 12.18  ? 17  PHE D CD1   1 
ATOM   4089 C  CD2   . PHE F 3 17  ? 7.477  66.570  54.413 1.00 10.99  ? 17  PHE D CD2   1 
ATOM   4090 C  CE1   . PHE F 3 17  ? 9.558  66.438  56.223 1.00 10.55  ? 17  PHE D CE1   1 
ATOM   4091 C  CE2   . PHE F 3 17  ? 8.777  66.803  53.992 1.00 9.72   ? 17  PHE D CE2   1 
ATOM   4092 C  CZ    . PHE F 3 17  ? 9.817  66.738  54.898 1.00 8.93   ? 17  PHE D CZ    1 
ATOM   4093 N  N     . ALA F 3 18  ? 2.984  67.546  56.898 1.00 29.43  ? 18  ALA D N     1 
ATOM   4094 C  CA    . ALA F 3 18  ? 1.552  67.362  57.049 1.00 33.97  ? 18  ALA D CA    1 
ATOM   4095 C  C     . ALA F 3 18  ? 1.120  66.209  56.131 1.00 39.03  ? 18  ALA D C     1 
ATOM   4096 O  O     . ALA F 3 18  ? 1.681  66.036  55.041 1.00 37.92  ? 18  ALA D O     1 
ATOM   4097 C  CB    . ALA F 3 18  ? 0.823  68.638  56.674 1.00 33.48  ? 18  ALA D CB    1 
ATOM   4098 N  N     . ASP F 3 19  ? 0.139  65.426  56.588 1.00 42.61  ? 19  ASP D N     1 
ATOM   4099 C  CA    . ASP F 3 19  ? -0.411 64.281  55.850 1.00 44.82  ? 19  ASP D CA    1 
ATOM   4100 C  C     . ASP F 3 19  ? 0.137  62.939  56.335 1.00 47.77  ? 19  ASP D C     1 
ATOM   4101 O  O     . ASP F 3 19  ? -0.613 61.974  56.476 1.00 48.98  ? 19  ASP D O     1 
ATOM   4102 C  CB    . ASP F 3 19  ? -0.150 64.413  54.340 1.00 44.15  ? 19  ASP D CB    1 
ATOM   4103 C  CG    . ASP F 3 19  ? -1.304 65.060  53.599 1.00 44.08  ? 19  ASP D CG    1 
ATOM   4104 O  OD1   . ASP F 3 19  ? -1.690 66.191  53.955 1.00 43.62  ? 19  ASP D OD1   1 
ATOM   4105 O  OD2   . ASP F 3 19  ? -1.826 64.436  52.653 1.00 45.59  ? 19  ASP D OD2   1 
ATOM   4106 N  N     . CYS F 3 20  ? 1.443  62.881  56.589 1.00 48.60  ? 20  CYS D N     1 
ATOM   4107 C  CA    . CYS F 3 20  ? 2.097  61.651  57.042 1.00 46.34  ? 20  CYS D CA    1 
ATOM   4108 C  C     . CYS F 3 20  ? 1.363  61.016  58.211 1.00 43.57  ? 20  CYS D C     1 
ATOM   4109 O  O     . CYS F 3 20  ? 0.996  59.842  58.160 1.00 43.56  ? 20  CYS D O     1 
ATOM   4110 C  CB    . CYS F 3 20  ? 3.546  61.938  57.443 1.00 47.71  ? 20  CYS D CB    1 
ATOM   4111 S  SG    . CYS F 3 20  ? 4.283  60.684  58.526 1.00 51.35  ? 20  CYS D SG    1 
ATOM   4112 N  N     . GLY F 3 21  ? 1.164  61.798  59.267 1.00 40.27  ? 21  GLY D N     1 
ATOM   4113 C  CA    . GLY F 3 21  ? 0.459  61.312  60.438 1.00 36.25  ? 21  GLY D CA    1 
ATOM   4114 C  C     . GLY F 3 21  ? 1.245  60.381  61.338 1.00 33.48  ? 21  GLY D C     1 
ATOM   4115 O  O     . GLY F 3 21  ? 0.739  59.939  62.369 1.00 34.68  ? 21  GLY D O     1 
ATOM   4116 N  N     . ALA F 3 22  ? 2.477  60.067  60.959 1.00 30.96  ? 22  ALA D N     1 
ATOM   4117 C  CA    . ALA F 3 22  ? 3.294  59.180  61.777 1.00 29.10  ? 22  ALA D CA    1 
ATOM   4118 C  C     . ALA F 3 22  ? 3.511  59.803  63.159 1.00 25.62  ? 22  ALA D C     1 
ATOM   4119 O  O     . ALA F 3 22  ? 3.376  61.022  63.338 1.00 25.19  ? 22  ALA D O     1 
ATOM   4120 C  CB    . ALA F 3 22  ? 4.634  58.921  61.093 1.00 29.54  ? 22  ALA D CB    1 
ATOM   4121 N  N     . ALA F 3 23  ? 3.833  58.966  64.137 1.00 19.09  ? 23  ALA D N     1 
ATOM   4122 C  CA    . ALA F 3 23  ? 4.071  59.453  65.487 1.00 17.22  ? 23  ALA D CA    1 
ATOM   4123 C  C     . ALA F 3 23  ? 4.876  58.417  66.252 1.00 15.36  ? 23  ALA D C     1 
ATOM   4124 O  O     . ALA F 3 23  ? 4.635  57.215  66.120 1.00 14.79  ? 23  ALA D O     1 
ATOM   4125 C  CB    . ALA F 3 23  ? 2.758  59.725  66.180 1.00 20.54  ? 23  ALA D CB    1 
ATOM   4126 N  N     . TYR F 3 24  ? 5.831  58.887  67.049 1.00 11.27  ? 24  TYR D N     1 
ATOM   4127 C  CA    . TYR F 3 24  ? 6.699  57.992  67.795 1.00 9.94   ? 24  TYR D CA    1 
ATOM   4128 C  C     . TYR F 3 24  ? 6.864  58.369  69.249 1.00 9.07   ? 24  TYR D C     1 
ATOM   4129 O  O     . TYR F 3 24  ? 6.665  59.517  69.629 1.00 10.13  ? 24  TYR D O     1 
ATOM   4130 C  CB    . TYR F 3 24  ? 8.079  57.944  67.141 1.00 10.22  ? 24  TYR D CB    1 
ATOM   4131 C  CG    . TYR F 3 24  ? 8.058  57.607  65.673 1.00 5.25   ? 24  TYR D CG    1 
ATOM   4132 C  CD1   . TYR F 3 24  ? 7.964  58.609  64.719 1.00 5.56   ? 24  TYR D CD1   1 
ATOM   4133 C  CD2   . TYR F 3 24  ? 8.139  56.289  65.242 1.00 5.49   ? 24  TYR D CD2   1 
ATOM   4134 C  CE1   . TYR F 3 24  ? 7.954  58.312  63.358 1.00 10.07  ? 24  TYR D CE1   1 
ATOM   4135 C  CE2   . TYR F 3 24  ? 8.129  55.974  63.883 1.00 11.49  ? 24  TYR D CE2   1 
ATOM   4136 C  CZ    . TYR F 3 24  ? 8.037  56.994  62.943 1.00 13.23  ? 24  TYR D CZ    1 
ATOM   4137 O  OH    . TYR F 3 24  ? 8.037  56.698  61.595 1.00 14.22  ? 24  TYR D OH    1 
ATOM   4138 N  N     . ASN F 3 25  ? 7.255  57.382  70.050 1.00 8.57   ? 25  ASN D N     1 
ATOM   4139 C  CA    . ASN F 3 25  ? 7.458  57.567  71.480 1.00 9.19   ? 25  ASN D CA    1 
ATOM   4140 C  C     . ASN F 3 25  ? 8.945  57.675  71.784 1.00 8.93   ? 25  ASN D C     1 
ATOM   4141 O  O     . ASN F 3 25  ? 9.444  57.060  72.728 1.00 5.56   ? 25  ASN D O     1 
ATOM   4142 C  CB    . ASN F 3 25  ? 6.879  56.383  72.246 1.00 10.75  ? 25  ASN D CB    1 
ATOM   4143 C  CG    . ASN F 3 25  ? 7.806  55.191  72.242 1.00 13.02  ? 25  ASN D CG    1 
ATOM   4144 O  OD1   . ASN F 3 25  ? 7.903  54.472  71.247 1.00 17.06  ? 25  ASN D OD1   1 
ATOM   4145 N  ND2   . ASN F 3 25  ? 8.505  54.982  73.351 1.00 10.99  ? 25  ASN D ND2   1 
ATOM   4146 N  N     . LYS F 3 26  ? 9.645  58.463  70.975 1.00 11.24  ? 26  LYS D N     1 
ATOM   4147 C  CA    . LYS F 3 26  ? 11.079 58.664  71.140 1.00 11.85  ? 26  LYS D CA    1 
ATOM   4148 C  C     . LYS F 3 26  ? 11.577 59.490  69.967 1.00 14.22  ? 26  LYS D C     1 
ATOM   4149 O  O     . LYS F 3 26  ? 11.578 59.028  68.827 1.00 12.05  ? 26  LYS D O     1 
ATOM   4150 C  CB    . LYS F 3 26  ? 11.801 57.315  71.181 1.00 10.18  ? 26  LYS D CB    1 
ATOM   4151 C  CG    . LYS F 3 26  ? 12.729 57.143  72.375 1.00 9.20   ? 26  LYS D CG    1 
ATOM   4152 C  CD    . LYS F 3 26  ? 11.980 57.185  73.683 1.00 4.59   ? 26  LYS D CD    1 
ATOM   4153 C  CE    . LYS F 3 26  ? 11.725 55.796  74.222 1.00 6.93   ? 26  LYS D CE    1 
ATOM   4154 N  NZ    . LYS F 3 26  ? 12.859 55.290  75.042 1.00 6.01   ? 26  LYS D NZ    1 
ATOM   4155 N  N     . ASN F 3 27  ? 11.994 60.716  70.255 1.00 18.83  ? 27  ASN D N     1 
ATOM   4156 C  CA    . ASN F 3 27  ? 12.473 61.616  69.220 1.00 24.24  ? 27  ASN D CA    1 
ATOM   4157 C  C     . ASN F 3 27  ? 13.336 60.939  68.149 1.00 27.60  ? 27  ASN D C     1 
ATOM   4158 O  O     . ASN F 3 27  ? 13.228 61.281  66.968 1.00 29.52  ? 27  ASN D O     1 
ATOM   4159 C  CB    . ASN F 3 27  ? 13.238 62.785  69.852 1.00 26.81  ? 27  ASN D CB    1 
ATOM   4160 C  CG    . ASN F 3 27  ? 13.691 63.818  68.823 1.00 30.51  ? 27  ASN D CG    1 
ATOM   4161 O  OD1   . ASN F 3 27  ? 12.871 64.429  68.126 1.00 31.05  ? 27  ASN D OD1   1 
ATOM   4162 N  ND2   . ASN F 3 27  ? 15.005 64.019  68.727 1.00 30.50  ? 27  ASN D ND2   1 
ATOM   4163 N  N     . TRP F 3 28  ? 14.183 59.982  68.530 1.00 27.47  ? 28  TRP D N     1 
ATOM   4164 C  CA    . TRP F 3 28  ? 15.017 59.331  67.517 1.00 25.45  ? 28  TRP D CA    1 
ATOM   4165 C  C     . TRP F 3 28  ? 14.174 58.581  66.496 1.00 27.58  ? 28  TRP D C     1 
ATOM   4166 O  O     . TRP F 3 28  ? 14.396 58.706  65.287 1.00 29.71  ? 28  TRP D O     1 
ATOM   4167 C  CB    . TRP F 3 28  ? 16.063 58.395  68.149 1.00 18.26  ? 28  TRP D CB    1 
ATOM   4168 C  CG    . TRP F 3 28  ? 15.589 57.066  68.689 1.00 13.93  ? 28  TRP D CG    1 
ATOM   4169 C  CD1   . TRP F 3 28  ? 15.530 56.711  69.999 1.00 17.49  ? 28  TRP D CD1   1 
ATOM   4170 C  CD2   . TRP F 3 28  ? 15.267 55.879  67.943 1.00 9.60   ? 28  TRP D CD2   1 
ATOM   4171 N  NE1   . TRP F 3 28  ? 15.205 55.381  70.125 1.00 15.99  ? 28  TRP D NE1   1 
ATOM   4172 C  CE2   . TRP F 3 28  ? 15.038 54.846  68.878 1.00 10.58  ? 28  TRP D CE2   1 
ATOM   4173 C  CE3   . TRP F 3 28  ? 15.155 55.588  66.580 1.00 9.18   ? 28  TRP D CE3   1 
ATOM   4174 C  CZ2   . TRP F 3 28  ? 14.703 53.541  68.496 1.00 8.92   ? 28  TRP D CZ2   1 
ATOM   4175 C  CZ3   . TRP F 3 28  ? 14.822 54.283  66.200 1.00 11.46  ? 28  TRP D CZ3   1 
ATOM   4176 C  CH2   . TRP F 3 28  ? 14.600 53.278  67.159 1.00 8.07   ? 28  TRP D CH2   1 
ATOM   4177 N  N     . LYS F 3 29  ? 13.200 57.814  66.982 1.00 22.98  ? 29  LYS D N     1 
ATOM   4178 C  CA    . LYS F 3 29  ? 12.330 57.069  66.096 1.00 13.62  ? 29  LYS D CA    1 
ATOM   4179 C  C     . LYS F 3 29  ? 11.884 58.049  65.036 1.00 7.41   ? 29  LYS D C     1 
ATOM   4180 O  O     . LYS F 3 29  ? 12.204 57.899  63.865 1.00 7.58   ? 29  LYS D O     1 
ATOM   4181 C  CB    . LYS F 3 29  ? 11.128 56.528  66.865 1.00 13.82  ? 29  LYS D CB    1 
ATOM   4182 C  CG    . LYS F 3 29  ? 11.505 55.595  67.993 1.00 14.87  ? 29  LYS D CG    1 
ATOM   4183 C  CD    . LYS F 3 29  ? 11.208 54.151  67.633 1.00 17.56  ? 29  LYS D CD    1 
ATOM   4184 C  CE    . LYS F 3 29  ? 11.045 53.302  68.878 1.00 21.03  ? 29  LYS D CE    1 
ATOM   4185 N  NZ    . LYS F 3 29  ? 9.722  53.518  69.532 1.00 24.80  ? 29  LYS D NZ    1 
ATOM   4186 N  N     . LEU F 3 30  ? 11.171 59.079  65.453 1.00 5.36   ? 30  LEU D N     1 
ATOM   4187 C  CA    . LEU F 3 30  ? 10.709 60.065  64.498 1.00 11.33  ? 30  LEU D CA    1 
ATOM   4188 C  C     . LEU F 3 30  ? 11.854 60.515  63.611 1.00 15.52  ? 30  LEU D C     1 
ATOM   4189 O  O     . LEU F 3 30  ? 11.753 60.490  62.386 1.00 15.20  ? 30  LEU D O     1 
ATOM   4190 C  CB    . LEU F 3 30  ? 10.130 61.272  65.227 1.00 9.30   ? 30  LEU D CB    1 
ATOM   4191 C  CG    . LEU F 3 30  ? 9.297  62.206  64.355 1.00 7.54   ? 30  LEU D CG    1 
ATOM   4192 C  CD1   . LEU F 3 30  ? 8.655  63.235  65.259 1.00 8.09   ? 30  LEU D CD1   1 
ATOM   4193 C  CD2   . LEU F 3 30  ? 10.156 62.866  63.281 1.00 2.00   ? 30  LEU D CD2   1 
ATOM   4194 N  N     . GLN F 3 31  ? 12.942 60.924  64.251 1.00 20.62  ? 31  GLN D N     1 
ATOM   4195 C  CA    . GLN F 3 31  ? 14.117 61.411  63.551 1.00 22.56  ? 31  GLN D CA    1 
ATOM   4196 C  C     . GLN F 3 31  ? 14.494 60.547  62.371 1.00 21.82  ? 31  GLN D C     1 
ATOM   4197 O  O     . GLN F 3 31  ? 14.912 61.060  61.338 1.00 23.35  ? 31  GLN D O     1 
ATOM   4198 C  CB    . GLN F 3 31  ? 15.293 61.531  64.520 1.00 24.70  ? 31  GLN D CB    1 
ATOM   4199 C  CG    . GLN F 3 31  ? 15.403 62.909  65.136 1.00 25.22  ? 31  GLN D CG    1 
ATOM   4200 C  CD    . GLN F 3 31  ? 14.400 63.879  64.532 1.00 25.91  ? 31  GLN D CD    1 
ATOM   4201 O  OE1   . GLN F 3 31  ? 14.524 64.272  63.368 1.00 24.07  ? 31  GLN D OE1   1 
ATOM   4202 N  NE2   . GLN F 3 31  ? 13.395 64.262  65.318 1.00 24.54  ? 31  GLN D NE2   1 
ATOM   4203 N  N     . ALA F 3 32  ? 14.346 59.237  62.526 1.00 19.96  ? 32  ALA D N     1 
ATOM   4204 C  CA    . ALA F 3 32  ? 14.661 58.312  61.445 1.00 20.61  ? 32  ALA D CA    1 
ATOM   4205 C  C     . ALA F 3 32  ? 13.573 58.426  60.372 1.00 22.17  ? 32  ALA D C     1 
ATOM   4206 O  O     . ALA F 3 32  ? 13.866 58.535  59.176 1.00 21.26  ? 32  ALA D O     1 
ATOM   4207 C  CB    . ALA F 3 32  ? 14.731 56.890  61.980 1.00 21.70  ? 32  ALA D CB    1 
ATOM   4208 N  N     . HIS F 3 33  ? 12.316 58.408  60.813 1.00 21.79  ? 33  HIS D N     1 
ATOM   4209 C  CA    . HIS F 3 33  ? 11.187 58.517  59.904 1.00 19.41  ? 33  HIS D CA    1 
ATOM   4210 C  C     . HIS F 3 33  ? 11.341 59.784  59.080 1.00 24.41  ? 33  HIS D C     1 
ATOM   4211 O  O     . HIS F 3 33  ? 10.936 59.833  57.919 1.00 26.44  ? 33  HIS D O     1 
ATOM   4212 C  CB    . HIS F 3 33  ? 9.875  58.574  60.689 1.00 14.40  ? 33  HIS D CB    1 
ATOM   4213 C  CG    . HIS F 3 33  ? 8.714  59.107  59.898 1.00 12.37  ? 33  HIS D CG    1 
ATOM   4214 N  ND1   . HIS F 3 33  ? 8.030  58.389  58.943 1.00 8.57   ? 33  HIS D ND1   1 
ATOM   4215 C  CD2   . HIS F 3 33  ? 8.111  60.322  59.936 1.00 9.87   ? 33  HIS D CD2   1 
ATOM   4216 C  CE1   . HIS F 3 33  ? 7.065  59.173  58.452 1.00 2.00   ? 33  HIS D CE1   1 
ATOM   4217 N  NE2   . HIS F 3 33  ? 7.078  60.355  59.029 1.00 2.00   ? 33  HIS D NE2   1 
ATOM   4218 N  N     . LEU F 3 34  ? 11.930 60.811  59.685 1.00 28.48  ? 34  LEU D N     1 
ATOM   4219 C  CA    . LEU F 3 34  ? 12.120 62.086  59.000 1.00 32.99  ? 34  LEU D CA    1 
ATOM   4220 C  C     . LEU F 3 34  ? 13.105 61.940  57.853 1.00 32.67  ? 34  LEU D C     1 
ATOM   4221 O  O     . LEU F 3 34  ? 12.882 62.452  56.752 1.00 28.76  ? 34  LEU D O     1 
ATOM   4222 C  CB    . LEU F 3 34  ? 12.617 63.149  59.983 1.00 36.49  ? 34  LEU D CB    1 
ATOM   4223 C  CG    . LEU F 3 34  ? 11.539 63.983  60.691 1.00 39.02  ? 34  LEU D CG    1 
ATOM   4224 C  CD1   . LEU F 3 34  ? 12.216 65.095  61.472 1.00 41.11  ? 34  LEU D CD1   1 
ATOM   4225 C  CD2   . LEU F 3 34  ? 10.541 64.557  59.684 1.00 37.23  ? 34  LEU D CD2   1 
ATOM   4226 N  N     . CYS F 3 35  ? 14.194 61.231  58.120 1.00 34.84  ? 35  CYS D N     1 
ATOM   4227 C  CA    . CYS F 3 35  ? 15.215 61.005  57.112 1.00 38.03  ? 35  CYS D CA    1 
ATOM   4228 C  C     . CYS F 3 35  ? 14.575 60.374  55.884 1.00 35.78  ? 35  CYS D C     1 
ATOM   4229 O  O     . CYS F 3 35  ? 15.065 60.518  54.766 1.00 38.54  ? 35  CYS D O     1 
ATOM   4230 C  CB    . CYS F 3 35  ? 16.303 60.102  57.681 1.00 40.59  ? 35  CYS D CB    1 
ATOM   4231 S  SG    . CYS F 3 35  ? 16.779 60.581  59.356 1.00 46.23  ? 35  CYS D SG    1 
ATOM   4232 N  N     . LYS F 3 36  ? 13.474 59.670  56.101 1.00 29.25  ? 36  LYS D N     1 
ATOM   4233 C  CA    . LYS F 3 36  ? 12.765 59.056  55.000 1.00 27.23  ? 36  LYS D CA    1 
ATOM   4234 C  C     . LYS F 3 36  ? 12.368 60.206  54.085 1.00 28.08  ? 36  LYS D C     1 
ATOM   4235 O  O     . LYS F 3 36  ? 12.810 60.286  52.938 1.00 27.01  ? 36  LYS D O     1 
ATOM   4236 C  CB    . LYS F 3 36  ? 11.514 58.343  55.518 1.00 28.92  ? 36  LYS D CB    1 
ATOM   4237 C  CG    . LYS F 3 36  ? 10.879 57.363  54.539 1.00 30.19  ? 36  LYS D CG    1 
ATOM   4238 C  CD    . LYS F 3 36  ? 10.768 55.966  55.146 1.00 29.24  ? 36  LYS D CD    1 
ATOM   4239 C  CE    . LYS F 3 36  ? 9.497  55.267  54.699 1.00 27.98  ? 36  LYS D CE    1 
ATOM   4240 N  NZ    . LYS F 3 36  ? 8.843  54.571  55.839 1.00 27.70  ? 36  LYS D NZ    1 
ATOM   4241 N  N     . HIS F 3 37  ? 11.544 61.106  54.618 1.00 30.47  ? 37  HIS D N     1 
ATOM   4242 C  CA    . HIS F 3 37  ? 11.059 62.267  53.873 1.00 32.64  ? 37  HIS D CA    1 
ATOM   4243 C  C     . HIS F 3 37  ? 12.209 62.988  53.199 1.00 33.63  ? 37  HIS D C     1 
ATOM   4244 O  O     . HIS F 3 37  ? 12.238 63.131  51.983 1.00 32.01  ? 37  HIS D O     1 
ATOM   4245 C  CB    . HIS F 3 37  ? 10.353 63.258  54.806 1.00 33.57  ? 37  HIS D CB    1 
ATOM   4246 C  CG    . HIS F 3 37  ? 8.991  62.823  55.251 1.00 33.33  ? 37  HIS D CG    1 
ATOM   4247 N  ND1   . HIS F 3 37  ? 7.828  63.489  54.937 1.00 32.90  ? 37  HIS D ND1   1 
ATOM   4248 C  CD2   . HIS F 3 37  ? 8.619  61.791  56.049 1.00 34.35  ? 37  HIS D CD2   1 
ATOM   4249 C  CE1   . HIS F 3 37  ? 6.810  62.855  55.543 1.00 33.42  ? 37  HIS D CE1   1 
ATOM   4250 N  NE2   . HIS F 3 37  ? 7.238  61.816  56.231 1.00 33.90  ? 37  HIS D NE2   1 
ATOM   4251 N  N     . THR F 3 38  ? 13.155 63.440  54.015 1.00 39.89  ? 38  THR D N     1 
ATOM   4252 C  CA    . THR F 3 38  ? 14.326 64.172  53.546 1.00 45.56  ? 38  THR D CA    1 
ATOM   4253 C  C     . THR F 3 38  ? 15.208 63.364  52.595 1.00 49.20  ? 38  THR D C     1 
ATOM   4254 O  O     . THR F 3 38  ? 15.309 63.675  51.410 1.00 48.02  ? 38  THR D O     1 
ATOM   4255 C  CB    . THR F 3 38  ? 15.186 64.641  54.743 1.00 45.83  ? 38  THR D CB    1 
ATOM   4256 O  OG1   . THR F 3 38  ? 15.005 63.742  55.846 1.00 44.78  ? 38  THR D OG1   1 
ATOM   4257 C  CG2   . THR F 3 38  ? 14.776 66.042  55.175 1.00 44.95  ? 38  THR D CG2   1 
ATOM   4258 N  N     . GLY F 3 39  ? 15.844 62.325  53.123 1.00 54.02  ? 39  GLY D N     1 
ATOM   4259 C  CA    . GLY F 3 39  ? 16.717 61.501  52.309 1.00 57.81  ? 39  GLY D CA    1 
ATOM   4260 C  C     . GLY F 3 39  ? 18.143 61.769  52.730 1.00 60.99  ? 39  GLY D C     1 
ATOM   4261 O  O     . GLY F 3 39  ? 19.036 61.923  51.898 1.00 60.78  ? 39  GLY D O     1 
ATOM   4262 N  N     . GLU F 3 40  ? 18.346 61.826  54.041 1.00 64.33  ? 40  GLU D N     1 
ATOM   4263 C  CA    . GLU F 3 40  ? 19.656 62.096  54.608 1.00 68.35  ? 40  GLU D CA    1 
ATOM   4264 C  C     . GLU F 3 40  ? 20.462 60.829  54.845 1.00 66.99  ? 40  GLU D C     1 
ATOM   4265 O  O     . GLU F 3 40  ? 19.925 59.724  54.837 1.00 64.24  ? 40  GLU D O     1 
ATOM   4266 C  CB    . GLU F 3 40  ? 19.502 62.858  55.926 1.00 73.32  ? 40  GLU D CB    1 
ATOM   4267 C  CG    . GLU F 3 40  ? 19.069 64.306  55.754 1.00 77.82  ? 40  GLU D CG    1 
ATOM   4268 C  CD    . GLU F 3 40  ? 19.361 65.153  56.978 1.00 80.22  ? 40  GLU D CD    1 
ATOM   4269 O  OE1   . GLU F 3 40  ? 20.481 65.045  57.526 1.00 81.82  ? 40  GLU D OE1   1 
ATOM   4270 O  OE2   . GLU F 3 40  ? 18.468 65.925  57.390 1.00 80.37  ? 40  GLU D OE2   1 
ATOM   4271 N  N     . LYS F 3 41  ? 21.761 61.010  55.058 1.00 68.81  ? 41  LYS D N     1 
ATOM   4272 C  CA    . LYS F 3 41  ? 22.670 59.899  55.313 1.00 70.70  ? 41  LYS D CA    1 
ATOM   4273 C  C     . LYS F 3 41  ? 23.411 60.117  56.636 1.00 67.24  ? 41  LYS D C     1 
ATOM   4274 O  O     . LYS F 3 41  ? 24.640 60.206  56.662 1.00 67.39  ? 41  LYS D O     1 
ATOM   4275 C  CB    . LYS F 3 41  ? 23.687 59.764  54.172 1.00 76.02  ? 41  LYS D CB    1 
ATOM   4276 C  CG    . LYS F 3 41  ? 23.481 60.720  52.998 1.00 80.39  ? 41  LYS D CG    1 
ATOM   4277 C  CD    . LYS F 3 41  ? 23.937 60.089  51.679 1.00 82.97  ? 41  LYS D CD    1 
ATOM   4278 C  CE    . LYS F 3 41  ? 25.263 60.672  51.199 1.00 83.49  ? 41  LYS D CE    1 
ATOM   4279 N  NZ    . LYS F 3 41  ? 26.031 59.724  50.339 1.00 82.83  ? 41  LYS D NZ    1 
ATOM   4280 N  N     . PRO F 3 42  ? 22.668 60.207  57.753 1.00 62.78  ? 42  PRO D N     1 
ATOM   4281 C  CA    . PRO F 3 42  ? 23.267 60.417  59.076 1.00 57.74  ? 42  PRO D CA    1 
ATOM   4282 C  C     . PRO F 3 42  ? 24.383 59.431  59.398 1.00 53.28  ? 42  PRO D C     1 
ATOM   4283 O  O     . PRO F 3 42  ? 25.189 59.662  60.296 1.00 51.60  ? 42  PRO D O     1 
ATOM   4284 C  CB    . PRO F 3 42  ? 22.086 60.271  60.035 1.00 58.54  ? 42  PRO D CB    1 
ATOM   4285 C  CG    . PRO F 3 42  ? 20.897 60.615  59.217 1.00 60.44  ? 42  PRO D CG    1 
ATOM   4286 C  CD    . PRO F 3 42  ? 21.199 60.118  57.831 1.00 62.07  ? 42  PRO D CD    1 
ATOM   4287 N  N     . PHE F 3 43  ? 24.421 58.326  58.668 1.00 50.94  ? 43  PHE D N     1 
ATOM   4288 C  CA    . PHE F 3 43  ? 25.444 57.321  58.891 1.00 51.82  ? 43  PHE D CA    1 
ATOM   4289 C  C     . PHE F 3 43  ? 25.866 56.687  57.579 1.00 53.77  ? 43  PHE D C     1 
ATOM   4290 O  O     . PHE F 3 43  ? 25.331 55.653  57.185 1.00 55.27  ? 43  PHE D O     1 
ATOM   4291 C  CB    . PHE F 3 43  ? 24.925 56.238  59.836 1.00 51.79  ? 43  PHE D CB    1 
ATOM   4292 C  CG    . PHE F 3 43  ? 24.424 56.768  61.146 1.00 53.35  ? 43  PHE D CG    1 
ATOM   4293 C  CD1   . PHE F 3 43  ? 23.120 57.235  61.268 1.00 53.10  ? 43  PHE D CD1   1 
ATOM   4294 C  CD2   . PHE F 3 43  ? 25.252 56.797  62.263 1.00 54.40  ? 43  PHE D CD2   1 
ATOM   4295 C  CE1   . PHE F 3 43  ? 22.646 57.722  62.482 1.00 53.28  ? 43  PHE D CE1   1 
ATOM   4296 C  CE2   . PHE F 3 43  ? 24.789 57.281  63.482 1.00 54.88  ? 43  PHE D CE2   1 
ATOM   4297 C  CZ    . PHE F 3 43  ? 23.482 57.743  63.592 1.00 54.84  ? 43  PHE D CZ    1 
ATOM   4298 N  N     . PRO F 3 44  ? 26.825 57.309  56.875 1.00 54.75  ? 44  PRO D N     1 
ATOM   4299 C  CA    . PRO F 3 44  ? 27.308 56.781  55.598 1.00 57.91  ? 44  PRO D CA    1 
ATOM   4300 C  C     . PRO F 3 44  ? 28.511 55.866  55.812 1.00 61.90  ? 44  PRO D C     1 
ATOM   4301 O  O     . PRO F 3 44  ? 29.122 55.880  56.883 1.00 60.23  ? 44  PRO D O     1 
ATOM   4302 C  CB    . PRO F 3 44  ? 27.670 58.038  54.812 1.00 56.12  ? 44  PRO D CB    1 
ATOM   4303 C  CG    . PRO F 3 44  ? 27.964 59.088  55.874 1.00 53.96  ? 44  PRO D CG    1 
ATOM   4304 C  CD    . PRO F 3 44  ? 27.510 58.564  57.221 1.00 53.53  ? 44  PRO D CD    1 
ATOM   4305 N  N     . CYS F 3 45  ? 28.848 55.074  54.797 1.00 67.00  ? 45  CYS D N     1 
ATOM   4306 C  CA    . CYS F 3 45  ? 29.980 54.161  54.901 1.00 72.16  ? 45  CYS D CA    1 
ATOM   4307 C  C     . CYS F 3 45  ? 31.298 54.885  54.673 1.00 77.89  ? 45  CYS D C     1 
ATOM   4308 O  O     . CYS F 3 45  ? 31.315 56.027  54.209 1.00 78.98  ? 45  CYS D O     1 
ATOM   4309 C  CB    . CYS F 3 45  ? 29.849 53.024  53.894 1.00 71.16  ? 45  CYS D CB    1 
ATOM   4310 S  SG    . CYS F 3 45  ? 30.867 51.611  54.323 1.00 71.11  ? 45  CYS D SG    1 
ATOM   4311 N  N     . LYS F 3 46  ? 32.403 54.215  54.989 1.00 82.21  ? 46  LYS D N     1 
ATOM   4312 C  CA    . LYS F 3 46  ? 33.723 54.814  54.830 1.00 86.34  ? 46  LYS D CA    1 
ATOM   4313 C  C     . LYS F 3 46  ? 34.606 54.098  53.806 1.00 88.64  ? 46  LYS D C     1 
ATOM   4314 O  O     . LYS F 3 46  ? 35.675 53.586  54.145 1.00 89.91  ? 46  LYS D O     1 
ATOM   4315 C  CB    . LYS F 3 46  ? 34.432 54.861  56.186 1.00 87.99  ? 46  LYS D CB    1 
ATOM   4316 C  CG    . LYS F 3 46  ? 33.857 55.895  57.152 1.00 89.02  ? 46  LYS D CG    1 
ATOM   4317 C  CD    . LYS F 3 46  ? 32.757 55.301  58.028 1.00 88.96  ? 46  LYS D CD    1 
ATOM   4318 C  CE    . LYS F 3 46  ? 32.528 56.137  59.282 1.00 88.57  ? 46  LYS D CE    1 
ATOM   4319 N  NZ    . LYS F 3 46  ? 31.526 57.216  59.060 1.00 88.17  ? 46  LYS D NZ    1 
ATOM   4320 N  N     . GLU F 3 47  ? 34.150 54.065  52.556 1.00 90.09  ? 47  GLU D N     1 
ATOM   4321 C  CA    . GLU F 3 47  ? 34.886 53.427  51.464 1.00 90.92  ? 47  GLU D CA    1 
ATOM   4322 C  C     . GLU F 3 47  ? 34.227 53.796  50.138 1.00 91.56  ? 47  GLU D C     1 
ATOM   4323 O  O     . GLU F 3 47  ? 33.005 53.928  50.060 1.00 91.26  ? 47  GLU D O     1 
ATOM   4324 C  CB    . GLU F 3 47  ? 34.910 51.895  51.628 1.00 91.00  ? 47  GLU D CB    1 
ATOM   4325 C  CG    . GLU F 3 47  ? 34.043 51.341  52.766 1.00 92.28  ? 47  GLU D CG    1 
ATOM   4326 C  CD    . GLU F 3 47  ? 34.854 50.667  53.870 1.00 92.04  ? 47  GLU D CD    1 
ATOM   4327 O  OE1   . GLU F 3 47  ? 35.597 49.711  53.564 1.00 92.01  ? 47  GLU D OE1   1 
ATOM   4328 O  OE2   . GLU F 3 47  ? 34.746 51.088  55.045 1.00 91.34  ? 47  GLU D OE2   1 
ATOM   4329 N  N     . GLU F 3 48  ? 35.039 53.967  49.100 1.00 92.65  ? 48  GLU D N     1 
ATOM   4330 C  CA    . GLU F 3 48  ? 34.531 54.333  47.782 1.00 93.54  ? 48  GLU D CA    1 
ATOM   4331 C  C     . GLU F 3 48  ? 33.608 53.269  47.212 1.00 93.64  ? 48  GLU D C     1 
ATOM   4332 O  O     . GLU F 3 48  ? 33.495 52.172  47.761 1.00 92.31  ? 48  GLU D O     1 
ATOM   4333 C  CB    . GLU F 3 48  ? 35.690 54.572  46.813 1.00 94.64  ? 48  GLU D CB    1 
ATOM   4334 C  CG    . GLU F 3 48  ? 36.013 56.037  46.594 1.00 96.67  ? 48  GLU D CG    1 
ATOM   4335 C  CD    . GLU F 3 48  ? 36.562 56.700  47.842 1.00 98.96  ? 48  GLU D CD    1 
ATOM   4336 O  OE1   . GLU F 3 48  ? 35.864 56.695  48.880 1.00 99.86  ? 48  GLU D OE1   1 
ATOM   4337 O  OE2   . GLU F 3 48  ? 37.694 57.227  47.784 1.00 100.00 ? 48  GLU D OE2   1 
ATOM   4338 N  N     . GLY F 3 49  ? 32.948 53.605  46.108 1.00 95.87  ? 49  GLY D N     1 
ATOM   4339 C  CA    . GLY F 3 49  ? 32.037 52.671  45.467 1.00 98.92  ? 49  GLY D CA    1 
ATOM   4340 C  C     . GLY F 3 49  ? 30.745 52.445  46.235 1.00 99.86  ? 49  GLY D C     1 
ATOM   4341 O  O     . GLY F 3 49  ? 29.730 52.033  45.660 1.00 100.00 ? 49  GLY D O     1 
ATOM   4342 N  N     . CYS F 3 50  ? 30.779 52.717  47.537 1.00 98.42  ? 50  CYS D N     1 
ATOM   4343 C  CA    . CYS F 3 50  ? 29.612 52.540  48.391 1.00 95.37  ? 50  CYS D CA    1 
ATOM   4344 C  C     . CYS F 3 50  ? 28.957 53.867  48.749 1.00 94.91  ? 50  CYS D C     1 
ATOM   4345 O  O     . CYS F 3 50  ? 29.597 54.759  49.312 1.00 95.51  ? 50  CYS D O     1 
ATOM   4346 C  CB    . CYS F 3 50  ? 30.003 51.809  49.677 1.00 92.85  ? 50  CYS D CB    1 
ATOM   4347 S  SG    . CYS F 3 50  ? 28.609 51.443  50.760 1.00 89.07  ? 50  CYS D SG    1 
ATOM   4348 N  N     . GLU F 3 51  ? 27.675 53.987  48.419 1.00 93.89  ? 51  GLU D N     1 
ATOM   4349 C  CA    . GLU F 3 51  ? 26.921 55.198  48.714 1.00 93.04  ? 51  GLU D CA    1 
ATOM   4350 C  C     . GLU F 3 51  ? 25.818 54.875  49.719 1.00 90.15  ? 51  GLU D C     1 
ATOM   4351 O  O     . GLU F 3 51  ? 24.912 55.681  49.944 1.00 90.08  ? 51  GLU D O     1 
ATOM   4352 C  CB    . GLU F 3 51  ? 26.314 55.768  47.427 1.00 95.25  ? 51  GLU D CB    1 
ATOM   4353 C  CG    . GLU F 3 51  ? 26.082 57.279  47.459 1.00 98.51  ? 51  GLU D CG    1 
ATOM   4354 C  CD    . GLU F 3 51  ? 27.320 58.082  47.081 1.00 100.00 ? 51  GLU D CD    1 
ATOM   4355 O  OE1   . GLU F 3 51  ? 28.008 57.697  46.110 1.00 100.00 ? 51  GLU D OE1   1 
ATOM   4356 O  OE2   . GLU F 3 51  ? 27.602 59.100  47.755 1.00 100.00 ? 51  GLU D OE2   1 
ATOM   4357 N  N     . LYS F 3 52  ? 25.909 53.692  50.325 1.00 86.57  ? 52  LYS D N     1 
ATOM   4358 C  CA    . LYS F 3 52  ? 24.918 53.245  51.300 1.00 83.09  ? 52  LYS D CA    1 
ATOM   4359 C  C     . LYS F 3 52  ? 24.825 54.198  52.483 1.00 79.83  ? 52  LYS D C     1 
ATOM   4360 O  O     . LYS F 3 52  ? 25.842 54.602  53.055 1.00 78.31  ? 52  LYS D O     1 
ATOM   4361 C  CB    . LYS F 3 52  ? 25.251 51.832  51.798 1.00 83.46  ? 52  LYS D CB    1 
ATOM   4362 C  CG    . LYS F 3 52  ? 24.867 50.715  50.827 1.00 84.71  ? 52  LYS D CG    1 
ATOM   4363 C  CD    . LYS F 3 52  ? 23.358 50.649  50.596 1.00 85.29  ? 52  LYS D CD    1 
ATOM   4364 C  CE    . LYS F 3 52  ? 23.021 50.391  49.125 1.00 85.45  ? 52  LYS D CE    1 
ATOM   4365 N  NZ    . LYS F 3 52  ? 21.548 50.431  48.845 1.00 84.80  ? 52  LYS D NZ    1 
ATOM   4366 N  N     . GLY F 3 53  ? 23.590 54.555  52.833 1.00 76.78  ? 53  GLY D N     1 
ATOM   4367 C  CA    . GLY F 3 53  ? 23.345 55.463  53.941 1.00 69.97  ? 53  GLY D CA    1 
ATOM   4368 C  C     . GLY F 3 53  ? 22.492 54.812  55.006 1.00 62.18  ? 53  GLY D C     1 
ATOM   4369 O  O     . GLY F 3 53  ? 21.913 53.748  54.774 1.00 61.02  ? 53  GLY D O     1 
ATOM   4370 N  N     . PHE F 3 54  ? 22.411 55.442  56.174 1.00 57.42  ? 54  PHE D N     1 
ATOM   4371 C  CA    . PHE F 3 54  ? 21.630 54.886  57.271 1.00 55.87  ? 54  PHE D CA    1 
ATOM   4372 C  C     . PHE F 3 54  ? 21.121 55.931  58.262 1.00 54.16  ? 54  PHE D C     1 
ATOM   4373 O  O     . PHE F 3 54  ? 21.352 57.128  58.089 1.00 54.54  ? 54  PHE D O     1 
ATOM   4374 C  CB    . PHE F 3 54  ? 22.463 53.832  58.008 1.00 56.26  ? 54  PHE D CB    1 
ATOM   4375 C  CG    . PHE F 3 54  ? 22.814 52.642  57.162 1.00 53.85  ? 54  PHE D CG    1 
ATOM   4376 C  CD1   . PHE F 3 54  ? 21.961 51.546  57.096 1.00 53.37  ? 54  PHE D CD1   1 
ATOM   4377 C  CD2   . PHE F 3 54  ? 23.977 52.635  56.402 1.00 51.83  ? 54  PHE D CD2   1 
ATOM   4378 C  CE1   . PHE F 3 54  ? 22.259 50.466  56.287 1.00 53.50  ? 54  PHE D CE1   1 
ATOM   4379 C  CE2   . PHE F 3 54  ? 24.284 51.561  55.589 1.00 52.97  ? 54  PHE D CE2   1 
ATOM   4380 C  CZ    . PHE F 3 54  ? 23.425 50.473  55.529 1.00 54.32  ? 54  PHE D CZ    1 
ATOM   4381 N  N     . THR F 3 55  ? 20.431 55.460  59.301 1.00 52.70  ? 55  THR D N     1 
ATOM   4382 C  CA    . THR F 3 55  ? 19.859 56.324  60.334 1.00 52.95  ? 55  THR D CA    1 
ATOM   4383 C  C     . THR F 3 55  ? 20.006 55.733  61.743 1.00 53.50  ? 55  THR D C     1 
ATOM   4384 O  O     . THR F 3 55  ? 19.049 55.694  62.524 1.00 48.90  ? 55  THR D O     1 
ATOM   4385 C  CB    . THR F 3 55  ? 18.376 56.565  60.054 1.00 52.68  ? 55  THR D CB    1 
ATOM   4386 O  OG1   . THR F 3 55  ? 17.792 55.366  59.529 1.00 54.41  ? 55  THR D OG1   1 
ATOM   4387 C  CG2   . THR F 3 55  ? 18.211 57.675  59.035 1.00 51.69  ? 55  THR D CG2   1 
ATOM   4388 N  N     . SER F 3 56  ? 21.218 55.274  62.043 1.00 57.05  ? 56  SER D N     1 
ATOM   4389 C  CA    . SER F 3 56  ? 21.575 54.676  63.328 1.00 60.52  ? 56  SER D CA    1 
ATOM   4390 C  C     . SER F 3 56  ? 23.051 54.276  63.255 1.00 64.91  ? 56  SER D C     1 
ATOM   4391 O  O     . SER F 3 56  ? 23.508 53.743  62.240 1.00 66.61  ? 56  SER D O     1 
ATOM   4392 C  CB    . SER F 3 56  ? 20.708 53.438  63.606 1.00 59.52  ? 56  SER D CB    1 
ATOM   4393 O  OG    . SER F 3 56  ? 21.371 52.499  64.443 1.00 56.69  ? 56  SER D OG    1 
ATOM   4394 N  N     . LEU F 3 57  ? 23.798 54.539  64.321 1.00 67.23  ? 57  LEU D N     1 
ATOM   4395 C  CA    . LEU F 3 57  ? 25.215 54.197  64.349 1.00 70.03  ? 57  LEU D CA    1 
ATOM   4396 C  C     . LEU F 3 57  ? 25.441 52.689  64.374 1.00 71.92  ? 57  LEU D C     1 
ATOM   4397 O  O     . LEU F 3 57  ? 26.580 52.226  64.384 1.00 71.55  ? 57  LEU D O     1 
ATOM   4398 C  CB    . LEU F 3 57  ? 25.876 54.834  65.564 1.00 71.29  ? 57  LEU D CB    1 
ATOM   4399 C  CG    . LEU F 3 57  ? 24.905 55.559  66.493 1.00 72.87  ? 57  LEU D CG    1 
ATOM   4400 C  CD1   . LEU F 3 57  ? 24.642 54.698  67.715 1.00 73.94  ? 57  LEU D CD1   1 
ATOM   4401 C  CD2   . LEU F 3 57  ? 25.480 56.908  66.893 1.00 74.10  ? 57  LEU D CD2   1 
ATOM   4402 N  N     . HIS F 3 58  ? 24.351 51.928  64.389 1.00 74.43  ? 58  HIS D N     1 
ATOM   4403 C  CA    . HIS F 3 58  ? 24.432 50.472  64.406 1.00 75.28  ? 58  HIS D CA    1 
ATOM   4404 C  C     . HIS F 3 58  ? 24.055 49.903  63.048 1.00 72.99  ? 58  HIS D C     1 
ATOM   4405 O  O     . HIS F 3 58  ? 24.481 48.807  62.684 1.00 73.54  ? 58  HIS D O     1 
ATOM   4406 C  CB    . HIS F 3 58  ? 23.497 49.889  65.464 1.00 79.29  ? 58  HIS D CB    1 
ATOM   4407 C  CG    . HIS F 3 58  ? 23.019 48.506  65.143 1.00 82.51  ? 58  HIS D CG    1 
ATOM   4408 N  ND1   . HIS F 3 58  ? 23.882 47.454  64.925 1.00 82.64  ? 58  HIS D ND1   1 
ATOM   4409 C  CD2   . HIS F 3 58  ? 21.770 48.009  64.982 1.00 84.41  ? 58  HIS D CD2   1 
ATOM   4410 C  CE1   . HIS F 3 58  ? 23.184 46.368  64.643 1.00 83.83  ? 58  HIS D CE1   1 
ATOM   4411 N  NE2   . HIS F 3 58  ? 21.900 46.677  64.671 1.00 84.45  ? 58  HIS D NE2   1 
ATOM   4412 N  N     . HIS F 3 59  ? 23.236 50.640  62.310 1.00 69.67  ? 59  HIS D N     1 
ATOM   4413 C  CA    . HIS F 3 59  ? 22.827 50.197  60.991 1.00 68.17  ? 59  HIS D CA    1 
ATOM   4414 C  C     . HIS F 3 59  ? 23.960 50.458  60.015 1.00 70.52  ? 59  HIS D C     1 
ATOM   4415 O  O     . HIS F 3 59  ? 23.849 50.164  58.825 1.00 73.44  ? 59  HIS D O     1 
ATOM   4416 C  CB    . HIS F 3 59  ? 21.575 50.938  60.544 1.00 65.78  ? 59  HIS D CB    1 
ATOM   4417 C  CG    . HIS F 3 59  ? 20.304 50.285  60.984 1.00 63.96  ? 59  HIS D CG    1 
ATOM   4418 N  ND1   . HIS F 3 59  ? 19.060 50.762  60.627 1.00 63.46  ? 59  HIS D ND1   1 
ATOM   4419 C  CD2   . HIS F 3 59  ? 20.083 49.198  61.761 1.00 61.80  ? 59  HIS D CD2   1 
ATOM   4420 C  CE1   . HIS F 3 59  ? 18.128 49.997  61.166 1.00 62.40  ? 59  HIS D CE1   1 
ATOM   4421 N  NE2   . HIS F 3 59  ? 18.722 49.041  61.858 1.00 61.77  ? 59  HIS D NE2   1 
ATOM   4422 N  N     . LEU F 3 60  ? 25.048 51.026  60.525 1.00 69.63  ? 60  LEU D N     1 
ATOM   4423 C  CA    . LEU F 3 60  ? 26.217 51.294  59.701 1.00 69.49  ? 60  LEU D CA    1 
ATOM   4424 C  C     . LEU F 3 60  ? 27.223 50.176  59.954 1.00 71.72  ? 60  LEU D C     1 
ATOM   4425 O  O     . LEU F 3 60  ? 27.892 49.704  59.032 1.00 73.45  ? 60  LEU D O     1 
ATOM   4426 C  CB    . LEU F 3 60  ? 26.839 52.645  60.059 1.00 66.29  ? 60  LEU D CB    1 
ATOM   4427 C  CG    . LEU F 3 60  ? 28.085 53.053  59.265 1.00 63.72  ? 60  LEU D CG    1 
ATOM   4428 C  CD1   . LEU F 3 60  ? 27.978 52.623  57.812 1.00 60.98  ? 60  LEU D CD1   1 
ATOM   4429 C  CD2   . LEU F 3 60  ? 28.241 54.553  59.351 1.00 64.53  ? 60  LEU D CD2   1 
ATOM   4430 N  N     . THR F 3 61  ? 27.310 49.751  61.213 1.00 72.81  ? 61  THR D N     1 
ATOM   4431 C  CA    . THR F 3 61  ? 28.220 48.681  61.612 1.00 74.33  ? 61  THR D CA    1 
ATOM   4432 C  C     . THR F 3 61  ? 27.832 47.363  60.952 1.00 72.85  ? 61  THR D C     1 
ATOM   4433 O  O     . THR F 3 61  ? 28.679 46.668  60.389 1.00 74.08  ? 61  THR D O     1 
ATOM   4434 C  CB    . THR F 3 61  ? 28.216 48.478  63.137 1.00 76.76  ? 61  THR D CB    1 
ATOM   4435 O  OG1   . THR F 3 61  ? 27.090 49.157  63.710 1.00 79.26  ? 61  THR D OG1   1 
ATOM   4436 C  CG2   . THR F 3 61  ? 29.504 49.017  63.743 1.00 77.37  ? 61  THR D CG2   1 
ATOM   4437 N  N     . ARG F 3 62  ? 26.551 47.017  61.027 1.00 69.57  ? 62  ARG D N     1 
ATOM   4438 C  CA    . ARG F 3 62  ? 26.071 45.784  60.422 1.00 65.71  ? 62  ARG D CA    1 
ATOM   4439 C  C     . ARG F 3 62  ? 26.401 45.779  58.925 1.00 64.73  ? 62  ARG D C     1 
ATOM   4440 O  O     . ARG F 3 62  ? 26.492 44.717  58.310 1.00 66.61  ? 62  ARG D O     1 
ATOM   4441 C  CB    . ARG F 3 62  ? 24.558 45.628  60.664 1.00 63.72  ? 62  ARG D CB    1 
ATOM   4442 C  CG    . ARG F 3 62  ? 23.655 46.008  59.494 1.00 60.94  ? 62  ARG D CG    1 
ATOM   4443 C  CD    . ARG F 3 62  ? 22.260 46.420  59.963 1.00 57.59  ? 62  ARG D CD    1 
ATOM   4444 N  NE    . ARG F 3 62  ? 21.599 45.379  60.750 1.00 56.29  ? 62  ARG D NE    1 
ATOM   4445 C  CZ    . ARG F 3 62  ? 20.285 45.161  60.757 1.00 54.41  ? 62  ARG D CZ    1 
ATOM   4446 N  NH1   . ARG F 3 62  ? 19.483 45.914  60.013 1.00 52.59  ? 62  ARG D NH1   1 
ATOM   4447 N  NH2   . ARG F 3 62  ? 19.767 44.195  61.512 1.00 51.84  ? 62  ARG D NH2   1 
ATOM   4448 N  N     . HIS F 3 63  ? 26.594 46.964  58.348 1.00 61.24  ? 63  HIS D N     1 
ATOM   4449 C  CA    . HIS F 3 63  ? 26.931 47.074  56.932 1.00 60.97  ? 63  HIS D CA    1 
ATOM   4450 C  C     . HIS F 3 63  ? 28.438 46.952  56.734 1.00 65.65  ? 63  HIS D C     1 
ATOM   4451 O  O     . HIS F 3 63  ? 28.908 46.642  55.638 1.00 66.96  ? 63  HIS D O     1 
ATOM   4452 C  CB    . HIS F 3 63  ? 26.461 48.411  56.360 1.00 57.62  ? 63  HIS D CB    1 
ATOM   4453 C  CG    . HIS F 3 63  ? 27.168 48.808  55.100 1.00 55.34  ? 63  HIS D CG    1 
ATOM   4454 N  ND1   . HIS F 3 63  ? 26.700 48.540  53.833 1.00 54.32  ? 63  HIS D ND1   1 
ATOM   4455 C  CD2   . HIS F 3 63  ? 28.347 49.457  54.923 1.00 54.36  ? 63  HIS D CD2   1 
ATOM   4456 C  CE1   . HIS F 3 63  ? 27.585 49.021  52.949 1.00 54.36  ? 63  HIS D CE1   1 
ATOM   4457 N  NE2   . HIS F 3 63  ? 28.608 49.591  53.558 1.00 55.46  ? 63  HIS D NE2   1 
ATOM   4458 N  N     . SER F 3 64  ? 29.195 47.210  57.794 1.00 69.12  ? 64  SER D N     1 
ATOM   4459 C  CA    . SER F 3 64  ? 30.650 47.122  57.728 1.00 72.59  ? 64  SER D CA    1 
ATOM   4460 C  C     . SER F 3 64  ? 31.110 45.693  57.442 1.00 74.37  ? 64  SER D C     1 
ATOM   4461 O  O     . SER F 3 64  ? 31.753 45.429  56.424 1.00 72.40  ? 64  SER D O     1 
ATOM   4462 C  CB    . SER F 3 64  ? 31.266 47.601  59.043 1.00 72.92  ? 64  SER D CB    1 
ATOM   4463 O  OG    . SER F 3 64  ? 30.395 48.496  59.708 1.00 73.68  ? 64  SER D OG    1 
ATOM   4464 N  N     . LEU F 3 65  ? 30.773 44.776  58.345 1.00 77.60  ? 65  LEU D N     1 
ATOM   4465 C  CA    . LEU F 3 65  ? 31.144 43.370  58.208 1.00 81.13  ? 65  LEU D CA    1 
ATOM   4466 C  C     . LEU F 3 65  ? 30.942 42.864  56.785 1.00 83.13  ? 65  LEU D C     1 
ATOM   4467 O  O     . LEU F 3 65  ? 31.493 41.833  56.398 1.00 83.55  ? 65  LEU D O     1 
ATOM   4468 C  CB    . LEU F 3 65  ? 30.318 42.514  59.173 1.00 82.00  ? 65  LEU D CB    1 
ATOM   4469 C  CG    . LEU F 3 65  ? 28.841 42.889  59.333 1.00 82.60  ? 65  LEU D CG    1 
ATOM   4470 C  CD1   . LEU F 3 65  ? 27.964 41.851  58.648 1.00 82.07  ? 65  LEU D CD1   1 
ATOM   4471 C  CD2   . LEU F 3 65  ? 28.495 42.988  60.812 1.00 83.01  ? 65  LEU D CD2   1 
ATOM   4472 N  N     . THR F 3 66  ? 30.155 43.603  56.011 1.00 85.36  ? 66  THR D N     1 
ATOM   4473 C  CA    . THR F 3 66  ? 29.855 43.240  54.633 1.00 89.89  ? 66  THR D CA    1 
ATOM   4474 C  C     . THR F 3 66  ? 30.909 43.690  53.621 1.00 91.75  ? 66  THR D C     1 
ATOM   4475 O  O     . THR F 3 66  ? 31.222 42.962  52.676 1.00 91.55  ? 66  THR D O     1 
ATOM   4476 C  CB    . THR F 3 66  ? 28.496 43.817  54.208 1.00 91.46  ? 66  THR D CB    1 
ATOM   4477 O  OG1   . THR F 3 66  ? 28.691 45.075  53.546 1.00 92.19  ? 66  THR D OG1   1 
ATOM   4478 C  CG2   . THR F 3 66  ? 27.598 44.005  55.427 1.00 92.41  ? 66  THR D CG2   1 
ATOM   4479 N  N     . HIS F 3 67  ? 31.450 44.890  53.809 1.00 93.25  ? 67  HIS D N     1 
ATOM   4480 C  CA    . HIS F 3 67  ? 32.469 45.404  52.899 1.00 92.99  ? 67  HIS D CA    1 
ATOM   4481 C  C     . HIS F 3 67  ? 33.721 44.551  53.017 1.00 89.91  ? 67  HIS D C     1 
ATOM   4482 O  O     . HIS F 3 67  ? 34.748 44.842  52.408 1.00 89.15  ? 67  HIS D O     1 
ATOM   4483 C  CB    . HIS F 3 67  ? 32.799 46.859  53.227 1.00 96.36  ? 67  HIS D CB    1 
ATOM   4484 C  CG    . HIS F 3 67  ? 32.224 47.841  52.254 1.00 98.99  ? 67  HIS D CG    1 
ATOM   4485 N  ND1   . HIS F 3 67  ? 32.577 47.907  50.923 1.00 99.64  ? 67  HIS D ND1   1 
ATOM   4486 C  CD2   . HIS F 3 67  ? 31.293 48.811  52.436 1.00 99.89  ? 67  HIS D CD2   1 
ATOM   4487 C  CE1   . HIS F 3 67  ? 31.865 48.894  50.356 1.00 99.99  ? 67  HIS D CE1   1 
ATOM   4488 N  NE2   . HIS F 3 67  ? 31.070 49.474  51.234 1.00 100.00 ? 67  HIS D NE2   1 
ATOM   4489 N  N     . THR F 3 68  ? 33.615 43.498  53.820 1.00 87.33  ? 68  THR D N     1 
ATOM   4490 C  CA    . THR F 3 68  ? 34.706 42.564  54.043 1.00 84.75  ? 68  THR D CA    1 
ATOM   4491 C  C     . THR F 3 68  ? 34.203 41.156  53.763 1.00 86.32  ? 68  THR D C     1 
ATOM   4492 O  O     . THR F 3 68  ? 34.740 40.449  52.912 1.00 87.18  ? 68  THR D O     1 
ATOM   4493 C  CB    . THR F 3 68  ? 35.212 42.615  55.498 1.00 81.00  ? 68  THR D CB    1 
ATOM   4494 O  OG1   . THR F 3 68  ? 35.135 41.305  56.075 1.00 77.02  ? 68  THR D OG1   1 
ATOM   4495 C  CG2   . THR F 3 68  ? 34.376 43.579  56.324 1.00 80.16  ? 68  THR D CG2   1 
ATOM   4496 N  N     . GLY F 3 69  ? 33.160 40.759  54.483 1.00 87.34  ? 69  GLY D N     1 
ATOM   4497 C  CA    . GLY F 3 69  ? 32.601 39.432  54.307 1.00 88.70  ? 69  GLY D CA    1 
ATOM   4498 C  C     . GLY F 3 69  ? 32.846 38.592  55.542 1.00 89.54  ? 69  GLY D C     1 
ATOM   4499 O  O     . GLY F 3 69  ? 33.049 37.380  55.456 1.00 88.74  ? 69  GLY D O     1 
ATOM   4500 N  N     . GLU F 3 70  ? 32.830 39.249  56.697 1.00 90.96  ? 70  GLU D N     1 
ATOM   4501 C  CA    . GLU F 3 70  ? 33.053 38.574  57.971 1.00 93.34  ? 70  GLU D CA    1 
ATOM   4502 C  C     . GLU F 3 70  ? 31.847 37.736  58.379 1.00 94.01  ? 70  GLU D C     1 
ATOM   4503 O  O     . GLU F 3 70  ? 30.742 37.926  57.870 1.00 94.45  ? 70  GLU D O     1 
ATOM   4504 C  CB    . GLU F 3 70  ? 33.348 39.599  59.070 1.00 94.61  ? 70  GLU D CB    1 
ATOM   4505 C  CG    . GLU F 3 70  ? 33.597 41.008  58.563 1.00 95.49  ? 70  GLU D CG    1 
ATOM   4506 C  CD    . GLU F 3 70  ? 35.019 41.460  58.804 1.00 96.74  ? 70  GLU D CD    1 
ATOM   4507 O  OE1   . GLU F 3 70  ? 35.951 40.690  58.490 1.00 97.08  ? 70  GLU D OE1   1 
ATOM   4508 O  OE2   . GLU F 3 70  ? 35.208 42.585  59.306 1.00 98.03  ? 70  GLU D OE2   1 
ATOM   4509 N  N     . LYS F 3 71  ? 32.070 36.809  59.303 1.00 94.75  ? 71  LYS D N     1 
ATOM   4510 C  CA    . LYS F 3 71  ? 31.011 35.940  59.798 1.00 96.13  ? 71  LYS D CA    1 
ATOM   4511 C  C     . LYS F 3 71  ? 31.218 35.731  61.290 1.00 97.00  ? 71  LYS D C     1 
ATOM   4512 O  O     . LYS F 3 71  ? 31.627 34.655  61.732 1.00 97.16  ? 71  LYS D O     1 
ATOM   4513 C  CB    . LYS F 3 71  ? 31.045 34.597  59.070 1.00 97.08  ? 71  LYS D CB    1 
ATOM   4514 C  CG    . LYS F 3 71  ? 29.697 34.148  58.540 1.00 98.05  ? 71  LYS D CG    1 
ATOM   4515 C  CD    . LYS F 3 71  ? 29.032 35.218  57.688 1.00 99.03  ? 71  LYS D CD    1 
ATOM   4516 C  CE    . LYS F 3 71  ? 29.512 35.157  56.247 1.00 100.00 ? 71  LYS D CE    1 
ATOM   4517 N  NZ    . LYS F 3 71  ? 30.717 36.006  56.033 1.00 100.00 ? 71  LYS D NZ    1 
ATOM   4518 N  N     . ASN F 3 72  ? 30.930 36.779  62.056 1.00 97.80  ? 72  ASN D N     1 
ATOM   4519 C  CA    . ASN F 3 72  ? 31.094 36.763  63.504 1.00 99.11  ? 72  ASN D CA    1 
ATOM   4520 C  C     . ASN F 3 72  ? 30.060 35.919  64.246 1.00 99.41  ? 72  ASN D C     1 
ATOM   4521 O  O     . ASN F 3 72  ? 30.351 35.376  65.311 1.00 100.00 ? 72  ASN D O     1 
ATOM   4522 C  CB    . ASN F 3 72  ? 31.077 38.197  64.036 1.00 99.86  ? 72  ASN D CB    1 
ATOM   4523 C  CG    . ASN F 3 72  ? 32.131 39.073  63.376 1.00 100.00 ? 72  ASN D CG    1 
ATOM   4524 O  OD1   . ASN F 3 72  ? 32.818 38.644  62.446 1.00 100.00 ? 72  ASN D OD1   1 
ATOM   4525 N  ND2   . ASN F 3 72  ? 32.264 40.305  63.856 1.00 100.00 ? 72  ASN D ND2   1 
ATOM   4526 N  N     . PHE F 3 73  ? 28.854 35.816  63.696 1.00 99.25  ? 73  PHE D N     1 
ATOM   4527 C  CA    . PHE F 3 73  ? 27.811 35.014  64.326 1.00 99.21  ? 73  PHE D CA    1 
ATOM   4528 C  C     . PHE F 3 73  ? 27.827 33.610  63.732 1.00 99.15  ? 73  PHE D C     1 
ATOM   4529 O  O     . PHE F 3 73  ? 28.194 33.430  62.576 1.00 97.38  ? 73  PHE D O     1 
ATOM   4530 C  CB    . PHE F 3 73  ? 26.441 35.662  64.125 1.00 98.97  ? 73  PHE D CB    1 
ATOM   4531 C  CG    . PHE F 3 73  ? 25.938 36.393  65.339 1.00 99.35  ? 73  PHE D CG    1 
ATOM   4532 C  CD1   . PHE F 3 73  ? 26.014 35.808  66.602 1.00 99.40  ? 73  PHE D CD1   1 
ATOM   4533 C  CD2   . PHE F 3 73  ? 25.401 37.672  65.226 1.00 100.00 ? 73  PHE D CD2   1 
ATOM   4534 C  CE1   . PHE F 3 73  ? 25.562 36.486  67.736 1.00 99.92  ? 73  PHE D CE1   1 
ATOM   4535 C  CE2   . PHE F 3 73  ? 24.945 38.361  66.355 1.00 100.00 ? 73  PHE D CE2   1 
ATOM   4536 C  CZ    . PHE F 3 73  ? 25.026 37.766  67.612 1.00 100.00 ? 73  PHE D CZ    1 
ATOM   4537 N  N     . THR F 3 74  ? 27.438 32.618  64.530 1.00 100.00 ? 74  THR D N     1 
ATOM   4538 C  CA    . THR F 3 74  ? 27.433 31.228  64.076 1.00 100.00 ? 74  THR D CA    1 
ATOM   4539 C  C     . THR F 3 74  ? 26.048 30.590  64.086 1.00 99.72  ? 74  THR D C     1 
ATOM   4540 O  O     . THR F 3 74  ? 25.106 31.122  64.674 1.00 99.35  ? 74  THR D O     1 
ATOM   4541 C  CB    . THR F 3 74  ? 28.368 30.350  64.947 1.00 99.66  ? 74  THR D CB    1 
ATOM   4542 O  OG1   . THR F 3 74  ? 28.055 30.538  66.334 1.00 98.52  ? 74  THR D OG1   1 
ATOM   4543 C  CG2   . THR F 3 74  ? 29.826 30.716  64.702 1.00 99.37  ? 74  THR D CG2   1 
ATOM   4544 N  N     . CYS F 3 75  ? 25.938 29.441  63.428 1.00 99.30  ? 75  CYS D N     1 
ATOM   4545 C  CA    . CYS F 3 75  ? 24.683 28.709  63.359 1.00 98.71  ? 75  CYS D CA    1 
ATOM   4546 C  C     . CYS F 3 75  ? 24.535 27.823  64.592 1.00 99.03  ? 75  CYS D C     1 
ATOM   4547 O  O     . CYS F 3 75  ? 25.152 26.760  64.680 1.00 99.14  ? 75  CYS D O     1 
ATOM   4548 C  CB    . CYS F 3 75  ? 24.649 27.849  62.094 1.00 97.60  ? 75  CYS D CB    1 
ATOM   4549 S  SG    . CYS F 3 75  ? 23.981 26.192  62.333 1.00 95.58  ? 75  CYS D SG    1 
ATOM   4550 N  N     . ASP F 3 76  ? 23.724 28.271  65.545 1.00 99.32  ? 76  ASP D N     1 
ATOM   4551 C  CA    . ASP F 3 76  ? 23.496 27.514  66.772 1.00 100.00 ? 76  ASP D CA    1 
ATOM   4552 C  C     . ASP F 3 76  ? 22.949 26.128  66.426 1.00 100.00 ? 76  ASP D C     1 
ATOM   4553 O  O     . ASP F 3 76  ? 21.739 25.898  66.477 1.00 100.00 ? 76  ASP D O     1 
ATOM   4554 C  CB    . ASP F 3 76  ? 22.503 28.255  67.681 1.00 100.00 ? 76  ASP D CB    1 
ATOM   4555 C  CG    . ASP F 3 76  ? 22.945 29.677  68.001 1.00 99.95  ? 76  ASP D CG    1 
ATOM   4556 O  OD1   . ASP F 3 76  ? 24.083 30.041  67.636 1.00 100.00 ? 76  ASP D OD1   1 
ATOM   4557 O  OD2   . ASP F 3 76  ? 22.156 30.430  68.617 1.00 98.60  ? 76  ASP D OD2   1 
ATOM   4558 N  N     . SER F 3 77  ? 23.847 25.208  66.075 1.00 99.96  ? 77  SER D N     1 
ATOM   4559 C  CA    . SER F 3 77  ? 23.447 23.854  65.711 1.00 99.70  ? 77  SER D CA    1 
ATOM   4560 C  C     . SER F 3 77  ? 24.574 22.831  65.826 1.00 100.00 ? 77  SER D C     1 
ATOM   4561 O  O     . SER F 3 77  ? 25.758 23.176  65.799 1.00 99.43  ? 77  SER D O     1 
ATOM   4562 C  CB    . SER F 3 77  ? 22.912 23.837  64.280 1.00 99.34  ? 77  SER D CB    1 
ATOM   4563 O  OG    . SER F 3 77  ? 23.928 23.460  63.365 1.00 98.78  ? 77  SER D OG    1 
ATOM   4564 N  N     . ASP F 3 78  ? 24.182 21.566  65.949 1.00 100.00 ? 78  ASP D N     1 
ATOM   4565 C  CA    . ASP F 3 78  ? 25.126 20.460  66.049 1.00 99.83  ? 78  ASP D CA    1 
ATOM   4566 C  C     . ASP F 3 78  ? 25.289 19.843  64.662 1.00 98.82  ? 78  ASP D C     1 
ATOM   4567 O  O     . ASP F 3 78  ? 24.328 19.337  64.076 1.00 97.37  ? 78  ASP D O     1 
ATOM   4568 C  CB    . ASP F 3 78  ? 24.605 19.399  67.029 1.00 100.00 ? 78  ASP D CB    1 
ATOM   4569 C  CG    . ASP F 3 78  ? 25.576 19.124  68.173 1.00 100.00 ? 78  ASP D CG    1 
ATOM   4570 O  OD1   . ASP F 3 78  ? 26.131 20.093  68.734 1.00 100.00 ? 78  ASP D OD1   1 
ATOM   4571 O  OD2   . ASP F 3 78  ? 25.781 17.938  68.514 1.00 100.00 ? 78  ASP D OD2   1 
ATOM   4572 N  N     . GLY F 3 79  ? 26.508 19.897  64.139 1.00 99.17  ? 79  GLY D N     1 
ATOM   4573 C  CA    . GLY F 3 79  ? 26.770 19.343  62.825 1.00 99.82  ? 79  GLY D CA    1 
ATOM   4574 C  C     . GLY F 3 79  ? 27.360 20.390  61.903 1.00 100.00 ? 79  GLY D C     1 
ATOM   4575 O  O     . GLY F 3 79  ? 28.436 20.195  61.339 1.00 100.00 ? 79  GLY D O     1 
ATOM   4576 N  N     . CYS F 3 80  ? 26.650 21.504  61.752 1.00 99.83  ? 80  CYS D N     1 
ATOM   4577 C  CA    . CYS F 3 80  ? 27.110 22.594  60.901 1.00 98.55  ? 80  CYS D CA    1 
ATOM   4578 C  C     . CYS F 3 80  ? 27.850 23.628  61.738 1.00 98.86  ? 80  CYS D C     1 
ATOM   4579 O  O     . CYS F 3 80  ? 27.392 24.017  62.815 1.00 98.93  ? 80  CYS D O     1 
ATOM   4580 C  CB    . CYS F 3 80  ? 25.928 23.265  60.199 1.00 96.99  ? 80  CYS D CB    1 
ATOM   4581 S  SG    . CYS F 3 80  ? 26.147 25.043  59.933 1.00 94.93  ? 80  CYS D SG    1 
ATOM   4582 N  N     . ASP F 3 81  ? 28.998 24.067  61.235 1.00 98.34  ? 81  ASP D N     1 
ATOM   4583 C  CA    . ASP F 3 81  ? 29.804 25.057  61.931 1.00 97.74  ? 81  ASP D CA    1 
ATOM   4584 C  C     . ASP F 3 81  ? 29.716 26.387  61.196 1.00 97.12  ? 81  ASP D C     1 
ATOM   4585 O  O     . ASP F 3 81  ? 29.972 27.445  61.773 1.00 96.38  ? 81  ASP D O     1 
ATOM   4586 C  CB    . ASP F 3 81  ? 31.262 24.592  62.008 1.00 97.91  ? 81  ASP D CB    1 
ATOM   4587 C  CG    . ASP F 3 81  ? 31.412 23.247  62.701 1.00 97.94  ? 81  ASP D CG    1 
ATOM   4588 O  OD1   . ASP F 3 81  ? 30.612 22.949  63.614 1.00 98.01  ? 81  ASP D OD1   1 
ATOM   4589 O  OD2   . ASP F 3 81  ? 32.333 22.486  62.333 1.00 97.72  ? 81  ASP D OD2   1 
ATOM   4590 N  N     . LEU F 3 82  ? 29.344 26.323  59.920 1.00 96.62  ? 82  LEU D N     1 
ATOM   4591 C  CA    . LEU F 3 82  ? 29.213 27.516  59.093 1.00 96.18  ? 82  LEU D CA    1 
ATOM   4592 C  C     . LEU F 3 82  ? 28.626 28.668  59.898 1.00 95.98  ? 82  LEU D C     1 
ATOM   4593 O  O     . LEU F 3 82  ? 27.478 28.605  60.341 1.00 95.17  ? 82  LEU D O     1 
ATOM   4594 C  CB    . LEU F 3 82  ? 28.317 27.228  57.883 1.00 96.00  ? 82  LEU D CB    1 
ATOM   4595 C  CG    . LEU F 3 82  ? 28.624 27.988  56.585 1.00 96.39  ? 82  LEU D CG    1 
ATOM   4596 C  CD1   . LEU F 3 82  ? 27.680 27.520  55.479 1.00 96.19  ? 82  LEU D CD1   1 
ATOM   4597 C  CD2   . LEU F 3 82  ? 28.481 29.489  56.813 1.00 95.81  ? 82  LEU D CD2   1 
ATOM   4598 N  N     . ARG F 3 83  ? 29.425 29.712  60.095 1.00 96.81  ? 83  ARG D N     1 
ATOM   4599 C  CA    . ARG F 3 83  ? 28.978 30.882  60.841 1.00 97.59  ? 83  ARG D CA    1 
ATOM   4600 C  C     . ARG F 3 83  ? 28.208 31.822  59.919 1.00 97.17  ? 83  ARG D C     1 
ATOM   4601 O  O     . ARG F 3 83  ? 28.281 31.708  58.693 1.00 96.08  ? 83  ARG D O     1 
ATOM   4602 C  CB    . ARG F 3 83  ? 30.175 31.620  61.458 1.00 98.22  ? 83  ARG D CB    1 
ATOM   4603 C  CG    . ARG F 3 83  ? 31.488 31.438  60.717 1.00 99.11  ? 83  ARG D CG    1 
ATOM   4604 C  CD    . ARG F 3 83  ? 32.329 30.332  61.343 1.00 99.86  ? 83  ARG D CD    1 
ATOM   4605 N  NE    . ARG F 3 83  ? 32.313 29.105  60.548 1.00 100.00 ? 83  ARG D NE    1 
ATOM   4606 C  CZ    . ARG F 3 83  ? 32.598 27.897  61.027 1.00 99.88  ? 83  ARG D CZ    1 
ATOM   4607 N  NH1   . ARG F 3 83  ? 32.923 27.746  62.306 1.00 100.00 ? 83  ARG D NH1   1 
ATOM   4608 N  NH2   . ARG F 3 83  ? 32.557 26.839  60.227 1.00 99.11  ? 83  ARG D NH2   1 
ATOM   4609 N  N     . PHE F 3 84  ? 27.469 32.750  60.517 1.00 96.21  ? 84  PHE D N     1 
ATOM   4610 C  CA    . PHE F 3 84  ? 26.676 33.706  59.760 1.00 95.76  ? 84  PHE D CA    1 
ATOM   4611 C  C     . PHE F 3 84  ? 26.992 35.146  60.151 1.00 94.02  ? 84  PHE D C     1 
ATOM   4612 O  O     . PHE F 3 84  ? 27.691 35.392  61.135 1.00 94.19  ? 84  PHE D O     1 
ATOM   4613 C  CB    . PHE F 3 84  ? 25.187 33.417  59.966 1.00 96.40  ? 84  PHE D CB    1 
ATOM   4614 C  CG    . PHE F 3 84  ? 24.739 32.119  59.360 1.00 96.15  ? 84  PHE D CG    1 
ATOM   4615 C  CD1   . PHE F 3 84  ? 25.044 30.909  59.975 1.00 96.33  ? 84  PHE D CD1   1 
ATOM   4616 C  CD2   . PHE F 3 84  ? 24.029 32.102  58.164 1.00 96.03  ? 84  PHE D CD2   1 
ATOM   4617 C  CE1   . PHE F 3 84  ? 24.650 29.702  59.408 1.00 96.66  ? 84  PHE D CE1   1 
ATOM   4618 C  CE2   . PHE F 3 84  ? 23.632 30.901  57.588 1.00 96.26  ? 84  PHE D CE2   1 
ATOM   4619 C  CZ    . PHE F 3 84  ? 23.943 29.698  58.211 1.00 96.67  ? 84  PHE D CZ    1 
ATOM   4620 N  N     . THR F 3 85  ? 26.471 36.090  59.371 1.00 90.67  ? 85  THR D N     1 
ATOM   4621 C  CA    . THR F 3 85  ? 26.699 37.511  59.610 1.00 85.99  ? 85  THR D CA    1 
ATOM   4622 C  C     . THR F 3 85  ? 25.835 38.088  60.730 1.00 84.29  ? 85  THR D C     1 
ATOM   4623 O  O     . THR F 3 85  ? 26.270 38.999  61.442 1.00 84.62  ? 85  THR D O     1 
ATOM   4624 C  CB    . THR F 3 85  ? 26.465 38.342  58.322 1.00 84.61  ? 85  THR D CB    1 
ATOM   4625 O  OG1   . THR F 3 85  ? 25.842 39.589  58.659 1.00 84.18  ? 85  THR D OG1   1 
ATOM   4626 C  CG2   . THR F 3 85  ? 25.582 37.584  57.343 1.00 83.42  ? 85  THR D CG2   1 
ATOM   4627 N  N     . THR F 3 86  ? 24.620 37.566  60.890 1.00 81.23  ? 86  THR D N     1 
ATOM   4628 C  CA    . THR F 3 86  ? 23.722 38.053  61.937 1.00 79.43  ? 86  THR D CA    1 
ATOM   4629 C  C     . THR F 3 86  ? 23.033 36.916  62.670 1.00 76.58  ? 86  THR D C     1 
ATOM   4630 O  O     . THR F 3 86  ? 22.909 35.815  62.141 1.00 76.08  ? 86  THR D O     1 
ATOM   4631 C  CB    . THR F 3 86  ? 22.641 38.980  61.362 1.00 80.10  ? 86  THR D CB    1 
ATOM   4632 O  OG1   . THR F 3 86  ? 22.834 39.118  59.950 1.00 79.89  ? 86  THR D OG1   1 
ATOM   4633 C  CG2   . THR F 3 86  ? 22.706 40.351  62.027 1.00 80.37  ? 86  THR D CG2   1 
ATOM   4634 N  N     . LYS F 3 87  ? 22.581 37.193  63.889 1.00 75.52  ? 87  LYS D N     1 
ATOM   4635 C  CA    . LYS F 3 87  ? 21.909 36.187  64.701 1.00 77.51  ? 87  LYS D CA    1 
ATOM   4636 C  C     . LYS F 3 87  ? 20.513 35.883  64.182 1.00 77.79  ? 87  LYS D C     1 
ATOM   4637 O  O     . LYS F 3 87  ? 20.286 34.831  63.589 1.00 79.79  ? 87  LYS D O     1 
ATOM   4638 C  CB    . LYS F 3 87  ? 21.816 36.642  66.158 1.00 80.42  ? 87  LYS D CB    1 
ATOM   4639 C  CG    . LYS F 3 87  ? 21.420 35.529  67.125 1.00 82.74  ? 87  LYS D CG    1 
ATOM   4640 C  CD    . LYS F 3 87  ? 20.729 36.079  68.366 1.00 85.14  ? 87  LYS D CD    1 
ATOM   4641 C  CE    . LYS F 3 87  ? 20.377 34.972  69.357 1.00 86.88  ? 87  LYS D CE    1 
ATOM   4642 N  NZ    . LYS F 3 87  ? 20.899 35.249  70.728 1.00 87.69  ? 87  LYS D NZ    1 
ATOM   4643 N  N     . ALA F 3 88  ? 19.577 36.800  64.414 1.00 76.73  ? 88  ALA D N     1 
ATOM   4644 C  CA    . ALA F 3 88  ? 18.203 36.612  63.957 1.00 75.13  ? 88  ALA D CA    1 
ATOM   4645 C  C     . ALA F 3 88  ? 18.236 36.180  62.492 1.00 73.36  ? 88  ALA D C     1 
ATOM   4646 O  O     . ALA F 3 88  ? 17.314 35.532  61.991 1.00 72.90  ? 88  ALA D O     1 
ATOM   4647 C  CB    . ALA F 3 88  ? 17.416 37.908  64.116 1.00 75.71  ? 88  ALA D CB    1 
ATOM   4648 N  N     . ASN F 3 89  ? 19.315 36.549  61.811 1.00 71.44  ? 89  ASN D N     1 
ATOM   4649 C  CA    . ASN F 3 89  ? 19.500 36.181  60.417 1.00 70.40  ? 89  ASN D CA    1 
ATOM   4650 C  C     . ASN F 3 89  ? 19.749 34.678  60.394 1.00 69.21  ? 89  ASN D C     1 
ATOM   4651 O  O     . ASN F 3 89  ? 18.910 33.912  59.929 1.00 69.65  ? 89  ASN D O     1 
ATOM   4652 C  CB    . ASN F 3 89  ? 20.707 36.919  59.834 1.00 70.28  ? 89  ASN D CB    1 
ATOM   4653 C  CG    . ASN F 3 89  ? 20.839 36.731  58.337 1.00 69.81  ? 89  ASN D CG    1 
ATOM   4654 O  OD1   . ASN F 3 89  ? 19.896 36.976  57.582 1.00 69.52  ? 89  ASN D OD1   1 
ATOM   4655 N  ND2   . ASN F 3 89  ? 22.016 36.295  57.897 1.00 69.79  ? 89  ASN D ND2   1 
ATOM   4656 N  N     . MET F 3 90  ? 20.902 34.269  60.917 1.00 68.07  ? 90  MET D N     1 
ATOM   4657 C  CA    . MET F 3 90  ? 21.287 32.860  60.978 1.00 67.23  ? 90  MET D CA    1 
ATOM   4658 C  C     . MET F 3 90  ? 20.151 31.985  61.503 1.00 66.81  ? 90  MET D C     1 
ATOM   4659 O  O     . MET F 3 90  ? 20.023 30.818  61.118 1.00 66.10  ? 90  MET D O     1 
ATOM   4660 C  CB    . MET F 3 90  ? 22.512 32.692  61.880 1.00 66.84  ? 90  MET D CB    1 
ATOM   4661 C  CG    . MET F 3 90  ? 22.875 31.247  62.186 1.00 65.47  ? 90  MET D CG    1 
ATOM   4662 S  SD    . MET F 3 90  ? 21.808 30.476  63.409 1.00 65.52  ? 90  MET D SD    1 
ATOM   4663 C  CE    . MET F 3 90  ? 22.176 31.467  64.856 1.00 64.90  ? 90  MET D CE    1 
ATOM   4664 N  N     . LYS F 3 91  ? 19.343 32.549  62.396 1.00 66.82  ? 91  LYS D N     1 
ATOM   4665 C  CA    . LYS F 3 91  ? 18.211 31.838  62.975 1.00 67.31  ? 91  LYS D CA    1 
ATOM   4666 C  C     . LYS F 3 91  ? 17.394 31.228  61.842 1.00 68.25  ? 91  LYS D C     1 
ATOM   4667 O  O     . LYS F 3 91  ? 16.706 30.224  62.020 1.00 66.84  ? 91  LYS D O     1 
ATOM   4668 C  CB    . LYS F 3 91  ? 17.351 32.807  63.790 1.00 68.61  ? 91  LYS D CB    1 
ATOM   4669 C  CG    . LYS F 3 91  ? 15.913 32.366  63.984 1.00 70.49  ? 91  LYS D CG    1 
ATOM   4670 C  CD    . LYS F 3 91  ? 15.435 32.653  65.400 1.00 72.42  ? 91  LYS D CD    1 
ATOM   4671 C  CE    . LYS F 3 91  ? 14.799 31.419  66.030 1.00 72.86  ? 91  LYS D CE    1 
ATOM   4672 N  NZ    . LYS F 3 91  ? 15.428 31.068  67.334 1.00 71.60  ? 91  LYS D NZ    1 
ATOM   4673 N  N     . LYS F 3 92  ? 17.480 31.846  60.669 1.00 71.52  ? 92  LYS D N     1 
ATOM   4674 C  CA    . LYS F 3 92  ? 16.768 31.358  59.497 1.00 73.70  ? 92  LYS D CA    1 
ATOM   4675 C  C     . LYS F 3 92  ? 17.309 29.975  59.143 1.00 76.77  ? 92  LYS D C     1 
ATOM   4676 O  O     . LYS F 3 92  ? 16.616 28.970  59.309 1.00 77.79  ? 92  LYS D O     1 
ATOM   4677 C  CB    . LYS F 3 92  ? 16.967 32.310  58.309 1.00 72.00  ? 92  LYS D CB    1 
ATOM   4678 C  CG    . LYS F 3 92  ? 15.896 33.390  58.173 1.00 70.39  ? 92  LYS D CG    1 
ATOM   4679 C  CD    . LYS F 3 92  ? 16.017 34.141  56.847 1.00 68.26  ? 92  LYS D CD    1 
ATOM   4680 C  CE    . LYS F 3 92  ? 17.054 35.260  56.919 1.00 65.15  ? 92  LYS D CE    1 
ATOM   4681 N  NZ    . LYS F 3 92  ? 17.328 35.867  55.586 1.00 61.77  ? 92  LYS D NZ    1 
ATOM   4682 N  N     . HIS F 3 93  ? 18.553 29.934  58.669 1.00 78.88  ? 93  HIS D N     1 
ATOM   4683 C  CA    . HIS F 3 93  ? 19.198 28.685  58.279 1.00 79.75  ? 93  HIS D CA    1 
ATOM   4684 C  C     . HIS F 3 93  ? 18.752 27.497  59.116 1.00 75.24  ? 93  HIS D C     1 
ATOM   4685 O  O     . HIS F 3 93  ? 18.162 26.555  58.591 1.00 72.84  ? 93  HIS D O     1 
ATOM   4686 C  CB    . HIS F 3 93  ? 20.718 28.807  58.383 1.00 86.10  ? 93  HIS D CB    1 
ATOM   4687 C  CG    . HIS F 3 93  ? 21.404 27.508  58.680 1.00 91.57  ? 93  HIS D CG    1 
ATOM   4688 N  ND1   . HIS F 3 93  ? 21.253 26.366  57.924 1.00 93.31  ? 93  HIS D ND1   1 
ATOM   4689 C  CD2   . HIS F 3 93  ? 22.238 27.168  59.696 1.00 93.86  ? 93  HIS D CD2   1 
ATOM   4690 C  CE1   . HIS F 3 93  ? 21.983 25.390  58.489 1.00 94.64  ? 93  HIS D CE1   1 
ATOM   4691 N  NE2   . HIS F 3 93  ? 22.605 25.822  59.571 1.00 95.77  ? 93  HIS D NE2   1 
ATOM   4692 N  N     . PHE F 3 94  ? 19.047 27.545  60.415 1.00 71.40  ? 94  PHE D N     1 
ATOM   4693 C  CA    . PHE F 3 94  ? 18.686 26.458  61.312 1.00 68.76  ? 94  PHE D CA    1 
ATOM   4694 C  C     . PHE F 3 94  ? 17.273 25.984  61.033 1.00 69.86  ? 94  PHE D C     1 
ATOM   4695 O  O     . PHE F 3 94  ? 17.065 24.838  60.634 1.00 72.66  ? 94  PHE D O     1 
ATOM   4696 C  CB    . PHE F 3 94  ? 18.794 26.888  62.772 1.00 66.77  ? 94  PHE D CB    1 
ATOM   4697 C  CG    . PHE F 3 94  ? 18.673 25.747  63.745 1.00 65.24  ? 94  PHE D CG    1 
ATOM   4698 C  CD1   . PHE F 3 94  ? 17.428 25.308  64.175 1.00 64.17  ? 94  PHE D CD1   1 
ATOM   4699 C  CD2   . PHE F 3 94  ? 19.806 25.095  64.216 1.00 64.98  ? 94  PHE D CD2   1 
ATOM   4700 C  CE1   . PHE F 3 94  ? 17.316 24.235  65.059 1.00 63.42  ? 94  PHE D CE1   1 
ATOM   4701 C  CE2   . PHE F 3 94  ? 19.699 24.022  65.100 1.00 63.92  ? 94  PHE D CE2   1 
ATOM   4702 C  CZ    . PHE F 3 94  ? 18.453 23.592  65.519 1.00 62.87  ? 94  PHE D CZ    1 
ATOM   4703 N  N     . ASN F 3 95  ? 16.301 26.866  61.242 1.00 68.42  ? 95  ASN D N     1 
ATOM   4704 C  CA    . ASN F 3 95  ? 14.906 26.523  60.992 1.00 68.57  ? 95  ASN D CA    1 
ATOM   4705 C  C     . ASN F 3 95  ? 14.735 25.958  59.577 1.00 70.62  ? 95  ASN D C     1 
ATOM   4706 O  O     . ASN F 3 95  ? 13.917 25.060  59.346 1.00 69.87  ? 95  ASN D O     1 
ATOM   4707 C  CB    . ASN F 3 95  ? 14.027 27.763  61.167 1.00 65.40  ? 95  ASN D CB    1 
ATOM   4708 C  CG    . ASN F 3 95  ? 14.045 28.285  62.580 1.00 62.83  ? 95  ASN D CG    1 
ATOM   4709 O  OD1   . ASN F 3 95  ? 14.473 27.588  63.503 1.00 60.29  ? 95  ASN D OD1   1 
ATOM   4710 N  ND2   . ASN F 3 95  ? 13.580 29.517  62.763 1.00 61.21  ? 95  ASN D ND2   1 
ATOM   4711 N  N     . ARG F 3 96  ? 15.522 26.482  58.639 1.00 71.97  ? 96  ARG D N     1 
ATOM   4712 C  CA    . ARG F 3 96  ? 15.466 26.052  57.245 1.00 73.73  ? 96  ARG D CA    1 
ATOM   4713 C  C     . ARG F 3 96  ? 16.265 24.776  57.017 1.00 76.03  ? 96  ARG D C     1 
ATOM   4714 O  O     . ARG F 3 96  ? 16.369 24.293  55.888 1.00 76.52  ? 96  ARG D O     1 
ATOM   4715 C  CB    . ARG F 3 96  ? 16.013 27.153  56.328 1.00 72.82  ? 96  ARG D CB    1 
ATOM   4716 C  CG    . ARG F 3 96  ? 15.188 28.440  56.302 1.00 72.01  ? 96  ARG D CG    1 
ATOM   4717 C  CD    . ARG F 3 96  ? 16.066 29.653  55.991 1.00 70.06  ? 96  ARG D CD    1 
ATOM   4718 N  NE    . ARG F 3 96  ? 15.415 30.613  55.101 1.00 65.66  ? 96  ARG D NE    1 
ATOM   4719 C  CZ    . ARG F 3 96  ? 16.047 31.603  54.475 1.00 61.57  ? 96  ARG D CZ    1 
ATOM   4720 N  NH1   . ARG F 3 96  ? 17.356 31.770  54.636 1.00 58.72  ? 96  ARG D NH1   1 
ATOM   4721 N  NH2   . ARG F 3 96  ? 15.370 32.429  53.687 1.00 59.18  ? 96  ARG D NH2   1 
ATOM   4722 N  N     . PHE F 3 97  ? 16.817 24.223  58.090 1.00 78.13  ? 97  PHE D N     1 
ATOM   4723 C  CA    . PHE F 3 97  ? 17.628 23.020  57.977 1.00 80.89  ? 97  PHE D CA    1 
ATOM   4724 C  C     . PHE F 3 97  ? 17.428 22.063  59.141 1.00 79.17  ? 97  PHE D C     1 
ATOM   4725 O  O     . PHE F 3 97  ? 16.781 21.028  59.012 1.00 78.48  ? 97  PHE D O     1 
ATOM   4726 C  CB    . PHE F 3 97  ? 19.110 23.412  57.897 1.00 85.88  ? 97  PHE D CB    1 
ATOM   4727 C  CG    . PHE F 3 97  ? 19.894 22.638  56.875 1.00 90.42  ? 97  PHE D CG    1 
ATOM   4728 C  CD1   . PHE F 3 97  ? 20.267 21.320  57.120 1.00 92.30  ? 97  PHE D CD1   1 
ATOM   4729 C  CD2   . PHE F 3 97  ? 20.258 23.227  55.664 1.00 91.91  ? 97  PHE D CD2   1 
ATOM   4730 C  CE1   . PHE F 3 97  ? 20.991 20.597  56.175 1.00 93.76  ? 97  PHE D CE1   1 
ATOM   4731 C  CE2   . PHE F 3 97  ? 20.983 22.513  54.711 1.00 92.84  ? 97  PHE D CE2   1 
ATOM   4732 C  CZ    . PHE F 3 97  ? 21.350 21.196  54.967 1.00 93.94  ? 97  PHE D CZ    1 
ATOM   4733 N  N     . HIS F 3 98  ? 17.999 22.427  60.280 1.00 79.17  ? 98  HIS D N     1 
ATOM   4734 C  CA    . HIS F 3 98  ? 17.935 21.612  61.480 1.00 79.77  ? 98  HIS D CA    1 
ATOM   4735 C  C     . HIS F 3 98  ? 16.548 21.515  62.112 1.00 80.07  ? 98  HIS D C     1 
ATOM   4736 O  O     . HIS F 3 98  ? 15.847 20.522  61.914 1.00 80.39  ? 98  HIS D O     1 
ATOM   4737 C  CB    . HIS F 3 98  ? 18.956 22.139  62.493 1.00 79.42  ? 98  HIS D CB    1 
ATOM   4738 C  CG    . HIS F 3 98  ? 20.285 22.470  61.884 1.00 78.54  ? 98  HIS D CG    1 
ATOM   4739 N  ND1   . HIS F 3 98  ? 21.284 21.548  61.661 1.00 78.64  ? 98  HIS D ND1   1 
ATOM   4740 C  CD2   . HIS F 3 98  ? 20.761 23.649  61.409 1.00 78.06  ? 98  HIS D CD2   1 
ATOM   4741 C  CE1   . HIS F 3 98  ? 22.308 22.182  61.069 1.00 78.41  ? 98  HIS D CE1   1 
ATOM   4742 N  NE2   . HIS F 3 98  ? 22.040 23.461  60.894 1.00 77.59  ? 98  HIS D NE2   1 
ATOM   4743 N  N     . ASN F 3 99  ? 16.157 22.538  62.868 1.00 80.21  ? 99  ASN D N     1 
ATOM   4744 C  CA    . ASN F 3 99  ? 14.861 22.548  63.544 1.00 81.23  ? 99  ASN D CA    1 
ATOM   4745 C  C     . ASN F 3 99  ? 13.844 21.663  62.846 1.00 78.75  ? 99  ASN D C     1 
ATOM   4746 O  O     . ASN F 3 99  ? 13.431 21.938  61.721 1.00 76.15  ? 99  ASN D O     1 
ATOM   4747 C  CB    . ASN F 3 99  ? 14.311 23.975  63.647 1.00 85.72  ? 99  ASN D CB    1 
ATOM   4748 C  CG    . ASN F 3 99  ? 13.426 24.172  64.870 1.00 88.16  ? 99  ASN D CG    1 
ATOM   4749 O  OD1   . ASN F 3 99  ? 13.743 24.963  65.764 1.00 89.31  ? 99  ASN D OD1   1 
ATOM   4750 N  ND2   . ASN F 3 99  ? 12.311 23.449  64.914 1.00 89.00  ? 99  ASN D ND2   1 
ATOM   4751 N  N     . ILE F 3 100 ? 13.448 20.595  63.527 1.00 78.17  ? 100 ILE D N     1 
ATOM   4752 C  CA    . ILE F 3 100 ? 12.487 19.657  62.977 1.00 78.28  ? 100 ILE D CA    1 
ATOM   4753 C  C     . ILE F 3 100 ? 11.126 20.306  62.766 1.00 79.05  ? 100 ILE D C     1 
ATOM   4754 O  O     . ILE F 3 100 ? 11.034 21.483  62.416 1.00 75.76  ? 100 ILE D O     1 
ATOM   4755 C  CB    . ILE F 3 100 ? 12.314 18.412  63.888 1.00 77.30  ? 100 ILE D CB    1 
ATOM   4756 C  CG1   . ILE F 3 100 ? 13.355 18.422  65.017 1.00 75.79  ? 100 ILE D CG1   1 
ATOM   4757 C  CG2   . ILE F 3 100 ? 12.404 17.141  63.046 1.00 77.20  ? 100 ILE D CG2   1 
ATOM   4758 C  CD1   . ILE F 3 100 ? 14.745 17.955  64.613 1.00 75.29  ? 100 ILE D CD1   1 
ATOM   4759 N  N     . LYS F 3 101 ? 10.074 19.524  62.988 1.00 83.78  ? 101 LYS D N     1 
ATOM   4760 C  CA    . LYS F 3 101 ? 8.703  19.983  62.807 1.00 88.17  ? 101 LYS D CA    1 
ATOM   4761 C  C     . LYS F 3 101 ? 8.421  20.103  61.308 1.00 90.21  ? 101 LYS D C     1 
ATOM   4762 O  O     . LYS F 3 101 ? 7.342  19.734  60.831 1.00 90.07  ? 101 LYS D O     1 
ATOM   4763 C  CB    . LYS F 3 101 ? 8.496  21.333  63.499 1.00 90.24  ? 101 LYS D CB    1 
ATOM   4764 C  CG    . LYS F 3 101 ? 7.095  21.534  64.045 1.00 92.75  ? 101 LYS D CG    1 
ATOM   4765 C  CD    . LYS F 3 101 ? 6.463  22.803  63.491 1.00 94.96  ? 101 LYS D CD    1 
ATOM   4766 C  CE    . LYS F 3 101 ? 5.684  22.528  62.210 1.00 96.34  ? 101 LYS D CE    1 
ATOM   4767 N  NZ    . LYS F 3 101 ? 5.879  23.600  61.191 1.00 96.62  ? 101 LYS D NZ    1 
ATOM   4768 N  N     . ILE F 3 102 ? 9.409  20.614  60.574 1.00 91.54  ? 102 ILE D N     1 
ATOM   4769 C  CA    . ILE F 3 102 ? 9.309  20.784  59.126 1.00 92.54  ? 102 ILE D CA    1 
ATOM   4770 C  C     . ILE F 3 102 ? 10.269 19.810  58.432 1.00 92.51  ? 102 ILE D C     1 
ATOM   4771 O  O     . ILE F 3 102 ? 9.871  19.067  57.528 1.00 94.33  ? 102 ILE D O     1 
ATOM   4772 C  CB    . ILE F 3 102 ? 9.654  22.232  58.704 1.00 92.87  ? 102 ILE D CB    1 
ATOM   4773 C  CG1   . ILE F 3 102 ? 9.882  23.103  59.944 1.00 91.94  ? 102 ILE D CG1   1 
ATOM   4774 C  CG2   . ILE F 3 102 ? 8.523  22.807  57.858 1.00 93.96  ? 102 ILE D CG2   1 
ATOM   4775 C  CD1   . ILE F 3 102 ? 11.335 23.421  60.213 1.00 90.69  ? 102 ILE D CD1   1 
ATOM   4776 N  N     . CYS F 3 103 ? 11.532 19.823  58.858 1.00 89.47  ? 103 CYS D N     1 
ATOM   4777 C  CA    . CYS F 3 103 ? 12.544 18.923  58.306 1.00 83.80  ? 103 CYS D CA    1 
ATOM   4778 C  C     . CYS F 3 103 ? 12.569 17.691  59.203 1.00 79.34  ? 103 CYS D C     1 
ATOM   4779 O  O     . CYS F 3 103 ? 13.533 17.446  59.928 1.00 77.55  ? 103 CYS D O     1 
ATOM   4780 C  CB    . CYS F 3 103 ? 13.926 19.591  58.290 1.00 82.86  ? 103 CYS D CB    1 
ATOM   4781 S  SG    . CYS F 3 103 ? 14.106 21.054  59.345 1.00 82.56  ? 103 CYS D SG    1 
ATOM   4782 N  N     . VAL F 3 104 ? 11.483 16.930  59.152 1.00 75.78  ? 104 VAL D N     1 
ATOM   4783 C  CA    . VAL F 3 104 ? 11.336 15.733  59.961 1.00 73.87  ? 104 VAL D CA    1 
ATOM   4784 C  C     . VAL F 3 104 ? 12.319 14.633  59.569 1.00 73.04  ? 104 VAL D C     1 
ATOM   4785 O  O     . VAL F 3 104 ? 12.913 13.987  60.436 1.00 72.62  ? 104 VAL D O     1 
ATOM   4786 C  CB    . VAL F 3 104 ? 9.892  15.179  59.858 1.00 74.34  ? 104 VAL D CB    1 
ATOM   4787 C  CG1   . VAL F 3 104 ? 9.210  15.247  61.216 1.00 75.74  ? 104 VAL D CG1   1 
ATOM   4788 C  CG2   . VAL F 3 104 ? 9.094  15.974  58.831 1.00 72.79  ? 104 VAL D CG2   1 
ATOM   4789 N  N     . TYR F 3 105 ? 12.499 14.436  58.264 1.00 71.53  ? 105 TYR D N     1 
ATOM   4790 C  CA    . TYR F 3 105 ? 13.389 13.396  57.748 1.00 70.00  ? 105 TYR D CA    1 
ATOM   4791 C  C     . TYR F 3 105 ? 14.882 13.715  57.849 1.00 68.07  ? 105 TYR D C     1 
ATOM   4792 O  O     . TYR F 3 105 ? 15.373 14.670  57.249 1.00 67.77  ? 105 TYR D O     1 
ATOM   4793 C  CB    . TYR F 3 105 ? 12.995 13.067  56.310 1.00 71.12  ? 105 TYR D CB    1 
ATOM   4794 C  CG    . TYR F 3 105 ? 11.530 12.712  56.193 1.00 74.27  ? 105 TYR D CG    1 
ATOM   4795 C  CD1   . TYR F 3 105 ? 11.008 11.600  56.855 1.00 75.23  ? 105 TYR D CD1   1 
ATOM   4796 C  CD2   . TYR F 3 105 ? 10.654 13.510  55.459 1.00 76.17  ? 105 TYR D CD2   1 
ATOM   4797 C  CE1   . TYR F 3 105 ? 9.650  11.292  56.791 1.00 76.80  ? 105 TYR D CE1   1 
ATOM   4798 C  CE2   . TYR F 3 105 ? 9.289  13.209  55.388 1.00 77.94  ? 105 TYR D CE2   1 
ATOM   4799 C  CZ    . TYR F 3 105 ? 8.796  12.098  56.060 1.00 78.05  ? 105 TYR D CZ    1 
ATOM   4800 O  OH    . TYR F 3 105 ? 7.453  11.792  56.013 1.00 77.97  ? 105 TYR D OH    1 
ATOM   4801 N  N     . VAL F 3 106 ? 15.602 12.887  58.600 1.00 65.80  ? 106 VAL D N     1 
ATOM   4802 C  CA    . VAL F 3 106 ? 17.025 13.102  58.820 1.00 64.26  ? 106 VAL D CA    1 
ATOM   4803 C  C     . VAL F 3 106 ? 17.897 11.850  58.763 1.00 63.44  ? 106 VAL D C     1 
ATOM   4804 O  O     . VAL F 3 106 ? 17.490 10.769  59.183 1.00 63.28  ? 106 VAL D O     1 
ATOM   4805 C  CB    . VAL F 3 106 ? 17.242 13.756  60.190 1.00 66.04  ? 106 VAL D CB    1 
ATOM   4806 C  CG1   . VAL F 3 106 ? 18.725 13.811  60.524 1.00 66.97  ? 106 VAL D CG1   1 
ATOM   4807 C  CG2   . VAL F 3 106 ? 16.622 15.137  60.199 1.00 67.71  ? 106 VAL D CG2   1 
ATOM   4808 N  N     . CYS F 3 107 ? 19.113 12.018  58.252 1.00 62.86  ? 107 CYS D N     1 
ATOM   4809 C  CA    . CYS F 3 107 ? 20.069 10.921  58.165 1.00 60.80  ? 107 CYS D CA    1 
ATOM   4810 C  C     . CYS F 3 107 ? 20.785 10.826  59.504 1.00 59.52  ? 107 CYS D C     1 
ATOM   4811 O  O     . CYS F 3 107 ? 21.781 11.506  59.732 1.00 58.59  ? 107 CYS D O     1 
ATOM   4812 C  CB    . CYS F 3 107 ? 21.096 11.183  57.061 1.00 58.27  ? 107 CYS D CB    1 
ATOM   4813 S  SG    . CYS F 3 107 ? 22.568 10.140  57.196 1.00 55.92  ? 107 CYS D SG    1 
ATOM   4814 N  N     . HIS F 3 108 ? 20.274 9.980   60.387 1.00 60.23  ? 108 HIS D N     1 
ATOM   4815 C  CA    . HIS F 3 108 ? 20.864 9.823   61.708 1.00 63.14  ? 108 HIS D CA    1 
ATOM   4816 C  C     . HIS F 3 108 ? 22.109 8.940   61.731 1.00 60.20  ? 108 HIS D C     1 
ATOM   4817 O  O     . HIS F 3 108 ? 22.442 8.351   62.766 1.00 59.05  ? 108 HIS D O     1 
ATOM   4818 C  CB    . HIS F 3 108 ? 19.820 9.263   62.678 1.00 68.19  ? 108 HIS D CB    1 
ATOM   4819 C  CG    . HIS F 3 108 ? 18.822 10.278  63.142 1.00 70.81  ? 108 HIS D CG    1 
ATOM   4820 N  ND1   . HIS F 3 108 ? 18.455 11.367  62.380 1.00 71.31  ? 108 HIS D ND1   1 
ATOM   4821 C  CD2   . HIS F 3 108 ? 18.115 10.368  64.293 1.00 71.51  ? 108 HIS D CD2   1 
ATOM   4822 C  CE1   . HIS F 3 108 ? 17.564 12.084  63.042 1.00 71.98  ? 108 HIS D CE1   1 
ATOM   4823 N  NE2   . HIS F 3 108 ? 17.340 11.499  64.205 1.00 72.76  ? 108 HIS D NE2   1 
ATOM   4824 N  N     . PHE F 3 109 ? 22.800 8.851   60.599 1.00 56.97  ? 109 PHE D N     1 
ATOM   4825 C  CA    . PHE F 3 109 ? 24.014 8.042   60.523 1.00 55.47  ? 109 PHE D CA    1 
ATOM   4826 C  C     . PHE F 3 109 ? 25.105 8.688   61.381 1.00 60.29  ? 109 PHE D C     1 
ATOM   4827 O  O     . PHE F 3 109 ? 26.215 8.159   61.518 1.00 57.58  ? 109 PHE D O     1 
ATOM   4828 C  CB    . PHE F 3 109 ? 24.488 7.930   59.072 1.00 48.92  ? 109 PHE D CB    1 
ATOM   4829 C  CG    . PHE F 3 109 ? 25.499 6.840   58.844 1.00 43.99  ? 109 PHE D CG    1 
ATOM   4830 C  CD1   . PHE F 3 109 ? 25.693 5.837   59.787 1.00 42.15  ? 109 PHE D CD1   1 
ATOM   4831 C  CD2   . PHE F 3 109 ? 26.261 6.819   57.685 1.00 41.36  ? 109 PHE D CD2   1 
ATOM   4832 C  CE1   . PHE F 3 109 ? 26.627 4.837   59.576 1.00 40.56  ? 109 PHE D CE1   1 
ATOM   4833 C  CE2   . PHE F 3 109 ? 27.197 5.822   57.465 1.00 39.45  ? 109 PHE D CE2   1 
ATOM   4834 C  CZ    . PHE F 3 109 ? 27.380 4.829   58.413 1.00 39.91  ? 109 PHE D CZ    1 
ATOM   4835 N  N     . GLU F 3 110 ? 24.760 9.838   61.960 1.00 66.91  ? 110 GLU D N     1 
ATOM   4836 C  CA    . GLU F 3 110 ? 25.657 10.615  62.812 1.00 69.83  ? 110 GLU D CA    1 
ATOM   4837 C  C     . GLU F 3 110 ? 26.896 11.065  62.051 1.00 70.30  ? 110 GLU D C     1 
ATOM   4838 O  O     . GLU F 3 110 ? 27.360 10.372  61.145 1.00 72.36  ? 110 GLU D O     1 
ATOM   4839 C  CB    . GLU F 3 110 ? 26.055 9.805   64.048 1.00 70.10  ? 110 GLU D CB    1 
ATOM   4840 C  CG    . GLU F 3 110 ? 26.018 10.608  65.349 1.00 72.17  ? 110 GLU D CG    1 
ATOM   4841 C  CD    . GLU F 3 110 ? 24.624 11.132  65.710 1.00 73.58  ? 110 GLU D CD    1 
ATOM   4842 O  OE1   . GLU F 3 110 ? 23.965 11.757  64.847 1.00 74.29  ? 110 GLU D OE1   1 
ATOM   4843 O  OE2   . GLU F 3 110 ? 24.190 10.924  66.867 1.00 72.43  ? 110 GLU D OE2   1 
ATOM   4844 N  N     . ASN F 3 111 ? 27.424 12.227  62.430 1.00 67.54  ? 111 ASN D N     1 
ATOM   4845 C  CA    . ASN F 3 111 ? 28.597 12.808  61.783 1.00 66.47  ? 111 ASN D CA    1 
ATOM   4846 C  C     . ASN F 3 111 ? 28.101 13.539  60.542 1.00 64.78  ? 111 ASN D C     1 
ATOM   4847 O  O     . ASN F 3 111 ? 28.201 14.759  60.455 1.00 66.39  ? 111 ASN D O     1 
ATOM   4848 C  CB    . ASN F 3 111 ? 29.615 11.723  61.380 1.00 68.01  ? 111 ASN D CB    1 
ATOM   4849 C  CG    . ASN F 3 111 ? 30.930 11.823  62.151 1.00 66.81  ? 111 ASN D CG    1 
ATOM   4850 O  OD1   . ASN F 3 111 ? 31.949 12.258  61.609 1.00 64.72  ? 111 ASN D OD1   1 
ATOM   4851 N  ND2   . ASN F 3 111 ? 30.912 11.407  63.416 1.00 66.29  ? 111 ASN D ND2   1 
ATOM   4852 N  N     . CYS F 3 112 ? 27.553 12.788  59.591 1.00 63.72  ? 112 CYS D N     1 
ATOM   4853 C  CA    . CYS F 3 112 ? 27.036 13.368  58.355 1.00 63.60  ? 112 CYS D CA    1 
ATOM   4854 C  C     . CYS F 3 112 ? 25.923 14.353  58.684 1.00 62.10  ? 112 CYS D C     1 
ATOM   4855 O  O     . CYS F 3 112 ? 25.775 15.379  58.018 1.00 62.01  ? 112 CYS D O     1 
ATOM   4856 C  CB    . CYS F 3 112 ? 26.507 12.263  57.430 1.00 64.23  ? 112 CYS D CB    1 
ATOM   4857 S  SG    . CYS F 3 112 ? 25.044 12.684  56.422 1.00 68.52  ? 112 CYS D SG    1 
ATOM   4858 N  N     . GLY F 3 113 ? 25.156 14.025  59.721 1.00 59.88  ? 113 GLY D N     1 
ATOM   4859 C  CA    . GLY F 3 113 ? 24.054 14.862  60.162 1.00 58.51  ? 113 GLY D CA    1 
ATOM   4860 C  C     . GLY F 3 113 ? 23.462 15.829  59.147 1.00 59.29  ? 113 GLY D C     1 
ATOM   4861 O  O     . GLY F 3 113 ? 23.965 16.941  58.970 1.00 61.61  ? 113 GLY D O     1 
ATOM   4862 N  N     . LYS F 3 114 ? 22.390 15.413  58.479 1.00 57.61  ? 114 LYS D N     1 
ATOM   4863 C  CA    . LYS F 3 114 ? 21.720 16.265  57.497 1.00 55.85  ? 114 LYS D CA    1 
ATOM   4864 C  C     . LYS F 3 114 ? 20.211 16.098  57.635 1.00 54.98  ? 114 LYS D C     1 
ATOM   4865 O  O     . LYS F 3 114 ? 19.738 15.540  58.620 1.00 53.14  ? 114 LYS D O     1 
ATOM   4866 C  CB    . LYS F 3 114 ? 22.165 15.902  56.079 1.00 56.25  ? 114 LYS D CB    1 
ATOM   4867 C  CG    . LYS F 3 114 ? 23.582 16.368  55.742 1.00 58.66  ? 114 LYS D CG    1 
ATOM   4868 C  CD    . LYS F 3 114 ? 23.603 17.797  55.193 1.00 60.29  ? 114 LYS D CD    1 
ATOM   4869 C  CE    . LYS F 3 114 ? 24.196 18.786  56.201 1.00 61.05  ? 114 LYS D CE    1 
ATOM   4870 N  NZ    . LYS F 3 114 ? 24.339 20.164  55.641 1.00 57.87  ? 114 LYS D NZ    1 
ATOM   4871 N  N     . ALA F 3 115 ? 19.453 16.579  56.659 1.00 56.34  ? 115 ALA D N     1 
ATOM   4872 C  CA    . ALA F 3 115 ? 18.002 16.458  56.725 1.00 58.33  ? 115 ALA D CA    1 
ATOM   4873 C  C     . ALA F 3 115 ? 17.347 16.680  55.373 1.00 61.16  ? 115 ALA D C     1 
ATOM   4874 O  O     . ALA F 3 115 ? 17.984 17.141  54.429 1.00 60.61  ? 115 ALA D O     1 
ATOM   4875 C  CB    . ALA F 3 115 ? 17.449 17.445  57.733 1.00 57.80  ? 115 ALA D CB    1 
ATOM   4876 N  N     . PHE F 3 116 ? 16.065 16.344  55.289 1.00 66.98  ? 116 PHE D N     1 
ATOM   4877 C  CA    . PHE F 3 116 ? 15.307 16.502  54.053 1.00 72.59  ? 116 PHE D CA    1 
ATOM   4878 C  C     . PHE F 3 116 ? 13.825 16.706  54.345 1.00 77.45  ? 116 PHE D C     1 
ATOM   4879 O  O     . PHE F 3 116 ? 13.306 16.225  55.355 1.00 78.10  ? 116 PHE D O     1 
ATOM   4880 C  CB    . PHE F 3 116 ? 15.483 15.272  53.164 1.00 70.31  ? 116 PHE D CB    1 
ATOM   4881 C  CG    . PHE F 3 116 ? 16.860 15.130  52.595 1.00 68.56  ? 116 PHE D CG    1 
ATOM   4882 C  CD1   . PHE F 3 116 ? 17.193 15.736  51.391 1.00 69.24  ? 116 PHE D CD1   1 
ATOM   4883 C  CD2   . PHE F 3 116 ? 17.823 14.381  53.256 1.00 67.84  ? 116 PHE D CD2   1 
ATOM   4884 C  CE1   . PHE F 3 116 ? 18.465 15.595  50.851 1.00 69.59  ? 116 PHE D CE1   1 
ATOM   4885 C  CE2   . PHE F 3 116 ? 19.096 14.234  52.726 1.00 68.46  ? 116 PHE D CE2   1 
ATOM   4886 C  CZ    . PHE F 3 116 ? 19.419 14.841  51.520 1.00 69.48  ? 116 PHE D CZ    1 
ATOM   4887 N  N     . LYS F 3 117 ? 13.145 17.418  53.451 1.00 81.32  ? 117 LYS D N     1 
ATOM   4888 C  CA    . LYS F 3 117 ? 11.724 17.683  53.624 1.00 84.48  ? 117 LYS D CA    1 
ATOM   4889 C  C     . LYS F 3 117 ? 10.916 16.422  53.367 1.00 82.15  ? 117 LYS D C     1 
ATOM   4890 O  O     . LYS F 3 117 ? 9.894  16.186  54.008 1.00 82.04  ? 117 LYS D O     1 
ATOM   4891 C  CB    . LYS F 3 117 ? 11.267 18.799  52.677 1.00 88.98  ? 117 LYS D CB    1 
ATOM   4892 C  CG    . LYS F 3 117 ? 11.525 18.530  51.202 1.00 92.12  ? 117 LYS D CG    1 
ATOM   4893 C  CD    . LYS F 3 117 ? 10.536 19.298  50.329 1.00 94.81  ? 117 LYS D CD    1 
ATOM   4894 C  CE    . LYS F 3 117 ? 11.214 19.902  49.103 1.00 96.60  ? 117 LYS D CE    1 
ATOM   4895 N  NZ    . LYS F 3 117 ? 10.343 20.892  48.400 1.00 97.24  ? 117 LYS D NZ    1 
ATOM   4896 N  N     . LYS F 3 118 ? 11.386 15.612  52.427 1.00 80.03  ? 118 LYS D N     1 
ATOM   4897 C  CA    . LYS F 3 118 ? 10.701 14.376  52.086 1.00 79.51  ? 118 LYS D CA    1 
ATOM   4898 C  C     . LYS F 3 118 ? 11.474 13.165  52.590 1.00 77.33  ? 118 LYS D C     1 
ATOM   4899 O  O     . LYS F 3 118 ? 12.678 13.241  52.837 1.00 77.17  ? 118 LYS D O     1 
ATOM   4900 C  CB    . LYS F 3 118 ? 10.521 14.277  50.569 1.00 80.97  ? 118 LYS D CB    1 
ATOM   4901 C  CG    . LYS F 3 118 ? 10.683 15.597  49.833 1.00 81.23  ? 118 LYS D CG    1 
ATOM   4902 C  CD    . LYS F 3 118 ? 9.595  15.782  48.786 1.00 82.11  ? 118 LYS D CD    1 
ATOM   4903 C  CE    . LYS F 3 118 ? 10.185 16.127  47.423 1.00 81.78  ? 118 LYS D CE    1 
ATOM   4904 N  NZ    . LYS F 3 118 ? 10.346 14.922  46.560 1.00 81.05  ? 118 LYS D NZ    1 
ATOM   4905 N  N     . HIS F 3 119 ? 10.770 12.050  52.752 1.00 74.47  ? 119 HIS D N     1 
ATOM   4906 C  CA    . HIS F 3 119 ? 11.383 10.816  53.222 1.00 71.98  ? 119 HIS D CA    1 
ATOM   4907 C  C     . HIS F 3 119 ? 12.296 10.269  52.136 1.00 70.40  ? 119 HIS D C     1 
ATOM   4908 O  O     . HIS F 3 119 ? 13.472 10.002  52.374 1.00 68.94  ? 119 HIS D O     1 
ATOM   4909 C  CB    . HIS F 3 119 ? 10.292 9.795   53.562 1.00 71.92  ? 119 HIS D CB    1 
ATOM   4910 C  CG    . HIS F 3 119 ? 10.776 8.380   53.618 1.00 71.33  ? 119 HIS D CG    1 
ATOM   4911 N  ND1   . HIS F 3 119 ? 10.979 7.619   52.487 1.00 72.25  ? 119 HIS D ND1   1 
ATOM   4912 C  CD2   . HIS F 3 119 ? 11.078 7.581   54.669 1.00 71.01  ? 119 HIS D CD2   1 
ATOM   4913 C  CE1   . HIS F 3 119 ? 11.385 6.412   52.839 1.00 72.91  ? 119 HIS D CE1   1 
ATOM   4914 N  NE2   . HIS F 3 119 ? 11.452 6.362   54.157 1.00 71.64  ? 119 HIS D NE2   1 
ATOM   4915 N  N     . ASN F 3 120 ? 11.741 10.111  50.940 1.00 71.05  ? 120 ASN D N     1 
ATOM   4916 C  CA    . ASN F 3 120 ? 12.491 9.601   49.802 1.00 72.79  ? 120 ASN D CA    1 
ATOM   4917 C  C     . ASN F 3 120 ? 13.790 10.369  49.631 1.00 72.23  ? 120 ASN D C     1 
ATOM   4918 O  O     . ASN F 3 120 ? 14.840 9.782   49.366 1.00 72.88  ? 120 ASN D O     1 
ATOM   4919 C  CB    . ASN F 3 120 ? 11.656 9.724   48.529 1.00 75.83  ? 120 ASN D CB    1 
ATOM   4920 C  CG    . ASN F 3 120 ? 10.404 8.878   48.574 1.00 77.72  ? 120 ASN D CG    1 
ATOM   4921 O  OD1   . ASN F 3 120 ? 10.057 8.210   47.602 1.00 78.40  ? 120 ASN D OD1   1 
ATOM   4922 N  ND2   . ASN F 3 120 ? 9.717  8.900   49.710 1.00 77.99  ? 120 ASN D ND2   1 
ATOM   4923 N  N     . GLN F 3 121 ? 13.710 11.688  49.781 1.00 71.41  ? 121 GLN D N     1 
ATOM   4924 C  CA    . GLN F 3 121 ? 14.879 12.550  49.649 1.00 69.26  ? 121 GLN D CA    1 
ATOM   4925 C  C     . GLN F 3 121 ? 15.983 11.998  50.541 1.00 63.42  ? 121 GLN D C     1 
ATOM   4926 O  O     . GLN F 3 121 ? 17.133 11.877  50.120 1.00 64.27  ? 121 GLN D O     1 
ATOM   4927 C  CB    . GLN F 3 121 ? 14.532 13.987  50.063 1.00 72.44  ? 121 GLN D CB    1 
ATOM   4928 C  CG    . GLN F 3 121 ? 13.974 14.860  48.941 1.00 75.33  ? 121 GLN D CG    1 
ATOM   4929 C  CD    . GLN F 3 121 ? 13.435 14.054  47.772 1.00 78.91  ? 121 GLN D CD    1 
ATOM   4930 O  OE1   . GLN F 3 121 ? 12.428 13.355  47.894 1.00 81.03  ? 121 GLN D OE1   1 
ATOM   4931 N  NE2   . GLN F 3 121 ? 14.106 14.149  46.630 1.00 80.22  ? 121 GLN D NE2   1 
ATOM   4932 N  N     . LEU F 3 122 ? 15.619 11.654  51.772 1.00 55.75  ? 122 LEU D N     1 
ATOM   4933 C  CA    . LEU F 3 122 ? 16.569 11.101  52.724 1.00 48.62  ? 122 LEU D CA    1 
ATOM   4934 C  C     . LEU F 3 122 ? 17.121 9.805   52.160 1.00 48.00  ? 122 LEU D C     1 
ATOM   4935 O  O     . LEU F 3 122 ? 18.331 9.618   52.076 1.00 49.60  ? 122 LEU D O     1 
ATOM   4936 C  CB    . LEU F 3 122 ? 15.878 10.818  54.056 1.00 45.16  ? 122 LEU D CB    1 
ATOM   4937 C  CG    . LEU F 3 122 ? 16.510 9.746   54.944 1.00 41.97  ? 122 LEU D CG    1 
ATOM   4938 C  CD1   . LEU F 3 122 ? 17.691 10.339  55.686 1.00 42.81  ? 122 LEU D CD1   1 
ATOM   4939 C  CD2   . LEU F 3 122 ? 15.483 9.220   55.926 1.00 40.42  ? 122 LEU D CD2   1 
ATOM   4940 N  N     . LYS F 3 123 ? 16.217 8.912   51.776 1.00 47.07  ? 123 LYS D N     1 
ATOM   4941 C  CA    . LYS F 3 123 ? 16.594 7.623   51.216 1.00 44.26  ? 123 LYS D CA    1 
ATOM   4942 C  C     . LYS F 3 123 ? 17.767 7.764   50.260 1.00 41.46  ? 123 LYS D C     1 
ATOM   4943 O  O     . LYS F 3 123 ? 18.774 7.072   50.403 1.00 41.90  ? 123 LYS D O     1 
ATOM   4944 C  CB    . LYS F 3 123 ? 15.407 7.000   50.484 1.00 43.53  ? 123 LYS D CB    1 
ATOM   4945 C  CG    . LYS F 3 123 ? 14.600 6.060   51.341 1.00 45.36  ? 123 LYS D CG    1 
ATOM   4946 C  CD    . LYS F 3 123 ? 15.056 4.629   51.159 1.00 48.64  ? 123 LYS D CD    1 
ATOM   4947 C  CE    . LYS F 3 123 ? 13.934 3.770   50.595 1.00 52.89  ? 123 LYS D CE    1 
ATOM   4948 N  NZ    . LYS F 3 123 ? 14.142 3.415   49.156 1.00 53.16  ? 123 LYS D NZ    1 
ATOM   4949 N  N     . VAL F 3 124 ? 17.634 8.666   49.291 1.00 38.35  ? 124 VAL D N     1 
ATOM   4950 C  CA    . VAL F 3 124 ? 18.688 8.897   48.308 1.00 36.31  ? 124 VAL D CA    1 
ATOM   4951 C  C     . VAL F 3 124 ? 20.003 9.218   49.002 1.00 36.66  ? 124 VAL D C     1 
ATOM   4952 O  O     . VAL F 3 124 ? 20.926 8.405   49.006 1.00 38.55  ? 124 VAL D O     1 
ATOM   4953 C  CB    . VAL F 3 124 ? 18.334 10.060  47.370 1.00 34.23  ? 124 VAL D CB    1 
ATOM   4954 C  CG1   . VAL F 3 124 ? 19.562 10.477  46.578 1.00 30.72  ? 124 VAL D CG1   1 
ATOM   4955 C  CG2   . VAL F 3 124 ? 17.201 9.644   46.437 1.00 35.56  ? 124 VAL D CG2   1 
ATOM   4956 N  N     . HIS F 3 125 ? 20.086 10.408  49.583 1.00 34.86  ? 125 HIS D N     1 
ATOM   4957 C  CA    . HIS F 3 125 ? 21.287 10.826  50.294 1.00 32.37  ? 125 HIS D CA    1 
ATOM   4958 C  C     . HIS F 3 125 ? 21.955 9.605   50.908 1.00 32.65  ? 125 HIS D C     1 
ATOM   4959 O  O     . HIS F 3 125 ? 23.061 9.248   50.542 1.00 33.39  ? 125 HIS D O     1 
ATOM   4960 C  CB    . HIS F 3 125 ? 20.930 11.823  51.400 1.00 27.58  ? 125 HIS D CB    1 
ATOM   4961 C  CG    . HIS F 3 125 ? 22.009 12.011  52.421 1.00 24.62  ? 125 HIS D CG    1 
ATOM   4962 N  ND1   . HIS F 3 125 ? 23.357 11.943  52.144 1.00 23.10  ? 125 HIS D ND1   1 
ATOM   4963 C  CD2   . HIS F 3 125 ? 21.922 12.307  53.743 1.00 22.74  ? 125 HIS D CD2   1 
ATOM   4964 C  CE1   . HIS F 3 125 ? 24.024 12.200  53.279 1.00 19.49  ? 125 HIS D CE1   1 
ATOM   4965 N  NE2   . HIS F 3 125 ? 23.194 12.428  54.276 1.00 18.02  ? 125 HIS D NE2   1 
ATOM   4966 N  N     . GLN F 3 126 ? 21.254 8.963   51.831 1.00 34.92  ? 126 GLN D N     1 
ATOM   4967 C  CA    . GLN F 3 126 ? 21.757 7.781   52.514 1.00 36.43  ? 126 GLN D CA    1 
ATOM   4968 C  C     . GLN F 3 126 ? 22.679 6.933   51.643 1.00 36.14  ? 126 GLN D C     1 
ATOM   4969 O  O     . GLN F 3 126 ? 23.709 6.443   52.110 1.00 34.20  ? 126 GLN D O     1 
ATOM   4970 C  CB    . GLN F 3 126 ? 20.578 6.940   53.008 1.00 38.57  ? 126 GLN D CB    1 
ATOM   4971 C  CG    . GLN F 3 126 ? 19.754 7.623   54.092 1.00 39.76  ? 126 GLN D CG    1 
ATOM   4972 C  CD    . GLN F 3 126 ? 18.931 6.642   54.895 1.00 41.63  ? 126 GLN D CD    1 
ATOM   4973 O  OE1   . GLN F 3 126 ? 18.105 5.917   54.340 1.00 43.40  ? 126 GLN D OE1   1 
ATOM   4974 N  NE2   . GLN F 3 126 ? 19.153 6.608   56.210 1.00 39.67  ? 126 GLN D NE2   1 
ATOM   4975 N  N     . PHE F 3 127 ? 22.312 6.766   50.377 1.00 38.11  ? 127 PHE D N     1 
ATOM   4976 C  CA    . PHE F 3 127 ? 23.119 5.974   49.457 1.00 41.84  ? 127 PHE D CA    1 
ATOM   4977 C  C     . PHE F 3 127 ? 24.535 6.538   49.366 1.00 43.71  ? 127 PHE D C     1 
ATOM   4978 O  O     . PHE F 3 127 ? 25.483 5.837   49.015 1.00 43.16  ? 127 PHE D O     1 
ATOM   4979 C  CB    . PHE F 3 127 ? 22.472 5.944   48.070 1.00 41.10  ? 127 PHE D CB    1 
ATOM   4980 C  CG    . PHE F 3 127 ? 21.490 4.821   47.884 1.00 40.87  ? 127 PHE D CG    1 
ATOM   4981 C  CD1   . PHE F 3 127 ? 20.616 4.461   48.908 1.00 42.98  ? 127 PHE D CD1   1 
ATOM   4982 C  CD2   . PHE F 3 127 ? 21.423 4.135   46.680 1.00 40.25  ? 127 PHE D CD2   1 
ATOM   4983 C  CE1   . PHE F 3 127 ? 19.689 3.432   48.730 1.00 43.77  ? 127 PHE D CE1   1 
ATOM   4984 C  CE2   . PHE F 3 127 ? 20.502 3.107   46.489 1.00 41.99  ? 127 PHE D CE2   1 
ATOM   4985 C  CZ    . PHE F 3 127 ? 19.632 2.755   47.515 1.00 43.75  ? 127 PHE D CZ    1 
ATOM   4986 N  N     . SER F 3 128 ? 24.668 7.815   49.691 1.00 45.43  ? 128 SER D N     1 
ATOM   4987 C  CA    . SER F 3 128 ? 25.960 8.477   49.663 1.00 47.40  ? 128 SER D CA    1 
ATOM   4988 C  C     . SER F 3 128 ? 26.878 7.826   50.689 1.00 46.61  ? 128 SER D C     1 
ATOM   4989 O  O     . SER F 3 128 ? 28.096 7.989   50.641 1.00 50.93  ? 128 SER D O     1 
ATOM   4990 C  CB    . SER F 3 128 ? 25.796 9.961   49.988 1.00 49.37  ? 128 SER D CB    1 
ATOM   4991 O  OG    . SER F 3 128 ? 25.359 10.134  51.327 1.00 50.23  ? 128 SER D OG    1 
ATOM   4992 N  N     . HIS F 3 129 ? 26.290 7.099   51.628 1.00 41.29  ? 129 HIS D N     1 
ATOM   4993 C  CA    . HIS F 3 129 ? 27.084 6.433   52.640 1.00 39.98  ? 129 HIS D CA    1 
ATOM   4994 C  C     . HIS F 3 129 ? 27.228 4.979   52.245 1.00 41.27  ? 129 HIS D C     1 
ATOM   4995 O  O     . HIS F 3 129 ? 27.405 4.109   53.094 1.00 42.88  ? 129 HIS D O     1 
ATOM   4996 C  CB    . HIS F 3 129 ? 26.412 6.524   54.003 1.00 39.34  ? 129 HIS D CB    1 
ATOM   4997 C  CG    . HIS F 3 129 ? 25.947 7.900   54.361 1.00 41.88  ? 129 HIS D CG    1 
ATOM   4998 N  ND1   . HIS F 3 129 ? 26.332 8.572   55.500 1.00 40.84  ? 129 HIS D ND1   1 
ATOM   4999 C  CD2   . HIS F 3 129 ? 25.059 8.717   53.736 1.00 42.02  ? 129 HIS D CD2   1 
ATOM   5000 C  CE1   . HIS F 3 129 ? 25.678 9.742   55.532 1.00 40.08  ? 129 HIS D CE1   1 
ATOM   5001 N  NE2   . HIS F 3 129 ? 24.892 9.878   54.483 1.00 40.19  ? 129 HIS D NE2   1 
ATOM   5002 N  N     . THR F 3 130 ? 27.151 4.719   50.946 1.00 41.07  ? 130 THR D N     1 
ATOM   5003 C  CA    . THR F 3 130 ? 27.265 3.357   50.448 1.00 43.70  ? 130 THR D CA    1 
ATOM   5004 C  C     . THR F 3 130 ? 28.340 3.226   49.387 1.00 46.21  ? 130 THR D C     1 
ATOM   5005 O  O     . THR F 3 130 ? 29.344 3.934   49.408 1.00 47.24  ? 130 THR D O     1 
ATOM   5006 C  CB    . THR F 3 130 ? 25.940 2.877   49.840 1.00 45.47  ? 130 THR D CB    1 
ATOM   5007 O  OG1   . THR F 3 130 ? 25.854 3.299   48.470 1.00 44.72  ? 130 THR D OG1   1 
ATOM   5008 C  CG2   . THR F 3 130 ? 24.771 3.448   50.623 1.00 47.67  ? 130 THR D CG2   1 
ATOM   5009 N  N     . GLN F 3 131 ? 28.112 2.306   48.459 1.00 48.67  ? 131 GLN D N     1 
ATOM   5010 C  CA    . GLN F 3 131 ? 29.035 2.052   47.369 1.00 51.46  ? 131 GLN D CA    1 
ATOM   5011 C  C     . GLN F 3 131 ? 28.238 2.038   46.072 1.00 51.05  ? 131 GLN D C     1 
ATOM   5012 O  O     . GLN F 3 131 ? 28.789 2.216   44.985 1.00 52.27  ? 131 GLN D O     1 
ATOM   5013 C  CB    . GLN F 3 131 ? 29.716 0.700   47.576 1.00 55.43  ? 131 GLN D CB    1 
ATOM   5014 C  CG    . GLN F 3 131 ? 30.684 0.662   48.745 1.00 57.63  ? 131 GLN D CG    1 
ATOM   5015 C  CD    . GLN F 3 131 ? 32.096 0.311   48.316 1.00 59.22  ? 131 GLN D CD    1 
ATOM   5016 O  OE1   . GLN F 3 131 ? 32.790 1.124   47.704 1.00 60.25  ? 131 GLN D OE1   1 
ATOM   5017 N  NE2   . GLN F 3 131 ? 32.527 -0.907  48.634 1.00 58.61  ? 131 GLN D NE2   1 
ATOM   5018 N  N     . GLN F 3 132 ? 26.933 1.823   46.206 1.00 50.65  ? 132 GLN D N     1 
ATOM   5019 C  CA    . GLN F 3 132 ? 26.024 1.775   45.066 1.00 50.15  ? 132 GLN D CA    1 
ATOM   5020 C  C     . GLN F 3 132 ? 25.373 3.133   44.846 1.00 48.17  ? 132 GLN D C     1 
ATOM   5021 O  O     . GLN F 3 132 ? 25.377 3.986   45.738 1.00 45.58  ? 132 GLN D O     1 
ATOM   5022 C  CB    . GLN F 3 132 ? 24.938 0.726   45.308 1.00 51.26  ? 132 GLN D CB    1 
ATOM   5023 C  CG    . GLN F 3 132 ? 24.464 0.672   46.755 1.00 56.11  ? 132 GLN D CG    1 
ATOM   5024 C  CD    . GLN F 3 132 ? 23.993 -0.710  47.176 1.00 57.54  ? 132 GLN D CD    1 
ATOM   5025 O  OE1   . GLN F 3 132 ? 23.469 -1.472  46.362 1.00 57.47  ? 132 GLN D OE1   1 
ATOM   5026 N  NE2   . GLN F 3 132 ? 24.175 -1.039  48.454 1.00 56.60  ? 132 GLN D NE2   1 
ATOM   5027 N  N     . LEU F 3 133 ? 24.815 3.327   43.655 1.00 46.59  ? 133 LEU D N     1 
ATOM   5028 C  CA    . LEU F 3 133 ? 24.152 4.579   43.314 1.00 47.80  ? 133 LEU D CA    1 
ATOM   5029 C  C     . LEU F 3 133 ? 22.678 4.476   43.661 1.00 50.04  ? 133 LEU D C     1 
ATOM   5030 O  O     . LEU F 3 133 ? 22.177 3.385   43.913 1.00 55.00  ? 133 LEU D O     1 
ATOM   5031 C  CB    . LEU F 3 133 ? 24.307 4.871   41.826 1.00 48.43  ? 133 LEU D CB    1 
ATOM   5032 C  CG    . LEU F 3 133 ? 25.249 6.027   41.506 1.00 48.86  ? 133 LEU D CG    1 
ATOM   5033 C  CD1   . LEU F 3 133 ? 26.575 5.832   42.236 1.00 50.74  ? 133 LEU D CD1   1 
ATOM   5034 C  CD2   . LEU F 3 133 ? 25.467 6.086   40.009 1.00 49.33  ? 133 LEU D CD2   1 
ATOM   5035 N  N     . PRO F 3 134 ? 21.961 5.611   43.672 1.00 48.03  ? 134 PRO D N     1 
ATOM   5036 C  CA    . PRO F 3 134 ? 20.534 5.607   44.000 1.00 47.06  ? 134 PRO D CA    1 
ATOM   5037 C  C     . PRO F 3 134 ? 19.643 5.130   42.857 1.00 48.52  ? 134 PRO D C     1 
ATOM   5038 O  O     . PRO F 3 134 ? 19.512 3.930   42.616 1.00 49.78  ? 134 PRO D O     1 
ATOM   5039 C  CB    . PRO F 3 134 ? 20.261 7.054   44.373 1.00 47.09  ? 134 PRO D CB    1 
ATOM   5040 C  CG    . PRO F 3 134 ? 21.210 7.820   43.518 1.00 48.21  ? 134 PRO D CG    1 
ATOM   5041 C  CD    . PRO F 3 134 ? 22.447 6.971   43.380 1.00 48.68  ? 134 PRO D CD    1 
ATOM   5042 N  N     . TYR F 3 135 ? 19.024 6.078   42.163 1.00 49.27  ? 135 TYR D N     1 
ATOM   5043 C  CA    . TYR F 3 135 ? 18.142 5.762   41.051 1.00 53.15  ? 135 TYR D CA    1 
ATOM   5044 C  C     . TYR F 3 135 ? 18.789 4.729   40.132 1.00 56.77  ? 135 TYR D C     1 
ATOM   5045 O  O     . TYR F 3 135 ? 19.592 5.084   39.273 1.00 60.40  ? 135 TYR D O     1 
ATOM   5046 C  CB    . TYR F 3 135 ? 17.836 7.033   40.255 1.00 55.61  ? 135 TYR D CB    1 
ATOM   5047 C  CG    . TYR F 3 135 ? 17.181 8.144   41.056 1.00 57.40  ? 135 TYR D CG    1 
ATOM   5048 C  CD1   . TYR F 3 135 ? 15.800 8.176   41.245 1.00 58.27  ? 135 TYR D CD1   1 
ATOM   5049 C  CD2   . TYR F 3 135 ? 17.939 9.179   41.599 1.00 57.47  ? 135 TYR D CD2   1 
ATOM   5050 C  CE1   . TYR F 3 135 ? 15.192 9.213   41.953 1.00 58.71  ? 135 TYR D CE1   1 
ATOM   5051 C  CE2   . TYR F 3 135 ? 17.341 10.221  42.307 1.00 58.08  ? 135 TYR D CE2   1 
ATOM   5052 C  CZ    . TYR F 3 135 ? 15.968 10.230  42.479 1.00 58.56  ? 135 TYR D CZ    1 
ATOM   5053 O  OH    . TYR F 3 135 ? 15.372 11.254  43.175 1.00 59.81  ? 135 TYR D OH    1 
ATOM   5054 N  N     . GLU F 3 136 ? 18.440 3.456   40.306 1.00 57.81  ? 136 GLU D N     1 
ATOM   5055 C  CA    . GLU F 3 136 ? 19.012 2.396   39.479 1.00 61.07  ? 136 GLU D CA    1 
ATOM   5056 C  C     . GLU F 3 136 ? 18.046 1.918   38.403 1.00 60.71  ? 136 GLU D C     1 
ATOM   5057 O  O     . GLU F 3 136 ? 16.833 2.075   38.536 1.00 59.40  ? 136 GLU D O     1 
ATOM   5058 C  CB    . GLU F 3 136 ? 19.432 1.220   40.357 1.00 66.46  ? 136 GLU D CB    1 
ATOM   5059 C  CG    . GLU F 3 136 ? 19.100 -0.146  39.784 1.00 72.27  ? 136 GLU D CG    1 
ATOM   5060 C  CD    . GLU F 3 136 ? 17.730 -0.632  40.214 1.00 76.14  ? 136 GLU D CD    1 
ATOM   5061 O  OE1   . GLU F 3 136 ? 16.719 -0.038  39.777 1.00 76.98  ? 136 GLU D OE1   1 
ATOM   5062 O  OE2   . GLU F 3 136 ? 17.666 -1.609  40.992 1.00 77.51  ? 136 GLU D OE2   1 
ATOM   5063 N  N     . CYS F 3 137 ? 18.589 1.329   37.339 1.00 62.20  ? 137 CYS D N     1 
ATOM   5064 C  CA    . CYS F 3 137 ? 17.764 0.836   36.240 1.00 64.20  ? 137 CYS D CA    1 
ATOM   5065 C  C     . CYS F 3 137 ? 16.838 -0.279  36.693 1.00 68.26  ? 137 CYS D C     1 
ATOM   5066 O  O     . CYS F 3 137 ? 17.260 -1.227  37.359 1.00 70.80  ? 137 CYS D O     1 
ATOM   5067 C  CB    . CYS F 3 137 ? 18.626 0.320   35.084 1.00 61.66  ? 137 CYS D CB    1 
ATOM   5068 S  SG    . CYS F 3 137 ? 17.654 -0.363  33.708 1.00 56.94  ? 137 CYS D SG    1 
ATOM   5069 N  N     . PRO F 3 138 ? 15.555 -0.178  36.332 1.00 69.44  ? 138 PRO D N     1 
ATOM   5070 C  CA    . PRO F 3 138 ? 14.546 -1.171  36.692 1.00 71.71  ? 138 PRO D CA    1 
ATOM   5071 C  C     . PRO F 3 138 ? 14.343 -2.153  35.542 1.00 75.42  ? 138 PRO D C     1 
ATOM   5072 O  O     . PRO F 3 138 ? 13.830 -1.782  34.487 1.00 76.06  ? 138 PRO D O     1 
ATOM   5073 C  CB    . PRO F 3 138 ? 13.309 -0.320  36.949 1.00 71.47  ? 138 PRO D CB    1 
ATOM   5074 C  CG    . PRO F 3 138 ? 13.536 0.953   36.090 1.00 71.37  ? 138 PRO D CG    1 
ATOM   5075 C  CD    . PRO F 3 138 ? 14.957 0.922   35.562 1.00 68.51  ? 138 PRO D CD    1 
ATOM   5076 N  N     . HIS F 3 139 ? 14.755 -3.400  35.749 1.00 79.20  ? 139 HIS D N     1 
ATOM   5077 C  CA    . HIS F 3 139 ? 14.626 -4.441  34.732 1.00 84.15  ? 139 HIS D CA    1 
ATOM   5078 C  C     . HIS F 3 139 ? 15.460 -5.638  35.163 1.00 87.83  ? 139 HIS D C     1 
ATOM   5079 O  O     . HIS F 3 139 ? 16.220 -5.550  36.130 1.00 89.42  ? 139 HIS D O     1 
ATOM   5080 C  CB    . HIS F 3 139 ? 15.138 -3.941  33.379 1.00 85.43  ? 139 HIS D CB    1 
ATOM   5081 C  CG    . HIS F 3 139 ? 14.092 -3.900  32.308 1.00 86.58  ? 139 HIS D CG    1 
ATOM   5082 N  ND1   . HIS F 3 139 ? 13.313 -2.789  32.070 1.00 87.03  ? 139 HIS D ND1   1 
ATOM   5083 C  CD2   . HIS F 3 139 ? 13.713 -4.826  31.396 1.00 87.32  ? 139 HIS D CD2   1 
ATOM   5084 C  CE1   . HIS F 3 139 ? 12.500 -3.031  31.057 1.00 87.29  ? 139 HIS D CE1   1 
ATOM   5085 N  NE2   . HIS F 3 139 ? 12.723 -4.260  30.629 1.00 87.84  ? 139 HIS D NE2   1 
ATOM   5086 N  N     . GLU F 3 140 ? 15.319 -6.753  34.450 1.00 89.83  ? 140 GLU D N     1 
ATOM   5087 C  CA    . GLU F 3 140 ? 16.086 -7.952  34.768 1.00 91.07  ? 140 GLU D CA    1 
ATOM   5088 C  C     . GLU F 3 140 ? 17.449 -7.845  34.096 1.00 89.43  ? 140 GLU D C     1 
ATOM   5089 O  O     . GLU F 3 140 ? 17.556 -7.362  32.964 1.00 87.49  ? 140 GLU D O     1 
ATOM   5090 C  CB    . GLU F 3 140 ? 15.357 -9.207  34.284 1.00 94.35  ? 140 GLU D CB    1 
ATOM   5091 C  CG    . GLU F 3 140 ? 14.802 -10.074 35.412 1.00 97.96  ? 140 GLU D CG    1 
ATOM   5092 C  CD    . GLU F 3 140 ? 15.877 -10.568 36.371 1.00 99.59  ? 140 GLU D CD    1 
ATOM   5093 O  OE1   . GLU F 3 140 ? 16.173 -9.857  37.358 1.00 99.61  ? 140 GLU D OE1   1 
ATOM   5094 O  OE2   . GLU F 3 140 ? 16.423 -11.670 36.138 1.00 100.00 ? 140 GLU D OE2   1 
ATOM   5095 N  N     . GLY F 3 141 ? 18.484 -8.299  34.797 1.00 88.58  ? 141 GLY D N     1 
ATOM   5096 C  CA    . GLY F 3 141 ? 19.830 -8.217  34.265 1.00 88.57  ? 141 GLY D CA    1 
ATOM   5097 C  C     . GLY F 3 141 ? 20.283 -6.779  34.409 1.00 88.79  ? 141 GLY D C     1 
ATOM   5098 O  O     . GLY F 3 141 ? 19.859 -6.097  35.344 1.00 88.80  ? 141 GLY D O     1 
ATOM   5099 N  N     . CYS F 3 142 ? 21.134 -6.315  33.497 1.00 88.18  ? 142 CYS D N     1 
ATOM   5100 C  CA    . CYS F 3 142 ? 21.618 -4.937  33.530 1.00 87.10  ? 142 CYS D CA    1 
ATOM   5101 C  C     . CYS F 3 142 ? 22.175 -4.563  34.902 1.00 86.02  ? 142 CYS D C     1 
ATOM   5102 O  O     . CYS F 3 142 ? 23.385 -4.610  35.124 1.00 84.34  ? 142 CYS D O     1 
ATOM   5103 C  CB    . CYS F 3 142 ? 20.478 -3.979  33.163 1.00 87.27  ? 142 CYS D CB    1 
ATOM   5104 S  SG    . CYS F 3 142 ? 20.995 -2.402  32.441 1.00 87.06  ? 142 CYS D SG    1 
ATOM   5105 N  N     . ASP F 3 143 ? 21.273 -4.189  35.808 1.00 85.60  ? 143 ASP D N     1 
ATOM   5106 C  CA    . ASP F 3 143 ? 21.622 -3.796  37.170 1.00 84.59  ? 143 ASP D CA    1 
ATOM   5107 C  C     . ASP F 3 143 ? 22.281 -2.421  37.186 1.00 80.22  ? 143 ASP D C     1 
ATOM   5108 O  O     . ASP F 3 143 ? 22.509 -1.844  38.250 1.00 81.13  ? 143 ASP D O     1 
ATOM   5109 C  CB    . ASP F 3 143 ? 22.545 -4.842  37.811 1.00 88.35  ? 143 ASP D CB    1 
ATOM   5110 C  CG    . ASP F 3 143 ? 23.954 -4.324  38.041 1.00 90.65  ? 143 ASP D CG    1 
ATOM   5111 O  OD1   . ASP F 3 143 ? 24.194 -3.698  39.097 1.00 90.93  ? 143 ASP D OD1   1 
ATOM   5112 O  OD2   . ASP F 3 143 ? 24.818 -4.548  37.166 1.00 92.04  ? 143 ASP D OD2   1 
ATOM   5113 N  N     . LYS F 3 144 ? 22.579 -1.903  35.999 1.00 73.43  ? 144 LYS D N     1 
ATOM   5114 C  CA    . LYS F 3 144 ? 23.197 -0.591  35.866 1.00 67.78  ? 144 LYS D CA    1 
ATOM   5115 C  C     . LYS F 3 144 ? 22.422 0.417   36.712 1.00 64.22  ? 144 LYS D C     1 
ATOM   5116 O  O     . LYS F 3 144 ? 21.216 0.586   36.543 1.00 64.97  ? 144 LYS D O     1 
ATOM   5117 C  CB    . LYS F 3 144 ? 23.181 -0.154  34.399 1.00 67.27  ? 144 LYS D CB    1 
ATOM   5118 C  CG    . LYS F 3 144 ? 24.559 -0.007  33.763 1.00 67.44  ? 144 LYS D CG    1 
ATOM   5119 C  CD    . LYS F 3 144 ? 24.459 0.249   32.259 1.00 66.51  ? 144 LYS D CD    1 
ATOM   5120 C  CE    . LYS F 3 144 ? 25.053 1.604   31.878 1.00 65.87  ? 144 LYS D CE    1 
ATOM   5121 N  NZ    . LYS F 3 144 ? 25.106 1.830   30.405 1.00 63.25  ? 144 LYS D NZ    1 
ATOM   5122 N  N     . ARG F 3 145 ? 23.111 1.077   37.633 1.00 59.44  ? 145 ARG D N     1 
ATOM   5123 C  CA    . ARG F 3 145 ? 22.462 2.058   38.487 1.00 56.51  ? 145 ARG D CA    1 
ATOM   5124 C  C     . ARG F 3 145 ? 22.824 3.460   38.024 1.00 53.69  ? 145 ARG D C     1 
ATOM   5125 O  O     . ARG F 3 145 ? 23.598 3.631   37.081 1.00 52.57  ? 145 ARG D O     1 
ATOM   5126 C  CB    . ARG F 3 145 ? 22.887 1.860   39.943 1.00 58.82  ? 145 ARG D CB    1 
ATOM   5127 C  CG    . ARG F 3 145 ? 22.818 0.414   40.421 1.00 60.88  ? 145 ARG D CG    1 
ATOM   5128 C  CD    . ARG F 3 145 ? 23.432 0.253   41.807 1.00 62.83  ? 145 ARG D CD    1 
ATOM   5129 N  NE    . ARG F 3 145 ? 22.486 -0.321  42.759 1.00 64.25  ? 145 ARG D NE    1 
ATOM   5130 C  CZ    . ARG F 3 145 ? 21.383 0.292   43.178 1.00 64.93  ? 145 ARG D CZ    1 
ATOM   5131 N  NH1   . ARG F 3 145 ? 21.084 1.501   42.730 1.00 65.16  ? 145 ARG D NH1   1 
ATOM   5132 N  NH2   . ARG F 3 145 ? 20.575 -0.304  44.042 1.00 66.72  ? 145 ARG D NH2   1 
ATOM   5133 N  N     . PHE F 3 146 ? 22.251 4.464   38.681 1.00 51.37  ? 146 PHE D N     1 
ATOM   5134 C  CA    . PHE F 3 146 ? 22.512 5.854   38.323 1.00 50.96  ? 146 PHE D CA    1 
ATOM   5135 C  C     . PHE F 3 146 ? 22.303 6.825   39.480 1.00 51.08  ? 146 PHE D C     1 
ATOM   5136 O  O     . PHE F 3 146 ? 21.894 6.442   40.580 1.00 50.67  ? 146 PHE D O     1 
ATOM   5137 C  CB    . PHE F 3 146 ? 21.609 6.289   37.167 1.00 50.19  ? 146 PHE D CB    1 
ATOM   5138 C  CG    . PHE F 3 146 ? 21.644 5.369   35.993 1.00 48.20  ? 146 PHE D CG    1 
ATOM   5139 C  CD1   . PHE F 3 146 ? 20.882 4.208   35.982 1.00 47.24  ? 146 PHE D CD1   1 
ATOM   5140 C  CD2   . PHE F 3 146 ? 22.449 5.654   34.902 1.00 47.50  ? 146 PHE D CD2   1 
ATOM   5141 C  CE1   . PHE F 3 146 ? 20.923 3.344   34.905 1.00 47.74  ? 146 PHE D CE1   1 
ATOM   5142 C  CE2   . PHE F 3 146 ? 22.496 4.797   33.817 1.00 48.29  ? 146 PHE D CE2   1 
ATOM   5143 C  CZ    . PHE F 3 146 ? 21.733 3.638   33.817 1.00 48.69  ? 146 PHE D CZ    1 
ATOM   5144 N  N     . SER F 3 147 ? 22.587 8.093   39.202 1.00 49.56  ? 147 SER D N     1 
ATOM   5145 C  CA    . SER F 3 147 ? 22.437 9.158   40.178 1.00 48.37  ? 147 SER D CA    1 
ATOM   5146 C  C     . SER F 3 147 ? 21.256 10.015  39.747 1.00 46.73  ? 147 SER D C     1 
ATOM   5147 O  O     . SER F 3 147 ? 20.167 9.912   40.300 1.00 48.50  ? 147 SER D O     1 
ATOM   5148 C  CB    . SER F 3 147 ? 23.708 10.013  40.236 1.00 48.93  ? 147 SER D CB    1 
ATOM   5149 O  OG    . SER F 3 147 ? 24.730 9.378   40.990 1.00 49.30  ? 147 SER D OG    1 
ATOM   5150 N  N     . LEU F 3 148 ? 21.477 10.856  38.746 1.00 43.93  ? 148 LEU D N     1 
ATOM   5151 C  CA    . LEU F 3 148 ? 20.427 11.726  38.236 1.00 41.00  ? 148 LEU D CA    1 
ATOM   5152 C  C     . LEU F 3 148 ? 19.418 10.902  37.445 1.00 38.49  ? 148 LEU D C     1 
ATOM   5153 O  O     . LEU F 3 148 ? 19.712 10.417  36.355 1.00 38.82  ? 148 LEU D O     1 
ATOM   5154 C  CB    . LEU F 3 148 ? 21.035 12.806  37.347 1.00 42.29  ? 148 LEU D CB    1 
ATOM   5155 C  CG    . LEU F 3 148 ? 22.293 13.447  37.932 1.00 44.73  ? 148 LEU D CG    1 
ATOM   5156 C  CD1   . LEU F 3 148 ? 23.486 12.513  37.784 1.00 47.17  ? 148 LEU D CD1   1 
ATOM   5157 C  CD2   . LEU F 3 148 ? 22.559 14.751  37.224 1.00 46.69  ? 148 LEU D CD2   1 
ATOM   5158 N  N     . PRO F 3 149 ? 18.203 10.749  37.985 1.00 35.10  ? 149 PRO D N     1 
ATOM   5159 C  CA    . PRO F 3 149 ? 17.137 9.980   37.345 1.00 33.03  ? 149 PRO D CA    1 
ATOM   5160 C  C     . PRO F 3 149 ? 16.997 10.290  35.867 1.00 32.07  ? 149 PRO D C     1 
ATOM   5161 O  O     . PRO F 3 149 ? 16.725 9.399   35.067 1.00 33.94  ? 149 PRO D O     1 
ATOM   5162 C  CB    . PRO F 3 149 ? 15.885 10.368  38.131 1.00 36.13  ? 149 PRO D CB    1 
ATOM   5163 C  CG    . PRO F 3 149 ? 16.291 11.544  38.985 1.00 38.22  ? 149 PRO D CG    1 
ATOM   5164 C  CD    . PRO F 3 149 ? 17.745 11.355  39.241 1.00 37.01  ? 149 PRO D CD    1 
ATOM   5165 N  N     . SER F 3 150 ? 17.186 11.554  35.506 1.00 29.83  ? 150 SER D N     1 
ATOM   5166 C  CA    . SER F 3 150 ? 17.069 11.965  34.113 1.00 29.91  ? 150 SER D CA    1 
ATOM   5167 C  C     . SER F 3 150 ? 17.968 11.140  33.200 1.00 29.80  ? 150 SER D C     1 
ATOM   5168 O  O     . SER F 3 150 ? 17.564 10.743  32.107 1.00 27.23  ? 150 SER D O     1 
ATOM   5169 C  CB    . SER F 3 150 ? 17.440 13.431  33.972 1.00 30.65  ? 150 SER D CB    1 
ATOM   5170 O  OG    . SER F 3 150 ? 18.844 13.576  34.033 1.00 32.39  ? 150 SER D OG    1 
ATOM   5171 N  N     . ARG F 3 151 ? 19.193 10.895  33.652 1.00 32.94  ? 151 ARG D N     1 
ATOM   5172 C  CA    . ARG F 3 151 ? 20.156 10.118  32.876 1.00 36.20  ? 151 ARG D CA    1 
ATOM   5173 C  C     . ARG F 3 151 ? 19.729 8.650   32.780 1.00 35.75  ? 151 ARG D C     1 
ATOM   5174 O  O     . ARG F 3 151 ? 19.892 8.012   31.739 1.00 34.34  ? 151 ARG D O     1 
ATOM   5175 C  CB    . ARG F 3 151 ? 21.557 10.213  33.508 1.00 37.43  ? 151 ARG D CB    1 
ATOM   5176 C  CG    . ARG F 3 151 ? 22.358 11.479  33.154 1.00 37.31  ? 151 ARG D CG    1 
ATOM   5177 C  CD    . ARG F 3 151 ? 22.249 11.843  31.677 1.00 38.51  ? 151 ARG D CD    1 
ATOM   5178 N  NE    . ARG F 3 151 ? 23.526 12.224  31.066 1.00 39.09  ? 151 ARG D NE    1 
ATOM   5179 C  CZ    . ARG F 3 151 ? 24.663 11.542  31.189 1.00 39.79  ? 151 ARG D CZ    1 
ATOM   5180 N  NH1   . ARG F 3 151 ? 24.707 10.427  31.908 1.00 40.77  ? 151 ARG D NH1   1 
ATOM   5181 N  NH2   . ARG F 3 151 ? 25.757 11.964  30.571 1.00 39.54  ? 151 ARG D NH2   1 
ATOM   5182 N  N     . LEU F 3 152 ? 19.190 8.119   33.872 1.00 36.12  ? 152 LEU D N     1 
ATOM   5183 C  CA    . LEU F 3 152 ? 18.733 6.735   33.900 1.00 38.82  ? 152 LEU D CA    1 
ATOM   5184 C  C     . LEU F 3 152 ? 17.683 6.532   32.813 1.00 41.10  ? 152 LEU D C     1 
ATOM   5185 O  O     . LEU F 3 152 ? 17.816 5.650   31.963 1.00 41.36  ? 152 LEU D O     1 
ATOM   5186 C  CB    . LEU F 3 152 ? 18.124 6.412   35.262 1.00 39.71  ? 152 LEU D CB    1 
ATOM   5187 C  CG    . LEU F 3 152 ? 17.366 5.090   35.397 1.00 40.47  ? 152 LEU D CG    1 
ATOM   5188 C  CD1   . LEU F 3 152 ? 17.565 4.552   36.805 1.00 40.47  ? 152 LEU D CD1   1 
ATOM   5189 C  CD2   . LEU F 3 152 ? 15.884 5.298   35.111 1.00 39.05  ? 152 LEU D CD2   1 
ATOM   5190 N  N     . LYS F 3 153 ? 16.639 7.357   32.860 1.00 41.72  ? 153 LYS D N     1 
ATOM   5191 C  CA    . LYS F 3 153 ? 15.553 7.309   31.888 1.00 41.79  ? 153 LYS D CA    1 
ATOM   5192 C  C     . LYS F 3 153 ? 16.154 7.219   30.490 1.00 42.05  ? 153 LYS D C     1 
ATOM   5193 O  O     . LYS F 3 153 ? 15.606 6.562   29.605 1.00 44.61  ? 153 LYS D O     1 
ATOM   5194 C  CB    . LYS F 3 153 ? 14.686 8.572   32.008 1.00 44.50  ? 153 LYS D CB    1 
ATOM   5195 C  CG    . LYS F 3 153 ? 13.412 8.568   31.163 1.00 47.16  ? 153 LYS D CG    1 
ATOM   5196 C  CD    . LYS F 3 153 ? 13.256 9.872   30.371 1.00 48.92  ? 153 LYS D CD    1 
ATOM   5197 C  CE    . LYS F 3 153 ? 12.308 10.841  31.068 1.00 51.48  ? 153 LYS D CE    1 
ATOM   5198 N  NZ    . LYS F 3 153 ? 11.920 11.995  30.204 1.00 52.06  ? 153 LYS D NZ    1 
ATOM   5199 N  N     . ARG F 3 154 ? 17.293 7.879   30.304 1.00 39.47  ? 154 ARG D N     1 
ATOM   5200 C  CA    . ARG F 3 154 ? 17.980 7.878   29.019 1.00 34.89  ? 154 ARG D CA    1 
ATOM   5201 C  C     . ARG F 3 154 ? 18.438 6.473   28.656 1.00 33.65  ? 154 ARG D C     1 
ATOM   5202 O  O     . ARG F 3 154 ? 18.196 5.990   27.550 1.00 33.17  ? 154 ARG D O     1 
ATOM   5203 C  CB    . ARG F 3 154 ? 19.190 8.804   29.071 1.00 31.73  ? 154 ARG D CB    1 
ATOM   5204 C  CG    . ARG F 3 154 ? 19.936 8.887   27.770 1.00 29.63  ? 154 ARG D CG    1 
ATOM   5205 C  CD    . ARG F 3 154 ? 20.833 10.092  27.756 1.00 28.87  ? 154 ARG D CD    1 
ATOM   5206 N  NE    . ARG F 3 154 ? 22.086 9.819   28.445 1.00 29.99  ? 154 ARG D NE    1 
ATOM   5207 C  CZ    . ARG F 3 154 ? 23.267 10.259  28.028 1.00 31.78  ? 154 ARG D CZ    1 
ATOM   5208 N  NH1   . ARG F 3 154 ? 23.338 10.991  26.921 1.00 32.63  ? 154 ARG D NH1   1 
ATOM   5209 N  NH2   . ARG F 3 154 ? 24.371 9.973   28.712 1.00 30.10  ? 154 ARG D NH2   1 
ATOM   5210 N  N     . HIS F 3 155 ? 19.104 5.816   29.595 1.00 32.88  ? 155 HIS D N     1 
ATOM   5211 C  CA    . HIS F 3 155 ? 19.585 4.470   29.348 1.00 33.54  ? 155 HIS D CA    1 
ATOM   5212 C  C     . HIS F 3 155 ? 18.433 3.538   29.017 1.00 38.52  ? 155 HIS D C     1 
ATOM   5213 O  O     . HIS F 3 155 ? 18.571 2.659   28.171 1.00 41.74  ? 155 HIS D O     1 
ATOM   5214 C  CB    . HIS F 3 155 ? 20.325 3.934   30.567 1.00 29.43  ? 155 HIS D CB    1 
ATOM   5215 C  CG    . HIS F 3 155 ? 20.392 2.440   30.617 1.00 26.69  ? 155 HIS D CG    1 
ATOM   5216 N  ND1   . HIS F 3 155 ? 21.129 1.670   29.742 1.00 26.29  ? 155 HIS D ND1   1 
ATOM   5217 C  CD2   . HIS F 3 155 ? 19.805 1.566   31.473 1.00 24.86  ? 155 HIS D CD2   1 
ATOM   5218 C  CE1   . HIS F 3 155 ? 20.970 0.383   30.093 1.00 26.42  ? 155 HIS D CE1   1 
ATOM   5219 N  NE2   . HIS F 3 155 ? 20.174 0.272   31.140 1.00 25.10  ? 155 HIS D NE2   1 
ATOM   5220 N  N     . GLU F 3 156 ? 17.301 3.735   29.689 1.00 42.37  ? 156 GLU D N     1 
ATOM   5221 C  CA    . GLU F 3 156 ? 16.115 2.904   29.479 1.00 45.56  ? 156 GLU D CA    1 
ATOM   5222 C  C     . GLU F 3 156 ? 15.834 2.614   28.003 1.00 47.36  ? 156 GLU D C     1 
ATOM   5223 O  O     . GLU F 3 156 ? 15.454 1.493   27.648 1.00 49.66  ? 156 GLU D O     1 
ATOM   5224 C  CB    . GLU F 3 156 ? 14.881 3.567   30.101 1.00 46.98  ? 156 GLU D CB    1 
ATOM   5225 C  CG    . GLU F 3 156 ? 15.069 4.030   31.532 1.00 51.14  ? 156 GLU D CG    1 
ATOM   5226 C  CD    . GLU F 3 156 ? 14.308 3.175   32.522 1.00 53.67  ? 156 GLU D CD    1 
ATOM   5227 O  OE1   . GLU F 3 156 ? 14.087 1.984   32.224 1.00 55.82  ? 156 GLU D OE1   1 
ATOM   5228 O  OE2   . GLU F 3 156 ? 13.932 3.692   33.595 1.00 53.85  ? 156 GLU D OE2   1 
ATOM   5229 N  N     . LYS F 3 157 ? 16.022 3.618   27.148 1.00 45.05  ? 157 LYS D N     1 
ATOM   5230 C  CA    . LYS F 3 157 ? 15.775 3.467   25.714 1.00 44.95  ? 157 LYS D CA    1 
ATOM   5231 C  C     . LYS F 3 157 ? 16.335 2.168   25.125 1.00 42.51  ? 157 LYS D C     1 
ATOM   5232 O  O     . LYS F 3 157 ? 16.040 1.812   23.987 1.00 38.52  ? 157 LYS D O     1 
ATOM   5233 C  CB    . LYS F 3 157 ? 16.349 4.665   24.954 1.00 46.63  ? 157 LYS D CB    1 
ATOM   5234 C  CG    . LYS F 3 157 ? 15.968 6.018   25.536 1.00 47.26  ? 157 LYS D CG    1 
ATOM   5235 C  CD    . LYS F 3 157 ? 16.201 7.142   24.527 1.00 49.87  ? 157 LYS D CD    1 
ATOM   5236 C  CE    . LYS F 3 157 ? 17.689 7.357   24.232 1.00 51.00  ? 157 LYS D CE    1 
ATOM   5237 N  NZ    . LYS F 3 157 ? 17.933 8.218   23.029 1.00 52.19  ? 157 LYS D NZ    1 
ATOM   5238 N  N     . VAL F 3 158 ? 17.153 1.466   25.895 1.00 44.89  ? 158 VAL D N     1 
ATOM   5239 C  CA    . VAL F 3 158 ? 17.705 0.209   25.423 1.00 52.32  ? 158 VAL D CA    1 
ATOM   5240 C  C     . VAL F 3 158 ? 16.662 -0.881  25.641 1.00 54.51  ? 158 VAL D C     1 
ATOM   5241 O  O     . VAL F 3 158 ? 16.089 -1.387  24.681 1.00 56.51  ? 158 VAL D O     1 
ATOM   5242 C  CB    . VAL F 3 158 ? 19.004 -0.166  26.170 1.00 54.77  ? 158 VAL D CB    1 
ATOM   5243 C  CG1   . VAL F 3 158 ? 19.574 -1.467  25.606 1.00 54.52  ? 158 VAL D CG1   1 
ATOM   5244 C  CG2   . VAL F 3 158 ? 20.022 0.962   26.033 1.00 55.30  ? 158 VAL D CG2   1 
ATOM   5245 N  N     . HIS F 3 159 ? 16.412 -1.245  26.896 1.00 55.53  ? 159 HIS D N     1 
ATOM   5246 C  CA    . HIS F 3 159 ? 15.413 -2.271  27.176 1.00 58.87  ? 159 HIS D CA    1 
ATOM   5247 C  C     . HIS F 3 159 ? 14.026 -1.682  26.954 1.00 61.38  ? 159 HIS D C     1 
ATOM   5248 O  O     . HIS F 3 159 ? 13.360 -1.266  27.902 1.00 61.47  ? 159 HIS D O     1 
ATOM   5249 C  CB    . HIS F 3 159 ? 15.522 -2.777  28.617 1.00 59.48  ? 159 HIS D CB    1 
ATOM   5250 C  CG    . HIS F 3 159 ? 16.662 -2.186  29.383 1.00 62.88  ? 159 HIS D CG    1 
ATOM   5251 N  ND1   . HIS F 3 159 ? 17.879 -2.807  29.554 1.00 64.56  ? 159 HIS D ND1   1 
ATOM   5252 C  CD2   . HIS F 3 159 ? 16.753 -1.008  30.051 1.00 64.26  ? 159 HIS D CD2   1 
ATOM   5253 C  CE1   . HIS F 3 159 ? 18.650 -2.007  30.304 1.00 63.91  ? 159 HIS D CE1   1 
ATOM   5254 N  NE2   . HIS F 3 159 ? 18.011 -0.901  30.631 1.00 64.00  ? 159 HIS D NE2   1 
ATOM   5255 N  N     . ALA F 3 160 ? 13.601 -1.642  25.693 1.00 63.79  ? 160 ALA D N     1 
ATOM   5256 C  CA    . ALA F 3 160 ? 12.292 -1.107  25.331 1.00 64.64  ? 160 ALA D CA    1 
ATOM   5257 C  C     . ALA F 3 160 ? 11.895 -1.486  23.902 1.00 65.11  ? 160 ALA D C     1 
ATOM   5258 O  O     . ALA F 3 160 ? 12.447 -0.966  22.926 1.00 64.04  ? 160 ALA D O     1 
ATOM   5259 C  CB    . ALA F 3 160 ? 12.288 0.409   25.494 1.00 65.16  ? 160 ALA D CB    1 
ATOM   5260 N  N     . GLY F 3 161 ? 10.924 -2.388  23.790 1.00 66.74  ? 161 GLY D N     1 
ATOM   5261 C  CA    . GLY F 3 161 ? 10.460 -2.828  22.486 1.00 68.14  ? 161 GLY D CA    1 
ATOM   5262 C  C     . GLY F 3 161 ? 9.700  -4.137  22.580 1.00 69.55  ? 161 GLY D C     1 
ATOM   5263 O  O     . GLY F 3 161 ? 8.557  -4.160  23.035 1.00 70.26  ? 161 GLY D O     1 
ATOM   5264 N  N     . TYR F 3 162 ? 10.335 -5.227  22.158 1.00 71.10  ? 162 TYR D N     1 
ATOM   5265 C  CA    . TYR F 3 162 ? 9.717  -6.548  22.196 1.00 72.47  ? 162 TYR D CA    1 
ATOM   5266 C  C     . TYR F 3 162 ? 10.767 -7.647  22.139 1.00 73.87  ? 162 TYR D C     1 
ATOM   5267 O  O     . TYR F 3 162 ? 10.858 -8.373  21.150 1.00 73.22  ? 162 TYR D O     1 
ATOM   5268 C  CB    . TYR F 3 162 ? 8.763  -6.721  21.016 1.00 74.84  ? 162 TYR D CB    1 
ATOM   5269 C  CG    . TYR F 3 162 ? 7.447  -5.992  21.165 1.00 77.20  ? 162 TYR D CG    1 
ATOM   5270 C  CD1   . TYR F 3 162 ? 6.562  -6.312  22.195 1.00 77.92  ? 162 TYR D CD1   1 
ATOM   5271 C  CD2   . TYR F 3 162 ? 7.086  -4.979  20.275 1.00 77.84  ? 162 TYR D CD2   1 
ATOM   5272 C  CE1   . TYR F 3 162 ? 5.348  -5.641  22.336 1.00 78.37  ? 162 TYR D CE1   1 
ATOM   5273 C  CE2   . TYR F 3 162 ? 5.876  -4.303  20.406 1.00 78.57  ? 162 TYR D CE2   1 
ATOM   5274 C  CZ    . TYR F 3 162 ? 5.014  -4.639  21.438 1.00 79.02  ? 162 TYR D CZ    1 
ATOM   5275 O  OH    . TYR F 3 162 ? 3.820  -3.970  21.573 1.00 80.17  ? 162 TYR D OH    1 
ATOM   5276 N  N     . PRO F 3 163 ? 11.580 -7.785  23.198 1.00 77.34  ? 163 PRO D N     1 
ATOM   5277 C  CA    . PRO F 3 163 ? 12.608 -8.833  23.187 1.00 79.38  ? 163 PRO D CA    1 
ATOM   5278 C  C     . PRO F 3 163 ? 12.024 -10.247 23.209 1.00 79.78  ? 163 PRO D C     1 
ATOM   5279 O  O     . PRO F 3 163 ? 11.031 -10.520 23.889 1.00 78.67  ? 163 PRO D O     1 
ATOM   5280 C  CB    . PRO F 3 163 ? 13.452 -8.534  24.430 1.00 79.23  ? 163 PRO D CB    1 
ATOM   5281 C  CG    . PRO F 3 163 ? 12.540 -7.770  25.333 1.00 79.22  ? 163 PRO D CG    1 
ATOM   5282 C  CD    . PRO F 3 163 ? 11.604 -6.993  24.441 1.00 78.27  ? 163 PRO D CD    1 
ATOM   5283 N  N     . CYS F 3 164 ? 12.646 -11.138 22.447 1.00 81.52  ? 164 CYS D N     1 
ATOM   5284 C  CA    . CYS F 3 164 ? 12.207 -12.523 22.379 1.00 84.76  ? 164 CYS D CA    1 
ATOM   5285 C  C     . CYS F 3 164 ? 12.707 -13.258 23.614 1.00 87.69  ? 164 CYS D C     1 
ATOM   5286 O  O     . CYS F 3 164 ? 13.541 -12.739 24.361 1.00 86.58  ? 164 CYS D O     1 
ATOM   5287 C  CB    . CYS F 3 164 ? 12.764 -13.195 21.121 1.00 84.99  ? 164 CYS D CB    1 
ATOM   5288 S  SG    . CYS F 3 164 ? 14.060 -14.427 21.430 1.00 85.16  ? 164 CYS D SG    1 
ATOM   5289 N  N     . LYS F 3 165 ? 12.197 -14.469 23.820 1.00 91.43  ? 165 LYS D N     1 
ATOM   5290 C  CA    . LYS F 3 165 ? 12.593 -15.283 24.964 1.00 94.28  ? 165 LYS D CA    1 
ATOM   5291 C  C     . LYS F 3 165 ? 13.217 -16.597 24.510 1.00 94.75  ? 165 LYS D C     1 
ATOM   5292 O  O     . LYS F 3 165 ? 12.515 -17.581 24.275 1.00 93.98  ? 165 LYS D O     1 
ATOM   5293 C  CB    . LYS F 3 165 ? 11.378 -15.563 25.853 1.00 95.91  ? 165 LYS D CB    1 
ATOM   5294 C  CG    . LYS F 3 165 ? 10.785 -14.316 26.501 1.00 98.61  ? 165 LYS D CG    1 
ATOM   5295 C  CD    . LYS F 3 165 ? 11.807 -13.592 27.382 1.00 100.00 ? 165 LYS D CD    1 
ATOM   5296 C  CE    . LYS F 3 165 ? 11.759 -12.075 27.176 1.00 100.00 ? 165 LYS D CE    1 
ATOM   5297 N  NZ    . LYS F 3 165 ? 13.014 -11.394 27.624 1.00 100.00 ? 165 LYS D NZ    1 
ATOM   5298 N  N     . LYS F 3 166 ? 14.540 -16.604 24.387 1.00 96.35  ? 166 LYS D N     1 
ATOM   5299 C  CA    . LYS F 3 166 ? 15.261 -17.793 23.956 1.00 98.63  ? 166 LYS D CA    1 
ATOM   5300 C  C     . LYS F 3 166 ? 16.554 -17.965 24.739 1.00 99.00  ? 166 LYS D C     1 
ATOM   5301 O  O     . LYS F 3 166 ? 17.641 -17.997 24.160 1.00 98.27  ? 166 LYS D O     1 
ATOM   5302 C  CB    . LYS F 3 166 ? 15.573 -17.708 22.458 1.00 99.78  ? 166 LYS D CB    1 
ATOM   5303 C  CG    . LYS F 3 166 ? 15.040 -18.879 21.644 1.00 99.68  ? 166 LYS D CG    1 
ATOM   5304 C  CD    . LYS F 3 166 ? 13.523 -18.960 21.724 1.00 99.38  ? 166 LYS D CD    1 
ATOM   5305 C  CE    . LYS F 3 166 ? 13.077 -20.151 22.556 1.00 99.05  ? 166 LYS D CE    1 
ATOM   5306 N  NZ    . LYS F 3 166 ? 13.347 -19.973 24.013 1.00 97.41  ? 166 LYS D NZ    1 
ATOM   5307 N  N     . ASP F 3 167 ? 16.424 -18.071 26.059 1.00 99.69  ? 167 ASP D N     1 
ATOM   5308 C  CA    . ASP F 3 167 ? 17.572 -18.245 26.944 1.00 99.98  ? 167 ASP D CA    1 
ATOM   5309 C  C     . ASP F 3 167 ? 18.510 -17.048 26.847 1.00 99.76  ? 167 ASP D C     1 
ATOM   5310 O  O     . ASP F 3 167 ? 18.460 -16.292 25.877 1.00 99.78  ? 167 ASP D O     1 
ATOM   5311 C  CB    . ASP F 3 167 ? 18.324 -19.532 26.580 1.00 100.00 ? 167 ASP D CB    1 
ATOM   5312 C  CG    . ASP F 3 167 ? 19.715 -19.593 27.186 1.00 100.00 ? 167 ASP D CG    1 
ATOM   5313 O  OD1   . ASP F 3 167 ? 19.848 -19.359 28.408 1.00 99.73  ? 167 ASP D OD1   1 
ATOM   5314 O  OD2   . ASP F 3 167 ? 20.674 -19.879 26.437 1.00 100.00 ? 167 ASP D OD2   1 
ATOM   5315 N  N     . ASP F 3 168 ? 19.360 -16.874 27.855 1.00 99.28  ? 168 ASP D N     1 
ATOM   5316 C  CA    . ASP F 3 168 ? 20.305 -15.764 27.862 1.00 99.63  ? 168 ASP D CA    1 
ATOM   5317 C  C     . ASP F 3 168 ? 21.066 -15.699 26.539 1.00 99.32  ? 168 ASP D C     1 
ATOM   5318 O  O     . ASP F 3 168 ? 21.541 -14.633 26.141 1.00 100.00 ? 168 ASP D O     1 
ATOM   5319 C  CB    . ASP F 3 168 ? 21.290 -15.905 29.025 1.00 99.34  ? 168 ASP D CB    1 
ATOM   5320 C  CG    . ASP F 3 168 ? 21.403 -14.634 29.852 1.00 99.17  ? 168 ASP D CG    1 
ATOM   5321 O  OD1   . ASP F 3 168 ? 21.232 -13.532 29.288 1.00 98.30  ? 168 ASP D OD1   1 
ATOM   5322 O  OD2   . ASP F 3 168 ? 21.664 -14.737 31.069 1.00 100.00 ? 168 ASP D OD2   1 
ATOM   5323 N  N     . SER F 3 169 ? 21.181 -16.841 25.863 1.00 97.39  ? 169 SER D N     1 
ATOM   5324 C  CA    . SER F 3 169 ? 21.868 -16.899 24.575 1.00 96.20  ? 169 SER D CA    1 
ATOM   5325 C  C     . SER F 3 169 ? 21.322 -15.756 23.730 1.00 96.15  ? 169 SER D C     1 
ATOM   5326 O  O     . SER F 3 169 ? 22.020 -14.779 23.455 1.00 95.46  ? 169 SER D O     1 
ATOM   5327 C  CB    . SER F 3 169 ? 21.595 -18.238 23.882 1.00 95.22  ? 169 SER D CB    1 
ATOM   5328 O  OG    . SER F 3 169 ? 20.234 -18.610 24.005 1.00 93.83  ? 169 SER D OG    1 
ATOM   5329 N  N     . CYS F 3 170 ? 20.065 -15.887 23.327 1.00 96.82  ? 170 CYS D N     1 
ATOM   5330 C  CA    . CYS F 3 170 ? 19.406 -14.852 22.546 1.00 97.88  ? 170 CYS D CA    1 
ATOM   5331 C  C     . CYS F 3 170 ? 18.994 -13.787 23.555 1.00 98.77  ? 170 CYS D C     1 
ATOM   5332 O  O     . CYS F 3 170 ? 18.428 -14.109 24.601 1.00 99.08  ? 170 CYS D O     1 
ATOM   5333 C  CB    . CYS F 3 170 ? 18.169 -15.426 21.847 1.00 97.98  ? 170 CYS D CB    1 
ATOM   5334 S  SG    . CYS F 3 170 ? 17.202 -14.223 20.898 1.00 98.64  ? 170 CYS D SG    1 
ATOM   5335 N  N     . SER F 3 171 ? 19.283 -12.524 23.262 1.00 99.16  ? 171 SER D N     1 
ATOM   5336 C  CA    . SER F 3 171 ? 18.923 -11.458 24.189 1.00 99.87  ? 171 SER D CA    1 
ATOM   5337 C  C     . SER F 3 171 ? 18.627 -10.125 23.509 1.00 99.82  ? 171 SER D C     1 
ATOM   5338 O  O     . SER F 3 171 ? 18.682 -9.072  24.145 1.00 100.00 ? 171 SER D O     1 
ATOM   5339 C  CB    . SER F 3 171 ? 20.036 -11.274 25.225 1.00 100.00 ? 171 SER D CB    1 
ATOM   5340 O  OG    . SER F 3 171 ? 19.911 -12.214 26.278 1.00 99.92  ? 171 SER D OG    1 
ATOM   5341 N  N     . PHE F 3 172 ? 18.309 -10.169 22.220 1.00 99.19  ? 172 PHE D N     1 
ATOM   5342 C  CA    . PHE F 3 172 ? 18.004 -8.947  21.486 1.00 98.43  ? 172 PHE D CA    1 
ATOM   5343 C  C     . PHE F 3 172 ? 16.667 -8.368  21.937 1.00 96.08  ? 172 PHE D C     1 
ATOM   5344 O  O     . PHE F 3 172 ? 15.763 -9.102  22.338 1.00 95.39  ? 172 PHE D O     1 
ATOM   5345 C  CB    . PHE F 3 172 ? 17.952 -9.223  19.981 1.00 99.86  ? 172 PHE D CB    1 
ATOM   5346 C  CG    . PHE F 3 172 ? 17.111 -8.237  19.214 1.00 100.00 ? 172 PHE D CG    1 
ATOM   5347 C  CD1   . PHE F 3 172 ? 17.495 -6.901  19.118 1.00 99.82  ? 172 PHE D CD1   1 
ATOM   5348 C  CD2   . PHE F 3 172 ? 15.927 -8.639  18.603 1.00 100.00 ? 172 PHE D CD2   1 
ATOM   5349 C  CE1   . PHE F 3 172 ? 16.712 -5.980  18.426 1.00 100.00 ? 172 PHE D CE1   1 
ATOM   5350 C  CE2   . PHE F 3 172 ? 15.135 -7.726  17.908 1.00 100.00 ? 172 PHE D CE2   1 
ATOM   5351 C  CZ    . PHE F 3 172 ? 15.529 -6.393  17.820 1.00 100.00 ? 172 PHE D CZ    1 
ATOM   5352 N  N     . VAL F 3 173 ? 16.551 -7.046  21.871 1.00 94.00  ? 173 VAL D N     1 
ATOM   5353 C  CA    . VAL F 3 173 ? 15.321 -6.372  22.257 1.00 92.88  ? 173 VAL D CA    1 
ATOM   5354 C  C     . VAL F 3 173 ? 14.270 -6.607  21.178 1.00 91.77  ? 173 VAL D C     1 
ATOM   5355 O  O     . VAL F 3 173 ? 14.048 -7.743  20.762 1.00 92.44  ? 173 VAL D O     1 
ATOM   5356 C  CB    . VAL F 3 173 ? 15.543 -4.856  22.428 1.00 93.40  ? 173 VAL D CB    1 
ATOM   5357 C  CG1   . VAL F 3 173 ? 16.154 -4.576  23.794 1.00 93.28  ? 173 VAL D CG1   1 
ATOM   5358 C  CG2   . VAL F 3 173 ? 16.443 -4.332  21.317 1.00 92.99  ? 173 VAL D CG2   1 
ATOM   5359 N  N     . GLY F 3 174 ? 13.629 -5.537  20.719 1.00 89.78  ? 174 GLY D N     1 
ATOM   5360 C  CA    . GLY F 3 174 ? 12.613 -5.683  19.695 1.00 88.47  ? 174 GLY D CA    1 
ATOM   5361 C  C     . GLY F 3 174 ? 11.922 -4.376  19.393 1.00 88.39  ? 174 GLY D C     1 
ATOM   5362 O  O     . GLY F 3 174 ? 10.861 -4.088  19.940 1.00 87.13  ? 174 GLY D O     1 
ATOM   5363 N  N     . LYS F 3 175 ? 12.533 -3.585  18.517 1.00 90.87  ? 175 LYS D N     1 
ATOM   5364 C  CA    . LYS F 3 175 ? 11.995 -2.288  18.116 1.00 93.36  ? 175 LYS D CA    1 
ATOM   5365 C  C     . LYS F 3 175 ? 10.465 -2.283  18.118 1.00 92.85  ? 175 LYS D C     1 
ATOM   5366 O  O     . LYS F 3 175 ? 9.835  -1.539  18.876 1.00 92.09  ? 175 LYS D O     1 
ATOM   5367 C  CB    . LYS F 3 175 ? 12.511 -1.918  16.717 1.00 95.01  ? 175 LYS D CB    1 
ATOM   5368 C  CG    . LYS F 3 175 ? 13.852 -1.188  16.705 1.00 96.72  ? 175 LYS D CG    1 
ATOM   5369 C  CD    . LYS F 3 175 ? 15.033 -2.124  16.506 1.00 97.96  ? 175 LYS D CD    1 
ATOM   5370 C  CE    . LYS F 3 175 ? 15.903 -2.220  17.754 1.00 98.92  ? 175 LYS D CE    1 
ATOM   5371 N  NZ    . LYS F 3 175 ? 15.446 -3.303  18.674 1.00 98.98  ? 175 LYS D NZ    1 
ATOM   5372 N  N     . THR F 3 176 ? 9.875  -3.123  17.272 1.00 92.30  ? 176 THR D N     1 
ATOM   5373 C  CA    . THR F 3 176 ? 8.423  -3.220  17.168 1.00 90.85  ? 176 THR D CA    1 
ATOM   5374 C  C     . THR F 3 176 ? 7.999  -4.648  16.822 1.00 88.66  ? 176 THR D C     1 
ATOM   5375 O  O     . THR F 3 176 ? 8.780  -5.409  16.252 1.00 89.20  ? 176 THR D O     1 
ATOM   5376 C  CB    . THR F 3 176 ? 7.881  -2.261  16.082 1.00 91.54  ? 176 THR D CB    1 
ATOM   5377 O  OG1   . THR F 3 176 ? 8.741  -1.119  15.978 1.00 92.04  ? 176 THR D OG1   1 
ATOM   5378 C  CG2   . THR F 3 176 ? 6.475  -1.799  16.433 1.00 91.91  ? 176 THR D CG2   1 
ATOM   5379 N  N     . TRP F 3 177 ? 6.762  -4.999  17.169 1.00 85.57  ? 177 TRP D N     1 
ATOM   5380 C  CA    . TRP F 3 177 ? 6.213  -6.331  16.903 1.00 82.25  ? 177 TRP D CA    1 
ATOM   5381 C  C     . TRP F 3 177 ? 6.554  -6.840  15.505 1.00 81.70  ? 177 TRP D C     1 
ATOM   5382 O  O     . TRP F 3 177 ? 7.222  -7.864  15.354 1.00 80.06  ? 177 TRP D O     1 
ATOM   5383 C  CB    . TRP F 3 177 ? 4.691  -6.313  17.075 1.00 78.57  ? 177 TRP D CB    1 
ATOM   5384 C  CG    . TRP F 3 177 ? 4.098  -7.654  17.398 1.00 73.78  ? 177 TRP D CG    1 
ATOM   5385 C  CD1   . TRP F 3 177 ? 3.813  -8.661  16.520 1.00 71.83  ? 177 TRP D CD1   1 
ATOM   5386 C  CD2   . TRP F 3 177 ? 3.712  -8.130  18.691 1.00 71.14  ? 177 TRP D CD2   1 
ATOM   5387 N  NE1   . TRP F 3 177 ? 3.272  -9.735  17.186 1.00 69.87  ? 177 TRP D NE1   1 
ATOM   5388 C  CE2   . TRP F 3 177 ? 3.200  -9.435  18.520 1.00 70.32  ? 177 TRP D CE2   1 
ATOM   5389 C  CE3   . TRP F 3 177 ? 3.750  -7.579  19.977 1.00 69.60  ? 177 TRP D CE3   1 
ATOM   5390 C  CZ2   . TRP F 3 177 ? 2.728  -10.199 19.590 1.00 70.18  ? 177 TRP D CZ2   1 
ATOM   5391 C  CZ3   . TRP F 3 177 ? 3.281  -8.339  21.041 1.00 70.30  ? 177 TRP D CZ3   1 
ATOM   5392 C  CH2   . TRP F 3 177 ? 2.777  -9.636  20.839 1.00 70.36  ? 177 TRP D CH2   1 
ATOM   5393 N  N     . THR F 3 178 ? 6.082  -6.119  14.492 1.00 82.64  ? 178 THR D N     1 
ATOM   5394 C  CA    . THR F 3 178 ? 6.330  -6.476  13.100 1.00 85.20  ? 178 THR D CA    1 
ATOM   5395 C  C     . THR F 3 178 ? 7.781  -6.896  12.903 1.00 84.13  ? 178 THR D C     1 
ATOM   5396 O  O     . THR F 3 178 ? 8.063  -7.907  12.255 1.00 84.69  ? 178 THR D O     1 
ATOM   5397 C  CB    . THR F 3 178 ? 6.032  -5.290  12.160 1.00 88.12  ? 178 THR D CB    1 
ATOM   5398 O  OG1   . THR F 3 178 ? 7.155  -4.399  12.144 1.00 90.36  ? 178 THR D OG1   1 
ATOM   5399 C  CG2   . THR F 3 178 ? 4.794  -4.533  12.631 1.00 88.76  ? 178 THR D CG2   1 
ATOM   5400 N  N     . LEU F 3 179 ? 8.694  -6.114  13.473 1.00 81.72  ? 179 LEU D N     1 
ATOM   5401 C  CA    . LEU F 3 179 ? 10.125 -6.386  13.379 1.00 79.12  ? 179 LEU D CA    1 
ATOM   5402 C  C     . LEU F 3 179 ? 10.533 -7.468  14.379 1.00 77.74  ? 179 LEU D C     1 
ATOM   5403 O  O     . LEU F 3 179 ? 11.439 -8.267  14.122 1.00 76.23  ? 179 LEU D O     1 
ATOM   5404 C  CB    . LEU F 3 179 ? 10.917 -5.100  13.643 1.00 76.28  ? 179 LEU D CB    1 
ATOM   5405 C  CG    . LEU F 3 179 ? 10.191 -3.797  13.294 1.00 75.13  ? 179 LEU D CG    1 
ATOM   5406 C  CD1   . LEU F 3 179 ? 10.910 -2.617  13.927 1.00 74.84  ? 179 LEU D CD1   1 
ATOM   5407 C  CD2   . LEU F 3 179 ? 10.125 -3.638  11.781 1.00 74.20  ? 179 LEU D CD2   1 
ATOM   5408 N  N     . TYR F 3 180 ? 9.847  -7.487  15.517 1.00 76.01  ? 180 TYR D N     1 
ATOM   5409 C  CA    . TYR F 3 180 ? 10.117 -8.451  16.569 1.00 73.81  ? 180 TYR D CA    1 
ATOM   5410 C  C     . TYR F 3 180 ? 9.746  -9.834  16.087 1.00 72.75  ? 180 TYR D C     1 
ATOM   5411 O  O     . TYR F 3 180 ? 10.470 -10.796 16.321 1.00 72.78  ? 180 TYR D O     1 
ATOM   5412 C  CB    . TYR F 3 180 ? 9.315  -8.097  17.821 1.00 75.37  ? 180 TYR D CB    1 
ATOM   5413 C  CG    . TYR F 3 180 ? 8.513  -9.242  18.406 1.00 78.03  ? 180 TYR D CG    1 
ATOM   5414 C  CD1   . TYR F 3 180 ? 9.147  -10.333 19.001 1.00 78.90  ? 180 TYR D CD1   1 
ATOM   5415 C  CD2   . TYR F 3 180 ? 7.118  -9.226  18.381 1.00 78.55  ? 180 TYR D CD2   1 
ATOM   5416 C  CE1   . TYR F 3 180 ? 8.411  -11.379 19.555 1.00 79.44  ? 180 TYR D CE1   1 
ATOM   5417 C  CE2   . TYR F 3 180 ? 6.374  -10.265 18.933 1.00 78.63  ? 180 TYR D CE2   1 
ATOM   5418 C  CZ    . TYR F 3 180 ? 7.025  -11.336 19.516 1.00 79.12  ? 180 TYR D CZ    1 
ATOM   5419 O  OH    . TYR F 3 180 ? 6.287  -12.365 20.047 1.00 80.05  ? 180 TYR D OH    1 
ATOM   5420 N  N     . LEU F 3 181 ? 8.607  -9.933  15.420 1.00 73.16  ? 181 LEU D N     1 
ATOM   5421 C  CA    . LEU F 3 181 ? 8.157  -11.214 14.908 1.00 76.59  ? 181 LEU D CA    1 
ATOM   5422 C  C     . LEU F 3 181 ? 9.281  -11.847 14.092 1.00 78.00  ? 181 LEU D C     1 
ATOM   5423 O  O     . LEU F 3 181 ? 9.720  -12.965 14.373 1.00 76.51  ? 181 LEU D O     1 
ATOM   5424 C  CB    . LEU F 3 181 ? 6.915  -11.028 14.030 1.00 77.38  ? 181 LEU D CB    1 
ATOM   5425 C  CG    . LEU F 3 181 ? 5.540  -10.922 14.706 1.00 77.48  ? 181 LEU D CG    1 
ATOM   5426 C  CD1   . LEU F 3 181 ? 4.455  -11.177 13.668 1.00 77.44  ? 181 LEU D CD1   1 
ATOM   5427 C  CD2   . LEU F 3 181 ? 5.421  -11.919 15.850 1.00 77.79  ? 181 LEU D CD2   1 
ATOM   5428 N  N     . LYS F 3 182 ? 9.748  -11.111 13.087 1.00 79.36  ? 182 LYS D N     1 
ATOM   5429 C  CA    . LYS F 3 182 ? 10.815 -11.581 12.213 1.00 81.21  ? 182 LYS D CA    1 
ATOM   5430 C  C     . LYS F 3 182 ? 11.965 -12.231 12.982 1.00 82.44  ? 182 LYS D C     1 
ATOM   5431 O  O     . LYS F 3 182 ? 12.393 -13.336 12.648 1.00 81.63  ? 182 LYS D O     1 
ATOM   5432 C  CB    . LYS F 3 182 ? 11.343 -10.418 11.370 1.00 81.60  ? 182 LYS D CB    1 
ATOM   5433 C  CG    . LYS F 3 182 ? 10.253 -9.640  10.651 1.00 82.60  ? 182 LYS D CG    1 
ATOM   5434 C  CD    . LYS F 3 182 ? 10.830 -8.493  9.827  1.00 83.85  ? 182 LYS D CD    1 
ATOM   5435 C  CE    . LYS F 3 182 ? 10.127 -7.170  10.137 1.00 84.46  ? 182 LYS D CE    1 
ATOM   5436 N  NZ    . LYS F 3 182 ? 9.918  -6.313  8.930  1.00 84.53  ? 182 LYS D NZ    1 
ATOM   5437 N  N     . HIS F 3 183 ? 12.461 -11.547 14.011 1.00 83.70  ? 183 HIS D N     1 
ATOM   5438 C  CA    . HIS F 3 183 ? 13.565 -12.070 14.816 1.00 83.87  ? 183 HIS D CA    1 
ATOM   5439 C  C     . HIS F 3 183 ? 13.307 -13.528 15.191 1.00 84.18  ? 183 HIS D C     1 
ATOM   5440 O  O     . HIS F 3 183 ? 14.229 -14.344 15.234 1.00 82.43  ? 183 HIS D O     1 
ATOM   5441 C  CB    . HIS F 3 183 ? 13.744 -11.224 16.083 1.00 83.57  ? 183 HIS D CB    1 
ATOM   5442 C  CG    . HIS F 3 183 ? 14.790 -11.747 17.020 1.00 83.48  ? 183 HIS D CG    1 
ATOM   5443 N  ND1   . HIS F 3 183 ? 16.104 -11.334 17.023 1.00 83.42  ? 183 HIS D ND1   1 
ATOM   5444 C  CD2   . HIS F 3 183 ? 14.696 -12.672 18.009 1.00 83.60  ? 183 HIS D CD2   1 
ATOM   5445 C  CE1   . HIS F 3 183 ? 16.747 -12.006 17.992 1.00 82.81  ? 183 HIS D CE1   1 
ATOM   5446 N  NE2   . HIS F 3 183 ? 15.933 -12.833 18.620 1.00 83.16  ? 183 HIS D NE2   1 
ATOM   5447 N  N     . VAL F 3 184 ? 12.045 -13.846 15.464 1.00 85.29  ? 184 VAL D N     1 
ATOM   5448 C  CA    . VAL F 3 184 ? 11.666 -15.205 15.821 1.00 86.05  ? 184 VAL D CA    1 
ATOM   5449 C  C     . VAL F 3 184 ? 11.609 -16.022 14.543 1.00 87.76  ? 184 VAL D C     1 
ATOM   5450 O  O     . VAL F 3 184 ? 12.282 -17.043 14.411 1.00 87.45  ? 184 VAL D O     1 
ATOM   5451 C  CB    . VAL F 3 184 ? 10.278 -15.257 16.492 1.00 84.76  ? 184 VAL D CB    1 
ATOM   5452 C  CG1   . VAL F 3 184 ? 10.124 -16.559 17.266 1.00 83.44  ? 184 VAL D CG1   1 
ATOM   5453 C  CG2   . VAL F 3 184 ? 10.097 -14.062 17.414 1.00 84.63  ? 184 VAL D CG2   1 
ATOM   5454 N  N     . ALA F 3 185 ? 10.800 -15.554 13.599 1.00 89.44  ? 185 ALA D N     1 
ATOM   5455 C  CA    . ALA F 3 185 ? 10.648 -16.232 12.322 1.00 92.06  ? 185 ALA D CA    1 
ATOM   5456 C  C     . ALA F 3 185 ? 11.958 -16.208 11.545 1.00 92.94  ? 185 ALA D C     1 
ATOM   5457 O  O     . ALA F 3 185 ? 12.704 -17.190 11.541 1.00 93.00  ? 185 ALA D O     1 
ATOM   5458 C  CB    . ALA F 3 185 ? 9.543  -15.571 11.509 1.00 92.65  ? 185 ALA D CB    1 
ATOM   5459 N  N     . GLU F 3 186 ? 12.232 -15.081 10.893 1.00 94.14  ? 186 GLU D N     1 
ATOM   5460 C  CA    . GLU F 3 186 ? 13.448 -14.915 10.104 1.00 96.21  ? 186 GLU D CA    1 
ATOM   5461 C  C     . GLU F 3 186 ? 14.657 -15.571 10.766 1.00 97.43  ? 186 GLU D C     1 
ATOM   5462 O  O     . GLU F 3 186 ? 15.533 -16.112 10.084 1.00 98.29  ? 186 GLU D O     1 
ATOM   5463 C  CB    . GLU F 3 186 ? 13.730 -13.427 9.870  1.00 95.98  ? 186 GLU D CB    1 
ATOM   5464 C  CG    . GLU F 3 186 ? 14.816 -13.160 8.830  1.00 96.59  ? 186 GLU D CG    1 
ATOM   5465 C  CD    . GLU F 3 186 ? 14.255 -12.831 7.455  1.00 96.51  ? 186 GLU D CD    1 
ATOM   5466 O  OE1   . GLU F 3 186 ? 13.032 -12.594 7.352  1.00 96.83  ? 186 GLU D OE1   1 
ATOM   5467 O  OE2   . GLU F 3 186 ? 15.037 -12.808 6.478  1.00 95.51  ? 186 GLU D OE2   1 
ATOM   5468 N  N     . CYS F 3 187 ? 14.701 -15.524 12.093 1.00 97.63  ? 187 CYS D N     1 
ATOM   5469 C  CA    . CYS F 3 187 ? 15.801 -16.133 12.823 1.00 99.13  ? 187 CYS D CA    1 
ATOM   5470 C  C     . CYS F 3 187 ? 15.301 -17.226 13.766 1.00 99.49  ? 187 CYS D C     1 
ATOM   5471 O  O     . CYS F 3 187 ? 14.394 -17.987 13.420 1.00 98.35  ? 187 CYS D O     1 
ATOM   5472 C  CB    . CYS F 3 187 ? 16.581 -15.069 13.603 1.00 99.85  ? 187 CYS D CB    1 
ATOM   5473 S  SG    . CYS F 3 187 ? 18.363 -15.048 13.236 1.00 100.00 ? 187 CYS D SG    1 
ATOM   5474 N  N     . HIS F 3 188 ? 15.897 -17.305 14.951 1.00 100.00 ? 188 HIS D N     1 
ATOM   5475 C  CA    . HIS F 3 188 ? 15.519 -18.315 15.934 1.00 100.00 ? 188 HIS D CA    1 
ATOM   5476 C  C     . HIS F 3 188 ? 15.802 -19.717 15.396 1.00 99.97  ? 188 HIS D C     1 
ATOM   5477 O  O     . HIS F 3 188 ? 16.539 -20.494 16.007 1.00 100.00 ? 188 HIS D O     1 
ATOM   5478 C  CB    . HIS F 3 188 ? 14.033 -18.189 16.281 1.00 99.62  ? 188 HIS D CB    1 
ATOM   5479 C  CG    . HIS F 3 188 ? 13.751 -17.235 17.399 1.00 99.19  ? 188 HIS D CG    1 
ATOM   5480 N  ND1   . HIS F 3 188 ? 12.778 -17.433 18.354 1.00 99.01  ? 188 HIS D ND1   1 
ATOM   5481 C  CD2   . HIS F 3 188 ? 14.333 -16.049 17.708 1.00 98.45  ? 188 HIS D CD2   1 
ATOM   5482 C  CE1   . HIS F 3 188 ? 12.801 -16.387 19.188 1.00 98.56  ? 188 HIS D CE1   1 
ATOM   5483 N  NE2   . HIS F 3 188 ? 13.729 -15.521 18.835 1.00 98.19  ? 188 HIS D NE2   1 
HETATM 5484 ZN ZN    . ZN  G 4 .   ? 46.613 69.805  24.788 1.00 27.07  ? 201 ZN  A ZN    1 
HETATM 5485 ZN ZN    . ZN  H 4 .   ? 29.247 50.312  29.469 1.00 64.89  ? 202 ZN  A ZN    1 
HETATM 5486 ZN ZN    . ZN  I 4 .   ? 46.900 28.975  21.724 1.00 84.21  ? 203 ZN  A ZN    1 
HETATM 5487 ZN ZN    . ZN  J 4 .   ? 52.958 17.256  26.009 1.00 24.01  ? 204 ZN  A ZN    1 
HETATM 5488 ZN ZN    . ZN  K 4 .   ? 62.070 7.973   49.429 1.00 32.91  ? 205 ZN  A ZN    1 
HETATM 5489 ZN ZN    . ZN  L 4 .   ? 71.843 -2.504  62.325 1.00 100.00 ? 206 ZN  A ZN    1 
HETATM 5490 ZN ZN    . ZN  M 4 .   ? 6.122  61.262  57.602 1.00 12.75  ? 201 ZN  D ZN    1 
HETATM 5491 ZN ZN    . ZN  N 4 .   ? 29.890 50.836  52.344 1.00 91.98  ? 202 ZN  D ZN    1 
HETATM 5492 ZN ZN    . ZN  O 4 .   ? 23.858 24.536  60.721 1.00 100.00 ? 203 ZN  D ZN    1 
HETATM 5493 ZN ZN    . ZN  P 4 .   ? 23.583 10.918  55.381 1.00 40.19  ? 204 ZN  D ZN    1 
HETATM 5494 ZN ZN    . ZN  Q 4 .   ? 19.095 -1.056  32.130 1.00 49.10  ? 205 ZN  D ZN    1 
HETATM 5495 ZN ZN    . ZN  R 4 .   ? 15.247 -14.658 19.457 1.00 100.00 ? 206 ZN  D ZN    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   B . n 
A 1 2   DC  2   2   2   DC  C   B . n 
A 1 3   DG  3   3   3   DG  G   B . n 
A 1 4   DG  4   4   4   DG  G   B . n 
A 1 5   DG  5   5   5   DG  G   B . n 
A 1 6   DC  6   6   6   DC  C   B . n 
A 1 7   DC  7   7   7   DC  C   B . n 
A 1 8   DT  8   8   8   DT  T   B . n 
A 1 9   DG  9   9   9   DG  G   B . n 
A 1 10  DG  10  10  10  DG  G   B . n 
A 1 11  DT  11  11  11  DT  T   B . n 
A 1 12  DT  12  12  12  DT  T   B . n 
A 1 13  DA  13  13  13  DA  A   B . n 
A 1 14  DG  14  14  14  DG  G   B . n 
A 1 15  DT  15  15  15  DT  T   B . n 
A 1 16  DA  16  16  16  DA  A   B . n 
A 1 17  DC  17  17  17  DC  C   B . n 
A 1 18  DC  18  18  18  DC  C   B . n 
A 1 19  DT  19  19  19  DT  T   B . n 
A 1 20  DG  20  20  20  DG  G   B . n 
A 1 21  DG  21  21  21  DG  G   B . n 
A 1 22  DA  22  22  22  DA  A   B . n 
A 1 23  DT  23  23  23  DT  T   B . n 
A 1 24  DG  24  24  24  DG  G   B . n 
A 1 25  DG  25  25  25  DG  G   B . n 
A 1 26  DG  26  26  26  DG  G   B . n 
A 1 27  DA  27  27  27  DA  A   B . n 
A 1 28  DG  28  28  28  DG  G   B . n 
A 1 29  DA  29  29  29  DA  A   B . n 
A 1 30  DC  30  30  30  DC  C   B . n 
A 1 31  DC  31  31  31  DC  C   B . n 
B 2 1   DT  1   33  33  DT  T   C . n 
B 2 2   DG  2   34  34  DG  G   C . n 
B 2 3   DG  3   35  35  DG  G   C . n 
B 2 4   DT  4   36  36  DT  T   C . n 
B 2 5   DC  5   37  37  DC  C   C . n 
B 2 6   DT  6   38  38  DT  T   C . n 
B 2 7   DC  7   39  39  DC  C   C . n 
B 2 8   DC  8   40  40  DC  C   C . n 
B 2 9   DC  9   41  41  DC  C   C . n 
B 2 10  DA  10  42  42  DA  A   C . n 
B 2 11  DT  11  43  43  DT  T   C . n 
B 2 12  DC  12  44  44  DC  C   C . n 
B 2 13  DC  13  45  45  DC  C   C . n 
B 2 14  DA  14  46  46  DA  A   C . n 
B 2 15  DG  15  47  47  DG  G   C . n 
B 2 16  DG  16  48  48  DG  G   C . n 
B 2 17  DT  17  49  49  DT  T   C . n 
B 2 18  DA  18  50  50  DA  A   C . n 
B 2 19  DC  19  51  51  DC  C   C . n 
B 2 20  DT  20  52  52  DT  T   C . n 
B 2 21  DA  21  53  53  DA  A   C . n 
B 2 22  DA  22  54  54  DA  A   C . n 
B 2 23  DC  23  55  55  DC  C   C . n 
B 2 24  DC  24  56  56  DC  C   C . n 
B 2 25  DA  25  57  57  DA  A   C . n 
B 2 26  DG  26  58  58  DG  G   C . n 
B 2 27  DG  27  59  59  DG  G   C . n 
B 2 28  DC  28  60  60  DC  C   C . n 
B 2 29  DC  29  61  61  DC  C   C . n 
B 2 30  DC  30  62  62  DC  C   C . n 
B 2 31  DG  31  63  63  DG  G   C . n 
C 1 1   DA  1   1   1   DA  A   E . n 
C 1 2   DC  2   2   2   DC  C   E . n 
C 1 3   DG  3   3   3   DG  G   E . n 
C 1 4   DG  4   4   4   DG  G   E . n 
C 1 5   DG  5   5   5   DG  G   E . n 
C 1 6   DC  6   6   6   DC  C   E . n 
C 1 7   DC  7   7   7   DC  C   E . n 
C 1 8   DT  8   8   8   DT  T   E . n 
C 1 9   DG  9   9   9   DG  G   E . n 
C 1 10  DG  10  10  10  DG  G   E . n 
C 1 11  DT  11  11  11  DT  T   E . n 
C 1 12  DT  12  12  12  DT  T   E . n 
C 1 13  DA  13  13  13  DA  A   E . n 
C 1 14  DG  14  14  14  DG  G   E . n 
C 1 15  DT  15  15  15  DT  T   E . n 
C 1 16  DA  16  16  16  DA  A   E . n 
C 1 17  DC  17  17  17  DC  C   E . n 
C 1 18  DC  18  18  18  DC  C   E . n 
C 1 19  DT  19  19  19  DT  T   E . n 
C 1 20  DG  20  20  20  DG  G   E . n 
C 1 21  DG  21  21  21  DG  G   E . n 
C 1 22  DA  22  22  22  DA  A   E . n 
C 1 23  DT  23  23  23  DT  T   E . n 
C 1 24  DG  24  24  24  DG  G   E . n 
C 1 25  DG  25  25  25  DG  G   E . n 
C 1 26  DG  26  26  26  DG  G   E . n 
C 1 27  DA  27  27  27  DA  A   E . n 
C 1 28  DG  28  28  28  DG  G   E . n 
C 1 29  DA  29  29  29  DA  A   E . n 
C 1 30  DC  30  30  30  DC  C   E . n 
C 1 31  DC  31  31  31  DC  C   E . n 
D 2 1   DT  1   33  33  DT  T   F . n 
D 2 2   DG  2   34  34  DG  G   F . n 
D 2 3   DG  3   35  35  DG  G   F . n 
D 2 4   DT  4   36  36  DT  T   F . n 
D 2 5   DC  5   37  37  DC  C   F . n 
D 2 6   DT  6   38  38  DT  T   F . n 
D 2 7   DC  7   39  39  DC  C   F . n 
D 2 8   DC  8   40  40  DC  C   F . n 
D 2 9   DC  9   41  41  DC  C   F . n 
D 2 10  DA  10  42  42  DA  A   F . n 
D 2 11  DT  11  43  43  DT  T   F . n 
D 2 12  DC  12  44  44  DC  C   F . n 
D 2 13  DC  13  45  45  DC  C   F . n 
D 2 14  DA  14  46  46  DA  A   F . n 
D 2 15  DG  15  47  47  DG  G   F . n 
D 2 16  DG  16  48  48  DG  G   F . n 
D 2 17  DT  17  49  49  DT  T   F . n 
D 2 18  DA  18  50  50  DA  A   F . n 
D 2 19  DC  19  51  51  DC  C   F . n 
D 2 20  DT  20  52  52  DT  T   F . n 
D 2 21  DA  21  53  53  DA  A   F . n 
D 2 22  DA  22  54  54  DA  A   F . n 
D 2 23  DC  23  55  55  DC  C   F . n 
D 2 24  DC  24  56  56  DC  C   F . n 
D 2 25  DA  25  57  57  DA  A   F . n 
D 2 26  DG  26  58  58  DG  G   F . n 
D 2 27  DG  27  59  59  DG  G   F . n 
D 2 28  DC  28  60  60  DC  C   F . n 
D 2 29  DC  29  61  61  DC  C   F . n 
D 2 30  DC  30  62  62  DC  C   F . n 
D 2 31  DG  31  63  63  DG  G   F . n 
E 3 1   MET 1   1   ?   ?   ?   A . n 
E 3 2   GLY 2   2   ?   ?   ?   A . n 
E 3 3   GLU 3   3   ?   ?   ?   A . n 
E 3 4   LYS 4   4   ?   ?   ?   A . n 
E 3 5   ALA 5   5   ?   ?   ?   A . n 
E 3 6   LEU 6   6   ?   ?   ?   A . n 
E 3 7   PRO 7   7   ?   ?   ?   A . n 
E 3 8   VAL 8   8   ?   ?   ?   A . n 
E 3 9   VAL 9   9   ?   ?   ?   A . n 
E 3 10  TYR 10  10  10  TYR TYR A . n 
E 3 11  LYS 11  11  11  LYS LYS A . n 
E 3 12  ARG 12  12  12  ARG ARG A . n 
E 3 13  TYR 13  13  13  TYR TYR A . n 
E 3 14  ILE 14  14  14  ILE ILE A . n 
E 3 15  CYS 15  15  15  CYS CYS A . n 
E 3 16  SER 16  16  16  SER SER A . n 
E 3 17  PHE 17  17  17  PHE PHE A . n 
E 3 18  ALA 18  18  18  ALA ALA A . n 
E 3 19  ASP 19  19  19  ASP ASP A . n 
E 3 20  CYS 20  20  20  CYS CYS A . n 
E 3 21  GLY 21  21  21  GLY GLY A . n 
E 3 22  ALA 22  22  22  ALA ALA A . n 
E 3 23  ALA 23  23  23  ALA ALA A . n 
E 3 24  TYR 24  24  24  TYR TYR A . n 
E 3 25  ASN 25  25  25  ASN ASN A . n 
E 3 26  LYS 26  26  26  LYS LYS A . n 
E 3 27  ASN 27  27  27  ASN ASN A . n 
E 3 28  TRP 28  28  28  TRP TRP A . n 
E 3 29  LYS 29  29  29  LYS LYS A . n 
E 3 30  LEU 30  30  30  LEU LEU A . n 
E 3 31  GLN 31  31  31  GLN GLN A . n 
E 3 32  ALA 32  32  32  ALA ALA A . n 
E 3 33  HIS 33  33  33  HIS HIS A . n 
E 3 34  LEU 34  34  34  LEU LEU A . n 
E 3 35  CYS 35  35  35  CYS CYS A . n 
E 3 36  LYS 36  36  36  LYS LYS A . n 
E 3 37  HIS 37  37  37  HIS HIS A . n 
E 3 38  THR 38  38  38  THR THR A . n 
E 3 39  GLY 39  39  39  GLY GLY A . n 
E 3 40  GLU 40  40  40  GLU GLU A . n 
E 3 41  LYS 41  41  41  LYS LYS A . n 
E 3 42  PRO 42  42  42  PRO PRO A . n 
E 3 43  PHE 43  43  43  PHE PHE A . n 
E 3 44  PRO 44  44  44  PRO PRO A . n 
E 3 45  CYS 45  45  45  CYS CYS A . n 
E 3 46  LYS 46  46  46  LYS LYS A . n 
E 3 47  GLU 47  47  47  GLU GLU A . n 
E 3 48  GLU 48  48  48  GLU GLU A . n 
E 3 49  GLY 49  49  49  GLY GLY A . n 
E 3 50  CYS 50  50  50  CYS CYS A . n 
E 3 51  GLU 51  51  51  GLU GLU A . n 
E 3 52  LYS 52  52  52  LYS LYS A . n 
E 3 53  GLY 53  53  53  GLY GLY A . n 
E 3 54  PHE 54  54  54  PHE PHE A . n 
E 3 55  THR 55  55  55  THR THR A . n 
E 3 56  SER 56  56  56  SER SER A . n 
E 3 57  LEU 57  57  57  LEU LEU A . n 
E 3 58  HIS 58  58  58  HIS HIS A . n 
E 3 59  HIS 59  59  59  HIS HIS A . n 
E 3 60  LEU 60  60  60  LEU LEU A . n 
E 3 61  THR 61  61  61  THR THR A . n 
E 3 62  ARG 62  62  62  ARG ARG A . n 
E 3 63  HIS 63  63  63  HIS HIS A . n 
E 3 64  SER 64  64  64  SER SER A . n 
E 3 65  LEU 65  65  65  LEU LEU A . n 
E 3 66  THR 66  66  66  THR THR A . n 
E 3 67  HIS 67  67  67  HIS HIS A . n 
E 3 68  THR 68  68  68  THR THR A . n 
E 3 69  GLY 69  69  69  GLY GLY A . n 
E 3 70  GLU 70  70  70  GLU GLU A . n 
E 3 71  LYS 71  71  71  LYS LYS A . n 
E 3 72  ASN 72  72  72  ASN ASN A . n 
E 3 73  PHE 73  73  73  PHE PHE A . n 
E 3 74  THR 74  74  74  THR THR A . n 
E 3 75  CYS 75  75  75  CYS CYS A . n 
E 3 76  ASP 76  76  76  ASP ASP A . n 
E 3 77  SER 77  77  77  SER SER A . n 
E 3 78  ASP 78  78  78  ASP ASP A . n 
E 3 79  GLY 79  79  79  GLY GLY A . n 
E 3 80  CYS 80  80  80  CYS CYS A . n 
E 3 81  ASP 81  81  81  ASP ASP A . n 
E 3 82  LEU 82  82  82  LEU LEU A . n 
E 3 83  ARG 83  83  83  ARG ARG A . n 
E 3 84  PHE 84  84  84  PHE PHE A . n 
E 3 85  THR 85  85  85  THR THR A . n 
E 3 86  THR 86  86  86  THR THR A . n 
E 3 87  LYS 87  87  87  LYS LYS A . n 
E 3 88  ALA 88  88  88  ALA ALA A . n 
E 3 89  ASN 89  89  89  ASN ASN A . n 
E 3 90  MET 90  90  90  MET MET A . n 
E 3 91  LYS 91  91  91  LYS LYS A . n 
E 3 92  LYS 92  92  92  LYS LYS A . n 
E 3 93  HIS 93  93  93  HIS HIS A . n 
E 3 94  PHE 94  94  94  PHE PHE A . n 
E 3 95  ASN 95  95  95  ASN ASN A . n 
E 3 96  ARG 96  96  96  ARG ARG A . n 
E 3 97  PHE 97  97  97  PHE PHE A . n 
E 3 98  HIS 98  98  98  HIS HIS A . n 
E 3 99  ASN 99  99  99  ASN ASN A . n 
E 3 100 ILE 100 100 100 ILE ILE A . n 
E 3 101 LYS 101 101 101 LYS LYS A . n 
E 3 102 ILE 102 102 102 ILE ILE A . n 
E 3 103 CYS 103 103 103 CYS CYS A . n 
E 3 104 VAL 104 104 104 VAL VAL A . n 
E 3 105 TYR 105 105 105 TYR TYR A . n 
E 3 106 VAL 106 106 106 VAL VAL A . n 
E 3 107 CYS 107 107 107 CYS CYS A . n 
E 3 108 HIS 108 108 108 HIS HIS A . n 
E 3 109 PHE 109 109 109 PHE PHE A . n 
E 3 110 GLU 110 110 110 GLU GLU A . n 
E 3 111 ASN 111 111 111 ASN ASN A . n 
E 3 112 CYS 112 112 112 CYS CYS A . n 
E 3 113 GLY 113 113 113 GLY GLY A . n 
E 3 114 LYS 114 114 114 LYS LYS A . n 
E 3 115 ALA 115 115 115 ALA ALA A . n 
E 3 116 PHE 116 116 116 PHE PHE A . n 
E 3 117 LYS 117 117 117 LYS LYS A . n 
E 3 118 LYS 118 118 118 LYS LYS A . n 
E 3 119 HIS 119 119 119 HIS HIS A . n 
E 3 120 ASN 120 120 120 ASN ASN A . n 
E 3 121 GLN 121 121 121 GLN GLN A . n 
E 3 122 LEU 122 122 122 LEU LEU A . n 
E 3 123 LYS 123 123 123 LYS LYS A . n 
E 3 124 VAL 124 124 124 VAL VAL A . n 
E 3 125 HIS 125 125 125 HIS HIS A . n 
E 3 126 GLN 126 126 126 GLN GLN A . n 
E 3 127 PHE 127 127 127 PHE PHE A . n 
E 3 128 SER 128 128 128 SER SER A . n 
E 3 129 HIS 129 129 129 HIS HIS A . n 
E 3 130 THR 130 130 130 THR THR A . n 
E 3 131 GLN 131 131 131 GLN GLN A . n 
E 3 132 GLN 132 132 132 GLN GLN A . n 
E 3 133 LEU 133 133 133 LEU LEU A . n 
E 3 134 PRO 134 134 134 PRO PRO A . n 
E 3 135 TYR 135 135 135 TYR TYR A . n 
E 3 136 GLU 136 136 136 GLU GLU A . n 
E 3 137 CYS 137 137 137 CYS CYS A . n 
E 3 138 PRO 138 138 138 PRO PRO A . n 
E 3 139 HIS 139 139 139 HIS HIS A . n 
E 3 140 GLU 140 140 140 GLU GLU A . n 
E 3 141 GLY 141 141 141 GLY GLY A . n 
E 3 142 CYS 142 142 142 CYS CYS A . n 
E 3 143 ASP 143 143 143 ASP ASP A . n 
E 3 144 LYS 144 144 144 LYS LYS A . n 
E 3 145 ARG 145 145 145 ARG ARG A . n 
E 3 146 PHE 146 146 146 PHE PHE A . n 
E 3 147 SER 147 147 147 SER SER A . n 
E 3 148 LEU 148 148 148 LEU LEU A . n 
E 3 149 PRO 149 149 149 PRO PRO A . n 
E 3 150 SER 150 150 150 SER SER A . n 
E 3 151 ARG 151 151 151 ARG ARG A . n 
E 3 152 LEU 152 152 152 LEU LEU A . n 
E 3 153 LYS 153 153 153 LYS LYS A . n 
E 3 154 ARG 154 154 154 ARG ARG A . n 
E 3 155 HIS 155 155 155 HIS HIS A . n 
E 3 156 GLU 156 156 156 GLU GLU A . n 
E 3 157 LYS 157 157 157 LYS LYS A . n 
E 3 158 VAL 158 158 158 VAL VAL A . n 
E 3 159 HIS 159 159 159 HIS HIS A . n 
E 3 160 ALA 160 160 160 ALA ALA A . n 
E 3 161 GLY 161 161 161 GLY GLY A . n 
E 3 162 TYR 162 162 162 TYR TYR A . n 
E 3 163 PRO 163 163 163 PRO PRO A . n 
E 3 164 CYS 164 164 164 CYS CYS A . n 
E 3 165 LYS 165 165 165 LYS LYS A . n 
E 3 166 LYS 166 166 166 LYS LYS A . n 
E 3 167 ASP 167 167 167 ASP ASP A . n 
E 3 168 ASP 168 168 168 ASP ASP A . n 
E 3 169 SER 169 169 169 SER SER A . n 
E 3 170 CYS 170 170 170 CYS CYS A . n 
E 3 171 SER 171 171 171 SER SER A . n 
E 3 172 PHE 172 172 172 PHE PHE A . n 
E 3 173 VAL 173 173 173 VAL VAL A . n 
E 3 174 GLY 174 174 174 GLY GLY A . n 
E 3 175 LYS 175 175 175 LYS LYS A . n 
E 3 176 THR 176 176 176 THR THR A . n 
E 3 177 TRP 177 177 177 TRP TRP A . n 
E 3 178 THR 178 178 178 THR THR A . n 
E 3 179 LEU 179 179 179 LEU LEU A . n 
E 3 180 TYR 180 180 180 TYR TYR A . n 
E 3 181 LEU 181 181 181 LEU LEU A . n 
E 3 182 LYS 182 182 182 LYS LYS A . n 
E 3 183 HIS 183 183 183 HIS HIS A . n 
E 3 184 VAL 184 184 184 VAL VAL A . n 
E 3 185 ALA 185 185 185 ALA ALA A . n 
E 3 186 GLU 186 186 186 GLU GLU A . n 
E 3 187 CYS 187 187 187 CYS CYS A . n 
E 3 188 HIS 188 188 188 HIS HIS A . n 
E 3 189 GLN 189 189 ?   ?   ?   A . n 
E 3 190 ASP 190 190 ?   ?   ?   A . n 
F 3 1   MET 1   1   ?   ?   ?   D . n 
F 3 2   GLY 2   2   ?   ?   ?   D . n 
F 3 3   GLU 3   3   ?   ?   ?   D . n 
F 3 4   LYS 4   4   ?   ?   ?   D . n 
F 3 5   ALA 5   5   ?   ?   ?   D . n 
F 3 6   LEU 6   6   ?   ?   ?   D . n 
F 3 7   PRO 7   7   7   PRO PRO D . n 
F 3 8   VAL 8   8   8   VAL VAL D . n 
F 3 9   VAL 9   9   9   VAL VAL D . n 
F 3 10  TYR 10  10  10  TYR TYR D . n 
F 3 11  LYS 11  11  11  LYS LYS D . n 
F 3 12  ARG 12  12  12  ARG ARG D . n 
F 3 13  TYR 13  13  13  TYR TYR D . n 
F 3 14  ILE 14  14  14  ILE ILE D . n 
F 3 15  CYS 15  15  15  CYS CYS D . n 
F 3 16  SER 16  16  16  SER SER D . n 
F 3 17  PHE 17  17  17  PHE PHE D . n 
F 3 18  ALA 18  18  18  ALA ALA D . n 
F 3 19  ASP 19  19  19  ASP ASP D . n 
F 3 20  CYS 20  20  20  CYS CYS D . n 
F 3 21  GLY 21  21  21  GLY GLY D . n 
F 3 22  ALA 22  22  22  ALA ALA D . n 
F 3 23  ALA 23  23  23  ALA ALA D . n 
F 3 24  TYR 24  24  24  TYR TYR D . n 
F 3 25  ASN 25  25  25  ASN ASN D . n 
F 3 26  LYS 26  26  26  LYS LYS D . n 
F 3 27  ASN 27  27  27  ASN ASN D . n 
F 3 28  TRP 28  28  28  TRP TRP D . n 
F 3 29  LYS 29  29  29  LYS LYS D . n 
F 3 30  LEU 30  30  30  LEU LEU D . n 
F 3 31  GLN 31  31  31  GLN GLN D . n 
F 3 32  ALA 32  32  32  ALA ALA D . n 
F 3 33  HIS 33  33  33  HIS HIS D . n 
F 3 34  LEU 34  34  34  LEU LEU D . n 
F 3 35  CYS 35  35  35  CYS CYS D . n 
F 3 36  LYS 36  36  36  LYS LYS D . n 
F 3 37  HIS 37  37  37  HIS HIS D . n 
F 3 38  THR 38  38  38  THR THR D . n 
F 3 39  GLY 39  39  39  GLY GLY D . n 
F 3 40  GLU 40  40  40  GLU GLU D . n 
F 3 41  LYS 41  41  41  LYS LYS D . n 
F 3 42  PRO 42  42  42  PRO PRO D . n 
F 3 43  PHE 43  43  43  PHE PHE D . n 
F 3 44  PRO 44  44  44  PRO PRO D . n 
F 3 45  CYS 45  45  45  CYS CYS D . n 
F 3 46  LYS 46  46  46  LYS LYS D . n 
F 3 47  GLU 47  47  47  GLU GLU D . n 
F 3 48  GLU 48  48  48  GLU GLU D . n 
F 3 49  GLY 49  49  49  GLY GLY D . n 
F 3 50  CYS 50  50  50  CYS CYS D . n 
F 3 51  GLU 51  51  51  GLU GLU D . n 
F 3 52  LYS 52  52  52  LYS LYS D . n 
F 3 53  GLY 53  53  53  GLY GLY D . n 
F 3 54  PHE 54  54  54  PHE PHE D . n 
F 3 55  THR 55  55  55  THR THR D . n 
F 3 56  SER 56  56  56  SER SER D . n 
F 3 57  LEU 57  57  57  LEU LEU D . n 
F 3 58  HIS 58  58  58  HIS HIS D . n 
F 3 59  HIS 59  59  59  HIS HIS D . n 
F 3 60  LEU 60  60  60  LEU LEU D . n 
F 3 61  THR 61  61  61  THR THR D . n 
F 3 62  ARG 62  62  62  ARG ARG D . n 
F 3 63  HIS 63  63  63  HIS HIS D . n 
F 3 64  SER 64  64  64  SER SER D . n 
F 3 65  LEU 65  65  65  LEU LEU D . n 
F 3 66  THR 66  66  66  THR THR D . n 
F 3 67  HIS 67  67  67  HIS HIS D . n 
F 3 68  THR 68  68  68  THR THR D . n 
F 3 69  GLY 69  69  69  GLY GLY D . n 
F 3 70  GLU 70  70  70  GLU GLU D . n 
F 3 71  LYS 71  71  71  LYS LYS D . n 
F 3 72  ASN 72  72  72  ASN ASN D . n 
F 3 73  PHE 73  73  73  PHE PHE D . n 
F 3 74  THR 74  74  74  THR THR D . n 
F 3 75  CYS 75  75  75  CYS CYS D . n 
F 3 76  ASP 76  76  76  ASP ASP D . n 
F 3 77  SER 77  77  77  SER SER D . n 
F 3 78  ASP 78  78  78  ASP ASP D . n 
F 3 79  GLY 79  79  79  GLY GLY D . n 
F 3 80  CYS 80  80  80  CYS CYS D . n 
F 3 81  ASP 81  81  81  ASP ASP D . n 
F 3 82  LEU 82  82  82  LEU LEU D . n 
F 3 83  ARG 83  83  83  ARG ARG D . n 
F 3 84  PHE 84  84  84  PHE PHE D . n 
F 3 85  THR 85  85  85  THR THR D . n 
F 3 86  THR 86  86  86  THR THR D . n 
F 3 87  LYS 87  87  87  LYS LYS D . n 
F 3 88  ALA 88  88  88  ALA ALA D . n 
F 3 89  ASN 89  89  89  ASN ASN D . n 
F 3 90  MET 90  90  90  MET MET D . n 
F 3 91  LYS 91  91  91  LYS LYS D . n 
F 3 92  LYS 92  92  92  LYS LYS D . n 
F 3 93  HIS 93  93  93  HIS HIS D . n 
F 3 94  PHE 94  94  94  PHE PHE D . n 
F 3 95  ASN 95  95  95  ASN ASN D . n 
F 3 96  ARG 96  96  96  ARG ARG D . n 
F 3 97  PHE 97  97  97  PHE PHE D . n 
F 3 98  HIS 98  98  98  HIS HIS D . n 
F 3 99  ASN 99  99  99  ASN ASN D . n 
F 3 100 ILE 100 100 100 ILE ILE D . n 
F 3 101 LYS 101 101 101 LYS LYS D . n 
F 3 102 ILE 102 102 102 ILE ILE D . n 
F 3 103 CYS 103 103 103 CYS CYS D . n 
F 3 104 VAL 104 104 104 VAL VAL D . n 
F 3 105 TYR 105 105 105 TYR TYR D . n 
F 3 106 VAL 106 106 106 VAL VAL D . n 
F 3 107 CYS 107 107 107 CYS CYS D . n 
F 3 108 HIS 108 108 108 HIS HIS D . n 
F 3 109 PHE 109 109 109 PHE PHE D . n 
F 3 110 GLU 110 110 110 GLU GLU D . n 
F 3 111 ASN 111 111 111 ASN ASN D . n 
F 3 112 CYS 112 112 112 CYS CYS D . n 
F 3 113 GLY 113 113 113 GLY GLY D . n 
F 3 114 LYS 114 114 114 LYS LYS D . n 
F 3 115 ALA 115 115 115 ALA ALA D . n 
F 3 116 PHE 116 116 116 PHE PHE D . n 
F 3 117 LYS 117 117 117 LYS LYS D . n 
F 3 118 LYS 118 118 118 LYS LYS D . n 
F 3 119 HIS 119 119 119 HIS HIS D . n 
F 3 120 ASN 120 120 120 ASN ASN D . n 
F 3 121 GLN 121 121 121 GLN GLN D . n 
F 3 122 LEU 122 122 122 LEU LEU D . n 
F 3 123 LYS 123 123 123 LYS LYS D . n 
F 3 124 VAL 124 124 124 VAL VAL D . n 
F 3 125 HIS 125 125 125 HIS HIS D . n 
F 3 126 GLN 126 126 126 GLN GLN D . n 
F 3 127 PHE 127 127 127 PHE PHE D . n 
F 3 128 SER 128 128 128 SER SER D . n 
F 3 129 HIS 129 129 129 HIS HIS D . n 
F 3 130 THR 130 130 130 THR THR D . n 
F 3 131 GLN 131 131 131 GLN GLN D . n 
F 3 132 GLN 132 132 132 GLN GLN D . n 
F 3 133 LEU 133 133 133 LEU LEU D . n 
F 3 134 PRO 134 134 134 PRO PRO D . n 
F 3 135 TYR 135 135 135 TYR TYR D . n 
F 3 136 GLU 136 136 136 GLU GLU D . n 
F 3 137 CYS 137 137 137 CYS CYS D . n 
F 3 138 PRO 138 138 138 PRO PRO D . n 
F 3 139 HIS 139 139 139 HIS HIS D . n 
F 3 140 GLU 140 140 140 GLU GLU D . n 
F 3 141 GLY 141 141 141 GLY GLY D . n 
F 3 142 CYS 142 142 142 CYS CYS D . n 
F 3 143 ASP 143 143 143 ASP ASP D . n 
F 3 144 LYS 144 144 144 LYS LYS D . n 
F 3 145 ARG 145 145 145 ARG ARG D . n 
F 3 146 PHE 146 146 146 PHE PHE D . n 
F 3 147 SER 147 147 147 SER SER D . n 
F 3 148 LEU 148 148 148 LEU LEU D . n 
F 3 149 PRO 149 149 149 PRO PRO D . n 
F 3 150 SER 150 150 150 SER SER D . n 
F 3 151 ARG 151 151 151 ARG ARG D . n 
F 3 152 LEU 152 152 152 LEU LEU D . n 
F 3 153 LYS 153 153 153 LYS LYS D . n 
F 3 154 ARG 154 154 154 ARG ARG D . n 
F 3 155 HIS 155 155 155 HIS HIS D . n 
F 3 156 GLU 156 156 156 GLU GLU D . n 
F 3 157 LYS 157 157 157 LYS LYS D . n 
F 3 158 VAL 158 158 158 VAL VAL D . n 
F 3 159 HIS 159 159 159 HIS HIS D . n 
F 3 160 ALA 160 160 160 ALA ALA D . n 
F 3 161 GLY 161 161 161 GLY GLY D . n 
F 3 162 TYR 162 162 162 TYR TYR D . n 
F 3 163 PRO 163 163 163 PRO PRO D . n 
F 3 164 CYS 164 164 164 CYS CYS D . n 
F 3 165 LYS 165 165 165 LYS LYS D . n 
F 3 166 LYS 166 166 166 LYS LYS D . n 
F 3 167 ASP 167 167 167 ASP ASP D . n 
F 3 168 ASP 168 168 168 ASP ASP D . n 
F 3 169 SER 169 169 169 SER SER D . n 
F 3 170 CYS 170 170 170 CYS CYS D . n 
F 3 171 SER 171 171 171 SER SER D . n 
F 3 172 PHE 172 172 172 PHE PHE D . n 
F 3 173 VAL 173 173 173 VAL VAL D . n 
F 3 174 GLY 174 174 174 GLY GLY D . n 
F 3 175 LYS 175 175 175 LYS LYS D . n 
F 3 176 THR 176 176 176 THR THR D . n 
F 3 177 TRP 177 177 177 TRP TRP D . n 
F 3 178 THR 178 178 178 THR THR D . n 
F 3 179 LEU 179 179 179 LEU LEU D . n 
F 3 180 TYR 180 180 180 TYR TYR D . n 
F 3 181 LEU 181 181 181 LEU LEU D . n 
F 3 182 LYS 182 182 182 LYS LYS D . n 
F 3 183 HIS 183 183 183 HIS HIS D . n 
F 3 184 VAL 184 184 184 VAL VAL D . n 
F 3 185 ALA 185 185 185 ALA ALA D . n 
F 3 186 GLU 186 186 186 GLU GLU D . n 
F 3 187 CYS 187 187 187 CYS CYS D . n 
F 3 188 HIS 188 188 188 HIS HIS D . n 
F 3 189 GLN 189 189 ?   ?   ?   D . n 
F 3 190 ASP 190 190 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 ZN 1 201 201 ZN ZN A . 
H 4 ZN 1 202 202 ZN ZN A . 
I 4 ZN 1 203 203 ZN ZN A . 
J 4 ZN 1 204 204 ZN ZN A . 
K 4 ZN 1 205 205 ZN ZN A . 
L 4 ZN 1 206 206 ZN ZN A . 
M 4 ZN 1 201 201 ZN ZN D . 
N 4 ZN 1 202 202 ZN ZN D . 
O 4 ZN 1 203 203 ZN ZN D . 
P 4 ZN 1 204 204 ZN ZN D . 
Q 4 ZN 1 205 205 ZN ZN D . 
R 4 ZN 1 206 206 ZN ZN D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H,I,J,K,L 
2 1 C,D,F,M,N,O,P,Q,R 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? E CYS 15  ? A CYS 15  ? 1_555 ZN ? G ZN . ? A ZN 201 ? 1_555 SG  ? E CYS 20  ? A CYS 20  ? 1_555 91.3  ? 
2  SG  ? E CYS 15  ? A CYS 15  ? 1_555 ZN ? G ZN . ? A ZN 201 ? 1_555 NE2 ? E HIS 33  ? A HIS 33  ? 1_555 88.3  ? 
3  SG  ? E CYS 20  ? A CYS 20  ? 1_555 ZN ? G ZN . ? A ZN 201 ? 1_555 NE2 ? E HIS 33  ? A HIS 33  ? 1_555 99.8  ? 
4  SG  ? E CYS 15  ? A CYS 15  ? 1_555 ZN ? G ZN . ? A ZN 201 ? 1_555 NE2 ? E HIS 37  ? A HIS 37  ? 1_555 105.2 ? 
5  SG  ? E CYS 20  ? A CYS 20  ? 1_555 ZN ? G ZN . ? A ZN 201 ? 1_555 NE2 ? E HIS 37  ? A HIS 37  ? 1_555 155.4 ? 
6  NE2 ? E HIS 33  ? A HIS 33  ? 1_555 ZN ? G ZN . ? A ZN 201 ? 1_555 NE2 ? E HIS 37  ? A HIS 37  ? 1_555 98.8  ? 
7  SG  ? E CYS 45  ? A CYS 45  ? 1_555 ZN ? H ZN . ? A ZN 202 ? 1_555 SG  ? E CYS 50  ? A CYS 50  ? 1_555 152.1 ? 
8  SG  ? E CYS 45  ? A CYS 45  ? 1_555 ZN ? H ZN . ? A ZN 202 ? 1_555 NE2 ? E HIS 63  ? A HIS 63  ? 1_555 86.8  ? 
9  SG  ? E CYS 50  ? A CYS 50  ? 1_555 ZN ? H ZN . ? A ZN 202 ? 1_555 NE2 ? E HIS 63  ? A HIS 63  ? 1_555 104.2 ? 
10 SG  ? E CYS 45  ? A CYS 45  ? 1_555 ZN ? H ZN . ? A ZN 202 ? 1_555 NE2 ? E HIS 67  ? A HIS 67  ? 1_555 105.5 ? 
11 SG  ? E CYS 50  ? A CYS 50  ? 1_555 ZN ? H ZN . ? A ZN 202 ? 1_555 NE2 ? E HIS 67  ? A HIS 67  ? 1_555 96.3  ? 
12 NE2 ? E HIS 63  ? A HIS 63  ? 1_555 ZN ? H ZN . ? A ZN 202 ? 1_555 NE2 ? E HIS 67  ? A HIS 67  ? 1_555 105.2 ? 
13 SG  ? E CYS 75  ? A CYS 75  ? 1_555 ZN ? I ZN . ? A ZN 203 ? 1_555 SG  ? E CYS 80  ? A CYS 80  ? 1_555 90.9  ? 
14 SG  ? E CYS 75  ? A CYS 75  ? 1_555 ZN ? I ZN . ? A ZN 203 ? 1_555 NE2 ? E HIS 93  ? A HIS 93  ? 1_555 87.3  ? 
15 SG  ? E CYS 80  ? A CYS 80  ? 1_555 ZN ? I ZN . ? A ZN 203 ? 1_555 NE2 ? E HIS 93  ? A HIS 93  ? 1_555 99.6  ? 
16 SG  ? E CYS 75  ? A CYS 75  ? 1_555 ZN ? I ZN . ? A ZN 203 ? 1_555 NE2 ? E HIS 98  ? A HIS 98  ? 1_555 113.0 ? 
17 SG  ? E CYS 80  ? A CYS 80  ? 1_555 ZN ? I ZN . ? A ZN 203 ? 1_555 NE2 ? E HIS 98  ? A HIS 98  ? 1_555 154.1 ? 
18 NE2 ? E HIS 93  ? A HIS 93  ? 1_555 ZN ? I ZN . ? A ZN 203 ? 1_555 NE2 ? E HIS 98  ? A HIS 98  ? 1_555 91.7  ? 
19 SG  ? E CYS 107 ? A CYS 107 ? 1_555 ZN ? J ZN . ? A ZN 204 ? 1_555 SG  ? E CYS 112 ? A CYS 112 ? 1_555 111.9 ? 
20 SG  ? E CYS 107 ? A CYS 107 ? 1_555 ZN ? J ZN . ? A ZN 204 ? 1_555 NE2 ? E HIS 125 ? A HIS 125 ? 1_555 129.3 ? 
21 SG  ? E CYS 112 ? A CYS 112 ? 1_555 ZN ? J ZN . ? A ZN 204 ? 1_555 NE2 ? E HIS 125 ? A HIS 125 ? 1_555 93.8  ? 
22 SG  ? E CYS 107 ? A CYS 107 ? 1_555 ZN ? J ZN . ? A ZN 204 ? 1_555 NE2 ? E HIS 129 ? A HIS 129 ? 1_555 115.5 ? 
23 SG  ? E CYS 112 ? A CYS 112 ? 1_555 ZN ? J ZN . ? A ZN 204 ? 1_555 NE2 ? E HIS 129 ? A HIS 129 ? 1_555 110.2 ? 
24 NE2 ? E HIS 125 ? A HIS 125 ? 1_555 ZN ? J ZN . ? A ZN 204 ? 1_555 NE2 ? E HIS 129 ? A HIS 129 ? 1_555 93.0  ? 
25 SG  ? E CYS 137 ? A CYS 137 ? 1_555 ZN ? K ZN . ? A ZN 205 ? 1_555 SG  ? E CYS 142 ? A CYS 142 ? 1_555 130.7 ? 
26 SG  ? E CYS 137 ? A CYS 137 ? 1_555 ZN ? K ZN . ? A ZN 205 ? 1_555 NE2 ? E HIS 155 ? A HIS 155 ? 1_555 103.5 ? 
27 SG  ? E CYS 142 ? A CYS 142 ? 1_555 ZN ? K ZN . ? A ZN 205 ? 1_555 NE2 ? E HIS 155 ? A HIS 155 ? 1_555 101.9 ? 
28 SG  ? E CYS 137 ? A CYS 137 ? 1_555 ZN ? K ZN . ? A ZN 205 ? 1_555 NE2 ? E HIS 159 ? A HIS 159 ? 1_555 91.6  ? 
29 SG  ? E CYS 142 ? A CYS 142 ? 1_555 ZN ? K ZN . ? A ZN 205 ? 1_555 NE2 ? E HIS 159 ? A HIS 159 ? 1_555 133.4 ? 
30 NE2 ? E HIS 155 ? A HIS 155 ? 1_555 ZN ? K ZN . ? A ZN 205 ? 1_555 NE2 ? E HIS 159 ? A HIS 159 ? 1_555 82.3  ? 
31 SG  ? E CYS 164 ? A CYS 164 ? 1_555 ZN ? L ZN . ? A ZN 206 ? 1_555 SG  ? E CYS 170 ? A CYS 170 ? 1_555 99.1  ? 
32 SG  ? E CYS 164 ? A CYS 164 ? 1_555 ZN ? L ZN . ? A ZN 206 ? 1_555 NE2 ? E HIS 183 ? A HIS 183 ? 1_555 145.9 ? 
33 SG  ? E CYS 170 ? A CYS 170 ? 1_555 ZN ? L ZN . ? A ZN 206 ? 1_555 NE2 ? E HIS 183 ? A HIS 183 ? 1_555 84.0  ? 
34 SG  ? E CYS 164 ? A CYS 164 ? 1_555 ZN ? L ZN . ? A ZN 206 ? 1_555 NE2 ? E HIS 188 ? A HIS 188 ? 1_555 78.2  ? 
35 SG  ? E CYS 170 ? A CYS 170 ? 1_555 ZN ? L ZN . ? A ZN 206 ? 1_555 NE2 ? E HIS 188 ? A HIS 188 ? 1_555 136.1 ? 
36 NE2 ? E HIS 183 ? A HIS 183 ? 1_555 ZN ? L ZN . ? A ZN 206 ? 1_555 NE2 ? E HIS 188 ? A HIS 188 ? 1_555 122.4 ? 
37 SG  ? F CYS 15  ? D CYS 15  ? 1_555 ZN ? M ZN . ? D ZN 201 ? 1_555 SG  ? F CYS 20  ? D CYS 20  ? 1_555 89.5  ? 
38 SG  ? F CYS 15  ? D CYS 15  ? 1_555 ZN ? M ZN . ? D ZN 201 ? 1_555 NE2 ? F HIS 33  ? D HIS 33  ? 1_555 83.1  ? 
39 SG  ? F CYS 20  ? D CYS 20  ? 1_555 ZN ? M ZN . ? D ZN 201 ? 1_555 NE2 ? F HIS 33  ? D HIS 33  ? 1_555 88.8  ? 
40 SG  ? F CYS 15  ? D CYS 15  ? 1_555 ZN ? M ZN . ? D ZN 201 ? 1_555 NE2 ? F HIS 37  ? D HIS 37  ? 1_555 101.1 ? 
41 SG  ? F CYS 20  ? D CYS 20  ? 1_555 ZN ? M ZN . ? D ZN 201 ? 1_555 NE2 ? F HIS 37  ? D HIS 37  ? 1_555 156.8 ? 
42 NE2 ? F HIS 33  ? D HIS 33  ? 1_555 ZN ? M ZN . ? D ZN 201 ? 1_555 NE2 ? F HIS 37  ? D HIS 37  ? 1_555 112.8 ? 
43 SG  ? F CYS 45  ? D CYS 45  ? 1_555 ZN ? N ZN . ? D ZN 202 ? 1_555 SG  ? F CYS 50  ? D CYS 50  ? 1_555 142.0 ? 
44 SG  ? F CYS 45  ? D CYS 45  ? 1_555 ZN ? N ZN . ? D ZN 202 ? 1_555 NE2 ? F HIS 63  ? D HIS 63  ? 1_555 87.9  ? 
45 SG  ? F CYS 50  ? D CYS 50  ? 1_555 ZN ? N ZN . ? D ZN 202 ? 1_555 NE2 ? F HIS 63  ? D HIS 63  ? 1_555 103.0 ? 
46 SG  ? F CYS 45  ? D CYS 45  ? 1_555 ZN ? N ZN . ? D ZN 202 ? 1_555 NE2 ? F HIS 67  ? D HIS 67  ? 1_555 115.1 ? 
47 SG  ? F CYS 50  ? D CYS 50  ? 1_555 ZN ? N ZN . ? D ZN 202 ? 1_555 NE2 ? F HIS 67  ? D HIS 67  ? 1_555 97.4  ? 
48 NE2 ? F HIS 63  ? D HIS 63  ? 1_555 ZN ? N ZN . ? D ZN 202 ? 1_555 NE2 ? F HIS 67  ? D HIS 67  ? 1_555 104.8 ? 
49 SG  ? F CYS 75  ? D CYS 75  ? 1_555 ZN ? O ZN . ? D ZN 203 ? 1_555 SG  ? F CYS 80  ? D CYS 80  ? 1_555 91.5  ? 
50 SG  ? F CYS 75  ? D CYS 75  ? 1_555 ZN ? O ZN . ? D ZN 203 ? 1_555 NE2 ? F HIS 93  ? D HIS 93  ? 1_555 88.6  ? 
51 SG  ? F CYS 80  ? D CYS 80  ? 1_555 ZN ? O ZN . ? D ZN 203 ? 1_555 NE2 ? F HIS 93  ? D HIS 93  ? 1_555 104.4 ? 
52 SG  ? F CYS 75  ? D CYS 75  ? 1_555 ZN ? O ZN . ? D ZN 203 ? 1_555 NE2 ? F HIS 98  ? D HIS 98  ? 1_555 110.6 ? 
53 SG  ? F CYS 80  ? D CYS 80  ? 1_555 ZN ? O ZN . ? D ZN 203 ? 1_555 NE2 ? F HIS 98  ? D HIS 98  ? 1_555 157.5 ? 
54 NE2 ? F HIS 93  ? D HIS 93  ? 1_555 ZN ? O ZN . ? D ZN 203 ? 1_555 NE2 ? F HIS 98  ? D HIS 98  ? 1_555 81.1  ? 
55 SG  ? F CYS 107 ? D CYS 107 ? 1_555 ZN ? P ZN . ? D ZN 204 ? 1_555 SG  ? F CYS 112 ? D CYS 112 ? 1_555 100.0 ? 
56 SG  ? F CYS 107 ? D CYS 107 ? 1_555 ZN ? P ZN . ? D ZN 204 ? 1_555 NE2 ? F HIS 125 ? D HIS 125 ? 1_555 131.0 ? 
57 SG  ? F CYS 112 ? D CYS 112 ? 1_555 ZN ? P ZN . ? D ZN 204 ? 1_555 NE2 ? F HIS 125 ? D HIS 125 ? 1_555 78.6  ? 
58 SG  ? F CYS 107 ? D CYS 107 ? 1_555 ZN ? P ZN . ? D ZN 204 ? 1_555 NE2 ? F HIS 129 ? D HIS 129 ? 1_555 120.7 ? 
59 SG  ? F CYS 112 ? D CYS 112 ? 1_555 ZN ? P ZN . ? D ZN 204 ? 1_555 NE2 ? F HIS 129 ? D HIS 129 ? 1_555 100.4 ? 
60 NE2 ? F HIS 125 ? D HIS 125 ? 1_555 ZN ? P ZN . ? D ZN 204 ? 1_555 NE2 ? F HIS 129 ? D HIS 129 ? 1_555 107.4 ? 
61 SG  ? F CYS 137 ? D CYS 137 ? 1_555 ZN ? Q ZN . ? D ZN 205 ? 1_555 SG  ? F CYS 142 ? D CYS 142 ? 1_555 127.1 ? 
62 SG  ? F CYS 137 ? D CYS 137 ? 1_555 ZN ? Q ZN . ? D ZN 205 ? 1_555 NE2 ? F HIS 155 ? D HIS 155 ? 1_555 119.6 ? 
63 SG  ? F CYS 142 ? D CYS 142 ? 1_555 ZN ? Q ZN . ? D ZN 205 ? 1_555 NE2 ? F HIS 155 ? D HIS 155 ? 1_555 90.6  ? 
64 SG  ? F CYS 137 ? D CYS 137 ? 1_555 ZN ? Q ZN . ? D ZN 205 ? 1_555 NE2 ? F HIS 159 ? D HIS 159 ? 1_555 99.6  ? 
65 SG  ? F CYS 142 ? D CYS 142 ? 1_555 ZN ? Q ZN . ? D ZN 205 ? 1_555 NE2 ? F HIS 159 ? D HIS 159 ? 1_555 128.8 ? 
66 NE2 ? F HIS 155 ? D HIS 155 ? 1_555 ZN ? Q ZN . ? D ZN 205 ? 1_555 NE2 ? F HIS 159 ? D HIS 159 ? 1_555 81.9  ? 
67 SG  ? F CYS 164 ? D CYS 164 ? 1_555 ZN ? R ZN . ? D ZN 206 ? 1_555 SG  ? F CYS 170 ? D CYS 170 ? 1_555 83.7  ? 
68 SG  ? F CYS 164 ? D CYS 164 ? 1_555 ZN ? R ZN . ? D ZN 206 ? 1_555 NE2 ? F HIS 183 ? D HIS 183 ? 1_555 114.6 ? 
69 SG  ? F CYS 170 ? D CYS 170 ? 1_555 ZN ? R ZN . ? D ZN 206 ? 1_555 NE2 ? F HIS 183 ? D HIS 183 ? 1_555 79.8  ? 
70 SG  ? F CYS 164 ? D CYS 164 ? 1_555 ZN ? R ZN . ? D ZN 206 ? 1_555 NE2 ? F HIS 188 ? D HIS 188 ? 1_555 85.0  ? 
71 SG  ? F CYS 170 ? D CYS 170 ? 1_555 ZN ? R ZN . ? D ZN 206 ? 1_555 NE2 ? F HIS 188 ? D HIS 188 ? 1_555 158.0 ? 
72 NE2 ? F HIS 183 ? D HIS 183 ? 1_555 ZN ? R ZN . ? D ZN 206 ? 1_555 NE2 ? F HIS 188 ? D HIS 188 ? 1_555 122.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-07-10 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CCP4      'model building' 'RAVE DM' ? 1 
X-PLOR    refinement       3.851     ? 2 
DENZO     'data reduction' .         ? 3 
SCALEPACK 'data scaling'   .         ? 4 
CCP4      phasing          .         ? 5 
RAVE      phasing          .         ? 6 
DM        phasing          .         ? 7 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 12  ? ? -52.77  -76.75  
2  1 CYS A 15  ? ? -38.33  150.08  
3  1 ASP A 19  ? ? 102.68  -34.21  
4  1 ASN A 25  ? ? -102.25 41.26   
5  1 LYS A 26  ? ? -178.09 105.10  
6  1 THR A 38  ? ? -62.02  -73.63  
7  1 LYS A 46  ? ? -119.36 63.07   
8  1 GLU A 48  ? ? -58.61  171.33  
9  1 SER A 56  ? ? -170.72 131.33  
10 1 LEU A 65  ? ? -43.52  -15.91  
11 1 HIS A 67  ? ? -66.95  6.57    
12 1 THR A 68  ? ? -131.42 -54.72  
13 1 ASP A 76  ? ? -57.74  82.24   
14 1 LEU A 82  ? ? -37.02  113.08  
15 1 LYS A 87  ? ? -75.32  -77.45  
16 1 PHE A 97  ? ? -146.54 -70.02  
17 1 ILE A 100 ? ? -59.52  -139.34 
18 1 LYS A 101 ? ? 68.41   -40.04  
19 1 GLU A 110 ? ? 58.61   151.19  
20 1 ASN A 111 ? ? 81.80   -57.21  
21 1 VAL A 124 ? ? -51.11  -75.12  
22 1 HIS A 125 ? ? -29.09  -62.05  
23 1 GLN A 126 ? ? -35.21  -36.80  
24 1 THR A 130 ? ? -121.11 -144.70 
25 1 PRO A 134 ? ? -74.86  -98.08  
26 1 TYR A 135 ? ? -44.89  98.97   
27 1 HIS A 139 ? ? 168.60  169.38  
28 1 CYS A 142 ? ? 54.89   -82.28  
29 1 ASP A 143 ? ? 72.29   -11.78  
30 1 SER A 147 ? ? -102.67 -79.30  
31 1 LYS A 157 ? ? -45.02  -13.86  
32 1 ALA A 160 ? ? -167.43 95.42   
33 1 TYR A 162 ? ? -162.24 66.11   
34 1 LYS A 166 ? ? -144.13 57.07   
35 1 ASP A 167 ? ? 62.76   152.87  
36 1 SER A 171 ? ? -153.29 23.21   
37 1 VAL A 173 ? ? -73.39  -126.74 
38 1 ALA A 185 ? ? -65.61  -76.68  
39 1 GLU A 186 ? ? -39.50  -36.47  
40 1 CYS A 187 ? ? -119.26 -138.55 
41 1 TYR D 10  ? ? -24.36  84.66   
42 1 LYS D 11  ? ? 144.87  2.15    
43 1 ARG D 12  ? ? -4.34   -80.25  
44 1 ASP D 19  ? ? 100.66  -42.61  
45 1 ASN D 25  ? ? -102.48 45.05   
46 1 LYS D 26  ? ? 173.88  112.38  
47 1 ASN D 27  ? ? -39.97  -37.93  
48 1 LYS D 46  ? ? -116.32 61.13   
49 1 SER D 56  ? ? 179.63  137.40  
50 1 LEU D 65  ? ? -43.15  -17.57  
51 1 HIS D 67  ? ? -66.01  4.27    
52 1 THR D 68  ? ? -126.71 -57.90  
53 1 ASP D 76  ? ? -58.03  81.98   
54 1 LEU D 82  ? ? -38.25  114.55  
55 1 LYS D 87  ? ? -72.55  -74.57  
56 1 PHE D 97  ? ? -142.50 -74.70  
57 1 HIS D 98  ? ? -68.77  -80.17  
58 1 ASN D 99  ? ? -25.11  113.51  
59 1 ILE D 100 ? ? -64.54  -144.39 
60 1 LYS D 101 ? ? 72.80   -40.76  
61 1 HIS D 108 ? ? -79.27  25.23   
62 1 GLU D 110 ? ? 61.08   148.52  
63 1 ASN D 111 ? ? 82.95   -64.54  
64 1 VAL D 124 ? ? -54.76  -71.74  
65 1 THR D 130 ? ? -126.03 -148.56 
66 1 PRO D 134 ? ? -77.62  -101.09 
67 1 TYR D 135 ? ? -46.21  97.36   
68 1 HIS D 139 ? ? 167.50  171.07  
69 1 CYS D 142 ? ? 51.43   -82.78  
70 1 ASP D 143 ? ? 73.08   -8.25   
71 1 SER D 147 ? ? -109.49 -76.94  
72 1 LYS D 157 ? ? -44.67  -11.24  
73 1 VAL D 158 ? ? -81.72  -70.28  
74 1 ALA D 160 ? ? -165.64 108.45  
75 1 TYR D 162 ? ? -159.86 67.98   
76 1 LYS D 166 ? ? -140.19 58.81   
77 1 ASP D 167 ? ? 61.82   160.48  
78 1 SER D 171 ? ? -149.87 20.83   
79 1 VAL D 173 ? ? -73.68  -130.03 
80 1 ALA D 185 ? ? -64.83  -80.37  
81 1 GLU D 186 ? ? -38.41  -35.48  
82 1 CYS D 187 ? ? -119.56 -141.24 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? E MET 1   
2  1 Y 1 A GLY 2   ? E GLY 2   
3  1 Y 1 A GLU 3   ? E GLU 3   
4  1 Y 1 A LYS 4   ? E LYS 4   
5  1 Y 1 A ALA 5   ? E ALA 5   
6  1 Y 1 A LEU 6   ? E LEU 6   
7  1 Y 1 A PRO 7   ? E PRO 7   
8  1 Y 1 A VAL 8   ? E VAL 8   
9  1 Y 1 A VAL 9   ? E VAL 9   
10 1 Y 1 A GLN 189 ? E GLN 189 
11 1 Y 1 A ASP 190 ? E ASP 190 
12 1 Y 1 D MET 1   ? F MET 1   
13 1 Y 1 D GLY 2   ? F GLY 2   
14 1 Y 1 D GLU 3   ? F GLU 3   
15 1 Y 1 D LYS 4   ? F LYS 4   
16 1 Y 1 D ALA 5   ? F ALA 5   
17 1 Y 1 D LEU 6   ? F LEU 6   
18 1 Y 1 D GLN 189 ? F GLN 189 
19 1 Y 1 D ASP 190 ? F ASP 190 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1TF6 'double helix'         
1TF6 'b-form double helix'  
1TF6 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2  1_555 B DG 31 1_555 0.096  -0.036 0.059  -8.547  -1.549  -1.024 1  B_DC2:DG63_C  B 2  ? C 63 ? 19 1 
1 A DG 3  1_555 B DC 30 1_555 -0.203 -0.059 0.244  3.969   10.486  -0.072 2  B_DG3:DC62_C  B 3  ? C 62 ? 19 1 
1 A DG 4  1_555 B DC 29 1_555 -0.109 -0.019 0.224  8.648   -6.497  -0.762 3  B_DG4:DC61_C  B 4  ? C 61 ? 19 1 
1 A DG 5  1_555 B DC 28 1_555 -0.176 -0.078 0.667  12.491  0.807   -0.677 4  B_DG5:DC60_C  B 5  ? C 60 ? 19 1 
1 A DC 6  1_555 B DG 27 1_555 0.186  -0.040 -0.025 3.620   -6.518  -0.853 5  B_DC6:DG59_C  B 6  ? C 59 ? 19 1 
1 A DC 7  1_555 B DG 26 1_555 0.093  -0.068 -0.413 1.864   5.871   -1.226 6  B_DC7:DG58_C  B 7  ? C 58 ? 19 1 
1 A DT 8  1_555 B DA 25 1_555 -0.033 -0.113 -0.539 3.855   0.752   1.290  7  B_DT8:DA57_C  B 8  ? C 57 ? 20 1 
1 A DG 9  1_555 B DC 24 1_555 -0.104 -0.060 -0.440 7.579   0.210   -0.989 8  B_DG9:DC56_C  B 9  ? C 56 ? 19 1 
1 A DG 10 1_555 B DC 23 1_555 -0.065 -0.124 -0.709 -2.955  -2.195  -0.496 9  B_DG10:DC55_C B 10 ? C 55 ? 19 1 
1 A DT 11 1_555 B DA 22 1_555 -0.030 -0.082 -0.092 -4.604  3.435   0.372  10 B_DT11:DA54_C B 11 ? C 54 ? 20 1 
1 A DT 12 1_555 B DA 21 1_555 -0.018 -0.086 0.218  -4.646  -3.733  0.980  11 B_DT12:DA53_C B 12 ? C 53 ? 20 1 
1 A DA 13 1_555 B DT 20 1_555 -0.030 -0.107 0.227  -6.372  -0.948  0.584  12 B_DA13:DT52_C B 13 ? C 52 ? 20 1 
1 A DG 14 1_555 B DC 19 1_555 -0.110 -0.003 -0.309 -16.122 -2.047  -0.614 13 B_DG14:DC51_C B 14 ? C 51 ? 19 1 
1 A DT 15 1_555 B DA 18 1_555 0.047  -0.110 0.203  -1.320  3.812   1.993  14 B_DT15:DA50_C B 15 ? C 50 ? 20 1 
1 A DA 16 1_555 B DT 17 1_555 0.097  -0.088 0.300  13.528  -8.804  -0.684 15 B_DA16:DT49_C B 16 ? C 49 ? 20 1 
1 A DC 17 1_555 B DG 16 1_555 0.102  -0.034 0.295  -8.388  -1.012  -0.538 16 B_DC17:DG48_C B 17 ? C 48 ? 19 1 
1 A DC 18 1_555 B DG 15 1_555 0.051  -0.066 0.048  -3.187  -2.463  -1.541 17 B_DC18:DG47_C B 18 ? C 47 ? 19 1 
1 A DT 19 1_555 B DA 14 1_555 -0.017 -0.124 -0.307 0.845   -6.272  0.054  18 B_DT19:DA46_C B 19 ? C 46 ? 20 1 
1 A DG 20 1_555 B DC 13 1_555 -0.144 -0.037 0.048  -4.134  -3.846  -0.480 19 B_DG20:DC45_C B 20 ? C 45 ? 19 1 
1 A DG 21 1_555 B DC 12 1_555 -0.106 -0.058 0.062  -7.484  -8.607  0.177  20 B_DG21:DC44_C B 21 ? C 44 ? 19 1 
1 A DA 22 1_555 B DT 11 1_555 0.072  -0.092 -0.142 -4.411  -10.224 0.670  21 B_DA22:DT43_C B 22 ? C 43 ? 20 1 
1 A DT 23 1_555 B DA 10 1_555 -0.014 -0.113 0.395  -10.580 -6.787  1.000  22 B_DT23:DA42_C B 23 ? C 42 ? 20 1 
1 A DG 24 1_555 B DC 9  1_555 -0.077 -0.124 0.813  6.791   0.047   -0.614 23 B_DG24:DC41_C B 24 ? C 41 ? 19 1 
1 A DG 25 1_555 B DC 8  1_555 -0.114 -0.074 -0.020 3.219   5.466   -0.158 24 B_DG25:DC40_C B 25 ? C 40 ? 19 1 
1 A DG 26 1_555 B DC 7  1_555 -0.102 -0.023 -0.213 14.749  6.797   -1.283 25 B_DG26:DC39_C B 26 ? C 39 ? 19 1 
1 A DA 27 1_555 B DT 6  1_555 0.074  -0.083 -0.029 10.054  -6.826  0.786  26 B_DA27:DT38_C B 27 ? C 38 ? 20 1 
1 A DG 28 1_555 B DC 5  1_555 -0.185 -0.055 -0.107 -4.280  0.383   0.478  27 B_DG28:DC37_C B 28 ? C 37 ? 19 1 
1 A DA 29 1_555 B DT 4  1_555 0.099  -0.177 0.759  1.470   -5.534  -0.813 28 B_DA29:DT36_C B 29 ? C 36 ? 20 1 
1 A DC 30 1_555 B DG 3  1_555 0.175  -0.095 0.133  4.006   0.986   -0.875 29 B_DC30:DG35_C B 30 ? C 35 ? 19 1 
1 A DC 31 1_555 B DG 2  1_555 0.113  -0.048 0.166  2.401   -2.170  -1.061 30 B_DC31:DG34_C B 31 ? C 34 ? 19 1 
1 C DC 2  1_555 D DG 31 1_555 0.106  -0.030 0.104  -8.592  -0.069  -0.661 31 E_DC2:DG63_F  E 2  ? F 63 ? 19 1 
1 C DG 3  1_555 D DC 30 1_555 -0.153 -0.105 -0.097 0.280   11.751  0.201  32 E_DG3:DC62_F  E 3  ? F 62 ? 19 1 
1 C DG 4  1_555 D DC 29 1_555 -0.142 -0.016 -0.044 9.861   -4.664  -0.426 33 E_DG4:DC61_F  E 4  ? F 61 ? 19 1 
1 C DG 5  1_555 D DC 28 1_555 -0.169 -0.097 0.395  9.445   1.005   -1.116 34 E_DG5:DC60_F  E 5  ? F 60 ? 19 1 
1 C DC 6  1_555 D DG 27 1_555 0.172  -0.048 0.195  -1.032  -0.872  -0.776 35 E_DC6:DG59_F  E 6  ? F 59 ? 19 1 
1 C DC 7  1_555 D DG 26 1_555 0.155  -0.067 -0.420 1.167   8.029   -1.377 36 E_DC7:DG58_F  E 7  ? F 58 ? 19 1 
1 C DT 8  1_555 D DA 25 1_555 -0.031 -0.129 -0.651 3.198   -1.289  1.753  37 E_DT8:DA57_F  E 8  ? F 57 ? 20 1 
1 C DG 9  1_555 D DC 24 1_555 -0.080 -0.108 -0.602 6.699   -0.057  -1.618 38 E_DG9:DC56_F  E 9  ? F 56 ? 19 1 
1 C DG 10 1_555 D DC 23 1_555 -0.066 -0.145 -0.798 -1.148  0.484   -0.081 39 E_DG10:DC55_F E 10 ? F 55 ? 19 1 
1 C DT 11 1_555 D DA 22 1_555 -0.090 -0.094 -0.166 -5.648  1.815   0.157  40 E_DT11:DA54_F E 11 ? F 54 ? 20 1 
1 C DT 12 1_555 D DA 21 1_555 0.018  -0.091 -0.087 -0.094  -2.454  1.556  41 E_DT12:DA53_F E 12 ? F 53 ? 20 1 
1 C DA 13 1_555 D DT 20 1_555 0.011  -0.055 -0.233 -11.356 -4.050  0.982  42 E_DA13:DT52_F E 13 ? F 52 ? 20 1 
1 C DG 14 1_555 D DC 19 1_555 -0.114 -0.001 -0.364 -15.432 -0.455  -0.044 43 E_DG14:DC51_F E 14 ? F 51 ? 19 1 
1 C DT 15 1_555 D DA 18 1_555 0.048  -0.111 0.075  -0.169  2.051   1.676  44 E_DT15:DA50_F E 15 ? F 50 ? 20 1 
1 C DA 16 1_555 D DT 17 1_555 0.100  -0.085 0.298  13.407  -7.514  -0.478 45 E_DA16:DT49_F E 16 ? F 49 ? 20 1 
1 C DC 17 1_555 D DG 16 1_555 0.115  -0.029 0.220  -7.917  -2.149  -0.491 46 E_DC17:DG48_F E 17 ? F 48 ? 19 1 
1 C DC 18 1_555 D DG 15 1_555 0.072  -0.094 -0.172 -0.646  -4.816  -1.779 47 E_DC18:DG47_F E 18 ? F 47 ? 19 1 
1 C DT 19 1_555 D DA 14 1_555 0.024  -0.150 -0.506 2.256   -6.603  0.521  48 E_DT19:DA46_F E 19 ? F 46 ? 20 1 
1 C DG 20 1_555 D DC 13 1_555 -0.112 -0.043 -0.075 -5.004  -3.723  -0.048 49 E_DG20:DC45_F E 20 ? F 45 ? 19 1 
1 C DG 21 1_555 D DC 12 1_555 -0.109 -0.050 -0.004 -8.228  -8.848  0.272  50 E_DG21:DC44_F E 21 ? F 44 ? 19 1 
1 C DA 22 1_555 D DT 11 1_555 0.082  -0.087 0.023  -4.803  -4.157  0.410  51 E_DA22:DT43_F E 22 ? F 43 ? 20 1 
1 C DT 23 1_555 D DA 10 1_555 0.020  -0.097 0.047  -11.719 -6.753  2.141  52 E_DT23:DA42_F E 23 ? F 42 ? 20 1 
1 C DG 24 1_555 D DC 9  1_555 -0.075 -0.129 0.691  2.583   -0.470  -0.036 53 E_DG24:DC41_F E 24 ? F 41 ? 19 1 
1 C DG 25 1_555 D DC 8  1_555 -0.065 -0.072 0.168  4.342   6.528   -1.355 54 E_DG25:DC40_F E 25 ? F 40 ? 19 1 
1 C DG 26 1_555 D DC 7  1_555 -0.110 -0.002 0.067  16.684  7.502   -1.502 55 E_DG26:DC39_F E 26 ? F 39 ? 19 1 
1 C DA 27 1_555 D DT 6  1_555 0.069  -0.113 -0.163 8.750   -4.263  0.777  56 E_DA27:DT38_F E 27 ? F 38 ? 20 1 
1 C DG 28 1_555 D DC 5  1_555 -0.136 -0.047 -0.262 -4.715  1.358   -0.181 57 E_DG28:DC37_F E 28 ? F 37 ? 19 1 
1 C DA 29 1_555 D DT 4  1_555 0.086  -0.193 0.805  -2.564  -4.805  -0.791 58 E_DA29:DT36_F E 29 ? F 36 ? 20 1 
1 C DC 30 1_555 D DG 3  1_555 0.178  -0.051 0.268  5.794   -2.279  -0.725 59 E_DC30:DG35_F E 30 ? F 35 ? 19 1 
1 C DC 31 1_555 D DG 2  1_555 0.114  -0.043 0.080  5.290   -4.349  -0.871 60 E_DC31:DG34_F E 31 ? F 34 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2  1_555 B DG 31 1_555 A DG 3  1_555 B DC 30 1_555 0.242  1.338  3.163 1.117  -0.159 39.673 1.989  -0.230 3.163 -0.234  
-1.646  39.688 1  BB_DC2DG3:DC62DG63_CC   B 2  ? C 63 ? B 3  ? C 62 ? 
1 A DG 3  1_555 B DC 30 1_555 A DG 4  1_555 B DC 29 1_555 -0.012 0.306  3.391 2.290  3.412  33.182 -0.055 0.416  3.396 5.946   
-3.991  33.428 2  BB_DG3DG4:DC61DC62_CC   B 3  ? C 62 ? B 4  ? C 61 ? 
1 A DG 4  1_555 B DC 29 1_555 A DG 5  1_555 B DC 28 1_555 0.176  -0.313 3.093 -3.886 4.373  33.421 -1.195 -0.887 2.991 7.533   
6.694   33.915 3  BB_DG4DG5:DC60DC61_CC   B 4  ? C 61 ? B 5  ? C 60 ? 
1 A DG 5  1_555 B DC 28 1_555 A DC 6  1_555 B DG 27 1_555 -0.162 -0.500 3.486 6.124  5.843  35.063 -1.680 1.174  3.289 9.528   
-9.985  36.039 4  BB_DG5DC6:DG59DC60_CC   B 5  ? C 60 ? B 6  ? C 59 ? 
1 A DC 6  1_555 B DG 27 1_555 A DC 7  1_555 B DG 26 1_555 0.887  -0.567 3.352 3.377  4.137  33.082 -1.684 -0.967 3.330 7.207   
-5.884  33.499 5  BB_DC6DC7:DG58DG59_CC   B 6  ? C 59 ? B 7  ? C 58 ? 
1 A DC 7  1_555 B DG 26 1_555 A DT 8  1_555 B DA 25 1_555 0.926  0.282  3.122 4.864  6.252  34.457 -0.442 -0.821 3.219 10.384  
-8.079  35.329 6  BB_DC7DT8:DA57DG58_CC   B 7  ? C 58 ? B 8  ? C 57 ? 
1 A DT 8  1_555 B DA 25 1_555 A DG 9  1_555 B DC 24 1_555 -0.764 1.196  3.256 -2.146 6.554  37.474 0.974  0.890  3.446 10.097  
3.306   38.080 7  BB_DT8DG9:DC56DA57_CC   B 8  ? C 57 ? B 9  ? C 56 ? 
1 A DG 9  1_555 B DC 24 1_555 A DG 10 1_555 B DC 23 1_555 0.022  -0.963 3.469 -1.112 11.645 30.440 -3.769 -0.236 2.911 21.220  
2.027   32.561 8  BB_DG9DG10:DC55DC56_CC  B 9  ? C 56 ? B 10 ? C 55 ? 
1 A DG 10 1_555 B DC 23 1_555 A DT 11 1_555 B DA 22 1_555 0.305  -1.528 3.348 -3.397 0.120  30.917 -2.873 -1.231 3.290 0.224   
6.347   31.098 9  BB_DG10DT11:DA54DC55_CC B 10 ? C 55 ? B 11 ? C 54 ? 
1 A DT 11 1_555 B DA 22 1_555 A DT 12 1_555 B DA 21 1_555 0.140  -0.816 3.211 0.136  -2.292 32.638 -1.057 -0.225 3.260 -4.072  
-0.242  32.717 10 BB_DT11DT12:DA53DA54_CC B 11 ? C 54 ? B 12 ? C 53 ? 
1 A DT 12 1_555 B DA 21 1_555 A DA 13 1_555 B DT 20 1_555 -0.295 0.368  3.121 -1.439 1.677  41.747 0.347  0.268  3.141 2.351   
2.017   41.803 11 BB_DT12DA13:DT52DA53_CC B 12 ? C 53 ? B 13 ? C 52 ? 
1 A DA 13 1_555 B DT 20 1_555 A DG 14 1_555 B DC 19 1_555 -0.165 -0.681 3.613 3.586  -2.157 37.028 -0.748 0.785  3.614 -3.382  
-5.625  37.256 12 BB_DA13DG14:DC51DT52_CC B 13 ? C 52 ? B 14 ? C 51 ? 
1 A DG 14 1_555 B DC 19 1_555 A DT 15 1_555 B DA 18 1_555 0.104  -1.115 3.046 -2.867 5.604  22.708 -4.404 -1.110 2.664 13.894  
7.108   23.553 13 BB_DG14DT15:DA50DC51_CC B 14 ? C 51 ? B 15 ? C 50 ? 
1 A DT 15 1_555 B DA 18 1_555 A DA 16 1_555 B DT 17 1_555 -0.775 1.198  2.821 -2.344 4.838  38.638 1.273  0.909  2.984 7.268   
3.522   38.996 14 BB_DT15DA16:DT49DA50_CC B 15 ? C 50 ? B 16 ? C 49 ? 
1 A DA 16 1_555 B DT 17 1_555 A DC 17 1_555 B DG 16 1_555 0.161  -1.408 3.894 -2.100 -4.754 36.131 -1.448 -0.611 4.026 -7.617  
3.364   36.491 15 BB_DA16DC17:DG48DT49_CC B 16 ? C 49 ? B 17 ? C 48 ? 
1 A DC 17 1_555 B DG 16 1_555 A DC 18 1_555 B DG 15 1_555 0.039  -1.002 3.472 3.464  -6.849 31.306 -0.469 0.605  3.588 -12.458 
-6.300  32.210 16 BB_DC17DC18:DG47DG48_CC B 17 ? C 48 ? B 18 ? C 47 ? 
1 A DC 18 1_555 B DG 15 1_555 A DT 19 1_555 B DA 14 1_555 0.558  0.089  3.177 2.777  -1.731 37.323 0.360  -0.513 3.201 -2.698  
-4.329  37.461 17 BB_DC18DT19:DA46DG47_CC B 18 ? C 47 ? B 19 ? C 46 ? 
1 A DT 19 1_555 B DA 14 1_555 A DG 20 1_555 B DC 13 1_555 0.571  1.197  3.521 0.421  0.052  37.390 1.860  -0.832 3.529 0.081   
-0.656  37.392 18 BB_DT19DG20:DC45DA46_CC B 19 ? C 46 ? B 20 ? C 45 ? 
1 A DG 20 1_555 B DC 13 1_555 A DG 21 1_555 B DC 12 1_555 -0.262 0.137  3.346 -1.182 5.295  36.881 -0.506 0.249  3.340 8.314   
1.856   37.264 19 BB_DG20DG21:DC44DC45_CC B 20 ? C 45 ? B 21 ? C 44 ? 
1 A DG 21 1_555 B DC 12 1_555 A DA 22 1_555 B DT 11 1_555 0.693  0.245  3.232 2.765  5.138  36.140 -0.317 -0.723 3.277 8.215   
-4.421  36.592 20 BB_DG21DA22:DT43DC44_CC B 21 ? C 44 ? B 22 ? C 43 ? 
1 A DA 22 1_555 B DT 11 1_555 A DT 23 1_555 B DA 10 1_555 -0.258 -1.198 3.431 -2.034 3.436  27.186 -3.392 0.028  3.268 7.260   
4.298   27.472 21 BB_DA22DT23:DA42DT43_CC B 22 ? C 43 ? B 23 ? C 42 ? 
1 A DT 23 1_555 B DA 10 1_555 A DG 24 1_555 B DC 9  1_555 -0.032 0.827  2.770 -3.639 -6.815 39.254 1.857  -0.300 2.589 -10.027 
5.354   39.977 22 BB_DT23DG24:DC41DA42_CC B 23 ? C 42 ? B 24 ? C 41 ? 
1 A DG 24 1_555 B DC 9  1_555 A DG 25 1_555 B DC 8  1_555 0.318  -0.527 3.560 5.808  15.486 29.149 -3.644 0.471  2.931 28.100  
-10.539 33.426 23 BB_DG24DG25:DC40DC41_CC B 24 ? C 41 ? B 25 ? C 40 ? 
1 A DG 25 1_555 B DC 8  1_555 A DG 26 1_555 B DC 7  1_555 0.702  -0.984 3.178 -0.097 -5.682 22.535 -0.466 -1.778 3.319 -14.251 
0.244   23.232 24 BB_DG25DG26:DC39DC40_CC B 25 ? C 40 ? B 26 ? C 39 ? 
1 A DG 26 1_555 B DC 7  1_555 A DA 27 1_555 B DT 6  1_555 -0.551 0.321  3.539 -1.531 -1.711 43.106 0.619  0.586  3.541 -2.326  
2.082   43.165 25 BB_DG26DA27:DT38DC39_CC B 26 ? C 39 ? B 27 ? C 38 ? 
1 A DA 27 1_555 B DT 6  1_555 A DG 28 1_555 B DC 5  1_555 -0.032 -1.520 3.567 -2.989 5.178  31.582 -3.725 -0.506 3.272 9.408   
5.431   32.129 26 BB_DA27DG28:DC37DT38_CC B 27 ? C 38 ? B 28 ? C 37 ? 
1 A DG 28 1_555 B DC 5  1_555 A DA 29 1_555 B DT 4  1_555 -0.830 0.869  3.209 -6.232 -6.750 37.902 2.103  0.505  3.108 -10.210 
9.427   38.960 27 BB_DG28DA29:DT36DC37_CC B 28 ? C 37 ? B 29 ? C 36 ? 
1 A DA 29 1_555 B DT 4  1_555 A DC 30 1_555 B DG 3  1_555 0.542  -0.773 3.358 4.675  5.074  31.707 -2.295 -0.132 3.243 9.152   
-8.431  32.430 28 BB_DA29DC30:DG35DT36_CC B 29 ? C 36 ? B 30 ? C 35 ? 
1 A DC 30 1_555 B DG 3  1_555 A DC 31 1_555 B DG 2  1_555 0.727  -0.069 3.155 3.790  8.209  37.665 -1.086 -0.643 3.129 12.495  
-5.769  38.697 29 BB_DC30DC31:DG34DG35_CC B 30 ? C 35 ? B 31 ? C 34 ? 
1 C DC 2  1_555 D DG 31 1_555 C DG 3  1_555 D DC 30 1_555 0.162  1.290  3.182 1.337  1.736  39.883 1.692  -0.086 3.237 2.543   
-1.958  39.940 30 EE_DC2DG3:DC62DG63_FF   E 2  ? F 63 ? E 3  ? F 62 ? 
1 C DG 3  1_555 D DC 30 1_555 C DG 4  1_555 D DC 29 1_555 -0.040 0.382  3.327 1.810  1.340  33.380 0.438  0.374  3.332 2.330   
-3.146  33.453 31 EE_DG3DG4:DC61DC62_FF   E 3  ? F 62 ? E 4  ? F 61 ? 
1 C DG 4  1_555 D DC 29 1_555 C DG 5  1_555 D DC 28 1_555 0.083  -0.317 3.173 -3.455 6.852  33.212 -1.588 -0.669 3.026 11.793  
5.946   34.062 32 EE_DG4DG5:DC60DC61_FF   E 4  ? F 61 ? E 5  ? F 60 ? 
1 C DG 5  1_555 D DC 28 1_555 C DC 6  1_555 D DG 27 1_555 -0.155 -0.578 3.544 2.018  5.497  35.177 -1.796 0.566  3.405 9.017   
-3.310  35.645 33 EE_DG5DC6:DG59DC60_FF   E 5  ? F 60 ? E 6  ? F 59 ? 
1 C DC 6  1_555 D DG 27 1_555 C DC 7  1_555 D DG 26 1_555 0.807  -0.594 3.202 4.582  1.778  33.159 -1.321 -0.653 3.246 3.095   
-7.974  33.512 34 EE_DC6DC7:DG58DG59_FF   E 6  ? F 59 ? E 7  ? F 58 ? 
1 C DC 7  1_555 D DG 26 1_555 C DT 8  1_555 D DA 25 1_555 0.905  0.337  3.123 6.089  7.898  34.858 -0.558 -0.608 3.228 12.862  
-9.917  36.214 35 EE_DC7DT8:DA57DG58_FF   E 7  ? F 58 ? E 8  ? F 57 ? 
1 C DT 8  1_555 D DA 25 1_555 C DG 9  1_555 D DC 24 1_555 -0.845 1.215  3.268 -3.910 6.699  37.008 0.974  0.778  3.495 10.413  
6.078   37.784 36 EE_DT8DG9:DC56DA57_FF   E 8  ? F 57 ? E 9  ? F 56 ? 
1 C DG 9  1_555 D DC 24 1_555 C DG 10 1_555 D DC 23 1_555 0.005  -0.984 3.360 -1.955 11.793 30.468 -3.742 -0.340 2.792 21.432  
3.553   32.677 37 EE_DG9DG10:DC55DC56_FF  E 9  ? F 56 ? E 10 ? F 55 ? 
1 C DG 10 1_555 D DC 23 1_555 C DT 11 1_555 D DA 22 1_555 0.214  -1.514 3.457 -3.449 0.126  31.002 -2.841 -1.089 3.408 0.235   
6.427   31.189 38 EE_DG10DT11:DA54DC55_FF E 10 ? F 55 ? E 11 ? F 54 ? 
1 C DT 11 1_555 D DA 22 1_555 C DT 12 1_555 D DA 21 1_555 0.163  -0.750 3.095 -0.243 -2.778 32.005 -0.879 -0.336 3.146 -5.026  
0.440   32.123 39 EE_DT11DT12:DA53DA54_FF E 11 ? F 54 ? E 12 ? F 53 ? 
1 C DT 12 1_555 D DA 21 1_555 C DA 13 1_555 D DT 20 1_555 -0.343 0.428  3.392 0.783  3.937  42.039 0.173  0.559  3.410 5.473   
-1.088  42.222 40 EE_DT12DA13:DT52DA53_FF E 12 ? F 53 ? E 13 ? F 52 ? 
1 C DA 13 1_555 D DT 20 1_555 C DG 14 1_555 D DC 19 1_555 -0.177 -0.560 3.407 -0.082 -2.175 37.177 -0.575 0.265  3.433 -3.408  
0.129   37.239 41 EE_DA13DG14:DC51DT52_FF E 13 ? F 52 ? E 14 ? F 51 ? 
1 C DG 14 1_555 D DC 19 1_555 C DT 15 1_555 D DA 18 1_555 0.079  -1.065 3.018 -0.887 5.433  22.537 -4.313 -0.469 2.685 13.641  
2.228   23.192 42 EE_DG14DT15:DA50DC51_FF E 14 ? F 51 ? E 15 ? F 50 ? 
1 C DT 15 1_555 D DA 18 1_555 C DA 16 1_555 D DT 17 1_555 -0.700 1.226  2.885 -3.762 5.081  38.607 1.272  0.632  3.068 7.622   
5.644   39.102 43 EE_DT15DA16:DT49DA50_FF E 15 ? F 50 ? E 16 ? F 49 ? 
1 C DA 16 1_555 D DT 17 1_555 C DC 17 1_555 D DG 16 1_555 0.235  -1.437 3.890 -1.200 -4.339 36.489 -1.562 -0.572 4.019 -6.897  
1.908   36.756 44 EE_DA16DC17:DG48DT49_FF E 16 ? F 49 ? E 17 ? F 48 ? 
1 C DC 17 1_555 D DG 16 1_555 C DC 18 1_555 D DG 15 1_555 0.091  -0.955 3.359 4.776  -6.160 30.853 -0.550 0.759  3.455 -11.353 
-8.802  31.800 45 EE_DC17DC18:DG47DG48_FF E 17 ? F 48 ? E 18 ? F 47 ? 
1 C DC 18 1_555 D DG 15 1_555 C DT 19 1_555 D DA 14 1_555 0.602  0.181  3.286 2.338  -0.229 37.936 0.307  -0.625 3.315 -0.352  
-3.592  38.006 46 EE_DC18DT19:DA46DG47_FF E 18 ? F 47 ? E 19 ? F 46 ? 
1 C DT 19 1_555 D DA 14 1_555 C DG 20 1_555 D DC 13 1_555 0.522  1.224  3.516 -0.920 0.680  37.242 1.818  -0.948 3.524 1.065   
1.441   37.259 47 EE_DT19DG20:DC45DA46_FF E 19 ? F 46 ? E 20 ? F 45 ? 
1 C DG 20 1_555 D DC 13 1_555 C DG 21 1_555 D DC 12 1_555 -0.187 0.155  3.475 -0.761 2.769  37.414 -0.145 0.184  3.481 4.310   
1.185   37.520 48 EE_DG20DG21:DC44DC45_FF E 20 ? F 45 ? E 21 ? F 44 ? 
1 C DG 21 1_555 D DC 12 1_555 C DA 22 1_555 D DT 11 1_555 0.812  0.151  3.114 1.193  5.178  35.890 -0.454 -1.145 3.129 8.346   
-1.923  36.269 49 EE_DG21DA22:DT43DC44_FF E 21 ? F 44 ? E 22 ? F 43 ? 
1 C DA 22 1_555 D DT 11 1_555 C DT 23 1_555 D DA 10 1_555 -0.236 -1.276 3.446 1.302  3.211  27.499 -3.463 0.817  3.264 6.720   
-2.726  27.713 50 EE_DA22DT23:DA42DT43_FF E 22 ? F 43 ? E 23 ? F 42 ? 
1 C DT 23 1_555 D DA 10 1_555 C DG 24 1_555 D DC 9  1_555 -0.041 0.834  2.912 -5.491 -3.857 39.691 1.598  -0.488 2.804 -5.632  
8.018   40.232 51 EE_DT23DG24:DC41DA42_FF E 23 ? F 42 ? E 24 ? F 41 ? 
1 C DG 24 1_555 D DC 9  1_555 C DG 25 1_555 D DC 8  1_555 0.208  -0.576 3.372 5.205  12.893 29.046 -3.360 0.561  2.862 24.045  
-9.707  32.138 52 EE_DG24DG25:DC40DC41_FF E 24 ? F 41 ? E 25 ? F 40 ? 
1 C DG 25 1_555 D DC 8  1_555 C DG 26 1_555 D DC 7  1_555 0.720  -1.093 3.140 -0.209 -6.285 22.269 -0.528 -1.870 3.311 -15.871 
0.528   23.129 53 EE_DG25DG26:DC39DC40_FF E 25 ? F 40 ? E 26 ? F 39 ? 
1 C DG 26 1_555 D DC 7  1_555 C DA 27 1_555 D DT 6  1_555 -0.556 0.331  3.579 -1.041 0.391  42.703 0.411  0.649  3.594 0.537   
1.429   42.717 54 EE_DG26DA27:DT38DC39_FF E 26 ? F 39 ? E 27 ? F 38 ? 
1 C DA 27 1_555 D DT 6  1_555 C DG 28 1_555 D DC 5  1_555 -0.168 -1.457 3.520 -2.618 4.294  31.233 -3.507 -0.199 3.298 7.911   
4.824   31.625 55 EE_DA27DG28:DC37DT38_FF E 27 ? F 38 ? E 28 ? F 37 ? 
1 C DG 28 1_555 D DC 5  1_555 C DA 29 1_555 D DT 4  1_555 -0.839 0.977  3.312 -8.842 -5.606 38.200 2.117  0.179  3.250 -8.375  
13.211  39.557 56 EE_DG28DA29:DT36DC37_FF E 28 ? F 37 ? E 29 ? F 36 ? 
1 C DA 29 1_555 D DT 4  1_555 C DC 30 1_555 D DG 3  1_555 0.469  -0.757 3.096 5.485  4.273  31.077 -2.117 0.090  3.005 7.852   
-10.081 31.826 57 EE_DA29DC30:DG35DT36_FF E 29 ? F 36 ? E 30 ? F 35 ? 
1 C DC 30 1_555 D DG 3  1_555 C DC 31 1_555 D DG 2  1_555 0.656  -0.019 3.198 3.842  9.938  38.036 -1.188 -0.524 3.145 14.895  
-5.758  39.447 58 EE_DC30DC31:DG34DG35_FF E 30 ? F 35 ? E 31 ? F 34 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
#