data_1THF
# 
_entry.id   1THF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1THF         
WWPDB D_1000176679 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1THF 
_pdbx_database_status.recvd_initial_deposition_date   1998-09-17 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lang, D.A.'   1 
'Wilmanns, M.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural evidence for evolution of the beta/alpha barrel scaffold by gene duplication and fusion.'                   
Science       289 1546 1550 2000 SCIEAS US 0036-8075 0038 ? 10968789 10.1126/science.289.5484.1546 
1       'A Histidine Gene Cluster of the Hyperthermophile Thermotoga Maritima: Sequence Analysis and Evolutionary Significance' 
Extremophiles 2   379  ?    1998 EXTRFI GW 1431-0651 ?    ? ?        ?                             
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lang, D.A.'    1  
primary 'Obmolova, G.'  2  
primary 'Thoma, R.'     3  
primary 'Kirschner, K.' 4  
primary 'Sterner, R.'   5  
primary 'Wilmanns, M.'  6  
1       'Thoma, R.'     7  
1       'Schwander, M.' 8  
1       'Liebl, W.'     9  
1       'Kirschner, K.' 10 
1       'Sterner, R.'   11 
# 
_cell.entry_id           1THF 
_cell.length_a           79.680 
_cell.length_b           44.420 
_cell.length_c           63.910 
_cell.angle_alpha        90.00 
_cell.angle_beta         112.01 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1THF 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HISF PROTEIN'  27739.846 1   ? ? 'CYCLASE SUBUNIT' ? 
2 non-polymer syn 'PHOSPHATE ION' 94.971    2   ? ? ?                 ? 
3 water       nat water           18.015    304 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IMIDAZOLEGLYCEROL PHOSPHATE SYNTHASE SUBUNIT' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MLAKRIIACLDVKDGRVVKGSNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFTVG
GGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVVEV
EKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEY
LKKHGVNVRLEGL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MLAKRIIACLDVKDGRVVKGSNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFTVG
GGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVVEV
EKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEY
LKKHGVNVRLEGL
;
_entity_poly.pdbx_strand_id                 D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   ALA n 
1 4   LYS n 
1 5   ARG n 
1 6   ILE n 
1 7   ILE n 
1 8   ALA n 
1 9   CYS n 
1 10  LEU n 
1 11  ASP n 
1 12  VAL n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  ARG n 
1 17  VAL n 
1 18  VAL n 
1 19  LYS n 
1 20  GLY n 
1 21  SER n 
1 22  ASN n 
1 23  PHE n 
1 24  GLU n 
1 25  ASN n 
1 26  LEU n 
1 27  ARG n 
1 28  ASP n 
1 29  SER n 
1 30  GLY n 
1 31  ASP n 
1 32  PRO n 
1 33  VAL n 
1 34  GLU n 
1 35  LEU n 
1 36  GLY n 
1 37  LYS n 
1 38  PHE n 
1 39  TYR n 
1 40  SER n 
1 41  GLU n 
1 42  ILE n 
1 43  GLY n 
1 44  ILE n 
1 45  ASP n 
1 46  GLU n 
1 47  LEU n 
1 48  VAL n 
1 49  PHE n 
1 50  LEU n 
1 51  ASP n 
1 52  ILE n 
1 53  THR n 
1 54  ALA n 
1 55  SER n 
1 56  VAL n 
1 57  GLU n 
1 58  LYS n 
1 59  ARG n 
1 60  LYS n 
1 61  THR n 
1 62  MET n 
1 63  LEU n 
1 64  GLU n 
1 65  LEU n 
1 66  VAL n 
1 67  GLU n 
1 68  LYS n 
1 69  VAL n 
1 70  ALA n 
1 71  GLU n 
1 72  GLN n 
1 73  ILE n 
1 74  ASP n 
1 75  ILE n 
1 76  PRO n 
1 77  PHE n 
1 78  THR n 
1 79  VAL n 
1 80  GLY n 
1 81  GLY n 
1 82  GLY n 
1 83  ILE n 
1 84  HIS n 
1 85  ASP n 
1 86  PHE n 
1 87  GLU n 
1 88  THR n 
1 89  ALA n 
1 90  SER n 
1 91  GLU n 
1 92  LEU n 
1 93  ILE n 
1 94  LEU n 
1 95  ARG n 
1 96  GLY n 
1 97  ALA n 
1 98  ASP n 
1 99  LYS n 
1 100 VAL n 
1 101 SER n 
1 102 ILE n 
1 103 ASN n 
1 104 THR n 
1 105 ALA n 
1 106 ALA n 
1 107 VAL n 
1 108 GLU n 
1 109 ASN n 
1 110 PRO n 
1 111 SER n 
1 112 LEU n 
1 113 ILE n 
1 114 THR n 
1 115 GLN n 
1 116 ILE n 
1 117 ALA n 
1 118 GLN n 
1 119 THR n 
1 120 PHE n 
1 121 GLY n 
1 122 SER n 
1 123 GLN n 
1 124 ALA n 
1 125 VAL n 
1 126 VAL n 
1 127 VAL n 
1 128 ALA n 
1 129 ILE n 
1 130 ASP n 
1 131 ALA n 
1 132 LYS n 
1 133 ARG n 
1 134 VAL n 
1 135 ASP n 
1 136 GLY n 
1 137 GLU n 
1 138 PHE n 
1 139 MET n 
1 140 VAL n 
1 141 PHE n 
1 142 THR n 
1 143 TYR n 
1 144 SER n 
1 145 GLY n 
1 146 LYS n 
1 147 LYS n 
1 148 ASN n 
1 149 THR n 
1 150 GLY n 
1 151 ILE n 
1 152 LEU n 
1 153 LEU n 
1 154 ARG n 
1 155 ASP n 
1 156 TRP n 
1 157 VAL n 
1 158 VAL n 
1 159 GLU n 
1 160 VAL n 
1 161 GLU n 
1 162 LYS n 
1 163 ARG n 
1 164 GLY n 
1 165 ALA n 
1 166 GLY n 
1 167 GLU n 
1 168 ILE n 
1 169 LEU n 
1 170 LEU n 
1 171 THR n 
1 172 SER n 
1 173 ILE n 
1 174 ASP n 
1 175 ARG n 
1 176 ASP n 
1 177 GLY n 
1 178 THR n 
1 179 LYS n 
1 180 SER n 
1 181 GLY n 
1 182 TYR n 
1 183 ASP n 
1 184 THR n 
1 185 GLU n 
1 186 MET n 
1 187 ILE n 
1 188 ARG n 
1 189 PHE n 
1 190 VAL n 
1 191 ARG n 
1 192 PRO n 
1 193 LEU n 
1 194 THR n 
1 195 THR n 
1 196 LEU n 
1 197 PRO n 
1 198 ILE n 
1 199 ILE n 
1 200 ALA n 
1 201 SER n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 GLY n 
1 206 LYS n 
1 207 MET n 
1 208 GLU n 
1 209 HIS n 
1 210 PHE n 
1 211 LEU n 
1 212 GLU n 
1 213 ALA n 
1 214 PHE n 
1 215 LEU n 
1 216 ALA n 
1 217 GLY n 
1 218 ALA n 
1 219 ASP n 
1 220 ALA n 
1 221 ALA n 
1 222 LEU n 
1 223 ALA n 
1 224 ALA n 
1 225 SER n 
1 226 VAL n 
1 227 PHE n 
1 228 HIS n 
1 229 PHE n 
1 230 ARG n 
1 231 GLU n 
1 232 ILE n 
1 233 ASP n 
1 234 VAL n 
1 235 ARG n 
1 236 GLU n 
1 237 LEU n 
1 238 LYS n 
1 239 GLU n 
1 240 TYR n 
1 241 LEU n 
1 242 LYS n 
1 243 LYS n 
1 244 HIS n 
1 245 GLY n 
1 246 VAL n 
1 247 ASN n 
1 248 VAL n 
1 249 ARG n 
1 250 LEU n 
1 251 GLU n 
1 252 GLY n 
1 253 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermotoga 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 HISF 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'UTH 860' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    INTRACELLULAR 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PUN121-I 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HIS6_THEMA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q9X0C6 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MLAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFTVG
GGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVVEV
EKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEY
LKKHGVNVRLEGL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1THF 
_struct_ref_seq.pdbx_strand_id                D 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 253 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9X0C6 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  253 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       253 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1THF 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           D 
_struct_ref_seq_dif.seq_num                      21 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q9X0C6 
_struct_ref_seq_dif.db_mon_id                    THR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          21 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            21 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1THF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   41.0 
_exptl_crystal.description           'THREE WAVELENGTHS SELENO-METHIONYL MAD EXPERIMENT' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 4.80' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-12-15 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9789  1.0 
2 0.9795  1.0 
3 0.98085 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7A' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   BW7A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9789, 0.9795, 0.98085' 
# 
_reflns.entry_id                     1THF 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             38.000 
_reflns.d_resolution_high            1.400 
_reflns.number_obs                   38416 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0740000 
_reflns.pdbx_netI_over_sigmaI        20.6000 
_reflns.B_iso_Wilson_estimate        13.10 
_reflns.pdbx_redundancy              6.300 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.40 
_reflns_shell.d_res_low              1.44 
_reflns_shell.percent_possible_all   94.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1130000 
_reflns_shell.meanI_over_sigI_obs    7.300 
_reflns_shell.pdbx_redundancy        3.20 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1THF 
_refine.ls_number_reflns_obs                     36206 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.45 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          0.1980000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1780000 
_refine.ls_R_factor_R_free                       0.2140000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1797 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               16.70 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               FREE-RFACTOR 
_refine.details                                  
;NO ELECTRON DENSITY WAS VISIBLE FOR THE RESIDUES 54-58, THEREFORE THE RESIDUES WERE BUILT STEREOCHEMICALLY, BUT THEIR OCCUPANCIES WERE SET TO ZERO. LOCALISATION OF TWO HETEROCOMPOUNDS (PHOSPHATES) INTO THE ELECTRON DENSITY. DOUBLE CONFORMATIONS COULD BE OBSERVED FOR THE FOLLOWING RESIDUE ATOMS: OG SER90, NZ LYS99, OG SER122, AND FOR THE ATOMS NE, CZ, NH1, NH2 OF ARG175. VAL79 SHOWS A TRIPLE CONFORMATION FOR ITS CG1 AND CG2 ATOMS.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1960 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             304 
_refine_hist.number_atoms_total               2274 
_refine_hist.d_res_high                       1.45 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.006  0.020  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.020  0.040  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?      ?      ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.024  0.050  ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?      ?      ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         0.846  2.000  ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        1.353  3.000  ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         1.311  2.000  ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        2.053  3.000  ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?      ?      ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.081  0.150  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.176  0.300  ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.237  0.300  ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?      ?      ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.150  0.300  ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        3.100  7.000  ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     11.300 15.000 ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?      ?      ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    25.900 20.000 ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?      ?      ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1THF 
_struct.title                     'CYCLASE SUBUNIT OF IMIDAZOLEGLYCEROLPHOSPHATE SYNTHASE FROM THERMOTOGA MARITIMA' 
_struct.pdbx_descriptor           'HISF PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1THF 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'THERMOPHILE, TIM-BARREL, HISTIDINE BIOSYNTHESIS, LYASE, PHOSPHATE-BINDING SITES' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 32  ? ILE A 42  ? PRO D 32  ILE D 42  1 ? 11 
HELX_P HELX_P2  2  LYS A 58  ? ALA A 70  ? LYS D 58  ALA D 70  1 ? 13 
HELX_P HELX_P3  3  PHE A 86  ? LEU A 94  ? PHE D 86  LEU D 94  1 ? 9  
HELX_P HELX_P4  4  THR A 104 ? GLU A 108 ? THR D 104 GLU D 108 1 ? 5  
HELX_P HELX_P5  5  PRO A 110 ? PHE A 120 ? PRO D 110 PHE D 120 5 ? 11 
HELX_P HELX_P6  6  SER A 122 ? ALA A 124 ? SER D 122 ALA D 124 5 ? 3  
HELX_P HELX_P7  7  LEU A 153 ? LYS A 162 ? LEU D 153 LYS D 162 1 ? 10 
HELX_P HELX_P8  8  THR A 184 ? LEU A 193 ? THR D 184 LEU D 193 1 ? 10 
HELX_P HELX_P9  9  MET A 207 ? LEU A 215 ? MET D 207 LEU D 215 1 ? 9  
HELX_P HELX_P10 10 SER A 225 ? HIS A 228 ? SER D 225 HIS D 228 1 ? 4  
HELX_P HELX_P11 11 VAL A 234 ? HIS A 244 ? VAL D 234 HIS D 244 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
A 8 9 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 220 ? ALA A 223 ? ALA D 220 ALA D 223 
A 2 ARG A 5   ? VAL A 12  ? ARG D 5   VAL D 12  
A 3 GLU A 46  ? ASP A 51  ? GLU D 46  ASP D 51  
A 4 PRO A 76  ? GLY A 80  ? PRO D 76  GLY D 80  
A 5 LYS A 99  ? ILE A 102 ? LYS D 99  ILE D 102 
A 6 VAL A 125 ? ALA A 131 ? VAL D 125 ALA D 131 
A 7 GLU A 167 ? SER A 172 ? GLU D 167 SER D 172 
A 8 PRO A 197 ? SER A 201 ? PRO D 197 SER D 201 
A 9 ALA A 220 ? LEU A 222 ? ALA D 220 LEU D 222 
B 1 ASP A 130 ? VAL A 134 ? ASP D 130 VAL D 134 
B 2 GLU A 137 ? PHE A 141 ? GLU D 137 PHE D 141 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 221 ? O ALA D 221 N ARG A 5   ? N ARG D 5   
A 2 3 O ALA A 8   ? O ALA D 8   N GLU A 46  ? N GLU D 46  
A 3 4 O LEU A 47  ? O LEU D 47  N PRO A 76  ? N PRO D 76  
A 4 5 O VAL A 79  ? O VAL D 79  N LYS A 99  ? N LYS D 99  
A 5 6 O VAL A 100 ? O VAL D 100 N VAL A 126 ? N VAL D 126 
A 6 7 O VAL A 127 ? O VAL D 127 N GLU A 167 ? N GLU D 167 
A 7 8 O ILE A 168 ? O ILE D 168 N PRO A 197 ? N PRO D 197 
A 8 9 O ALA A 200 ? O ALA D 200 N ALA A 220 ? N ALA D 220 
B 1 2 O ASP A 130 ? O ASP D 130 N PHE A 141 ? N PHE D 141 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PO4 D 305' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PO4 D 306' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ASP A 176 ? ASP D 176 . ? 1_555 ? 
2  AC1 12 GLY A 177 ? GLY D 177 . ? 1_555 ? 
3  AC1 12 GLY A 202 ? GLY D 202 . ? 1_555 ? 
4  AC1 12 GLY A 203 ? GLY D 203 . ? 1_555 ? 
5  AC1 12 ALA A 223 ? ALA D 223 . ? 1_555 ? 
6  AC1 12 ALA A 224 ? ALA D 224 . ? 1_555 ? 
7  AC1 12 SER A 225 ? SER D 225 . ? 1_555 ? 
8  AC1 12 HOH D .   ? HOH D 312 . ? 1_555 ? 
9  AC1 12 HOH D .   ? HOH D 313 . ? 1_555 ? 
10 AC1 12 HOH D .   ? HOH D 317 . ? 1_555 ? 
11 AC1 12 HOH D .   ? HOH D 318 . ? 1_555 ? 
12 AC1 12 HOH D .   ? HOH D 379 . ? 1_555 ? 
13 AC2 9  GLY A 82  ? GLY D 82  . ? 1_555 ? 
14 AC2 9  ASN A 103 ? ASN D 103 . ? 1_555 ? 
15 AC2 9  THR A 104 ? THR D 104 . ? 1_555 ? 
16 AC2 9  HOH D .   ? HOH D 321 . ? 1_555 ? 
17 AC2 9  HOH D .   ? HOH D 327 . ? 1_555 ? 
18 AC2 9  HOH D .   ? HOH D 333 . ? 1_555 ? 
19 AC2 9  HOH D .   ? HOH D 520 . ? 1_555 ? 
20 AC2 9  HOH D .   ? HOH D 549 . ? 1_555 ? 
21 AC2 9  HOH D .   ? HOH D 573 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1THF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1THF 
_atom_sites.fract_transf_matrix[1][1]   0.012550 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005073 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022512 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016877 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 14.322 20.430 -2.337 1.00 17.78 ? 1   MET D N   1 
ATOM   2    C CA  . MET A 1 1   ? 14.423 20.285 -0.855 1.00 18.66 ? 1   MET D CA  1 
ATOM   3    C C   . MET A 1 1   ? 15.153 21.479 -0.242 1.00 18.46 ? 1   MET D C   1 
ATOM   4    O O   . MET A 1 1   ? 15.811 22.241 -0.941 1.00 18.84 ? 1   MET D O   1 
ATOM   5    C CB  . MET A 1 1   ? 15.068 18.970 -0.457 1.00 20.20 ? 1   MET D CB  1 
ATOM   6    C CG  . MET A 1 1   ? 16.569 18.895 -0.674 1.00 20.60 ? 1   MET D CG  1 
ATOM   7    S SD  . MET A 1 1   ? 17.240 17.319 -0.103 1.00 22.81 ? 1   MET D SD  1 
ATOM   8    C CE  . MET A 1 1   ? 16.378 16.194 -1.196 1.00 13.23 ? 1   MET D CE  1 
ATOM   9    N N   . LEU A 1 2   ? 14.983 21.653 1.071  1.00 18.40 ? 2   LEU D N   1 
ATOM   10   C CA  . LEU A 1 2   ? 15.568 22.825 1.718  1.00 19.14 ? 2   LEU D CA  1 
ATOM   11   C C   . LEU A 1 2   ? 17.093 22.722 1.765  1.00 18.53 ? 2   LEU D C   1 
ATOM   12   O O   . LEU A 1 2   ? 17.655 21.647 1.945  1.00 19.07 ? 2   LEU D O   1 
ATOM   13   C CB  . LEU A 1 2   ? 15.025 23.078 3.121  1.00 21.35 ? 2   LEU D CB  1 
ATOM   14   C CG  . LEU A 1 2   ? 15.438 24.404 3.773  1.00 22.45 ? 2   LEU D CG  1 
ATOM   15   C CD1 . LEU A 1 2   ? 14.856 25.606 3.049  1.00 23.53 ? 2   LEU D CD1 1 
ATOM   16   C CD2 . LEU A 1 2   ? 15.042 24.430 5.244  1.00 23.83 ? 2   LEU D CD2 1 
ATOM   17   N N   . ALA A 1 3   ? 17.718 23.869 1.555  1.00 18.93 ? 3   ALA D N   1 
ATOM   18   C CA  . ALA A 1 3   ? 19.176 23.928 1.588  1.00 18.60 ? 3   ALA D CA  1 
ATOM   19   C C   . ALA A 1 3   ? 19.638 23.677 3.021  1.00 17.66 ? 3   ALA D C   1 
ATOM   20   O O   . ALA A 1 3   ? 18.895 23.920 3.977  1.00 18.81 ? 3   ALA D O   1 
ATOM   21   C CB  . ALA A 1 3   ? 19.645 25.294 1.112  1.00 20.27 ? 3   ALA D CB  1 
ATOM   22   N N   . LYS A 1 4   ? 20.804 23.080 3.160  1.00 15.26 ? 4   LYS D N   1 
ATOM   23   C CA  . LYS A 1 4   ? 21.453 22.839 4.456  1.00 13.62 ? 4   LYS D CA  1 
ATOM   24   C C   . LYS A 1 4   ? 22.656 23.776 4.446  1.00 12.68 ? 4   LYS D C   1 
ATOM   25   O O   . LYS A 1 4   ? 23.459 23.732 3.507  1.00 15.38 ? 4   LYS D O   1 
ATOM   26   C CB  . LYS A 1 4   ? 21.835 21.376 4.609  1.00 14.36 ? 4   LYS D CB  1 
ATOM   27   C CG  . LYS A 1 4   ? 20.605 20.471 4.552  1.00 15.68 ? 4   LYS D CG  1 
ATOM   28   C CD  . LYS A 1 4   ? 19.743 20.675 5.799  1.00 16.41 ? 4   LYS D CD  1 
ATOM   29   C CE  . LYS A 1 4   ? 18.522 19.763 5.704  1.00 18.96 ? 4   LYS D CE  1 
ATOM   30   N NZ  . LYS A 1 4   ? 17.621 19.951 6.870  1.00 19.34 ? 4   LYS D NZ  1 
ATOM   31   N N   . ARG A 1 5   ? 22.770 24.669 5.416  1.00 9.73  ? 5   ARG D N   1 
ATOM   32   C CA  . ARG A 1 5   ? 23.815 25.682 5.434  1.00 10.14 ? 5   ARG D CA  1 
ATOM   33   C C   . ARG A 1 5   ? 24.918 25.463 6.449  1.00 8.25  ? 5   ARG D C   1 
ATOM   34   O O   . ARG A 1 5   ? 24.674 24.917 7.529  1.00 8.34  ? 5   ARG D O   1 
ATOM   35   C CB  . ARG A 1 5   ? 23.141 27.033 5.749  1.00 9.39  ? 5   ARG D CB  1 
ATOM   36   C CG  . ARG A 1 5   ? 22.204 27.476 4.611  1.00 10.16 ? 5   ARG D CG  1 
ATOM   37   C CD  . ARG A 1 5   ? 21.292 28.607 5.079  1.00 10.85 ? 5   ARG D CD  1 
ATOM   38   N NE  . ARG A 1 5   ? 20.248 28.106 5.979  1.00 12.29 ? 5   ARG D NE  1 
ATOM   39   C CZ  . ARG A 1 5   ? 19.814 28.692 7.084  1.00 11.62 ? 5   ARG D CZ  1 
ATOM   40   N NH1 . ARG A 1 5   ? 20.276 29.841 7.556  1.00 11.38 ? 5   ARG D NH1 1 
ATOM   41   N NH2 . ARG A 1 5   ? 18.847 28.075 7.763  1.00 11.28 ? 5   ARG D NH2 1 
ATOM   42   N N   . ILE A 1 6   ? 26.116 25.894 6.085  1.00 8.22  ? 6   ILE D N   1 
ATOM   43   C CA  . ILE A 1 6   ? 27.267 25.873 6.985  1.00 8.50  ? 6   ILE D CA  1 
ATOM   44   C C   . ILE A 1 6   ? 27.578 27.318 7.366  1.00 8.28  ? 6   ILE D C   1 
ATOM   45   O O   . ILE A 1 6   ? 27.773 28.166 6.499  1.00 8.05  ? 6   ILE D O   1 
ATOM   46   C CB  . ILE A 1 6   ? 28.513 25.269 6.323  1.00 8.00  ? 6   ILE D CB  1 
ATOM   47   C CG1 . ILE A 1 6   ? 28.254 23.867 5.767  1.00 9.43  ? 6   ILE D CG1 1 
ATOM   48   C CG2 . ILE A 1 6   ? 29.667 25.222 7.323  1.00 9.90  ? 6   ILE D CG2 1 
ATOM   49   C CD1 . ILE A 1 6   ? 27.776 22.855 6.794  1.00 10.62 ? 6   ILE D CD1 1 
ATOM   50   N N   . ILE A 1 7   ? 27.500 27.631 8.661  1.00 7.50  ? 7   ILE D N   1 
ATOM   51   C CA  . ILE A 1 7   ? 27.634 29.012 9.130  1.00 7.31  ? 7   ILE D CA  1 
ATOM   52   C C   . ILE A 1 7   ? 28.799 29.146 10.106 1.00 7.98  ? 7   ILE D C   1 
ATOM   53   O O   . ILE A 1 7   ? 28.982 28.319 11.004 1.00 7.85  ? 7   ILE D O   1 
ATOM   54   C CB  . ILE A 1 7   ? 26.319 29.483 9.816  1.00 6.53  ? 7   ILE D CB  1 
ATOM   55   C CG1 . ILE A 1 7   ? 25.130 29.263 8.858  1.00 7.00  ? 7   ILE D CG1 1 
ATOM   56   C CG2 . ILE A 1 7   ? 26.426 30.931 10.251 1.00 7.36  ? 7   ILE D CG2 1 
ATOM   57   C CD1 . ILE A 1 7   ? 23.772 29.658 9.395  1.00 8.91  ? 7   ILE D CD1 1 
ATOM   58   N N   . ALA A 1 8   ? 29.642 30.162 9.890  1.00 7.78  ? 8   ALA D N   1 
ATOM   59   C CA  . ALA A 1 8   ? 30.752 30.423 10.797 1.00 7.62  ? 8   ALA D CA  1 
ATOM   60   C C   . ALA A 1 8   ? 30.383 31.489 11.821 1.00 8.01  ? 8   ALA D C   1 
ATOM   61   O O   . ALA A 1 8   ? 29.884 32.542 11.446 1.00 7.39  ? 8   ALA D O   1 
ATOM   62   C CB  . ALA A 1 8   ? 31.994 30.864 10.024 1.00 8.46  ? 8   ALA D CB  1 
ATOM   63   N N   . CYS A 1 9   ? 30.685 31.225 13.088 1.00 8.31  ? 9   CYS D N   1 
ATOM   64   C CA  . CYS A 1 9   ? 30.463 32.176 14.167 1.00 8.67  ? 9   CYS D CA  1 
ATOM   65   C C   . CYS A 1 9   ? 31.780 32.894 14.490 1.00 9.31  ? 9   CYS D C   1 
ATOM   66   O O   . CYS A 1 9   ? 32.765 32.216 14.823 1.00 10.26 ? 9   CYS D O   1 
ATOM   67   C CB  . CYS A 1 9   ? 29.927 31.475 15.424 1.00 8.49  ? 9   CYS D CB  1 
ATOM   68   S SG  . CYS A 1 9   ? 29.366 32.684 16.655 1.00 9.22  ? 9   CYS D SG  1 
ATOM   69   N N   . LEU A 1 10  ? 31.760 34.207 14.329 1.00 8.82  ? 10  LEU D N   1 
ATOM   70   C CA  . LEU A 1 10  ? 32.949 35.024 14.566 1.00 10.23 ? 10  LEU D CA  1 
ATOM   71   C C   . LEU A 1 10  ? 32.710 35.823 15.845 1.00 10.60 ? 10  LEU D C   1 
ATOM   72   O O   . LEU A 1 10  ? 31.799 36.649 15.886 1.00 10.14 ? 10  LEU D O   1 
ATOM   73   C CB  . LEU A 1 10  ? 33.218 35.929 13.363 1.00 12.05 ? 10  LEU D CB  1 
ATOM   74   C CG  . LEU A 1 10  ? 33.256 35.260 11.983 1.00 14.08 ? 10  LEU D CG  1 
ATOM   75   C CD1 . LEU A 1 10  ? 33.426 36.302 10.883 1.00 16.36 ? 10  LEU D CD1 1 
ATOM   76   C CD2 . LEU A 1 10  ? 34.286 34.155 11.868 1.00 16.19 ? 10  LEU D CD2 1 
ATOM   77   N N   . ASP A 1 11  ? 33.431 35.467 16.896 1.00 10.80 ? 11  ASP D N   1 
ATOM   78   C CA  . ASP A 1 11  ? 33.267 36.153 18.179 1.00 11.32 ? 11  ASP D CA  1 
ATOM   79   C C   . ASP A 1 11  ? 33.961 37.504 18.106 1.00 11.41 ? 11  ASP D C   1 
ATOM   80   O O   . ASP A 1 11  ? 35.121 37.582 17.703 1.00 12.15 ? 11  ASP D O   1 
ATOM   81   C CB  . ASP A 1 11  ? 33.814 35.258 19.289 1.00 12.74 ? 11  ASP D CB  1 
ATOM   82   C CG  . ASP A 1 11  ? 32.933 34.043 19.507 1.00 14.88 ? 11  ASP D CG  1 
ATOM   83   O OD1 . ASP A 1 11  ? 31.888 33.857 18.861 1.00 15.57 ? 11  ASP D OD1 1 
ATOM   84   O OD2 . ASP A 1 11  ? 33.315 33.222 20.374 1.00 17.26 ? 11  ASP D OD2 1 
ATOM   85   N N   . VAL A 1 12  ? 33.247 38.551 18.481 1.00 11.86 ? 12  VAL D N   1 
ATOM   86   C CA  . VAL A 1 12  ? 33.709 39.924 18.422 1.00 13.91 ? 12  VAL D CA  1 
ATOM   87   C C   . VAL A 1 12  ? 33.888 40.573 19.786 1.00 14.01 ? 12  VAL D C   1 
ATOM   88   O O   . VAL A 1 12  ? 33.105 40.376 20.705 1.00 14.36 ? 12  VAL D O   1 
ATOM   89   C CB  . VAL A 1 12  ? 32.687 40.757 17.599 1.00 14.75 ? 12  VAL D CB  1 
ATOM   90   C CG1 . VAL A 1 12  ? 32.957 42.253 17.646 1.00 16.83 ? 12  VAL D CG1 1 
ATOM   91   C CG2 . VAL A 1 12  ? 32.658 40.300 16.145 1.00 15.86 ? 12  VAL D CG2 1 
ATOM   92   N N   . LYS A 1 13  ? 34.945 41.356 19.905 1.00 15.05 ? 13  LYS D N   1 
ATOM   93   C CA  . LYS A 1 13  ? 35.263 42.156 21.077 1.00 15.99 ? 13  LYS D CA  1 
ATOM   94   C C   . LYS A 1 13  ? 35.764 43.511 20.558 1.00 16.92 ? 13  LYS D C   1 
ATOM   95   O O   . LYS A 1 13  ? 36.693 43.580 19.758 1.00 16.56 ? 13  LYS D O   1 
ATOM   96   C CB  . LYS A 1 13  ? 36.331 41.553 21.984 1.00 17.39 ? 13  LYS D CB  1 
ATOM   97   C CG  . LYS A 1 13  ? 36.841 42.532 23.047 1.00 19.24 ? 13  LYS D CG  1 
ATOM   98   C CD  . LYS A 1 13  ? 37.868 41.879 23.960 1.00 21.05 ? 13  LYS D CD  1 
ATOM   99   C CE  . LYS A 1 13  ? 38.479 42.877 24.932 1.00 22.25 ? 13  LYS D CE  1 
ATOM   100  N NZ  . LYS A 1 13  ? 39.420 43.815 24.256 1.00 23.70 ? 13  LYS D NZ  1 
ATOM   101  N N   . ASP A 1 14  ? 35.117 44.588 20.989 1.00 18.27 ? 14  ASP D N   1 
ATOM   102  C CA  . ASP A 1 14  ? 35.474 45.943 20.586 1.00 20.43 ? 14  ASP D CA  1 
ATOM   103  C C   . ASP A 1 14  ? 35.501 46.133 19.072 1.00 20.53 ? 14  ASP D C   1 
ATOM   104  O O   . ASP A 1 14  ? 36.378 46.795 18.502 1.00 20.49 ? 14  ASP D O   1 
ATOM   105  C CB  . ASP A 1 14  ? 36.820 46.354 21.196 1.00 21.79 ? 14  ASP D CB  1 
ATOM   106  C CG  . ASP A 1 14  ? 36.886 46.265 22.703 1.00 23.18 ? 14  ASP D CG  1 
ATOM   107  O OD1 . ASP A 1 14  ? 35.858 46.492 23.372 1.00 24.02 ? 14  ASP D OD1 1 
ATOM   108  O OD2 . ASP A 1 14  ? 37.971 45.956 23.253 1.00 24.46 ? 14  ASP D OD2 1 
ATOM   109  N N   . GLY A 1 15  ? 34.555 45.530 18.364 1.00 19.85 ? 15  GLY D N   1 
ATOM   110  C CA  . GLY A 1 15  ? 34.409 45.642 16.928 1.00 19.80 ? 15  GLY D CA  1 
ATOM   111  C C   . GLY A 1 15  ? 35.389 44.853 16.091 1.00 20.24 ? 15  GLY D C   1 
ATOM   112  O O   . GLY A 1 15  ? 35.466 45.056 14.871 1.00 20.13 ? 15  GLY D O   1 
ATOM   113  N N   . ARG A 1 16  ? 36.187 43.987 16.699 1.00 20.11 ? 16  ARG D N   1 
ATOM   114  C CA  . ARG A 1 16  ? 37.159 43.168 15.991 1.00 20.89 ? 16  ARG D CA  1 
ATOM   115  C C   . ARG A 1 16  ? 36.963 41.696 16.361 1.00 20.00 ? 16  ARG D C   1 
ATOM   116  O O   . ARG A 1 16  ? 36.503 41.382 17.460 1.00 20.39 ? 16  ARG D O   1 
ATOM   117  C CB  . ARG A 1 16  ? 38.591 43.588 16.311 1.00 23.64 ? 16  ARG D CB  1 
ATOM   118  C CG  . ARG A 1 16  ? 38.916 45.033 15.955 1.00 25.95 ? 16  ARG D CG  1 
ATOM   119  C CD  . ARG A 1 16  ? 40.384 45.336 16.182 1.00 27.87 ? 16  ARG D CD  1 
ATOM   120  N NE  . ARG A 1 16  ? 41.253 44.514 15.367 1.00 29.47 ? 16  ARG D NE  1 
ATOM   121  C CZ  . ARG A 1 16  ? 41.332 44.508 14.043 1.00 30.42 ? 16  ARG D CZ  1 
ATOM   122  N NH1 . ARG A 1 16  ? 40.585 45.276 13.266 1.00 31.44 ? 16  ARG D NH1 1 
ATOM   123  N NH2 . ARG A 1 16  ? 42.209 43.681 13.497 1.00 30.51 ? 16  ARG D NH2 1 
ATOM   124  N N   . VAL A 1 17  ? 37.296 40.813 15.429 1.00 18.30 ? 17  VAL D N   1 
ATOM   125  C CA  . VAL A 1 17  ? 37.146 39.381 15.693 1.00 17.30 ? 17  VAL D CA  1 
ATOM   126  C C   . VAL A 1 17  ? 38.255 38.885 16.604 1.00 17.73 ? 17  VAL D C   1 
ATOM   127  O O   . VAL A 1 17  ? 39.430 39.202 16.412 1.00 16.75 ? 17  VAL D O   1 
ATOM   128  C CB  . VAL A 1 17  ? 37.088 38.585 14.380 1.00 17.47 ? 17  VAL D CB  1 
ATOM   129  C CG1 . VAL A 1 17  ? 36.822 37.111 14.652 1.00 16.52 ? 17  VAL D CG1 1 
ATOM   130  C CG2 . VAL A 1 17  ? 35.963 39.137 13.504 1.00 17.60 ? 17  VAL D CG2 1 
ATOM   131  N N   . VAL A 1 18  ? 37.894 38.156 17.654 1.00 17.81 ? 18  VAL D N   1 
ATOM   132  C CA  . VAL A 1 18  ? 38.879 37.600 18.585 1.00 19.40 ? 18  VAL D CA  1 
ATOM   133  C C   . VAL A 1 18  ? 39.936 36.867 17.773 1.00 19.73 ? 18  VAL D C   1 
ATOM   134  O O   . VAL A 1 18  ? 39.601 36.070 16.887 1.00 19.33 ? 18  VAL D O   1 
ATOM   135  C CB  . VAL A 1 18  ? 38.185 36.680 19.602 1.00 20.44 ? 18  VAL D CB  1 
ATOM   136  C CG1 . VAL A 1 18  ? 39.187 35.910 20.443 1.00 21.33 ? 18  VAL D CG1 1 
ATOM   137  C CG2 . VAL A 1 18  ? 37.271 37.528 20.480 1.00 21.50 ? 18  VAL D CG2 1 
ATOM   138  N N   . LYS A 1 19  ? 41.198 37.180 18.015 1.00 21.33 ? 19  LYS D N   1 
ATOM   139  C CA  . LYS A 1 19  ? 42.309 36.625 17.258 1.00 24.04 ? 19  LYS D CA  1 
ATOM   140  C C   . LYS A 1 19  ? 43.019 35.494 17.980 1.00 26.31 ? 19  LYS D C   1 
ATOM   141  O O   . LYS A 1 19  ? 42.390 34.751 18.741 1.00 25.92 ? 19  LYS D O   1 
ATOM   142  C CB  . LYS A 1 19  ? 43.306 37.752 16.937 1.00 23.62 ? 19  LYS D CB  1 
ATOM   143  C CG  . LYS A 1 19  ? 42.837 38.727 15.879 1.00 23.77 ? 19  LYS D CG  1 
ATOM   144  C CD  . LYS A 1 19  ? 43.935 39.693 15.457 1.00 23.31 ? 19  LYS D CD  1 
ATOM   145  C CE  . LYS A 1 19  ? 44.923 39.118 14.461 1.00 22.59 ? 19  LYS D CE  1 
ATOM   146  N NZ  . LYS A 1 19  ? 45.687 40.201 13.765 1.00 21.25 ? 19  LYS D NZ  1 
ATOM   147  N N   . GLY A 1 20  ? 44.312 35.339 17.722 1.00 28.86 ? 20  GLY D N   1 
ATOM   148  C CA  . GLY A 1 20  ? 45.128 34.306 18.326 1.00 32.27 ? 20  GLY D CA  1 
ATOM   149  C C   . GLY A 1 20  ? 45.027 32.962 17.627 1.00 33.98 ? 20  GLY D C   1 
ATOM   150  O O   . GLY A 1 20  ? 45.359 31.956 18.266 1.00 35.27 ? 20  GLY D O   1 
ATOM   151  N N   . SER A 1 21  ? 44.664 32.912 16.336 1.00 35.57 ? 21  SER D N   1 
ATOM   152  C CA  . SER A 1 21  ? 44.440 31.608 15.722 1.00 37.15 ? 21  SER D CA  1 
ATOM   153  C C   . SER A 1 21  ? 45.287 31.439 14.465 1.00 38.16 ? 21  SER D C   1 
ATOM   154  O O   . SER A 1 21  ? 45.189 30.433 13.738 1.00 39.40 ? 21  SER D O   1 
ATOM   155  C CB  . SER A 1 21  ? 42.957 31.418 15.396 1.00 36.87 ? 21  SER D CB  1 
ATOM   156  O OG  . SER A 1 21  ? 42.519 32.364 14.437 1.00 20.00 ? 21  SER D OG  1 
ATOM   157  N N   . ASN A 1 22  ? 46.153 32.391 14.219 1.00 38.71 ? 22  ASN D N   1 
ATOM   158  C CA  . ASN A 1 22  ? 47.080 32.420 13.109 1.00 38.22 ? 22  ASN D CA  1 
ATOM   159  C C   . ASN A 1 22  ? 46.507 31.999 11.768 1.00 37.00 ? 22  ASN D C   1 
ATOM   160  O O   . ASN A 1 22  ? 46.394 30.858 11.330 1.00 36.51 ? 22  ASN D O   1 
ATOM   161  C CB  . ASN A 1 22  ? 48.350 31.640 13.487 1.00 39.66 ? 22  ASN D CB  1 
ATOM   162  C CG  . ASN A 1 22  ? 48.996 32.291 14.702 1.00 40.79 ? 22  ASN D CG  1 
ATOM   163  O OD1 . ASN A 1 22  ? 48.997 33.520 14.822 1.00 41.54 ? 22  ASN D OD1 1 
ATOM   164  N ND2 . ASN A 1 22  ? 49.516 31.487 15.620 1.00 41.66 ? 22  ASN D ND2 1 
ATOM   165  N N   . PHE A 1 23  ? 46.088 33.035 11.055 1.00 35.59 ? 23  PHE D N   1 
ATOM   166  C CA  . PHE A 1 23  ? 45.629 32.992 9.678  1.00 34.65 ? 23  PHE D CA  1 
ATOM   167  C C   . PHE A 1 23  ? 46.751 33.648 8.873  1.00 34.95 ? 23  PHE D C   1 
ATOM   168  O O   . PHE A 1 23  ? 46.650 34.741 8.329  1.00 34.51 ? 23  PHE D O   1 
ATOM   169  C CB  . PHE A 1 23  ? 44.311 33.724 9.487  1.00 33.76 ? 23  PHE D CB  1 
ATOM   170  C CG  . PHE A 1 23  ? 43.095 32.953 9.918  1.00 32.46 ? 23  PHE D CG  1 
ATOM   171  C CD1 . PHE A 1 23  ? 42.784 32.787 11.254 1.00 32.10 ? 23  PHE D CD1 1 
ATOM   172  C CD2 . PHE A 1 23  ? 42.256 32.406 8.961  1.00 31.98 ? 23  PHE D CD2 1 
ATOM   173  C CE1 . PHE A 1 23  ? 41.657 32.080 11.630 1.00 31.44 ? 23  PHE D CE1 1 
ATOM   174  C CE2 . PHE A 1 23  ? 41.128 31.698 9.331  1.00 31.59 ? 23  PHE D CE2 1 
ATOM   175  C CZ  . PHE A 1 23  ? 40.831 31.539 10.669 1.00 31.40 ? 23  PHE D CZ  1 
ATOM   176  N N   . GLU A 1 24  ? 47.866 32.924 8.779  1.00 34.84 ? 24  GLU D N   1 
ATOM   177  C CA  . GLU A 1 24  ? 49.062 33.378 8.079  1.00 34.93 ? 24  GLU D CA  1 
ATOM   178  C C   . GLU A 1 24  ? 48.819 33.721 6.621  1.00 33.18 ? 24  GLU D C   1 
ATOM   179  O O   . GLU A 1 24  ? 49.535 34.526 6.020  1.00 33.23 ? 24  GLU D O   1 
ATOM   180  C CB  . GLU A 1 24  ? 50.169 32.333 8.247  1.00 36.75 ? 24  GLU D CB  1 
ATOM   181  C CG  . GLU A 1 24  ? 50.404 31.948 9.701  1.00 39.11 ? 24  GLU D CG  1 
ATOM   182  C CD  . GLU A 1 24  ? 51.080 33.010 10.539 1.00 40.37 ? 24  GLU D CD  1 
ATOM   183  O OE1 . GLU A 1 24  ? 50.668 34.188 10.533 1.00 41.43 ? 24  GLU D OE1 1 
ATOM   184  O OE2 . GLU A 1 24  ? 52.054 32.658 11.243 1.00 41.54 ? 24  GLU D OE2 1 
ATOM   185  N N   . ASN A 1 25  ? 47.768 33.177 6.027  1.00 30.80 ? 25  ASN D N   1 
ATOM   186  C CA  . ASN A 1 25  ? 47.280 33.463 4.704  1.00 28.70 ? 25  ASN D CA  1 
ATOM   187  C C   . ASN A 1 25  ? 46.478 34.761 4.617  1.00 28.21 ? 25  ASN D C   1 
ATOM   188  O O   . ASN A 1 25  ? 46.100 35.153 3.510  1.00 27.75 ? 25  ASN D O   1 
ATOM   189  C CB  . ASN A 1 25  ? 46.409 32.298 4.209  1.00 28.44 ? 25  ASN D CB  1 
ATOM   190  C CG  . ASN A 1 25  ? 45.278 31.936 5.149  1.00 27.79 ? 25  ASN D CG  1 
ATOM   191  O OD1 . ASN A 1 25  ? 45.494 31.681 6.338  1.00 27.30 ? 25  ASN D OD1 1 
ATOM   192  N ND2 . ASN A 1 25  ? 44.064 31.909 4.610  1.00 26.63 ? 25  ASN D ND2 1 
ATOM   193  N N   . LEU A 1 26  ? 46.209 35.442 5.725  1.00 26.66 ? 26  LEU D N   1 
ATOM   194  C CA  . LEU A 1 26  ? 45.479 36.698 5.750  1.00 25.76 ? 26  LEU D CA  1 
ATOM   195  C C   . LEU A 1 26  ? 46.312 37.827 6.360  1.00 25.83 ? 26  LEU D C   1 
ATOM   196  O O   . LEU A 1 26  ? 47.135 37.577 7.239  1.00 26.13 ? 26  LEU D O   1 
ATOM   197  C CB  . LEU A 1 26  ? 44.196 36.572 6.578  1.00 24.98 ? 26  LEU D CB  1 
ATOM   198  C CG  . LEU A 1 26  ? 43.183 35.480 6.280  1.00 24.58 ? 26  LEU D CG  1 
ATOM   199  C CD1 . LEU A 1 26  ? 41.939 35.636 7.162  1.00 24.80 ? 26  LEU D CD1 1 
ATOM   200  C CD2 . LEU A 1 26  ? 42.752 35.458 4.821  1.00 24.92 ? 26  LEU D CD2 1 
ATOM   201  N N   . ARG A 1 27  ? 46.045 39.072 5.974  1.00 25.94 ? 27  ARG D N   1 
ATOM   202  C CA  . ARG A 1 27  ? 46.769 40.217 6.515  1.00 26.42 ? 27  ARG D CA  1 
ATOM   203  C C   . ARG A 1 27  ? 46.401 40.462 7.974  1.00 24.86 ? 27  ARG D C   1 
ATOM   204  O O   . ARG A 1 27  ? 47.265 40.738 8.808  1.00 24.51 ? 27  ARG D O   1 
ATOM   205  C CB  . ARG A 1 27  ? 46.500 41.468 5.680  1.00 28.24 ? 27  ARG D CB  1 
ATOM   206  C CG  . ARG A 1 27  ? 47.488 42.608 5.843  1.00 30.67 ? 27  ARG D CG  1 
ATOM   207  C CD  . ARG A 1 27  ? 48.824 42.340 5.184  1.00 31.63 ? 27  ARG D CD  1 
ATOM   208  N NE  . ARG A 1 27  ? 48.851 42.551 3.746  1.00 32.52 ? 27  ARG D NE  1 
ATOM   209  C CZ  . ARG A 1 27  ? 49.189 43.656 3.100  1.00 33.13 ? 27  ARG D CZ  1 
ATOM   210  N NH1 . ARG A 1 27  ? 49.576 44.748 3.754  1.00 33.92 ? 27  ARG D NH1 1 
ATOM   211  N NH2 . ARG A 1 27  ? 49.172 43.715 1.775  1.00 32.66 ? 27  ARG D NH2 1 
ATOM   212  N N   . ASP A 1 28  ? 45.110 40.374 8.294  1.00 22.48 ? 28  ASP D N   1 
ATOM   213  C CA  . ASP A 1 28  ? 44.641 40.589 9.657  1.00 21.95 ? 28  ASP D CA  1 
ATOM   214  C C   . ASP A 1 28  ? 43.354 39.821 9.913  1.00 20.24 ? 28  ASP D C   1 
ATOM   215  O O   . ASP A 1 28  ? 42.243 40.306 9.658  1.00 18.91 ? 28  ASP D O   1 
ATOM   216  C CB  . ASP A 1 28  ? 44.432 42.074 9.921  1.00 22.24 ? 28  ASP D CB  1 
ATOM   217  C CG  . ASP A 1 28  ? 43.901 42.435 11.283 1.00 22.45 ? 28  ASP D CG  1 
ATOM   218  O OD1 . ASP A 1 28  ? 43.784 41.579 12.192 1.00 21.65 ? 28  ASP D OD1 1 
ATOM   219  O OD2 . ASP A 1 28  ? 43.562 43.626 11.468 1.00 23.49 ? 28  ASP D OD2 1 
ATOM   220  N N   . SER A 1 29  ? 43.481 38.662 10.561 1.00 19.82 ? 29  SER D N   1 
ATOM   221  C CA  . SER A 1 29  ? 42.322 37.837 10.895 1.00 19.06 ? 29  SER D CA  1 
ATOM   222  C C   . SER A 1 29  ? 41.425 38.431 11.963 1.00 17.97 ? 29  SER D C   1 
ATOM   223  O O   . SER A 1 29  ? 40.374 37.852 12.274 1.00 16.96 ? 29  SER D O   1 
ATOM   224  C CB  . SER A 1 29  ? 42.777 36.430 11.290 1.00 20.16 ? 29  SER D CB  1 
ATOM   225  O OG  . SER A 1 29  ? 43.604 36.505 12.439 1.00 20.14 ? 29  SER D OG  1 
ATOM   226  N N   . GLY A 1 30  ? 41.758 39.574 12.548 1.00 17.49 ? 30  GLY D N   1 
ATOM   227  C CA  . GLY A 1 30  ? 40.929 40.258 13.518 1.00 17.00 ? 30  GLY D CA  1 
ATOM   228  C C   . GLY A 1 30  ? 39.974 41.221 12.814 1.00 15.64 ? 30  GLY D C   1 
ATOM   229  O O   . GLY A 1 30  ? 39.032 41.726 13.410 1.00 15.92 ? 30  GLY D O   1 
ATOM   230  N N   . ASP A 1 31  ? 40.239 41.502 11.533 1.00 14.98 ? 31  ASP D N   1 
ATOM   231  C CA  . ASP A 1 31  ? 39.376 42.423 10.787 1.00 16.13 ? 31  ASP D CA  1 
ATOM   232  C C   . ASP A 1 31  ? 38.123 41.689 10.333 1.00 15.12 ? 31  ASP D C   1 
ATOM   233  O O   . ASP A 1 31  ? 38.201 40.732 9.560  1.00 15.05 ? 31  ASP D O   1 
ATOM   234  C CB  . ASP A 1 31  ? 40.175 42.931 9.584  1.00 17.25 ? 31  ASP D CB  1 
ATOM   235  C CG  . ASP A 1 31  ? 39.389 43.798 8.629  1.00 18.88 ? 31  ASP D CG  1 
ATOM   236  O OD1 . ASP A 1 31  ? 38.276 44.257 8.945  1.00 19.28 ? 31  ASP D OD1 1 
ATOM   237  O OD2 . ASP A 1 31  ? 39.927 44.025 7.515  1.00 20.42 ? 31  ASP D OD2 1 
ATOM   238  N N   . PRO A 1 32  ? 36.950 42.173 10.749 1.00 15.29 ? 32  PRO D N   1 
ATOM   239  C CA  . PRO A 1 32  ? 35.698 41.535 10.355 1.00 15.08 ? 32  PRO D CA  1 
ATOM   240  C C   . PRO A 1 32  ? 35.460 41.533 8.855  1.00 15.37 ? 32  PRO D C   1 
ATOM   241  O O   . PRO A 1 32  ? 34.860 40.574 8.348  1.00 14.89 ? 32  PRO D O   1 
ATOM   242  C CB  . PRO A 1 32  ? 34.620 42.306 11.096 1.00 16.42 ? 32  PRO D CB  1 
ATOM   243  C CG  . PRO A 1 32  ? 35.246 43.574 11.544 1.00 17.20 ? 32  PRO D CG  1 
ATOM   244  C CD  . PRO A 1 32  ? 36.728 43.305 11.663 1.00 15.98 ? 32  PRO D CD  1 
ATOM   245  N N   . VAL A 1 33  ? 35.913 42.558 8.153  1.00 15.54 ? 33  VAL D N   1 
ATOM   246  C CA  . VAL A 1 33  ? 35.761 42.645 6.708  1.00 16.44 ? 33  VAL D CA  1 
ATOM   247  C C   . VAL A 1 33  ? 36.634 41.622 5.993  1.00 15.45 ? 33  VAL D C   1 
ATOM   248  O O   . VAL A 1 33  ? 36.133 40.761 5.269  1.00 15.91 ? 33  VAL D O   1 
ATOM   249  C CB  . VAL A 1 33  ? 36.075 44.074 6.219  1.00 17.88 ? 33  VAL D CB  1 
ATOM   250  C CG1 . VAL A 1 33  ? 36.066 44.163 4.700  1.00 19.02 ? 33  VAL D CG1 1 
ATOM   251  C CG2 . VAL A 1 33  ? 35.068 45.056 6.807  1.00 19.55 ? 33  VAL D CG2 1 
ATOM   252  N N   . GLU A 1 34  ? 37.942 41.618 6.288  1.00 15.18 ? 34  GLU D N   1 
ATOM   253  C CA  . GLU A 1 34  ? 38.834 40.672 5.632  1.00 15.17 ? 34  GLU D CA  1 
ATOM   254  C C   . GLU A 1 34  ? 38.486 39.221 5.941  1.00 13.17 ? 34  GLU D C   1 
ATOM   255  O O   . GLU A 1 34  ? 38.464 38.353 5.075  1.00 12.97 ? 34  GLU D O   1 
ATOM   256  C CB  . GLU A 1 34  ? 40.310 40.927 5.970  1.00 15.86 ? 34  GLU D CB  1 
ATOM   257  C CG  . GLU A 1 34  ? 41.267 40.154 5.073  1.00 17.92 ? 34  GLU D CG  1 
ATOM   258  C CD  . GLU A 1 34  ? 42.721 40.272 5.507  1.00 19.68 ? 34  GLU D CD  1 
ATOM   259  O OE1 . GLU A 1 34  ? 42.981 40.833 6.585  1.00 20.04 ? 34  GLU D OE1 1 
ATOM   260  O OE2 . GLU A 1 34  ? 43.566 39.746 4.756  1.00 21.14 ? 34  GLU D OE2 1 
ATOM   261  N N   . LEU A 1 35  ? 38.184 38.929 7.212  1.00 12.59 ? 35  LEU D N   1 
ATOM   262  C CA  . LEU A 1 35  ? 37.879 37.559 7.615  1.00 12.86 ? 35  LEU D CA  1 
ATOM   263  C C   . LEU A 1 35  ? 36.518 37.103 7.079  1.00 12.31 ? 35  LEU D C   1 
ATOM   264  O O   . LEU A 1 35  ? 36.417 35.991 6.565  1.00 12.76 ? 35  LEU D O   1 
ATOM   265  C CB  . LEU A 1 35  ? 37.925 37.396 9.134  1.00 12.70 ? 35  LEU D CB  1 
ATOM   266  C CG  . LEU A 1 35  ? 37.761 35.963 9.660  1.00 12.76 ? 35  LEU D CG  1 
ATOM   267  C CD1 . LEU A 1 35  ? 38.906 35.066 9.225  1.00 14.46 ? 35  LEU D CD1 1 
ATOM   268  C CD2 . LEU A 1 35  ? 37.643 36.014 11.182 1.00 13.34 ? 35  LEU D CD2 1 
ATOM   269  N N   . GLY A 1 36  ? 35.543 38.008 7.137  1.00 14.15 ? 36  GLY D N   1 
ATOM   270  C CA  . GLY A 1 36  ? 34.214 37.678 6.602  1.00 14.03 ? 36  GLY D CA  1 
ATOM   271  C C   . GLY A 1 36  ? 34.276 37.431 5.101  1.00 14.37 ? 36  GLY D C   1 
ATOM   272  O O   . GLY A 1 36  ? 33.710 36.446 4.613  1.00 14.97 ? 36  GLY D O   1 
ATOM   273  N N   . LYS A 1 37  ? 35.013 38.287 4.384  1.00 13.83 ? 37  LYS D N   1 
ATOM   274  C CA  . LYS A 1 37  ? 35.157 38.085 2.940  1.00 15.07 ? 37  LYS D CA  1 
ATOM   275  C C   . LYS A 1 37  ? 35.895 36.795 2.613  1.00 14.38 ? 37  LYS D C   1 
ATOM   276  O O   . LYS A 1 37  ? 35.494 36.041 1.727  1.00 14.08 ? 37  LYS D O   1 
ATOM   277  C CB  . LYS A 1 37  ? 35.897 39.269 2.320  1.00 16.62 ? 37  LYS D CB  1 
ATOM   278  C CG  . LYS A 1 37  ? 36.019 39.123 0.801  1.00 19.28 ? 37  LYS D CG  1 
ATOM   279  C CD  . LYS A 1 37  ? 36.282 40.477 0.164  1.00 21.73 ? 37  LYS D CD  1 
ATOM   280  C CE  . LYS A 1 37  ? 36.583 40.331 -1.323 1.00 23.18 ? 37  LYS D CE  1 
ATOM   281  N NZ  . LYS A 1 37  ? 35.553 39.516 -2.021 1.00 25.01 ? 37  LYS D NZ  1 
ATOM   282  N N   . PHE A 1 38  ? 36.933 36.473 3.379  1.00 12.82 ? 38  PHE D N   1 
ATOM   283  C CA  . PHE A 1 38  ? 37.626 35.204 3.236  1.00 14.08 ? 38  PHE D CA  1 
ATOM   284  C C   . PHE A 1 38  ? 36.683 34.011 3.331  1.00 14.73 ? 38  PHE D C   1 
ATOM   285  O O   . PHE A 1 38  ? 36.578 33.200 2.427  1.00 14.69 ? 38  PHE D O   1 
ATOM   286  C CB  . PHE A 1 38  ? 38.732 35.072 4.281  1.00 15.73 ? 38  PHE D CB  1 
ATOM   287  C CG  . PHE A 1 38  ? 39.293 33.686 4.378  1.00 17.83 ? 38  PHE D CG  1 
ATOM   288  C CD1 . PHE A 1 38  ? 40.044 33.157 3.342  1.00 17.96 ? 38  PHE D CD1 1 
ATOM   289  C CD2 . PHE A 1 38  ? 39.064 32.912 5.501  1.00 18.83 ? 38  PHE D CD2 1 
ATOM   290  C CE1 . PHE A 1 38  ? 40.560 31.879 3.426  1.00 19.81 ? 38  PHE D CE1 1 
ATOM   291  C CE2 . PHE A 1 38  ? 39.577 31.632 5.591  1.00 21.00 ? 38  PHE D CE2 1 
ATOM   292  C CZ  . PHE A 1 38  ? 40.326 31.115 4.552  1.00 20.90 ? 38  PHE D CZ  1 
ATOM   293  N N   . TYR A 1 39  ? 35.900 33.963 4.429  1.00 15.55 ? 39  TYR D N   1 
ATOM   294  C CA  . TYR A 1 39  ? 34.949 32.853 4.561  1.00 16.28 ? 39  TYR D CA  1 
ATOM   295  C C   . TYR A 1 39  ? 33.975 32.765 3.397  1.00 17.37 ? 39  TYR D C   1 
ATOM   296  O O   . TYR A 1 39  ? 33.692 31.649 2.939  1.00 17.98 ? 39  TYR D O   1 
ATOM   297  C CB  . TYR A 1 39  ? 34.189 32.942 5.896  1.00 15.43 ? 39  TYR D CB  1 
ATOM   298  C CG  . TYR A 1 39  ? 35.063 32.429 7.021  1.00 14.27 ? 39  TYR D CG  1 
ATOM   299  C CD1 . TYR A 1 39  ? 35.615 31.156 6.974  1.00 14.85 ? 39  TYR D CD1 1 
ATOM   300  C CD2 . TYR A 1 39  ? 35.337 33.234 8.118  1.00 14.28 ? 39  TYR D CD2 1 
ATOM   301  C CE1 . TYR A 1 39  ? 36.438 30.692 7.978  1.00 15.48 ? 39  TYR D CE1 1 
ATOM   302  C CE2 . TYR A 1 39  ? 36.155 32.770 9.130  1.00 15.07 ? 39  TYR D CE2 1 
ATOM   303  C CZ  . TYR A 1 39  ? 36.695 31.511 9.064  1.00 14.61 ? 39  TYR D CZ  1 
ATOM   304  O OH  . TYR A 1 39  ? 37.511 31.078 10.071 1.00 16.50 ? 39  TYR D OH  1 
ATOM   305  N N   . SER A 1 40  ? 33.477 33.889 2.930  1.00 18.34 ? 40  SER D N   1 
ATOM   306  C CA  . SER A 1 40  ? 32.615 34.018 1.762  1.00 20.88 ? 40  SER D CA  1 
ATOM   307  C C   . SER A 1 40  ? 33.243 33.374 0.527  1.00 22.03 ? 40  SER D C   1 
ATOM   308  O O   . SER A 1 40  ? 32.577 32.708 -0.270 1.00 22.09 ? 40  SER D O   1 
ATOM   309  C CB  . SER A 1 40  ? 32.402 35.503 1.469  1.00 22.91 ? 40  SER D CB  1 
ATOM   310  O OG  . SER A 1 40  ? 31.285 35.878 0.703  1.00 26.05 ? 40  SER D OG  1 
ATOM   311  N N   . GLU A 1 41  ? 34.548 33.569 0.355  1.00 21.69 ? 41  GLU D N   1 
ATOM   312  C CA  . GLU A 1 41  ? 35.251 33.018 -0.796 1.00 21.55 ? 41  GLU D CA  1 
ATOM   313  C C   . GLU A 1 41  ? 35.599 31.553 -0.705 1.00 21.86 ? 41  GLU D C   1 
ATOM   314  O O   . GLU A 1 41  ? 35.842 30.947 -1.761 1.00 22.39 ? 41  GLU D O   1 
ATOM   315  C CB  . GLU A 1 41  ? 36.527 33.858 -1.030 1.00 22.48 ? 41  GLU D CB  1 
ATOM   316  C CG  . GLU A 1 41  ? 36.165 35.293 -1.368 1.00 23.72 ? 41  GLU D CG  1 
ATOM   317  C CD  . GLU A 1 41  ? 37.317 36.263 -1.480 1.00 25.72 ? 41  GLU D CD  1 
ATOM   318  O OE1 . GLU A 1 41  ? 38.402 35.991 -0.940 1.00 25.92 ? 41  GLU D OE1 1 
ATOM   319  O OE2 . GLU A 1 41  ? 37.103 37.328 -2.109 1.00 27.51 ? 41  GLU D OE2 1 
ATOM   320  N N   . ILE A 1 42  ? 35.644 30.928 0.468  1.00 19.90 ? 42  ILE D N   1 
ATOM   321  C CA  . ILE A 1 42  ? 36.020 29.536 0.582  1.00 19.71 ? 42  ILE D CA  1 
ATOM   322  C C   . ILE A 1 42  ? 34.822 28.609 0.814  1.00 17.50 ? 42  ILE D C   1 
ATOM   323  O O   . ILE A 1 42  ? 35.049 27.438 1.102  1.00 18.36 ? 42  ILE D O   1 
ATOM   324  C CB  . ILE A 1 42  ? 37.093 29.238 1.649  1.00 20.83 ? 42  ILE D CB  1 
ATOM   325  C CG1 . ILE A 1 42  ? 36.619 29.714 3.020  1.00 22.00 ? 42  ILE D CG1 1 
ATOM   326  C CG2 . ILE A 1 42  ? 38.418 29.880 1.253  1.00 21.50 ? 42  ILE D CG2 1 
ATOM   327  C CD1 . ILE A 1 42  ? 37.517 29.331 4.175  1.00 22.85 ? 42  ILE D CD1 1 
ATOM   328  N N   . GLY A 1 43  ? 33.607 29.144 0.709  1.00 17.39 ? 43  GLY D N   1 
ATOM   329  C CA  . GLY A 1 43  ? 32.442 28.296 0.811  1.00 16.08 ? 43  GLY D CA  1 
ATOM   330  C C   . GLY A 1 43  ? 31.515 28.419 1.995  1.00 13.57 ? 43  GLY D C   1 
ATOM   331  O O   . GLY A 1 43  ? 30.541 27.660 2.039  1.00 13.78 ? 43  GLY D O   1 
ATOM   332  N N   . ILE A 1 44  ? 31.792 29.302 2.946  1.00 12.27 ? 44  ILE D N   1 
ATOM   333  C CA  . ILE A 1 44  ? 30.870 29.452 4.096  1.00 11.17 ? 44  ILE D CA  1 
ATOM   334  C C   . ILE A 1 44  ? 29.577 30.041 3.571  1.00 10.77 ? 44  ILE D C   1 
ATOM   335  O O   . ILE A 1 44  ? 29.582 30.920 2.713  1.00 11.35 ? 44  ILE D O   1 
ATOM   336  C CB  . ILE A 1 44  ? 31.523 30.260 5.221  1.00 11.45 ? 44  ILE D CB  1 
ATOM   337  C CG1 . ILE A 1 44  ? 32.560 29.387 5.943  1.00 12.27 ? 44  ILE D CG1 1 
ATOM   338  C CG2 . ILE A 1 44  ? 30.519 30.793 6.245  1.00 12.08 ? 44  ILE D CG2 1 
ATOM   339  C CD1 . ILE A 1 44  ? 31.937 28.229 6.723  1.00 12.82 ? 44  ILE D CD1 1 
ATOM   340  N N   . ASP A 1 45  ? 28.415 29.586 4.067  1.00 8.98  ? 45  ASP D N   1 
ATOM   341  C CA  . ASP A 1 45  ? 27.153 30.101 3.534  1.00 9.43  ? 45  ASP D CA  1 
ATOM   342  C C   . ASP A 1 45  ? 26.701 31.393 4.160  1.00 8.18  ? 45  ASP D C   1 
ATOM   343  O O   . ASP A 1 45  ? 26.024 32.200 3.520  1.00 9.01  ? 45  ASP D O   1 
ATOM   344  C CB  . ASP A 1 45  ? 26.053 29.038 3.650  1.00 9.40  ? 45  ASP D CB  1 
ATOM   345  C CG  . ASP A 1 45  ? 26.440 27.778 2.903  1.00 10.30 ? 45  ASP D CG  1 
ATOM   346  O OD1 . ASP A 1 45  ? 26.764 27.910 1.692  1.00 11.10 ? 45  ASP D OD1 1 
ATOM   347  O OD2 . ASP A 1 45  ? 26.444 26.671 3.446  1.00 9.14  ? 45  ASP D OD2 1 
ATOM   348  N N   . GLU A 1 46  ? 26.876 31.544 5.481  1.00 8.34  ? 46  GLU D N   1 
ATOM   349  C CA  . GLU A 1 46  ? 26.493 32.739 6.204  1.00 7.79  ? 46  GLU D CA  1 
ATOM   350  C C   . GLU A 1 46  ? 27.466 32.926 7.376  1.00 7.31  ? 46  GLU D C   1 
ATOM   351  O O   . GLU A 1 46  ? 28.215 32.005 7.706  1.00 7.61  ? 46  GLU D O   1 
ATOM   352  C CB  . GLU A 1 46  ? 25.079 32.706 6.809  1.00 8.51  ? 46  GLU D CB  1 
ATOM   353  C CG  . GLU A 1 46  ? 23.954 32.239 5.929  1.00 9.13  ? 46  GLU D CG  1 
ATOM   354  C CD  . GLU A 1 46  ? 22.585 32.301 6.564  1.00 10.04 ? 46  GLU D CD  1 
ATOM   355  O OE1 . GLU A 1 46  ? 22.441 32.889 7.645  1.00 10.80 ? 46  GLU D OE1 1 
ATOM   356  O OE2 . GLU A 1 46  ? 21.669 31.737 5.925  1.00 11.26 ? 46  GLU D OE2 1 
ATOM   357  N N   . LEU A 1 47  ? 27.423 34.119 7.962  1.00 7.36  ? 47  LEU D N   1 
ATOM   358  C CA  . LEU A 1 47  ? 28.227 34.410 9.141  1.00 8.06  ? 47  LEU D CA  1 
ATOM   359  C C   . LEU A 1 47  ? 27.341 34.844 10.309 1.00 7.75  ? 47  LEU D C   1 
ATOM   360  O O   . LEU A 1 47  ? 26.248 35.368 10.103 1.00 7.93  ? 47  LEU D O   1 
ATOM   361  C CB  . LEU A 1 47  ? 29.199 35.579 8.895  1.00 10.22 ? 47  LEU D CB  1 
ATOM   362  C CG  . LEU A 1 47  ? 30.104 35.465 7.661  1.00 10.74 ? 47  LEU D CG  1 
ATOM   363  C CD1 . LEU A 1 47  ? 30.779 36.801 7.363  1.00 11.32 ? 47  LEU D CD1 1 
ATOM   364  C CD2 . LEU A 1 47  ? 31.120 34.349 7.862  1.00 12.29 ? 47  LEU D CD2 1 
ATOM   365  N N   . VAL A 1 48  ? 27.820 34.607 11.494 1.00 8.23  ? 48  VAL D N   1 
ATOM   366  C CA  . VAL A 1 48  ? 27.287 35.209 12.709 1.00 8.60  ? 48  VAL D CA  1 
ATOM   367  C C   . VAL A 1 48  ? 28.358 36.023 13.427 1.00 9.32  ? 48  VAL D C   1 
ATOM   368  O O   . VAL A 1 48  ? 29.461 35.455 13.567 1.00 9.58  ? 48  VAL D O   1 
ATOM   369  C CB  . VAL A 1 48  ? 26.704 34.145 13.657 1.00 9.24  ? 48  VAL D CB  1 
ATOM   370  C CG1 . VAL A 1 48  ? 26.265 34.781 14.967 1.00 10.90 ? 48  VAL D CG1 1 
ATOM   371  C CG2 . VAL A 1 48  ? 25.544 33.419 12.992 1.00 10.55 ? 48  VAL D CG2 1 
ATOM   372  N N   . PHE A 1 49  ? 28.131 37.281 13.655 1.00 8.39  ? 49  PHE D N   1 
ATOM   373  C CA  . PHE A 1 49  ? 29.057 38.098 14.438 1.00 8.96  ? 49  PHE D CA  1 
ATOM   374  C C   . PHE A 1 49  ? 28.452 38.211 15.848 1.00 9.94  ? 49  PHE D C   1 
ATOM   375  O O   . PHE A 1 49  ? 27.394 38.824 16.003 1.00 10.66 ? 49  PHE D O   1 
ATOM   376  C CB  . PHE A 1 49  ? 29.247 39.483 13.835 1.00 9.38  ? 49  PHE D CB  1 
ATOM   377  C CG  . PHE A 1 49  ? 30.028 39.490 12.550 1.00 9.59  ? 49  PHE D CG  1 
ATOM   378  C CD1 . PHE A 1 49  ? 31.411 39.536 12.545 1.00 11.19 ? 49  PHE D CD1 1 
ATOM   379  C CD2 . PHE A 1 49  ? 29.350 39.460 11.343 1.00 12.26 ? 49  PHE D CD2 1 
ATOM   380  C CE1 . PHE A 1 49  ? 32.093 39.556 11.336 1.00 12.66 ? 49  PHE D CE1 1 
ATOM   381  C CE2 . PHE A 1 49  ? 30.032 39.483 10.144 1.00 12.78 ? 49  PHE D CE2 1 
ATOM   382  C CZ  . PHE A 1 49  ? 31.414 39.534 10.142 1.00 13.19 ? 49  PHE D CZ  1 
ATOM   383  N N   . LEU A 1 50  ? 29.097 37.538 16.788 1.00 10.12 ? 50  LEU D N   1 
ATOM   384  C CA  . LEU A 1 50  ? 28.596 37.510 18.160 1.00 11.47 ? 50  LEU D CA  1 
ATOM   385  C C   . LEU A 1 50  ? 29.459 38.375 19.057 1.00 12.28 ? 50  LEU D C   1 
ATOM   386  O O   . LEU A 1 50  ? 30.640 38.065 19.232 1.00 11.11 ? 50  LEU D O   1 
ATOM   387  C CB  . LEU A 1 50  ? 28.593 36.049 18.618 1.00 13.42 ? 50  LEU D CB  1 
ATOM   388  C CG  . LEU A 1 50  ? 28.100 35.749 20.032 1.00 15.14 ? 50  LEU D CG  1 
ATOM   389  C CD1 . LEU A 1 50  ? 26.641 36.137 20.219 1.00 16.22 ? 50  LEU D CD1 1 
ATOM   390  C CD2 . LEU A 1 50  ? 28.297 34.264 20.327 1.00 16.49 ? 50  LEU D CD2 1 
ATOM   391  N N   . ASP A 1 51  ? 28.892 39.449 19.601 1.00 12.20 ? 51  ASP D N   1 
ATOM   392  C CA  . ASP A 1 51  ? 29.655 40.272 20.545 1.00 15.17 ? 51  ASP D CA  1 
ATOM   393  C C   . ASP A 1 51  ? 29.654 39.510 21.870 1.00 15.89 ? 51  ASP D C   1 
ATOM   394  O O   . ASP A 1 51  ? 28.605 39.310 22.491 1.00 16.19 ? 51  ASP D O   1 
ATOM   395  C CB  . ASP A 1 51  ? 29.084 41.682 20.706 1.00 16.89 ? 51  ASP D CB  1 
ATOM   396  C CG  . ASP A 1 51  ? 30.085 42.498 21.518 1.00 17.54 ? 51  ASP D CG  1 
ATOM   397  O OD1 . ASP A 1 51  ? 30.352 42.101 22.674 1.00 19.38 ? 51  ASP D OD1 1 
ATOM   398  O OD2 . ASP A 1 51  ? 30.679 43.484 21.076 1.00 19.38 ? 51  ASP D OD2 1 
ATOM   399  N N   . ILE A 1 52  ? 30.836 39.059 22.296 1.00 17.28 ? 52  ILE D N   1 
ATOM   400  C CA  . ILE A 1 52  ? 30.937 38.230 23.495 1.00 19.88 ? 52  ILE D CA  1 
ATOM   401  C C   . ILE A 1 52  ? 31.146 38.982 24.797 1.00 22.00 ? 52  ILE D C   1 
ATOM   402  O O   . ILE A 1 52  ? 31.269 38.381 25.863 1.00 21.47 ? 52  ILE D O   1 
ATOM   403  C CB  . ILE A 1 52  ? 32.007 37.124 23.380 1.00 19.41 ? 52  ILE D CB  1 
ATOM   404  C CG1 . ILE A 1 52  ? 33.397 37.729 23.211 1.00 19.15 ? 52  ILE D CG1 1 
ATOM   405  C CG2 . ILE A 1 52  ? 31.611 36.204 22.236 1.00 19.71 ? 52  ILE D CG2 1 
ATOM   406  C CD1 . ILE A 1 52  ? 34.546 36.745 23.283 1.00 18.76 ? 52  ILE D CD1 1 
ATOM   407  N N   . THR A 1 53  ? 31.288 40.282 24.672 1.00 24.92 ? 53  THR D N   1 
ATOM   408  C CA  . THR A 1 53  ? 31.290 41.180 25.824 1.00 28.54 ? 53  THR D CA  1 
ATOM   409  C C   . THR A 1 53  ? 29.826 41.622 25.894 1.00 31.23 ? 53  THR D C   1 
ATOM   410  O O   . THR A 1 53  ? 29.116 41.525 26.875 1.00 32.52 ? 53  THR D O   1 
ATOM   411  C CB  . THR A 1 53  ? 32.221 42.372 25.614 1.00 28.22 ? 53  THR D CB  1 
ATOM   412  O OG1 . THR A 1 53  ? 31.615 43.315 24.723 1.00 28.10 ? 53  THR D OG1 1 
ATOM   413  C CG2 . THR A 1 53  ? 33.546 41.936 24.999 1.00 28.57 ? 53  THR D CG2 1 
ATOM   414  N N   . ALA A 1 54  ? 29.361 42.130 24.753 1.00 34.18 ? 54  ALA D N   1 
ATOM   415  C CA  . ALA A 1 54  ? 28.009 42.589 24.503 1.00 36.72 ? 54  ALA D CA  1 
ATOM   416  C C   . ALA A 1 54  ? 27.585 43.678 25.477 1.00 38.39 ? 54  ALA D C   1 
ATOM   417  O O   . ALA A 1 54  ? 26.402 43.913 25.721 1.00 39.51 ? 54  ALA D O   1 
ATOM   418  C CB  . ALA A 1 54  ? 27.088 41.386 24.682 1.00 36.60 ? 54  ALA D CB  1 
ATOM   419  N N   . SER A 1 55  ? 28.559 44.412 25.992 1.00 40.06 ? 55  SER D N   1 
ATOM   420  C CA  . SER A 1 55  ? 28.399 45.387 27.034 1.00 41.08 ? 55  SER D CA  1 
ATOM   421  C C   . SER A 1 55  ? 28.811 46.817 26.740 1.00 41.72 ? 55  SER D C   1 
ATOM   422  O O   . SER A 1 55  ? 27.989 47.646 26.346 1.00 42.07 ? 55  SER D O   1 
ATOM   423  C CB  . SER A 1 55  ? 29.237 44.888 28.241 1.00 41.43 ? 55  SER D CB  1 
ATOM   424  O OG  . SER A 1 55  ? 30.611 44.834 27.881 1.00 41.83 ? 55  SER D OG  1 
ATOM   425  N N   . VAL A 1 56  ? 30.074 47.148 26.988 1.00 42.20 ? 56  VAL D N   1 
ATOM   426  C CA  . VAL A 1 56  ? 30.583 48.501 26.898 1.00 42.91 ? 56  VAL D CA  1 
ATOM   427  C C   . VAL A 1 56  ? 31.203 48.899 25.573 1.00 43.28 ? 56  VAL D C   1 
ATOM   428  O O   . VAL A 1 56  ? 32.149 48.338 25.034 1.00 43.79 ? 56  VAL D O   1 
ATOM   429  C CB  . VAL A 1 56  ? 31.644 48.772 27.990 1.00 42.86 ? 56  VAL D CB  1 
ATOM   430  C CG1 . VAL A 1 56  ? 31.949 50.265 28.067 1.00 43.06 ? 56  VAL D CG1 1 
ATOM   431  C CG2 . VAL A 1 56  ? 31.178 48.265 29.344 1.00 42.90 ? 56  VAL D CG2 1 
ATOM   432  N N   . GLU A 1 57  ? 30.587 49.935 25.000 1.00 43.38 ? 57  GLU D N   1 
ATOM   433  C CA  . GLU A 1 57  ? 30.905 50.522 23.711 1.00 43.35 ? 57  GLU D CA  1 
ATOM   434  C C   . GLU A 1 57  ? 30.272 49.687 22.599 1.00 42.79 ? 57  GLU D C   1 
ATOM   435  O O   . GLU A 1 57  ? 30.208 50.034 21.428 1.00 42.70 ? 57  GLU D O   1 
ATOM   436  C CB  . GLU A 1 57  ? 32.406 50.716 23.516 1.00 44.15 ? 57  GLU D CB  1 
ATOM   437  C CG  . GLU A 1 57  ? 32.999 51.836 24.361 1.00 45.23 ? 57  GLU D CG  1 
ATOM   438  C CD  . GLU A 1 57  ? 34.503 51.950 24.228 1.00 45.79 ? 57  GLU D CD  1 
ATOM   439  O OE1 . GLU A 1 57  ? 34.971 52.513 23.215 1.00 46.16 ? 57  GLU D OE1 1 
ATOM   440  O OE2 . GLU A 1 57  ? 35.219 51.481 25.139 1.00 46.38 ? 57  GLU D OE2 1 
ATOM   441  N N   . LYS A 1 58  ? 29.720 48.548 22.978 1.00 42.31 ? 58  LYS D N   1 
ATOM   442  C CA  . LYS A 1 58  ? 29.089 47.520 22.209 1.00 41.60 ? 58  LYS D CA  1 
ATOM   443  C C   . LYS A 1 58  ? 28.164 48.071 21.133 1.00 40.60 ? 58  LYS D C   1 
ATOM   444  O O   . LYS A 1 58  ? 28.362 47.805 19.953 1.00 39.77 ? 58  LYS D O   1 
ATOM   445  C CB  . LYS A 1 58  ? 28.250 46.605 23.117 1.00 42.40 ? 58  LYS D CB  1 
ATOM   446  C CG  . LYS A 1 58  ? 27.455 45.511 22.457 1.00 43.32 ? 58  LYS D CG  1 
ATOM   447  C CD  . LYS A 1 58  ? 26.129 45.865 21.848 1.00 43.97 ? 58  LYS D CD  1 
ATOM   448  C CE  . LYS A 1 58  ? 25.180 46.664 22.706 1.00 44.21 ? 58  LYS D CE  1 
ATOM   449  N NZ  . LYS A 1 58  ? 24.587 45.860 23.804 1.00 44.56 ? 58  LYS D NZ  1 
ATOM   450  N N   . ARG A 1 59  ? 27.128 48.776 21.591 1.00 39.48 ? 59  ARG D N   1 
ATOM   451  C CA  . ARG A 1 59  ? 26.139 49.300 20.657 1.00 38.38 ? 59  ARG D CA  1 
ATOM   452  C C   . ARG A 1 59  ? 26.831 50.080 19.548 1.00 36.92 ? 59  ARG D C   1 
ATOM   453  O O   . ARG A 1 59  ? 26.678 49.732 18.377 1.00 36.38 ? 59  ARG D O   1 
ATOM   454  C CB  . ARG A 1 59  ? 25.079 50.146 21.359 1.00 39.22 ? 59  ARG D CB  1 
ATOM   455  C CG  . ARG A 1 59  ? 23.916 50.499 20.443 1.00 39.78 ? 59  ARG D CG  1 
ATOM   456  C CD  . ARG A 1 59  ? 22.684 50.903 21.238 1.00 40.63 ? 59  ARG D CD  1 
ATOM   457  N NE  . ARG A 1 59  ? 21.560 51.191 20.358 1.00 41.15 ? 59  ARG D NE  1 
ATOM   458  C CZ  . ARG A 1 59  ? 20.402 51.705 20.744 1.00 41.81 ? 59  ARG D CZ  1 
ATOM   459  N NH1 . ARG A 1 59  ? 20.179 52.002 22.018 1.00 42.26 ? 59  ARG D NH1 1 
ATOM   460  N NH2 . ARG A 1 59  ? 19.441 51.927 19.861 1.00 42.07 ? 59  ARG D NH2 1 
ATOM   461  N N   . LYS A 1 60  ? 27.645 51.070 19.910 1.00 34.92 ? 60  LYS D N   1 
ATOM   462  C CA  . LYS A 1 60  ? 28.340 51.857 18.901 1.00 33.02 ? 60  LYS D CA  1 
ATOM   463  C C   . LYS A 1 60  ? 29.383 51.064 18.124 1.00 30.49 ? 60  LYS D C   1 
ATOM   464  O O   . LYS A 1 60  ? 29.489 51.275 16.908 1.00 28.89 ? 60  LYS D O   1 
ATOM   465  C CB  . LYS A 1 60  ? 28.977 53.109 19.516 1.00 34.77 ? 60  LYS D CB  1 
ATOM   466  C CG  . LYS A 1 60  ? 30.345 52.910 20.135 1.00 36.07 ? 60  LYS D CG  1 
ATOM   467  C CD  . LYS A 1 60  ? 30.865 54.161 20.826 1.00 36.87 ? 60  LYS D CD  1 
ATOM   468  C CE  . LYS A 1 60  ? 32.079 53.828 21.686 1.00 37.20 ? 60  LYS D CE  1 
ATOM   469  N NZ  . LYS A 1 60  ? 32.290 54.854 22.743 1.00 37.48 ? 60  LYS D NZ  1 
ATOM   470  N N   . THR A 1 61  ? 30.147 50.175 18.765 1.00 27.72 ? 61  THR D N   1 
ATOM   471  C CA  . THR A 1 61  ? 31.177 49.446 18.023 1.00 25.40 ? 61  THR D CA  1 
ATOM   472  C C   . THR A 1 61  ? 30.549 48.439 17.061 1.00 23.42 ? 61  THR D C   1 
ATOM   473  O O   . THR A 1 61  ? 31.067 48.283 15.951 1.00 21.96 ? 61  THR D O   1 
ATOM   474  C CB  . THR A 1 61  ? 32.243 48.786 18.904 1.00 25.62 ? 61  THR D CB  1 
ATOM   475  O OG1 . THR A 1 61  ? 31.671 47.826 19.793 1.00 25.39 ? 61  THR D OG1 1 
ATOM   476  C CG2 . THR A 1 61  ? 32.951 49.850 19.742 1.00 25.06 ? 61  THR D CG2 1 
ATOM   477  N N   . MET A 1 62  ? 29.431 47.834 17.455 1.00 22.66 ? 62  MET D N   1 
ATOM   478  C CA  . MET A 1 62  ? 28.744 46.902 16.567 1.00 21.66 ? 62  MET D CA  1 
ATOM   479  C C   . MET A 1 62  ? 28.123 47.615 15.374 1.00 20.98 ? 62  MET D C   1 
ATOM   480  O O   . MET A 1 62  ? 28.129 47.068 14.265 1.00 19.19 ? 62  MET D O   1 
ATOM   481  C CB  . MET A 1 62  ? 27.675 46.092 17.299 1.00 22.60 ? 62  MET D CB  1 
ATOM   482  C CG  . MET A 1 62  ? 27.128 44.932 16.493 1.00 23.69 ? 62  MET D CG  1 
ATOM   483  S SD  . MET A 1 62  ? 28.363 43.797 15.815 1.00 24.98 ? 62  MET D SD  1 
ATOM   484  C CE  . MET A 1 62  ? 29.520 43.709 17.186 1.00 22.74 ? 62  MET D CE  1 
ATOM   485  N N   . LEU A 1 63  ? 27.630 48.841 15.556 1.00 20.28 ? 63  LEU D N   1 
ATOM   486  C CA  . LEU A 1 63  ? 27.063 49.588 14.432 1.00 20.07 ? 63  LEU D CA  1 
ATOM   487  C C   . LEU A 1 63  ? 28.127 49.850 13.376 1.00 19.40 ? 63  LEU D C   1 
ATOM   488  O O   . LEU A 1 63  ? 27.916 49.658 12.183 1.00 17.86 ? 63  LEU D O   1 
ATOM   489  C CB  . LEU A 1 63  ? 26.413 50.894 14.905 1.00 21.56 ? 63  LEU D CB  1 
ATOM   490  C CG  . LEU A 1 63  ? 25.185 50.722 15.803 1.00 22.65 ? 63  LEU D CG  1 
ATOM   491  C CD1 . LEU A 1 63  ? 24.776 52.047 16.431 1.00 23.37 ? 63  LEU D CD1 1 
ATOM   492  C CD2 . LEU A 1 63  ? 24.022 50.139 15.013 1.00 23.48 ? 63  LEU D CD2 1 
ATOM   493  N N   . GLU A 1 64  ? 29.323 50.252 13.811 1.00 19.32 ? 64  GLU D N   1 
ATOM   494  C CA  . GLU A 1 64  ? 30.438 50.490 12.905 1.00 19.57 ? 64  GLU D CA  1 
ATOM   495  C C   . GLU A 1 64  ? 30.853 49.211 12.191 1.00 17.13 ? 64  GLU D C   1 
ATOM   496  O O   . GLU A 1 64  ? 31.122 49.220 10.995 1.00 16.02 ? 64  GLU D O   1 
ATOM   497  C CB  . GLU A 1 64  ? 31.603 51.111 13.678 1.00 22.54 ? 64  GLU D CB  1 
ATOM   498  C CG  . GLU A 1 64  ? 32.917 51.137 12.913 1.00 26.02 ? 64  GLU D CG  1 
ATOM   499  C CD  . GLU A 1 64  ? 33.822 52.243 13.433 1.00 28.17 ? 64  GLU D CD  1 
ATOM   500  O OE1 . GLU A 1 64  ? 34.203 52.164 14.619 1.00 29.43 ? 64  GLU D OE1 1 
ATOM   501  O OE2 . GLU A 1 64  ? 34.076 53.182 12.650 1.00 29.92 ? 64  GLU D OE2 1 
ATOM   502  N N   . LEU A 1 65  ? 30.861 48.073 12.897 1.00 16.93 ? 65  LEU D N   1 
ATOM   503  C CA  . LEU A 1 65  ? 31.212 46.799 12.276 1.00 14.47 ? 65  LEU D CA  1 
ATOM   504  C C   . LEU A 1 65  ? 30.219 46.454 11.172 1.00 13.25 ? 65  LEU D C   1 
ATOM   505  O O   . LEU A 1 65  ? 30.588 46.069 10.065 1.00 13.06 ? 65  LEU D O   1 
ATOM   506  C CB  . LEU A 1 65  ? 31.239 45.691 13.338 1.00 13.39 ? 65  LEU D CB  1 
ATOM   507  C CG  . LEU A 1 65  ? 31.573 44.283 12.827 1.00 13.48 ? 65  LEU D CG  1 
ATOM   508  C CD1 . LEU A 1 65  ? 32.256 43.465 13.917 1.00 12.56 ? 65  LEU D CD1 1 
ATOM   509  C CD2 . LEU A 1 65  ? 30.328 43.543 12.348 1.00 13.78 ? 65  LEU D CD2 1 
ATOM   510  N N   . VAL A 1 66  ? 28.927 46.632 11.478 1.00 13.07 ? 66  VAL D N   1 
ATOM   511  C CA  . VAL A 1 66  ? 27.895 46.343 10.491 1.00 12.68 ? 66  VAL D CA  1 
ATOM   512  C C   . VAL A 1 66  ? 28.061 47.200 9.244  1.00 13.42 ? 66  VAL D C   1 
ATOM   513  O O   . VAL A 1 66  ? 28.000 46.703 8.124  1.00 13.57 ? 66  VAL D O   1 
ATOM   514  C CB  . VAL A 1 66  ? 26.483 46.509 11.091 1.00 12.69 ? 66  VAL D CB  1 
ATOM   515  C CG1 . VAL A 1 66  ? 25.428 46.422 10.002 1.00 12.97 ? 66  VAL D CG1 1 
ATOM   516  C CG2 . VAL A 1 66  ? 26.245 45.413 12.134 1.00 13.96 ? 66  VAL D CG2 1 
ATOM   517  N N   . GLU A 1 67  ? 28.282 48.492 9.445  1.00 13.98 ? 67  GLU D N   1 
ATOM   518  C CA  . GLU A 1 67  ? 28.467 49.422 8.322  1.00 16.60 ? 67  GLU D CA  1 
ATOM   519  C C   . GLU A 1 67  ? 29.581 48.972 7.397  1.00 18.12 ? 67  GLU D C   1 
ATOM   520  O O   . GLU A 1 67  ? 29.398 48.895 6.172  1.00 20.26 ? 67  GLU D O   1 
ATOM   521  C CB  . GLU A 1 67  ? 28.718 50.818 8.907  1.00 16.96 ? 67  GLU D CB  1 
ATOM   522  C CG  . GLU A 1 67  ? 27.454 51.397 9.528  1.00 17.85 ? 67  GLU D CG  1 
ATOM   523  C CD  . GLU A 1 67  ? 27.628 52.636 10.371 1.00 19.25 ? 67  GLU D CD  1 
ATOM   524  O OE1 . GLU A 1 67  ? 28.767 53.122 10.514 1.00 20.35 ? 67  GLU D OE1 1 
ATOM   525  O OE2 . GLU A 1 67  ? 26.610 53.129 10.913 1.00 19.31 ? 67  GLU D OE2 1 
ATOM   526  N N   . LYS A 1 68  ? 30.721 48.590 7.959  1.00 17.77 ? 68  LYS D N   1 
ATOM   527  C CA  . LYS A 1 68  ? 31.846 48.127 7.155  1.00 18.59 ? 68  LYS D CA  1 
ATOM   528  C C   . LYS A 1 68  ? 31.646 46.768 6.518  1.00 18.16 ? 68  LYS D C   1 
ATOM   529  O O   . LYS A 1 68  ? 31.989 46.555 5.347  1.00 18.55 ? 68  LYS D O   1 
ATOM   530  C CB  . LYS A 1 68  ? 33.123 48.115 8.006  1.00 19.82 ? 68  LYS D CB  1 
ATOM   531  C CG  . LYS A 1 68  ? 33.621 49.518 8.338  1.00 22.00 ? 68  LYS D CG  1 
ATOM   532  C CD  . LYS A 1 68  ? 34.919 49.466 9.127  1.00 23.91 ? 68  LYS D CD  1 
ATOM   533  C CE  . LYS A 1 68  ? 34.730 48.825 10.494 1.00 25.24 ? 68  LYS D CE  1 
ATOM   534  N NZ  . LYS A 1 68  ? 35.963 48.092 10.905 1.00 27.23 ? 68  LYS D NZ  1 
ATOM   535  N N   . VAL A 1 69  ? 31.119 45.797 7.259  1.00 17.15 ? 69  VAL D N   1 
ATOM   536  C CA  . VAL A 1 69  ? 30.928 44.452 6.734  1.00 16.23 ? 69  VAL D CA  1 
ATOM   537  C C   . VAL A 1 69  ? 29.877 44.404 5.634  1.00 16.59 ? 69  VAL D C   1 
ATOM   538  O O   . VAL A 1 69  ? 30.090 43.797 4.591  1.00 15.14 ? 69  VAL D O   1 
ATOM   539  C CB  . VAL A 1 69  ? 30.538 43.484 7.873  1.00 16.17 ? 69  VAL D CB  1 
ATOM   540  C CG1 . VAL A 1 69  ? 30.050 42.139 7.354  1.00 16.52 ? 69  VAL D CG1 1 
ATOM   541  C CG2 . VAL A 1 69  ? 31.735 43.292 8.802  1.00 16.36 ? 69  VAL D CG2 1 
ATOM   542  N N   . ALA A 1 70  ? 28.767 45.107 5.824  1.00 16.79 ? 70  ALA D N   1 
ATOM   543  C CA  . ALA A 1 70  ? 27.657 45.075 4.874  1.00 17.63 ? 70  ALA D CA  1 
ATOM   544  C C   . ALA A 1 70  ? 28.028 45.484 3.457  1.00 18.91 ? 70  ALA D C   1 
ATOM   545  O O   . ALA A 1 70  ? 27.498 44.909 2.502  1.00 18.30 ? 70  ALA D O   1 
ATOM   546  C CB  . ALA A 1 70  ? 26.515 45.946 5.385  1.00 17.55 ? 70  ALA D CB  1 
ATOM   547  N N   . GLU A 1 71  ? 28.942 46.429 3.305  1.00 20.26 ? 71  GLU D N   1 
ATOM   548  C CA  . GLU A 1 71  ? 29.328 46.880 1.973  1.00 22.77 ? 71  GLU D CA  1 
ATOM   549  C C   . GLU A 1 71  ? 30.356 45.985 1.311  1.00 22.57 ? 71  GLU D C   1 
ATOM   550  O O   . GLU A 1 71  ? 30.604 46.149 0.105  1.00 23.13 ? 71  GLU D O   1 
ATOM   551  C CB  . GLU A 1 71  ? 29.829 48.323 2.052  1.00 25.15 ? 71  GLU D CB  1 
ATOM   552  C CG  . GLU A 1 71  ? 31.022 48.564 2.952  1.00 27.77 ? 71  GLU D CG  1 
ATOM   553  C CD  . GLU A 1 71  ? 31.310 50.038 3.170  1.00 29.28 ? 71  GLU D CD  1 
ATOM   554  O OE1 . GLU A 1 71  ? 30.429 50.873 2.862  1.00 30.45 ? 71  GLU D OE1 1 
ATOM   555  O OE2 . GLU A 1 71  ? 32.416 50.374 3.644  1.00 31.09 ? 71  GLU D OE2 1 
ATOM   556  N N   . GLN A 1 72  ? 30.984 45.059 2.034  1.00 21.11 ? 72  GLN D N   1 
ATOM   557  C CA  . GLN A 1 72  ? 32.036 44.235 1.465  1.00 21.06 ? 72  GLN D CA  1 
ATOM   558  C C   . GLN A 1 72  ? 31.771 42.744 1.382  1.00 20.41 ? 72  GLN D C   1 
ATOM   559  O O   . GLN A 1 72  ? 32.489 42.041 0.654  1.00 19.51 ? 72  GLN D O   1 
ATOM   560  C CB  . GLN A 1 72  ? 33.326 44.431 2.282  1.00 22.99 ? 72  GLN D CB  1 
ATOM   561  C CG  . GLN A 1 72  ? 33.859 45.844 2.374  1.00 25.71 ? 72  GLN D CG  1 
ATOM   562  C CD  . GLN A 1 72  ? 34.042 46.542 1.048  1.00 27.73 ? 72  GLN D CD  1 
ATOM   563  O OE1 . GLN A 1 72  ? 34.698 46.055 0.132  1.00 28.95 ? 72  GLN D OE1 1 
ATOM   564  N NE2 . GLN A 1 72  ? 33.445 47.728 0.924  1.00 29.07 ? 72  GLN D NE2 1 
ATOM   565  N N   . ILE A 1 73  ? 30.793 42.230 2.133  1.00 19.02 ? 73  ILE D N   1 
ATOM   566  C CA  . ILE A 1 73  ? 30.551 40.788 2.065  1.00 19.79 ? 73  ILE D CA  1 
ATOM   567  C C   . ILE A 1 73  ? 29.237 40.509 1.332  1.00 18.75 ? 73  ILE D C   1 
ATOM   568  O O   . ILE A 1 73  ? 28.260 41.237 1.473  1.00 19.16 ? 73  ILE D O   1 
ATOM   569  C CB  . ILE A 1 73  ? 30.593 40.020 3.384  1.00 21.77 ? 73  ILE D CB  1 
ATOM   570  C CG1 . ILE A 1 73  ? 29.356 40.260 4.243  1.00 22.35 ? 73  ILE D CG1 1 
ATOM   571  C CG2 . ILE A 1 73  ? 31.864 40.338 4.165  1.00 21.26 ? 73  ILE D CG2 1 
ATOM   572  C CD1 . ILE A 1 73  ? 29.236 39.304 5.413  1.00 23.04 ? 73  ILE D CD1 1 
ATOM   573  N N   . ASP A 1 74  ? 29.264 39.415 0.592  1.00 16.15 ? 74  ASP D N   1 
ATOM   574  C CA  . ASP A 1 74  ? 28.188 39.007 -0.283 1.00 17.20 ? 74  ASP D CA  1 
ATOM   575  C C   . ASP A 1 74  ? 27.416 37.776 0.149  1.00 16.66 ? 74  ASP D C   1 
ATOM   576  O O   . ASP A 1 74  ? 26.643 37.210 -0.634 1.00 18.46 ? 74  ASP D O   1 
ATOM   577  C CB  . ASP A 1 74  ? 28.745 38.812 -1.712 1.00 19.38 ? 74  ASP D CB  1 
ATOM   578  C CG  . ASP A 1 74  ? 29.382 40.087 -2.237 1.00 20.89 ? 74  ASP D CG  1 
ATOM   579  O OD1 . ASP A 1 74  ? 28.785 41.175 -2.099 1.00 21.96 ? 74  ASP D OD1 1 
ATOM   580  O OD2 . ASP A 1 74  ? 30.506 39.978 -2.773 1.00 23.20 ? 74  ASP D OD2 1 
ATOM   581  N N   . ILE A 1 75  ? 27.571 37.369 1.407  1.00 12.58 ? 75  ILE D N   1 
ATOM   582  C CA  . ILE A 1 75  ? 26.761 36.288 1.976  1.00 11.09 ? 75  ILE D CA  1 
ATOM   583  C C   . ILE A 1 75  ? 26.018 36.890 3.172  1.00 9.40  ? 75  ILE D C   1 
ATOM   584  O O   . ILE A 1 75  ? 26.463 37.902 3.711  1.00 9.42  ? 75  ILE D O   1 
ATOM   585  C CB  . ILE A 1 75  ? 27.585 35.078 2.437  1.00 10.61 ? 75  ILE D CB  1 
ATOM   586  C CG1 . ILE A 1 75  ? 28.726 35.487 3.369  1.00 10.86 ? 75  ILE D CG1 1 
ATOM   587  C CG2 . ILE A 1 75  ? 28.108 34.301 1.229  1.00 12.10 ? 75  ILE D CG2 1 
ATOM   588  C CD1 . ILE A 1 75  ? 29.475 34.343 4.027  1.00 10.80 ? 75  ILE D CD1 1 
ATOM   589  N N   . PRO A 1 76  ? 24.898 36.318 3.589  1.00 9.10  ? 76  PRO D N   1 
ATOM   590  C CA  . PRO A 1 76  ? 24.168 36.864 4.720  1.00 9.42  ? 76  PRO D CA  1 
ATOM   591  C C   . PRO A 1 76  ? 24.954 36.827 6.028  1.00 9.04  ? 76  PRO D C   1 
ATOM   592  O O   . PRO A 1 76  ? 25.756 35.917 6.261  1.00 8.76  ? 76  PRO D O   1 
ATOM   593  C CB  . PRO A 1 76  ? 22.967 35.927 4.850  1.00 9.52  ? 76  PRO D CB  1 
ATOM   594  C CG  . PRO A 1 76  ? 22.800 35.327 3.488  1.00 10.74 ? 76  PRO D CG  1 
ATOM   595  C CD  . PRO A 1 76  ? 24.227 35.148 2.976  1.00 9.39  ? 76  PRO D CD  1 
ATOM   596  N N   . PHE A 1 77  ? 24.706 37.823 6.875  1.00 8.45  ? 77  PHE D N   1 
ATOM   597  C CA  . PHE A 1 77  ? 25.270 37.790 8.224  1.00 8.64  ? 77  PHE D CA  1 
ATOM   598  C C   . PHE A 1 77  ? 24.228 38.224 9.252  1.00 8.49  ? 77  PHE D C   1 
ATOM   599  O O   . PHE A 1 77  ? 23.348 39.050 9.019  1.00 8.38  ? 77  PHE D O   1 
ATOM   600  C CB  . PHE A 1 77  ? 26.568 38.574 8.367  1.00 9.08  ? 77  PHE D CB  1 
ATOM   601  C CG  . PHE A 1 77  ? 26.473 40.067 8.293  1.00 9.83  ? 77  PHE D CG  1 
ATOM   602  C CD1 . PHE A 1 77  ? 26.402 40.704 7.060  1.00 10.29 ? 77  PHE D CD1 1 
ATOM   603  C CD2 . PHE A 1 77  ? 26.472 40.836 9.440  1.00 10.66 ? 77  PHE D CD2 1 
ATOM   604  C CE1 . PHE A 1 77  ? 26.325 42.084 6.996  1.00 10.86 ? 77  PHE D CE1 1 
ATOM   605  C CE2 . PHE A 1 77  ? 26.408 42.219 9.373  1.00 11.10 ? 77  PHE D CE2 1 
ATOM   606  C CZ  . PHE A 1 77  ? 26.321 42.844 8.147  1.00 11.18 ? 77  PHE D CZ  1 
ATOM   607  N N   . THR A 1 78  ? 24.339 37.586 10.411 1.00 7.76  ? 78  THR D N   1 
ATOM   608  C CA  . THR A 1 78  ? 23.545 37.845 11.589 1.00 7.87  ? 78  THR D CA  1 
ATOM   609  C C   . THR A 1 78  ? 24.443 38.528 12.627 1.00 8.26  ? 78  THR D C   1 
ATOM   610  O O   . THR A 1 78  ? 25.608 38.147 12.723 1.00 8.65  ? 78  THR D O   1 
ATOM   611  C CB  . THR A 1 78  ? 23.050 36.517 12.207 1.00 7.90  ? 78  THR D CB  1 
ATOM   612  O OG1 . THR A 1 78  ? 22.232 35.880 11.218 1.00 8.78  ? 78  THR D OG1 1 
ATOM   613  C CG2 . THR A 1 78  ? 22.261 36.730 13.482 1.00 8.11  ? 78  THR D CG2 1 
ATOM   614  N N   . VAL A 1 79  ? 23.900 39.455 13.376 1.00 8.57  ? 79  VAL D N   1 
ATOM   615  C CA  . VAL A 1 79  ? 24.610 40.068 14.485 1.00 9.50  ? 79  VAL D CA  1 
ATOM   616  C C   . VAL A 1 79  ? 23.866 39.695 15.767 1.00 9.50  ? 79  VAL D C   1 
ATOM   617  O O   . VAL A 1 79  ? 22.631 39.747 15.833 1.00 10.43 ? 79  VAL D O   1 
ATOM   618  C CB  . VAL A 1 79  ? 24.755 41.593 14.397 1.00 10.47 ? 79  VAL D CB  1 
ATOM   619  C CG1 A VAL A 1 79  ? 25.861 41.967 13.415 0.33 10.06 ? 79  VAL D CG1 1 
ATOM   620  C CG1 B VAL A 1 79  ? 25.161 42.192 15.863 0.33 7.91  ? 79  VAL D CG1 1 
ATOM   621  C CG1 C VAL A 1 79  ? 23.404 42.284 14.311 0.33 10.91 ? 79  VAL D CG1 1 
ATOM   622  C CG2 A VAL A 1 79  ? 23.445 42.253 14.003 0.33 11.01 ? 79  VAL D CG2 1 
ATOM   623  C CG2 B VAL A 1 79  ? 25.321 41.944 13.223 0.33 6.00  ? 79  VAL D CG2 1 
ATOM   624  C CG2 C VAL A 1 79  ? 25.553 42.107 15.585 0.33 10.06 ? 79  VAL D CG2 1 
ATOM   625  N N   . GLY A 1 80  ? 24.618 39.300 16.784 1.00 10.78 ? 80  GLY D N   1 
ATOM   626  C CA  . GLY A 1 80  ? 24.000 38.924 18.053 1.00 11.68 ? 80  GLY D CA  1 
ATOM   627  C C   . GLY A 1 80  ? 24.916 39.321 19.204 1.00 12.85 ? 80  GLY D C   1 
ATOM   628  O O   . GLY A 1 80  ? 26.076 39.673 19.030 1.00 11.04 ? 80  GLY D O   1 
ATOM   629  N N   . GLY A 1 81  ? 24.348 39.204 20.393 1.00 14.19 ? 81  GLY D N   1 
ATOM   630  C CA  . GLY A 1 81  ? 25.090 39.453 21.618 1.00 16.46 ? 81  GLY D CA  1 
ATOM   631  C C   . GLY A 1 81  ? 24.665 40.750 22.267 1.00 18.01 ? 81  GLY D C   1 
ATOM   632  O O   . GLY A 1 81  ? 25.160 41.817 21.924 1.00 19.59 ? 81  GLY D O   1 
ATOM   633  N N   . GLY A 1 82  ? 23.769 40.655 23.253 1.00 17.68 ? 82  GLY D N   1 
ATOM   634  C CA  . GLY A 1 82  ? 23.326 41.829 23.970 1.00 17.85 ? 82  GLY D CA  1 
ATOM   635  C C   . GLY A 1 82  ? 22.423 42.783 23.227 1.00 17.85 ? 82  GLY D C   1 
ATOM   636  O O   . GLY A 1 82  ? 22.413 43.965 23.591 1.00 20.33 ? 82  GLY D O   1 
ATOM   637  N N   . ILE A 1 83  ? 21.688 42.347 22.219 1.00 15.74 ? 83  ILE D N   1 
ATOM   638  C CA  . ILE A 1 83  ? 20.703 43.218 21.552 1.00 14.86 ? 83  ILE D CA  1 
ATOM   639  C C   . ILE A 1 83  ? 19.522 43.225 22.515 1.00 15.70 ? 83  ILE D C   1 
ATOM   640  O O   . ILE A 1 83  ? 18.811 42.230 22.670 1.00 15.39 ? 83  ILE D O   1 
ATOM   641  C CB  . ILE A 1 83  ? 20.357 42.692 20.156 1.00 14.61 ? 83  ILE D CB  1 
ATOM   642  C CG1 . ILE A 1 83  ? 21.612 42.769 19.269 1.00 14.81 ? 83  ILE D CG1 1 
ATOM   643  C CG2 . ILE A 1 83  ? 19.216 43.476 19.527 1.00 14.81 ? 83  ILE D CG2 1 
ATOM   644  C CD1 . ILE A 1 83  ? 21.451 42.189 17.879 1.00 14.99 ? 83  ILE D CD1 1 
ATOM   645  N N   . HIS A 1 84  ? 19.353 44.354 23.206 1.00 16.26 ? 84  HIS D N   1 
ATOM   646  C CA  . HIS A 1 84  ? 18.326 44.420 24.240 1.00 18.00 ? 84  HIS D CA  1 
ATOM   647  C C   . HIS A 1 84  ? 16.980 45.001 23.883 1.00 16.84 ? 84  HIS D C   1 
ATOM   648  O O   . HIS A 1 84  ? 16.066 44.919 24.714 1.00 17.50 ? 84  HIS D O   1 
ATOM   649  C CB  . HIS A 1 84  ? 18.897 45.236 25.418 1.00 21.01 ? 84  HIS D CB  1 
ATOM   650  C CG  . HIS A 1 84  ? 20.242 44.835 25.926 1.00 23.53 ? 84  HIS D CG  1 
ATOM   651  N ND1 . HIS A 1 84  ? 20.497 43.567 26.400 1.00 24.64 ? 84  HIS D ND1 1 
ATOM   652  C CD2 . HIS A 1 84  ? 21.405 45.518 26.082 1.00 24.38 ? 84  HIS D CD2 1 
ATOM   653  C CE1 . HIS A 1 84  ? 21.748 43.474 26.804 1.00 24.52 ? 84  HIS D CE1 1 
ATOM   654  N NE2 . HIS A 1 84  ? 22.328 44.648 26.613 1.00 25.36 ? 84  HIS D NE2 1 
ATOM   655  N N   . ASP A 1 85  ? 16.803 45.615 22.716 1.00 15.23 ? 85  ASP D N   1 
ATOM   656  C CA  . ASP A 1 85  ? 15.522 46.248 22.413 1.00 14.74 ? 85  ASP D CA  1 
ATOM   657  C C   . ASP A 1 85  ? 15.299 46.405 20.917 1.00 13.60 ? 85  ASP D C   1 
ATOM   658  O O   . ASP A 1 85  ? 16.219 46.142 20.131 1.00 11.83 ? 85  ASP D O   1 
ATOM   659  C CB  . ASP A 1 85  ? 15.439 47.624 23.117 1.00 16.30 ? 85  ASP D CB  1 
ATOM   660  C CG  . ASP A 1 85  ? 16.739 48.393 22.960 1.00 18.53 ? 85  ASP D CG  1 
ATOM   661  O OD1 . ASP A 1 85  ? 17.147 48.592 21.806 1.00 17.23 ? 85  ASP D OD1 1 
ATOM   662  O OD2 . ASP A 1 85  ? 17.373 48.730 23.989 1.00 21.82 ? 85  ASP D OD2 1 
ATOM   663  N N   . PHE A 1 86  ? 14.115 46.849 20.535 1.00 12.61 ? 86  PHE D N   1 
ATOM   664  C CA  . PHE A 1 86  ? 13.721 47.044 19.157 1.00 12.76 ? 86  PHE D CA  1 
ATOM   665  C C   . PHE A 1 86  ? 14.595 48.082 18.466 1.00 13.51 ? 86  PHE D C   1 
ATOM   666  O O   . PHE A 1 86  ? 15.002 47.859 17.332 1.00 13.01 ? 86  PHE D O   1 
ATOM   667  C CB  . PHE A 1 86  ? 12.244 47.474 19.060 1.00 13.17 ? 86  PHE D CB  1 
ATOM   668  C CG  . PHE A 1 86  ? 11.807 47.742 17.645 1.00 14.00 ? 86  PHE D CG  1 
ATOM   669  C CD1 . PHE A 1 86  ? 11.462 46.715 16.791 1.00 14.46 ? 86  PHE D CD1 1 
ATOM   670  C CD2 . PHE A 1 86  ? 11.790 49.045 17.151 1.00 16.05 ? 86  PHE D CD2 1 
ATOM   671  C CE1 . PHE A 1 86  ? 11.065 46.958 15.495 1.00 15.31 ? 86  PHE D CE1 1 
ATOM   672  C CE2 . PHE A 1 86  ? 11.412 49.290 15.845 1.00 17.22 ? 86  PHE D CE2 1 
ATOM   673  C CZ  . PHE A 1 86  ? 11.053 48.252 15.007 1.00 16.60 ? 86  PHE D CZ  1 
ATOM   674  N N   . GLU A 1 87  ? 14.859 49.215 19.100 1.00 13.11 ? 87  GLU D N   1 
ATOM   675  C CA  . GLU A 1 87  ? 15.681 50.252 18.478 1.00 13.45 ? 87  GLU D CA  1 
ATOM   676  C C   . GLU A 1 87  ? 17.073 49.762 18.129 1.00 13.33 ? 87  GLU D C   1 
ATOM   677  O O   . GLU A 1 87  ? 17.591 50.055 17.051 1.00 12.66 ? 87  GLU D O   1 
ATOM   678  C CB  . GLU A 1 87  ? 15.744 51.475 19.399 1.00 14.16 ? 87  GLU D CB  1 
ATOM   679  C CG  . GLU A 1 87  ? 16.647 52.591 18.910 1.00 15.66 ? 87  GLU D CG  1 
ATOM   680  C CD  . GLU A 1 87  ? 16.304 53.117 17.530 1.00 16.51 ? 87  GLU D CD  1 
ATOM   681  O OE1 . GLU A 1 87  ? 15.115 53.083 17.165 1.00 18.69 ? 87  GLU D OE1 1 
ATOM   682  O OE2 . GLU A 1 87  ? 17.233 53.542 16.808 1.00 18.03 ? 87  GLU D OE2 1 
ATOM   683  N N   . THR A 1 88  ? 17.712 48.994 19.000 1.00 12.71 ? 88  THR D N   1 
ATOM   684  C CA  . THR A 1 88  ? 19.040 48.458 18.719 1.00 12.57 ? 88  THR D CA  1 
ATOM   685  C C   . THR A 1 88  ? 18.982 47.524 17.511 1.00 12.24 ? 88  THR D C   1 
ATOM   686  O O   . THR A 1 88  ? 19.795 47.605 16.592 1.00 12.45 ? 88  THR D O   1 
ATOM   687  C CB  . THR A 1 88  ? 19.622 47.716 19.938 1.00 13.18 ? 88  THR D CB  1 
ATOM   688  O OG1 . THR A 1 88  ? 19.694 48.639 21.046 1.00 14.35 ? 88  THR D OG1 1 
ATOM   689  C CG2 . THR A 1 88  ? 21.014 47.187 19.653 1.00 14.26 ? 88  THR D CG2 1 
ATOM   690  N N   . ALA A 1 89  ? 17.990 46.637 17.496 1.00 12.14 ? 89  ALA D N   1 
ATOM   691  C CA  . ALA A 1 89  ? 17.822 45.703 16.384 1.00 11.83 ? 89  ALA D CA  1 
ATOM   692  C C   . ALA A 1 89  ? 17.565 46.449 15.080 1.00 11.08 ? 89  ALA D C   1 
ATOM   693  O O   . ALA A 1 89  ? 18.200 46.155 14.061 1.00 10.52 ? 89  ALA D O   1 
ATOM   694  C CB  . ALA A 1 89  ? 16.701 44.720 16.680 1.00 12.36 ? 89  ALA D CB  1 
ATOM   695  N N   . SER A 1 90  ? 16.702 47.468 15.134 1.00 10.99 ? 90  SER D N   1 
ATOM   696  C CA  . SER A 1 90  ? 16.392 48.272 13.957 1.00 11.27 ? 90  SER D CA  1 
ATOM   697  C C   . SER A 1 90  ? 17.623 48.978 13.393 1.00 11.05 ? 90  SER D C   1 
ATOM   698  O O   . SER A 1 90  ? 17.852 48.930 12.179 1.00 11.45 ? 90  SER D O   1 
ATOM   699  C CB  . SER A 1 90  ? 15.360 49.338 14.338 1.00 11.42 ? 90  SER D CB  1 
ATOM   700  O OG  A SER A 1 90  ? 14.128 48.738 14.668 0.50 12.56 ? 90  SER D OG  1 
ATOM   701  O OG  B SER A 1 90  ? 15.045 50.196 13.258 0.50 10.68 ? 90  SER D OG  1 
ATOM   702  N N   . GLU A 1 91  ? 18.441 49.556 14.261 1.00 11.61 ? 91  GLU D N   1 
ATOM   703  C CA  . GLU A 1 91  ? 19.635 50.254 13.811 1.00 13.03 ? 91  GLU D CA  1 
ATOM   704  C C   . GLU A 1 91  ? 20.579 49.311 13.080 1.00 12.09 ? 91  GLU D C   1 
ATOM   705  O O   . GLU A 1 91  ? 21.123 49.669 12.027 1.00 12.10 ? 91  GLU D O   1 
ATOM   706  C CB  . GLU A 1 91  ? 20.379 50.894 14.986 1.00 13.98 ? 91  GLU D CB  1 
ATOM   707  C CG  . GLU A 1 91  ? 19.630 52.076 15.585 1.00 16.99 ? 91  GLU D CG  1 
ATOM   708  C CD  . GLU A 1 91  ? 20.224 52.541 16.894 1.00 18.94 ? 91  GLU D CD  1 
ATOM   709  O OE1 . GLU A 1 91  ? 21.347 52.156 17.270 1.00 20.86 ? 91  GLU D OE1 1 
ATOM   710  O OE2 . GLU A 1 91  ? 19.517 53.313 17.578 1.00 20.54 ? 91  GLU D OE2 1 
ATOM   711  N N   . LEU A 1 92  ? 20.750 48.099 13.614 1.00 11.07 ? 92  LEU D N   1 
ATOM   712  C CA  . LEU A 1 92  ? 21.639 47.130 12.979 1.00 11.03 ? 92  LEU D CA  1 
ATOM   713  C C   . LEU A 1 92  ? 21.142 46.693 11.611 1.00 10.95 ? 92  LEU D C   1 
ATOM   714  O O   . LEU A 1 92  ? 21.942 46.620 10.669 1.00 11.80 ? 92  LEU D O   1 
ATOM   715  C CB  . LEU A 1 92  ? 21.859 45.920 13.900 1.00 11.84 ? 92  LEU D CB  1 
ATOM   716  C CG  . LEU A 1 92  ? 22.584 46.271 15.209 1.00 12.26 ? 92  LEU D CG  1 
ATOM   717  C CD1 . LEU A 1 92  ? 22.354 45.209 16.275 1.00 13.93 ? 92  LEU D CD1 1 
ATOM   718  C CD2 . LEU A 1 92  ? 24.073 46.485 14.985 1.00 13.13 ? 92  LEU D CD2 1 
ATOM   719  N N   . ILE A 1 93  ? 19.866 46.381 11.488 1.00 10.85 ? 93  ILE D N   1 
ATOM   720  C CA  . ILE A 1 93  ? 19.313 45.947 10.203 1.00 11.65 ? 93  ILE D CA  1 
ATOM   721  C C   . ILE A 1 93  ? 19.349 47.077 9.179  1.00 12.38 ? 93  ILE D C   1 
ATOM   722  O O   . ILE A 1 93  ? 19.738 46.873 8.022  1.00 12.73 ? 93  ILE D O   1 
ATOM   723  C CB  . ILE A 1 93  ? 17.876 45.427 10.365 1.00 11.82 ? 93  ILE D CB  1 
ATOM   724  C CG1 . ILE A 1 93  ? 17.880 44.169 11.240 1.00 12.30 ? 93  ILE D CG1 1 
ATOM   725  C CG2 . ILE A 1 93  ? 17.279 45.099 9.001  1.00 12.16 ? 93  ILE D CG2 1 
ATOM   726  C CD1 . ILE A 1 93  ? 16.512 43.795 11.758 1.00 12.68 ? 93  ILE D CD1 1 
ATOM   727  N N   . LEU A 1 94  ? 18.998 48.285 9.623  1.00 13.85 ? 94  LEU D N   1 
ATOM   728  C CA  . LEU A 1 94  ? 19.044 49.449 8.736  1.00 15.06 ? 94  LEU D CA  1 
ATOM   729  C C   . LEU A 1 94  ? 20.426 49.695 8.173  1.00 15.06 ? 94  LEU D C   1 
ATOM   730  O O   . LEU A 1 94  ? 20.547 50.170 7.037  1.00 16.79 ? 94  LEU D O   1 
ATOM   731  C CB  . LEU A 1 94  ? 18.547 50.688 9.481  1.00 16.06 ? 94  LEU D CB  1 
ATOM   732  C CG  . LEU A 1 94  ? 17.047 50.683 9.783  1.00 17.42 ? 94  LEU D CG  1 
ATOM   733  C CD1 . LEU A 1 94  ? 16.675 51.709 10.839 1.00 17.80 ? 94  LEU D CD1 1 
ATOM   734  C CD2 . LEU A 1 94  ? 16.290 51.037 8.530  1.00 19.18 ? 94  LEU D CD2 1 
ATOM   735  N N   . ARG A 1 95  ? 21.477 49.417 8.931  1.00 13.44 ? 95  ARG D N   1 
ATOM   736  C CA  . ARG A 1 95  ? 22.839 49.605 8.457  1.00 13.94 ? 95  ARG D CA  1 
ATOM   737  C C   . ARG A 1 95  ? 23.351 48.443 7.627  1.00 13.37 ? 95  ARG D C   1 
ATOM   738  O O   . ARG A 1 95  ? 24.482 48.561 7.147  1.00 13.86 ? 95  ARG D O   1 
ATOM   739  C CB  . ARG A 1 95  ? 23.744 49.890 9.654  1.00 14.01 ? 95  ARG D CB  1 
ATOM   740  C CG  . ARG A 1 95  ? 23.521 51.323 10.167 1.00 17.14 ? 95  ARG D CG  1 
ATOM   741  C CD  . ARG A 1 95  ? 23.988 51.448 11.606 1.00 17.92 ? 95  ARG D CD  1 
ATOM   742  N NE  . ARG A 1 95  ? 23.716 52.756 12.194 1.00 18.38 ? 95  ARG D NE  1 
ATOM   743  C CZ  . ARG A 1 95  ? 22.521 53.271 12.444 1.00 18.49 ? 95  ARG D CZ  1 
ATOM   744  N NH1 . ARG A 1 95  ? 21.406 52.624 12.131 1.00 17.21 ? 95  ARG D NH1 1 
ATOM   745  N NH2 . ARG A 1 95  ? 22.473 54.470 13.013 1.00 19.02 ? 95  ARG D NH2 1 
ATOM   746  N N   . GLY A 1 96  ? 22.575 47.377 7.434  1.00 13.12 ? 96  GLY D N   1 
ATOM   747  C CA  . GLY A 1 96  ? 23.062 46.300 6.592  1.00 12.33 ? 96  GLY D CA  1 
ATOM   748  C C   . GLY A 1 96  ? 23.122 44.918 7.200  1.00 12.02 ? 96  GLY D C   1 
ATOM   749  O O   . GLY A 1 96  ? 23.377 43.984 6.444  1.00 11.32 ? 96  GLY D O   1 
ATOM   750  N N   . ALA A 1 97  ? 22.843 44.749 8.493  1.00 11.21 ? 97  ALA D N   1 
ATOM   751  C CA  . ALA A 1 97  ? 22.805 43.362 8.990  1.00 9.92  ? 97  ALA D CA  1 
ATOM   752  C C   . ALA A 1 97  ? 21.616 42.671 8.329  1.00 9.53  ? 97  ALA D C   1 
ATOM   753  O O   . ALA A 1 97  ? 20.516 43.235 8.310  1.00 10.74 ? 97  ALA D O   1 
ATOM   754  C CB  . ALA A 1 97  ? 22.671 43.338 10.500 1.00 9.96  ? 97  ALA D CB  1 
ATOM   755  N N   . ASP A 1 98  ? 21.818 41.451 7.838  1.00 9.03  ? 98  ASP D N   1 
ATOM   756  C CA  . ASP A 1 98  ? 20.691 40.740 7.237  1.00 9.08  ? 98  ASP D CA  1 
ATOM   757  C C   . ASP A 1 98  ? 19.734 40.238 8.298  1.00 9.21  ? 98  ASP D C   1 
ATOM   758  O O   . ASP A 1 98  ? 18.531 40.128 8.049  1.00 10.32 ? 98  ASP D O   1 
ATOM   759  C CB  . ASP A 1 98  ? 21.230 39.565 6.407  1.00 9.65  ? 98  ASP D CB  1 
ATOM   760  C CG  . ASP A 1 98  ? 22.153 40.116 5.329  1.00 10.75 ? 98  ASP D CG  1 
ATOM   761  O OD1 . ASP A 1 98  ? 21.654 40.777 4.393  1.00 12.93 ? 98  ASP D OD1 1 
ATOM   762  O OD2 . ASP A 1 98  ? 23.367 39.903 5.465  1.00 10.44 ? 98  ASP D OD2 1 
ATOM   763  N N   . LYS A 1 99  ? 20.275 39.843 9.440  1.00 8.13  ? 99  LYS D N   1 
ATOM   764  C CA  . LYS A 1 99  ? 19.481 39.298 10.533 1.00 8.50  ? 99  LYS D CA  1 
ATOM   765  C C   . LYS A 1 99  ? 20.066 39.743 11.874 1.00 8.03  ? 99  LYS D C   1 
ATOM   766  O O   . LYS A 1 99  ? 21.267 40.021 11.986 1.00 8.32  ? 99  LYS D O   1 
ATOM   767  C CB  . LYS A 1 99  ? 19.521 37.759 10.528 1.00 9.43  ? 99  LYS D CB  1 
ATOM   768  C CG  . LYS A 1 99  ? 19.171 37.078 9.218  1.00 10.51 ? 99  LYS D CG  1 
ATOM   769  C CD  . LYS A 1 99  ? 19.405 35.581 9.266  1.00 11.33 ? 99  LYS D CD  1 
ATOM   770  C CE  . LYS A 1 99  ? 19.342 35.007 7.851  1.00 13.19 ? 99  LYS D CE  1 
ATOM   771  N NZ  A LYS A 1 99  ? 19.645 33.549 7.875  0.50 11.52 ? 99  LYS D NZ  1 
ATOM   772  N NZ  B LYS A 1 99  ? 17.927 34.918 7.402  0.50 15.13 ? 99  LYS D NZ  1 
ATOM   773  N N   . VAL A 1 100 ? 19.212 39.747 12.892 1.00 8.05  ? 100 VAL D N   1 
ATOM   774  C CA  . VAL A 1 100 ? 19.631 40.006 14.254 1.00 9.02  ? 100 VAL D CA  1 
ATOM   775  C C   . VAL A 1 100 ? 19.245 38.791 15.107 1.00 9.22  ? 100 VAL D C   1 
ATOM   776  O O   . VAL A 1 100 ? 18.198 38.196 14.850 1.00 10.07 ? 100 VAL D O   1 
ATOM   777  C CB  . VAL A 1 100 ? 19.032 41.243 14.935 1.00 9.35  ? 100 VAL D CB  1 
ATOM   778  C CG1 . VAL A 1 100 ? 19.576 42.523 14.312 1.00 11.21 ? 100 VAL D CG1 1 
ATOM   779  C CG2 . VAL A 1 100 ? 17.514 41.185 14.859 1.00 11.23 ? 100 VAL D CG2 1 
ATOM   780  N N   . SER A 1 101 ? 20.096 38.460 16.064 1.00 9.20  ? 101 SER D N   1 
ATOM   781  C CA  . SER A 1 101 ? 19.809 37.369 16.989 1.00 9.74  ? 101 SER D CA  1 
ATOM   782  C C   . SER A 1 101 ? 19.479 37.964 18.356 1.00 10.40 ? 101 SER D C   1 
ATOM   783  O O   . SER A 1 101 ? 20.264 38.718 18.918 1.00 12.01 ? 101 SER D O   1 
ATOM   784  C CB  . SER A 1 101 ? 20.997 36.424 17.108 1.00 11.54 ? 101 SER D CB  1 
ATOM   785  O OG  . SER A 1 101 ? 20.790 35.415 18.087 1.00 13.76 ? 101 SER D OG  1 
ATOM   786  N N   . ILE A 1 102 ? 18.304 37.608 18.866 1.00 8.90  ? 102 ILE D N   1 
ATOM   787  C CA  . ILE A 1 102 ? 17.863 38.051 20.186 1.00 8.90  ? 102 ILE D CA  1 
ATOM   788  C C   . ILE A 1 102 ? 17.611 36.826 21.053 1.00 8.51  ? 102 ILE D C   1 
ATOM   789  O O   . ILE A 1 102 ? 17.222 35.758 20.555 1.00 8.00  ? 102 ILE D O   1 
ATOM   790  C CB  . ILE A 1 102 ? 16.623 38.962 20.114 1.00 9.72  ? 102 ILE D CB  1 
ATOM   791  C CG1 . ILE A 1 102 ? 15.511 38.298 19.299 1.00 10.03 ? 102 ILE D CG1 1 
ATOM   792  C CG2 . ILE A 1 102 ? 16.997 40.336 19.549 1.00 11.58 ? 102 ILE D CG2 1 
ATOM   793  C CD1 . ILE A 1 102 ? 14.183 39.040 19.349 1.00 11.09 ? 102 ILE D CD1 1 
ATOM   794  N N   . ASN A 1 103 ? 17.904 36.934 22.341 1.00 10.05 ? 103 ASN D N   1 
ATOM   795  C CA  . ASN A 1 103 ? 17.767 35.818 23.272 1.00 9.15  ? 103 ASN D CA  1 
ATOM   796  C C   . ASN A 1 103 ? 17.138 36.311 24.573 1.00 8.83  ? 103 ASN D C   1 
ATOM   797  O O   . ASN A 1 103 ? 15.918 36.226 24.704 1.00 8.62  ? 103 ASN D O   1 
ATOM   798  C CB  . ASN A 1 103 ? 19.099 35.114 23.561 1.00 12.07 ? 103 ASN D CB  1 
ATOM   799  C CG  . ASN A 1 103 ? 18.990 33.982 24.569 1.00 12.44 ? 103 ASN D CG  1 
ATOM   800  O OD1 . ASN A 1 103 ? 19.964 33.272 24.888 1.00 19.72 ? 103 ASN D OD1 1 
ATOM   801  N ND2 . ASN A 1 103 ? 17.830 33.695 25.113 1.00 11.95 ? 103 ASN D ND2 1 
ATOM   802  N N   . THR A 1 104 ? 17.944 36.847 25.496 1.00 8.38  ? 104 THR D N   1 
ATOM   803  C CA  . THR A 1 104 ? 17.345 37.287 26.762 1.00 8.81  ? 104 THR D CA  1 
ATOM   804  C C   . THR A 1 104 ? 16.260 38.320 26.541 1.00 9.18  ? 104 THR D C   1 
ATOM   805  O O   . THR A 1 104 ? 15.209 38.261 27.178 1.00 9.21  ? 104 THR D O   1 
ATOM   806  C CB  . THR A 1 104 ? 18.433 37.907 27.653 1.00 8.17  ? 104 THR D CB  1 
ATOM   807  O OG1 . THR A 1 104 ? 19.415 36.893 27.902 1.00 9.78  ? 104 THR D OG1 1 
ATOM   808  C CG2 . THR A 1 104 ? 17.832 38.414 28.961 1.00 8.36  ? 104 THR D CG2 1 
ATOM   809  N N   . ALA A 1 105 ? 16.458 39.241 25.597 1.00 8.81  ? 105 ALA D N   1 
ATOM   810  C CA  . ALA A 1 105 ? 15.432 40.262 25.349 1.00 9.25  ? 105 ALA D CA  1 
ATOM   811  C C   . ALA A 1 105 ? 14.147 39.667 24.803 1.00 9.25  ? 105 ALA D C   1 
ATOM   812  O O   . ALA A 1 105 ? 13.056 40.188 25.071 1.00 10.43 ? 105 ALA D O   1 
ATOM   813  C CB  . ALA A 1 105 ? 15.991 41.307 24.388 1.00 10.15 ? 105 ALA D CB  1 
ATOM   814  N N   . ALA A 1 106 ? 14.256 38.579 24.030 1.00 8.23  ? 106 ALA D N   1 
ATOM   815  C CA  . ALA A 1 106 ? 13.046 37.929 23.518 1.00 8.96  ? 106 ALA D CA  1 
ATOM   816  C C   . ALA A 1 106 ? 12.286 37.217 24.631 1.00 9.22  ? 106 ALA D C   1 
ATOM   817  O O   . ALA A 1 106 ? 11.053 37.279 24.725 1.00 8.63  ? 106 ALA D O   1 
ATOM   818  C CB  . ALA A 1 106 ? 13.431 36.936 22.435 1.00 9.78  ? 106 ALA D CB  1 
ATOM   819  N N   . VAL A 1 107 ? 13.012 36.501 25.507 1.00 8.00  ? 107 VAL D N   1 
ATOM   820  C CA  . VAL A 1 107 ? 12.346 35.825 26.627 1.00 8.80  ? 107 VAL D CA  1 
ATOM   821  C C   . VAL A 1 107 ? 11.623 36.831 27.522 1.00 9.57  ? 107 VAL D C   1 
ATOM   822  O O   . VAL A 1 107 ? 10.510 36.565 27.978 1.00 10.35 ? 107 VAL D O   1 
ATOM   823  C CB  . VAL A 1 107 ? 13.368 35.020 27.446 1.00 7.80  ? 107 VAL D CB  1 
ATOM   824  C CG1 . VAL A 1 107 ? 12.765 34.512 28.750 1.00 9.90  ? 107 VAL D CG1 1 
ATOM   825  C CG2 . VAL A 1 107 ? 13.952 33.858 26.644 1.00 9.07  ? 107 VAL D CG2 1 
ATOM   826  N N   . GLU A 1 108 ? 12.253 37.987 27.743 1.00 10.18 ? 108 GLU D N   1 
ATOM   827  C CA  . GLU A 1 108 ? 11.659 39.006 28.615 1.00 11.24 ? 108 GLU D CA  1 
ATOM   828  C C   . GLU A 1 108 ? 10.580 39.838 27.978 1.00 11.43 ? 108 GLU D C   1 
ATOM   829  O O   . GLU A 1 108 ? 9.801  40.518 28.665 1.00 11.36 ? 108 GLU D O   1 
ATOM   830  C CB  . GLU A 1 108 ? 12.806 39.870 29.165 1.00 12.62 ? 108 GLU D CB  1 
ATOM   831  C CG  . GLU A 1 108 ? 13.612 38.999 30.131 1.00 15.18 ? 108 GLU D CG  1 
ATOM   832  C CD  . GLU A 1 108 ? 14.777 39.705 30.779 1.00 15.84 ? 108 GLU D CD  1 
ATOM   833  O OE1 . GLU A 1 108 ? 15.110 40.823 30.342 1.00 17.51 ? 108 GLU D OE1 1 
ATOM   834  O OE2 . GLU A 1 108 ? 15.371 39.070 31.689 1.00 16.68 ? 108 GLU D OE2 1 
ATOM   835  N N   . ASN A 1 109 ? 10.476 39.827 26.658 1.00 11.24 ? 109 ASN D N   1 
ATOM   836  C CA  . ASN A 1 109 ? 9.450  40.574 25.933 1.00 10.59 ? 109 ASN D CA  1 
ATOM   837  C C   . ASN A 1 109 ? 9.182  39.863 24.617 1.00 9.97  ? 109 ASN D C   1 
ATOM   838  O O   . ASN A 1 109 ? 9.689  40.253 23.551 1.00 10.22 ? 109 ASN D O   1 
ATOM   839  C CB  . ASN A 1 109 ? 9.935  42.002 25.706 1.00 10.41 ? 109 ASN D CB  1 
ATOM   840  C CG  . ASN A 1 109 ? 9.047  42.924 24.906 1.00 11.59 ? 109 ASN D CG  1 
ATOM   841  O OD1 . ASN A 1 109 ? 9.559  43.867 24.285 1.00 13.40 ? 109 ASN D OD1 1 
ATOM   842  N ND2 . ASN A 1 109 ? 7.754  42.668 24.868 1.00 12.18 ? 109 ASN D ND2 1 
ATOM   843  N N   . PRO A 1 110 ? 8.424  38.777 24.632 1.00 8.51  ? 110 PRO D N   1 
ATOM   844  C CA  . PRO A 1 110 ? 8.215  37.967 23.438 1.00 9.18  ? 110 PRO D CA  1 
ATOM   845  C C   . PRO A 1 110 ? 7.690  38.732 22.253 1.00 9.37  ? 110 PRO D C   1 
ATOM   846  O O   . PRO A 1 110 ? 8.043  38.397 21.110 1.00 9.24  ? 110 PRO D O   1 
ATOM   847  C CB  . PRO A 1 110 ? 7.287  36.842 23.884 1.00 9.40  ? 110 PRO D CB  1 
ATOM   848  C CG  . PRO A 1 110 ? 7.625  36.692 25.340 1.00 10.84 ? 110 PRO D CG  1 
ATOM   849  C CD  . PRO A 1 110 ? 7.869  38.103 25.837 1.00 9.49  ? 110 PRO D CD  1 
ATOM   850  N N   . SER A 1 111 ? 6.913  39.808 22.413 1.00 9.32  ? 111 SER D N   1 
ATOM   851  C CA  . SER A 1 111 ? 6.433  40.564 21.260 1.00 9.99  ? 111 SER D CA  1 
ATOM   852  C C   . SER A 1 111 ? 7.545  41.345 20.585 1.00 9.79  ? 111 SER D C   1 
ATOM   853  O O   . SER A 1 111 ? 7.320  41.822 19.463 1.00 10.27 ? 111 SER D O   1 
ATOM   854  C CB  . SER A 1 111 ? 5.248  41.468 21.596 1.00 12.48 ? 111 SER D CB  1 
ATOM   855  O OG  . SER A 1 111 ? 5.615  42.397 22.584 1.00 14.70 ? 111 SER D OG  1 
ATOM   856  N N   . LEU A 1 112 ? 8.740  41.443 21.157 1.00 9.62  ? 112 LEU D N   1 
ATOM   857  C CA  . LEU A 1 112 ? 9.883  42.024 20.458 1.00 9.20  ? 112 LEU D CA  1 
ATOM   858  C C   . LEU A 1 112 ? 10.133 41.229 19.181 1.00 9.59  ? 112 LEU D C   1 
ATOM   859  O O   . LEU A 1 112 ? 10.485 41.812 18.146 1.00 10.00 ? 112 LEU D O   1 
ATOM   860  C CB  . LEU A 1 112 ? 11.136 42.007 21.325 1.00 9.81  ? 112 LEU D CB  1 
ATOM   861  C CG  . LEU A 1 112 ? 12.453 42.457 20.680 1.00 10.59 ? 112 LEU D CG  1 
ATOM   862  C CD1 . LEU A 1 112 ? 12.327 43.891 20.175 1.00 11.06 ? 112 LEU D CD1 1 
ATOM   863  C CD2 . LEU A 1 112 ? 13.573 42.330 21.711 1.00 11.45 ? 112 LEU D CD2 1 
ATOM   864  N N   . ILE A 1 113 ? 10.012 39.903 19.249 1.00 8.74  ? 113 ILE D N   1 
ATOM   865  C CA  . ILE A 1 113 ? 10.145 39.047 18.075 1.00 9.07  ? 113 ILE D CA  1 
ATOM   866  C C   . ILE A 1 113 ? 9.227  39.527 16.962 1.00 9.13  ? 113 ILE D C   1 
ATOM   867  O O   . ILE A 1 113 ? 9.661  39.741 15.816 1.00 9.29  ? 113 ILE D O   1 
ATOM   868  C CB  . ILE A 1 113 ? 9.787  37.588 18.437 1.00 8.90  ? 113 ILE D CB  1 
ATOM   869  C CG1 . ILE A 1 113 ? 10.751 37.006 19.477 1.00 8.70  ? 113 ILE D CG1 1 
ATOM   870  C CG2 . ILE A 1 113 ? 9.781  36.734 17.170 1.00 9.40  ? 113 ILE D CG2 1 
ATOM   871  C CD1 . ILE A 1 113 ? 10.210 35.754 20.152 1.00 9.87  ? 113 ILE D CD1 1 
ATOM   872  N N   . THR A 1 114 ? 7.942  39.683 17.304 1.00 9.52  ? 114 THR D N   1 
ATOM   873  C CA  . THR A 1 114 ? 6.941  40.102 16.329 1.00 9.33  ? 114 THR D CA  1 
ATOM   874  C C   . THR A 1 114 ? 7.183  41.504 15.794 1.00 9.72  ? 114 THR D C   1 
ATOM   875  O O   . THR A 1 114 ? 6.987  41.754 14.597 1.00 10.65 ? 114 THR D O   1 
ATOM   876  C CB  . THR A 1 114 ? 5.556  40.054 17.017 1.00 9.86  ? 114 THR D CB  1 
ATOM   877  O OG1 . THR A 1 114 ? 5.482  38.840 17.770 1.00 10.85 ? 114 THR D OG1 1 
ATOM   878  C CG2 . THR A 1 114 ? 4.452  40.088 15.977 1.00 11.26 ? 114 THR D CG2 1 
ATOM   879  N N   . GLN A 1 115 ? 7.642  42.409 16.642 1.00 10.01 ? 115 GLN D N   1 
ATOM   880  C CA  . GLN A 1 115 ? 7.918  43.781 16.222 1.00 11.50 ? 115 GLN D CA  1 
ATOM   881  C C   . GLN A 1 115 ? 8.984  43.806 15.134 1.00 11.95 ? 115 GLN D C   1 
ATOM   882  O O   . GLN A 1 115 ? 8.845  44.493 14.109 1.00 12.71 ? 115 GLN D O   1 
ATOM   883  C CB  . GLN A 1 115 ? 8.358  44.628 17.418 1.00 13.05 ? 115 GLN D CB  1 
ATOM   884  C CG  . GLN A 1 115 ? 7.188  44.874 18.373 1.00 15.70 ? 115 GLN D CG  1 
ATOM   885  C CD  . GLN A 1 115 ? 7.672  45.404 19.705 1.00 18.35 ? 115 GLN D CD  1 
ATOM   886  O OE1 . GLN A 1 115 ? 7.125  45.030 20.748 1.00 20.55 ? 115 GLN D OE1 1 
ATOM   887  N NE2 . GLN A 1 115 ? 8.654  46.297 19.660 1.00 18.99 ? 115 GLN D NE2 1 
ATOM   888  N N   . ILE A 1 116 ? 10.087 43.093 15.352 1.00 11.29 ? 116 ILE D N   1 
ATOM   889  C CA  . ILE A 1 116 ? 11.162 43.068 14.367 1.00 10.97 ? 116 ILE D CA  1 
ATOM   890  C C   . ILE A 1 116 ? 10.657 42.380 13.112 1.00 10.81 ? 116 ILE D C   1 
ATOM   891  O O   . ILE A 1 116 ? 10.905 42.872 11.993 1.00 11.48 ? 116 ILE D O   1 
ATOM   892  C CB  . ILE A 1 116 ? 12.422 42.375 14.911 1.00 10.34 ? 116 ILE D CB  1 
ATOM   893  C CG1 . ILE A 1 116 ? 12.987 43.096 16.125 1.00 11.35 ? 116 ILE D CG1 1 
ATOM   894  C CG2 . ILE A 1 116 ? 13.481 42.326 13.809 1.00 12.21 ? 116 ILE D CG2 1 
ATOM   895  C CD1 . ILE A 1 116 ? 13.994 42.288 16.941 1.00 12.13 ? 116 ILE D CD1 1 
ATOM   896  N N   . ALA A 1 117 ? 9.949  41.262 13.229 1.00 10.29 ? 117 ALA D N   1 
ATOM   897  C CA  . ALA A 1 117 ? 9.446  40.555 12.055 1.00 10.51 ? 117 ALA D CA  1 
ATOM   898  C C   . ALA A 1 117 ? 8.480  41.410 11.239 1.00 11.66 ? 117 ALA D C   1 
ATOM   899  O O   . ALA A 1 117 ? 8.522  41.373 9.996  1.00 11.93 ? 117 ALA D O   1 
ATOM   900  C CB  . ALA A 1 117 ? 8.760  39.254 12.461 1.00 10.95 ? 117 ALA D CB  1 
ATOM   901  N N   . GLN A 1 118 ? 7.597  42.143 11.888 1.00 12.51 ? 118 GLN D N   1 
ATOM   902  C CA  . GLN A 1 118 ? 6.627  42.957 11.142 1.00 14.81 ? 118 GLN D CA  1 
ATOM   903  C C   . GLN A 1 118 ? 7.296  44.102 10.413 1.00 14.99 ? 118 GLN D C   1 
ATOM   904  O O   . GLN A 1 118 ? 6.834  44.443 9.314  1.00 17.22 ? 118 GLN D O   1 
ATOM   905  C CB  . GLN A 1 118 ? 5.551  43.481 12.115 1.00 16.62 ? 118 GLN D CB  1 
ATOM   906  C CG  . GLN A 1 118 ? 4.670  42.309 12.514 1.00 19.14 ? 118 GLN D CG  1 
ATOM   907  C CD  . GLN A 1 118 ? 3.629  42.584 13.565 1.00 20.58 ? 118 GLN D CD  1 
ATOM   908  O OE1 . GLN A 1 118 ? 2.641  41.838 13.599 1.00 22.59 ? 118 GLN D OE1 1 
ATOM   909  N NE2 . GLN A 1 118 ? 3.881  43.595 14.371 1.00 20.28 ? 118 GLN D NE2 1 
ATOM   910  N N   . THR A 1 119 ? 8.334  44.697 10.982 1.00 13.96 ? 119 THR D N   1 
ATOM   911  C CA  . THR A 1 119 ? 8.986  45.831 10.346 1.00 14.51 ? 119 THR D CA  1 
ATOM   912  C C   . THR A 1 119 ? 9.953  45.420 9.254  1.00 13.75 ? 119 THR D C   1 
ATOM   913  O O   . THR A 1 119 ? 9.991  46.019 8.171  1.00 14.11 ? 119 THR D O   1 
ATOM   914  C CB  . THR A 1 119 ? 9.773  46.653 11.394 1.00 15.48 ? 119 THR D CB  1 
ATOM   915  O OG1 . THR A 1 119 ? 8.824  47.034 12.413 1.00 17.56 ? 119 THR D OG1 1 
ATOM   916  C CG2 . THR A 1 119 ? 10.446 47.852 10.759 1.00 16.90 ? 119 THR D CG2 1 
ATOM   917  N N   . PHE A 1 120 ? 10.754 44.389 9.519  1.00 12.12 ? 120 PHE D N   1 
ATOM   918  C CA  . PHE A 1 120 ? 11.823 43.986 8.613  1.00 12.21 ? 120 PHE D CA  1 
ATOM   919  C C   . PHE A 1 120 ? 11.634 42.663 7.918  1.00 11.76 ? 120 PHE D C   1 
ATOM   920  O O   . PHE A 1 120 ? 12.501 42.288 7.104  1.00 12.44 ? 120 PHE D O   1 
ATOM   921  C CB  . PHE A 1 120 ? 13.117 43.914 9.464  1.00 12.23 ? 120 PHE D CB  1 
ATOM   922  C CG  . PHE A 1 120 ? 13.470 45.251 10.053 1.00 12.55 ? 120 PHE D CG  1 
ATOM   923  C CD1 . PHE A 1 120 ? 13.989 46.259 9.253  1.00 13.60 ? 120 PHE D CD1 1 
ATOM   924  C CD2 . PHE A 1 120 ? 13.262 45.523 11.394 1.00 13.53 ? 120 PHE D CD2 1 
ATOM   925  C CE1 . PHE A 1 120 ? 14.305 47.491 9.797  1.00 13.67 ? 120 PHE D CE1 1 
ATOM   926  C CE2 . PHE A 1 120 ? 13.584 46.747 11.935 1.00 13.72 ? 120 PHE D CE2 1 
ATOM   927  C CZ  . PHE A 1 120 ? 14.109 47.749 11.139 1.00 13.88 ? 120 PHE D CZ  1 
ATOM   928  N N   . GLY A 1 121 ? 10.562 41.947 8.236  1.00 10.68 ? 121 GLY D N   1 
ATOM   929  C CA  . GLY A 1 121 ? 10.332 40.617 7.675  1.00 11.05 ? 121 GLY D CA  1 
ATOM   930  C C   . GLY A 1 121 ? 10.802 39.564 8.684  1.00 10.06 ? 121 GLY D C   1 
ATOM   931  O O   . GLY A 1 121 ? 11.774 39.761 9.419  1.00 9.97  ? 121 GLY D O   1 
ATOM   932  N N   . SER A 1 122 ? 10.110 38.433 8.715  1.00 10.33 ? 122 SER D N   1 
ATOM   933  C CA  . SER A 1 122 ? 10.460 37.352 9.638  1.00 11.20 ? 122 SER D CA  1 
ATOM   934  C C   . SER A 1 122 ? 11.866 36.836 9.436  1.00 12.06 ? 122 SER D C   1 
ATOM   935  O O   . SER A 1 122 ? 12.527 36.418 10.396 1.00 10.69 ? 122 SER D O   1 
ATOM   936  C CB  . SER A 1 122 ? 9.481  36.184 9.479  1.00 10.11 ? 122 SER D CB  1 
ATOM   937  O OG  A SER A 1 122 ? 8.323  36.423 10.241 0.50 12.84 ? 122 SER D OG  1 
ATOM   938  O OG  B SER A 1 122 ? 9.601  35.630 8.160  0.50 9.79  ? 122 SER D OG  1 
ATOM   939  N N   . GLN A 1 123 ? 12.370 36.858 8.204  1.00 11.62 ? 123 GLN D N   1 
ATOM   940  C CA  . GLN A 1 123 ? 13.717 36.352 7.939  1.00 13.41 ? 123 GLN D CA  1 
ATOM   941  C C   . GLN A 1 123 ? 14.797 37.160 8.620  1.00 12.93 ? 123 GLN D C   1 
ATOM   942  O O   . GLN A 1 123 ? 15.913 36.644 8.776  1.00 14.18 ? 123 GLN D O   1 
ATOM   943  C CB  . GLN A 1 123 ? 13.972 36.259 6.424  1.00 16.09 ? 123 GLN D CB  1 
ATOM   944  C CG  . GLN A 1 123 ? 12.988 35.296 5.771  1.00 21.12 ? 123 GLN D CG  1 
ATOM   945  C CD  . GLN A 1 123 ? 12.725 35.549 4.306  1.00 23.81 ? 123 GLN D CD  1 
ATOM   946  O OE1 . GLN A 1 123 ? 13.516 35.130 3.460  1.00 25.69 ? 123 GLN D OE1 1 
ATOM   947  N NE2 . GLN A 1 123 ? 11.603 36.198 3.987  1.00 25.24 ? 123 GLN D NE2 1 
ATOM   948  N N   . ALA A 1 124 ? 14.534 38.385 9.053  1.00 10.82 ? 124 ALA D N   1 
ATOM   949  C CA  . ALA A 1 124 ? 15.495 39.208 9.757  1.00 11.13 ? 124 ALA D CA  1 
ATOM   950  C C   . ALA A 1 124 ? 15.600 38.853 11.234 1.00 10.86 ? 124 ALA D C   1 
ATOM   951  O O   . ALA A 1 124 ? 16.472 39.407 11.911 1.00 10.47 ? 124 ALA D O   1 
ATOM   952  C CB  . ALA A 1 124 ? 15.127 40.680 9.612  1.00 11.06 ? 124 ALA D CB  1 
ATOM   953  N N   . VAL A 1 125 ? 14.678 38.039 11.763 1.00 10.52 ? 125 VAL D N   1 
ATOM   954  C CA  . VAL A 1 125 ? 14.726 37.746 13.191 1.00 11.61 ? 125 VAL D CA  1 
ATOM   955  C C   . VAL A 1 125 ? 15.072 36.299 13.488 1.00 9.77  ? 125 VAL D C   1 
ATOM   956  O O   . VAL A 1 125 ? 14.381 35.338 13.156 1.00 10.85 ? 125 VAL D O   1 
ATOM   957  C CB  . VAL A 1 125 ? 13.440 38.190 13.923 1.00 13.67 ? 125 VAL D CB  1 
ATOM   958  C CG1 . VAL A 1 125 ? 12.199 37.454 13.472 1.00 16.06 ? 125 VAL D CG1 1 
ATOM   959  C CG2 . VAL A 1 125 ? 13.639 38.082 15.432 1.00 14.25 ? 125 VAL D CG2 1 
ATOM   960  N N   . VAL A 1 126 ? 16.240 36.172 14.127 1.00 7.74  ? 126 VAL D N   1 
ATOM   961  C CA  . VAL A 1 126 ? 16.734 34.913 14.646 1.00 7.67  ? 126 VAL D CA  1 
ATOM   962  C C   . VAL A 1 126 ? 16.556 34.909 16.164 1.00 7.68  ? 126 VAL D C   1 
ATOM   963  O O   . VAL A 1 126 ? 17.024 35.846 16.817 1.00 8.82  ? 126 VAL D O   1 
ATOM   964  C CB  . VAL A 1 126 ? 18.216 34.724 14.298 1.00 7.53  ? 126 VAL D CB  1 
ATOM   965  C CG1 . VAL A 1 126 ? 18.736 33.434 14.935 1.00 9.57  ? 126 VAL D CG1 1 
ATOM   966  C CG2 . VAL A 1 126 ? 18.406 34.658 12.787 1.00 9.13  ? 126 VAL D CG2 1 
ATOM   967  N N   . VAL A 1 127 ? 15.830 33.931 16.700 1.00 6.75  ? 127 VAL D N   1 
ATOM   968  C CA  . VAL A 1 127 ? 15.752 33.824 18.159 1.00 7.20  ? 127 VAL D CA  1 
ATOM   969  C C   . VAL A 1 127 ? 16.765 32.774 18.614 1.00 6.86  ? 127 VAL D C   1 
ATOM   970  O O   . VAL A 1 127 ? 16.679 31.622 18.189 1.00 7.19  ? 127 VAL D O   1 
ATOM   971  C CB  . VAL A 1 127 ? 14.338 33.484 18.641 1.00 7.27  ? 127 VAL D CB  1 
ATOM   972  C CG1 . VAL A 1 127 ? 14.358 33.223 20.148 1.00 8.22  ? 127 VAL D CG1 1 
ATOM   973  C CG2 . VAL A 1 127 ? 13.422 34.658 18.340 1.00 8.61  ? 127 VAL D CG2 1 
ATOM   974  N N   . ALA A 1 128 ? 17.770 33.241 19.353 1.00 6.95  ? 128 ALA D N   1 
ATOM   975  C CA  . ALA A 1 128 ? 18.771 32.341 19.908 1.00 7.37  ? 128 ALA D CA  1 
ATOM   976  C C   . ALA A 1 128 ? 18.191 31.755 21.196 1.00 7.98  ? 128 ALA D C   1 
ATOM   977  O O   . ALA A 1 128 ? 17.774 32.515 22.077 1.00 7.91  ? 128 ALA D O   1 
ATOM   978  C CB  . ALA A 1 128 ? 20.076 33.082 20.204 1.00 8.42  ? 128 ALA D CB  1 
ATOM   979  N N   . ILE A 1 129 ? 18.119 30.446 21.250 1.00 7.50  ? 129 ILE D N   1 
ATOM   980  C CA  . ILE A 1 129 ? 17.637 29.741 22.438 1.00 7.16  ? 129 ILE D CA  1 
ATOM   981  C C   . ILE A 1 129 ? 18.800 28.928 23.006 1.00 7.60  ? 129 ILE D C   1 
ATOM   982  O O   . ILE A 1 129 ? 19.330 28.062 22.310 1.00 8.57  ? 129 ILE D O   1 
ATOM   983  C CB  . ILE A 1 129 ? 16.443 28.814 22.140 1.00 7.82  ? 129 ILE D CB  1 
ATOM   984  C CG1 . ILE A 1 129 ? 15.281 29.579 21.489 1.00 8.36  ? 129 ILE D CG1 1 
ATOM   985  C CG2 . ILE A 1 129 ? 15.975 28.150 23.431 1.00 9.12  ? 129 ILE D CG2 1 
ATOM   986  C CD1 . ILE A 1 129 ? 14.107 28.693 21.101 1.00 8.77  ? 129 ILE D CD1 1 
ATOM   987  N N   . ASP A 1 130 ? 19.227 29.277 24.209 1.00 7.33  ? 130 ASP D N   1 
ATOM   988  C CA  . ASP A 1 130 ? 20.263 28.536 24.919 1.00 8.10  ? 130 ASP D CA  1 
ATOM   989  C C   . ASP A 1 130 ? 19.561 27.593 25.897 1.00 8.00  ? 130 ASP D C   1 
ATOM   990  O O   . ASP A 1 130 ? 18.737 28.066 26.689 1.00 9.40  ? 130 ASP D O   1 
ATOM   991  C CB  . ASP A 1 130 ? 21.172 29.450 25.717 1.00 8.52  ? 130 ASP D CB  1 
ATOM   992  C CG  . ASP A 1 130 ? 22.017 30.384 24.880 1.00 10.03 ? 130 ASP D CG  1 
ATOM   993  O OD1 . ASP A 1 130 ? 22.121 30.226 23.651 1.00 10.76 ? 130 ASP D OD1 1 
ATOM   994  O OD2 . ASP A 1 130 ? 22.585 31.319 25.502 1.00 12.48 ? 130 ASP D OD2 1 
ATOM   995  N N   . ALA A 1 131 ? 19.866 26.319 25.809 1.00 7.79  ? 131 ALA D N   1 
ATOM   996  C CA  . ALA A 1 131 ? 19.189 25.358 26.682 1.00 7.70  ? 131 ALA D CA  1 
ATOM   997  C C   . ALA A 1 131 ? 20.158 24.360 27.286 1.00 7.77  ? 131 ALA D C   1 
ATOM   998  O O   . ALA A 1 131 ? 21.283 24.153 26.814 1.00 8.48  ? 131 ALA D O   1 
ATOM   999  C CB  . ALA A 1 131 ? 18.143 24.590 25.873 1.00 9.07  ? 131 ALA D CB  1 
ATOM   1000 N N   . LYS A 1 132 ? 19.701 23.759 28.383 1.00 8.33  ? 132 LYS D N   1 
ATOM   1001 C CA  . LYS A 1 132 ? 20.407 22.717 29.098 1.00 9.17  ? 132 LYS D CA  1 
ATOM   1002 C C   . LYS A 1 132 ? 19.372 21.683 29.567 1.00 8.69  ? 132 LYS D C   1 
ATOM   1003 O O   . LYS A 1 132 ? 18.215 22.054 29.771 1.00 9.07  ? 132 LYS D O   1 
ATOM   1004 C CB  . LYS A 1 132 ? 21.137 23.179 30.369 1.00 10.86 ? 132 LYS D CB  1 
ATOM   1005 C CG  . LYS A 1 132 ? 22.066 24.372 30.207 1.00 11.57 ? 132 LYS D CG  1 
ATOM   1006 C CD  . LYS A 1 132 ? 22.909 24.554 31.468 1.00 12.82 ? 132 LYS D CD  1 
ATOM   1007 C CE  . LYS A 1 132 ? 23.912 25.690 31.307 1.00 13.06 ? 132 LYS D CE  1 
ATOM   1008 N NZ  . LYS A 1 132 ? 25.223 25.292 31.912 1.00 10.39 ? 132 LYS D NZ  1 
ATOM   1009 N N   . ARG A 1 133 ? 19.843 20.450 29.760 1.00 9.58  ? 133 ARG D N   1 
ATOM   1010 C CA  . ARG A 1 133 ? 18.953 19.415 30.308 1.00 11.55 ? 133 ARG D CA  1 
ATOM   1011 C C   . ARG A 1 133 ? 19.067 19.506 31.829 1.00 11.36 ? 133 ARG D C   1 
ATOM   1012 O O   . ARG A 1 133 ? 20.157 19.392 32.387 1.00 12.22 ? 133 ARG D O   1 
ATOM   1013 C CB  . ARG A 1 133 ? 19.330 18.050 29.757 1.00 12.93 ? 133 ARG D CB  1 
ATOM   1014 C CG  . ARG A 1 133 ? 18.188 17.036 29.849 1.00 16.73 ? 133 ARG D CG  1 
ATOM   1015 C CD  . ARG A 1 133 ? 18.552 15.779 29.044 1.00 21.06 ? 133 ARG D CD  1 
ATOM   1016 N NE  . ARG A 1 133 ? 19.568 15.034 29.781 1.00 23.75 ? 133 ARG D NE  1 
ATOM   1017 C CZ  . ARG A 1 133 ? 20.307 14.025 29.347 1.00 25.65 ? 133 ARG D CZ  1 
ATOM   1018 N NH1 . ARG A 1 133 ? 20.200 13.545 28.115 1.00 26.43 ? 133 ARG D NH1 1 
ATOM   1019 N NH2 . ARG A 1 133 ? 21.188 13.461 30.172 1.00 26.44 ? 133 ARG D NH2 1 
ATOM   1020 N N   . VAL A 1 134 ? 17.970 19.844 32.480 1.00 10.62 ? 134 VAL D N   1 
ATOM   1021 C CA  . VAL A 1 134 ? 17.900 20.042 33.930 1.00 10.86 ? 134 VAL D CA  1 
ATOM   1022 C C   . VAL A 1 134 ? 17.078 18.912 34.519 1.00 11.62 ? 134 VAL D C   1 
ATOM   1023 O O   . VAL A 1 134 ? 15.868 18.819 34.297 1.00 10.93 ? 134 VAL D O   1 
ATOM   1024 C CB  . VAL A 1 134 ? 17.255 21.404 34.248 1.00 10.54 ? 134 VAL D CB  1 
ATOM   1025 C CG1 . VAL A 1 134 ? 17.215 21.641 35.755 1.00 9.94  ? 134 VAL D CG1 1 
ATOM   1026 C CG2 . VAL A 1 134 ? 18.000 22.525 33.518 1.00 10.47 ? 134 VAL D CG2 1 
ATOM   1027 N N   . ASP A 1 135 ? 17.730 17.989 35.239 1.00 14.25 ? 135 ASP D N   1 
ATOM   1028 C CA  . ASP A 1 135 ? 17.008 16.831 35.763 1.00 16.09 ? 135 ASP D CA  1 
ATOM   1029 C C   . ASP A 1 135 ? 16.131 16.173 34.711 1.00 15.45 ? 135 ASP D C   1 
ATOM   1030 O O   . ASP A 1 135 ? 14.935 15.963 34.934 1.00 15.43 ? 135 ASP D O   1 
ATOM   1031 C CB  . ASP A 1 135 ? 16.105 17.229 36.931 1.00 20.05 ? 135 ASP D CB  1 
ATOM   1032 C CG  . ASP A 1 135 ? 16.823 17.503 38.220 1.00 23.25 ? 135 ASP D CG  1 
ATOM   1033 O OD1 . ASP A 1 135 ? 17.933 16.969 38.423 1.00 26.38 ? 135 ASP D OD1 1 
ATOM   1034 O OD2 . ASP A 1 135 ? 16.249 18.246 39.050 1.00 25.95 ? 135 ASP D OD2 1 
ATOM   1035 N N   . GLY A 1 136 ? 16.655 15.881 33.520 1.00 13.85 ? 136 GLY D N   1 
ATOM   1036 C CA  . GLY A 1 136 ? 15.907 15.232 32.478 1.00 12.20 ? 136 GLY D CA  1 
ATOM   1037 C C   . GLY A 1 136 ? 14.963 16.066 31.638 1.00 12.15 ? 136 GLY D C   1 
ATOM   1038 O O   . GLY A 1 136 ? 14.255 15.520 30.790 1.00 13.36 ? 136 GLY D O   1 
ATOM   1039 N N   . GLU A 1 137 ? 14.847 17.366 31.893 1.00 10.65 ? 137 GLU D N   1 
ATOM   1040 C CA  . GLU A 1 137 ? 13.967 18.239 31.128 1.00 10.13 ? 137 GLU D CA  1 
ATOM   1041 C C   . GLU A 1 137 ? 14.752 19.404 30.524 1.00 9.29  ? 137 GLU D C   1 
ATOM   1042 O O   . GLU A 1 137 ? 15.503 20.100 31.211 1.00 9.15  ? 137 GLU D O   1 
ATOM   1043 C CB  . GLU A 1 137 ? 12.843 18.842 31.988 1.00 10.32 ? 137 GLU D CB  1 
ATOM   1044 C CG  . GLU A 1 137 ? 11.888 17.779 32.531 1.00 12.12 ? 137 GLU D CG  1 
ATOM   1045 C CD  . GLU A 1 137 ? 10.788 18.414 33.362 1.00 13.33 ? 137 GLU D CD  1 
ATOM   1046 O OE1 . GLU A 1 137 ? 11.057 18.603 34.563 1.00 15.06 ? 137 GLU D OE1 1 
ATOM   1047 O OE2 . GLU A 1 137 ? 9.715  18.729 32.817 1.00 13.18 ? 137 GLU D OE2 1 
ATOM   1048 N N   . PHE A 1 138 ? 14.558 19.624 29.216 1.00 7.64  ? 138 PHE D N   1 
ATOM   1049 C CA  . PHE A 1 138 ? 15.243 20.764 28.575 1.00 7.65  ? 138 PHE D CA  1 
ATOM   1050 C C   . PHE A 1 138 ? 14.626 22.082 29.022 1.00 7.51  ? 138 PHE D C   1 
ATOM   1051 O O   . PHE A 1 138 ? 13.414 22.281 28.910 1.00 8.14  ? 138 PHE D O   1 
ATOM   1052 C CB  . PHE A 1 138 ? 15.204 20.620 27.062 1.00 8.70  ? 138 PHE D CB  1 
ATOM   1053 C CG  . PHE A 1 138 ? 16.085 19.542 26.492 1.00 8.99  ? 138 PHE D CG  1 
ATOM   1054 C CD1 . PHE A 1 138 ? 17.469 19.620 26.550 1.00 10.34 ? 138 PHE D CD1 1 
ATOM   1055 C CD2 . PHE A 1 138 ? 15.529 18.449 25.852 1.00 9.39  ? 138 PHE D CD2 1 
ATOM   1056 C CE1 . PHE A 1 138 ? 18.271 18.629 26.013 1.00 11.06 ? 138 PHE D CE1 1 
ATOM   1057 C CE2 . PHE A 1 138 ? 16.321 17.451 25.313 1.00 11.07 ? 138 PHE D CE2 1 
ATOM   1058 C CZ  . PHE A 1 138 ? 17.694 17.546 25.392 1.00 10.70 ? 138 PHE D CZ  1 
ATOM   1059 N N   . MET A 1 139 ? 15.446 22.973 29.579 1.00 7.82  ? 139 MET D N   1 
ATOM   1060 C CA  . MET A 1 139 ? 15.028 24.279 30.044 1.00 8.65  ? 139 MET D CA  1 
ATOM   1061 C C   . MET A 1 139 ? 15.783 25.413 29.356 1.00 7.93  ? 139 MET D C   1 
ATOM   1062 O O   . MET A 1 139 ? 16.937 25.248 28.938 1.00 7.95  ? 139 MET D O   1 
ATOM   1063 C CB  . MET A 1 139 ? 15.201 24.419 31.559 1.00 10.80 ? 139 MET D CB  1 
ATOM   1064 C CG  . MET A 1 139 ? 14.755 23.253 32.419 1.00 12.93 ? 139 MET D CG  1 
ATOM   1065 S SD  . MET A 1 139 ? 14.132 23.741 34.053 1.00 14.88 ? 139 MET D SD  1 
ATOM   1066 C CE  . MET A 1 139 ? 13.329 22.230 34.573 1.00 17.30 ? 139 MET D CE  1 
ATOM   1067 N N   . VAL A 1 140 ? 15.129 26.559 29.235 1.00 7.77  ? 140 VAL D N   1 
ATOM   1068 C CA  . VAL A 1 140 ? 15.698 27.754 28.618 1.00 7.89  ? 140 VAL D CA  1 
ATOM   1069 C C   . VAL A 1 140 ? 16.488 28.583 29.618 1.00 8.60  ? 140 VAL D C   1 
ATOM   1070 O O   . VAL A 1 140 ? 16.041 28.857 30.749 1.00 9.26  ? 140 VAL D O   1 
ATOM   1071 C CB  . VAL A 1 140 ? 14.557 28.611 28.028 1.00 8.56  ? 140 VAL D CB  1 
ATOM   1072 C CG1 . VAL A 1 140 ? 15.058 29.903 27.417 1.00 9.47  ? 140 VAL D CG1 1 
ATOM   1073 C CG2 . VAL A 1 140 ? 13.804 27.778 26.993 1.00 9.48  ? 140 VAL D CG2 1 
ATOM   1074 N N   . PHE A 1 141 ? 17.719 28.925 29.266 1.00 8.02  ? 141 PHE D N   1 
ATOM   1075 C CA  . PHE A 1 141 ? 18.620 29.727 30.069 1.00 8.13  ? 141 PHE D CA  1 
ATOM   1076 C C   . PHE A 1 141 ? 18.880 31.071 29.404 1.00 8.15  ? 141 PHE D C   1 
ATOM   1077 O O   . PHE A 1 141 ? 19.083 31.150 28.197 1.00 9.52  ? 141 PHE D O   1 
ATOM   1078 C CB  . PHE A 1 141 ? 19.959 29.008 30.272 1.00 9.03  ? 141 PHE D CB  1 
ATOM   1079 C CG  . PHE A 1 141 ? 19.893 27.921 31.306 1.00 9.69  ? 141 PHE D CG  1 
ATOM   1080 C CD1 . PHE A 1 141 ? 19.183 26.746 31.092 1.00 9.62  ? 141 PHE D CD1 1 
ATOM   1081 C CD2 . PHE A 1 141 ? 20.550 28.098 32.515 1.00 10.35 ? 141 PHE D CD2 1 
ATOM   1082 C CE1 . PHE A 1 141 ? 19.119 25.763 32.061 1.00 10.19 ? 141 PHE D CE1 1 
ATOM   1083 C CE2 . PHE A 1 141 ? 20.495 27.110 33.483 1.00 12.37 ? 141 PHE D CE2 1 
ATOM   1084 C CZ  . PHE A 1 141 ? 19.787 25.940 33.264 1.00 11.53 ? 141 PHE D CZ  1 
ATOM   1085 N N   . THR A 1 142 ? 18.855 32.129 30.220 1.00 8.54  ? 142 THR D N   1 
ATOM   1086 C CA  . THR A 1 142 ? 19.151 33.473 29.746 1.00 8.76  ? 142 THR D CA  1 
ATOM   1087 C C   . THR A 1 142 ? 20.400 34.012 30.452 1.00 9.19  ? 142 THR D C   1 
ATOM   1088 O O   . THR A 1 142 ? 20.997 33.304 31.257 1.00 10.32 ? 142 THR D O   1 
ATOM   1089 C CB  . THR A 1 142 ? 17.967 34.438 29.922 1.00 8.67  ? 142 THR D CB  1 
ATOM   1090 O OG1 . THR A 1 142 ? 17.479 34.346 31.262 1.00 9.92  ? 142 THR D OG1 1 
ATOM   1091 C CG2 . THR A 1 142 ? 16.855 34.055 28.939 1.00 8.93  ? 142 THR D CG2 1 
ATOM   1092 N N   . TYR A 1 143 ? 20.786 35.239 30.124 1.00 10.14 ? 143 TYR D N   1 
ATOM   1093 C CA  . TYR A 1 143 ? 21.962 35.871 30.719 1.00 11.79 ? 143 TYR D CA  1 
ATOM   1094 C C   . TYR A 1 143 ? 23.219 35.033 30.556 1.00 12.81 ? 143 TYR D C   1 
ATOM   1095 O O   . TYR A 1 143 ? 23.839 34.644 31.542 1.00 13.21 ? 143 TYR D O   1 
ATOM   1096 C CB  . TYR A 1 143 ? 21.711 36.229 32.202 1.00 11.76 ? 143 TYR D CB  1 
ATOM   1097 C CG  . TYR A 1 143 ? 20.618 37.278 32.317 1.00 11.01 ? 143 TYR D CG  1 
ATOM   1098 C CD1 . TYR A 1 143 ? 20.903 38.628 32.172 1.00 12.00 ? 143 TYR D CD1 1 
ATOM   1099 C CD2 . TYR A 1 143 ? 19.290 36.912 32.534 1.00 10.53 ? 143 TYR D CD2 1 
ATOM   1100 C CE1 . TYR A 1 143 ? 19.915 39.590 32.241 1.00 12.21 ? 143 TYR D CE1 1 
ATOM   1101 C CE2 . TYR A 1 143 ? 18.302 37.869 32.614 1.00 12.59 ? 143 TYR D CE2 1 
ATOM   1102 C CZ  . TYR A 1 143 ? 18.618 39.197 32.465 1.00 12.93 ? 143 TYR D CZ  1 
ATOM   1103 O OH  . TYR A 1 143 ? 17.595 40.124 32.535 1.00 14.89 ? 143 TYR D OH  1 
ATOM   1104 N N   . SER A 1 144 ? 23.570 34.707 29.317 1.00 14.12 ? 144 SER D N   1 
ATOM   1105 C CA  . SER A 1 144 ? 24.771 33.906 29.047 1.00 14.60 ? 144 SER D CA  1 
ATOM   1106 C C   . SER A 1 144 ? 24.829 32.627 29.854 1.00 16.49 ? 144 SER D C   1 
ATOM   1107 O O   . SER A 1 144 ? 25.849 32.256 30.447 1.00 16.32 ? 144 SER D O   1 
ATOM   1108 C CB  . SER A 1 144 ? 26.030 34.758 29.315 1.00 16.10 ? 144 SER D CB  1 
ATOM   1109 O OG  . SER A 1 144 ? 26.054 35.868 28.441 1.00 18.35 ? 144 SER D OG  1 
ATOM   1110 N N   . GLY A 1 145 ? 23.735 31.860 29.883 1.00 15.92 ? 145 GLY D N   1 
ATOM   1111 C CA  . GLY A 1 145 ? 23.634 30.616 30.606 1.00 16.13 ? 145 GLY D CA  1 
ATOM   1112 C C   . GLY A 1 145 ? 23.661 30.667 32.108 1.00 16.51 ? 145 GLY D C   1 
ATOM   1113 O O   . GLY A 1 145 ? 23.786 29.634 32.780 1.00 17.07 ? 145 GLY D O   1 
ATOM   1114 N N   . LYS A 1 146 ? 23.455 31.841 32.717 1.00 16.68 ? 146 LYS D N   1 
ATOM   1115 C CA  . LYS A 1 146 ? 23.496 31.922 34.172 1.00 17.24 ? 146 LYS D CA  1 
ATOM   1116 C C   . LYS A 1 146 ? 22.128 31.963 34.824 1.00 16.77 ? 146 LYS D C   1 
ATOM   1117 O O   . LYS A 1 146 ? 22.017 31.847 36.057 1.00 17.69 ? 146 LYS D O   1 
ATOM   1118 C CB  . LYS A 1 146 ? 24.340 33.107 34.635 1.00 18.84 ? 146 LYS D CB  1 
ATOM   1119 C CG  . LYS A 1 146 ? 25.837 32.922 34.481 1.00 20.46 ? 146 LYS D CG  1 
ATOM   1120 C CD  . LYS A 1 146 ? 26.403 31.664 35.114 1.00 21.29 ? 146 LYS D CD  1 
ATOM   1121 C CE  . LYS A 1 146 ? 26.276 31.602 36.623 1.00 22.29 ? 146 LYS D CE  1 
ATOM   1122 N NZ  . LYS A 1 146 ? 27.144 30.543 37.233 1.00 22.74 ? 146 LYS D NZ  1 
ATOM   1123 N N   . LYS A 1 147 ? 21.068 32.124 34.041 1.00 14.69 ? 147 LYS D N   1 
ATOM   1124 C CA  . LYS A 1 147 ? 19.738 32.139 34.628 1.00 12.92 ? 147 LYS D CA  1 
ATOM   1125 C C   . LYS A 1 147 ? 18.850 31.033 34.052 1.00 12.63 ? 147 LYS D C   1 
ATOM   1126 O O   . LYS A 1 147 ? 18.517 31.077 32.868 1.00 11.83 ? 147 LYS D O   1 
ATOM   1127 C CB  . LYS A 1 147 ? 19.026 33.482 34.470 1.00 12.99 ? 147 LYS D CB  1 
ATOM   1128 C CG  . LYS A 1 147 ? 17.613 33.467 35.041 1.00 13.92 ? 147 LYS D CG  1 
ATOM   1129 C CD  . LYS A 1 147 ? 16.892 34.776 34.758 1.00 15.12 ? 147 LYS D CD  1 
ATOM   1130 C CE  . LYS A 1 147 ? 15.554 34.770 35.498 1.00 16.04 ? 147 LYS D CE  1 
ATOM   1131 N NZ  . LYS A 1 147 ? 14.792 36.016 35.167 1.00 18.31 ? 147 LYS D NZ  1 
ATOM   1132 N N   . ASN A 1 148 ? 18.466 30.098 34.913 1.00 12.22 ? 148 ASN D N   1 
ATOM   1133 C CA  . ASN A 1 148 ? 17.466 29.102 34.520 1.00 11.84 ? 148 ASN D CA  1 
ATOM   1134 C C   . ASN A 1 148 ? 16.138 29.839 34.578 1.00 12.63 ? 148 ASN D C   1 
ATOM   1135 O O   . ASN A 1 148 ? 15.682 30.190 35.680 1.00 14.07 ? 148 ASN D O   1 
ATOM   1136 C CB  . ASN A 1 148 ? 17.477 27.928 35.505 1.00 12.10 ? 148 ASN D CB  1 
ATOM   1137 C CG  . ASN A 1 148 ? 16.506 26.822 35.152 1.00 12.90 ? 148 ASN D CG  1 
ATOM   1138 O OD1 . ASN A 1 148 ? 16.617 25.689 35.636 1.00 13.69 ? 148 ASN D OD1 1 
ATOM   1139 N ND2 . ASN A 1 148 ? 15.555 27.127 34.284 1.00 12.04 ? 148 ASN D ND2 1 
ATOM   1140 N N   . THR A 1 149 ? 15.485 30.104 33.458 1.00 10.83 ? 149 THR D N   1 
ATOM   1141 C CA  . THR A 1 149 ? 14.227 30.832 33.443 1.00 11.72 ? 149 THR D CA  1 
ATOM   1142 C C   . THR A 1 149 ? 13.052 30.025 33.985 1.00 12.57 ? 149 THR D C   1 
ATOM   1143 O O   . THR A 1 149 ? 11.990 30.620 34.201 1.00 14.40 ? 149 THR D O   1 
ATOM   1144 C CB  . THR A 1 149 ? 13.844 31.189 31.981 1.00 10.98 ? 149 THR D CB  1 
ATOM   1145 O OG1 . THR A 1 149 ? 13.635 29.964 31.257 1.00 9.81  ? 149 THR D OG1 1 
ATOM   1146 C CG2 . THR A 1 149 ? 14.954 32.015 31.352 1.00 12.04 ? 149 THR D CG2 1 
ATOM   1147 N N   . GLY A 1 150 ? 13.185 28.705 34.056 1.00 13.44 ? 150 GLY D N   1 
ATOM   1148 C CA  . GLY A 1 150 ? 12.082 27.849 34.475 1.00 14.37 ? 150 GLY D CA  1 
ATOM   1149 C C   . GLY A 1 150 ? 11.135 27.534 33.321 1.00 13.78 ? 150 GLY D C   1 
ATOM   1150 O O   . GLY A 1 150 ? 10.127 26.844 33.492 1.00 15.29 ? 150 GLY D O   1 
ATOM   1151 N N   . ILE A 1 151 ? 11.397 28.080 32.138 1.00 11.08 ? 151 ILE D N   1 
ATOM   1152 C CA  . ILE A 1 151 ? 10.582 27.864 30.957 1.00 11.19 ? 151 ILE D CA  1 
ATOM   1153 C C   . ILE A 1 151 ? 11.109 26.625 30.238 1.00 10.11 ? 151 ILE D C   1 
ATOM   1154 O O   . ILE A 1 151 ? 12.308 26.473 29.997 1.00 9.25  ? 151 ILE D O   1 
ATOM   1155 C CB  . ILE A 1 151 ? 10.614 29.065 30.000 1.00 10.99 ? 151 ILE D CB  1 
ATOM   1156 C CG1 . ILE A 1 151 ? 10.124 30.337 30.706 1.00 11.72 ? 151 ILE D CG1 1 
ATOM   1157 C CG2 . ILE A 1 151 ? 9.763  28.799 28.763 1.00 11.40 ? 151 ILE D CG2 1 
ATOM   1158 C CD1 . ILE A 1 151 ? 10.412 31.613 29.920 1.00 13.37 ? 151 ILE D CD1 1 
ATOM   1159 N N   . LEU A 1 152 ? 10.216 25.688 29.947 1.00 9.22  ? 152 LEU D N   1 
ATOM   1160 C CA  . LEU A 1 152 ? 10.608 24.472 29.249 1.00 8.67  ? 152 LEU D CA  1 
ATOM   1161 C C   . LEU A 1 152 ? 10.920 24.831 27.789 1.00 8.59  ? 152 LEU D C   1 
ATOM   1162 O O   . LEU A 1 152 ? 10.180 25.585 27.142 1.00 8.61  ? 152 LEU D O   1 
ATOM   1163 C CB  . LEU A 1 152 ? 9.478  23.436 29.287 1.00 10.28 ? 152 LEU D CB  1 
ATOM   1164 C CG  . LEU A 1 152 ? 9.227  22.787 30.655 1.00 11.67 ? 152 LEU D CG  1 
ATOM   1165 C CD1 . LEU A 1 152 ? 7.854  22.121 30.668 1.00 13.65 ? 152 LEU D CD1 1 
ATOM   1166 C CD2 . LEU A 1 152 ? 10.309 21.757 30.940 1.00 13.41 ? 152 LEU D CD2 1 
ATOM   1167 N N   . LEU A 1 153 ? 11.994 24.242 27.291 1.00 7.50  ? 153 LEU D N   1 
ATOM   1168 C CA  . LEU A 1 153 ? 12.360 24.431 25.888 1.00 7.82  ? 153 LEU D CA  1 
ATOM   1169 C C   . LEU A 1 153 ? 11.190 24.118 24.964 1.00 8.14  ? 153 LEU D C   1 
ATOM   1170 O O   . LEU A 1 153 ? 10.945 24.850 24.001 1.00 8.24  ? 153 LEU D O   1 
ATOM   1171 C CB  . LEU A 1 153 ? 13.532 23.495 25.588 1.00 7.33  ? 153 LEU D CB  1 
ATOM   1172 C CG  . LEU A 1 153 ? 14.011 23.523 24.129 1.00 6.82  ? 153 LEU D CG  1 
ATOM   1173 C CD1 . LEU A 1 153 ? 14.475 24.921 23.713 1.00 8.39  ? 153 LEU D CD1 1 
ATOM   1174 C CD2 . LEU A 1 153 ? 15.138 22.516 23.961 1.00 8.63  ? 153 LEU D CD2 1 
ATOM   1175 N N   . ARG A 1 154 ? 10.416 23.066 25.244 1.00 8.38  ? 154 ARG D N   1 
ATOM   1176 C CA  . ARG A 1 154 ? 9.275  22.712 24.411 1.00 9.49  ? 154 ARG D CA  1 
ATOM   1177 C C   . ARG A 1 154 ? 8.301  23.866 24.248 1.00 9.61  ? 154 ARG D C   1 
ATOM   1178 O O   . ARG A 1 154 ? 7.876  24.197 23.131 1.00 11.20 ? 154 ARG D O   1 
ATOM   1179 C CB  . ARG A 1 154 ? 8.563  21.502 25.050 1.00 10.53 ? 154 ARG D CB  1 
ATOM   1180 C CG  . ARG A 1 154 ? 7.306  21.082 24.310 1.00 11.27 ? 154 ARG D CG  1 
ATOM   1181 C CD  . ARG A 1 154 ? 6.398  20.237 25.212 1.00 12.25 ? 154 ARG D CD  1 
ATOM   1182 N NE  . ARG A 1 154 ? 5.891  21.031 26.316 1.00 12.52 ? 154 ARG D NE  1 
ATOM   1183 C CZ  . ARG A 1 154 ? 5.676  20.619 27.562 1.00 13.07 ? 154 ARG D CZ  1 
ATOM   1184 N NH1 . ARG A 1 154 ? 5.906  19.365 27.922 1.00 13.78 ? 154 ARG D NH1 1 
ATOM   1185 N NH2 . ARG A 1 154 ? 5.215  21.507 28.426 1.00 15.55 ? 154 ARG D NH2 1 
ATOM   1186 N N   . ASP A 1 155 ? 7.952  24.516 25.357 1.00 10.12 ? 155 ASP D N   1 
ATOM   1187 C CA  . ASP A 1 155 ? 6.984  25.603 25.334 1.00 9.55  ? 155 ASP D CA  1 
ATOM   1188 C C   . ASP A 1 155 ? 7.519  26.855 24.656 1.00 9.32  ? 155 ASP D C   1 
ATOM   1189 O O   . ASP A 1 155 ? 6.812  27.530 23.907 1.00 9.63  ? 155 ASP D O   1 
ATOM   1190 C CB  . ASP A 1 155 ? 6.546  25.939 26.768 1.00 10.96 ? 155 ASP D CB  1 
ATOM   1191 C CG  . ASP A 1 155 ? 5.792  24.799 27.434 1.00 12.65 ? 155 ASP D CG  1 
ATOM   1192 O OD1 . ASP A 1 155 ? 5.151  24.016 26.700 1.00 13.14 ? 155 ASP D OD1 1 
ATOM   1193 O OD2 . ASP A 1 155 ? 5.921  24.712 28.676 1.00 13.66 ? 155 ASP D OD2 1 
ATOM   1194 N N   . TRP A 1 156 ? 8.800  27.174 24.894 1.00 8.40  ? 156 TRP D N   1 
ATOM   1195 C CA  . TRP A 1 156 ? 9.390  28.377 24.287 1.00 8.33  ? 156 TRP D CA  1 
ATOM   1196 C C   . TRP A 1 156 ? 9.568  28.229 22.779 1.00 7.90  ? 156 TRP D C   1 
ATOM   1197 O O   . TRP A 1 156 ? 9.267  29.187 22.053 1.00 8.01  ? 156 TRP D O   1 
ATOM   1198 C CB  . TRP A 1 156 ? 10.713 28.700 24.985 1.00 7.46  ? 156 TRP D CB  1 
ATOM   1199 C CG  . TRP A 1 156 ? 11.346 29.989 24.559 1.00 7.10  ? 156 TRP D CG  1 
ATOM   1200 C CD1 . TRP A 1 156 ? 12.655 30.135 24.181 1.00 7.88  ? 156 TRP D CD1 1 
ATOM   1201 C CD2 . TRP A 1 156 ? 10.763 31.292 24.451 1.00 7.60  ? 156 TRP D CD2 1 
ATOM   1202 N NE1 . TRP A 1 156 ? 12.920 31.434 23.863 1.00 7.63  ? 156 TRP D NE1 1 
ATOM   1203 C CE2 . TRP A 1 156 ? 11.772 32.177 24.009 1.00 7.87  ? 156 TRP D CE2 1 
ATOM   1204 C CE3 . TRP A 1 156 ? 9.485  31.814 24.686 1.00 8.58  ? 156 TRP D CE3 1 
ATOM   1205 C CZ2 . TRP A 1 156 ? 11.563 33.536 23.787 1.00 8.45  ? 156 TRP D CZ2 1 
ATOM   1206 C CZ3 . TRP A 1 156 ? 9.265  33.162 24.459 1.00 9.65  ? 156 TRP D CZ3 1 
ATOM   1207 C CH2 . TRP A 1 156 ? 10.302 34.014 24.013 1.00 9.62  ? 156 TRP D CH2 1 
ATOM   1208 N N   . VAL A 1 157 ? 9.961  27.049 22.298 1.00 7.74  ? 157 VAL D N   1 
ATOM   1209 C CA  . VAL A 1 157 ? 10.057 26.852 20.848 1.00 8.13  ? 157 VAL D CA  1 
ATOM   1210 C C   . VAL A 1 157 ? 8.723  27.149 20.175 1.00 8.77  ? 157 VAL D C   1 
ATOM   1211 O O   . VAL A 1 157 ? 8.644  27.853 19.158 1.00 8.22  ? 157 VAL D O   1 
ATOM   1212 C CB  . VAL A 1 157 ? 10.524 25.434 20.493 1.00 7.60  ? 157 VAL D CB  1 
ATOM   1213 C CG1 . VAL A 1 157 ? 10.332 25.118 19.009 1.00 8.89  ? 157 VAL D CG1 1 
ATOM   1214 C CG2 . VAL A 1 157 ? 12.007 25.297 20.845 1.00 8.18  ? 157 VAL D CG2 1 
ATOM   1215 N N   . VAL A 1 158 ? 7.645  26.560 20.701 1.00 9.51  ? 158 VAL D N   1 
ATOM   1216 C CA  . VAL A 1 158 ? 6.322  26.780 20.121 1.00 10.24 ? 158 VAL D CA  1 
ATOM   1217 C C   . VAL A 1 158 ? 5.929  28.245 20.156 1.00 10.35 ? 158 VAL D C   1 
ATOM   1218 O O   . VAL A 1 158 ? 5.440  28.823 19.176 1.00 9.92  ? 158 VAL D O   1 
ATOM   1219 C CB  . VAL A 1 158 ? 5.307  25.872 20.845 1.00 10.74 ? 158 VAL D CB  1 
ATOM   1220 C CG1 . VAL A 1 158 ? 3.881  26.194 20.404 1.00 11.39 ? 158 VAL D CG1 1 
ATOM   1221 C CG2 . VAL A 1 158 ? 5.619  24.413 20.539 1.00 11.65 ? 158 VAL D CG2 1 
ATOM   1222 N N   . GLU A 1 159 ? 6.214  28.929 21.271 1.00 9.34  ? 159 GLU D N   1 
ATOM   1223 C CA  . GLU A 1 159 ? 5.894  30.347 21.388 1.00 9.67  ? 159 GLU D CA  1 
ATOM   1224 C C   . GLU A 1 159 ? 6.684  31.198 20.410 1.00 9.12  ? 159 GLU D C   1 
ATOM   1225 O O   . GLU A 1 159 ? 6.191  32.157 19.806 1.00 9.18  ? 159 GLU D O   1 
ATOM   1226 C CB  . GLU A 1 159 ? 6.157  30.822 22.823 1.00 10.48 ? 159 GLU D CB  1 
ATOM   1227 C CG  . GLU A 1 159 ? 5.730  32.266 23.057 1.00 12.58 ? 159 GLU D CG  1 
ATOM   1228 C CD  . GLU A 1 159 ? 4.227  32.457 22.974 1.00 13.85 ? 159 GLU D CD  1 
ATOM   1229 O OE1 . GLU A 1 159 ? 3.468  31.567 23.428 1.00 16.48 ? 159 GLU D OE1 1 
ATOM   1230 O OE2 . GLU A 1 159 ? 3.810  33.523 22.484 1.00 14.85 ? 159 GLU D OE2 1 
ATOM   1231 N N   . VAL A 1 160 ? 7.978  30.871 20.225 1.00 8.49  ? 160 VAL D N   1 
ATOM   1232 C CA  . VAL A 1 160 ? 8.820  31.660 19.317 1.00 9.16  ? 160 VAL D CA  1 
ATOM   1233 C C   . VAL A 1 160 ? 8.302  31.615 17.894 1.00 8.22  ? 160 VAL D C   1 
ATOM   1234 O O   . VAL A 1 160 ? 8.258  32.653 17.216 1.00 8.54  ? 160 VAL D O   1 
ATOM   1235 C CB  . VAL A 1 160 ? 10.265 31.150 19.448 1.00 8.98  ? 160 VAL D CB  1 
ATOM   1236 C CG1 . VAL A 1 160 ? 11.144 31.538 18.268 1.00 10.34 ? 160 VAL D CG1 1 
ATOM   1237 C CG2 . VAL A 1 160 ? 10.856 31.660 20.764 1.00 8.95  ? 160 VAL D CG2 1 
ATOM   1238 N N   . GLU A 1 161 ? 7.851  30.430 17.458 1.00 8.57  ? 161 GLU D N   1 
ATOM   1239 C CA  . GLU A 1 161 ? 7.265  30.352 16.120 1.00 9.57  ? 161 GLU D CA  1 
ATOM   1240 C C   . GLU A 1 161 ? 5.954  31.131 16.076 1.00 9.85  ? 161 GLU D C   1 
ATOM   1241 O O   . GLU A 1 161 ? 5.728  31.893 15.136 1.00 9.83  ? 161 GLU D O   1 
ATOM   1242 C CB  . GLU A 1 161 ? 7.096  28.911 15.652 1.00 10.44 ? 161 GLU D CB  1 
ATOM   1243 C CG  . GLU A 1 161 ? 6.443  28.854 14.272 1.00 11.33 ? 161 GLU D CG  1 
ATOM   1244 C CD  . GLU A 1 161 ? 6.396  27.475 13.667 1.00 13.05 ? 161 GLU D CD  1 
ATOM   1245 O OE1 . GLU A 1 161 ? 7.134  26.562 14.058 1.00 12.57 ? 161 GLU D OE1 1 
ATOM   1246 O OE2 . GLU A 1 161 ? 5.577  27.283 12.730 1.00 16.07 ? 161 GLU D OE2 1 
ATOM   1247 N N   . LYS A 1 162 ? 5.122  31.027 17.117 1.00 9.49  ? 162 LYS D N   1 
ATOM   1248 C CA  . LYS A 1 162 ? 3.868  31.786 17.141 1.00 11.04 ? 162 LYS D CA  1 
ATOM   1249 C C   . LYS A 1 162 ? 4.089  33.279 17.064 1.00 10.72 ? 162 LYS D C   1 
ATOM   1250 O O   . LYS A 1 162 ? 3.326  34.002 16.408 1.00 12.11 ? 162 LYS D O   1 
ATOM   1251 C CB  . LYS A 1 162 ? 3.162  31.442 18.443 1.00 12.10 ? 162 LYS D CB  1 
ATOM   1252 C CG  . LYS A 1 162 ? 1.738  31.913 18.662 1.00 16.91 ? 162 LYS D CG  1 
ATOM   1253 C CD  . LYS A 1 162 ? 1.133  31.105 19.819 1.00 19.78 ? 162 LYS D CD  1 
ATOM   1254 C CE  . LYS A 1 162 ? 1.214  29.607 19.563 1.00 21.96 ? 162 LYS D CE  1 
ATOM   1255 N NZ  . LYS A 1 162 ? 0.708  28.750 20.666 1.00 24.12 ? 162 LYS D NZ  1 
ATOM   1256 N N   . ARG A 1 163 ? 5.171  33.788 17.651 1.00 9.64  ? 163 ARG D N   1 
ATOM   1257 C CA  . ARG A 1 163 ? 5.510  35.197 17.656 1.00 10.28 ? 163 ARG D CA  1 
ATOM   1258 C C   . ARG A 1 163 ? 6.089  35.686 16.333 1.00 10.25 ? 163 ARG D C   1 
ATOM   1259 O O   . ARG A 1 163 ? 6.251  36.895 16.169 1.00 11.57 ? 163 ARG D O   1 
ATOM   1260 C CB  . ARG A 1 163 ? 6.485  35.507 18.795 1.00 10.41 ? 163 ARG D CB  1 
ATOM   1261 C CG  . ARG A 1 163 ? 5.886  35.247 20.178 1.00 10.99 ? 163 ARG D CG  1 
ATOM   1262 C CD  . ARG A 1 163 ? 4.936  36.376 20.565 1.00 12.28 ? 163 ARG D CD  1 
ATOM   1263 N NE  . ARG A 1 163 ? 4.413  36.154 21.913 1.00 13.17 ? 163 ARG D NE  1 
ATOM   1264 C CZ  . ARG A 1 163 ? 3.650  37.047 22.556 1.00 14.54 ? 163 ARG D CZ  1 
ATOM   1265 N NH1 . ARG A 1 163 ? 3.311  38.198 22.002 1.00 13.74 ? 163 ARG D NH1 1 
ATOM   1266 N NH2 . ARG A 1 163 ? 3.253  36.724 23.786 1.00 15.46 ? 163 ARG D NH2 1 
ATOM   1267 N N   . GLY A 1 164 ? 6.366  34.792 15.384 1.00 9.58  ? 164 GLY D N   1 
ATOM   1268 C CA  . GLY A 1 164 ? 6.791  35.258 14.072 1.00 10.80 ? 164 GLY D CA  1 
ATOM   1269 C C   . GLY A 1 164 ? 8.275  35.201 13.807 1.00 9.74  ? 164 GLY D C   1 
ATOM   1270 O O   . GLY A 1 164 ? 8.706  35.830 12.834 1.00 10.41 ? 164 GLY D O   1 
ATOM   1271 N N   . ALA A 1 165 ? 9.060  34.489 14.604 1.00 8.98  ? 165 ALA D N   1 
ATOM   1272 C CA  . ALA A 1 165 ? 10.486 34.401 14.309 1.00 8.55  ? 165 ALA D CA  1 
ATOM   1273 C C   . ALA A 1 165 ? 10.711 33.745 12.947 1.00 8.82  ? 165 ALA D C   1 
ATOM   1274 O O   . ALA A 1 165 ? 9.932  32.917 12.471 1.00 9.54  ? 165 ALA D O   1 
ATOM   1275 C CB  . ALA A 1 165 ? 11.182 33.574 15.377 1.00 8.61  ? 165 ALA D CB  1 
ATOM   1276 N N   . GLY A 1 166 ? 11.854 34.092 12.362 1.00 8.64  ? 166 GLY D N   1 
ATOM   1277 C CA  . GLY A 1 166 ? 12.214 33.486 11.073 1.00 8.94  ? 166 GLY D CA  1 
ATOM   1278 C C   . GLY A 1 166 ? 13.009 32.211 11.242 1.00 8.56  ? 166 GLY D C   1 
ATOM   1279 O O   . GLY A 1 166 ? 12.900 31.290 10.419 1.00 8.32  ? 166 GLY D O   1 
ATOM   1280 N N   . GLU A 1 167 ? 13.840 32.131 12.277 1.00 8.08  ? 167 GLU D N   1 
ATOM   1281 C CA  . GLU A 1 167 ? 14.739 31.002 12.472 1.00 8.34  ? 167 GLU D CA  1 
ATOM   1282 C C   . GLU A 1 167 ? 15.047 30.879 13.966 1.00 7.17  ? 167 GLU D C   1 
ATOM   1283 O O   . GLU A 1 167 ? 14.934 31.872 14.705 1.00 7.77  ? 167 GLU D O   1 
ATOM   1284 C CB  . GLU A 1 167 ? 16.080 31.197 11.761 1.00 10.70 ? 167 GLU D CB  1 
ATOM   1285 C CG  . GLU A 1 167 ? 16.147 31.133 10.247 1.00 12.86 ? 167 GLU D CG  1 
ATOM   1286 C CD  . GLU A 1 167 ? 17.620 31.200 9.841  1.00 13.35 ? 167 GLU D CD  1 
ATOM   1287 O OE1 . GLU A 1 167 ? 18.109 32.341 9.783  1.00 13.47 ? 167 GLU D OE1 1 
ATOM   1288 O OE2 . GLU A 1 167 ? 18.247 30.148 9.626  1.00 12.91 ? 167 GLU D OE2 1 
ATOM   1289 N N   . ILE A 1 168 ? 15.416 29.666 14.360 1.00 7.19  ? 168 ILE D N   1 
ATOM   1290 C CA  . ILE A 1 168 ? 15.844 29.436 15.742 1.00 7.83  ? 168 ILE D CA  1 
ATOM   1291 C C   . ILE A 1 168 ? 17.321 29.054 15.755 1.00 7.43  ? 168 ILE D C   1 
ATOM   1292 O O   . ILE A 1 168 ? 17.708 28.117 15.029 1.00 8.09  ? 168 ILE D O   1 
ATOM   1293 C CB  . ILE A 1 168 ? 14.994 28.347 16.422 1.00 8.20  ? 168 ILE D CB  1 
ATOM   1294 C CG1 . ILE A 1 168 ? 13.580 28.853 16.709 1.00 9.06  ? 168 ILE D CG1 1 
ATOM   1295 C CG2 . ILE A 1 168 ? 15.632 27.908 17.739 1.00 9.06  ? 168 ILE D CG2 1 
ATOM   1296 C CD1 . ILE A 1 168 ? 12.557 27.784 17.028 1.00 9.11  ? 168 ILE D CD1 1 
ATOM   1297 N N   . LEU A 1 169 ? 18.121 29.736 16.554 1.00 7.03  ? 169 LEU D N   1 
ATOM   1298 C CA  . LEU A 1 169 ? 19.538 29.403 16.730 1.00 7.76  ? 169 LEU D CA  1 
ATOM   1299 C C   . LEU A 1 169 ? 19.596 28.644 18.059 1.00 7.16  ? 169 LEU D C   1 
ATOM   1300 O O   . LEU A 1 169 ? 19.478 29.262 19.130 1.00 7.58  ? 169 LEU D O   1 
ATOM   1301 C CB  . LEU A 1 169 ? 20.380 30.669 16.706 1.00 7.43  ? 169 LEU D CB  1 
ATOM   1302 C CG  . LEU A 1 169 ? 21.887 30.524 16.527 1.00 10.27 ? 169 LEU D CG  1 
ATOM   1303 C CD1 . LEU A 1 169 ? 22.515 31.896 16.253 1.00 10.74 ? 169 LEU D CD1 1 
ATOM   1304 C CD2 . LEU A 1 169 ? 22.580 29.913 17.721 1.00 11.85 ? 169 LEU D CD2 1 
ATOM   1305 N N   . LEU A 1 170 ? 19.719 27.337 17.970 1.00 7.06  ? 170 LEU D N   1 
ATOM   1306 C CA  . LEU A 1 170 ? 19.594 26.453 19.118 1.00 7.40  ? 170 LEU D CA  1 
ATOM   1307 C C   . LEU A 1 170 ? 20.958 26.054 19.650 1.00 8.07  ? 170 LEU D C   1 
ATOM   1308 O O   . LEU A 1 170 ? 21.656 25.246 19.040 1.00 7.71  ? 170 LEU D O   1 
ATOM   1309 C CB  . LEU A 1 170 ? 18.793 25.221 18.699 1.00 7.34  ? 170 LEU D CB  1 
ATOM   1310 C CG  . LEU A 1 170 ? 18.500 24.210 19.820 1.00 7.41  ? 170 LEU D CG  1 
ATOM   1311 C CD1 . LEU A 1 170 ? 17.483 24.747 20.810 1.00 9.11  ? 170 LEU D CD1 1 
ATOM   1312 C CD2 . LEU A 1 170 ? 17.990 22.923 19.176 1.00 9.52  ? 170 LEU D CD2 1 
ATOM   1313 N N   . THR A 1 171 ? 21.323 26.606 20.803 1.00 8.13  ? 171 THR D N   1 
ATOM   1314 C CA  . THR A 1 171 ? 22.628 26.339 21.381 1.00 8.86  ? 171 THR D CA  1 
ATOM   1315 C C   . THR A 1 171 ? 22.559 25.429 22.593 1.00 8.14  ? 171 THR D C   1 
ATOM   1316 O O   . THR A 1 171 ? 21.810 25.684 23.536 1.00 9.26  ? 171 THR D O   1 
ATOM   1317 C CB  . THR A 1 171 ? 23.328 27.642 21.839 1.00 8.89  ? 171 THR D CB  1 
ATOM   1318 O OG1 . THR A 1 171 ? 23.494 28.486 20.687 1.00 10.87 ? 171 THR D OG1 1 
ATOM   1319 C CG2 . THR A 1 171 ? 24.711 27.381 22.421 1.00 11.50 ? 171 THR D CG2 1 
ATOM   1320 N N   . SER A 1 172 ? 23.385 24.397 22.581 1.00 8.54  ? 172 SER D N   1 
ATOM   1321 C CA  . SER A 1 172 ? 23.523 23.536 23.751 1.00 8.23  ? 172 SER D CA  1 
ATOM   1322 C C   . SER A 1 172 ? 24.745 24.072 24.492 1.00 9.38  ? 172 SER D C   1 
ATOM   1323 O O   . SER A 1 172 ? 25.900 23.814 24.133 1.00 9.86  ? 172 SER D O   1 
ATOM   1324 C CB  . SER A 1 172 ? 23.672 22.081 23.359 1.00 9.39  ? 172 SER D CB  1 
ATOM   1325 O OG  . SER A 1 172 ? 23.844 21.291 24.541 1.00 10.31 ? 172 SER D OG  1 
ATOM   1326 N N   . ILE A 1 173 ? 24.502 24.838 25.550 1.00 10.69 ? 173 ILE D N   1 
ATOM   1327 C CA  . ILE A 1 173 ? 25.559 25.439 26.349 1.00 11.39 ? 173 ILE D CA  1 
ATOM   1328 C C   . ILE A 1 173 ? 26.552 24.387 26.830 1.00 10.32 ? 173 ILE D C   1 
ATOM   1329 O O   . ILE A 1 173 ? 27.770 24.592 26.787 1.00 10.47 ? 173 ILE D O   1 
ATOM   1330 C CB  . ILE A 1 173 ? 24.955 26.152 27.585 1.00 12.11 ? 173 ILE D CB  1 
ATOM   1331 C CG1 . ILE A 1 173 ? 24.072 27.329 27.144 1.00 12.38 ? 173 ILE D CG1 1 
ATOM   1332 C CG2 . ILE A 1 173 ? 26.052 26.605 28.540 1.00 12.12 ? 173 ILE D CG2 1 
ATOM   1333 C CD1 . ILE A 1 173 ? 23.183 27.852 28.271 1.00 14.34 ? 173 ILE D CD1 1 
ATOM   1334 N N   . ASP A 1 174 ? 26.067 23.216 27.232 1.00 9.42  ? 174 ASP D N   1 
ATOM   1335 C CA  . ASP A 1 174 ? 26.907 22.179 27.817 1.00 9.76  ? 174 ASP D CA  1 
ATOM   1336 C C   . ASP A 1 174 ? 27.793 21.448 26.827 1.00 9.61  ? 174 ASP D C   1 
ATOM   1337 O O   . ASP A 1 174 ? 28.684 20.697 27.259 1.00 10.94 ? 174 ASP D O   1 
ATOM   1338 C CB  . ASP A 1 174 ? 26.010 21.243 28.634 1.00 9.85  ? 174 ASP D CB  1 
ATOM   1339 C CG  . ASP A 1 174 ? 25.310 21.966 29.767 1.00 10.91 ? 174 ASP D CG  1 
ATOM   1340 O OD1 . ASP A 1 174 ? 25.763 23.051 30.174 1.00 10.86 ? 174 ASP D OD1 1 
ATOM   1341 O OD2 . ASP A 1 174 ? 24.269 21.458 30.268 1.00 11.62 ? 174 ASP D OD2 1 
ATOM   1342 N N   . ARG A 1 175 ? 27.580 21.665 25.521 1.00 9.72  ? 175 ARG D N   1 
ATOM   1343 C CA  . ARG A 1 175 ? 28.484 21.119 24.525 1.00 10.42 ? 175 ARG D CA  1 
ATOM   1344 C C   . ARG A 1 175 ? 29.323 22.208 23.867 1.00 9.97  ? 175 ARG D C   1 
ATOM   1345 O O   . ARG A 1 175 ? 30.332 21.934 23.218 1.00 9.57  ? 175 ARG D O   1 
ATOM   1346 C CB  . ARG A 1 175 ? 27.726 20.440 23.376 1.00 12.12 ? 175 ARG D CB  1 
ATOM   1347 C CG  . ARG A 1 175 ? 26.760 19.347 23.749 1.00 17.17 ? 175 ARG D CG  1 
ATOM   1348 C CD  . ARG A 1 175 ? 27.435 18.231 24.521 1.00 20.89 ? 175 ARG D CD  1 
ATOM   1349 N NE  A ARG A 1 175 ? 26.692 16.982 24.483 0.50 22.67 ? 175 ARG D NE  1 
ATOM   1350 N NE  B ARG A 1 175 ? 26.500 17.126 24.727 0.50 22.79 ? 175 ARG D NE  1 
ATOM   1351 C CZ  A ARG A 1 175 ? 26.633 16.152 23.451 0.50 22.84 ? 175 ARG D CZ  1 
ATOM   1352 C CZ  B ARG A 1 175 ? 25.409 17.156 25.477 0.50 23.29 ? 175 ARG D CZ  1 
ATOM   1353 N NH1 A ARG A 1 175 ? 27.291 16.420 22.331 0.50 23.43 ? 175 ARG D NH1 1 
ATOM   1354 N NH1 B ARG A 1 175 ? 25.071 18.257 26.142 0.50 24.29 ? 175 ARG D NH1 1 
ATOM   1355 N NH2 A ARG A 1 175 ? 25.915 15.043 23.543 0.50 23.27 ? 175 ARG D NH2 1 
ATOM   1356 N NH2 B ARG A 1 175 ? 24.631 16.086 25.582 0.50 23.13 ? 175 ARG D NH2 1 
ATOM   1357 N N   . ASP A 1 176 ? 28.914 23.464 23.995 1.00 9.96  ? 176 ASP D N   1 
ATOM   1358 C CA  . ASP A 1 176 ? 29.608 24.585 23.360 1.00 9.64  ? 176 ASP D CA  1 
ATOM   1359 C C   . ASP A 1 176 ? 31.077 24.641 23.698 1.00 9.65  ? 176 ASP D C   1 
ATOM   1360 O O   . ASP A 1 176 ? 31.485 24.635 24.863 1.00 10.53 ? 176 ASP D O   1 
ATOM   1361 C CB  . ASP A 1 176 ? 28.901 25.879 23.765 1.00 11.03 ? 176 ASP D CB  1 
ATOM   1362 C CG  . ASP A 1 176 ? 29.190 27.092 22.922 1.00 13.77 ? 176 ASP D CG  1 
ATOM   1363 O OD1 . ASP A 1 176 ? 30.104 27.102 22.084 1.00 15.52 ? 176 ASP D OD1 1 
ATOM   1364 O OD2 . ASP A 1 176 ? 28.479 28.120 23.104 1.00 16.53 ? 176 ASP D OD2 1 
ATOM   1365 N N   . GLY A 1 177 ? 31.933 24.620 22.681 1.00 8.91  ? 177 GLY D N   1 
ATOM   1366 C CA  . GLY A 1 177 ? 33.378 24.707 22.825 1.00 8.93  ? 177 GLY D CA  1 
ATOM   1367 C C   . GLY A 1 177 ? 34.033 23.382 23.195 1.00 8.67  ? 177 GLY D C   1 
ATOM   1368 O O   . GLY A 1 177 ? 35.272 23.359 23.300 1.00 9.73  ? 177 GLY D O   1 
ATOM   1369 N N   . THR A 1 178 ? 33.295 22.303 23.390 1.00 8.35  ? 178 THR D N   1 
ATOM   1370 C CA  . THR A 1 178 ? 33.878 21.052 23.849 1.00 9.49  ? 178 THR D CA  1 
ATOM   1371 C C   . THR A 1 178 ? 34.474 20.213 22.732 1.00 9.38  ? 178 THR D C   1 
ATOM   1372 O O   . THR A 1 178 ? 35.232 19.275 22.997 1.00 10.11 ? 178 THR D O   1 
ATOM   1373 C CB  . THR A 1 178 ? 32.876 20.161 24.617 1.00 9.67  ? 178 THR D CB  1 
ATOM   1374 O OG1 . THR A 1 178 ? 31.848 19.742 23.698 1.00 9.35  ? 178 THR D OG1 1 
ATOM   1375 C CG2 . THR A 1 178 ? 32.301 20.911 25.805 1.00 11.52 ? 178 THR D CG2 1 
ATOM   1376 N N   . LYS A 1 179 ? 34.080 20.447 21.490 1.00 9.41  ? 179 LYS D N   1 
ATOM   1377 C CA  . LYS A 1 179 ? 34.496 19.669 20.324 1.00 9.30  ? 179 LYS D CA  1 
ATOM   1378 C C   . LYS A 1 179 ? 34.017 18.225 20.453 1.00 9.21  ? 179 LYS D C   1 
ATOM   1379 O O   . LYS A 1 179 ? 34.514 17.354 19.729 1.00 11.34 ? 179 LYS D O   1 
ATOM   1380 C CB  . LYS A 1 179 ? 36.015 19.765 20.108 1.00 9.80  ? 179 LYS D CB  1 
ATOM   1381 C CG  . LYS A 1 179 ? 36.519 21.186 19.908 1.00 9.93  ? 179 LYS D CG  1 
ATOM   1382 C CD  . LYS A 1 179 ? 38.044 21.229 19.803 1.00 10.98 ? 179 LYS D CD  1 
ATOM   1383 C CE  . LYS A 1 179 ? 38.587 22.632 20.011 1.00 11.42 ? 179 LYS D CE  1 
ATOM   1384 N NZ  . LYS A 1 179 ? 40.072 22.653 19.929 1.00 12.55 ? 179 LYS D NZ  1 
ATOM   1385 N N   . SER A 1 180 ? 33.022 17.944 21.292 1.00 8.77  ? 180 SER D N   1 
ATOM   1386 C CA  . SER A 1 180 ? 32.537 16.603 21.542 1.00 10.48 ? 180 SER D CA  1 
ATOM   1387 C C   . SER A 1 180 ? 31.338 16.174 20.713 1.00 10.25 ? 180 SER D C   1 
ATOM   1388 O O   . SER A 1 180 ? 30.902 15.015 20.809 1.00 12.87 ? 180 SER D O   1 
ATOM   1389 C CB  . SER A 1 180 ? 32.203 16.421 23.037 1.00 11.18 ? 180 SER D CB  1 
ATOM   1390 O OG  . SER A 1 180 ? 31.039 17.134 23.427 1.00 12.04 ? 180 SER D OG  1 
ATOM   1391 N N   . GLY A 1 181 ? 30.839 17.088 19.893 1.00 9.49  ? 181 GLY D N   1 
ATOM   1392 C CA  . GLY A 1 181 ? 29.691 16.790 19.045 1.00 9.75  ? 181 GLY D CA  1 
ATOM   1393 C C   . GLY A 1 181 ? 28.509 17.694 19.383 1.00 9.34  ? 181 GLY D C   1 
ATOM   1394 O O   . GLY A 1 181 ? 28.422 18.263 20.475 1.00 9.79  ? 181 GLY D O   1 
ATOM   1395 N N   . TYR A 1 182 ? 27.692 17.947 18.371 1.00 8.84  ? 182 TYR D N   1 
ATOM   1396 C CA  . TYR A 1 182 ? 26.461 18.698 18.615 1.00 8.28  ? 182 TYR D CA  1 
ATOM   1397 C C   . TYR A 1 182 ? 25.561 17.871 19.528 1.00 8.39  ? 182 TYR D C   1 
ATOM   1398 O O   . TYR A 1 182 ? 25.653 16.635 19.666 1.00 8.50  ? 182 TYR D O   1 
ATOM   1399 C CB  . TYR A 1 182 ? 25.722 18.970 17.306 1.00 8.16  ? 182 TYR D CB  1 
ATOM   1400 C CG  . TYR A 1 182 ? 26.334 20.012 16.405 1.00 7.01  ? 182 TYR D CG  1 
ATOM   1401 C CD1 . TYR A 1 182 ? 26.090 21.372 16.608 1.00 7.98  ? 182 TYR D CD1 1 
ATOM   1402 C CD2 . TYR A 1 182 ? 27.155 19.645 15.352 1.00 7.74  ? 182 TYR D CD2 1 
ATOM   1403 C CE1 . TYR A 1 182 ? 26.639 22.327 15.777 1.00 7.65  ? 182 TYR D CE1 1 
ATOM   1404 C CE2 . TYR A 1 182 ? 27.716 20.588 14.512 1.00 7.74  ? 182 TYR D CE2 1 
ATOM   1405 C CZ  . TYR A 1 182 ? 27.463 21.932 14.731 1.00 7.79  ? 182 TYR D CZ  1 
ATOM   1406 O OH  . TYR A 1 182 ? 28.021 22.870 13.898 1.00 8.51  ? 182 TYR D OH  1 
ATOM   1407 N N   . ASP A 1 183 ? 24.634 18.592 20.147 1.00 8.14  ? 183 ASP D N   1 
ATOM   1408 C CA  . ASP A 1 183 ? 23.653 17.952 21.033 1.00 8.08  ? 183 ASP D CA  1 
ATOM   1409 C C   . ASP A 1 183 ? 22.500 17.466 20.164 1.00 8.45  ? 183 ASP D C   1 
ATOM   1410 O O   . ASP A 1 183 ? 21.446 18.080 20.046 1.00 8.63  ? 183 ASP D O   1 
ATOM   1411 C CB  . ASP A 1 183 ? 23.198 18.946 22.098 1.00 8.75  ? 183 ASP D CB  1 
ATOM   1412 C CG  . ASP A 1 183 ? 22.408 18.335 23.231 1.00 8.85  ? 183 ASP D CG  1 
ATOM   1413 O OD1 . ASP A 1 183 ? 21.871 17.213 23.083 1.00 10.38 ? 183 ASP D OD1 1 
ATOM   1414 O OD2 . ASP A 1 183 ? 22.315 19.016 24.286 1.00 10.66 ? 183 ASP D OD2 1 
ATOM   1415 N N   . THR A 1 184 ? 22.685 16.280 19.576 1.00 8.81  ? 184 THR D N   1 
ATOM   1416 C CA  . THR A 1 184 ? 21.688 15.728 18.663 1.00 9.40  ? 184 THR D CA  1 
ATOM   1417 C C   . THR A 1 184 ? 20.418 15.314 19.378 1.00 9.35  ? 184 THR D C   1 
ATOM   1418 O O   . THR A 1 184 ? 19.346 15.407 18.765 1.00 9.42  ? 184 THR D O   1 
ATOM   1419 C CB  . THR A 1 184 ? 22.272 14.574 17.834 1.00 10.33 ? 184 THR D CB  1 
ATOM   1420 O OG1 . THR A 1 184 ? 22.806 13.595 18.743 1.00 12.43 ? 184 THR D OG1 1 
ATOM   1421 C CG2 . THR A 1 184 ? 23.411 15.052 16.942 1.00 10.56 ? 184 THR D CG2 1 
ATOM   1422 N N   . GLU A 1 185 ? 20.474 14.962 20.670 1.00 9.27  ? 185 GLU D N   1 
ATOM   1423 C CA  . GLU A 1 185 ? 19.244 14.710 21.419 1.00 11.20 ? 185 GLU D CA  1 
ATOM   1424 C C   . GLU A 1 185 ? 18.427 16.005 21.468 1.00 9.45  ? 185 GLU D C   1 
ATOM   1425 O O   . GLU A 1 185 ? 17.209 15.998 21.283 1.00 9.67  ? 185 GLU D O   1 
ATOM   1426 C CB  . GLU A 1 185 ? 19.570 14.213 22.823 1.00 13.81 ? 185 GLU D CB  1 
ATOM   1427 C CG  . GLU A 1 185 ? 18.408 13.883 23.737 1.00 18.73 ? 185 GLU D CG  1 
ATOM   1428 C CD  . GLU A 1 185 ? 18.715 13.930 25.221 1.00 21.96 ? 185 GLU D CD  1 
ATOM   1429 O OE1 . GLU A 1 185 ? 19.870 14.113 25.657 1.00 23.48 ? 185 GLU D OE1 1 
ATOM   1430 O OE2 . GLU A 1 185 ? 17.765 13.801 26.034 1.00 24.55 ? 185 GLU D OE2 1 
ATOM   1431 N N   . MET A 1 186 ? 19.094 17.141 21.747 1.00 9.25  ? 186 MET D N   1 
ATOM   1432 C CA  . MET A 1 186 ? 18.352 18.416 21.793 1.00 8.42  ? 186 MET D CA  1 
ATOM   1433 C C   . MET A 1 186 ? 17.778 18.812 20.442 1.00 7.96  ? 186 MET D C   1 
ATOM   1434 O O   . MET A 1 186 ? 16.627 19.271 20.331 1.00 8.64  ? 186 MET D O   1 
ATOM   1435 C CB  . MET A 1 186 ? 19.259 19.514 22.356 1.00 8.77  ? 186 MET D CB  1 
ATOM   1436 C CG  . MET A 1 186 ? 18.508 20.825 22.560 1.00 9.26  ? 186 MET D CG  1 
ATOM   1437 S SD  . MET A 1 186 ? 19.587 22.208 22.961 1.00 7.79  ? 186 MET D SD  1 
ATOM   1438 C CE  . MET A 1 186 ? 20.183 21.684 24.576 1.00 9.66  ? 186 MET D CE  1 
ATOM   1439 N N   . ILE A 1 187 ? 18.555 18.631 19.365 1.00 7.68  ? 187 ILE D N   1 
ATOM   1440 C CA  . ILE A 1 187 ? 18.088 18.946 18.019 1.00 8.41  ? 187 ILE D CA  1 
ATOM   1441 C C   . ILE A 1 187 ? 16.877 18.097 17.652 1.00 8.70  ? 187 ILE D C   1 
ATOM   1442 O O   . ILE A 1 187 ? 15.870 18.625 17.179 1.00 8.62  ? 187 ILE D O   1 
ATOM   1443 C CB  . ILE A 1 187 ? 19.219 18.758 16.989 1.00 8.07  ? 187 ILE D CB  1 
ATOM   1444 C CG1 . ILE A 1 187 ? 20.379 19.718 17.283 1.00 9.26  ? 187 ILE D CG1 1 
ATOM   1445 C CG2 . ILE A 1 187 ? 18.711 18.971 15.569 1.00 9.39  ? 187 ILE D CG2 1 
ATOM   1446 C CD1 . ILE A 1 187 ? 21.663 19.310 16.560 1.00 9.83  ? 187 ILE D CD1 1 
ATOM   1447 N N   . ARG A 1 188 ? 16.937 16.795 17.933 1.00 9.13  ? 188 ARG D N   1 
ATOM   1448 C CA  . ARG A 1 188 ? 15.827 15.891 17.655 1.00 9.45  ? 188 ARG D CA  1 
ATOM   1449 C C   . ARG A 1 188 ? 14.586 16.251 18.467 1.00 8.96  ? 188 ARG D C   1 
ATOM   1450 O O   . ARG A 1 188 ? 13.471 16.124 17.972 1.00 10.21 ? 188 ARG D O   1 
ATOM   1451 C CB  . ARG A 1 188 ? 16.191 14.438 17.962 1.00 11.95 ? 188 ARG D CB  1 
ATOM   1452 C CG  . ARG A 1 188 ? 17.053 13.751 16.905 1.00 15.82 ? 188 ARG D CG  1 
ATOM   1453 C CD  . ARG A 1 188 ? 17.139 12.252 17.184 1.00 17.79 ? 188 ARG D CD  1 
ATOM   1454 N NE  . ARG A 1 188 ? 17.762 11.933 18.453 1.00 20.88 ? 188 ARG D NE  1 
ATOM   1455 C CZ  . ARG A 1 188 ? 19.052 11.788 18.705 1.00 21.62 ? 188 ARG D CZ  1 
ATOM   1456 N NH1 . ARG A 1 188 ? 19.982 11.921 17.769 1.00 22.57 ? 188 ARG D NH1 1 
ATOM   1457 N NH2 . ARG A 1 188 ? 19.440 11.495 19.948 1.00 23.89 ? 188 ARG D NH2 1 
ATOM   1458 N N   . PHE A 1 189 ? 14.806 16.706 19.697 1.00 8.82  ? 189 PHE D N   1 
ATOM   1459 C CA  . PHE A 1 189 ? 13.721 17.109 20.567 1.00 9.00  ? 189 PHE D CA  1 
ATOM   1460 C C   . PHE A 1 189 ? 12.979 18.311 20.004 1.00 9.03  ? 189 PHE D C   1 
ATOM   1461 O O   . PHE A 1 189 ? 11.757 18.366 20.058 1.00 10.25 ? 189 PHE D O   1 
ATOM   1462 C CB  . PHE A 1 189 ? 14.289 17.420 21.964 1.00 9.81  ? 189 PHE D CB  1 
ATOM   1463 C CG  . PHE A 1 189 ? 13.245 17.890 22.936 1.00 10.04 ? 189 PHE D CG  1 
ATOM   1464 C CD1 . PHE A 1 189 ? 12.504 16.975 23.667 1.00 10.70 ? 189 PHE D CD1 1 
ATOM   1465 C CD2 . PHE A 1 189 ? 13.018 19.235 23.124 1.00 9.54  ? 189 PHE D CD2 1 
ATOM   1466 C CE1 . PHE A 1 189 ? 11.542 17.424 24.560 1.00 10.72 ? 189 PHE D CE1 1 
ATOM   1467 C CE2 . PHE A 1 189 ? 12.054 19.699 24.003 1.00 9.50  ? 189 PHE D CE2 1 
ATOM   1468 C CZ  . PHE A 1 189 ? 11.317 18.777 24.728 1.00 9.99  ? 189 PHE D CZ  1 
ATOM   1469 N N   . VAL A 1 190 ? 13.702 19.288 19.463 1.00 8.37  ? 190 VAL D N   1 
ATOM   1470 C CA  . VAL A 1 190 ? 13.122 20.507 18.938 1.00 8.57  ? 190 VAL D CA  1 
ATOM   1471 C C   . VAL A 1 190 ? 12.526 20.374 17.546 1.00 8.69  ? 190 VAL D C   1 
ATOM   1472 O O   . VAL A 1 190 ? 11.506 20.990 17.228 1.00 8.95  ? 190 VAL D O   1 
ATOM   1473 C CB  . VAL A 1 190 ? 14.202 21.620 18.964 1.00 7.82  ? 190 VAL D CB  1 
ATOM   1474 C CG1 . VAL A 1 190 ? 13.729 22.890 18.278 1.00 8.88  ? 190 VAL D CG1 1 
ATOM   1475 C CG2 . VAL A 1 190 ? 14.581 21.923 20.418 1.00 8.20  ? 190 VAL D CG2 1 
ATOM   1476 N N   . ARG A 1 191 ? 13.083 19.474 16.730 1.00 8.31  ? 191 ARG D N   1 
ATOM   1477 C CA  . ARG A 1 191 ? 12.640 19.325 15.345 1.00 8.82  ? 191 ARG D CA  1 
ATOM   1478 C C   . ARG A 1 191 ? 11.146 19.185 15.120 1.00 9.42  ? 191 ARG D C   1 
ATOM   1479 O O   . ARG A 1 191 ? 10.596 19.923 14.289 1.00 10.00 ? 191 ARG D O   1 
ATOM   1480 C CB  . ARG A 1 191 ? 13.386 18.184 14.647 1.00 9.27  ? 191 ARG D CB  1 
ATOM   1481 C CG  . ARG A 1 191 ? 13.065 18.037 13.161 1.00 9.68  ? 191 ARG D CG  1 
ATOM   1482 C CD  . ARG A 1 191 ? 13.561 19.186 12.301 1.00 10.34 ? 191 ARG D CD  1 
ATOM   1483 N NE  . ARG A 1 191 ? 12.701 20.367 12.358 1.00 10.10 ? 191 ARG D NE  1 
ATOM   1484 C CZ  . ARG A 1 191 ? 13.028 21.513 11.769 1.00 9.29  ? 191 ARG D CZ  1 
ATOM   1485 N NH1 . ARG A 1 191 ? 14.183 21.639 11.125 1.00 9.54  ? 191 ARG D NH1 1 
ATOM   1486 N NH2 . ARG A 1 191 ? 12.220 22.558 11.833 1.00 9.44  ? 191 ARG D NH2 1 
ATOM   1487 N N   . PRO A 1 192 ? 10.432 18.335 15.848 1.00 9.74  ? 192 PRO D N   1 
ATOM   1488 C CA  . PRO A 1 192 ? 9.004  18.191 15.614 1.00 9.71  ? 192 PRO D CA  1 
ATOM   1489 C C   . PRO A 1 192 ? 8.162  19.320 16.156 1.00 10.60 ? 192 PRO D C   1 
ATOM   1490 O O   . PRO A 1 192 ? 6.976  19.437 15.831 1.00 12.04 ? 192 PRO D O   1 
ATOM   1491 C CB  . PRO A 1 192 ? 8.654  16.872 16.300 1.00 10.66 ? 192 PRO D CB  1 
ATOM   1492 C CG  . PRO A 1 192 ? 9.714  16.649 17.314 1.00 12.01 ? 192 PRO D CG  1 
ATOM   1493 C CD  . PRO A 1 192 ? 10.948 17.357 16.824 1.00 10.27 ? 192 PRO D CD  1 
ATOM   1494 N N   . LEU A 1 193 ? 8.724  20.231 16.942 1.00 10.45 ? 193 LEU D N   1 
ATOM   1495 C CA  . LEU A 1 193 ? 7.986  21.313 17.561 1.00 11.24 ? 193 LEU D CA  1 
ATOM   1496 C C   . LEU A 1 193 ? 7.920  22.589 16.748 1.00 10.85 ? 193 LEU D C   1 
ATOM   1497 O O   . LEU A 1 193 ? 7.175  23.519 17.099 1.00 13.36 ? 193 LEU D O   1 
ATOM   1498 C CB  . LEU A 1 193 ? 8.625  21.664 18.914 1.00 11.09 ? 193 LEU D CB  1 
ATOM   1499 C CG  . LEU A 1 193 ? 8.807  20.502 19.888 1.00 12.74 ? 193 LEU D CG  1 
ATOM   1500 C CD1 . LEU A 1 193 ? 9.496  21.006 21.148 1.00 12.73 ? 193 LEU D CD1 1 
ATOM   1501 C CD2 . LEU A 1 193 ? 7.479  19.842 20.230 1.00 14.65 ? 193 LEU D CD2 1 
ATOM   1502 N N   . THR A 1 194 ? 8.700  22.680 15.672 1.00 10.83 ? 194 THR D N   1 
ATOM   1503 C CA  . THR A 1 194 ? 8.701  23.891 14.866 1.00 10.28 ? 194 THR D CA  1 
ATOM   1504 C C   . THR A 1 194 ? 8.919  23.557 13.389 1.00 9.84  ? 194 THR D C   1 
ATOM   1505 O O   . THR A 1 194 ? 9.603  22.590 13.095 1.00 9.92  ? 194 THR D O   1 
ATOM   1506 C CB  . THR A 1 194 ? 9.780  24.880 15.362 1.00 10.84 ? 194 THR D CB  1 
ATOM   1507 O OG1 . THR A 1 194 ? 9.729  26.087 14.592 1.00 11.05 ? 194 THR D OG1 1 
ATOM   1508 C CG2 . THR A 1 194 ? 11.183 24.313 15.260 1.00 11.97 ? 194 THR D CG2 1 
ATOM   1509 N N   . THR A 1 195 ? 8.344  24.415 12.553 1.00 10.02 ? 195 THR D N   1 
ATOM   1510 C CA  . THR A 1 195 ? 8.569  24.310 11.122 1.00 11.14 ? 195 THR D CA  1 
ATOM   1511 C C   . THR A 1 195 ? 9.714  25.226 10.695 1.00 10.93 ? 195 THR D C   1 
ATOM   1512 O O   . THR A 1 195 ? 10.074 25.275 9.523  1.00 12.24 ? 195 THR D O   1 
ATOM   1513 C CB  . THR A 1 195 ? 7.321  24.734 10.313 1.00 11.56 ? 195 THR D CB  1 
ATOM   1514 O OG1 . THR A 1 195 ? 7.008  26.103 10.554 1.00 13.56 ? 195 THR D OG1 1 
ATOM   1515 C CG2 . THR A 1 195 ? 6.127  23.858 10.668 1.00 14.00 ? 195 THR D CG2 1 
ATOM   1516 N N   . LEU A 1 196 ? 10.194 26.090 11.597 1.00 9.21  ? 196 LEU D N   1 
ATOM   1517 C CA  . LEU A 1 196 ? 11.225 27.045 11.214 1.00 9.39  ? 196 LEU D CA  1 
ATOM   1518 C C   . LEU A 1 196 ? 12.591 26.406 11.029 1.00 8.80  ? 196 LEU D C   1 
ATOM   1519 O O   . LEU A 1 196 ? 12.899 25.369 11.589 1.00 8.65  ? 196 LEU D O   1 
ATOM   1520 C CB  . LEU A 1 196 ? 11.367 28.061 12.366 1.00 8.54  ? 196 LEU D CB  1 
ATOM   1521 C CG  . LEU A 1 196 ? 10.120 28.881 12.728 1.00 9.12  ? 196 LEU D CG  1 
ATOM   1522 C CD1 . LEU A 1 196 ? 10.421 29.766 13.928 1.00 9.80  ? 196 LEU D CD1 1 
ATOM   1523 C CD2 . LEU A 1 196 ? 9.655  29.681 11.522 1.00 9.76  ? 196 LEU D CD2 1 
ATOM   1524 N N   . PRO A 1 197 ? 13.448 27.050 10.249 1.00 8.12  ? 197 PRO D N   1 
ATOM   1525 C CA  . PRO A 1 197 ? 14.823 26.582 10.112 1.00 8.51  ? 197 PRO D CA  1 
ATOM   1526 C C   . PRO A 1 197 ? 15.492 26.603 11.486 1.00 8.02  ? 197 PRO D C   1 
ATOM   1527 O O   . PRO A 1 197 ? 15.396 27.573 12.262 1.00 8.93  ? 197 PRO D O   1 
ATOM   1528 C CB  . PRO A 1 197 ? 15.446 27.564 9.141  1.00 9.98  ? 197 PRO D CB  1 
ATOM   1529 C CG  . PRO A 1 197 ? 14.283 28.167 8.412  1.00 10.72 ? 197 PRO D CG  1 
ATOM   1530 C CD  . PRO A 1 197 ? 13.193 28.270 9.461  1.00 8.96  ? 197 PRO D CD  1 
ATOM   1531 N N   . ILE A 1 198 ? 16.161 25.501 11.804 1.00 6.69  ? 198 ILE D N   1 
ATOM   1532 C CA  . ILE A 1 198 ? 16.913 25.356 13.035 1.00 7.84  ? 198 ILE D CA  1 
ATOM   1533 C C   . ILE A 1 198 ? 18.415 25.411 12.732 1.00 7.69  ? 198 ILE D C   1 
ATOM   1534 O O   . ILE A 1 198 ? 18.918 24.603 11.948 1.00 7.64  ? 198 ILE D O   1 
ATOM   1535 C CB  . ILE A 1 198 ? 16.634 24.024 13.753 1.00 8.18  ? 198 ILE D CB  1 
ATOM   1536 C CG1 . ILE A 1 198 ? 15.157 23.983 14.174 1.00 8.56  ? 198 ILE D CG1 1 
ATOM   1537 C CG2 . ILE A 1 198 ? 17.538 23.861 14.972 1.00 8.86  ? 198 ILE D CG2 1 
ATOM   1538 C CD1 . ILE A 1 198 ? 14.738 22.583 14.562 1.00 10.18 ? 198 ILE D CD1 1 
ATOM   1539 N N   . ILE A 1 199 ? 19.088 26.387 13.310 1.00 6.76  ? 199 ILE D N   1 
ATOM   1540 C CA  . ILE A 1 199 ? 20.538 26.507 13.243 1.00 6.39  ? 199 ILE D CA  1 
ATOM   1541 C C   . ILE A 1 199 ? 21.113 25.846 14.505 1.00 6.98  ? 199 ILE D C   1 
ATOM   1542 O O   . ILE A 1 199 ? 20.909 26.356 15.611 1.00 7.09  ? 199 ILE D O   1 
ATOM   1543 C CB  . ILE A 1 199 ? 21.000 27.973 13.218 1.00 7.20  ? 199 ILE D CB  1 
ATOM   1544 C CG1 . ILE A 1 199 ? 20.342 28.758 12.068 1.00 7.62  ? 199 ILE D CG1 1 
ATOM   1545 C CG2 . ILE A 1 199 ? 22.516 28.023 13.116 1.00 8.45  ? 199 ILE D CG2 1 
ATOM   1546 C CD1 . ILE A 1 199 ? 20.542 30.252 12.270 1.00 9.93  ? 199 ILE D CD1 1 
ATOM   1547 N N   . ALA A 1 200 ? 21.722 24.681 14.374 1.00 7.03  ? 200 ALA D N   1 
ATOM   1548 C CA  . ALA A 1 200 ? 22.317 24.004 15.522 1.00 7.51  ? 200 ALA D CA  1 
ATOM   1549 C C   . ALA A 1 200 ? 23.645 24.648 15.891 1.00 7.38  ? 200 ALA D C   1 
ATOM   1550 O O   . ALA A 1 200 ? 24.436 24.945 14.995 1.00 7.31  ? 200 ALA D O   1 
ATOM   1551 C CB  . ALA A 1 200 ? 22.563 22.536 15.207 1.00 9.24  ? 200 ALA D CB  1 
ATOM   1552 N N   . SER A 1 201 ? 23.926 24.810 17.174 1.00 7.50  ? 201 SER D N   1 
ATOM   1553 C CA  . SER A 1 201 ? 25.157 25.442 17.601 1.00 8.15  ? 201 SER D CA  1 
ATOM   1554 C C   . SER A 1 201 ? 25.684 24.830 18.895 1.00 7.04  ? 201 SER D C   1 
ATOM   1555 O O   . SER A 1 201 ? 24.915 24.589 19.817 1.00 7.57  ? 201 SER D O   1 
ATOM   1556 C CB  . SER A 1 201 ? 24.880 26.936 17.882 1.00 9.01  ? 201 SER D CB  1 
ATOM   1557 O OG  . SER A 1 201 ? 26.100 27.596 18.226 1.00 10.28 ? 201 SER D OG  1 
ATOM   1558 N N   . GLY A 1 202 ? 27.000 24.647 18.915 1.00 7.98  ? 202 GLY D N   1 
ATOM   1559 C CA  . GLY A 1 202 ? 27.675 24.216 20.134 1.00 7.79  ? 202 GLY D CA  1 
ATOM   1560 C C   . GLY A 1 202 ? 28.092 22.747 20.097 1.00 8.37  ? 202 GLY D C   1 
ATOM   1561 O O   . GLY A 1 202 ? 27.239 21.866 20.092 1.00 9.19  ? 202 GLY D O   1 
ATOM   1562 N N   . GLY A 1 203 ? 29.404 22.540 20.061 1.00 7.19  ? 203 GLY D N   1 
ATOM   1563 C CA  . GLY A 1 203 ? 29.949 21.191 20.116 1.00 8.04  ? 203 GLY D CA  1 
ATOM   1564 C C   . GLY A 1 203 ? 30.701 20.715 18.901 1.00 8.41  ? 203 GLY D C   1 
ATOM   1565 O O   . GLY A 1 203 ? 31.380 19.675 18.995 1.00 8.68  ? 203 GLY D O   1 
ATOM   1566 N N   . ALA A 1 204 ? 30.586 21.355 17.735 1.00 8.21  ? 204 ALA D N   1 
ATOM   1567 C CA  . ALA A 1 204 ? 31.282 20.807 16.569 1.00 8.46  ? 204 ALA D CA  1 
ATOM   1568 C C   . ALA A 1 204 ? 32.768 20.590 16.819 1.00 9.21  ? 204 ALA D C   1 
ATOM   1569 O O   . ALA A 1 204 ? 33.469 21.492 17.290 1.00 9.78  ? 204 ALA D O   1 
ATOM   1570 C CB  . ALA A 1 204 ? 31.112 21.737 15.374 1.00 9.02  ? 204 ALA D CB  1 
ATOM   1571 N N   . GLY A 1 205 ? 33.268 19.426 16.399 1.00 9.32  ? 205 GLY D N   1 
ATOM   1572 C CA  . GLY A 1 205 ? 34.694 19.137 16.546 1.00 10.98 ? 205 GLY D CA  1 
ATOM   1573 C C   . GLY A 1 205 ? 35.257 18.441 15.308 1.00 11.84 ? 205 GLY D C   1 
ATOM   1574 O O   . GLY A 1 205 ? 36.450 18.578 15.039 1.00 12.92 ? 205 GLY D O   1 
ATOM   1575 N N   . LYS A 1 206 ? 34.426 17.708 14.583 1.00 12.01 ? 206 LYS D N   1 
ATOM   1576 C CA  . LYS A 1 206 ? 34.909 17.018 13.379 1.00 12.93 ? 206 LYS D CA  1 
ATOM   1577 C C   . LYS A 1 206 ? 33.820 16.957 12.319 1.00 11.84 ? 206 LYS D C   1 
ATOM   1578 O O   . LYS A 1 206 ? 32.642 17.172 12.617 1.00 11.38 ? 206 LYS D O   1 
ATOM   1579 C CB  . LYS A 1 206 ? 35.412 15.622 13.728 1.00 15.08 ? 206 LYS D CB  1 
ATOM   1580 C CG  . LYS A 1 206 ? 34.357 14.667 14.239 1.00 16.27 ? 206 LYS D CG  1 
ATOM   1581 C CD  . LYS A 1 206 ? 34.969 13.289 14.499 1.00 18.38 ? 206 LYS D CD  1 
ATOM   1582 C CE  . LYS A 1 206 ? 33.940 12.362 15.135 1.00 19.97 ? 206 LYS D CE  1 
ATOM   1583 N NZ  . LYS A 1 206 ? 34.535 11.004 15.323 1.00 21.36 ? 206 LYS D NZ  1 
ATOM   1584 N N   . MET A 1 207 ? 34.191 16.631 11.078 1.00 11.11 ? 207 MET D N   1 
ATOM   1585 C CA  . MET A 1 207 ? 33.220 16.610 9.983  1.00 11.46 ? 207 MET D CA  1 
ATOM   1586 C C   . MET A 1 207 ? 32.007 15.746 10.259 1.00 10.46 ? 207 MET D C   1 
ATOM   1587 O O   . MET A 1 207 ? 30.859 16.148 9.990  1.00 10.75 ? 207 MET D O   1 
ATOM   1588 C CB  . MET A 1 207 ? 33.881 16.171 8.666  1.00 12.51 ? 207 MET D CB  1 
ATOM   1589 C CG  . MET A 1 207 ? 34.908 17.197 8.188  1.00 13.81 ? 207 MET D CG  1 
ATOM   1590 S SD  . MET A 1 207 ? 35.540 16.748 6.552  1.00 16.59 ? 207 MET D SD  1 
ATOM   1591 C CE  . MET A 1 207 ? 36.660 15.420 6.981  1.00 18.97 ? 207 MET D CE  1 
ATOM   1592 N N   . GLU A 1 208 ? 32.198 14.550 10.822 1.00 10.86 ? 208 GLU D N   1 
ATOM   1593 C CA  . GLU A 1 208 ? 31.070 13.683 11.137 1.00 11.55 ? 208 GLU D CA  1 
ATOM   1594 C C   . GLU A 1 208 ? 30.065 14.306 12.084 1.00 11.31 ? 208 GLU D C   1 
ATOM   1595 O O   . GLU A 1 208 ? 28.864 14.017 11.987 1.00 11.52 ? 208 GLU D O   1 
ATOM   1596 C CB  . GLU A 1 208 ? 31.639 12.369 11.666 1.00 14.05 ? 208 GLU D CB  1 
ATOM   1597 C CG  . GLU A 1 208 ? 30.603 11.258 11.682 1.00 18.79 ? 208 GLU D CG  1 
ATOM   1598 C CD  . GLU A 1 208 ? 30.032 11.090 13.073 1.00 21.87 ? 208 GLU D CD  1 
ATOM   1599 O OE1 . GLU A 1 208 ? 30.303 11.917 13.964 1.00 23.97 ? 208 GLU D OE1 1 
ATOM   1600 O OE2 . GLU A 1 208 ? 29.308 10.084 13.242 1.00 24.31 ? 208 GLU D OE2 1 
ATOM   1601 N N   . HIS A 1 209 ? 30.473 15.230 12.961 1.00 10.33 ? 209 HIS D N   1 
ATOM   1602 C CA  . HIS A 1 209 ? 29.520 15.887 13.848 1.00 10.30 ? 209 HIS D CA  1 
ATOM   1603 C C   . HIS A 1 209 ? 28.485 16.701 13.076 1.00 9.94  ? 209 HIS D C   1 
ATOM   1604 O O   . HIS A 1 209 ? 27.323 16.717 13.486 1.00 9.14  ? 209 HIS D O   1 
ATOM   1605 C CB  . HIS A 1 209 ? 30.224 16.813 14.825 1.00 10.27 ? 209 HIS D CB  1 
ATOM   1606 C CG  . HIS A 1 209 ? 31.091 16.098 15.814 1.00 10.79 ? 209 HIS D CG  1 
ATOM   1607 N ND1 . HIS A 1 209 ? 32.124 16.749 16.436 1.00 11.21 ? 209 HIS D ND1 1 
ATOM   1608 C CD2 . HIS A 1 209 ? 31.059 14.820 16.290 1.00 11.00 ? 209 HIS D CD2 1 
ATOM   1609 C CE1 . HIS A 1 209 ? 32.704 15.902 17.275 1.00 10.69 ? 209 HIS D CE1 1 
ATOM   1610 N NE2 . HIS A 1 209 ? 32.085 14.731 17.202 1.00 12.23 ? 209 HIS D NE2 1 
ATOM   1611 N N   . PHE A 1 210 ? 28.913 17.321 11.982 1.00 9.82  ? 210 PHE D N   1 
ATOM   1612 C CA  . PHE A 1 210 ? 27.999 18.062 11.122 1.00 9.75  ? 210 PHE D CA  1 
ATOM   1613 C C   . PHE A 1 210 ? 26.985 17.114 10.499 1.00 9.53  ? 210 PHE D C   1 
ATOM   1614 O O   . PHE A 1 210 ? 25.797 17.427 10.452 1.00 9.55  ? 210 PHE D O   1 
ATOM   1615 C CB  . PHE A 1 210 ? 28.770 18.806 10.035 1.00 10.06 ? 210 PHE D CB  1 
ATOM   1616 C CG  . PHE A 1 210 ? 29.551 19.986 10.563 1.00 8.67  ? 210 PHE D CG  1 
ATOM   1617 C CD1 . PHE A 1 210 ? 30.776 19.832 11.184 1.00 8.84  ? 210 PHE D CD1 1 
ATOM   1618 C CD2 . PHE A 1 210 ? 29.056 21.273 10.417 1.00 8.89  ? 210 PHE D CD2 1 
ATOM   1619 C CE1 . PHE A 1 210 ? 31.483 20.935 11.640 1.00 9.42  ? 210 PHE D CE1 1 
ATOM   1620 C CE2 . PHE A 1 210 ? 29.736 22.377 10.888 1.00 9.23  ? 210 PHE D CE2 1 
ATOM   1621 C CZ  . PHE A 1 210 ? 30.956 22.212 11.500 1.00 8.38  ? 210 PHE D CZ  1 
ATOM   1622 N N   . LEU A 1 211 ? 27.438 15.937 10.027 1.00 9.04  ? 211 LEU D N   1 
ATOM   1623 C CA  . LEU A 1 211 ? 26.503 14.979 9.459  1.00 9.88  ? 211 LEU D CA  1 
ATOM   1624 C C   . LEU A 1 211 ? 25.434 14.599 10.478 1.00 9.53  ? 211 LEU D C   1 
ATOM   1625 O O   . LEU A 1 211 ? 24.242 14.636 10.154 1.00 9.65  ? 211 LEU D O   1 
ATOM   1626 C CB  . LEU A 1 211 ? 27.241 13.732 8.958  1.00 10.78 ? 211 LEU D CB  1 
ATOM   1627 C CG  . LEU A 1 211 ? 26.328 12.609 8.433  1.00 10.31 ? 211 LEU D CG  1 
ATOM   1628 C CD1 . LEU A 1 211 ? 25.502 13.086 7.247  1.00 11.67 ? 211 LEU D CD1 1 
ATOM   1629 C CD2 . LEU A 1 211 ? 27.172 11.387 8.074  1.00 11.45 ? 211 LEU D CD2 1 
ATOM   1630 N N   . GLU A 1 212 ? 25.849 14.300 11.706 1.00 9.64  ? 212 GLU D N   1 
ATOM   1631 C CA  . GLU A 1 212 ? 24.886 13.939 12.750 1.00 10.14 ? 212 GLU D CA  1 
ATOM   1632 C C   . GLU A 1 212 ? 23.899 15.058 13.050 1.00 10.03 ? 212 GLU D C   1 
ATOM   1633 O O   . GLU A 1 212 ? 22.704 14.808 13.298 1.00 9.33  ? 212 GLU D O   1 
ATOM   1634 C CB  . GLU A 1 212 ? 25.603 13.476 14.023 1.00 12.34 ? 212 GLU D CB  1 
ATOM   1635 C CG  . GLU A 1 212 ? 26.639 12.392 13.828 1.00 15.97 ? 212 GLU D CG  1 
ATOM   1636 C CD  . GLU A 1 212 ? 26.245 11.203 12.996 1.00 18.96 ? 212 GLU D CD  1 
ATOM   1637 O OE1 . GLU A 1 212 ? 25.067 10.815 12.931 1.00 21.07 ? 212 GLU D OE1 1 
ATOM   1638 O OE2 . GLU A 1 212 ? 27.148 10.618 12.358 1.00 22.05 ? 212 GLU D OE2 1 
ATOM   1639 N N   . ALA A 1 213 ? 24.363 16.315 13.047 1.00 9.14  ? 213 ALA D N   1 
ATOM   1640 C CA  . ALA A 1 213 ? 23.458 17.432 13.312 1.00 9.26  ? 213 ALA D CA  1 
ATOM   1641 C C   . ALA A 1 213 ? 22.383 17.509 12.231 1.00 8.91  ? 213 ALA D C   1 
ATOM   1642 O O   . ALA A 1 213 ? 21.189 17.685 12.501 1.00 8.70  ? 213 ALA D O   1 
ATOM   1643 C CB  . ALA A 1 213 ? 24.235 18.746 13.388 1.00 9.05  ? 213 ALA D CB  1 
ATOM   1644 N N   . PHE A 1 214 ? 22.796 17.354 10.965 1.00 8.42  ? 214 PHE D N   1 
ATOM   1645 C CA  . PHE A 1 214 ? 21.816 17.379 9.878  1.00 9.08  ? 214 PHE D CA  1 
ATOM   1646 C C   . PHE A 1 214 ? 20.898 16.159 9.906  1.00 9.51  ? 214 PHE D C   1 
ATOM   1647 O O   . PHE A 1 214 ? 19.674 16.324 9.710  1.00 10.37 ? 214 PHE D O   1 
ATOM   1648 C CB  . PHE A 1 214 ? 22.526 17.549 8.536  1.00 9.57  ? 214 PHE D CB  1 
ATOM   1649 C CG  . PHE A 1 214 ? 23.143 18.909 8.359  1.00 8.68  ? 214 PHE D CG  1 
ATOM   1650 C CD1 . PHE A 1 214 ? 22.374 20.064 8.400  1.00 8.48  ? 214 PHE D CD1 1 
ATOM   1651 C CD2 . PHE A 1 214 ? 24.509 19.040 8.132  1.00 9.20  ? 214 PHE D CD2 1 
ATOM   1652 C CE1 . PHE A 1 214 ? 22.940 21.318 8.240  1.00 8.97  ? 214 PHE D CE1 1 
ATOM   1653 C CE2 . PHE A 1 214 ? 25.082 20.289 7.964  1.00 9.18  ? 214 PHE D CE2 1 
ATOM   1654 C CZ  . PHE A 1 214 ? 24.304 21.427 8.005  1.00 8.66  ? 214 PHE D CZ  1 
ATOM   1655 N N   . LEU A 1 215 ? 21.408 14.975 10.258 1.00 10.02 ? 215 LEU D N   1 
ATOM   1656 C CA  . LEU A 1 215 ? 20.542 13.795 10.353 1.00 11.28 ? 215 LEU D CA  1 
ATOM   1657 C C   . LEU A 1 215 ? 19.536 13.945 11.487 1.00 11.34 ? 215 LEU D C   1 
ATOM   1658 O O   . LEU A 1 215 ? 18.433 13.418 11.364 1.00 11.67 ? 215 LEU D O   1 
ATOM   1659 C CB  . LEU A 1 215 ? 21.350 12.509 10.504 1.00 12.21 ? 215 LEU D CB  1 
ATOM   1660 C CG  . LEU A 1 215 ? 22.147 12.066 9.270  1.00 12.90 ? 215 LEU D CG  1 
ATOM   1661 C CD1 . LEU A 1 215 ? 23.039 10.879 9.609  1.00 13.71 ? 215 LEU D CD1 1 
ATOM   1662 C CD2 . LEU A 1 215 ? 21.202 11.715 8.116  1.00 15.68 ? 215 LEU D CD2 1 
ATOM   1663 N N   . ALA A 1 216 ? 19.850 14.719 12.521 1.00 10.31 ? 216 ALA D N   1 
ATOM   1664 C CA  . ALA A 1 216 ? 18.946 14.985 13.624 1.00 10.42 ? 216 ALA D CA  1 
ATOM   1665 C C   . ALA A 1 216 ? 17.904 16.036 13.260 1.00 10.03 ? 216 ALA D C   1 
ATOM   1666 O O   . ALA A 1 216 ? 16.980 16.223 14.076 1.00 11.07 ? 216 ALA D O   1 
ATOM   1667 C CB  . ALA A 1 216 ? 19.730 15.427 14.855 1.00 10.52 ? 216 ALA D CB  1 
ATOM   1668 N N   . GLY A 1 217 ? 17.999 16.715 12.124 1.00 10.37 ? 217 GLY D N   1 
ATOM   1669 C CA  . GLY A 1 217 ? 16.994 17.661 11.703 1.00 10.87 ? 217 GLY D CA  1 
ATOM   1670 C C   . GLY A 1 217 ? 17.444 19.111 11.593 1.00 9.22  ? 217 GLY D C   1 
ATOM   1671 O O   . GLY A 1 217 ? 16.602 19.937 11.206 1.00 9.78  ? 217 GLY D O   1 
ATOM   1672 N N   . ALA A 1 218 ? 18.709 19.407 11.866 1.00 8.74  ? 218 ALA D N   1 
ATOM   1673 C CA  . ALA A 1 218 ? 19.147 20.789 11.718 1.00 8.05  ? 218 ALA D CA  1 
ATOM   1674 C C   . ALA A 1 218 ? 19.040 21.247 10.258 1.00 7.97  ? 218 ALA D C   1 
ATOM   1675 O O   . ALA A 1 218 ? 19.260 20.438 9.328  1.00 8.48  ? 218 ALA D O   1 
ATOM   1676 C CB  . ALA A 1 218 ? 20.595 20.932 12.161 1.00 8.44  ? 218 ALA D CB  1 
ATOM   1677 N N   . ASP A 1 219 ? 18.753 22.527 10.072 1.00 7.01  ? 219 ASP D N   1 
ATOM   1678 C CA  . ASP A 1 219 ? 18.774 23.118 8.731  1.00 7.90  ? 219 ASP D CA  1 
ATOM   1679 C C   . ASP A 1 219 ? 20.094 23.820 8.465  1.00 7.40  ? 219 ASP D C   1 
ATOM   1680 O O   . ASP A 1 219 ? 20.450 24.071 7.315  1.00 7.87  ? 219 ASP D O   1 
ATOM   1681 C CB  . ASP A 1 219 ? 17.605 24.090 8.548  1.00 8.26  ? 219 ASP D CB  1 
ATOM   1682 C CG  . ASP A 1 219 ? 16.313 23.318 8.762  1.00 9.48  ? 219 ASP D CG  1 
ATOM   1683 O OD1 . ASP A 1 219 ? 16.029 22.422 7.927  1.00 11.82 ? 219 ASP D OD1 1 
ATOM   1684 O OD2 . ASP A 1 219 ? 15.646 23.602 9.773  1.00 9.22  ? 219 ASP D OD2 1 
ATOM   1685 N N   . ALA A 1 220 ? 20.811 24.198 9.512  1.00 7.15  ? 220 ALA D N   1 
ATOM   1686 C CA  . ALA A 1 220 ? 22.102 24.844 9.379  1.00 7.08  ? 220 ALA D CA  1 
ATOM   1687 C C   . ALA A 1 220 ? 22.942 24.396 10.578 1.00 6.99  ? 220 ALA D C   1 
ATOM   1688 O O   . ALA A 1 220 ? 22.398 24.091 11.656 1.00 7.02  ? 220 ALA D O   1 
ATOM   1689 C CB  . ALA A 1 220 ? 21.991 26.366 9.339  1.00 7.46  ? 220 ALA D CB  1 
ATOM   1690 N N   . ALA A 1 221 ? 24.244 24.419 10.371 1.00 7.20  ? 221 ALA D N   1 
ATOM   1691 C CA  . ALA A 1 221 ? 25.185 24.068 11.432 1.00 8.03  ? 221 ALA D CA  1 
ATOM   1692 C C   . ALA A 1 221 ? 26.103 25.270 11.638 1.00 8.03  ? 221 ALA D C   1 
ATOM   1693 O O   . ALA A 1 221 ? 26.791 25.709 10.724 1.00 9.07  ? 221 ALA D O   1 
ATOM   1694 C CB  . ALA A 1 221 ? 25.968 22.817 11.064 1.00 8.82  ? 221 ALA D CB  1 
ATOM   1695 N N   . LEU A 1 222 ? 26.056 25.840 12.834 1.00 7.74  ? 222 LEU D N   1 
ATOM   1696 C CA  . LEU A 1 222 ? 26.914 26.959 13.217 1.00 7.94  ? 222 LEU D CA  1 
ATOM   1697 C C   . LEU A 1 222 ? 28.097 26.412 14.005 1.00 7.63  ? 222 LEU D C   1 
ATOM   1698 O O   . LEU A 1 222 ? 27.921 25.507 14.839 1.00 8.49  ? 222 LEU D O   1 
ATOM   1699 C CB  . LEU A 1 222 ? 26.139 27.902 14.150 1.00 6.90  ? 222 LEU D CB  1 
ATOM   1700 C CG  . LEU A 1 222 ? 26.870 29.165 14.613 1.00 7.15  ? 222 LEU D CG  1 
ATOM   1701 C CD1 . LEU A 1 222 ? 27.161 30.065 13.413 1.00 8.07  ? 222 LEU D CD1 1 
ATOM   1702 C CD2 . LEU A 1 222 ? 26.048 29.919 15.652 1.00 9.09  ? 222 LEU D CD2 1 
ATOM   1703 N N   . ALA A 1 223 ? 29.275 26.944 13.765 1.00 7.99  ? 223 ALA D N   1 
ATOM   1704 C CA  . ALA A 1 223 ? 30.453 26.543 14.526 1.00 7.64  ? 223 ALA D CA  1 
ATOM   1705 C C   . ALA A 1 223 ? 31.384 27.732 14.715 1.00 8.12  ? 223 ALA D C   1 
ATOM   1706 O O   . ALA A 1 223 ? 31.509 28.586 13.833 1.00 8.00  ? 223 ALA D O   1 
ATOM   1707 C CB  . ALA A 1 223 ? 31.189 25.374 13.890 1.00 7.82  ? 223 ALA D CB  1 
ATOM   1708 N N   . ALA A 1 224 ? 31.982 27.760 15.908 1.00 8.66  ? 224 ALA D N   1 
ATOM   1709 C CA  . ALA A 1 224 ? 32.993 28.756 16.214 1.00 9.59  ? 224 ALA D CA  1 
ATOM   1710 C C   . ALA A 1 224 ? 34.371 28.115 16.288 1.00 9.37  ? 224 ALA D C   1 
ATOM   1711 O O   . ALA A 1 224 ? 35.224 28.392 15.439 1.00 9.51  ? 224 ALA D O   1 
ATOM   1712 C CB  . ALA A 1 224 ? 32.665 29.440 17.539 1.00 10.07 ? 224 ALA D CB  1 
ATOM   1713 N N   . SER A 1 225 ? 34.611 27.238 17.254 1.00 9.87  ? 225 SER D N   1 
ATOM   1714 C CA  . SER A 1 225 ? 35.922 26.647 17.464 1.00 10.01 ? 225 SER D CA  1 
ATOM   1715 C C   . SER A 1 225 ? 36.565 25.992 16.259 1.00 10.70 ? 225 SER D C   1 
ATOM   1716 O O   . SER A 1 225 ? 37.737 26.293 15.982 1.00 11.69 ? 225 SER D O   1 
ATOM   1717 C CB  . SER A 1 225 ? 35.868 25.617 18.597 1.00 10.51 ? 225 SER D CB  1 
ATOM   1718 O OG  . SER A 1 225 ? 35.441 26.224 19.802 1.00 11.80 ? 225 SER D OG  1 
ATOM   1719 N N   . VAL A 1 226 ? 35.870 25.141 15.498 1.00 10.01 ? 226 VAL D N   1 
ATOM   1720 C CA  . VAL A 1 226 ? 36.549 24.474 14.389 1.00 10.79 ? 226 VAL D CA  1 
ATOM   1721 C C   . VAL A 1 226 ? 37.018 25.418 13.298 1.00 10.85 ? 226 VAL D C   1 
ATOM   1722 O O   . VAL A 1 226 ? 37.987 25.076 12.596 1.00 12.83 ? 226 VAL D O   1 
ATOM   1723 C CB  . VAL A 1 226 ? 35.778 23.298 13.769 1.00 10.96 ? 226 VAL D CB  1 
ATOM   1724 C CG1 . VAL A 1 226 ? 35.615 22.196 14.810 1.00 10.54 ? 226 VAL D CG1 1 
ATOM   1725 C CG2 . VAL A 1 226 ? 34.434 23.710 13.197 1.00 11.22 ? 226 VAL D CG2 1 
ATOM   1726 N N   . PHE A 1 227 ? 36.388 26.569 13.118 1.00 11.27 ? 227 PHE D N   1 
ATOM   1727 C CA  . PHE A 1 227 ? 36.826 27.522 12.101 1.00 12.09 ? 227 PHE D CA  1 
ATOM   1728 C C   . PHE A 1 227 ? 37.857 28.454 12.718 1.00 13.80 ? 227 PHE D C   1 
ATOM   1729 O O   . PHE A 1 227 ? 38.905 28.704 12.117 1.00 14.51 ? 227 PHE D O   1 
ATOM   1730 C CB  . PHE A 1 227 ? 35.624 28.257 11.488 1.00 11.64 ? 227 PHE D CB  1 
ATOM   1731 C CG  . PHE A 1 227 ? 34.655 27.304 10.830 1.00 11.73 ? 227 PHE D CG  1 
ATOM   1732 C CD1 . PHE A 1 227 ? 35.089 26.330 9.942  1.00 13.44 ? 227 PHE D CD1 1 
ATOM   1733 C CD2 . PHE A 1 227 ? 33.295 27.394 11.096 1.00 12.05 ? 227 PHE D CD2 1 
ATOM   1734 C CE1 . PHE A 1 227 ? 34.199 25.458 9.348  1.00 13.54 ? 227 PHE D CE1 1 
ATOM   1735 C CE2 . PHE A 1 227 ? 32.407 26.523 10.494 1.00 12.36 ? 227 PHE D CE2 1 
ATOM   1736 C CZ  . PHE A 1 227 ? 32.841 25.546 9.620  1.00 13.51 ? 227 PHE D CZ  1 
ATOM   1737 N N   . HIS A 1 228 ? 37.646 28.891 13.951 1.00 13.70 ? 228 HIS D N   1 
ATOM   1738 C CA  . HIS A 1 228 ? 38.562 29.790 14.635 1.00 15.62 ? 228 HIS D CA  1 
ATOM   1739 C C   . HIS A 1 228 ? 39.925 29.144 14.824 1.00 15.72 ? 228 HIS D C   1 
ATOM   1740 O O   . HIS A 1 228 ? 40.941 29.798 14.580 1.00 17.68 ? 228 HIS D O   1 
ATOM   1741 C CB  . HIS A 1 228 ? 37.960 30.228 15.980 1.00 16.74 ? 228 HIS D CB  1 
ATOM   1742 C CG  . HIS A 1 228 ? 38.916 31.106 16.738 1.00 18.67 ? 228 HIS D CG  1 
ATOM   1743 N ND1 . HIS A 1 228 ? 39.149 32.415 16.388 1.00 19.35 ? 228 HIS D ND1 1 
ATOM   1744 C CD2 . HIS A 1 228 ? 39.736 30.813 17.772 1.00 20.06 ? 228 HIS D CD2 1 
ATOM   1745 C CE1 . HIS A 1 228 ? 40.049 32.921 17.222 1.00 20.31 ? 228 HIS D CE1 1 
ATOM   1746 N NE2 . HIS A 1 228 ? 40.427 31.974 18.059 1.00 20.42 ? 228 HIS D NE2 1 
ATOM   1747 N N   . PHE A 1 229 ? 39.975 27.884 15.202 1.00 15.06 ? 229 PHE D N   1 
ATOM   1748 C CA  . PHE A 1 229 ? 41.231 27.162 15.393 1.00 16.54 ? 229 PHE D CA  1 
ATOM   1749 C C   . PHE A 1 229 ? 41.673 26.417 14.144 1.00 16.51 ? 229 PHE D C   1 
ATOM   1750 O O   . PHE A 1 229 ? 42.643 25.651 14.195 1.00 17.44 ? 229 PHE D O   1 
ATOM   1751 C CB  . PHE A 1 229 ? 41.121 26.184 16.569 1.00 16.55 ? 229 PHE D CB  1 
ATOM   1752 C CG  . PHE A 1 229 ? 40.918 26.831 17.905 1.00 18.26 ? 229 PHE D CG  1 
ATOM   1753 C CD1 . PHE A 1 229 ? 41.888 27.647 18.461 1.00 18.51 ? 229 PHE D CD1 1 
ATOM   1754 C CD2 . PHE A 1 229 ? 39.753 26.615 18.633 1.00 18.30 ? 229 PHE D CD2 1 
ATOM   1755 C CE1 . PHE A 1 229 ? 41.708 28.237 19.697 1.00 19.41 ? 229 PHE D CE1 1 
ATOM   1756 C CE2 . PHE A 1 229 ? 39.564 27.205 19.868 1.00 19.33 ? 229 PHE D CE2 1 
ATOM   1757 C CZ  . PHE A 1 229 ? 40.543 28.018 20.411 1.00 19.49 ? 229 PHE D CZ  1 
ATOM   1758 N N   . ARG A 1 230 ? 41.006 26.621 13.023 1.00 16.71 ? 230 ARG D N   1 
ATOM   1759 C CA  . ARG A 1 230 ? 41.325 26.009 11.743 1.00 16.24 ? 230 ARG D CA  1 
ATOM   1760 C C   . ARG A 1 230 ? 41.512 24.507 11.840 1.00 16.04 ? 230 ARG D C   1 
ATOM   1761 O O   . ARG A 1 230 ? 42.520 23.921 11.417 1.00 16.33 ? 230 ARG D O   1 
ATOM   1762 C CB  . ARG A 1 230 ? 42.571 26.701 11.165 1.00 17.75 ? 230 ARG D CB  1 
ATOM   1763 C CG  . ARG A 1 230 ? 42.398 28.213 11.055 1.00 19.94 ? 230 ARG D CG  1 
ATOM   1764 C CD  . ARG A 1 230 ? 43.559 28.815 10.276 1.00 21.72 ? 230 ARG D CD  1 
ATOM   1765 N NE  . ARG A 1 230 ? 43.322 28.644 8.848  1.00 22.79 ? 230 ARG D NE  1 
ATOM   1766 C CZ  . ARG A 1 230 ? 44.213 28.896 7.899  1.00 24.07 ? 230 ARG D CZ  1 
ATOM   1767 N NH1 . ARG A 1 230 ? 45.434 29.303 8.214  1.00 24.92 ? 230 ARG D NH1 1 
ATOM   1768 N NH2 . ARG A 1 230 ? 43.836 28.718 6.638  1.00 25.15 ? 230 ARG D NH2 1 
ATOM   1769 N N   . GLU A 1 231 ? 40.512 23.834 12.400 1.00 14.43 ? 231 GLU D N   1 
ATOM   1770 C CA  . GLU A 1 231 ? 40.491 22.402 12.607 1.00 14.26 ? 231 GLU D CA  1 
ATOM   1771 C C   . GLU A 1 231 ? 39.755 21.628 11.533 1.00 14.92 ? 231 GLU D C   1 
ATOM   1772 O O   . GLU A 1 231 ? 39.889 20.400 11.454 1.00 16.84 ? 231 GLU D O   1 
ATOM   1773 C CB  . GLU A 1 231 ? 39.881 22.105 13.998 1.00 14.80 ? 231 GLU D CB  1 
ATOM   1774 C CG  . GLU A 1 231 ? 40.762 22.715 15.094 1.00 16.03 ? 231 GLU D CG  1 
ATOM   1775 C CD  . GLU A 1 231 ? 40.125 22.636 16.466 1.00 16.21 ? 231 GLU D CD  1 
ATOM   1776 O OE1 . GLU A 1 231 ? 38.895 22.479 16.554 1.00 16.38 ? 231 GLU D OE1 1 
ATOM   1777 O OE2 . GLU A 1 231 ? 40.878 22.731 17.459 1.00 16.82 ? 231 GLU D OE2 1 
ATOM   1778 N N   . ILE A 1 232 ? 38.914 22.292 10.752 1.00 14.91 ? 232 ILE D N   1 
ATOM   1779 C CA  . ILE A 1 232 ? 38.131 21.690 9.686  1.00 15.07 ? 232 ILE D CA  1 
ATOM   1780 C C   . ILE A 1 232 ? 38.171 22.591 8.453  1.00 15.44 ? 232 ILE D C   1 
ATOM   1781 O O   . ILE A 1 232 ? 38.019 23.810 8.552  1.00 16.82 ? 232 ILE D O   1 
ATOM   1782 C CB  . ILE A 1 232 ? 36.652 21.460 10.072 1.00 15.44 ? 232 ILE D CB  1 
ATOM   1783 C CG1 . ILE A 1 232 ? 36.498 20.416 11.186 1.00 15.81 ? 232 ILE D CG1 1 
ATOM   1784 C CG2 . ILE A 1 232 ? 35.833 20.997 8.871  1.00 16.58 ? 232 ILE D CG2 1 
ATOM   1785 C CD1 . ILE A 1 232 ? 35.106 20.311 11.767 1.00 17.42 ? 232 ILE D CD1 1 
ATOM   1786 N N   . ASP A 1 233 ? 38.372 21.990 7.288  1.00 14.60 ? 233 ASP D N   1 
ATOM   1787 C CA  . ASP A 1 233 ? 38.376 22.694 6.018  1.00 14.69 ? 233 ASP D CA  1 
ATOM   1788 C C   . ASP A 1 233 ? 36.948 22.789 5.471  1.00 14.50 ? 233 ASP D C   1 
ATOM   1789 O O   . ASP A 1 233 ? 36.287 21.757 5.387  1.00 13.59 ? 233 ASP D O   1 
ATOM   1790 C CB  . ASP A 1 233 ? 39.247 21.941 5.014  1.00 16.52 ? 233 ASP D CB  1 
ATOM   1791 C CG  . ASP A 1 233 ? 39.327 22.693 3.693  1.00 16.43 ? 233 ASP D CG  1 
ATOM   1792 O OD1 . ASP A 1 233 ? 40.026 23.735 3.669  1.00 17.56 ? 233 ASP D OD1 1 
ATOM   1793 O OD2 . ASP A 1 233 ? 38.701 22.238 2.708  1.00 17.06 ? 233 ASP D OD2 1 
ATOM   1794 N N   . VAL A 1 234 ? 36.506 23.981 5.103  1.00 14.42 ? 234 VAL D N   1 
ATOM   1795 C CA  . VAL A 1 234 ? 35.120 24.137 4.644  1.00 15.59 ? 234 VAL D CA  1 
ATOM   1796 C C   . VAL A 1 234 ? 34.784 23.348 3.394  1.00 15.81 ? 234 VAL D C   1 
ATOM   1797 O O   . VAL A 1 234 ? 33.734 22.684 3.339  1.00 16.05 ? 234 VAL D O   1 
ATOM   1798 C CB  . VAL A 1 234 ? 34.770 25.625 4.472  1.00 15.90 ? 234 VAL D CB  1 
ATOM   1799 C CG1 . VAL A 1 234 ? 33.328 25.775 4.002  1.00 16.25 ? 234 VAL D CG1 1 
ATOM   1800 C CG2 . VAL A 1 234 ? 34.983 26.374 5.775  1.00 16.29 ? 234 VAL D CG2 1 
ATOM   1801 N N   . ARG A 1 235 ? 35.626 23.398 2.358  1.00 16.17 ? 235 ARG D N   1 
ATOM   1802 C CA  . ARG A 1 235 ? 35.331 22.647 1.142  1.00 16.84 ? 235 ARG D CA  1 
ATOM   1803 C C   . ARG A 1 235 ? 35.332 21.150 1.405  1.00 15.65 ? 235 ARG D C   1 
ATOM   1804 O O   . ARG A 1 235 ? 34.382 20.455 1.018  1.00 15.62 ? 235 ARG D O   1 
ATOM   1805 C CB  . ARG A 1 235 ? 36.314 23.044 0.045  1.00 19.13 ? 235 ARG D CB  1 
ATOM   1806 C CG  . ARG A 1 235 ? 36.136 22.239 -1.237 1.00 22.25 ? 235 ARG D CG  1 
ATOM   1807 C CD  . ARG A 1 235 ? 37.126 22.744 -2.284 1.00 25.14 ? 235 ARG D CD  1 
ATOM   1808 N NE  . ARG A 1 235 ? 37.084 21.989 -3.525 1.00 28.83 ? 235 ARG D NE  1 
ATOM   1809 C CZ  . ARG A 1 235 ? 37.728 20.862 -3.788 1.00 30.83 ? 235 ARG D CZ  1 
ATOM   1810 N NH1 . ARG A 1 235 ? 38.318 20.162 -2.826 1.00 32.26 ? 235 ARG D NH1 1 
ATOM   1811 N NH2 . ARG A 1 235 ? 37.531 20.271 -4.968 1.00 32.29 ? 235 ARG D NH2 1 
ATOM   1812 N N   . GLU A 1 236 ? 36.298 20.629 2.165  1.00 14.89 ? 236 GLU D N   1 
ATOM   1813 C CA  . GLU A 1 236 ? 36.347 19.231 2.542  1.00 15.43 ? 236 GLU D CA  1 
ATOM   1814 C C   . GLU A 1 236 ? 35.049 18.833 3.252  1.00 14.24 ? 236 GLU D C   1 
ATOM   1815 O O   . GLU A 1 236 ? 34.468 17.791 2.968  1.00 14.10 ? 236 GLU D O   1 
ATOM   1816 C CB  . GLU A 1 236 ? 37.555 18.906 3.426  1.00 17.99 ? 236 GLU D CB  1 
ATOM   1817 C CG  . GLU A 1 236 ? 37.733 17.416 3.692  1.00 20.37 ? 236 GLU D CG  1 
ATOM   1818 C CD  . GLU A 1 236 ? 39.029 17.070 4.400  1.00 21.36 ? 236 GLU D CD  1 
ATOM   1819 O OE1 . GLU A 1 236 ? 39.791 17.985 4.772  1.00 21.11 ? 236 GLU D OE1 1 
ATOM   1820 O OE2 . GLU A 1 236 ? 39.283 15.858 4.605  1.00 23.35 ? 236 GLU D OE2 1 
ATOM   1821 N N   . LEU A 1 237 ? 34.623 19.664 4.196  1.00 14.21 ? 237 LEU D N   1 
ATOM   1822 C CA  . LEU A 1 237 ? 33.395 19.405 4.937  1.00 12.65 ? 237 LEU D CA  1 
ATOM   1823 C C   . LEU A 1 237 ? 32.177 19.314 4.023  1.00 12.14 ? 237 LEU D C   1 
ATOM   1824 O O   . LEU A 1 237 ? 31.387 18.370 4.160  1.00 11.28 ? 237 LEU D O   1 
ATOM   1825 C CB  . LEU A 1 237 ? 33.208 20.509 5.978  1.00 12.60 ? 237 LEU D CB  1 
ATOM   1826 C CG  . LEU A 1 237 ? 31.870 20.479 6.727  1.00 11.43 ? 237 LEU D CG  1 
ATOM   1827 C CD1 . LEU A 1 237 ? 31.647 19.167 7.458  1.00 12.49 ? 237 LEU D CD1 1 
ATOM   1828 C CD2 . LEU A 1 237 ? 31.810 21.659 7.683  1.00 11.85 ? 237 LEU D CD2 1 
ATOM   1829 N N   . LYS A 1 238 ? 32.014 20.298 3.143  1.00 12.35 ? 238 LYS D N   1 
ATOM   1830 C CA  . LYS A 1 238 ? 30.877 20.272 2.226  1.00 11.78 ? 238 LYS D CA  1 
ATOM   1831 C C   . LYS A 1 238 ? 30.910 19.082 1.276  1.00 13.07 ? 238 LYS D C   1 
ATOM   1832 O O   . LYS A 1 238 ? 29.868 18.466 1.014  1.00 12.78 ? 238 LYS D O   1 
ATOM   1833 C CB  . LYS A 1 238 ? 30.749 21.571 1.437  1.00 10.47 ? 238 LYS D CB  1 
ATOM   1834 C CG  . LYS A 1 238 ? 30.258 22.756 2.265  1.00 10.88 ? 238 LYS D CG  1 
ATOM   1835 C CD  . LYS A 1 238 ? 29.984 23.953 1.376  1.00 11.14 ? 238 LYS D CD  1 
ATOM   1836 C CE  . LYS A 1 238 ? 28.958 24.913 1.972  1.00 11.74 ? 238 LYS D CE  1 
ATOM   1837 N NZ  . LYS A 1 238 ? 28.667 26.029 1.026  1.00 11.87 ? 238 LYS D NZ  1 
ATOM   1838 N N   . GLU A 1 239 ? 32.092 18.725 0.764  1.00 14.12 ? 239 GLU D N   1 
ATOM   1839 C CA  . GLU A 1 239 ? 32.136 17.549 -0.113 1.00 14.89 ? 239 GLU D CA  1 
ATOM   1840 C C   . GLU A 1 239 ? 31.748 16.284 0.621  1.00 14.68 ? 239 GLU D C   1 
ATOM   1841 O O   . GLU A 1 239 ? 31.041 15.427 0.083  1.00 14.91 ? 239 GLU D O   1 
ATOM   1842 C CB  . GLU A 1 239 ? 33.542 17.357 -0.701 1.00 16.31 ? 239 GLU D CB  1 
ATOM   1843 C CG  . GLU A 1 239 ? 33.856 18.581 -1.516 1.00 19.15 ? 239 GLU D CG  1 
ATOM   1844 C CD  . GLU A 1 239 ? 33.173 18.711 -2.858 1.00 20.40 ? 239 GLU D CD  1 
ATOM   1845 O OE1 . GLU A 1 239 ? 32.496 17.773 -3.301 1.00 22.69 ? 239 GLU D OE1 1 
ATOM   1846 O OE2 . GLU A 1 239 ? 33.366 19.775 -3.496 1.00 22.26 ? 239 GLU D OE2 1 
ATOM   1847 N N   . TYR A 1 240 ? 32.183 16.140 1.873  1.00 13.92 ? 240 TYR D N   1 
ATOM   1848 C CA  . TYR A 1 240 ? 31.815 14.973 2.676  1.00 13.80 ? 240 TYR D CA  1 
ATOM   1849 C C   . TYR A 1 240 ? 30.317 14.908 2.943  1.00 13.35 ? 240 TYR D C   1 
ATOM   1850 O O   . TYR A 1 240 ? 29.674 13.857 2.852  1.00 13.53 ? 240 TYR D O   1 
ATOM   1851 C CB  . TYR A 1 240 ? 32.636 15.031 3.968  1.00 14.07 ? 240 TYR D CB  1 
ATOM   1852 C CG  . TYR A 1 240 ? 32.124 14.168 5.097  1.00 14.37 ? 240 TYR D CG  1 
ATOM   1853 C CD1 . TYR A 1 240 ? 32.404 12.809 5.179  1.00 15.41 ? 240 TYR D CD1 1 
ATOM   1854 C CD2 . TYR A 1 240 ? 31.349 14.741 6.104  1.00 13.86 ? 240 TYR D CD2 1 
ATOM   1855 C CE1 . TYR A 1 240 ? 31.924 12.047 6.231  1.00 15.65 ? 240 TYR D CE1 1 
ATOM   1856 C CE2 . TYR A 1 240 ? 30.870 13.982 7.149  1.00 14.40 ? 240 TYR D CE2 1 
ATOM   1857 C CZ  . TYR A 1 240 ? 31.159 12.640 7.214  1.00 15.77 ? 240 TYR D CZ  1 
ATOM   1858 O OH  . TYR A 1 240 ? 30.674 11.895 8.267  1.00 16.88 ? 240 TYR D OH  1 
ATOM   1859 N N   . LEU A 1 241 ? 29.728 16.062 3.286  1.00 12.76 ? 241 LEU D N   1 
ATOM   1860 C CA  . LEU A 1 241 ? 28.297 16.127 3.554  1.00 12.85 ? 241 LEU D CA  1 
ATOM   1861 C C   . LEU A 1 241 ? 27.463 15.804 2.324  1.00 14.48 ? 241 LEU D C   1 
ATOM   1862 O O   . LEU A 1 241 ? 26.505 15.029 2.435  1.00 14.36 ? 241 LEU D O   1 
ATOM   1863 C CB  . LEU A 1 241 ? 27.914 17.506 4.111  1.00 11.17 ? 241 LEU D CB  1 
ATOM   1864 C CG  . LEU A 1 241 ? 28.461 17.766 5.526  1.00 11.07 ? 241 LEU D CG  1 
ATOM   1865 C CD1 . LEU A 1 241 ? 28.269 19.229 5.888  1.00 10.79 ? 241 LEU D CD1 1 
ATOM   1866 C CD2 . LEU A 1 241 ? 27.798 16.860 6.546  1.00 11.15 ? 241 LEU D CD2 1 
ATOM   1867 N N   . LYS A 1 242 ? 27.849 16.336 1.166  1.00 15.47 ? 242 LYS D N   1 
ATOM   1868 C CA  . LYS A 1 242 ? 27.111 16.061 -0.072 1.00 17.13 ? 242 LYS D CA  1 
ATOM   1869 C C   . LYS A 1 242 ? 27.211 14.594 -0.462 1.00 18.58 ? 242 LYS D C   1 
ATOM   1870 O O   . LYS A 1 242 ? 26.202 13.990 -0.837 1.00 19.12 ? 242 LYS D O   1 
ATOM   1871 C CB  . LYS A 1 242 ? 27.604 16.975 -1.193 1.00 17.33 ? 242 LYS D CB  1 
ATOM   1872 C CG  . LYS A 1 242 ? 26.655 17.116 -2.379 1.00 18.04 ? 242 LYS D CG  1 
ATOM   1873 C CD  . LYS A 1 242 ? 25.512 18.060 -2.037 1.00 19.08 ? 242 LYS D CD  1 
ATOM   1874 C CE  . LYS A 1 242 ? 24.891 18.699 -3.268 1.00 20.21 ? 242 LYS D CE  1 
ATOM   1875 N NZ  . LYS A 1 242 ? 23.639 19.444 -2.948 1.00 20.65 ? 242 LYS D NZ  1 
ATOM   1876 N N   . LYS A 1 243 ? 28.343 13.954 -0.206 1.00 18.82 ? 243 LYS D N   1 
ATOM   1877 C CA  . LYS A 1 243 ? 28.538 12.527 -0.443 1.00 21.54 ? 243 LYS D CA  1 
ATOM   1878 C C   . LYS A 1 243 ? 27.629 11.679 0.435  1.00 22.30 ? 243 LYS D C   1 
ATOM   1879 O O   . LYS A 1 243 ? 27.264 10.557 0.065  1.00 23.29 ? 243 LYS D O   1 
ATOM   1880 C CB  . LYS A 1 243 ? 30.005 12.143 -0.232 1.00 23.45 ? 243 LYS D CB  1 
ATOM   1881 C CG  . LYS A 1 243 ? 30.328 10.665 -0.378 1.00 26.12 ? 243 LYS D CG  1 
ATOM   1882 C CD  . LYS A 1 243 ? 31.808 10.393 -0.168 1.00 27.93 ? 243 LYS D CD  1 
ATOM   1883 C CE  . LYS A 1 243 ? 32.214 9.023  -0.688 1.00 29.27 ? 243 LYS D CE  1 
ATOM   1884 N NZ  . LYS A 1 243 ? 33.678 8.782  -0.522 1.00 31.00 ? 243 LYS D NZ  1 
ATOM   1885 N N   . HIS A 1 244 ? 27.247 12.180 1.604  1.00 22.38 ? 244 HIS D N   1 
ATOM   1886 C CA  . HIS A 1 244 ? 26.367 11.490 2.525  1.00 22.41 ? 244 HIS D CA  1 
ATOM   1887 C C   . HIS A 1 244 ? 24.920 11.945 2.435  1.00 22.13 ? 244 HIS D C   1 
ATOM   1888 O O   . HIS A 1 244 ? 24.132 11.757 3.366  1.00 22.09 ? 244 HIS D O   1 
ATOM   1889 C CB  . HIS A 1 244 ? 26.906 11.620 3.961  1.00 23.13 ? 244 HIS D CB  1 
ATOM   1890 C CG  . HIS A 1 244 ? 28.079 10.719 4.195  1.00 23.61 ? 244 HIS D CG  1 
ATOM   1891 N ND1 . HIS A 1 244 ? 29.373 11.054 3.860  1.00 24.34 ? 244 HIS D ND1 1 
ATOM   1892 C CD2 . HIS A 1 244 ? 28.135 9.472  4.733  1.00 23.82 ? 244 HIS D CD2 1 
ATOM   1893 C CE1 . HIS A 1 244 ? 30.174 10.045 4.180  1.00 24.39 ? 244 HIS D CE1 1 
ATOM   1894 N NE2 . HIS A 1 244 ? 29.448 9.077  4.711  1.00 24.98 ? 244 HIS D NE2 1 
ATOM   1895 N N   . GLY A 1 245 ? 24.532 12.530 1.308  1.00 21.63 ? 245 GLY D N   1 
ATOM   1896 C CA  . GLY A 1 245 ? 23.196 12.970 1.016  1.00 20.64 ? 245 GLY D CA  1 
ATOM   1897 C C   . GLY A 1 245 ? 22.673 14.262 1.583  1.00 19.84 ? 245 GLY D C   1 
ATOM   1898 O O   . GLY A 1 245 ? 21.491 14.587 1.412  1.00 20.14 ? 245 GLY D O   1 
ATOM   1899 N N   . VAL A 1 246 ? 23.512 15.064 2.229  1.00 17.04 ? 246 VAL D N   1 
ATOM   1900 C CA  . VAL A 1 246 ? 23.075 16.336 2.808  1.00 16.15 ? 246 VAL D CA  1 
ATOM   1901 C C   . VAL A 1 246 ? 23.097 17.412 1.733  1.00 14.65 ? 246 VAL D C   1 
ATOM   1902 O O   . VAL A 1 246 ? 24.126 17.588 1.058  1.00 15.24 ? 246 VAL D O   1 
ATOM   1903 C CB  . VAL A 1 246 ? 23.964 16.702 4.005  1.00 15.70 ? 246 VAL D CB  1 
ATOM   1904 C CG1 . VAL A 1 246 ? 23.532 18.017 4.636  1.00 16.00 ? 246 VAL D CG1 1 
ATOM   1905 C CG2 . VAL A 1 246 ? 23.961 15.586 5.044  1.00 16.71 ? 246 VAL D CG2 1 
ATOM   1906 N N   . ASN A 1 247 ? 22.015 18.167 1.591  1.00 14.45 ? 247 ASN D N   1 
ATOM   1907 C CA  . ASN A 1 247 ? 21.860 19.195 0.579  1.00 13.86 ? 247 ASN D CA  1 
ATOM   1908 C C   . ASN A 1 247 ? 22.593 20.504 0.860  1.00 12.84 ? 247 ASN D C   1 
ATOM   1909 O O   . ASN A 1 247 ? 21.999 21.572 0.954  1.00 12.91 ? 247 ASN D O   1 
ATOM   1910 C CB  . ASN A 1 247 ? 20.363 19.460 0.330  1.00 14.17 ? 247 ASN D CB  1 
ATOM   1911 C CG  . ASN A 1 247 ? 20.082 20.338 -0.880 1.00 14.83 ? 247 ASN D CG  1 
ATOM   1912 O OD1 . ASN A 1 247 ? 19.081 21.061 -0.915 1.00 17.06 ? 247 ASN D OD1 1 
ATOM   1913 N ND2 . ASN A 1 247 ? 20.958 20.298 -1.862 1.00 13.67 ? 247 ASN D ND2 1 
ATOM   1914 N N   . VAL A 1 248 ? 23.929 20.423 0.858  1.00 13.36 ? 248 VAL D N   1 
ATOM   1915 C CA  . VAL A 1 248 ? 24.764 21.608 1.021  1.00 13.20 ? 248 VAL D CA  1 
ATOM   1916 C C   . VAL A 1 248 ? 25.036 22.193 -0.366 1.00 13.04 ? 248 VAL D C   1 
ATOM   1917 O O   . VAL A 1 248 ? 24.928 21.483 -1.382 1.00 14.87 ? 248 VAL D O   1 
ATOM   1918 C CB  . VAL A 1 248 ? 26.102 21.320 1.712  1.00 12.44 ? 248 VAL D CB  1 
ATOM   1919 C CG1 . VAL A 1 248 ? 25.895 20.922 3.174  1.00 14.16 ? 248 VAL D CG1 1 
ATOM   1920 C CG2 . VAL A 1 248 ? 26.883 20.215 1.008  1.00 13.60 ? 248 VAL D CG2 1 
ATOM   1921 N N   . ARG A 1 249 ? 25.365 23.469 -0.425 1.00 14.51 ? 249 ARG D N   1 
ATOM   1922 C CA  . ARG A 1 249 ? 25.647 24.131 -1.702 1.00 16.50 ? 249 ARG D CA  1 
ATOM   1923 C C   . ARG A 1 249 ? 27.116 23.991 -2.061 1.00 15.91 ? 249 ARG D C   1 
ATOM   1924 O O   . ARG A 1 249 ? 27.969 24.453 -1.301 1.00 13.95 ? 249 ARG D O   1 
ATOM   1925 C CB  . ARG A 1 249 ? 25.274 25.609 -1.588 1.00 18.70 ? 249 ARG D CB  1 
ATOM   1926 C CG  . ARG A 1 249 ? 25.783 26.541 -2.667 1.00 22.29 ? 249 ARG D CG  1 
ATOM   1927 C CD  . ARG A 1 249 ? 25.355 27.984 -2.455 1.00 25.08 ? 249 ARG D CD  1 
ATOM   1928 N NE  . ARG A 1 249 ? 26.017 28.919 -3.358 1.00 27.90 ? 249 ARG D NE  1 
ATOM   1929 C CZ  . ARG A 1 249 ? 27.081 29.661 -3.080 1.00 29.06 ? 249 ARG D CZ  1 
ATOM   1930 N NH1 . ARG A 1 249 ? 27.639 29.616 -1.879 1.00 30.53 ? 249 ARG D NH1 1 
ATOM   1931 N NH2 . ARG A 1 249 ? 27.598 30.475 -3.996 1.00 29.89 ? 249 ARG D NH2 1 
ATOM   1932 N N   . LEU A 1 250 ? 27.432 23.400 -3.213 1.00 16.10 ? 250 LEU D N   1 
ATOM   1933 C CA  . LEU A 1 250 ? 28.825 23.256 -3.627 1.00 18.27 ? 250 LEU D CA  1 
ATOM   1934 C C   . LEU A 1 250 ? 29.205 24.337 -4.636 1.00 19.66 ? 250 LEU D C   1 
ATOM   1935 O O   . LEU A 1 250 ? 30.395 24.484 -4.941 1.00 21.06 ? 250 LEU D O   1 
ATOM   1936 C CB  . LEU A 1 250 ? 29.107 21.883 -4.241 1.00 17.78 ? 250 LEU D CB  1 
ATOM   1937 C CG  . LEU A 1 250 ? 28.869 20.648 -3.373 1.00 18.25 ? 250 LEU D CG  1 
ATOM   1938 C CD1 . LEU A 1 250 ? 29.275 19.385 -4.127 1.00 19.48 ? 250 LEU D CD1 1 
ATOM   1939 C CD2 . LEU A 1 250 ? 29.619 20.731 -2.050 1.00 18.97 ? 250 LEU D CD2 1 
ATOM   1940 N N   . GLU A 1 251 ? 28.249 25.088 -5.159 1.00 22.02 ? 251 GLU D N   1 
ATOM   1941 C CA  . GLU A 1 251 ? 28.523 26.150 -6.122 1.00 26.20 ? 251 GLU D CA  1 
ATOM   1942 C C   . GLU A 1 251 ? 29.550 27.155 -5.604 1.00 26.96 ? 251 GLU D C   1 
ATOM   1943 O O   . GLU A 1 251 ? 29.392 27.682 -4.503 1.00 27.98 ? 251 GLU D O   1 
ATOM   1944 C CB  . GLU A 1 251 ? 27.252 26.953 -6.422 1.00 28.41 ? 251 GLU D CB  1 
ATOM   1945 C CG  . GLU A 1 251 ? 26.009 26.171 -6.761 1.00 31.60 ? 251 GLU D CG  1 
ATOM   1946 C CD  . GLU A 1 251 ? 24.719 26.915 -6.487 1.00 33.43 ? 251 GLU D CD  1 
ATOM   1947 O OE1 . GLU A 1 251 ? 24.781 28.127 -6.176 1.00 35.50 ? 251 GLU D OE1 1 
ATOM   1948 O OE2 . GLU A 1 251 ? 23.632 26.297 -6.570 1.00 34.41 ? 251 GLU D OE2 1 
ATOM   1949 N N   . GLY A 1 252 ? 30.580 27.451 -6.382 1.00 27.66 ? 252 GLY D N   1 
ATOM   1950 C CA  . GLY A 1 252 ? 31.621 28.396 -6.082 1.00 28.98 ? 252 GLY D CA  1 
ATOM   1951 C C   . GLY A 1 252 ? 32.860 27.886 -5.369 1.00 29.76 ? 252 GLY D C   1 
ATOM   1952 O O   . GLY A 1 252 ? 33.775 28.659 -5.043 1.00 29.36 ? 252 GLY D O   1 
ATOM   1953 N N   . LEU A 1 253 ? 32.832 26.636 -4.918 1.00 29.10 ? 253 LEU D N   1 
ATOM   1954 C CA  . LEU A 1 253 ? 33.906 26.053 -4.131 1.00 30.18 ? 253 LEU D CA  1 
ATOM   1955 C C   . LEU A 1 253 ? 35.149 25.739 -4.939 1.00 31.08 ? 253 LEU D C   1 
ATOM   1956 O O   . LEU A 1 253 ? 36.218 25.466 -4.351 1.00 32.40 ? 253 LEU D O   1 
ATOM   1957 C CB  . LEU A 1 253 ? 33.495 24.738 -3.459 1.00 29.02 ? 253 LEU D CB  1 
ATOM   1958 C CG  . LEU A 1 253 ? 32.701 24.843 -2.152 1.00 28.80 ? 253 LEU D CG  1 
ATOM   1959 C CD1 . LEU A 1 253 ? 32.214 23.456 -1.719 1.00 27.59 ? 253 LEU D CD1 1 
ATOM   1960 C CD2 . LEU A 1 253 ? 33.576 25.444 -1.045 1.00 28.02 ? 253 LEU D CD2 1 
HETATM 1961 P P   . PO4 B 2 .   ? 31.557 25.942 19.190 1.00 8.50  ? 305 PO4 D P   1 
HETATM 1962 O O1  . PO4 B 2 .   ? 31.309 24.687 19.947 1.00 8.12  ? 305 PO4 D O1  1 
HETATM 1963 O O2  . PO4 B 2 .   ? 32.886 26.528 19.522 1.00 10.09 ? 305 PO4 D O2  1 
HETATM 1964 O O3  . PO4 B 2 .   ? 31.488 25.698 17.678 1.00 9.16  ? 305 PO4 D O3  1 
HETATM 1965 O O4  . PO4 B 2 .   ? 30.436 26.984 19.500 1.00 9.38  ? 305 PO4 D O4  1 
HETATM 1966 P P   . PO4 C 2 .   ? 21.501 38.238 24.871 1.00 24.16 ? 306 PO4 D P   1 
HETATM 1967 O O1  . PO4 C 2 .   ? 20.896 37.076 25.588 1.00 19.79 ? 306 PO4 D O1  1 
HETATM 1968 O O2  . PO4 C 2 .   ? 22.949 38.056 24.609 1.00 25.71 ? 306 PO4 D O2  1 
HETATM 1969 O O3  . PO4 C 2 .   ? 20.823 38.294 23.497 1.00 24.13 ? 306 PO4 D O3  1 
HETATM 1970 O O4  . PO4 C 2 .   ? 21.223 39.551 25.625 1.00 25.02 ? 306 PO4 D O4  1 
HETATM 1971 O O   . HOH D 3 .   ? 17.804 31.154 25.741 1.00 10.60 ? 307 HOH D O   1 
HETATM 1972 O O   . HOH D 3 .   ? 11.232 21.178 27.294 1.00 8.81  ? 308 HOH D O   1 
HETATM 1973 O O   . HOH D 3 .   ? 15.493 32.707 23.627 1.00 11.22 ? 309 HOH D O   1 
HETATM 1974 O O   . HOH D 3 .   ? 27.163 16.078 16.270 1.00 10.44 ? 310 HOH D O   1 
HETATM 1975 O O   . HOH D 3 .   ? 24.554 21.364 19.848 1.00 9.70  ? 311 HOH D O   1 
HETATM 1976 O O   . HOH D 3 .   ? 33.456 24.208 16.566 1.00 9.94  ? 312 HOH D O   1 
HETATM 1977 O O   . HOH D 3 .   ? 29.241 24.187 17.109 1.00 7.44  ? 313 HOH D O   1 
HETATM 1978 O O   . HOH D 3 .   ? 23.342 22.306 27.112 1.00 10.20 ? 314 HOH D O   1 
HETATM 1979 O O   . HOH D 3 .   ? 21.978 22.546 19.942 1.00 10.24 ? 315 HOH D O   1 
HETATM 1980 O O   . HOH D 3 .   ? 9.939  18.763 27.934 1.00 10.69 ? 316 HOH D O   1 
HETATM 1981 O O   . HOH D 3 .   ? 28.854 28.182 17.493 1.00 12.42 ? 317 HOH D O   1 
HETATM 1982 O O   . HOH D 3 .   ? 33.118 22.666 19.983 1.00 9.30  ? 318 HOH D O   1 
HETATM 1983 O O   . HOH D 3 .   ? 4.049  27.379 24.056 1.00 14.45 ? 319 HOH D O   1 
HETATM 1984 O O   . HOH D 3 .   ? 8.896  17.997 30.398 1.00 12.85 ? 320 HOH D O   1 
HETATM 1985 O O   . HOH D 3 .   ? 18.672 39.529 23.532 1.00 13.13 ? 321 HOH D O   1 
HETATM 1986 O O   . HOH D 3 .   ? 12.626 17.967 27.988 1.00 11.62 ? 322 HOH D O   1 
HETATM 1987 O O   . HOH D 3 .   ? 21.684 32.289 27.793 1.00 13.54 ? 323 HOH D O   1 
HETATM 1988 O O   . HOH D 3 .   ? 36.910 25.105 21.914 1.00 13.39 ? 324 HOH D O   1 
HETATM 1989 O O   . HOH D 3 .   ? 7.337  26.340 30.373 1.00 15.05 ? 325 HOH D O   1 
HETATM 1990 O O   . HOH D 3 .   ? 19.690 17.420 3.108  1.00 15.46 ? 326 HOH D O   1 
HETATM 1991 O O   . HOH D 3 .   ? 21.433 39.537 21.146 1.00 16.50 ? 327 HOH D O   1 
HETATM 1992 O O   . HOH D 3 .   ? 22.589 19.759 29.183 1.00 15.95 ? 328 HOH D O   1 
HETATM 1993 O O   . HOH D 3 .   ? 23.085 43.089 3.946  1.00 15.30 ? 329 HOH D O   1 
HETATM 1994 O O   . HOH D 3 .   ? 21.501 30.178 20.932 1.00 12.60 ? 330 HOH D O   1 
HETATM 1995 O O   . HOH D 3 .   ? 26.484 30.417 40.184 1.00 15.39 ? 331 HOH D O   1 
HETATM 1996 O O   . HOH D 3 .   ? 13.478 18.763 35.845 1.00 14.96 ? 332 HOH D O   1 
HETATM 1997 O O   . HOH D 3 .   ? 22.258 35.067 26.817 1.00 14.71 ? 333 HOH D O   1 
HETATM 1998 O O   . HOH D 3 .   ? 15.340 36.151 31.532 1.00 14.68 ? 334 HOH D O   1 
HETATM 1999 O O   . HOH D 3 .   ? 3.288  39.048 19.340 1.00 15.27 ? 335 HOH D O   1 
HETATM 2000 O O   . HOH D 3 .   ? 23.741 33.983 9.808  1.00 15.88 ? 336 HOH D O   1 
HETATM 2001 O O   . HOH D 3 .   ? 12.184 44.817 24.487 1.00 17.81 ? 337 HOH D O   1 
HETATM 2002 O O   . HOH D 3 .   ? 13.192 42.815 26.057 1.00 14.57 ? 338 HOH D O   1 
HETATM 2003 O O   . HOH D 3 .   ? 15.490 13.848 21.878 1.00 17.24 ? 339 HOH D O   1 
HETATM 2004 O O   . HOH D 3 .   ? 12.139 46.917 22.674 1.00 19.06 ? 340 HOH D O   1 
HETATM 2005 O O   . HOH D 3 .   ? 14.304 18.312 -3.878 1.00 13.78 ? 341 HOH D O   1 
HETATM 2006 O O   . HOH D 3 .   ? 41.607 20.432 21.086 1.00 17.61 ? 342 HOH D O   1 
HETATM 2007 O O   . HOH D 3 .   ? 37.125 16.525 10.875 1.00 19.08 ? 343 HOH D O   1 
HETATM 2008 O O   . HOH D 3 .   ? 3.939  21.422 30.952 1.00 18.72 ? 344 HOH D O   1 
HETATM 2009 O O   . HOH D 3 .   ? 4.056  27.621 17.044 1.00 20.09 ? 345 HOH D O   1 
HETATM 2010 O O   . HOH D 3 .   ? 22.973 14.487 22.270 1.00 18.61 ? 346 HOH D O   1 
HETATM 2011 O O   . HOH D 3 .   ? 36.980 31.932 12.613 1.00 16.91 ? 347 HOH D O   1 
HETATM 2012 O O   . HOH D 3 .   ? 14.767 14.529 13.748 1.00 18.78 ? 348 HOH D O   1 
HETATM 2013 O O   . HOH D 3 .   ? 25.365 24.678 2.117  1.00 16.72 ? 349 HOH D O   1 
HETATM 2014 O O   . HOH D 3 .   ? 21.281 16.337 25.739 1.00 21.53 ? 350 HOH D O   1 
HETATM 2015 O O   . HOH D 3 .   ? 13.424 50.165 21.578 1.00 17.99 ? 351 HOH D O   1 
HETATM 2016 O O   . HOH D 3 .   ? 9.680  16.914 21.231 1.00 15.90 ? 352 HOH D O   1 
HETATM 2017 O O   . HOH D 3 .   ? 35.757 15.547 1.913  1.00 18.39 ? 353 HOH D O   1 
HETATM 2018 O O   . HOH D 3 .   ? 34.646 30.660 13.730 1.00 16.69 ? 354 HOH D O   1 
HETATM 2019 O O   . HOH D 3 .   ? 39.475 38.508 2.421  1.00 19.71 ? 355 HOH D O   1 
HETATM 2020 O O   . HOH D 3 .   ? 8.426  17.266 26.098 1.00 13.99 ? 356 HOH D O   1 
HETATM 2021 O O   . HOH D 3 .   ? 6.490  37.490 29.286 1.00 15.83 ? 357 HOH D O   1 
HETATM 2022 O O   . HOH D 3 .   ? 18.522 22.749 -3.379 1.00 21.35 ? 358 HOH D O   1 
HETATM 2023 O O   . HOH D 3 .   ? 43.492 23.536 17.501 1.00 24.63 ? 359 HOH D O   1 
HETATM 2024 O O   . HOH D 3 .   ? 18.377 25.914 5.683  1.00 20.82 ? 360 HOH D O   1 
HETATM 2025 O O   . HOH D 3 .   ? 7.246  32.233 12.725 1.00 16.28 ? 361 HOH D O   1 
HETATM 2026 O O   . HOH D 3 .   ? 19.491 44.711 5.992  1.00 21.54 ? 362 HOH D O   1 
HETATM 2027 O O   . HOH D 3 .   ? 21.844 12.525 14.683 1.00 18.47 ? 363 HOH D O   1 
HETATM 2028 O O   . HOH D 3 .   ? 37.935 33.876 14.349 1.00 20.28 ? 364 HOH D O   1 
HETATM 2029 O O   . HOH D 3 .   ? 34.767 13.176 10.894 1.00 15.85 ? 365 HOH D O   1 
HETATM 2030 O O   . HOH D 3 .   ? 20.191 16.823 5.704  1.00 18.44 ? 366 HOH D O   1 
HETATM 2031 O O   . HOH D 3 .   ? 26.258 27.948 32.205 1.00 17.80 ? 367 HOH D O   1 
HETATM 2032 O O   . HOH D 3 .   ? 7.977  17.661 23.341 1.00 20.37 ? 368 HOH D O   1 
HETATM 2033 O O   . HOH D 3 .   ? 32.781 44.635 22.469 1.00 25.81 ? 369 HOH D O   1 
HETATM 2034 O O   . HOH D 3 .   ? 13.640 39.850 6.216  1.00 21.08 ? 370 HOH D O   1 
HETATM 2035 O O   . HOH D 3 .   ? 39.255 42.484 19.861 1.00 29.93 ? 371 HOH D O   1 
HETATM 2036 O O   . HOH D 3 .   ? 41.303 24.803 5.613  1.00 23.37 ? 372 HOH D O   1 
HETATM 2037 O O   . HOH D 3 .   ? 6.062  16.553 27.082 1.00 22.37 ? 373 HOH D O   1 
HETATM 2038 O O   . HOH D 3 .   ? 18.836 53.862 12.539 1.00 21.04 ? 374 HOH D O   1 
HETATM 2039 O O   . HOH D 3 .   ? 39.938 35.639 14.078 1.00 19.98 ? 375 HOH D O   1 
HETATM 2040 O O   . HOH D 3 .   ? 32.479 28.035 23.756 1.00 21.61 ? 376 HOH D O   1 
HETATM 2041 O O   . HOH D 3 .   ? 19.345 11.485 14.387 1.00 17.51 ? 377 HOH D O   1 
HETATM 2042 O O   . HOH D 3 .   ? 11.338 31.183 8.212  1.00 20.68 ? 378 HOH D O   1 
HETATM 2043 O O   . HOH D 3 .   ? 33.175 28.644 21.250 1.00 20.41 ? 379 HOH D O   1 
HETATM 2044 O O   . HOH D 3 .   ? 31.790 30.971 20.533 1.00 19.50 ? 380 HOH D O   1 
HETATM 2045 O O   . HOH D 3 .   ? 12.992 14.462 15.815 1.00 20.94 ? 381 HOH D O   1 
HETATM 2046 O O   . HOH D 3 .   ? 19.467 15.722 33.042 1.00 25.52 ? 382 HOH D O   1 
HETATM 2047 O O   . HOH D 3 .   ? 8.174  20.101 12.551 1.00 23.05 ? 383 HOH D O   1 
HETATM 2048 O O   . HOH D 3 .   ? 1.322  34.250 21.610 1.00 24.27 ? 384 HOH D O   1 
HETATM 2049 O O   . HOH D 3 .   ? 12.888 35.379 32.607 1.00 27.13 ? 385 HOH D O   1 
HETATM 2050 O O   . HOH D 3 .   ? 2.724  29.080 22.322 1.00 19.28 ? 386 HOH D O   1 
HETATM 2051 O O   . HOH D 3 .   ? 23.755 32.240 20.150 1.00 28.82 ? 387 HOH D O   1 
HETATM 2052 O O   . HOH D 3 .   ? 34.176 13.324 0.752  1.00 26.27 ? 388 HOH D O   1 
HETATM 2053 O O   . HOH D 3 .   ? 17.783 10.888 10.490 1.00 18.43 ? 389 HOH D O   1 
HETATM 2054 O O   . HOH D 3 .   ? 7.745  37.948 6.864  1.00 27.90 ? 390 HOH D O   1 
HETATM 2055 O O   . HOH D 3 .   ? 27.606 13.468 17.081 1.00 26.36 ? 391 HOH D O   1 
HETATM 2056 O O   . HOH D 3 .   ? 31.672 45.189 19.036 1.00 20.64 ? 392 HOH D O   1 
HETATM 2057 O O   . HOH D 3 .   ? 15.621 43.680 27.044 1.00 19.92 ? 393 HOH D O   1 
HETATM 2058 O O   . HOH D 3 .   ? 41.282 24.642 21.577 1.00 26.96 ? 394 HOH D O   1 
HETATM 2059 O O   . HOH D 3 .   ? 27.114 14.415 19.528 1.00 21.59 ? 395 HOH D O   1 
HETATM 2060 O O   . HOH D 3 .   ? 38.247 19.823 16.587 1.00 20.37 ? 396 HOH D O   1 
HETATM 2061 O O   . HOH D 3 .   ? 18.308 30.803 37.763 1.00 21.89 ? 397 HOH D O   1 
HETATM 2062 O O   . HOH D 3 .   ? 45.913 43.932 13.691 1.00 20.81 ? 398 HOH D O   1 
HETATM 2063 O O   . HOH D 3 .   ? 6.320  36.861 11.206 1.00 25.79 ? 399 HOH D O   1 
HETATM 2064 O O   . HOH D 3 .   ? 6.712  41.100 7.980  1.00 23.84 ? 400 HOH D O   1 
HETATM 2065 O O   . HOH D 3 .   ? 22.611 18.548 27.281 1.00 31.04 ? 401 HOH D O   1 
HETATM 2066 O O   . HOH D 3 .   ? 38.699 28.710 9.353  1.00 24.93 ? 402 HOH D O   1 
HETATM 2067 O O   . HOH D 3 .   ? 27.181 28.537 25.343 1.00 22.81 ? 403 HOH D O   1 
HETATM 2068 O O   . HOH D 3 .   ? 21.407 17.295 33.329 1.00 30.17 ? 404 HOH D O   1 
HETATM 2069 O O   . HOH D 3 .   ? 37.559 25.581 2.213  1.00 29.11 ? 405 HOH D O   1 
HETATM 2070 O O   . HOH D 3 .   ? 4.238  34.823 25.813 1.00 26.41 ? 406 HOH D O   1 
HETATM 2071 O O   . HOH D 3 .   ? 4.189  30.285 25.861 1.00 22.06 ? 407 HOH D O   1 
HETATM 2072 O O   . HOH D 3 .   ? 40.405 40.124 21.628 1.00 26.93 ? 408 HOH D O   1 
HETATM 2073 O O   . HOH D 3 .   ? 12.749 24.378 8.281  1.00 24.17 ? 409 HOH D O   1 
HETATM 2074 O O   . HOH D 3 .   ? 31.146 15.226 -2.682 1.00 24.09 ? 410 HOH D O   1 
HETATM 2075 O O   . HOH D 3 .   ? 13.388 15.310 27.176 1.00 23.42 ? 411 HOH D O   1 
HETATM 2076 O O   . HOH D 3 .   ? 22.197 16.889 -1.820 1.00 23.62 ? 412 HOH D O   1 
HETATM 2077 O O   . HOH D 3 .   ? 17.335 18.952 2.617  1.00 22.44 ? 413 HOH D O   1 
HETATM 2078 O O   . HOH D 3 .   ? 37.405 46.660 8.996  1.00 32.80 ? 414 HOH D O   1 
HETATM 2079 O O   . HOH D 3 .   ? 39.204 19.197 7.166  1.00 22.72 ? 415 HOH D O   1 
HETATM 2080 O O   . HOH D 3 .   ? 12.618 39.336 34.053 1.00 24.48 ? 416 HOH D O   1 
HETATM 2081 O O   . HOH D 3 .   ? 17.612 10.458 7.713  1.00 30.14 ? 417 HOH D O   1 
HETATM 2082 O O   . HOH D 3 .   ? 24.477 48.165 18.130 1.00 25.80 ? 418 HOH D O   1 
HETATM 2083 O O   . HOH D 3 .   ? 40.795 41.010 18.092 1.00 28.80 ? 419 HOH D O   1 
HETATM 2084 O O   . HOH D 3 .   ? 21.664 31.483 3.094  1.00 23.21 ? 420 HOH D O   1 
HETATM 2085 O O   . HOH D 3 .   ? 20.631 46.883 23.172 1.00 24.14 ? 421 HOH D O   1 
HETATM 2086 O O   . HOH D 3 .   ? 5.298  18.461 22.384 1.00 21.71 ? 422 HOH D O   1 
HETATM 2087 O O   . HOH D 3 .   ? 29.881 16.320 25.869 1.00 25.68 ? 423 HOH D O   1 
HETATM 2088 O O   . HOH D 3 .   ? 14.006 43.183 30.347 1.00 24.61 ? 424 HOH D O   1 
HETATM 2089 O O   . HOH D 3 .   ? 29.880 36.085 26.274 1.00 25.96 ? 425 HOH D O   1 
HETATM 2090 O O   . HOH D 3 .   ? 11.706 38.234 5.709  1.00 26.57 ? 426 HOH D O   1 
HETATM 2091 O O   . HOH D 3 .   ? 27.669 50.417 4.760  1.00 26.86 ? 427 HOH D O   1 
HETATM 2092 O O   . HOH D 3 .   ? 16.552 52.598 13.883 1.00 23.76 ? 428 HOH D O   1 
HETATM 2093 O O   . HOH D 3 .   ? 23.663 32.092 22.537 1.00 27.98 ? 429 HOH D O   1 
HETATM 2094 O O   . HOH D 3 .   ? 42.499 34.835 14.208 1.00 22.26 ? 430 HOH D O   1 
HETATM 2095 O O   . HOH D 3 .   ? 7.351  46.922 14.772 1.00 24.83 ? 431 HOH D O   1 
HETATM 2096 O O   . HOH D 3 .   ? 6.248  28.714 29.284 1.00 24.48 ? 432 HOH D O   1 
HETATM 2097 O O   . HOH D 3 .   ? 26.582 42.464 -2.586 1.00 32.11 ? 433 HOH D O   1 
HETATM 2098 O O   . HOH D 3 .   ? 42.106 38.586 20.278 1.00 26.67 ? 434 HOH D O   1 
HETATM 2099 O O   . HOH D 3 .   ? 6.834  30.235 26.788 1.00 19.93 ? 435 HOH D O   1 
HETATM 2100 O O   . HOH D 3 .   ? 42.575 43.356 6.779  1.00 24.08 ? 436 HOH D O   1 
HETATM 2101 O O   . HOH D 3 .   ? 4.090  21.030 22.139 1.00 25.98 ? 437 HOH D O   1 
HETATM 2102 O O   . HOH D 3 .   ? 13.500 19.276 40.536 1.00 25.74 ? 438 HOH D O   1 
HETATM 2103 O O   . HOH D 3 .   ? 2.705  24.972 23.751 1.00 24.44 ? 439 HOH D O   1 
HETATM 2104 O O   . HOH D 3 .   ? 35.629 33.649 16.220 1.00 29.99 ? 440 HOH D O   1 
HETATM 2105 O O   . HOH D 3 .   ? 0.946  41.137 16.028 1.00 28.42 ? 441 HOH D O   1 
HETATM 2106 O O   . HOH D 3 .   ? 31.868 38.389 0.316  1.00 24.34 ? 442 HOH D O   1 
HETATM 2107 O O   . HOH D 3 .   ? 15.049 13.957 24.650 1.00 32.96 ? 443 HOH D O   1 
HETATM 2108 O O   . HOH D 3 .   ? 7.399  16.056 19.929 1.00 26.98 ? 444 HOH D O   1 
HETATM 2109 O O   . HOH D 3 .   ? 39.687 40.935 -1.372 1.00 29.78 ? 445 HOH D O   1 
HETATM 2110 O O   . HOH D 3 .   ? 29.518 18.180 27.726 1.00 23.69 ? 446 HOH D O   1 
HETATM 2111 O O   . HOH D 3 .   ? 25.731 29.761 19.703 1.00 21.98 ? 447 HOH D O   1 
HETATM 2112 O O   . HOH D 3 .   ? 11.904 26.695 5.737  1.00 26.17 ? 448 HOH D O   1 
HETATM 2113 O O   . HOH D 3 .   ? 37.486 13.737 10.775 1.00 23.97 ? 449 HOH D O   1 
HETATM 2114 O O   . HOH D 3 .   ? 16.753 14.388 37.569 1.00 34.08 ? 450 HOH D O   1 
HETATM 2115 O O   . HOH D 3 .   ? 22.578 18.164 31.253 1.00 26.82 ? 451 HOH D O   1 
HETATM 2116 O O   . HOH D 3 .   ? 22.740 54.284 18.364 1.00 27.29 ? 452 HOH D O   1 
HETATM 2117 O O   . HOH D 3 .   ? 30.337 31.391 0.091  1.00 25.80 ? 453 HOH D O   1 
HETATM 2118 O O   . HOH D 3 .   ? 7.786  27.930 8.527  1.00 24.94 ? 454 HOH D O   1 
HETATM 2119 O O   . HOH D 3 .   ? 15.273 18.264 3.808  1.00 30.89 ? 455 HOH D O   1 
HETATM 2120 O O   . HOH D 3 .   ? 20.823 31.969 9.476  1.00 28.91 ? 456 HOH D O   1 
HETATM 2121 O O   . HOH D 3 .   ? 4.074  44.664 20.409 1.00 24.43 ? 457 HOH D O   1 
HETATM 2122 O O   . HOH D 3 .   ? 47.811 39.470 12.085 1.00 36.52 ? 458 HOH D O   1 
HETATM 2123 O O   . HOH D 3 .   ? 1.275  36.157 19.317 1.00 28.10 ? 459 HOH D O   1 
HETATM 2124 O O   . HOH D 3 .   ? 35.885 32.973 21.125 1.00 28.33 ? 460 HOH D O   1 
HETATM 2125 O O   . HOH D 3 .   ? 32.139 22.866 -6.603 1.00 23.90 ? 461 HOH D O   1 
HETATM 2126 O O   . HOH D 3 .   ? 11.636 33.264 34.088 1.00 30.83 ? 462 HOH D O   1 
HETATM 2127 O O   . HOH D 3 .   ? 26.484 44.045 19.610 1.00 31.49 ? 463 HOH D O   1 
HETATM 2128 O O   . HOH D 3 .   ? 21.276 36.435 20.860 1.00 29.84 ? 464 HOH D O   1 
HETATM 2129 O O   . HOH D 3 .   ? 23.773 14.766 -1.920 1.00 31.07 ? 465 HOH D O   1 
HETATM 2130 O O   . HOH D 3 .   ? 24.833 31.924 1.175  1.00 27.63 ? 466 HOH D O   1 
HETATM 2131 O O   . HOH D 3 .   ? 10.070 14.960 27.181 1.00 33.64 ? 467 HOH D O   1 
HETATM 2132 O O   . HOH D 3 .   ? 30.149 33.973 -1.740 1.00 33.24 ? 468 HOH D O   1 
HETATM 2133 O O   . HOH D 3 .   ? 16.786 22.024 5.612  1.00 29.16 ? 469 HOH D O   1 
HETATM 2134 O O   . HOH D 3 .   ? 3.915  24.083 30.458 1.00 27.65 ? 470 HOH D O   1 
HETATM 2135 O O   . HOH D 3 .   ? 15.989 11.438 20.634 1.00 30.76 ? 471 HOH D O   1 
HETATM 2136 O O   . HOH D 3 .   ? 4.893  24.048 14.081 1.00 29.64 ? 472 HOH D O   1 
HETATM 2137 O O   . HOH D 3 .   ? 19.290 41.862 4.371  1.00 28.73 ? 473 HOH D O   1 
HETATM 2138 O O   . HOH D 3 .   ? 16.404 38.439 35.704 1.00 24.00 ? 474 HOH D O   1 
HETATM 2139 O O   . HOH D 3 .   ? 9.656  47.594 21.678 1.00 28.75 ? 475 HOH D O   1 
HETATM 2140 O O   . HOH D 3 .   ? 38.369 26.107 5.069  1.00 24.59 ? 476 HOH D O   1 
HETATM 2141 O O   . HOH D 3 .   ? 15.113 32.677 6.774  1.00 31.40 ? 477 HOH D O   1 
HETATM 2142 O O   . HOH D 3 .   ? 11.652 51.689 20.143 1.00 30.46 ? 478 HOH D O   1 
HETATM 2143 O O   . HOH D 3 .   ? 18.953 14.778 2.604  1.00 29.67 ? 479 HOH D O   1 
HETATM 2144 O O   . HOH D 3 .   ? 4.760  17.636 19.842 1.00 24.40 ? 480 HOH D O   1 
HETATM 2145 O O   . HOH D 3 .   ? 46.365 37.681 10.359 1.00 31.73 ? 481 HOH D O   1 
HETATM 2146 O O   . HOH D 3 .   ? 0.862  32.055 24.001 1.00 29.31 ? 482 HOH D O   1 
HETATM 2147 O O   . HOH D 3 .   ? 42.216 42.704 25.605 1.00 30.22 ? 483 HOH D O   1 
HETATM 2148 O O   . HOH D 3 .   ? 34.515 47.090 13.320 1.00 28.69 ? 484 HOH D O   1 
HETATM 2149 O O   . HOH D 3 .   ? 45.098 24.645 10.235 1.00 33.54 ? 485 HOH D O   1 
HETATM 2150 O O   . HOH D 3 .   ? 12.644 51.048 12.701 1.00 30.91 ? 486 HOH D O   1 
HETATM 2151 O O   . HOH D 3 .   ? 11.833 14.099 19.108 1.00 26.67 ? 487 HOH D O   1 
HETATM 2152 O O   . HOH D 3 .   ? 39.688 25.805 8.824  1.00 39.46 ? 488 HOH D O   1 
HETATM 2153 O O   . HOH D 3 .   ? 32.212 20.064 -5.735 1.00 25.61 ? 489 HOH D O   1 
HETATM 2154 O O   . HOH D 3 .   ? 1.347  34.046 25.573 1.00 34.27 ? 490 HOH D O   1 
HETATM 2155 O O   . HOH D 3 .   ? 24.906 29.594 0.097  1.00 33.47 ? 491 HOH D O   1 
HETATM 2156 O O   . HOH D 3 .   ? 25.252 23.698 -5.354 1.00 25.67 ? 492 HOH D O   1 
HETATM 2157 O O   . HOH D 3 .   ? 17.119 41.675 28.232 1.00 27.75 ? 493 HOH D O   1 
HETATM 2158 O O   . HOH D 3 .   ? 11.574 14.287 31.173 1.00 23.92 ? 494 HOH D O   1 
HETATM 2159 O O   . HOH D 3 .   ? 39.476 45.981 5.866  1.00 29.12 ? 495 HOH D O   1 
HETATM 2160 O O   . HOH D 3 .   ? 29.437 31.983 36.584 1.00 27.49 ? 496 HOH D O   1 
HETATM 2161 O O   . HOH D 3 .   ? 31.502 38.364 29.109 1.00 32.95 ? 497 HOH D O   1 
HETATM 2162 O O   . HOH D 3 .   ? 47.210 36.435 17.969 1.00 33.69 ? 498 HOH D O   1 
HETATM 2163 O O   . HOH D 3 .   ? 33.636 48.748 15.244 1.00 23.79 ? 499 HOH D O   1 
HETATM 2164 O O   . HOH D 3 .   ? 12.437 52.528 17.491 1.00 34.44 ? 500 HOH D O   1 
HETATM 2165 O O   . HOH D 3 .   ? 10.569 14.433 21.745 1.00 29.54 ? 501 HOH D O   1 
HETATM 2166 O O   . HOH D 3 .   ? 38.412 17.688 13.294 1.00 31.07 ? 502 HOH D O   1 
HETATM 2167 O O   . HOH D 3 .   ? 12.804 36.822 37.226 1.00 28.43 ? 503 HOH D O   1 
HETATM 2168 O O   . HOH D 3 .   ? 20.208 38.998 2.727  1.00 31.15 ? 504 HOH D O   1 
HETATM 2169 O O   . HOH D 3 .   ? 29.476 11.560 16.508 1.00 28.03 ? 505 HOH D O   1 
HETATM 2170 O O   . HOH D 3 .   ? 22.997 35.056 21.922 1.00 34.47 ? 506 HOH D O   1 
HETATM 2171 O O   . HOH D 3 .   ? 21.968 54.715 22.899 1.00 43.85 ? 507 HOH D O   1 
HETATM 2172 O O   . HOH D 3 .   ? 35.917 31.487 18.373 1.00 28.42 ? 508 HOH D O   1 
HETATM 2173 O O   . HOH D 3 .   ? 17.138 17.654 41.325 1.00 32.22 ? 509 HOH D O   1 
HETATM 2174 O O   . HOH D 3 .   ? 18.956 32.438 5.517  1.00 36.67 ? 510 HOH D O   1 
HETATM 2175 O O   . HOH D 3 .   ? 9.984  25.263 35.830 1.00 29.98 ? 511 HOH D O   1 
HETATM 2176 O O   . HOH D 3 .   ? 33.225 12.563 18.881 1.00 38.85 ? 512 HOH D O   1 
HETATM 2177 O O   . HOH D 3 .   ? 39.207 18.143 9.697  1.00 28.45 ? 513 HOH D O   1 
HETATM 2178 O O   . HOH D 3 .   ? 32.707 47.555 22.197 1.00 29.96 ? 514 HOH D O   1 
HETATM 2179 O O   . HOH D 3 .   ? 18.362 17.455 7.709  1.00 27.44 ? 515 HOH D O   1 
HETATM 2180 O O   . HOH D 3 .   ? 17.980 12.921 6.732  1.00 32.59 ? 516 HOH D O   1 
HETATM 2181 O O   . HOH D 3 .   ? 16.044 11.989 13.881 1.00 30.18 ? 517 HOH D O   1 
HETATM 2182 O O   . HOH D 3 .   ? 19.474 36.843 4.639  1.00 28.57 ? 518 HOH D O   1 
HETATM 2183 O O   . HOH D 3 .   ? 33.093 9.371  3.611  1.00 37.85 ? 519 HOH D O   1 
HETATM 2184 O O   . HOH D 3 .   ? 24.678 36.397 23.434 1.00 31.28 ? 520 HOH D O   1 
HETATM 2185 O O   . HOH D 3 .   ? 43.485 41.887 18.031 1.00 32.55 ? 521 HOH D O   1 
HETATM 2186 O O   . HOH D 3 .   ? 9.020  37.003 30.360 1.00 30.99 ? 522 HOH D O   1 
HETATM 2187 O O   . HOH D 3 .   ? 46.352 35.458 11.865 1.00 26.82 ? 523 HOH D O   1 
HETATM 2188 O O   . HOH D 3 .   ? 4.584  23.318 17.290 1.00 37.76 ? 524 HOH D O   1 
HETATM 2189 O O   . HOH D 3 .   ? 13.521 28.555 4.965  1.00 31.74 ? 525 HOH D O   1 
HETATM 2190 O O   . HOH D 3 .   ? 36.116 28.930 20.229 1.00 30.71 ? 526 HOH D O   1 
HETATM 2191 O O   . HOH D 3 .   ? 16.561 35.108 4.251  1.00 44.84 ? 527 HOH D O   1 
HETATM 2192 O O   . HOH D 3 .   ? 18.948 16.052 40.489 1.00 32.92 ? 528 HOH D O   1 
HETATM 2193 O O   . HOH D 3 .   ? 9.246  30.607 34.604 1.00 31.89 ? 529 HOH D O   1 
HETATM 2194 O O   . HOH D 3 .   ? 12.285 49.249 24.095 1.00 35.51 ? 530 HOH D O   1 
HETATM 2195 O O   . HOH D 3 .   ? 29.261 27.646 -1.510 1.00 39.15 ? 531 HOH D O   1 
HETATM 2196 O O   . HOH D 3 .   ? 22.224 11.387 20.538 1.00 36.14 ? 532 HOH D O   1 
HETATM 2197 O O   . HOH D 3 .   ? 16.341 12.774 35.443 1.00 37.92 ? 533 HOH D O   1 
HETATM 2198 O O   . HOH D 3 .   ? 30.817 9.263  8.379  1.00 29.25 ? 534 HOH D O   1 
HETATM 2199 O O   . HOH D 3 .   ? 27.245 29.935 30.716 1.00 27.26 ? 535 HOH D O   1 
HETATM 2200 O O   . HOH D 3 .   ? 40.928 28.334 7.674  1.00 48.61 ? 536 HOH D O   1 
HETATM 2201 O O   . HOH D 3 .   ? 3.958  22.606 24.289 1.00 30.78 ? 537 HOH D O   1 
HETATM 2202 O O   . HOH D 3 .   ? 16.864 30.742 6.827  1.00 29.53 ? 538 HOH D O   1 
HETATM 2203 O O   . HOH D 3 .   ? 23.347 34.662 18.940 1.00 28.15 ? 539 HOH D O   1 
HETATM 2204 O O   . HOH D 3 .   ? 3.440  21.710 19.707 1.00 32.97 ? 540 HOH D O   1 
HETATM 2205 O O   . HOH D 3 .   ? 27.138 37.368 23.819 1.00 34.68 ? 541 HOH D O   1 
HETATM 2206 O O   . HOH D 3 .   ? 6.128  44.875 23.365 1.00 39.22 ? 542 HOH D O   1 
HETATM 2207 O O   . HOH D 3 .   ? 22.204 49.310 17.468 1.00 28.22 ? 543 HOH D O   1 
HETATM 2208 O O   . HOH D 3 .   ? 24.954 12.321 17.755 1.00 38.18 ? 544 HOH D O   1 
HETATM 2209 O O   . HOH D 3 .   ? 47.319 37.033 1.765  1.00 33.90 ? 545 HOH D O   1 
HETATM 2210 O O   . HOH D 3 .   ? 6.162  34.500 9.951  1.00 32.72 ? 546 HOH D O   1 
HETATM 2211 O O   . HOH D 3 .   ? 15.023 43.341 6.436  1.00 25.78 ? 547 HOH D O   1 
HETATM 2212 O O   . HOH D 3 .   ? 39.087 12.506 13.209 1.00 41.31 ? 548 HOH D O   1 
HETATM 2213 O O   . HOH D 3 .   ? 21.852 38.569 28.265 1.00 38.39 ? 549 HOH D O   1 
HETATM 2214 O O   . HOH D 3 .   ? 25.440 30.712 25.260 1.00 31.09 ? 550 HOH D O   1 
HETATM 2215 O O   . HOH D 3 .   ? 21.877 23.580 -1.241 1.00 34.18 ? 551 HOH D O   1 
HETATM 2216 O O   . HOH D 3 .   ? 17.321 42.243 6.244  1.00 32.57 ? 552 HOH D O   1 
HETATM 2217 O O   . HOH D 3 .   ? 9.168  34.702 31.650 1.00 32.81 ? 553 HOH D O   1 
HETATM 2218 O O   . HOH D 3 .   ? -1.004 31.949 21.787 1.00 43.81 ? 554 HOH D O   1 
HETATM 2219 O O   . HOH D 3 .   ? 4.777  45.855 14.844 1.00 33.38 ? 555 HOH D O   1 
HETATM 2220 O O   . HOH D 3 .   ? 8.270  35.294 28.264 1.00 26.17 ? 556 HOH D O   1 
HETATM 2221 O O   . HOH D 3 .   ? 15.688 31.936 37.960 1.00 38.99 ? 557 HOH D O   1 
HETATM 2222 O O   . HOH D 3 .   ? 13.222 31.043 5.936  1.00 34.19 ? 558 HOH D O   1 
HETATM 2223 O O   . HOH D 3 .   ? 35.854 16.626 22.754 1.00 36.17 ? 559 HOH D O   1 
HETATM 2224 O O   . HOH D 3 .   ? 22.138 32.957 11.720 1.00 27.86 ? 560 HOH D O   1 
HETATM 2225 O O   . HOH D 3 .   ? 32.345 53.789 15.756 1.00 43.85 ? 561 HOH D O   1 
HETATM 2226 O O   . HOH D 3 .   ? 25.298 13.566 21.373 1.00 34.07 ? 562 HOH D O   1 
HETATM 2227 O O   . HOH D 3 .   ? 49.750 28.842 13.177 1.00 36.16 ? 563 HOH D O   1 
HETATM 2228 O O   . HOH D 3 .   ? 13.693 49.675 26.220 1.00 36.26 ? 564 HOH D O   1 
HETATM 2229 O O   . HOH D 3 .   ? 18.112 42.352 30.510 1.00 32.55 ? 565 HOH D O   1 
HETATM 2230 O O   . HOH D 3 .   ? 8.304  46.176 23.526 1.00 30.14 ? 566 HOH D O   1 
HETATM 2231 O O   . HOH D 3 .   ? 41.926 23.145 7.955  1.00 32.69 ? 567 HOH D O   1 
HETATM 2232 O O   . HOH D 3 .   ? 25.208 38.262 -2.770 1.00 35.01 ? 568 HOH D O   1 
HETATM 2233 O O   . HOH D 3 .   ? 37.433 14.101 3.636  1.00 27.10 ? 569 HOH D O   1 
HETATM 2234 O O   . HOH D 3 .   ? 24.350 45.714 19.414 1.00 39.93 ? 570 HOH D O   1 
HETATM 2235 O O   . HOH D 3 .   ? 2.629  22.423 26.923 1.00 33.87 ? 571 HOH D O   1 
HETATM 2236 O O   . HOH D 3 .   ? 21.895 33.629 23.501 1.00 43.34 ? 572 HOH D O   1 
HETATM 2237 O O   . HOH D 3 .   ? 19.066 41.543 26.422 1.00 37.40 ? 573 HOH D O   1 
HETATM 2238 O O   . HOH D 3 .   ? 3.770  27.813 28.947 1.00 31.55 ? 574 HOH D O   1 
HETATM 2239 O O   . HOH D 3 .   ? 38.432 12.771 8.494  1.00 33.88 ? 575 HOH D O   1 
HETATM 2240 O O   . HOH D 3 .   ? 40.857 27.396 5.272  1.00 39.49 ? 576 HOH D O   1 
HETATM 2241 O O   . HOH D 3 .   ? 13.270 21.921 7.880  1.00 36.50 ? 577 HOH D O   1 
HETATM 2242 O O   . HOH D 3 .   ? 16.768 39.670 6.006  1.00 38.09 ? 578 HOH D O   1 
HETATM 2243 O O   . HOH D 3 .   ? 38.907 14.768 15.589 1.00 38.68 ? 579 HOH D O   1 
HETATM 2244 O O   . HOH D 3 .   ? 42.504 26.453 7.038  1.00 42.44 ? 580 HOH D O   1 
HETATM 2245 O O   . HOH D 3 .   ? 33.200 41.309 -1.777 1.00 41.82 ? 581 HOH D O   1 
HETATM 2246 O O   . HOH D 3 .   ? 38.163 18.746 -0.544 1.00 37.89 ? 582 HOH D O   1 
HETATM 2247 O O   . HOH D 3 .   ? 15.983 33.892 8.798  1.00 36.60 ? 583 HOH D O   1 
HETATM 2248 O O   . HOH D 3 .   ? 8.238  48.428 17.508 1.00 34.88 ? 584 HOH D O   1 
HETATM 2249 O O   . HOH D 3 .   ? 16.368 26.514 0.560  1.00 34.52 ? 585 HOH D O   1 
HETATM 2250 O O   . HOH D 3 .   ? 4.401  37.820 12.671 1.00 40.06 ? 586 HOH D O   1 
HETATM 2251 O O   . HOH D 3 .   ? 48.684 42.769 10.032 1.00 35.59 ? 587 HOH D O   1 
HETATM 2252 O O   . HOH D 3 .   ? 15.420 19.866 8.344  1.00 30.84 ? 588 HOH D O   1 
HETATM 2253 O O   . HOH D 3 .   ? 35.870 19.481 -2.785 1.00 35.80 ? 589 HOH D O   1 
HETATM 2254 O O   . HOH D 3 .   ? 37.123 17.498 -5.966 1.00 35.68 ? 590 HOH D O   1 
HETATM 2255 O O   . HOH D 3 .   ? 9.240  22.986 7.821  1.00 33.55 ? 591 HOH D O   1 
HETATM 2256 O O   . HOH D 3 .   ? 2.502  36.840 16.069 1.00 32.87 ? 592 HOH D O   1 
HETATM 2257 O O   . HOH D 3 .   ? 32.511 12.888 21.307 1.00 36.01 ? 593 HOH D O   1 
HETATM 2258 O O   . HOH D 3 .   ? 24.736 35.068 -0.969 1.00 35.07 ? 594 HOH D O   1 
HETATM 2259 O O   . HOH D 3 .   ? 55.320 32.465 11.892 1.00 35.76 ? 595 HOH D O   1 
HETATM 2260 O O   . HOH D 3 .   ? 3.001  28.182 26.575 1.00 35.80 ? 596 HOH D O   1 
HETATM 2261 O O   . HOH D 3 .   ? 4.035  23.625 7.820  1.00 32.47 ? 597 HOH D O   1 
HETATM 2262 O O   . HOH D 3 .   ? 40.717 44.664 20.304 1.00 39.29 ? 598 HOH D O   1 
HETATM 2263 O O   . HOH D 3 .   ? 35.199 48.579 25.923 1.00 39.39 ? 599 HOH D O   1 
HETATM 2264 O O   . HOH D 3 .   ? 15.747 24.732 -2.592 1.00 43.30 ? 600 HOH D O   1 
HETATM 2265 O O   . HOH D 3 .   ? 14.109 55.140 15.375 1.00 39.61 ? 601 HOH D O   1 
HETATM 2266 O O   . HOH D 3 .   ? 33.845 48.371 4.310  1.00 34.30 ? 602 HOH D O   1 
HETATM 2267 O O   . HOH D 3 .   ? 10.037 28.771 7.461  1.00 35.23 ? 603 HOH D O   1 
HETATM 2268 O O   . HOH D 3 .   ? 4.037  47.073 21.729 1.00 33.25 ? 604 HOH D O   1 
HETATM 2269 O O   . HOH D 3 .   ? 37.175 10.765 13.623 1.00 38.01 ? 605 HOH D O   1 
HETATM 2270 O O   . HOH D 3 .   ? 12.097 23.841 32.055 1.00 36.72 ? 606 HOH D O   1 
HETATM 2271 O O   . HOH D 3 .   ? 39.840 21.516 0.000  0.50 21.00 ? 607 HOH D O   1 
HETATM 2272 O O   . HOH D 3 .   ? 27.864 37.827 29.625 0.50 22.00 ? 608 HOH D O   1 
HETATM 2273 O O   . HOH D 3 .   ? 7.180  29.498 33.247 1.00 27.00 ? 609 HOH D O   1 
HETATM 2274 O O   . HOH D 3 .   ? 16.393 28.457 5.267  1.00 28.00 ? 610 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET D . n 
A 1 2   LEU 2   2   2   LEU LEU D . n 
A 1 3   ALA 3   3   3   ALA ALA D . n 
A 1 4   LYS 4   4   4   LYS LYS D . n 
A 1 5   ARG 5   5   5   ARG ARG D . n 
A 1 6   ILE 6   6   6   ILE ILE D . n 
A 1 7   ILE 7   7   7   ILE ILE D . n 
A 1 8   ALA 8   8   8   ALA ALA D . n 
A 1 9   CYS 9   9   9   CYS CYS D . n 
A 1 10  LEU 10  10  10  LEU LEU D . n 
A 1 11  ASP 11  11  11  ASP ASP D . n 
A 1 12  VAL 12  12  12  VAL VAL D . n 
A 1 13  LYS 13  13  13  LYS LYS D . n 
A 1 14  ASP 14  14  14  ASP ASP D . n 
A 1 15  GLY 15  15  15  GLY GLY D . n 
A 1 16  ARG 16  16  16  ARG ARG D . n 
A 1 17  VAL 17  17  17  VAL VAL D . n 
A 1 18  VAL 18  18  18  VAL VAL D . n 
A 1 19  LYS 19  19  19  LYS LYS D . n 
A 1 20  GLY 20  20  20  GLY GLY D . n 
A 1 21  SER 21  21  21  SER SER D . n 
A 1 22  ASN 22  22  22  ASN ASN D . n 
A 1 23  PHE 23  23  23  PHE PHE D . n 
A 1 24  GLU 24  24  24  GLU GLU D . n 
A 1 25  ASN 25  25  25  ASN ASN D . n 
A 1 26  LEU 26  26  26  LEU LEU D . n 
A 1 27  ARG 27  27  27  ARG ARG D . n 
A 1 28  ASP 28  28  28  ASP ASP D . n 
A 1 29  SER 29  29  29  SER SER D . n 
A 1 30  GLY 30  30  30  GLY GLY D . n 
A 1 31  ASP 31  31  31  ASP ASP D . n 
A 1 32  PRO 32  32  32  PRO PRO D . n 
A 1 33  VAL 33  33  33  VAL VAL D . n 
A 1 34  GLU 34  34  34  GLU GLU D . n 
A 1 35  LEU 35  35  35  LEU LEU D . n 
A 1 36  GLY 36  36  36  GLY GLY D . n 
A 1 37  LYS 37  37  37  LYS LYS D . n 
A 1 38  PHE 38  38  38  PHE PHE D . n 
A 1 39  TYR 39  39  39  TYR TYR D . n 
A 1 40  SER 40  40  40  SER SER D . n 
A 1 41  GLU 41  41  41  GLU GLU D . n 
A 1 42  ILE 42  42  42  ILE ILE D . n 
A 1 43  GLY 43  43  43  GLY GLY D . n 
A 1 44  ILE 44  44  44  ILE ILE D . n 
A 1 45  ASP 45  45  45  ASP ASP D . n 
A 1 46  GLU 46  46  46  GLU GLU D . n 
A 1 47  LEU 47  47  47  LEU LEU D . n 
A 1 48  VAL 48  48  48  VAL VAL D . n 
A 1 49  PHE 49  49  49  PHE PHE D . n 
A 1 50  LEU 50  50  50  LEU LEU D . n 
A 1 51  ASP 51  51  51  ASP ASP D . n 
A 1 52  ILE 52  52  52  ILE ILE D . n 
A 1 53  THR 53  53  53  THR THR D . n 
A 1 54  ALA 54  54  54  ALA ALA D . n 
A 1 55  SER 55  55  55  SER SER D . n 
A 1 56  VAL 56  56  56  VAL VAL D . n 
A 1 57  GLU 57  57  57  GLU GLU D . n 
A 1 58  LYS 58  58  58  LYS LYS D . n 
A 1 59  ARG 59  59  59  ARG ARG D . n 
A 1 60  LYS 60  60  60  LYS LYS D . n 
A 1 61  THR 61  61  61  THR THR D . n 
A 1 62  MET 62  62  62  MET MET D . n 
A 1 63  LEU 63  63  63  LEU LEU D . n 
A 1 64  GLU 64  64  64  GLU GLU D . n 
A 1 65  LEU 65  65  65  LEU LEU D . n 
A 1 66  VAL 66  66  66  VAL VAL D . n 
A 1 67  GLU 67  67  67  GLU GLU D . n 
A 1 68  LYS 68  68  68  LYS LYS D . n 
A 1 69  VAL 69  69  69  VAL VAL D . n 
A 1 70  ALA 70  70  70  ALA ALA D . n 
A 1 71  GLU 71  71  71  GLU GLU D . n 
A 1 72  GLN 72  72  72  GLN GLN D . n 
A 1 73  ILE 73  73  73  ILE ILE D . n 
A 1 74  ASP 74  74  74  ASP ASP D . n 
A 1 75  ILE 75  75  75  ILE ILE D . n 
A 1 76  PRO 76  76  76  PRO PRO D . n 
A 1 77  PHE 77  77  77  PHE PHE D . n 
A 1 78  THR 78  78  78  THR THR D . n 
A 1 79  VAL 79  79  79  VAL VAL D . n 
A 1 80  GLY 80  80  80  GLY GLY D . n 
A 1 81  GLY 81  81  81  GLY GLY D . n 
A 1 82  GLY 82  82  82  GLY GLY D . n 
A 1 83  ILE 83  83  83  ILE ILE D . n 
A 1 84  HIS 84  84  84  HIS HIS D . n 
A 1 85  ASP 85  85  85  ASP ASP D . n 
A 1 86  PHE 86  86  86  PHE PHE D . n 
A 1 87  GLU 87  87  87  GLU GLU D . n 
A 1 88  THR 88  88  88  THR THR D . n 
A 1 89  ALA 89  89  89  ALA ALA D . n 
A 1 90  SER 90  90  90  SER SER D . n 
A 1 91  GLU 91  91  91  GLU GLU D . n 
A 1 92  LEU 92  92  92  LEU LEU D . n 
A 1 93  ILE 93  93  93  ILE ILE D . n 
A 1 94  LEU 94  94  94  LEU LEU D . n 
A 1 95  ARG 95  95  95  ARG ARG D . n 
A 1 96  GLY 96  96  96  GLY GLY D . n 
A 1 97  ALA 97  97  97  ALA ALA D . n 
A 1 98  ASP 98  98  98  ASP ASP D . n 
A 1 99  LYS 99  99  99  LYS LYS D . n 
A 1 100 VAL 100 100 100 VAL VAL D . n 
A 1 101 SER 101 101 101 SER SER D . n 
A 1 102 ILE 102 102 102 ILE ILE D . n 
A 1 103 ASN 103 103 103 ASN ASN D . n 
A 1 104 THR 104 104 104 THR THR D . n 
A 1 105 ALA 105 105 105 ALA ALA D . n 
A 1 106 ALA 106 106 106 ALA ALA D . n 
A 1 107 VAL 107 107 107 VAL VAL D . n 
A 1 108 GLU 108 108 108 GLU GLU D . n 
A 1 109 ASN 109 109 109 ASN ASN D . n 
A 1 110 PRO 110 110 110 PRO PRO D . n 
A 1 111 SER 111 111 111 SER SER D . n 
A 1 112 LEU 112 112 112 LEU LEU D . n 
A 1 113 ILE 113 113 113 ILE ILE D . n 
A 1 114 THR 114 114 114 THR THR D . n 
A 1 115 GLN 115 115 115 GLN GLN D . n 
A 1 116 ILE 116 116 116 ILE ILE D . n 
A 1 117 ALA 117 117 117 ALA ALA D . n 
A 1 118 GLN 118 118 118 GLN GLN D . n 
A 1 119 THR 119 119 119 THR THR D . n 
A 1 120 PHE 120 120 120 PHE PHE D . n 
A 1 121 GLY 121 121 121 GLY GLY D . n 
A 1 122 SER 122 122 122 SER SER D . n 
A 1 123 GLN 123 123 123 GLN GLN D . n 
A 1 124 ALA 124 124 124 ALA ALA D . n 
A 1 125 VAL 125 125 125 VAL VAL D . n 
A 1 126 VAL 126 126 126 VAL VAL D . n 
A 1 127 VAL 127 127 127 VAL VAL D . n 
A 1 128 ALA 128 128 128 ALA ALA D . n 
A 1 129 ILE 129 129 129 ILE ILE D . n 
A 1 130 ASP 130 130 130 ASP ASP D . n 
A 1 131 ALA 131 131 131 ALA ALA D . n 
A 1 132 LYS 132 132 132 LYS LYS D . n 
A 1 133 ARG 133 133 133 ARG ARG D . n 
A 1 134 VAL 134 134 134 VAL VAL D . n 
A 1 135 ASP 135 135 135 ASP ASP D . n 
A 1 136 GLY 136 136 136 GLY GLY D . n 
A 1 137 GLU 137 137 137 GLU GLU D . n 
A 1 138 PHE 138 138 138 PHE PHE D . n 
A 1 139 MET 139 139 139 MET MET D . n 
A 1 140 VAL 140 140 140 VAL VAL D . n 
A 1 141 PHE 141 141 141 PHE PHE D . n 
A 1 142 THR 142 142 142 THR THR D . n 
A 1 143 TYR 143 143 143 TYR TYR D . n 
A 1 144 SER 144 144 144 SER SER D . n 
A 1 145 GLY 145 145 145 GLY GLY D . n 
A 1 146 LYS 146 146 146 LYS LYS D . n 
A 1 147 LYS 147 147 147 LYS LYS D . n 
A 1 148 ASN 148 148 148 ASN ASN D . n 
A 1 149 THR 149 149 149 THR THR D . n 
A 1 150 GLY 150 150 150 GLY GLY D . n 
A 1 151 ILE 151 151 151 ILE ILE D . n 
A 1 152 LEU 152 152 152 LEU LEU D . n 
A 1 153 LEU 153 153 153 LEU LEU D . n 
A 1 154 ARG 154 154 154 ARG ARG D . n 
A 1 155 ASP 155 155 155 ASP ASP D . n 
A 1 156 TRP 156 156 156 TRP TRP D . n 
A 1 157 VAL 157 157 157 VAL VAL D . n 
A 1 158 VAL 158 158 158 VAL VAL D . n 
A 1 159 GLU 159 159 159 GLU GLU D . n 
A 1 160 VAL 160 160 160 VAL VAL D . n 
A 1 161 GLU 161 161 161 GLU GLU D . n 
A 1 162 LYS 162 162 162 LYS LYS D . n 
A 1 163 ARG 163 163 163 ARG ARG D . n 
A 1 164 GLY 164 164 164 GLY GLY D . n 
A 1 165 ALA 165 165 165 ALA ALA D . n 
A 1 166 GLY 166 166 166 GLY GLY D . n 
A 1 167 GLU 167 167 167 GLU GLU D . n 
A 1 168 ILE 168 168 168 ILE ILE D . n 
A 1 169 LEU 169 169 169 LEU LEU D . n 
A 1 170 LEU 170 170 170 LEU LEU D . n 
A 1 171 THR 171 171 171 THR THR D . n 
A 1 172 SER 172 172 172 SER SER D . n 
A 1 173 ILE 173 173 173 ILE ILE D . n 
A 1 174 ASP 174 174 174 ASP ASP D . n 
A 1 175 ARG 175 175 175 ARG ARG D . n 
A 1 176 ASP 176 176 176 ASP ASP D . n 
A 1 177 GLY 177 177 177 GLY GLY D . n 
A 1 178 THR 178 178 178 THR THR D . n 
A 1 179 LYS 179 179 179 LYS LYS D . n 
A 1 180 SER 180 180 180 SER SER D . n 
A 1 181 GLY 181 181 181 GLY GLY D . n 
A 1 182 TYR 182 182 182 TYR TYR D . n 
A 1 183 ASP 183 183 183 ASP ASP D . n 
A 1 184 THR 184 184 184 THR THR D . n 
A 1 185 GLU 185 185 185 GLU GLU D . n 
A 1 186 MET 186 186 186 MET MET D . n 
A 1 187 ILE 187 187 187 ILE ILE D . n 
A 1 188 ARG 188 188 188 ARG ARG D . n 
A 1 189 PHE 189 189 189 PHE PHE D . n 
A 1 190 VAL 190 190 190 VAL VAL D . n 
A 1 191 ARG 191 191 191 ARG ARG D . n 
A 1 192 PRO 192 192 192 PRO PRO D . n 
A 1 193 LEU 193 193 193 LEU LEU D . n 
A 1 194 THR 194 194 194 THR THR D . n 
A 1 195 THR 195 195 195 THR THR D . n 
A 1 196 LEU 196 196 196 LEU LEU D . n 
A 1 197 PRO 197 197 197 PRO PRO D . n 
A 1 198 ILE 198 198 198 ILE ILE D . n 
A 1 199 ILE 199 199 199 ILE ILE D . n 
A 1 200 ALA 200 200 200 ALA ALA D . n 
A 1 201 SER 201 201 201 SER SER D . n 
A 1 202 GLY 202 202 202 GLY GLY D . n 
A 1 203 GLY 203 203 203 GLY GLY D . n 
A 1 204 ALA 204 204 204 ALA ALA D . n 
A 1 205 GLY 205 205 205 GLY GLY D . n 
A 1 206 LYS 206 206 206 LYS LYS D . n 
A 1 207 MET 207 207 207 MET MET D . n 
A 1 208 GLU 208 208 208 GLU GLU D . n 
A 1 209 HIS 209 209 209 HIS HIS D . n 
A 1 210 PHE 210 210 210 PHE PHE D . n 
A 1 211 LEU 211 211 211 LEU LEU D . n 
A 1 212 GLU 212 212 212 GLU GLU D . n 
A 1 213 ALA 213 213 213 ALA ALA D . n 
A 1 214 PHE 214 214 214 PHE PHE D . n 
A 1 215 LEU 215 215 215 LEU LEU D . n 
A 1 216 ALA 216 216 216 ALA ALA D . n 
A 1 217 GLY 217 217 217 GLY GLY D . n 
A 1 218 ALA 218 218 218 ALA ALA D . n 
A 1 219 ASP 219 219 219 ASP ASP D . n 
A 1 220 ALA 220 220 220 ALA ALA D . n 
A 1 221 ALA 221 221 221 ALA ALA D . n 
A 1 222 LEU 222 222 222 LEU LEU D . n 
A 1 223 ALA 223 223 223 ALA ALA D . n 
A 1 224 ALA 224 224 224 ALA ALA D . n 
A 1 225 SER 225 225 225 SER SER D . n 
A 1 226 VAL 226 226 226 VAL VAL D . n 
A 1 227 PHE 227 227 227 PHE PHE D . n 
A 1 228 HIS 228 228 228 HIS HIS D . n 
A 1 229 PHE 229 229 229 PHE PHE D . n 
A 1 230 ARG 230 230 230 ARG ARG D . n 
A 1 231 GLU 231 231 231 GLU GLU D . n 
A 1 232 ILE 232 232 232 ILE ILE D . n 
A 1 233 ASP 233 233 233 ASP ASP D . n 
A 1 234 VAL 234 234 234 VAL VAL D . n 
A 1 235 ARG 235 235 235 ARG ARG D . n 
A 1 236 GLU 236 236 236 GLU GLU D . n 
A 1 237 LEU 237 237 237 LEU LEU D . n 
A 1 238 LYS 238 238 238 LYS LYS D . n 
A 1 239 GLU 239 239 239 GLU GLU D . n 
A 1 240 TYR 240 240 240 TYR TYR D . n 
A 1 241 LEU 241 241 241 LEU LEU D . n 
A 1 242 LYS 242 242 242 LYS LYS D . n 
A 1 243 LYS 243 243 243 LYS LYS D . n 
A 1 244 HIS 244 244 244 HIS HIS D . n 
A 1 245 GLY 245 245 245 GLY GLY D . n 
A 1 246 VAL 246 246 246 VAL VAL D . n 
A 1 247 ASN 247 247 247 ASN ASN D . n 
A 1 248 VAL 248 248 248 VAL VAL D . n 
A 1 249 ARG 249 249 249 ARG ARG D . n 
A 1 250 LEU 250 250 250 LEU LEU D . n 
A 1 251 GLU 251 251 251 GLU GLU D . n 
A 1 252 GLY 252 252 252 GLY GLY D . n 
A 1 253 LEU 253 253 253 LEU LEU D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 55.7285508006 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 59.2521407314 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 D HOH 607 ? D HOH . 
2 1 D HOH 608 ? D HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-14 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHARP     phasing          . ? 1 
REFMAC    refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            VAL 
_pdbx_validate_rmsd_bond.auth_seq_id_1             79 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            VAL 
_pdbx_validate_rmsd_bond.auth_seq_id_2             79 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            B 
_pdbx_validate_rmsd_bond.bond_value                1.350 
_pdbx_validate_rmsd_bond.bond_target_value         1.524 
_pdbx_validate_rmsd_bond.bond_deviation            -0.174 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.021 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE  D ARG 5   ? ? CZ D ARG 5   ? ? NH1 D ARG 5   ? ? 124.52 120.30 4.22  0.50 N 
2 1 NE  D ARG 5   ? ? CZ D ARG 5   ? ? NH2 D ARG 5   ? ? 117.26 120.30 -3.04 0.50 N 
3 1 NE  D ARG 16  ? ? CZ D ARG 16  ? ? NH1 D ARG 16  ? ? 123.35 120.30 3.05  0.50 N 
4 1 NE  D ARG 16  ? ? CZ D ARG 16  ? ? NH2 D ARG 16  ? ? 117.01 120.30 -3.29 0.50 N 
5 1 CG1 D VAL 79  ? B CB D VAL 79  ? ? CG2 D VAL 79  ? B 125.49 110.90 14.59 1.60 N 
6 1 NE  D ARG 163 ? ? CZ D ARG 163 ? ? NH2 D ARG 163 ? ? 116.84 120.30 -3.46 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS D 19  ? ? -100.67 -150.22 
2 1 ASN D 22  ? ? 43.10   94.34   
3 1 PHE D 23  ? ? -107.63 70.87   
4 1 SER D 55  ? ? -121.46 -88.86  
5 1 GLU D 57  ? ? 80.95   -7.80   
6 1 ASN D 103 ? ? -137.21 -84.48  
7 1 ASN D 109 ? ? -153.11 78.11   
8 1 ALA D 224 ? ? -108.85 -65.41  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   305 305 PO4 PO4 D . 
C 2 PO4 1   306 306 PO4 PO4 D . 
D 3 HOH 1   307 1   HOH HOH D . 
D 3 HOH 2   308 2   HOH HOH D . 
D 3 HOH 3   309 3   HOH HOH D . 
D 3 HOH 4   310 4   HOH HOH D . 
D 3 HOH 5   311 5   HOH HOH D . 
D 3 HOH 6   312 6   HOH HOH D . 
D 3 HOH 7   313 7   HOH HOH D . 
D 3 HOH 8   314 8   HOH HOH D . 
D 3 HOH 9   315 9   HOH HOH D . 
D 3 HOH 10  316 10  HOH HOH D . 
D 3 HOH 11  317 11  HOH HOH D . 
D 3 HOH 12  318 12  HOH HOH D . 
D 3 HOH 13  319 13  HOH HOH D . 
D 3 HOH 14  320 14  HOH HOH D . 
D 3 HOH 15  321 15  HOH HOH D . 
D 3 HOH 16  322 16  HOH HOH D . 
D 3 HOH 17  323 17  HOH HOH D . 
D 3 HOH 18  324 18  HOH HOH D . 
D 3 HOH 19  325 19  HOH HOH D . 
D 3 HOH 20  326 20  HOH HOH D . 
D 3 HOH 21  327 21  HOH HOH D . 
D 3 HOH 22  328 22  HOH HOH D . 
D 3 HOH 23  329 23  HOH HOH D . 
D 3 HOH 24  330 24  HOH HOH D . 
D 3 HOH 25  331 25  HOH HOH D . 
D 3 HOH 26  332 26  HOH HOH D . 
D 3 HOH 27  333 27  HOH HOH D . 
D 3 HOH 28  334 28  HOH HOH D . 
D 3 HOH 29  335 29  HOH HOH D . 
D 3 HOH 30  336 30  HOH HOH D . 
D 3 HOH 31  337 31  HOH HOH D . 
D 3 HOH 32  338 32  HOH HOH D . 
D 3 HOH 33  339 33  HOH HOH D . 
D 3 HOH 34  340 34  HOH HOH D . 
D 3 HOH 35  341 35  HOH HOH D . 
D 3 HOH 36  342 36  HOH HOH D . 
D 3 HOH 37  343 37  HOH HOH D . 
D 3 HOH 38  344 38  HOH HOH D . 
D 3 HOH 39  345 39  HOH HOH D . 
D 3 HOH 40  346 40  HOH HOH D . 
D 3 HOH 41  347 41  HOH HOH D . 
D 3 HOH 42  348 42  HOH HOH D . 
D 3 HOH 43  349 43  HOH HOH D . 
D 3 HOH 44  350 44  HOH HOH D . 
D 3 HOH 45  351 45  HOH HOH D . 
D 3 HOH 46  352 46  HOH HOH D . 
D 3 HOH 47  353 47  HOH HOH D . 
D 3 HOH 48  354 48  HOH HOH D . 
D 3 HOH 49  355 49  HOH HOH D . 
D 3 HOH 50  356 50  HOH HOH D . 
D 3 HOH 51  357 51  HOH HOH D . 
D 3 HOH 52  358 52  HOH HOH D . 
D 3 HOH 53  359 53  HOH HOH D . 
D 3 HOH 54  360 54  HOH HOH D . 
D 3 HOH 55  361 55  HOH HOH D . 
D 3 HOH 56  362 56  HOH HOH D . 
D 3 HOH 57  363 57  HOH HOH D . 
D 3 HOH 58  364 58  HOH HOH D . 
D 3 HOH 59  365 59  HOH HOH D . 
D 3 HOH 60  366 60  HOH HOH D . 
D 3 HOH 61  367 61  HOH HOH D . 
D 3 HOH 62  368 62  HOH HOH D . 
D 3 HOH 63  369 63  HOH HOH D . 
D 3 HOH 64  370 64  HOH HOH D . 
D 3 HOH 65  371 65  HOH HOH D . 
D 3 HOH 66  372 66  HOH HOH D . 
D 3 HOH 67  373 67  HOH HOH D . 
D 3 HOH 68  374 68  HOH HOH D . 
D 3 HOH 69  375 69  HOH HOH D . 
D 3 HOH 70  376 70  HOH HOH D . 
D 3 HOH 71  377 71  HOH HOH D . 
D 3 HOH 72  378 72  HOH HOH D . 
D 3 HOH 73  379 73  HOH HOH D . 
D 3 HOH 74  380 74  HOH HOH D . 
D 3 HOH 75  381 75  HOH HOH D . 
D 3 HOH 76  382 76  HOH HOH D . 
D 3 HOH 77  383 77  HOH HOH D . 
D 3 HOH 78  384 78  HOH HOH D . 
D 3 HOH 79  385 79  HOH HOH D . 
D 3 HOH 80  386 80  HOH HOH D . 
D 3 HOH 81  387 81  HOH HOH D . 
D 3 HOH 82  388 82  HOH HOH D . 
D 3 HOH 83  389 83  HOH HOH D . 
D 3 HOH 84  390 84  HOH HOH D . 
D 3 HOH 85  391 85  HOH HOH D . 
D 3 HOH 86  392 86  HOH HOH D . 
D 3 HOH 87  393 87  HOH HOH D . 
D 3 HOH 88  394 88  HOH HOH D . 
D 3 HOH 89  395 89  HOH HOH D . 
D 3 HOH 90  396 90  HOH HOH D . 
D 3 HOH 91  397 91  HOH HOH D . 
D 3 HOH 92  398 92  HOH HOH D . 
D 3 HOH 93  399 93  HOH HOH D . 
D 3 HOH 94  400 94  HOH HOH D . 
D 3 HOH 95  401 95  HOH HOH D . 
D 3 HOH 96  402 96  HOH HOH D . 
D 3 HOH 97  403 97  HOH HOH D . 
D 3 HOH 98  404 98  HOH HOH D . 
D 3 HOH 99  405 99  HOH HOH D . 
D 3 HOH 100 406 100 HOH HOH D . 
D 3 HOH 101 407 101 HOH HOH D . 
D 3 HOH 102 408 102 HOH HOH D . 
D 3 HOH 103 409 103 HOH HOH D . 
D 3 HOH 104 410 104 HOH HOH D . 
D 3 HOH 105 411 105 HOH HOH D . 
D 3 HOH 106 412 106 HOH HOH D . 
D 3 HOH 107 413 107 HOH HOH D . 
D 3 HOH 108 414 108 HOH HOH D . 
D 3 HOH 109 415 109 HOH HOH D . 
D 3 HOH 110 416 110 HOH HOH D . 
D 3 HOH 111 417 111 HOH HOH D . 
D 3 HOH 112 418 112 HOH HOH D . 
D 3 HOH 113 419 113 HOH HOH D . 
D 3 HOH 114 420 114 HOH HOH D . 
D 3 HOH 115 421 115 HOH HOH D . 
D 3 HOH 116 422 116 HOH HOH D . 
D 3 HOH 117 423 117 HOH HOH D . 
D 3 HOH 118 424 118 HOH HOH D . 
D 3 HOH 119 425 119 HOH HOH D . 
D 3 HOH 120 426 120 HOH HOH D . 
D 3 HOH 121 427 121 HOH HOH D . 
D 3 HOH 122 428 122 HOH HOH D . 
D 3 HOH 123 429 123 HOH HOH D . 
D 3 HOH 124 430 124 HOH HOH D . 
D 3 HOH 125 431 125 HOH HOH D . 
D 3 HOH 126 432 126 HOH HOH D . 
D 3 HOH 127 433 127 HOH HOH D . 
D 3 HOH 128 434 128 HOH HOH D . 
D 3 HOH 129 435 129 HOH HOH D . 
D 3 HOH 130 436 130 HOH HOH D . 
D 3 HOH 131 437 131 HOH HOH D . 
D 3 HOH 132 438 132 HOH HOH D . 
D 3 HOH 133 439 133 HOH HOH D . 
D 3 HOH 134 440 134 HOH HOH D . 
D 3 HOH 135 441 135 HOH HOH D . 
D 3 HOH 136 442 136 HOH HOH D . 
D 3 HOH 137 443 137 HOH HOH D . 
D 3 HOH 138 444 138 HOH HOH D . 
D 3 HOH 139 445 139 HOH HOH D . 
D 3 HOH 140 446 140 HOH HOH D . 
D 3 HOH 141 447 141 HOH HOH D . 
D 3 HOH 142 448 142 HOH HOH D . 
D 3 HOH 143 449 143 HOH HOH D . 
D 3 HOH 144 450 144 HOH HOH D . 
D 3 HOH 145 451 145 HOH HOH D . 
D 3 HOH 146 452 146 HOH HOH D . 
D 3 HOH 147 453 147 HOH HOH D . 
D 3 HOH 148 454 148 HOH HOH D . 
D 3 HOH 149 455 149 HOH HOH D . 
D 3 HOH 150 456 150 HOH HOH D . 
D 3 HOH 151 457 151 HOH HOH D . 
D 3 HOH 152 458 152 HOH HOH D . 
D 3 HOH 153 459 153 HOH HOH D . 
D 3 HOH 154 460 154 HOH HOH D . 
D 3 HOH 155 461 155 HOH HOH D . 
D 3 HOH 156 462 156 HOH HOH D . 
D 3 HOH 157 463 157 HOH HOH D . 
D 3 HOH 158 464 158 HOH HOH D . 
D 3 HOH 159 465 159 HOH HOH D . 
D 3 HOH 160 466 160 HOH HOH D . 
D 3 HOH 161 467 161 HOH HOH D . 
D 3 HOH 162 468 162 HOH HOH D . 
D 3 HOH 163 469 163 HOH HOH D . 
D 3 HOH 164 470 164 HOH HOH D . 
D 3 HOH 165 471 165 HOH HOH D . 
D 3 HOH 166 472 166 HOH HOH D . 
D 3 HOH 167 473 167 HOH HOH D . 
D 3 HOH 168 474 168 HOH HOH D . 
D 3 HOH 169 475 169 HOH HOH D . 
D 3 HOH 170 476 170 HOH HOH D . 
D 3 HOH 171 477 171 HOH HOH D . 
D 3 HOH 172 478 172 HOH HOH D . 
D 3 HOH 173 479 173 HOH HOH D . 
D 3 HOH 174 480 174 HOH HOH D . 
D 3 HOH 175 481 175 HOH HOH D . 
D 3 HOH 176 482 176 HOH HOH D . 
D 3 HOH 177 483 177 HOH HOH D . 
D 3 HOH 178 484 178 HOH HOH D . 
D 3 HOH 179 485 179 HOH HOH D . 
D 3 HOH 180 486 180 HOH HOH D . 
D 3 HOH 181 487 181 HOH HOH D . 
D 3 HOH 182 488 182 HOH HOH D . 
D 3 HOH 183 489 183 HOH HOH D . 
D 3 HOH 184 490 184 HOH HOH D . 
D 3 HOH 185 491 185 HOH HOH D . 
D 3 HOH 186 492 186 HOH HOH D . 
D 3 HOH 187 493 187 HOH HOH D . 
D 3 HOH 188 494 188 HOH HOH D . 
D 3 HOH 189 495 189 HOH HOH D . 
D 3 HOH 190 496 190 HOH HOH D . 
D 3 HOH 191 497 191 HOH HOH D . 
D 3 HOH 192 498 192 HOH HOH D . 
D 3 HOH 193 499 193 HOH HOH D . 
D 3 HOH 194 500 194 HOH HOH D . 
D 3 HOH 195 501 195 HOH HOH D . 
D 3 HOH 196 502 196 HOH HOH D . 
D 3 HOH 197 503 197 HOH HOH D . 
D 3 HOH 198 504 198 HOH HOH D . 
D 3 HOH 199 505 199 HOH HOH D . 
D 3 HOH 200 506 200 HOH HOH D . 
D 3 HOH 201 507 201 HOH HOH D . 
D 3 HOH 202 508 202 HOH HOH D . 
D 3 HOH 203 509 203 HOH HOH D . 
D 3 HOH 204 510 204 HOH HOH D . 
D 3 HOH 205 511 205 HOH HOH D . 
D 3 HOH 206 512 206 HOH HOH D . 
D 3 HOH 207 513 207 HOH HOH D . 
D 3 HOH 208 514 208 HOH HOH D . 
D 3 HOH 209 515 209 HOH HOH D . 
D 3 HOH 210 516 210 HOH HOH D . 
D 3 HOH 211 517 211 HOH HOH D . 
D 3 HOH 212 518 212 HOH HOH D . 
D 3 HOH 213 519 213 HOH HOH D . 
D 3 HOH 214 520 214 HOH HOH D . 
D 3 HOH 215 521 215 HOH HOH D . 
D 3 HOH 216 522 216 HOH HOH D . 
D 3 HOH 217 523 217 HOH HOH D . 
D 3 HOH 218 524 218 HOH HOH D . 
D 3 HOH 219 525 219 HOH HOH D . 
D 3 HOH 220 526 220 HOH HOH D . 
D 3 HOH 221 527 221 HOH HOH D . 
D 3 HOH 222 528 222 HOH HOH D . 
D 3 HOH 223 529 223 HOH HOH D . 
D 3 HOH 224 530 224 HOH HOH D . 
D 3 HOH 225 531 225 HOH HOH D . 
D 3 HOH 226 532 226 HOH HOH D . 
D 3 HOH 227 533 227 HOH HOH D . 
D 3 HOH 228 534 228 HOH HOH D . 
D 3 HOH 229 535 229 HOH HOH D . 
D 3 HOH 230 536 230 HOH HOH D . 
D 3 HOH 231 537 231 HOH HOH D . 
D 3 HOH 232 538 232 HOH HOH D . 
D 3 HOH 233 539 233 HOH HOH D . 
D 3 HOH 234 540 234 HOH HOH D . 
D 3 HOH 235 541 235 HOH HOH D . 
D 3 HOH 236 542 236 HOH HOH D . 
D 3 HOH 237 543 237 HOH HOH D . 
D 3 HOH 238 544 238 HOH HOH D . 
D 3 HOH 239 545 239 HOH HOH D . 
D 3 HOH 240 546 240 HOH HOH D . 
D 3 HOH 241 547 241 HOH HOH D . 
D 3 HOH 242 548 242 HOH HOH D . 
D 3 HOH 243 549 243 HOH HOH D . 
D 3 HOH 244 550 244 HOH HOH D . 
D 3 HOH 245 551 245 HOH HOH D . 
D 3 HOH 246 552 246 HOH HOH D . 
D 3 HOH 247 553 247 HOH HOH D . 
D 3 HOH 248 554 248 HOH HOH D . 
D 3 HOH 249 555 249 HOH HOH D . 
D 3 HOH 250 556 250 HOH HOH D . 
D 3 HOH 251 557 251 HOH HOH D . 
D 3 HOH 252 558 252 HOH HOH D . 
D 3 HOH 253 559 253 HOH HOH D . 
D 3 HOH 254 560 254 HOH HOH D . 
D 3 HOH 255 561 255 HOH HOH D . 
D 3 HOH 256 562 256 HOH HOH D . 
D 3 HOH 257 563 257 HOH HOH D . 
D 3 HOH 258 564 258 HOH HOH D . 
D 3 HOH 259 565 259 HOH HOH D . 
D 3 HOH 260 566 260 HOH HOH D . 
D 3 HOH 261 567 261 HOH HOH D . 
D 3 HOH 262 568 262 HOH HOH D . 
D 3 HOH 263 569 263 HOH HOH D . 
D 3 HOH 264 570 264 HOH HOH D . 
D 3 HOH 265 571 265 HOH HOH D . 
D 3 HOH 266 572 266 HOH HOH D . 
D 3 HOH 267 573 267 HOH HOH D . 
D 3 HOH 268 574 268 HOH HOH D . 
D 3 HOH 269 575 269 HOH HOH D . 
D 3 HOH 270 576 270 HOH HOH D . 
D 3 HOH 271 577 271 HOH HOH D . 
D 3 HOH 272 578 272 HOH HOH D . 
D 3 HOH 273 579 273 HOH HOH D . 
D 3 HOH 274 580 274 HOH HOH D . 
D 3 HOH 275 581 275 HOH HOH D . 
D 3 HOH 276 582 276 HOH HOH D . 
D 3 HOH 277 583 277 HOH HOH D . 
D 3 HOH 278 584 278 HOH HOH D . 
D 3 HOH 279 585 279 HOH HOH D . 
D 3 HOH 280 586 280 HOH HOH D . 
D 3 HOH 281 587 281 HOH HOH D . 
D 3 HOH 282 588 282 HOH HOH D . 
D 3 HOH 283 589 283 HOH HOH D . 
D 3 HOH 284 590 284 HOH HOH D . 
D 3 HOH 285 591 285 HOH HOH D . 
D 3 HOH 286 592 286 HOH HOH D . 
D 3 HOH 287 593 287 HOH HOH D . 
D 3 HOH 288 594 288 HOH HOH D . 
D 3 HOH 289 595 289 HOH HOH D . 
D 3 HOH 290 596 290 HOH HOH D . 
D 3 HOH 291 597 291 HOH HOH D . 
D 3 HOH 292 598 292 HOH HOH D . 
D 3 HOH 293 599 293 HOH HOH D . 
D 3 HOH 294 600 294 HOH HOH D . 
D 3 HOH 295 601 295 HOH HOH D . 
D 3 HOH 296 602 296 HOH HOH D . 
D 3 HOH 297 603 297 HOH HOH D . 
D 3 HOH 298 604 298 HOH HOH D . 
D 3 HOH 299 605 299 HOH HOH D . 
D 3 HOH 300 606 300 HOH HOH D . 
D 3 HOH 301 607 301 HOH HOH D . 
D 3 HOH 302 608 302 HOH HOH D . 
D 3 HOH 303 609 303 HOH HOH D . 
D 3 HOH 304 610 304 HOH HOH D . 
#