data_1TK0
# 
_entry.id   1TK0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TK0         
NDB   PD0554       
RCSB  RCSB022705   
WWPDB D_1000022705 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1T8E 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TK0 
_pdbx_database_status.recvd_initial_deposition_date   2004-06-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brieba, L.G.'    1 
'Eichman, B.F.'   2 
'Kokoska, R.J.'   3 
'Doublie, S.'     4 
'Kunkel, T.A.'    5 
'Ellenberger, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the dual coding potential of 8-oxoguanosine by a high-fidelity DNA polymerase.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            23 
_citation.page_first                3452 
_citation.page_last                 3461 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15297882 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600354 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brieba, L.G.'    1 
primary 'Eichman, B.F.'   2 
primary 'Kokoska, R.J.'   3 
primary 'Doublie, S.'     4 
primary 'Kunkel, T.A.'    5 
primary 'Ellenberger, T.' 6 
# 
_cell.entry_id           1TK0 
_cell.length_a           106.230 
_cell.length_b           215.096 
_cell.length_c           52.136 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TK0 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn "5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*A*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*(DDG))-3'"              6764.397  1   ? ? 
? 'primer strand'   
2  polymer     syn "5'-D(*CP*CP*CP*(8OG)P*CP*TP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*TP*CP*G)-3'" 7939.063  1   ? ? 
? 'template strand' 
3  polymer     man 'DNA polymerase'                                                                             79089.789 1   
2.7.7.7 'deletion 118-123' ? ?                 
4  polymer     man 'Thioredoxin 1'                                                                              11687.388 1   ? ? 
? ?                 
5  non-polymer syn 'MAGNESIUM ION'                                                                              24.305    3   ? ? 
? ?                 
6  non-polymer syn 'SULFATE ION'                                                                                96.063    2   ? ? 
? ?                 
7  non-polymer syn 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
451.158   1   ?       ?                  ? ?                 
8  non-polymer syn 'PENTAETHYLENE GLYCOL'                                                                       238.278   1   ? ? 
? ?                 
9  non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                                       195.237   1   ? ? 
? ?                 
10 water       nat water                                                                                        18.015    533 ? ? 
? ?                 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'T7 DNA polymerase' 
4 'TRX1, TRX'         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(DA)(DDG)
;
CGAAAACGACGGCCAGTGCCAG P ? 
2 polydeoxyribonucleotide no yes 
;(DC)(DC)(DC)(8OG)(DC)(DT)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DT)(DC)
(DG)(DT)(DT)(DT)(DT)(DC)(DG)
;
CCCGCTGGCACTGGCCGTCGTTTTCG T ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DC  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DA  n 
1 22  DDG n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   8OG n 
2 5   DC  n 
2 6   DT  n 
2 7   DG  n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DG  n 
2 14  DG  n 
2 15  DC  n 
2 16  DC  n 
2 17  DG  n 
2 18  DT  n 
2 19  DC  n 
2 20  DG  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DT  n 
2 25  DC  n 
2 26  DG  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? 'T7-like viruses' 5 ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 
Escherichia ? ? 'Escherichia coli' ? ? BL-21 ? ? ? ? ? ? ? ?      ? ? ? pGP5 ? ? 
4 1 sample ? ? ? ? Escherichia       
'TRXA, TSNC, FIPA, B3781, C4701, Z5291, ECS4714, STM3915, STMD1.75, STY3639, T3381, SF3854, S3905' ? ? ? ? ? ? 'Escherichia coli' 
562   ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 Escherichia ? ? 'Escherichia coli' ? ? BL21  ? ? ? ? ? ? ? pTrx-3 ? ? ? ?    
? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPT7  P00581 3 
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEW
WNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIE
ELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREY
VAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSA
EGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLE
LRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTP
AIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKH
GWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
1 ? 
2 UNP THIO_ECOLI P0AA25 4 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
1 ? 
3 PDB 1TK0       1TK0   1 ? ? ? 
4 PDB 1TK0       1TK0   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TK0 A 1 ? 698 ? P00581 1   ? 704 ? 1   704 
2 2 1TK0 B 1 ? 108 ? P0AA25 1   ? 108 ? 1   108 
3 3 1TK0 P 1 ? 22  ? 1TK0   801 ? 822 ? 801 822 
4 4 1TK0 T 1 ? 26  ? 1TK0   851 ? 876 ? 851 876 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1TK0 ? A ? ? UNP P00581 LYS 118 DELETION ? 1 
1 1TK0 ? A ? ? UNP P00581 ARG 119 DELETION ? 2 
1 1TK0 ? A ? ? UNP P00581 PHE 120 DELETION ? 3 
1 1TK0 ? A ? ? UNP P00581 GLY 121 DELETION ? 4 
1 1TK0 ? A ? ? UNP P00581 SER 122 DELETION ? 5 
1 1TK0 ? A ? ? UNP P00581 HIS 123 DELETION ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL'                      PEG400                                                  
'C10 H22 O6'       238.278 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P'  363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'   307.197 
DCT 'DNA linking'       n 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
?                                                       'C9 H16 N3 O12 P3' 451.158 
DDG 'DNA linking'       n "2',3'-DIDEOXY-GUANOSINE-5'-MONOPHOSPHATE"  ?                                                       
'C10 H14 N5 O6 P'  331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'   147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'      ?                                                       
'C6 H13 N O4 S'    195.237 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                             ?                                                       
'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                               ?                                                       
'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?                                                       
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1TK0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3 
_exptl_crystal.density_percent_sol   58.3 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG8000, Amonium Sulfate, PEG400, Ethylene Glycol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 21K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-01-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X26C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X26C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     1TK0 
_reflns.observed_criterion_sigma_I   5 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   51127 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        23.8 
_reflns.B_iso_Wilson_estimate        25.1 
_reflns.pdbx_redundancy              7 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   93.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.224 
_reflns_shell.meanI_over_sigI_obs    5.1 
_reflns_shell.pdbx_redundancy        2.9 
_reflns_shell.percent_possible_obs   66.1 
_reflns_shell.number_unique_all      51127 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1TK0 
_refine.ls_number_reflns_obs                     50921 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2122174.09 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.85 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    94.0 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.217 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  2455 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               38.0 
_refine.aniso_B[1][1]                            8.97 
_refine.aniso_B[2][2]                            -0.04 
_refine.aniso_B[3][3]                            -8.93 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.334463 
_refine.solvent_model_param_bsol                 42.6982 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1T7P' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1TK0 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.20 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6246 
_refine_hist.pdbx_number_atoms_nucleic_acid   581 
_refine_hist.pdbx_number_atoms_ligand         68 
_refine_hist.number_atoms_solvent             533 
_refine_hist.number_atoms_total               7428 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        35.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.88  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.21  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.92  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.96  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.84  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             6345 
_refine_ls_shell.R_factor_R_work                  0.237 
_refine_ls_shell.percent_reflns_obs               74.9 
_refine_ls_shell.R_factor_R_free                  0.279 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             307 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP        'X-RAY DIFFRACTION' 
2 DNA-RNA-TT5.PARAM DNA-RNA-TT_4TD.TOP 'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP            'X-RAY DIFFRACTION' 
4 WATER.PARAM       WATER.TOP          'X-RAY DIFFRACTION' 
5 LIGAND.PAR        LIGAND.TOP         'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1TK0 
_struct.title                     'T7 DNA polymerase ternary complex with 8 oxo guanosine and ddCTP at the insertion site' 
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)/THIOREDOXIN 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TK0 
_struct_keywords.pdbx_keywords   'TRANSFERASE/ELECTRON TRANSPORT/DNA' 
_struct_keywords.text            '8 oxo guanosine, DNA polymerase, TRANSFERASE-ELECTRON TRANSPORT-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 5  ? 
H N N 6  ? 
I N N 6  ? 
J N N 7  ? 
K N N 8  ? 
L N N 9  ? 
M N N 10 ? 
N N N 10 ? 
O N N 10 ? 
P N N 10 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 11  ? VAL C 15  ? LEU A 11  VAL A 15  5 ? 5  
HELX_P HELX_P2  2  ARG C 35  ? SER C 37  ? ARG A 35  SER A 37  5 ? 3  
HELX_P HELX_P3  3  ASP C 38  ? ARG C 52  ? ASP A 38  ARG A 52  1 ? 15 
HELX_P HELX_P4  4  TYR C 64  ? ASN C 78  ? TYR A 64  ASN A 78  1 ? 15 
HELX_P HELX_P5  5  PRO C 84  ? GLU C 86  ? PRO A 84  GLU A 86  5 ? 3  
HELX_P HELX_P6  6  THR C 91  ? HIS C 99  ? THR A 91  HIS A 99  1 ? 9  
HELX_P HELX_P7  7  ARG C 111 ? LEU C 115 ? ARG A 111 LEU A 115 5 ? 5  
HELX_P HELX_P8  8  GLU C 120 ? GLU C 143 ? GLU A 126 GLU A 149 1 ? 24 
HELX_P HELX_P9  9  GLY C 151 ? TRP C 155 ? GLY A 157 TRP A 161 5 ? 5  
HELX_P HELX_P10 10 ASN C 158 ? SER C 181 ? ASN A 164 SER A 187 1 ? 24 
HELX_P HELX_P11 11 GLY C 196 ? SER C 204 ? GLY A 202 SER A 210 1 ? 9  
HELX_P HELX_P12 12 LEU C 205 ? GLY C 225 ? LEU A 211 GLY A 231 1 ? 21 
HELX_P HELX_P13 13 ASP C 229 ? PHE C 255 ? ASP A 235 PHE A 261 1 ? 27 
HELX_P HELX_P14 14 SER C 332 ? GLU C 342 ? SER A 338 GLU A 348 1 ? 11 
HELX_P HELX_P15 15 ASP C 359 ? VAL C 366 ? ASP A 365 VAL A 372 1 ? 8  
HELX_P HELX_P16 16 ASP C 370 ? ALA C 394 ? ASP A 376 ALA A 400 1 ? 25 
HELX_P HELX_P17 17 ALA C 399 ? VAL C 404 ? ALA A 405 VAL A 410 1 ? 6  
HELX_P HELX_P18 18 TYR C 441 ? ALA C 448 ? TYR A 447 ALA A 454 1 ? 8  
HELX_P HELX_P19 19 GLY C 450 ? HIS C 454 ? GLY A 456 HIS A 460 5 ? 5  
HELX_P HELX_P20 20 GLY C 472 ? ASN C 487 ? GLY A 478 ASN A 493 1 ? 16 
HELX_P HELX_P21 21 GLY C 488 ? ILE C 494 ? GLY A 494 ILE A 500 1 ? 7  
HELX_P HELX_P22 22 ASP C 498 ? ALA C 507 ? ASP A 504 ALA A 513 1 ? 10 
HELX_P HELX_P23 23 THR C 511 ? TYR C 524 ? THR A 517 TYR A 530 1 ? 14 
HELX_P HELX_P24 24 GLY C 527 ? GLY C 536 ? GLY A 533 GLY A 542 1 ? 10 
HELX_P HELX_P25 25 GLY C 538 ? THR C 553 ? GLY A 544 THR A 559 1 ? 16 
HELX_P HELX_P26 26 PRO C 554 ? LEU C 567 ? PRO A 560 LEU A 573 1 ? 14 
HELX_P HELX_P27 27 SER C 599 ? HIS C 601 ? SER A 605 HIS A 607 5 ? 3  
HELX_P HELX_P28 28 ALA C 602 ? LYS C 630 ? ALA A 608 LYS A 636 1 ? 29 
HELX_P HELX_P29 29 THR C 656 ? TRP C 678 ? THR A 662 TRP A 684 1 ? 23 
HELX_P HELX_P30 30 THR D 8   ? ASP D 10  ? THR B 8   ASP B 10  5 ? 3  
HELX_P HELX_P31 31 SER D 11  ? VAL D 16  ? SER B 11  VAL B 16  1 ? 6  
HELX_P HELX_P32 32 CYS D 32  ? TYR D 49  ? CYS B 32  TYR B 49  1 ? 18 
HELX_P HELX_P33 33 THR D 66  ? GLY D 71  ? THR B 66  GLY B 71  5 ? 6  
HELX_P HELX_P34 34 SER D 95  ? LEU D 107 ? SER B 95  LEU B 107 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 469 OD1 ? ? A MG  991 A ASP 475  1_555 ? ? ? ? ? ? ?            1.961 ? 
metalc2  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ALA 470 O   ? ? A MG  991 A ALA 476  1_555 ? ? ? ? ? ? ?            2.142 ? 
metalc3  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 648 OD2 ? ? A MG  991 A ASP 654  1_555 ? ? ? ? ? ? ?            2.102 ? 
metalc4  metalc ? ? E MG  .  MG    ? ? ? 1_555 J DCT .   O2A ? ? A MG  991 A DCT 823  1_555 ? ? ? ? ? ? ?            2.267 ? 
metalc5  metalc ? ? E MG  .  MG    ? ? ? 1_555 J DCT .   O2B ? ? A MG  991 A DCT 823  1_555 ? ? ? ? ? ? ?            2.068 ? 
metalc6  metalc ? ? E MG  .  MG    ? ? ? 1_555 J DCT .   O1G ? ? A MG  991 A DCT 823  1_555 ? ? ? ? ? ? ?            2.097 ? 
metalc7  metalc ? ? F MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? A MG  992 A HOH 1333 1_555 ? ? ? ? ? ? ?            2.521 ? 
metalc8  metalc ? ? F MG  .  MG    ? ? ? 1_555 J DCT .   O2A ? ? A MG  992 A DCT 823  1_555 ? ? ? ? ? ? ?            2.384 ? 
metalc9  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 648 OD1 ? ? A MG  992 A ASP 654  1_555 ? ? ? ? ? ? ?            2.183 ? 
metalc10 metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 469 OD2 ? ? A MG  992 A ASP 475  1_555 ? ? ? ? ? ? ?            2.132 ? 
metalc11 metalc ? ? F MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? A MG  992 A HOH 1618 1_555 ? ? ? ? ? ? ?            2.509 ? 
metalc12 metalc ? ? G MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? A MG  993 A HOH 1621 1_555 ? ? ? ? ? ? ?            2.202 ? 
metalc13 metalc ? ? G MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? A MG  993 A HOH 1054 1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc14 metalc ? ? G MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? A MG  993 A HOH 1113 1_555 ? ? ? ? ? ? ?            2.264 ? 
metalc15 metalc ? ? G MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? A MG  993 A HOH 1622 1_555 ? ? ? ? ? ? ?            2.110 ? 
metalc16 metalc ? ? G MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? A MG  993 A HOH 1620 1_555 ? ? ? ? ? ? ?            2.280 ? 
metalc17 metalc ? ? G MG  .  MG    ? ? ? 1_555 C ASP 5   OD1 ? ? A MG  993 A ASP 5    1_555 ? ? ? ? ? ? ?            2.098 ? 
covale1  covale ? ? A DA  21 "O3'" ? ? ? 1_555 A DDG 22  P   ? ? P DA  821 P DDG 822  1_555 ? ? ? ? ? ? ?            1.607 ? 
covale2  covale ? ? B DC  3  "O3'" ? ? ? 1_555 B 8OG 4   P   ? ? T DC  853 T 8OG 854  1_555 ? ? ? ? ? ? ?            1.605 ? 
covale3  covale ? ? B 8OG 4  "O3'" ? ? ? 1_555 B DC  5   P   ? ? T 8OG 854 T DC  855  1_555 ? ? ? ? ? ? ?            1.604 ? 
hydrog1  hydrog ? ? A DC  10 N3    ? ? ? 1_555 B DG  17  N1  ? ? P DC  810 T DG  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  10 N4    ? ? ? 1_555 B DG  17  O6  ? ? P DC  810 T DG  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  10 O2    ? ? ? 1_555 B DG  17  N2  ? ? P DC  810 T DG  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  11 N1    ? ? ? 1_555 B DC  16  N3  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  11 N2    ? ? ? 1_555 B DC  16  O2  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  11 O6    ? ? ? 1_555 B DC  16  N4  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  13 N3    ? ? ? 1_555 B DG  14  N1  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  13 N4    ? ? ? 1_555 B DG  14  O6  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  13 O2    ? ? ? 1_555 B DG  14  N2  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  13  N1  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  13  O6  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  13  N2  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  12  N3  ? ? P DA  815 T DT  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  12  O4  ? ? P DA  815 T DT  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  11  N3  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  11  O2  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  11  N4  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  10  N1  ? ? P DT  817 T DA  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  10  N6  ? ? P DT  817 T DA  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  9   N3  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  9   O2  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  9   N4  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC  19 N3    ? ? ? 1_555 B DG  8   N1  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC  19 N4    ? ? ? 1_555 B DG  8   O6  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC  19 O2    ? ? ? 1_555 B DG  8   N2  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DC  20 N3    ? ? ? 1_555 B DG  7   N1  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DC  20 N4    ? ? ? 1_555 B DG  7   O6  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DC  20 O2    ? ? ? 1_555 B DG  7   N2  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DA  21 N1    ? ? ? 1_555 B DT  6   N3  ? ? P DA  821 T DT  856  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DA  21 N6    ? ? ? 1_555 B DT  6   O4  ? ? P DA  821 T DT  856  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DDG 22 N1    ? ? ? 1_555 B DC  5   N3  ? ? P DDG 822 T DC  855  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DDG 22 N2    ? ? ? 1_555 B DC  5   O2  ? ? P DDG 822 T DC  855  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DDG 22 O6    ? ? ? 1_555 B DC  5   N4  ? ? P DDG 822 T DC  855  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 C . ? PHE 434 A PRO 429 C ? PRO 435 A 1 -0.72 
2 ILE 75  D . ? ILE 75  B PRO 76  D ? PRO 76  B 1 -0.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 2 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 30  ? TYR C 34  ? GLU A 30  TYR A 34  
A 2 PHE C 18  ? ASP C 25  ? PHE A 18  ASP A 25  
A 3 ILE C 2   ? ALA C 8   ? ILE A 2   ALA A 8   
A 4 ILE C 56  ? PHE C 58  ? ILE A 56  PHE A 58  
A 5 CYS C 88  ? ASP C 90  ? CYS A 88  ASP A 90  
B 1 PHE C 226 ? PRO C 227 ? PHE A 232 PRO A 233 
B 2 LYS C 409 ? ILE C 410 ? LYS A 415 ILE A 416 
C 1 TRP C 258 ? PRO C 261 ? TRP A 264 PRO A 267 
C 2 THR C 321 ? VAL C 326 ? THR A 327 VAL A 332 
C 3 GLY D 74  ? ILE D 75  ? GLY B 74  ILE B 75  
D 1 SER C 413 ? ASN C 415 ? SER A 419 ASN A 421 
D 2 THR C 425 ? ALA C 427 ? THR A 431 ALA A 433 
E 1 PHE C 640 ? TRP C 645 ? PHE A 646 TRP A 651 
E 2 GLU C 649 ? CYS C 654 ? GLU A 655 CYS A 660 
E 3 VAL C 464 ? ALA C 470 ? VAL A 470 ALA A 476 
E 4 THR C 686 ? GLY C 691 ? THR A 692 GLY A 697 
F 1 VAL C 568 ? SER C 570 ? VAL A 574 SER A 576 
F 2 LYS C 581 ? TRP C 582 ? LYS A 587 TRP A 588 
G 1 TRP C 586 ? LYS C 588 ? TRP A 592 LYS A 594 
G 2 LYS C 594 ? HIS C 596 ? LYS A 600 HIS A 602 
H 1 ILE D 5   ? HIS D 6   ? ILE B 5   HIS B 6   
H 2 THR D 54  ? ASN D 59  ? THR B 54  ASN B 59  
H 3 ALA D 22  ? TRP D 28  ? ALA B 22  TRP B 28  
H 4 THR D 77  ? LYS D 82  ? THR B 77  LYS B 82  
H 5 GLU D 85  ? VAL D 91  ? GLU B 85  VAL B 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR C 34  ? O TYR A 34  N GLY C 21  ? N GLY A 21  
A 2 3 O CYS C 20  ? O CYS A 20  N GLU C 7   ? N GLU A 7   
A 3 4 N SER C 4   ? N SER A 4   O VAL C 57  ? O VAL A 57  
A 4 5 N ILE C 56  ? N ILE A 56  O ILE C 89  ? O ILE A 89  
B 1 2 N PHE C 226 ? N PHE A 232 O ILE C 410 ? O ILE A 416 
C 1 2 N TRP C 258 ? N TRP A 264 O VAL C 326 ? O VAL A 332 
C 2 3 N THR C 321 ? N THR A 327 O ILE D 75  ? O ILE B 75  
D 1 2 N ASN C 415 ? N ASN A 421 O THR C 425 ? O THR A 431 
E 1 2 N ALA C 641 ? N ALA A 647 O GLY C 653 ? O GLY A 659 
E 2 3 O CYS C 654 ? O CYS A 660 N VAL C 464 ? N VAL A 470 
E 3 4 N GLN C 465 ? N GLN A 471 O GLY C 691 ? O GLY A 697 
F 1 2 N SER C 570 ? N SER A 576 O LYS C 581 ? O LYS A 587 
G 1 2 N ILE C 587 ? N ILE A 593 O VAL C 595 ? O VAL A 601 
H 1 2 N ILE D 5   ? N ILE B 5   O VAL D 55  ? O VAL B 55  
H 2 3 O ALA D 56  ? O ALA B 56  N LEU D 24  ? N LEU B 24  
H 3 4 N ILE D 23  ? N ILE B 23  O PHE D 81  ? O PHE B 81  
H 4 5 N LEU D 80  ? N LEU B 80  O ALA D 87  ? O ALA B 87  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 991'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 992'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 993'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 994' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 995' 
AC6 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE DCT A 823' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE 1PE A 901' 
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MES A 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP C 469 ? ASP A 475  . ? 1_555 ? 
2  AC1 5  ALA C 470 ? ALA A 476  . ? 1_555 ? 
3  AC1 5  ASP C 648 ? ASP A 654  . ? 1_555 ? 
4  AC1 5  DCT J .   ? DCT A 823  . ? 1_555 ? 
5  AC1 5  MG  F .   ? MG  A 992  . ? 1_555 ? 
6  AC2 7  ASP C 469 ? ASP A 475  . ? 1_555 ? 
7  AC2 7  ASP C 648 ? ASP A 654  . ? 1_555 ? 
8  AC2 7  DCT J .   ? DCT A 823  . ? 1_555 ? 
9  AC2 7  MG  E .   ? MG  A 991  . ? 1_555 ? 
10 AC2 7  HOH O .   ? HOH A 1333 . ? 1_555 ? 
11 AC2 7  HOH O .   ? HOH A 1618 . ? 1_555 ? 
12 AC2 7  DDG A 22  ? DDG P 822  . ? 1_555 ? 
13 AC3 6  ASP C 5   ? ASP A 5    . ? 1_555 ? 
14 AC3 6  HOH O .   ? HOH A 1054 . ? 1_555 ? 
15 AC3 6  HOH O .   ? HOH A 1113 . ? 1_555 ? 
16 AC3 6  HOH O .   ? HOH A 1620 . ? 1_555 ? 
17 AC3 6  HOH O .   ? HOH A 1621 . ? 1_555 ? 
18 AC3 6  HOH O .   ? HOH A 1622 . ? 1_555 ? 
19 AC4 7  LYS C 220 ? LYS A 226  . ? 1_555 ? 
20 AC4 7  ARG C 223 ? ARG A 229  . ? 1_555 ? 
21 AC4 7  HOH O .   ? HOH A 1063 . ? 1_555 ? 
22 AC4 7  HOH O .   ? HOH A 1303 . ? 1_555 ? 
23 AC4 7  HOH O .   ? HOH A 1311 . ? 1_555 ? 
24 AC4 7  HOH O .   ? HOH A 1362 . ? 1_555 ? 
25 AC4 7  HOH O .   ? HOH A 1385 . ? 1_555 ? 
26 AC5 5  LYS C 178 ? LYS A 184  . ? 1_555 ? 
27 AC5 5  ARG C 655 ? ARG A 661  . ? 1_554 ? 
28 AC5 5  HOH O .   ? HOH A 1043 . ? 1_554 ? 
29 AC5 5  HOH O .   ? HOH A 1051 . ? 1_555 ? 
30 AC5 5  HOH O .   ? HOH A 1593 . ? 1_555 ? 
31 AC6 18 ARG C 423 ? ARG A 429  . ? 1_555 ? 
32 AC6 18 ASP C 469 ? ASP A 475  . ? 1_555 ? 
33 AC6 18 ALA C 470 ? ALA A 476  . ? 1_555 ? 
34 AC6 18 SER C 471 ? SER A 477  . ? 1_555 ? 
35 AC6 18 GLY C 472 ? GLY A 478  . ? 1_555 ? 
36 AC6 18 LEU C 473 ? LEU A 479  . ? 1_555 ? 
37 AC6 18 GLU C 474 ? GLU A 480  . ? 1_555 ? 
38 AC6 18 HIS C 500 ? HIS A 506  . ? 1_555 ? 
39 AC6 18 ARG C 512 ? ARG A 518  . ? 1_555 ? 
40 AC6 18 LYS C 516 ? LYS A 522  . ? 1_555 ? 
41 AC6 18 TYR C 520 ? TYR A 526  . ? 1_555 ? 
42 AC6 18 ASP C 648 ? ASP A 654  . ? 1_555 ? 
43 AC6 18 MG  E .   ? MG  A 991  . ? 1_555 ? 
44 AC6 18 MG  F .   ? MG  A 992  . ? 1_555 ? 
45 AC6 18 HOH O .   ? HOH A 1078 . ? 1_555 ? 
46 AC6 18 HOH O .   ? HOH A 1249 . ? 1_555 ? 
47 AC6 18 DDG A 22  ? DDG P 822  . ? 1_555 ? 
48 AC6 18 8OG B 4   ? 8OG T 854  . ? 1_555 ? 
49 AC7 5  ALA C 10  ? ALA A 10   . ? 1_555 ? 
50 AC7 5  TYR C 64  ? TYR A 64   . ? 1_555 ? 
51 AC7 5  MET C 107 ? MET A 107  . ? 1_555 ? 
52 AC7 5  LYS C 130 ? LYS A 136  . ? 1_555 ? 
53 AC7 5  TRP C 154 ? TRP A 160  . ? 1_555 ? 
54 AC8 8  LEU C 77  ? LEU A 77   . ? 1_555 ? 
55 AC8 8  ARG C 79  ? ARG A 79   . ? 1_555 ? 
56 AC8 8  HOH O .   ? HOH A 1341 . ? 1_555 ? 
57 AC8 8  ILE D 5   ? ILE B 5    . ? 4_557 ? 
58 AC8 8  SER D 11  ? SER B 11   . ? 4_557 ? 
59 AC8 8  THR D 14  ? THR B 14   . ? 4_557 ? 
60 AC8 8  ASP D 15  ? ASP B 15   . ? 4_557 ? 
61 AC8 8  HOH P .   ? HOH B 1239 . ? 4_557 ? 
# 
_database_PDB_matrix.entry_id          1TK0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TK0 
_atom_sites.fract_transf_matrix[1][1]   0.009414 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004649 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019181 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    C  "C5'" . DC  A 1  10  ? 68.859 48.855  41.756 1.00 98.52  ? 810  DC  P "C5'" 1 
ATOM   2    C  "C4'" . DC  A 1  10  ? 69.815 49.626  40.902 1.00 98.81  ? 810  DC  P "C4'" 1 
ATOM   3    O  "O4'" . DC  A 1  10  ? 69.815 49.061  39.594 1.00 98.86  ? 810  DC  P "O4'" 1 
ATOM   4    C  "C3'" . DC  A 1  10  ? 69.516 51.101  40.707 1.00 98.98  ? 810  DC  P "C3'" 1 
ATOM   5    O  "O3'" . DC  A 1  10  ? 70.203 51.709  41.804 1.00 99.70  ? 810  DC  P "O3'" 1 
ATOM   6    C  "C2'" . DC  A 1  10  ? 70.251 51.395  39.390 1.00 98.58  ? 810  DC  P "C2'" 1 
ATOM   7    C  "C1'" . DC  A 1  10  ? 70.195 50.045  38.665 1.00 98.71  ? 810  DC  P "C1'" 1 
ATOM   8    N  N1    . DC  A 1  10  ? 69.342 49.932  37.450 1.00 98.41  ? 810  DC  P N1    1 
ATOM   9    C  C2    . DC  A 1  10  ? 69.732 50.633  36.296 1.00 98.18  ? 810  DC  P C2    1 
ATOM   10   O  O2    . DC  A 1  10  ? 70.714 51.384  36.353 1.00 98.34  ? 810  DC  P O2    1 
ATOM   11   N  N3    . DC  A 1  10  ? 69.020 50.486  35.155 1.00 97.76  ? 810  DC  P N3    1 
ATOM   12   C  C4    . DC  A 1  10  ? 67.945 49.694  35.135 1.00 97.99  ? 810  DC  P C4    1 
ATOM   13   N  N4    . DC  A 1  10  ? 67.297 49.540  33.971 1.00 97.72  ? 810  DC  P N4    1 
ATOM   14   C  C5    . DC  A 1  10  ? 67.491 49.008  36.302 1.00 97.94  ? 810  DC  P C5    1 
ATOM   15   C  C6    . DC  A 1  10  ? 68.215 49.149  37.427 1.00 97.96  ? 810  DC  P C6    1 
ATOM   16   P  P     . DG  A 1  11  ? 69.479 52.734  42.817 1.00 100.10 ? 811  DG  P P     1 
ATOM   17   O  OP1   . DG  A 1  11  ? 69.988 52.439  44.155 1.00 99.80  ? 811  DG  P OP1   1 
ATOM   18   O  OP2   . DG  A 1  11  ? 68.015 52.838  42.548 1.00 100.10 ? 811  DG  P OP2   1 
ATOM   19   O  "O5'" . DG  A 1  11  ? 70.055 54.174  42.481 1.00 99.51  ? 811  DG  P "O5'" 1 
ATOM   20   C  "C5'" . DG  A 1  11  ? 71.351 54.328  41.870 1.00 98.84  ? 811  DG  P "C5'" 1 
ATOM   21   C  "C4'" . DG  A 1  11  ? 71.266 55.362  40.776 1.00 98.18  ? 811  DG  P "C4'" 1 
ATOM   22   O  "O4'" . DG  A 1  11  ? 70.765 54.794  39.533 1.00 97.62  ? 811  DG  P "O4'" 1 
ATOM   23   C  "C3'" . DG  A 1  11  ? 70.372 56.563  41.096 1.00 98.32  ? 811  DG  P "C3'" 1 
ATOM   24   O  "O3'" . DG  A 1  11  ? 71.004 57.745  40.633 1.00 99.15  ? 811  DG  P "O3'" 1 
ATOM   25   C  "C2'" . DG  A 1  11  ? 69.131 56.299  40.268 1.00 97.77  ? 811  DG  P "C2'" 1 
ATOM   26   C  "C1'" . DG  A 1  11  ? 69.704 55.593  39.047 1.00 97.21  ? 811  DG  P "C1'" 1 
ATOM   27   N  N9    . DG  A 1  11  ? 68.763 54.731  38.332 1.00 96.65  ? 811  DG  P N9    1 
ATOM   28   C  C8    . DG  A 1  11  ? 67.887 53.816  38.871 1.00 96.46  ? 811  DG  P C8    1 
ATOM   29   N  N7    . DG  A 1  11  ? 67.177 53.193  37.968 1.00 96.07  ? 811  DG  P N7    1 
ATOM   30   C  C5    . DG  A 1  11  ? 67.599 53.736  36.761 1.00 95.85  ? 811  DG  P C5    1 
ATOM   31   C  C6    . DG  A 1  11  ? 67.183 53.457  35.430 1.00 95.53  ? 811  DG  P C6    1 
ATOM   32   O  O6    . DG  A 1  11  ? 66.325 52.654  35.042 1.00 95.43  ? 811  DG  P O6    1 
ATOM   33   N  N1    . DG  A 1  11  ? 67.876 54.232  34.505 1.00 95.21  ? 811  DG  P N1    1 
ATOM   34   C  C2    . DG  A 1  11  ? 68.844 55.160  34.815 1.00 95.64  ? 811  DG  P C2    1 
ATOM   35   N  N2    . DG  A 1  11  ? 69.406 55.814  33.780 1.00 95.23  ? 811  DG  P N2    1 
ATOM   36   N  N3    . DG  A 1  11  ? 69.238 55.430  36.049 1.00 95.77  ? 811  DG  P N3    1 
ATOM   37   C  C4    . DG  A 1  11  ? 68.579 54.685  36.966 1.00 96.07  ? 811  DG  P C4    1 
ATOM   38   P  P     . DG  A 1  12  ? 70.776 59.113  41.430 1.00 100.10 ? 812  DG  P P     1 
ATOM   39   O  OP1   . DG  A 1  12  ? 71.798 59.198  42.505 1.00 100.10 ? 812  DG  P OP1   1 
ATOM   40   O  OP2   . DG  A 1  12  ? 69.330 59.173  41.783 1.00 99.71  ? 812  DG  P OP2   1 
ATOM   41   O  "O5'" . DG  A 1  12  ? 71.087 60.260  40.369 1.00 99.42  ? 812  DG  P "O5'" 1 
ATOM   42   C  "C5'" . DG  A 1  12  ? 70.055 61.126  39.894 1.00 97.50  ? 812  DG  P "C5'" 1 
ATOM   43   C  "C4'" . DG  A 1  12  ? 70.154 61.281  38.395 1.00 96.08  ? 812  DG  P "C4'" 1 
ATOM   44   O  "O4'" . DG  A 1  12  ? 69.862 60.014  37.743 1.00 95.32  ? 812  DG  P "O4'" 1 
ATOM   45   C  "C3'" . DG  A 1  12  ? 69.139 62.280  37.851 1.00 95.22  ? 812  DG  P "C3'" 1 
ATOM   46   O  "O3'" . DG  A 1  12  ? 69.732 63.094  36.836 1.00 94.52  ? 812  DG  P "O3'" 1 
ATOM   47   C  "C2'" . DG  A 1  12  ? 68.027 61.403  37.307 1.00 94.88  ? 812  DG  P "C2'" 1 
ATOM   48   C  "C1'" . DG  A 1  12  ? 68.767 60.163  36.845 1.00 94.37  ? 812  DG  P "C1'" 1 
ATOM   49   N  N9    . DG  A 1  12  ? 67.940 58.959  36.919 1.00 93.39  ? 812  DG  P N9    1 
ATOM   50   C  C8    . DG  A 1  12  ? 67.637 58.233  38.047 1.00 92.97  ? 812  DG  P C8    1 
ATOM   51   N  N7    . DG  A 1  12  ? 66.831 57.232  37.813 1.00 92.41  ? 812  DG  P N7    1 
ATOM   52   C  C5    . DG  A 1  12  ? 66.593 57.290  36.446 1.00 91.76  ? 812  DG  P C5    1 
ATOM   53   C  C6    . DG  A 1  12  ? 65.786 56.465  35.621 1.00 90.84  ? 812  DG  P C6    1 
ATOM   54   O  O6    . DG  A 1  12  ? 65.097 55.492  35.944 1.00 90.42  ? 812  DG  P O6    1 
ATOM   55   N  N1    . DG  A 1  12  ? 65.828 56.872  34.293 1.00 90.61  ? 812  DG  P N1    1 
ATOM   56   C  C2    . DG  A 1  12  ? 66.550 57.935  33.816 1.00 91.19  ? 812  DG  P C2    1 
ATOM   57   N  N2    . DG  A 1  12  ? 66.460 58.159  32.495 1.00 90.83  ? 812  DG  P N2    1 
ATOM   58   N  N3    . DG  A 1  12  ? 67.303 58.720  34.575 1.00 91.93  ? 812  DG  P N3    1 
ATOM   59   C  C4    . DG  A 1  12  ? 67.278 58.342  35.873 1.00 92.32  ? 812  DG  P C4    1 
ATOM   60   P  P     . DC  A 1  13  ? 69.144 64.565  36.560 1.00 94.70  ? 813  DC  P P     1 
ATOM   61   O  OP1   . DC  A 1  13  ? 70.254 65.473  36.174 1.00 94.67  ? 813  DC  P OP1   1 
ATOM   62   O  OP2   . DC  A 1  13  ? 68.278 64.915  37.718 1.00 94.19  ? 813  DC  P OP2   1 
ATOM   63   O  "O5'" . DC  A 1  13  ? 68.212 64.357  35.288 1.00 92.78  ? 813  DC  P "O5'" 1 
ATOM   64   C  "C5'" . DC  A 1  13  ? 67.594 63.099  35.049 1.00 89.92  ? 813  DC  P "C5'" 1 
ATOM   65   C  "C4'" . DC  A 1  13  ? 66.764 63.158  33.795 1.00 88.58  ? 813  DC  P "C4'" 1 
ATOM   66   O  "O4'" . DC  A 1  13  ? 66.147 61.865  33.592 1.00 88.19  ? 813  DC  P "O4'" 1 
ATOM   67   C  "C3'" . DC  A 1  13  ? 65.630 64.171  33.877 1.00 87.62  ? 813  DC  P "C3'" 1 
ATOM   68   O  "O3'" . DC  A 1  13  ? 65.506 64.848  32.626 1.00 87.33  ? 813  DC  P "O3'" 1 
ATOM   69   C  "C2'" . DC  A 1  13  ? 64.412 63.335  34.235 1.00 87.11  ? 813  DC  P "C2'" 1 
ATOM   70   C  "C1'" . DC  A 1  13  ? 64.731 61.959  33.660 1.00 87.65  ? 813  DC  P "C1'" 1 
ATOM   71   N  N1    . DC  A 1  13  ? 64.243 60.828  34.482 1.00 87.00  ? 813  DC  P N1    1 
ATOM   72   C  C2    . DC  A 1  13  ? 63.342 59.905  33.918 1.00 86.38  ? 813  DC  P C2    1 
ATOM   73   O  O2    . DC  A 1  13  ? 62.985 60.047  32.738 1.00 86.20  ? 813  DC  P O2    1 
ATOM   74   N  N3    . DC  A 1  13  ? 62.886 58.880  34.677 1.00 85.74  ? 813  DC  P N3    1 
ATOM   75   C  C4    . DC  A 1  13  ? 63.292 58.753  35.943 1.00 85.60  ? 813  DC  P C4    1 
ATOM   76   N  N4    . DC  A 1  13  ? 62.810 57.732  36.657 1.00 84.87  ? 813  DC  P N4    1 
ATOM   77   C  C5    . DC  A 1  13  ? 64.210 59.668  36.536 1.00 85.82  ? 813  DC  P C5    1 
ATOM   78   C  C6    . DC  A 1  13  ? 64.656 60.678  35.779 1.00 86.32  ? 813  DC  P C6    1 
ATOM   79   P  P     . DC  A 1  14  ? 64.495 66.085  32.488 1.00 87.41  ? 814  DC  P P     1 
ATOM   80   O  OP1   . DC  A 1  14  ? 64.812 66.803  31.227 1.00 87.60  ? 814  DC  P OP1   1 
ATOM   81   O  OP2   . DC  A 1  14  ? 64.483 66.831  33.777 1.00 87.08  ? 814  DC  P OP2   1 
ATOM   82   O  "O5'" . DC  A 1  14  ? 63.096 65.352  32.314 1.00 84.25  ? 814  DC  P "O5'" 1 
ATOM   83   C  "C5'" . DC  A 1  14  ? 62.938 64.319  31.341 1.00 79.81  ? 814  DC  P "C5'" 1 
ATOM   84   C  "C4'" . DC  A 1  14  ? 61.541 63.748  31.408 1.00 76.95  ? 814  DC  P "C4'" 1 
ATOM   85   O  "O4'" . DC  A 1  14  ? 61.454 62.610  32.301 1.00 75.81  ? 814  DC  P "O4'" 1 
ATOM   86   C  "C3'" . DC  A 1  14  ? 60.489 64.748  31.884 1.00 75.10  ? 814  DC  P "C3'" 1 
ATOM   87   O  "O3'" . DC  A 1  14  ? 59.346 64.676  31.055 1.00 73.35  ? 814  DC  P "O3'" 1 
ATOM   88   C  "C2'" . DC  A 1  14  ? 60.131 64.259  33.273 1.00 74.99  ? 814  DC  P "C2'" 1 
ATOM   89   C  "C1'" . DC  A 1  14  ? 60.294 62.762  33.100 1.00 74.56  ? 814  DC  P "C1'" 1 
ATOM   90   N  N1    . DC  A 1  14  ? 60.466 61.980  34.338 1.00 73.10  ? 814  DC  P N1    1 
ATOM   91   C  C2    . DC  A 1  14  ? 59.741 60.786  34.485 1.00 72.55  ? 814  DC  P C2    1 
ATOM   92   O  O2    . DC  A 1  14  ? 58.999 60.410  33.561 1.00 71.99  ? 814  DC  P O2    1 
ATOM   93   N  N3    . DC  A 1  14  ? 59.867 60.075  35.628 1.00 71.96  ? 814  DC  P N3    1 
ATOM   94   C  C4    . DC  A 1  14  ? 60.678 60.506  36.596 1.00 72.36  ? 814  DC  P C4    1 
ATOM   95   N  N4    . DC  A 1  14  ? 60.767 59.776  37.708 1.00 71.62  ? 814  DC  P N4    1 
ATOM   96   C  C5    . DC  A 1  14  ? 61.435 61.707  36.468 1.00 73.11  ? 814  DC  P C5    1 
ATOM   97   C  C6    . DC  A 1  14  ? 61.302 62.404  35.334 1.00 72.89  ? 814  DC  P C6    1 
ATOM   98   P  P     . DA  A 1  15  ? 58.549 66.014  30.712 1.00 71.63  ? 815  DA  P P     1 
ATOM   99   O  OP1   . DA  A 1  15  ? 59.399 66.863  29.837 1.00 73.08  ? 815  DA  P OP1   1 
ATOM   100  O  OP2   . DA  A 1  15  ? 58.057 66.553  32.009 1.00 71.31  ? 815  DA  P OP2   1 
ATOM   101  O  "O5'" . DA  A 1  15  ? 57.319 65.484  29.863 1.00 69.23  ? 815  DA  P "O5'" 1 
ATOM   102  C  "C5'" . DA  A 1  15  ? 56.008 65.590  30.375 1.00 66.32  ? 815  DA  P "C5'" 1 
ATOM   103  C  "C4'" . DA  A 1  15  ? 55.358 64.231  30.434 1.00 62.69  ? 815  DA  P "C4'" 1 
ATOM   104  O  "O4'" . DA  A 1  15  ? 56.055 63.346  31.353 1.00 61.66  ? 815  DA  P "O4'" 1 
ATOM   105  C  "C3'" . DA  A 1  15  ? 53.927 64.329  30.944 1.00 61.02  ? 815  DA  P "C3'" 1 
ATOM   106  O  "O3'" . DA  A 1  15  ? 53.085 63.513  30.136 1.00 59.61  ? 815  DA  P "O3'" 1 
ATOM   107  C  "C2'" . DA  A 1  15  ? 54.017 63.857  32.386 1.00 59.10  ? 815  DA  P "C2'" 1 
ATOM   108  C  "C1'" . DA  A 1  15  ? 55.149 62.849  32.335 1.00 58.44  ? 815  DA  P "C1'" 1 
ATOM   109  N  N9    . DA  A 1  15  ? 55.874 62.687  33.605 1.00 55.18  ? 815  DA  P N9    1 
ATOM   110  C  C8    . DA  A 1  15  ? 56.900 63.460  34.093 1.00 54.34  ? 815  DA  P C8    1 
ATOM   111  N  N7    . DA  A 1  15  ? 57.356 63.062  35.259 1.00 52.52  ? 815  DA  P N7    1 
ATOM   112  C  C5    . DA  A 1  15  ? 56.579 61.955  35.563 1.00 51.04  ? 815  DA  P C5    1 
ATOM   113  C  C6    . DA  A 1  15  ? 56.570 61.077  36.668 1.00 49.56  ? 815  DA  P C6    1 
ATOM   114  N  N6    . DA  A 1  15  ? 57.405 61.186  37.706 1.00 47.06  ? 815  DA  P N6    1 
ATOM   115  N  N1    . DA  A 1  15  ? 55.666 60.073  36.669 1.00 48.03  ? 815  DA  P N1    1 
ATOM   116  C  C2    . DA  A 1  15  ? 54.833 59.963  35.627 1.00 49.66  ? 815  DA  P C2    1 
ATOM   117  N  N3    . DA  A 1  15  ? 54.746 60.721  34.529 1.00 51.98  ? 815  DA  P N3    1 
ATOM   118  C  C4    . DA  A 1  15  ? 55.656 61.711  34.557 1.00 53.23  ? 815  DA  P C4    1 
ATOM   119  P  P     . DG  A 1  16  ? 51.554 63.937  29.908 1.00 60.60  ? 816  DG  P P     1 
ATOM   120  O  OP1   . DG  A 1  16  ? 51.171 63.616  28.507 1.00 61.49  ? 816  DG  P OP1   1 
ATOM   121  O  OP2   . DG  A 1  16  ? 51.384 65.325  30.424 1.00 59.09  ? 816  DG  P OP2   1 
ATOM   122  O  "O5'" . DG  A 1  16  ? 50.783 62.946  30.882 1.00 58.92  ? 816  DG  P "O5'" 1 
ATOM   123  C  "C5'" . DG  A 1  16  ? 51.457 62.439  32.021 1.00 52.92  ? 816  DG  P "C5'" 1 
ATOM   124  C  "C4'" . DG  A 1  16  ? 50.618 61.419  32.744 1.00 48.09  ? 816  DG  P "C4'" 1 
ATOM   125  O  "O4'" . DG  A 1  16  ? 51.383 61.055  33.913 1.00 46.20  ? 816  DG  P "O4'" 1 
ATOM   126  C  "C3'" . DG  A 1  16  ? 49.292 61.958  33.269 1.00 45.33  ? 816  DG  P "C3'" 1 
ATOM   127  O  "O3'" . DG  A 1  16  ? 48.352 60.874  33.353 1.00 42.52  ? 816  DG  P "O3'" 1 
ATOM   128  C  "C2'" . DG  A 1  16  ? 49.682 62.529  34.622 1.00 44.49  ? 816  DG  P "C2'" 1 
ATOM   129  C  "C1'" . DG  A 1  16  ? 50.787 61.588  35.085 1.00 43.78  ? 816  DG  P "C1'" 1 
ATOM   130  N  N9    . DG  A 1  16  ? 51.848 62.205  35.880 1.00 42.65  ? 816  DG  P N9    1 
ATOM   131  C  C8    . DG  A 1  16  ? 52.531 63.366  35.607 1.00 41.10  ? 816  DG  P C8    1 
ATOM   132  N  N7    . DG  A 1  16  ? 53.428 63.660  36.510 1.00 40.61  ? 816  DG  P N7    1 
ATOM   133  C  C5    . DG  A 1  16  ? 53.332 62.634  37.437 1.00 40.13  ? 816  DG  P C5    1 
ATOM   134  C  C6    . DG  A 1  16  ? 54.049 62.411  38.646 1.00 40.74  ? 816  DG  P C6    1 
ATOM   135  O  O6    . DG  A 1  16  ? 54.928 63.112  39.169 1.00 39.14  ? 816  DG  P O6    1 
ATOM   136  N  N1    . DG  A 1  16  ? 53.642 61.237  39.266 1.00 40.35  ? 816  DG  P N1    1 
ATOM   137  C  C2    . DG  A 1  16  ? 52.667 60.392  38.798 1.00 39.78  ? 816  DG  P C2    1 
ATOM   138  N  N2    . DG  A 1  16  ? 52.426 59.301  39.529 1.00 39.72  ? 816  DG  P N2    1 
ATOM   139  N  N3    . DG  A 1  16  ? 51.981 60.597  37.691 1.00 41.32  ? 816  DG  P N3    1 
ATOM   140  C  C4    . DG  A 1  16  ? 52.364 61.725  37.062 1.00 41.87  ? 816  DG  P C4    1 
ATOM   141  P  P     . DT  A 1  17  ? 46.780 61.168  33.580 1.00 43.28  ? 817  DT  P P     1 
ATOM   142  O  OP1   . DT  A 1  17  ? 46.020 60.137  32.834 1.00 44.11  ? 817  DT  P OP1   1 
ATOM   143  O  OP2   . DT  A 1  17  ? 46.485 62.607  33.352 1.00 39.98  ? 817  DT  P OP2   1 
ATOM   144  O  "O5'" . DT  A 1  17  ? 46.582 60.869  35.129 1.00 42.89  ? 817  DT  P "O5'" 1 
ATOM   145  C  "C5'" . DT  A 1  17  ? 47.653 61.092  36.028 1.00 39.36  ? 817  DT  P "C5'" 1 
ATOM   146  C  "C4'" . DT  A 1  17  ? 47.272 60.692  37.426 1.00 36.79  ? 817  DT  P "C4'" 1 
ATOM   147  O  "O4'" . DT  A 1  17  ? 48.407 61.000  38.263 1.00 35.99  ? 817  DT  P "O4'" 1 
ATOM   148  C  "C3'" . DT  A 1  17  ? 46.093 61.467  38.004 1.00 36.46  ? 817  DT  P "C3'" 1 
ATOM   149  O  "O3'" . DT  A 1  17  ? 45.360 60.585  38.866 1.00 34.24  ? 817  DT  P "O3'" 1 
ATOM   150  C  "C2'" . DT  A 1  17  ? 46.762 62.625  38.733 1.00 36.27  ? 817  DT  P "C2'" 1 
ATOM   151  C  "C1'" . DT  A 1  17  ? 48.091 62.028  39.190 1.00 37.01  ? 817  DT  P "C1'" 1 
ATOM   152  N  N1    . DT  A 1  17  ? 49.261 62.948  39.243 1.00 36.17  ? 817  DT  P N1    1 
ATOM   153  C  C2    . DT  A 1  17  ? 50.193 62.747  40.242 1.00 36.42  ? 817  DT  P C2    1 
ATOM   154  O  O2    . DT  A 1  17  ? 50.106 61.854  41.070 1.00 36.91  ? 817  DT  P O2    1 
ATOM   155  N  N3    . DT  A 1  17  ? 51.251 63.630  40.229 1.00 38.00  ? 817  DT  P N3    1 
ATOM   156  C  C4    . DT  A 1  17  ? 51.471 64.660  39.330 1.00 39.02  ? 817  DT  P C4    1 
ATOM   157  O  O4    . DT  A 1  17  ? 52.468 65.375  39.449 1.00 41.13  ? 817  DT  P O4    1 
ATOM   158  C  C5    . DT  A 1  17  ? 50.465 64.802  38.296 1.00 37.56  ? 817  DT  P C5    1 
ATOM   159  C  C7    . DT  A 1  17  ? 50.636 65.868  37.256 1.00 36.81  ? 817  DT  P C7    1 
ATOM   160  C  C6    . DT  A 1  17  ? 49.421 63.960  38.314 1.00 35.86  ? 817  DT  P C6    1 
ATOM   161  P  P     . DG  A 1  18  ? 43.892 60.989  39.391 1.00 35.12  ? 818  DG  P P     1 
ATOM   162  O  OP1   . DG  A 1  18  ? 43.051 59.762  39.358 1.00 39.26  ? 818  DG  P OP1   1 
ATOM   163  O  OP2   . DG  A 1  18  ? 43.422 62.219  38.706 1.00 36.71  ? 818  DG  P OP2   1 
ATOM   164  O  "O5'" . DG  A 1  18  ? 44.149 61.343  40.917 1.00 35.51  ? 818  DG  P "O5'" 1 
ATOM   165  C  "C5'" . DG  A 1  18  ? 45.432 61.784  41.314 1.00 37.36  ? 818  DG  P "C5'" 1 
ATOM   166  C  "C4'" . DG  A 1  18  ? 45.574 61.744  42.811 1.00 36.77  ? 818  DG  P "C4'" 1 
ATOM   167  O  "O4'" . DG  A 1  18  ? 46.895 62.260  43.080 1.00 37.32  ? 818  DG  P "O4'" 1 
ATOM   168  C  "C3'" . DG  A 1  18  ? 44.598 62.660  43.541 1.00 36.50  ? 818  DG  P "C3'" 1 
ATOM   169  O  "O3'" . DG  A 1  18  ? 44.212 62.069  44.779 1.00 34.74  ? 818  DG  P "O3'" 1 
ATOM   170  C  "C2'" . DG  A 1  18  ? 45.365 63.962  43.701 1.00 36.01  ? 818  DG  P "C2'" 1 
ATOM   171  C  "C1'" . DG  A 1  18  ? 46.831 63.547  43.666 1.00 37.95  ? 818  DG  P "C1'" 1 
ATOM   172  N  N9    . DG  A 1  18  ? 47.681 64.434  42.873 1.00 37.43  ? 818  DG  P N9    1 
ATOM   173  C  C8    . DG  A 1  18  ? 47.373 65.036  41.674 1.00 37.32  ? 818  DG  P C8    1 
ATOM   174  N  N7    . DG  A 1  18  ? 48.321 65.818  41.235 1.00 37.17  ? 818  DG  P N7    1 
ATOM   175  C  C5    . DG  A 1  18  ? 49.319 65.720  42.196 1.00 36.84  ? 818  DG  P C5    1 
ATOM   176  C  C6    . DG  A 1  18  ? 50.581 66.357  42.275 1.00 37.49  ? 818  DG  P C6    1 
ATOM   177  O  O6    . DG  A 1  18  ? 51.083 67.179  41.493 1.00 36.07  ? 818  DG  P O6    1 
ATOM   178  N  N1    . DG  A 1  18  ? 51.281 65.962  43.413 1.00 35.96  ? 818  DG  P N1    1 
ATOM   179  C  C2    . DG  A 1  18  ? 50.821 65.074  44.356 1.00 37.55  ? 818  DG  P C2    1 
ATOM   180  N  N2    . DG  A 1  18  ? 51.644 64.805  45.381 1.00 36.53  ? 818  DG  P N2    1 
ATOM   181  N  N3    . DG  A 1  18  ? 49.641 64.486  44.299 1.00 37.18  ? 818  DG  P N3    1 
ATOM   182  C  C4    . DG  A 1  18  ? 48.947 64.853  43.202 1.00 37.58  ? 818  DG  P C4    1 
ATOM   183  P  P     . DC  A 1  19  ? 43.288 62.885  45.805 1.00 36.77  ? 819  DC  P P     1 
ATOM   184  O  OP1   . DC  A 1  19  ? 42.549 61.877  46.613 1.00 38.37  ? 819  DC  P OP1   1 
ATOM   185  O  OP2   . DC  A 1  19  ? 42.531 63.930  45.069 1.00 36.64  ? 819  DC  P OP2   1 
ATOM   186  O  "O5'" . DC  A 1  19  ? 44.355 63.591  46.755 1.00 36.05  ? 819  DC  P "O5'" 1 
ATOM   187  C  "C5'" . DC  A 1  19  ? 45.296 62.799  47.484 1.00 34.30  ? 819  DC  P "C5'" 1 
ATOM   188  C  "C4'" . DC  A 1  19  ? 46.150 63.670  48.372 1.00 34.55  ? 819  DC  P "C4'" 1 
ATOM   189  O  "O4'" . DC  A 1  19  ? 47.130 64.387  47.579 1.00 34.72  ? 819  DC  P "O4'" 1 
ATOM   190  C  "C3'" . DC  A 1  19  ? 45.370 64.727  49.160 1.00 36.33  ? 819  DC  P "C3'" 1 
ATOM   191  O  "O3'" . DC  A 1  19  ? 45.873 64.800  50.499 1.00 35.60  ? 819  DC  P "O3'" 1 
ATOM   192  C  "C2'" . DC  A 1  19  ? 45.653 66.012  48.398 1.00 34.90  ? 819  DC  P "C2'" 1 
ATOM   193  C  "C1'" . DC  A 1  19  ? 47.067 65.770  47.899 1.00 35.85  ? 819  DC  P "C1'" 1 
ATOM   194  N  N1    . DC  A 1  19  ? 47.482 66.551  46.714 1.00 35.29  ? 819  DC  P N1    1 
ATOM   195  C  C2    . DC  A 1  19  ? 48.761 67.133  46.703 1.00 33.93  ? 819  DC  P C2    1 
ATOM   196  O  O2    . DC  A 1  19  ? 49.518 66.950  47.667 1.00 33.92  ? 819  DC  P O2    1 
ATOM   197  N  N3    . DC  A 1  19  ? 49.138 67.879  45.645 1.00 34.51  ? 819  DC  P N3    1 
ATOM   198  C  C4    . DC  A 1  19  ? 48.303 68.054  44.620 1.00 35.35  ? 819  DC  P C4    1 
ATOM   199  N  N4    . DC  A 1  19  ? 48.717 68.813  43.600 1.00 35.02  ? 819  DC  P N4    1 
ATOM   200  C  C5    . DC  A 1  19  ? 47.007 67.461  44.593 1.00 34.19  ? 819  DC  P C5    1 
ATOM   201  C  C6    . DC  A 1  19  ? 46.642 66.724  45.649 1.00 34.48  ? 819  DC  P C6    1 
ATOM   202  P  P     . DC  A 1  20  ? 45.110 65.694  51.601 1.00 34.37  ? 820  DC  P P     1 
ATOM   203  O  OP1   . DC  A 1  20  ? 44.758 64.816  52.738 1.00 33.64  ? 820  DC  P OP1   1 
ATOM   204  O  OP2   . DC  A 1  20  ? 44.049 66.511  50.948 1.00 33.13  ? 820  DC  P OP2   1 
ATOM   205  O  "O5'" . DC  A 1  20  ? 46.252 66.692  52.082 1.00 33.95  ? 820  DC  P "O5'" 1 
ATOM   206  C  "C5'" . DC  A 1  20  ? 47.492 66.200  52.582 1.00 29.04  ? 820  DC  P "C5'" 1 
ATOM   207  C  "C4'" . DC  A 1  20  ? 48.403 67.354  52.922 1.00 28.99  ? 820  DC  P "C4'" 1 
ATOM   208  O  "O4'" . DC  A 1  20  ? 49.181 67.668  51.737 1.00 28.63  ? 820  DC  P "O4'" 1 
ATOM   209  C  "C3'" . DC  A 1  20  ? 47.612 68.616  53.257 1.00 28.46  ? 820  DC  P "C3'" 1 
ATOM   210  O  "O3'" . DC  A 1  20  ? 47.583 69.021  54.606 1.00 27.48  ? 820  DC  P "O3'" 1 
ATOM   211  C  "C2'" . DC  A 1  20  ? 48.247 69.726  52.449 1.00 28.74  ? 820  DC  P "C2'" 1 
ATOM   212  C  "C1'" . DC  A 1  20  ? 49.266 69.075  51.543 1.00 28.66  ? 820  DC  P "C1'" 1 
ATOM   213  N  N1    . DC  A 1  20  ? 48.825 69.396  50.176 1.00 28.96  ? 820  DC  P N1    1 
ATOM   214  C  C2    . DC  A 1  20  ? 49.543 70.347  49.440 1.00 27.43  ? 820  DC  P C2    1 
ATOM   215  O  O2    . DC  A 1  20  ? 50.607 70.783  49.899 1.00 30.09  ? 820  DC  P O2    1 
ATOM   216  N  N3    . DC  A 1  20  ? 49.059 70.761  48.248 1.00 27.73  ? 820  DC  P N3    1 
ATOM   217  C  C4    . DC  A 1  20  ? 47.919 70.249  47.773 1.00 27.48  ? 820  DC  P C4    1 
ATOM   218  N  N4    . DC  A 1  20  ? 47.456 70.720  46.614 1.00 23.34  ? 820  DC  P N4    1 
ATOM   219  C  C5    . DC  A 1  20  ? 47.199 69.237  48.473 1.00 28.17  ? 820  DC  P C5    1 
ATOM   220  C  C6    . DC  A 1  20  ? 47.689 68.835  49.654 1.00 27.97  ? 820  DC  P C6    1 
ATOM   221  P  P     . DA  A 1  21  ? 46.522 70.149  55.028 1.00 29.85  ? 821  DA  P P     1 
ATOM   222  O  OP1   . DA  A 1  21  ? 46.221 70.054  56.478 1.00 33.34  ? 821  DA  P OP1   1 
ATOM   223  O  OP2   . DA  A 1  21  ? 45.409 70.111  54.052 1.00 29.52  ? 821  DA  P OP2   1 
ATOM   224  O  "O5'" . DA  A 1  21  ? 47.314 71.496  54.731 1.00 30.13  ? 821  DA  P "O5'" 1 
ATOM   225  C  "C5'" . DA  A 1  21  ? 48.679 71.634  55.125 1.00 28.89  ? 821  DA  P "C5'" 1 
ATOM   226  C  "C4'" . DA  A 1  21  ? 49.179 73.018  54.794 1.00 28.50  ? 821  DA  P "C4'" 1 
ATOM   227  O  "O4'" . DA  A 1  21  ? 49.495 73.092  53.380 1.00 28.34  ? 821  DA  P "O4'" 1 
ATOM   228  C  "C3'" . DA  A 1  21  ? 48.107 74.067  55.062 1.00 27.47  ? 821  DA  P "C3'" 1 
ATOM   229  O  "O3'" . DA  A 1  21  ? 48.464 75.034  56.021 1.00 28.45  ? 821  DA  P "O3'" 1 
ATOM   230  C  "C2'" . DA  A 1  21  ? 47.849 74.741  53.733 1.00 30.22  ? 821  DA  P "C2'" 1 
ATOM   231  C  "C1'" . DA  A 1  21  ? 48.955 74.273  52.808 1.00 30.15  ? 821  DA  P "C1'" 1 
ATOM   232  N  N9    . DA  A 1  21  ? 48.333 73.928  51.528 1.00 30.03  ? 821  DA  P N9    1 
ATOM   233  C  C8    . DA  A 1  21  ? 47.494 72.871  51.247 1.00 28.97  ? 821  DA  P C8    1 
ATOM   234  N  N7    . DA  A 1  21  ? 46.974 72.917  50.044 1.00 31.20  ? 821  DA  P N7    1 
ATOM   235  C  C5    . DA  A 1  21  ? 47.528 74.060  49.487 1.00 30.47  ? 821  DA  P C5    1 
ATOM   236  C  C6    . DA  A 1  21  ? 47.356 74.681  48.237 1.00 33.76  ? 821  DA  P C6    1 
ATOM   237  N  N6    . DA  A 1  21  ? 46.523 74.230  47.293 1.00 32.78  ? 821  DA  P N6    1 
ATOM   238  N  N1    . DA  A 1  21  ? 48.067 75.805  47.989 1.00 34.46  ? 821  DA  P N1    1 
ATOM   239  C  C2    . DA  A 1  21  ? 48.884 76.272  48.947 1.00 34.30  ? 821  DA  P C2    1 
ATOM   240  N  N3    . DA  A 1  21  ? 49.118 75.786  50.167 1.00 30.71  ? 821  DA  P N3    1 
ATOM   241  C  C4    . DA  A 1  21  ? 48.399 74.672  50.376 1.00 30.42  ? 821  DA  P C4    1 
HETATM 242  P  P     . DDG A 1  22  ? 47.315 75.993  56.605 1.00 28.72  ? 822  DDG P P     1 
HETATM 243  O  OP1   . DDG A 1  22  ? 47.569 76.295  58.041 1.00 29.74  ? 822  DDG P OP1   1 
HETATM 244  O  OP2   . DDG A 1  22  ? 45.997 75.482  56.182 1.00 27.18  ? 822  DDG P OP2   1 
HETATM 245  O  "O5'" . DDG A 1  22  ? 47.477 77.307  55.738 1.00 26.20  ? 822  DDG P "O5'" 1 
HETATM 246  C  "C5'" . DDG A 1  22  ? 48.734 77.945  55.622 1.00 24.95  ? 822  DDG P "C5'" 1 
HETATM 247  C  "C4'" . DDG A 1  22  ? 48.640 79.059  54.616 1.00 26.16  ? 822  DDG P "C4'" 1 
HETATM 248  O  "O4'" . DDG A 1  22  ? 48.690 78.499  53.282 1.00 28.82  ? 822  DDG P "O4'" 1 
HETATM 249  C  "C3'" . DDG A 1  22  ? 47.351 79.875  54.658 1.00 27.63  ? 822  DDG P "C3'" 1 
HETATM 250  C  "C2'" . DDG A 1  22  ? 47.263 80.420  53.232 1.00 26.85  ? 822  DDG P "C2'" 1 
HETATM 251  C  "C1'" . DDG A 1  22  ? 47.880 79.279  52.424 1.00 28.02  ? 822  DDG P "C1'" 1 
HETATM 252  N  N9    . DDG A 1  22  ? 46.917 78.411  51.752 1.00 27.63  ? 822  DDG P N9    1 
HETATM 253  C  C8    . DDG A 1  22  ? 46.258 77.314  52.251 1.00 29.13  ? 822  DDG P C8    1 
HETATM 254  N  N7    . DDG A 1  22  ? 45.541 76.696  51.347 1.00 28.70  ? 822  DDG P N7    1 
HETATM 255  C  C5    . DDG A 1  22  ? 45.724 77.446  50.191 1.00 29.26  ? 822  DDG P C5    1 
HETATM 256  C  C6    . DDG A 1  22  ? 45.211 77.274  48.843 1.00 30.38  ? 822  DDG P C6    1 
HETATM 257  O  O6    . DDG A 1  22  ? 44.466 76.376  48.386 1.00 32.55  ? 822  DDG P O6    1 
HETATM 258  N  N1    . DDG A 1  22  ? 45.656 78.291  48.003 1.00 27.57  ? 822  DDG P N1    1 
HETATM 259  C  C2    . DDG A 1  22  ? 46.465 79.333  48.389 1.00 27.32  ? 822  DDG P C2    1 
HETATM 260  N  N2    . DDG A 1  22  ? 46.789 80.218  47.451 1.00 28.41  ? 822  DDG P N2    1 
HETATM 261  N  N3    . DDG A 1  22  ? 46.930 79.500  49.607 1.00 28.27  ? 822  DDG P N3    1 
HETATM 262  C  C4    . DDG A 1  22  ? 46.539 78.528  50.443 1.00 28.78  ? 822  DDG P C4    1 
ATOM   263  P  P     . DC  B 2  3   ? 33.576 79.475  34.198 1.00 74.85  ? 853  DC  T P     1 
ATOM   264  O  OP1   . DC  B 2  3   ? 32.601 78.393  33.751 1.00 74.28  ? 853  DC  T OP1   1 
ATOM   265  O  OP2   . DC  B 2  3   ? 34.298 80.122  33.024 1.00 74.77  ? 853  DC  T OP2   1 
ATOM   266  O  "O5'" . DC  B 2  3   ? 34.742 78.731  35.061 1.00 71.67  ? 853  DC  T "O5'" 1 
ATOM   267  C  "C5'" . DC  B 2  3   ? 34.563 77.384  35.527 1.00 67.57  ? 853  DC  T "C5'" 1 
ATOM   268  C  "C4'" . DC  B 2  3   ? 35.894 76.674  35.616 1.00 63.85  ? 853  DC  T "C4'" 1 
ATOM   269  O  "O4'" . DC  B 2  3   ? 36.695 76.974  34.446 1.00 63.61  ? 853  DC  T "O4'" 1 
ATOM   270  C  "C3'" . DC  B 2  3   ? 36.747 77.050  36.830 1.00 60.94  ? 853  DC  T "C3'" 1 
ATOM   271  O  "O3'" . DC  B 2  3   ? 37.355 75.871  37.361 1.00 55.29  ? 853  DC  T "O3'" 1 
ATOM   272  C  "C2'" . DC  B 2  3   ? 37.808 77.968  36.249 1.00 62.17  ? 853  DC  T "C2'" 1 
ATOM   273  C  "C1'" . DC  B 2  3   ? 37.988 77.393  34.855 1.00 63.06  ? 853  DC  T "C1'" 1 
ATOM   274  N  N1    . DC  B 2  3   ? 38.518 78.332  33.846 1.00 62.90  ? 853  DC  T N1    1 
ATOM   275  C  C2    . DC  B 2  3   ? 39.792 78.089  33.304 1.00 63.60  ? 853  DC  T C2    1 
ATOM   276  O  O2    . DC  B 2  3   ? 40.425 77.081  33.671 1.00 62.79  ? 853  DC  T O2    1 
ATOM   277  N  N3    . DC  B 2  3   ? 40.300 78.956  32.395 1.00 63.40  ? 853  DC  T N3    1 
ATOM   278  C  C4    . DC  B 2  3   ? 39.590 80.022  32.018 1.00 63.07  ? 853  DC  T C4    1 
ATOM   279  N  N4    . DC  B 2  3   ? 40.136 80.853  31.126 1.00 63.42  ? 853  DC  T N4    1 
ATOM   280  C  C5    . DC  B 2  3   ? 38.288 80.285  32.540 1.00 63.03  ? 853  DC  T C5    1 
ATOM   281  C  C6    . DC  B 2  3   ? 37.795 79.424  33.443 1.00 62.69  ? 853  DC  T C6    1 
HETATM 282  P  P     . 8OG B 2  4   ? 36.691 75.137  38.625 1.00 51.30  ? 854  8OG T P     1 
HETATM 283  O  OP1   . 8OG B 2  4   ? 37.388 73.837  38.788 1.00 51.84  ? 854  8OG T OP1   1 
HETATM 284  O  OP2   . 8OG B 2  4   ? 35.216 75.168  38.450 1.00 53.47  ? 854  8OG T OP2   1 
HETATM 285  O  "O5'" . 8OG B 2  4   ? 37.051 76.067  39.866 1.00 48.97  ? 854  8OG T "O5'" 1 
HETATM 286  C  "C5'" . 8OG B 2  4   ? 38.393 76.171  40.313 1.00 45.83  ? 854  8OG T "C5'" 1 
HETATM 287  C  "C4'" . 8OG B 2  4   ? 38.821 77.616  40.348 1.00 43.50  ? 854  8OG T "C4'" 1 
HETATM 288  O  "O4'" . 8OG B 2  4   ? 38.389 78.183  41.611 1.00 42.09  ? 854  8OG T "O4'" 1 
HETATM 289  C  "C3'" . 8OG B 2  4   ? 40.340 77.752  40.300 1.00 43.63  ? 854  8OG T "C3'" 1 
HETATM 290  O  "O3'" . 8OG B 2  4   ? 40.803 78.497  39.187 1.00 40.96  ? 854  8OG T "O3'" 1 
HETATM 291  C  "C2'" . 8OG B 2  4   ? 40.752 78.394  41.608 1.00 43.74  ? 854  8OG T "C2'" 1 
HETATM 292  C  "C1'" . 8OG B 2  4   ? 39.478 78.709  42.363 1.00 43.57  ? 854  8OG T "C1'" 1 
HETATM 293  N  N9    . 8OG B 2  4   ? 39.543 78.027  43.660 1.00 42.31  ? 854  8OG T N9    1 
HETATM 294  C  C8    . 8OG B 2  4   ? 38.970 76.823  44.058 1.00 42.92  ? 854  8OG T C8    1 
HETATM 295  N  N7    . 8OG B 2  4   ? 39.336 76.472  45.262 1.00 41.27  ? 854  8OG T N7    1 
HETATM 296  C  C5    . 8OG B 2  4   ? 40.169 77.494  45.694 1.00 41.07  ? 854  8OG T C5    1 
HETATM 297  C  C6    . 8OG B 2  4   ? 40.876 77.648  46.916 1.00 39.80  ? 854  8OG T C6    1 
HETATM 298  O  O6    . 8OG B 2  4   ? 40.908 76.887  47.883 1.00 38.80  ? 854  8OG T O6    1 
HETATM 299  N  N1    . 8OG B 2  4   ? 41.608 78.830  46.940 1.00 38.35  ? 854  8OG T N1    1 
HETATM 300  C  C2    . 8OG B 2  4   ? 41.656 79.747  45.921 1.00 39.32  ? 854  8OG T C2    1 
HETATM 301  N  N2    . 8OG B 2  4   ? 42.415 80.832  46.130 1.00 39.96  ? 854  8OG T N2    1 
HETATM 302  N  N3    . 8OG B 2  4   ? 41.009 79.613  44.777 1.00 40.35  ? 854  8OG T N3    1 
HETATM 303  C  C4    . 8OG B 2  4   ? 40.292 78.469  44.731 1.00 41.75  ? 854  8OG T C4    1 
HETATM 304  O  O8    . 8OG B 2  4   ? 38.228 76.173  43.333 1.00 43.73  ? 854  8OG T O8    1 
ATOM   305  P  P     . DC  B 2  5   ? 42.211 78.102  38.528 1.00 39.84  ? 855  DC  T P     1 
ATOM   306  O  OP1   . DC  B 2  5   ? 42.185 78.484  37.087 1.00 40.56  ? 855  DC  T OP1   1 
ATOM   307  O  OP2   . DC  B 2  5   ? 42.555 76.707  38.912 1.00 37.54  ? 855  DC  T OP2   1 
ATOM   308  O  "O5'" . DC  B 2  5   ? 43.225 79.051  39.295 1.00 38.24  ? 855  DC  T "O5'" 1 
ATOM   309  C  "C5'" . DC  B 2  5   ? 43.004 80.458  39.359 1.00 35.67  ? 855  DC  T "C5'" 1 
ATOM   310  C  "C4'" . DC  B 2  5   ? 44.092 81.097  40.183 1.00 36.00  ? 855  DC  T "C4'" 1 
ATOM   311  O  "O4'" . DC  B 2  5   ? 43.781 80.888  41.587 1.00 33.85  ? 855  DC  T "O4'" 1 
ATOM   312  C  "C3'" . DC  B 2  5   ? 45.427 80.401  39.920 1.00 33.63  ? 855  DC  T "C3'" 1 
ATOM   313  O  "O3'" . DC  B 2  5   ? 46.500 81.243  39.550 1.00 30.59  ? 855  DC  T "O3'" 1 
ATOM   314  C  "C2'" . DC  B 2  5   ? 45.764 79.687  41.210 1.00 34.09  ? 855  DC  T "C2'" 1 
ATOM   315  C  "C1'" . DC  B 2  5   ? 44.899 80.339  42.266 1.00 33.13  ? 855  DC  T "C1'" 1 
ATOM   316  N  N1    . DC  B 2  5   ? 44.426 79.297  43.198 1.00 32.13  ? 855  DC  T N1    1 
ATOM   317  C  C2    . DC  B 2  5   ? 44.770 79.385  44.551 1.00 30.19  ? 855  DC  T C2    1 
ATOM   318  O  O2    . DC  B 2  5   ? 45.340 80.417  44.968 1.00 28.34  ? 855  DC  T O2    1 
ATOM   319  N  N3    . DC  B 2  5   ? 44.470 78.345  45.371 1.00 28.61  ? 855  DC  T N3    1 
ATOM   320  C  C4    . DC  B 2  5   ? 43.835 77.272  44.886 1.00 29.58  ? 855  DC  T C4    1 
ATOM   321  N  N4    . DC  B 2  5   ? 43.612 76.246  45.706 1.00 30.32  ? 855  DC  T N4    1 
ATOM   322  C  C5    . DC  B 2  5   ? 43.411 77.198  43.532 1.00 30.25  ? 855  DC  T C5    1 
ATOM   323  C  C6    . DC  B 2  5   ? 43.717 78.221  42.735 1.00 30.65  ? 855  DC  T C6    1 
ATOM   324  P  P     . DT  B 2  6   ? 47.909 80.567  39.205 1.00 29.04  ? 856  DT  T P     1 
ATOM   325  O  OP1   . DT  B 2  6   ? 48.587 81.341  38.140 1.00 32.02  ? 856  DT  T OP1   1 
ATOM   326  O  OP2   . DT  B 2  6   ? 47.669 79.112  39.014 1.00 28.84  ? 856  DT  T OP2   1 
ATOM   327  O  "O5'" . DT  B 2  6   ? 48.712 80.689  40.572 1.00 29.23  ? 856  DT  T "O5'" 1 
ATOM   328  C  "C5'" . DT  B 2  6   ? 48.598 81.854  41.389 1.00 27.24  ? 856  DT  T "C5'" 1 
ATOM   329  C  "C4'" . DT  B 2  6   ? 49.575 81.777  42.536 1.00 26.49  ? 856  DT  T "C4'" 1 
ATOM   330  O  "O4'" . DT  B 2  6   ? 48.915 81.168  43.673 1.00 24.25  ? 856  DT  T "O4'" 1 
ATOM   331  C  "C3'" . DT  B 2  6   ? 50.773 80.893  42.198 1.00 26.91  ? 856  DT  T "C3'" 1 
ATOM   332  O  "O3'" . DT  B 2  6   ? 52.021 81.540  42.117 1.00 25.87  ? 856  DT  T "O3'" 1 
ATOM   333  C  "C2'" . DT  B 2  6   ? 50.823 79.824  43.268 1.00 27.14  ? 856  DT  T "C2'" 1 
ATOM   334  C  "C1'" . DT  B 2  6   ? 49.728 80.157  44.259 1.00 25.68  ? 856  DT  T "C1'" 1 
ATOM   335  N  N1    . DT  B 2  6   ? 48.906 78.944  44.424 1.00 25.25  ? 856  DT  T N1    1 
ATOM   336  C  C2    . DT  B 2  6   ? 48.924 78.279  45.630 1.00 25.29  ? 856  DT  T C2    1 
ATOM   337  O  O2    . DT  B 2  6   ? 49.525 78.684  46.616 1.00 23.43  ? 856  DT  T O2    1 
ATOM   338  N  N3    . DT  B 2  6   ? 48.208 77.110  45.639 1.00 25.99  ? 856  DT  T N3    1 
ATOM   339  C  C4    . DT  B 2  6   ? 47.490 76.557  44.595 1.00 25.41  ? 856  DT  T C4    1 
ATOM   340  O  O4    . DT  B 2  6   ? 46.914 75.487  44.753 1.00 28.81  ? 856  DT  T O4    1 
ATOM   341  C  C5    . DT  B 2  6   ? 47.494 77.321  43.371 1.00 27.85  ? 856  DT  T C5    1 
ATOM   342  C  C7    . DT  B 2  6   ? 46.759 76.799  42.175 1.00 28.39  ? 856  DT  T C7    1 
ATOM   343  C  C6    . DT  B 2  6   ? 48.175 78.467  43.355 1.00 25.62  ? 856  DT  T C6    1 
ATOM   344  P  P     . DG  B 2  7   ? 53.222 80.770  41.387 1.00 23.27  ? 857  DG  T P     1 
ATOM   345  O  OP1   . DG  B 2  7   ? 54.157 81.762  40.798 1.00 22.14  ? 857  DG  T OP1   1 
ATOM   346  O  OP2   . DG  B 2  7   ? 52.607 79.738  40.513 1.00 24.05  ? 857  DG  T OP2   1 
ATOM   347  O  "O5'" . DG  B 2  7   ? 53.924 80.002  42.593 1.00 23.30  ? 857  DG  T "O5'" 1 
ATOM   348  C  "C5'" . DG  B 2  7   ? 53.821 78.583  42.725 1.00 25.68  ? 857  DG  T "C5'" 1 
ATOM   349  C  "C4'" . DG  B 2  7   ? 54.234 78.161  44.115 1.00 27.38  ? 857  DG  T "C4'" 1 
ATOM   350  O  "O4'" . DG  B 2  7   ? 53.012 77.972  44.878 1.00 26.98  ? 857  DG  T "O4'" 1 
ATOM   351  C  "C3'" . DG  B 2  7   ? 54.965 76.820  44.133 1.00 25.58  ? 857  DG  T "C3'" 1 
ATOM   352  O  "O3'" . DG  B 2  7   ? 56.306 76.869  44.581 1.00 24.36  ? 857  DG  T "O3'" 1 
ATOM   353  C  "C2'" . DG  B 2  7   ? 54.192 75.934  45.081 1.00 27.94  ? 857  DG  T "C2'" 1 
ATOM   354  C  "C1'" . DG  B 2  7   ? 53.037 76.750  45.607 1.00 28.30  ? 857  DG  T "C1'" 1 
ATOM   355  N  N9    . DG  B 2  7   ? 51.853 75.969  45.261 1.00 28.01  ? 857  DG  T N9    1 
ATOM   356  C  C8    . DG  B 2  7   ? 51.130 76.003  44.092 1.00 28.35  ? 857  DG  T C8    1 
ATOM   357  N  N7    . DG  B 2  7   ? 50.228 75.060  44.022 1.00 28.07  ? 857  DG  T N7    1 
ATOM   358  C  C5    . DG  B 2  7   ? 50.342 74.387  45.232 1.00 27.96  ? 857  DG  T C5    1 
ATOM   359  C  C6    . DG  B 2  7   ? 49.645 73.252  45.729 1.00 27.03  ? 857  DG  T C6    1 
ATOM   360  O  O6    . DG  B 2  7   ? 48.774 72.584  45.178 1.00 28.38  ? 857  DG  T O6    1 
ATOM   361  N  N1    . DG  B 2  7   ? 50.070 72.911  47.006 1.00 26.48  ? 857  DG  T N1    1 
ATOM   362  C  C2    . DG  B 2  7   ? 51.047 73.570  47.715 1.00 27.20  ? 857  DG  T C2    1 
ATOM   363  N  N2    . DG  B 2  7   ? 51.311 73.108  48.941 1.00 28.61  ? 857  DG  T N2    1 
ATOM   364  N  N3    . DG  B 2  7   ? 51.712 74.609  47.258 1.00 25.41  ? 857  DG  T N3    1 
ATOM   365  C  C4    . DG  B 2  7   ? 51.313 74.962  46.021 1.00 27.08  ? 857  DG  T C4    1 
ATOM   366  P  P     . DG  B 2  8   ? 57.280 75.644  44.216 1.00 20.92  ? 858  DG  T P     1 
ATOM   367  O  OP1   . DG  B 2  8   ? 58.679 76.105  44.357 1.00 23.99  ? 858  DG  T OP1   1 
ATOM   368  O  OP2   . DG  B 2  8   ? 56.831 75.040  42.936 1.00 21.52  ? 858  DG  T OP2   1 
ATOM   369  O  "O5'" . DG  B 2  8   ? 56.968 74.556  45.334 1.00 19.86  ? 858  DG  T "O5'" 1 
ATOM   370  C  "C5'" . DG  B 2  8   ? 57.206 74.834  46.706 1.00 19.61  ? 858  DG  T "C5'" 1 
ATOM   371  C  "C4'" . DG  B 2  8   ? 57.236 73.547  47.496 1.00 20.82  ? 858  DG  T "C4'" 1 
ATOM   372  O  "O4'" . DG  B 2  8   ? 55.938 72.913  47.425 1.00 20.32  ? 858  DG  T "O4'" 1 
ATOM   373  C  "C3'" . DG  B 2  8   ? 58.247 72.510  47.008 1.00 21.75  ? 858  DG  T "C3'" 1 
ATOM   374  O  "O3'" . DG  B 2  8   ? 58.829 71.874  48.149 1.00 20.53  ? 858  DG  T "O3'" 1 
ATOM   375  C  "C2'" . DG  B 2  8   ? 57.408 71.561  46.169 1.00 22.50  ? 858  DG  T "C2'" 1 
ATOM   376  C  "C1'" . DG  B 2  8   ? 56.028 71.633  46.818 1.00 23.21  ? 858  DG  T "C1'" 1 
ATOM   377  N  N9    . DG  B 2  8   ? 54.907 71.519  45.886 1.00 24.54  ? 858  DG  T N9    1 
ATOM   378  C  C8    . DG  B 2  8   ? 54.747 72.209  44.705 1.00 26.55  ? 858  DG  T C8    1 
ATOM   379  N  N7    . DG  B 2  8   ? 53.629 71.927  44.092 1.00 25.59  ? 858  DG  T N7    1 
ATOM   380  C  C5    . DG  B 2  8   ? 53.013 70.993  44.912 1.00 26.17  ? 858  DG  T C5    1 
ATOM   381  C  C6    . DG  B 2  8   ? 51.767 70.321  44.764 1.00 29.03  ? 858  DG  T C6    1 
ATOM   382  O  O6    . DG  B 2  8   ? 50.937 70.422  43.844 1.00 31.15  ? 858  DG  T O6    1 
ATOM   383  N  N1    . DG  B 2  8   ? 51.526 69.452  45.825 1.00 28.23  ? 858  DG  T N1    1 
ATOM   384  C  C2    . DG  B 2  8   ? 52.377 69.241  46.882 1.00 29.10  ? 858  DG  T C2    1 
ATOM   385  N  N2    . DG  B 2  8   ? 51.975 68.331  47.792 1.00 26.06  ? 858  DG  T N2    1 
ATOM   386  N  N3    . DG  B 2  8   ? 53.543 69.868  47.035 1.00 25.70  ? 858  DG  T N3    1 
ATOM   387  C  C4    . DG  B 2  8   ? 53.793 70.721  46.021 1.00 24.23  ? 858  DG  T C4    1 
ATOM   388  P  P     . DC  B 2  9   ? 59.985 70.769  47.967 1.00 22.10  ? 859  DC  T P     1 
ATOM   389  O  OP1   . DC  B 2  9   ? 60.738 70.709  49.239 1.00 20.49  ? 859  DC  T OP1   1 
ATOM   390  O  OP2   . DC  B 2  9   ? 60.716 70.982  46.691 1.00 21.66  ? 859  DC  T OP2   1 
ATOM   391  O  "O5'" . DC  B 2  9   ? 59.155 69.424  47.821 1.00 24.62  ? 859  DC  T "O5'" 1 
ATOM   392  C  "C5'" . DC  B 2  9   ? 58.184 69.074  48.804 1.00 26.42  ? 859  DC  T "C5'" 1 
ATOM   393  C  "C4'" . DC  B 2  9   ? 57.469 67.804  48.412 1.00 26.72  ? 859  DC  T "C4'" 1 
ATOM   394  O  "O4'" . DC  B 2  9   ? 56.370 68.059  47.504 1.00 28.02  ? 859  DC  T "O4'" 1 
ATOM   395  C  "C3'" . DC  B 2  9   ? 58.345 66.742  47.747 1.00 26.59  ? 859  DC  T "C3'" 1 
ATOM   396  O  "O3'" . DC  B 2  9   ? 58.084 65.500  48.371 1.00 27.75  ? 859  DC  T "O3'" 1 
ATOM   397  C  "C2'" . DC  B 2  9   ? 57.831 66.698  46.316 1.00 27.23  ? 859  DC  T "C2'" 1 
ATOM   398  C  "C1'" . DC  B 2  9   ? 56.367 67.048  46.514 1.00 27.39  ? 859  DC  T "C1'" 1 
ATOM   399  N  N1    . DC  B 2  9   ? 55.631 67.554  45.336 1.00 28.29  ? 859  DC  T N1    1 
ATOM   400  C  C2    . DC  B 2  9   ? 54.336 67.063  45.085 1.00 28.65  ? 859  DC  T C2    1 
ATOM   401  O  O2    . DC  B 2  9   ? 53.844 66.220  45.854 1.00 29.60  ? 859  DC  T O2    1 
ATOM   402  N  N3    . DC  B 2  9   ? 53.654 67.520  44.016 1.00 29.09  ? 859  DC  T N3    1 
ATOM   403  C  C4    . DC  B 2  9   ? 54.206 68.427  43.210 1.00 30.23  ? 859  DC  T C4    1 
ATOM   404  N  N4    . DC  B 2  9   ? 53.491 68.847  42.162 1.00 31.17  ? 859  DC  T N4    1 
ATOM   405  C  C5    . DC  B 2  9   ? 55.514 68.946  43.440 1.00 28.49  ? 859  DC  T C5    1 
ATOM   406  C  C6    . DC  B 2  9   ? 56.185 68.486  44.501 1.00 27.92  ? 859  DC  T C6    1 
ATOM   407  P  P     . DA  B 2  10  ? 59.231 64.382  48.458 1.00 28.02  ? 860  DA  T P     1 
ATOM   408  O  OP1   . DA  B 2  10  ? 59.882 64.517  49.789 1.00 30.80  ? 860  DA  T OP1   1 
ATOM   409  O  OP2   . DA  B 2  10  ? 60.059 64.387  47.234 1.00 29.57  ? 860  DA  T OP2   1 
ATOM   410  O  "O5'" . DA  B 2  10  ? 58.345 63.072  48.488 1.00 30.45  ? 860  DA  T "O5'" 1 
ATOM   411  C  "C5'" . DA  B 2  10  ? 57.271 62.983  49.426 1.00 34.75  ? 860  DA  T "C5'" 1 
ATOM   412  C  "C4'" . DA  B 2  10  ? 56.264 61.959  48.970 1.00 37.26  ? 860  DA  T "C4'" 1 
ATOM   413  O  "O4'" . DA  B 2  10  ? 55.434 62.489  47.910 1.00 36.14  ? 860  DA  T "O4'" 1 
ATOM   414  C  "C3'" . DA  B 2  10  ? 56.927 60.702  48.424 1.00 38.37  ? 860  DA  T "C3'" 1 
ATOM   415  O  "O3'" . DA  B 2  10  ? 56.283 59.549  48.943 1.00 40.33  ? 860  DA  T "O3'" 1 
ATOM   416  C  "C2'" . DA  B 2  10  ? 56.784 60.836  46.918 1.00 38.61  ? 860  DA  T "C2'" 1 
ATOM   417  C  "C1'" . DA  B 2  10  ? 55.530 61.684  46.748 1.00 37.87  ? 860  DA  T "C1'" 1 
ATOM   418  N  N9    . DA  B 2  10  ? 55.576 62.587  45.595 1.00 37.86  ? 860  DA  T N9    1 
ATOM   419  C  C8    . DA  B 2  10  ? 56.573 63.476  45.263 1.00 37.01  ? 860  DA  T C8    1 
ATOM   420  N  N7    . DA  B 2  10  ? 56.326 64.165  44.175 1.00 36.79  ? 860  DA  T N7    1 
ATOM   421  C  C5    . DA  B 2  10  ? 55.087 63.701  43.760 1.00 36.77  ? 860  DA  T C5    1 
ATOM   422  C  C6    . DA  B 2  10  ? 54.269 64.037  42.668 1.00 36.11  ? 860  DA  T C6    1 
ATOM   423  N  N6    . DA  B 2  10  ? 54.589 64.959  41.760 1.00 34.67  ? 860  DA  T N6    1 
ATOM   424  N  N1    . DA  B 2  10  ? 53.093 63.386  42.538 1.00 36.76  ? 860  DA  T N1    1 
ATOM   425  C  C2    . DA  B 2  10  ? 52.772 62.463  43.448 1.00 37.70  ? 860  DA  T C2    1 
ATOM   426  N  N3    . DA  B 2  10  ? 53.454 62.059  44.519 1.00 37.71  ? 860  DA  T N3    1 
ATOM   427  C  C4    . DA  B 2  10  ? 54.614 62.724  44.620 1.00 37.35  ? 860  DA  T C4    1 
ATOM   428  P  P     . DC  B 2  11  ? 57.037 58.140  48.900 1.00 43.09  ? 861  DC  T P     1 
ATOM   429  O  OP1   . DC  B 2  11  ? 57.041 57.592  50.277 1.00 45.66  ? 861  DC  T OP1   1 
ATOM   430  O  OP2   . DC  B 2  11  ? 58.329 58.320  48.176 1.00 42.30  ? 861  DC  T OP2   1 
ATOM   431  O  "O5'" . DC  B 2  11  ? 56.049 57.285  47.991 1.00 42.76  ? 861  DC  T "O5'" 1 
ATOM   432  C  "C5'" . DC  B 2  11  ? 55.300 57.945  46.980 1.00 41.68  ? 861  DC  T "C5'" 1 
ATOM   433  C  "C4'" . DC  B 2  11  ? 54.469 56.968  46.189 1.00 39.10  ? 861  DC  T "C4'" 1 
ATOM   434  O  "O4'" . DC  B 2  11  ? 53.875 57.760  45.135 1.00 38.20  ? 861  DC  T "O4'" 1 
ATOM   435  C  "C3'" . DC  B 2  11  ? 55.280 55.869  45.500 1.00 38.02  ? 861  DC  T "C3'" 1 
ATOM   436  O  "O3'" . DC  B 2  11  ? 54.564 54.625  45.448 1.00 37.96  ? 861  DC  T "O3'" 1 
ATOM   437  C  "C2'" . DC  B 2  11  ? 55.560 56.426  44.118 1.00 37.27  ? 861  DC  T "C2'" 1 
ATOM   438  C  "C1'" . DC  B 2  11  ? 54.451 57.447  43.873 1.00 39.46  ? 861  DC  T "C1'" 1 
ATOM   439  N  N1    . DC  B 2  11  ? 54.948 58.707  43.264 1.00 37.82  ? 861  DC  T N1    1 
ATOM   440  C  C2    . DC  B 2  11  ? 54.150 59.375  42.329 1.00 37.67  ? 861  DC  T C2    1 
ATOM   441  O  O2    . DC  B 2  11  ? 53.005 58.966  42.112 1.00 38.53  ? 861  DC  T O2    1 
ATOM   442  N  N3    . DC  B 2  11  ? 54.647 60.461  41.694 1.00 38.20  ? 861  DC  T N3    1 
ATOM   443  C  C4    . DC  B 2  11  ? 55.874 60.898  41.979 1.00 36.72  ? 861  DC  T C4    1 
ATOM   444  N  N4    . DC  B 2  11  ? 56.336 61.951  41.300 1.00 37.39  ? 861  DC  T N4    1 
ATOM   445  C  C5    . DC  B 2  11  ? 56.684 60.273  42.964 1.00 35.24  ? 861  DC  T C5    1 
ATOM   446  C  C6    . DC  B 2  11  ? 56.187 59.196  43.579 1.00 35.17  ? 861  DC  T C6    1 
ATOM   447  P  P     . DT  B 2  12  ? 55.213 53.351  44.689 1.00 34.95  ? 862  DT  T P     1 
ATOM   448  O  OP1   . DT  B 2  12  ? 54.723 52.115  45.350 1.00 35.96  ? 862  DT  T OP1   1 
ATOM   449  O  OP2   . DT  B 2  12  ? 56.676 53.570  44.546 1.00 37.00  ? 862  DT  T OP2   1 
ATOM   450  O  "O5'" . DT  B 2  12  ? 54.563 53.431  43.240 1.00 33.98  ? 862  DT  T "O5'" 1 
ATOM   451  C  "C5'" . DT  B 2  12  ? 53.147 53.476  43.093 1.00 35.48  ? 862  DT  T "C5'" 1 
ATOM   452  C  "C4'" . DT  B 2  12  ? 52.765 53.563  41.635 1.00 37.74  ? 862  DT  T "C4'" 1 
ATOM   453  O  "O4'" . DT  B 2  12  ? 53.162 54.849  41.104 1.00 37.36  ? 862  DT  T "O4'" 1 
ATOM   454  C  "C3'" . DT  B 2  12  ? 53.389 52.503  40.726 1.00 37.52  ? 862  DT  T "C3'" 1 
ATOM   455  O  "O3'" . DT  B 2  12  ? 52.401 52.018  39.813 1.00 40.52  ? 862  DT  T "O3'" 1 
ATOM   456  C  "C2'" . DT  B 2  12  ? 54.487 53.257  39.997 1.00 38.02  ? 862  DT  T "C2'" 1 
ATOM   457  C  "C1'" . DT  B 2  12  ? 53.936 54.674  39.927 1.00 39.26  ? 862  DT  T "C1'" 1 
ATOM   458  N  N1    . DT  B 2  12  ? 54.954 55.754  39.892 1.00 40.74  ? 862  DT  T N1    1 
ATOM   459  C  C2    . DT  B 2  12  ? 54.841 56.737  38.926 1.00 41.86  ? 862  DT  T C2    1 
ATOM   460  O  O2    . DT  B 2  12  ? 53.958 56.756  38.083 1.00 42.48  ? 862  DT  T O2    1 
ATOM   461  N  N3    . DT  B 2  12  ? 55.809 57.711  38.987 1.00 43.11  ? 862  DT  T N3    1 
ATOM   462  C  C4    . DT  B 2  12  ? 56.853 57.799  39.886 1.00 42.80  ? 862  DT  T C4    1 
ATOM   463  O  O4    . DT  B 2  12  ? 57.634 58.745  39.824 1.00 44.17  ? 862  DT  T O4    1 
ATOM   464  C  C5    . DT  B 2  12  ? 56.924 56.728  40.855 1.00 42.44  ? 862  DT  T C5    1 
ATOM   465  C  C7    . DT  B 2  12  ? 58.037 56.724  41.855 1.00 41.99  ? 862  DT  T C7    1 
ATOM   466  C  C6    . DT  B 2  12  ? 55.983 55.776  40.811 1.00 41.42  ? 862  DT  T C6    1 
ATOM   467  P  P     . DG  B 2  13  ? 52.667 50.668  38.977 1.00 37.64  ? 863  DG  T P     1 
ATOM   468  O  OP1   . DG  B 2  13  ? 51.345 50.073  38.698 1.00 38.62  ? 863  DG  T OP1   1 
ATOM   469  O  OP2   . DG  B 2  13  ? 53.708 49.858  39.650 1.00 38.98  ? 863  DG  T OP2   1 
ATOM   470  O  "O5'" . DG  B 2  13  ? 53.270 51.215  37.610 1.00 42.23  ? 863  DG  T "O5'" 1 
ATOM   471  C  "C5'" . DG  B 2  13  ? 52.473 52.022  36.743 1.00 44.98  ? 863  DG  T "C5'" 1 
ATOM   472  C  "C4'" . DG  B 2  13  ? 53.304 52.536  35.591 1.00 48.00  ? 863  DG  T "C4'" 1 
ATOM   473  O  "O4'" . DG  B 2  13  ? 54.173 53.609  36.027 1.00 48.77  ? 863  DG  T "O4'" 1 
ATOM   474  C  "C3'" . DG  B 2  13  ? 54.216 51.497  34.935 1.00 49.85  ? 863  DG  T "C3'" 1 
ATOM   475  O  "O3'" . DG  B 2  13  ? 54.203 51.693  33.522 1.00 53.38  ? 863  DG  T "O3'" 1 
ATOM   476  C  "C2'" . DG  B 2  13  ? 55.590 51.850  35.480 1.00 47.85  ? 863  DG  T "C2'" 1 
ATOM   477  C  "C1'" . DG  B 2  13  ? 55.476 53.357  35.541 1.00 47.50  ? 863  DG  T "C1'" 1 
ATOM   478  N  N9    . DG  B 2  13  ? 56.431 54.071  36.383 1.00 47.03  ? 863  DG  T N9    1 
ATOM   479  C  C8    . DG  B 2  13  ? 56.994 53.661  37.569 1.00 46.52  ? 863  DG  T C8    1 
ATOM   480  N  N7    . DG  B 2  13  ? 57.831 54.532  38.065 1.00 47.23  ? 863  DG  T N7    1 
ATOM   481  C  C5    . DG  B 2  13  ? 57.815 55.583  37.156 1.00 47.14  ? 863  DG  T C5    1 
ATOM   482  C  C6    . DG  B 2  13  ? 58.529 56.821  37.154 1.00 47.21  ? 863  DG  T C6    1 
ATOM   483  O  O6    . DG  B 2  13  ? 59.348 57.246  37.985 1.00 44.74  ? 863  DG  T O6    1 
ATOM   484  N  N1    . DG  B 2  13  ? 58.212 57.591  36.036 1.00 46.05  ? 863  DG  T N1    1 
ATOM   485  C  C2    . DG  B 2  13  ? 57.329 57.222  35.047 1.00 45.93  ? 863  DG  T C2    1 
ATOM   486  N  N2    . DG  B 2  13  ? 57.156 58.097  34.043 1.00 44.24  ? 863  DG  T N2    1 
ATOM   487  N  N3    . DG  B 2  13  ? 56.664 56.079  35.039 1.00 46.00  ? 863  DG  T N3    1 
ATOM   488  C  C4    . DG  B 2  13  ? 56.955 55.314  36.115 1.00 46.45  ? 863  DG  T C4    1 
ATOM   489  P  P     . DG  B 2  14  ? 54.757 50.545  32.545 1.00 55.02  ? 864  DG  T P     1 
ATOM   490  O  OP1   . DG  B 2  14  ? 53.590 49.784  32.033 1.00 56.64  ? 864  DG  T OP1   1 
ATOM   491  O  OP2   . DG  B 2  14  ? 55.867 49.823  33.223 1.00 54.84  ? 864  DG  T OP2   1 
ATOM   492  O  "O5'" . DG  B 2  14  ? 55.393 51.370  31.346 1.00 58.32  ? 864  DG  T "O5'" 1 
ATOM   493  C  "C5'" . DG  B 2  14  ? 54.693 52.465  30.756 1.00 63.02  ? 864  DG  T "C5'" 1 
ATOM   494  C  "C4'" . DG  B 2  14  ? 55.661 53.380  30.041 1.00 65.85  ? 864  DG  T "C4'" 1 
ATOM   495  O  "O4'" . DG  B 2  14  ? 56.375 54.216  30.988 1.00 66.01  ? 864  DG  T "O4'" 1 
ATOM   496  C  "C3'" . DG  B 2  14  ? 56.726 52.651  29.221 1.00 67.65  ? 864  DG  T "C3'" 1 
ATOM   497  O  "O3'" . DG  B 2  14  ? 56.871 53.261  27.937 1.00 71.42  ? 864  DG  T "O3'" 1 
ATOM   498  C  "C2'" . DG  B 2  14  ? 57.988 52.796  30.057 1.00 66.39  ? 864  DG  T "C2'" 1 
ATOM   499  C  "C1'" . DG  B 2  14  ? 57.774 54.124  30.763 1.00 65.18  ? 864  DG  T "C1'" 1 
ATOM   500  N  N9    . DG  B 2  14  ? 58.447 54.236  32.056 1.00 64.71  ? 864  DG  T N9    1 
ATOM   501  C  C8    . DG  B 2  14  ? 58.364 53.356  33.111 1.00 65.03  ? 864  DG  T C8    1 
ATOM   502  N  N7    . DG  B 2  14  ? 59.083 53.716  34.139 1.00 64.03  ? 864  DG  T N7    1 
ATOM   503  C  C5    . DG  B 2  14  ? 59.678 54.906  33.745 1.00 64.25  ? 864  DG  T C5    1 
ATOM   504  C  C6    . DG  B 2  14  ? 60.565 55.762  34.445 1.00 64.61  ? 864  DG  T C6    1 
ATOM   505  O  O6    . DG  B 2  14  ? 61.019 55.633  35.589 1.00 64.27  ? 864  DG  T O6    1 
ATOM   506  N  N1    . DG  B 2  14  ? 60.925 56.864  33.677 1.00 65.45  ? 864  DG  T N1    1 
ATOM   507  C  C2    . DG  B 2  14  ? 60.488 57.114  32.400 1.00 65.84  ? 864  DG  T C2    1 
ATOM   508  N  N2    . DG  B 2  14  ? 60.951 58.238  31.828 1.00 65.77  ? 864  DG  T N2    1 
ATOM   509  N  N3    . DG  B 2  14  ? 59.659 56.323  31.733 1.00 65.55  ? 864  DG  T N3    1 
ATOM   510  C  C4    . DG  B 2  14  ? 59.296 55.243  32.461 1.00 64.81  ? 864  DG  T C4    1 
ATOM   511  P  P     . DC  B 2  15  ? 57.943 52.674  26.894 1.00 74.15  ? 865  DC  T P     1 
ATOM   512  O  OP1   . DC  B 2  15  ? 57.532 53.122  25.537 1.00 74.47  ? 865  DC  T OP1   1 
ATOM   513  O  OP2   . DC  B 2  15  ? 58.124 51.223  27.163 1.00 74.20  ? 865  DC  T OP2   1 
ATOM   514  O  "O5'" . DC  B 2  15  ? 59.282 53.433  27.302 1.00 73.38  ? 865  DC  T "O5'" 1 
ATOM   515  C  "C5'" . DC  B 2  15  ? 59.371 54.849  27.164 1.00 76.12  ? 865  DC  T "C5'" 1 
ATOM   516  C  "C4'" . DC  B 2  15  ? 60.799 55.313  27.333 1.00 77.57  ? 865  DC  T "C4'" 1 
ATOM   517  O  "O4'" . DC  B 2  15  ? 61.140 55.420  28.737 1.00 77.78  ? 865  DC  T "O4'" 1 
ATOM   518  C  "C3'" . DC  B 2  15  ? 61.859 54.409  26.696 1.00 78.61  ? 865  DC  T "C3'" 1 
ATOM   519  O  "O3'" . DC  B 2  15  ? 62.835 55.199  26.012 1.00 80.00  ? 865  DC  T "O3'" 1 
ATOM   520  C  "C2'" . DC  B 2  15  ? 62.492 53.717  27.891 1.00 78.35  ? 865  DC  T "C2'" 1 
ATOM   521  C  "C1'" . DC  B 2  15  ? 62.394 54.800  28.953 1.00 77.86  ? 865  DC  T "C1'" 1 
ATOM   522  N  N1    . DC  B 2  15  ? 62.457 54.346  30.357 1.00 77.53  ? 865  DC  T N1    1 
ATOM   523  C  C2    . DC  B 2  15  ? 63.234 55.083  31.273 1.00 77.08  ? 865  DC  T C2    1 
ATOM   524  O  O2    . DC  B 2  15  ? 63.823 56.109  30.885 1.00 76.79  ? 865  DC  T O2    1 
ATOM   525  N  N3    . DC  B 2  15  ? 63.321 54.659  32.554 1.00 76.66  ? 865  DC  T N3    1 
ATOM   526  C  C4    . DC  B 2  15  ? 62.671 53.558  32.940 1.00 76.84  ? 865  DC  T C4    1 
ATOM   527  N  N4    . DC  B 2  15  ? 62.793 53.173  34.213 1.00 76.71  ? 865  DC  T N4    1 
ATOM   528  C  C5    . DC  B 2  15  ? 61.867 52.799  32.037 1.00 76.68  ? 865  DC  T C5    1 
ATOM   529  C  C6    . DC  B 2  15  ? 61.787 53.226  30.770 1.00 77.06  ? 865  DC  T C6    1 
ATOM   530  P  P     . DC  B 2  16  ? 63.885 54.493  25.019 1.00 81.52  ? 866  DC  T P     1 
ATOM   531  O  OP1   . DC  B 2  16  ? 63.773 55.177  23.704 1.00 80.95  ? 866  DC  T OP1   1 
ATOM   532  O  OP2   . DC  B 2  16  ? 63.723 53.018  25.094 1.00 80.87  ? 866  DC  T OP2   1 
ATOM   533  O  "O5'" . DC  B 2  16  ? 65.292 54.856  25.665 1.00 82.48  ? 866  DC  T "O5'" 1 
ATOM   534  C  "C5'" . DC  B 2  16  ? 65.647 56.213  25.928 1.00 85.19  ? 866  DC  T "C5'" 1 
ATOM   535  C  "C4'" . DC  B 2  16  ? 66.892 56.270  26.780 1.00 87.44  ? 866  DC  T "C4'" 1 
ATOM   536  O  "O4'" . DC  B 2  16  ? 66.589 55.833  28.129 1.00 87.71  ? 866  DC  T "O4'" 1 
ATOM   537  C  "C3'" . DC  B 2  16  ? 68.024 55.368  26.284 1.00 89.35  ? 866  DC  T "C3'" 1 
ATOM   538  O  "O3'" . DC  B 2  16  ? 69.289 56.013  26.447 1.00 92.54  ? 866  DC  T "O3'" 1 
ATOM   539  C  "C2'" . DC  B 2  16  ? 67.936 54.160  27.199 1.00 88.21  ? 866  DC  T "C2'" 1 
ATOM   540  C  "C1'" . DC  B 2  16  ? 67.491 54.802  28.502 1.00 87.27  ? 866  DC  T "C1'" 1 
ATOM   541  N  N1    . DC  B 2  16  ? 66.815 53.916  29.473 1.00 85.98  ? 866  DC  T N1    1 
ATOM   542  C  C2    . DC  B 2  16  ? 67.049 54.119  30.843 1.00 85.07  ? 866  DC  T C2    1 
ATOM   543  O  O2    . DC  B 2  16  ? 67.796 55.047  31.197 1.00 84.75  ? 866  DC  T O2    1 
ATOM   544  N  N3    . DC  B 2  16  ? 66.455 53.301  31.744 1.00 84.51  ? 866  DC  T N3    1 
ATOM   545  C  C4    . DC  B 2  16  ? 65.655 52.315  31.327 1.00 84.14  ? 866  DC  T C4    1 
ATOM   546  N  N4    . DC  B 2  16  ? 65.098 51.526  32.250 1.00 83.19  ? 866  DC  T N4    1 
ATOM   547  C  C5    . DC  B 2  16  ? 65.393 52.092  29.943 1.00 84.27  ? 866  DC  T C5    1 
ATOM   548  C  C6    . DC  B 2  16  ? 65.985 52.908  29.060 1.00 85.30  ? 866  DC  T C6    1 
ATOM   549  P  P     . DG  B 2  17  ? 70.499 55.650  25.455 1.00 95.43  ? 867  DG  T P     1 
ATOM   550  O  OP1   . DG  B 2  17  ? 70.661 56.812  24.540 1.00 95.04  ? 867  DG  T OP1   1 
ATOM   551  O  OP2   . DG  B 2  17  ? 70.261 54.293  24.884 1.00 94.90  ? 867  DG  T OP2   1 
ATOM   552  O  "O5'" . DG  B 2  17  ? 71.768 55.572  26.418 1.00 95.39  ? 867  DG  T "O5'" 1 
ATOM   553  C  "C5'" . DG  B 2  17  ? 72.245 56.731  27.103 1.00 96.66  ? 867  DG  T "C5'" 1 
ATOM   554  C  "C4'" . DG  B 2  17  ? 72.950 56.334  28.379 1.00 97.56  ? 867  DG  T "C4'" 1 
ATOM   555  O  "O4'" . DG  B 2  17  ? 72.003 55.671  29.252 1.00 98.06  ? 867  DG  T "O4'" 1 
ATOM   556  C  "C3'" . DG  B 2  17  ? 74.117 55.354  28.215 1.00 98.06  ? 867  DG  T "C3'" 1 
ATOM   557  O  "O3'" . DG  B 2  17  ? 75.121 55.642  29.201 1.00 99.12  ? 867  DG  T "O3'" 1 
ATOM   558  C  "C2'" . DG  B 2  17  ? 73.479 54.016  28.532 1.00 97.95  ? 867  DG  T "C2'" 1 
ATOM   559  C  "C1'" . DG  B 2  17  ? 72.546 54.425  29.647 1.00 97.71  ? 867  DG  T "C1'" 1 
ATOM   560  N  N9    . DG  B 2  17  ? 71.451 53.506  29.928 1.00 97.14  ? 867  DG  T N9    1 
ATOM   561  C  C8    . DG  B 2  17  ? 70.519 52.994  29.055 1.00 96.77  ? 867  DG  T C8    1 
ATOM   562  N  N7    . DG  B 2  17  ? 69.679 52.177  29.630 1.00 96.79  ? 867  DG  T N7    1 
ATOM   563  C  C5    . DG  B 2  17  ? 70.081 52.155  30.961 1.00 96.68  ? 867  DG  T C5    1 
ATOM   564  C  C6    . DG  B 2  17  ? 69.559 51.445  32.074 1.00 96.50  ? 867  DG  T C6    1 
ATOM   565  O  O6    . DG  B 2  17  ? 68.605 50.661  32.108 1.00 96.29  ? 867  DG  T O6    1 
ATOM   566  N  N1    . DG  B 2  17  ? 70.275 51.722  33.238 1.00 96.36  ? 867  DG  T N1    1 
ATOM   567  C  C2    . DG  B 2  17  ? 71.354 52.567  33.323 1.00 96.07  ? 867  DG  T C2    1 
ATOM   568  N  N2    . DG  B 2  17  ? 71.915 52.709  34.535 1.00 95.61  ? 867  DG  T N2    1 
ATOM   569  N  N3    . DG  B 2  17  ? 71.849 53.227  32.296 1.00 96.09  ? 867  DG  T N3    1 
ATOM   570  C  C4    . DG  B 2  17  ? 71.169 52.975  31.156 1.00 96.59  ? 867  DG  T C4    1 
ATOM   571  P  P     . DT  B 2  18  ? 76.511 54.827  29.199 1.00 100.10 ? 868  DT  T P     1 
ATOM   572  O  OP1   . DT  B 2  18  ? 77.561 55.763  28.716 1.00 100.10 ? 868  DT  T OP1   1 
ATOM   573  O  OP2   . DT  B 2  18  ? 76.322 53.521  28.510 1.00 100.10 ? 868  DT  T OP2   1 
ATOM   574  O  "O5'" . DT  B 2  18  ? 76.782 54.525  30.743 1.00 100.10 ? 868  DT  T "O5'" 1 
ATOM   575  C  "C5'" . DT  B 2  18  ? 77.146 55.568  31.651 1.00 100.10 ? 868  DT  T "C5'" 1 
ATOM   576  C  "C4'" . DT  B 2  18  ? 77.702 54.984  32.932 1.00 100.10 ? 868  DT  T "C4'" 1 
ATOM   577  O  "O4'" . DT  B 2  18  ? 76.666 54.227  33.602 1.00 100.10 ? 868  DT  T "O4'" 1 
ATOM   578  C  "C3'" . DT  B 2  18  ? 78.885 54.027  32.763 1.00 100.10 ? 868  DT  T "C3'" 1 
ATOM   579  O  "O3'" . DT  B 2  18  ? 79.824 54.198  33.831 1.00 99.58  ? 868  DT  T "O3'" 1 
ATOM   580  C  "C2'" . DT  B 2  18  ? 78.243 52.654  32.852 1.00 100.10 ? 868  DT  T "C2'" 1 
ATOM   581  C  "C1'" . DT  B 2  18  ? 77.099 52.891  33.824 1.00 100.10 ? 868  DT  T "C1'" 1 
ATOM   582  N  N     . MET C 3  1   ? 79.964 102.244 44.783 1.00 25.62  ? 1    MET A N     1 
ATOM   583  C  CA    . MET C 3  1   ? 79.341 100.906 44.574 1.00 24.83  ? 1    MET A CA    1 
ATOM   584  C  C     . MET C 3  1   ? 80.358 99.881  44.095 1.00 25.90  ? 1    MET A C     1 
ATOM   585  O  O     . MET C 3  1   ? 81.153 100.164 43.202 1.00 26.25  ? 1    MET A O     1 
ATOM   586  C  CB    . MET C 3  1   ? 78.216 100.989 43.532 1.00 23.88  ? 1    MET A CB    1 
ATOM   587  C  CG    . MET C 3  1   ? 77.596 99.632  43.202 1.00 22.93  ? 1    MET A CG    1 
ATOM   588  S  SD    . MET C 3  1   ? 76.170 99.685  42.093 1.00 26.07  ? 1    MET A SD    1 
ATOM   589  C  CE    . MET C 3  1   ? 74.884 100.072 43.238 1.00 19.79  ? 1    MET A CE    1 
ATOM   590  N  N     . ILE C 3  2   ? 80.331 98.693  44.691 1.00 24.49  ? 2    ILE A N     1 
ATOM   591  C  CA    . ILE C 3  2   ? 81.221 97.624  44.267 1.00 24.56  ? 2    ILE A CA    1 
ATOM   592  C  C     . ILE C 3  2   ? 80.389 96.372  44.001 1.00 23.68  ? 2    ILE A C     1 
ATOM   593  O  O     . ILE C 3  2   ? 79.274 96.242  44.501 1.00 22.74  ? 2    ILE A O     1 
ATOM   594  C  CB    . ILE C 3  2   ? 82.301 97.300  45.325 1.00 24.71  ? 2    ILE A CB    1 
ATOM   595  C  CG1   . ILE C 3  2   ? 81.651 96.802  46.612 1.00 25.73  ? 2    ILE A CG1   1 
ATOM   596  C  CG2   . ILE C 3  2   ? 83.156 98.534  45.586 1.00 25.89  ? 2    ILE A CG2   1 
ATOM   597  C  CD1   . ILE C 3  2   ? 82.658 96.386  47.672 1.00 27.63  ? 2    ILE A CD1   1 
ATOM   598  N  N     . VAL C 3  3   ? 80.928 95.476  43.182 1.00 22.84  ? 3    VAL A N     1 
ATOM   599  C  CA    . VAL C 3  3   ? 80.272 94.223  42.845 1.00 21.70  ? 3    VAL A CA    1 
ATOM   600  C  C     . VAL C 3  3   ? 81.242 93.141  43.302 1.00 23.85  ? 3    VAL A C     1 
ATOM   601  O  O     . VAL C 3  3   ? 82.418 93.161  42.939 1.00 23.56  ? 3    VAL A O     1 
ATOM   602  C  CB    . VAL C 3  3   ? 80.043 94.103  41.335 1.00 21.16  ? 3    VAL A CB    1 
ATOM   603  C  CG1   . VAL C 3  3   ? 79.243 92.836  41.020 1.00 19.49  ? 3    VAL A CG1   1 
ATOM   604  C  CG2   . VAL C 3  3   ? 79.322 95.334  40.839 1.00 21.96  ? 3    VAL A CG2   1 
ATOM   605  N  N     . SER C 3  4   ? 80.760 92.195  44.099 1.00 23.51  ? 4    SER A N     1 
ATOM   606  C  CA    . SER C 3  4   ? 81.648 91.168  44.605 1.00 22.98  ? 4    SER A CA    1 
ATOM   607  C  C     . SER C 3  4   ? 81.051 89.770  44.633 1.00 22.88  ? 4    SER A C     1 
ATOM   608  O  O     . SER C 3  4   ? 79.851 89.577  44.405 1.00 20.87  ? 4    SER A O     1 
ATOM   609  C  CB    . SER C 3  4   ? 82.117 91.565  46.007 1.00 21.41  ? 4    SER A CB    1 
ATOM   610  O  OG    . SER C 3  4   ? 83.183 90.750  46.437 1.00 23.99  ? 4    SER A OG    1 
ATOM   611  N  N     . ASP C 3  5   ? 81.913 88.801  44.923 1.00 21.40  ? 5    ASP A N     1 
ATOM   612  C  CA    . ASP C 3  5   ? 81.537 87.396  44.990 1.00 22.90  ? 5    ASP A CA    1 
ATOM   613  C  C     . ASP C 3  5   ? 82.699 86.643  45.628 1.00 23.13  ? 5    ASP A C     1 
ATOM   614  O  O     . ASP C 3  5   ? 83.858 86.993  45.411 1.00 24.60  ? 5    ASP A O     1 
ATOM   615  C  CB    . ASP C 3  5   ? 81.295 86.845  43.582 1.00 21.66  ? 5    ASP A CB    1 
ATOM   616  C  CG    . ASP C 3  5   ? 80.809 85.404  43.594 1.00 23.22  ? 5    ASP A CG    1 
ATOM   617  O  OD1   . ASP C 3  5   ? 79.767 85.134  44.227 1.00 20.10  ? 5    ASP A OD1   1 
ATOM   618  O  OD2   . ASP C 3  5   ? 81.464 84.543  42.962 1.00 25.55  ? 5    ASP A OD2   1 
ATOM   619  N  N     . ILE C 3  6   ? 82.402 85.617  46.412 1.00 22.13  ? 6    ILE A N     1 
ATOM   620  C  CA    . ILE C 3  6   ? 83.467 84.843  47.036 1.00 22.50  ? 6    ILE A CA    1 
ATOM   621  C  C     . ILE C 3  6   ? 83.338 83.370  46.690 1.00 24.20  ? 6    ILE A C     1 
ATOM   622  O  O     . ILE C 3  6   ? 82.280 82.909  46.256 1.00 24.59  ? 6    ILE A O     1 
ATOM   623  C  CB    . ILE C 3  6   ? 83.434 84.937  48.582 1.00 22.46  ? 6    ILE A CB    1 
ATOM   624  C  CG1   . ILE C 3  6   ? 82.305 84.054  49.134 1.00 21.33  ? 6    ILE A CG1   1 
ATOM   625  C  CG2   . ILE C 3  6   ? 83.247 86.383  49.020 1.00 23.23  ? 6    ILE A CG2   1 
ATOM   626  C  CD1   . ILE C 3  6   ? 82.187 84.081  50.657 1.00 21.28  ? 6    ILE A CD1   1 
ATOM   627  N  N     . GLU C 3  7   ? 84.430 82.642  46.882 1.00 23.90  ? 7    GLU A N     1 
ATOM   628  C  CA    . GLU C 3  7   ? 84.447 81.204  46.670 1.00 24.29  ? 7    GLU A CA    1 
ATOM   629  C  C     . GLU C 3  7   ? 84.946 80.661  48.010 1.00 23.83  ? 7    GLU A C     1 
ATOM   630  O  O     . GLU C 3  7   ? 85.986 81.095  48.512 1.00 23.25  ? 7    GLU A O     1 
ATOM   631  C  CB    . GLU C 3  7   ? 85.427 80.820  45.551 1.00 26.58  ? 7    GLU A CB    1 
ATOM   632  C  CG    . GLU C 3  7   ? 85.132 81.458  44.189 1.00 29.52  ? 7    GLU A CG    1 
ATOM   633  C  CD    . GLU C 3  7   ? 83.904 80.883  43.500 1.00 28.12  ? 7    GLU A CD    1 
ATOM   634  O  OE1   . GLU C 3  7   ? 83.173 80.090  44.120 1.00 27.58  ? 7    GLU A OE1   1 
ATOM   635  O  OE2   . GLU C 3  7   ? 83.667 81.231  42.325 1.00 33.09  ? 7    GLU A OE2   1 
ATOM   636  N  N     . ALA C 3  8   ? 84.191 79.741  48.598 1.00 23.72  ? 8    ALA A N     1 
ATOM   637  C  CA    . ALA C 3  8   ? 84.555 79.143  49.872 1.00 22.97  ? 8    ALA A CA    1 
ATOM   638  C  C     . ALA C 3  8   ? 84.497 77.625  49.726 1.00 23.33  ? 8    ALA A C     1 
ATOM   639  O  O     . ALA C 3  8   ? 84.085 77.123  48.689 1.00 23.79  ? 8    ALA A O     1 
ATOM   640  C  CB    . ALA C 3  8   ? 83.616 79.621  50.967 1.00 21.76  ? 8    ALA A CB    1 
ATOM   641  N  N     . ASN C 3  9   ? 84.878 76.897  50.771 1.00 23.88  ? 9    ASN A N     1 
ATOM   642  C  CA    . ASN C 3  9   ? 84.940 75.441  50.690 1.00 26.21  ? 9    ASN A CA    1 
ATOM   643  C  C     . ASN C 3  9   ? 83.686 74.621  50.926 1.00 26.38  ? 9    ASN A C     1 
ATOM   644  O  O     . ASN C 3  9   ? 83.750 73.398  50.882 1.00 28.25  ? 9    ASN A O     1 
ATOM   645  C  CB    . ASN C 3  9   ? 86.054 74.926  51.609 1.00 26.71  ? 9    ASN A CB    1 
ATOM   646  C  CG    . ASN C 3  9   ? 85.718 75.074  53.092 1.00 28.12  ? 9    ASN A CG    1 
ATOM   647  O  OD1   . ASN C 3  9   ? 84.897 75.909  53.485 1.00 27.98  ? 9    ASN A OD1   1 
ATOM   648  N  ND2   . ASN C 3  9   ? 86.377 74.273  53.925 1.00 26.15  ? 9    ASN A ND2   1 
ATOM   649  N  N     . ALA C 3  10  ? 82.550 75.266  51.170 1.00 24.88  ? 10   ALA A N     1 
ATOM   650  C  CA    . ALA C 3  10  ? 81.312 74.520  51.395 1.00 23.81  ? 10   ALA A CA    1 
ATOM   651  C  C     . ALA C 3  10  ? 80.110 75.431  51.545 1.00 24.34  ? 10   ALA A C     1 
ATOM   652  O  O     . ALA C 3  10  ? 80.243 76.659  51.547 1.00 24.08  ? 10   ALA A O     1 
ATOM   653  C  CB    . ALA C 3  10  ? 81.446 73.641  52.633 1.00 20.49  ? 10   ALA A CB    1 
ATOM   654  N  N     . LEU C 3  11  ? 78.931 74.825  51.657 1.00 24.36  ? 11   LEU A N     1 
ATOM   655  C  CA    . LEU C 3  11  ? 77.706 75.587  51.852 1.00 23.58  ? 11   LEU A CA    1 
ATOM   656  C  C     . LEU C 3  11  ? 77.803 76.249  53.232 1.00 24.87  ? 11   LEU A C     1 
ATOM   657  O  O     . LEU C 3  11  ? 78.644 75.868  54.056 1.00 23.48  ? 11   LEU A O     1 
ATOM   658  C  CB    . LEU C 3  11  ? 76.490 74.660  51.779 1.00 24.16  ? 11   LEU A CB    1 
ATOM   659  C  CG    . LEU C 3  11  ? 76.269 73.975  50.421 1.00 27.28  ? 11   LEU A CG    1 
ATOM   660  C  CD1   . LEU C 3  11  ? 75.087 73.011  50.503 1.00 26.35  ? 11   LEU A CD1   1 
ATOM   661  C  CD2   . LEU C 3  11  ? 76.022 75.032  49.350 1.00 26.69  ? 11   LEU A CD2   1 
ATOM   662  N  N     . LEU C 3  12  ? 76.944 77.232  53.479 1.00 23.41  ? 12   LEU A N     1 
ATOM   663  C  CA    . LEU C 3  12  ? 76.955 77.982  54.733 1.00 24.22  ? 12   LEU A CA    1 
ATOM   664  C  C     . LEU C 3  12  ? 77.012 77.157  56.003 1.00 24.87  ? 12   LEU A C     1 
ATOM   665  O  O     . LEU C 3  12  ? 77.788 77.467  56.909 1.00 25.15  ? 12   LEU A O     1 
ATOM   666  C  CB    . LEU C 3  12  ? 75.740 78.907  54.814 1.00 20.08  ? 12   LEU A CB    1 
ATOM   667  C  CG    . LEU C 3  12  ? 75.713 79.796  56.065 1.00 21.74  ? 12   LEU A CG    1 
ATOM   668  C  CD1   . LEU C 3  12  ? 76.919 80.734  56.080 1.00 17.98  ? 12   LEU A CD1   1 
ATOM   669  C  CD2   . LEU C 3  12  ? 74.419 80.602  56.077 1.00 21.35  ? 12   LEU A CD2   1 
ATOM   670  N  N     . GLU C 3  13  ? 76.192 76.115  56.069 1.00 26.81  ? 13   GLU A N     1 
ATOM   671  C  CA    . GLU C 3  13  ? 76.127 75.261  57.254 1.00 29.78  ? 13   GLU A CA    1 
ATOM   672  C  C     . GLU C 3  13  ? 77.471 74.748  57.756 1.00 28.64  ? 13   GLU A C     1 
ATOM   673  O  O     . GLU C 3  13  ? 77.660 74.597  58.963 1.00 27.13  ? 13   GLU A O     1 
ATOM   674  C  CB    . GLU C 3  13  ? 75.212 74.056  57.006 1.00 32.28  ? 13   GLU A CB    1 
ATOM   675  C  CG    . GLU C 3  13  ? 73.810 74.423  56.557 1.00 41.43  ? 13   GLU A CG    1 
ATOM   676  C  CD    . GLU C 3  13  ? 73.659 74.448  55.040 1.00 45.84  ? 13   GLU A CD    1 
ATOM   677  O  OE1   . GLU C 3  13  ? 73.732 73.354  54.426 1.00 48.80  ? 13   GLU A OE1   1 
ATOM   678  O  OE2   . GLU C 3  13  ? 73.471 75.552  54.467 1.00 44.61  ? 13   GLU A OE2   1 
ATOM   679  N  N     . SER C 3  14  ? 78.403 74.478  56.847 1.00 27.15  ? 14   SER A N     1 
ATOM   680  C  CA    . SER C 3  14  ? 79.691 73.951  57.268 1.00 28.43  ? 14   SER A CA    1 
ATOM   681  C  C     . SER C 3  14  ? 80.919 74.583  56.623 1.00 28.03  ? 14   SER A C     1 
ATOM   682  O  O     . SER C 3  14  ? 82.002 73.999  56.643 1.00 26.70  ? 14   SER A O     1 
ATOM   683  C  CB    . SER C 3  14  ? 79.717 72.433  57.055 1.00 29.40  ? 14   SER A CB    1 
ATOM   684  O  OG    . SER C 3  14  ? 79.456 72.097  55.707 1.00 28.15  ? 14   SER A OG    1 
ATOM   685  N  N     . VAL C 3  15  ? 80.768 75.782  56.068 1.00 27.39  ? 15   VAL A N     1 
ATOM   686  C  CA    . VAL C 3  15  ? 81.910 76.444  55.445 1.00 25.75  ? 15   VAL A CA    1 
ATOM   687  C  C     . VAL C 3  15  ? 82.956 76.766  56.522 1.00 26.76  ? 15   VAL A C     1 
ATOM   688  O  O     . VAL C 3  15  ? 82.610 77.207  57.622 1.00 25.30  ? 15   VAL A O     1 
ATOM   689  C  CB    . VAL C 3  15  ? 81.470 77.748  54.721 1.00 24.52  ? 15   VAL A CB    1 
ATOM   690  C  CG1   . VAL C 3  15  ? 81.078 78.820  55.737 1.00 23.84  ? 15   VAL A CG1   1 
ATOM   691  C  CG2   . VAL C 3  15  ? 82.574 78.233  53.803 1.00 19.08  ? 15   VAL A CG2   1 
ATOM   692  N  N     . THR C 3  16  ? 84.229 76.515  56.217 1.00 26.49  ? 16   THR A N     1 
ATOM   693  C  CA    . THR C 3  16  ? 85.308 76.800  57.165 1.00 25.87  ? 16   THR A CA    1 
ATOM   694  C  C     . THR C 3  16  ? 86.468 77.519  56.486 1.00 26.20  ? 16   THR A C     1 
ATOM   695  O  O     . THR C 3  16  ? 87.352 78.047  57.154 1.00 25.96  ? 16   THR A O     1 
ATOM   696  C  CB    . THR C 3  16  ? 85.871 75.511  57.834 1.00 26.55  ? 16   THR A CB    1 
ATOM   697  O  OG1   . THR C 3  16  ? 86.342 74.610  56.826 1.00 27.11  ? 16   THR A OG1   1 
ATOM   698  C  CG2   . THR C 3  16  ? 84.796 74.814  58.670 1.00 24.83  ? 16   THR A CG2   1 
ATOM   699  N  N     . LYS C 3  17  ? 86.466 77.556  55.158 1.00 26.67  ? 17   LYS A N     1 
ATOM   700  C  CA    . LYS C 3  17  ? 87.558 78.217  54.450 1.00 28.15  ? 17   LYS A CA    1 
ATOM   701  C  C     . LYS C 3  17  ? 87.154 79.151  53.326 1.00 26.61  ? 17   LYS A C     1 
ATOM   702  O  O     . LYS C 3  17  ? 86.342 78.806  52.463 1.00 24.12  ? 17   LYS A O     1 
ATOM   703  C  CB    . LYS C 3  17  ? 88.524 77.185  53.854 1.00 31.88  ? 17   LYS A CB    1 
ATOM   704  C  CG    . LYS C 3  17  ? 89.452 76.470  54.824 1.00 36.88  ? 17   LYS A CG    1 
ATOM   705  C  CD    . LYS C 3  17  ? 90.067 75.252  54.119 1.00 42.50  ? 17   LYS A CD    1 
ATOM   706  C  CE    . LYS C 3  17  ? 91.278 74.684  54.849 1.00 45.80  ? 17   LYS A CE    1 
ATOM   707  N  NZ    . LYS C 3  17  ? 92.469 75.580  54.719 1.00 49.70  ? 17   LYS A NZ    1 
ATOM   708  N  N     . PHE C 3  18  ? 87.755 80.333  53.339 1.00 25.32  ? 18   PHE A N     1 
ATOM   709  C  CA    . PHE C 3  18  ? 87.550 81.326  52.298 1.00 24.32  ? 18   PHE A CA    1 
ATOM   710  C  C     . PHE C 3  18  ? 88.628 80.968  51.280 1.00 25.21  ? 18   PHE A C     1 
ATOM   711  O  O     . PHE C 3  18  ? 89.805 80.893  51.634 1.00 23.87  ? 18   PHE A O     1 
ATOM   712  C  CB    . PHE C 3  18  ? 87.823 82.723  52.855 1.00 24.00  ? 18   PHE A CB    1 
ATOM   713  C  CG    . PHE C 3  18  ? 87.909 83.798  51.810 1.00 21.30  ? 18   PHE A CG    1 
ATOM   714  C  CD1   . PHE C 3  18  ? 86.768 84.467  51.378 1.00 23.29  ? 18   PHE A CD1   1 
ATOM   715  C  CD2   . PHE C 3  18  ? 89.142 84.180  51.292 1.00 22.89  ? 18   PHE A CD2   1 
ATOM   716  C  CE1   . PHE C 3  18  ? 86.856 85.512  50.444 1.00 18.88  ? 18   PHE A CE1   1 
ATOM   717  C  CE2   . PHE C 3  18  ? 89.240 85.223  50.360 1.00 22.90  ? 18   PHE A CE2   1 
ATOM   718  C  CZ    . PHE C 3  18  ? 88.091 85.888  49.940 1.00 21.12  ? 18   PHE A CZ    1 
ATOM   719  N  N     . HIS C 3  19  ? 88.243 80.721  50.033 1.00 24.03  ? 19   HIS A N     1 
ATOM   720  C  CA    . HIS C 3  19  ? 89.235 80.395  49.026 1.00 23.79  ? 19   HIS A CA    1 
ATOM   721  C  C     . HIS C 3  19  ? 89.679 81.652  48.301 1.00 26.14  ? 19   HIS A C     1 
ATOM   722  O  O     . HIS C 3  19  ? 90.874 81.918  48.184 1.00 26.70  ? 19   HIS A O     1 
ATOM   723  C  CB    . HIS C 3  19  ? 88.688 79.365  48.036 1.00 25.55  ? 19   HIS A CB    1 
ATOM   724  C  CG    . HIS C 3  19  ? 88.609 77.979  48.598 1.00 26.79  ? 19   HIS A CG    1 
ATOM   725  N  ND1   . HIS C 3  19  ? 89.603 77.442  49.389 1.00 26.22  ? 19   HIS A ND1   1 
ATOM   726  C  CD2   . HIS C 3  19  ? 87.666 77.016  48.473 1.00 27.50  ? 19   HIS A CD2   1 
ATOM   727  C  CE1   . HIS C 3  19  ? 89.273 76.207  49.728 1.00 27.76  ? 19   HIS A CE1   1 
ATOM   728  N  NE2   . HIS C 3  19  ? 88.102 75.923  49.184 1.00 26.26  ? 19   HIS A NE2   1 
ATOM   729  N  N     . CYS C 3  20  ? 88.721 82.438  47.824 1.00 25.22  ? 20   CYS A N     1 
ATOM   730  C  CA    . CYS C 3  20  ? 89.060 83.673  47.137 1.00 26.16  ? 20   CYS A CA    1 
ATOM   731  C  C     . CYS C 3  20  ? 87.854 84.578  46.965 1.00 25.26  ? 20   CYS A C     1 
ATOM   732  O  O     . CYS C 3  20  ? 86.721 84.199  47.264 1.00 22.78  ? 20   CYS A O     1 
ATOM   733  C  CB    . CYS C 3  20  ? 89.674 83.372  45.767 1.00 24.52  ? 20   CYS A CB    1 
ATOM   734  S  SG    . CYS C 3  20  ? 88.598 82.444  44.670 1.00 26.74  ? 20   CYS A SG    1 
ATOM   735  N  N     . GLY C 3  21  ? 88.119 85.783  46.480 1.00 25.83  ? 21   GLY A N     1 
ATOM   736  C  CA    . GLY C 3  21  ? 87.062 86.745  46.258 1.00 26.60  ? 21   GLY A CA    1 
ATOM   737  C  C     . GLY C 3  21  ? 87.475 87.733  45.190 1.00 26.32  ? 21   GLY A C     1 
ATOM   738  O  O     . GLY C 3  21  ? 88.659 87.880  44.896 1.00 26.57  ? 21   GLY A O     1 
ATOM   739  N  N     . VAL C 3  22  ? 86.495 88.403  44.596 1.00 26.03  ? 22   VAL A N     1 
ATOM   740  C  CA    . VAL C 3  22  ? 86.769 89.387  43.565 1.00 26.25  ? 22   VAL A CA    1 
ATOM   741  C  C     . VAL C 3  22  ? 85.899 90.605  43.804 1.00 26.56  ? 22   VAL A C     1 
ATOM   742  O  O     . VAL C 3  22  ? 84.730 90.484  44.185 1.00 24.73  ? 22   VAL A O     1 
ATOM   743  C  CB    . VAL C 3  22  ? 86.471 88.835  42.148 1.00 26.13  ? 22   VAL A CB    1 
ATOM   744  C  CG1   . VAL C 3  22  ? 86.637 89.937  41.114 1.00 24.29  ? 22   VAL A CG1   1 
ATOM   745  C  CG2   . VAL C 3  22  ? 87.414 87.693  41.827 1.00 25.09  ? 22   VAL A CG2   1 
ATOM   746  N  N     . ILE C 3  23  ? 86.482 91.780  43.589 1.00 26.01  ? 23   ILE A N     1 
ATOM   747  C  CA    . ILE C 3  23  ? 85.759 93.029  43.764 1.00 25.25  ? 23   ILE A CA    1 
ATOM   748  C  C     . ILE C 3  23  ? 85.913 93.910  42.540 1.00 27.51  ? 23   ILE A C     1 
ATOM   749  O  O     . ILE C 3  23  ? 87.027 94.147  42.071 1.00 28.05  ? 23   ILE A O     1 
ATOM   750  C  CB    . ILE C 3  23  ? 86.281 93.832  44.966 1.00 24.06  ? 23   ILE A CB    1 
ATOM   751  C  CG1   . ILE C 3  23  ? 86.055 93.048  46.256 1.00 24.08  ? 23   ILE A CG1   1 
ATOM   752  C  CG2   . ILE C 3  23  ? 85.565 95.191  45.044 1.00 21.64  ? 23   ILE A CG2   1 
ATOM   753  C  CD1   . ILE C 3  23  ? 86.605 93.755  47.486 1.00 26.72  ? 23   ILE A CD1   1 
ATOM   754  N  N     . TYR C 3  24  ? 84.785 94.365  42.006 1.00 27.62  ? 24   TYR A N     1 
ATOM   755  C  CA    . TYR C 3  24  ? 84.798 95.278  40.880 1.00 27.61  ? 24   TYR A CA    1 
ATOM   756  C  C     . TYR C 3  24  ? 84.305 96.576  41.490 1.00 26.69  ? 24   TYR A C     1 
ATOM   757  O  O     . TYR C 3  24  ? 83.207 96.625  42.043 1.00 25.70  ? 24   TYR A O     1 
ATOM   758  C  CB    . TYR C 3  24  ? 83.835 94.854  39.774 1.00 28.06  ? 24   TYR A CB    1 
ATOM   759  C  CG    . TYR C 3  24  ? 83.703 95.933  38.729 1.00 30.19  ? 24   TYR A CG    1 
ATOM   760  C  CD1   . TYR C 3  24  ? 84.694 96.125  37.765 1.00 31.89  ? 24   TYR A CD1   1 
ATOM   761  C  CD2   . TYR C 3  24  ? 82.635 96.834  38.767 1.00 31.40  ? 24   TYR A CD2   1 
ATOM   762  C  CE1   . TYR C 3  24  ? 84.628 97.197  36.862 1.00 31.72  ? 24   TYR A CE1   1 
ATOM   763  C  CE2   . TYR C 3  24  ? 82.558 97.903  37.878 1.00 32.05  ? 24   TYR A CE2   1 
ATOM   764  C  CZ    . TYR C 3  24  ? 83.556 98.083  36.930 1.00 32.71  ? 24   TYR A CZ    1 
ATOM   765  O  OH    . TYR C 3  24  ? 83.490 99.155  36.067 1.00 32.49  ? 24   TYR A OH    1 
ATOM   766  N  N     . ASP C 3  25  ? 85.119 97.618  41.398 1.00 28.61  ? 25   ASP A N     1 
ATOM   767  C  CA    . ASP C 3  25  ? 84.767 98.911  41.965 1.00 29.31  ? 25   ASP A CA    1 
ATOM   768  C  C     . ASP C 3  25  ? 84.394 99.900  40.862 1.00 31.10  ? 25   ASP A C     1 
ATOM   769  O  O     . ASP C 3  25  ? 85.184 100.149 39.952 1.00 31.35  ? 25   ASP A O     1 
ATOM   770  C  CB    . ASP C 3  25  ? 85.947 99.461  42.759 1.00 28.00  ? 25   ASP A CB    1 
ATOM   771  C  CG    . ASP C 3  25  ? 85.558 100.619 43.649 1.00 28.72  ? 25   ASP A CG    1 
ATOM   772  O  OD1   . ASP C 3  25  ? 84.709 101.428 43.235 1.00 30.18  ? 25   ASP A OD1   1 
ATOM   773  O  OD2   . ASP C 3  25  ? 86.109 100.729 44.761 1.00 31.81  ? 25   ASP A OD2   1 
ATOM   774  N  N     . TYR C 3  26  ? 83.196 100.468 40.951 1.00 30.35  ? 26   TYR A N     1 
ATOM   775  C  CA    . TYR C 3  26  ? 82.737 101.426 39.953 1.00 31.01  ? 26   TYR A CA    1 
ATOM   776  C  C     . TYR C 3  26  ? 83.545 102.717 39.875 1.00 31.94  ? 26   TYR A C     1 
ATOM   777  O  O     . TYR C 3  26  ? 83.644 103.316 38.809 1.00 32.79  ? 26   TYR A O     1 
ATOM   778  C  CB    . TYR C 3  26  ? 81.266 101.771 40.191 1.00 27.42  ? 26   TYR A CB    1 
ATOM   779  C  CG    . TYR C 3  26  ? 80.330 100.841 39.472 1.00 27.50  ? 26   TYR A CG    1 
ATOM   780  C  CD1   . TYR C 3  26  ? 80.131 100.953 38.096 1.00 25.06  ? 26   TYR A CD1   1 
ATOM   781  C  CD2   . TYR C 3  26  ? 79.690 99.804  40.151 1.00 24.98  ? 26   TYR A CD2   1 
ATOM   782  C  CE1   . TYR C 3  26  ? 79.321 100.054 37.413 1.00 25.84  ? 26   TYR A CE1   1 
ATOM   783  C  CE2   . TYR C 3  26  ? 78.880 98.896  39.477 1.00 24.61  ? 26   TYR A CE2   1 
ATOM   784  C  CZ    . TYR C 3  26  ? 78.701 99.026  38.111 1.00 24.42  ? 26   TYR A CZ    1 
ATOM   785  O  OH    . TYR C 3  26  ? 77.910 98.127  37.443 1.00 23.87  ? 26   TYR A OH    1 
ATOM   786  N  N     . SER C 3  27  ? 84.122 103.152 40.988 1.00 32.86  ? 27   SER A N     1 
ATOM   787  C  CA    . SER C 3  27  ? 84.885 104.395 40.972 1.00 34.69  ? 27   SER A CA    1 
ATOM   788  C  C     . SER C 3  27  ? 86.260 104.275 40.318 1.00 34.99  ? 27   SER A C     1 
ATOM   789  O  O     . SER C 3  27  ? 86.820 105.274 39.864 1.00 37.15  ? 27   SER A O     1 
ATOM   790  C  CB    . SER C 3  27  ? 85.023 104.953 42.391 1.00 34.06  ? 27   SER A CB    1 
ATOM   791  O  OG    . SER C 3  27  ? 85.634 104.016 43.252 1.00 39.74  ? 27   SER A OG    1 
ATOM   792  N  N     . THR C 3  28  ? 86.801 103.061 40.265 1.00 33.75  ? 28   THR A N     1 
ATOM   793  C  CA    . THR C 3  28  ? 88.104 102.835 39.644 1.00 32.95  ? 28   THR A CA    1 
ATOM   794  C  C     . THR C 3  28  ? 87.912 102.081 38.335 1.00 33.34  ? 28   THR A C     1 
ATOM   795  O  O     . THR C 3  28  ? 88.794 102.068 37.481 1.00 32.37  ? 28   THR A O     1 
ATOM   796  C  CB    . THR C 3  28  ? 89.031 101.973 40.536 1.00 34.10  ? 28   THR A CB    1 
ATOM   797  O  OG1   . THR C 3  28  ? 88.404 100.709 40.788 1.00 33.64  ? 28   THR A OG1   1 
ATOM   798  C  CG2   . THR C 3  28  ? 89.325 102.666 41.857 1.00 32.76  ? 28   THR A CG2   1 
ATOM   799  N  N     . ALA C 3  29  ? 86.755 101.440 38.197 1.00 33.87  ? 29   ALA A N     1 
ATOM   800  C  CA    . ALA C 3  29  ? 86.431 100.658 37.009 1.00 33.75  ? 29   ALA A CA    1 
ATOM   801  C  C     . ALA C 3  29  ? 87.382 99.475  36.848 1.00 34.94  ? 29   ALA A C     1 
ATOM   802  O  O     . ALA C 3  29  ? 87.678 99.055  35.730 1.00 35.87  ? 29   ALA A O     1 
ATOM   803  C  CB    . ALA C 3  29  ? 86.483 101.536 35.769 1.00 34.21  ? 29   ALA A CB    1 
ATOM   804  N  N     . GLU C 3  30  ? 87.860 98.931  37.961 1.00 35.72  ? 30   GLU A N     1 
ATOM   805  C  CA    . GLU C 3  30  ? 88.774 97.798  37.886 1.00 36.69  ? 30   GLU A CA    1 
ATOM   806  C  C     . GLU C 3  30  ? 88.436 96.610  38.772 1.00 33.96  ? 30   GLU A C     1 
ATOM   807  O  O     . GLU C 3  30  ? 87.763 96.744  39.799 1.00 32.31  ? 30   GLU A O     1 
ATOM   808  C  CB    . GLU C 3  30  ? 90.203 98.255  38.182 1.00 40.82  ? 30   GLU A CB    1 
ATOM   809  C  CG    . GLU C 3  30  ? 91.045 98.352  36.925 1.00 48.33  ? 30   GLU A CG    1 
ATOM   810  C  CD    . GLU C 3  30  ? 92.424 98.887  37.190 1.00 52.76  ? 30   GLU A CD    1 
ATOM   811  O  OE1   . GLU C 3  30  ? 93.127 98.320  38.057 1.00 56.20  ? 30   GLU A OE1   1 
ATOM   812  O  OE2   . GLU C 3  30  ? 92.807 99.873  36.524 1.00 55.65  ? 30   GLU A OE2   1 
ATOM   813  N  N     . TYR C 3  31  ? 88.905 95.442  38.351 1.00 31.88  ? 31   TYR A N     1 
ATOM   814  C  CA    . TYR C 3  31  ? 88.692 94.213  39.093 1.00 31.42  ? 31   TYR A CA    1 
ATOM   815  C  C     . TYR C 3  31  ? 89.926 93.901  39.921 1.00 31.97  ? 31   TYR A C     1 
ATOM   816  O  O     . TYR C 3  31  ? 91.053 94.079  39.457 1.00 33.22  ? 31   TYR A O     1 
ATOM   817  C  CB    . TYR C 3  31  ? 88.445 93.038  38.149 1.00 31.28  ? 31   TYR A CB    1 
ATOM   818  C  CG    . TYR C 3  31  ? 87.156 93.101  37.366 1.00 30.40  ? 31   TYR A CG    1 
ATOM   819  C  CD1   . TYR C 3  31  ? 87.066 93.836  36.181 1.00 31.07  ? 31   TYR A CD1   1 
ATOM   820  C  CD2   . TYR C 3  31  ? 86.029 92.408  37.802 1.00 27.24  ? 31   TYR A CD2   1 
ATOM   821  C  CE1   . TYR C 3  31  ? 85.883 93.872  35.448 1.00 29.20  ? 31   TYR A CE1   1 
ATOM   822  C  CE2   . TYR C 3  31  ? 84.851 92.439  37.083 1.00 28.40  ? 31   TYR A CE2   1 
ATOM   823  C  CZ    . TYR C 3  31  ? 84.784 93.170  35.907 1.00 29.43  ? 31   TYR A CZ    1 
ATOM   824  O  OH    . TYR C 3  31  ? 83.614 93.191  35.193 1.00 32.89  ? 31   TYR A OH    1 
ATOM   825  N  N     . VAL C 3  32  ? 89.706 93.442  41.149 1.00 31.53  ? 32   VAL A N     1 
ATOM   826  C  CA    . VAL C 3  32  ? 90.790 93.057  42.043 1.00 28.39  ? 32   VAL A CA    1 
ATOM   827  C  C     . VAL C 3  32  ? 90.492 91.678  42.619 1.00 28.23  ? 32   VAL A C     1 
ATOM   828  O  O     . VAL C 3  32  ? 89.400 91.434  43.131 1.00 27.92  ? 32   VAL A O     1 
ATOM   829  C  CB    . VAL C 3  32  ? 90.952 94.040  43.210 1.00 28.97  ? 32   VAL A CB    1 
ATOM   830  C  CG1   . VAL C 3  32  ? 92.045 93.542  44.148 1.00 26.55  ? 32   VAL A CG1   1 
ATOM   831  C  CG2   . VAL C 3  32  ? 91.291 95.431  42.681 1.00 27.40  ? 32   VAL A CG2   1 
ATOM   832  N  N     . SER C 3  33  ? 91.467 90.778  42.520 1.00 27.96  ? 33   SER A N     1 
ATOM   833  C  CA    . SER C 3  33  ? 91.322 89.425  43.036 1.00 26.42  ? 33   SER A CA    1 
ATOM   834  C  C     . SER C 3  33  ? 92.028 89.267  44.367 1.00 25.44  ? 33   SER A C     1 
ATOM   835  O  O     . SER C 3  33  ? 93.098 89.825  44.576 1.00 26.51  ? 33   SER A O     1 
ATOM   836  C  CB    . SER C 3  33  ? 91.903 88.410  42.056 1.00 26.25  ? 33   SER A CB    1 
ATOM   837  O  OG    . SER C 3  33  ? 91.102 88.319  40.899 1.00 29.32  ? 33   SER A OG    1 
ATOM   838  N  N     . TYR C 3  34  ? 91.412 88.507  45.263 1.00 26.24  ? 34   TYR A N     1 
ATOM   839  C  CA    . TYR C 3  34  ? 91.977 88.226  46.575 1.00 26.10  ? 34   TYR A CA    1 
ATOM   840  C  C     . TYR C 3  34  ? 92.039 86.714  46.690 1.00 27.29  ? 34   TYR A C     1 
ATOM   841  O  O     . TYR C 3  34  ? 91.032 86.030  46.505 1.00 27.93  ? 34   TYR A O     1 
ATOM   842  C  CB    . TYR C 3  34  ? 91.091 88.788  47.681 1.00 25.66  ? 34   TYR A CB    1 
ATOM   843  C  CG    . TYR C 3  34  ? 90.839 90.265  47.542 1.00 27.86  ? 34   TYR A CG    1 
ATOM   844  C  CD1   . TYR C 3  34  ? 89.911 90.750  46.620 1.00 27.50  ? 34   TYR A CD1   1 
ATOM   845  C  CD2   . TYR C 3  34  ? 91.548 91.185  48.309 1.00 25.43  ? 34   TYR A CD2   1 
ATOM   846  C  CE1   . TYR C 3  34  ? 89.698 92.120  46.470 1.00 27.95  ? 34   TYR A CE1   1 
ATOM   847  C  CE2   . TYR C 3  34  ? 91.342 92.550  48.166 1.00 25.75  ? 34   TYR A CE2   1 
ATOM   848  C  CZ    . TYR C 3  34  ? 90.419 93.011  47.248 1.00 26.16  ? 34   TYR A CZ    1 
ATOM   849  O  OH    . TYR C 3  34  ? 90.221 94.363  47.107 1.00 27.59  ? 34   TYR A OH    1 
ATOM   850  N  N     . ARG C 3  35  ? 93.227 86.193  46.963 1.00 28.57  ? 35   ARG A N     1 
ATOM   851  C  CA    . ARG C 3  35  ? 93.408 84.757  47.100 1.00 29.53  ? 35   ARG A CA    1 
ATOM   852  C  C     . ARG C 3  35  ? 93.304 84.401  48.578 1.00 28.86  ? 35   ARG A C     1 
ATOM   853  O  O     . ARG C 3  35  ? 93.067 85.278  49.402 1.00 27.77  ? 35   ARG A O     1 
ATOM   854  C  CB    . ARG C 3  35  ? 94.749 84.355  46.479 1.00 32.01  ? 35   ARG A CB    1 
ATOM   855  C  CG    . ARG C 3  35  ? 94.721 84.516  44.963 1.00 36.24  ? 35   ARG A CG    1 
ATOM   856  C  CD    . ARG C 3  35  ? 95.996 84.080  44.274 1.00 39.62  ? 35   ARG A CD    1 
ATOM   857  N  NE    . ARG C 3  35  ? 95.812 84.047  42.825 1.00 43.98  ? 35   ARG A NE    1 
ATOM   858  C  CZ    . ARG C 3  35  ? 95.508 85.109  42.083 1.00 47.24  ? 35   ARG A CZ    1 
ATOM   859  N  NH1   . ARG C 3  35  ? 95.355 86.297  42.653 1.00 49.04  ? 35   ARG A NH1   1 
ATOM   860  N  NH2   . ARG C 3  35  ? 95.349 84.984  40.771 1.00 48.48  ? 35   ARG A NH2   1 
ATOM   861  N  N     . PRO C 3  36  ? 93.472 83.120  48.938 1.00 29.02  ? 36   PRO A N     1 
ATOM   862  C  CA    . PRO C 3  36  ? 93.357 82.767  50.360 1.00 29.11  ? 36   PRO A CA    1 
ATOM   863  C  C     . PRO C 3  36  ? 94.107 83.596  51.405 1.00 28.29  ? 36   PRO A C     1 
ATOM   864  O  O     . PRO C 3  36  ? 93.562 83.890  52.463 1.00 29.26  ? 36   PRO A O     1 
ATOM   865  C  CB    . PRO C 3  36  ? 93.718 81.274  50.395 1.00 29.11  ? 36   PRO A CB    1 
ATOM   866  C  CG    . PRO C 3  36  ? 94.377 81.004  49.060 1.00 31.69  ? 36   PRO A CG    1 
ATOM   867  C  CD    . PRO C 3  36  ? 93.692 81.926  48.104 1.00 28.84  ? 36   PRO A CD    1 
ATOM   868  N  N     . SER C 3  37  ? 95.338 83.993  51.132 1.00 28.55  ? 37   SER A N     1 
ATOM   869  C  CA    . SER C 3  37  ? 96.057 84.786  52.116 1.00 28.06  ? 37   SER A CA    1 
ATOM   870  C  C     . SER C 3  37  ? 95.640 86.259  52.080 1.00 28.15  ? 37   SER A C     1 
ATOM   871  O  O     . SER C 3  37  ? 96.143 87.066  52.863 1.00 26.01  ? 37   SER A O     1 
ATOM   872  C  CB    . SER C 3  37  ? 97.568 84.662  51.901 1.00 30.29  ? 37   SER A CB    1 
ATOM   873  O  OG    . SER C 3  37  ? 97.950 85.144  50.626 1.00 34.39  ? 37   SER A OG    1 
ATOM   874  N  N     . ASP C 3  38  ? 94.721 86.609  51.182 1.00 27.39  ? 38   ASP A N     1 
ATOM   875  C  CA    . ASP C 3  38  ? 94.262 87.995  51.073 1.00 28.45  ? 38   ASP A CA    1 
ATOM   876  C  C     . ASP C 3  38  ? 92.915 88.230  51.752 1.00 28.83  ? 38   ASP A C     1 
ATOM   877  O  O     . ASP C 3  38  ? 92.362 89.329  51.678 1.00 29.80  ? 38   ASP A O     1 
ATOM   878  C  CB    . ASP C 3  38  ? 94.145 88.423  49.608 1.00 27.91  ? 38   ASP A CB    1 
ATOM   879  C  CG    . ASP C 3  38  ? 95.486 88.458  48.890 1.00 30.70  ? 38   ASP A CG    1 
ATOM   880  O  OD1   . ASP C 3  38  ? 96.460 89.017  49.445 1.00 33.56  ? 38   ASP A OD1   1 
ATOM   881  O  OD2   . ASP C 3  38  ? 95.563 87.939  47.756 1.00 31.55  ? 38   ASP A OD2   1 
ATOM   882  N  N     . PHE C 3  39  ? 92.396 87.203  52.418 1.00 27.17  ? 39   PHE A N     1 
ATOM   883  C  CA    . PHE C 3  39  ? 91.104 87.286  53.093 1.00 26.16  ? 39   PHE A CA    1 
ATOM   884  C  C     . PHE C 3  39  ? 90.906 88.565  53.917 1.00 26.29  ? 39   PHE A C     1 
ATOM   885  O  O     . PHE C 3  39  ? 89.906 89.266  53.756 1.00 26.73  ? 39   PHE A O     1 
ATOM   886  C  CB    . PHE C 3  39  ? 90.906 86.043  53.977 1.00 25.03  ? 39   PHE A CB    1 
ATOM   887  C  CG    . PHE C 3  39  ? 89.521 85.920  54.558 1.00 24.07  ? 39   PHE A CG    1 
ATOM   888  C  CD1   . PHE C 3  39  ? 88.412 86.417  53.869 1.00 20.94  ? 39   PHE A CD1   1 
ATOM   889  C  CD2   . PHE C 3  39  ? 89.321 85.286  55.782 1.00 22.53  ? 39   PHE A CD2   1 
ATOM   890  C  CE1   . PHE C 3  39  ? 87.119 86.285  54.392 1.00 18.97  ? 39   PHE A CE1   1 
ATOM   891  C  CE2   . PHE C 3  39  ? 88.030 85.145  56.315 1.00 21.42  ? 39   PHE A CE2   1 
ATOM   892  C  CZ    . PHE C 3  39  ? 86.928 85.650  55.614 1.00 18.41  ? 39   PHE A CZ    1 
ATOM   893  N  N     . GLY C 3  40  ? 91.855 88.869  54.797 1.00 25.18  ? 40   GLY A N     1 
ATOM   894  C  CA    . GLY C 3  40  ? 91.739 90.065  55.609 1.00 24.03  ? 40   GLY A CA    1 
ATOM   895  C  C     . GLY C 3  40  ? 91.614 91.322  54.768 1.00 24.22  ? 40   GLY A C     1 
ATOM   896  O  O     . GLY C 3  40  ? 90.830 92.218  55.078 1.00 24.98  ? 40   GLY A O     1 
ATOM   897  N  N     . ALA C 3  41  ? 92.396 91.391  53.700 1.00 24.30  ? 41   ALA A N     1 
ATOM   898  C  CA    . ALA C 3  41  ? 92.377 92.543  52.815 1.00 25.12  ? 41   ALA A CA    1 
ATOM   899  C  C     . ALA C 3  41  ? 91.023 92.645  52.129 1.00 25.44  ? 41   ALA A C     1 
ATOM   900  O  O     . ALA C 3  41  ? 90.503 93.735  51.939 1.00 25.42  ? 41   ALA A O     1 
ATOM   901  C  CB    . ALA C 3  41  ? 93.493 92.426  51.776 1.00 24.86  ? 41   ALA A CB    1 
ATOM   902  N  N     . TYR C 3  42  ? 90.456 91.500  51.759 1.00 26.29  ? 42   TYR A N     1 
ATOM   903  C  CA    . TYR C 3  42  ? 89.150 91.466  51.106 1.00 24.53  ? 42   TYR A CA    1 
ATOM   904  C  C     . TYR C 3  42  ? 88.104 92.081  52.026 1.00 23.87  ? 42   TYR A C     1 
ATOM   905  O  O     . TYR C 3  42  ? 87.328 92.941  51.611 1.00 25.98  ? 42   TYR A O     1 
ATOM   906  C  CB    . TYR C 3  42  ? 88.753 90.026  50.784 1.00 24.09  ? 42   TYR A CB    1 
ATOM   907  C  CG    . TYR C 3  42  ? 87.352 89.891  50.238 1.00 23.45  ? 42   TYR A CG    1 
ATOM   908  C  CD1   . TYR C 3  42  ? 87.039 90.316  48.950 1.00 24.34  ? 42   TYR A CD1   1 
ATOM   909  C  CD2   . TYR C 3  42  ? 86.330 89.362  51.023 1.00 22.28  ? 42   TYR A CD2   1 
ATOM   910  C  CE1   . TYR C 3  42  ? 85.733 90.219  48.458 1.00 23.12  ? 42   TYR A CE1   1 
ATOM   911  C  CE2   . TYR C 3  42  ? 85.036 89.259  50.544 1.00 21.63  ? 42   TYR A CE2   1 
ATOM   912  C  CZ    . TYR C 3  42  ? 84.739 89.689  49.263 1.00 22.99  ? 42   TYR A CZ    1 
ATOM   913  O  OH    . TYR C 3  42  ? 83.449 89.591  48.793 1.00 21.78  ? 42   TYR A OH    1 
ATOM   914  N  N     . LEU C 3  43  ? 88.082 91.633  53.275 1.00 23.68  ? 43   LEU A N     1 
ATOM   915  C  CA    . LEU C 3  43  ? 87.126 92.154  54.244 1.00 23.41  ? 43   LEU A CA    1 
ATOM   916  C  C     . LEU C 3  43  ? 87.353 93.647  54.446 1.00 24.26  ? 43   LEU A C     1 
ATOM   917  O  O     . LEU C 3  43  ? 86.400 94.415  54.590 1.00 22.55  ? 43   LEU A O     1 
ATOM   918  C  CB    . LEU C 3  43  ? 87.262 91.429  55.581 1.00 23.35  ? 43   LEU A CB    1 
ATOM   919  C  CG    . LEU C 3  43  ? 86.952 89.931  55.601 1.00 23.97  ? 43   LEU A CG    1 
ATOM   920  C  CD1   . LEU C 3  43  ? 87.273 89.377  56.971 1.00 22.66  ? 43   LEU A CD1   1 
ATOM   921  C  CD2   . LEU C 3  43  ? 85.497 89.687  55.260 1.00 20.30  ? 43   LEU A CD2   1 
ATOM   922  N  N     . ASP C 3  44  ? 88.617 94.063  54.455 1.00 25.19  ? 44   ASP A N     1 
ATOM   923  C  CA    . ASP C 3  44  ? 88.920 95.478  54.627 1.00 25.65  ? 44   ASP A CA    1 
ATOM   924  C  C     . ASP C 3  44  ? 88.266 96.280  53.507 1.00 24.15  ? 44   ASP A C     1 
ATOM   925  O  O     . ASP C 3  44  ? 87.644 97.309  53.753 1.00 24.94  ? 44   ASP A O     1 
ATOM   926  C  CB    . ASP C 3  44  ? 90.438 95.725  54.636 1.00 25.31  ? 44   ASP A CB    1 
ATOM   927  C  CG    . ASP C 3  44  ? 91.118 95.211  55.912 1.00 27.19  ? 44   ASP A CG    1 
ATOM   928  O  OD1   . ASP C 3  44  ? 90.428 94.983  56.933 1.00 26.15  ? 44   ASP A OD1   1 
ATOM   929  O  OD2   . ASP C 3  44  ? 92.357 95.048  55.898 1.00 29.07  ? 44   ASP A OD2   1 
ATOM   930  N  N     . ALA C 3  45  ? 88.392 95.796  52.277 1.00 23.69  ? 45   ALA A N     1 
ATOM   931  C  CA    . ALA C 3  45  ? 87.814 96.484  51.127 1.00 24.09  ? 45   ALA A CA    1 
ATOM   932  C  C     . ALA C 3  45  ? 86.291 96.599  51.225 1.00 24.63  ? 45   ALA A C     1 
ATOM   933  O  O     . ALA C 3  45  ? 85.717 97.616  50.830 1.00 24.25  ? 45   ALA A O     1 
ATOM   934  C  CB    . ALA C 3  45  ? 88.205 95.771  49.849 1.00 24.40  ? 45   ALA A CB    1 
ATOM   935  N  N     . LEU C 3  46  ? 85.636 95.565  51.749 1.00 22.21  ? 46   LEU A N     1 
ATOM   936  C  CA    . LEU C 3  46  ? 84.189 95.608  51.890 1.00 21.55  ? 46   LEU A CA    1 
ATOM   937  C  C     . LEU C 3  46  ? 83.803 96.646  52.942 1.00 21.91  ? 46   LEU A C     1 
ATOM   938  O  O     . LEU C 3  46  ? 82.938 97.486  52.700 1.00 24.37  ? 46   LEU A O     1 
ATOM   939  C  CB    . LEU C 3  46  ? 83.638 94.231  52.274 1.00 18.77  ? 46   LEU A CB    1 
ATOM   940  C  CG    . LEU C 3  46  ? 83.872 93.124  51.247 1.00 18.20  ? 46   LEU A CG    1 
ATOM   941  C  CD1   . LEU C 3  46  ? 83.148 91.870  51.692 1.00 19.85  ? 46   LEU A CD1   1 
ATOM   942  C  CD2   . LEU C 3  46  ? 83.361 93.559  49.869 1.00 17.60  ? 46   LEU A CD2   1 
ATOM   943  N  N     . GLU C 3  47  ? 84.445 96.603  54.106 1.00 20.67  ? 47   GLU A N     1 
ATOM   944  C  CA    . GLU C 3  47  ? 84.141 97.572  55.151 1.00 22.26  ? 47   GLU A CA    1 
ATOM   945  C  C     . GLU C 3  47  ? 84.439 99.014  54.721 1.00 24.19  ? 47   GLU A C     1 
ATOM   946  O  O     . GLU C 3  47  ? 83.746 99.947  55.141 1.00 25.52  ? 47   GLU A O     1 
ATOM   947  C  CB    . GLU C 3  47  ? 84.902 97.227  56.432 1.00 23.68  ? 47   GLU A CB    1 
ATOM   948  C  CG    . GLU C 3  47  ? 84.465 95.897  57.038 1.00 24.59  ? 47   GLU A CG    1 
ATOM   949  C  CD    . GLU C 3  47  ? 85.118 95.606  58.371 1.00 25.49  ? 47   GLU A CD    1 
ATOM   950  O  OE1   . GLU C 3  47  ? 86.343 95.801  58.490 1.00 25.49  ? 47   GLU A OE1   1 
ATOM   951  O  OE2   . GLU C 3  47  ? 84.412 95.171  59.303 1.00 25.03  ? 47   GLU A OE2   1 
ATOM   952  N  N     . ALA C 3  48  ? 85.449 99.198  53.875 1.00 21.84  ? 48   ALA A N     1 
ATOM   953  C  CA    . ALA C 3  48  ? 85.800 100.532 53.393 1.00 24.15  ? 48   ALA A CA    1 
ATOM   954  C  C     . ALA C 3  48  ? 84.638 101.140 52.598 1.00 25.39  ? 48   ALA A C     1 
ATOM   955  O  O     . ALA C 3  48  ? 84.332 102.329 52.731 1.00 26.32  ? 48   ALA A O     1 
ATOM   956  C  CB    . ALA C 3  48  ? 87.052 100.464 52.521 1.00 22.67  ? 48   ALA A CB    1 
ATOM   957  N  N     . GLU C 3  49  ? 83.997 100.315 51.775 1.00 25.28  ? 49   GLU A N     1 
ATOM   958  C  CA    . GLU C 3  49  ? 82.864 100.754 50.972 1.00 25.81  ? 49   GLU A CA    1 
ATOM   959  C  C     . GLU C 3  49  ? 81.718 101.134 51.914 1.00 25.75  ? 49   GLU A C     1 
ATOM   960  O  O     . GLU C 3  49  ? 80.951 102.056 51.633 1.00 24.83  ? 49   GLU A O     1 
ATOM   961  C  CB    . GLU C 3  49  ? 82.440 99.632  50.012 1.00 24.42  ? 49   GLU A CB    1 
ATOM   962  C  CG    . GLU C 3  49  ? 81.255 99.952  49.092 1.00 26.00  ? 49   GLU A CG    1 
ATOM   963  C  CD    . GLU C 3  49  ? 81.519 101.106 48.125 1.00 28.72  ? 49   GLU A CD    1 
ATOM   964  O  OE1   . GLU C 3  49  ? 82.698 101.408 47.830 1.00 28.65  ? 49   GLU A OE1   1 
ATOM   965  O  OE2   . GLU C 3  49  ? 80.539 101.706 47.637 1.00 30.53  ? 49   GLU A OE2   1 
ATOM   966  N  N     . VAL C 3  50  ? 81.608 100.422 53.034 1.00 25.51  ? 50   VAL A N     1 
ATOM   967  C  CA    . VAL C 3  50  ? 80.568 100.709 54.022 1.00 26.70  ? 50   VAL A CA    1 
ATOM   968  C  C     . VAL C 3  50  ? 80.844 102.054 54.707 1.00 27.68  ? 50   VAL A C     1 
ATOM   969  O  O     . VAL C 3  50  ? 79.918 102.815 55.002 1.00 26.44  ? 50   VAL A O     1 
ATOM   970  C  CB    . VAL C 3  50  ? 80.495 99.607  55.118 1.00 25.41  ? 50   VAL A CB    1 
ATOM   971  C  CG1   . VAL C 3  50  ? 79.613 100.067 56.269 1.00 25.07  ? 50   VAL A CG1   1 
ATOM   972  C  CG2   . VAL C 3  50  ? 79.941 98.325  54.534 1.00 24.99  ? 50   VAL A CG2   1 
ATOM   973  N  N     . ALA C 3  51  ? 82.121 102.339 54.960 1.00 28.56  ? 51   ALA A N     1 
ATOM   974  C  CA    . ALA C 3  51  ? 82.510 103.590 55.612 1.00 30.25  ? 51   ALA A CA    1 
ATOM   975  C  C     . ALA C 3  51  ? 82.238 104.796 54.709 1.00 30.18  ? 51   ALA A C     1 
ATOM   976  O  O     . ALA C 3  51  ? 81.994 105.893 55.192 1.00 30.32  ? 51   ALA A O     1 
ATOM   977  C  CB    . ALA C 3  51  ? 83.980 103.543 56.004 1.00 29.07  ? 51   ALA A CB    1 
ATOM   978  N  N     . ARG C 3  52  ? 82.278 104.579 53.400 1.00 30.58  ? 52   ARG A N     1 
ATOM   979  C  CA    . ARG C 3  52  ? 82.010 105.633 52.425 1.00 30.15  ? 52   ARG A CA    1 
ATOM   980  C  C     . ARG C 3  52  ? 80.508 105.825 52.207 1.00 28.20  ? 52   ARG A C     1 
ATOM   981  O  O     . ARG C 3  52  ? 80.097 106.666 51.411 1.00 27.87  ? 52   ARG A O     1 
ATOM   982  C  CB    . ARG C 3  52  ? 82.653 105.281 51.080 1.00 32.62  ? 52   ARG A CB    1 
ATOM   983  C  CG    . ARG C 3  52  ? 84.079 105.761 50.906 1.00 36.69  ? 52   ARG A CG    1 
ATOM   984  C  CD    . ARG C 3  52  ? 84.667 105.260 49.589 1.00 39.59  ? 52   ARG A CD    1 
ATOM   985  N  NE    . ARG C 3  52  ? 84.906 103.817 49.614 1.00 44.54  ? 52   ARG A NE    1 
ATOM   986  C  CZ    . ARG C 3  52  ? 85.463 103.127 48.622 1.00 46.70  ? 52   ARG A CZ    1 
ATOM   987  N  NH1   . ARG C 3  52  ? 85.847 103.749 47.511 1.00 48.58  ? 52   ARG A NH1   1 
ATOM   988  N  NH2   . ARG C 3  52  ? 85.637 101.816 48.738 1.00 43.84  ? 52   ARG A NH2   1 
ATOM   989  N  N     . GLY C 3  53  ? 79.694 105.049 52.917 1.00 26.14  ? 53   GLY A N     1 
ATOM   990  C  CA    . GLY C 3  53  ? 78.254 105.136 52.748 1.00 23.04  ? 53   GLY A CA    1 
ATOM   991  C  C     . GLY C 3  53  ? 77.893 104.553 51.391 1.00 23.66  ? 53   GLY A C     1 
ATOM   992  O  O     . GLY C 3  53  ? 76.884 104.920 50.785 1.00 25.24  ? 53   GLY A O     1 
ATOM   993  N  N     . GLY C 3  54  ? 78.726 103.629 50.919 1.00 21.14  ? 54   GLY A N     1 
ATOM   994  C  CA    . GLY C 3  54  ? 78.515 103.016 49.620 1.00 20.35  ? 54   GLY A CA    1 
ATOM   995  C  C     . GLY C 3  54  ? 77.630 101.782 49.584 1.00 20.73  ? 54   GLY A C     1 
ATOM   996  O  O     . GLY C 3  54  ? 76.867 101.514 50.511 1.00 21.62  ? 54   GLY A O     1 
ATOM   997  N  N     . LEU C 3  55  ? 77.753 101.020 48.501 1.00 19.77  ? 55   LEU A N     1 
ATOM   998  C  CA    . LEU C 3  55  ? 76.952 99.826  48.301 1.00 18.25  ? 55   LEU A CA    1 
ATOM   999  C  C     . LEU C 3  55  ? 77.764 98.621  47.822 1.00 20.09  ? 55   LEU A C     1 
ATOM   1000 O  O     . LEU C 3  55  ? 78.722 98.753  47.057 1.00 19.84  ? 55   LEU A O     1 
ATOM   1001 C  CB    . LEU C 3  55  ? 75.843 100.138 47.296 1.00 18.64  ? 55   LEU A CB    1 
ATOM   1002 C  CG    . LEU C 3  55  ? 74.739 101.084 47.801 1.00 19.40  ? 55   LEU A CG    1 
ATOM   1003 C  CD1   . LEU C 3  55  ? 74.027 101.737 46.635 1.00 16.94  ? 55   LEU A CD1   1 
ATOM   1004 C  CD2   . LEU C 3  55  ? 73.762 100.300 48.661 1.00 13.34  ? 55   LEU A CD2   1 
ATOM   1005 N  N     . ILE C 3  56  ? 77.363 97.442  48.282 1.00 19.21  ? 56   ILE A N     1 
ATOM   1006 C  CA    . ILE C 3  56  ? 78.024 96.198  47.910 1.00 20.06  ? 56   ILE A CA    1 
ATOM   1007 C  C     . ILE C 3  56  ? 77.005 95.286  47.224 1.00 20.60  ? 56   ILE A C     1 
ATOM   1008 O  O     . ILE C 3  56  ? 75.973 94.938  47.810 1.00 20.42  ? 56   ILE A O     1 
ATOM   1009 C  CB    . ILE C 3  56  ? 78.574 95.488  49.163 1.00 19.73  ? 56   ILE A CB    1 
ATOM   1010 C  CG1   . ILE C 3  56  ? 79.529 96.436  49.900 1.00 17.32  ? 56   ILE A CG1   1 
ATOM   1011 C  CG2   . ILE C 3  56  ? 79.256 94.175  48.772 1.00 17.26  ? 56   ILE A CG2   1 
ATOM   1012 C  CD1   . ILE C 3  56  ? 79.998 95.919  51.219 1.00 16.74  ? 56   ILE A CD1   1 
ATOM   1013 N  N     . VAL C 3  57  ? 77.296 94.902  45.986 1.00 19.17  ? 57   VAL A N     1 
ATOM   1014 C  CA    . VAL C 3  57  ? 76.399 94.038  45.231 1.00 17.88  ? 57   VAL A CA    1 
ATOM   1015 C  C     . VAL C 3  57  ? 76.944 92.616  45.124 1.00 21.12  ? 57   VAL A C     1 
ATOM   1016 O  O     . VAL C 3  57  ? 78.071 92.409  44.670 1.00 22.37  ? 57   VAL A O     1 
ATOM   1017 C  CB    . VAL C 3  57  ? 76.191 94.567  43.804 1.00 17.25  ? 57   VAL A CB    1 
ATOM   1018 C  CG1   . VAL C 3  57  ? 75.302 93.617  43.026 1.00 15.38  ? 57   VAL A CG1   1 
ATOM   1019 C  CG2   . VAL C 3  57  ? 75.583 95.965  43.840 1.00 18.16  ? 57   VAL A CG2   1 
ATOM   1020 N  N     . PHE C 3  58  ? 76.133 91.650  45.548 1.00 19.41  ? 58   PHE A N     1 
ATOM   1021 C  CA    . PHE C 3  58  ? 76.471 90.232  45.486 1.00 19.40  ? 58   PHE A CA    1 
ATOM   1022 C  C     . PHE C 3  58  ? 75.304 89.611  44.722 1.00 19.33  ? 58   PHE A C     1 
ATOM   1023 O  O     . PHE C 3  58  ? 74.257 90.239  44.568 1.00 20.45  ? 58   PHE A O     1 
ATOM   1024 C  CB    . PHE C 3  58  ? 76.471 89.586  46.888 1.00 19.77  ? 58   PHE A CB    1 
ATOM   1025 C  CG    . PHE C 3  58  ? 77.644 89.958  47.767 1.00 19.91  ? 58   PHE A CG    1 
ATOM   1026 C  CD1   . PHE C 3  58  ? 78.905 89.408  47.545 1.00 18.49  ? 58   PHE A CD1   1 
ATOM   1027 C  CD2   . PHE C 3  58  ? 77.470 90.811  48.854 1.00 19.43  ? 58   PHE A CD2   1 
ATOM   1028 C  CE1   . PHE C 3  58  ? 79.972 89.698  48.393 1.00 19.12  ? 58   PHE A CE1   1 
ATOM   1029 C  CE2   . PHE C 3  58  ? 78.534 91.111  49.715 1.00 18.33  ? 58   PHE A CE2   1 
ATOM   1030 C  CZ    . PHE C 3  58  ? 79.788 90.552  49.485 1.00 17.66  ? 58   PHE A CZ    1 
ATOM   1031 N  N     . HIS C 3  59  ? 75.486 88.392  44.227 1.00 19.14  ? 59   HIS A N     1 
ATOM   1032 C  CA    . HIS C 3  59  ? 74.384 87.678  43.585 1.00 18.13  ? 59   HIS A CA    1 
ATOM   1033 C  C     . HIS C 3  59  ? 74.141 86.557  44.596 1.00 18.30  ? 59   HIS A C     1 
ATOM   1034 O  O     . HIS C 3  59  ? 74.983 85.667  44.764 1.00 18.61  ? 59   HIS A O     1 
ATOM   1035 C  CB    . HIS C 3  59  ? 74.778 87.083  42.234 1.00 18.84  ? 59   HIS A CB    1 
ATOM   1036 C  CG    . HIS C 3  59  ? 73.654 86.363  41.555 1.00 20.26  ? 59   HIS A CG    1 
ATOM   1037 N  ND1   . HIS C 3  59  ? 72.601 87.022  40.954 1.00 19.28  ? 59   HIS A ND1   1 
ATOM   1038 C  CD2   . HIS C 3  59  ? 73.386 85.040  41.439 1.00 18.96  ? 59   HIS A CD2   1 
ATOM   1039 C  CE1   . HIS C 3  59  ? 71.733 86.134  40.498 1.00 20.27  ? 59   HIS A CE1   1 
ATOM   1040 N  NE2   . HIS C 3  59  ? 72.186 84.925  40.781 1.00 20.50  ? 59   HIS A NE2   1 
ATOM   1041 N  N     . ASN C 3  60  ? 73.013 86.638  45.296 1.00 17.21  ? 60   ASN A N     1 
ATOM   1042 C  CA    . ASN C 3  60  ? 72.635 85.672  46.332 1.00 17.40  ? 60   ASN A CA    1 
ATOM   1043 C  C     . ASN C 3  60  ? 73.495 85.884  47.579 1.00 17.95  ? 60   ASN A C     1 
ATOM   1044 O  O     . ASN C 3  60  ? 73.713 84.957  48.365 1.00 14.99  ? 60   ASN A O     1 
ATOM   1045 C  CB    . ASN C 3  60  ? 72.784 84.220  45.846 1.00 16.57  ? 60   ASN A CB    1 
ATOM   1046 C  CG    . ASN C 3  60  ? 72.185 83.210  46.830 1.00 17.35  ? 60   ASN A CG    1 
ATOM   1047 O  OD1   . ASN C 3  60  ? 71.060 83.374  47.276 1.00 15.98  ? 60   ASN A OD1   1 
ATOM   1048 N  ND2   . ASN C 3  60  ? 72.940 82.164  47.163 1.00 17.05  ? 60   ASN A ND2   1 
ATOM   1049 N  N     . GLY C 3  61  ? 73.979 87.112  47.755 1.00 17.49  ? 61   GLY A N     1 
ATOM   1050 C  CA    . GLY C 3  61  ? 74.798 87.425  48.915 1.00 15.78  ? 61   GLY A CA    1 
ATOM   1051 C  C     . GLY C 3  61  ? 74.004 87.455  50.209 1.00 17.39  ? 61   GLY A C     1 
ATOM   1052 O  O     . GLY C 3  61  ? 74.531 87.138  51.268 1.00 20.70  ? 61   GLY A O     1 
ATOM   1053 N  N     . HIS C 3  62  ? 72.732 87.831  50.152 1.00 17.46  ? 62   HIS A N     1 
ATOM   1054 C  CA    . HIS C 3  62  ? 71.937 87.870  51.378 1.00 18.60  ? 62   HIS A CA    1 
ATOM   1055 C  C     . HIS C 3  62  ? 71.880 86.508  52.064 1.00 18.49  ? 62   HIS A C     1 
ATOM   1056 O  O     . HIS C 3  62  ? 71.980 86.424  53.281 1.00 17.78  ? 62   HIS A O     1 
ATOM   1057 C  CB    . HIS C 3  62  ? 70.513 88.360  51.088 1.00 17.34  ? 62   HIS A CB    1 
ATOM   1058 C  CG    . HIS C 3  62  ? 70.387 89.849  51.040 1.00 17.55  ? 62   HIS A CG    1 
ATOM   1059 N  ND1   . HIS C 3  62  ? 71.328 90.658  50.440 1.00 19.38  ? 62   HIS A ND1   1 
ATOM   1060 C  CD2   . HIS C 3  62  ? 69.407 90.675  51.480 1.00 16.22  ? 62   HIS A CD2   1 
ATOM   1061 C  CE1   . HIS C 3  62  ? 70.933 91.918  50.508 1.00 14.64  ? 62   HIS A CE1   1 
ATOM   1062 N  NE2   . HIS C 3  62  ? 69.771 91.954  51.134 1.00 17.95  ? 62   HIS A NE2   1 
ATOM   1063 N  N     . LYS C 3  63  ? 71.720 85.436  51.296 1.00 18.67  ? 63   LYS A N     1 
ATOM   1064 C  CA    . LYS C 3  63  ? 71.657 84.116  51.912 1.00 20.70  ? 63   LYS A CA    1 
ATOM   1065 C  C     . LYS C 3  63  ? 73.010 83.435  52.060 1.00 19.84  ? 63   LYS A C     1 
ATOM   1066 O  O     . LYS C 3  63  ? 73.211 82.647  52.987 1.00 20.46  ? 63   LYS A O     1 
ATOM   1067 C  CB    . LYS C 3  63  ? 70.717 83.200  51.130 1.00 20.84  ? 63   LYS A CB    1 
ATOM   1068 C  CG    . LYS C 3  63  ? 69.259 83.624  51.193 1.00 23.62  ? 63   LYS A CG    1 
ATOM   1069 C  CD    . LYS C 3  63  ? 68.374 82.740  50.298 1.00 24.01  ? 63   LYS A CD    1 
ATOM   1070 C  CE    . LYS C 3  63  ? 68.432 81.270  50.687 1.00 22.29  ? 63   LYS A CE    1 
ATOM   1071 N  NZ    . LYS C 3  63  ? 67.258 80.528  50.138 1.00 23.97  ? 63   LYS A NZ    1 
ATOM   1072 N  N     . TYR C 3  64  ? 73.949 83.742  51.173 1.00 20.05  ? 64   TYR A N     1 
ATOM   1073 C  CA    . TYR C 3  64  ? 75.247 83.085  51.260 1.00 20.05  ? 64   TYR A CA    1 
ATOM   1074 C  C     . TYR C 3  64  ? 76.465 83.933  51.630 1.00 19.85  ? 64   TYR A C     1 
ATOM   1075 O  O     . TYR C 3  64  ? 76.936 83.880  52.765 1.00 19.88  ? 64   TYR A O     1 
ATOM   1076 C  CB    . TYR C 3  64  ? 75.555 82.333  49.958 1.00 19.17  ? 64   TYR A CB    1 
ATOM   1077 C  CG    . TYR C 3  64  ? 76.804 81.488  50.083 1.00 21.45  ? 64   TYR A CG    1 
ATOM   1078 C  CD1   . TYR C 3  64  ? 76.818 80.352  50.889 1.00 22.50  ? 64   TYR A CD1   1 
ATOM   1079 C  CD2   . TYR C 3  64  ? 77.995 81.882  49.484 1.00 21.08  ? 64   TYR A CD2   1 
ATOM   1080 C  CE1   . TYR C 3  64  ? 77.987 79.638  51.102 1.00 25.15  ? 64   TYR A CE1   1 
ATOM   1081 C  CE2   . TYR C 3  64  ? 79.171 81.175  49.690 1.00 23.47  ? 64   TYR A CE2   1 
ATOM   1082 C  CZ    . TYR C 3  64  ? 79.163 80.056  50.500 1.00 24.24  ? 64   TYR A CZ    1 
ATOM   1083 O  OH    . TYR C 3  64  ? 80.332 79.365  50.720 1.00 25.26  ? 64   TYR A OH    1 
ATOM   1084 N  N     . ASP C 3  65  ? 76.981 84.696  50.671 1.00 18.37  ? 65   ASP A N     1 
ATOM   1085 C  CA    . ASP C 3  65  ? 78.179 85.508  50.889 1.00 19.11  ? 65   ASP A CA    1 
ATOM   1086 C  C     . ASP C 3  65  ? 78.265 86.326  52.178 1.00 20.04  ? 65   ASP A C     1 
ATOM   1087 O  O     . ASP C 3  65  ? 79.257 86.243  52.897 1.00 21.99  ? 65   ASP A O     1 
ATOM   1088 C  CB    . ASP C 3  65  ? 78.412 86.436  49.689 1.00 19.11  ? 65   ASP A CB    1 
ATOM   1089 C  CG    . ASP C 3  65  ? 78.393 85.690  48.364 1.00 20.19  ? 65   ASP A CG    1 
ATOM   1090 O  OD1   . ASP C 3  65  ? 77.326 85.145  48.023 1.00 19.01  ? 65   ASP A OD1   1 
ATOM   1091 O  OD2   . ASP C 3  65  ? 79.437 85.643  47.672 1.00 20.27  ? 65   ASP A OD2   1 
ATOM   1092 N  N     . VAL C 3  66  ? 77.247 87.123  52.479 1.00 18.40  ? 66   VAL A N     1 
ATOM   1093 C  CA    . VAL C 3  66  ? 77.293 87.946  53.679 1.00 17.83  ? 66   VAL A CA    1 
ATOM   1094 C  C     . VAL C 3  66  ? 77.381 87.130  54.974 1.00 17.84  ? 66   VAL A C     1 
ATOM   1095 O  O     . VAL C 3  66  ? 78.274 87.356  55.792 1.00 19.24  ? 66   VAL A O     1 
ATOM   1096 C  CB    . VAL C 3  66  ? 76.098 88.919  53.707 1.00 17.02  ? 66   VAL A CB    1 
ATOM   1097 C  CG1   . VAL C 3  66  ? 76.082 89.721  55.002 1.00 13.51  ? 66   VAL A CG1   1 
ATOM   1098 C  CG2   . VAL C 3  66  ? 76.203 89.859  52.517 1.00 18.20  ? 66   VAL A CG2   1 
ATOM   1099 N  N     . PRO C 3  67  ? 76.467 86.173  55.179 1.00 17.47  ? 67   PRO A N     1 
ATOM   1100 C  CA    . PRO C 3  67  ? 76.552 85.380  56.412 1.00 18.13  ? 67   PRO A CA    1 
ATOM   1101 C  C     . PRO C 3  67  ? 77.841 84.540  56.416 1.00 18.40  ? 67   PRO A C     1 
ATOM   1102 O  O     . PRO C 3  67  ? 78.465 84.359  57.457 1.00 18.76  ? 67   PRO A O     1 
ATOM   1103 C  CB    . PRO C 3  67  ? 75.312 84.486  56.354 1.00 18.29  ? 67   PRO A CB    1 
ATOM   1104 C  CG    . PRO C 3  67  ? 74.399 85.170  55.364 1.00 19.03  ? 67   PRO A CG    1 
ATOM   1105 C  CD    . PRO C 3  67  ? 75.328 85.747  54.347 1.00 17.91  ? 67   PRO A CD    1 
ATOM   1106 N  N     . ALA C 3  68  ? 78.236 84.032  55.251 1.00 15.96  ? 68   ALA A N     1 
ATOM   1107 C  CA    . ALA C 3  68  ? 79.447 83.214  55.154 1.00 19.06  ? 68   ALA A CA    1 
ATOM   1108 C  C     . ALA C 3  68  ? 80.691 83.990  55.587 1.00 20.48  ? 68   ALA A C     1 
ATOM   1109 O  O     . ALA C 3  68  ? 81.562 83.451  56.273 1.00 20.10  ? 68   ALA A O     1 
ATOM   1110 C  CB    . ALA C 3  68  ? 79.630 82.702  53.723 1.00 14.76  ? 68   ALA A CB    1 
ATOM   1111 N  N     . LEU C 3  69  ? 80.766 85.255  55.187 1.00 20.54  ? 69   LEU A N     1 
ATOM   1112 C  CA    . LEU C 3  69  ? 81.908 86.092  55.533 1.00 21.82  ? 69   LEU A CA    1 
ATOM   1113 C  C     . LEU C 3  69  ? 81.954 86.354  57.029 1.00 22.17  ? 69   LEU A C     1 
ATOM   1114 O  O     . LEU C 3  69  ? 83.032 86.362  57.629 1.00 21.17  ? 69   LEU A O     1 
ATOM   1115 C  CB    . LEU C 3  69  ? 81.856 87.409  54.761 1.00 19.80  ? 69   LEU A CB    1 
ATOM   1116 C  CG    . LEU C 3  69  ? 82.107 87.221  53.265 1.00 19.65  ? 69   LEU A CG    1 
ATOM   1117 C  CD1   . LEU C 3  69  ? 81.757 88.500  52.502 1.00 16.48  ? 69   LEU A CD1   1 
ATOM   1118 C  CD2   . LEU C 3  69  ? 83.572 86.837  53.050 1.00 15.41  ? 69   LEU A CD2   1 
ATOM   1119 N  N     . THR C 3  70  ? 80.790 86.565  57.634 1.00 20.97  ? 70   THR A N     1 
ATOM   1120 C  CA    . THR C 3  70  ? 80.741 86.793  59.072 1.00 21.54  ? 70   THR A CA    1 
ATOM   1121 C  C     . THR C 3  70  ? 81.286 85.550  59.775 1.00 22.93  ? 70   THR A C     1 
ATOM   1122 O  O     . THR C 3  70  ? 82.111 85.633  60.690 1.00 22.92  ? 70   THR A O     1 
ATOM   1123 C  CB    . THR C 3  70  ? 79.298 87.038  59.548 1.00 22.37  ? 70   THR A CB    1 
ATOM   1124 O  OG1   . THR C 3  70  ? 78.866 88.317  59.083 1.00 23.32  ? 70   THR A OG1   1 
ATOM   1125 C  CG2   . THR C 3  70  ? 79.202 86.985  61.079 1.00 21.02  ? 70   THR A CG2   1 
ATOM   1126 N  N     . LYS C 3  71  ? 80.816 84.393  59.331 1.00 22.72  ? 71   LYS A N     1 
ATOM   1127 C  CA    . LYS C 3  71  ? 81.237 83.128  59.910 1.00 23.72  ? 71   LYS A CA    1 
ATOM   1128 C  C     . LYS C 3  71  ? 82.723 82.867  59.701 1.00 21.92  ? 71   LYS A C     1 
ATOM   1129 O  O     . LYS C 3  71  ? 83.432 82.523  60.638 1.00 20.99  ? 71   LYS A O     1 
ATOM   1130 C  CB    . LYS C 3  71  ? 80.426 81.983  59.306 1.00 22.84  ? 71   LYS A CB    1 
ATOM   1131 C  CG    . LYS C 3  71  ? 80.778 80.619  59.879 1.00 24.01  ? 71   LYS A CG    1 
ATOM   1132 C  CD    . LYS C 3  71  ? 79.881 79.541  59.304 1.00 23.68  ? 71   LYS A CD    1 
ATOM   1133 C  CE    . LYS C 3  71  ? 80.182 78.196  59.924 1.00 24.52  ? 71   LYS A CE    1 
ATOM   1134 N  NZ    . LYS C 3  71  ? 79.264 77.162  59.387 1.00 29.05  ? 71   LYS A NZ    1 
ATOM   1135 N  N     . LEU C 3  72  ? 83.187 83.031  58.470 1.00 22.84  ? 72   LEU A N     1 
ATOM   1136 C  CA    . LEU C 3  72  ? 84.592 82.798  58.141 1.00 23.07  ? 72   LEU A CA    1 
ATOM   1137 C  C     . LEU C 3  72  ? 85.541 83.783  58.816 1.00 24.27  ? 72   LEU A C     1 
ATOM   1138 O  O     . LEU C 3  72  ? 86.642 83.404  59.227 1.00 24.91  ? 72   LEU A O     1 
ATOM   1139 C  CB    . LEU C 3  72  ? 84.790 82.838  56.622 1.00 19.65  ? 72   LEU A CB    1 
ATOM   1140 C  CG    . LEU C 3  72  ? 84.139 81.673  55.866 1.00 21.97  ? 72   LEU A CG    1 
ATOM   1141 C  CD1   . LEU C 3  72  ? 84.217 81.890  54.350 1.00 19.34  ? 72   LEU A CD1   1 
ATOM   1142 C  CD2   . LEU C 3  72  ? 84.846 80.376  56.262 1.00 22.29  ? 72   LEU A CD2   1 
ATOM   1143 N  N     . ALA C 3  73  ? 85.120 85.041  58.934 1.00 25.31  ? 73   ALA A N     1 
ATOM   1144 C  CA    . ALA C 3  73  ? 85.953 86.059  59.567 1.00 26.73  ? 73   ALA A CA    1 
ATOM   1145 C  C     . ALA C 3  73  ? 86.211 85.666  61.019 1.00 29.36  ? 73   ALA A C     1 
ATOM   1146 O  O     . ALA C 3  73  ? 87.316 85.840  61.540 1.00 29.45  ? 73   ALA A O     1 
ATOM   1147 C  CB    . ALA C 3  73  ? 85.266 87.412  59.507 1.00 25.89  ? 73   ALA A CB    1 
ATOM   1148 N  N     . LYS C 3  74  ? 85.187 85.127  61.667 1.00 29.16  ? 74   LYS A N     1 
ATOM   1149 C  CA    . LYS C 3  74  ? 85.318 84.714  63.051 1.00 29.84  ? 74   LYS A CA    1 
ATOM   1150 C  C     . LYS C 3  74  ? 86.226 83.493  63.168 1.00 29.67  ? 74   LYS A C     1 
ATOM   1151 O  O     . LYS C 3  74  ? 87.157 83.488  63.969 1.00 29.26  ? 74   LYS A O     1 
ATOM   1152 C  CB    . LYS C 3  74  ? 83.941 84.407  63.650 1.00 30.67  ? 74   LYS A CB    1 
ATOM   1153 C  CG    . LYS C 3  74  ? 83.979 84.055  65.124 1.00 32.49  ? 74   LYS A CG    1 
ATOM   1154 C  CD    . LYS C 3  74  ? 84.798 85.074  65.907 1.00 37.71  ? 74   LYS A CD    1 
ATOM   1155 C  CE    . LYS C 3  74  ? 84.931 84.677  67.372 1.00 40.46  ? 74   LYS A CE    1 
ATOM   1156 N  NZ    . LYS C 3  74  ? 86.034 85.418  68.061 1.00 43.24  ? 74   LYS A NZ    1 
ATOM   1157 N  N     . LEU C 3  75  ? 85.964 82.469  62.360 1.00 26.76  ? 75   LEU A N     1 
ATOM   1158 C  CA    . LEU C 3  75  ? 86.768 81.252  62.389 1.00 29.13  ? 75   LEU A CA    1 
ATOM   1159 C  C     . LEU C 3  75  ? 88.243 81.417  62.009 1.00 28.56  ? 75   LEU A C     1 
ATOM   1160 O  O     . LEU C 3  75  ? 89.134 81.025  62.758 1.00 29.71  ? 75   LEU A O     1 
ATOM   1161 C  CB    . LEU C 3  75  ? 86.152 80.188  61.473 1.00 30.72  ? 75   LEU A CB    1 
ATOM   1162 C  CG    . LEU C 3  75  ? 84.858 79.506  61.934 1.00 33.26  ? 75   LEU A CG    1 
ATOM   1163 C  CD1   . LEU C 3  75  ? 84.244 78.713  60.781 1.00 31.70  ? 75   LEU A CD1   1 
ATOM   1164 C  CD2   . LEU C 3  75  ? 85.164 78.595  63.121 1.00 32.69  ? 75   LEU A CD2   1 
ATOM   1165 N  N     . GLN C 3  76  ? 88.498 82.000  60.847 1.00 28.67  ? 76   GLN A N     1 
ATOM   1166 C  CA    . GLN C 3  76  ? 89.860 82.149  60.360 1.00 27.88  ? 76   GLN A CA    1 
ATOM   1167 C  C     . GLN C 3  76  ? 90.696 83.320  60.865 1.00 28.45  ? 76   GLN A C     1 
ATOM   1168 O  O     . GLN C 3  76  ? 91.902 83.179  61.051 1.00 29.72  ? 76   GLN A O     1 
ATOM   1169 C  CB    . GLN C 3  76  ? 89.843 82.190  58.838 1.00 26.86  ? 76   GLN A CB    1 
ATOM   1170 C  CG    . GLN C 3  76  ? 89.164 81.006  58.204 1.00 28.02  ? 76   GLN A CG    1 
ATOM   1171 C  CD    . GLN C 3  76  ? 89.195 81.087  56.696 1.00 28.18  ? 76   GLN A CD    1 
ATOM   1172 O  OE1   . GLN C 3  76  ? 88.174 81.311  56.047 1.00 27.29  ? 76   GLN A OE1   1 
ATOM   1173 N  NE2   . GLN C 3  76  ? 90.380 80.920  56.129 1.00 29.75  ? 76   GLN A NE2   1 
ATOM   1174 N  N     . LEU C 3  77  ? 90.069 84.473  61.070 1.00 27.21  ? 77   LEU A N     1 
ATOM   1175 C  CA    . LEU C 3  77  ? 90.793 85.657  61.513 1.00 27.57  ? 77   LEU A CA    1 
ATOM   1176 C  C     . LEU C 3  77  ? 90.381 86.087  62.901 1.00 27.19  ? 77   LEU A C     1 
ATOM   1177 O  O     . LEU C 3  77  ? 90.917 87.051  63.443 1.00 27.42  ? 77   LEU A O     1 
ATOM   1178 C  CB    . LEU C 3  77  ? 90.555 86.817  60.534 1.00 26.49  ? 77   LEU A CB    1 
ATOM   1179 C  CG    . LEU C 3  77  ? 91.103 86.629  59.115 1.00 27.21  ? 77   LEU A CG    1 
ATOM   1180 C  CD1   . LEU C 3  77  ? 90.638 87.758  58.195 1.00 24.66  ? 77   LEU A CD1   1 
ATOM   1181 C  CD2   . LEU C 3  77  ? 92.619 86.588  59.178 1.00 26.89  ? 77   LEU A CD2   1 
ATOM   1182 N  N     . ASN C 3  78  ? 89.427 85.373  63.476 1.00 29.44  ? 78   ASN A N     1 
ATOM   1183 C  CA    . ASN C 3  78  ? 88.940 85.715  64.797 1.00 31.54  ? 78   ASN A CA    1 
ATOM   1184 C  C     . ASN C 3  78  ? 88.538 87.189  64.801 1.00 32.34  ? 78   ASN A C     1 
ATOM   1185 O  O     . ASN C 3  78  ? 88.823 87.927  65.748 1.00 32.51  ? 78   ASN A O     1 
ATOM   1186 C  CB    . ASN C 3  78  ? 90.030 85.455  65.834 1.00 33.89  ? 78   ASN A CB    1 
ATOM   1187 C  CG    . ASN C 3  78  ? 89.534 85.642  67.238 1.00 38.18  ? 78   ASN A CG    1 
ATOM   1188 O  OD1   . ASN C 3  78  ? 88.497 85.093  67.616 1.00 40.86  ? 78   ASN A OD1   1 
ATOM   1189 N  ND2   . ASN C 3  78  ? 90.267 86.417  68.030 1.00 40.11  ? 78   ASN A ND2   1 
ATOM   1190 N  N     . ARG C 3  79  ? 87.875 87.606  63.722 1.00 33.44  ? 79   ARG A N     1 
ATOM   1191 C  CA    . ARG C 3  79  ? 87.423 88.987  63.554 1.00 32.21  ? 79   ARG A CA    1 
ATOM   1192 C  C     . ARG C 3  79  ? 85.898 89.077  63.497 1.00 31.12  ? 79   ARG A C     1 
ATOM   1193 O  O     . ARG C 3  79  ? 85.236 88.168  62.993 1.00 30.41  ? 79   ARG A O     1 
ATOM   1194 C  CB    . ARG C 3  79  ? 87.980 89.583  62.250 1.00 33.29  ? 79   ARG A CB    1 
ATOM   1195 C  CG    . ARG C 3  79  ? 87.597 91.054  62.053 1.00 33.78  ? 79   ARG A CG    1 
ATOM   1196 C  CD    . ARG C 3  79  ? 87.489 91.509  60.595 1.00 32.13  ? 79   ARG A CD    1 
ATOM   1197 N  NE    . ARG C 3  79  ? 88.747 91.525  59.861 1.00 30.23  ? 79   ARG A NE    1 
ATOM   1198 C  CZ    . ARG C 3  79  ? 89.005 92.357  58.852 1.00 30.22  ? 79   ARG A CZ    1 
ATOM   1199 N  NH1   . ARG C 3  79  ? 88.097 93.248  58.471 1.00 26.26  ? 79   ARG A NH1   1 
ATOM   1200 N  NH2   . ARG C 3  79  ? 90.162 92.285  58.203 1.00 28.66  ? 79   ARG A NH2   1 
ATOM   1201 N  N     . GLU C 3  80  ? 85.352 90.174  64.017 1.00 30.24  ? 80   GLU A N     1 
ATOM   1202 C  CA    . GLU C 3  80  ? 83.909 90.417  63.979 1.00 27.80  ? 80   GLU A CA    1 
ATOM   1203 C  C     . GLU C 3  80  ? 83.665 91.143  62.652 1.00 26.17  ? 80   GLU A C     1 
ATOM   1204 O  O     . GLU C 3  80  ? 84.251 92.197  62.399 1.00 23.65  ? 80   GLU A O     1 
ATOM   1205 C  CB    . GLU C 3  80  ? 83.468 91.325  65.137 1.00 30.22  ? 80   GLU A CB    1 
ATOM   1206 C  CG    . GLU C 3  80  ? 83.425 90.673  66.512 1.00 33.56  ? 80   GLU A CG    1 
ATOM   1207 C  CD    . GLU C 3  80  ? 82.464 89.504  66.567 1.00 36.23  ? 80   GLU A CD    1 
ATOM   1208 O  OE1   . GLU C 3  80  ? 81.383 89.593  65.952 1.00 36.67  ? 80   GLU A OE1   1 
ATOM   1209 O  OE2   . GLU C 3  80  ? 82.778 88.497  67.232 1.00 37.92  ? 80   GLU A OE2   1 
ATOM   1210 N  N     . PHE C 3  81  ? 82.818 90.574  61.802 1.00 24.81  ? 81   PHE A N     1 
ATOM   1211 C  CA    . PHE C 3  81  ? 82.519 91.169  60.501 1.00 25.02  ? 81   PHE A CA    1 
ATOM   1212 C  C     . PHE C 3  81  ? 81.016 91.084  60.278 1.00 25.58  ? 81   PHE A C     1 
ATOM   1213 O  O     . PHE C 3  81  ? 80.441 89.992  60.276 1.00 23.79  ? 81   PHE A O     1 
ATOM   1214 C  CB    . PHE C 3  81  ? 83.261 90.401  59.408 1.00 24.70  ? 81   PHE A CB    1 
ATOM   1215 C  CG    . PHE C 3  81  ? 83.122 90.995  58.037 1.00 23.41  ? 81   PHE A CG    1 
ATOM   1216 C  CD1   . PHE C 3  81  ? 83.905 92.078  57.647 1.00 20.71  ? 81   PHE A CD1   1 
ATOM   1217 C  CD2   . PHE C 3  81  ? 82.214 90.459  57.129 1.00 23.21  ? 81   PHE A CD2   1 
ATOM   1218 C  CE1   . PHE C 3  81  ? 83.792 92.616  56.377 1.00 20.50  ? 81   PHE A CE1   1 
ATOM   1219 C  CE2   . PHE C 3  81  ? 82.087 90.992  55.844 1.00 22.07  ? 81   PHE A CE2   1 
ATOM   1220 C  CZ    . PHE C 3  81  ? 82.879 92.072  55.467 1.00 21.89  ? 81   PHE A CZ    1 
ATOM   1221 N  N     . HIS C 3  82  ? 80.375 92.236  60.098 1.00 25.27  ? 82   HIS A N     1 
ATOM   1222 C  CA    . HIS C 3  82  ? 78.928 92.272  59.912 1.00 25.30  ? 82   HIS A CA    1 
ATOM   1223 C  C     . HIS C 3  82  ? 78.492 93.382  58.959 1.00 25.61  ? 82   HIS A C     1 
ATOM   1224 O  O     . HIS C 3  82  ? 78.189 94.485  59.403 1.00 25.99  ? 82   HIS A O     1 
ATOM   1225 C  CB    . HIS C 3  82  ? 78.238 92.502  61.262 1.00 24.88  ? 82   HIS A CB    1 
ATOM   1226 C  CG    . HIS C 3  82  ? 78.715 91.595  62.357 1.00 27.50  ? 82   HIS A CG    1 
ATOM   1227 N  ND1   . HIS C 3  82  ? 78.229 90.317  62.533 1.00 27.53  ? 82   HIS A ND1   1 
ATOM   1228 C  CD2   . HIS C 3  82  ? 79.635 91.786  63.332 1.00 25.65  ? 82   HIS A CD2   1 
ATOM   1229 C  CE1   . HIS C 3  82  ? 78.828 89.761  63.572 1.00 27.23  ? 82   HIS A CE1   1 
ATOM   1230 N  NE2   . HIS C 3  82  ? 79.685 90.632  64.075 1.00 26.97  ? 82   HIS A NE2   1 
ATOM   1231 N  N     . LEU C 3  83  ? 78.465 93.110  57.658 1.00 24.40  ? 83   LEU A N     1 
ATOM   1232 C  CA    . LEU C 3  83  ? 78.029 94.130  56.711 1.00 22.98  ? 83   LEU A CA    1 
ATOM   1233 C  C     . LEU C 3  83  ? 76.596 94.506  57.072 1.00 23.20  ? 83   LEU A C     1 
ATOM   1234 O  O     . LEU C 3  83  ? 75.771 93.633  57.317 1.00 23.80  ? 83   LEU A O     1 
ATOM   1235 C  CB    . LEU C 3  83  ? 78.072 93.598  55.279 1.00 20.12  ? 83   LEU A CB    1 
ATOM   1236 C  CG    . LEU C 3  83  ? 79.439 93.221  54.712 1.00 17.95  ? 83   LEU A CG    1 
ATOM   1237 C  CD1   . LEU C 3  83  ? 79.244 92.600  53.344 1.00 16.51  ? 83   LEU A CD1   1 
ATOM   1238 C  CD2   . LEU C 3  83  ? 80.337 94.451  54.622 1.00 15.52  ? 83   LEU A CD2   1 
ATOM   1239 N  N     . PRO C 3  84  ? 76.288 95.811  57.131 1.00 22.46  ? 84   PRO A N     1 
ATOM   1240 C  CA    . PRO C 3  84  ? 74.936 96.263  57.472 1.00 23.42  ? 84   PRO A CA    1 
ATOM   1241 C  C     . PRO C 3  84  ? 73.959 95.987  56.332 1.00 22.88  ? 84   PRO A C     1 
ATOM   1242 O  O     . PRO C 3  84  ? 74.320 96.092  55.164 1.00 24.79  ? 84   PRO A O     1 
ATOM   1243 C  CB    . PRO C 3  84  ? 75.115 97.767  57.710 1.00 22.32  ? 84   PRO A CB    1 
ATOM   1244 C  CG    . PRO C 3  84  ? 76.586 97.896  58.058 1.00 24.71  ? 84   PRO A CG    1 
ATOM   1245 C  CD    . PRO C 3  84  ? 77.224 96.946  57.087 1.00 22.50  ? 84   PRO A CD    1 
ATOM   1246 N  N     . ARG C 3  85  ? 72.721 95.654  56.677 1.00 22.34  ? 85   ARG A N     1 
ATOM   1247 C  CA    . ARG C 3  85  ? 71.689 95.368  55.679 1.00 24.43  ? 85   ARG A CA    1 
ATOM   1248 C  C     . ARG C 3  85  ? 71.538 96.471  54.618 1.00 24.88  ? 85   ARG A C     1 
ATOM   1249 O  O     . ARG C 3  85  ? 71.493 96.189  53.413 1.00 22.88  ? 85   ARG A O     1 
ATOM   1250 C  CB    . ARG C 3  85  ? 70.337 95.176  56.372 1.00 25.93  ? 85   ARG A CB    1 
ATOM   1251 C  CG    . ARG C 3  85  ? 69.202 94.801  55.432 1.00 27.78  ? 85   ARG A CG    1 
ATOM   1252 C  CD    . ARG C 3  85  ? 67.932 95.552  55.785 1.00 30.96  ? 85   ARG A CD    1 
ATOM   1253 N  NE    . ARG C 3  85  ? 67.770 96.741  54.957 1.00 32.80  ? 85   ARG A NE    1 
ATOM   1254 C  CZ    . ARG C 3  85  ? 67.713 97.989  55.411 1.00 32.24  ? 85   ARG A CZ    1 
ATOM   1255 N  NH1   . ARG C 3  85  ? 67.803 98.254  56.710 1.00 30.67  ? 85   ARG A NH1   1 
ATOM   1256 N  NH2   . ARG C 3  85  ? 67.561 98.982  54.546 1.00 35.57  ? 85   ARG A NH2   1 
ATOM   1257 N  N     . GLU C 3  86  ? 71.452 97.721  55.075 1.00 24.05  ? 86   GLU A N     1 
ATOM   1258 C  CA    . GLU C 3  86  ? 71.273 98.863  54.176 1.00 24.73  ? 86   GLU A CA    1 
ATOM   1259 C  C     . GLU C 3  86  ? 72.399 99.076  53.169 1.00 23.12  ? 86   GLU A C     1 
ATOM   1260 O  O     . GLU C 3  86  ? 72.246 99.844  52.220 1.00 20.35  ? 86   GLU A O     1 
ATOM   1261 C  CB    . GLU C 3  86  ? 71.070 100.156 54.973 1.00 26.13  ? 86   GLU A CB    1 
ATOM   1262 C  CG    . GLU C 3  86  ? 72.231 100.531 55.875 1.00 31.03  ? 86   GLU A CG    1 
ATOM   1263 C  CD    . GLU C 3  86  ? 72.040 100.045 57.301 1.00 35.15  ? 86   GLU A CD    1 
ATOM   1264 O  OE1   . GLU C 3  86  ? 71.534 98.909  57.493 1.00 34.93  ? 86   GLU A OE1   1 
ATOM   1265 O  OE2   . GLU C 3  86  ? 72.405 100.798 58.232 1.00 37.50  ? 86   GLU A OE2   1 
ATOM   1266 N  N     . ASN C 3  87  ? 73.527 98.400  53.364 1.00 22.54  ? 87   ASN A N     1 
ATOM   1267 C  CA    . ASN C 3  87  ? 74.641 98.556  52.435 1.00 22.10  ? 87   ASN A CA    1 
ATOM   1268 C  C     . ASN C 3  87  ? 74.703 97.445  51.391 1.00 20.78  ? 87   ASN A C     1 
ATOM   1269 O  O     . ASN C 3  87  ? 75.561 97.478  50.505 1.00 23.06  ? 87   ASN A O     1 
ATOM   1270 C  CB    . ASN C 3  87  ? 75.982 98.596  53.191 1.00 23.06  ? 87   ASN A CB    1 
ATOM   1271 C  CG    . ASN C 3  87  ? 76.098 99.788  54.109 1.00 21.73  ? 87   ASN A CG    1 
ATOM   1272 O  OD1   . ASN C 3  87  ? 75.865 99.685  55.312 1.00 24.46  ? 87   ASN A OD1   1 
ATOM   1273 N  ND2   . ASN C 3  87  ? 76.443 100.937 53.541 1.00 21.93  ? 87   ASN A ND2   1 
ATOM   1274 N  N     . CYS C 3  88  ? 73.799 96.474  51.477 1.00 16.90  ? 88   CYS A N     1 
ATOM   1275 C  CA    . CYS C 3  88  ? 73.834 95.364  50.537 1.00 17.98  ? 88   CYS A CA    1 
ATOM   1276 C  C     . CYS C 3  88  ? 72.720 95.277  49.509 1.00 18.02  ? 88   CYS A C     1 
ATOM   1277 O  O     . CYS C 3  88  ? 71.558 95.579  49.786 1.00 17.97  ? 88   CYS A O     1 
ATOM   1278 C  CB    . CYS C 3  88  ? 73.894 94.044  51.303 1.00 18.46  ? 88   CYS A CB    1 
ATOM   1279 S  SG    . CYS C 3  88  ? 75.247 93.966  52.479 1.00 20.01  ? 88   CYS A SG    1 
ATOM   1280 N  N     . ILE C 3  89  ? 73.107 94.839  48.316 1.00 18.33  ? 89   ILE A N     1 
ATOM   1281 C  CA    . ILE C 3  89  ? 72.200 94.644  47.199 1.00 19.05  ? 89   ILE A CA    1 
ATOM   1282 C  C     . ILE C 3  89  ? 72.398 93.205  46.708 1.00 19.80  ? 89   ILE A C     1 
ATOM   1283 O  O     . ILE C 3  89  ? 73.517 92.690  46.685 1.00 20.26  ? 89   ILE A O     1 
ATOM   1284 C  CB    . ILE C 3  89  ? 72.510 95.645  46.056 1.00 20.68  ? 89   ILE A CB    1 
ATOM   1285 C  CG1   . ILE C 3  89  ? 72.117 97.058  46.497 1.00 20.58  ? 89   ILE A CG1   1 
ATOM   1286 C  CG2   . ILE C 3  89  ? 71.745 95.264  44.784 1.00 19.67  ? 89   ILE A CG2   1 
ATOM   1287 C  CD1   . ILE C 3  89  ? 72.512 98.131  45.522 1.00 23.00  ? 89   ILE A CD1   1 
ATOM   1288 N  N     . ASP C 3  90  ? 71.308 92.551  46.330 1.00 20.26  ? 90   ASP A N     1 
ATOM   1289 C  CA    . ASP C 3  90  ? 71.380 91.179  45.843 1.00 20.18  ? 90   ASP A CA    1 
ATOM   1290 C  C     . ASP C 3  90  ? 70.718 91.112  44.459 1.00 20.30  ? 90   ASP A C     1 
ATOM   1291 O  O     . ASP C 3  90  ? 69.508 91.325  44.343 1.00 19.26  ? 90   ASP A O     1 
ATOM   1292 C  CB    . ASP C 3  90  ? 70.653 90.255  46.826 1.00 20.40  ? 90   ASP A CB    1 
ATOM   1293 C  CG    . ASP C 3  90  ? 70.890 88.789  46.535 1.00 18.46  ? 90   ASP A CG    1 
ATOM   1294 O  OD1   . ASP C 3  90  ? 70.797 88.384  45.356 1.00 20.58  ? 90   ASP A OD1   1 
ATOM   1295 O  OD2   . ASP C 3  90  ? 71.159 88.038  47.492 1.00 18.26  ? 90   ASP A OD2   1 
ATOM   1296 N  N     . THR C 3  91  ? 71.501 90.830  43.414 1.00 19.10  ? 91   THR A N     1 
ATOM   1297 C  CA    . THR C 3  91  ? 70.940 90.757  42.065 1.00 16.98  ? 91   THR A CA    1 
ATOM   1298 C  C     . THR C 3  91  ? 69.953 89.615  41.891 1.00 18.89  ? 91   THR A C     1 
ATOM   1299 O  O     . THR C 3  91  ? 69.144 89.639  40.964 1.00 19.11  ? 91   THR A O     1 
ATOM   1300 C  CB    . THR C 3  91  ? 72.021 90.627  40.972 1.00 16.09  ? 91   THR A CB    1 
ATOM   1301 O  OG1   . THR C 3  91  ? 72.982 89.624  41.338 1.00 14.14  ? 91   THR A OG1   1 
ATOM   1302 C  CG2   . THR C 3  91  ? 72.699 91.971  40.740 1.00 13.67  ? 91   THR A CG2   1 
ATOM   1303 N  N     . LEU C 3  92  ? 70.025 88.608  42.763 1.00 17.75  ? 92   LEU A N     1 
ATOM   1304 C  CA    . LEU C 3  92  ? 69.089 87.491  42.678 1.00 17.70  ? 92   LEU A CA    1 
ATOM   1305 C  C     . LEU C 3  92  ? 67.743 87.994  43.202 1.00 17.84  ? 92   LEU A C     1 
ATOM   1306 O  O     . LEU C 3  92  ? 66.699 87.710  42.619 1.00 19.55  ? 92   LEU A O     1 
ATOM   1307 C  CB    . LEU C 3  92  ? 69.562 86.296  43.516 1.00 15.22  ? 92   LEU A CB    1 
ATOM   1308 C  CG    . LEU C 3  92  ? 68.601 85.096  43.471 1.00 16.54  ? 92   LEU A CG    1 
ATOM   1309 C  CD1   . LEU C 3  92  ? 68.417 84.636  42.024 1.00 11.79  ? 92   LEU A CD1   1 
ATOM   1310 C  CD2   . LEU C 3  92  ? 69.139 83.959  44.334 1.00 17.80  ? 92   LEU A CD2   1 
ATOM   1311 N  N     . VAL C 3  93  ? 67.776 88.736  44.308 1.00 17.73  ? 93   VAL A N     1 
ATOM   1312 C  CA    . VAL C 3  93  ? 66.565 89.315  44.888 1.00 18.02  ? 93   VAL A CA    1 
ATOM   1313 C  C     . VAL C 3  93  ? 65.961 90.290  43.868 1.00 19.69  ? 93   VAL A C     1 
ATOM   1314 O  O     . VAL C 3  93  ? 64.750 90.308  43.653 1.00 21.18  ? 93   VAL A O     1 
ATOM   1315 C  CB    . VAL C 3  93  ? 66.873 90.086  46.199 1.00 18.19  ? 93   VAL A CB    1 
ATOM   1316 C  CG1   . VAL C 3  93  ? 65.594 90.767  46.728 1.00 15.26  ? 93   VAL A CG1   1 
ATOM   1317 C  CG2   . VAL C 3  93  ? 67.441 89.136  47.243 1.00 15.31  ? 93   VAL A CG2   1 
ATOM   1318 N  N     . LEU C 3  94  ? 66.810 91.099  43.241 1.00 19.19  ? 94   LEU A N     1 
ATOM   1319 C  CA    . LEU C 3  94  ? 66.353 92.043  42.223 1.00 20.15  ? 94   LEU A CA    1 
ATOM   1320 C  C     . LEU C 3  94  ? 65.753 91.318  41.019 1.00 20.81  ? 94   LEU A C     1 
ATOM   1321 O  O     . LEU C 3  94  ? 64.711 91.728  40.514 1.00 22.15  ? 94   LEU A O     1 
ATOM   1322 C  CB    . LEU C 3  94  ? 67.507 92.920  41.736 1.00 19.08  ? 94   LEU A CB    1 
ATOM   1323 C  CG    . LEU C 3  94  ? 67.533 94.374  42.187 1.00 23.53  ? 94   LEU A CG    1 
ATOM   1324 C  CD1   . LEU C 3  94  ? 68.709 95.073  41.518 1.00 22.27  ? 94   LEU A CD1   1 
ATOM   1325 C  CD2   . LEU C 3  94  ? 66.226 95.062  41.812 1.00 22.42  ? 94   LEU A CD2   1 
ATOM   1326 N  N     . SER C 3  95  ? 66.414 90.253  40.555 1.00 19.60  ? 95   SER A N     1 
ATOM   1327 C  CA    . SER C 3  95  ? 65.925 89.483  39.405 1.00 20.80  ? 95   SER A CA    1 
ATOM   1328 C  C     . SER C 3  95  ? 64.563 88.892  39.703 1.00 19.86  ? 95   SER A C     1 
ATOM   1329 O  O     . SER C 3  95  ? 63.661 88.915  38.860 1.00 19.06  ? 95   SER A O     1 
ATOM   1330 C  CB    . SER C 3  95  ? 66.866 88.327  39.064 1.00 21.88  ? 95   SER A CB    1 
ATOM   1331 O  OG    . SER C 3  95  ? 68.191 88.777  38.851 1.00 28.45  ? 95   SER A OG    1 
ATOM   1332 N  N     . ARG C 3  96  ? 64.418 88.355  40.909 1.00 18.15  ? 96   ARG A N     1 
ATOM   1333 C  CA    . ARG C 3  96  ? 63.160 87.745  41.306 1.00 18.10  ? 96   ARG A CA    1 
ATOM   1334 C  C     . ARG C 3  96  ? 62.045 88.761  41.448 1.00 19.28  ? 96   ARG A C     1 
ATOM   1335 O  O     . ARG C 3  96  ? 60.871 88.401  41.394 1.00 20.67  ? 96   ARG A O     1 
ATOM   1336 C  CB    . ARG C 3  96  ? 63.342 86.954  42.601 1.00 14.79  ? 96   ARG A CB    1 
ATOM   1337 C  CG    . ARG C 3  96  ? 64.177 85.712  42.374 1.00 15.32  ? 96   ARG A CG    1 
ATOM   1338 C  CD    . ARG C 3  96  ? 64.574 85.030  43.663 1.00 16.49  ? 96   ARG A CD    1 
ATOM   1339 N  NE    . ARG C 3  96  ? 65.033 83.673  43.392 1.00 17.33  ? 96   ARG A NE    1 
ATOM   1340 C  CZ    . ARG C 3  96  ? 65.456 82.823  44.323 1.00 19.72  ? 96   ARG A CZ    1 
ATOM   1341 N  NH1   . ARG C 3  96  ? 65.485 83.195  45.599 1.00 15.35  ? 96   ARG A NH1   1 
ATOM   1342 N  NH2   . ARG C 3  96  ? 65.833 81.593  43.977 1.00 16.09  ? 96   ARG A NH2   1 
ATOM   1343 N  N     . LEU C 3  97  ? 62.404 90.028  41.633 1.00 19.76  ? 97   LEU A N     1 
ATOM   1344 C  CA    . LEU C 3  97  ? 61.386 91.072  41.749 1.00 21.07  ? 97   LEU A CA    1 
ATOM   1345 C  C     . LEU C 3  97  ? 60.981 91.521  40.356 1.00 22.32  ? 97   LEU A C     1 
ATOM   1346 O  O     . LEU C 3  97  ? 59.813 91.473  39.993 1.00 23.71  ? 97   LEU A O     1 
ATOM   1347 C  CB    . LEU C 3  97  ? 61.913 92.287  42.525 1.00 19.32  ? 97   LEU A CB    1 
ATOM   1348 C  CG    . LEU C 3  97  ? 61.058 93.564  42.396 1.00 20.39  ? 97   LEU A CG    1 
ATOM   1349 C  CD1   . LEU C 3  97  ? 59.627 93.292  42.894 1.00 13.48  ? 97   LEU A CD1   1 
ATOM   1350 C  CD2   . LEU C 3  97  ? 61.704 94.711  43.190 1.00 16.90  ? 97   LEU A CD2   1 
ATOM   1351 N  N     . ILE C 3  98  ? 61.970 91.942  39.577 1.00 24.76  ? 98   ILE A N     1 
ATOM   1352 C  CA    . ILE C 3  98  ? 61.748 92.434  38.226 1.00 25.85  ? 98   ILE A CA    1 
ATOM   1353 C  C     . ILE C 3  98  ? 61.261 91.371  37.246 1.00 26.89  ? 98   ILE A C     1 
ATOM   1354 O  O     . ILE C 3  98  ? 60.363 91.634  36.454 1.00 28.11  ? 98   ILE A O     1 
ATOM   1355 C  CB    . ILE C 3  98  ? 63.030 93.110  37.708 1.00 26.68  ? 98   ILE A CB    1 
ATOM   1356 C  CG1   . ILE C 3  98  ? 63.346 94.316  38.602 1.00 25.90  ? 98   ILE A CG1   1 
ATOM   1357 C  CG2   . ILE C 3  98  ? 62.859 93.539  36.270 1.00 27.34  ? 98   ILE A CG2   1 
ATOM   1358 C  CD1   . ILE C 3  98  ? 64.593 95.070  38.228 1.00 29.41  ? 98   ILE A CD1   1 
ATOM   1359 N  N     . HIS C 3  99  ? 61.840 90.174  37.307 1.00 27.19  ? 99   HIS A N     1 
ATOM   1360 C  CA    . HIS C 3  99  ? 61.442 89.069  36.427 1.00 26.35  ? 99   HIS A CA    1 
ATOM   1361 C  C     . HIS C 3  99  ? 60.650 88.068  37.261 1.00 27.08  ? 99   HIS A C     1 
ATOM   1362 O  O     . HIS C 3  99  ? 60.959 86.877  37.292 1.00 26.91  ? 99   HIS A O     1 
ATOM   1363 C  CB    . HIS C 3  99  ? 62.686 88.387  35.837 1.00 25.31  ? 99   HIS A CB    1 
ATOM   1364 C  CG    . HIS C 3  99  ? 63.531 89.293  34.993 1.00 27.47  ? 99   HIS A CG    1 
ATOM   1365 N  ND1   . HIS C 3  99  ? 63.087 89.831  33.803 1.00 27.71  ? 99   HIS A ND1   1 
ATOM   1366 C  CD2   . HIS C 3  99  ? 64.789 89.762  35.170 1.00 27.86  ? 99   HIS A CD2   1 
ATOM   1367 C  CE1   . HIS C 3  99  ? 64.035 90.591  33.283 1.00 26.36  ? 99   HIS A CE1   1 
ATOM   1368 N  NE2   . HIS C 3  99  ? 65.078 90.567  34.092 1.00 27.64  ? 99   HIS A NE2   1 
ATOM   1369 N  N     . SER C 3  100 ? 59.628 88.567  37.944 1.00 28.63  ? 100  SER A N     1 
ATOM   1370 C  CA    . SER C 3  100 ? 58.803 87.738  38.815 1.00 30.40  ? 100  SER A CA    1 
ATOM   1371 C  C     . SER C 3  100 ? 57.961 86.694  38.086 1.00 30.77  ? 100  SER A C     1 
ATOM   1372 O  O     . SER C 3  100 ? 57.433 85.768  38.706 1.00 29.09  ? 100  SER A O     1 
ATOM   1373 C  CB    . SER C 3  100 ? 57.888 88.630  39.658 1.00 29.52  ? 100  SER A CB    1 
ATOM   1374 O  OG    . SER C 3  100 ? 57.064 89.428  38.831 1.00 31.18  ? 100  SER A OG    1 
ATOM   1375 N  N     . ASN C 3  101 ? 57.833 86.843  36.775 1.00 31.46  ? 101  ASN A N     1 
ATOM   1376 C  CA    . ASN C 3  101 ? 57.048 85.903  35.990 1.00 33.26  ? 101  ASN A CA    1 
ATOM   1377 C  C     . ASN C 3  101 ? 57.886 84.703  35.549 1.00 33.77  ? 101  ASN A C     1 
ATOM   1378 O  O     . ASN C 3  101 ? 57.349 83.713  35.055 1.00 34.33  ? 101  ASN A O     1 
ATOM   1379 C  CB    . ASN C 3  101 ? 56.448 86.616  34.774 1.00 35.36  ? 101  ASN A CB    1 
ATOM   1380 C  CG    . ASN C 3  101 ? 57.494 87.344  33.949 1.00 36.60  ? 101  ASN A CG    1 
ATOM   1381 O  OD1   . ASN C 3  101 ? 58.375 88.008  34.495 1.00 36.98  ? 101  ASN A OD1   1 
ATOM   1382 N  ND2   . ASN C 3  101 ? 57.392 87.234  32.626 1.00 39.23  ? 101  ASN A ND2   1 
ATOM   1383 N  N     . LEU C 3  102 ? 59.199 84.786  35.745 1.00 31.47  ? 102  LEU A N     1 
ATOM   1384 C  CA    . LEU C 3  102 ? 60.088 83.694  35.361 1.00 31.39  ? 102  LEU A CA    1 
ATOM   1385 C  C     . LEU C 3  102 ? 60.546 82.858  36.558 1.00 31.74  ? 102  LEU A C     1 
ATOM   1386 O  O     . LEU C 3  102 ? 60.548 83.319  37.701 1.00 32.30  ? 102  LEU A O     1 
ATOM   1387 C  CB    . LEU C 3  102 ? 61.325 84.242  34.638 1.00 29.97  ? 102  LEU A CB    1 
ATOM   1388 C  CG    . LEU C 3  102 ? 61.127 85.100  33.378 1.00 29.81  ? 102  LEU A CG    1 
ATOM   1389 C  CD1   . LEU C 3  102 ? 62.486 85.590  32.895 1.00 28.67  ? 102  LEU A CD1   1 
ATOM   1390 C  CD2   . LEU C 3  102 ? 60.435 84.295  32.290 1.00 28.24  ? 102  LEU A CD2   1 
ATOM   1391 N  N     . LYS C 3  103 ? 60.928 81.618  36.285 1.00 30.63  ? 103  LYS A N     1 
ATOM   1392 C  CA    . LYS C 3  103 ? 61.427 80.729  37.322 1.00 29.52  ? 103  LYS A CA    1 
ATOM   1393 C  C     . LYS C 3  103 ? 62.942 80.898  37.297 1.00 30.16  ? 103  LYS A C     1 
ATOM   1394 O  O     . LYS C 3  103 ? 63.476 81.626  36.456 1.00 28.90  ? 103  LYS A O     1 
ATOM   1395 C  CB    . LYS C 3  103 ? 61.103 79.271  36.976 1.00 30.36  ? 103  LYS A CB    1 
ATOM   1396 C  CG    . LYS C 3  103 ? 59.626 78.943  36.806 1.00 30.97  ? 103  LYS A CG    1 
ATOM   1397 C  CD    . LYS C 3  103 ? 58.932 78.811  38.153 1.00 32.74  ? 103  LYS A CD    1 
ATOM   1398 C  CE    . LYS C 3  103 ? 57.485 78.364  37.989 1.00 34.47  ? 103  LYS A CE    1 
ATOM   1399 N  NZ    . LYS C 3  103 ? 56.814 78.231  39.304 1.00 32.17  ? 103  LYS A NZ    1 
ATOM   1400 N  N     . ASP C 3  104 ? 63.624 80.238  38.230 1.00 29.77  ? 104  ASP A N     1 
ATOM   1401 C  CA    . ASP C 3  104 ? 65.084 80.223  38.277 1.00 29.55  ? 104  ASP A CA    1 
ATOM   1402 C  C     . ASP C 3  104 ? 65.452 78.924  38.980 1.00 30.11  ? 104  ASP A C     1 
ATOM   1403 O  O     . ASP C 3  104 ? 64.596 78.291  39.591 1.00 29.60  ? 104  ASP A O     1 
ATOM   1404 C  CB    . ASP C 3  104 ? 65.676 81.452  38.991 1.00 31.47  ? 104  ASP A CB    1 
ATOM   1405 C  CG    . ASP C 3  104 ? 65.296 81.537  40.444 1.00 30.98  ? 104  ASP A CG    1 
ATOM   1406 O  OD1   . ASP C 3  104 ? 65.511 80.552  41.176 1.00 31.76  ? 104  ASP A OD1   1 
ATOM   1407 O  OD2   . ASP C 3  104 ? 64.793 82.602  40.857 1.00 31.81  ? 104  ASP A OD2   1 
ATOM   1408 N  N     . THR C 3  105 ? 66.712 78.516  38.881 1.00 30.52  ? 105  THR A N     1 
ATOM   1409 C  CA    . THR C 3  105 ? 67.151 77.248  39.461 1.00 30.98  ? 105  THR A CA    1 
ATOM   1410 C  C     . THR C 3  105 ? 67.523 77.297  40.934 1.00 31.92  ? 105  THR A C     1 
ATOM   1411 O  O     . THR C 3  105 ? 68.033 76.316  41.485 1.00 31.15  ? 105  THR A O     1 
ATOM   1412 C  CB    . THR C 3  105 ? 68.360 76.696  38.689 1.00 28.80  ? 105  THR A CB    1 
ATOM   1413 O  OG1   . THR C 3  105 ? 69.454 77.612  38.810 1.00 29.54  ? 105  THR A OG1   1 
ATOM   1414 C  CG2   . THR C 3  105 ? 68.022 76.525  37.225 1.00 29.01  ? 105  THR A CG2   1 
ATOM   1415 N  N     . ASP C 3  106 ? 67.265 78.432  41.570 1.00 32.36  ? 106  ASP A N     1 
ATOM   1416 C  CA    . ASP C 3  106 ? 67.600 78.614  42.976 1.00 32.68  ? 106  ASP A CA    1 
ATOM   1417 C  C     . ASP C 3  106 ? 69.079 78.325  43.187 1.00 32.97  ? 106  ASP A C     1 
ATOM   1418 O  O     . ASP C 3  106 ? 69.465 77.604  44.110 1.00 32.06  ? 106  ASP A O     1 
ATOM   1419 C  CB    . ASP C 3  106 ? 66.762 77.694  43.861 1.00 34.06  ? 106  ASP A CB    1 
ATOM   1420 C  CG    . ASP C 3  106 ? 66.724 78.162  45.298 1.00 38.63  ? 106  ASP A CG    1 
ATOM   1421 O  OD1   . ASP C 3  106 ? 67.199 79.292  45.555 1.00 36.81  ? 106  ASP A OD1   1 
ATOM   1422 O  OD2   . ASP C 3  106 ? 66.211 77.416  46.167 1.00 41.85  ? 106  ASP A OD2   1 
ATOM   1423 N  N     . MET C 3  107 ? 69.895 78.894  42.306 1.00 32.37  ? 107  MET A N     1 
ATOM   1424 C  CA    . MET C 3  107 ? 71.340 78.747  42.351 1.00 34.08  ? 107  MET A CA    1 
ATOM   1425 C  C     . MET C 3  107 ? 71.833 77.314  42.155 1.00 36.69  ? 107  MET A C     1 
ATOM   1426 O  O     . MET C 3  107 ? 72.789 76.880  42.803 1.00 36.70  ? 107  MET A O     1 
ATOM   1427 C  CB    . MET C 3  107 ? 71.880 79.316  43.665 1.00 33.69  ? 107  MET A CB    1 
ATOM   1428 C  CG    . MET C 3  107 ? 71.771 80.822  43.760 1.00 31.36  ? 107  MET A CG    1 
ATOM   1429 S  SD    . MET C 3  107 ? 72.629 81.606  42.382 1.00 36.09  ? 107  MET A SD    1 
ATOM   1430 C  CE    . MET C 3  107 ? 74.348 81.517  42.954 1.00 32.37  ? 107  MET A CE    1 
ATOM   1431 N  N     . GLY C 3  108 ? 71.174 76.581  41.261 1.00 37.32  ? 108  GLY A N     1 
ATOM   1432 C  CA    . GLY C 3  108 ? 71.593 75.219  40.980 1.00 37.94  ? 108  GLY A CA    1 
ATOM   1433 C  C     . GLY C 3  108 ? 70.993 74.108  41.822 1.00 38.58  ? 108  GLY A C     1 
ATOM   1434 O  O     . GLY C 3  108 ? 71.392 72.957  41.678 1.00 38.07  ? 108  GLY A O     1 
ATOM   1435 N  N     . LEU C 3  109 ? 70.045 74.431  42.694 1.00 39.04  ? 109  LEU A N     1 
ATOM   1436 C  CA    . LEU C 3  109 ? 69.417 73.407  43.527 1.00 39.56  ? 109  LEU A CA    1 
ATOM   1437 C  C     . LEU C 3  109 ? 68.311 72.687  42.769 1.00 39.68  ? 109  LEU A C     1 
ATOM   1438 O  O     . LEU C 3  109 ? 67.903 71.584  43.140 1.00 40.24  ? 109  LEU A O     1 
ATOM   1439 C  CB    . LEU C 3  109 ? 68.846 74.024  44.809 1.00 38.92  ? 109  LEU A CB    1 
ATOM   1440 C  CG    . LEU C 3  109 ? 69.870 74.406  45.879 1.00 41.45  ? 109  LEU A CG    1 
ATOM   1441 C  CD1   . LEU C 3  109 ? 69.185 75.135  47.031 1.00 40.80  ? 109  LEU A CD1   1 
ATOM   1442 C  CD2   . LEU C 3  109 ? 70.560 73.138  46.384 1.00 41.98  ? 109  LEU A CD2   1 
ATOM   1443 N  N     . LEU C 3  110 ? 67.822 73.319  41.707 1.00 39.76  ? 110  LEU A N     1 
ATOM   1444 C  CA    . LEU C 3  110 ? 66.765 72.736  40.887 1.00 39.98  ? 110  LEU A CA    1 
ATOM   1445 C  C     . LEU C 3  110 ? 67.286 72.565  39.463 1.00 41.47  ? 110  LEU A C     1 
ATOM   1446 O  O     . LEU C 3  110 ? 67.984 73.432  38.944 1.00 42.09  ? 110  LEU A O     1 
ATOM   1447 C  CB    . LEU C 3  110 ? 65.531 73.642  40.886 1.00 38.86  ? 110  LEU A CB    1 
ATOM   1448 C  CG    . LEU C 3  110 ? 64.884 73.958  42.241 1.00 39.55  ? 110  LEU A CG    1 
ATOM   1449 C  CD1   . LEU C 3  110 ? 63.843 75.049  42.060 1.00 41.10  ? 110  LEU A CD1   1 
ATOM   1450 C  CD2   . LEU C 3  110 ? 64.247 72.712  42.828 1.00 38.33  ? 110  LEU A CD2   1 
ATOM   1451 N  N     . ARG C 3  111 ? 66.961 71.438  38.840 1.00 43.13  ? 111  ARG A N     1 
ATOM   1452 C  CA    . ARG C 3  111 ? 67.402 71.170  37.476 1.00 45.65  ? 111  ARG A CA    1 
ATOM   1453 C  C     . ARG C 3  111 ? 66.703 72.148  36.543 1.00 44.66  ? 111  ARG A C     1 
ATOM   1454 O  O     . ARG C 3  111 ? 65.480 72.293  36.591 1.00 44.34  ? 111  ARG A O     1 
ATOM   1455 C  CB    . ARG C 3  111 ? 67.042 69.740  37.082 1.00 49.38  ? 111  ARG A CB    1 
ATOM   1456 C  CG    . ARG C 3  111 ? 67.529 68.685  38.060 1.00 54.89  ? 111  ARG A CG    1 
ATOM   1457 C  CD    . ARG C 3  111 ? 66.796 67.375  37.826 1.00 59.70  ? 111  ARG A CD    1 
ATOM   1458 N  NE    . ARG C 3  111 ? 65.344 67.546  37.889 1.00 65.08  ? 111  ARG A NE    1 
ATOM   1459 C  CZ    . ARG C 3  111 ? 64.459 66.564  37.725 1.00 67.00  ? 111  ARG A CZ    1 
ATOM   1460 N  NH1   . ARG C 3  111 ? 64.867 65.322  37.487 1.00 68.92  ? 111  ARG A NH1   1 
ATOM   1461 N  NH2   . ARG C 3  111 ? 63.159 66.824  37.791 1.00 68.23  ? 111  ARG A NH2   1 
ATOM   1462 N  N     . SER C 3  112 ? 67.478 72.813  35.694 1.00 43.42  ? 112  SER A N     1 
ATOM   1463 C  CA    . SER C 3  112 ? 66.919 73.791  34.767 1.00 43.89  ? 112  SER A CA    1 
ATOM   1464 C  C     . SER C 3  112 ? 65.865 73.222  33.816 1.00 43.30  ? 112  SER A C     1 
ATOM   1465 O  O     . SER C 3  112 ? 64.909 73.912  33.475 1.00 41.77  ? 112  SER A O     1 
ATOM   1466 C  CB    . SER C 3  112 ? 68.043 74.463  33.966 1.00 42.65  ? 112  SER A CB    1 
ATOM   1467 O  OG    . SER C 3  112 ? 68.872 73.506  33.333 1.00 44.21  ? 112  SER A OG    1 
ATOM   1468 N  N     . GLY C 3  113 ? 66.029 71.965  33.405 1.00 44.03  ? 113  GLY A N     1 
ATOM   1469 C  CA    . GLY C 3  113 ? 65.083 71.347  32.486 1.00 43.33  ? 113  GLY A CA    1 
ATOM   1470 C  C     . GLY C 3  113 ? 63.705 71.010  33.036 1.00 43.77  ? 113  GLY A C     1 
ATOM   1471 O  O     . GLY C 3  113 ? 62.769 70.759  32.276 1.00 44.32  ? 113  GLY A O     1 
ATOM   1472 N  N     . LYS C 3  114 ? 63.571 71.011  34.356 1.00 43.77  ? 114  LYS A N     1 
ATOM   1473 C  CA    . LYS C 3  114 ? 62.301 70.690  35.005 1.00 43.86  ? 114  LYS A CA    1 
ATOM   1474 C  C     . LYS C 3  114 ? 61.404 71.922  35.170 1.00 42.47  ? 114  LYS A C     1 
ATOM   1475 O  O     . LYS C 3  114 ? 60.209 71.799  35.434 1.00 41.87  ? 114  LYS A O     1 
ATOM   1476 C  CB    . LYS C 3  114 ? 62.584 70.071  36.379 1.00 46.63  ? 114  LYS A CB    1 
ATOM   1477 C  CG    . LYS C 3  114 ? 61.360 69.636  37.169 1.00 49.95  ? 114  LYS A CG    1 
ATOM   1478 C  CD    . LYS C 3  114 ? 61.749 69.309  38.608 1.00 52.95  ? 114  LYS A CD    1 
ATOM   1479 C  CE    . LYS C 3  114 ? 60.594 68.695  39.390 1.00 55.15  ? 114  LYS A CE    1 
ATOM   1480 N  NZ    . LYS C 3  114 ? 59.405 69.595  39.470 1.00 57.53  ? 114  LYS A NZ    1 
ATOM   1481 N  N     . LEU C 3  115 ? 61.986 73.106  35.009 1.00 40.70  ? 115  LEU A N     1 
ATOM   1482 C  CA    . LEU C 3  115 ? 61.246 74.356  35.170 1.00 39.44  ? 115  LEU A CA    1 
ATOM   1483 C  C     . LEU C 3  115 ? 60.498 74.785  33.909 1.00 38.02  ? 115  LEU A C     1 
ATOM   1484 O  O     . LEU C 3  115 ? 61.011 74.663  32.794 1.00 39.31  ? 115  LEU A O     1 
ATOM   1485 C  CB    . LEU C 3  115 ? 62.208 75.469  35.591 1.00 37.78  ? 115  LEU A CB    1 
ATOM   1486 C  CG    . LEU C 3  115 ? 63.048 75.210  36.845 1.00 38.19  ? 115  LEU A CG    1 
ATOM   1487 C  CD1   . LEU C 3  115 ? 64.144 76.259  36.959 1.00 38.05  ? 115  LEU A CD1   1 
ATOM   1488 C  CD2   . LEU C 3  115 ? 62.153 75.224  38.070 1.00 38.43  ? 115  LEU A CD2   1 
ATOM   1489 N  N     . PRO C 3  116 ? 59.264 75.288  34.071 1.00 36.94  ? 116  PRO A N     1 
ATOM   1490 C  CA    . PRO C 3  116 ? 58.466 75.737  32.922 1.00 35.94  ? 116  PRO A CA    1 
ATOM   1491 C  C     . PRO C 3  116 ? 58.890 77.132  32.469 1.00 35.25  ? 116  PRO A C     1 
ATOM   1492 O  O     . PRO C 3  116 ? 59.439 77.902  33.258 1.00 34.62  ? 116  PRO A O     1 
ATOM   1493 C  CB    . PRO C 3  116 ? 57.040 75.719  33.467 1.00 35.92  ? 116  PRO A CB    1 
ATOM   1494 C  CG    . PRO C 3  116 ? 57.240 76.097  34.914 1.00 35.29  ? 116  PRO A CG    1 
ATOM   1495 C  CD    . PRO C 3  116 ? 58.452 75.268  35.303 1.00 35.50  ? 116  PRO A CD    1 
ATOM   1496 N  N     . GLY C 3  117 ? 58.651 77.444  31.196 1.00 34.97  ? 117  GLY A N     1 
ATOM   1497 C  CA    . GLY C 3  117 ? 58.989 78.757  30.667 1.00 33.03  ? 117  GLY A CA    1 
ATOM   1498 C  C     . GLY C 3  117 ? 60.463 79.007  30.417 1.00 32.56  ? 117  GLY A C     1 
ATOM   1499 O  O     . GLY C 3  117 ? 61.266 78.076  30.389 1.00 34.43  ? 117  GLY A O     1 
ATOM   1500 N  N     . ALA C 3  118 ? 60.816 80.275  30.240 1.00 30.77  ? 124  ALA A N     1 
ATOM   1501 C  CA    . ALA C 3  118 ? 62.196 80.674  29.974 1.00 29.24  ? 124  ALA A CA    1 
ATOM   1502 C  C     . ALA C 3  118 ? 62.938 81.122  31.231 1.00 27.74  ? 124  ALA A C     1 
ATOM   1503 O  O     . ALA C 3  118 ? 62.334 81.357  32.280 1.00 27.68  ? 124  ALA A O     1 
ATOM   1504 C  CB    . ALA C 3  118 ? 62.216 81.794  28.933 1.00 27.52  ? 124  ALA A CB    1 
ATOM   1505 N  N     . LEU C 3  119 ? 64.255 81.243  31.118 1.00 25.20  ? 125  LEU A N     1 
ATOM   1506 C  CA    . LEU C 3  119 ? 65.075 81.671  32.241 1.00 24.68  ? 125  LEU A CA    1 
ATOM   1507 C  C     . LEU C 3  119 ? 65.975 82.819  31.793 1.00 25.32  ? 125  LEU A C     1 
ATOM   1508 O  O     . LEU C 3  119 ? 66.503 82.802  30.682 1.00 24.01  ? 125  LEU A O     1 
ATOM   1509 C  CB    . LEU C 3  119 ? 65.937 80.505  32.745 1.00 24.39  ? 125  LEU A CB    1 
ATOM   1510 C  CG    . LEU C 3  119 ? 65.240 79.177  33.061 1.00 25.13  ? 125  LEU A CG    1 
ATOM   1511 C  CD1   . LEU C 3  119 ? 66.265 78.156  33.534 1.00 23.06  ? 125  LEU A CD1   1 
ATOM   1512 C  CD2   . LEU C 3  119 ? 64.174 79.393  34.122 1.00 26.69  ? 125  LEU A CD2   1 
ATOM   1513 N  N     . GLU C 3  120 ? 66.139 83.818  32.656 1.00 26.36  ? 126  GLU A N     1 
ATOM   1514 C  CA    . GLU C 3  120 ? 66.986 84.967  32.345 1.00 26.31  ? 126  GLU A CA    1 
ATOM   1515 C  C     . GLU C 3  120 ? 68.412 84.432  32.205 1.00 26.72  ? 126  GLU A C     1 
ATOM   1516 O  O     . GLU C 3  120 ? 68.899 83.710  33.076 1.00 28.06  ? 126  GLU A O     1 
ATOM   1517 C  CB    . GLU C 3  120 ? 66.878 85.997  33.470 1.00 25.98  ? 126  GLU A CB    1 
ATOM   1518 C  CG    . GLU C 3  120 ? 67.461 87.361  33.143 1.00 28.73  ? 126  GLU A CG    1 
ATOM   1519 C  CD    . GLU C 3  120 ? 68.966 87.377  33.231 1.00 29.42  ? 126  GLU A CD    1 
ATOM   1520 O  OE1   . GLU C 3  120 ? 69.494 86.955  34.283 1.00 27.89  ? 126  GLU A OE1   1 
ATOM   1521 O  OE2   . GLU C 3  120 ? 69.619 87.812  32.259 1.00 32.09  ? 126  GLU A OE2   1 
ATOM   1522 N  N     . ALA C 3  121 ? 69.072 84.794  31.110 1.00 26.25  ? 127  ALA A N     1 
ATOM   1523 C  CA    . ALA C 3  121 ? 70.414 84.304  30.782 1.00 26.29  ? 127  ALA A CA    1 
ATOM   1524 C  C     . ALA C 3  121 ? 71.564 84.492  31.776 1.00 26.14  ? 127  ALA A C     1 
ATOM   1525 O  O     . ALA C 3  121 ? 72.249 83.526  32.111 1.00 26.20  ? 127  ALA A O     1 
ATOM   1526 C  CB    . ALA C 3  121 ? 70.829 84.843  29.411 1.00 25.06  ? 127  ALA A CB    1 
ATOM   1527 N  N     . TRP C 3  122 ? 71.796 85.716  32.235 1.00 25.55  ? 128  TRP A N     1 
ATOM   1528 C  CA    . TRP C 3  122 ? 72.884 85.956  33.173 1.00 24.23  ? 128  TRP A CA    1 
ATOM   1529 C  C     . TRP C 3  122 ? 72.662 85.184  34.465 1.00 24.41  ? 128  TRP A C     1 
ATOM   1530 O  O     . TRP C 3  122 ? 73.593 84.603  35.020 1.00 21.95  ? 128  TRP A O     1 
ATOM   1531 C  CB    . TRP C 3  122 ? 73.011 87.449  33.469 1.00 26.87  ? 128  TRP A CB    1 
ATOM   1532 C  CG    . TRP C 3  122 ? 73.385 88.282  32.268 1.00 30.33  ? 128  TRP A CG    1 
ATOM   1533 C  CD1   . TRP C 3  122 ? 72.735 89.391  31.814 1.00 30.86  ? 128  TRP A CD1   1 
ATOM   1534 C  CD2   . TRP C 3  122 ? 74.527 88.112  31.415 1.00 32.89  ? 128  TRP A CD2   1 
ATOM   1535 N  NE1   . TRP C 3  122 ? 73.399 89.927  30.740 1.00 34.41  ? 128  TRP A NE1   1 
ATOM   1536 C  CE2   . TRP C 3  122 ? 74.504 89.164  30.473 1.00 34.06  ? 128  TRP A CE2   1 
ATOM   1537 C  CE3   . TRP C 3  122 ? 75.571 87.176  31.360 1.00 35.56  ? 128  TRP A CE3   1 
ATOM   1538 C  CZ2   . TRP C 3  122 ? 75.485 89.311  29.482 1.00 35.41  ? 128  TRP A CZ2   1 
ATOM   1539 C  CZ3   . TRP C 3  122 ? 76.552 87.322  30.371 1.00 37.84  ? 128  TRP A CZ3   1 
ATOM   1540 C  CH2   . TRP C 3  122 ? 76.498 88.384  29.447 1.00 37.48  ? 128  TRP A CH2   1 
ATOM   1541 N  N     . GLY C 3  123 ? 71.420 85.180  34.933 1.00 24.88  ? 129  GLY A N     1 
ATOM   1542 C  CA    . GLY C 3  123 ? 71.082 84.473  36.153 1.00 24.44  ? 129  GLY A CA    1 
ATOM   1543 C  C     . GLY C 3  123 ? 71.227 82.981  35.963 1.00 24.64  ? 129  GLY A C     1 
ATOM   1544 O  O     . GLY C 3  123 ? 71.619 82.268  36.884 1.00 23.76  ? 129  GLY A O     1 
ATOM   1545 N  N     . TYR C 3  124 ? 70.902 82.494  34.773 1.00 24.79  ? 130  TYR A N     1 
ATOM   1546 C  CA    . TYR C 3  124 ? 71.048 81.071  34.515 1.00 25.92  ? 130  TYR A CA    1 
ATOM   1547 C  C     . TYR C 3  124 ? 72.534 80.743  34.646 1.00 25.41  ? 130  TYR A C     1 
ATOM   1548 O  O     . TYR C 3  124 ? 72.907 79.781  35.312 1.00 25.27  ? 130  TYR A O     1 
ATOM   1549 C  CB    . TYR C 3  124 ? 70.579 80.705  33.102 1.00 28.06  ? 130  TYR A CB    1 
ATOM   1550 C  CG    . TYR C 3  124 ? 70.852 79.253  32.755 1.00 28.04  ? 130  TYR A CG    1 
ATOM   1551 C  CD1   . TYR C 3  124 ? 70.002 78.242  33.192 1.00 27.19  ? 130  TYR A CD1   1 
ATOM   1552 C  CD2   . TYR C 3  124 ? 71.997 78.888  32.047 1.00 29.03  ? 130  TYR A CD2   1 
ATOM   1553 C  CE1   . TYR C 3  124 ? 70.281 76.897  32.937 1.00 30.07  ? 130  TYR A CE1   1 
ATOM   1554 C  CE2   . TYR C 3  124 ? 72.293 77.536  31.789 1.00 31.35  ? 130  TYR A CE2   1 
ATOM   1555 C  CZ    . TYR C 3  124 ? 71.428 76.550  32.239 1.00 31.93  ? 130  TYR A CZ    1 
ATOM   1556 O  OH    . TYR C 3  124 ? 71.718 75.218  32.020 1.00 34.95  ? 130  TYR A OH    1 
ATOM   1557 N  N     . ARG C 3  125 ? 73.372 81.551  34.000 1.00 25.10  ? 131  ARG A N     1 
ATOM   1558 C  CA    . ARG C 3  125 ? 74.821 81.353  34.040 1.00 27.68  ? 131  ARG A CA    1 
ATOM   1559 C  C     . ARG C 3  125 ? 75.333 81.277  35.473 1.00 28.06  ? 131  ARG A C     1 
ATOM   1560 O  O     . ARG C 3  125 ? 75.993 80.310  35.859 1.00 28.36  ? 131  ARG A O     1 
ATOM   1561 C  CB    . ARG C 3  125 ? 75.535 82.492  33.303 1.00 29.48  ? 131  ARG A CB    1 
ATOM   1562 C  CG    . ARG C 3  125 ? 75.681 82.268  31.810 1.00 35.31  ? 131  ARG A CG    1 
ATOM   1563 C  CD    . ARG C 3  125 ? 76.806 81.276  31.529 1.00 41.61  ? 131  ARG A CD    1 
ATOM   1564 N  NE    . ARG C 3  125 ? 76.606 80.575  30.267 1.00 45.96  ? 131  ARG A NE    1 
ATOM   1565 C  CZ    . ARG C 3  125 ? 76.562 79.252  30.153 1.00 49.21  ? 131  ARG A CZ    1 
ATOM   1566 N  NH1   . ARG C 3  125 ? 76.711 78.491  31.231 1.00 48.66  ? 131  ARG A NH1   1 
ATOM   1567 N  NH2   . ARG C 3  125 ? 76.346 78.690  28.967 1.00 50.89  ? 131  ARG A NH2   1 
ATOM   1568 N  N     . LEU C 3  126 ? 75.032 82.305  36.258 1.00 25.63  ? 132  LEU A N     1 
ATOM   1569 C  CA    . LEU C 3  126 ? 75.464 82.339  37.644 1.00 26.38  ? 132  LEU A CA    1 
ATOM   1570 C  C     . LEU C 3  126 ? 74.995 81.088  38.386 1.00 24.83  ? 132  LEU A C     1 
ATOM   1571 O  O     . LEU C 3  126 ? 75.743 80.503  39.158 1.00 24.95  ? 132  LEU A O     1 
ATOM   1572 C  CB    . LEU C 3  126 ? 74.925 83.598  38.325 1.00 24.04  ? 132  LEU A CB    1 
ATOM   1573 C  CG    . LEU C 3  126 ? 75.499 84.900  37.754 1.00 25.35  ? 132  LEU A CG    1 
ATOM   1574 C  CD1   . LEU C 3  126 ? 74.696 86.091  38.251 1.00 23.78  ? 132  LEU A CD1   1 
ATOM   1575 C  CD2   . LEU C 3  126 ? 76.974 85.022  38.149 1.00 24.37  ? 132  LEU A CD2   1 
ATOM   1576 N  N     . GLY C 3  127 ? 73.758 80.672  38.140 1.00 24.32  ? 133  GLY A N     1 
ATOM   1577 C  CA    . GLY C 3  127 ? 73.241 79.490  38.806 1.00 23.91  ? 133  GLY A CA    1 
ATOM   1578 C  C     . GLY C 3  127 ? 73.954 78.194  38.435 1.00 26.00  ? 133  GLY A C     1 
ATOM   1579 O  O     . GLY C 3  127 ? 74.011 77.267  39.242 1.00 24.87  ? 133  GLY A O     1 
ATOM   1580 N  N     . GLU C 3  128 ? 74.508 78.129  37.226 1.00 26.05  ? 134  GLU A N     1 
ATOM   1581 C  CA    . GLU C 3  128 ? 75.193 76.928  36.748 1.00 29.34  ? 134  GLU A CA    1 
ATOM   1582 C  C     . GLU C 3  128 ? 76.710 76.919  36.942 1.00 31.57  ? 134  GLU A C     1 
ATOM   1583 O  O     . GLU C 3  128 ? 77.377 75.957  36.552 1.00 31.25  ? 134  GLU A O     1 
ATOM   1584 C  CB    . GLU C 3  128 ? 74.906 76.726  35.255 1.00 30.10  ? 134  GLU A CB    1 
ATOM   1585 C  CG    . GLU C 3  128 ? 73.441 76.542  34.914 1.00 34.66  ? 134  GLU A CG    1 
ATOM   1586 C  CD    . GLU C 3  128 ? 72.839 75.327  35.589 1.00 36.79  ? 134  GLU A CD    1 
ATOM   1587 O  OE1   . GLU C 3  128 ? 73.365 74.215  35.369 1.00 41.28  ? 134  GLU A OE1   1 
ATOM   1588 O  OE2   . GLU C 3  128 ? 71.846 75.480  36.335 1.00 37.64  ? 134  GLU A OE2   1 
ATOM   1589 N  N     . MET C 3  129 ? 77.259 77.974  37.533 1.00 32.10  ? 135  MET A N     1 
ATOM   1590 C  CA    . MET C 3  129 ? 78.703 78.051  37.722 1.00 35.28  ? 135  MET A CA    1 
ATOM   1591 C  C     . MET C 3  129 ? 79.312 76.919  38.542 1.00 34.23  ? 135  MET A C     1 
ATOM   1592 O  O     . MET C 3  129 ? 80.362 76.399  38.184 1.00 34.47  ? 135  MET A O     1 
ATOM   1593 C  CB    . MET C 3  129 ? 79.082 79.403  38.335 1.00 37.96  ? 135  MET A CB    1 
ATOM   1594 C  CG    . MET C 3  129 ? 78.788 80.586  37.421 1.00 45.27  ? 135  MET A CG    1 
ATOM   1595 S  SD    . MET C 3  129 ? 79.869 80.696  35.964 1.00 50.34  ? 135  MET A SD    1 
ATOM   1596 C  CE    . MET C 3  129 ? 79.082 79.502  34.858 1.00 48.61  ? 135  MET A CE    1 
ATOM   1597 N  N     . LYS C 3  130 ? 78.671 76.534  39.639 1.00 34.90  ? 136  LYS A N     1 
ATOM   1598 C  CA    . LYS C 3  130 ? 79.218 75.453  40.448 1.00 36.83  ? 136  LYS A CA    1 
ATOM   1599 C  C     . LYS C 3  130 ? 79.293 74.166  39.636 1.00 36.82  ? 136  LYS A C     1 
ATOM   1600 O  O     . LYS C 3  130 ? 80.370 73.596  39.478 1.00 37.32  ? 136  LYS A O     1 
ATOM   1601 C  CB    . LYS C 3  130 ? 78.384 75.244  41.715 1.00 35.57  ? 136  LYS A CB    1 
ATOM   1602 C  CG    . LYS C 3  130 ? 78.541 76.380  42.714 1.00 37.02  ? 136  LYS A CG    1 
ATOM   1603 C  CD    . LYS C 3  130 ? 77.718 76.176  43.981 1.00 36.19  ? 136  LYS A CD    1 
ATOM   1604 C  CE    . LYS C 3  130 ? 78.192 74.982  44.782 1.00 34.80  ? 136  LYS A CE    1 
ATOM   1605 N  NZ    . LYS C 3  130 ? 77.442 74.905  46.063 1.00 35.68  ? 136  LYS A NZ    1 
ATOM   1606 N  N     . GLY C 3  131 ? 78.158 73.721  39.107 1.00 36.65  ? 137  GLY A N     1 
ATOM   1607 C  CA    . GLY C 3  131 ? 78.152 72.502  38.317 1.00 38.19  ? 137  GLY A CA    1 
ATOM   1608 C  C     . GLY C 3  131 ? 79.087 72.595  37.125 1.00 39.90  ? 137  GLY A C     1 
ATOM   1609 O  O     . GLY C 3  131 ? 79.755 71.629  36.749 1.00 41.47  ? 137  GLY A O     1 
ATOM   1610 N  N     . GLU C 3  132 ? 79.143 73.778  36.534 1.00 40.02  ? 138  GLU A N     1 
ATOM   1611 C  CA    . GLU C 3  132 ? 79.983 74.021  35.379 1.00 41.15  ? 138  GLU A CA    1 
ATOM   1612 C  C     . GLU C 3  132 ? 81.456 73.915  35.774 1.00 40.82  ? 138  GLU A C     1 
ATOM   1613 O  O     . GLU C 3  132 ? 82.281 73.394  35.020 1.00 38.97  ? 138  GLU A O     1 
ATOM   1614 C  CB    . GLU C 3  132 ? 79.676 75.412  34.837 1.00 44.75  ? 138  GLU A CB    1 
ATOM   1615 C  CG    . GLU C 3  132 ? 79.981 75.625  33.374 1.00 49.82  ? 138  GLU A CG    1 
ATOM   1616 C  CD    . GLU C 3  132 ? 79.554 77.007  32.915 1.00 53.03  ? 138  GLU A CD    1 
ATOM   1617 O  OE1   . GLU C 3  132 ? 78.351 77.330  33.050 1.00 54.66  ? 138  GLU A OE1   1 
ATOM   1618 O  OE2   . GLU C 3  132 ? 80.419 77.769  32.430 1.00 54.84  ? 138  GLU A OE2   1 
ATOM   1619 N  N     . TYR C 3  133 ? 81.777 74.412  36.966 1.00 39.29  ? 139  TYR A N     1 
ATOM   1620 C  CA    . TYR C 3  133 ? 83.148 74.380  37.470 1.00 38.40  ? 139  TYR A CA    1 
ATOM   1621 C  C     . TYR C 3  133 ? 83.544 72.947  37.793 1.00 38.91  ? 139  TYR A C     1 
ATOM   1622 O  O     . TYR C 3  133 ? 84.678 72.535  37.553 1.00 38.05  ? 139  TYR A O     1 
ATOM   1623 C  CB    . TYR C 3  133 ? 83.270 75.257  38.721 1.00 33.96  ? 139  TYR A CB    1 
ATOM   1624 C  CG    . TYR C 3  133 ? 84.476 74.958  39.575 1.00 29.63  ? 139  TYR A CG    1 
ATOM   1625 C  CD1   . TYR C 3  133 ? 85.770 75.236  39.129 1.00 28.74  ? 139  TYR A CD1   1 
ATOM   1626 C  CD2   . TYR C 3  133 ? 84.324 74.375  40.829 1.00 29.03  ? 139  TYR A CD2   1 
ATOM   1627 C  CE1   . TYR C 3  133 ? 86.884 74.936  39.922 1.00 25.99  ? 139  TYR A CE1   1 
ATOM   1628 C  CE2   . TYR C 3  133 ? 85.423 74.072  41.626 1.00 26.56  ? 139  TYR A CE2   1 
ATOM   1629 C  CZ    . TYR C 3  133 ? 86.698 74.351  41.171 1.00 26.46  ? 139  TYR A CZ    1 
ATOM   1630 O  OH    . TYR C 3  133 ? 87.776 74.027  41.973 1.00 23.55  ? 139  TYR A OH    1 
ATOM   1631 N  N     . LYS C 3  134 ? 82.596 72.197  38.344 1.00 40.44  ? 140  LYS A N     1 
ATOM   1632 C  CA    . LYS C 3  134 ? 82.821 70.802  38.686 1.00 41.67  ? 140  LYS A CA    1 
ATOM   1633 C  C     . LYS C 3  134 ? 83.193 70.032  37.419 1.00 42.49  ? 140  LYS A C     1 
ATOM   1634 O  O     . LYS C 3  134 ? 84.087 69.185  37.436 1.00 42.83  ? 140  LYS A O     1 
ATOM   1635 C  CB    . LYS C 3  134 ? 81.556 70.208  39.309 1.00 42.54  ? 140  LYS A CB    1 
ATOM   1636 C  CG    . LYS C 3  134 ? 81.652 68.733  39.654 1.00 42.72  ? 140  LYS A CG    1 
ATOM   1637 C  CD    . LYS C 3  134 ? 80.295 68.187  40.056 1.00 44.05  ? 140  LYS A CD    1 
ATOM   1638 C  CE    . LYS C 3  134 ? 80.343 66.683  40.271 1.00 44.38  ? 140  LYS A CE    1 
ATOM   1639 N  NZ    . LYS C 3  134 ? 79.005 66.149  40.653 1.00 46.98  ? 140  LYS A NZ    1 
ATOM   1640 N  N     . ASP C 3  135 ? 82.507 70.325  36.318 1.00 44.34  ? 141  ASP A N     1 
ATOM   1641 C  CA    . ASP C 3  135 ? 82.800 69.654  35.057 1.00 46.03  ? 141  ASP A CA    1 
ATOM   1642 C  C     . ASP C 3  135 ? 84.250 69.886  34.654 1.00 46.84  ? 141  ASP A C     1 
ATOM   1643 O  O     . ASP C 3  135 ? 84.974 68.938  34.368 1.00 47.95  ? 141  ASP A O     1 
ATOM   1644 C  CB    . ASP C 3  135 ? 81.882 70.151  33.938 1.00 46.06  ? 141  ASP A CB    1 
ATOM   1645 C  CG    . ASP C 3  135 ? 80.458 69.674  34.102 1.00 46.70  ? 141  ASP A CG    1 
ATOM   1646 O  OD1   . ASP C 3  135 ? 80.280 68.510  34.506 1.00 45.72  ? 141  ASP A OD1   1 
ATOM   1647 O  OD2   . ASP C 3  135 ? 79.519 70.453  33.817 1.00 48.84  ? 141  ASP A OD2   1 
ATOM   1648 N  N     . ASP C 3  136 ? 84.669 71.146  34.629 1.00 47.39  ? 142  ASP A N     1 
ATOM   1649 C  CA    . ASP C 3  136 ? 86.041 71.473  34.267 1.00 49.40  ? 142  ASP A CA    1 
ATOM   1650 C  C     . ASP C 3  136 ? 86.999 70.643  35.112 1.00 49.23  ? 142  ASP A C     1 
ATOM   1651 O  O     . ASP C 3  136 ? 87.836 69.909  34.589 1.00 49.80  ? 142  ASP A O     1 
ATOM   1652 C  CB    . ASP C 3  136 ? 86.318 72.957  34.515 1.00 52.78  ? 142  ASP A CB    1 
ATOM   1653 C  CG    . ASP C 3  136 ? 85.463 73.865  33.655 1.00 56.19  ? 142  ASP A CG    1 
ATOM   1654 O  OD1   . ASP C 3  136 ? 84.230 73.669  33.624 1.00 59.67  ? 142  ASP A OD1   1 
ATOM   1655 O  OD2   . ASP C 3  136 ? 86.020 74.783  33.018 1.00 57.39  ? 142  ASP A OD2   1 
ATOM   1656 N  N     . PHE C 3  137 ? 86.854 70.764  36.426 1.00 48.65  ? 143  PHE A N     1 
ATOM   1657 C  CA    . PHE C 3  137 ? 87.697 70.058  37.379 1.00 47.65  ? 143  PHE A CA    1 
ATOM   1658 C  C     . PHE C 3  137 ? 87.767 68.558  37.110 1.00 49.62  ? 143  PHE A C     1 
ATOM   1659 O  O     . PHE C 3  137 ? 88.854 67.991  37.036 1.00 48.83  ? 143  PHE A O     1 
ATOM   1660 C  CB    . PHE C 3  137 ? 87.177 70.291  38.795 1.00 44.16  ? 143  PHE A CB    1 
ATOM   1661 C  CG    . PHE C 3  137 ? 88.188 70.011  39.865 1.00 41.43  ? 143  PHE A CG    1 
ATOM   1662 C  CD1   . PHE C 3  137 ? 89.071 71.002  40.276 1.00 40.18  ? 143  PHE A CD1   1 
ATOM   1663 C  CD2   . PHE C 3  137 ? 88.264 68.756  40.457 1.00 39.41  ? 143  PHE A CD2   1 
ATOM   1664 C  CE1   . PHE C 3  137 ? 90.013 70.753  41.260 1.00 38.93  ? 143  PHE A CE1   1 
ATOM   1665 C  CE2   . PHE C 3  137 ? 89.204 68.494  41.444 1.00 38.79  ? 143  PHE A CE2   1 
ATOM   1666 C  CZ    . PHE C 3  137 ? 90.081 69.495  41.847 1.00 39.13  ? 143  PHE A CZ    1 
ATOM   1667 N  N     . LYS C 3  138 ? 86.607 67.916  36.982 1.00 52.62  ? 144  LYS A N     1 
ATOM   1668 C  CA    . LYS C 3  138 ? 86.549 66.479  36.729 1.00 55.11  ? 144  LYS A CA    1 
ATOM   1669 C  C     . LYS C 3  138 ? 87.269 66.104  35.444 1.00 56.79  ? 144  LYS A C     1 
ATOM   1670 O  O     . LYS C 3  138 ? 87.989 65.102  35.397 1.00 56.78  ? 144  LYS A O     1 
ATOM   1671 C  CB    . LYS C 3  138 ? 85.096 65.999  36.654 1.00 55.75  ? 144  LYS A CB    1 
ATOM   1672 C  CG    . LYS C 3  138 ? 84.414 65.914  38.002 1.00 57.32  ? 144  LYS A CG    1 
ATOM   1673 C  CD    . LYS C 3  138 ? 82.976 65.423  37.896 1.00 58.61  ? 144  LYS A CD    1 
ATOM   1674 C  CE    . LYS C 3  138 ? 82.895 63.983  37.427 1.00 58.22  ? 144  LYS A CE    1 
ATOM   1675 N  NZ    . LYS C 3  138 ? 81.507 63.458  37.585 1.00 58.33  ? 144  LYS A NZ    1 
ATOM   1676 N  N     . ARG C 3  139 ? 87.067 66.908  34.405 1.00 57.99  ? 145  ARG A N     1 
ATOM   1677 C  CA    . ARG C 3  139 ? 87.702 66.666  33.117 1.00 60.05  ? 145  ARG A CA    1 
ATOM   1678 C  C     . ARG C 3  139 ? 89.219 66.793  33.223 1.00 61.17  ? 145  ARG A C     1 
ATOM   1679 O  O     . ARG C 3  139 ? 89.952 65.926  32.748 1.00 62.02  ? 145  ARG A O     1 
ATOM   1680 C  CB    . ARG C 3  139 ? 87.160 67.642  32.067 1.00 59.95  ? 145  ARG A CB    1 
ATOM   1681 C  CG    . ARG C 3  139 ? 88.166 67.999  30.984 1.00 61.43  ? 145  ARG A CG    1 
ATOM   1682 C  CD    . ARG C 3  139 ? 87.534 68.668  29.765 1.00 62.72  ? 145  ARG A CD    1 
ATOM   1683 N  NE    . ARG C 3  139 ? 86.979 69.998  30.019 1.00 65.15  ? 145  ARG A NE    1 
ATOM   1684 C  CZ    . ARG C 3  139 ? 85.784 70.237  30.557 1.00 65.81  ? 145  ARG A CZ    1 
ATOM   1685 N  NH1   . ARG C 3  139 ? 84.992 69.234  30.914 1.00 66.39  ? 145  ARG A NH1   1 
ATOM   1686 N  NH2   . ARG C 3  139 ? 85.369 71.488  30.720 1.00 66.43  ? 145  ARG A NH2   1 
ATOM   1687 N  N     . MET C 3  140 ? 89.689 67.870  33.844 1.00 62.24  ? 146  MET A N     1 
ATOM   1688 C  CA    . MET C 3  140 ? 91.123 68.072  34.002 1.00 63.57  ? 146  MET A CA    1 
ATOM   1689 C  C     . MET C 3  140 ? 91.782 66.900  34.732 1.00 63.61  ? 146  MET A C     1 
ATOM   1690 O  O     . MET C 3  140 ? 92.897 66.509  34.395 1.00 62.96  ? 146  MET A O     1 
ATOM   1691 C  CB    . MET C 3  140 ? 91.408 69.378  34.755 1.00 64.68  ? 146  MET A CB    1 
ATOM   1692 C  CG    . MET C 3  140 ? 91.067 70.637  33.967 1.00 67.92  ? 146  MET A CG    1 
ATOM   1693 S  SD    . MET C 3  140 ? 91.719 72.168  34.702 1.00 71.73  ? 146  MET A SD    1 
ATOM   1694 C  CE    . MET C 3  140 ? 93.156 72.480  33.661 1.00 71.40  ? 146  MET A CE    1 
ATOM   1695 N  N     . LEU C 3  141 ? 91.095 66.336  35.723 1.00 64.01  ? 147  LEU A N     1 
ATOM   1696 C  CA    . LEU C 3  141 ? 91.646 65.211  36.475 1.00 65.33  ? 147  LEU A CA    1 
ATOM   1697 C  C     . LEU C 3  141 ? 91.736 63.924  35.659 1.00 66.39  ? 147  LEU A C     1 
ATOM   1698 O  O     . LEU C 3  141 ? 92.809 63.334  35.538 1.00 66.54  ? 147  LEU A O     1 
ATOM   1699 C  CB    . LEU C 3  141 ? 90.825 64.940  37.740 1.00 63.26  ? 147  LEU A CB    1 
ATOM   1700 C  CG    . LEU C 3  141 ? 90.996 65.890  38.925 1.00 62.45  ? 147  LEU A CG    1 
ATOM   1701 C  CD1   . LEU C 3  141 ? 90.408 65.237  40.167 1.00 61.93  ? 147  LEU A CD1   1 
ATOM   1702 C  CD2   . LEU C 3  141 ? 92.470 66.196  39.149 1.00 61.76  ? 147  LEU A CD2   1 
ATOM   1703 N  N     . GLU C 3  142 ? 90.607 63.484  35.111 1.00 67.67  ? 148  GLU A N     1 
ATOM   1704 C  CA    . GLU C 3  142 ? 90.577 62.264  34.310 1.00 69.02  ? 148  GLU A CA    1 
ATOM   1705 C  C     . GLU C 3  142 ? 91.423 62.450  33.057 1.00 68.86  ? 148  GLU A C     1 
ATOM   1706 O  O     . GLU C 3  142 ? 91.613 61.523  32.271 1.00 68.53  ? 148  GLU A O     1 
ATOM   1707 C  CB    . GLU C 3  142 ? 89.133 61.921  33.940 1.00 70.06  ? 148  GLU A CB    1 
ATOM   1708 C  CG    . GLU C 3  142 ? 88.249 61.688  35.157 1.00 71.89  ? 148  GLU A CG    1 
ATOM   1709 C  CD    . GLU C 3  142 ? 86.812 61.379  34.791 1.00 73.08  ? 148  GLU A CD    1 
ATOM   1710 O  OE1   . GLU C 3  142 ? 86.585 60.420  34.019 1.00 74.81  ? 148  GLU A OE1   1 
ATOM   1711 O  OE2   . GLU C 3  142 ? 85.909 62.092  35.280 1.00 72.69  ? 148  GLU A OE2   1 
ATOM   1712 N  N     . GLU C 3  143 ? 91.927 63.667  32.892 1.00 69.08  ? 149  GLU A N     1 
ATOM   1713 C  CA    . GLU C 3  143 ? 92.775 64.025  31.768 1.00 69.20  ? 149  GLU A CA    1 
ATOM   1714 C  C     . GLU C 3  143 ? 94.198 63.796  32.266 1.00 69.40  ? 149  GLU A C     1 
ATOM   1715 O  O     . GLU C 3  143 ? 95.142 63.695  31.484 1.00 69.73  ? 149  GLU A O     1 
ATOM   1716 C  CB    . GLU C 3  143 ? 92.565 65.503  31.420 1.00 70.49  ? 149  GLU A CB    1 
ATOM   1717 C  CG    . GLU C 3  143 ? 92.711 65.854  29.944 1.00 71.18  ? 149  GLU A CG    1 
ATOM   1718 C  CD    . GLU C 3  143 ? 92.308 67.293  29.645 1.00 70.77  ? 149  GLU A CD    1 
ATOM   1719 O  OE1   . GLU C 3  143 ? 93.039 68.221  30.052 1.00 70.44  ? 149  GLU A OE1   1 
ATOM   1720 O  OE2   . GLU C 3  143 ? 91.253 67.495  29.007 1.00 71.37  ? 149  GLU A OE2   1 
ATOM   1721 N  N     . GLN C 3  144 ? 94.327 63.712  33.587 1.00 69.49  ? 150  GLN A N     1 
ATOM   1722 C  CA    . GLN C 3  144 ? 95.608 63.497  34.251 1.00 69.77  ? 150  GLN A CA    1 
ATOM   1723 C  C     . GLN C 3  144 ? 95.668 62.113  34.887 1.00 69.61  ? 150  GLN A C     1 
ATOM   1724 O  O     . GLN C 3  144 ? 96.567 61.830  35.677 1.00 69.39  ? 150  GLN A O     1 
ATOM   1725 C  CB    . GLN C 3  144 ? 95.818 64.552  35.338 1.00 70.97  ? 150  GLN A CB    1 
ATOM   1726 C  CG    . GLN C 3  144 ? 95.955 65.968  34.814 1.00 73.07  ? 150  GLN A CG    1 
ATOM   1727 C  CD    . GLN C 3  144 ? 97.309 66.222  34.195 1.00 74.70  ? 150  GLN A CD    1 
ATOM   1728 O  OE1   . GLN C 3  144 ? 98.330 66.199  34.886 1.00 75.48  ? 150  GLN A OE1   1 
ATOM   1729 N  NE2   . GLN C 3  144 ? 97.331 66.460  32.886 1.00 74.07  ? 150  GLN A NE2   1 
ATOM   1730 N  N     . GLY C 3  145 ? 94.701 61.262  34.554 1.00 69.64  ? 151  GLY A N     1 
ATOM   1731 C  CA    . GLY C 3  145 ? 94.672 59.916  35.103 1.00 69.47  ? 151  GLY A CA    1 
ATOM   1732 C  C     . GLY C 3  145 ? 94.017 59.808  36.469 1.00 69.72  ? 151  GLY A C     1 
ATOM   1733 O  O     . GLY C 3  145 ? 93.282 58.855  36.744 1.00 70.29  ? 151  GLY A O     1 
ATOM   1734 N  N     . GLU C 3  146 ? 94.287 60.785  37.330 1.00 69.42  ? 152  GLU A N     1 
ATOM   1735 C  CA    . GLU C 3  146 ? 93.725 60.815  38.678 1.00 68.16  ? 152  GLU A CA    1 
ATOM   1736 C  C     . GLU C 3  146 ? 92.213 60.611  38.685 1.00 66.39  ? 152  GLU A C     1 
ATOM   1737 O  O     . GLU C 3  146 ? 91.525 60.952  37.723 1.00 67.09  ? 152  GLU A O     1 
ATOM   1738 C  CB    . GLU C 3  146 ? 94.056 62.147  39.347 1.00 69.47  ? 152  GLU A CB    1 
ATOM   1739 C  CG    . GLU C 3  146 ? 95.531 62.354  39.621 1.00 71.73  ? 152  GLU A CG    1 
ATOM   1740 C  CD    . GLU C 3  146 ? 95.844 63.779  40.031 1.00 73.39  ? 152  GLU A CD    1 
ATOM   1741 O  OE1   . GLU C 3  146 ? 95.865 64.663  39.148 1.00 74.16  ? 152  GLU A OE1   1 
ATOM   1742 O  OE2   . GLU C 3  146 ? 96.058 64.017  41.239 1.00 74.61  ? 152  GLU A OE2   1 
ATOM   1743 N  N     . GLU C 3  147 ? 91.702 60.053  39.778 1.00 64.24  ? 153  GLU A N     1 
ATOM   1744 C  CA    . GLU C 3  147 ? 90.274 59.804  39.919 1.00 61.94  ? 153  GLU A CA    1 
ATOM   1745 C  C     . GLU C 3  147 ? 89.580 60.969  40.614 1.00 59.35  ? 153  GLU A C     1 
ATOM   1746 O  O     . GLU C 3  147 ? 90.195 61.698  41.394 1.00 58.40  ? 153  GLU A O     1 
ATOM   1747 C  CB    . GLU C 3  147 ? 90.030 58.532  40.731 1.00 63.63  ? 153  GLU A CB    1 
ATOM   1748 C  CG    . GLU C 3  147 ? 90.588 57.267  40.114 1.00 68.23  ? 153  GLU A CG    1 
ATOM   1749 C  CD    . GLU C 3  147 ? 90.312 56.045  40.973 1.00 70.87  ? 153  GLU A CD    1 
ATOM   1750 O  OE1   . GLU C 3  147 ? 90.826 55.988  42.114 1.00 72.13  ? 153  GLU A OE1   1 
ATOM   1751 O  OE2   . GLU C 3  147 ? 89.577 55.145  40.508 1.00 71.78  ? 153  GLU A OE2   1 
ATOM   1752 N  N     . TYR C 3  148 ? 88.294 61.135  40.326 1.00 55.23  ? 154  TYR A N     1 
ATOM   1753 C  CA    . TYR C 3  148 ? 87.509 62.196  40.933 1.00 51.22  ? 154  TYR A CA    1 
ATOM   1754 C  C     . TYR C 3  148 ? 86.819 61.649  42.169 1.00 49.67  ? 154  TYR A C     1 
ATOM   1755 O  O     . TYR C 3  148 ? 86.210 60.583  42.123 1.00 49.48  ? 154  TYR A O     1 
ATOM   1756 C  CB    . TYR C 3  148 ? 86.454 62.716  39.959 1.00 47.93  ? 154  TYR A CB    1 
ATOM   1757 C  CG    . TYR C 3  148 ? 85.500 63.688  40.609 1.00 45.35  ? 154  TYR A CG    1 
ATOM   1758 C  CD1   . TYR C 3  148 ? 85.906 64.984  40.929 1.00 42.40  ? 154  TYR A CD1   1 
ATOM   1759 C  CD2   . TYR C 3  148 ? 84.211 63.295  40.960 1.00 43.36  ? 154  TYR A CD2   1 
ATOM   1760 C  CE1   . TYR C 3  148 ? 85.054 65.860  41.582 1.00 42.77  ? 154  TYR A CE1   1 
ATOM   1761 C  CE2   . TYR C 3  148 ? 83.351 64.166  41.617 1.00 44.46  ? 154  TYR A CE2   1 
ATOM   1762 C  CZ    . TYR C 3  148 ? 83.781 65.447  41.926 1.00 43.34  ? 154  TYR A CZ    1 
ATOM   1763 O  OH    . TYR C 3  148 ? 82.942 66.307  42.591 1.00 43.88  ? 154  TYR A OH    1 
ATOM   1764 N  N     . VAL C 3  149 ? 86.901 62.386  43.270 1.00 49.49  ? 155  VAL A N     1 
ATOM   1765 C  CA    . VAL C 3  149 ? 86.288 61.953  44.519 1.00 50.62  ? 155  VAL A CA    1 
ATOM   1766 C  C     . VAL C 3  149 ? 85.100 62.808  44.952 1.00 51.83  ? 155  VAL A C     1 
ATOM   1767 O  O     . VAL C 3  149 ? 84.999 63.983  44.593 1.00 51.30  ? 155  VAL A O     1 
ATOM   1768 C  CB    . VAL C 3  149 ? 87.335 61.929  45.666 1.00 50.03  ? 155  VAL A CB    1 
ATOM   1769 C  CG1   . VAL C 3  149 ? 86.655 61.665  47.005 1.00 48.99  ? 155  VAL A CG1   1 
ATOM   1770 C  CG2   . VAL C 3  149 ? 88.376 60.852  45.389 1.00 48.21  ? 155  VAL A CG2   1 
ATOM   1771 N  N     . ASP C 3  150 ? 84.210 62.181  45.721 1.00 54.01  ? 156  ASP A N     1 
ATOM   1772 C  CA    . ASP C 3  150 ? 83.004 62.802  46.271 1.00 54.99  ? 156  ASP A CA    1 
ATOM   1773 C  C     . ASP C 3  150 ? 82.657 64.140  45.638 1.00 53.55  ? 156  ASP A C     1 
ATOM   1774 O  O     . ASP C 3  150 ? 81.757 64.222  44.800 1.00 55.17  ? 156  ASP A O     1 
ATOM   1775 C  CB    . ASP C 3  150 ? 83.163 62.983  47.791 1.00 57.93  ? 156  ASP A CB    1 
ATOM   1776 C  CG    . ASP C 3  150 ? 82.148 62.172  48.594 1.00 59.47  ? 156  ASP A CG    1 
ATOM   1777 O  OD1   . ASP C 3  150 ? 82.095 60.930  48.427 1.00 59.20  ? 156  ASP A OD1   1 
ATOM   1778 O  OD2   . ASP C 3  150 ? 81.406 62.783  49.398 1.00 59.54  ? 156  ASP A OD2   1 
ATOM   1779 N  N     . GLY C 3  151 ? 83.372 65.180  46.063 1.00 49.93  ? 157  GLY A N     1 
ATOM   1780 C  CA    . GLY C 3  151 ? 83.157 66.522  45.544 1.00 47.03  ? 157  GLY A CA    1 
ATOM   1781 C  C     . GLY C 3  151 ? 84.367 67.369  45.895 1.00 45.39  ? 157  GLY A C     1 
ATOM   1782 O  O     . GLY C 3  151 ? 84.251 68.481  46.412 1.00 44.93  ? 157  GLY A O     1 
ATOM   1783 N  N     . MET C 3  152 ? 85.540 66.823  45.596 1.00 42.53  ? 158  MET A N     1 
ATOM   1784 C  CA    . MET C 3  152 ? 86.819 67.458  45.884 1.00 40.24  ? 158  MET A CA    1 
ATOM   1785 C  C     . MET C 3  152 ? 87.101 68.802  45.224 1.00 36.87  ? 158  MET A C     1 
ATOM   1786 O  O     . MET C 3  152 ? 88.078 69.464  45.572 1.00 36.60  ? 158  MET A O     1 
ATOM   1787 C  CB    . MET C 3  152 ? 87.951 66.487  45.530 1.00 41.64  ? 158  MET A CB    1 
ATOM   1788 C  CG    . MET C 3  152 ? 88.010 66.125  44.055 1.00 42.76  ? 158  MET A CG    1 
ATOM   1789 S  SD    . MET C 3  152 ? 89.258 64.872  43.694 1.00 46.47  ? 158  MET A SD    1 
ATOM   1790 C  CE    . MET C 3  152 ? 90.764 65.907  43.699 1.00 43.02  ? 158  MET A CE    1 
ATOM   1791 N  N     . GLU C 3  153 ? 86.268 69.216  44.278 1.00 35.76  ? 159  GLU A N     1 
ATOM   1792 C  CA    . GLU C 3  153 ? 86.504 70.485  43.593 1.00 32.52  ? 159  GLU A CA    1 
ATOM   1793 C  C     . GLU C 3  153 ? 86.504 71.687  44.538 1.00 31.13  ? 159  GLU A C     1 
ATOM   1794 O  O     . GLU C 3  153 ? 87.054 72.734  44.204 1.00 30.64  ? 159  GLU A O     1 
ATOM   1795 C  CB    . GLU C 3  153 ? 85.459 70.712  42.489 1.00 33.59  ? 159  GLU A CB    1 
ATOM   1796 C  CG    . GLU C 3  153 ? 84.044 70.961  42.990 1.00 33.84  ? 159  GLU A CG    1 
ATOM   1797 C  CD    . GLU C 3  153 ? 83.203 69.701  43.043 1.00 35.22  ? 159  GLU A CD    1 
ATOM   1798 O  OE1   . GLU C 3  153 ? 83.773 68.611  43.260 1.00 35.14  ? 159  GLU A OE1   1 
ATOM   1799 O  OE2   . GLU C 3  153 ? 81.967 69.802  42.879 1.00 36.62  ? 159  GLU A OE2   1 
ATOM   1800 N  N     . TRP C 3  154 ? 85.909 71.531  45.718 1.00 30.28  ? 160  TRP A N     1 
ATOM   1801 C  CA    . TRP C 3  154 ? 85.824 72.626  46.679 1.00 30.02  ? 160  TRP A CA    1 
ATOM   1802 C  C     . TRP C 3  154 ? 86.741 72.527  47.891 1.00 30.97  ? 160  TRP A C     1 
ATOM   1803 O  O     . TRP C 3  154 ? 86.714 73.406  48.757 1.00 30.09  ? 160  TRP A O     1 
ATOM   1804 C  CB    . TRP C 3  154 ? 84.376 72.779  47.162 1.00 29.48  ? 160  TRP A CB    1 
ATOM   1805 C  CG    . TRP C 3  154 ? 83.443 73.185  46.066 1.00 30.78  ? 160  TRP A CG    1 
ATOM   1806 C  CD1   . TRP C 3  154 ? 82.444 72.435  45.513 1.00 31.33  ? 160  TRP A CD1   1 
ATOM   1807 C  CD2   . TRP C 3  154 ? 83.475 74.414  45.335 1.00 28.85  ? 160  TRP A CD2   1 
ATOM   1808 N  NE1   . TRP C 3  154 ? 81.857 73.121  44.477 1.00 29.91  ? 160  TRP A NE1   1 
ATOM   1809 C  CE2   . TRP C 3  154 ? 82.470 74.337  44.347 1.00 29.25  ? 160  TRP A CE2   1 
ATOM   1810 C  CE3   . TRP C 3  154 ? 84.257 75.570  45.419 1.00 28.09  ? 160  TRP A CE3   1 
ATOM   1811 C  CZ2   . TRP C 3  154 ? 82.229 75.378  43.446 1.00 28.08  ? 160  TRP A CZ2   1 
ATOM   1812 C  CZ3   . TRP C 3  154 ? 84.017 76.604  44.524 1.00 26.87  ? 160  TRP A CZ3   1 
ATOM   1813 C  CH2   . TRP C 3  154 ? 83.010 76.499  43.549 1.00 28.37  ? 160  TRP A CH2   1 
ATOM   1814 N  N     . TRP C 3  155 ? 87.556 71.477  47.957 1.00 29.94  ? 161  TRP A N     1 
ATOM   1815 C  CA    . TRP C 3  155 ? 88.452 71.310  49.094 1.00 28.54  ? 161  TRP A CA    1 
ATOM   1816 C  C     . TRP C 3  155 ? 89.595 72.318  49.138 1.00 28.39  ? 161  TRP A C     1 
ATOM   1817 O  O     . TRP C 3  155 ? 89.973 72.772  50.216 1.00 29.22  ? 161  TRP A O     1 
ATOM   1818 C  CB    . TRP C 3  155 ? 89.046 69.901  49.118 1.00 29.05  ? 161  TRP A CB    1 
ATOM   1819 C  CG    . TRP C 3  155 ? 88.046 68.796  49.252 1.00 31.92  ? 161  TRP A CG    1 
ATOM   1820 C  CD1   . TRP C 3  155 ? 86.744 68.902  49.660 1.00 31.12  ? 161  TRP A CD1   1 
ATOM   1821 C  CD2   . TRP C 3  155 ? 88.280 67.399  49.018 1.00 31.81  ? 161  TRP A CD2   1 
ATOM   1822 N  NE1   . TRP C 3  155 ? 86.156 67.660  49.694 1.00 30.94  ? 161  TRP A NE1   1 
ATOM   1823 C  CE2   . TRP C 3  155 ? 87.076 66.721  49.305 1.00 31.27  ? 161  TRP A CE2   1 
ATOM   1824 C  CE3   . TRP C 3  155 ? 89.393 66.658  48.596 1.00 33.41  ? 161  TRP A CE3   1 
ATOM   1825 C  CZ2   . TRP C 3  155 ? 86.952 65.333  49.182 1.00 32.07  ? 161  TRP A CZ2   1 
ATOM   1826 C  CZ3   . TRP C 3  155 ? 89.270 65.274  48.476 1.00 32.33  ? 161  TRP A CZ3   1 
ATOM   1827 C  CH2   . TRP C 3  155 ? 88.057 64.630  48.768 1.00 33.06  ? 161  TRP A CH2   1 
ATOM   1828 N  N     . ASN C 3  156 ? 90.147 72.673  47.980 1.00 27.62  ? 162  ASN A N     1 
ATOM   1829 C  CA    . ASN C 3  156 ? 91.272 73.608  47.944 1.00 28.87  ? 162  ASN A CA    1 
ATOM   1830 C  C     . ASN C 3  156 ? 91.195 74.661  46.852 1.00 30.25  ? 162  ASN A C     1 
ATOM   1831 O  O     . ASN C 3  156 ? 90.551 74.467  45.819 1.00 31.36  ? 162  ASN A O     1 
ATOM   1832 C  CB    . ASN C 3  156 ? 92.589 72.844  47.781 1.00 28.82  ? 162  ASN A CB    1 
ATOM   1833 C  CG    . ASN C 3  156 ? 92.842 71.879  48.911 1.00 29.43  ? 162  ASN A CG    1 
ATOM   1834 O  OD1   . ASN C 3  156 ? 93.120 72.283  50.043 1.00 32.02  ? 162  ASN A OD1   1 
ATOM   1835 N  ND2   . ASN C 3  156 ? 92.728 70.590  48.618 1.00 31.61  ? 162  ASN A ND2   1 
ATOM   1836 N  N     . PHE C 3  157 ? 91.873 75.778  47.088 1.00 31.42  ? 163  PHE A N     1 
ATOM   1837 C  CA    . PHE C 3  157 ? 91.907 76.869  46.126 1.00 32.71  ? 163  PHE A CA    1 
ATOM   1838 C  C     . PHE C 3  157 ? 92.813 76.504  44.951 1.00 34.34  ? 163  PHE A C     1 
ATOM   1839 O  O     . PHE C 3  157 ? 93.807 75.796  45.109 1.00 33.93  ? 163  PHE A O     1 
ATOM   1840 C  CB    . PHE C 3  157 ? 92.436 78.144  46.792 1.00 31.45  ? 163  PHE A CB    1 
ATOM   1841 C  CG    . PHE C 3  157 ? 92.835 79.223  45.815 1.00 31.46  ? 163  PHE A CG    1 
ATOM   1842 C  CD1   . PHE C 3  157 ? 91.870 79.957  45.128 1.00 30.54  ? 163  PHE A CD1   1 
ATOM   1843 C  CD2   . PHE C 3  157 ? 94.179 79.487  45.567 1.00 30.68  ? 163  PHE A CD2   1 
ATOM   1844 C  CE1   . PHE C 3  157 ? 92.238 80.936  44.210 1.00 31.95  ? 163  PHE A CE1   1 
ATOM   1845 C  CE2   . PHE C 3  157 ? 94.560 80.462  44.652 1.00 30.50  ? 163  PHE A CE2   1 
ATOM   1846 C  CZ    . PHE C 3  157 ? 93.586 81.190  43.969 1.00 32.03  ? 163  PHE A CZ    1 
ATOM   1847 N  N     . ASN C 3  158 ? 92.458 76.988  43.770 1.00 34.44  ? 164  ASN A N     1 
ATOM   1848 C  CA    . ASN C 3  158 ? 93.257 76.755  42.577 1.00 34.64  ? 164  ASN A CA    1 
ATOM   1849 C  C     . ASN C 3  158 ? 92.909 77.868  41.596 1.00 35.95  ? 164  ASN A C     1 
ATOM   1850 O  O     . ASN C 3  158 ? 91.902 78.559  41.767 1.00 34.91  ? 164  ASN A O     1 
ATOM   1851 C  CB    . ASN C 3  158 ? 92.981 75.364  41.993 1.00 31.79  ? 164  ASN A CB    1 
ATOM   1852 C  CG    . ASN C 3  158 ? 91.542 75.172  41.594 1.00 31.66  ? 164  ASN A CG    1 
ATOM   1853 O  OD1   . ASN C 3  158 ? 91.041 75.867  40.719 1.00 30.79  ? 164  ASN A OD1   1 
ATOM   1854 N  ND2   . ASN C 3  158 ? 90.867 74.221  42.230 1.00 30.67  ? 164  ASN A ND2   1 
ATOM   1855 N  N     . GLU C 3  159 ? 93.745 78.061  40.584 1.00 37.11  ? 165  GLU A N     1 
ATOM   1856 C  CA    . GLU C 3  159 ? 93.512 79.130  39.625 1.00 37.02  ? 165  GLU A CA    1 
ATOM   1857 C  C     . GLU C 3  159 ? 92.251 79.043  38.766 1.00 36.20  ? 165  GLU A C     1 
ATOM   1858 O  O     . GLU C 3  159 ? 91.822 80.057  38.226 1.00 35.23  ? 165  GLU A O     1 
ATOM   1859 C  CB    . GLU C 3  159 ? 94.737 79.312  38.725 1.00 37.76  ? 165  GLU A CB    1 
ATOM   1860 C  CG    . GLU C 3  159 ? 95.904 80.036  39.396 1.00 40.63  ? 165  GLU A CG    1 
ATOM   1861 C  CD    . GLU C 3  159 ? 95.502 81.350  40.070 1.00 43.39  ? 165  GLU A CD    1 
ATOM   1862 O  OE1   . GLU C 3  159 ? 94.731 82.137  39.472 1.00 43.53  ? 165  GLU A OE1   1 
ATOM   1863 O  OE2   . GLU C 3  159 ? 95.977 81.603  41.200 1.00 44.10  ? 165  GLU A OE2   1 
ATOM   1864 N  N     . GLU C 3  160 ? 91.653 77.864  38.624 1.00 36.04  ? 166  GLU A N     1 
ATOM   1865 C  CA    . GLU C 3  160 ? 90.440 77.777  37.816 1.00 37.23  ? 166  GLU A CA    1 
ATOM   1866 C  C     . GLU C 3  160 ? 89.269 78.267  38.664 1.00 34.91  ? 166  GLU A C     1 
ATOM   1867 O  O     . GLU C 3  160 ? 88.282 78.793  38.148 1.00 33.25  ? 166  GLU A O     1 
ATOM   1868 C  CB    . GLU C 3  160 ? 90.202 76.344  37.304 1.00 41.38  ? 166  GLU A CB    1 
ATOM   1869 C  CG    . GLU C 3  160 ? 89.990 75.285  38.368 1.00 50.07  ? 166  GLU A CG    1 
ATOM   1870 C  CD    . GLU C 3  160 ? 89.989 73.862  37.804 1.00 55.52  ? 166  GLU A CD    1 
ATOM   1871 O  OE1   . GLU C 3  160 ? 89.064 73.523  37.026 1.00 57.74  ? 166  GLU A OE1   1 
ATOM   1872 O  OE2   . GLU C 3  160 ? 90.916 73.083  38.141 1.00 56.60  ? 166  GLU A OE2   1 
ATOM   1873 N  N     . MET C 3  161 ? 89.395 78.102  39.974 1.00 32.61  ? 167  MET A N     1 
ATOM   1874 C  CA    . MET C 3  161 ? 88.371 78.564  40.894 1.00 29.42  ? 167  MET A CA    1 
ATOM   1875 C  C     . MET C 3  161 ? 88.429 80.089  40.865 1.00 28.37  ? 167  MET A C     1 
ATOM   1876 O  O     . MET C 3  161 ? 87.399 80.762  40.832 1.00 29.18  ? 167  MET A O     1 
ATOM   1877 C  CB    . MET C 3  161 ? 88.667 78.056  42.300 1.00 29.32  ? 167  MET A CB    1 
ATOM   1878 C  CG    . MET C 3  161 ? 87.637 78.457  43.333 1.00 26.00  ? 167  MET A CG    1 
ATOM   1879 S  SD    . MET C 3  161 ? 88.114 77.873  44.949 1.00 30.39  ? 167  MET A SD    1 
ATOM   1880 C  CE    . MET C 3  161 ? 87.663 76.157  44.826 1.00 26.77  ? 167  MET A CE    1 
ATOM   1881 N  N     . MET C 3  162 ? 89.647 80.622  40.864 1.00 25.59  ? 168  MET A N     1 
ATOM   1882 C  CA    . MET C 3  162 ? 89.859 82.062  40.816 1.00 26.78  ? 168  MET A CA    1 
ATOM   1883 C  C     . MET C 3  162 ? 89.181 82.649  39.573 1.00 28.57  ? 168  MET A C     1 
ATOM   1884 O  O     . MET C 3  162 ? 88.433 83.622  39.672 1.00 29.81  ? 168  MET A O     1 
ATOM   1885 C  CB    . MET C 3  162 ? 91.359 82.366  40.783 1.00 25.42  ? 168  MET A CB    1 
ATOM   1886 C  CG    . MET C 3  162 ? 91.738 83.842  40.865 1.00 24.56  ? 168  MET A CG    1 
ATOM   1887 S  SD    . MET C 3  162 ? 91.538 84.552  42.523 1.00 32.49  ? 168  MET A SD    1 
ATOM   1888 C  CE    . MET C 3  162 ? 89.910 85.279  42.389 1.00 28.41  ? 168  MET A CE    1 
ATOM   1889 N  N     . ASP C 3  163 ? 89.429 82.050  38.407 1.00 29.23  ? 169  ASP A N     1 
ATOM   1890 C  CA    . ASP C 3  163 ? 88.844 82.543  37.157 1.00 32.26  ? 169  ASP A CA    1 
ATOM   1891 C  C     . ASP C 3  163 ? 87.320 82.537  37.161 1.00 31.77  ? 169  ASP A C     1 
ATOM   1892 O  O     . ASP C 3  163 ? 86.695 83.460  36.651 1.00 32.55  ? 169  ASP A O     1 
ATOM   1893 C  CB    . ASP C 3  163 ? 89.345 81.734  35.949 1.00 34.42  ? 169  ASP A CB    1 
ATOM   1894 C  CG    . ASP C 3  163 ? 90.834 81.909  35.699 1.00 37.70  ? 169  ASP A CG    1 
ATOM   1895 O  OD1   . ASP C 3  163 ? 91.348 83.039  35.850 1.00 38.05  ? 169  ASP A OD1   1 
ATOM   1896 O  OD2   . ASP C 3  163 ? 91.492 80.912  35.331 1.00 42.50  ? 169  ASP A OD2   1 
ATOM   1897 N  N     . TYR C 3  164 ? 86.723 81.489  37.713 1.00 31.69  ? 170  TYR A N     1 
ATOM   1898 C  CA    . TYR C 3  164 ? 85.273 81.416  37.780 1.00 33.12  ? 170  TYR A CA    1 
ATOM   1899 C  C     . TYR C 3  164 ? 84.773 82.532  38.693 1.00 33.70  ? 170  TYR A C     1 
ATOM   1900 O  O     . TYR C 3  164 ? 83.720 83.120  38.455 1.00 34.85  ? 170  TYR A O     1 
ATOM   1901 C  CB    . TYR C 3  164 ? 84.837 80.057  38.323 1.00 35.69  ? 170  TYR A CB    1 
ATOM   1902 C  CG    . TYR C 3  164 ? 84.550 79.033  37.255 1.00 37.09  ? 170  TYR A CG    1 
ATOM   1903 C  CD1   . TYR C 3  164 ? 83.333 79.040  36.572 1.00 39.24  ? 170  TYR A CD1   1 
ATOM   1904 C  CD2   . TYR C 3  164 ? 85.484 78.048  36.932 1.00 37.94  ? 170  TYR A CD2   1 
ATOM   1905 C  CE1   . TYR C 3  164 ? 83.048 78.091  35.601 1.00 40.43  ? 170  TYR A CE1   1 
ATOM   1906 C  CE2   . TYR C 3  164 ? 85.209 77.092  35.957 1.00 39.82  ? 170  TYR A CE2   1 
ATOM   1907 C  CZ    . TYR C 3  164 ? 83.987 77.120  35.299 1.00 40.67  ? 170  TYR A CZ    1 
ATOM   1908 O  OH    . TYR C 3  164 ? 83.689 76.171  34.351 1.00 44.99  ? 170  TYR A OH    1 
ATOM   1909 N  N     . ASN C 3  165 ? 85.541 82.823  39.737 1.00 32.90  ? 171  ASN A N     1 
ATOM   1910 C  CA    . ASN C 3  165 ? 85.181 83.876  40.677 1.00 31.98  ? 171  ASN A CA    1 
ATOM   1911 C  C     . ASN C 3  165 ? 85.124 85.196  39.909 1.00 30.69  ? 171  ASN A C     1 
ATOM   1912 O  O     . ASN C 3  165 ? 84.206 85.993  40.093 1.00 28.80  ? 171  ASN A O     1 
ATOM   1913 C  CB    . ASN C 3  165 ? 86.225 83.955  41.796 1.00 32.14  ? 171  ASN A CB    1 
ATOM   1914 C  CG    . ASN C 3  165 ? 85.745 84.744  42.997 1.00 33.28  ? 171  ASN A CG    1 
ATOM   1915 O  OD1   . ASN C 3  165 ? 86.522 85.038  43.905 1.00 33.97  ? 171  ASN A OD1   1 
ATOM   1916 N  ND2   . ASN C 3  165 ? 84.460 85.081  43.018 1.00 34.69  ? 171  ASN A ND2   1 
ATOM   1917 N  N     . VAL C 3  166 ? 86.105 85.413  39.037 1.00 32.06  ? 172  VAL A N     1 
ATOM   1918 C  CA    . VAL C 3  166 ? 86.160 86.631  38.231 1.00 30.94  ? 172  VAL A CA    1 
ATOM   1919 C  C     . VAL C 3  166 ? 84.993 86.699  37.251 1.00 30.94  ? 172  VAL A C     1 
ATOM   1920 O  O     . VAL C 3  166 ? 84.365 87.744  37.104 1.00 31.59  ? 172  VAL A O     1 
ATOM   1921 C  CB    . VAL C 3  166 ? 87.488 86.740  37.441 1.00 30.16  ? 172  VAL A CB    1 
ATOM   1922 C  CG1   . VAL C 3  166 ? 87.363 87.789  36.348 1.00 29.89  ? 172  VAL A CG1   1 
ATOM   1923 C  CG2   . VAL C 3  166 ? 88.614 87.142  38.378 1.00 28.55  ? 172  VAL A CG2   1 
ATOM   1924 N  N     . GLN C 3  167 ? 84.696 85.592  36.582 1.00 30.84  ? 173  GLN A N     1 
ATOM   1925 C  CA    . GLN C 3  167 ? 83.580 85.590  35.644 1.00 31.48  ? 173  GLN A CA    1 
ATOM   1926 C  C     . GLN C 3  167 ? 82.256 85.835  36.354 1.00 28.36  ? 173  GLN A C     1 
ATOM   1927 O  O     . GLN C 3  167 ? 81.374 86.482  35.807 1.00 27.05  ? 173  GLN A O     1 
ATOM   1928 C  CB    . GLN C 3  167 ? 83.507 84.268  34.876 1.00 33.65  ? 173  GLN A CB    1 
ATOM   1929 C  CG    . GLN C 3  167 ? 84.406 84.214  33.648 1.00 41.91  ? 173  GLN A CG    1 
ATOM   1930 C  CD    . GLN C 3  167 ? 84.141 85.361  32.676 1.00 46.35  ? 173  GLN A CD    1 
ATOM   1931 O  OE1   . GLN C 3  167 ? 84.923 86.317  32.595 1.00 47.46  ? 173  GLN A OE1   1 
ATOM   1932 N  NE2   . GLN C 3  167 ? 83.031 85.275  31.939 1.00 47.46  ? 173  GLN A NE2   1 
ATOM   1933 N  N     . ASP C 3  168 ? 82.102 85.302  37.561 1.00 27.88  ? 174  ASP A N     1 
ATOM   1934 C  CA    . ASP C 3  168 ? 80.861 85.512  38.295 1.00 28.10  ? 174  ASP A CA    1 
ATOM   1935 C  C     . ASP C 3  168 ? 80.622 87.006  38.485 1.00 26.18  ? 174  ASP A C     1 
ATOM   1936 O  O     . ASP C 3  168 ? 79.512 87.496  38.311 1.00 24.95  ? 174  ASP A O     1 
ATOM   1937 C  CB    . ASP C 3  168 ? 80.905 84.812  39.658 1.00 29.34  ? 174  ASP A CB    1 
ATOM   1938 C  CG    . ASP C 3  168 ? 80.452 83.359  39.585 1.00 32.21  ? 174  ASP A CG    1 
ATOM   1939 O  OD1   . ASP C 3  168 ? 80.206 82.852  38.470 1.00 32.79  ? 174  ASP A OD1   1 
ATOM   1940 O  OD2   . ASP C 3  168 ? 80.341 82.720  40.648 1.00 36.77  ? 174  ASP A OD2   1 
ATOM   1941 N  N     . VAL C 3  169 ? 81.674 87.737  38.816 1.00 24.10  ? 175  VAL A N     1 
ATOM   1942 C  CA    . VAL C 3  169 ? 81.521 89.160  39.028 1.00 24.92  ? 175  VAL A CA    1 
ATOM   1943 C  C     . VAL C 3  169 ? 81.232 89.925  37.745 1.00 25.23  ? 175  VAL A C     1 
ATOM   1944 O  O     . VAL C 3  169 ? 80.393 90.826  37.744 1.00 22.59  ? 175  VAL A O     1 
ATOM   1945 C  CB    . VAL C 3  169 ? 82.755 89.747  39.730 1.00 25.73  ? 175  VAL A CB    1 
ATOM   1946 C  CG1   . VAL C 3  169 ? 82.574 91.244  39.947 1.00 23.65  ? 175  VAL A CG1   1 
ATOM   1947 C  CG2   . VAL C 3  169 ? 82.949 89.048  41.070 1.00 23.41  ? 175  VAL A CG2   1 
ATOM   1948 N  N     . VAL C 3  170 ? 81.904 89.580  36.649 1.00 25.98  ? 176  VAL A N     1 
ATOM   1949 C  CA    . VAL C 3  170 ? 81.630 90.291  35.404 1.00 27.01  ? 176  VAL A CA    1 
ATOM   1950 C  C     . VAL C 3  170 ? 80.177 90.020  35.023 1.00 25.51  ? 176  VAL A C     1 
ATOM   1951 O  O     . VAL C 3  170 ? 79.477 90.915  34.575 1.00 27.15  ? 176  VAL A O     1 
ATOM   1952 C  CB    . VAL C 3  170 ? 82.557 89.851  34.222 1.00 28.86  ? 176  VAL A CB    1 
ATOM   1953 C  CG1   . VAL C 3  170 ? 84.016 89.923  34.632 1.00 29.42  ? 176  VAL A CG1   1 
ATOM   1954 C  CG2   . VAL C 3  170 ? 82.200 88.464  33.758 1.00 33.26  ? 176  VAL A CG2   1 
ATOM   1955 N  N     . VAL C 3  171 ? 79.722 88.785  35.210 1.00 24.51  ? 177  VAL A N     1 
ATOM   1956 C  CA    . VAL C 3  171 ? 78.347 88.439  34.880 1.00 23.28  ? 177  VAL A CA    1 
ATOM   1957 C  C     . VAL C 3  171 ? 77.378 89.128  35.839 1.00 23.42  ? 177  VAL A C     1 
ATOM   1958 O  O     . VAL C 3  171 ? 76.316 89.590  35.424 1.00 23.23  ? 177  VAL A O     1 
ATOM   1959 C  CB    . VAL C 3  171 ? 78.124 86.909  34.922 1.00 22.79  ? 177  VAL A CB    1 
ATOM   1960 C  CG1   . VAL C 3  171 ? 76.641 86.588  34.838 1.00 23.08  ? 177  VAL A CG1   1 
ATOM   1961 C  CG2   . VAL C 3  171 ? 78.852 86.252  33.750 1.00 23.94  ? 177  VAL A CG2   1 
ATOM   1962 N  N     . THR C 3  172 ? 77.745 89.210  37.115 1.00 21.85  ? 178  THR A N     1 
ATOM   1963 C  CA    . THR C 3  172 ? 76.884 89.862  38.091 1.00 22.77  ? 178  THR A CA    1 
ATOM   1964 C  C     . THR C 3  172 ? 76.764 91.350  37.769 1.00 24.13  ? 178  THR A C     1 
ATOM   1965 O  O     . THR C 3  172 ? 75.685 91.938  37.897 1.00 25.06  ? 178  THR A O     1 
ATOM   1966 C  CB    . THR C 3  172 ? 77.423 89.688  39.515 1.00 22.38  ? 178  THR A CB    1 
ATOM   1967 O  OG1   . THR C 3  172 ? 77.418 88.294  39.850 1.00 23.30  ? 178  THR A OG1   1 
ATOM   1968 C  CG2   . THR C 3  172 ? 76.556 90.445  40.513 1.00 21.09  ? 178  THR A CG2   1 
ATOM   1969 N  N     . LYS C 3  173 ? 77.869 91.952  37.335 1.00 24.28  ? 179  LYS A N     1 
ATOM   1970 C  CA    . LYS C 3  173 ? 77.881 93.363  36.978 1.00 24.48  ? 179  LYS A CA    1 
ATOM   1971 C  C     . LYS C 3  173 ? 76.932 93.585  35.807 1.00 25.90  ? 179  LYS A C     1 
ATOM   1972 O  O     . LYS C 3  173 ? 76.165 94.547  35.789 1.00 24.49  ? 179  LYS A O     1 
ATOM   1973 C  CB    . LYS C 3  173 ? 79.284 93.807  36.569 1.00 24.84  ? 179  LYS A CB    1 
ATOM   1974 C  CG    . LYS C 3  173 ? 79.346 95.246  36.070 1.00 25.05  ? 179  LYS A CG    1 
ATOM   1975 C  CD    . LYS C 3  173 ? 80.737 95.591  35.562 1.00 27.04  ? 179  LYS A CD    1 
ATOM   1976 C  CE    . LYS C 3  173 ? 80.844 97.059  35.145 1.00 28.52  ? 179  LYS A CE    1 
ATOM   1977 N  NZ    . LYS C 3  173 ? 79.980 97.414  33.981 1.00 27.79  ? 179  LYS A NZ    1 
ATOM   1978 N  N     . ALA C 3  174 ? 76.979 92.684  34.832 1.00 25.07  ? 180  ALA A N     1 
ATOM   1979 C  CA    . ALA C 3  174 ? 76.115 92.810  33.666 1.00 25.47  ? 180  ALA A CA    1 
ATOM   1980 C  C     . ALA C 3  174 ? 74.655 92.654  34.065 1.00 23.87  ? 180  ALA A C     1 
ATOM   1981 O  O     . ALA C 3  174 ? 73.798 93.405  33.612 1.00 24.96  ? 180  ALA A O     1 
ATOM   1982 C  CB    . ALA C 3  174 ? 76.491 91.769  32.615 1.00 24.92  ? 180  ALA A CB    1 
ATOM   1983 N  N     . LEU C 3  175 ? 74.379 91.669  34.913 1.00 23.81  ? 181  LEU A N     1 
ATOM   1984 C  CA    . LEU C 3  175 ? 73.018 91.412  35.374 1.00 22.74  ? 181  LEU A CA    1 
ATOM   1985 C  C     . LEU C 3  175 ? 72.495 92.668  36.072 1.00 22.30  ? 181  LEU A C     1 
ATOM   1986 O  O     . LEU C 3  175 ? 71.390 93.137  35.793 1.00 19.95  ? 181  LEU A O     1 
ATOM   1987 C  CB    . LEU C 3  175 ? 73.007 90.245  36.359 1.00 23.15  ? 181  LEU A CB    1 
ATOM   1988 C  CG    . LEU C 3  175 ? 71.735 89.401  36.495 1.00 27.00  ? 181  LEU A CG    1 
ATOM   1989 C  CD1   . LEU C 3  175 ? 71.685 88.813  37.895 1.00 23.80  ? 181  LEU A CD1   1 
ATOM   1990 C  CD2   . LEU C 3  175 ? 70.499 90.223  36.236 1.00 25.37  ? 181  LEU A CD2   1 
ATOM   1991 N  N     . LEU C 3  176 ? 73.300 93.201  36.984 1.00 21.39  ? 182  LEU A N     1 
ATOM   1992 C  CA    . LEU C 3  176 ? 72.935 94.401  37.720 1.00 23.06  ? 182  LEU A CA    1 
ATOM   1993 C  C     . LEU C 3  176 ? 72.512 95.534  36.785 1.00 25.13  ? 182  LEU A C     1 
ATOM   1994 O  O     . LEU C 3  176 ? 71.418 96.075  36.916 1.00 26.41  ? 182  LEU A O     1 
ATOM   1995 C  CB    . LEU C 3  176 ? 74.106 94.870  38.583 1.00 21.06  ? 182  LEU A CB    1 
ATOM   1996 C  CG    . LEU C 3  176 ? 73.957 96.216  39.305 1.00 21.50  ? 182  LEU A CG    1 
ATOM   1997 C  CD1   . LEU C 3  176 ? 72.897 96.127  40.398 1.00 19.11  ? 182  LEU A CD1   1 
ATOM   1998 C  CD2   . LEU C 3  176 ? 75.304 96.609  39.894 1.00 16.96  ? 182  LEU A CD2   1 
ATOM   1999 N  N     . GLU C 3  177 ? 73.367 95.888  35.833 1.00 25.83  ? 183  GLU A N     1 
ATOM   2000 C  CA    . GLU C 3  177 ? 73.044 96.980  34.921 1.00 28.29  ? 183  GLU A CA    1 
ATOM   2001 C  C     . GLU C 3  177 ? 71.812 96.702  34.058 1.00 28.41  ? 183  GLU A C     1 
ATOM   2002 O  O     . GLU C 3  177 ? 71.098 97.624  33.666 1.00 29.92  ? 183  GLU A O     1 
ATOM   2003 C  CB    . GLU C 3  177 ? 74.275 97.320  34.077 1.00 26.51  ? 183  GLU A CB    1 
ATOM   2004 C  CG    . GLU C 3  177 ? 75.456 97.695  34.969 1.00 29.59  ? 183  GLU A CG    1 
ATOM   2005 C  CD    . GLU C 3  177 ? 76.736 97.959  34.209 1.00 30.43  ? 183  GLU A CD    1 
ATOM   2006 O  OE1   . GLU C 3  177 ? 76.826 97.548  33.037 1.00 35.80  ? 183  GLU A OE1   1 
ATOM   2007 O  OE2   . GLU C 3  177 ? 77.662 98.562  34.787 1.00 29.74  ? 183  GLU A OE2   1 
ATOM   2008 N  N     . LYS C 3  178 ? 71.542 95.433  33.784 1.00 27.00  ? 184  LYS A N     1 
ATOM   2009 C  CA    . LYS C 3  178 ? 70.365 95.083  33.003 1.00 28.06  ? 184  LYS A CA    1 
ATOM   2010 C  C     . LYS C 3  178 ? 69.120 95.355  33.841 1.00 26.69  ? 184  LYS A C     1 
ATOM   2011 O  O     . LYS C 3  178 ? 68.114 95.845  33.333 1.00 27.73  ? 184  LYS A O     1 
ATOM   2012 C  CB    . LYS C 3  178 ? 70.406 93.607  32.608 1.00 31.14  ? 184  LYS A CB    1 
ATOM   2013 C  CG    . LYS C 3  178 ? 69.118 93.081  31.995 1.00 36.60  ? 184  LYS A CG    1 
ATOM   2014 C  CD    . LYS C 3  178 ? 69.261 91.602  31.648 1.00 40.90  ? 184  LYS A CD    1 
ATOM   2015 C  CE    . LYS C 3  178 ? 67.982 91.020  31.072 1.00 43.04  ? 184  LYS A CE    1 
ATOM   2016 N  NZ    . LYS C 3  178 ? 68.169 89.580  30.749 1.00 44.92  ? 184  LYS A NZ    1 
ATOM   2017 N  N     . LEU C 3  179 ? 69.194 95.037  35.129 1.00 24.58  ? 185  LEU A N     1 
ATOM   2018 C  CA    . LEU C 3  179 ? 68.072 95.247  36.030 1.00 23.99  ? 185  LEU A CA    1 
ATOM   2019 C  C     . LEU C 3  179 ? 67.873 96.736  36.331 1.00 23.71  ? 185  LEU A C     1 
ATOM   2020 O  O     . LEU C 3  179 ? 66.741 97.221  36.376 1.00 21.14  ? 185  LEU A O     1 
ATOM   2021 C  CB    . LEU C 3  179 ? 68.301 94.474  37.330 1.00 24.04  ? 185  LEU A CB    1 
ATOM   2022 C  CG    . LEU C 3  179 ? 68.465 92.958  37.184 1.00 24.82  ? 185  LEU A CG    1 
ATOM   2023 C  CD1   . LEU C 3  179 ? 68.956 92.374  38.501 1.00 23.20  ? 185  LEU A CD1   1 
ATOM   2024 C  CD2   . LEU C 3  179 ? 67.145 92.318  36.772 1.00 23.52  ? 185  LEU A CD2   1 
ATOM   2025 N  N     . LEU C 3  180 ? 68.973 97.456  36.534 1.00 21.41  ? 186  LEU A N     1 
ATOM   2026 C  CA    . LEU C 3  180 ? 68.898 98.883  36.815 1.00 24.62  ? 186  LEU A CA    1 
ATOM   2027 C  C     . LEU C 3  180 ? 68.330 99.666  35.631 1.00 25.85  ? 186  LEU A C     1 
ATOM   2028 O  O     . LEU C 3  180 ? 67.815 100.767 35.796 1.00 25.09  ? 186  LEU A O     1 
ATOM   2029 C  CB    . LEU C 3  180 ? 70.283 99.443  37.163 1.00 23.94  ? 186  LEU A CB    1 
ATOM   2030 C  CG    . LEU C 3  180 ? 70.933 99.053  38.488 1.00 23.17  ? 186  LEU A CG    1 
ATOM   2031 C  CD1   . LEU C 3  180 ? 72.227 99.835  38.650 1.00 22.20  ? 186  LEU A CD1   1 
ATOM   2032 C  CD2   . LEU C 3  180 ? 69.979 99.347  39.648 1.00 22.46  ? 186  LEU A CD2   1 
ATOM   2033 N  N     . SER C 3  181 ? 68.428 99.090  34.437 1.00 27.59  ? 187  SER A N     1 
ATOM   2034 C  CA    . SER C 3  181 ? 67.924 99.744  33.237 1.00 27.73  ? 187  SER A CA    1 
ATOM   2035 C  C     . SER C 3  181 ? 66.407 99.661  33.149 1.00 28.58  ? 187  SER A C     1 
ATOM   2036 O  O     . SER C 3  181 ? 65.810 100.149 32.190 1.00 28.46  ? 187  SER A O     1 
ATOM   2037 C  CB    . SER C 3  181 ? 68.531 99.104  31.982 1.00 26.70  ? 187  SER A CB    1 
ATOM   2038 O  OG    . SER C 3  181 ? 67.859 97.901  31.645 1.00 27.60  ? 187  SER A OG    1 
ATOM   2039 N  N     . ASP C 3  182 ? 65.772 99.041  34.135 1.00 29.08  ? 188  ASP A N     1 
ATOM   2040 C  CA    . ASP C 3  182 ? 64.323 98.933  34.089 1.00 30.78  ? 188  ASP A CA    1 
ATOM   2041 C  C     . ASP C 3  182 ? 63.681 100.193 34.651 1.00 31.79  ? 188  ASP A C     1 
ATOM   2042 O  O     . ASP C 3  182 ? 63.561 100.366 35.866 1.00 31.92  ? 188  ASP A O     1 
ATOM   2043 C  CB    . ASP C 3  182 ? 63.831 97.704  34.856 1.00 29.76  ? 188  ASP A CB    1 
ATOM   2044 C  CG    . ASP C 3  182 ? 62.357 97.443  34.631 1.00 30.04  ? 188  ASP A CG    1 
ATOM   2045 O  OD1   . ASP C 3  182 ? 61.572 98.405  34.747 1.00 30.20  ? 188  ASP A OD1   1 
ATOM   2046 O  OD2   . ASP C 3  182 ? 61.974 96.289  34.341 1.00 29.64  ? 188  ASP A OD2   1 
ATOM   2047 N  N     . LYS C 3  183 ? 63.277 101.064 33.735 1.00 31.81  ? 189  LYS A N     1 
ATOM   2048 C  CA    . LYS C 3  183 ? 62.645 102.337 34.049 1.00 33.14  ? 189  LYS A CA    1 
ATOM   2049 C  C     . LYS C 3  183 ? 61.514 102.263 35.077 1.00 29.77  ? 189  LYS A C     1 
ATOM   2050 O  O     . LYS C 3  183 ? 61.308 103.200 35.838 1.00 28.73  ? 189  LYS A O     1 
ATOM   2051 C  CB    . LYS C 3  183 ? 62.150 102.972 32.739 1.00 38.68  ? 189  LYS A CB    1 
ATOM   2052 C  CG    . LYS C 3  183 ? 61.060 104.027 32.886 1.00 46.66  ? 189  LYS A CG    1 
ATOM   2053 C  CD    . LYS C 3  183 ? 61.339 105.250 31.997 1.00 51.90  ? 189  LYS A CD    1 
ATOM   2054 C  CE    . LYS C 3  183 ? 60.126 106.177 31.891 1.00 52.67  ? 189  LYS A CE    1 
ATOM   2055 N  NZ    . LYS C 3  183 ? 59.591 106.556 33.230 1.00 54.35  ? 189  LYS A NZ    1 
ATOM   2056 N  N     . HIS C 3  184 ? 60.787 101.154 35.114 1.00 27.63  ? 190  HIS A N     1 
ATOM   2057 C  CA    . HIS C 3  184 ? 59.694 101.027 36.072 1.00 26.57  ? 190  HIS A CA    1 
ATOM   2058 C  C     . HIS C 3  184 ? 60.179 101.017 37.520 1.00 25.87  ? 190  HIS A C     1 
ATOM   2059 O  O     . HIS C 3  184 ? 59.513 101.546 38.407 1.00 27.19  ? 190  HIS A O     1 
ATOM   2060 C  CB    . HIS C 3  184 ? 58.894 99.752  35.822 1.00 25.32  ? 190  HIS A CB    1 
ATOM   2061 C  CG    . HIS C 3  184 ? 57.703 99.606  36.718 1.00 27.22  ? 190  HIS A CG    1 
ATOM   2062 N  ND1   . HIS C 3  184 ? 56.508 100.252 36.480 1.00 29.15  ? 190  HIS A ND1   1 
ATOM   2063 C  CD2   . HIS C 3  184 ? 57.528 98.907  37.865 1.00 27.41  ? 190  HIS A CD2   1 
ATOM   2064 C  CE1   . HIS C 3  184 ? 55.650 99.956  37.440 1.00 28.76  ? 190  HIS A CE1   1 
ATOM   2065 N  NE2   . HIS C 3  184 ? 56.244 99.141  38.294 1.00 26.07  ? 190  HIS A NE2   1 
ATOM   2066 N  N     . TYR C 3  185 ? 61.339 100.419 37.757 1.00 24.12  ? 191  TYR A N     1 
ATOM   2067 C  CA    . TYR C 3  185 ? 61.872 100.329 39.105 1.00 22.48  ? 191  TYR A CA    1 
ATOM   2068 C  C     . TYR C 3  185 ? 62.924 101.370 39.425 1.00 23.53  ? 191  TYR A C     1 
ATOM   2069 O  O     . TYR C 3  185 ? 63.027 101.812 40.568 1.00 23.64  ? 191  TYR A O     1 
ATOM   2070 C  CB    . TYR C 3  185 ? 62.454 98.934  39.345 1.00 18.70  ? 191  TYR A CB    1 
ATOM   2071 C  CG    . TYR C 3  185 ? 61.420 97.855  39.213 1.00 18.14  ? 191  TYR A CG    1 
ATOM   2072 C  CD1   . TYR C 3  185 ? 61.056 97.357  37.961 1.00 17.93  ? 191  TYR A CD1   1 
ATOM   2073 C  CD2   . TYR C 3  185 ? 60.745 97.378  40.335 1.00 18.81  ? 191  TYR A CD2   1 
ATOM   2074 C  CE1   . TYR C 3  185 ? 60.039 96.411  37.834 1.00 16.91  ? 191  TYR A CE1   1 
ATOM   2075 C  CE2   . TYR C 3  185 ? 59.727 96.436  40.218 1.00 18.17  ? 191  TYR A CE2   1 
ATOM   2076 C  CZ    . TYR C 3  185 ? 59.381 95.959  38.966 1.00 16.80  ? 191  TYR A CZ    1 
ATOM   2077 O  OH    . TYR C 3  185 ? 58.368 95.038  38.861 1.00 20.73  ? 191  TYR A OH    1 
ATOM   2078 N  N     . PHE C 3  186 ? 63.710 101.753 38.424 1.00 24.49  ? 192  PHE A N     1 
ATOM   2079 C  CA    . PHE C 3  186 ? 64.768 102.735 38.632 1.00 25.03  ? 192  PHE A CA    1 
ATOM   2080 C  C     . PHE C 3  186 ? 64.636 103.929 37.681 1.00 26.74  ? 192  PHE A C     1 
ATOM   2081 O  O     . PHE C 3  186 ? 64.778 103.788 36.467 1.00 23.79  ? 192  PHE A O     1 
ATOM   2082 C  CB    . PHE C 3  186 ? 66.136 102.060 38.448 1.00 23.02  ? 192  PHE A CB    1 
ATOM   2083 C  CG    . PHE C 3  186 ? 66.386 100.928 39.410 1.00 21.73  ? 192  PHE A CG    1 
ATOM   2084 C  CD1   . PHE C 3  186 ? 66.840 101.183 40.701 1.00 21.59  ? 192  PHE A CD1   1 
ATOM   2085 C  CD2   . PHE C 3  186 ? 66.119 99.610  39.043 1.00 19.45  ? 192  PHE A CD2   1 
ATOM   2086 C  CE1   . PHE C 3  186 ? 67.023 100.144 41.618 1.00 20.16  ? 192  PHE A CE1   1 
ATOM   2087 C  CE2   . PHE C 3  186 ? 66.299 98.562  39.951 1.00 18.86  ? 192  PHE A CE2   1 
ATOM   2088 C  CZ    . PHE C 3  186 ? 66.751 98.835  41.243 1.00 20.77  ? 192  PHE A CZ    1 
ATOM   2089 N  N     . PRO C 3  187 ? 64.353 105.121 38.227 1.00 29.13  ? 193  PRO A N     1 
ATOM   2090 C  CA    . PRO C 3  187 ? 64.211 106.327 37.401 1.00 32.57  ? 193  PRO A CA    1 
ATOM   2091 C  C     . PRO C 3  187 ? 65.428 106.566 36.514 1.00 33.94  ? 193  PRO A C     1 
ATOM   2092 O  O     . PRO C 3  187 ? 66.566 106.496 36.972 1.00 34.21  ? 193  PRO A O     1 
ATOM   2093 C  CB    . PRO C 3  187 ? 64.025 107.436 38.435 1.00 30.55  ? 193  PRO A CB    1 
ATOM   2094 C  CG    . PRO C 3  187 ? 63.247 106.738 39.505 1.00 32.78  ? 193  PRO A CG    1 
ATOM   2095 C  CD    . PRO C 3  187 ? 63.972 105.399 39.624 1.00 30.56  ? 193  PRO A CD    1 
ATOM   2096 N  N     . PRO C 3  188 ? 65.195 106.859 35.226 1.00 36.51  ? 194  PRO A N     1 
ATOM   2097 C  CA    . PRO C 3  188 ? 66.269 107.111 34.259 1.00 37.93  ? 194  PRO A CA    1 
ATOM   2098 C  C     . PRO C 3  188 ? 67.212 108.254 34.649 1.00 38.58  ? 194  PRO A C     1 
ATOM   2099 O  O     . PRO C 3  188 ? 68.406 108.185 34.372 1.00 39.55  ? 194  PRO A O     1 
ATOM   2100 C  CB    . PRO C 3  188 ? 65.507 107.421 32.967 1.00 37.95  ? 194  PRO A CB    1 
ATOM   2101 C  CG    . PRO C 3  188 ? 64.224 106.684 33.140 1.00 38.04  ? 194  PRO A CG    1 
ATOM   2102 C  CD    . PRO C 3  188 ? 63.877 106.950 34.578 1.00 35.65  ? 194  PRO A CD    1 
ATOM   2103 N  N     . GLU C 3  189 ? 66.683 109.293 35.297 1.00 39.56  ? 195  GLU A N     1 
ATOM   2104 C  CA    . GLU C 3  189 ? 67.493 110.460 35.684 1.00 40.74  ? 195  GLU A CA    1 
ATOM   2105 C  C     . GLU C 3  189 ? 68.635 110.180 36.652 1.00 39.13  ? 195  GLU A C     1 
ATOM   2106 O  O     . GLU C 3  189 ? 69.517 111.021 36.833 1.00 39.34  ? 195  GLU A O     1 
ATOM   2107 C  CB    . GLU C 3  189 ? 66.627 111.550 36.326 1.00 43.14  ? 195  GLU A CB    1 
ATOM   2108 C  CG    . GLU C 3  189 ? 65.355 111.888 35.592 1.00 49.62  ? 195  GLU A CG    1 
ATOM   2109 C  CD    . GLU C 3  189 ? 64.314 110.803 35.736 1.00 53.84  ? 195  GLU A CD    1 
ATOM   2110 O  OE1   . GLU C 3  189 ? 64.020 110.417 36.890 1.00 54.46  ? 195  GLU A OE1   1 
ATOM   2111 O  OE2   . GLU C 3  189 ? 63.789 110.340 34.700 1.00 57.35  ? 195  GLU A OE2   1 
ATOM   2112 N  N     . ILE C 3  190 ? 68.622 109.013 37.281 1.00 36.28  ? 196  ILE A N     1 
ATOM   2113 C  CA    . ILE C 3  190 ? 69.651 108.695 38.261 1.00 31.58  ? 196  ILE A CA    1 
ATOM   2114 C  C     . ILE C 3  190 ? 70.532 107.513 37.871 1.00 29.31  ? 196  ILE A C     1 
ATOM   2115 O  O     . ILE C 3  190 ? 70.038 106.488 37.414 1.00 28.73  ? 196  ILE A O     1 
ATOM   2116 C  CB    . ILE C 3  190 ? 68.988 108.405 39.628 1.00 31.48  ? 196  ILE A CB    1 
ATOM   2117 C  CG1   . ILE C 3  190 ? 68.068 109.568 40.007 1.00 30.99  ? 196  ILE A CG1   1 
ATOM   2118 C  CG2   . ILE C 3  190 ? 70.041 108.205 40.693 1.00 30.40  ? 196  ILE A CG2   1 
ATOM   2119 C  CD1   . ILE C 3  190 ? 67.144 109.270 41.170 1.00 29.60  ? 196  ILE A CD1   1 
ATOM   2120 N  N     . ASP C 3  191 ? 71.842 107.673 38.036 1.00 28.27  ? 197  ASP A N     1 
ATOM   2121 C  CA    . ASP C 3  191 ? 72.790 106.597 37.751 1.00 26.90  ? 197  ASP A CA    1 
ATOM   2122 C  C     . ASP C 3  191 ? 72.928 105.873 39.084 1.00 26.44  ? 197  ASP A C     1 
ATOM   2123 O  O     . ASP C 3  191 ? 73.689 106.302 39.949 1.00 24.66  ? 197  ASP A O     1 
ATOM   2124 C  CB    . ASP C 3  191 ? 74.148 107.169 37.343 1.00 28.70  ? 197  ASP A CB    1 
ATOM   2125 C  CG    . ASP C 3  191 ? 75.196 106.084 37.082 1.00 34.34  ? 197  ASP A CG    1 
ATOM   2126 O  OD1   . ASP C 3  191 ? 74.935 104.892 37.378 1.00 31.10  ? 197  ASP A OD1   1 
ATOM   2127 O  OD2   . ASP C 3  191 ? 76.294 106.431 36.584 1.00 36.90  ? 197  ASP A OD2   1 
ATOM   2128 N  N     . PHE C 3  192 ? 72.188 104.784 39.262 1.00 25.16  ? 198  PHE A N     1 
ATOM   2129 C  CA    . PHE C 3  192 ? 72.243 104.063 40.523 1.00 24.09  ? 198  PHE A CA    1 
ATOM   2130 C  C     . PHE C 3  192 ? 73.554 103.345 40.836 1.00 24.40  ? 198  PHE A C     1 
ATOM   2131 O  O     . PHE C 3  192 ? 73.695 102.768 41.906 1.00 26.84  ? 198  PHE A O     1 
ATOM   2132 C  CB    . PHE C 3  192 ? 71.068 103.088 40.620 1.00 23.55  ? 198  PHE A CB    1 
ATOM   2133 C  CG    . PHE C 3  192 ? 69.734 103.768 40.830 1.00 22.13  ? 198  PHE A CG    1 
ATOM   2134 C  CD1   . PHE C 3  192 ? 68.981 104.203 39.751 1.00 19.29  ? 198  PHE A CD1   1 
ATOM   2135 C  CD2   . PHE C 3  192 ? 69.253 103.999 42.114 1.00 21.21  ? 198  PHE A CD2   1 
ATOM   2136 C  CE1   . PHE C 3  192 ? 67.768 104.861 39.943 1.00 21.82  ? 198  PHE A CE1   1 
ATOM   2137 C  CE2   . PHE C 3  192 ? 68.041 104.659 42.319 1.00 23.33  ? 198  PHE A CE2   1 
ATOM   2138 C  CZ    . PHE C 3  192 ? 67.295 105.092 41.228 1.00 20.01  ? 198  PHE A CZ    1 
ATOM   2139 N  N     . THR C 3  193 ? 74.514 103.368 39.920 1.00 24.63  ? 199  THR A N     1 
ATOM   2140 C  CA    . THR C 3  193 ? 75.796 102.725 40.195 1.00 25.65  ? 199  THR A CA    1 
ATOM   2141 C  C     . THR C 3  193 ? 76.733 103.805 40.718 1.00 25.26  ? 199  THR A C     1 
ATOM   2142 O  O     . THR C 3  193 ? 77.916 103.559 40.946 1.00 25.51  ? 199  THR A O     1 
ATOM   2143 C  CB    . THR C 3  193 ? 76.449 102.100 38.927 1.00 25.99  ? 199  THR A CB    1 
ATOM   2144 O  OG1   . THR C 3  193 ? 76.813 103.137 38.005 1.00 29.06  ? 199  THR A OG1   1 
ATOM   2145 C  CG2   . THR C 3  193 ? 75.497 101.133 38.245 1.00 24.51  ? 199  THR A CG2   1 
ATOM   2146 N  N     . ASP C 3  194 ? 76.194 105.003 40.919 1.00 23.99  ? 200  ASP A N     1 
ATOM   2147 C  CA    . ASP C 3  194 ? 77.005 106.114 41.395 1.00 25.24  ? 200  ASP A CA    1 
ATOM   2148 C  C     . ASP C 3  194 ? 76.321 106.949 42.475 1.00 26.53  ? 200  ASP A C     1 
ATOM   2149 O  O     . ASP C 3  194 ? 76.428 108.178 42.485 1.00 25.26  ? 200  ASP A O     1 
ATOM   2150 C  CB    . ASP C 3  194 ? 77.395 107.003 40.213 1.00 27.03  ? 200  ASP A CB    1 
ATOM   2151 C  CG    . ASP C 3  194 ? 78.353 108.111 40.603 1.00 31.93  ? 200  ASP A CG    1 
ATOM   2152 O  OD1   . ASP C 3  194 ? 79.328 107.825 41.337 1.00 33.00  ? 200  ASP A OD1   1 
ATOM   2153 O  OD2   . ASP C 3  194 ? 78.135 109.267 40.166 1.00 33.65  ? 200  ASP A OD2   1 
ATOM   2154 N  N     . VAL C 3  195 ? 75.622 106.275 43.386 1.00 25.60  ? 201  VAL A N     1 
ATOM   2155 C  CA    . VAL C 3  195 ? 74.943 106.952 44.487 1.00 25.70  ? 201  VAL A CA    1 
ATOM   2156 C  C     . VAL C 3  195 ? 75.170 106.247 45.827 1.00 26.30  ? 201  VAL A C     1 
ATOM   2157 O  O     . VAL C 3  195 ? 75.506 105.057 45.873 1.00 25.88  ? 201  VAL A O     1 
ATOM   2158 C  CB    . VAL C 3  195 ? 73.428 107.045 44.237 1.00 25.13  ? 201  VAL A CB    1 
ATOM   2159 C  CG1   . VAL C 3  195 ? 73.153 107.923 43.012 1.00 24.88  ? 201  VAL A CG1   1 
ATOM   2160 C  CG2   . VAL C 3  195 ? 72.852 105.658 44.043 1.00 21.71  ? 201  VAL A CG2   1 
ATOM   2161 N  N     . GLY C 3  196 ? 75.002 106.988 46.917 1.00 24.46  ? 202  GLY A N     1 
ATOM   2162 C  CA    . GLY C 3  196 ? 75.176 106.400 48.233 1.00 24.38  ? 202  GLY A CA    1 
ATOM   2163 C  C     . GLY C 3  196 ? 74.004 105.484 48.516 1.00 24.67  ? 202  GLY A C     1 
ATOM   2164 O  O     . GLY C 3  196 ? 72.997 105.541 47.813 1.00 26.41  ? 202  GLY A O     1 
ATOM   2165 N  N     . TYR C 3  197 ? 74.104 104.659 49.553 1.00 23.84  ? 203  TYR A N     1 
ATOM   2166 C  CA    . TYR C 3  197 ? 73.026 103.726 49.858 1.00 22.84  ? 203  TYR A CA    1 
ATOM   2167 C  C     . TYR C 3  197 ? 71.676 104.387 50.144 1.00 24.21  ? 203  TYR A C     1 
ATOM   2168 O  O     . TYR C 3  197 ? 70.640 103.901 49.680 1.00 24.71  ? 203  TYR A O     1 
ATOM   2169 C  CB    . TYR C 3  197 ? 73.437 102.786 51.011 1.00 21.71  ? 203  TYR A CB    1 
ATOM   2170 C  CG    . TYR C 3  197 ? 73.293 103.342 52.409 1.00 20.50  ? 203  TYR A CG    1 
ATOM   2171 C  CD1   . TYR C 3  197 ? 72.055 103.348 53.053 1.00 20.12  ? 203  TYR A CD1   1 
ATOM   2172 C  CD2   . TYR C 3  197 ? 74.399 103.855 53.094 1.00 21.23  ? 203  TYR A CD2   1 
ATOM   2173 C  CE1   . TYR C 3  197 ? 71.918 103.849 54.340 1.00 18.76  ? 203  TYR A CE1   1 
ATOM   2174 C  CE2   . TYR C 3  197 ? 74.271 104.362 54.387 1.00 18.98  ? 203  TYR A CE2   1 
ATOM   2175 C  CZ    . TYR C 3  197 ? 73.028 104.354 54.999 1.00 20.39  ? 203  TYR A CZ    1 
ATOM   2176 O  OH    . TYR C 3  197 ? 72.884 104.866 56.270 1.00 24.00  ? 203  TYR A OH    1 
ATOM   2177 N  N     . THR C 3  198 ? 71.670 105.490 50.887 1.00 22.33  ? 204  THR A N     1 
ATOM   2178 C  CA    . THR C 3  198 ? 70.408 106.154 51.187 1.00 23.98  ? 204  THR A CA    1 
ATOM   2179 C  C     . THR C 3  198 ? 69.681 106.579 49.909 1.00 25.23  ? 204  THR A C     1 
ATOM   2180 O  O     . THR C 3  198 ? 68.469 106.416 49.798 1.00 27.11  ? 204  THR A O     1 
ATOM   2181 C  CB    . THR C 3  198 ? 70.607 107.385 52.090 1.00 26.44  ? 204  THR A CB    1 
ATOM   2182 O  OG1   . THR C 3  198 ? 71.264 106.989 53.303 1.00 26.24  ? 204  THR A OG1   1 
ATOM   2183 C  CG2   . THR C 3  198 ? 69.250 107.995 52.455 1.00 25.06  ? 204  THR A CG2   1 
ATOM   2184 N  N     . THR C 3  199 ? 70.417 107.115 48.941 1.00 24.81  ? 205  THR A N     1 
ATOM   2185 C  CA    . THR C 3  199 ? 69.817 107.524 47.676 1.00 24.86  ? 205  THR A CA    1 
ATOM   2186 C  C     . THR C 3  199 ? 69.285 106.307 46.909 1.00 25.42  ? 205  THR A C     1 
ATOM   2187 O  O     . THR C 3  199 ? 68.219 106.363 46.297 1.00 25.51  ? 205  THR A O     1 
ATOM   2188 C  CB    . THR C 3  199 ? 70.846 108.236 46.779 1.00 25.46  ? 205  THR A CB    1 
ATOM   2189 O  OG1   . THR C 3  199 ? 71.257 109.456 47.403 1.00 25.42  ? 205  THR A OG1   1 
ATOM   2190 C  CG2   . THR C 3  199 ? 70.253 108.537 45.418 1.00 25.04  ? 205  THR A CG2   1 
ATOM   2191 N  N     . PHE C 3  200 ? 70.031 105.207 46.946 1.00 25.15  ? 206  PHE A N     1 
ATOM   2192 C  CA    . PHE C 3  200 ? 69.623 103.993 46.240 1.00 23.88  ? 206  PHE A CA    1 
ATOM   2193 C  C     . PHE C 3  200 ? 68.258 103.496 46.707 1.00 23.80  ? 206  PHE A C     1 
ATOM   2194 O  O     . PHE C 3  200 ? 67.396 103.184 45.885 1.00 22.92  ? 206  PHE A O     1 
ATOM   2195 C  CB    . PHE C 3  200 ? 70.678 102.889 46.424 1.00 22.66  ? 206  PHE A CB    1 
ATOM   2196 C  CG    . PHE C 3  200 ? 70.384 101.633 45.653 1.00 22.18  ? 206  PHE A CG    1 
ATOM   2197 C  CD1   . PHE C 3  200 ? 69.549 100.651 46.182 1.00 20.95  ? 206  PHE A CD1   1 
ATOM   2198 C  CD2   . PHE C 3  200 ? 70.928 101.442 44.386 1.00 19.25  ? 206  PHE A CD2   1 
ATOM   2199 C  CE1   . PHE C 3  200 ? 69.262 99.496  45.460 1.00 19.74  ? 206  PHE A CE1   1 
ATOM   2200 C  CE2   . PHE C 3  200 ? 70.644 100.289 43.652 1.00 20.22  ? 206  PHE A CE2   1 
ATOM   2201 C  CZ    . PHE C 3  200 ? 69.810 99.315  44.191 1.00 19.88  ? 206  PHE A CZ    1 
ATOM   2202 N  N     . TRP C 3  201 ? 68.060 103.420 48.020 1.00 22.99  ? 207  TRP A N     1 
ATOM   2203 C  CA    . TRP C 3  201 ? 66.788 102.953 48.560 1.00 23.97  ? 207  TRP A CA    1 
ATOM   2204 C  C     . TRP C 3  201 ? 65.653 103.984 48.435 1.00 25.69  ? 207  TRP A C     1 
ATOM   2205 O  O     . TRP C 3  201 ? 64.529 103.631 48.076 1.00 25.44  ? 207  TRP A O     1 
ATOM   2206 C  CB    . TRP C 3  201 ? 66.940 102.545 50.034 1.00 23.71  ? 207  TRP A CB    1 
ATOM   2207 C  CG    . TRP C 3  201 ? 68.023 101.503 50.312 1.00 24.01  ? 207  TRP A CG    1 
ATOM   2208 C  CD1   . TRP C 3  201 ? 69.100 101.656 51.130 1.00 21.87  ? 207  TRP A CD1   1 
ATOM   2209 C  CD2   . TRP C 3  201 ? 68.127 100.177 49.762 1.00 22.32  ? 207  TRP A CD2   1 
ATOM   2210 N  NE1   . TRP C 3  201 ? 69.868 100.523 51.124 1.00 23.74  ? 207  TRP A NE1   1 
ATOM   2211 C  CE2   . TRP C 3  201 ? 69.297 99.597  50.294 1.00 24.60  ? 207  TRP A CE2   1 
ATOM   2212 C  CE3   . TRP C 3  201 ? 67.345 99.426  48.874 1.00 22.99  ? 207  TRP A CE3   1 
ATOM   2213 C  CZ2   . TRP C 3  201 ? 69.711 98.295  49.968 1.00 23.88  ? 207  TRP A CZ2   1 
ATOM   2214 C  CZ3   . TRP C 3  201 ? 67.752 98.133  48.547 1.00 23.44  ? 207  TRP A CZ3   1 
ATOM   2215 C  CH2   . TRP C 3  201 ? 68.928 97.581  49.096 1.00 24.57  ? 207  TRP A CH2   1 
ATOM   2216 N  N     . SER C 3  202 ? 65.932 105.254 48.715 1.00 26.78  ? 208  SER A N     1 
ATOM   2217 C  CA    . SER C 3  202 ? 64.881 106.277 48.639 1.00 29.28  ? 208  SER A CA    1 
ATOM   2218 C  C     . SER C 3  202 ? 64.455 106.697 47.226 1.00 27.99  ? 208  SER A C     1 
ATOM   2219 O  O     . SER C 3  202 ? 63.326 107.139 47.028 1.00 27.77  ? 208  SER A O     1 
ATOM   2220 C  CB    . SER C 3  202 ? 65.294 107.525 49.426 1.00 29.62  ? 208  SER A CB    1 
ATOM   2221 O  OG    . SER C 3  202 ? 66.402 108.157 48.815 1.00 35.11  ? 208  SER A OG    1 
ATOM   2222 N  N     . GLU C 3  203 ? 65.345 106.555 46.247 1.00 28.67  ? 209  GLU A N     1 
ATOM   2223 C  CA    . GLU C 3  203 ? 65.028 106.943 44.869 1.00 27.69  ? 209  GLU A CA    1 
ATOM   2224 C  C     . GLU C 3  203 ? 64.471 105.815 43.998 1.00 26.55  ? 209  GLU A C     1 
ATOM   2225 O  O     . GLU C 3  203 ? 63.884 106.083 42.952 1.00 26.24  ? 209  GLU A O     1 
ATOM   2226 C  CB    . GLU C 3  203 ? 66.266 107.516 44.175 1.00 29.24  ? 209  GLU A CB    1 
ATOM   2227 C  CG    . GLU C 3  203 ? 66.853 108.764 44.817 1.00 36.10  ? 209  GLU A CG    1 
ATOM   2228 C  CD    . GLU C 3  203 ? 65.947 109.973 44.700 1.00 39.20  ? 209  GLU A CD    1 
ATOM   2229 O  OE1   . GLU C 3  203 ? 65.406 110.207 43.598 1.00 41.78  ? 209  GLU A OE1   1 
ATOM   2230 O  OE2   . GLU C 3  203 ? 65.785 110.692 45.705 1.00 41.99  ? 209  GLU A OE2   1 
ATOM   2231 N  N     . SER C 3  204 ? 64.667 104.561 44.402 1.00 24.41  ? 210  SER A N     1 
ATOM   2232 C  CA    . SER C 3  204 ? 64.156 103.437 43.617 1.00 23.95  ? 210  SER A CA    1 
ATOM   2233 C  C     . SER C 3  204 ? 62.751 103.101 44.086 1.00 22.44  ? 210  SER A C     1 
ATOM   2234 O  O     . SER C 3  204 ? 62.340 103.536 45.153 1.00 23.86  ? 210  SER A O     1 
ATOM   2235 C  CB    . SER C 3  204 ? 65.059 102.213 43.776 1.00 24.78  ? 210  SER A CB    1 
ATOM   2236 O  OG    . SER C 3  204 ? 65.123 101.797 45.129 1.00 27.57  ? 210  SER A OG    1 
ATOM   2237 N  N     . LEU C 3  205 ? 62.014 102.332 43.294 1.00 22.32  ? 211  LEU A N     1 
ATOM   2238 C  CA    . LEU C 3  205 ? 60.645 101.957 43.655 1.00 21.57  ? 211  LEU A CA    1 
ATOM   2239 C  C     . LEU C 3  205 ? 60.633 101.298 45.035 1.00 23.56  ? 211  LEU A C     1 
ATOM   2240 O  O     . LEU C 3  205 ? 61.576 100.588 45.399 1.00 22.43  ? 211  LEU A O     1 
ATOM   2241 C  CB    . LEU C 3  205 ? 60.075 100.995 42.608 1.00 20.65  ? 211  LEU A CB    1 
ATOM   2242 C  CG    . LEU C 3  205 ? 58.551 100.866 42.499 1.00 21.07  ? 211  LEU A CG    1 
ATOM   2243 C  CD1   . LEU C 3  205 ? 57.929 102.185 42.028 1.00 18.18  ? 211  LEU A CD1   1 
ATOM   2244 C  CD2   . LEU C 3  205 ? 58.221 99.750  41.521 1.00 18.84  ? 211  LEU A CD2   1 
ATOM   2245 N  N     . GLU C 3  206 ? 59.571 101.544 45.804 1.00 23.72  ? 212  GLU A N     1 
ATOM   2246 C  CA    . GLU C 3  206 ? 59.433 100.979 47.143 1.00 23.09  ? 212  GLU A CA    1 
ATOM   2247 C  C     . GLU C 3  206 ? 59.701 99.470  47.185 1.00 23.14  ? 212  GLU A C     1 
ATOM   2248 O  O     . GLU C 3  206 ? 60.339 98.976  48.114 1.00 22.48  ? 212  GLU A O     1 
ATOM   2249 C  CB    . GLU C 3  206 ? 58.030 101.265 47.700 1.00 24.90  ? 212  GLU A CB    1 
ATOM   2250 C  CG    . GLU C 3  206 ? 57.760 100.646 49.082 1.00 25.44  ? 212  GLU A CG    1 
ATOM   2251 C  CD    . GLU C 3  206 ? 56.385 100.995 49.637 1.00 27.74  ? 212  GLU A CD    1 
ATOM   2252 O  OE1   . GLU C 3  206 ? 55.494 101.362 48.843 1.00 30.72  ? 212  GLU A OE1   1 
ATOM   2253 O  OE2   . GLU C 3  206 ? 56.181 100.889 50.866 1.00 26.76  ? 212  GLU A OE2   1 
ATOM   2254 N  N     . ALA C 3  207 ? 59.224 98.748  46.176 1.00 20.51  ? 213  ALA A N     1 
ATOM   2255 C  CA    . ALA C 3  207 ? 59.395 97.296  46.117 1.00 20.66  ? 213  ALA A CA    1 
ATOM   2256 C  C     . ALA C 3  207 ? 60.853 96.833  46.229 1.00 19.42  ? 213  ALA A C     1 
ATOM   2257 O  O     . ALA C 3  207 ? 61.132 95.764  46.781 1.00 17.46  ? 213  ALA A O     1 
ATOM   2258 C  CB    . ALA C 3  207 ? 58.769 96.746  44.832 1.00 17.18  ? 213  ALA A CB    1 
ATOM   2259 N  N     . VAL C 3  208 ? 61.778 97.627  45.704 1.00 17.38  ? 214  VAL A N     1 
ATOM   2260 C  CA    . VAL C 3  208 ? 63.186 97.274  45.773 1.00 18.69  ? 214  VAL A CA    1 
ATOM   2261 C  C     . VAL C 3  208 ? 63.648 97.224  47.222 1.00 20.14  ? 214  VAL A C     1 
ATOM   2262 O  O     . VAL C 3  208 ? 64.383 96.323  47.616 1.00 20.08  ? 214  VAL A O     1 
ATOM   2263 C  CB    . VAL C 3  208 ? 64.063 98.288  45.013 1.00 19.51  ? 214  VAL A CB    1 
ATOM   2264 C  CG1   . VAL C 3  208 ? 65.547 97.915  45.145 1.00 18.72  ? 214  VAL A CG1   1 
ATOM   2265 C  CG2   . VAL C 3  208 ? 63.656 98.315  43.549 1.00 19.54  ? 214  VAL A CG2   1 
ATOM   2266 N  N     . ASP C 3  209 ? 63.211 98.194  48.016 1.00 20.72  ? 215  ASP A N     1 
ATOM   2267 C  CA    . ASP C 3  209 ? 63.600 98.249  49.415 1.00 22.24  ? 215  ASP A CA    1 
ATOM   2268 C  C     . ASP C 3  209 ? 62.945 97.116  50.199 1.00 22.95  ? 215  ASP A C     1 
ATOM   2269 O  O     . ASP C 3  209 ? 63.597 96.449  50.999 1.00 22.75  ? 215  ASP A O     1 
ATOM   2270 C  CB    . ASP C 3  209 ? 63.214 99.602  50.014 1.00 23.13  ? 215  ASP A CB    1 
ATOM   2271 C  CG    . ASP C 3  209 ? 63.618 99.735  51.476 1.00 25.28  ? 215  ASP A CG    1 
ATOM   2272 O  OD1   . ASP C 3  209 ? 64.723 99.283  51.843 1.00 22.28  ? 215  ASP A OD1   1 
ATOM   2273 O  OD2   . ASP C 3  209 ? 62.835 100.309 52.257 1.00 29.33  ? 215  ASP A OD2   1 
ATOM   2274 N  N     . ILE C 3  210 ? 61.658 96.895  49.952 1.00 21.81  ? 216  ILE A N     1 
ATOM   2275 C  CA    . ILE C 3  210 ? 60.921 95.845  50.633 1.00 21.02  ? 216  ILE A CA    1 
ATOM   2276 C  C     . ILE C 3  210 ? 61.475 94.448  50.353 1.00 21.54  ? 216  ILE A C     1 
ATOM   2277 O  O     . ILE C 3  210 ? 61.555 93.620  51.264 1.00 19.51  ? 216  ILE A O     1 
ATOM   2278 C  CB    . ILE C 3  210 ? 59.435 95.862  50.237 1.00 23.02  ? 216  ILE A CB    1 
ATOM   2279 C  CG1   . ILE C 3  210 ? 58.758 97.091  50.852 1.00 23.23  ? 216  ILE A CG1   1 
ATOM   2280 C  CG2   . ILE C 3  210 ? 58.758 94.562  50.683 1.00 20.59  ? 216  ILE A CG2   1 
ATOM   2281 C  CD1   . ILE C 3  210 ? 57.279 97.165  50.603 1.00 24.82  ? 216  ILE A CD1   1 
ATOM   2282 N  N     . GLU C 3  211 ? 61.844 94.182  49.102 1.00 18.37  ? 217  GLU A N     1 
ATOM   2283 C  CA    . GLU C 3  211 ? 62.369 92.868  48.754 1.00 17.68  ? 217  GLU A CA    1 
ATOM   2284 C  C     . GLU C 3  211 ? 63.700 92.589  49.437 1.00 16.21  ? 217  GLU A C     1 
ATOM   2285 O  O     . GLU C 3  211 ? 63.914 91.495  49.955 1.00 17.84  ? 217  GLU A O     1 
ATOM   2286 C  CB    . GLU C 3  211 ? 62.496 92.716  47.235 1.00 16.22  ? 217  GLU A CB    1 
ATOM   2287 C  CG    . GLU C 3  211 ? 61.153 92.490  46.546 1.00 16.41  ? 217  GLU A CG    1 
ATOM   2288 C  CD    . GLU C 3  211 ? 60.428 91.260  47.075 1.00 18.30  ? 217  GLU A CD    1 
ATOM   2289 O  OE1   . GLU C 3  211 ? 61.084 90.207  47.229 1.00 17.03  ? 217  GLU A OE1   1 
ATOM   2290 O  OE2   . GLU C 3  211 ? 59.207 91.343  47.331 1.00 17.44  ? 217  GLU A OE2   1 
ATOM   2291 N  N     . HIS C 3  212 ? 64.596 93.569  49.449 1.00 16.05  ? 218  HIS A N     1 
ATOM   2292 C  CA    . HIS C 3  212 ? 65.878 93.377  50.110 1.00 16.21  ? 218  HIS A CA    1 
ATOM   2293 C  C     . HIS C 3  212 ? 65.698 93.188  51.617 1.00 16.51  ? 218  HIS A C     1 
ATOM   2294 O  O     . HIS C 3  212 ? 66.378 92.370  52.226 1.00 16.87  ? 218  HIS A O     1 
ATOM   2295 C  CB    . HIS C 3  212 ? 66.821 94.545  49.810 1.00 14.50  ? 218  HIS A CB    1 
ATOM   2296 C  CG    . HIS C 3  212 ? 67.454 94.459  48.458 1.00 15.74  ? 218  HIS A CG    1 
ATOM   2297 N  ND1   . HIS C 3  212 ? 66.797 94.827  47.302 1.00 16.35  ? 218  HIS A ND1   1 
ATOM   2298 C  CD2   . HIS C 3  212 ? 68.648 93.952  48.067 1.00 16.36  ? 218  HIS A CD2   1 
ATOM   2299 C  CE1   . HIS C 3  212 ? 67.559 94.548  46.258 1.00 15.90  ? 218  HIS A CE1   1 
ATOM   2300 N  NE2   . HIS C 3  212 ? 68.687 94.014  46.694 1.00 15.37  ? 218  HIS A NE2   1 
ATOM   2301 N  N     . ARG C 3  213 ? 64.777 93.924  52.224 1.00 17.08  ? 219  ARG A N     1 
ATOM   2302 C  CA    . ARG C 3  213 ? 64.552 93.762  53.656 1.00 18.30  ? 219  ARG A CA    1 
ATOM   2303 C  C     . ARG C 3  213 ? 63.964 92.376  53.955 1.00 20.19  ? 219  ARG A C     1 
ATOM   2304 O  O     . ARG C 3  213 ? 64.355 91.728  54.933 1.00 18.62  ? 219  ARG A O     1 
ATOM   2305 C  CB    . ARG C 3  213 ? 63.622 94.856  54.185 1.00 18.31  ? 219  ARG A CB    1 
ATOM   2306 C  CG    . ARG C 3  213 ? 64.288 96.223  54.355 1.00 20.96  ? 219  ARG A CG    1 
ATOM   2307 C  CD    . ARG C 3  213 ? 63.254 97.284  54.706 1.00 19.09  ? 219  ARG A CD    1 
ATOM   2308 N  NE    . ARG C 3  213 ? 63.825 98.621  54.834 1.00 24.01  ? 219  ARG A NE    1 
ATOM   2309 C  CZ    . ARG C 3  213 ? 64.312 99.133  55.964 1.00 28.31  ? 219  ARG A CZ    1 
ATOM   2310 N  NH1   . ARG C 3  213 ? 64.303 98.412  57.080 1.00 28.72  ? 219  ARG A NH1   1 
ATOM   2311 N  NH2   . ARG C 3  213 ? 64.795 100.376 55.984 1.00 23.77  ? 219  ARG A NH2   1 
ATOM   2312 N  N     . ALA C 3  214 ? 63.038 91.915  53.114 1.00 18.56  ? 220  ALA A N     1 
ATOM   2313 C  CA    . ALA C 3  214 ? 62.427 90.597  53.311 1.00 18.43  ? 220  ALA A CA    1 
ATOM   2314 C  C     . ALA C 3  214 ? 63.443 89.465  53.157 1.00 17.02  ? 220  ALA A C     1 
ATOM   2315 O  O     . ALA C 3  214 ? 63.446 88.507  53.931 1.00 18.04  ? 220  ALA A O     1 
ATOM   2316 C  CB    . ALA C 3  214 ? 61.278 90.391  52.326 1.00 16.36  ? 220  ALA A CB    1 
ATOM   2317 N  N     . ALA C 3  215 ? 64.306 89.576  52.156 1.00 17.78  ? 221  ALA A N     1 
ATOM   2318 C  CA    . ALA C 3  215 ? 65.306 88.542  51.915 1.00 18.88  ? 221  ALA A CA    1 
ATOM   2319 C  C     . ALA C 3  215 ? 66.321 88.489  53.059 1.00 19.07  ? 221  ALA A C     1 
ATOM   2320 O  O     . ALA C 3  215 ? 66.753 87.413  53.464 1.00 18.69  ? 221  ALA A O     1 
ATOM   2321 C  CB    . ALA C 3  215 ? 66.010 88.796  50.593 1.00 12.85  ? 221  ALA A CB    1 
ATOM   2322 N  N     . TRP C 3  216 ? 66.696 89.653  53.581 1.00 18.84  ? 222  TRP A N     1 
ATOM   2323 C  CA    . TRP C 3  216 ? 67.652 89.707  54.681 1.00 19.98  ? 222  TRP A CA    1 
ATOM   2324 C  C     . TRP C 3  216 ? 67.049 89.092  55.943 1.00 20.26  ? 222  TRP A C     1 
ATOM   2325 O  O     . TRP C 3  216 ? 67.727 88.384  56.680 1.00 19.83  ? 222  TRP A O     1 
ATOM   2326 C  CB    . TRP C 3  216 ? 68.064 91.152  54.942 1.00 17.87  ? 222  TRP A CB    1 
ATOM   2327 C  CG    . TRP C 3  216 ? 69.150 91.315  55.956 1.00 19.41  ? 222  TRP A CG    1 
ATOM   2328 C  CD1   . TRP C 3  216 ? 69.006 91.337  57.314 1.00 19.03  ? 222  TRP A CD1   1 
ATOM   2329 C  CD2   . TRP C 3  216 ? 70.548 91.528  55.698 1.00 19.27  ? 222  TRP A CD2   1 
ATOM   2330 N  NE1   . TRP C 3  216 ? 70.221 91.559  57.918 1.00 20.07  ? 222  TRP A NE1   1 
ATOM   2331 C  CE2   . TRP C 3  216 ? 71.184 91.679  56.953 1.00 19.24  ? 222  TRP A CE2   1 
ATOM   2332 C  CE3   . TRP C 3  216 ? 71.321 91.609  54.532 1.00 18.59  ? 222  TRP A CE3   1 
ATOM   2333 C  CZ2   . TRP C 3  216 ? 72.559 91.910  57.076 1.00 17.39  ? 222  TRP A CZ2   1 
ATOM   2334 C  CZ3   . TRP C 3  216 ? 72.695 91.840  54.655 1.00 19.29  ? 222  TRP A CZ3   1 
ATOM   2335 C  CH2   . TRP C 3  216 ? 73.295 91.989  55.920 1.00 17.49  ? 222  TRP A CH2   1 
ATOM   2336 N  N     . LEU C 3  217 ? 65.770 89.362  56.187 1.00 18.89  ? 223  LEU A N     1 
ATOM   2337 C  CA    . LEU C 3  217 ? 65.086 88.822  57.359 1.00 18.27  ? 223  LEU A CA    1 
ATOM   2338 C  C     . LEU C 3  217 ? 64.901 87.307  57.233 1.00 18.41  ? 223  LEU A C     1 
ATOM   2339 O  O     . LEU C 3  217 ? 65.181 86.550  58.162 1.00 17.22  ? 223  LEU A O     1 
ATOM   2340 C  CB    . LEU C 3  217 ? 63.721 89.495  57.516 1.00 17.01  ? 223  LEU A CB    1 
ATOM   2341 C  CG    . LEU C 3  217 ? 62.748 88.913  58.548 1.00 18.17  ? 223  LEU A CG    1 
ATOM   2342 C  CD1   . LEU C 3  217 ? 63.392 88.897  59.926 1.00 17.40  ? 223  LEU A CD1   1 
ATOM   2343 C  CD2   . LEU C 3  217 ? 61.473 89.752  58.569 1.00 16.64  ? 223  LEU A CD2   1 
ATOM   2344 N  N     . LEU C 3  218 ? 64.438 86.875  56.065 1.00 16.81  ? 224  LEU A N     1 
ATOM   2345 C  CA    . LEU C 3  218 ? 64.188 85.469  55.815 1.00 16.78  ? 224  LEU A CA    1 
ATOM   2346 C  C     . LEU C 3  218 ? 65.454 84.605  55.785 1.00 17.06  ? 224  LEU A C     1 
ATOM   2347 O  O     . LEU C 3  218 ? 65.410 83.434  56.158 1.00 16.77  ? 224  LEU A O     1 
ATOM   2348 C  CB    . LEU C 3  218 ? 63.359 85.332  54.527 1.00 17.67  ? 224  LEU A CB    1 
ATOM   2349 C  CG    . LEU C 3  218 ? 61.973 85.968  54.758 1.00 18.02  ? 224  LEU A CG    1 
ATOM   2350 C  CD1   . LEU C 3  218 ? 61.182 86.108  53.470 1.00 16.27  ? 224  LEU A CD1   1 
ATOM   2351 C  CD2   . LEU C 3  218 ? 61.224 85.104  55.760 1.00 14.99  ? 224  LEU A CD2   1 
ATOM   2352 N  N     . ALA C 3  219 ? 66.577 85.169  55.354 1.00 14.50  ? 225  ALA A N     1 
ATOM   2353 C  CA    . ALA C 3  219 ? 67.822 84.413  55.361 1.00 16.38  ? 225  ALA A CA    1 
ATOM   2354 C  C     . ALA C 3  219 ? 68.115 84.136  56.833 1.00 18.49  ? 225  ALA A C     1 
ATOM   2355 O  O     . ALA C 3  219 ? 68.548 83.043  57.206 1.00 19.79  ? 225  ALA A O     1 
ATOM   2356 C  CB    . ALA C 3  219 ? 68.950 85.228  54.743 1.00 14.27  ? 225  ALA A CB    1 
ATOM   2357 N  N     . LYS C 3  220 ? 67.870 85.140  57.670 1.00 18.40  ? 226  LYS A N     1 
ATOM   2358 C  CA    . LYS C 3  220 ? 68.074 85.003  59.110 1.00 20.08  ? 226  LYS A CA    1 
ATOM   2359 C  C     . LYS C 3  220 ? 67.166 83.892  59.657 1.00 20.99  ? 226  LYS A C     1 
ATOM   2360 O  O     . LYS C 3  220 ? 67.582 83.084  60.491 1.00 20.29  ? 226  LYS A O     1 
ATOM   2361 C  CB    . LYS C 3  220 ? 67.748 86.327  59.802 1.00 21.38  ? 226  LYS A CB    1 
ATOM   2362 C  CG    . LYS C 3  220 ? 67.657 86.250  61.307 1.00 19.91  ? 226  LYS A CG    1 
ATOM   2363 C  CD    . LYS C 3  220 ? 68.992 85.949  61.943 1.00 22.01  ? 226  LYS A CD    1 
ATOM   2364 C  CE    . LYS C 3  220 ? 68.890 86.134  63.443 1.00 24.45  ? 226  LYS A CE    1 
ATOM   2365 N  NZ    . LYS C 3  220 ? 70.220 86.107  64.084 1.00 26.18  ? 226  LYS A NZ    1 
ATOM   2366 N  N     . GLN C 3  221 ? 65.922 83.863  59.184 1.00 20.79  ? 227  GLN A N     1 
ATOM   2367 C  CA    . GLN C 3  221 ? 64.967 82.846  59.607 1.00 18.95  ? 227  GLN A CA    1 
ATOM   2368 C  C     . GLN C 3  221 ? 65.473 81.453  59.249 1.00 19.80  ? 227  GLN A C     1 
ATOM   2369 O  O     . GLN C 3  221 ? 65.350 80.522  60.041 1.00 19.08  ? 227  GLN A O     1 
ATOM   2370 C  CB    . GLN C 3  221 ? 63.623 83.071  58.931 1.00 18.04  ? 227  GLN A CB    1 
ATOM   2371 C  CG    . GLN C 3  221 ? 62.622 81.978  59.221 1.00 18.99  ? 227  GLN A CG    1 
ATOM   2372 C  CD    . GLN C 3  221 ? 61.271 82.265  58.625 1.00 19.35  ? 227  GLN A CD    1 
ATOM   2373 O  OE1   . GLN C 3  221 ? 60.573 83.180  59.058 1.00 17.13  ? 227  GLN A OE1   1 
ATOM   2374 N  NE2   . GLN C 3  221 ? 60.894 81.490  57.614 1.00 20.06  ? 227  GLN A NE2   1 
ATOM   2375 N  N     . GLU C 3  222 ? 66.028 81.307  58.049 1.00 19.00  ? 228  GLU A N     1 
ATOM   2376 C  CA    . GLU C 3  222 ? 66.556 80.012  57.626 1.00 20.62  ? 228  GLU A CA    1 
ATOM   2377 C  C     . GLU C 3  222 ? 67.664 79.587  58.590 1.00 21.00  ? 228  GLU A C     1 
ATOM   2378 O  O     . GLU C 3  222 ? 67.668 78.461  59.083 1.00 20.62  ? 228  GLU A O     1 
ATOM   2379 C  CB    . GLU C 3  222 ? 67.113 80.092  56.203 1.00 19.90  ? 228  GLU A CB    1 
ATOM   2380 C  CG    . GLU C 3  222 ? 66.056 80.315  55.134 1.00 22.79  ? 228  GLU A CG    1 
ATOM   2381 C  CD    . GLU C 3  222 ? 66.616 80.201  53.725 1.00 24.13  ? 228  GLU A CD    1 
ATOM   2382 O  OE1   . GLU C 3  222 ? 67.801 79.826  53.575 1.00 26.86  ? 228  GLU A OE1   1 
ATOM   2383 O  OE2   . GLU C 3  222 ? 65.871 80.471  52.764 1.00 24.68  ? 228  GLU A OE2   1 
ATOM   2384 N  N     . ARG C 3  223 ? 68.594 80.501  58.860 1.00 18.61  ? 229  ARG A N     1 
ATOM   2385 C  CA    . ARG C 3  223 ? 69.693 80.224  59.768 1.00 19.39  ? 229  ARG A CA    1 
ATOM   2386 C  C     . ARG C 3  223 ? 69.188 79.826  61.148 1.00 18.74  ? 229  ARG A C     1 
ATOM   2387 O  O     . ARG C 3  223 ? 69.802 78.998  61.813 1.00 20.81  ? 229  ARG A O     1 
ATOM   2388 C  CB    . ARG C 3  223 ? 70.614 81.440  59.881 1.00 19.83  ? 229  ARG A CB    1 
ATOM   2389 C  CG    . ARG C 3  223 ? 71.767 81.473  58.881 1.00 19.20  ? 229  ARG A CG    1 
ATOM   2390 C  CD    . ARG C 3  223 ? 72.511 82.804  58.994 1.00 20.14  ? 229  ARG A CD    1 
ATOM   2391 N  NE    . ARG C 3  223 ? 71.927 83.751  58.060 1.00 32.47  ? 229  ARG A NE    1 
ATOM   2392 C  CZ    . ARG C 3  223 ? 71.640 85.015  58.325 1.00 27.59  ? 229  ARG A CZ    1 
ATOM   2393 N  NH1   . ARG C 3  223 ? 71.876 85.536  59.516 1.00 30.60  ? 229  ARG A NH1   1 
ATOM   2394 N  NH2   . ARG C 3  223 ? 71.108 85.753  57.374 1.00 36.10  ? 229  ARG A NH2   1 
ATOM   2395 N  N     . ASN C 3  224 ? 68.077 80.420  61.578 1.00 19.44  ? 230  ASN A N     1 
ATOM   2396 C  CA    . ASN C 3  224 ? 67.493 80.094  62.876 1.00 17.27  ? 230  ASN A CA    1 
ATOM   2397 C  C     . ASN C 3  224 ? 66.989 78.658  62.832 1.00 17.75  ? 230  ASN A C     1 
ATOM   2398 O  O     . ASN C 3  224 ? 67.244 77.870  63.739 1.00 16.42  ? 230  ASN A O     1 
ATOM   2399 C  CB    . ASN C 3  224 ? 66.284 80.985  63.207 1.00 16.11  ? 230  ASN A CB    1 
ATOM   2400 C  CG    . ASN C 3  224 ? 66.651 82.437  63.466 1.00 18.92  ? 230  ASN A CG    1 
ATOM   2401 O  OD1   . ASN C 3  224 ? 67.788 82.769  63.814 1.00 17.05  ? 230  ASN A OD1   1 
ATOM   2402 N  ND2   . ASN C 3  224 ? 65.664 83.314  63.327 1.00 17.88  ? 230  ASN A ND2   1 
ATOM   2403 N  N     . GLY C 3  225 ? 66.260 78.331  61.769 1.00 16.64  ? 231  GLY A N     1 
ATOM   2404 C  CA    . GLY C 3  225 ? 65.700 77.002  61.647 1.00 17.20  ? 231  GLY A CA    1 
ATOM   2405 C  C     . GLY C 3  225 ? 64.483 76.880  62.544 1.00 18.77  ? 231  GLY A C     1 
ATOM   2406 O  O     . GLY C 3  225 ? 64.160 77.806  63.294 1.00 16.11  ? 231  GLY A O     1 
ATOM   2407 N  N     . PHE C 3  226 ? 63.814 75.733  62.477 1.00 17.55  ? 232  PHE A N     1 
ATOM   2408 C  CA    . PHE C 3  226 ? 62.619 75.482  63.273 1.00 17.95  ? 232  PHE A CA    1 
ATOM   2409 C  C     . PHE C 3  226 ? 62.886 74.305  64.218 1.00 19.35  ? 232  PHE A C     1 
ATOM   2410 O  O     . PHE C 3  226 ? 63.077 73.174  63.762 1.00 18.50  ? 232  PHE A O     1 
ATOM   2411 C  CB    . PHE C 3  226 ? 61.451 75.121  62.346 1.00 18.59  ? 232  PHE A CB    1 
ATOM   2412 C  CG    . PHE C 3  226 ? 60.094 75.471  62.893 1.00 17.58  ? 232  PHE A CG    1 
ATOM   2413 C  CD1   . PHE C 3  226 ? 59.785 75.260  64.232 1.00 15.41  ? 232  PHE A CD1   1 
ATOM   2414 C  CD2   . PHE C 3  226 ? 59.119 76.016  62.058 1.00 18.65  ? 232  PHE A CD2   1 
ATOM   2415 C  CE1   . PHE C 3  226 ? 58.525 75.592  64.733 1.00 18.77  ? 232  PHE A CE1   1 
ATOM   2416 C  CE2   . PHE C 3  226 ? 57.856 76.350  62.547 1.00 17.67  ? 232  PHE A CE2   1 
ATOM   2417 C  CZ    . PHE C 3  226 ? 57.557 76.141  63.886 1.00 16.39  ? 232  PHE A CZ    1 
ATOM   2418 N  N     . PRO C 3  227 ? 62.916 74.554  65.543 1.00 19.54  ? 233  PRO A N     1 
ATOM   2419 C  CA    . PRO C 3  227 ? 63.161 73.478  66.516 1.00 20.52  ? 233  PRO A CA    1 
ATOM   2420 C  C     . PRO C 3  227 ? 62.254 72.294  66.177 1.00 21.09  ? 233  PRO A C     1 
ATOM   2421 O  O     . PRO C 3  227 ? 61.033 72.439  66.092 1.00 20.07  ? 233  PRO A O     1 
ATOM   2422 C  CB    . PRO C 3  227 ? 62.802 74.135  67.847 1.00 21.44  ? 233  PRO A CB    1 
ATOM   2423 C  CG    . PRO C 3  227 ? 63.199 75.580  67.606 1.00 20.61  ? 233  PRO A CG    1 
ATOM   2424 C  CD    . PRO C 3  227 ? 62.652 75.833  66.225 1.00 17.00  ? 233  PRO A CD    1 
ATOM   2425 N  N     . PHE C 3  228 ? 62.854 71.123  65.996 1.00 21.61  ? 234  PHE A N     1 
ATOM   2426 C  CA    . PHE C 3  228 ? 62.109 69.935  65.593 1.00 20.88  ? 234  PHE A CA    1 
ATOM   2427 C  C     . PHE C 3  228 ? 62.292 68.740  66.536 1.00 21.17  ? 234  PHE A C     1 
ATOM   2428 O  O     . PHE C 3  228 ? 63.414 68.400  66.919 1.00 22.90  ? 234  PHE A O     1 
ATOM   2429 C  CB    . PHE C 3  228 ? 62.559 69.572  64.174 1.00 19.67  ? 234  PHE A CB    1 
ATOM   2430 C  CG    . PHE C 3  228 ? 61.921 68.333  63.613 1.00 18.15  ? 234  PHE A CG    1 
ATOM   2431 C  CD1   . PHE C 3  228 ? 60.640 68.375  63.077 1.00 14.63  ? 234  PHE A CD1   1 
ATOM   2432 C  CD2   . PHE C 3  228 ? 62.637 67.142  63.549 1.00 17.00  ? 234  PHE A CD2   1 
ATOM   2433 C  CE1   . PHE C 3  228 ? 60.075 67.248  62.470 1.00 16.56  ? 234  PHE A CE1   1 
ATOM   2434 C  CE2   . PHE C 3  228 ? 62.087 66.007  62.945 1.00 18.43  ? 234  PHE A CE2   1 
ATOM   2435 C  CZ    . PHE C 3  228 ? 60.804 66.061  62.403 1.00 18.08  ? 234  PHE A CZ    1 
ATOM   2436 N  N     . ASP C 3  229 ? 61.185 68.091  66.885 1.00 20.60  ? 235  ASP A N     1 
ATOM   2437 C  CA    . ASP C 3  229 ? 61.201 66.941  67.790 1.00 20.86  ? 235  ASP A CA    1 
ATOM   2438 C  C     . ASP C 3  229 ? 61.458 65.637  67.026 1.00 22.81  ? 235  ASP A C     1 
ATOM   2439 O  O     . ASP C 3  229 ? 60.526 64.892  66.716 1.00 22.58  ? 235  ASP A O     1 
ATOM   2440 C  CB    . ASP C 3  229 ? 59.856 66.849  68.520 1.00 23.94  ? 235  ASP A CB    1 
ATOM   2441 C  CG    . ASP C 3  229 ? 59.876 65.862  69.688 1.00 25.70  ? 235  ASP A CG    1 
ATOM   2442 O  OD1   . ASP C 3  229 ? 60.789 65.003  69.756 1.00 22.51  ? 235  ASP A OD1   1 
ATOM   2443 O  OD2   . ASP C 3  229 ? 58.958 65.952  70.531 1.00 24.25  ? 235  ASP A OD2   1 
ATOM   2444 N  N     . THR C 3  230 ? 62.725 65.364  66.734 1.00 23.99  ? 236  THR A N     1 
ATOM   2445 C  CA    . THR C 3  230 ? 63.108 64.171  66.001 1.00 25.90  ? 236  THR A CA    1 
ATOM   2446 C  C     . THR C 3  230 ? 62.583 62.879  66.616 1.00 28.20  ? 236  THR A C     1 
ATOM   2447 O  O     . THR C 3  230 ? 62.084 62.005  65.903 1.00 29.03  ? 236  THR A O     1 
ATOM   2448 C  CB    . THR C 3  230 ? 64.633 64.083  65.881 1.00 25.07  ? 236  THR A CB    1 
ATOM   2449 O  OG1   . THR C 3  230 ? 65.115 65.252  65.216 1.00 25.80  ? 236  THR A OG1   1 
ATOM   2450 C  CG2   . THR C 3  230 ? 65.042 62.859  65.079 1.00 23.32  ? 236  THR A CG2   1 
ATOM   2451 N  N     . LYS C 3  231 ? 62.688 62.758  67.934 1.00 28.99  ? 237  LYS A N     1 
ATOM   2452 C  CA    . LYS C 3  231 ? 62.230 61.553  68.617 1.00 30.85  ? 237  LYS A CA    1 
ATOM   2453 C  C     . LYS C 3  231 ? 60.760 61.241  68.368 1.00 28.40  ? 237  LYS A C     1 
ATOM   2454 O  O     . LYS C 3  231 ? 60.418 60.119  68.008 1.00 29.04  ? 237  LYS A O     1 
ATOM   2455 C  CB    . LYS C 3  231 ? 62.476 61.667  70.123 1.00 35.51  ? 237  LYS A CB    1 
ATOM   2456 C  CG    . LYS C 3  231 ? 63.482 60.655  70.662 1.00 44.85  ? 237  LYS A CG    1 
ATOM   2457 C  CD    . LYS C 3  231 ? 62.963 59.219  70.540 1.00 50.18  ? 237  LYS A CD    1 
ATOM   2458 C  CE    . LYS C 3  231 ? 63.946 58.206  71.136 1.00 53.66  ? 237  LYS A CE    1 
ATOM   2459 N  NZ    . LYS C 3  231 ? 65.280 58.234  70.451 1.00 56.32  ? 237  LYS A NZ    1 
ATOM   2460 N  N     . ALA C 3  232 ? 59.898 62.237  68.555 1.00 25.33  ? 238  ALA A N     1 
ATOM   2461 C  CA    . ALA C 3  232 ? 58.462 62.062  68.370 1.00 23.53  ? 238  ALA A CA    1 
ATOM   2462 C  C     . ALA C 3  232 ? 58.084 61.665  66.956 1.00 24.06  ? 238  ALA A C     1 
ATOM   2463 O  O     . ALA C 3  232 ? 57.115 60.936  66.761 1.00 25.20  ? 238  ALA A O     1 
ATOM   2464 C  CB    . ALA C 3  232 ? 57.718 63.333  68.760 1.00 20.56  ? 238  ALA A CB    1 
ATOM   2465 N  N     . ILE C 3  233 ? 58.840 62.140  65.971 1.00 24.66  ? 239  ILE A N     1 
ATOM   2466 C  CA    . ILE C 3  233 ? 58.542 61.811  64.585 1.00 25.54  ? 239  ILE A CA    1 
ATOM   2467 C  C     . ILE C 3  233 ? 59.049 60.422  64.231 1.00 27.24  ? 239  ILE A C     1 
ATOM   2468 O  O     . ILE C 3  233 ? 58.442 59.730  63.410 1.00 26.90  ? 239  ILE A O     1 
ATOM   2469 C  CB    . ILE C 3  233 ? 59.131 62.864  63.616 1.00 24.31  ? 239  ILE A CB    1 
ATOM   2470 C  CG1   . ILE C 3  233 ? 58.505 64.228  63.907 1.00 23.47  ? 239  ILE A CG1   1 
ATOM   2471 C  CG2   . ILE C 3  233 ? 58.832 62.482  62.178 1.00 21.21  ? 239  ILE A CG2   1 
ATOM   2472 C  CD1   . ILE C 3  233 ? 56.975 64.217  63.884 1.00 22.25  ? 239  ILE A CD1   1 
ATOM   2473 N  N     . GLU C 3  234 ? 60.158 60.014  64.843 1.00 29.07  ? 240  GLU A N     1 
ATOM   2474 C  CA    . GLU C 3  234 ? 60.684 58.673  64.603 1.00 31.97  ? 240  GLU A CA    1 
ATOM   2475 C  C     . GLU C 3  234 ? 59.659 57.686  65.175 1.00 31.99  ? 240  GLU A C     1 
ATOM   2476 O  O     . GLU C 3  234 ? 59.420 56.620  64.609 1.00 31.88  ? 240  GLU A O     1 
ATOM   2477 C  CB    . GLU C 3  234 ? 62.034 58.472  65.305 1.00 32.55  ? 240  GLU A CB    1 
ATOM   2478 C  CG    . GLU C 3  234 ? 63.157 59.350  64.774 1.00 36.36  ? 240  GLU A CG    1 
ATOM   2479 C  CD    . GLU C 3  234 ? 64.479 59.115  65.491 1.00 36.95  ? 240  GLU A CD    1 
ATOM   2480 O  OE1   . GLU C 3  234 ? 64.485 59.093  66.738 1.00 38.21  ? 240  GLU A OE1   1 
ATOM   2481 O  OE2   . GLU C 3  234 ? 65.515 58.966  64.808 1.00 38.40  ? 240  GLU A OE2   1 
ATOM   2482 N  N     . GLU C 3  235 ? 59.049 58.054  66.299 1.00 32.08  ? 241  GLU A N     1 
ATOM   2483 C  CA    . GLU C 3  235 ? 58.052 57.192  66.926 1.00 33.70  ? 241  GLU A CA    1 
ATOM   2484 C  C     . GLU C 3  235 ? 56.789 57.196  66.075 1.00 33.15  ? 241  GLU A C     1 
ATOM   2485 O  O     . GLU C 3  235 ? 56.123 56.177  65.941 1.00 34.17  ? 241  GLU A O     1 
ATOM   2486 C  CB    . GLU C 3  235 ? 57.734 57.671  68.345 1.00 35.20  ? 241  GLU A CB    1 
ATOM   2487 C  CG    . GLU C 3  235 ? 58.970 57.819  69.229 1.00 40.66  ? 241  GLU A CG    1 
ATOM   2488 C  CD    . GLU C 3  235 ? 58.652 58.323  70.632 1.00 42.56  ? 241  GLU A CD    1 
ATOM   2489 O  OE1   . GLU C 3  235 ? 57.788 59.220  70.767 1.00 43.16  ? 241  GLU A OE1   1 
ATOM   2490 O  OE2   . GLU C 3  235 ? 59.282 57.831  71.597 1.00 45.00  ? 241  GLU A OE2   1 
ATOM   2491 N  N     . LEU C 3  236 ? 56.459 58.348  65.502 1.00 32.37  ? 242  LEU A N     1 
ATOM   2492 C  CA    . LEU C 3  236 ? 55.287 58.446  64.643 1.00 30.46  ? 242  LEU A CA    1 
ATOM   2493 C  C     . LEU C 3  236 ? 55.512 57.547  63.437 1.00 29.11  ? 242  LEU A C     1 
ATOM   2494 O  O     . LEU C 3  236 ? 54.594 56.873  62.979 1.00 28.61  ? 242  LEU A O     1 
ATOM   2495 C  CB    . LEU C 3  236 ? 55.084 59.880  64.161 1.00 29.49  ? 242  LEU A CB    1 
ATOM   2496 C  CG    . LEU C 3  236 ? 53.965 60.050  63.130 1.00 29.28  ? 242  LEU A CG    1 
ATOM   2497 C  CD1   . LEU C 3  236 ? 52.623 59.770  63.784 1.00 28.29  ? 242  LEU A CD1   1 
ATOM   2498 C  CD2   . LEU C 3  236 ? 53.994 61.461  62.563 1.00 29.50  ? 242  LEU A CD2   1 
ATOM   2499 N  N     . TYR C 3  237 ? 56.744 57.548  62.932 1.00 27.79  ? 243  TYR A N     1 
ATOM   2500 C  CA    . TYR C 3  237 ? 57.120 56.744  61.776 1.00 28.10  ? 243  TYR A CA    1 
ATOM   2501 C  C     . TYR C 3  237 ? 56.924 55.251  62.044 1.00 29.20  ? 243  TYR A C     1 
ATOM   2502 O  O     . TYR C 3  237 ? 56.505 54.502  61.159 1.00 29.34  ? 243  TYR A O     1 
ATOM   2503 C  CB    . TYR C 3  237 ? 58.580 57.037  61.392 1.00 26.12  ? 243  TYR A CB    1 
ATOM   2504 C  CG    . TYR C 3  237 ? 59.087 56.257  60.200 1.00 24.31  ? 243  TYR A CG    1 
ATOM   2505 C  CD1   . TYR C 3  237 ? 58.245 55.962  59.126 1.00 24.10  ? 243  TYR A CD1   1 
ATOM   2506 C  CD2   . TYR C 3  237 ? 60.412 55.828  60.134 1.00 24.68  ? 243  TYR A CD2   1 
ATOM   2507 C  CE1   . TYR C 3  237 ? 58.712 55.254  58.015 1.00 24.87  ? 243  TYR A CE1   1 
ATOM   2508 C  CE2   . TYR C 3  237 ? 60.890 55.123  59.027 1.00 22.53  ? 243  TYR A CE2   1 
ATOM   2509 C  CZ    . TYR C 3  237 ? 60.032 54.840  57.973 1.00 24.21  ? 243  TYR A CZ    1 
ATOM   2510 O  OH    . TYR C 3  237 ? 60.488 54.145  56.873 1.00 25.76  ? 243  TYR A OH    1 
ATOM   2511 N  N     . VAL C 3  238 ? 57.229 54.820  63.263 1.00 31.12  ? 244  VAL A N     1 
ATOM   2512 C  CA    . VAL C 3  238 ? 57.063 53.418  63.640 1.00 32.83  ? 244  VAL A CA    1 
ATOM   2513 C  C     . VAL C 3  238 ? 55.579 53.060  63.608 1.00 33.00  ? 244  VAL A C     1 
ATOM   2514 O  O     . VAL C 3  238 ? 55.183 52.048  63.033 1.00 33.62  ? 244  VAL A O     1 
ATOM   2515 C  CB    . VAL C 3  238 ? 57.613 53.156  65.064 1.00 34.26  ? 244  VAL A CB    1 
ATOM   2516 C  CG1   . VAL C 3  238 ? 57.311 51.716  65.497 1.00 34.27  ? 244  VAL A CG1   1 
ATOM   2517 C  CG2   . VAL C 3  238 ? 59.115 53.412  65.086 1.00 33.49  ? 244  VAL A CG2   1 
ATOM   2518 N  N     . GLU C 3  239 ? 54.766 53.909  64.226 1.00 32.59  ? 245  GLU A N     1 
ATOM   2519 C  CA    . GLU C 3  239 ? 53.323 53.710  64.278 1.00 32.95  ? 245  GLU A CA    1 
ATOM   2520 C  C     . GLU C 3  239 ? 52.728 53.656  62.874 1.00 33.69  ? 245  GLU A C     1 
ATOM   2521 O  O     . GLU C 3  239 ? 51.928 52.770  62.569 1.00 35.35  ? 245  GLU A O     1 
ATOM   2522 C  CB    . GLU C 3  239 ? 52.666 54.846  65.064 1.00 32.91  ? 245  GLU A CB    1 
ATOM   2523 C  CG    . GLU C 3  239 ? 51.149 54.743  65.178 1.00 34.50  ? 245  GLU A CG    1 
ATOM   2524 C  CD    . GLU C 3  239 ? 50.520 56.007  65.735 1.00 37.55  ? 245  GLU A CD    1 
ATOM   2525 O  OE1   . GLU C 3  239 ? 51.227 56.779  66.422 1.00 39.23  ? 245  GLU A OE1   1 
ATOM   2526 O  OE2   . GLU C 3  239 ? 49.314 56.229  65.496 1.00 38.64  ? 245  GLU A OE2   1 
ATOM   2527 N  N     . LEU C 3  240 ? 53.116 54.606  62.025 1.00 32.16  ? 246  LEU A N     1 
ATOM   2528 C  CA    . LEU C 3  240 ? 52.617 54.657  60.652 1.00 31.25  ? 246  LEU A CA    1 
ATOM   2529 C  C     . LEU C 3  240 ? 53.090 53.449  59.858 1.00 30.48  ? 246  LEU A C     1 
ATOM   2530 O  O     . LEU C 3  240 ? 52.319 52.853  59.110 1.00 31.00  ? 246  LEU A O     1 
ATOM   2531 C  CB    . LEU C 3  240 ? 53.082 55.939  59.952 1.00 29.37  ? 246  LEU A CB    1 
ATOM   2532 C  CG    . LEU C 3  240 ? 52.568 57.236  60.576 1.00 30.11  ? 246  LEU A CG    1 
ATOM   2533 C  CD1   . LEU C 3  240 ? 53.287 58.423  59.964 1.00 30.07  ? 246  LEU A CD1   1 
ATOM   2534 C  CD2   . LEU C 3  240 ? 51.065 57.341  60.367 1.00 30.43  ? 246  LEU A CD2   1 
ATOM   2535 N  N     . ALA C 3  241 ? 54.357 53.084  60.023 1.00 29.85  ? 247  ALA A N     1 
ATOM   2536 C  CA    . ALA C 3  241 ? 54.903 51.937  59.306 1.00 30.50  ? 247  ALA A CA    1 
ATOM   2537 C  C     . ALA C 3  241 ? 54.186 50.639  59.686 1.00 30.82  ? 247  ALA A C     1 
ATOM   2538 O  O     . ALA C 3  241 ? 53.952 49.783  58.835 1.00 31.39  ? 247  ALA A O     1 
ATOM   2539 C  CB    . ALA C 3  241 ? 56.393 51.808  59.585 1.00 30.45  ? 247  ALA A CB    1 
ATOM   2540 N  N     . ALA C 3  242 ? 53.850 50.493  60.965 1.00 30.35  ? 248  ALA A N     1 
ATOM   2541 C  CA    . ALA C 3  242 ? 53.160 49.293  61.438 1.00 31.46  ? 248  ALA A CA    1 
ATOM   2542 C  C     . ALA C 3  242 ? 51.781 49.212  60.795 1.00 31.35  ? 248  ALA A C     1 
ATOM   2543 O  O     . ALA C 3  242 ? 51.371 48.158  60.309 1.00 32.36  ? 248  ALA A O     1 
ATOM   2544 C  CB    . ALA C 3  242 ? 53.034 49.319  62.962 1.00 30.12  ? 248  ALA A CB    1 
ATOM   2545 N  N     . ARG C 3  243 ? 51.074 50.335  60.789 1.00 31.25  ? 249  ARG A N     1 
ATOM   2546 C  CA    . ARG C 3  243 ? 49.753 50.393  60.197 1.00 31.68  ? 249  ARG A CA    1 
ATOM   2547 C  C     . ARG C 3  243 ? 49.836 50.137  58.693 1.00 31.91  ? 249  ARG A C     1 
ATOM   2548 O  O     . ARG C 3  243 ? 48.991 49.439  58.131 1.00 32.51  ? 249  ARG A O     1 
ATOM   2549 C  CB    . ARG C 3  243 ? 49.115 51.752  60.472 1.00 33.27  ? 249  ARG A CB    1 
ATOM   2550 C  CG    . ARG C 3  243 ? 47.672 51.856  60.015 1.00 35.29  ? 249  ARG A CG    1 
ATOM   2551 C  CD    . ARG C 3  243 ? 46.831 50.724  60.593 1.00 36.79  ? 249  ARG A CD    1 
ATOM   2552 N  NE    . ARG C 3  243 ? 45.431 50.819  60.182 1.00 36.42  ? 249  ARG A NE    1 
ATOM   2553 C  CZ    . ARG C 3  243 ? 44.551 49.831  60.300 1.00 33.87  ? 249  ARG A CZ    1 
ATOM   2554 N  NH1   . ARG C 3  243 ? 44.922 48.667  60.817 1.00 33.74  ? 249  ARG A NH1   1 
ATOM   2555 N  NH2   . ARG C 3  243 ? 43.303 50.007  59.897 1.00 30.82  ? 249  ARG A NH2   1 
ATOM   2556 N  N     . ARG C 3  244 ? 50.849 50.691  58.032 1.00 31.30  ? 250  ARG A N     1 
ATOM   2557 C  CA    . ARG C 3  244 ? 50.988 50.463  56.596 1.00 30.79  ? 250  ARG A CA    1 
ATOM   2558 C  C     . ARG C 3  244 ? 51.145 48.965  56.343 1.00 30.64  ? 250  ARG A C     1 
ATOM   2559 O  O     . ARG C 3  244 ? 50.461 48.405  55.490 1.00 30.50  ? 250  ARG A O     1 
ATOM   2560 C  CB    . ARG C 3  244 ? 52.200 51.215  56.023 1.00 29.97  ? 250  ARG A CB    1 
ATOM   2561 C  CG    . ARG C 3  244 ? 52.458 50.944  54.529 1.00 29.56  ? 250  ARG A CG    1 
ATOM   2562 C  CD    . ARG C 3  244 ? 53.561 51.840  53.950 1.00 27.19  ? 250  ARG A CD    1 
ATOM   2563 N  NE    . ARG C 3  244 ? 54.844 51.677  54.635 1.00 30.18  ? 250  ARG A NE    1 
ATOM   2564 C  CZ    . ARG C 3  244 ? 55.899 52.474  54.460 1.00 30.46  ? 250  ARG A CZ    1 
ATOM   2565 N  NH1   . ARG C 3  244 ? 55.835 53.501  53.619 1.00 27.91  ? 250  ARG A NH1   1 
ATOM   2566 N  NH2   . ARG C 3  244 ? 57.022 52.247  55.130 1.00 28.78  ? 250  ARG A NH2   1 
ATOM   2567 N  N     . SER C 3  245 ? 52.042 48.324  57.090 1.00 29.98  ? 251  SER A N     1 
ATOM   2568 C  CA    . SER C 3  245 ? 52.289 46.892  56.945 1.00 32.13  ? 251  SER A CA    1 
ATOM   2569 C  C     . SER C 3  245 ? 51.038 46.041  57.126 1.00 32.17  ? 251  SER A C     1 
ATOM   2570 O  O     . SER C 3  245 ? 50.815 45.088  56.381 1.00 32.89  ? 251  SER A O     1 
ATOM   2571 C  CB    . SER C 3  245 ? 53.349 46.420  57.946 1.00 33.74  ? 251  SER A CB    1 
ATOM   2572 O  OG    . SER C 3  245 ? 54.643 46.854  57.567 1.00 39.12  ? 251  SER A OG    1 
ATOM   2573 N  N     . GLU C 3  246 ? 50.230 46.381  58.123 1.00 31.96  ? 252  GLU A N     1 
ATOM   2574 C  CA    . GLU C 3  246 ? 49.007 45.640  58.397 1.00 31.73  ? 252  GLU A CA    1 
ATOM   2575 C  C     . GLU C 3  246 ? 47.971 45.858  57.296 1.00 31.68  ? 252  GLU A C     1 
ATOM   2576 O  O     . GLU C 3  246 ? 47.229 44.938  56.941 1.00 32.70  ? 252  GLU A O     1 
ATOM   2577 C  CB    . GLU C 3  246 ? 48.451 46.058  59.763 1.00 32.88  ? 252  GLU A CB    1 
ATOM   2578 C  CG    . GLU C 3  246 ? 47.109 45.437  60.148 1.00 36.35  ? 252  GLU A CG    1 
ATOM   2579 C  CD    . GLU C 3  246 ? 47.130 43.910  60.257 1.00 35.85  ? 252  GLU A CD    1 
ATOM   2580 O  OE1   . GLU C 3  246 ? 48.220 43.298  60.272 1.00 33.80  ? 252  GLU A OE1   1 
ATOM   2581 O  OE2   . GLU C 3  246 ? 46.034 43.324  60.340 1.00 37.43  ? 252  GLU A OE2   1 
ATOM   2582 N  N     . LEU C 3  247 ? 47.914 47.069  56.749 1.00 29.58  ? 253  LEU A N     1 
ATOM   2583 C  CA    . LEU C 3  247 ? 46.966 47.341  55.682 1.00 29.98  ? 253  LEU A CA    1 
ATOM   2584 C  C     . LEU C 3  247 ? 47.400 46.557  54.453 1.00 31.34  ? 253  LEU A C     1 
ATOM   2585 O  O     . LEU C 3  247 ? 46.570 45.996  53.734 1.00 31.78  ? 253  LEU A O     1 
ATOM   2586 C  CB    . LEU C 3  247 ? 46.919 48.831  55.365 1.00 27.02  ? 253  LEU A CB    1 
ATOM   2587 C  CG    . LEU C 3  247 ? 46.368 49.690  56.498 1.00 26.91  ? 253  LEU A CG    1 
ATOM   2588 C  CD1   . LEU C 3  247 ? 46.514 51.161  56.154 1.00 26.72  ? 253  LEU A CD1   1 
ATOM   2589 C  CD2   . LEU C 3  247 ? 44.917 49.337  56.729 1.00 26.23  ? 253  LEU A CD2   1 
ATOM   2590 N  N     . LEU C 3  248 ? 48.707 46.510  54.221 1.00 31.28  ? 254  LEU A N     1 
ATOM   2591 C  CA    . LEU C 3  248 ? 49.239 45.776  53.083 1.00 33.40  ? 254  LEU A CA    1 
ATOM   2592 C  C     . LEU C 3  248 ? 48.869 44.300  53.214 1.00 35.09  ? 254  LEU A C     1 
ATOM   2593 O  O     . LEU C 3  248 ? 48.406 43.679  52.256 1.00 36.41  ? 254  LEU A O     1 
ATOM   2594 C  CB    . LEU C 3  248 ? 50.762 45.919  53.014 1.00 30.46  ? 254  LEU A CB    1 
ATOM   2595 C  CG    . LEU C 3  248 ? 51.395 45.305  51.760 1.00 30.13  ? 254  LEU A CG    1 
ATOM   2596 C  CD1   . LEU C 3  248 ? 50.835 45.990  50.521 1.00 27.14  ? 254  LEU A CD1   1 
ATOM   2597 C  CD2   . LEU C 3  248 ? 52.907 45.454  51.811 1.00 29.37  ? 254  LEU A CD2   1 
ATOM   2598 N  N     . ARG C 3  249 ? 49.077 43.748  54.407 1.00 35.34  ? 255  ARG A N     1 
ATOM   2599 C  CA    . ARG C 3  249 ? 48.764 42.348  54.678 1.00 36.84  ? 255  ARG A CA    1 
ATOM   2600 C  C     . ARG C 3  249 ? 47.306 42.035  54.343 1.00 36.23  ? 255  ARG A C     1 
ATOM   2601 O  O     . ARG C 3  249 ? 47.025 41.085  53.620 1.00 36.86  ? 255  ARG A O     1 
ATOM   2602 C  CB    . ARG C 3  249 ? 49.030 42.015  56.152 1.00 36.98  ? 255  ARG A CB    1 
ATOM   2603 C  CG    . ARG C 3  249 ? 48.933 40.522  56.468 1.00 36.75  ? 255  ARG A CG    1 
ATOM   2604 C  CD    . ARG C 3  249 ? 49.012 40.239  57.960 1.00 36.62  ? 255  ARG A CD    1 
ATOM   2605 N  NE    . ARG C 3  249 ? 47.805 40.667  58.663 1.00 37.69  ? 255  ARG A NE    1 
ATOM   2606 C  CZ    . ARG C 3  249 ? 46.615 40.085  58.539 1.00 39.02  ? 255  ARG A CZ    1 
ATOM   2607 N  NH1   . ARG C 3  249 ? 46.463 39.037  57.736 1.00 38.39  ? 255  ARG A NH1   1 
ATOM   2608 N  NH2   . ARG C 3  249 ? 45.572 40.553  59.217 1.00 38.41  ? 255  ARG A NH2   1 
ATOM   2609 N  N     . LYS C 3  250 ? 46.384 42.835  54.871 1.00 37.06  ? 256  LYS A N     1 
ATOM   2610 C  CA    . LYS C 3  250 ? 44.964 42.628  54.615 1.00 37.34  ? 256  LYS A CA    1 
ATOM   2611 C  C     . LYS C 3  250 ? 44.610 42.813  53.143 1.00 37.47  ? 256  LYS A C     1 
ATOM   2612 O  O     . LYS C 3  250 ? 43.875 42.012  52.566 1.00 36.03  ? 256  LYS A O     1 
ATOM   2613 C  CB    . LYS C 3  250 ? 44.118 43.580  55.464 1.00 38.10  ? 256  LYS A CB    1 
ATOM   2614 C  CG    . LYS C 3  250 ? 43.984 43.159  56.918 1.00 42.82  ? 256  LYS A CG    1 
ATOM   2615 C  CD    . LYS C 3  250 ? 42.930 43.978  57.640 1.00 45.41  ? 256  LYS A CD    1 
ATOM   2616 C  CE    . LYS C 3  250 ? 42.597 43.371  58.997 1.00 48.43  ? 256  LYS A CE    1 
ATOM   2617 N  NZ    . LYS C 3  250 ? 42.070 41.976  58.875 1.00 49.64  ? 256  LYS A NZ    1 
ATOM   2618 N  N     . LEU C 3  251 ? 45.130 43.873  52.535 1.00 36.98  ? 257  LEU A N     1 
ATOM   2619 C  CA    . LEU C 3  251 ? 44.848 44.140  51.133 1.00 35.94  ? 257  LEU A CA    1 
ATOM   2620 C  C     . LEU C 3  251 ? 45.403 43.066  50.197 1.00 36.29  ? 257  LEU A C     1 
ATOM   2621 O  O     . LEU C 3  251 ? 44.749 42.693  49.222 1.00 36.14  ? 257  LEU A O     1 
ATOM   2622 C  CB    . LEU C 3  251 ? 45.387 45.514  50.740 1.00 33.71  ? 257  LEU A CB    1 
ATOM   2623 C  CG    . LEU C 3  251 ? 44.570 46.695  51.269 1.00 35.32  ? 257  LEU A CG    1 
ATOM   2624 C  CD1   . LEU C 3  251 ? 45.235 48.001  50.874 1.00 35.39  ? 257  LEU A CD1   1 
ATOM   2625 C  CD2   . LEU C 3  251 ? 43.158 46.631  50.710 1.00 33.62  ? 257  LEU A CD2   1 
ATOM   2626 N  N     . THR C 3  252 ? 46.597 42.562  50.488 1.00 35.24  ? 258  THR A N     1 
ATOM   2627 C  CA    . THR C 3  252 ? 47.180 41.538  49.641 1.00 37.84  ? 258  THR A CA    1 
ATOM   2628 C  C     . THR C 3  252 ? 46.504 40.185  49.849 1.00 40.59  ? 258  THR A C     1 
ATOM   2629 O  O     . THR C 3  252 ? 46.723 39.251  49.080 1.00 41.69  ? 258  THR A O     1 
ATOM   2630 C  CB    . THR C 3  252 ? 48.699 41.415  49.868 1.00 38.62  ? 258  THR A CB    1 
ATOM   2631 O  OG1   . THR C 3  252 ? 48.979 41.397  51.270 1.00 40.31  ? 258  THR A OG1   1 
ATOM   2632 C  CG2   . THR C 3  252 ? 49.425 42.592  49.229 1.00 38.12  ? 258  THR A CG2   1 
ATOM   2633 N  N     . GLU C 3  253 ? 45.682 40.082  50.889 1.00 41.68  ? 259  GLU A N     1 
ATOM   2634 C  CA    . GLU C 3  253 ? 44.946 38.848  51.159 1.00 43.68  ? 259  GLU A CA    1 
ATOM   2635 C  C     . GLU C 3  253 ? 43.711 38.937  50.284 1.00 41.71  ? 259  GLU A C     1 
ATOM   2636 O  O     . GLU C 3  253 ? 43.337 37.987  49.606 1.00 42.55  ? 259  GLU A O     1 
ATOM   2637 C  CB    . GLU C 3  253 ? 44.527 38.774  52.636 1.00 47.33  ? 259  GLU A CB    1 
ATOM   2638 C  CG    . GLU C 3  253 ? 43.688 37.542  53.026 1.00 53.52  ? 259  GLU A CG    1 
ATOM   2639 C  CD    . GLU C 3  253 ? 42.176 37.799  53.027 1.00 56.46  ? 259  GLU A CD    1 
ATOM   2640 O  OE1   . GLU C 3  253 ? 41.728 38.747  53.711 1.00 58.92  ? 259  GLU A OE1   1 
ATOM   2641 O  OE2   . GLU C 3  253 ? 41.432 37.047  52.357 1.00 58.36  ? 259  GLU A OE2   1 
ATOM   2642 N  N     . THR C 3  254 ? 43.097 40.113  50.306 1.00 40.12  ? 260  THR A N     1 
ATOM   2643 C  CA    . THR C 3  254 ? 41.900 40.391  49.538 1.00 38.52  ? 260  THR A CA    1 
ATOM   2644 C  C     . THR C 3  254 ? 42.165 40.397  48.039 1.00 38.22  ? 260  THR A C     1 
ATOM   2645 O  O     . THR C 3  254 ? 41.472 39.725  47.278 1.00 36.74  ? 260  THR A O     1 
ATOM   2646 C  CB    . THR C 3  254 ? 41.315 41.744  49.953 1.00 37.94  ? 260  THR A CB    1 
ATOM   2647 O  OG1   . THR C 3  254 ? 40.796 41.639  51.284 1.00 36.20  ? 260  THR A OG1   1 
ATOM   2648 C  CG2   . THR C 3  254 ? 40.212 42.171  49.004 1.00 37.67  ? 260  THR A CG2   1 
ATOM   2649 N  N     . PHE C 3  255 ? 43.164 41.165  47.619 1.00 37.88  ? 261  PHE A N     1 
ATOM   2650 C  CA    . PHE C 3  255 ? 43.522 41.256  46.208 1.00 38.02  ? 261  PHE A CA    1 
ATOM   2651 C  C     . PHE C 3  255 ? 44.833 40.511  45.959 1.00 39.10  ? 261  PHE A C     1 
ATOM   2652 O  O     . PHE C 3  255 ? 45.915 41.031  46.231 1.00 41.80  ? 261  PHE A O     1 
ATOM   2653 C  CB    . PHE C 3  255 ? 43.663 42.725  45.815 1.00 35.58  ? 261  PHE A CB    1 
ATOM   2654 C  CG    . PHE C 3  255 ? 42.437 43.536  46.085 1.00 33.80  ? 261  PHE A CG    1 
ATOM   2655 C  CD1   . PHE C 3  255 ? 41.258 43.289  45.392 1.00 31.06  ? 261  PHE A CD1   1 
ATOM   2656 C  CD2   . PHE C 3  255 ? 42.455 44.545  47.040 1.00 32.29  ? 261  PHE A CD2   1 
ATOM   2657 C  CE1   . PHE C 3  255 ? 40.113 44.038  45.645 1.00 31.32  ? 261  PHE A CE1   1 
ATOM   2658 C  CE2   . PHE C 3  255 ? 41.314 45.298  47.301 1.00 31.39  ? 261  PHE A CE2   1 
ATOM   2659 C  CZ    . PHE C 3  255 ? 40.140 45.044  46.602 1.00 28.45  ? 261  PHE A CZ    1 
ATOM   2660 N  N     . GLY C 3  256 ? 44.735 39.294  45.438 1.00 39.99  ? 262  GLY A N     1 
ATOM   2661 C  CA    . GLY C 3  256 ? 45.925 38.496  45.191 1.00 40.09  ? 262  GLY A CA    1 
ATOM   2662 C  C     . GLY C 3  256 ? 46.780 38.916  44.011 1.00 40.30  ? 262  GLY A C     1 
ATOM   2663 O  O     . GLY C 3  256 ? 46.377 39.747  43.197 1.00 41.60  ? 262  GLY A O     1 
ATOM   2664 N  N     . SER C 3  257 ? 47.965 38.315  43.924 1.00 40.57  ? 263  SER A N     1 
ATOM   2665 C  CA    . SER C 3  257 ? 48.936 38.585  42.867 1.00 39.51  ? 263  SER A CA    1 
ATOM   2666 C  C     . SER C 3  257 ? 48.496 38.092  41.490 1.00 39.25  ? 263  SER A C     1 
ATOM   2667 O  O     . SER C 3  257 ? 47.521 37.349  41.366 1.00 39.00  ? 263  SER A O     1 
ATOM   2668 C  CB    . SER C 3  257 ? 50.265 37.930  43.226 1.00 40.50  ? 263  SER A CB    1 
ATOM   2669 O  OG    . SER C 3  257 ? 50.114 36.525  43.335 1.00 42.80  ? 263  SER A OG    1 
ATOM   2670 N  N     . TRP C 3  258 ? 49.232 38.499  40.458 1.00 39.31  ? 264  TRP A N     1 
ATOM   2671 C  CA    . TRP C 3  258 ? 48.916 38.109  39.087 1.00 39.30  ? 264  TRP A CA    1 
ATOM   2672 C  C     . TRP C 3  258 ? 50.111 38.302  38.154 1.00 40.33  ? 264  TRP A C     1 
ATOM   2673 O  O     . TRP C 3  258 ? 51.099 38.946  38.519 1.00 41.12  ? 264  TRP A O     1 
ATOM   2674 C  CB    . TRP C 3  258 ? 47.726 38.928  38.582 1.00 39.91  ? 264  TRP A CB    1 
ATOM   2675 C  CG    . TRP C 3  258 ? 48.044 40.375  38.332 1.00 41.45  ? 264  TRP A CG    1 
ATOM   2676 C  CD1   . TRP C 3  258 ? 48.543 40.920  37.180 1.00 40.91  ? 264  TRP A CD1   1 
ATOM   2677 C  CD2   . TRP C 3  258 ? 47.899 41.458  39.257 1.00 40.77  ? 264  TRP A CD2   1 
ATOM   2678 N  NE1   . TRP C 3  258 ? 48.716 42.275  37.333 1.00 41.52  ? 264  TRP A NE1   1 
ATOM   2679 C  CE2   . TRP C 3  258 ? 48.328 42.633  38.598 1.00 40.92  ? 264  TRP A CE2   1 
ATOM   2680 C  CE3   . TRP C 3  258 ? 47.449 41.552  40.582 1.00 40.93  ? 264  TRP A CE3   1 
ATOM   2681 C  CZ2   . TRP C 3  258 ? 48.322 43.890  39.218 1.00 40.79  ? 264  TRP A CZ2   1 
ATOM   2682 C  CZ3   . TRP C 3  258 ? 47.445 42.806  41.203 1.00 40.64  ? 264  TRP A CZ3   1 
ATOM   2683 C  CH2   . TRP C 3  258 ? 47.879 43.957  40.518 1.00 40.03  ? 264  TRP A CH2   1 
ATOM   2684 N  N     . TYR C 3  259 ? 50.020 37.746  36.949 1.00 39.33  ? 265  TYR A N     1 
ATOM   2685 C  CA    . TYR C 3  259 ? 51.100 37.869  35.975 1.00 38.90  ? 265  TYR A CA    1 
ATOM   2686 C  C     . TYR C 3  259 ? 50.793 38.853  34.851 1.00 38.43  ? 265  TYR A C     1 
ATOM   2687 O  O     . TYR C 3  259 ? 49.654 38.978  34.406 1.00 37.35  ? 265  TYR A O     1 
ATOM   2688 C  CB    . TYR C 3  259 ? 51.438 36.508  35.363 1.00 39.01  ? 265  TYR A CB    1 
ATOM   2689 C  CG    . TYR C 3  259 ? 52.172 35.569  36.290 1.00 38.88  ? 265  TYR A CG    1 
ATOM   2690 C  CD1   . TYR C 3  259 ? 51.479 34.754  37.184 1.00 37.87  ? 265  TYR A CD1   1 
ATOM   2691 C  CD2   . TYR C 3  259 ? 53.564 35.495  36.273 1.00 38.76  ? 265  TYR A CD2   1 
ATOM   2692 C  CE1   . TYR C 3  259 ? 52.156 33.884  38.035 1.00 37.05  ? 265  TYR A CE1   1 
ATOM   2693 C  CE2   . TYR C 3  259 ? 54.251 34.630  37.121 1.00 38.27  ? 265  TYR A CE2   1 
ATOM   2694 C  CZ    . TYR C 3  259 ? 53.540 33.827  37.999 1.00 38.34  ? 265  TYR A CZ    1 
ATOM   2695 O  OH    . TYR C 3  259 ? 54.216 32.970  38.841 1.00 38.80  ? 265  TYR A OH    1 
ATOM   2696 N  N     . GLN C 3  260 ? 51.826 39.552  34.401 1.00 38.69  ? 266  GLN A N     1 
ATOM   2697 C  CA    . GLN C 3  260 ? 51.694 40.524  33.322 1.00 40.40  ? 266  GLN A CA    1 
ATOM   2698 C  C     . GLN C 3  260 ? 52.849 40.329  32.363 1.00 39.59  ? 266  GLN A C     1 
ATOM   2699 O  O     . GLN C 3  260 ? 53.965 40.012  32.782 1.00 40.71  ? 266  GLN A O     1 
ATOM   2700 C  CB    . GLN C 3  260 ? 51.746 41.962  33.862 1.00 42.34  ? 266  GLN A CB    1 
ATOM   2701 C  CG    . GLN C 3  260 ? 50.407 42.559  34.289 1.00 46.81  ? 266  GLN A CG    1 
ATOM   2702 C  CD    . GLN C 3  260 ? 50.547 43.974  34.848 1.00 50.21  ? 266  GLN A CD    1 
ATOM   2703 O  OE1   . GLN C 3  260 ? 49.552 44.631  35.165 1.00 51.21  ? 266  GLN A OE1   1 
ATOM   2704 N  NE2   . GLN C 3  260 ? 51.788 44.445  34.975 1.00 51.33  ? 266  GLN A NE2   1 
ATOM   2705 N  N     . PRO C 3  261 ? 52.600 40.507  31.059 1.00 39.75  ? 267  PRO A N     1 
ATOM   2706 C  CA    . PRO C 3  261 ? 53.688 40.339  30.096 1.00 40.37  ? 267  PRO A CA    1 
ATOM   2707 C  C     . PRO C 3  261 ? 54.730 41.432  30.321 1.00 41.17  ? 267  PRO A C     1 
ATOM   2708 O  O     . PRO C 3  261 ? 54.383 42.581  30.586 1.00 39.09  ? 267  PRO A O     1 
ATOM   2709 C  CB    . PRO C 3  261 ? 52.978 40.459  28.751 1.00 38.74  ? 267  PRO A CB    1 
ATOM   2710 C  CG    . PRO C 3  261 ? 51.835 41.368  29.055 1.00 38.75  ? 267  PRO A CG    1 
ATOM   2711 C  CD    . PRO C 3  261 ? 51.342 40.860  30.380 1.00 38.67  ? 267  PRO A CD    1 
ATOM   2712 N  N     . LYS C 3  262 ? 56.002 41.063  30.233 1.00 43.78  ? 268  LYS A N     1 
ATOM   2713 C  CA    . LYS C 3  262 ? 57.089 42.010  30.437 1.00 47.28  ? 268  LYS A CA    1 
ATOM   2714 C  C     . LYS C 3  262 ? 58.384 41.507  29.810 1.00 48.91  ? 268  LYS A C     1 
ATOM   2715 O  O     . LYS C 3  262 ? 58.736 40.336  29.946 1.00 49.06  ? 268  LYS A O     1 
ATOM   2716 C  CB    . LYS C 3  262 ? 57.299 42.242  31.938 1.00 49.14  ? 268  LYS A CB    1 
ATOM   2717 C  CG    . LYS C 3  262 ? 58.571 43.007  32.291 1.00 52.13  ? 268  LYS A CG    1 
ATOM   2718 C  CD    . LYS C 3  262 ? 58.517 44.450  31.806 1.00 55.82  ? 268  LYS A CD    1 
ATOM   2719 C  CE    . LYS C 3  262 ? 57.638 45.318  32.697 1.00 58.03  ? 268  LYS A CE    1 
ATOM   2720 N  NZ    . LYS C 3  262 ? 58.235 45.499  34.055 1.00 60.84  ? 268  LYS A NZ    1 
ATOM   2721 N  N     . GLY C 3  263 ? 59.089 42.397  29.117 1.00 50.69  ? 269  GLY A N     1 
ATOM   2722 C  CA    . GLY C 3  263 ? 60.349 42.024  28.500 1.00 51.63  ? 269  GLY A CA    1 
ATOM   2723 C  C     . GLY C 3  263 ? 60.230 41.395  27.129 1.00 52.80  ? 269  GLY A C     1 
ATOM   2724 O  O     . GLY C 3  263 ? 61.162 40.745  26.660 1.00 54.39  ? 269  GLY A O     1 
ATOM   2725 N  N     . GLY C 3  264 ? 59.086 41.580  26.482 1.00 53.83  ? 270  GLY A N     1 
ATOM   2726 C  CA    . GLY C 3  264 ? 58.895 41.018  25.159 1.00 55.05  ? 270  GLY A CA    1 
ATOM   2727 C  C     . GLY C 3  264 ? 59.396 41.973  24.092 1.00 55.69  ? 270  GLY A C     1 
ATOM   2728 O  O     . GLY C 3  264 ? 59.049 43.152  24.100 1.00 55.53  ? 270  GLY A O     1 
ATOM   2729 N  N     . THR C 3  265 ? 60.211 41.467  23.173 1.00 56.41  ? 271  THR A N     1 
ATOM   2730 C  CA    . THR C 3  265 ? 60.765 42.290  22.101 1.00 57.75  ? 271  THR A CA    1 
ATOM   2731 C  C     . THR C 3  265 ? 60.059 42.079  20.763 1.00 57.84  ? 271  THR A C     1 
ATOM   2732 O  O     . THR C 3  265 ? 59.591 43.033  20.140 1.00 58.24  ? 271  THR A O     1 
ATOM   2733 C  CB    . THR C 3  265 ? 62.266 42.002  21.898 1.00 58.08  ? 271  THR A CB    1 
ATOM   2734 O  OG1   . THR C 3  265 ? 62.459 40.598  21.677 1.00 59.87  ? 271  THR A OG1   1 
ATOM   2735 C  CG2   . THR C 3  265 ? 63.063 42.433  23.118 1.00 59.24  ? 271  THR A CG2   1 
ATOM   2736 N  N     . GLU C 3  266 ? 59.984 40.824  20.330 1.00 57.25  ? 272  GLU A N     1 
ATOM   2737 C  CA    . GLU C 3  266 ? 59.358 40.478  19.059 1.00 56.75  ? 272  GLU A CA    1 
ATOM   2738 C  C     . GLU C 3  266 ? 57.852 40.723  19.025 1.00 55.44  ? 272  GLU A C     1 
ATOM   2739 O  O     . GLU C 3  266 ? 57.168 40.667  20.046 1.00 55.90  ? 272  GLU A O     1 
ATOM   2740 C  CB    . GLU C 3  266 ? 59.623 39.011  18.729 1.00 58.11  ? 272  GLU A CB    1 
ATOM   2741 C  CG    . GLU C 3  266 ? 61.038 38.551  19.018 1.00 60.64  ? 272  GLU A CG    1 
ATOM   2742 C  CD    . GLU C 3  266 ? 61.227 37.070  18.753 1.00 63.05  ? 272  GLU A CD    1 
ATOM   2743 O  OE1   . GLU C 3  266 ? 62.289 36.529  19.133 1.00 63.76  ? 272  GLU A OE1   1 
ATOM   2744 O  OE2   . GLU C 3  266 ? 60.313 36.449  18.161 1.00 63.75  ? 272  GLU A OE2   1 
ATOM   2745 N  N     . MET C 3  267 ? 57.350 40.989  17.827 1.00 53.93  ? 273  MET A N     1 
ATOM   2746 C  CA    . MET C 3  267 ? 55.930 41.228  17.592 1.00 52.36  ? 273  MET A CA    1 
ATOM   2747 C  C     . MET C 3  267 ? 55.254 39.876  17.373 1.00 50.45  ? 273  MET A C     1 
ATOM   2748 O  O     . MET C 3  267 ? 55.814 39.015  16.696 1.00 50.22  ? 273  MET A O     1 
ATOM   2749 C  CB    . MET C 3  267 ? 55.767 42.080  16.331 1.00 53.94  ? 273  MET A CB    1 
ATOM   2750 C  CG    . MET C 3  267 ? 54.364 42.120  15.764 1.00 54.47  ? 273  MET A CG    1 
ATOM   2751 S  SD    . MET C 3  267 ? 53.284 43.096  16.789 1.00 58.83  ? 273  MET A SD    1 
ATOM   2752 C  CE    . MET C 3  267 ? 53.586 44.722  16.097 1.00 58.30  ? 273  MET A CE    1 
ATOM   2753 N  N     . PHE C 3  268 ? 54.068 39.673  17.939 1.00 48.00  ? 274  PHE A N     1 
ATOM   2754 C  CA    . PHE C 3  268 ? 53.382 38.403  17.723 1.00 47.30  ? 274  PHE A CA    1 
ATOM   2755 C  C     . PHE C 3  268 ? 52.586 38.500  16.429 1.00 47.21  ? 274  PHE A C     1 
ATOM   2756 O  O     . PHE C 3  268 ? 51.797 39.428  16.239 1.00 46.32  ? 274  PHE A O     1 
ATOM   2757 C  CB    . PHE C 3  268 ? 52.436 38.059  18.878 1.00 45.76  ? 274  PHE A CB    1 
ATOM   2758 C  CG    . PHE C 3  268 ? 51.731 36.740  18.701 1.00 44.18  ? 274  PHE A CG    1 
ATOM   2759 C  CD1   . PHE C 3  268 ? 52.445 35.544  18.726 1.00 44.74  ? 274  PHE A CD1   1 
ATOM   2760 C  CD2   . PHE C 3  268 ? 50.361 36.694  18.466 1.00 44.66  ? 274  PHE A CD2   1 
ATOM   2761 C  CE1   . PHE C 3  268 ? 51.804 34.319  18.517 1.00 43.56  ? 274  PHE A CE1   1 
ATOM   2762 C  CE2   . PHE C 3  268 ? 49.710 35.478  18.256 1.00 44.01  ? 274  PHE A CE2   1 
ATOM   2763 C  CZ    . PHE C 3  268 ? 50.434 34.288  18.281 1.00 43.76  ? 274  PHE A CZ    1 
ATOM   2764 N  N     . CYS C 3  269 ? 52.800 37.541  15.538 1.00 47.99  ? 275  CYS A N     1 
ATOM   2765 C  CA    . CYS C 3  269 ? 52.106 37.531  14.257 1.00 50.38  ? 275  CYS A CA    1 
ATOM   2766 C  C     . CYS C 3  269 ? 51.247 36.284  14.090 1.00 51.02  ? 275  CYS A C     1 
ATOM   2767 O  O     . CYS C 3  269 ? 51.637 35.188  14.502 1.00 50.17  ? 275  CYS A O     1 
ATOM   2768 C  CB    . CYS C 3  269 ? 53.119 37.600  13.109 1.00 51.03  ? 275  CYS A CB    1 
ATOM   2769 S  SG    . CYS C 3  269 ? 54.193 39.064  13.111 1.00 53.74  ? 275  CYS A SG    1 
ATOM   2770 N  N     . HIS C 3  270 ? 50.081 36.454  13.477 1.00 52.07  ? 276  HIS A N     1 
ATOM   2771 C  CA    . HIS C 3  270 ? 49.180 35.331  13.242 1.00 53.73  ? 276  HIS A CA    1 
ATOM   2772 C  C     . HIS C 3  270 ? 49.960 34.233  12.518 1.00 54.02  ? 276  HIS A C     1 
ATOM   2773 O  O     . HIS C 3  270 ? 50.561 34.477  11.478 1.00 52.65  ? 276  HIS A O     1 
ATOM   2774 C  CB    . HIS C 3  270 ? 47.993 35.776  12.386 1.00 54.51  ? 276  HIS A CB    1 
ATOM   2775 C  CG    . HIS C 3  270 ? 46.826 34.842  12.448 1.00 56.37  ? 276  HIS A CG    1 
ATOM   2776 N  ND1   . HIS C 3  270 ? 45.641 35.168  13.073 1.00 56.28  ? 276  HIS A ND1   1 
ATOM   2777 C  CD2   . HIS C 3  270 ? 46.676 33.574  11.997 1.00 56.14  ? 276  HIS A CD2   1 
ATOM   2778 C  CE1   . HIS C 3  270 ? 44.812 34.142  13.006 1.00 55.72  ? 276  HIS A CE1   1 
ATOM   2779 N  NE2   . HIS C 3  270 ? 45.416 33.162  12.358 1.00 56.64  ? 276  HIS A NE2   1 
ATOM   2780 N  N     . PRO C 3  271 ? 49.968 33.008  13.067 1.00 55.47  ? 277  PRO A N     1 
ATOM   2781 C  CA    . PRO C 3  271 ? 50.690 31.885  12.453 1.00 56.90  ? 277  PRO A CA    1 
ATOM   2782 C  C     . PRO C 3  271 ? 50.125 31.489  11.091 1.00 58.66  ? 277  PRO A C     1 
ATOM   2783 O  O     . PRO C 3  271 ? 50.854 31.024  10.215 1.00 59.32  ? 277  PRO A O     1 
ATOM   2784 C  CB    . PRO C 3  271 ? 50.529 30.766  13.479 1.00 55.93  ? 277  PRO A CB    1 
ATOM   2785 C  CG    . PRO C 3  271 ? 50.324 31.502  14.771 1.00 55.40  ? 277  PRO A CG    1 
ATOM   2786 C  CD    . PRO C 3  271 ? 49.399 32.610  14.364 1.00 55.51  ? 277  PRO A CD    1 
ATOM   2787 N  N     . ARG C 3  272 ? 48.818 31.670  10.931 1.00 59.79  ? 278  ARG A N     1 
ATOM   2788 C  CA    . ARG C 3  272 ? 48.120 31.339  9.691  1.00 60.94  ? 278  ARG A CA    1 
ATOM   2789 C  C     . ARG C 3  272 ? 48.410 32.433  8.659  1.00 60.95  ? 278  ARG A C     1 
ATOM   2790 O  O     . ARG C 3  272 ? 49.272 32.283  7.792  1.00 60.19  ? 278  ARG A O     1 
ATOM   2791 C  CB    . ARG C 3  272 ? 46.614 31.261  9.976  1.00 62.49  ? 278  ARG A CB    1 
ATOM   2792 C  CG    . ARG C 3  272 ? 45.725 30.710  8.871  1.00 64.84  ? 278  ARG A CG    1 
ATOM   2793 C  CD    . ARG C 3  272 ? 44.259 31.044  9.176  1.00 64.74  ? 278  ARG A CD    1 
ATOM   2794 N  NE    . ARG C 3  272 ? 43.882 30.718  10.553 1.00 66.74  ? 278  ARG A NE    1 
ATOM   2795 C  CZ    . ARG C 3  272 ? 43.209 31.538  11.358 1.00 67.46  ? 278  ARG A CZ    1 
ATOM   2796 N  NH1   . ARG C 3  272 ? 42.840 32.735  10.925 1.00 69.10  ? 278  ARG A NH1   1 
ATOM   2797 N  NH2   . ARG C 3  272 ? 42.901 31.166  12.595 1.00 67.48  ? 278  ARG A NH2   1 
ATOM   2798 N  N     . THR C 3  273 ? 47.685 33.540  8.774  1.00 61.04  ? 279  THR A N     1 
ATOM   2799 C  CA    . THR C 3  273 ? 47.838 34.671  7.873  1.00 60.90  ? 279  THR A CA    1 
ATOM   2800 C  C     . THR C 3  273 ? 49.232 35.276  7.943  1.00 61.43  ? 279  THR A C     1 
ATOM   2801 O  O     . THR C 3  273 ? 49.803 35.669  6.926  1.00 61.66  ? 279  THR A O     1 
ATOM   2802 C  CB    . THR C 3  273 ? 46.817 35.766  8.204  1.00 61.54  ? 279  THR A CB    1 
ATOM   2803 O  OG1   . THR C 3  273 ? 45.510 35.339  7.796  1.00 61.58  ? 279  THR A OG1   1 
ATOM   2804 C  CG2   . THR C 3  273 ? 47.178 37.060  7.504  1.00 62.74  ? 279  THR A CG2   1 
ATOM   2805 N  N     . GLY C 3  274 ? 49.773 35.362  9.152  1.00 61.07  ? 280  GLY A N     1 
ATOM   2806 C  CA    . GLY C 3  274 ? 51.097 35.925  9.314  1.00 60.25  ? 280  GLY A CA    1 
ATOM   2807 C  C     . GLY C 3  274 ? 51.072 37.420  9.544  1.00 60.33  ? 280  GLY A C     1 
ATOM   2808 O  O     . GLY C 3  274 ? 52.127 38.055  9.570  1.00 60.29  ? 280  GLY A O     1 
ATOM   2809 N  N     . LYS C 3  275 ? 49.881 37.990  9.718  1.00 59.80  ? 281  LYS A N     1 
ATOM   2810 C  CA    . LYS C 3  275 ? 49.775 39.428  9.939  1.00 60.13  ? 281  LYS A CA    1 
ATOM   2811 C  C     . LYS C 3  275 ? 50.138 39.800  11.374 1.00 59.78  ? 281  LYS A C     1 
ATOM   2812 O  O     . LYS C 3  275 ? 49.801 39.081  12.317 1.00 60.11  ? 281  LYS A O     1 
ATOM   2813 C  CB    . LYS C 3  275 ? 48.362 39.931  9.604  1.00 60.48  ? 281  LYS A CB    1 
ATOM   2814 C  CG    . LYS C 3  275 ? 47.371 39.939  10.757 1.00 61.25  ? 281  LYS A CG    1 
ATOM   2815 C  CD    . LYS C 3  275 ? 46.016 40.465  10.286 1.00 62.25  ? 281  LYS A CD    1 
ATOM   2816 C  CE    . LYS C 3  275 ? 44.955 40.395  11.377 1.00 62.14  ? 281  LYS A CE    1 
ATOM   2817 N  NZ    . LYS C 3  275 ? 43.594 40.716  10.850 1.00 62.18  ? 281  LYS A NZ    1 
ATOM   2818 N  N     . PRO C 3  276 ? 50.849 40.927  11.553 1.00 59.20  ? 282  PRO A N     1 
ATOM   2819 C  CA    . PRO C 3  276 ? 51.274 41.415  12.868 1.00 58.68  ? 282  PRO A CA    1 
ATOM   2820 C  C     . PRO C 3  276 ? 50.094 41.736  13.778 1.00 58.21  ? 282  PRO A C     1 
ATOM   2821 O  O     . PRO C 3  276 ? 49.154 42.418  13.369 1.00 57.60  ? 282  PRO A O     1 
ATOM   2822 C  CB    . PRO C 3  276 ? 52.088 42.661  12.527 1.00 58.37  ? 282  PRO A CB    1 
ATOM   2823 C  CG    . PRO C 3  276 ? 52.643 42.342  11.174 1.00 58.35  ? 282  PRO A CG    1 
ATOM   2824 C  CD    . PRO C 3  276 ? 51.440 41.752  10.484 1.00 59.27  ? 282  PRO A CD    1 
ATOM   2825 N  N     . LEU C 3  277 ? 50.157 41.238  15.010 1.00 57.92  ? 283  LEU A N     1 
ATOM   2826 C  CA    . LEU C 3  277 ? 49.111 41.465  16.003 1.00 57.87  ? 283  LEU A CA    1 
ATOM   2827 C  C     . LEU C 3  277 ? 49.670 42.323  17.141 1.00 58.95  ? 283  LEU A C     1 
ATOM   2828 O  O     . LEU C 3  277 ? 50.058 41.808  18.193 1.00 58.40  ? 283  LEU A O     1 
ATOM   2829 C  CB    . LEU C 3  277 ? 48.615 40.126  16.549 1.00 56.94  ? 283  LEU A CB    1 
ATOM   2830 C  CG    . LEU C 3  277 ? 48.030 39.179  15.501 1.00 55.39  ? 283  LEU A CG    1 
ATOM   2831 C  CD1   . LEU C 3  277 ? 47.781 37.814  16.114 1.00 55.17  ? 283  LEU A CD1   1 
ATOM   2832 C  CD2   . LEU C 3  277 ? 46.746 39.773  14.955 1.00 54.63  ? 283  LEU A CD2   1 
ATOM   2833 N  N     . PRO C 3  278 ? 49.721 43.651  16.936 1.00 59.61  ? 284  PRO A N     1 
ATOM   2834 C  CA    . PRO C 3  278 ? 50.229 44.622  17.911 1.00 59.74  ? 284  PRO A CA    1 
ATOM   2835 C  C     . PRO C 3  278 ? 49.467 44.696  19.228 1.00 59.17  ? 284  PRO A C     1 
ATOM   2836 O  O     . PRO C 3  278 ? 49.963 45.275  20.192 1.00 59.52  ? 284  PRO A O     1 
ATOM   2837 C  CB    . PRO C 3  278 ? 50.168 45.945  17.148 1.00 59.81  ? 284  PRO A CB    1 
ATOM   2838 C  CG    . PRO C 3  278 ? 50.333 45.518  15.722 1.00 60.56  ? 284  PRO A CG    1 
ATOM   2839 C  CD    . PRO C 3  278 ? 49.430 44.318  15.655 1.00 59.16  ? 284  PRO A CD    1 
ATOM   2840 N  N     . LYS C 3  279 ? 48.265 44.127  19.273 1.00 58.75  ? 285  LYS A N     1 
ATOM   2841 C  CA    . LYS C 3  279 ? 47.475 44.159  20.500 1.00 59.03  ? 285  LYS A CA    1 
ATOM   2842 C  C     . LYS C 3  279 ? 47.799 42.993  21.426 1.00 58.22  ? 285  LYS A C     1 
ATOM   2843 O  O     . LYS C 3  279 ? 47.438 43.006  22.603 1.00 58.56  ? 285  LYS A O     1 
ATOM   2844 C  CB    . LYS C 3  279 ? 45.981 44.166  20.177 1.00 60.55  ? 285  LYS A CB    1 
ATOM   2845 C  CG    . LYS C 3  279 ? 45.492 45.414  19.445 1.00 62.51  ? 285  LYS A CG    1 
ATOM   2846 C  CD    . LYS C 3  279 ? 45.694 46.707  20.244 1.00 63.95  ? 285  LYS A CD    1 
ATOM   2847 C  CE    . LYS C 3  279 ? 47.084 47.306  20.039 1.00 65.07  ? 285  LYS A CE    1 
ATOM   2848 N  NZ    . LYS C 3  279 ? 47.235 48.642  20.688 1.00 64.96  ? 285  LYS A NZ    1 
ATOM   2849 N  N     . TYR C 3  280 ? 48.470 41.981  20.888 1.00 57.11  ? 286  TYR A N     1 
ATOM   2850 C  CA    . TYR C 3  280 ? 48.869 40.823  21.677 1.00 55.30  ? 286  TYR A CA    1 
ATOM   2851 C  C     . TYR C 3  280 ? 50.206 41.144  22.325 1.00 54.36  ? 286  TYR A C     1 
ATOM   2852 O  O     . TYR C 3  280 ? 50.986 41.931  21.796 1.00 54.66  ? 286  TYR A O     1 
ATOM   2853 C  CB    . TYR C 3  280 ? 49.014 39.591  20.783 1.00 54.97  ? 286  TYR A CB    1 
ATOM   2854 C  CG    . TYR C 3  280 ? 47.812 38.677  20.807 1.00 56.74  ? 286  TYR A CG    1 
ATOM   2855 C  CD1   . TYR C 3  280 ? 47.630 37.758  21.840 1.00 57.48  ? 286  TYR A CD1   1 
ATOM   2856 C  CD2   . TYR C 3  280 ? 46.839 38.749  19.814 1.00 57.25  ? 286  TYR A CD2   1 
ATOM   2857 C  CE1   . TYR C 3  280 ? 46.509 36.931  21.883 1.00 57.71  ? 286  TYR A CE1   1 
ATOM   2858 C  CE2   . TYR C 3  280 ? 45.713 37.928  19.848 1.00 58.15  ? 286  TYR A CE2   1 
ATOM   2859 C  CZ    . TYR C 3  280 ? 45.556 37.023  20.883 1.00 57.80  ? 286  TYR A CZ    1 
ATOM   2860 O  OH    . TYR C 3  280 ? 44.445 36.213  20.913 1.00 58.95  ? 286  TYR A OH    1 
ATOM   2861 N  N     . PRO C 3  281 ? 50.486 40.546  23.489 1.00 53.73  ? 287  PRO A N     1 
ATOM   2862 C  CA    . PRO C 3  281 ? 51.756 40.808  24.168 1.00 52.94  ? 287  PRO A CA    1 
ATOM   2863 C  C     . PRO C 3  281 ? 52.942 40.518  23.258 1.00 52.59  ? 287  PRO A C     1 
ATOM   2864 O  O     . PRO C 3  281 ? 52.869 39.648  22.395 1.00 51.50  ? 287  PRO A O     1 
ATOM   2865 C  CB    . PRO C 3  281 ? 51.708 39.857  25.358 1.00 52.69  ? 287  PRO A CB    1 
ATOM   2866 C  CG    . PRO C 3  281 ? 50.243 39.798  25.667 1.00 52.97  ? 287  PRO A CG    1 
ATOM   2867 C  CD    . PRO C 3  281 ? 49.629 39.664  24.298 1.00 53.31  ? 287  PRO A CD    1 
ATOM   2868 N  N     . ARG C 3  282 ? 54.029 41.257  23.444 1.00 53.35  ? 288  ARG A N     1 
ATOM   2869 C  CA    . ARG C 3  282 ? 55.222 41.033  22.643 1.00 53.77  ? 288  ARG A CA    1 
ATOM   2870 C  C     . ARG C 3  282 ? 55.745 39.666  23.064 1.00 52.84  ? 288  ARG A C     1 
ATOM   2871 O  O     . ARG C 3  282 ? 55.586 39.268  24.217 1.00 52.52  ? 288  ARG A O     1 
ATOM   2872 C  CB    . ARG C 3  282 ? 56.265 42.117  22.924 1.00 55.58  ? 288  ARG A CB    1 
ATOM   2873 C  CG    . ARG C 3  282 ? 55.890 43.517  22.422 1.00 59.14  ? 288  ARG A CG    1 
ATOM   2874 C  CD    . ARG C 3  282 ? 55.905 43.615  20.892 1.00 61.55  ? 288  ARG A CD    1 
ATOM   2875 N  NE    . ARG C 3  282 ? 54.569 43.552  20.297 1.00 64.21  ? 288  ARG A NE    1 
ATOM   2876 C  CZ    . ARG C 3  282 ? 53.653 44.514  20.395 1.00 65.27  ? 288  ARG A CZ    1 
ATOM   2877 N  NH1   . ARG C 3  282 ? 53.919 45.626  21.066 1.00 66.48  ? 288  ARG A NH1   1 
ATOM   2878 N  NH2   . ARG C 3  282 ? 52.465 44.367  19.823 1.00 66.15  ? 288  ARG A NH2   1 
ATOM   2879 N  N     . ILE C 3  283 ? 56.359 38.940  22.138 1.00 51.90  ? 289  ILE A N     1 
ATOM   2880 C  CA    . ILE C 3  283 ? 56.868 37.615  22.458 1.00 51.62  ? 289  ILE A CA    1 
ATOM   2881 C  C     . ILE C 3  283 ? 58.384 37.563  22.432 1.00 52.82  ? 289  ILE A C     1 
ATOM   2882 O  O     . ILE C 3  283 ? 59.051 38.594  22.363 1.00 53.57  ? 289  ILE A O     1 
ATOM   2883 C  CB    . ILE C 3  283 ? 56.320 36.556  21.481 1.00 50.03  ? 289  ILE A CB    1 
ATOM   2884 C  CG1   . ILE C 3  283 ? 56.964 36.723  20.104 1.00 47.89  ? 289  ILE A CG1   1 
ATOM   2885 C  CG2   . ILE C 3  283 ? 54.813 36.705  21.361 1.00 50.51  ? 289  ILE A CG2   1 
ATOM   2886 C  CD1   . ILE C 3  283 ? 56.597 35.634  19.120 1.00 45.92  ? 289  ILE A CD1   1 
ATOM   2887 N  N     . LYS C 3  284 ? 58.923 36.352  22.480 1.00 54.00  ? 290  LYS A N     1 
ATOM   2888 C  CA    . LYS C 3  284 ? 60.361 36.169  22.475 1.00 55.82  ? 290  LYS A CA    1 
ATOM   2889 C  C     . LYS C 3  284 ? 60.699 34.786  21.932 1.00 57.12  ? 290  LYS A C     1 
ATOM   2890 O  O     . LYS C 3  284 ? 60.631 33.797  22.657 1.00 58.13  ? 290  LYS A O     1 
ATOM   2891 C  CB    . LYS C 3  284 ? 60.890 36.329  23.902 1.00 56.44  ? 290  LYS A CB    1 
ATOM   2892 C  CG    . LYS C 3  284 ? 62.372 36.647  24.019 1.00 58.60  ? 290  LYS A CG    1 
ATOM   2893 C  CD    . LYS C 3  284 ? 63.252 35.444  23.731 1.00 60.33  ? 290  LYS A CD    1 
ATOM   2894 C  CE    . LYS C 3  284 ? 64.725 35.802  23.896 1.00 61.89  ? 290  LYS A CE    1 
ATOM   2895 N  NZ    . LYS C 3  284 ? 65.628 34.652  23.605 1.00 61.99  ? 290  LYS A NZ    1 
ATOM   2896 N  N     . THR C 3  285 ? 61.048 34.721  20.650 1.00 57.77  ? 291  THR A N     1 
ATOM   2897 C  CA    . THR C 3  285 ? 61.406 33.455  20.021 1.00 58.85  ? 291  THR A CA    1 
ATOM   2898 C  C     . THR C 3  285 ? 62.872 33.172  20.293 1.00 60.49  ? 291  THR A C     1 
ATOM   2899 O  O     . THR C 3  285 ? 63.742 33.924  19.862 1.00 61.25  ? 291  THR A O     1 
ATOM   2900 C  CB    . THR C 3  285 ? 61.212 33.502  18.499 1.00 57.78  ? 291  THR A CB    1 
ATOM   2901 O  OG1   . THR C 3  285 ? 59.849 33.814  18.198 1.00 58.81  ? 291  THR A OG1   1 
ATOM   2902 C  CG2   . THR C 3  285 ? 61.567 32.160  17.882 1.00 57.84  ? 291  THR A CG2   1 
ATOM   2903 N  N     . PRO C 3  286 ? 63.169 32.083  21.016 1.00 62.32  ? 292  PRO A N     1 
ATOM   2904 C  CA    . PRO C 3  286 ? 64.564 31.756  21.314 1.00 63.51  ? 292  PRO A CA    1 
ATOM   2905 C  C     . PRO C 3  286 ? 65.292 31.201  20.092 1.00 65.64  ? 292  PRO A C     1 
ATOM   2906 O  O     . PRO C 3  286 ? 64.667 30.661  19.178 1.00 65.90  ? 292  PRO A O     1 
ATOM   2907 C  CB    . PRO C 3  286 ? 64.436 30.732  22.436 1.00 62.62  ? 292  PRO A CB    1 
ATOM   2908 C  CG    . PRO C 3  286 ? 63.197 29.992  22.048 1.00 62.02  ? 292  PRO A CG    1 
ATOM   2909 C  CD    . PRO C 3  286 ? 62.254 31.107  21.637 1.00 62.03  ? 292  PRO A CD    1 
ATOM   2910 N  N     . LYS C 3  287 ? 66.615 31.339  20.083 1.00 67.54  ? 293  LYS A N     1 
ATOM   2911 C  CA    . LYS C 3  287 ? 67.432 30.851  18.977 1.00 69.04  ? 293  LYS A CA    1 
ATOM   2912 C  C     . LYS C 3  287 ? 68.193 29.600  19.398 1.00 70.11  ? 293  LYS A C     1 
ATOM   2913 O  O     . LYS C 3  287 ? 68.418 28.695  18.595 1.00 70.61  ? 293  LYS A O     1 
ATOM   2914 C  CB    . LYS C 3  287 ? 68.420 31.933  18.535 1.00 69.43  ? 293  LYS A CB    1 
ATOM   2915 N  N     . VAL C 3  288 ? 68.589 29.557  20.665 1.00 70.90  ? 294  VAL A N     1 
ATOM   2916 C  CA    . VAL C 3  288 ? 69.319 28.416  21.202 1.00 71.91  ? 294  VAL A CA    1 
ATOM   2917 C  C     . VAL C 3  288 ? 68.333 27.475  21.887 1.00 72.27  ? 294  VAL A C     1 
ATOM   2918 O  O     . VAL C 3  288 ? 67.432 27.927  22.595 1.00 72.96  ? 294  VAL A O     1 
ATOM   2919 C  CB    . VAL C 3  288 ? 70.373 28.868  22.243 1.00 72.06  ? 294  VAL A CB    1 
ATOM   2920 C  CG1   . VAL C 3  288 ? 71.145 27.665  22.761 1.00 72.61  ? 294  VAL A CG1   1 
ATOM   2921 C  CG2   . VAL C 3  288 ? 71.320 29.884  21.621 1.00 72.28  ? 294  VAL A CG2   1 
ATOM   2922 N  N     . GLY C 3  289 ? 68.490 26.173  21.669 1.00 72.25  ? 295  GLY A N     1 
ATOM   2923 C  CA    . GLY C 3  289 ? 67.596 25.225  22.308 1.00 72.21  ? 295  GLY A CA    1 
ATOM   2924 C  C     . GLY C 3  289 ? 66.989 24.150  21.429 1.00 72.09  ? 295  GLY A C     1 
ATOM   2925 O  O     . GLY C 3  289 ? 66.666 24.379  20.263 1.00 72.41  ? 295  GLY A O     1 
ATOM   2926 N  N     . GLY C 3  290 ? 66.833 22.968  22.015 1.00 72.11  ? 296  GLY A N     1 
ATOM   2927 C  CA    . GLY C 3  290 ? 66.256 21.831  21.323 1.00 72.32  ? 296  GLY A CA    1 
ATOM   2928 C  C     . GLY C 3  290 ? 65.929 20.768  22.357 1.00 73.06  ? 296  GLY A C     1 
ATOM   2929 O  O     . GLY C 3  290 ? 66.235 20.943  23.539 1.00 72.80  ? 296  GLY A O     1 
ATOM   2930 N  N     . ILE C 3  291 ? 65.307 19.671  21.937 1.00 73.22  ? 297  ILE A N     1 
ATOM   2931 C  CA    . ILE C 3  291 ? 64.970 18.611  22.881 1.00 73.33  ? 297  ILE A CA    1 
ATOM   2932 C  C     . ILE C 3  291 ? 66.263 18.020  23.431 1.00 73.36  ? 297  ILE A C     1 
ATOM   2933 O  O     . ILE C 3  291 ? 66.416 17.843  24.639 1.00 73.33  ? 297  ILE A O     1 
ATOM   2934 C  CB    . ILE C 3  291 ? 64.165 17.468  22.217 1.00 73.89  ? 297  ILE A CB    1 
ATOM   2935 C  CG1   . ILE C 3  291 ? 63.040 18.036  21.350 1.00 74.45  ? 297  ILE A CG1   1 
ATOM   2936 C  CG2   . ILE C 3  291 ? 63.576 16.564  23.288 1.00 73.43  ? 297  ILE A CG2   1 
ATOM   2937 C  CD1   . ILE C 3  291 ? 63.514 18.599  20.018 1.00 76.08  ? 297  ILE A CD1   1 
ATOM   2938 N  N     . PHE C 3  292 ? 67.193 17.718  22.530 1.00 73.65  ? 298  PHE A N     1 
ATOM   2939 C  CA    . PHE C 3  292 ? 68.475 17.146  22.918 1.00 73.54  ? 298  PHE A CA    1 
ATOM   2940 C  C     . PHE C 3  292 ? 69.614 18.112  22.635 1.00 74.09  ? 298  PHE A C     1 
ATOM   2941 O  O     . PHE C 3  292 ? 69.436 19.126  21.959 1.00 73.97  ? 298  PHE A O     1 
ATOM   2942 C  CB    . PHE C 3  292 ? 68.747 15.844  22.157 1.00 72.05  ? 298  PHE A CB    1 
ATOM   2943 C  CG    . PHE C 3  292 ? 67.585 14.896  22.132 1.00 71.13  ? 298  PHE A CG    1 
ATOM   2944 C  CD1   . PHE C 3  292 ? 66.606 15.004  21.148 1.00 70.38  ? 298  PHE A CD1   1 
ATOM   2945 C  CD2   . PHE C 3  292 ? 67.470 13.890  23.087 1.00 69.82  ? 298  PHE A CD2   1 
ATOM   2946 C  CE1   . PHE C 3  292 ? 65.529 14.123  21.112 1.00 69.77  ? 298  PHE A CE1   1 
ATOM   2947 C  CE2   . PHE C 3  292 ? 66.398 13.004  23.061 1.00 69.66  ? 298  PHE A CE2   1 
ATOM   2948 C  CZ    . PHE C 3  292 ? 65.424 13.120  22.070 1.00 69.59  ? 298  PHE A CZ    1 
ATOM   2949 N  N     . LYS C 3  293 ? 70.788 17.779  23.161 1.00 75.12  ? 299  LYS A N     1 
ATOM   2950 C  CA    . LYS C 3  293 ? 71.990 18.578  22.968 1.00 75.73  ? 299  LYS A CA    1 
ATOM   2951 C  C     . LYS C 3  293 ? 72.668 18.003  21.726 1.00 76.73  ? 299  LYS A C     1 
ATOM   2952 O  O     . LYS C 3  293 ? 72.516 16.816  21.432 1.00 76.55  ? 299  LYS A O     1 
ATOM   2953 C  CB    . LYS C 3  293 ? 72.901 18.441  24.194 1.00 75.19  ? 299  LYS A CB    1 
ATOM   2954 C  CG    . LYS C 3  293 ? 72.144 18.574  25.513 1.00 74.86  ? 299  LYS A CG    1 
ATOM   2955 C  CD    . LYS C 3  293 ? 72.986 18.219  26.733 1.00 74.25  ? 299  LYS A CD    1 
ATOM   2956 C  CE    . LYS C 3  293 ? 73.954 19.329  27.104 1.00 73.74  ? 299  LYS A CE    1 
ATOM   2957 N  NZ    . LYS C 3  293 ? 74.664 19.025  28.379 1.00 72.96  ? 299  LYS A NZ    1 
ATOM   2958 N  N     . LYS C 3  294 ? 73.400 18.835  20.990 1.00 78.03  ? 300  LYS A N     1 
ATOM   2959 C  CA    . LYS C 3  294 ? 74.074 18.361  19.784 1.00 79.05  ? 300  LYS A CA    1 
ATOM   2960 C  C     . LYS C 3  294 ? 74.855 17.072  20.050 1.00 79.27  ? 300  LYS A C     1 
ATOM   2961 O  O     . LYS C 3  294 ? 75.467 16.909  21.111 1.00 79.62  ? 300  LYS A O     1 
ATOM   2962 C  CB    . LYS C 3  294 ? 75.014 19.443  19.231 1.00 79.90  ? 300  LYS A CB    1 
ATOM   2963 C  CG    . LYS C 3  294 ? 75.858 18.978  18.044 1.00 81.31  ? 300  LYS A CG    1 
ATOM   2964 C  CD    . LYS C 3  294 ? 76.443 20.138  17.246 1.00 81.80  ? 300  LYS A CD    1 
ATOM   2965 C  CE    . LYS C 3  294 ? 77.428 19.644  16.189 1.00 81.58  ? 300  LYS A CE    1 
ATOM   2966 N  NZ    . LYS C 3  294 ? 76.838 18.612  15.289 1.00 82.37  ? 300  LYS A NZ    1 
ATOM   2967 N  N     . PRO C 3  295 ? 74.838 16.135  19.084 1.00 78.97  ? 301  PRO A N     1 
ATOM   2968 C  CA    . PRO C 3  295 ? 75.540 14.853  19.205 1.00 78.47  ? 301  PRO A CA    1 
ATOM   2969 C  C     . PRO C 3  295 ? 77.019 14.990  19.555 1.00 78.02  ? 301  PRO A C     1 
ATOM   2970 O  O     . PRO C 3  295 ? 77.829 15.392  18.723 1.00 78.46  ? 301  PRO A O     1 
ATOM   2971 C  CB    . PRO C 3  295 ? 75.316 14.207  17.834 1.00 78.49  ? 301  PRO A CB    1 
ATOM   2972 C  CG    . PRO C 3  295 ? 75.117 15.386  16.915 1.00 78.54  ? 301  PRO A CG    1 
ATOM   2973 C  CD    . PRO C 3  295 ? 74.227 16.264  17.748 1.00 78.81  ? 301  PRO A CD    1 
ATOM   2974 N  N     . GLU C 3  302 ? 77.106 9.509   19.402 1.00 79.61  ? 308  GLU A N     1 
ATOM   2975 C  CA    . GLU C 3  302 ? 75.712 9.887   19.197 1.00 79.43  ? 308  GLU A CA    1 
ATOM   2976 C  C     . GLU C 3  302 ? 75.200 9.401   17.853 1.00 80.04  ? 308  GLU A C     1 
ATOM   2977 O  O     . GLU C 3  302 ? 74.166 9.856   17.360 1.00 80.08  ? 308  GLU A O     1 
ATOM   2978 C  CB    . GLU C 3  302 ? 75.551 11.402  19.311 1.00 78.61  ? 308  GLU A CB    1 
ATOM   2979 C  CG    . GLU C 3  302 ? 75.081 11.891  20.681 1.00 77.29  ? 308  GLU A CG    1 
ATOM   2980 C  CD    . GLU C 3  302 ? 75.861 11.294  21.845 1.00 76.36  ? 308  GLU A CD    1 
ATOM   2981 O  OE1   . GLU C 3  302 ? 76.306 12.064  22.721 1.00 75.65  ? 308  GLU A OE1   1 
ATOM   2982 O  OE2   . GLU C 3  302 ? 76.019 10.057  21.901 1.00 75.46  ? 308  GLU A OE2   1 
ATOM   2983 N  N     . GLY C 3  303 ? 75.951 8.484   17.258 1.00 80.78  ? 309  GLY A N     1 
ATOM   2984 C  CA    . GLY C 3  303 ? 75.551 7.896   15.997 1.00 81.46  ? 309  GLY A CA    1 
ATOM   2985 C  C     . GLY C 3  303 ? 74.930 6.570   16.390 1.00 82.11  ? 309  GLY A C     1 
ATOM   2986 O  O     . GLY C 3  303 ? 75.598 5.535   16.371 1.00 82.35  ? 309  GLY A O     1 
ATOM   2987 N  N     . ARG C 3  304 ? 73.654 6.618   16.770 1.00 82.55  ? 310  ARG A N     1 
ATOM   2988 C  CA    . ARG C 3  304 ? 72.897 5.447   17.209 1.00 82.44  ? 310  ARG A CA    1 
ATOM   2989 C  C     . ARG C 3  304 ? 73.167 5.188   18.691 1.00 82.70  ? 310  ARG A C     1 
ATOM   2990 O  O     . ARG C 3  304 ? 73.499 4.073   19.098 1.00 82.35  ? 310  ARG A O     1 
ATOM   2991 C  CB    . ARG C 3  304 ? 73.267 4.213   16.379 1.00 82.68  ? 310  ARG A CB    1 
ATOM   2992 N  N     . GLU C 3  305 ? 73.026 6.242   19.487 1.00 82.56  ? 311  GLU A N     1 
ATOM   2993 C  CA    . GLU C 3  305 ? 73.232 6.184   20.929 1.00 82.46  ? 311  GLU A CA    1 
ATOM   2994 C  C     . GLU C 3  305 ? 72.643 7.465   21.515 1.00 82.22  ? 311  GLU A C     1 
ATOM   2995 O  O     . GLU C 3  305 ? 73.335 8.475   21.641 1.00 82.82  ? 311  GLU A O     1 
ATOM   2996 C  CB    . GLU C 3  305 ? 74.724 6.092   21.258 1.00 82.70  ? 311  GLU A CB    1 
ATOM   2997 C  CG    . GLU C 3  305 ? 75.025 5.950   22.745 1.00 83.17  ? 311  GLU A CG    1 
ATOM   2998 C  CD    . GLU C 3  305 ? 76.507 5.807   23.028 1.00 83.49  ? 311  GLU A CD    1 
ATOM   2999 O  OE1   . GLU C 3  305 ? 76.879 5.683   24.215 1.00 83.86  ? 311  GLU A OE1   1 
ATOM   3000 O  OE2   . GLU C 3  305 ? 77.299 5.818   22.063 1.00 84.28  ? 311  GLU A OE2   1 
ATOM   3001 N  N     . PRO C 3  306 ? 71.352 7.425   21.890 1.00 81.39  ? 312  PRO A N     1 
ATOM   3002 C  CA    . PRO C 3  306 ? 70.572 8.522   22.466 1.00 80.01  ? 312  PRO A CA    1 
ATOM   3003 C  C     . PRO C 3  306 ? 71.319 9.789   22.872 1.00 78.81  ? 312  PRO A C     1 
ATOM   3004 O  O     . PRO C 3  306 ? 72.086 9.793   23.836 1.00 78.95  ? 312  PRO A O     1 
ATOM   3005 C  CB    . PRO C 3  306 ? 69.877 7.847   23.635 1.00 80.26  ? 312  PRO A CB    1 
ATOM   3006 C  CG    . PRO C 3  306 ? 69.467 6.549   23.009 1.00 80.66  ? 312  PRO A CG    1 
ATOM   3007 C  CD    . PRO C 3  306 ? 70.686 6.137   22.173 1.00 81.37  ? 312  PRO A CD    1 
ATOM   3008 N  N     . CYS C 3  307 ? 71.085 10.863  22.123 1.00 77.08  ? 313  CYS A N     1 
ATOM   3009 C  CA    . CYS C 3  307 ? 71.707 12.147  22.414 1.00 75.67  ? 313  CYS A CA    1 
ATOM   3010 C  C     . CYS C 3  307 ? 71.284 12.595  23.806 1.00 74.38  ? 313  CYS A C     1 
ATOM   3011 O  O     . CYS C 3  307 ? 70.134 12.406  24.202 1.00 73.68  ? 313  CYS A O     1 
ATOM   3012 C  CB    . CYS C 3  307 ? 71.272 13.201  21.394 1.00 75.68  ? 313  CYS A CB    1 
ATOM   3013 S  SG    . CYS C 3  307 ? 72.293 13.294  19.916 1.00 77.03  ? 313  CYS A SG    1 
ATOM   3014 N  N     . GLU C 3  308 ? 72.216 13.186  24.545 1.00 73.30  ? 314  GLU A N     1 
ATOM   3015 C  CA    . GLU C 3  308 ? 71.931 13.669  25.888 1.00 72.31  ? 314  GLU A CA    1 
ATOM   3016 C  C     . GLU C 3  308 ? 70.852 14.747  25.830 1.00 71.65  ? 314  GLU A C     1 
ATOM   3017 O  O     . GLU C 3  308 ? 70.963 15.707  25.065 1.00 71.20  ? 314  GLU A O     1 
ATOM   3018 C  CB    . GLU C 3  308 ? 73.202 14.241  26.524 1.00 72.24  ? 314  GLU A CB    1 
ATOM   3019 N  N     . LEU C 3  309 ? 69.805 14.578  26.633 1.00 70.83  ? 315  LEU A N     1 
ATOM   3020 C  CA    . LEU C 3  309 ? 68.707 15.539  26.679 1.00 70.00  ? 315  LEU A CA    1 
ATOM   3021 C  C     . LEU C 3  309 ? 69.182 16.934  27.059 1.00 69.52  ? 315  LEU A C     1 
ATOM   3022 O  O     . LEU C 3  309 ? 70.043 17.100  27.924 1.00 69.18  ? 315  LEU A O     1 
ATOM   3023 C  CB    . LEU C 3  309 ? 67.639 15.080  27.673 1.00 69.89  ? 315  LEU A CB    1 
ATOM   3024 C  CG    . LEU C 3  309 ? 66.530 14.190  27.109 1.00 70.52  ? 315  LEU A CG    1 
ATOM   3025 C  CD1   . LEU C 3  309 ? 65.698 13.611  28.242 1.00 69.72  ? 315  LEU A CD1   1 
ATOM   3026 C  CD2   . LEU C 3  309 ? 65.661 15.009  26.165 1.00 70.59  ? 315  LEU A CD2   1 
ATOM   3027 N  N     . ASP C 3  310 ? 68.610 17.937  26.404 1.00 69.05  ? 316  ASP A N     1 
ATOM   3028 C  CA    . ASP C 3  310 ? 68.965 19.321  26.670 1.00 69.36  ? 316  ASP A CA    1 
ATOM   3029 C  C     . ASP C 3  310 ? 68.155 19.837  27.855 1.00 69.66  ? 316  ASP A C     1 
ATOM   3030 O  O     . ASP C 3  310 ? 66.963 20.117  27.730 1.00 69.63  ? 316  ASP A O     1 
ATOM   3031 C  CB    . ASP C 3  310 ? 68.689 20.180  25.432 1.00 69.60  ? 316  ASP A CB    1 
ATOM   3032 C  CG    . ASP C 3  310 ? 69.173 21.610  25.591 1.00 70.90  ? 316  ASP A CG    1 
ATOM   3033 O  OD1   . ASP C 3  310 ? 68.991 22.412  24.647 1.00 70.89  ? 316  ASP A OD1   1 
ATOM   3034 O  OD2   . ASP C 3  310 ? 69.736 21.935  26.660 1.00 70.95  ? 316  ASP A OD2   1 
ATOM   3035 N  N     . THR C 3  311 ? 68.809 19.951  29.006 1.00 69.89  ? 317  THR A N     1 
ATOM   3036 C  CA    . THR C 3  311 ? 68.158 20.439  30.217 1.00 70.15  ? 317  THR A CA    1 
ATOM   3037 C  C     . THR C 3  311 ? 67.623 21.857  29.989 1.00 69.69  ? 317  THR A C     1 
ATOM   3038 O  O     . THR C 3  311 ? 66.911 22.409  30.830 1.00 69.32  ? 317  THR A O     1 
ATOM   3039 C  CB    . THR C 3  311 ? 69.152 20.450  31.407 1.00 71.13  ? 317  THR A CB    1 
ATOM   3040 O  OG1   . THR C 3  311 ? 69.669 19.129  31.608 1.00 72.00  ? 317  THR A OG1   1 
ATOM   3041 C  CG2   . THR C 3  311 ? 68.468 20.908  32.688 1.00 72.02  ? 317  THR A CG2   1 
ATOM   3042 N  N     . ARG C 3  312 ? 67.967 22.438  28.842 1.00 69.13  ? 318  ARG A N     1 
ATOM   3043 C  CA    . ARG C 3  312 ? 67.525 23.787  28.505 1.00 67.89  ? 318  ARG A CA    1 
ATOM   3044 C  C     . ARG C 3  312 ? 66.013 23.940  28.650 1.00 66.60  ? 318  ARG A C     1 
ATOM   3045 O  O     . ARG C 3  312 ? 65.238 23.039  28.318 1.00 65.38  ? 318  ARG A O     1 
ATOM   3046 C  CB    . ARG C 3  312 ? 67.943 24.149  27.076 1.00 68.43  ? 318  ARG A CB    1 
ATOM   3047 N  N     . GLU C 3  313 ? 65.612 25.103  29.144 1.00 65.08  ? 319  GLU A N     1 
ATOM   3048 C  CA    . GLU C 3  313 ? 64.213 25.424  29.366 1.00 63.41  ? 319  GLU A CA    1 
ATOM   3049 C  C     . GLU C 3  313 ? 63.508 25.898  28.093 1.00 61.87  ? 319  GLU A C     1 
ATOM   3050 O  O     . GLU C 3  313 ? 62.281 25.954  28.042 1.00 61.32  ? 319  GLU A O     1 
ATOM   3051 C  CB    . GLU C 3  313 ? 64.129 26.487  30.466 1.00 64.32  ? 319  GLU A CB    1 
ATOM   3052 C  CG    . GLU C 3  313 ? 62.750 27.036  30.745 1.00 67.01  ? 319  GLU A CG    1 
ATOM   3053 C  CD    . GLU C 3  313 ? 62.698 27.811  32.049 1.00 68.16  ? 319  GLU A CD    1 
ATOM   3054 O  OE1   . GLU C 3  313 ? 62.689 27.165  33.121 1.00 69.22  ? 319  GLU A OE1   1 
ATOM   3055 O  OE2   . GLU C 3  313 ? 62.679 29.061  32.003 1.00 68.37  ? 319  GLU A OE2   1 
ATOM   3056 N  N     . TYR C 3  314 ? 64.281 26.216  27.059 1.00 60.57  ? 320  TYR A N     1 
ATOM   3057 C  CA    . TYR C 3  314 ? 63.703 26.696  25.808 1.00 59.15  ? 320  TYR A CA    1 
ATOM   3058 C  C     . TYR C 3  314 ? 63.966 25.789  24.608 1.00 58.28  ? 320  TYR A C     1 
ATOM   3059 O  O     . TYR C 3  314 ? 64.714 24.816  24.693 1.00 57.86  ? 320  TYR A O     1 
ATOM   3060 C  CB    . TYR C 3  314 ? 64.233 28.096  25.495 1.00 59.64  ? 320  TYR A CB    1 
ATOM   3061 C  CG    . TYR C 3  314 ? 64.002 29.103  26.596 1.00 60.57  ? 320  TYR A CG    1 
ATOM   3062 C  CD1   . TYR C 3  314 ? 62.714 29.527  26.923 1.00 61.74  ? 320  TYR A CD1   1 
ATOM   3063 C  CD2   . TYR C 3  314 ? 65.069 29.620  27.325 1.00 60.79  ? 320  TYR A CD2   1 
ATOM   3064 C  CE1   . TYR C 3  314 ? 62.497 30.443  27.954 1.00 61.90  ? 320  TYR A CE1   1 
ATOM   3065 C  CE2   . TYR C 3  314 ? 64.865 30.534  28.356 1.00 61.22  ? 320  TYR A CE2   1 
ATOM   3066 C  CZ    . TYR C 3  314 ? 63.578 30.940  28.667 1.00 62.28  ? 320  TYR A CZ    1 
ATOM   3067 O  OH    . TYR C 3  314 ? 63.373 31.830  29.698 1.00 62.53  ? 320  TYR A OH    1 
ATOM   3068 N  N     . VAL C 3  315 ? 63.332 26.130  23.491 1.00 57.38  ? 321  VAL A N     1 
ATOM   3069 C  CA    . VAL C 3  315 ? 63.476 25.396  22.240 1.00 57.34  ? 321  VAL A CA    1 
ATOM   3070 C  C     . VAL C 3  315 ? 63.386 26.381  21.080 1.00 57.47  ? 321  VAL A C     1 
ATOM   3071 O  O     . VAL C 3  315 ? 62.340 26.997  20.856 1.00 57.24  ? 321  VAL A O     1 
ATOM   3072 C  CB    . VAL C 3  315 ? 62.374 24.332  22.072 1.00 56.95  ? 321  VAL A CB    1 
ATOM   3073 C  CG1   . VAL C 3  315 ? 62.377 23.800  20.646 1.00 56.53  ? 321  VAL A CG1   1 
ATOM   3074 C  CG2   . VAL C 3  315 ? 62.602 23.197  23.054 1.00 57.18  ? 321  VAL A CG2   1 
ATOM   3075 N  N     . ALA C 3  316 ? 64.488 26.530  20.351 1.00 57.15  ? 322  ALA A N     1 
ATOM   3076 C  CA    . ALA C 3  316 ? 64.542 27.445  19.215 1.00 56.51  ? 322  ALA A CA    1 
ATOM   3077 C  C     . ALA C 3  316 ? 63.330 27.261  18.309 1.00 56.05  ? 322  ALA A C     1 
ATOM   3078 O  O     . ALA C 3  316 ? 63.003 26.139  17.913 1.00 55.55  ? 322  ALA A O     1 
ATOM   3079 C  CB    . ALA C 3  316 ? 65.823 27.215  18.425 1.00 56.93  ? 322  ALA A CB    1 
ATOM   3080 N  N     . GLY C 3  317 ? 62.664 28.369  17.992 1.00 55.13  ? 323  GLY A N     1 
ATOM   3081 C  CA    . GLY C 3  317 ? 61.496 28.310  17.133 1.00 53.37  ? 323  GLY A CA    1 
ATOM   3082 C  C     . GLY C 3  317 ? 60.183 28.497  17.870 1.00 52.52  ? 323  GLY A C     1 
ATOM   3083 O  O     . GLY C 3  317 ? 59.319 29.255  17.421 1.00 52.75  ? 323  GLY A O     1 
ATOM   3084 N  N     . ALA C 3  318 ? 60.031 27.810  19.000 1.00 51.15  ? 324  ALA A N     1 
ATOM   3085 C  CA    . ALA C 3  318 ? 58.811 27.889  19.803 1.00 49.26  ? 324  ALA A CA    1 
ATOM   3086 C  C     . ALA C 3  318 ? 58.741 29.185  20.613 1.00 47.94  ? 324  ALA A C     1 
ATOM   3087 O  O     . ALA C 3  318 ? 59.454 29.356  21.597 1.00 47.22  ? 324  ALA A O     1 
ATOM   3088 C  CB    . ALA C 3  318 ? 58.728 26.688  20.731 1.00 50.01  ? 324  ALA A CB    1 
ATOM   3089 N  N     . PRO C 3  319 ? 57.859 30.109  20.211 1.00 46.76  ? 325  PRO A N     1 
ATOM   3090 C  CA    . PRO C 3  319 ? 57.695 31.393  20.893 1.00 46.31  ? 325  PRO A CA    1 
ATOM   3091 C  C     . PRO C 3  319 ? 56.932 31.316  22.213 1.00 47.13  ? 325  PRO A C     1 
ATOM   3092 O  O     . PRO C 3  319 ? 56.101 30.429  22.413 1.00 47.45  ? 325  PRO A O     1 
ATOM   3093 C  CB    . PRO C 3  319 ? 56.953 32.225  19.860 1.00 44.80  ? 325  PRO A CB    1 
ATOM   3094 C  CG    . PRO C 3  319 ? 56.040 31.210  19.248 1.00 45.31  ? 325  PRO A CG    1 
ATOM   3095 C  CD    . PRO C 3  319 ? 56.952 30.011  19.053 1.00 45.83  ? 325  PRO A CD    1 
ATOM   3096 N  N     . TYR C 3  320 ? 57.220 32.256  23.109 1.00 46.99  ? 326  TYR A N     1 
ATOM   3097 C  CA    . TYR C 3  320 ? 56.544 32.321  24.399 1.00 46.35  ? 326  TYR A CA    1 
ATOM   3098 C  C     . TYR C 3  320 ? 56.408 33.777  24.819 1.00 45.07  ? 326  TYR A C     1 
ATOM   3099 O  O     . TYR C 3  320 ? 57.056 34.653  24.254 1.00 45.98  ? 326  TYR A O     1 
ATOM   3100 C  CB    . TYR C 3  320 ? 57.322 31.548  25.465 1.00 48.28  ? 326  TYR A CB    1 
ATOM   3101 C  CG    . TYR C 3  320 ? 58.630 32.185  25.881 1.00 50.07  ? 326  TYR A CG    1 
ATOM   3102 C  CD1   . TYR C 3  320 ? 59.810 31.942  25.177 1.00 50.32  ? 326  TYR A CD1   1 
ATOM   3103 C  CD2   . TYR C 3  320 ? 58.688 33.027  26.990 1.00 51.28  ? 326  TYR A CD2   1 
ATOM   3104 C  CE1   . TYR C 3  320 ? 61.020 32.523  25.572 1.00 50.95  ? 326  TYR A CE1   1 
ATOM   3105 C  CE2   . TYR C 3  320 ? 59.887 33.612  27.392 1.00 52.53  ? 326  TYR A CE2   1 
ATOM   3106 C  CZ    . TYR C 3  320 ? 61.049 33.357  26.682 1.00 52.32  ? 326  TYR A CZ    1 
ATOM   3107 O  OH    . TYR C 3  320 ? 62.229 33.944  27.086 1.00 52.53  ? 326  TYR A OH    1 
ATOM   3108 N  N     . THR C 3  321 ? 55.562 34.040  25.805 1.00 42.95  ? 327  THR A N     1 
ATOM   3109 C  CA    . THR C 3  321 ? 55.373 35.403  26.269 1.00 41.14  ? 327  THR A CA    1 
ATOM   3110 C  C     . THR C 3  321 ? 56.011 35.618  27.632 1.00 41.33  ? 327  THR A C     1 
ATOM   3111 O  O     . THR C 3  321 ? 55.572 35.043  28.630 1.00 41.83  ? 327  THR A O     1 
ATOM   3112 C  CB    . THR C 3  321 ? 53.884 35.767  26.379 1.00 40.64  ? 327  THR A CB    1 
ATOM   3113 O  OG1   . THR C 3  321 ? 53.251 35.616  25.101 1.00 39.89  ? 327  THR A OG1   1 
ATOM   3114 C  CG2   . THR C 3  321 ? 53.731 37.206  26.851 1.00 38.63  ? 327  THR A CG2   1 
ATOM   3115 N  N     . PRO C 3  322 ? 57.070 36.442  27.689 1.00 40.42  ? 328  PRO A N     1 
ATOM   3116 C  CA    . PRO C 3  322 ? 57.770 36.739  28.942 1.00 38.88  ? 328  PRO A CA    1 
ATOM   3117 C  C     . PRO C 3  322 ? 56.799 37.425  29.900 1.00 37.59  ? 328  PRO A C     1 
ATOM   3118 O  O     . PRO C 3  322 ? 56.038 38.304  29.493 1.00 37.03  ? 328  PRO A O     1 
ATOM   3119 C  CB    . PRO C 3  322 ? 58.889 37.682  28.496 1.00 39.38  ? 328  PRO A CB    1 
ATOM   3120 C  CG    . PRO C 3  322 ? 59.160 37.250  27.097 1.00 40.48  ? 328  PRO A CG    1 
ATOM   3121 C  CD    . PRO C 3  322 ? 57.766 37.058  26.546 1.00 40.19  ? 328  PRO A CD    1 
ATOM   3122 N  N     . VAL C 3  323 ? 56.817 37.033  31.167 1.00 36.52  ? 329  VAL A N     1 
ATOM   3123 C  CA    . VAL C 3  323 ? 55.911 37.644  32.127 1.00 37.02  ? 329  VAL A CA    1 
ATOM   3124 C  C     . VAL C 3  323 ? 56.584 37.883  33.463 1.00 38.75  ? 329  VAL A C     1 
ATOM   3125 O  O     . VAL C 3  323 ? 57.592 37.257  33.789 1.00 39.85  ? 329  VAL A O     1 
ATOM   3126 C  CB    . VAL C 3  323 ? 54.655 36.763  32.363 1.00 35.43  ? 329  VAL A CB    1 
ATOM   3127 C  CG1   . VAL C 3  323 ? 53.868 36.610  31.073 1.00 33.19  ? 329  VAL A CG1   1 
ATOM   3128 C  CG2   . VAL C 3  323 ? 55.067 35.400  32.884 1.00 33.67  ? 329  VAL A CG2   1 
ATOM   3129 N  N     . GLU C 3  324 ? 56.018 38.805  34.232 1.00 40.89  ? 330  GLU A N     1 
ATOM   3130 C  CA    . GLU C 3  324 ? 56.536 39.127  35.552 1.00 42.15  ? 330  GLU A CA    1 
ATOM   3131 C  C     . GLU C 3  324 ? 55.403 38.885  36.545 1.00 41.79  ? 330  GLU A C     1 
ATOM   3132 O  O     . GLU C 3  324 ? 54.229 39.049  36.205 1.00 41.86  ? 330  GLU A O     1 
ATOM   3133 C  CB    . GLU C 3  324 ? 56.954 40.600  35.617 1.00 43.68  ? 330  GLU A CB    1 
ATOM   3134 C  CG    . GLU C 3  324 ? 55.772 41.562  35.629 1.00 46.38  ? 330  GLU A CG    1 
ATOM   3135 C  CD    . GLU C 3  324 ? 56.188 43.015  35.721 1.00 47.66  ? 330  GLU A CD    1 
ATOM   3136 O  OE1   . GLU C 3  324 ? 57.225 43.295  36.357 1.00 48.25  ? 330  GLU A OE1   1 
ATOM   3137 O  OE2   . GLU C 3  324 ? 55.466 43.876  35.171 1.00 48.04  ? 330  GLU A OE2   1 
ATOM   3138 N  N     . HIS C 3  325 ? 55.749 38.484  37.762 1.00 41.48  ? 331  HIS A N     1 
ATOM   3139 C  CA    . HIS C 3  325 ? 54.739 38.262  38.787 1.00 41.60  ? 331  HIS A CA    1 
ATOM   3140 C  C     . HIS C 3  325 ? 54.596 39.583  39.544 1.00 40.63  ? 331  HIS A C     1 
ATOM   3141 O  O     . HIS C 3  325 ? 55.590 40.145  40.002 1.00 41.31  ? 331  HIS A O     1 
ATOM   3142 C  CB    . HIS C 3  325 ? 55.188 37.163  39.753 1.00 41.76  ? 331  HIS A CB    1 
ATOM   3143 C  CG    . HIS C 3  325 ? 54.124 36.733  40.713 1.00 43.60  ? 331  HIS A CG    1 
ATOM   3144 N  ND1   . HIS C 3  325 ? 54.384 36.448  42.036 1.00 45.21  ? 331  HIS A ND1   1 
ATOM   3145 C  CD2   . HIS C 3  325 ? 52.794 36.537  40.541 1.00 43.56  ? 331  HIS A CD2   1 
ATOM   3146 C  CE1   . HIS C 3  325 ? 53.261 36.098  42.639 1.00 43.44  ? 331  HIS A CE1   1 
ATOM   3147 N  NE2   . HIS C 3  325 ? 52.282 36.144  41.753 1.00 43.26  ? 331  HIS A NE2   1 
ATOM   3148 N  N     . VAL C 3  326 ? 53.376 40.088  39.671 1.00 39.89  ? 332  VAL A N     1 
ATOM   3149 C  CA    . VAL C 3  326 ? 53.182 41.342  40.379 1.00 39.53  ? 332  VAL A CA    1 
ATOM   3150 C  C     . VAL C 3  326 ? 52.219 41.231  41.559 1.00 39.11  ? 332  VAL A C     1 
ATOM   3151 O  O     . VAL C 3  326 ? 51.153 40.613  41.469 1.00 37.56  ? 332  VAL A O     1 
ATOM   3152 C  CB    . VAL C 3  326 ? 52.723 42.475  39.411 1.00 41.12  ? 332  VAL A CB    1 
ATOM   3153 C  CG1   . VAL C 3  326 ? 52.524 41.918  38.011 1.00 41.63  ? 332  VAL A CG1   1 
ATOM   3154 C  CG2   . VAL C 3  326 ? 51.447 43.136  39.917 1.00 41.25  ? 332  VAL A CG2   1 
ATOM   3155 N  N     . VAL C 3  327 ? 52.627 41.840  42.667 1.00 36.69  ? 333  VAL A N     1 
ATOM   3156 C  CA    . VAL C 3  327 ? 51.865 41.850  43.905 1.00 34.47  ? 333  VAL A CA    1 
ATOM   3157 C  C     . VAL C 3  327 ? 51.051 43.140  44.005 1.00 33.59  ? 333  VAL A C     1 
ATOM   3158 O  O     . VAL C 3  327 ? 51.541 44.224  43.680 1.00 32.30  ? 333  VAL A O     1 
ATOM   3159 C  CB    . VAL C 3  327 ? 52.822 41.759  45.116 1.00 35.47  ? 333  VAL A CB    1 
ATOM   3160 C  CG1   . VAL C 3  327 ? 52.036 41.769  46.421 1.00 35.59  ? 333  VAL A CG1   1 
ATOM   3161 C  CG2   . VAL C 3  327 ? 53.674 40.498  45.004 1.00 35.99  ? 333  VAL A CG2   1 
ATOM   3162 N  N     . PHE C 3  328 ? 49.808 43.027  44.456 1.00 31.39  ? 334  PHE A N     1 
ATOM   3163 C  CA    . PHE C 3  328 ? 48.957 44.203  44.587 1.00 31.23  ? 334  PHE A CA    1 
ATOM   3164 C  C     . PHE C 3  328 ? 49.658 45.305  45.382 1.00 31.83  ? 334  PHE A C     1 
ATOM   3165 O  O     . PHE C 3  328 ? 50.131 45.073  46.492 1.00 33.65  ? 334  PHE A O     1 
ATOM   3166 C  CB    . PHE C 3  328 ? 47.655 43.843  45.285 1.00 27.27  ? 334  PHE A CB    1 
ATOM   3167 C  CG    . PHE C 3  328 ? 46.712 44.994  45.423 1.00 27.13  ? 334  PHE A CG    1 
ATOM   3168 C  CD1   . PHE C 3  328 ? 46.048 45.497  44.313 1.00 24.68  ? 334  PHE A CD1   1 
ATOM   3169 C  CD2   . PHE C 3  328 ? 46.486 45.581  46.666 1.00 25.92  ? 334  PHE A CD2   1 
ATOM   3170 C  CE1   . PHE C 3  328 ? 45.170 46.568  44.437 1.00 26.75  ? 334  PHE A CE1   1 
ATOM   3171 C  CE2   . PHE C 3  328 ? 45.610 46.651  46.801 1.00 23.84  ? 334  PHE A CE2   1 
ATOM   3172 C  CZ    . PHE C 3  328 ? 44.950 47.146  45.690 1.00 24.93  ? 334  PHE A CZ    1 
ATOM   3173 N  N     . ASN C 3  329 ? 49.718 46.502  44.807 1.00 31.49  ? 335  ASN A N     1 
ATOM   3174 C  CA    . ASN C 3  329 ? 50.348 47.649  45.456 1.00 29.52  ? 335  ASN A CA    1 
ATOM   3175 C  C     . ASN C 3  329 ? 49.278 48.709  45.666 1.00 28.41  ? 335  ASN A C     1 
ATOM   3176 O  O     . ASN C 3  329 ? 48.865 49.368  44.720 1.00 28.99  ? 335  ASN A O     1 
ATOM   3177 C  CB    . ASN C 3  329 ? 51.452 48.219  44.568 1.00 29.62  ? 335  ASN A CB    1 
ATOM   3178 C  CG    . ASN C 3  329 ? 52.165 49.401  45.210 1.00 31.63  ? 335  ASN A CG    1 
ATOM   3179 O  OD1   . ASN C 3  329 ? 51.641 50.034  46.130 1.00 27.56  ? 335  ASN A OD1   1 
ATOM   3180 N  ND2   . ASN C 3  329 ? 53.359 49.713  44.715 1.00 31.69  ? 335  ASN A ND2   1 
ATOM   3181 N  N     . PRO C 3  330 ? 48.825 48.902  46.914 1.00 28.07  ? 336  PRO A N     1 
ATOM   3182 C  CA    . PRO C 3  330 ? 47.787 49.891  47.232 1.00 26.97  ? 336  PRO A CA    1 
ATOM   3183 C  C     . PRO C 3  330 ? 48.119 51.321  46.802 1.00 27.89  ? 336  PRO A C     1 
ATOM   3184 O  O     . PRO C 3  330 ? 47.235 52.180  46.738 1.00 29.06  ? 336  PRO A O     1 
ATOM   3185 C  CB    . PRO C 3  330 ? 47.642 49.768  48.745 1.00 28.08  ? 336  PRO A CB    1 
ATOM   3186 C  CG    . PRO C 3  330 ? 48.116 48.372  49.035 1.00 29.72  ? 336  PRO A CG    1 
ATOM   3187 C  CD    . PRO C 3  330 ? 49.297 48.228  48.132 1.00 26.72  ? 336  PRO A CD    1 
ATOM   3188 N  N     . SER C 3  331 ? 49.392 51.581  46.519 1.00 28.82  ? 337  SER A N     1 
ATOM   3189 C  CA    . SER C 3  331 ? 49.820 52.910  46.088 1.00 28.57  ? 337  SER A CA    1 
ATOM   3190 C  C     . SER C 3  331 ? 49.672 53.096  44.582 1.00 30.46  ? 337  SER A C     1 
ATOM   3191 O  O     . SER C 3  331 ? 49.743 54.219  44.078 1.00 29.10  ? 337  SER A O     1 
ATOM   3192 C  CB    . SER C 3  331 ? 51.276 53.158  46.488 1.00 26.84  ? 337  SER A CB    1 
ATOM   3193 O  OG    . SER C 3  331 ? 51.358 53.603  47.828 1.00 25.85  ? 337  SER A OG    1 
ATOM   3194 N  N     . SER C 3  332 ? 49.463 51.994  43.869 1.00 31.41  ? 338  SER A N     1 
ATOM   3195 C  CA    . SER C 3  332 ? 49.307 52.042  42.421 1.00 32.42  ? 338  SER A CA    1 
ATOM   3196 C  C     . SER C 3  332 ? 47.860 52.272  42.030 1.00 32.96  ? 338  SER A C     1 
ATOM   3197 O  O     . SER C 3  332 ? 46.995 51.431  42.289 1.00 34.90  ? 338  SER A O     1 
ATOM   3198 C  CB    . SER C 3  332 ? 49.796 50.737  41.791 1.00 33.78  ? 338  SER A CB    1 
ATOM   3199 O  OG    . SER C 3  332 ? 49.505 50.704  40.407 1.00 34.76  ? 338  SER A OG    1 
ATOM   3200 N  N     . ARG C 3  333 ? 47.594 53.412  41.405 1.00 32.41  ? 339  ARG A N     1 
ATOM   3201 C  CA    . ARG C 3  333 ? 46.239 53.729  40.980 1.00 32.63  ? 339  ARG A CA    1 
ATOM   3202 C  C     . ARG C 3  333 ? 45.816 52.731  39.905 1.00 33.46  ? 339  ARG A C     1 
ATOM   3203 O  O     . ARG C 3  333 ? 44.630 52.433  39.753 1.00 32.06  ? 339  ARG A O     1 
ATOM   3204 C  CB    . ARG C 3  333 ? 46.170 55.157  40.427 1.00 32.74  ? 339  ARG A CB    1 
ATOM   3205 C  CG    . ARG C 3  333 ? 46.613 56.233  41.418 1.00 33.94  ? 339  ARG A CG    1 
ATOM   3206 C  CD    . ARG C 3  333 ? 45.866 56.101  42.740 1.00 33.35  ? 339  ARG A CD    1 
ATOM   3207 N  N     . ASP C 3  334 ? 46.796 52.218  39.166 1.00 33.65  ? 340  ASP A N     1 
ATOM   3208 C  CA    . ASP C 3  334 ? 46.534 51.257  38.108 1.00 35.92  ? 340  ASP A CA    1 
ATOM   3209 C  C     . ASP C 3  334 ? 46.033 49.968  38.745 1.00 35.67  ? 340  ASP A C     1 
ATOM   3210 O  O     . ASP C 3  334 ? 44.986 49.445  38.358 1.00 35.70  ? 340  ASP A O     1 
ATOM   3211 C  CB    . ASP C 3  334 ? 47.810 50.992  37.301 1.00 40.17  ? 340  ASP A CB    1 
ATOM   3212 C  CG    . ASP C 3  334 ? 47.526 50.351  35.946 1.00 44.92  ? 340  ASP A CG    1 
ATOM   3213 O  OD1   . ASP C 3  334 ? 46.617 50.840  35.234 1.00 45.46  ? 340  ASP A OD1   1 
ATOM   3214 O  OD2   . ASP C 3  334 ? 48.214 49.369  35.588 1.00 46.18  ? 340  ASP A OD2   1 
ATOM   3215 N  N     . HIS C 3  335 ? 46.774 49.466  39.731 1.00 33.99  ? 341  HIS A N     1 
ATOM   3216 C  CA    . HIS C 3  335 ? 46.380 48.245  40.420 1.00 32.59  ? 341  HIS A CA    1 
ATOM   3217 C  C     . HIS C 3  335 ? 44.974 48.383  40.999 1.00 32.95  ? 341  HIS A C     1 
ATOM   3218 O  O     . HIS C 3  335 ? 44.115 47.537  40.777 1.00 34.38  ? 341  HIS A O     1 
ATOM   3219 C  CB    . HIS C 3  335 ? 47.359 47.916  41.548 1.00 30.21  ? 341  HIS A CB    1 
ATOM   3220 C  CG    . HIS C 3  335 ? 48.683 47.407  41.075 1.00 26.39  ? 341  HIS A CG    1 
ATOM   3221 N  ND1   . HIS C 3  335 ? 49.615 46.860  41.929 1.00 27.45  ? 341  HIS A ND1   1 
ATOM   3222 C  CD2   . HIS C 3  335 ? 49.240 47.376  39.842 1.00 27.20  ? 341  HIS A CD2   1 
ATOM   3223 C  CE1   . HIS C 3  335 ? 50.691 46.515  41.245 1.00 24.89  ? 341  HIS A CE1   1 
ATOM   3224 N  NE2   . HIS C 3  335 ? 50.489 46.818  39.975 1.00 27.24  ? 341  HIS A NE2   1 
ATOM   3225 N  N     . ILE C 3  336 ? 44.740 49.454  41.742 1.00 33.57  ? 342  ILE A N     1 
ATOM   3226 C  CA    . ILE C 3  336 ? 43.433 49.677  42.338 1.00 34.26  ? 342  ILE A CA    1 
ATOM   3227 C  C     . ILE C 3  336 ? 42.356 49.669  41.261 1.00 36.73  ? 342  ILE A C     1 
ATOM   3228 O  O     . ILE C 3  336 ? 41.278 49.101  41.444 1.00 36.99  ? 342  ILE A O     1 
ATOM   3229 C  CB    . ILE C 3  336 ? 43.392 51.023  43.074 1.00 33.76  ? 342  ILE A CB    1 
ATOM   3230 C  CG1   . ILE C 3  336 ? 44.368 50.995  44.253 1.00 33.63  ? 342  ILE A CG1   1 
ATOM   3231 C  CG2   . ILE C 3  336 ? 41.972 51.326  43.531 1.00 31.28  ? 342  ILE A CG2   1 
ATOM   3232 C  CD1   . ILE C 3  336 ? 44.541 52.336  44.940 1.00 34.89  ? 342  ILE A CD1   1 
ATOM   3233 N  N     . GLN C 3  337 ? 42.662 50.308  40.136 1.00 38.45  ? 343  GLN A N     1 
ATOM   3234 C  CA    . GLN C 3  337 ? 41.740 50.393  39.012 1.00 38.68  ? 343  GLN A CA    1 
ATOM   3235 C  C     . GLN C 3  337 ? 41.401 49.004  38.485 1.00 37.93  ? 343  GLN A C     1 
ATOM   3236 O  O     . GLN C 3  337 ? 40.236 48.674  38.285 1.00 37.06  ? 343  GLN A O     1 
ATOM   3237 C  CB    . GLN C 3  337 ? 42.366 51.254  37.902 1.00 40.23  ? 343  GLN A CB    1 
ATOM   3238 C  CG    . GLN C 3  337 ? 41.721 51.107  36.541 1.00 42.98  ? 343  GLN A CG    1 
ATOM   3239 C  CD    . GLN C 3  337 ? 42.236 49.904  35.777 1.00 45.47  ? 343  GLN A CD    1 
ATOM   3240 O  OE1   . GLN C 3  337 ? 41.467 49.202  35.117 1.00 49.21  ? 343  GLN A OE1   1 
ATOM   3241 N  NE2   . GLN C 3  337 ? 43.545 49.663  35.853 1.00 44.57  ? 343  GLN A NE2   1 
ATOM   3242 N  N     . LYS C 3  338 ? 42.433 48.198  38.272 1.00 38.46  ? 344  LYS A N     1 
ATOM   3243 C  CA    . LYS C 3  338 ? 42.289 46.842  37.760 1.00 39.29  ? 344  LYS A CA    1 
ATOM   3244 C  C     . LYS C 3  338 ? 41.420 45.957  38.654 1.00 40.73  ? 344  LYS A C     1 
ATOM   3245 O  O     . LYS C 3  338 ? 40.446 45.352  38.196 1.00 40.90  ? 344  LYS A O     1 
ATOM   3246 C  CB    . LYS C 3  338 ? 43.673 46.216  37.615 1.00 40.45  ? 344  LYS A CB    1 
ATOM   3247 C  CG    . LYS C 3  338 ? 43.681 44.788  37.120 1.00 43.42  ? 344  LYS A CG    1 
ATOM   3248 C  CD    . LYS C 3  338 ? 45.108 44.279  36.992 1.00 44.94  ? 344  LYS A CD    1 
ATOM   3249 C  CE    . LYS C 3  338 ? 45.138 42.891  36.376 1.00 48.00  ? 344  LYS A CE    1 
ATOM   3250 N  NZ    . LYS C 3  338 ? 44.532 42.905  35.010 1.00 50.47  ? 344  LYS A NZ    1 
ATOM   3251 N  N     . LYS C 3  339 ? 41.776 45.885  39.931 1.00 39.85  ? 345  LYS A N     1 
ATOM   3252 C  CA    . LYS C 3  339 ? 41.044 45.063  40.882 1.00 40.65  ? 345  LYS A CA    1 
ATOM   3253 C  C     . LYS C 3  339 ? 39.585 45.485  41.088 1.00 40.39  ? 345  LYS A C     1 
ATOM   3254 O  O     . LYS C 3  339 ? 38.696 44.636  41.180 1.00 39.76  ? 345  LYS A O     1 
ATOM   3255 C  CB    . LYS C 3  339 ? 41.785 45.049  42.223 1.00 39.90  ? 345  LYS A CB    1 
ATOM   3256 C  CG    . LYS C 3  339 ? 43.138 44.347  42.176 1.00 40.15  ? 345  LYS A CG    1 
ATOM   3257 C  CD    . LYS C 3  339 ? 42.970 42.868  41.856 1.00 40.65  ? 345  LYS A CD    1 
ATOM   3258 C  CE    . LYS C 3  339 ? 44.301 42.141  41.901 1.00 42.68  ? 345  LYS A CE    1 
ATOM   3259 N  NZ    . LYS C 3  339 ? 44.147 40.662  41.759 1.00 43.40  ? 345  LYS A NZ    1 
ATOM   3260 N  N     . LEU C 3  340 ? 39.330 46.787  41.159 1.00 39.20  ? 346  LEU A N     1 
ATOM   3261 C  CA    . LEU C 3  340 ? 37.966 47.251  41.363 1.00 39.25  ? 346  LEU A CA    1 
ATOM   3262 C  C     . LEU C 3  340 ? 37.047 47.023  40.161 1.00 40.89  ? 346  LEU A C     1 
ATOM   3263 O  O     . LEU C 3  340 ? 35.875 46.691  40.336 1.00 40.91  ? 346  LEU A O     1 
ATOM   3264 C  CB    . LEU C 3  340 ? 37.952 48.726  41.772 1.00 35.74  ? 346  LEU A CB    1 
ATOM   3265 C  CG    . LEU C 3  340 ? 38.528 49.010  43.167 1.00 37.39  ? 346  LEU A CG    1 
ATOM   3266 C  CD1   . LEU C 3  340 ? 38.303 50.465  43.533 1.00 33.24  ? 346  LEU A CD1   1 
ATOM   3267 C  CD2   . LEU C 3  340 ? 37.863 48.109  44.195 1.00 34.92  ? 346  LEU A CD2   1 
ATOM   3268 N  N     . GLN C 3  341 ? 37.550 47.199  38.943 1.00 41.53  ? 347  GLN A N     1 
ATOM   3269 C  CA    . GLN C 3  341 ? 36.693 46.964  37.785 1.00 42.84  ? 347  GLN A CA    1 
ATOM   3270 C  C     . GLN C 3  341 ? 36.430 45.473  37.683 1.00 42.38  ? 347  GLN A C     1 
ATOM   3271 O  O     . GLN C 3  341 ? 35.353 45.050  37.261 1.00 43.10  ? 347  GLN A O     1 
ATOM   3272 C  CB    . GLN C 3  341 ? 37.335 47.477  36.493 1.00 42.61  ? 347  GLN A CB    1 
ATOM   3273 C  CG    . GLN C 3  341 ? 37.362 48.997  36.391 1.00 42.74  ? 347  GLN A CG    1 
ATOM   3274 C  CD    . GLN C 3  341 ? 37.546 49.483  34.966 1.00 43.72  ? 347  GLN A CD    1 
ATOM   3275 O  OE1   . GLN C 3  341 ? 36.635 49.384  34.140 1.00 41.47  ? 347  GLN A OE1   1 
ATOM   3276 N  NE2   . GLN C 3  341 ? 38.730 50.008  34.668 1.00 43.79  ? 347  GLN A NE2   1 
ATOM   3277 N  N     . GLU C 3  342 ? 37.421 44.682  38.084 1.00 42.68  ? 348  GLU A N     1 
ATOM   3278 C  CA    . GLU C 3  342 ? 37.300 43.231  38.068 1.00 42.90  ? 348  GLU A CA    1 
ATOM   3279 C  C     . GLU C 3  342 ? 36.277 42.805  39.104 1.00 43.41  ? 348  GLU A C     1 
ATOM   3280 O  O     . GLU C 3  342 ? 35.849 41.655  39.130 1.00 44.33  ? 348  GLU A O     1 
ATOM   3281 C  CB    . GLU C 3  342 ? 38.646 42.580  38.379 1.00 43.46  ? 348  GLU A CB    1 
ATOM   3282 C  CG    . GLU C 3  342 ? 39.459 42.229  37.148 1.00 44.48  ? 348  GLU A CG    1 
ATOM   3283 C  CD    . GLU C 3  342 ? 40.860 41.770  37.491 1.00 46.02  ? 348  GLU A CD    1 
ATOM   3284 O  OE1   . GLU C 3  342 ? 41.041 41.174  38.574 1.00 46.68  ? 348  GLU A OE1   1 
ATOM   3285 O  OE2   . GLU C 3  342 ? 41.778 41.993  36.673 1.00 47.42  ? 348  GLU A OE2   1 
ATOM   3286 N  N     . ALA C 3  343 ? 35.887 43.746  39.956 1.00 43.75  ? 349  ALA A N     1 
ATOM   3287 C  CA    . ALA C 3  343 ? 34.903 43.484  40.995 1.00 43.59  ? 349  ALA A CA    1 
ATOM   3288 C  C     . ALA C 3  343 ? 33.560 44.078  40.590 1.00 43.32  ? 349  ALA A C     1 
ATOM   3289 O  O     . ALA C 3  343 ? 32.637 44.163  41.401 1.00 44.28  ? 349  ALA A O     1 
ATOM   3290 C  CB    . ALA C 3  343 ? 35.366 44.082  42.322 1.00 44.18  ? 349  ALA A CB    1 
ATOM   3291 N  N     . GLY C 3  344 ? 33.461 44.506  39.336 1.00 43.95  ? 350  GLY A N     1 
ATOM   3292 C  CA    . GLY C 3  344 ? 32.212 45.062  38.842 1.00 44.47  ? 350  GLY A CA    1 
ATOM   3293 C  C     . GLY C 3  344 ? 32.075 46.573  38.861 1.00 45.30  ? 350  GLY A C     1 
ATOM   3294 O  O     . GLY C 3  344 ? 31.008 47.101  38.538 1.00 45.57  ? 350  GLY A O     1 
ATOM   3295 N  N     . TRP C 3  345 ? 33.136 47.280  39.234 1.00 45.25  ? 351  TRP A N     1 
ATOM   3296 C  CA    . TRP C 3  345 ? 33.075 48.738  39.274 1.00 44.15  ? 351  TRP A CA    1 
ATOM   3297 C  C     . TRP C 3  345 ? 33.074 49.315  37.866 1.00 43.41  ? 351  TRP A C     1 
ATOM   3298 O  O     . TRP C 3  345 ? 33.855 48.894  37.011 1.00 41.92  ? 351  TRP A O     1 
ATOM   3299 C  CB    . TRP C 3  345 ? 34.255 49.313  40.073 1.00 43.04  ? 351  TRP A CB    1 
ATOM   3300 C  CG    . TRP C 3  345 ? 34.367 50.821  39.986 1.00 43.43  ? 351  TRP A CG    1 
ATOM   3301 C  CD1   . TRP C 3  345 ? 33.358 51.735  40.152 1.00 42.90  ? 351  TRP A CD1   1 
ATOM   3302 C  CD2   . TRP C 3  345 ? 35.553 51.582  39.715 1.00 42.11  ? 351  TRP A CD2   1 
ATOM   3303 N  NE1   . TRP C 3  345 ? 33.844 53.013  39.998 1.00 41.70  ? 351  TRP A NE1   1 
ATOM   3304 C  CE2   . TRP C 3  345 ? 35.187 52.949  39.731 1.00 42.18  ? 351  TRP A CE2   1 
ATOM   3305 C  CE3   . TRP C 3  345 ? 36.891 51.242  39.461 1.00 41.05  ? 351  TRP A CE3   1 
ATOM   3306 C  CZ2   . TRP C 3  345 ? 36.110 53.975  39.502 1.00 42.51  ? 351  TRP A CZ2   1 
ATOM   3307 C  CZ3   . TRP C 3  345 ? 37.810 52.264  39.234 1.00 41.73  ? 351  TRP A CZ3   1 
ATOM   3308 C  CH2   . TRP C 3  345 ? 37.413 53.614  39.256 1.00 41.61  ? 351  TRP A CH2   1 
ATOM   3309 N  N     . VAL C 3  346 ? 32.187 50.277  37.633 1.00 44.79  ? 352  VAL A N     1 
ATOM   3310 C  CA    . VAL C 3  346 ? 32.085 50.924  36.330 1.00 47.10  ? 352  VAL A CA    1 
ATOM   3311 C  C     . VAL C 3  346 ? 32.609 52.354  36.423 1.00 47.30  ? 352  VAL A C     1 
ATOM   3312 O  O     . VAL C 3  346 ? 31.887 53.261  36.838 1.00 47.87  ? 352  VAL A O     1 
ATOM   3313 C  CB    . VAL C 3  346 ? 30.616 50.972  35.826 1.00 47.89  ? 352  VAL A CB    1 
ATOM   3314 C  CG1   . VAL C 3  346 ? 30.569 51.539  34.408 1.00 47.14  ? 352  VAL A CG1   1 
ATOM   3315 C  CG2   . VAL C 3  346 ? 30.000 49.582  35.864 1.00 48.19  ? 352  VAL A CG2   1 
ATOM   3316 N  N     . PRO C 3  347 ? 33.878 52.572  36.043 1.00 47.80  ? 353  PRO A N     1 
ATOM   3317 C  CA    . PRO C 3  347 ? 34.462 53.913  36.097 1.00 48.85  ? 353  PRO A CA    1 
ATOM   3318 C  C     . PRO C 3  347 ? 33.602 54.928  35.348 1.00 50.48  ? 353  PRO A C     1 
ATOM   3319 O  O     . PRO C 3  347 ? 33.200 54.700  34.206 1.00 51.17  ? 353  PRO A O     1 
ATOM   3320 C  CB    . PRO C 3  347 ? 35.826 53.718  35.444 1.00 48.78  ? 353  PRO A CB    1 
ATOM   3321 C  CG    . PRO C 3  347 ? 36.183 52.323  35.840 1.00 48.25  ? 353  PRO A CG    1 
ATOM   3322 C  CD    . PRO C 3  347 ? 34.881 51.583  35.606 1.00 47.72  ? 353  PRO A CD    1 
ATOM   3323 N  N     . THR C 3  348 ? 33.315 56.043  36.007 1.00 52.21  ? 354  THR A N     1 
ATOM   3324 C  CA    . THR C 3  348 ? 32.512 57.104  35.417 1.00 53.15  ? 354  THR A CA    1 
ATOM   3325 C  C     . THR C 3  348 ? 33.407 58.152  34.771 1.00 53.98  ? 354  THR A C     1 
ATOM   3326 O  O     . THR C 3  348 ? 33.335 58.386  33.566 1.00 55.17  ? 354  THR A O     1 
ATOM   3327 C  CB    . THR C 3  348 ? 31.637 57.791  36.484 1.00 53.86  ? 354  THR A CB    1 
ATOM   3328 O  OG1   . THR C 3  348 ? 30.489 56.977  36.751 1.00 54.94  ? 354  THR A OG1   1 
ATOM   3329 C  CG2   . THR C 3  348 ? 31.200 59.176  36.019 1.00 53.99  ? 354  THR A CG2   1 
ATOM   3330 N  N     . LYS C 3  349 ? 34.257 58.778  35.577 1.00 53.41  ? 355  LYS A N     1 
ATOM   3331 C  CA    . LYS C 3  349 ? 35.148 59.808  35.070 1.00 53.07  ? 355  LYS A CA    1 
ATOM   3332 C  C     . LYS C 3  349 ? 36.575 59.323  34.870 1.00 51.63  ? 355  LYS A C     1 
ATOM   3333 O  O     . LYS C 3  349 ? 37.124 58.599  35.700 1.00 50.83  ? 355  LYS A O     1 
ATOM   3334 C  CB    . LYS C 3  349 ? 35.120 61.020  36.004 1.00 54.64  ? 355  LYS A CB    1 
ATOM   3335 C  CG    . LYS C 3  349 ? 35.418 60.710  37.458 1.00 55.94  ? 355  LYS A CG    1 
ATOM   3336 C  CD    . LYS C 3  349 ? 34.788 61.757  38.377 1.00 57.99  ? 355  LYS A CD    1 
ATOM   3337 C  CE    . LYS C 3  349 ? 35.231 63.172  38.021 1.00 58.24  ? 355  LYS A CE    1 
ATOM   3338 N  NZ    . LYS C 3  349 ? 34.525 64.190  38.850 1.00 60.36  ? 355  LYS A NZ    1 
ATOM   3339 N  N     . TYR C 3  350 ? 37.157 59.723  33.744 1.00 50.71  ? 356  TYR A N     1 
ATOM   3340 C  CA    . TYR C 3  350 ? 38.521 59.358  33.390 1.00 51.24  ? 356  TYR A CA    1 
ATOM   3341 C  C     . TYR C 3  350 ? 39.383 60.612  33.307 1.00 52.40  ? 356  TYR A C     1 
ATOM   3342 O  O     . TYR C 3  350 ? 38.909 61.721  33.562 1.00 52.33  ? 356  TYR A O     1 
ATOM   3343 C  CB    . TYR C 3  350 ? 38.540 58.625  32.044 1.00 50.89  ? 356  TYR A CB    1 
ATOM   3344 C  CG    . TYR C 3  350 ? 37.900 57.256  32.085 1.00 48.93  ? 356  TYR A CG    1 
ATOM   3345 C  CD1   . TYR C 3  350 ? 36.530 57.109  32.304 1.00 48.10  ? 356  TYR A CD1   1 
ATOM   3346 C  CD2   . TYR C 3  350 ? 38.673 56.104  31.945 1.00 48.67  ? 356  TYR A CD2   1 
ATOM   3347 C  CE1   . TYR C 3  350 ? 35.945 55.846  32.386 1.00 47.45  ? 356  TYR A CE1   1 
ATOM   3348 C  CE2   . TYR C 3  350 ? 38.100 54.835  32.028 1.00 47.70  ? 356  TYR A CE2   1 
ATOM   3349 C  CZ    . TYR C 3  350 ? 36.737 54.714  32.249 1.00 48.91  ? 356  TYR A CZ    1 
ATOM   3350 O  OH    . TYR C 3  350 ? 36.170 53.462  32.343 1.00 49.10  ? 356  TYR A OH    1 
ATOM   3351 N  N     . THR C 3  351 ? 40.649 60.436  32.948 1.00 53.44  ? 357  THR A N     1 
ATOM   3352 C  CA    . THR C 3  351 ? 41.571 61.561  32.841 1.00 55.51  ? 357  THR A CA    1 
ATOM   3353 C  C     . THR C 3  351 ? 41.835 61.905  31.383 1.00 57.65  ? 357  THR A C     1 
ATOM   3354 O  O     . THR C 3  351 ? 41.506 61.129  30.485 1.00 58.42  ? 357  THR A O     1 
ATOM   3355 C  CB    . THR C 3  351 ? 42.925 61.242  33.500 1.00 54.89  ? 357  THR A CB    1 
ATOM   3356 O  OG1   . THR C 3  351 ? 43.567 60.184  32.780 1.00 52.97  ? 357  THR A OG1   1 
ATOM   3357 C  CG2   . THR C 3  351 ? 42.728 60.812  34.944 1.00 54.83  ? 357  THR A CG2   1 
ATOM   3358 N  N     . ASP C 3  352 ? 42.427 63.073  31.155 1.00 59.85  ? 358  ASP A N     1 
ATOM   3359 C  CA    . ASP C 3  352 ? 42.756 63.506  29.803 1.00 62.08  ? 358  ASP A CA    1 
ATOM   3360 C  C     . ASP C 3  352 ? 43.945 62.697  29.304 1.00 61.67  ? 358  ASP A C     1 
ATOM   3361 O  O     . ASP C 3  352 ? 44.980 63.251  28.930 1.00 62.11  ? 358  ASP A O     1 
ATOM   3362 C  CB    . ASP C 3  352 ? 43.096 64.999  29.779 1.00 64.84  ? 358  ASP A CB    1 
ATOM   3363 C  CG    . ASP C 3  352 ? 41.882 65.875  30.012 1.00 68.63  ? 358  ASP A CG    1 
ATOM   3364 O  OD1   . ASP C 3  352 ? 40.899 65.731  29.250 1.00 69.83  ? 358  ASP A OD1   1 
ATOM   3365 O  OD2   . ASP C 3  352 ? 41.912 66.707  30.951 1.00 70.50  ? 358  ASP A OD2   1 
ATOM   3366 N  N     . LYS C 3  353 ? 43.786 61.377  29.327 1.00 60.95  ? 359  LYS A N     1 
ATOM   3367 C  CA    . LYS C 3  353 ? 44.812 60.450  28.873 1.00 60.27  ? 359  LYS A CA    1 
ATOM   3368 C  C     . LYS C 3  353 ? 44.240 59.031  28.888 1.00 59.14  ? 359  LYS A C     1 
ATOM   3369 O  O     . LYS C 3  353 ? 44.956 58.049  28.668 1.00 58.95  ? 359  LYS A O     1 
ATOM   3370 C  CB    . LYS C 3  353 ? 46.054 60.530  29.764 1.00 60.57  ? 359  LYS A CB    1 
ATOM   3371 C  CG    . LYS C 3  353 ? 47.267 59.844  29.153 1.00 63.63  ? 359  LYS A CG    1 
ATOM   3372 C  CD    . LYS C 3  353 ? 48.490 59.920  30.053 1.00 65.05  ? 359  LYS A CD    1 
ATOM   3373 C  CE    . LYS C 3  353 ? 49.669 59.159  29.447 1.00 65.32  ? 359  LYS A CE    1 
ATOM   3374 N  NZ    . LYS C 3  353 ? 50.847 59.105  30.363 1.00 65.30  ? 359  LYS A NZ    1 
ATOM   3375 N  N     . GLY C 3  354 ? 42.943 58.936  29.164 1.00 57.21  ? 360  GLY A N     1 
ATOM   3376 C  CA    . GLY C 3  354 ? 42.274 57.647  29.168 1.00 55.89  ? 360  GLY A CA    1 
ATOM   3377 C  C     . GLY C 3  354 ? 42.355 56.793  30.419 1.00 53.81  ? 360  GLY A C     1 
ATOM   3378 O  O     . GLY C 3  354 ? 41.963 55.625  30.395 1.00 53.47  ? 360  GLY A O     1 
ATOM   3379 N  N     . ALA C 3  355 ? 42.859 57.353  31.512 1.00 51.79  ? 361  ALA A N     1 
ATOM   3380 C  CA    . ALA C 3  355 ? 42.956 56.591  32.751 1.00 48.80  ? 361  ALA A CA    1 
ATOM   3381 C  C     . ALA C 3  355 ? 41.796 56.938  33.670 1.00 46.77  ? 361  ALA A C     1 
ATOM   3382 O  O     . ALA C 3  355 ? 41.403 58.100  33.784 1.00 47.59  ? 361  ALA A O     1 
ATOM   3383 C  CB    . ALA C 3  355 ? 44.278 56.880  33.446 1.00 49.12  ? 361  ALA A CB    1 
ATOM   3384 N  N     . PRO C 3  356 ? 41.215 55.927  34.328 1.00 44.70  ? 362  PRO A N     1 
ATOM   3385 C  CA    . PRO C 3  356 ? 40.097 56.207  35.230 1.00 43.25  ? 362  PRO A CA    1 
ATOM   3386 C  C     . PRO C 3  356 ? 40.600 56.967  36.454 1.00 42.82  ? 362  PRO A C     1 
ATOM   3387 O  O     . PRO C 3  356 ? 41.663 56.655  36.996 1.00 41.64  ? 362  PRO A O     1 
ATOM   3388 C  CB    . PRO C 3  356 ? 39.582 54.814  35.576 1.00 43.12  ? 362  PRO A CB    1 
ATOM   3389 C  CG    . PRO C 3  356 ? 40.830 53.992  35.546 1.00 43.59  ? 362  PRO A CG    1 
ATOM   3390 C  CD    . PRO C 3  356 ? 41.535 54.489  34.308 1.00 42.97  ? 362  PRO A CD    1 
ATOM   3391 N  N     . VAL C 3  357 ? 39.848 57.977  36.874 1.00 42.28  ? 363  VAL A N     1 
ATOM   3392 C  CA    . VAL C 3  357 ? 40.231 58.759  38.040 1.00 41.46  ? 363  VAL A CA    1 
ATOM   3393 C  C     . VAL C 3  357 ? 40.148 57.870  39.274 1.00 42.05  ? 363  VAL A C     1 
ATOM   3394 O  O     . VAL C 3  357 ? 39.179 57.131  39.455 1.00 42.31  ? 363  VAL A O     1 
ATOM   3395 C  CB    . VAL C 3  357 ? 39.294 59.973  38.243 1.00 41.58  ? 363  VAL A CB    1 
ATOM   3396 C  CG1   . VAL C 3  357 ? 39.661 60.707  39.525 1.00 41.13  ? 363  VAL A CG1   1 
ATOM   3397 C  CG2   . VAL C 3  357 ? 39.393 60.917  37.054 1.00 40.51  ? 363  VAL A CG2   1 
ATOM   3398 N  N     . VAL C 3  358 ? 41.174 57.933  40.115 1.00 41.34  ? 364  VAL A N     1 
ATOM   3399 C  CA    . VAL C 3  358 ? 41.202 57.147  41.338 1.00 40.59  ? 364  VAL A CA    1 
ATOM   3400 C  C     . VAL C 3  358 ? 41.632 58.030  42.504 1.00 41.70  ? 364  VAL A C     1 
ATOM   3401 O  O     . VAL C 3  358 ? 42.657 57.788  43.139 1.00 41.92  ? 364  VAL A O     1 
ATOM   3402 C  CB    . VAL C 3  358 ? 42.166 55.943  41.217 1.00 40.17  ? 364  VAL A CB    1 
ATOM   3403 C  CG1   . VAL C 3  358 ? 42.078 55.070  42.467 1.00 37.40  ? 364  VAL A CG1   1 
ATOM   3404 C  CG2   . VAL C 3  358 ? 41.818 55.130  39.983 1.00 40.09  ? 364  VAL A CG2   1 
ATOM   3405 N  N     . ASP C 3  359 ? 40.857 59.078  42.762 1.00 43.54  ? 365  ASP A N     1 
ATOM   3406 C  CA    . ASP C 3  359 ? 41.149 59.968  43.873 1.00 44.42  ? 365  ASP A CA    1 
ATOM   3407 C  C     . ASP C 3  359 ? 40.198 59.598  45.002 1.00 45.28  ? 365  ASP A C     1 
ATOM   3408 O  O     . ASP C 3  359 ? 39.454 58.626  44.890 1.00 45.26  ? 365  ASP A O     1 
ATOM   3409 C  CB    . ASP C 3  359 ? 40.985 61.446  43.474 1.00 44.34  ? 365  ASP A CB    1 
ATOM   3410 C  CG    . ASP C 3  359 ? 39.601 61.775  42.934 1.00 45.21  ? 365  ASP A CG    1 
ATOM   3411 O  OD1   . ASP C 3  359 ? 38.596 61.270  43.479 1.00 43.63  ? 365  ASP A OD1   1 
ATOM   3412 O  OD2   . ASP C 3  359 ? 39.521 62.569  41.970 1.00 46.73  ? 365  ASP A OD2   1 
ATOM   3413 N  N     . ASP C 3  360 ? 40.210 60.366  46.084 1.00 46.09  ? 366  ASP A N     1 
ATOM   3414 C  CA    . ASP C 3  360 ? 39.352 60.057  47.219 1.00 46.94  ? 366  ASP A CA    1 
ATOM   3415 C  C     . ASP C 3  360 ? 37.855 60.217  46.955 1.00 46.55  ? 366  ASP A C     1 
ATOM   3416 O  O     . ASP C 3  360 ? 37.046 59.524  47.566 1.00 46.48  ? 366  ASP A O     1 
ATOM   3417 C  CB    . ASP C 3  360 ? 39.751 60.901  48.428 1.00 48.58  ? 366  ASP A CB    1 
ATOM   3418 C  CG    . ASP C 3  360 ? 39.802 60.087  49.708 1.00 52.07  ? 366  ASP A CG    1 
ATOM   3419 O  OD1   . ASP C 3  360 ? 40.770 59.306  49.879 1.00 53.52  ? 366  ASP A OD1   1 
ATOM   3420 O  OD2   . ASP C 3  360 ? 38.869 60.217  50.532 1.00 51.63  ? 366  ASP A OD2   1 
ATOM   3421 N  N     . GLU C 3  361 ? 37.481 61.124  46.058 1.00 46.89  ? 367  GLU A N     1 
ATOM   3422 C  CA    . GLU C 3  361 ? 36.068 61.327  45.750 1.00 48.06  ? 367  GLU A CA    1 
ATOM   3423 C  C     . GLU C 3  361 ? 35.462 60.066  45.149 1.00 47.16  ? 367  GLU A C     1 
ATOM   3424 O  O     . GLU C 3  361 ? 34.425 59.593  45.608 1.00 49.58  ? 367  GLU A O     1 
ATOM   3425 C  CB    . GLU C 3  361 ? 35.873 62.473  44.757 1.00 50.91  ? 367  GLU A CB    1 
ATOM   3426 C  CG    . GLU C 3  361 ? 36.429 63.805  45.191 1.00 54.37  ? 367  GLU A CG    1 
ATOM   3427 C  CD    . GLU C 3  361 ? 36.303 64.853  44.099 1.00 57.84  ? 367  GLU A CD    1 
ATOM   3428 O  OE1   . GLU C 3  361 ? 35.155 65.217  43.753 1.00 57.34  ? 367  GLU A OE1   1 
ATOM   3429 O  OE2   . GLU C 3  361 ? 37.355 65.301  43.583 1.00 58.64  ? 367  GLU A OE2   1 
ATOM   3430 N  N     . VAL C 3  362 ? 36.106 59.521  44.119 1.00 45.49  ? 368  VAL A N     1 
ATOM   3431 C  CA    . VAL C 3  362 ? 35.588 58.322  43.472 1.00 44.76  ? 368  VAL A CA    1 
ATOM   3432 C  C     . VAL C 3  362 ? 35.639 57.113  44.398 1.00 44.54  ? 368  VAL A C     1 
ATOM   3433 O  O     . VAL C 3  362 ? 34.654 56.381  44.514 1.00 45.57  ? 368  VAL A O     1 
ATOM   3434 C  CB    . VAL C 3  362 ? 36.348 57.991  42.162 1.00 42.56  ? 368  VAL A CB    1 
ATOM   3435 C  CG1   . VAL C 3  362 ? 36.517 59.243  41.338 1.00 41.01  ? 368  VAL A CG1   1 
ATOM   3436 C  CG2   . VAL C 3  362 ? 37.682 57.360  42.463 1.00 43.66  ? 368  VAL A CG2   1 
ATOM   3437 N  N     . LEU C 3  363 ? 36.776 56.903  45.056 1.00 42.72  ? 369  LEU A N     1 
ATOM   3438 C  CA    . LEU C 3  363 ? 36.911 55.775  45.969 1.00 41.62  ? 369  LEU A CA    1 
ATOM   3439 C  C     . LEU C 3  363 ? 35.746 55.753  46.957 1.00 41.95  ? 369  LEU A C     1 
ATOM   3440 O  O     . LEU C 3  363 ? 35.116 54.717  47.162 1.00 42.36  ? 369  LEU A O     1 
ATOM   3441 C  CB    . LEU C 3  363 ? 38.248 55.843  46.721 1.00 39.32  ? 369  LEU A CB    1 
ATOM   3442 C  CG    . LEU C 3  363 ? 39.490 55.430  45.917 1.00 38.54  ? 369  LEU A CG    1 
ATOM   3443 C  CD1   . LEU C 3  363 ? 40.741 55.566  46.768 1.00 37.52  ? 369  LEU A CD1   1 
ATOM   3444 C  CD2   . LEU C 3  363 ? 39.341 53.993  45.451 1.00 37.85  ? 369  LEU A CD2   1 
ATOM   3445 N  N     . GLU C 3  364 ? 35.448 56.904  47.549 1.00 42.09  ? 370  GLU A N     1 
ATOM   3446 C  CA    . GLU C 3  364 ? 34.358 57.001  48.508 1.00 43.89  ? 370  GLU A CA    1 
ATOM   3447 C  C     . GLU C 3  364 ? 33.019 56.628  47.880 1.00 43.92  ? 370  GLU A C     1 
ATOM   3448 O  O     . GLU C 3  364 ? 32.092 56.222  48.578 1.00 42.96  ? 370  GLU A O     1 
ATOM   3449 C  CB    . GLU C 3  364 ? 34.279 58.420  49.073 1.00 45.79  ? 370  GLU A CB    1 
ATOM   3450 C  CG    . GLU C 3  364 ? 33.155 58.633  50.079 1.00 50.63  ? 370  GLU A CG    1 
ATOM   3451 C  CD    . GLU C 3  364 ? 33.080 57.530  51.130 1.00 53.90  ? 370  GLU A CD    1 
ATOM   3452 O  OE1   . GLU C 3  364 ? 34.148 57.079  51.608 1.00 54.79  ? 370  GLU A OE1   1 
ATOM   3453 O  OE2   . GLU C 3  364 ? 31.950 57.120  51.486 1.00 54.16  ? 370  GLU A OE2   1 
ATOM   3454 N  N     . GLY C 3  365 ? 32.928 56.760  46.560 1.00 44.25  ? 371  GLY A N     1 
ATOM   3455 C  CA    . GLY C 3  365 ? 31.690 56.450  45.869 1.00 44.86  ? 371  GLY A CA    1 
ATOM   3456 C  C     . GLY C 3  365 ? 31.632 55.103  45.170 1.00 44.78  ? 371  GLY A C     1 
ATOM   3457 O  O     . GLY C 3  365 ? 30.582 54.714  44.665 1.00 44.96  ? 371  GLY A O     1 
ATOM   3458 N  N     . VAL C 3  366 ? 32.752 54.390  45.128 1.00 44.87  ? 372  VAL A N     1 
ATOM   3459 C  CA    . VAL C 3  366 ? 32.786 53.082  44.486 1.00 44.13  ? 372  VAL A CA    1 
ATOM   3460 C  C     . VAL C 3  366 ? 31.897 52.089  45.234 1.00 45.19  ? 372  VAL A C     1 
ATOM   3461 O  O     . VAL C 3  366 ? 31.825 52.106  46.465 1.00 43.63  ? 372  VAL A O     1 
ATOM   3462 C  CB    . VAL C 3  366 ? 34.227 52.530  44.428 1.00 44.07  ? 372  VAL A CB    1 
ATOM   3463 C  CG1   . VAL C 3  366 ? 34.222 51.084  43.961 1.00 43.26  ? 372  VAL A CG1   1 
ATOM   3464 C  CG2   . VAL C 3  366 ? 35.063 53.381  43.485 1.00 44.12  ? 372  VAL A CG2   1 
ATOM   3465 N  N     . ARG C 3  367 ? 31.220 51.231  44.476 1.00 46.21  ? 373  ARG A N     1 
ATOM   3466 C  CA    . ARG C 3  367 ? 30.333 50.217  45.044 1.00 47.33  ? 373  ARG A CA    1 
ATOM   3467 C  C     . ARG C 3  367 ? 30.476 48.887  44.305 1.00 46.61  ? 373  ARG A C     1 
ATOM   3468 O  O     . ARG C 3  367 ? 30.244 48.807  43.097 1.00 46.46  ? 373  ARG A O     1 
ATOM   3469 C  CB    . ARG C 3  367 ? 28.875 50.686  44.968 1.00 47.97  ? 373  ARG A CB    1 
ATOM   3470 C  CG    . ARG C 3  367 ? 28.549 51.872  45.862 1.00 49.89  ? 373  ARG A CG    1 
ATOM   3471 C  CD    . ARG C 3  367 ? 28.604 51.489  47.334 1.00 50.62  ? 373  ARG A CD    1 
ATOM   3472 N  NE    . ARG C 3  367 ? 28.262 52.610  48.205 1.00 51.99  ? 373  ARG A NE    1 
ATOM   3473 C  CZ    . ARG C 3  367 ? 29.017 53.694  48.369 1.00 53.93  ? 373  ARG A CZ    1 
ATOM   3474 N  NH1   . ARG C 3  367 ? 30.173 53.815  47.722 1.00 52.00  ? 373  ARG A NH1   1 
ATOM   3475 N  NH2   . ARG C 3  367 ? 28.614 54.662  49.182 1.00 54.11  ? 373  ARG A NH2   1 
ATOM   3476 N  N     . VAL C 3  368 ? 30.875 47.852  45.035 1.00 46.09  ? 374  VAL A N     1 
ATOM   3477 C  CA    . VAL C 3  368 ? 31.025 46.519  44.461 1.00 45.63  ? 374  VAL A CA    1 
ATOM   3478 C  C     . VAL C 3  368 ? 30.180 45.550  45.278 1.00 46.03  ? 374  VAL A C     1 
ATOM   3479 O  O     . VAL C 3  368 ? 29.885 45.810  46.445 1.00 45.18  ? 374  VAL A O     1 
ATOM   3480 C  CB    . VAL C 3  368 ? 32.501 46.051  44.475 1.00 45.35  ? 374  VAL A CB    1 
ATOM   3481 C  CG1   . VAL C 3  368 ? 33.329 46.922  43.543 1.00 43.86  ? 374  VAL A CG1   1 
ATOM   3482 C  CG2   . VAL C 3  368 ? 33.053 46.105  45.890 1.00 44.04  ? 374  VAL A CG2   1 
ATOM   3483 N  N     . ASP C 3  369 ? 29.791 44.435  44.670 1.00 47.67  ? 375  ASP A N     1 
ATOM   3484 C  CA    . ASP C 3  369 ? 28.964 43.457  45.364 1.00 48.46  ? 375  ASP A CA    1 
ATOM   3485 C  C     . ASP C 3  369 ? 29.660 42.706  46.498 1.00 47.20  ? 375  ASP A C     1 
ATOM   3486 O  O     . ASP C 3  369 ? 29.087 42.557  47.572 1.00 48.56  ? 375  ASP A O     1 
ATOM   3487 C  CB    . ASP C 3  369 ? 28.366 42.461  44.365 1.00 50.45  ? 375  ASP A CB    1 
ATOM   3488 C  CG    . ASP C 3  369 ? 27.260 43.079  43.526 1.00 54.07  ? 375  ASP A CG    1 
ATOM   3489 O  OD1   . ASP C 3  369 ? 26.350 43.699  44.118 1.00 54.29  ? 375  ASP A OD1   1 
ATOM   3490 O  OD2   . ASP C 3  369 ? 27.294 42.946  42.282 1.00 57.18  ? 375  ASP A OD2   1 
ATOM   3491 N  N     . ASP C 3  370 ? 30.882 42.232  46.276 1.00 45.82  ? 376  ASP A N     1 
ATOM   3492 C  CA    . ASP C 3  370 ? 31.584 41.504  47.331 1.00 45.10  ? 376  ASP A CA    1 
ATOM   3493 C  C     . ASP C 3  370 ? 31.904 42.419  48.506 1.00 44.20  ? 376  ASP A C     1 
ATOM   3494 O  O     . ASP C 3  370 ? 32.748 43.307  48.396 1.00 44.65  ? 376  ASP A O     1 
ATOM   3495 C  CB    . ASP C 3  370 ? 32.879 40.883  46.809 1.00 46.00  ? 376  ASP A CB    1 
ATOM   3496 C  CG    . ASP C 3  370 ? 33.731 40.310  47.926 1.00 46.73  ? 376  ASP A CG    1 
ATOM   3497 O  OD1   . ASP C 3  370 ? 33.210 39.491  48.711 1.00 48.60  ? 376  ASP A OD1   1 
ATOM   3498 O  OD2   . ASP C 3  370 ? 34.917 40.680  48.025 1.00 46.08  ? 376  ASP A OD2   1 
ATOM   3499 N  N     . PRO C 3  371 ? 31.241 42.199  49.653 1.00 42.56  ? 377  PRO A N     1 
ATOM   3500 C  CA    . PRO C 3  371 ? 31.425 42.989  50.873 1.00 41.16  ? 377  PRO A CA    1 
ATOM   3501 C  C     . PRO C 3  371 ? 32.854 43.102  51.393 1.00 41.01  ? 377  PRO A C     1 
ATOM   3502 O  O     . PRO C 3  371 ? 33.185 44.073  52.080 1.00 41.41  ? 377  PRO A O     1 
ATOM   3503 C  CB    . PRO C 3  371 ? 30.493 42.307  51.875 1.00 40.91  ? 377  PRO A CB    1 
ATOM   3504 C  CG    . PRO C 3  371 ? 30.439 40.897  51.387 1.00 42.49  ? 377  PRO A CG    1 
ATOM   3505 C  CD    . PRO C 3  371 ? 30.315 41.080  49.899 1.00 41.89  ? 377  PRO A CD    1 
ATOM   3506 N  N     . GLU C 3  372 ? 33.702 42.125  51.082 1.00 38.54  ? 378  GLU A N     1 
ATOM   3507 C  CA    . GLU C 3  372 ? 35.080 42.184  51.553 1.00 37.94  ? 378  GLU A CA    1 
ATOM   3508 C  C     . GLU C 3  372 ? 35.836 43.251  50.765 1.00 37.81  ? 378  GLU A C     1 
ATOM   3509 O  O     . GLU C 3  372 ? 36.508 44.109  51.342 1.00 37.19  ? 378  GLU A O     1 
ATOM   3510 C  CB    . GLU C 3  372 ? 35.779 40.833  51.385 1.00 37.75  ? 378  GLU A CB    1 
ATOM   3511 C  CG    . GLU C 3  372 ? 37.131 40.772  52.093 1.00 38.79  ? 378  GLU A CG    1 
ATOM   3512 C  CD    . GLU C 3  372 ? 37.915 39.510  51.786 1.00 38.80  ? 378  GLU A CD    1 
ATOM   3513 O  OE1   . GLU C 3  372 ? 37.323 38.411  51.811 1.00 38.40  ? 378  GLU A OE1   1 
ATOM   3514 O  OE2   . GLU C 3  372 ? 39.132 39.619  51.532 1.00 38.90  ? 378  GLU A OE2   1 
ATOM   3515 N  N     . LYS C 3  373 ? 35.727 43.187  49.443 1.00 36.94  ? 379  LYS A N     1 
ATOM   3516 C  CA    . LYS C 3  373 ? 36.386 44.157  48.583 1.00 37.56  ? 379  LYS A CA    1 
ATOM   3517 C  C     . LYS C 3  373 ? 35.763 45.527  48.823 1.00 37.05  ? 379  LYS A C     1 
ATOM   3518 O  O     . LYS C 3  373 ? 36.445 46.544  48.786 1.00 36.94  ? 379  LYS A O     1 
ATOM   3519 C  CB    . LYS C 3  373 ? 36.236 43.754  47.117 1.00 38.19  ? 379  LYS A CB    1 
ATOM   3520 C  CG    . LYS C 3  373 ? 36.945 42.456  46.765 1.00 39.35  ? 379  LYS A CG    1 
ATOM   3521 C  CD    . LYS C 3  373 ? 36.616 42.027  45.346 1.00 41.84  ? 379  LYS A CD    1 
ATOM   3522 C  CE    . LYS C 3  373 ? 37.168 40.647  45.036 1.00 42.10  ? 379  LYS A CE    1 
ATOM   3523 N  NZ    . LYS C 3  373 ? 38.642 40.594  45.199 1.00 45.49  ? 379  LYS A NZ    1 
ATOM   3524 N  N     . GLN C 3  374 ? 34.461 45.547  49.075 1.00 36.65  ? 380  GLN A N     1 
ATOM   3525 C  CA    . GLN C 3  374 ? 33.771 46.799  49.346 1.00 37.94  ? 380  GLN A CA    1 
ATOM   3526 C  C     . GLN C 3  374 ? 34.418 47.442  50.570 1.00 38.44  ? 380  GLN A C     1 
ATOM   3527 O  O     . GLN C 3  374 ? 34.532 48.666  50.660 1.00 40.28  ? 380  GLN A O     1 
ATOM   3528 C  CB    . GLN C 3  374 ? 32.289 46.539  49.630 1.00 37.22  ? 380  GLN A CB    1 
ATOM   3529 C  CG    . GLN C 3  374 ? 31.497 47.783  49.983 1.00 37.22  ? 380  GLN A CG    1 
ATOM   3530 C  CD    . GLN C 3  374 ? 31.538 48.824  48.887 1.00 37.68  ? 380  GLN A CD    1 
ATOM   3531 O  OE1   . GLN C 3  374 ? 31.079 48.586  47.768 1.00 39.18  ? 380  GLN A OE1   1 
ATOM   3532 N  NE2   . GLN C 3  374 ? 32.094 49.988  49.200 1.00 36.49  ? 380  GLN A NE2   1 
ATOM   3533 N  N     . ALA C 3  375 ? 34.846 46.599  51.506 1.00 36.97  ? 381  ALA A N     1 
ATOM   3534 C  CA    . ALA C 3  375 ? 35.475 47.063  52.732 1.00 34.64  ? 381  ALA A CA    1 
ATOM   3535 C  C     . ALA C 3  375 ? 36.949 47.392  52.508 1.00 33.79  ? 381  ALA A C     1 
ATOM   3536 O  O     . ALA C 3  375 ? 37.519 48.206  53.227 1.00 33.87  ? 381  ALA A O     1 
ATOM   3537 C  CB    . ALA C 3  375 ? 35.329 46.003  53.824 1.00 31.25  ? 381  ALA A CB    1 
ATOM   3538 N  N     . ALA C 3  376 ? 37.565 46.763  51.512 1.00 32.73  ? 382  ALA A N     1 
ATOM   3539 C  CA    . ALA C 3  376 ? 38.975 47.009  51.231 1.00 33.49  ? 382  ALA A CA    1 
ATOM   3540 C  C     . ALA C 3  376 ? 39.174 48.422  50.681 1.00 34.23  ? 382  ALA A C     1 
ATOM   3541 O  O     . ALA C 3  376 ? 40.274 48.977  50.740 1.00 33.37  ? 382  ALA A O     1 
ATOM   3542 C  CB    . ALA C 3  376 ? 39.505 45.977  50.245 1.00 31.64  ? 382  ALA A CB    1 
ATOM   3543 N  N     . ILE C 3  377 ? 38.104 49.001  50.151 1.00 35.02  ? 383  ILE A N     1 
ATOM   3544 C  CA    . ILE C 3  377 ? 38.170 50.346  49.607 1.00 35.96  ? 383  ILE A CA    1 
ATOM   3545 C  C     . ILE C 3  377 ? 38.480 51.353  50.715 1.00 36.56  ? 383  ILE A C     1 
ATOM   3546 O  O     . ILE C 3  377 ? 39.130 52.369  50.474 1.00 35.85  ? 383  ILE A O     1 
ATOM   3547 C  CB    . ILE C 3  377 ? 36.853 50.715  48.904 1.00 36.63  ? 383  ILE A CB    1 
ATOM   3548 C  CG1   . ILE C 3  377 ? 36.687 49.832  47.668 1.00 38.21  ? 383  ILE A CG1   1 
ATOM   3549 C  CG2   . ILE C 3  377 ? 36.845 52.198  48.520 1.00 36.46  ? 383  ILE A CG2   1 
ATOM   3550 C  CD1   . ILE C 3  377 ? 35.406 50.066  46.901 1.00 41.76  ? 383  ILE A CD1   1 
ATOM   3551 N  N     . ASP C 3  378 ? 38.023 51.079  51.931 1.00 36.50  ? 384  ASP A N     1 
ATOM   3552 C  CA    . ASP C 3  378 ? 38.317 51.990  53.030 1.00 37.07  ? 384  ASP A CA    1 
ATOM   3553 C  C     . ASP C 3  378 ? 39.767 51.796  53.469 1.00 35.58  ? 384  ASP A C     1 
ATOM   3554 O  O     . ASP C 3  378 ? 40.436 52.749  53.861 1.00 34.68  ? 384  ASP A O     1 
ATOM   3555 C  CB    . ASP C 3  378 ? 37.374 51.759  54.212 1.00 38.03  ? 384  ASP A CB    1 
ATOM   3556 C  CG    . ASP C 3  378 ? 36.018 52.421  54.017 1.00 41.66  ? 384  ASP A CG    1 
ATOM   3557 O  OD1   . ASP C 3  378 ? 35.979 53.630  53.691 1.00 41.84  ? 384  ASP A OD1   1 
ATOM   3558 O  OD2   . ASP C 3  378 ? 34.986 51.736  54.202 1.00 43.82  ? 384  ASP A OD2   1 
ATOM   3559 N  N     . LEU C 3  379 ? 40.252 50.560  53.389 1.00 34.47  ? 385  LEU A N     1 
ATOM   3560 C  CA    . LEU C 3  379 ? 41.630 50.269  53.765 1.00 33.77  ? 385  LEU A CA    1 
ATOM   3561 C  C     . LEU C 3  379 ? 42.583 50.960  52.791 1.00 33.41  ? 385  LEU A C     1 
ATOM   3562 O  O     . LEU C 3  379 ? 43.677 51.374  53.173 1.00 33.61  ? 385  LEU A O     1 
ATOM   3563 C  CB    . LEU C 3  379 ? 41.899 48.761  53.744 1.00 31.54  ? 385  LEU A CB    1 
ATOM   3564 C  CG    . LEU C 3  379 ? 41.032 47.820  54.591 1.00 33.60  ? 385  LEU A CG    1 
ATOM   3565 C  CD1   . LEU C 3  379 ? 41.722 46.455  54.644 1.00 28.98  ? 385  LEU A CD1   1 
ATOM   3566 C  CD2   . LEU C 3  379 ? 40.840 48.371  56.004 1.00 30.10  ? 385  LEU A CD2   1 
ATOM   3567 N  N     . ILE C 3  380 ? 42.163 51.068  51.532 1.00 32.32  ? 386  ILE A N     1 
ATOM   3568 C  CA    . ILE C 3  380 ? 42.963 51.719  50.502 1.00 31.81  ? 386  ILE A CA    1 
ATOM   3569 C  C     . ILE C 3  380 ? 43.023 53.225  50.760 1.00 32.92  ? 386  ILE A C     1 
ATOM   3570 O  O     . ILE C 3  380 ? 44.083 53.841  50.632 1.00 32.49  ? 386  ILE A O     1 
ATOM   3571 C  CB    . ILE C 3  380 ? 42.373 51.452  49.102 1.00 33.29  ? 386  ILE A CB    1 
ATOM   3572 C  CG1   . ILE C 3  380 ? 42.500 49.960  48.771 1.00 32.04  ? 386  ILE A CG1   1 
ATOM   3573 C  CG2   . ILE C 3  380 ? 43.086 52.298  48.053 1.00 29.78  ? 386  ILE A CG2   1 
ATOM   3574 C  CD1   . ILE C 3  380 ? 41.791 49.554  47.496 1.00 32.66  ? 386  ILE A CD1   1 
ATOM   3575 N  N     . LYS C 3  381 ? 41.885 53.813  51.126 1.00 32.86  ? 387  LYS A N     1 
ATOM   3576 C  CA    . LYS C 3  381 ? 41.834 55.241  51.420 1.00 34.83  ? 387  LYS A CA    1 
ATOM   3577 C  C     . LYS C 3  381 ? 42.855 55.514  52.525 1.00 34.26  ? 387  LYS A C     1 
ATOM   3578 O  O     . LYS C 3  381 ? 43.721 56.376  52.390 1.00 34.04  ? 387  LYS A O     1 
ATOM   3579 C  CB    . LYS C 3  381 ? 40.439 55.644  51.915 1.00 36.41  ? 387  LYS A CB    1 
ATOM   3580 C  CG    . LYS C 3  381 ? 39.290 55.271  50.984 1.00 40.03  ? 387  LYS A CG    1 
ATOM   3581 C  CD    . LYS C 3  381 ? 38.686 56.488  50.293 1.00 43.01  ? 387  LYS A CD    1 
ATOM   3582 C  CE    . LYS C 3  381 ? 38.098 57.487  51.288 1.00 43.41  ? 387  LYS A CE    1 
ATOM   3583 N  NZ    . LYS C 3  381 ? 36.950 56.944  52.059 1.00 46.21  ? 387  LYS A NZ    1 
ATOM   3584 N  N     . GLU C 3  382 ? 42.747 54.756  53.613 1.00 32.38  ? 388  GLU A N     1 
ATOM   3585 C  CA    . GLU C 3  382 ? 43.644 54.897  54.751 1.00 31.54  ? 388  GLU A CA    1 
ATOM   3586 C  C     . GLU C 3  382 ? 45.099 54.715  54.335 1.00 30.93  ? 388  GLU A C     1 
ATOM   3587 O  O     . GLU C 3  382 ? 45.958 55.517  54.698 1.00 30.66  ? 388  GLU A O     1 
ATOM   3588 C  CB    . GLU C 3  382 ? 43.298 53.866  55.837 1.00 32.43  ? 388  GLU A CB    1 
ATOM   3589 C  CG    . GLU C 3  382 ? 43.947 54.144  57.194 1.00 33.43  ? 388  GLU A CG    1 
ATOM   3590 C  CD    . GLU C 3  382 ? 43.605 53.091  58.243 1.00 36.52  ? 388  GLU A CD    1 
ATOM   3591 O  OE1   . GLU C 3  382 ? 42.548 52.434  58.106 1.00 39.48  ? 388  GLU A OE1   1 
ATOM   3592 O  OE2   . GLU C 3  382 ? 44.381 52.925  59.210 1.00 33.23  ? 388  GLU A OE2   1 
ATOM   3593 N  N     . TYR C 3  383 ? 45.370 53.661  53.573 1.00 29.25  ? 389  TYR A N     1 
ATOM   3594 C  CA    . TYR C 3  383 ? 46.728 53.368  53.128 1.00 28.04  ? 389  TYR A CA    1 
ATOM   3595 C  C     . TYR C 3  383 ? 47.356 54.543  52.383 1.00 29.20  ? 389  TYR A C     1 
ATOM   3596 O  O     . TYR C 3  383 ? 48.497 54.908  52.640 1.00 28.56  ? 389  TYR A O     1 
ATOM   3597 C  CB    . TYR C 3  383 ? 46.729 52.123  52.235 1.00 25.95  ? 389  TYR A CB    1 
ATOM   3598 C  CG    . TYR C 3  383 ? 48.102 51.618  51.850 1.00 24.00  ? 389  TYR A CG    1 
ATOM   3599 C  CD1   . TYR C 3  383 ? 48.843 52.242  50.849 1.00 25.03  ? 389  TYR A CD1   1 
ATOM   3600 C  CD2   . TYR C 3  383 ? 48.661 50.514  52.487 1.00 23.27  ? 389  TYR A CD2   1 
ATOM   3601 C  CE1   . TYR C 3  383 ? 50.112 51.777  50.492 1.00 24.88  ? 389  TYR A CE1   1 
ATOM   3602 C  CE2   . TYR C 3  383 ? 49.927 50.044  52.139 1.00 25.04  ? 389  TYR A CE2   1 
ATOM   3603 C  CZ    . TYR C 3  383 ? 50.644 50.682  51.142 1.00 24.62  ? 389  TYR A CZ    1 
ATOM   3604 O  OH    . TYR C 3  383 ? 51.898 50.233  50.801 1.00 28.03  ? 389  TYR A OH    1 
ATOM   3605 N  N     . LEU C 3  384 ? 46.612 55.138  51.461 1.00 29.80  ? 390  LEU A N     1 
ATOM   3606 C  CA    . LEU C 3  384 ? 47.154 56.250  50.702 1.00 29.80  ? 390  LEU A CA    1 
ATOM   3607 C  C     . LEU C 3  384 ? 47.469 57.418  51.626 1.00 29.98  ? 390  LEU A C     1 
ATOM   3608 O  O     . LEU C 3  384 ? 48.511 58.048  51.493 1.00 30.41  ? 390  LEU A O     1 
ATOM   3609 C  CB    . LEU C 3  384 ? 46.174 56.674  49.605 1.00 29.60  ? 390  LEU A CB    1 
ATOM   3610 C  CG    . LEU C 3  384 ? 45.977 55.619  48.509 1.00 29.92  ? 390  LEU A CG    1 
ATOM   3611 C  CD1   . LEU C 3  384 ? 44.882 56.067  47.556 1.00 28.78  ? 390  LEU A CD1   1 
ATOM   3612 C  CD2   . LEU C 3  384 ? 47.282 55.404  47.756 1.00 27.97  ? 390  LEU A CD2   1 
ATOM   3613 N  N     . MET C 3  385 ? 46.580 57.697  52.571 1.00 29.19  ? 391  MET A N     1 
ATOM   3614 C  CA    . MET C 3  385 ? 46.810 58.787  53.504 1.00 29.11  ? 391  MET A CA    1 
ATOM   3615 C  C     . MET C 3  385 ? 48.037 58.489  54.362 1.00 29.87  ? 391  MET A C     1 
ATOM   3616 O  O     . MET C 3  385 ? 48.870 59.372  54.592 1.00 29.62  ? 391  MET A O     1 
ATOM   3617 C  CB    . MET C 3  385 ? 45.584 59.007  54.387 1.00 28.21  ? 391  MET A CB    1 
ATOM   3618 C  CG    . MET C 3  385 ? 45.765 60.099  55.420 1.00 30.54  ? 391  MET A CG    1 
ATOM   3619 S  SD    . MET C 3  385 ? 45.969 59.430  57.077 1.00 34.80  ? 391  MET A SD    1 
ATOM   3620 C  CE    . MET C 3  385 ? 47.661 59.214  57.177 1.00 32.34  ? 391  MET A CE    1 
ATOM   3621 N  N     . ILE C 3  386 ? 48.157 57.247  54.822 1.00 28.84  ? 392  ILE A N     1 
ATOM   3622 C  CA    . ILE C 3  386 ? 49.302 56.845  55.638 1.00 28.48  ? 392  ILE A CA    1 
ATOM   3623 C  C     . ILE C 3  386 ? 50.600 57.079  54.863 1.00 28.61  ? 392  ILE A C     1 
ATOM   3624 O  O     . ILE C 3  386 ? 51.610 57.510  55.426 1.00 27.31  ? 392  ILE A O     1 
ATOM   3625 C  CB    . ILE C 3  386 ? 49.225 55.339  56.028 1.00 28.62  ? 392  ILE A CB    1 
ATOM   3626 C  CG1   . ILE C 3  386 ? 48.004 55.080  56.920 1.00 30.27  ? 392  ILE A CG1   1 
ATOM   3627 C  CG2   . ILE C 3  386 ? 50.484 54.921  56.760 1.00 25.04  ? 392  ILE A CG2   1 
ATOM   3628 C  CD1   . ILE C 3  386 ? 48.065 55.763  58.266 1.00 29.81  ? 392  ILE A CD1   1 
ATOM   3629 N  N     . GLN C 3  387 ? 50.568 56.789  53.568 1.00 29.30  ? 393  GLN A N     1 
ATOM   3630 C  CA    . GLN C 3  387 ? 51.742 56.968  52.729 1.00 31.68  ? 393  GLN A CA    1 
ATOM   3631 C  C     . GLN C 3  387 ? 52.120 58.430  52.606 1.00 30.82  ? 393  GLN A C     1 
ATOM   3632 O  O     . GLN C 3  387 ? 53.295 58.784  52.630 1.00 30.30  ? 393  GLN A O     1 
ATOM   3633 C  CB    . GLN C 3  387 ? 51.502 56.386  51.340 1.00 34.56  ? 393  GLN A CB    1 
ATOM   3634 C  CG    . GLN C 3  387 ? 52.048 54.993  51.205 1.00 39.71  ? 393  GLN A CG    1 
ATOM   3635 C  CD    . GLN C 3  387 ? 53.535 54.948  51.478 1.00 40.54  ? 393  GLN A CD    1 
ATOM   3636 O  OE1   . GLN C 3  387 ? 54.098 53.885  51.709 1.00 42.81  ? 393  GLN A OE1   1 
ATOM   3637 N  NE2   . GLN C 3  387 ? 54.184 56.110  51.443 1.00 44.00  ? 393  GLN A NE2   1 
ATOM   3638 N  N     . LYS C 3  388 ? 51.106 59.272  52.462 1.00 29.99  ? 394  LYS A N     1 
ATOM   3639 C  CA    . LYS C 3  388 ? 51.303 60.704  52.349 1.00 29.10  ? 394  LYS A CA    1 
ATOM   3640 C  C     . LYS C 3  388 ? 52.075 61.173  53.592 1.00 26.75  ? 394  LYS A C     1 
ATOM   3641 O  O     . LYS C 3  388 ? 53.029 61.937  53.488 1.00 26.38  ? 394  LYS A O     1 
ATOM   3642 C  CB    . LYS C 3  388 ? 49.933 61.383  52.271 1.00 32.27  ? 394  LYS A CB    1 
ATOM   3643 C  CG    . LYS C 3  388 ? 49.919 62.758  51.631 1.00 37.35  ? 394  LYS A CG    1 
ATOM   3644 C  CD    . LYS C 3  388 ? 50.303 62.682  50.157 1.00 42.29  ? 394  LYS A CD    1 
ATOM   3645 C  CE    . LYS C 3  388 ? 49.874 63.944  49.403 1.00 44.32  ? 394  LYS A CE    1 
ATOM   3646 N  NZ    . LYS C 3  388 ? 50.420 65.189  50.007 1.00 45.33  ? 394  LYS A NZ    1 
ATOM   3647 N  N     . ARG C 3  389 ? 51.674 60.692  54.766 1.00 24.40  ? 395  ARG A N     1 
ATOM   3648 C  CA    . ARG C 3  389 ? 52.332 61.079  56.018 1.00 25.00  ? 395  ARG A CA    1 
ATOM   3649 C  C     . ARG C 3  389 ? 53.738 60.521  56.145 1.00 24.54  ? 395  ARG A C     1 
ATOM   3650 O  O     . ARG C 3  389 ? 54.656 61.216  56.580 1.00 23.88  ? 395  ARG A O     1 
ATOM   3651 C  CB    . ARG C 3  389 ? 51.515 60.613  57.214 1.00 22.86  ? 395  ARG A CB    1 
ATOM   3652 C  CG    . ARG C 3  389 ? 50.130 61.163  57.232 1.00 22.28  ? 395  ARG A CG    1 
ATOM   3653 C  CD    . ARG C 3  389 ? 50.122 62.653  57.442 1.00 22.52  ? 395  ARG A CD    1 
ATOM   3654 N  NE    . ARG C 3  389 ? 48.743 63.105  57.541 1.00 28.68  ? 395  ARG A NE    1 
ATOM   3655 C  CZ    . ARG C 3  389 ? 48.000 63.484  56.511 1.00 26.40  ? 395  ARG A CZ    1 
ATOM   3656 N  NH1   . ARG C 3  389 ? 48.505 63.488  55.288 1.00 26.91  ? 395  ARG A NH1   1 
ATOM   3657 N  NH2   . ARG C 3  389 ? 46.739 63.827  56.708 1.00 29.23  ? 395  ARG A NH2   1 
ATOM   3658 N  N     . ILE C 3  390 ? 53.902 59.256  55.778 1.00 24.38  ? 396  ILE A N     1 
ATOM   3659 C  CA    . ILE C 3  390 ? 55.209 58.625  55.846 1.00 23.04  ? 396  ILE A CA    1 
ATOM   3660 C  C     . ILE C 3  390 ? 56.163 59.308  54.881 1.00 22.38  ? 396  ILE A C     1 
ATOM   3661 O  O     . ILE C 3  390 ? 57.292 59.643  55.239 1.00 23.67  ? 396  ILE A O     1 
ATOM   3662 C  CB    . ILE C 3  390 ? 55.123 57.130  55.496 1.00 20.74  ? 396  ILE A CB    1 
ATOM   3663 C  CG1   . ILE C 3  390 ? 54.307 56.399  56.569 1.00 22.68  ? 396  ILE A CG1   1 
ATOM   3664 C  CG2   . ILE C 3  390 ? 56.513 56.544  55.374 1.00 17.66  ? 396  ILE A CG2   1 
ATOM   3665 C  CD1   . ILE C 3  390 ? 54.182 54.906  56.346 1.00 24.12  ? 396  ILE A CD1   1 
ATOM   3666 N  N     . GLY C 3  391 ? 55.705 59.523  53.653 1.00 21.99  ? 397  GLY A N     1 
ATOM   3667 C  CA    . GLY C 3  391 ? 56.558 60.161  52.667 1.00 22.73  ? 397  GLY A CA    1 
ATOM   3668 C  C     . GLY C 3  391 ? 57.057 61.526  53.119 1.00 23.49  ? 397  GLY A C     1 
ATOM   3669 O  O     . GLY C 3  391 ? 58.243 61.823  53.032 1.00 22.92  ? 397  GLY A O     1 
ATOM   3670 N  N     . GLN C 3  392 ? 56.148 62.353  53.619 1.00 22.82  ? 398  GLN A N     1 
ATOM   3671 C  CA    . GLN C 3  392 ? 56.498 63.697  54.057 1.00 26.15  ? 398  GLN A CA    1 
ATOM   3672 C  C     . GLN C 3  392 ? 57.336 63.754  55.336 1.00 25.82  ? 398  GLN A C     1 
ATOM   3673 O  O     . GLN C 3  392 ? 58.218 64.594  55.467 1.00 28.25  ? 398  GLN A O     1 
ATOM   3674 C  CB    . GLN C 3  392 ? 55.216 64.527  54.227 1.00 24.66  ? 398  GLN A CB    1 
ATOM   3675 C  CG    . GLN C 3  392 ? 55.418 65.890  54.854 1.00 23.63  ? 398  GLN A CG    1 
ATOM   3676 C  CD    . GLN C 3  392 ? 54.193 66.770  54.714 1.00 26.63  ? 398  GLN A CD    1 
ATOM   3677 O  OE1   . GLN C 3  392 ? 53.065 66.278  54.708 1.00 27.25  ? 398  GLN A OE1   1 
ATOM   3678 N  NE2   . GLN C 3  392 ? 54.405 68.081  54.617 1.00 25.42  ? 398  GLN A NE2   1 
ATOM   3679 N  N     . SER C 3  393 ? 57.075 62.853  56.272 1.00 27.01  ? 399  SER A N     1 
ATOM   3680 C  CA    . SER C 3  393 ? 57.802 62.859  57.533 1.00 26.34  ? 399  SER A CA    1 
ATOM   3681 C  C     . SER C 3  393 ? 59.072 62.033  57.558 1.00 26.68  ? 399  SER A C     1 
ATOM   3682 O  O     . SER C 3  393 ? 60.054 62.435  58.183 1.00 27.97  ? 399  SER A O     1 
ATOM   3683 C  CB    . SER C 3  393 ? 56.888 62.380  58.670 1.00 26.50  ? 399  SER A CB    1 
ATOM   3684 O  OG    . SER C 3  393 ? 56.521 61.016  58.496 1.00 24.61  ? 399  SER A OG    1 
ATOM   3685 N  N     . ALA C 3  394 ? 59.080 60.892  56.876 1.00 26.25  ? 400  ALA A N     1 
ATOM   3686 C  CA    . ALA C 3  394 ? 60.258 60.044  56.949 1.00 25.53  ? 400  ALA A CA    1 
ATOM   3687 C  C     . ALA C 3  394 ? 60.913 59.453  55.709 1.00 25.80  ? 400  ALA A C     1 
ATOM   3688 O  O     . ALA C 3  394 ? 62.138 59.409  55.648 1.00 25.17  ? 400  ALA A O     1 
ATOM   3689 C  CB    . ALA C 3  394 ? 59.983 58.910  57.939 1.00 27.04  ? 400  ALA A CB    1 
ATOM   3690 N  N     . GLU C 3  395 ? 60.139 58.998  54.728 1.00 24.74  ? 401  GLU A N     1 
ATOM   3691 C  CA    . GLU C 3  395 ? 60.759 58.344  53.570 1.00 24.89  ? 401  GLU A CA    1 
ATOM   3692 C  C     . GLU C 3  395 ? 60.999 59.144  52.307 1.00 25.47  ? 401  GLU A C     1 
ATOM   3693 O  O     . GLU C 3  395 ? 61.861 58.780  51.501 1.00 25.49  ? 401  GLU A O     1 
ATOM   3694 C  CB    . GLU C 3  395 ? 59.972 57.078  53.209 1.00 24.06  ? 401  GLU A CB    1 
ATOM   3695 C  CG    . GLU C 3  395 ? 59.729 56.166  54.394 1.00 23.12  ? 401  GLU A CG    1 
ATOM   3696 C  CD    . GLU C 3  395 ? 59.096 54.845  54.002 1.00 25.22  ? 401  GLU A CD    1 
ATOM   3697 O  OE1   . GLU C 3  395 ? 58.411 54.795  52.955 1.00 22.33  ? 401  GLU A OE1   1 
ATOM   3698 O  OE2   . GLU C 3  395 ? 59.274 53.862  54.752 1.00 22.97  ? 401  GLU A OE2   1 
ATOM   3699 N  N     . GLY C 3  396 ? 60.241 60.220  52.122 1.00 26.61  ? 402  GLY A N     1 
ATOM   3700 C  CA    . GLY C 3  396 ? 60.407 61.038  50.934 1.00 26.04  ? 402  GLY A CA    1 
ATOM   3701 C  C     . GLY C 3  396 ? 61.805 61.612  50.829 1.00 27.23  ? 402  GLY A C     1 
ATOM   3702 O  O     . GLY C 3  396 ? 62.559 61.599  51.799 1.00 26.80  ? 402  GLY A O     1 
ATOM   3703 N  N     . ASP C 3  397 ? 62.152 62.118  49.651 1.00 28.29  ? 403  ASP A N     1 
ATOM   3704 C  CA    . ASP C 3  397 ? 63.472 62.703  49.424 1.00 30.00  ? 403  ASP A CA    1 
ATOM   3705 C  C     . ASP C 3  397 ? 63.655 63.964  50.262 1.00 29.58  ? 403  ASP A C     1 
ATOM   3706 O  O     . ASP C 3  397 ? 64.771 64.313  50.642 1.00 28.45  ? 403  ASP A O     1 
ATOM   3707 C  CB    . ASP C 3  397 ? 63.638 63.049  47.945 1.00 34.86  ? 403  ASP A CB    1 
ATOM   3708 C  CG    . ASP C 3  397 ? 63.441 61.850  47.047 1.00 40.76  ? 403  ASP A CG    1 
ATOM   3709 O  OD1   . ASP C 3  397 ? 62.353 61.220  47.108 1.00 47.83  ? 403  ASP A OD1   1 
ATOM   3710 O  OD2   . ASP C 3  397 ? 64.375 61.534  46.281 1.00 42.62  ? 403  ASP A OD2   1 
ATOM   3711 N  N     . LYS C 3  398 ? 62.547 64.642  50.543 1.00 28.23  ? 404  LYS A N     1 
ATOM   3712 C  CA    . LYS C 3  398 ? 62.567 65.865  51.336 1.00 27.99  ? 404  LYS A CA    1 
ATOM   3713 C  C     . LYS C 3  398 ? 61.903 65.635  52.693 1.00 25.91  ? 404  LYS A C     1 
ATOM   3714 O  O     . LYS C 3  398 ? 61.361 66.566  53.284 1.00 25.33  ? 404  LYS A O     1 
ATOM   3715 C  CB    . LYS C 3  398 ? 61.822 66.982  50.593 1.00 30.14  ? 404  LYS A CB    1 
ATOM   3716 C  CG    . LYS C 3  398 ? 62.237 67.159  49.138 1.00 29.76  ? 404  LYS A CG    1 
ATOM   3717 C  CD    . LYS C 3  398 ? 63.683 67.605  49.018 1.00 32.25  ? 404  LYS A CD    1 
ATOM   3718 C  CE    . LYS C 3  398 ? 64.112 67.657  47.564 1.00 33.77  ? 404  LYS A CE    1 
ATOM   3719 N  NZ    . LYS C 3  398 ? 63.157 68.474  46.765 1.00 38.26  ? 404  LYS A NZ    1 
ATOM   3720 N  N     . ALA C 3  399 ? 61.944 64.400  53.184 1.00 23.88  ? 405  ALA A N     1 
ATOM   3721 C  CA    . ALA C 3  399 ? 61.326 64.077  54.472 1.00 23.83  ? 405  ALA A CA    1 
ATOM   3722 C  C     . ALA C 3  399 ? 61.960 64.861  55.613 1.00 23.71  ? 405  ALA A C     1 
ATOM   3723 O  O     . ALA C 3  399 ? 63.164 65.129  55.599 1.00 21.77  ? 405  ALA A O     1 
ATOM   3724 C  CB    . ALA C 3  399 ? 61.432 62.582  54.748 1.00 23.05  ? 405  ALA A CB    1 
ATOM   3725 N  N     . TRP C 3  400 ? 61.146 65.221  56.604 1.00 24.24  ? 406  TRP A N     1 
ATOM   3726 C  CA    . TRP C 3  400 ? 61.633 65.986  57.752 1.00 23.48  ? 406  TRP A CA    1 
ATOM   3727 C  C     . TRP C 3  400 ? 62.795 65.282  58.432 1.00 23.55  ? 406  TRP A C     1 
ATOM   3728 O  O     . TRP C 3  400 ? 63.759 65.921  58.834 1.00 26.29  ? 406  TRP A O     1 
ATOM   3729 C  CB    . TRP C 3  400 ? 60.521 66.215  58.785 1.00 20.13  ? 406  TRP A CB    1 
ATOM   3730 C  CG    . TRP C 3  400 ? 59.261 66.798  58.235 1.00 20.45  ? 406  TRP A CG    1 
ATOM   3731 C  CD1   . TRP C 3  400 ? 59.145 67.700  57.212 1.00 20.32  ? 406  TRP A CD1   1 
ATOM   3732 C  CD2   . TRP C 3  400 ? 57.929 66.543  58.697 1.00 19.83  ? 406  TRP A CD2   1 
ATOM   3733 N  NE1   . TRP C 3  400 ? 57.821 68.019  57.010 1.00 21.03  ? 406  TRP A NE1   1 
ATOM   3734 C  CE2   . TRP C 3  400 ? 57.056 67.323  57.906 1.00 20.55  ? 406  TRP A CE2   1 
ATOM   3735 C  CE3   . TRP C 3  400 ? 57.389 65.732  59.704 1.00 20.83  ? 406  TRP A CE3   1 
ATOM   3736 C  CZ2   . TRP C 3  400 ? 55.668 67.312  58.090 1.00 21.72  ? 406  TRP A CZ2   1 
ATOM   3737 C  CZ3   . TRP C 3  400 ? 56.008 65.724  59.888 1.00 21.12  ? 406  TRP A CZ3   1 
ATOM   3738 C  CH2   . TRP C 3  400 ? 55.166 66.510  59.082 1.00 22.70  ? 406  TRP A CH2   1 
ATOM   3739 N  N     . LEU C 3  401 ? 62.715 63.966  58.564 1.00 23.69  ? 407  LEU A N     1 
ATOM   3740 C  CA    . LEU C 3  401 ? 63.798 63.229  59.211 1.00 24.07  ? 407  LEU A CA    1 
ATOM   3741 C  C     . LEU C 3  401 ? 65.113 63.274  58.436 1.00 24.77  ? 407  LEU A C     1 
ATOM   3742 O  O     . LEU C 3  401 ? 66.176 63.049  59.008 1.00 26.35  ? 407  LEU A O     1 
ATOM   3743 C  CB    . LEU C 3  401 ? 63.385 61.772  59.459 1.00 22.93  ? 407  LEU A CB    1 
ATOM   3744 C  CG    . LEU C 3  401 ? 62.330 61.579  60.552 1.00 22.55  ? 407  LEU A CG    1 
ATOM   3745 C  CD1   . LEU C 3  401 ? 61.942 60.109  60.642 1.00 23.05  ? 407  LEU A CD1   1 
ATOM   3746 C  CD2   . LEU C 3  401 ? 62.876 62.072  61.899 1.00 22.04  ? 407  LEU A CD2   1 
ATOM   3747 N  N     . ARG C 3  402 ? 65.055 63.559  57.140 1.00 24.87  ? 408  ARG A N     1 
ATOM   3748 C  CA    . ARG C 3  402 ? 66.284 63.639  56.353 1.00 26.31  ? 408  ARG A CA    1 
ATOM   3749 C  C     . ARG C 3  402 ? 66.850 65.048  56.435 1.00 26.68  ? 408  ARG A C     1 
ATOM   3750 O  O     . ARG C 3  402 ? 68.009 65.280  56.101 1.00 25.00  ? 408  ARG A O     1 
ATOM   3751 C  CB    . ARG C 3  402 ? 66.029 63.298  54.881 1.00 26.70  ? 408  ARG A CB    1 
ATOM   3752 C  CG    . ARG C 3  402 ? 65.546 61.878  54.630 1.00 26.93  ? 408  ARG A CG    1 
ATOM   3753 C  CD    . ARG C 3  402 ? 65.358 61.643  53.138 1.00 32.11  ? 408  ARG A CD    1 
ATOM   3754 N  NE    . ARG C 3  402 ? 64.752 60.344  52.839 1.00 33.57  ? 408  ARG A NE    1 
ATOM   3755 C  CZ    . ARG C 3  402 ? 65.316 59.167  53.102 1.00 37.39  ? 408  ARG A CZ    1 
ATOM   3756 N  NH1   . ARG C 3  402 ? 66.513 59.101  53.676 1.00 36.50  ? 408  ARG A NH1   1 
ATOM   3757 N  NH2   . ARG C 3  402 ? 64.683 58.048  52.779 1.00 40.83  ? 408  ARG A NH2   1 
ATOM   3758 N  N     . TYR C 3  403 ? 66.031 65.987  56.896 1.00 26.91  ? 409  TYR A N     1 
ATOM   3759 C  CA    . TYR C 3  403 ? 66.463 67.366  56.977 1.00 29.42  ? 409  TYR A CA    1 
ATOM   3760 C  C     . TYR C 3  403 ? 66.823 67.928  58.349 1.00 30.02  ? 409  TYR A C     1 
ATOM   3761 O  O     . TYR C 3  403 ? 67.305 69.058  58.438 1.00 31.99  ? 409  TYR A O     1 
ATOM   3762 C  CB    . TYR C 3  403 ? 65.429 68.252  56.280 1.00 30.91  ? 409  TYR A CB    1 
ATOM   3763 C  CG    . TYR C 3  403 ? 65.691 68.357  54.794 1.00 33.31  ? 409  TYR A CG    1 
ATOM   3764 C  CD1   . TYR C 3  403 ? 66.374 69.448  54.264 1.00 34.17  ? 409  TYR A CD1   1 
ATOM   3765 C  CD2   . TYR C 3  403 ? 65.332 67.328  53.931 1.00 35.05  ? 409  TYR A CD2   1 
ATOM   3766 C  CE1   . TYR C 3  403 ? 66.698 69.513  52.909 1.00 34.59  ? 409  TYR A CE1   1 
ATOM   3767 C  CE2   . TYR C 3  403 ? 65.655 67.378  52.571 1.00 36.49  ? 409  TYR A CE2   1 
ATOM   3768 C  CZ    . TYR C 3  403 ? 66.338 68.473  52.068 1.00 37.38  ? 409  TYR A CZ    1 
ATOM   3769 O  OH    . TYR C 3  403 ? 66.675 68.515  50.733 1.00 38.08  ? 409  TYR A OH    1 
ATOM   3770 N  N     . VAL C 3  404 ? 66.618 67.159  59.414 1.00 30.15  ? 410  VAL A N     1 
ATOM   3771 C  CA    . VAL C 3  404 ? 66.967 67.642  60.749 1.00 32.34  ? 410  VAL A CA    1 
ATOM   3772 C  C     . VAL C 3  404 ? 68.470 67.876  60.793 1.00 31.70  ? 410  VAL A C     1 
ATOM   3773 O  O     . VAL C 3  404 ? 69.243 66.992  60.435 1.00 33.11  ? 410  VAL A O     1 
ATOM   3774 C  CB    . VAL C 3  404 ? 66.599 66.616  61.864 1.00 34.76  ? 410  VAL A CB    1 
ATOM   3775 C  CG1   . VAL C 3  404 ? 65.141 66.284  61.796 1.00 37.01  ? 410  VAL A CG1   1 
ATOM   3776 C  CG2   . VAL C 3  404 ? 67.413 65.342  61.715 1.00 36.26  ? 410  VAL A CG2   1 
ATOM   3777 N  N     . ALA C 3  405 ? 68.888 69.064  61.220 1.00 30.55  ? 411  ALA A N     1 
ATOM   3778 C  CA    . ALA C 3  405 ? 70.312 69.374  61.305 1.00 30.58  ? 411  ALA A CA    1 
ATOM   3779 C  C     . ALA C 3  405 ? 70.852 68.912  62.657 1.00 31.55  ? 411  ALA A C     1 
ATOM   3780 O  O     . ALA C 3  405 ? 70.105 68.376  63.475 1.00 31.75  ? 411  ALA A O     1 
ATOM   3781 C  CB    . ALA C 3  405 ? 70.538 70.871  61.124 1.00 25.82  ? 411  ALA A CB    1 
ATOM   3782 N  N     . GLU C 3  406 ? 72.149 69.107  62.886 1.00 33.91  ? 412  GLU A N     1 
ATOM   3783 C  CA    . GLU C 3  406 ? 72.765 68.706  64.150 1.00 36.02  ? 412  GLU A CA    1 
ATOM   3784 C  C     . GLU C 3  406 ? 72.303 69.594  65.290 1.00 33.95  ? 412  GLU A C     1 
ATOM   3785 O  O     . GLU C 3  406 ? 72.377 69.205  66.454 1.00 34.00  ? 412  GLU A O     1 
ATOM   3786 C  CB    . GLU C 3  406 ? 74.294 68.760  64.056 1.00 40.30  ? 412  GLU A CB    1 
ATOM   3787 C  CG    . GLU C 3  406 ? 74.933 67.514  63.450 1.00 49.25  ? 412  GLU A CG    1 
ATOM   3788 C  CD    . GLU C 3  406 ? 74.814 66.288  64.350 1.00 53.48  ? 412  GLU A CD    1 
ATOM   3789 O  OE1   . GLU C 3  406 ? 75.492 66.249  65.403 1.00 55.70  ? 412  GLU A OE1   1 
ATOM   3790 O  OE2   . GLU C 3  406 ? 74.038 65.365  64.005 1.00 56.07  ? 412  GLU A OE2   1 
ATOM   3791 N  N     . ASP C 3  407 ? 71.825 70.789  64.960 1.00 32.55  ? 413  ASP A N     1 
ATOM   3792 C  CA    . ASP C 3  407 ? 71.362 71.702  65.993 1.00 28.26  ? 413  ASP A CA    1 
ATOM   3793 C  C     . ASP C 3  407 ? 69.922 71.416  66.384 1.00 27.75  ? 413  ASP A C     1 
ATOM   3794 O  O     . ASP C 3  407 ? 69.291 72.216  67.076 1.00 28.83  ? 413  ASP A O     1 
ATOM   3795 C  CB    . ASP C 3  407 ? 71.521 73.160  65.548 1.00 29.10  ? 413  ASP A CB    1 
ATOM   3796 C  CG    . ASP C 3  407 ? 70.687 73.510  64.322 1.00 30.89  ? 413  ASP A CG    1 
ATOM   3797 O  OD1   . ASP C 3  407 ? 69.796 72.727  63.938 1.00 31.98  ? 413  ASP A OD1   1 
ATOM   3798 O  OD2   . ASP C 3  407 ? 70.919 74.592  63.747 1.00 32.71  ? 413  ASP A OD2   1 
ATOM   3799 N  N     . GLY C 3  408 ? 69.407 70.270  65.940 1.00 26.09  ? 414  GLY A N     1 
ATOM   3800 C  CA    . GLY C 3  408 ? 68.043 69.873  66.267 1.00 24.57  ? 414  GLY A CA    1 
ATOM   3801 C  C     . GLY C 3  408 ? 66.936 70.681  65.607 1.00 25.26  ? 414  GLY A C     1 
ATOM   3802 O  O     . GLY C 3  408 ? 65.784 70.672  66.054 1.00 24.35  ? 414  GLY A O     1 
ATOM   3803 N  N     . LYS C 3  409 ? 67.273 71.388  64.540 1.00 24.57  ? 415  LYS A N     1 
ATOM   3804 C  CA    . LYS C 3  409 ? 66.279 72.194  63.843 1.00 25.17  ? 415  LYS A CA    1 
ATOM   3805 C  C     . LYS C 3  409 ? 66.277 71.859  62.365 1.00 22.80  ? 415  LYS A C     1 
ATOM   3806 O  O     . LYS C 3  409 ? 67.233 71.281  61.853 1.00 21.11  ? 415  LYS A O     1 
ATOM   3807 C  CB    . LYS C 3  409 ? 66.584 73.687  64.015 1.00 25.92  ? 415  LYS A CB    1 
ATOM   3808 C  CG    . LYS C 3  409 ? 66.395 74.208  65.422 1.00 30.09  ? 415  LYS A CG    1 
ATOM   3809 C  CD    . LYS C 3  409 ? 67.647 74.893  65.928 1.00 33.67  ? 415  LYS A CD    1 
ATOM   3810 C  CE    . LYS C 3  409 ? 67.523 75.224  67.405 1.00 35.76  ? 415  LYS A CE    1 
ATOM   3811 N  NZ    . LYS C 3  409 ? 68.863 75.288  68.055 1.00 43.16  ? 415  LYS A NZ    1 
ATOM   3812 N  N     . ILE C 3  410 ? 65.189 72.226  61.698 1.00 22.09  ? 416  ILE A N     1 
ATOM   3813 C  CA    . ILE C 3  410 ? 65.042 72.032  60.263 1.00 21.90  ? 416  ILE A CA    1 
ATOM   3814 C  C     . ILE C 3  410 ? 65.133 73.437  59.678 1.00 21.58  ? 416  ILE A C     1 
ATOM   3815 O  O     . ILE C 3  410 ? 64.366 74.327  60.049 1.00 23.93  ? 416  ILE A O     1 
ATOM   3816 C  CB    . ILE C 3  410 ? 63.675 71.409  59.901 1.00 21.35  ? 416  ILE A CB    1 
ATOM   3817 C  CG1   . ILE C 3  410 ? 63.627 69.953  60.380 1.00 21.65  ? 416  ILE A CG1   1 
ATOM   3818 C  CG2   . ILE C 3  410 ? 63.442 71.499  58.396 1.00 18.12  ? 416  ILE A CG2   1 
ATOM   3819 C  CD1   . ILE C 3  410 ? 62.300 69.240  60.082 1.00 20.09  ? 416  ILE A CD1   1 
ATOM   3820 N  N     . HIS C 3  411 ? 66.079 73.630  58.772 1.00 20.52  ? 417  HIS A N     1 
ATOM   3821 C  CA    . HIS C 3  411 ? 66.303 74.928  58.159 1.00 20.42  ? 417  HIS A CA    1 
ATOM   3822 C  C     . HIS C 3  411 ? 65.695 75.010  56.766 1.00 20.82  ? 417  HIS A C     1 
ATOM   3823 O  O     . HIS C 3  411 ? 66.407 75.050  55.758 1.00 19.62  ? 417  HIS A O     1 
ATOM   3824 C  CB    . HIS C 3  411 ? 67.808 75.190  58.123 1.00 19.41  ? 417  HIS A CB    1 
ATOM   3825 C  CG    . HIS C 3  411 ? 68.453 75.080  59.466 1.00 17.72  ? 417  HIS A CG    1 
ATOM   3826 N  ND1   . HIS C 3  411 ? 68.727 76.177  60.255 1.00 19.32  ? 417  HIS A ND1   1 
ATOM   3827 C  CD2   . HIS C 3  411 ? 68.832 73.996  60.184 1.00 18.96  ? 417  HIS A CD2   1 
ATOM   3828 C  CE1   . HIS C 3  411 ? 69.249 75.774  61.400 1.00 20.71  ? 417  HIS A CE1   1 
ATOM   3829 N  NE2   . HIS C 3  411 ? 69.323 74.455  61.383 1.00 20.71  ? 417  HIS A NE2   1 
ATOM   3830 N  N     . GLY C 3  412 ? 64.364 75.019  56.728 1.00 19.80  ? 418  GLY A N     1 
ATOM   3831 C  CA    . GLY C 3  412 ? 63.656 75.108  55.470 1.00 19.44  ? 418  GLY A CA    1 
ATOM   3832 C  C     . GLY C 3  412 ? 64.066 76.334  54.677 1.00 21.79  ? 418  GLY A C     1 
ATOM   3833 O  O     . GLY C 3  412 ? 64.319 77.411  55.236 1.00 21.91  ? 418  GLY A O     1 
ATOM   3834 N  N     . SER C 3  413 ? 64.123 76.173  53.364 1.00 20.42  ? 419  SER A N     1 
ATOM   3835 C  CA    . SER C 3  413 ? 64.510 77.263  52.490 1.00 22.03  ? 419  SER A CA    1 
ATOM   3836 C  C     . SER C 3  413 ? 63.309 78.117  52.068 1.00 20.85  ? 419  SER A C     1 
ATOM   3837 O  O     . SER C 3  413 ? 62.164 77.661  52.060 1.00 18.52  ? 419  SER A O     1 
ATOM   3838 C  CB    . SER C 3  413 ? 65.212 76.702  51.258 1.00 21.67  ? 419  SER A CB    1 
ATOM   3839 O  OG    . SER C 3  413 ? 65.721 77.750  50.455 1.00 29.52  ? 419  SER A OG    1 
ATOM   3840 N  N     . VAL C 3  414 ? 63.578 79.366  51.721 1.00 19.62  ? 420  VAL A N     1 
ATOM   3841 C  CA    . VAL C 3  414 ? 62.513 80.255  51.304 1.00 18.85  ? 420  VAL A CA    1 
ATOM   3842 C  C     . VAL C 3  414 ? 62.927 81.137  50.143 1.00 17.72  ? 420  VAL A C     1 
ATOM   3843 O  O     . VAL C 3  414 ? 63.967 81.777  50.179 1.00 19.42  ? 420  VAL A O     1 
ATOM   3844 C  CB    . VAL C 3  414 ? 62.054 81.198  52.459 1.00 19.54  ? 420  VAL A CB    1 
ATOM   3845 C  CG1   . VAL C 3  414 ? 60.908 82.082  51.977 1.00 16.81  ? 420  VAL A CG1   1 
ATOM   3846 C  CG2   . VAL C 3  414 ? 61.614 80.387  53.683 1.00 17.65  ? 420  VAL A CG2   1 
ATOM   3847 N  N     . ASN C 3  415 ? 62.110 81.147  49.103 1.00 17.88  ? 421  ASN A N     1 
ATOM   3848 C  CA    . ASN C 3  415 ? 62.344 82.021  47.970 1.00 18.20  ? 421  ASN A CA    1 
ATOM   3849 C  C     . ASN C 3  415 ? 61.366 83.134  48.349 1.00 18.62  ? 421  ASN A C     1 
ATOM   3850 O  O     . ASN C 3  415 ? 60.162 83.000  48.152 1.00 20.52  ? 421  ASN A O     1 
ATOM   3851 C  CB    . ASN C 3  415 ? 61.913 81.352  46.671 1.00 19.63  ? 421  ASN A CB    1 
ATOM   3852 C  CG    . ASN C 3  415 ? 62.129 82.242  45.471 1.00 21.25  ? 421  ASN A CG    1 
ATOM   3853 O  OD1   . ASN C 3  415 ? 61.883 83.451  45.536 1.00 21.73  ? 421  ASN A OD1   1 
ATOM   3854 N  ND2   . ASN C 3  415 ? 62.577 81.653  44.359 1.00 17.63  ? 421  ASN A ND2   1 
ATOM   3855 N  N     . PRO C 3  416 ? 61.873 84.233  48.923 1.00 18.01  ? 422  PRO A N     1 
ATOM   3856 C  CA    . PRO C 3  416 ? 61.063 85.376  49.358 1.00 18.23  ? 422  PRO A CA    1 
ATOM   3857 C  C     . PRO C 3  416 ? 60.054 85.915  48.361 1.00 19.95  ? 422  PRO A C     1 
ATOM   3858 O  O     . PRO C 3  416 ? 59.044 86.487  48.762 1.00 20.39  ? 422  PRO A O     1 
ATOM   3859 C  CB    . PRO C 3  416 ? 62.108 86.426  49.726 1.00 18.48  ? 422  PRO A CB    1 
ATOM   3860 C  CG    . PRO C 3  416 ? 63.296 85.608  50.123 1.00 17.65  ? 422  PRO A CG    1 
ATOM   3861 C  CD    . PRO C 3  416 ? 63.310 84.536  49.062 1.00 16.97  ? 422  PRO A CD    1 
ATOM   3862 N  N     . ASN C 3  417 ? 60.322 85.746  47.069 1.00 21.08  ? 423  ASN A N     1 
ATOM   3863 C  CA    . ASN C 3  417 ? 59.410 86.259  46.047 1.00 20.87  ? 423  ASN A CA    1 
ATOM   3864 C  C     . ASN C 3  417 ? 59.211 85.245  44.926 1.00 21.81  ? 423  ASN A C     1 
ATOM   3865 O  O     . ASN C 3  417 ? 59.127 85.612  43.753 1.00 22.32  ? 423  ASN A O     1 
ATOM   3866 C  CB    . ASN C 3  417 ? 59.963 87.566  45.469 1.00 18.61  ? 423  ASN A CB    1 
ATOM   3867 C  CG    . ASN C 3  417 ? 58.875 88.445  44.868 1.00 18.98  ? 423  ASN A CG    1 
ATOM   3868 O  OD1   . ASN C 3  417 ? 57.905 88.772  45.533 1.00 17.20  ? 423  ASN A OD1   1 
ATOM   3869 N  ND2   . ASN C 3  417 ? 59.037 88.825  43.610 1.00 19.04  ? 423  ASN A ND2   1 
ATOM   3870 N  N     . GLY C 3  418 ? 59.119 83.973  45.305 1.00 22.51  ? 424  GLY A N     1 
ATOM   3871 C  CA    . GLY C 3  418 ? 58.970 82.891  44.345 1.00 22.32  ? 424  GLY A CA    1 
ATOM   3872 C  C     . GLY C 3  418 ? 57.677 82.771  43.566 1.00 22.73  ? 424  GLY A C     1 
ATOM   3873 O  O     . GLY C 3  418 ? 57.676 82.176  42.491 1.00 23.22  ? 424  GLY A O     1 
ATOM   3874 N  N     . ALA C 3  419 ? 56.579 83.306  44.095 1.00 21.32  ? 425  ALA A N     1 
ATOM   3875 C  CA    . ALA C 3  419 ? 55.293 83.230  43.397 1.00 20.50  ? 425  ALA A CA    1 
ATOM   3876 C  C     . ALA C 3  419 ? 55.086 84.514  42.614 1.00 21.15  ? 425  ALA A C     1 
ATOM   3877 O  O     . ALA C 3  419 ? 55.487 85.580  43.069 1.00 20.80  ? 425  ALA A O     1 
ATOM   3878 C  CB    . ALA C 3  419 ? 54.159 83.043  44.400 1.00 19.46  ? 425  ALA A CB    1 
ATOM   3879 N  N     . VAL C 3  420 ? 54.453 84.416  41.447 1.00 21.38  ? 426  VAL A N     1 
ATOM   3880 C  CA    . VAL C 3  420 ? 54.211 85.581  40.604 1.00 23.11  ? 426  VAL A CA    1 
ATOM   3881 C  C     . VAL C 3  420 ? 53.521 86.747  41.322 1.00 21.63  ? 426  VAL A C     1 
ATOM   3882 O  O     . VAL C 3  420 ? 53.804 87.906  41.036 1.00 21.38  ? 426  VAL A O     1 
ATOM   3883 C  CB    . VAL C 3  420 ? 53.369 85.208  39.348 1.00 24.12  ? 426  VAL A CB    1 
ATOM   3884 C  CG1   . VAL C 3  420 ? 54.112 84.176  38.536 1.00 31.83  ? 426  VAL A CG1   1 
ATOM   3885 C  CG2   . VAL C 3  420 ? 52.004 84.668  39.755 1.00 23.54  ? 426  VAL A CG2   1 
ATOM   3886 N  N     . THR C 3  421 ? 52.633 86.429  42.256 1.00 20.62  ? 427  THR A N     1 
ATOM   3887 C  CA    . THR C 3  421 ? 51.889 87.437  43.000 1.00 20.36  ? 427  THR A CA    1 
ATOM   3888 C  C     . THR C 3  421 ? 52.684 88.190  44.052 1.00 21.02  ? 427  THR A C     1 
ATOM   3889 O  O     . THR C 3  421 ? 52.209 89.195  44.587 1.00 21.23  ? 427  THR A O     1 
ATOM   3890 C  CB    . THR C 3  421 ? 50.698 86.812  43.712 1.00 21.01  ? 427  THR A CB    1 
ATOM   3891 O  OG1   . THR C 3  421 ? 51.162 85.757  44.559 1.00 20.40  ? 427  THR A OG1   1 
ATOM   3892 C  CG2   . THR C 3  421 ? 49.706 86.259  42.702 1.00 23.95  ? 427  THR A CG2   1 
ATOM   3893 N  N     . GLY C 3  422 ? 53.879 87.709  44.369 1.00 20.42  ? 428  GLY A N     1 
ATOM   3894 C  CA    . GLY C 3  422 ? 54.674 88.391  45.373 1.00 18.96  ? 428  GLY A CA    1 
ATOM   3895 C  C     . GLY C 3  422 ? 54.774 87.563  46.631 1.00 20.37  ? 428  GLY A C     1 
ATOM   3896 O  O     . GLY C 3  422 ? 55.444 87.949  47.584 1.00 20.01  ? 428  GLY A O     1 
ATOM   3897 N  N     . ARG C 3  423 ? 54.076 86.432  46.641 1.00 20.66  ? 429  ARG A N     1 
ATOM   3898 C  CA    . ARG C 3  423 ? 54.128 85.516  47.765 1.00 21.10  ? 429  ARG A CA    1 
ATOM   3899 C  C     . ARG C 3  423 ? 55.486 84.843  47.696 1.00 21.59  ? 429  ARG A C     1 
ATOM   3900 O  O     . ARG C 3  423 ? 56.175 84.920  46.683 1.00 22.51  ? 429  ARG A O     1 
ATOM   3901 C  CB    . ARG C 3  423 ? 53.066 84.421  47.645 1.00 21.10  ? 429  ARG A CB    1 
ATOM   3902 C  CG    . ARG C 3  423 ? 51.730 84.740  48.265 1.00 21.71  ? 429  ARG A CG    1 
ATOM   3903 C  CD    . ARG C 3  423 ? 50.897 83.476  48.330 1.00 21.03  ? 429  ARG A CD    1 
ATOM   3904 N  NE    . ARG C 3  423 ? 49.650 83.661  49.063 1.00 21.14  ? 429  ARG A NE    1 
ATOM   3905 C  CZ    . ARG C 3  423 ? 48.884 82.654  49.471 1.00 21.54  ? 429  ARG A CZ    1 
ATOM   3906 N  NH1   . ARG C 3  423 ? 49.242 81.404  49.219 1.00 19.87  ? 429  ARG A NH1   1 
ATOM   3907 N  NH2   . ARG C 3  423 ? 47.766 82.895  50.131 1.00 20.53  ? 429  ARG A NH2   1 
ATOM   3908 N  N     . ALA C 3  424 ? 55.860 84.174  48.775 1.00 20.57  ? 430  ALA A N     1 
ATOM   3909 C  CA    . ALA C 3  424 ? 57.120 83.459  48.820 1.00 20.58  ? 430  ALA A CA    1 
ATOM   3910 C  C     . ALA C 3  424 ? 56.797 81.999  48.533 1.00 20.15  ? 430  ALA A C     1 
ATOM   3911 O  O     . ALA C 3  424 ? 55.631 81.620  48.499 1.00 18.78  ? 430  ALA A O     1 
ATOM   3912 C  CB    . ALA C 3  424 ? 57.737 83.589  50.211 1.00 18.41  ? 430  ALA A CB    1 
ATOM   3913 N  N     . THR C 3  425 ? 57.831 81.193  48.313 1.00 21.09  ? 431  THR A N     1 
ATOM   3914 C  CA    . THR C 3  425 ? 57.671 79.757  48.083 1.00 20.49  ? 431  THR A CA    1 
ATOM   3915 C  C     . THR C 3  425 ? 58.588 79.127  49.113 1.00 21.62  ? 431  THR A C     1 
ATOM   3916 O  O     . THR C 3  425 ? 59.559 79.748  49.547 1.00 21.76  ? 431  THR A O     1 
ATOM   3917 C  CB    . THR C 3  425 ? 58.122 79.324  46.676 1.00 21.39  ? 431  THR A CB    1 
ATOM   3918 O  OG1   . THR C 3  425 ? 59.511 79.630  46.497 1.00 21.51  ? 431  THR A OG1   1 
ATOM   3919 C  CG2   . THR C 3  425 ? 57.308 80.048  45.609 1.00 23.49  ? 431  THR A CG2   1 
ATOM   3920 N  N     . HIS C 3  426 ? 58.289 77.895  49.502 1.00 23.64  ? 432  HIS A N     1 
ATOM   3921 C  CA    . HIS C 3  426 ? 59.065 77.206  50.518 1.00 21.43  ? 432  HIS A CA    1 
ATOM   3922 C  C     . HIS C 3  426 ? 59.431 75.812  50.056 1.00 22.84  ? 432  HIS A C     1 
ATOM   3923 O  O     . HIS C 3  426 ? 58.622 75.121  49.449 1.00 23.98  ? 432  HIS A O     1 
ATOM   3924 C  CB    . HIS C 3  426 ? 58.243 77.126  51.799 1.00 20.80  ? 432  HIS A CB    1 
ATOM   3925 C  CG    . HIS C 3  426 ? 57.542 78.406  52.141 1.00 22.29  ? 432  HIS A CG    1 
ATOM   3926 N  ND1   . HIS C 3  426 ? 56.553 78.948  51.347 1.00 21.27  ? 432  HIS A ND1   1 
ATOM   3927 C  CD2   . HIS C 3  426 ? 57.696 79.256  53.183 1.00 22.31  ? 432  HIS A CD2   1 
ATOM   3928 C  CE1   . HIS C 3  426 ? 56.127 80.078  51.886 1.00 20.93  ? 432  HIS A CE1   1 
ATOM   3929 N  NE2   . HIS C 3  426 ? 56.805 80.288  53.000 1.00 23.26  ? 432  HIS A NE2   1 
ATOM   3930 N  N     . ALA C 3  427 ? 60.647 75.387  50.360 1.00 21.14  ? 433  ALA A N     1 
ATOM   3931 C  CA    . ALA C 3  427 ? 61.078 74.068  49.947 1.00 20.87  ? 433  ALA A CA    1 
ATOM   3932 C  C     . ALA C 3  427 ? 62.267 73.569  50.749 1.00 19.35  ? 433  ALA A C     1 
ATOM   3933 O  O     . ALA C 3  427 ? 62.941 74.347  51.423 1.00 20.25  ? 433  ALA A O     1 
ATOM   3934 C  CB    . ALA C 3  427 ? 61.432 74.094  48.461 1.00 17.57  ? 433  ALA A CB    1 
ATOM   3935 N  N     . PHE C 3  428 ? 62.501 72.262  50.670 1.00 20.04  ? 434  PHE A N     1 
ATOM   3936 C  CA    . PHE C 3  428 ? 63.635 71.613  51.312 1.00 20.50  ? 434  PHE A CA    1 
ATOM   3937 C  C     . PHE C 3  428 ? 63.716 71.648  52.829 1.00 20.71  ? 434  PHE A C     1 
ATOM   3938 O  O     . PHE C 3  428 ? 64.722 72.087  53.381 1.00 22.57  ? 434  PHE A O     1 
ATOM   3939 C  CB    . PHE C 3  428 ? 64.930 72.202  50.757 1.00 25.05  ? 434  PHE A CB    1 
ATOM   3940 C  CG    . PHE C 3  428 ? 64.955 72.317  49.265 1.00 27.50  ? 434  PHE A CG    1 
ATOM   3941 C  CD1   . PHE C 3  428 ? 64.698 71.213  48.458 1.00 32.10  ? 434  PHE A CD1   1 
ATOM   3942 C  CD2   . PHE C 3  428 ? 65.274 73.526  48.663 1.00 28.53  ? 434  PHE A CD2   1 
ATOM   3943 C  CE1   . PHE C 3  428 ? 64.764 71.316  47.066 1.00 31.61  ? 434  PHE A CE1   1 
ATOM   3944 C  CE2   . PHE C 3  428 ? 65.342 73.639  47.280 1.00 30.80  ? 434  PHE A CE2   1 
ATOM   3945 C  CZ    . PHE C 3  428 ? 65.087 72.532  46.481 1.00 31.87  ? 434  PHE A CZ    1 
ATOM   3946 N  N     . PRO C 3  429 ? 62.659 71.223  53.529 1.00 20.38  ? 435  PRO A N     1 
ATOM   3947 C  CA    . PRO C 3  429 ? 61.389 70.726  52.999 1.00 20.94  ? 435  PRO A CA    1 
ATOM   3948 C  C     . PRO C 3  429 ? 60.443 71.917  52.980 1.00 20.11  ? 435  PRO A C     1 
ATOM   3949 O  O     . PRO C 3  429 ? 60.798 72.982  53.470 1.00 19.28  ? 435  PRO A O     1 
ATOM   3950 C  CB    . PRO C 3  429 ? 60.980 69.689  54.030 1.00 20.17  ? 435  PRO A CB    1 
ATOM   3951 C  CG    . PRO C 3  429 ? 61.413 70.331  55.296 1.00 18.81  ? 435  PRO A CG    1 
ATOM   3952 C  CD    . PRO C 3  429 ? 62.781 70.905  54.962 1.00 19.50  ? 435  PRO A CD    1 
ATOM   3953 N  N     . ASN C 3  430 ? 59.249 71.751  52.426 1.00 20.65  ? 436  ASN A N     1 
ATOM   3954 C  CA    . ASN C 3  430 ? 58.301 72.861  52.380 1.00 21.44  ? 436  ASN A CA    1 
ATOM   3955 C  C     . ASN C 3  430 ? 57.595 73.011  53.726 1.00 21.10  ? 436  ASN A C     1 
ATOM   3956 O  O     . ASN C 3  430 ? 56.659 72.276  54.021 1.00 23.28  ? 436  ASN A O     1 
ATOM   3957 C  CB    . ASN C 3  430 ? 57.268 72.617  51.281 1.00 19.45  ? 436  ASN A CB    1 
ATOM   3958 C  CG    . ASN C 3  430 ? 56.234 73.713  51.206 1.00 22.09  ? 436  ASN A CG    1 
ATOM   3959 O  OD1   . ASN C 3  430 ? 56.234 74.647  52.021 1.00 21.45  ? 436  ASN A OD1   1 
ATOM   3960 N  ND2   . ASN C 3  430 ? 55.336 73.612  50.228 1.00 20.70  ? 436  ASN A ND2   1 
ATOM   3961 N  N     . LEU C 3  431 ? 58.030 73.972  54.535 1.00 20.87  ? 437  LEU A N     1 
ATOM   3962 C  CA    . LEU C 3  431 ? 57.424 74.169  55.844 1.00 20.89  ? 437  LEU A CA    1 
ATOM   3963 C  C     . LEU C 3  431 ? 56.062 74.849  55.776 1.00 22.80  ? 437  LEU A C     1 
ATOM   3964 O  O     . LEU C 3  431 ? 55.415 75.052  56.803 1.00 22.21  ? 437  LEU A O     1 
ATOM   3965 C  CB    . LEU C 3  431 ? 58.371 74.958  56.762 1.00 21.09  ? 437  LEU A CB    1 
ATOM   3966 C  CG    . LEU C 3  431 ? 59.652 74.195  57.137 1.00 21.12  ? 437  LEU A CG    1 
ATOM   3967 C  CD1   . LEU C 3  431 ? 60.475 74.980  58.145 1.00 19.58  ? 437  LEU A CD1   1 
ATOM   3968 C  CD2   . LEU C 3  431 ? 59.266 72.841  57.711 1.00 20.78  ? 437  LEU A CD2   1 
ATOM   3969 N  N     . ALA C 3  432 ? 55.629 75.189  54.562 1.00 22.73  ? 438  ALA A N     1 
ATOM   3970 C  CA    . ALA C 3  432 ? 54.331 75.821  54.348 1.00 22.43  ? 438  ALA A CA    1 
ATOM   3971 C  C     . ALA C 3  432 ? 53.274 74.786  53.946 1.00 22.60  ? 438  ALA A C     1 
ATOM   3972 O  O     . ALA C 3  432 ? 52.190 75.143  53.476 1.00 23.14  ? 438  ALA A O     1 
ATOM   3973 C  CB    . ALA C 3  432 ? 54.439 76.907  53.276 1.00 21.25  ? 438  ALA A CB    1 
ATOM   3974 N  N     . GLN C 3  433 ? 53.590 73.503  54.106 1.00 22.04  ? 439  GLN A N     1 
ATOM   3975 C  CA    . GLN C 3  433 ? 52.620 72.461  53.780 1.00 22.63  ? 439  GLN A CA    1 
ATOM   3976 C  C     . GLN C 3  433 ? 52.567 71.367  54.851 1.00 23.68  ? 439  GLN A C     1 
ATOM   3977 O  O     . GLN C 3  433 ? 52.292 70.207  54.542 1.00 24.24  ? 439  GLN A O     1 
ATOM   3978 C  CB    . GLN C 3  433 ? 52.907 71.836  52.401 1.00 20.93  ? 439  GLN A CB    1 
ATOM   3979 C  CG    . GLN C 3  433 ? 54.204 71.022  52.293 1.00 20.08  ? 439  GLN A CG    1 
ATOM   3980 C  CD    . GLN C 3  433 ? 54.437 70.442  50.890 1.00 22.30  ? 439  GLN A CD    1 
ATOM   3981 O  OE1   . GLN C 3  433 ? 55.504 69.902  50.605 1.00 21.55  ? 439  GLN A OE1   1 
ATOM   3982 N  NE2   . GLN C 3  433 ? 53.432 70.547  50.017 1.00 19.10  ? 439  GLN A NE2   1 
ATOM   3983 N  N     . ILE C 3  434 ? 52.835 71.730  56.106 1.00 23.48  ? 440  ILE A N     1 
ATOM   3984 C  CA    . ILE C 3  434 ? 52.776 70.756  57.201 1.00 23.22  ? 440  ILE A CA    1 
ATOM   3985 C  C     . ILE C 3  434 ? 51.297 70.449  57.423 1.00 22.45  ? 440  ILE A C     1 
ATOM   3986 O  O     . ILE C 3  434 ? 50.475 71.362  57.455 1.00 20.43  ? 440  ILE A O     1 
ATOM   3987 C  CB    . ILE C 3  434 ? 53.347 71.324  58.517 1.00 25.01  ? 440  ILE A CB    1 
ATOM   3988 C  CG1   . ILE C 3  434 ? 54.764 71.866  58.295 1.00 26.29  ? 440  ILE A CG1   1 
ATOM   3989 C  CG2   . ILE C 3  434 ? 53.337 70.244  59.591 1.00 24.80  ? 440  ILE A CG2   1 
ATOM   3990 C  CD1   . ILE C 3  434 ? 55.766 70.841  57.800 1.00 21.41  ? 440  ILE A CD1   1 
ATOM   3991 N  N     . PRO C 3  435 ? 50.936 69.161  57.575 1.00 23.34  ? 441  PRO A N     1 
ATOM   3992 C  CA    . PRO C 3  435 ? 49.526 68.805  57.787 1.00 23.31  ? 441  PRO A CA    1 
ATOM   3993 C  C     . PRO C 3  435 ? 48.855 69.625  58.885 1.00 24.32  ? 441  PRO A C     1 
ATOM   3994 O  O     . PRO C 3  435 ? 49.459 69.904  59.917 1.00 24.44  ? 441  PRO A O     1 
ATOM   3995 C  CB    . PRO C 3  435 ? 49.598 67.323  58.129 1.00 23.47  ? 441  PRO A CB    1 
ATOM   3996 C  CG    . PRO C 3  435 ? 50.778 66.857  57.309 1.00 23.91  ? 441  PRO A CG    1 
ATOM   3997 C  CD    . PRO C 3  435 ? 51.786 67.955  57.553 1.00 22.38  ? 441  PRO A CD    1 
ATOM   3998 N  N     . GLY C 3  436 ? 47.606 70.014  58.657 1.00 25.86  ? 442  GLY A N     1 
ATOM   3999 C  CA    . GLY C 3  436 ? 46.885 70.795  59.653 1.00 26.13  ? 442  GLY A CA    1 
ATOM   4000 C  C     . GLY C 3  436 ? 46.573 69.956  60.876 1.00 25.93  ? 442  GLY A C     1 
ATOM   4001 O  O     . GLY C 3  436 ? 46.412 68.745  60.764 1.00 25.50  ? 442  GLY A O     1 
ATOM   4002 N  N     . VAL C 3  437 ? 46.481 70.586  62.043 1.00 28.57  ? 443  VAL A N     1 
ATOM   4003 C  CA    . VAL C 3  437 ? 46.195 69.852  63.275 1.00 32.35  ? 443  VAL A CA    1 
ATOM   4004 C  C     . VAL C 3  437 ? 44.903 69.046  63.250 1.00 32.75  ? 443  VAL A C     1 
ATOM   4005 O  O     . VAL C 3  437 ? 44.780 68.075  63.985 1.00 35.70  ? 443  VAL A O     1 
ATOM   4006 C  CB    . VAL C 3  437 ? 46.125 70.789  64.507 1.00 33.14  ? 443  VAL A CB    1 
ATOM   4007 C  CG1   . VAL C 3  437 ? 47.470 71.390  64.777 1.00 34.25  ? 443  VAL A CG1   1 
ATOM   4008 C  CG2   . VAL C 3  437 ? 45.097 71.886  64.276 1.00 34.44  ? 443  VAL A CG2   1 
ATOM   4009 N  N     . ARG C 3  438 ? 43.943 69.432  62.414 1.00 34.57  ? 444  ARG A N     1 
ATOM   4010 C  CA    . ARG C 3  438 ? 42.671 68.710  62.362 1.00 35.91  ? 444  ARG A CA    1 
ATOM   4011 C  C     . ARG C 3  438 ? 42.613 67.564  61.362 1.00 36.76  ? 444  ARG A C     1 
ATOM   4012 O  O     . ARG C 3  438 ? 41.590 66.894  61.250 1.00 39.99  ? 444  ARG A O     1 
ATOM   4013 C  CB    . ARG C 3  438 ? 41.514 69.682  62.093 1.00 38.09  ? 444  ARG A CB    1 
ATOM   4014 C  CG    . ARG C 3  438 ? 41.281 70.678  63.221 1.00 39.38  ? 444  ARG A CG    1 
ATOM   4015 C  CD    . ARG C 3  438 ? 40.266 71.745  62.843 1.00 42.66  ? 444  ARG A CD    1 
ATOM   4016 N  NE    . ARG C 3  438 ? 40.519 72.990  63.566 1.00 44.49  ? 444  ARG A NE    1 
ATOM   4017 C  CZ    . ARG C 3  438 ? 41.502 73.841  63.275 1.00 44.06  ? 444  ARG A CZ    1 
ATOM   4018 N  NH1   . ARG C 3  438 ? 42.325 73.595  62.267 1.00 46.24  ? 444  ARG A NH1   1 
ATOM   4019 N  NH2   . ARG C 3  438 ? 41.681 74.923  64.014 1.00 44.54  ? 444  ARG A NH2   1 
ATOM   4020 N  N     . SER C 3  439 ? 43.697 67.332  60.629 1.00 35.18  ? 445  SER A N     1 
ATOM   4021 C  CA    . SER C 3  439 ? 43.720 66.232  59.671 1.00 32.79  ? 445  SER A CA    1 
ATOM   4022 C  C     . SER C 3  439 ? 44.364 65.036  60.366 1.00 31.22  ? 445  SER A C     1 
ATOM   4023 O  O     . SER C 3  439 ? 45.024 65.188  61.389 1.00 31.45  ? 445  SER A O     1 
ATOM   4024 C  CB    . SER C 3  439 ? 44.528 66.614  58.434 1.00 31.77  ? 445  SER A CB    1 
ATOM   4025 O  OG    . SER C 3  439 ? 45.888 66.798  58.771 1.00 34.12  ? 445  SER A OG    1 
ATOM   4026 N  N     . PRO C 3  440 ? 44.172 63.827  59.829 1.00 30.64  ? 446  PRO A N     1 
ATOM   4027 C  CA    . PRO C 3  440 ? 44.771 62.647  60.464 1.00 29.10  ? 446  PRO A CA    1 
ATOM   4028 C  C     . PRO C 3  440 ? 46.270 62.810  60.744 1.00 28.37  ? 446  PRO A C     1 
ATOM   4029 O  O     . PRO C 3  440 ? 47.041 63.168  59.849 1.00 27.41  ? 446  PRO A O     1 
ATOM   4030 C  CB    . PRO C 3  440 ? 44.479 61.536  59.456 1.00 28.27  ? 446  PRO A CB    1 
ATOM   4031 C  CG    . PRO C 3  440 ? 43.143 61.952  58.904 1.00 27.91  ? 446  PRO A CG    1 
ATOM   4032 C  CD    . PRO C 3  440 ? 43.338 63.442  58.676 1.00 28.56  ? 446  PRO A CD    1 
ATOM   4033 N  N     . TYR C 3  441 ? 46.664 62.547  61.990 1.00 27.27  ? 447  TYR A N     1 
ATOM   4034 C  CA    . TYR C 3  441 ? 48.058 62.646  62.422 1.00 27.41  ? 447  TYR A CA    1 
ATOM   4035 C  C     . TYR C 3  441 ? 48.571 64.079  62.459 1.00 27.03  ? 447  TYR A C     1 
ATOM   4036 O  O     . TYR C 3  441 ? 49.732 64.321  62.774 1.00 26.64  ? 447  TYR A O     1 
ATOM   4037 C  CB    . TYR C 3  441 ? 48.949 61.799  61.514 1.00 29.57  ? 447  TYR A CB    1 
ATOM   4038 C  CG    . TYR C 3  441 ? 48.618 60.329  61.574 1.00 30.97  ? 447  TYR A CG    1 
ATOM   4039 C  CD1   . TYR C 3  441 ? 48.906 59.574  62.713 1.00 30.09  ? 447  TYR A CD1   1 
ATOM   4040 C  CD2   . TYR C 3  441 ? 47.966 59.703  60.517 1.00 30.04  ? 447  TYR A CD2   1 
ATOM   4041 C  CE1   . TYR C 3  441 ? 48.546 58.233  62.795 1.00 27.51  ? 447  TYR A CE1   1 
ATOM   4042 C  CE2   . TYR C 3  441 ? 47.602 58.364  60.591 1.00 30.45  ? 447  TYR A CE2   1 
ATOM   4043 C  CZ    . TYR C 3  441 ? 47.892 57.638  61.734 1.00 28.92  ? 447  TYR A CZ    1 
ATOM   4044 O  OH    . TYR C 3  441 ? 47.487 56.325  61.819 1.00 32.07  ? 447  TYR A OH    1 
ATOM   4045 N  N     . GLY C 3  442 ? 47.693 65.026  62.147 1.00 27.86  ? 448  GLY A N     1 
ATOM   4046 C  CA    . GLY C 3  442 ? 48.074 66.424  62.154 1.00 29.85  ? 448  GLY A CA    1 
ATOM   4047 C  C     . GLY C 3  442 ? 48.644 66.905  63.477 1.00 31.71  ? 448  GLY A C     1 
ATOM   4048 O  O     . GLY C 3  442 ? 49.687 67.563  63.502 1.00 30.44  ? 448  GLY A O     1 
ATOM   4049 N  N     . GLU C 3  443 ? 47.976 66.581  64.581 1.00 31.52  ? 449  GLU A N     1 
ATOM   4050 C  CA    . GLU C 3  443 ? 48.451 67.023  65.885 1.00 32.96  ? 449  GLU A CA    1 
ATOM   4051 C  C     . GLU C 3  443 ? 49.884 66.601  66.140 1.00 30.52  ? 449  GLU A C     1 
ATOM   4052 O  O     . GLU C 3  443 ? 50.708 67.411  66.550 1.00 29.83  ? 449  GLU A O     1 
ATOM   4053 C  CB    . GLU C 3  443 ? 47.549 66.506  67.006 1.00 36.11  ? 449  GLU A CB    1 
ATOM   4054 C  CG    . GLU C 3  443 ? 46.172 67.136  66.997 1.00 44.94  ? 449  GLU A CG    1 
ATOM   4055 C  CD    . GLU C 3  443 ? 45.473 67.054  68.343 1.00 50.42  ? 449  GLU A CD    1 
ATOM   4056 O  OE1   . GLU C 3  443 ? 45.251 65.925  68.843 1.00 52.78  ? 449  GLU A OE1   1 
ATOM   4057 O  OE2   . GLU C 3  443 ? 45.144 68.129  68.900 1.00 52.30  ? 449  GLU A OE2   1 
ATOM   4058 N  N     . GLN C 3  444 ? 50.182 65.336  65.887 1.00 29.21  ? 450  GLN A N     1 
ATOM   4059 C  CA    . GLN C 3  444 ? 51.525 64.828  66.096 1.00 28.06  ? 450  GLN A CA    1 
ATOM   4060 C  C     . GLN C 3  444 ? 52.518 65.529  65.173 1.00 28.41  ? 450  GLN A C     1 
ATOM   4061 O  O     . GLN C 3  444 ? 53.618 65.888  65.595 1.00 26.11  ? 450  GLN A O     1 
ATOM   4062 C  CB    . GLN C 3  444 ? 51.551 63.314  65.858 1.00 29.39  ? 450  GLN A CB    1 
ATOM   4063 C  CG    . GLN C 3  444 ? 50.927 62.495  66.991 1.00 31.55  ? 450  GLN A CG    1 
ATOM   4064 C  CD    . GLN C 3  444 ? 50.594 61.069  66.574 1.00 32.34  ? 450  GLN A CD    1 
ATOM   4065 O  OE1   . GLN C 3  444 ? 49.601 60.829  65.887 1.00 33.28  ? 450  GLN A OE1   1 
ATOM   4066 N  NE2   . GLN C 3  444 ? 51.432 60.119  66.978 1.00 31.28  ? 450  GLN A NE2   1 
ATOM   4067 N  N     . CYS C 3  445 ? 52.132 65.731  63.916 1.00 27.07  ? 451  CYS A N     1 
ATOM   4068 C  CA    . CYS C 3  445 ? 53.018 66.393  62.964 1.00 27.12  ? 451  CYS A CA    1 
ATOM   4069 C  C     . CYS C 3  445 ? 53.312 67.826  63.389 1.00 27.77  ? 451  CYS A C     1 
ATOM   4070 O  O     . CYS C 3  445 ? 54.465 68.259  63.424 1.00 27.28  ? 451  CYS A O     1 
ATOM   4071 C  CB    . CYS C 3  445 ? 52.391 66.415  61.569 1.00 26.65  ? 451  CYS A CB    1 
ATOM   4072 S  SG    . CYS C 3  445 ? 52.281 64.813  60.748 1.00 28.74  ? 451  CYS A SG    1 
ATOM   4073 N  N     . ARG C 3  446 ? 52.248 68.549  63.714 1.00 26.26  ? 452  ARG A N     1 
ATOM   4074 C  CA    . ARG C 3  446 ? 52.324 69.941  64.107 1.00 25.53  ? 452  ARG A CA    1 
ATOM   4075 C  C     . ARG C 3  446 ? 53.034 70.174  65.442 1.00 27.29  ? 452  ARG A C     1 
ATOM   4076 O  O     . ARG C 3  446 ? 53.782 71.145  65.590 1.00 27.14  ? 452  ARG A O     1 
ATOM   4077 C  CB    . ARG C 3  446 ? 50.913 70.507  64.170 1.00 26.73  ? 452  ARG A CB    1 
ATOM   4078 C  CG    . ARG C 3  446 ? 50.759 71.875  63.569 1.00 31.07  ? 452  ARG A CG    1 
ATOM   4079 C  CD    . ARG C 3  446 ? 50.636 71.878  62.049 1.00 28.61  ? 452  ARG A CD    1 
ATOM   4080 N  NE    . ARG C 3  446 ? 50.610 73.268  61.626 1.00 29.96  ? 452  ARG A NE    1 
ATOM   4081 C  CZ    . ARG C 3  446 ? 50.291 73.709  60.420 1.00 24.87  ? 452  ARG A CZ    1 
ATOM   4082 N  NH1   . ARG C 3  446 ? 49.955 72.876  59.455 1.00 24.83  ? 452  ARG A NH1   1 
ATOM   4083 N  NH2   . ARG C 3  446 ? 50.307 75.009  60.203 1.00 25.63  ? 452  ARG A NH2   1 
ATOM   4084 N  N     . ALA C 3  447 ? 52.809 69.295  66.416 1.00 25.18  ? 453  ALA A N     1 
ATOM   4085 C  CA    . ALA C 3  447 ? 53.444 69.450  67.726 1.00 25.32  ? 453  ALA A CA    1 
ATOM   4086 C  C     . ALA C 3  447 ? 54.948 69.209  67.670 1.00 24.07  ? 453  ALA A C     1 
ATOM   4087 O  O     . ALA C 3  447 ? 55.691 69.676  68.533 1.00 25.45  ? 453  ALA A O     1 
ATOM   4088 C  CB    . ALA C 3  447 ? 52.810 68.500  68.744 1.00 26.20  ? 453  ALA A CB    1 
ATOM   4089 N  N     . ALA C 3  448 ? 55.397 68.476  66.661 1.00 21.26  ? 454  ALA A N     1 
ATOM   4090 C  CA    . ALA C 3  448 ? 56.816 68.188  66.520 1.00 19.48  ? 454  ALA A CA    1 
ATOM   4091 C  C     . ALA C 3  448 ? 57.613 69.428  66.114 1.00 18.99  ? 454  ALA A C     1 
ATOM   4092 O  O     . ALA C 3  448 ? 58.842 69.433  66.196 1.00 19.45  ? 454  ALA A O     1 
ATOM   4093 C  CB    . ALA C 3  448 ? 57.021 67.069  65.510 1.00 17.27  ? 454  ALA A CB    1 
ATOM   4094 N  N     . PHE C 3  449 ? 56.920 70.468  65.653 1.00 18.47  ? 455  PHE A N     1 
ATOM   4095 C  CA    . PHE C 3  449 ? 57.583 71.720  65.284 1.00 18.98  ? 455  PHE A CA    1 
ATOM   4096 C  C     . PHE C 3  449 ? 57.215 72.705  66.378 1.00 19.79  ? 455  PHE A C     1 
ATOM   4097 O  O     . PHE C 3  449 ? 56.059 73.108  66.480 1.00 20.36  ? 455  PHE A O     1 
ATOM   4098 C  CB    . PHE C 3  449 ? 57.085 72.264  63.934 1.00 18.96  ? 455  PHE A CB    1 
ATOM   4099 C  CG    . PHE C 3  449 ? 57.512 71.442  62.740 1.00 17.83  ? 455  PHE A CG    1 
ATOM   4100 C  CD1   . PHE C 3  449 ? 56.801 70.314  62.365 1.00 16.62  ? 455  PHE A CD1   1 
ATOM   4101 C  CD2   . PHE C 3  449 ? 58.647 71.788  62.018 1.00 16.83  ? 455  PHE A CD2   1 
ATOM   4102 C  CE1   . PHE C 3  449 ? 57.221 69.533  61.282 1.00 19.57  ? 455  PHE A CE1   1 
ATOM   4103 C  CE2   . PHE C 3  449 ? 59.075 71.021  60.942 1.00 18.80  ? 455  PHE A CE2   1 
ATOM   4104 C  CZ    . PHE C 3  449 ? 58.359 69.887  60.572 1.00 17.38  ? 455  PHE A CZ    1 
ATOM   4105 N  N     . GLY C 3  450 ? 58.178 73.082  67.213 1.00 19.74  ? 456  GLY A N     1 
ATOM   4106 C  CA    . GLY C 3  450 ? 57.854 74.013  68.276 1.00 20.65  ? 456  GLY A CA    1 
ATOM   4107 C  C     . GLY C 3  450 ? 59.025 74.542  69.072 1.00 20.20  ? 456  GLY A C     1 
ATOM   4108 O  O     . GLY C 3  450 ? 60.043 73.870  69.229 1.00 19.99  ? 456  GLY A O     1 
ATOM   4109 N  N     . ALA C 3  451 ? 58.864 75.760  69.578 1.00 20.36  ? 457  ALA A N     1 
ATOM   4110 C  CA    . ALA C 3  451 ? 59.892 76.415  70.372 1.00 20.90  ? 457  ALA A CA    1 
ATOM   4111 C  C     . ALA C 3  451 ? 60.248 75.588  71.602 1.00 22.24  ? 457  ALA A C     1 
ATOM   4112 O  O     . ALA C 3  451 ? 61.377 75.652  72.090 1.00 22.83  ? 457  ALA A O     1 
ATOM   4113 C  CB    . ALA C 3  451 ? 59.413 77.790  70.804 1.00 20.19  ? 457  ALA A CB    1 
ATOM   4114 N  N     . GLU C 3  452 ? 59.289 74.814  72.105 1.00 21.90  ? 458  GLU A N     1 
ATOM   4115 C  CA    . GLU C 3  452 ? 59.540 74.005  73.289 1.00 24.14  ? 458  GLU A CA    1 
ATOM   4116 C  C     . GLU C 3  452 ? 60.712 73.058  73.044 1.00 24.00  ? 458  GLU A C     1 
ATOM   4117 O  O     . GLU C 3  452 ? 61.472 72.748  73.959 1.00 25.84  ? 458  GLU A O     1 
ATOM   4118 C  CB    . GLU C 3  452 ? 58.292 73.202  73.673 1.00 22.35  ? 458  GLU A CB    1 
ATOM   4119 C  CG    . GLU C 3  452 ? 58.012 72.011  72.777 1.00 26.12  ? 458  GLU A CG    1 
ATOM   4120 C  CD    . GLU C 3  452 ? 56.821 71.204  73.252 1.00 28.22  ? 458  GLU A CD    1 
ATOM   4121 O  OE1   . GLU C 3  452 ? 56.763 70.890  74.460 1.00 30.15  ? 458  GLU A OE1   1 
ATOM   4122 O  OE2   . GLU C 3  452 ? 55.945 70.878  72.424 1.00 28.04  ? 458  GLU A OE2   1 
ATOM   4123 N  N     . HIS C 3  453 ? 60.868 72.623  71.797 1.00 23.67  ? 459  HIS A N     1 
ATOM   4124 C  CA    . HIS C 3  453 ? 61.937 71.703  71.444 1.00 22.95  ? 459  HIS A CA    1 
ATOM   4125 C  C     . HIS C 3  453 ? 63.318 72.355  71.373 1.00 22.14  ? 459  HIS A C     1 
ATOM   4126 O  O     . HIS C 3  453 ? 64.277 71.725  70.957 1.00 24.51  ? 459  HIS A O     1 
ATOM   4127 C  CB    . HIS C 3  453 ? 61.594 70.992  70.133 1.00 21.31  ? 459  HIS A CB    1 
ATOM   4128 C  CG    . HIS C 3  453 ? 60.237 70.355  70.144 1.00 24.31  ? 459  HIS A CG    1 
ATOM   4129 N  ND1   . HIS C 3  453 ? 59.867 69.412  71.081 1.00 22.77  ? 459  HIS A ND1   1 
ATOM   4130 C  CD2   . HIS C 3  453 ? 59.140 70.577  69.380 1.00 22.14  ? 459  HIS A CD2   1 
ATOM   4131 C  CE1   . HIS C 3  453 ? 58.600 69.084  70.898 1.00 23.66  ? 459  HIS A CE1   1 
ATOM   4132 N  NE2   . HIS C 3  453 ? 58.135 69.778  69.873 1.00 25.98  ? 459  HIS A NE2   1 
ATOM   4133 N  N     . HIS C 3  454 ? 63.422 73.616  71.773 1.00 21.35  ? 460  HIS A N     1 
ATOM   4134 C  CA    . HIS C 3  454 ? 64.723 74.283  71.802 1.00 21.72  ? 460  HIS A CA    1 
ATOM   4135 C  C     . HIS C 3  454 ? 64.999 74.690  73.239 1.00 21.86  ? 460  HIS A C     1 
ATOM   4136 O  O     . HIS C 3  454 ? 64.199 75.392  73.857 1.00 22.83  ? 460  HIS A O     1 
ATOM   4137 C  CB    . HIS C 3  454 ? 64.752 75.543  70.945 1.00 21.75  ? 460  HIS A CB    1 
ATOM   4138 C  CG    . HIS C 3  454 ? 65.981 76.376  71.158 1.00 22.82  ? 460  HIS A CG    1 
ATOM   4139 N  ND1   . HIS C 3  454 ? 67.213 76.035  70.641 1.00 24.37  ? 460  HIS A ND1   1 
ATOM   4140 C  CD2   . HIS C 3  454 ? 66.173 77.518  71.860 1.00 21.76  ? 460  HIS A CD2   1 
ATOM   4141 C  CE1   . HIS C 3  454 ? 68.110 76.931  71.012 1.00 20.28  ? 460  HIS A CE1   1 
ATOM   4142 N  NE2   . HIS C 3  454 ? 67.505 77.841  71.754 1.00 22.40  ? 460  HIS A NE2   1 
ATOM   4143 N  N     . LEU C 3  455 ? 66.132 74.250  73.763 1.00 22.46  ? 461  LEU A N     1 
ATOM   4144 C  CA    . LEU C 3  455 ? 66.520 74.564  75.125 1.00 22.82  ? 461  LEU A CA    1 
ATOM   4145 C  C     . LEU C 3  455 ? 67.468 75.761  75.097 1.00 23.04  ? 461  LEU A C     1 
ATOM   4146 O  O     . LEU C 3  455 ? 68.422 75.790  74.313 1.00 22.64  ? 461  LEU A O     1 
ATOM   4147 C  CB    . LEU C 3  455 ? 67.210 73.348  75.757 1.00 24.17  ? 461  LEU A CB    1 
ATOM   4148 C  CG    . LEU C 3  455 ? 66.442 72.022  75.701 1.00 25.34  ? 461  LEU A CG    1 
ATOM   4149 C  CD1   . LEU C 3  455 ? 67.291 70.928  76.354 1.00 25.24  ? 461  LEU A CD1   1 
ATOM   4150 C  CD2   . LEU C 3  455 ? 65.088 72.149  76.407 1.00 24.38  ? 461  LEU A CD2   1 
ATOM   4151 N  N     . ASP C 3  456 ? 67.204 76.753  75.944 1.00 22.75  ? 462  ASP A N     1 
ATOM   4152 C  CA    . ASP C 3  456 ? 68.044 77.942  75.972 1.00 21.24  ? 462  ASP A CA    1 
ATOM   4153 C  C     . ASP C 3  456 ? 69.504 77.554  76.131 1.00 23.36  ? 462  ASP A C     1 
ATOM   4154 O  O     . ASP C 3  456 ? 69.833 76.628  76.863 1.00 25.36  ? 462  ASP A O     1 
ATOM   4155 C  CB    . ASP C 3  456 ? 67.645 78.871  77.111 1.00 20.75  ? 462  ASP A CB    1 
ATOM   4156 C  CG    . ASP C 3  456 ? 68.374 80.191  77.047 1.00 21.98  ? 462  ASP A CG    1 
ATOM   4157 O  OD1   . ASP C 3  456 ? 68.011 81.027  76.201 1.00 23.68  ? 462  ASP A OD1   1 
ATOM   4158 O  OD2   . ASP C 3  456 ? 69.323 80.387  77.826 1.00 24.75  ? 462  ASP A OD2   1 
ATOM   4159 N  N     . GLY C 3  457 ? 70.378 78.280  75.450 1.00 24.30  ? 463  GLY A N     1 
ATOM   4160 C  CA    . GLY C 3  457 ? 71.791 77.974  75.517 1.00 25.20  ? 463  GLY A CA    1 
ATOM   4161 C  C     . GLY C 3  457 ? 72.429 78.214  76.866 1.00 26.14  ? 463  GLY A C     1 
ATOM   4162 O  O     . GLY C 3  457 ? 73.500 77.682  77.141 1.00 26.42  ? 463  GLY A O     1 
ATOM   4163 N  N     . ILE C 3  458 ? 71.781 79.009  77.712 1.00 26.59  ? 464  ILE A N     1 
ATOM   4164 C  CA    . ILE C 3  458 ? 72.338 79.306  79.027 1.00 24.90  ? 464  ILE A CA    1 
ATOM   4165 C  C     . ILE C 3  458 ? 71.641 78.544  80.145 1.00 23.97  ? 464  ILE A C     1 
ATOM   4166 O  O     . ILE C 3  458 ? 72.263 77.771  80.868 1.00 26.87  ? 464  ILE A O     1 
ATOM   4167 C  CB    . ILE C 3  458 ? 72.239 80.817  79.360 1.00 25.60  ? 464  ILE A CB    1 
ATOM   4168 C  CG1   . ILE C 3  458 ? 72.952 81.656  78.291 1.00 25.73  ? 464  ILE A CG1   1 
ATOM   4169 C  CG2   . ILE C 3  458 ? 72.818 81.080  80.745 1.00 23.43  ? 464  ILE A CG2   1 
ATOM   4170 C  CD1   . ILE C 3  458 ? 74.419 81.367  78.151 1.00 30.47  ? 464  ILE A CD1   1 
ATOM   4171 N  N     . THR C 3  459 ? 70.339 78.758  80.267 1.00 22.53  ? 465  THR A N     1 
ATOM   4172 C  CA    . THR C 3  459 ? 69.544 78.148  81.319 1.00 21.39  ? 465  THR A CA    1 
ATOM   4173 C  C     . THR C 3  459 ? 68.994 76.760  81.012 1.00 22.57  ? 465  THR A C     1 
ATOM   4174 O  O     . THR C 3  459 ? 68.447 76.106  81.893 1.00 23.72  ? 465  THR A O     1 
ATOM   4175 C  CB    . THR C 3  459 ? 68.351 79.032  81.652 1.00 21.03  ? 465  THR A CB    1 
ATOM   4176 O  OG1   . THR C 3  459 ? 67.416 78.959  80.572 1.00 20.93  ? 465  THR A OG1   1 
ATOM   4177 C  CG2   . THR C 3  459 ? 68.783 80.482  81.834 1.00 18.21  ? 465  THR A CG2   1 
ATOM   4178 N  N     . GLY C 3  460 ? 69.111 76.316  79.768 1.00 23.95  ? 466  GLY A N     1 
ATOM   4179 C  CA    . GLY C 3  460 ? 68.591 75.008  79.416 1.00 23.32  ? 466  GLY A CA    1 
ATOM   4180 C  C     . GLY C 3  460 ? 67.070 74.902  79.460 1.00 25.59  ? 466  GLY A C     1 
ATOM   4181 O  O     . GLY C 3  460 ? 66.519 73.816  79.282 1.00 25.93  ? 466  GLY A O     1 
ATOM   4182 N  N     . LYS C 3  461 ? 66.372 76.012  79.687 1.00 24.12  ? 467  LYS A N     1 
ATOM   4183 C  CA    . LYS C 3  461 ? 64.916 75.947  79.740 1.00 24.49  ? 467  LYS A CA    1 
ATOM   4184 C  C     . LYS C 3  461 ? 64.322 76.054  78.343 1.00 24.24  ? 467  LYS A C     1 
ATOM   4185 O  O     . LYS C 3  461 ? 64.825 76.787  77.491 1.00 25.05  ? 467  LYS A O     1 
ATOM   4186 C  CB    . LYS C 3  461 ? 64.348 77.066  80.624 1.00 27.64  ? 467  LYS A CB    1 
ATOM   4187 C  CG    . LYS C 3  461 ? 65.008 77.171  81.995 1.00 27.69  ? 467  LYS A CG    1 
ATOM   4188 C  CD    . LYS C 3  461 ? 65.057 75.834  82.722 1.00 28.60  ? 467  LYS A CD    1 
ATOM   4189 C  CE    . LYS C 3  461 ? 63.728 75.478  83.363 1.00 31.11  ? 467  LYS A CE    1 
ATOM   4190 N  NZ    . LYS C 3  461 ? 62.677 75.215  82.361 1.00 35.72  ? 467  LYS A NZ    1 
ATOM   4191 N  N     . PRO C 3  462 ? 63.246 75.311  78.082 1.00 24.25  ? 468  PRO A N     1 
ATOM   4192 C  CA    . PRO C 3  462 ? 62.649 75.393  76.746 1.00 23.63  ? 468  PRO A CA    1 
ATOM   4193 C  C     . PRO C 3  462 ? 62.096 76.775  76.419 1.00 24.82  ? 468  PRO A C     1 
ATOM   4194 O  O     . PRO C 3  462 ? 61.712 77.532  77.312 1.00 23.57  ? 468  PRO A O     1 
ATOM   4195 C  CB    . PRO C 3  462 ? 61.558 74.315  76.776 1.00 24.22  ? 468  PRO A CB    1 
ATOM   4196 C  CG    . PRO C 3  462 ? 61.265 74.130  78.252 1.00 25.80  ? 468  PRO A CG    1 
ATOM   4197 C  CD    . PRO C 3  462 ? 62.601 74.274  78.911 1.00 22.45  ? 468  PRO A CD    1 
ATOM   4198 N  N     . TRP C 3  463 ? 62.073 77.105  75.132 1.00 22.72  ? 469  TRP A N     1 
ATOM   4199 C  CA    . TRP C 3  463 ? 61.546 78.386  74.687 1.00 22.20  ? 469  TRP A CA    1 
ATOM   4200 C  C     . TRP C 3  463 ? 60.033 78.296  74.488 1.00 21.71  ? 469  TRP A C     1 
ATOM   4201 O  O     . TRP C 3  463 ? 59.466 77.210  74.518 1.00 21.67  ? 469  TRP A O     1 
ATOM   4202 C  CB    . TRP C 3  463 ? 62.237 78.803  73.388 1.00 18.53  ? 469  TRP A CB    1 
ATOM   4203 C  CG    . TRP C 3  463 ? 63.518 79.527  73.628 1.00 20.93  ? 469  TRP A CG    1 
ATOM   4204 C  CD1   . TRP C 3  463 ? 64.451 79.260  74.600 1.00 18.53  ? 469  TRP A CD1   1 
ATOM   4205 C  CD2   . TRP C 3  463 ? 64.027 80.636  72.879 1.00 18.86  ? 469  TRP A CD2   1 
ATOM   4206 N  NE1   . TRP C 3  463 ? 65.503 80.136  74.494 1.00 18.48  ? 469  TRP A NE1   1 
ATOM   4207 C  CE2   . TRP C 3  463 ? 65.270 80.989  73.448 1.00 17.31  ? 469  TRP A CE2   1 
ATOM   4208 C  CE3   . TRP C 3  463 ? 63.551 81.365  71.779 1.00 17.33  ? 469  TRP A CE3   1 
ATOM   4209 C  CZ2   . TRP C 3  463 ? 66.046 82.042  72.954 1.00 18.97  ? 469  TRP A CZ2   1 
ATOM   4210 C  CZ3   . TRP C 3  463 ? 64.322 82.413  71.287 1.00 16.49  ? 469  TRP A CZ3   1 
ATOM   4211 C  CH2   . TRP C 3  463 ? 65.555 82.741  71.875 1.00 19.23  ? 469  TRP A CH2   1 
ATOM   4212 N  N     . VAL C 3  464 ? 59.386 79.441  74.297 1.00 21.32  ? 470  VAL A N     1 
ATOM   4213 C  CA    . VAL C 3  464 ? 57.944 79.486  74.092 1.00 22.58  ? 470  VAL A CA    1 
ATOM   4214 C  C     . VAL C 3  464 ? 57.666 79.982  72.673 1.00 22.93  ? 470  VAL A C     1 
ATOM   4215 O  O     . VAL C 3  464 ? 58.486 80.676  72.070 1.00 23.62  ? 470  VAL A O     1 
ATOM   4216 C  CB    . VAL C 3  464 ? 57.266 80.413  75.128 1.00 24.51  ? 470  VAL A CB    1 
ATOM   4217 C  CG1   . VAL C 3  464 ? 55.772 80.499  74.854 1.00 27.74  ? 470  VAL A CG1   1 
ATOM   4218 C  CG2   . VAL C 3  464 ? 57.499 79.859  76.544 1.00 24.52  ? 470  VAL A CG2   1 
ATOM   4219 N  N     . GLN C 3  465 ? 56.508 79.624  72.141 1.00 20.35  ? 471  GLN A N     1 
ATOM   4220 C  CA    . GLN C 3  465 ? 56.166 79.998  70.782 1.00 20.33  ? 471  GLN A CA    1 
ATOM   4221 C  C     . GLN C 3  465 ? 55.036 81.019  70.667 1.00 19.94  ? 471  GLN A C     1 
ATOM   4222 O  O     . GLN C 3  465 ? 54.040 80.955  71.388 1.00 20.01  ? 471  GLN A O     1 
ATOM   4223 C  CB    . GLN C 3  465 ? 55.795 78.731  70.007 1.00 18.79  ? 471  GLN A CB    1 
ATOM   4224 C  CG    . GLN C 3  465 ? 55.673 78.902  68.513 1.00 15.78  ? 471  GLN A CG    1 
ATOM   4225 C  CD    . GLN C 3  465 ? 55.652 77.560  67.816 1.00 19.59  ? 471  GLN A CD    1 
ATOM   4226 O  OE1   . GLN C 3  465 ? 56.423 76.662  68.170 1.00 19.77  ? 471  GLN A OE1   1 
ATOM   4227 N  NE2   . GLN C 3  465 ? 54.784 77.413  66.819 1.00 14.91  ? 471  GLN A NE2   1 
ATOM   4228 N  N     . ALA C 3  466 ? 55.207 81.959  69.749 1.00 19.21  ? 472  ALA A N     1 
ATOM   4229 C  CA    . ALA C 3  466 ? 54.203 82.980  69.491 1.00 21.06  ? 472  ALA A CA    1 
ATOM   4230 C  C     . ALA C 3  466 ? 53.758 82.818  68.037 1.00 21.74  ? 472  ALA A C     1 
ATOM   4231 O  O     . ALA C 3  466 ? 54.556 82.963  67.109 1.00 20.68  ? 472  ALA A O     1 
ATOM   4232 C  CB    . ALA C 3  466 ? 54.784 84.369  69.714 1.00 19.84  ? 472  ALA A CB    1 
ATOM   4233 N  N     . GLY C 3  467 ? 52.486 82.487  67.847 1.00 22.59  ? 473  GLY A N     1 
ATOM   4234 C  CA    . GLY C 3  467 ? 51.966 82.315  66.506 1.00 22.43  ? 473  GLY A CA    1 
ATOM   4235 C  C     . GLY C 3  467 ? 51.016 83.447  66.203 1.00 24.63  ? 473  GLY A C     1 
ATOM   4236 O  O     . GLY C 3  467 ? 50.069 83.669  66.962 1.00 26.39  ? 473  GLY A O     1 
ATOM   4237 N  N     . ILE C 3  468 ? 51.270 84.181  65.119 1.00 22.88  ? 474  ILE A N     1 
ATOM   4238 C  CA    . ILE C 3  468 ? 50.404 85.293  64.737 1.00 21.05  ? 474  ILE A CA    1 
ATOM   4239 C  C     . ILE C 3  468 ? 49.961 85.139  63.287 1.00 22.38  ? 474  ILE A C     1 
ATOM   4240 O  O     . ILE C 3  468 ? 50.783 84.920  62.393 1.00 21.48  ? 474  ILE A O     1 
ATOM   4241 C  CB    . ILE C 3  468 ? 51.110 86.667  64.876 1.00 20.80  ? 474  ILE A CB    1 
ATOM   4242 C  CG1   . ILE C 3  468 ? 51.643 86.866  66.302 1.00 19.44  ? 474  ILE A CG1   1 
ATOM   4243 C  CG2   . ILE C 3  468 ? 50.123 87.782  64.537 1.00 17.84  ? 474  ILE A CG2   1 
ATOM   4244 C  CD1   . ILE C 3  468 ? 53.029 86.329  66.520 1.00 15.65  ? 474  ILE A CD1   1 
ATOM   4245 N  N     . ASP C 3  469 ? 48.661 85.263  63.053 1.00 24.03  ? 475  ASP A N     1 
ATOM   4246 C  CA    . ASP C 3  469 ? 48.119 85.116  61.707 1.00 25.88  ? 475  ASP A CA    1 
ATOM   4247 C  C     . ASP C 3  469 ? 47.177 86.274  61.381 1.00 25.78  ? 475  ASP A C     1 
ATOM   4248 O  O     . ASP C 3  469 ? 46.353 86.666  62.210 1.00 26.09  ? 475  ASP A O     1 
ATOM   4249 C  CB    . ASP C 3  469 ? 47.376 83.779  61.599 1.00 28.69  ? 475  ASP A CB    1 
ATOM   4250 C  CG    . ASP C 3  469 ? 46.986 83.437  60.173 1.00 33.06  ? 475  ASP A CG    1 
ATOM   4251 O  OD1   . ASP C 3  469 ? 46.287 84.251  59.535 1.00 37.46  ? 475  ASP A OD1   1 
ATOM   4252 O  OD2   . ASP C 3  469 ? 47.372 82.351  59.686 1.00 36.71  ? 475  ASP A OD2   1 
ATOM   4253 N  N     . ALA C 3  470 ? 47.317 86.827  60.181 1.00 23.85  ? 476  ALA A N     1 
ATOM   4254 C  CA    . ALA C 3  470 ? 46.475 87.932  59.742 1.00 26.16  ? 476  ALA A CA    1 
ATOM   4255 C  C     . ALA C 3  470 ? 45.031 87.450  59.589 1.00 26.15  ? 476  ALA A C     1 
ATOM   4256 O  O     . ALA C 3  470 ? 44.773 86.442  58.934 1.00 26.83  ? 476  ALA A O     1 
ATOM   4257 C  CB    . ALA C 3  470 ? 46.994 88.488  58.411 1.00 24.47  ? 476  ALA A CB    1 
ATOM   4258 N  N     . SER C 3  471 ? 44.092 88.183  60.179 1.00 25.98  ? 477  SER A N     1 
ATOM   4259 C  CA    . SER C 3  471 ? 42.675 87.808  60.129 1.00 26.21  ? 477  SER A CA    1 
ATOM   4260 C  C     . SER C 3  471 ? 41.975 88.071  58.794 1.00 24.62  ? 477  SER A C     1 
ATOM   4261 O  O     . SER C 3  471 ? 42.000 89.189  58.292 1.00 25.97  ? 477  SER A O     1 
ATOM   4262 C  CB    . SER C 3  471 ? 41.921 88.543  61.236 1.00 25.26  ? 477  SER A CB    1 
ATOM   4263 O  OG    . SER C 3  471 ? 42.588 88.399  62.471 1.00 23.33  ? 477  SER A OG    1 
ATOM   4264 N  N     . GLY C 3  472 ? 41.349 87.030  58.245 1.00 25.52  ? 478  GLY A N     1 
ATOM   4265 C  CA    . GLY C 3  472 ? 40.617 87.123  56.985 1.00 24.82  ? 478  GLY A CA    1 
ATOM   4266 C  C     . GLY C 3  472 ? 41.285 87.988  55.938 1.00 26.46  ? 478  GLY A C     1 
ATOM   4267 O  O     . GLY C 3  472 ? 40.628 88.731  55.212 1.00 26.71  ? 478  GLY A O     1 
ATOM   4268 N  N     . LEU C 3  473 ? 42.601 87.865  55.852 1.00 27.25  ? 479  LEU A N     1 
ATOM   4269 C  CA    . LEU C 3  473 ? 43.414 88.659  54.943 1.00 28.77  ? 479  LEU A CA    1 
ATOM   4270 C  C     . LEU C 3  473 ? 42.862 89.011  53.565 1.00 29.22  ? 479  LEU A C     1 
ATOM   4271 O  O     . LEU C 3  473 ? 42.606 90.181  53.278 1.00 29.08  ? 479  LEU A O     1 
ATOM   4272 C  CB    . LEU C 3  473 ? 44.786 88.007  54.765 1.00 29.78  ? 479  LEU A CB    1 
ATOM   4273 C  CG    . LEU C 3  473 ? 45.731 88.773  53.838 1.00 32.01  ? 479  LEU A CG    1 
ATOM   4274 C  CD1   . LEU C 3  473 ? 46.088 90.113  54.457 1.00 30.01  ? 479  LEU A CD1   1 
ATOM   4275 C  CD2   . LEU C 3  473 ? 46.978 87.940  53.585 1.00 33.72  ? 479  LEU A CD2   1 
ATOM   4276 N  N     . GLU C 3  474 ? 42.670 88.022  52.703 1.00 29.30  ? 480  GLU A N     1 
ATOM   4277 C  CA    . GLU C 3  474 ? 42.220 88.360  51.367 1.00 30.14  ? 480  GLU A CA    1 
ATOM   4278 C  C     . GLU C 3  474 ? 40.801 88.891  51.231 1.00 28.79  ? 480  GLU A C     1 
ATOM   4279 O  O     . GLU C 3  474 ? 40.498 89.573  50.255 1.00 28.11  ? 480  GLU A O     1 
ATOM   4280 C  CB    . GLU C 3  474 ? 42.528 87.208  50.399 1.00 31.64  ? 480  GLU A CB    1 
ATOM   4281 C  CG    . GLU C 3  474 ? 43.958 87.375  49.821 1.00 32.32  ? 480  GLU A CG    1 
ATOM   4282 C  CD    . GLU C 3  474 ? 44.552 86.111  49.210 1.00 32.62  ? 480  GLU A CD    1 
ATOM   4283 O  OE1   . GLU C 3  474 ? 43.937 85.548  48.281 1.00 32.08  ? 480  GLU A OE1   1 
ATOM   4284 O  OE2   . GLU C 3  474 ? 45.644 85.688  49.657 1.00 33.09  ? 480  GLU A OE2   1 
ATOM   4285 N  N     . LEU C 3  475 ? 39.941 88.614  52.205 1.00 27.16  ? 481  LEU A N     1 
ATOM   4286 C  CA    . LEU C 3  475 ? 38.594 89.161  52.151 1.00 26.82  ? 481  LEU A CA    1 
ATOM   4287 C  C     . LEU C 3  475 ? 38.692 90.642  52.519 1.00 27.05  ? 481  LEU A C     1 
ATOM   4288 O  O     . LEU C 3  475 ? 37.935 91.462  52.003 1.00 28.13  ? 481  LEU A O     1 
ATOM   4289 C  CB    . LEU C 3  475 ? 37.645 88.439  53.114 1.00 25.13  ? 481  LEU A CB    1 
ATOM   4290 C  CG    . LEU C 3  475 ? 37.108 87.080  52.645 1.00 26.31  ? 481  LEU A CG    1 
ATOM   4291 C  CD1   . LEU C 3  475 ? 36.024 86.601  53.594 1.00 25.66  ? 481  LEU A CD1   1 
ATOM   4292 C  CD2   . LEU C 3  475 ? 36.533 87.205  51.238 1.00 26.22  ? 481  LEU A CD2   1 
ATOM   4293 N  N     . ARG C 3  476 ? 39.622 90.992  53.410 1.00 25.19  ? 482  ARG A N     1 
ATOM   4294 C  CA    . ARG C 3  476 ? 39.789 92.393  53.775 1.00 24.34  ? 482  ARG A CA    1 
ATOM   4295 C  C     . ARG C 3  476 ? 40.420 93.119  52.592 1.00 24.67  ? 482  ARG A C     1 
ATOM   4296 O  O     . ARG C 3  476 ? 40.186 94.311  52.391 1.00 25.62  ? 482  ARG A O     1 
ATOM   4297 C  CB    . ARG C 3  476 ? 40.641 92.542  55.040 1.00 21.53  ? 482  ARG A CB    1 
ATOM   4298 C  CG    . ARG C 3  476 ? 39.928 91.997  56.280 1.00 22.59  ? 482  ARG A CG    1 
ATOM   4299 C  CD    . ARG C 3  476 ? 40.590 92.396  57.597 1.00 21.50  ? 482  ARG A CD    1 
ATOM   4300 N  NE    . ARG C 3  476 ? 40.049 91.618  58.712 1.00 20.68  ? 482  ARG A NE    1 
ATOM   4301 C  CZ    . ARG C 3  476 ? 39.993 92.047  59.971 1.00 20.42  ? 482  ARG A CZ    1 
ATOM   4302 N  NH1   . ARG C 3  476 ? 40.440 93.255  60.288 1.00 20.56  ? 482  ARG A NH1   1 
ATOM   4303 N  NH2   . ARG C 3  476 ? 39.498 91.268  60.917 1.00 15.82  ? 482  ARG A NH2   1 
ATOM   4304 N  N     . CYS C 3  477 ? 41.211 92.398  51.799 1.00 23.70  ? 483  CYS A N     1 
ATOM   4305 C  CA    . CYS C 3  477 ? 41.816 92.995  50.616 1.00 24.88  ? 483  CYS A CA    1 
ATOM   4306 C  C     . CYS C 3  477 ? 40.687 93.279  49.620 1.00 25.82  ? 483  CYS A C     1 
ATOM   4307 O  O     . CYS C 3  477 ? 40.686 94.313  48.934 1.00 25.22  ? 483  CYS A O     1 
ATOM   4308 C  CB    . CYS C 3  477 ? 42.837 92.046  49.988 1.00 23.66  ? 483  CYS A CB    1 
ATOM   4309 S  SG    . CYS C 3  477 ? 44.418 91.959  50.863 1.00 24.36  ? 483  CYS A SG    1 
ATOM   4310 N  N     . LEU C 3  478 ? 39.727 92.353  49.543 1.00 24.55  ? 484  LEU A N     1 
ATOM   4311 C  CA    . LEU C 3  478 ? 38.586 92.518  48.649 1.00 24.58  ? 484  LEU A CA    1 
ATOM   4312 C  C     . LEU C 3  478 ? 37.837 93.765  49.102 1.00 24.93  ? 484  LEU A C     1 
ATOM   4313 O  O     . LEU C 3  478 ? 37.571 94.657  48.307 1.00 23.63  ? 484  LEU A O     1 
ATOM   4314 C  CB    . LEU C 3  478 ? 37.639 91.307  48.725 1.00 25.70  ? 484  LEU A CB    1 
ATOM   4315 C  CG    . LEU C 3  478 ? 36.280 91.465  48.013 1.00 23.18  ? 484  LEU A CG    1 
ATOM   4316 C  CD1   . LEU C 3  478 ? 36.511 91.617  46.523 1.00 23.86  ? 484  LEU A CD1   1 
ATOM   4317 C  CD2   . LEU C 3  478 ? 35.378 90.260  48.284 1.00 22.71  ? 484  LEU A CD2   1 
ATOM   4318 N  N     . ALA C 3  479 ? 37.515 93.823  50.394 1.00 23.48  ? 485  ALA A N     1 
ATOM   4319 C  CA    . ALA C 3  479 ? 36.791 94.962  50.943 1.00 24.91  ? 485  ALA A CA    1 
ATOM   4320 C  C     . ALA C 3  479 ? 37.478 96.267  50.558 1.00 25.79  ? 485  ALA A C     1 
ATOM   4321 O  O     . ALA C 3  479 ? 36.818 97.241  50.191 1.00 25.58  ? 485  ALA A O     1 
ATOM   4322 C  CB    . ALA C 3  479 ? 36.700 94.846  52.458 1.00 23.45  ? 485  ALA A CB    1 
ATOM   4323 N  N     . HIS C 3  480 ? 38.807 96.278  50.639 1.00 24.44  ? 486  HIS A N     1 
ATOM   4324 C  CA    . HIS C 3  480 ? 39.588 97.463  50.302 1.00 23.29  ? 486  HIS A CA    1 
ATOM   4325 C  C     . HIS C 3  480 ? 39.363 97.900  48.866 1.00 24.35  ? 486  HIS A C     1 
ATOM   4326 O  O     . HIS C 3  480 ? 38.970 99.036  48.606 1.00 25.47  ? 486  HIS A O     1 
ATOM   4327 C  CB    . HIS C 3  480 ? 41.079 97.184  50.512 1.00 22.49  ? 486  HIS A CB    1 
ATOM   4328 C  CG    . HIS C 3  480 ? 41.982 98.165  49.835 1.00 19.14  ? 486  HIS A CG    1 
ATOM   4329 N  ND1   . HIS C 3  480 ? 42.233 99.422  50.342 1.00 20.66  ? 486  HIS A ND1   1 
ATOM   4330 C  CD2   . HIS C 3  480 ? 42.701 98.072  48.691 1.00 18.86  ? 486  HIS A CD2   1 
ATOM   4331 C  CE1   . HIS C 3  480 ? 43.071 100.059 49.543 1.00 20.50  ? 486  HIS A CE1   1 
ATOM   4332 N  NE2   . HIS C 3  480 ? 43.372 99.262  48.534 1.00 18.03  ? 486  HIS A NE2   1 
ATOM   4333 N  N     . PHE C 3  481 ? 39.613 96.993  47.930 1.00 25.57  ? 487  PHE A N     1 
ATOM   4334 C  CA    . PHE C 3  481 ? 39.471 97.317  46.522 1.00 25.49  ? 487  PHE A CA    1 
ATOM   4335 C  C     . PHE C 3  481 ? 38.054 97.609  46.059 1.00 26.49  ? 487  PHE A C     1 
ATOM   4336 O  O     . PHE C 3  481 ? 37.877 98.314  45.070 1.00 25.78  ? 487  PHE A O     1 
ATOM   4337 C  CB    . PHE C 3  481 ? 40.110 96.223  45.661 1.00 24.54  ? 487  PHE A CB    1 
ATOM   4338 C  CG    . PHE C 3  481 ? 41.619 96.269  45.659 1.00 22.38  ? 487  PHE A CG    1 
ATOM   4339 C  CD1   . PHE C 3  481 ? 42.289 97.335  45.073 1.00 20.82  ? 487  PHE A CD1   1 
ATOM   4340 C  CD2   . PHE C 3  481 ? 42.362 95.268  46.271 1.00 21.27  ? 487  PHE A CD2   1 
ATOM   4341 C  CE1   . PHE C 3  481 ? 43.681 97.408  45.099 1.00 21.99  ? 487  PHE A CE1   1 
ATOM   4342 C  CE2   . PHE C 3  481 ? 43.755 95.325  46.304 1.00 22.70  ? 487  PHE A CE2   1 
ATOM   4343 C  CZ    . PHE C 3  481 ? 44.417 96.397  45.718 1.00 23.24  ? 487  PHE A CZ    1 
ATOM   4344 N  N     . MET C 3  482 ? 37.038 97.089  46.741 1.00 27.37  ? 488  MET A N     1 
ATOM   4345 C  CA    . MET C 3  482 ? 35.688 97.412  46.297 1.00 30.02  ? 488  MET A CA    1 
ATOM   4346 C  C     . MET C 3  482 ? 35.068 98.585  47.048 1.00 29.27  ? 488  MET A C     1 
ATOM   4347 O  O     . MET C 3  482 ? 33.913 98.946  46.809 1.00 28.48  ? 488  MET A O     1 
ATOM   4348 C  CB    . MET C 3  482 ? 34.759 96.182  46.325 1.00 31.51  ? 488  MET A CB    1 
ATOM   4349 C  CG    . MET C 3  482 ? 34.798 95.290  47.534 1.00 32.76  ? 488  MET A CG    1 
ATOM   4350 S  SD    . MET C 3  482 ? 33.727 93.815  47.239 1.00 32.67  ? 488  MET A SD    1 
ATOM   4351 C  CE    . MET C 3  482 ? 32.693 93.891  48.670 1.00 29.32  ? 488  MET A CE    1 
ATOM   4352 N  N     . ALA C 3  483 ? 35.856 99.203  47.926 1.00 28.35  ? 489  ALA A N     1 
ATOM   4353 C  CA    . ALA C 3  483 ? 35.390 100.350 48.699 1.00 29.21  ? 489  ALA A CA    1 
ATOM   4354 C  C     . ALA C 3  483 ? 35.011 101.527 47.800 1.00 28.86  ? 489  ALA A C     1 
ATOM   4355 O  O     . ALA C 3  483 ? 34.207 102.368 48.183 1.00 30.32  ? 489  ALA A O     1 
ATOM   4356 C  CB    . ALA C 3  483 ? 36.462 100.783 49.706 1.00 29.72  ? 489  ALA A CB    1 
ATOM   4357 N  N     . ARG C 3  484 ? 35.593 101.598 46.611 1.00 29.36  ? 490  ARG A N     1 
ATOM   4358 C  CA    . ARG C 3  484 ? 35.271 102.685 45.692 1.00 30.55  ? 490  ARG A CA    1 
ATOM   4359 C  C     . ARG C 3  484 ? 33.929 102.438 45.017 1.00 29.27  ? 490  ARG A C     1 
ATOM   4360 O  O     . ARG C 3  484 ? 33.385 103.326 44.370 1.00 28.73  ? 490  ARG A O     1 
ATOM   4361 C  CB    . ARG C 3  484 ? 36.352 102.824 44.620 1.00 31.95  ? 490  ARG A CB    1 
ATOM   4362 C  CG    . ARG C 3  484 ? 36.702 101.517 43.952 1.00 37.90  ? 490  ARG A CG    1 
ATOM   4363 C  CD    . ARG C 3  484 ? 37.610 101.709 42.747 1.00 40.85  ? 490  ARG A CD    1 
ATOM   4364 N  NE    . ARG C 3  484 ? 36.862 102.052 41.544 1.00 44.44  ? 490  ARG A NE    1 
ATOM   4365 C  CZ    . ARG C 3  484 ? 37.319 101.867 40.308 1.00 47.09  ? 490  ARG A CZ    1 
ATOM   4366 N  NH1   . ARG C 3  484 ? 38.524 101.342 40.116 1.00 45.65  ? 490  ARG A NH1   1 
ATOM   4367 N  NH2   . ARG C 3  484 ? 36.569 102.203 39.263 1.00 47.11  ? 490  ARG A NH2   1 
ATOM   4368 N  N     . PHE C 3  485 ? 33.404 101.227 45.170 1.00 27.67  ? 491  PHE A N     1 
ATOM   4369 C  CA    . PHE C 3  485 ? 32.123 100.854 44.572 1.00 27.33  ? 491  PHE A CA    1 
ATOM   4370 C  C     . PHE C 3  485 ? 30.993 100.819 45.601 1.00 27.65  ? 491  PHE A C     1 
ATOM   4371 O  O     . PHE C 3  485 ? 29.852 101.158 45.285 1.00 29.51  ? 491  PHE A O     1 
ATOM   4372 C  CB    . PHE C 3  485 ? 32.237 99.484  43.895 1.00 25.11  ? 491  PHE A CB    1 
ATOM   4373 C  CG    . PHE C 3  485 ? 33.194 99.456  42.737 1.00 25.47  ? 491  PHE A CG    1 
ATOM   4374 C  CD1   . PHE C 3  485 ? 32.849 100.029 41.516 1.00 26.15  ? 491  PHE A CD1   1 
ATOM   4375 C  CD2   . PHE C 3  485 ? 34.432 98.841  42.860 1.00 23.54  ? 491  PHE A CD2   1 
ATOM   4376 C  CE1   . PHE C 3  485 ? 33.729 99.985  40.427 1.00 27.28  ? 491  PHE A CE1   1 
ATOM   4377 C  CE2   . PHE C 3  485 ? 35.317 98.792  41.783 1.00 27.26  ? 491  PHE A CE2   1 
ATOM   4378 C  CZ    . PHE C 3  485 ? 34.965 99.363  40.562 1.00 25.72  ? 491  PHE A CZ    1 
ATOM   4379 N  N     . ASP C 3  486 ? 31.306 100.424 46.832 1.00 26.74  ? 492  ASP A N     1 
ATOM   4380 C  CA    . ASP C 3  486 ? 30.287 100.354 47.876 1.00 26.91  ? 492  ASP A CA    1 
ATOM   4381 C  C     . ASP C 3  486 ? 30.585 101.271 49.064 1.00 26.69  ? 492  ASP A C     1 
ATOM   4382 O  O     . ASP C 3  486 ? 30.006 101.114 50.137 1.00 26.39  ? 492  ASP A O     1 
ATOM   4383 C  CB    . ASP C 3  486 ? 30.153 98.910  48.368 1.00 27.31  ? 492  ASP A CB    1 
ATOM   4384 C  CG    . ASP C 3  486 ? 31.304 98.492  49.262 1.00 28.02  ? 492  ASP A CG    1 
ATOM   4385 O  OD1   . ASP C 3  486 ? 32.395 99.094  49.151 1.00 29.43  ? 492  ASP A OD1   1 
ATOM   4386 O  OD2   . ASP C 3  486 ? 31.128 97.560  50.069 1.00 27.93  ? 492  ASP A OD2   1 
ATOM   4387 N  N     . ASN C 3  487 ? 31.502 102.215 48.876 1.00 26.87  ? 493  ASN A N     1 
ATOM   4388 C  CA    . ASN C 3  487 ? 31.869 103.159 49.927 1.00 28.39  ? 493  ASN A CA    1 
ATOM   4389 C  C     . ASN C 3  487 ? 32.275 102.547 51.259 1.00 30.52  ? 493  ASN A C     1 
ATOM   4390 O  O     . ASN C 3  487 ? 31.978 103.118 52.310 1.00 32.10  ? 493  ASN A O     1 
ATOM   4391 C  CB    . ASN C 3  487 ? 30.726 104.143 50.173 1.00 31.63  ? 493  ASN A CB    1 
ATOM   4392 C  CG    . ASN C 3  487 ? 30.403 104.965 48.952 1.00 34.42  ? 493  ASN A CG    1 
ATOM   4393 O  OD1   . ASN C 3  487 ? 31.284 105.600 48.371 1.00 37.99  ? 493  ASN A OD1   1 
ATOM   4394 N  ND2   . ASN C 3  487 ? 29.141 104.963 48.551 1.00 35.28  ? 493  ASN A ND2   1 
ATOM   4395 N  N     . GLY C 3  488 ? 32.947 101.397 51.229 1.00 30.24  ? 494  GLY A N     1 
ATOM   4396 C  CA    . GLY C 3  488 ? 33.385 100.775 52.468 1.00 29.21  ? 494  GLY A CA    1 
ATOM   4397 C  C     . GLY C 3  488 ? 32.322 99.971  53.184 1.00 30.79  ? 494  GLY A C     1 
ATOM   4398 O  O     . GLY C 3  488 ? 32.491 99.588  54.343 1.00 30.27  ? 494  GLY A O     1 
ATOM   4399 N  N     . GLU C 3  489 ? 31.223 99.706  52.492 1.00 30.65  ? 495  GLU A N     1 
ATOM   4400 C  CA    . GLU C 3  489 ? 30.127 98.937  53.067 1.00 31.95  ? 495  GLU A CA    1 
ATOM   4401 C  C     . GLU C 3  489 ? 30.641 97.577  53.554 1.00 31.72  ? 495  GLU A C     1 
ATOM   4402 O  O     . GLU C 3  489 ? 30.552 97.255  54.740 1.00 30.90  ? 495  GLU A O     1 
ATOM   4403 C  CB    . GLU C 3  489 ? 29.043 98.766  52.007 1.00 34.76  ? 495  GLU A CB    1 
ATOM   4404 C  CG    . GLU C 3  489 ? 27.813 97.998  52.422 1.00 41.11  ? 495  GLU A CG    1 
ATOM   4405 C  CD    . GLU C 3  489 ? 26.805 97.929  51.281 1.00 45.36  ? 495  GLU A CD    1 
ATOM   4406 O  OE1   . GLU C 3  489 ? 26.318 99.004  50.854 1.00 47.66  ? 495  GLU A OE1   1 
ATOM   4407 O  OE2   . GLU C 3  489 ? 26.513 96.810  50.804 1.00 45.45  ? 495  GLU A OE2   1 
ATOM   4408 N  N     . TYR C 3  490 ? 31.195 96.788  52.642 1.00 28.52  ? 496  TYR A N     1 
ATOM   4409 C  CA    . TYR C 3  490 ? 31.720 95.482  53.005 1.00 29.52  ? 496  TYR A CA    1 
ATOM   4410 C  C     . TYR C 3  490 ? 32.858 95.594  54.023 1.00 29.90  ? 496  TYR A C     1 
ATOM   4411 O  O     . TYR C 3  490 ? 32.946 94.799  54.952 1.00 27.96  ? 496  TYR A O     1 
ATOM   4412 C  CB    . TYR C 3  490 ? 32.208 94.758  51.754 1.00 30.93  ? 496  TYR A CB    1 
ATOM   4413 C  CG    . TYR C 3  490 ? 32.701 93.356  52.007 1.00 33.85  ? 496  TYR A CG    1 
ATOM   4414 C  CD1   . TYR C 3  490 ? 31.856 92.380  52.532 1.00 35.79  ? 496  TYR A CD1   1 
ATOM   4415 C  CD2   . TYR C 3  490 ? 34.015 93.002  51.714 1.00 34.76  ? 496  TYR A CD2   1 
ATOM   4416 C  CE1   . TYR C 3  490 ? 32.314 91.080  52.761 1.00 36.21  ? 496  TYR A CE1   1 
ATOM   4417 C  CE2   . TYR C 3  490 ? 34.483 91.714  51.936 1.00 36.89  ? 496  TYR A CE2   1 
ATOM   4418 C  CZ    . TYR C 3  490 ? 33.632 90.758  52.459 1.00 37.16  ? 496  TYR A CZ    1 
ATOM   4419 O  OH    . TYR C 3  490 ? 34.118 89.492  52.687 1.00 40.49  ? 496  TYR A OH    1 
ATOM   4420 N  N     . ALA C 3  491 ? 33.727 96.584  53.847 1.00 30.34  ? 497  ALA A N     1 
ATOM   4421 C  CA    . ALA C 3  491 ? 34.844 96.777  54.765 1.00 33.42  ? 497  ALA A CA    1 
ATOM   4422 C  C     . ALA C 3  491 ? 34.337 96.972  56.186 1.00 36.13  ? 497  ALA A C     1 
ATOM   4423 O  O     . ALA C 3  491 ? 35.008 96.604  57.152 1.00 37.23  ? 497  ALA A O     1 
ATOM   4424 C  CB    . ALA C 3  491 ? 35.684 97.984  54.342 1.00 30.91  ? 497  ALA A CB    1 
ATOM   4425 N  N     . HIS C 3  492 ? 33.152 97.558  56.312 1.00 37.46  ? 498  HIS A N     1 
ATOM   4426 C  CA    . HIS C 3  492 ? 32.571 97.792  57.623 1.00 38.91  ? 498  HIS A CA    1 
ATOM   4427 C  C     . HIS C 3  492 ? 31.888 96.535  58.145 1.00 39.09  ? 498  HIS A C     1 
ATOM   4428 O  O     . HIS C 3  492 ? 32.011 96.183  59.314 1.00 40.06  ? 498  HIS A O     1 
ATOM   4429 C  CB    . HIS C 3  492 ? 31.552 98.923  57.555 1.00 41.25  ? 498  HIS A CB    1 
ATOM   4430 C  CG    . HIS C 3  492 ? 30.962 99.270  58.883 1.00 44.01  ? 498  HIS A CG    1 
ATOM   4431 N  ND1   . HIS C 3  492 ? 31.612 100.073 59.796 1.00 44.41  ? 498  HIS A ND1   1 
ATOM   4432 C  CD2   . HIS C 3  492 ? 29.808 98.881  59.475 1.00 44.35  ? 498  HIS A CD2   1 
ATOM   4433 C  CE1   . HIS C 3  492 ? 30.882 100.163 60.894 1.00 45.09  ? 498  HIS A CE1   1 
ATOM   4434 N  NE2   . HIS C 3  492 ? 29.783 99.449  60.725 1.00 45.35  ? 498  HIS A NE2   1 
ATOM   4435 N  N     . GLU C 3  493 ? 31.156 95.864  57.270 1.00 39.89  ? 499  GLU A N     1 
ATOM   4436 C  CA    . GLU C 3  493 ? 30.448 94.645  57.636 1.00 41.92  ? 499  GLU A CA    1 
ATOM   4437 C  C     . GLU C 3  493 ? 31.405 93.512  57.998 1.00 41.62  ? 499  GLU A C     1 
ATOM   4438 O  O     . GLU C 3  493 ? 31.118 92.695  58.875 1.00 39.19  ? 499  GLU A O     1 
ATOM   4439 C  CB    . GLU C 3  493 ? 29.570 94.191  56.470 1.00 44.97  ? 499  GLU A CB    1 
ATOM   4440 C  CG    . GLU C 3  493 ? 28.897 92.843  56.680 1.00 52.78  ? 499  GLU A CG    1 
ATOM   4441 C  CD    . GLU C 3  493 ? 28.698 92.078  55.373 1.00 57.51  ? 499  GLU A CD    1 
ATOM   4442 O  OE1   . GLU C 3  493 ? 28.035 92.618  54.453 1.00 59.63  ? 499  GLU A OE1   1 
ATOM   4443 O  OE2   . GLU C 3  493 ? 29.208 90.935  55.267 1.00 57.99  ? 499  GLU A OE2   1 
ATOM   4444 N  N     . ILE C 3  494 ? 32.544 93.471  57.316 1.00 42.30  ? 500  ILE A N     1 
ATOM   4445 C  CA    . ILE C 3  494 ? 33.519 92.416  57.532 1.00 43.38  ? 500  ILE A CA    1 
ATOM   4446 C  C     . ILE C 3  494 ? 34.045 92.338  58.957 1.00 44.36  ? 500  ILE A C     1 
ATOM   4447 O  O     . ILE C 3  494 ? 34.389 91.260  59.429 1.00 44.43  ? 500  ILE A O     1 
ATOM   4448 C  CB    . ILE C 3  494 ? 34.714 92.552  56.562 1.00 44.03  ? 500  ILE A CB    1 
ATOM   4449 C  CG1   . ILE C 3  494 ? 35.401 91.194  56.395 1.00 43.31  ? 500  ILE A CG1   1 
ATOM   4450 C  CG2   . ILE C 3  494 ? 35.709 93.583  57.093 1.00 42.75  ? 500  ILE A CG2   1 
ATOM   4451 C  CD1   . ILE C 3  494 ? 36.470 91.165  55.312 1.00 43.07  ? 500  ILE A CD1   1 
ATOM   4452 N  N     . LEU C 3  495 ? 34.106 93.464  59.655 1.00 45.91  ? 501  LEU A N     1 
ATOM   4453 C  CA    . LEU C 3  495 ? 34.621 93.430  61.013 1.00 48.07  ? 501  LEU A CA    1 
ATOM   4454 C  C     . LEU C 3  495 ? 33.551 93.327  62.091 1.00 50.00  ? 501  LEU A C     1 
ATOM   4455 O  O     . LEU C 3  495 ? 33.782 93.668  63.253 1.00 50.39  ? 501  LEU A O     1 
ATOM   4456 C  CB    . LEU C 3  495 ? 35.553 94.622  61.263 1.00 49.03  ? 501  LEU A CB    1 
ATOM   4457 C  CG    . LEU C 3  495 ? 35.277 95.966  60.597 1.00 49.25  ? 501  LEU A CG    1 
ATOM   4458 C  CD1   . LEU C 3  495 ? 34.056 96.619  61.225 1.00 51.73  ? 501  LEU A CD1   1 
ATOM   4459 C  CD2   . LEU C 3  495 ? 36.498 96.854  60.764 1.00 48.59  ? 501  LEU A CD2   1 
ATOM   4460 N  N     . ASN C 3  496 ? 32.382 92.835  61.693 1.00 51.19  ? 502  ASN A N     1 
ATOM   4461 C  CA    . ASN C 3  496 ? 31.267 92.631  62.612 1.00 52.12  ? 502  ASN A CA    1 
ATOM   4462 C  C     . ASN C 3  496 ? 31.255 91.140  62.945 1.00 51.33  ? 502  ASN A C     1 
ATOM   4463 O  O     . ASN C 3  496 ? 30.497 90.364  62.358 1.00 51.56  ? 502  ASN A O     1 
ATOM   4464 C  CB    . ASN C 3  496 ? 29.948 93.039  61.948 1.00 53.95  ? 502  ASN A CB    1 
ATOM   4465 C  CG    . ASN C 3  496 ? 28.742 92.401  62.609 1.00 55.48  ? 502  ASN A CG    1 
ATOM   4466 O  OD1   . ASN C 3  496 ? 28.577 92.468  63.828 1.00 57.35  ? 502  ASN A OD1   1 
ATOM   4467 N  ND2   . ASN C 3  496 ? 27.892 91.775  61.804 1.00 56.09  ? 502  ASN A ND2   1 
ATOM   4468 N  N     . GLY C 3  497 ? 32.105 90.747  63.890 1.00 49.94  ? 503  GLY A N     1 
ATOM   4469 C  CA    . GLY C 3  497 ? 32.214 89.346  64.253 1.00 48.48  ? 503  GLY A CA    1 
ATOM   4470 C  C     . GLY C 3  497 ? 33.136 88.709  63.227 1.00 47.56  ? 503  GLY A C     1 
ATOM   4471 O  O     . GLY C 3  497 ? 33.459 89.346  62.226 1.00 47.49  ? 503  GLY A O     1 
ATOM   4472 N  N     . ASP C 3  498 ? 33.569 87.473  63.454 1.00 46.25  ? 504  ASP A N     1 
ATOM   4473 C  CA    . ASP C 3  498 ? 34.455 86.815  62.495 1.00 45.56  ? 504  ASP A CA    1 
ATOM   4474 C  C     . ASP C 3  498 ? 33.768 86.519  61.159 1.00 44.35  ? 504  ASP A C     1 
ATOM   4475 O  O     . ASP C 3  498 ? 32.762 85.812  61.105 1.00 44.60  ? 504  ASP A O     1 
ATOM   4476 C  CB    . ASP C 3  498 ? 35.002 85.512  63.065 1.00 45.59  ? 504  ASP A CB    1 
ATOM   4477 C  CG    . ASP C 3  498 ? 35.930 84.815  62.098 1.00 46.46  ? 504  ASP A CG    1 
ATOM   4478 O  OD1   . ASP C 3  498 ? 37.013 85.373  61.825 1.00 46.36  ? 504  ASP A OD1   1 
ATOM   4479 O  OD2   . ASP C 3  498 ? 35.573 83.725  61.599 1.00 46.48  ? 504  ASP A OD2   1 
ATOM   4480 N  N     . ILE C 3  499 ? 34.340 87.044  60.082 1.00 43.39  ? 505  ILE A N     1 
ATOM   4481 C  CA    . ILE C 3  499 ? 33.791 86.871  58.744 1.00 42.91  ? 505  ILE A CA    1 
ATOM   4482 C  C     . ILE C 3  499 ? 33.656 85.416  58.276 1.00 43.25  ? 505  ILE A C     1 
ATOM   4483 O  O     . ILE C 3  499 ? 32.644 85.048  57.674 1.00 43.25  ? 505  ILE A O     1 
ATOM   4484 C  CB    . ILE C 3  499 ? 34.633 87.668  57.704 1.00 41.65  ? 505  ILE A CB    1 
ATOM   4485 C  CG1   . ILE C 3  499 ? 33.981 87.591  56.317 1.00 40.60  ? 505  ILE A CG1   1 
ATOM   4486 C  CG2   . ILE C 3  499 ? 36.055 87.129  57.659 1.00 40.81  ? 505  ILE A CG2   1 
ATOM   4487 C  CD1   . ILE C 3  499 ? 32.647 88.297  56.220 1.00 37.10  ? 505  ILE A CD1   1 
ATOM   4488 N  N     . HIS C 3  500 ? 34.659 84.586  58.545 1.00 43.57  ? 506  HIS A N     1 
ATOM   4489 C  CA    . HIS C 3  500 ? 34.590 83.194  58.112 1.00 44.14  ? 506  HIS A CA    1 
ATOM   4490 C  C     . HIS C 3  500 ? 33.574 82.391  58.911 1.00 44.56  ? 506  HIS A C     1 
ATOM   4491 O  O     . HIS C 3  500 ? 32.919 81.499  58.372 1.00 43.50  ? 506  HIS A O     1 
ATOM   4492 C  CB    . HIS C 3  500 ? 35.975 82.545  58.174 1.00 43.96  ? 506  HIS A CB    1 
ATOM   4493 C  CG    . HIS C 3  500 ? 36.929 83.087  57.154 1.00 44.50  ? 506  HIS A CG    1 
ATOM   4494 N  ND1   . HIS C 3  500 ? 36.658 83.074  55.804 1.00 42.80  ? 506  HIS A ND1   1 
ATOM   4495 C  CD2   . HIS C 3  500 ? 38.139 83.681  57.288 1.00 44.86  ? 506  HIS A CD2   1 
ATOM   4496 C  CE1   . HIS C 3  500 ? 37.657 83.638  55.150 1.00 43.76  ? 506  HIS A CE1   1 
ATOM   4497 N  NE2   . HIS C 3  500 ? 38.568 84.015  56.027 1.00 43.08  ? 506  HIS A NE2   1 
ATOM   4498 N  N     . THR C 3  501 ? 33.435 82.706  60.194 1.00 45.25  ? 507  THR A N     1 
ATOM   4499 C  CA    . THR C 3  501 ? 32.458 82.012  61.023 1.00 46.19  ? 507  THR A CA    1 
ATOM   4500 C  C     . THR C 3  501 ? 31.061 82.444  60.592 1.00 46.08  ? 507  THR A C     1 
ATOM   4501 O  O     . THR C 3  501 ? 30.133 81.640  60.567 1.00 45.49  ? 507  THR A O     1 
ATOM   4502 C  CB    . THR C 3  501 ? 32.635 82.348  62.515 1.00 46.85  ? 507  THR A CB    1 
ATOM   4503 O  OG1   . THR C 3  501 ? 33.810 81.696  63.014 1.00 48.43  ? 507  THR A OG1   1 
ATOM   4504 C  CG2   . THR C 3  501 ? 31.422 81.885  63.312 1.00 44.53  ? 507  THR A CG2   1 
ATOM   4505 N  N     . LYS C 3  502 ? 30.920 83.721  60.250 1.00 46.39  ? 508  LYS A N     1 
ATOM   4506 C  CA    . LYS C 3  502 ? 29.632 84.245  59.821 1.00 47.30  ? 508  LYS A CA    1 
ATOM   4507 C  C     . LYS C 3  502 ? 29.221 83.586  58.505 1.00 47.13  ? 508  LYS A C     1 
ATOM   4508 O  O     . LYS C 3  502 ? 28.072 83.164  58.354 1.00 47.52  ? 508  LYS A O     1 
ATOM   4509 C  CB    . LYS C 3  502 ? 29.700 85.766  59.655 1.00 48.75  ? 508  LYS A CB    1 
ATOM   4510 C  CG    . LYS C 3  502 ? 28.345 86.454  59.770 1.00 50.04  ? 508  LYS A CG    1 
ATOM   4511 C  CD    . LYS C 3  502 ? 28.476 87.973  59.889 1.00 52.88  ? 508  LYS A CD    1 
ATOM   4512 C  CE    . LYS C 3  502 ? 28.328 88.683  58.546 1.00 53.24  ? 508  LYS A CE    1 
ATOM   4513 N  NZ    . LYS C 3  502 ? 29.405 88.353  57.575 1.00 54.42  ? 508  LYS A NZ    1 
ATOM   4514 N  N     . ASN C 3  503 ? 30.156 83.490  57.560 1.00 45.36  ? 509  ASN A N     1 
ATOM   4515 C  CA    . ASN C 3  503 ? 29.867 82.860  56.272 1.00 44.80  ? 509  ASN A CA    1 
ATOM   4516 C  C     . ASN C 3  503 ? 29.534 81.377  56.445 1.00 44.81  ? 509  ASN A C     1 
ATOM   4517 O  O     . ASN C 3  503 ? 28.672 80.837  55.746 1.00 44.69  ? 509  ASN A O     1 
ATOM   4518 C  CB    . ASN C 3  503 ? 31.054 82.989  55.313 1.00 42.73  ? 509  ASN A CB    1 
ATOM   4519 C  CG    . ASN C 3  503 ? 31.240 84.398  54.792 1.00 41.49  ? 509  ASN A CG    1 
ATOM   4520 O  OD1   . ASN C 3  503 ? 30.286 85.060  54.387 1.00 39.86  ? 509  ASN A OD1   1 
ATOM   4521 N  ND2   . ASN C 3  503 ? 32.481 84.858  54.781 1.00 41.75  ? 509  ASN A ND2   1 
ATOM   4522 N  N     . GLN C 3  504 ? 30.235 80.725  57.368 1.00 45.08  ? 510  GLN A N     1 
ATOM   4523 C  CA    . GLN C 3  504 ? 30.027 79.309  57.653 1.00 45.86  ? 510  GLN A CA    1 
ATOM   4524 C  C     . GLN C 3  504 ? 28.553 79.067  57.971 1.00 47.00  ? 510  GLN A C     1 
ATOM   4525 O  O     . GLN C 3  504 ? 27.903 78.220  57.360 1.00 45.38  ? 510  GLN A O     1 
ATOM   4526 C  CB    . GLN C 3  504 ? 30.884 78.890  58.851 1.00 45.87  ? 510  GLN A CB    1 
ATOM   4527 C  CG    . GLN C 3  504 ? 30.864 77.399  59.158 1.00 45.94  ? 510  GLN A CG    1 
ATOM   4528 C  CD    . GLN C 3  504 ? 31.444 77.084  60.523 1.00 46.95  ? 510  GLN A CD    1 
ATOM   4529 O  OE1   . GLN C 3  504 ? 32.343 77.776  61.002 1.00 46.48  ? 510  GLN A OE1   1 
ATOM   4530 N  NE2   . GLN C 3  504 ? 30.938 76.027  61.153 1.00 47.25  ? 510  GLN A NE2   1 
ATOM   4531 N  N     . ILE C 3  505 ? 28.043 79.831  58.934 1.00 47.68  ? 511  ILE A N     1 
ATOM   4532 C  CA    . ILE C 3  505 ? 26.658 79.736  59.374 1.00 49.12  ? 511  ILE A CA    1 
ATOM   4533 C  C     . ILE C 3  505 ? 25.686 79.967  58.224 1.00 50.01  ? 511  ILE A C     1 
ATOM   4534 O  O     . ILE C 3  505 ? 24.884 79.093  57.895 1.00 49.74  ? 511  ILE A O     1 
ATOM   4535 C  CB    . ILE C 3  505 ? 26.383 80.761  60.502 1.00 50.25  ? 511  ILE A CB    1 
ATOM   4536 C  CG1   . ILE C 3  505 ? 27.147 80.342  61.763 1.00 49.07  ? 511  ILE A CG1   1 
ATOM   4537 C  CG2   . ILE C 3  505 ? 24.882 80.874  60.768 1.00 49.73  ? 511  ILE A CG2   1 
ATOM   4538 C  CD1   . ILE C 3  505 ? 27.024 81.309  62.917 1.00 49.46  ? 511  ILE A CD1   1 
ATOM   4539 N  N     . ALA C 3  506 ? 25.759 81.144  57.616 1.00 50.70  ? 512  ALA A N     1 
ATOM   4540 C  CA    . ALA C 3  506 ? 24.882 81.470  56.501 1.00 52.48  ? 512  ALA A CA    1 
ATOM   4541 C  C     . ALA C 3  506 ? 24.962 80.391  55.426 1.00 53.76  ? 512  ALA A C     1 
ATOM   4542 O  O     . ALA C 3  506 ? 23.937 79.895  54.956 1.00 54.92  ? 512  ALA A O     1 
ATOM   4543 C  CB    . ALA C 3  506 ? 25.264 82.823  55.912 1.00 52.49  ? 512  ALA A CB    1 
ATOM   4544 N  N     . ALA C 3  507 ? 26.182 80.030  55.041 1.00 54.54  ? 513  ALA A N     1 
ATOM   4545 C  CA    . ALA C 3  507 ? 26.389 79.009  54.020 1.00 55.58  ? 513  ALA A CA    1 
ATOM   4546 C  C     . ALA C 3  507 ? 26.070 77.632  54.577 1.00 55.88  ? 513  ALA A C     1 
ATOM   4547 O  O     . ALA C 3  507 ? 26.127 76.634  53.860 1.00 56.22  ? 513  ALA A O     1 
ATOM   4548 C  CB    . ALA C 3  507 ? 27.825 79.046  53.519 1.00 55.99  ? 513  ALA A CB    1 
ATOM   4549 N  N     . GLU C 3  508 ? 25.748 77.585  55.866 1.00 56.52  ? 514  GLU A N     1 
ATOM   4550 C  CA    . GLU C 3  508 ? 25.403 76.336  56.533 1.00 57.38  ? 514  GLU A CA    1 
ATOM   4551 C  C     . GLU C 3  508 ? 26.467 75.265  56.299 1.00 56.87  ? 514  GLU A C     1 
ATOM   4552 O  O     . GLU C 3  508 ? 26.154 74.135  55.924 1.00 57.30  ? 514  GLU A O     1 
ATOM   4553 C  CB    . GLU C 3  508 ? 24.042 75.857  56.022 1.00 59.08  ? 514  GLU A CB    1 
ATOM   4554 C  CG    . GLU C 3  508 ? 23.010 76.974  55.971 1.00 61.97  ? 514  GLU A CG    1 
ATOM   4555 C  CD    . GLU C 3  508 ? 21.731 76.572  55.269 1.00 64.43  ? 514  GLU A CD    1 
ATOM   4556 O  OE1   . GLU C 3  508 ? 20.998 75.718  55.809 1.00 65.30  ? 514  GLU A OE1   1 
ATOM   4557 O  OE2   . GLU C 3  508 ? 21.460 77.112  54.174 1.00 66.32  ? 514  GLU A OE2   1 
ATOM   4558 N  N     . LEU C 3  509 ? 27.727 75.627  56.525 1.00 55.99  ? 515  LEU A N     1 
ATOM   4559 C  CA    . LEU C 3  509 ? 28.834 74.697  56.338 1.00 54.59  ? 515  LEU A CA    1 
ATOM   4560 C  C     . LEU C 3  509 ? 29.271 74.067  57.661 1.00 54.39  ? 515  LEU A C     1 
ATOM   4561 O  O     . LEU C 3  509 ? 29.120 74.666  58.726 1.00 54.44  ? 515  LEU A O     1 
ATOM   4562 C  CB    . LEU C 3  509 ? 30.016 75.410  55.672 1.00 53.72  ? 515  LEU A CB    1 
ATOM   4563 C  CG    . LEU C 3  509 ? 29.735 76.007  54.287 1.00 53.32  ? 515  LEU A CG    1 
ATOM   4564 C  CD1   . LEU C 3  509 ? 31.031 76.535  53.690 1.00 52.01  ? 515  LEU A CD1   1 
ATOM   4565 C  CD2   . LEU C 3  509 ? 29.130 74.948  53.368 1.00 51.48  ? 515  LEU A CD2   1 
ATOM   4566 N  N     . PRO C 3  510 ? 29.822 72.842  57.604 1.00 53.97  ? 516  PRO A N     1 
ATOM   4567 C  CA    . PRO C 3  510 ? 30.292 72.089  58.773 1.00 53.31  ? 516  PRO A CA    1 
ATOM   4568 C  C     . PRO C 3  510 ? 31.422 72.706  59.601 1.00 52.90  ? 516  PRO A C     1 
ATOM   4569 O  O     . PRO C 3  510 ? 31.308 72.802  60.823 1.00 53.20  ? 516  PRO A O     1 
ATOM   4570 C  CB    . PRO C 3  510 ? 30.684 70.735  58.177 1.00 53.46  ? 516  PRO A CB    1 
ATOM   4571 C  CG    . PRO C 3  510 ? 31.106 71.090  56.779 1.00 53.65  ? 516  PRO A CG    1 
ATOM   4572 C  CD    . PRO C 3  510 ? 30.027 72.063  56.368 1.00 53.96  ? 516  PRO A CD    1 
ATOM   4573 N  N     . THR C 3  511 ? 32.507 73.116  58.949 1.00 50.85  ? 517  THR A N     1 
ATOM   4574 C  CA    . THR C 3  511 ? 33.637 73.698  59.668 1.00 49.56  ? 517  THR A CA    1 
ATOM   4575 C  C     . THR C 3  511 ? 34.007 75.105  59.211 1.00 49.33  ? 517  THR A C     1 
ATOM   4576 O  O     . THR C 3  511 ? 33.668 75.522  58.103 1.00 48.26  ? 517  THR A O     1 
ATOM   4577 C  CB    . THR C 3  511 ? 34.887 72.813  59.540 1.00 49.72  ? 517  THR A CB    1 
ATOM   4578 O  OG1   . THR C 3  511 ? 35.175 72.596  58.153 1.00 50.03  ? 517  THR A OG1   1 
ATOM   4579 C  CG2   . THR C 3  511 ? 34.665 71.473  60.227 1.00 48.68  ? 517  THR A CG2   1 
ATOM   4580 N  N     . ARG C 3  512 ? 34.706 75.830  60.082 1.00 48.14  ? 518  ARG A N     1 
ATOM   4581 C  CA    . ARG C 3  512 ? 35.144 77.189  59.785 1.00 47.44  ? 518  ARG A CA    1 
ATOM   4582 C  C     . ARG C 3  512 ? 36.152 77.163  58.647 1.00 47.93  ? 518  ARG A C     1 
ATOM   4583 O  O     . ARG C 3  512 ? 36.233 78.108  57.858 1.00 48.38  ? 518  ARG A O     1 
ATOM   4584 C  CB    . ARG C 3  512 ? 35.784 77.834  61.020 1.00 45.97  ? 518  ARG A CB    1 
ATOM   4585 C  CG    . ARG C 3  512 ? 36.322 79.243  60.770 1.00 44.79  ? 518  ARG A CG    1 
ATOM   4586 C  CD    . ARG C 3  512 ? 36.888 79.880  62.045 1.00 42.48  ? 518  ARG A CD    1 
ATOM   4587 N  NE    . ARG C 3  512 ? 37.326 81.262  61.831 1.00 39.89  ? 518  ARG A NE    1 
ATOM   4588 C  CZ    . ARG C 3  512 ? 38.382 81.612  61.101 1.00 40.41  ? 518  ARG A CZ    1 
ATOM   4589 N  NH1   . ARG C 3  512 ? 39.122 80.684  60.509 1.00 41.30  ? 518  ARG A NH1   1 
ATOM   4590 N  NH2   . ARG C 3  512 ? 38.698 82.892  60.957 1.00 37.39  ? 518  ARG A NH2   1 
ATOM   4591 N  N     . ASP C 3  513 ? 36.927 76.083  58.570 1.00 47.66  ? 519  ASP A N     1 
ATOM   4592 C  CA    . ASP C 3  513 ? 37.919 75.942  57.509 1.00 48.39  ? 519  ASP A CA    1 
ATOM   4593 C  C     . ASP C 3  513 ? 37.206 75.729  56.183 1.00 46.99  ? 519  ASP A C     1 
ATOM   4594 O  O     . ASP C 3  513 ? 37.627 76.243  55.149 1.00 46.64  ? 519  ASP A O     1 
ATOM   4595 C  CB    . ASP C 3  513 ? 38.854 74.754  57.775 1.00 50.38  ? 519  ASP A CB    1 
ATOM   4596 C  CG    . ASP C 3  513 ? 39.919 75.062  58.809 1.00 52.89  ? 519  ASP A CG    1 
ATOM   4597 O  OD1   . ASP C 3  513 ? 40.588 76.114  58.697 1.00 54.79  ? 519  ASP A OD1   1 
ATOM   4598 O  OD2   . ASP C 3  513 ? 40.099 74.243  59.732 1.00 56.75  ? 519  ASP A OD2   1 
ATOM   4599 N  N     . ASN C 3  514 ? 36.119 74.969  56.220 1.00 46.16  ? 520  ASN A N     1 
ATOM   4600 C  CA    . ASN C 3  514 ? 35.361 74.694  55.016 1.00 45.77  ? 520  ASN A CA    1 
ATOM   4601 C  C     . ASN C 3  514 ? 34.752 75.981  54.460 1.00 45.82  ? 520  ASN A C     1 
ATOM   4602 O  O     . ASN C 3  514 ? 34.576 76.117  53.248 1.00 45.61  ? 520  ASN A O     1 
ATOM   4603 C  CB    . ASN C 3  514 ? 34.258 73.676  55.308 1.00 47.10  ? 520  ASN A CB    1 
ATOM   4604 C  CG    . ASN C 3  514 ? 33.592 73.164  54.045 1.00 49.23  ? 520  ASN A CG    1 
ATOM   4605 O  OD1   . ASN C 3  514 ? 32.364 73.186  53.922 1.00 50.62  ? 520  ASN A OD1   1 
ATOM   4606 N  ND2   . ASN C 3  514 ? 34.400 72.697  53.096 1.00 46.96  ? 520  ASN A ND2   1 
ATOM   4607 N  N     . ALA C 3  515 ? 34.435 76.928  55.340 1.00 44.51  ? 521  ALA A N     1 
ATOM   4608 C  CA    . ALA C 3  515 ? 33.852 78.194  54.896 1.00 44.33  ? 521  ALA A CA    1 
ATOM   4609 C  C     . ALA C 3  515 ? 34.907 79.040  54.177 1.00 43.84  ? 521  ALA A C     1 
ATOM   4610 O  O     . ALA C 3  515 ? 34.587 79.804  53.259 1.00 42.68  ? 521  ALA A O     1 
ATOM   4611 C  CB    . ALA C 3  515 ? 33.274 78.966  56.090 1.00 42.01  ? 521  ALA A CB    1 
ATOM   4612 N  N     . LYS C 3  516 ? 36.163 78.892  54.595 1.00 42.12  ? 522  LYS A N     1 
ATOM   4613 C  CA    . LYS C 3  516 ? 37.265 79.637  53.990 1.00 43.13  ? 522  LYS A CA    1 
ATOM   4614 C  C     . LYS C 3  516 ? 37.550 79.110  52.591 1.00 41.98  ? 522  LYS A C     1 
ATOM   4615 O  O     . LYS C 3  516 ? 37.667 79.881  51.637 1.00 41.02  ? 522  LYS A O     1 
ATOM   4616 C  CB    . LYS C 3  516 ? 38.520 79.523  54.861 1.00 42.80  ? 522  LYS A CB    1 
ATOM   4617 C  CG    . LYS C 3  516 ? 38.415 80.306  56.154 1.00 44.05  ? 522  LYS A CG    1 
ATOM   4618 C  CD    . LYS C 3  516 ? 39.470 79.896  57.165 1.00 44.67  ? 522  LYS A CD    1 
ATOM   4619 C  CE    . LYS C 3  516 ? 40.876 80.106  56.650 1.00 44.82  ? 522  LYS A CE    1 
ATOM   4620 N  NZ    . LYS C 3  516 ? 41.859 79.897  57.751 1.00 42.93  ? 522  LYS A NZ    1 
ATOM   4621 N  N     . THR C 3  517 ? 37.662 77.791  52.476 1.00 41.25  ? 523  THR A N     1 
ATOM   4622 C  CA    . THR C 3  517 ? 37.920 77.170  51.186 1.00 40.81  ? 523  THR A CA    1 
ATOM   4623 C  C     . THR C 3  517 ? 36.760 77.498  50.243 1.00 40.16  ? 523  THR A C     1 
ATOM   4624 O  O     . THR C 3  517 ? 36.954 77.677  49.039 1.00 40.21  ? 523  THR A O     1 
ATOM   4625 C  CB    . THR C 3  517 ? 38.101 75.637  51.329 1.00 39.51  ? 523  THR A CB    1 
ATOM   4626 O  OG1   . THR C 3  517 ? 38.250 75.054  50.032 1.00 41.48  ? 523  THR A OG1   1 
ATOM   4627 C  CG2   . THR C 3  517 ? 36.914 75.008  52.023 1.00 42.90  ? 523  THR A CG2   1 
ATOM   4628 N  N     . PHE C 3  518 ? 35.556 77.600  50.798 1.00 39.42  ? 524  PHE A N     1 
ATOM   4629 C  CA    . PHE C 3  518 ? 34.381 77.938  49.997 1.00 39.48  ? 524  PHE A CA    1 
ATOM   4630 C  C     . PHE C 3  518 ? 34.424 79.392  49.533 1.00 38.89  ? 524  PHE A C     1 
ATOM   4631 O  O     . PHE C 3  518 ? 34.366 79.679  48.339 1.00 38.32  ? 524  PHE A O     1 
ATOM   4632 C  CB    . PHE C 3  518 ? 33.087 77.743  50.798 1.00 39.39  ? 524  PHE A CB    1 
ATOM   4633 C  CG    . PHE C 3  518 ? 31.925 78.546  50.268 1.00 37.69  ? 524  PHE A CG    1 
ATOM   4634 C  CD1   . PHE C 3  518 ? 31.311 78.206  49.063 1.00 38.12  ? 524  PHE A CD1   1 
ATOM   4635 C  CD2   . PHE C 3  518 ? 31.487 79.685  50.942 1.00 39.00  ? 524  PHE A CD2   1 
ATOM   4636 C  CE1   . PHE C 3  518 ? 30.277 78.995  48.532 1.00 37.38  ? 524  PHE A CE1   1 
ATOM   4637 C  CE2   . PHE C 3  518 ? 30.455 80.481  50.421 1.00 38.71  ? 524  PHE A CE2   1 
ATOM   4638 C  CZ    . PHE C 3  518 ? 29.851 80.133  49.213 1.00 37.34  ? 524  PHE A CZ    1 
ATOM   4639 N  N     . ILE C 3  519 ? 34.520 80.309  50.489 1.00 38.29  ? 525  ILE A N     1 
ATOM   4640 C  CA    . ILE C 3  519 ? 34.520 81.722  50.159 1.00 37.98  ? 525  ILE A CA    1 
ATOM   4641 C  C     . ILE C 3  519 ? 35.607 82.084  49.159 1.00 38.60  ? 525  ILE A C     1 
ATOM   4642 O  O     . ILE C 3  519 ? 35.346 82.825  48.215 1.00 38.70  ? 525  ILE A O     1 
ATOM   4643 C  CB    . ILE C 3  519 ? 34.644 82.606  51.432 1.00 36.78  ? 525  ILE A CB    1 
ATOM   4644 C  CG1   . ILE C 3  519 ? 34.060 83.993  51.156 1.00 36.81  ? 525  ILE A CG1   1 
ATOM   4645 C  CG2   . ILE C 3  519 ? 36.096 82.733  51.858 1.00 35.34  ? 525  ILE A CG2   1 
ATOM   4646 C  CD1   . ILE C 3  519 ? 32.581 83.990  50.799 1.00 34.12  ? 525  ILE A CD1   1 
ATOM   4647 N  N     . TYR C 3  520 ? 36.814 81.549  49.334 1.00 38.94  ? 526  TYR A N     1 
ATOM   4648 C  CA    . TYR C 3  520 ? 37.891 81.876  48.405 1.00 38.60  ? 526  TYR A CA    1 
ATOM   4649 C  C     . TYR C 3  520 ? 37.763 81.138  47.084 1.00 38.35  ? 526  TYR A C     1 
ATOM   4650 O  O     . TYR C 3  520 ? 38.250 81.606  46.056 1.00 39.72  ? 526  TYR A O     1 
ATOM   4651 C  CB    . TYR C 3  520 ? 39.259 81.622  49.047 1.00 40.15  ? 526  TYR A CB    1 
ATOM   4652 C  CG    . TYR C 3  520 ? 39.627 82.677  50.074 1.00 39.83  ? 526  TYR A CG    1 
ATOM   4653 C  CD1   . TYR C 3  520 ? 39.732 84.026  49.713 1.00 39.39  ? 526  TYR A CD1   1 
ATOM   4654 C  CD2   . TYR C 3  520 ? 39.830 82.337  51.412 1.00 38.93  ? 526  TYR A CD2   1 
ATOM   4655 C  CE1   . TYR C 3  520 ? 40.029 85.010  50.665 1.00 39.20  ? 526  TYR A CE1   1 
ATOM   4656 C  CE2   . TYR C 3  520 ? 40.125 83.308  52.369 1.00 39.47  ? 526  TYR A CE2   1 
ATOM   4657 C  CZ    . TYR C 3  520 ? 40.223 84.640  51.993 1.00 39.91  ? 526  TYR A CZ    1 
ATOM   4658 O  OH    . TYR C 3  520 ? 40.515 85.588  52.950 1.00 39.81  ? 526  TYR A OH    1 
ATOM   4659 N  N     . GLY C 3  521 ? 37.101 79.988  47.106 1.00 37.75  ? 527  GLY A N     1 
ATOM   4660 C  CA    . GLY C 3  521 ? 36.899 79.249  45.877 1.00 35.54  ? 527  GLY A CA    1 
ATOM   4661 C  C     . GLY C 3  521 ? 35.912 80.054  45.053 1.00 35.21  ? 527  GLY A C     1 
ATOM   4662 O  O     . GLY C 3  521 ? 36.096 80.262  43.856 1.00 36.05  ? 527  GLY A O     1 
ATOM   4663 N  N     . PHE C 3  522 ? 34.860 80.522  45.715 1.00 35.28  ? 528  PHE A N     1 
ATOM   4664 C  CA    . PHE C 3  522 ? 33.823 81.326  45.078 1.00 33.80  ? 528  PHE A CA    1 
ATOM   4665 C  C     . PHE C 3  522 ? 34.388 82.649  44.577 1.00 34.30  ? 528  PHE A C     1 
ATOM   4666 O  O     . PHE C 3  522 ? 34.246 83.001  43.405 1.00 34.15  ? 528  PHE A O     1 
ATOM   4667 C  CB    . PHE C 3  522 ? 32.703 81.611  46.080 1.00 34.23  ? 528  PHE A CB    1 
ATOM   4668 C  CG    . PHE C 3  522 ? 31.945 82.879  45.797 1.00 35.48  ? 528  PHE A CG    1 
ATOM   4669 C  CD1   . PHE C 3  522 ? 31.065 82.958  44.724 1.00 36.12  ? 528  PHE A CD1   1 
ATOM   4670 C  CD2   . PHE C 3  522 ? 32.128 84.000  46.597 1.00 34.31  ? 528  PHE A CD2   1 
ATOM   4671 C  CE1   . PHE C 3  522 ? 30.372 84.144  44.449 1.00 37.41  ? 528  PHE A CE1   1 
ATOM   4672 C  CE2   . PHE C 3  522 ? 31.443 85.190  46.333 1.00 37.04  ? 528  PHE A CE2   1 
ATOM   4673 C  CZ    . PHE C 3  522 ? 30.561 85.262  45.255 1.00 35.91  ? 528  PHE A CZ    1 
ATOM   4674 N  N     . LEU C 3  523 ? 35.024 83.387  45.479 1.00 34.76  ? 529  LEU A N     1 
ATOM   4675 C  CA    . LEU C 3  523 ? 35.596 84.677  45.125 1.00 35.62  ? 529  LEU A CA    1 
ATOM   4676 C  C     . LEU C 3  523 ? 36.519 84.612  43.908 1.00 36.12  ? 529  LEU A C     1 
ATOM   4677 O  O     . LEU C 3  523 ? 36.541 85.535  43.091 1.00 35.76  ? 529  LEU A O     1 
ATOM   4678 C  CB    . LEU C 3  523 ? 36.369 85.255  46.311 1.00 33.98  ? 529  LEU A CB    1 
ATOM   4679 C  CG    . LEU C 3  523 ? 37.012 86.622  46.059 1.00 32.70  ? 529  LEU A CG    1 
ATOM   4680 C  CD1   . LEU C 3  523 ? 35.936 87.635  45.713 1.00 30.99  ? 529  LEU A CD1   1 
ATOM   4681 C  CD2   . LEU C 3  523 ? 37.782 87.062  47.299 1.00 30.71  ? 529  LEU A CD2   1 
ATOM   4682 N  N     . TYR C 3  524 ? 37.266 83.521  43.770 1.00 36.07  ? 530  TYR A N     1 
ATOM   4683 C  CA    . TYR C 3  524 ? 38.196 83.408  42.655 1.00 37.29  ? 530  TYR A CA    1 
ATOM   4684 C  C     . TYR C 3  524 ? 37.786 82.563  41.433 1.00 39.04  ? 530  TYR A C     1 
ATOM   4685 O  O     . TYR C 3  524 ? 38.626 81.906  40.815 1.00 39.41  ? 530  TYR A O     1 
ATOM   4686 C  CB    . TYR C 3  524 ? 39.559 82.956  43.187 1.00 35.66  ? 530  TYR A CB    1 
ATOM   4687 C  CG    . TYR C 3  524 ? 40.143 83.915  44.210 1.00 36.00  ? 530  TYR A CG    1 
ATOM   4688 C  CD1   . TYR C 3  524 ? 40.254 85.278  43.932 1.00 35.03  ? 530  TYR A CD1   1 
ATOM   4689 C  CD2   . TYR C 3  524 ? 40.599 83.458  45.448 1.00 34.84  ? 530  TYR A CD2   1 
ATOM   4690 C  CE1   . TYR C 3  524 ? 40.808 86.165  44.859 1.00 35.62  ? 530  TYR A CE1   1 
ATOM   4691 C  CE2   . TYR C 3  524 ? 41.153 84.335  46.383 1.00 36.35  ? 530  TYR A CE2   1 
ATOM   4692 C  CZ    . TYR C 3  524 ? 41.256 85.686  46.081 1.00 36.43  ? 530  TYR A CZ    1 
ATOM   4693 O  OH    . TYR C 3  524 ? 41.811 86.548  46.996 1.00 36.59  ? 530  TYR A OH    1 
ATOM   4694 N  N     . GLY C 3  525 ? 36.497 82.573  41.096 1.00 40.09  ? 531  GLY A N     1 
ATOM   4695 C  CA    . GLY C 3  525 ? 36.029 81.867  39.910 1.00 40.34  ? 531  GLY A CA    1 
ATOM   4696 C  C     . GLY C 3  525 ? 35.665 80.389  39.869 1.00 40.24  ? 531  GLY A C     1 
ATOM   4697 O  O     . GLY C 3  525 ? 35.565 79.831  38.776 1.00 40.31  ? 531  GLY A O     1 
ATOM   4698 N  N     . ALA C 3  526 ? 35.463 79.743  41.012 1.00 40.20  ? 532  ALA A N     1 
ATOM   4699 C  CA    . ALA C 3  526 ? 35.090 78.330  40.998 1.00 40.04  ? 532  ALA A CA    1 
ATOM   4700 C  C     . ALA C 3  526 ? 33.732 78.171  40.309 1.00 41.24  ? 532  ALA A C     1 
ATOM   4701 O  O     . ALA C 3  526 ? 32.835 78.996  40.488 1.00 39.95  ? 532  ALA A O     1 
ATOM   4702 C  CB    . ALA C 3  526 ? 35.023 77.787  42.412 1.00 37.20  ? 532  ALA A CB    1 
ATOM   4703 N  N     . GLY C 3  527 ? 33.589 77.114  39.513 1.00 43.61  ? 533  GLY A N     1 
ATOM   4704 C  CA    . GLY C 3  527 ? 32.337 76.874  38.814 1.00 44.66  ? 533  GLY A CA    1 
ATOM   4705 C  C     . GLY C 3  527 ? 31.262 76.349  39.746 1.00 45.62  ? 533  GLY A C     1 
ATOM   4706 O  O     . GLY C 3  527 ? 31.555 75.998  40.890 1.00 44.98  ? 533  GLY A O     1 
ATOM   4707 N  N     . ASP C 3  528 ? 30.020 76.293  39.269 1.00 47.64  ? 534  ASP A N     1 
ATOM   4708 C  CA    . ASP C 3  528 ? 28.913 75.802  40.089 1.00 49.01  ? 534  ASP A CA    1 
ATOM   4709 C  C     . ASP C 3  528 ? 29.225 74.425  40.668 1.00 48.25  ? 534  ASP A C     1 
ATOM   4710 O  O     . ASP C 3  528 ? 28.959 74.154  41.840 1.00 49.12  ? 534  ASP A O     1 
ATOM   4711 C  CB    . ASP C 3  528 ? 27.617 75.723  39.268 1.00 51.01  ? 534  ASP A CB    1 
ATOM   4712 C  CG    . ASP C 3  528 ? 27.066 77.092  38.899 1.00 53.65  ? 534  ASP A CG    1 
ATOM   4713 O  OD1   . ASP C 3  528 ? 26.978 77.967  39.787 1.00 54.42  ? 534  ASP A OD1   1 
ATOM   4714 O  OD2   . ASP C 3  528 ? 26.701 77.290  37.720 1.00 56.47  ? 534  ASP A OD2   1 
ATOM   4715 N  N     . GLU C 3  529 ? 29.802 73.561  39.841 1.00 48.36  ? 535  GLU A N     1 
ATOM   4716 C  CA    . GLU C 3  529 ? 30.139 72.210  40.268 1.00 48.50  ? 535  GLU A CA    1 
ATOM   4717 C  C     . GLU C 3  529 ? 31.263 72.170  41.292 1.00 46.81  ? 535  GLU A C     1 
ATOM   4718 O  O     . GLU C 3  529 ? 31.139 71.509  42.324 1.00 46.68  ? 535  GLU A O     1 
ATOM   4719 C  CB    . GLU C 3  529 ? 30.510 71.349  39.058 1.00 50.26  ? 535  GLU A CB    1 
ATOM   4720 C  CG    . GLU C 3  529 ? 30.835 69.906  39.413 1.00 54.66  ? 535  GLU A CG    1 
ATOM   4721 C  CD    . GLU C 3  529 ? 30.510 68.938  38.289 1.00 57.22  ? 535  GLU A CD    1 
ATOM   4722 O  OE1   . GLU C 3  529 ? 29.317 68.840  37.922 1.00 58.05  ? 535  GLU A OE1   1 
ATOM   4723 O  OE2   . GLU C 3  529 ? 31.441 68.276  37.774 1.00 58.11  ? 535  GLU A OE2   1 
ATOM   4724 N  N     . LYS C 3  530 ? 32.359 72.868  41.011 1.00 44.56  ? 536  LYS A N     1 
ATOM   4725 C  CA    . LYS C 3  530 ? 33.482 72.884  41.937 1.00 43.82  ? 536  LYS A CA    1 
ATOM   4726 C  C     . LYS C 3  530 ? 33.016 73.376  43.299 1.00 43.03  ? 536  LYS A C     1 
ATOM   4727 O  O     . LYS C 3  530 ? 33.416 72.837  44.330 1.00 41.70  ? 536  LYS A O     1 
ATOM   4728 C  CB    . LYS C 3  530 ? 34.611 73.783  41.416 1.00 44.48  ? 536  LYS A CB    1 
ATOM   4729 C  CG    . LYS C 3  530 ? 35.814 73.844  42.348 1.00 45.01  ? 536  LYS A CG    1 
ATOM   4730 C  CD    . LYS C 3  530 ? 36.342 72.445  42.651 1.00 45.09  ? 536  LYS A CD    1 
ATOM   4731 C  CE    . LYS C 3  530 ? 37.416 72.462  43.723 1.00 47.17  ? 536  LYS A CE    1 
ATOM   4732 N  NZ    . LYS C 3  530 ? 38.643 73.185  43.286 1.00 48.48  ? 536  LYS A NZ    1 
ATOM   4733 N  N     . ILE C 3  531 ? 32.170 74.401  43.301 1.00 43.41  ? 537  ILE A N     1 
ATOM   4734 C  CA    . ILE C 3  531 ? 31.647 74.940  44.551 1.00 44.65  ? 537  ILE A CA    1 
ATOM   4735 C  C     . ILE C 3  531 ? 30.926 73.815  45.287 1.00 46.39  ? 537  ILE A C     1 
ATOM   4736 O  O     . ILE C 3  531 ? 31.080 73.650  46.497 1.00 47.02  ? 537  ILE A O     1 
ATOM   4737 C  CB    . ILE C 3  531 ? 30.660 76.097  44.297 1.00 43.60  ? 537  ILE A CB    1 
ATOM   4738 C  CG1   . ILE C 3  531 ? 31.413 77.312  43.746 1.00 44.76  ? 537  ILE A CG1   1 
ATOM   4739 C  CG2   . ILE C 3  531 ? 29.933 76.459  45.579 1.00 41.76  ? 537  ILE A CG2   1 
ATOM   4740 C  CD1   . ILE C 3  531 ? 32.394 77.933  44.728 1.00 43.46  ? 537  ILE A CD1   1 
ATOM   4741 N  N     . GLY C 3  532 ? 30.149 73.035  44.544 1.00 47.38  ? 538  GLY A N     1 
ATOM   4742 C  CA    . GLY C 3  532 ? 29.426 71.932  45.147 1.00 48.77  ? 538  GLY A CA    1 
ATOM   4743 C  C     . GLY C 3  532 ? 30.369 70.955  45.820 1.00 49.48  ? 538  GLY A C     1 
ATOM   4744 O  O     . GLY C 3  532 ? 30.173 70.587  46.980 1.00 49.61  ? 538  GLY A O     1 
ATOM   4745 N  N     . GLN C 3  533 ? 31.400 70.539  45.094 1.00 49.69  ? 539  GLN A N     1 
ATOM   4746 C  CA    . GLN C 3  533 ? 32.377 69.594  45.623 1.00 50.82  ? 539  GLN A CA    1 
ATOM   4747 C  C     . GLN C 3  533 ? 32.945 70.066  46.959 1.00 50.73  ? 539  GLN A C     1 
ATOM   4748 O  O     . GLN C 3  533 ? 33.044 69.290  47.911 1.00 50.80  ? 539  GLN A O     1 
ATOM   4749 C  CB    . GLN C 3  533 ? 33.518 69.405  44.624 1.00 51.42  ? 539  GLN A CB    1 
ATOM   4750 C  CG    . GLN C 3  533 ? 34.618 68.492  45.124 1.00 54.59  ? 539  GLN A CG    1 
ATOM   4751 C  CD    . GLN C 3  533 ? 35.892 68.629  44.322 1.00 56.53  ? 539  GLN A CD    1 
ATOM   4752 O  OE1   . GLN C 3  533 ? 35.902 68.416  43.110 1.00 57.63  ? 539  GLN A OE1   1 
ATOM   4753 N  NE2   . GLN C 3  533 ? 36.980 68.990  44.998 1.00 58.07  ? 539  GLN A NE2   1 
ATOM   4754 N  N     . ILE C 3  534 ? 33.318 71.342  47.014 1.00 50.92  ? 540  ILE A N     1 
ATOM   4755 C  CA    . ILE C 3  534 ? 33.884 71.951  48.214 1.00 50.65  ? 540  ILE A CA    1 
ATOM   4756 C  C     . ILE C 3  534 ? 32.933 71.905  49.411 1.00 50.53  ? 540  ILE A C     1 
ATOM   4757 O  O     . ILE C 3  534 ? 33.368 71.746  50.549 1.00 49.63  ? 540  ILE A O     1 
ATOM   4758 C  CB    . ILE C 3  534 ? 34.274 73.429  47.948 1.00 50.72  ? 540  ILE A CB    1 
ATOM   4759 C  CG1   . ILE C 3  534 ? 35.422 73.492  46.938 1.00 50.24  ? 540  ILE A CG1   1 
ATOM   4760 C  CG2   . ILE C 3  534 ? 34.670 74.112  49.251 1.00 51.55  ? 540  ILE A CG2   1 
ATOM   4761 C  CD1   . ILE C 3  534 ? 35.829 74.899  46.560 1.00 49.93  ? 540  ILE A CD1   1 
ATOM   4762 N  N     . VAL C 3  535 ? 31.638 72.056  49.156 1.00 51.10  ? 541  VAL A N     1 
ATOM   4763 C  CA    . VAL C 3  535 ? 30.653 72.030  50.233 1.00 52.71  ? 541  VAL A CA    1 
ATOM   4764 C  C     . VAL C 3  535 ? 30.006 70.656  50.363 1.00 53.13  ? 541  VAL A C     1 
ATOM   4765 O  O     . VAL C 3  535 ? 29.095 70.466  51.165 1.00 53.35  ? 541  VAL A O     1 
ATOM   4766 C  CB    . VAL C 3  535 ? 29.540 73.075  50.002 1.00 53.36  ? 541  VAL A CB    1 
ATOM   4767 C  CG1   . VAL C 3  535 ? 30.154 74.463  49.858 1.00 52.61  ? 541  VAL A CG1   1 
ATOM   4768 C  CG2   . VAL C 3  535 ? 28.725 72.709  48.765 1.00 53.22  ? 541  VAL A CG2   1 
ATOM   4769 N  N     . GLY C 3  536 ? 30.484 69.704  49.568 1.00 54.23  ? 542  GLY A N     1 
ATOM   4770 C  CA    . GLY C 3  536 ? 29.942 68.358  49.607 1.00 56.11  ? 542  GLY A CA    1 
ATOM   4771 C  C     . GLY C 3  536 ? 28.509 68.286  49.116 1.00 57.15  ? 542  GLY A C     1 
ATOM   4772 O  O     . GLY C 3  536 ? 27.637 67.764  49.811 1.00 57.77  ? 542  GLY A O     1 
ATOM   4773 N  N     . ALA C 3  537 ? 28.263 68.810  47.918 1.00 57.66  ? 543  ALA A N     1 
ATOM   4774 C  CA    . ALA C 3  537 ? 26.925 68.806  47.335 1.00 58.37  ? 543  ALA A CA    1 
ATOM   4775 C  C     . ALA C 3  537 ? 27.004 68.734  45.815 1.00 59.08  ? 543  ALA A C     1 
ATOM   4776 O  O     . ALA C 3  537 ? 28.028 68.333  45.260 1.00 59.04  ? 543  ALA A O     1 
ATOM   4777 C  CB    . ALA C 3  537 ? 26.163 70.056  47.764 1.00 57.46  ? 543  ALA A CB    1 
ATOM   4778 N  N     . GLY C 3  538 ? 25.921 69.124  45.149 1.00 60.15  ? 544  GLY A N     1 
ATOM   4779 C  CA    . GLY C 3  538 ? 25.894 69.092  43.698 1.00 61.32  ? 544  GLY A CA    1 
ATOM   4780 C  C     . GLY C 3  538 ? 26.097 70.458  43.069 1.00 62.74  ? 544  GLY A C     1 
ATOM   4781 O  O     . GLY C 3  538 ? 26.400 71.435  43.760 1.00 62.72  ? 544  GLY A O     1 
ATOM   4782 N  N     . LYS C 3  539 ? 25.932 70.528  41.751 1.00 63.32  ? 545  LYS A N     1 
ATOM   4783 C  CA    . LYS C 3  539 ? 26.100 71.784  41.030 1.00 63.73  ? 545  LYS A CA    1 
ATOM   4784 C  C     . LYS C 3  539 ? 24.944 72.736  41.320 1.00 63.49  ? 545  LYS A C     1 
ATOM   4785 O  O     . LYS C 3  539 ? 25.081 73.954  41.180 1.00 63.38  ? 545  LYS A O     1 
ATOM   4786 C  CB    . LYS C 3  539 ? 26.187 71.528  39.523 1.00 63.76  ? 545  LYS A CB    1 
ATOM   4787 C  CG    . LYS C 3  539 ? 24.926 70.936  38.923 1.00 66.08  ? 545  LYS A CG    1 
ATOM   4788 C  CD    . LYS C 3  539 ? 24.955 70.987  37.400 1.00 68.26  ? 545  LYS A CD    1 
ATOM   4789 C  CE    . LYS C 3  539 ? 23.674 70.413  36.800 1.00 69.31  ? 545  LYS A CE    1 
ATOM   4790 N  NZ    . LYS C 3  539 ? 22.450 71.114  37.290 1.00 69.42  ? 545  LYS A NZ    1 
ATOM   4791 N  N     . GLU C 3  540 ? 23.807 72.176  41.725 1.00 63.06  ? 546  GLU A N     1 
ATOM   4792 C  CA    . GLU C 3  540 ? 22.626 72.977  42.030 1.00 63.06  ? 546  GLU A CA    1 
ATOM   4793 C  C     . GLU C 3  540 ? 22.894 73.776  43.296 1.00 61.84  ? 546  GLU A C     1 
ATOM   4794 O  O     . GLU C 3  540 ? 22.560 74.957  43.383 1.00 61.09  ? 546  GLU A O     1 
ATOM   4795 C  CB    . GLU C 3  540 ? 21.401 72.086  42.254 1.00 64.45  ? 546  GLU A CB    1 
ATOM   4796 C  CG    . GLU C 3  540 ? 21.379 70.798  41.446 1.00 67.81  ? 546  GLU A CG    1 
ATOM   4797 C  CD    . GLU C 3  540 ? 22.430 69.801  41.912 1.00 69.53  ? 546  GLU A CD    1 
ATOM   4798 O  OE1   . GLU C 3  540 ? 22.611 69.662  43.144 1.00 69.88  ? 546  GLU A OE1   1 
ATOM   4799 O  OE2   . GLU C 3  540 ? 23.065 69.152  41.049 1.00 70.32  ? 546  GLU A OE2   1 
ATOM   4800 N  N     . ARG C 3  541 ? 23.485 73.111  44.283 1.00 61.10  ? 547  ARG A N     1 
ATOM   4801 C  CA    . ARG C 3  541 ? 23.817 73.751  45.548 1.00 60.87  ? 547  ARG A CA    1 
ATOM   4802 C  C     . ARG C 3  541 ? 24.922 74.768  45.270 1.00 61.16  ? 547  ARG A C     1 
ATOM   4803 O  O     . ARG C 3  541 ? 25.022 75.798  45.938 1.00 59.83  ? 547  ARG A O     1 
ATOM   4804 C  CB    . ARG C 3  541 ? 24.291 72.700  46.557 1.00 60.41  ? 547  ARG A CB    1 
ATOM   4805 C  CG    . ARG C 3  541 ? 24.713 73.257  47.902 1.00 60.23  ? 547  ARG A CG    1 
ATOM   4806 C  CD    . ARG C 3  541 ? 23.593 74.044  48.559 1.00 61.23  ? 547  ARG A CD    1 
ATOM   4807 N  NE    . ARG C 3  541 ? 24.001 74.577  49.855 1.00 61.70  ? 547  ARG A NE    1 
ATOM   4808 C  CZ    . ARG C 3  541 ? 23.284 75.439  50.569 1.00 63.18  ? 547  ARG A CZ    1 
ATOM   4809 N  NH1   . ARG C 3  541 ? 22.115 75.874  50.114 1.00 63.64  ? 547  ARG A NH1   1 
ATOM   4810 N  NH2   . ARG C 3  541 ? 23.738 75.870  51.739 1.00 63.41  ? 547  ARG A NH2   1 
ATOM   4811 N  N     . GLY C 3  542 ? 25.747 74.465  44.271 1.00 61.42  ? 548  GLY A N     1 
ATOM   4812 C  CA    . GLY C 3  542 ? 26.821 75.364  43.898 1.00 61.54  ? 548  GLY A CA    1 
ATOM   4813 C  C     . GLY C 3  542 ? 26.232 76.669  43.400 1.00 61.59  ? 548  GLY A C     1 
ATOM   4814 O  O     . GLY C 3  542 ? 26.645 77.747  43.827 1.00 60.51  ? 548  GLY A O     1 
ATOM   4815 N  N     . LYS C 3  543 ? 25.255 76.569  42.501 1.00 62.05  ? 549  LYS A N     1 
ATOM   4816 C  CA    . LYS C 3  543 ? 24.597 77.746  41.940 1.00 62.94  ? 549  LYS A CA    1 
ATOM   4817 C  C     . LYS C 3  543 ? 23.948 78.604  43.019 1.00 62.19  ? 549  LYS A C     1 
ATOM   4818 O  O     . LYS C 3  543 ? 24.049 79.830  42.988 1.00 61.48  ? 549  LYS A O     1 
ATOM   4819 C  CB    . LYS C 3  543 ? 23.527 77.332  40.927 1.00 64.46  ? 549  LYS A CB    1 
ATOM   4820 C  CG    . LYS C 3  543 ? 24.062 76.671  39.669 1.00 66.76  ? 549  LYS A CG    1 
ATOM   4821 C  CD    . LYS C 3  543 ? 22.934 76.374  38.687 1.00 68.05  ? 549  LYS A CD    1 
ATOM   4822 C  CE    . LYS C 3  543 ? 22.210 77.648  38.259 1.00 68.40  ? 549  LYS A CE    1 
ATOM   4823 N  NZ    . LYS C 3  543 ? 21.073 77.361  37.335 1.00 68.83  ? 549  LYS A NZ    1 
ATOM   4824 N  N     . GLU C 3  544 ? 23.278 77.957  43.967 1.00 61.90  ? 550  GLU A N     1 
ATOM   4825 C  CA    . GLU C 3  544 ? 22.610 78.673  45.048 1.00 62.57  ? 550  GLU A CA    1 
ATOM   4826 C  C     . GLU C 3  544 ? 23.569 79.597  45.787 1.00 60.65  ? 550  GLU A C     1 
ATOM   4827 O  O     . GLU C 3  544 ? 23.293 80.786  45.943 1.00 59.64  ? 550  GLU A O     1 
ATOM   4828 C  CB    . GLU C 3  544 ? 21.993 77.693  46.049 1.00 65.36  ? 550  GLU A CB    1 
ATOM   4829 C  CG    . GLU C 3  544 ? 20.843 76.862  45.510 1.00 68.81  ? 550  GLU A CG    1 
ATOM   4830 C  CD    . GLU C 3  544 ? 20.287 75.909  46.554 1.00 71.33  ? 550  GLU A CD    1 
ATOM   4831 O  OE1   . GLU C 3  544 ? 19.824 76.390  47.613 1.00 72.27  ? 550  GLU A OE1   1 
ATOM   4832 O  OE2   . GLU C 3  544 ? 20.317 74.680  46.319 1.00 71.89  ? 550  GLU A OE2   1 
ATOM   4833 N  N     . LEU C 3  545 ? 24.690 79.042  46.245 1.00 59.37  ? 551  LEU A N     1 
ATOM   4834 C  CA    . LEU C 3  545 ? 25.693 79.812  46.977 1.00 58.42  ? 551  LEU A CA    1 
ATOM   4835 C  C     . LEU C 3  545 ? 26.339 80.912  46.135 1.00 57.65  ? 551  LEU A C     1 
ATOM   4836 O  O     . LEU C 3  545 ? 26.636 81.993  46.644 1.00 56.90  ? 551  LEU A O     1 
ATOM   4837 C  CB    . LEU C 3  545 ? 26.783 78.886  47.531 1.00 57.42  ? 551  LEU A CB    1 
ATOM   4838 C  CG    . LEU C 3  545 ? 26.535 78.098  48.826 1.00 56.73  ? 551  LEU A CG    1 
ATOM   4839 C  CD1   . LEU C 3  545 ? 25.248 78.553  49.490 1.00 55.91  ? 551  LEU A CD1   1 
ATOM   4840 C  CD2   . LEU C 3  545 ? 26.493 76.612  48.519 1.00 55.63  ? 551  LEU A CD2   1 
ATOM   4841 N  N     . LYS C 3  546 ? 26.557 80.632  44.854 1.00 57.09  ? 552  LYS A N     1 
ATOM   4842 C  CA    . LYS C 3  546 ? 27.157 81.601  43.944 1.00 57.62  ? 552  LYS A CA    1 
ATOM   4843 C  C     . LYS C 3  546 ? 26.329 82.886  43.904 1.00 57.79  ? 552  LYS A C     1 
ATOM   4844 O  O     . LYS C 3  546 ? 26.824 83.970  44.223 1.00 56.99  ? 552  LYS A O     1 
ATOM   4845 C  CB    . LYS C 3  546 ? 27.246 81.011  42.533 1.00 58.28  ? 552  LYS A CB    1 
ATOM   4846 C  CG    . LYS C 3  546 ? 28.139 79.780  42.407 1.00 59.30  ? 552  LYS A CG    1 
ATOM   4847 C  CD    . LYS C 3  546 ? 29.590 80.156  42.179 1.00 58.92  ? 552  LYS A CD    1 
ATOM   4848 C  CE    . LYS C 3  546 ? 29.762 80.909  40.864 1.00 58.67  ? 552  LYS A CE    1 
ATOM   4849 N  NZ    . LYS C 3  546 ? 29.440 80.076  39.675 1.00 57.37  ? 552  LYS A NZ    1 
ATOM   4850 N  N     . LYS C 3  547 ? 25.065 82.758  43.510 1.00 57.82  ? 553  LYS A N     1 
ATOM   4851 C  CA    . LYS C 3  547 ? 24.164 83.904  43.421 1.00 58.29  ? 553  LYS A CA    1 
ATOM   4852 C  C     . LYS C 3  547 ? 23.845 84.496  44.795 1.00 56.96  ? 553  LYS A C     1 
ATOM   4853 O  O     . LYS C 3  547 ? 23.667 85.707  44.934 1.00 56.15  ? 553  LYS A O     1 
ATOM   4854 C  CB    . LYS C 3  547 ? 22.867 83.491  42.713 1.00 60.02  ? 553  LYS A CB    1 
ATOM   4855 C  CG    . LYS C 3  547 ? 22.220 82.238  43.293 1.00 63.40  ? 553  LYS A CG    1 
ATOM   4856 C  CD    . LYS C 3  547 ? 21.106 81.682  42.399 1.00 65.19  ? 553  LYS A CD    1 
ATOM   4857 C  CE    . LYS C 3  547 ? 19.785 82.434  42.558 1.00 65.87  ? 553  LYS A CE    1 
ATOM   4858 N  NZ    . LYS C 3  547 ? 19.853 83.854  42.117 1.00 66.99  ? 553  LYS A NZ    1 
ATOM   4859 N  N     . LYS C 3  548 ? 23.788 83.633  45.806 1.00 55.19  ? 554  LYS A N     1 
ATOM   4860 C  CA    . LYS C 3  548 ? 23.481 84.046  47.171 1.00 54.00  ? 554  LYS A CA    1 
ATOM   4861 C  C     . LYS C 3  548 ? 24.542 84.987  47.745 1.00 53.84  ? 554  LYS A C     1 
ATOM   4862 O  O     . LYS C 3  548 ? 24.224 85.893  48.519 1.00 53.29  ? 554  LYS A O     1 
ATOM   4863 C  CB    . LYS C 3  548 ? 23.340 82.803  48.054 1.00 54.93  ? 554  LYS A CB    1 
ATOM   4864 C  CG    . LYS C 3  548 ? 22.619 83.012  49.376 1.00 57.12  ? 554  LYS A CG    1 
ATOM   4865 C  CD    . LYS C 3  548 ? 23.529 83.607  50.432 1.00 59.56  ? 554  LYS A CD    1 
ATOM   4866 C  CE    . LYS C 3  548 ? 22.826 83.707  51.776 1.00 60.61  ? 554  LYS A CE    1 
ATOM   4867 N  NZ    . LYS C 3  548 ? 23.727 84.282  52.815 1.00 62.41  ? 554  LYS A NZ    1 
ATOM   4868 N  N     . PHE C 3  549 ? 25.800 84.776  47.369 1.00 52.80  ? 555  PHE A N     1 
ATOM   4869 C  CA    . PHE C 3  549 ? 26.878 85.626  47.863 1.00 51.70  ? 555  PHE A CA    1 
ATOM   4870 C  C     . PHE C 3  549 ? 27.186 86.790  46.930 1.00 51.66  ? 555  PHE A C     1 
ATOM   4871 O  O     . PHE C 3  549 ? 27.706 87.818  47.367 1.00 50.40  ? 555  PHE A O     1 
ATOM   4872 C  CB    . PHE C 3  549 ? 28.146 84.803  48.119 1.00 50.02  ? 555  PHE A CB    1 
ATOM   4873 C  CG    . PHE C 3  549 ? 28.133 84.066  49.433 1.00 49.06  ? 555  PHE A CG    1 
ATOM   4874 C  CD1   . PHE C 3  549 ? 27.450 82.859  49.570 1.00 48.75  ? 555  PHE A CD1   1 
ATOM   4875 C  CD2   . PHE C 3  549 ? 28.773 84.603  50.549 1.00 48.27  ? 555  PHE A CD2   1 
ATOM   4876 C  CE1   . PHE C 3  549 ? 27.403 82.198  50.801 1.00 46.96  ? 555  PHE A CE1   1 
ATOM   4877 C  CE2   . PHE C 3  549 ? 28.732 83.953  51.780 1.00 46.74  ? 555  PHE A CE2   1 
ATOM   4878 C  CZ    . PHE C 3  549 ? 28.044 82.746  51.906 1.00 47.76  ? 555  PHE A CZ    1 
ATOM   4879 N  N     . LEU C 3  550 ? 26.865 86.635  45.649 1.00 52.70  ? 556  LEU A N     1 
ATOM   4880 C  CA    . LEU C 3  550 ? 27.104 87.708  44.691 1.00 54.47  ? 556  LEU A CA    1 
ATOM   4881 C  C     . LEU C 3  550 ? 26.098 88.825  44.967 1.00 55.34  ? 556  LEU A C     1 
ATOM   4882 O  O     . LEU C 3  550 ? 26.442 90.010  44.938 1.00 54.82  ? 556  LEU A O     1 
ATOM   4883 C  CB    . LEU C 3  550 ? 26.932 87.209  43.256 1.00 54.33  ? 556  LEU A CB    1 
ATOM   4884 C  CG    . LEU C 3  550 ? 27.611 88.088  42.201 1.00 55.76  ? 556  LEU A CG    1 
ATOM   4885 C  CD1   . LEU C 3  550 ? 29.100 87.756  42.154 1.00 55.46  ? 556  LEU A CD1   1 
ATOM   4886 C  CD2   . LEU C 3  550 ? 26.983 87.856  40.839 1.00 56.07  ? 556  LEU A CD2   1 
ATOM   4887 N  N     . GLU C 3  551 ? 24.852 88.439  45.239 1.00 56.35  ? 557  GLU A N     1 
ATOM   4888 C  CA    . GLU C 3  551 ? 23.798 89.407  45.534 1.00 57.49  ? 557  GLU A CA    1 
ATOM   4889 C  C     . GLU C 3  551 ? 24.164 90.211  46.770 1.00 56.81  ? 557  GLU A C     1 
ATOM   4890 O  O     . GLU C 3  551 ? 24.058 91.438  46.782 1.00 56.38  ? 557  GLU A O     1 
ATOM   4891 C  CB    . GLU C 3  551 ? 22.462 88.705  45.790 1.00 60.63  ? 557  GLU A CB    1 
ATOM   4892 C  CG    . GLU C 3  551 ? 21.538 88.611  44.587 1.00 64.52  ? 557  GLU A CG    1 
ATOM   4893 C  CD    . GLU C 3  551 ? 21.908 87.488  43.643 1.00 67.07  ? 557  GLU A CD    1 
ATOM   4894 O  OE1   . GLU C 3  551 ? 23.034 87.511  43.098 1.00 67.79  ? 557  GLU A OE1   1 
ATOM   4895 O  OE2   . GLU C 3  551 ? 21.065 86.580  43.448 1.00 67.60  ? 557  GLU A OE2   1 
ATOM   4896 N  N     . ASN C 3  552 ? 24.584 89.501  47.812 1.00 56.12  ? 558  ASN A N     1 
ATOM   4897 C  CA    . ASN C 3  552 ? 24.971 90.122  49.070 1.00 56.06  ? 558  ASN A CA    1 
ATOM   4898 C  C     . ASN C 3  552 ? 25.937 91.287  48.829 1.00 54.45  ? 558  ASN A C     1 
ATOM   4899 O  O     . ASN C 3  552 ? 25.801 92.348  49.440 1.00 54.39  ? 558  ASN A O     1 
ATOM   4900 C  CB    . ASN C 3  552 ? 25.602 89.070  49.992 1.00 57.67  ? 558  ASN A CB    1 
ATOM   4901 C  CG    . ASN C 3  552 ? 25.914 89.613  51.375 1.00 60.75  ? 558  ASN A CG    1 
ATOM   4902 O  OD1   . ASN C 3  552 ? 25.076 90.263  52.005 1.00 61.07  ? 558  ASN A OD1   1 
ATOM   4903 N  ND2   . ASN C 3  552 ? 27.123 89.335  51.862 1.00 62.02  ? 558  ASN A ND2   1 
ATOM   4904 N  N     . THR C 3  553 ? 26.904 91.093  47.935 1.00 52.58  ? 559  THR A N     1 
ATOM   4905 C  CA    . THR C 3  553 ? 27.863 92.151  47.620 1.00 51.13  ? 559  THR A CA    1 
ATOM   4906 C  C     . THR C 3  553 ? 28.093 92.267  46.111 1.00 47.64  ? 559  THR A C     1 
ATOM   4907 O  O     . THR C 3  553 ? 29.045 91.704  45.571 1.00 46.86  ? 559  THR A O     1 
ATOM   4908 C  CB    . THR C 3  553 ? 29.236 91.925  48.332 1.00 52.32  ? 559  THR A CB    1 
ATOM   4909 O  OG1   . THR C 3  553 ? 29.850 90.724  47.848 1.00 54.36  ? 559  THR A OG1   1 
ATOM   4910 C  CG2   . THR C 3  553 ? 29.044 91.808  49.837 1.00 53.88  ? 559  THR A CG2   1 
ATOM   4911 N  N     . PRO C 3  554 ? 27.213 93.004  45.413 1.00 45.21  ? 560  PRO A N     1 
ATOM   4912 C  CA    . PRO C 3  554 ? 27.306 93.206  43.962 1.00 43.45  ? 560  PRO A CA    1 
ATOM   4913 C  C     . PRO C 3  554 ? 28.500 94.048  43.502 1.00 42.76  ? 560  PRO A C     1 
ATOM   4914 O  O     . PRO C 3  554 ? 28.747 94.185  42.300 1.00 44.47  ? 560  PRO A O     1 
ATOM   4915 C  CB    . PRO C 3  554 ? 25.968 93.860  43.619 1.00 43.23  ? 560  PRO A CB    1 
ATOM   4916 C  CG    . PRO C 3  554 ? 25.639 94.620  44.856 1.00 42.01  ? 560  PRO A CG    1 
ATOM   4917 C  CD    . PRO C 3  554 ? 26.002 93.648  45.953 1.00 44.15  ? 560  PRO A CD    1 
ATOM   4918 N  N     . ALA C 3  555 ? 29.235 94.620  44.449 1.00 38.89  ? 561  ALA A N     1 
ATOM   4919 C  CA    . ALA C 3  555 ? 30.400 95.423  44.100 1.00 35.42  ? 561  ALA A CA    1 
ATOM   4920 C  C     . ALA C 3  555 ? 31.492 94.481  43.611 1.00 33.67  ? 561  ALA A C     1 
ATOM   4921 O  O     . ALA C 3  555 ? 32.456 94.910  42.978 1.00 32.20  ? 561  ALA A O     1 
ATOM   4922 C  CB    . ALA C 3  555 ? 30.885 96.206  45.308 1.00 36.13  ? 561  ALA A CB    1 
ATOM   4923 N  N     . ILE C 3  556 ? 31.335 93.193  43.909 1.00 30.85  ? 562  ILE A N     1 
ATOM   4924 C  CA    . ILE C 3  556 ? 32.307 92.199  43.480 1.00 31.37  ? 562  ILE A CA    1 
ATOM   4925 C  C     . ILE C 3  556 ? 32.311 92.187  41.956 1.00 33.00  ? 562  ILE A C     1 
ATOM   4926 O  O     . ILE C 3  556 ? 33.369 92.183  41.322 1.00 33.03  ? 562  ILE A O     1 
ATOM   4927 C  CB    . ILE C 3  556 ? 31.950 90.786  43.999 1.00 30.24  ? 562  ILE A CB    1 
ATOM   4928 C  CG1   . ILE C 3  556 ? 32.037 90.754  45.532 1.00 30.28  ? 562  ILE A CG1   1 
ATOM   4929 C  CG2   . ILE C 3  556 ? 32.892 89.756  43.403 1.00 29.15  ? 562  ILE A CG2   1 
ATOM   4930 C  CD1   . ILE C 3  556 ? 31.766 89.385  46.141 1.00 25.35  ? 562  ILE A CD1   1 
ATOM   4931 N  N     . ALA C 3  557 ? 31.119 92.192  41.370 1.00 32.71  ? 563  ALA A N     1 
ATOM   4932 C  CA    . ALA C 3  557 ? 30.996 92.195  39.918 1.00 33.27  ? 563  ALA A CA    1 
ATOM   4933 C  C     . ALA C 3  557 ? 31.615 93.474  39.357 1.00 32.02  ? 563  ALA A C     1 
ATOM   4934 O  O     . ALA C 3  557 ? 32.295 93.446  38.337 1.00 33.23  ? 563  ALA A O     1 
ATOM   4935 C  CB    . ALA C 3  557 ? 29.524 92.094  39.513 1.00 31.65  ? 563  ALA A CB    1 
ATOM   4936 N  N     . ALA C 3  558 ? 31.380 94.592  40.036 1.00 32.00  ? 564  ALA A N     1 
ATOM   4937 C  CA    . ALA C 3  558 ? 31.922 95.879  39.608 1.00 31.40  ? 564  ALA A CA    1 
ATOM   4938 C  C     . ALA C 3  558 ? 33.448 95.842  39.607 1.00 30.08  ? 564  ALA A C     1 
ATOM   4939 O  O     . ALA C 3  558 ? 34.090 96.310  38.667 1.00 29.63  ? 564  ALA A O     1 
ATOM   4940 C  CB    . ALA C 3  558 ? 31.428 96.986  40.533 1.00 31.38  ? 564  ALA A CB    1 
ATOM   4941 N  N     . LEU C 3  559 ? 34.027 95.295  40.671 1.00 28.97  ? 565  LEU A N     1 
ATOM   4942 C  CA    . LEU C 3  559 ? 35.476 95.201  40.761 1.00 27.35  ? 565  LEU A CA    1 
ATOM   4943 C  C     . LEU C 3  559 ? 35.967 94.293  39.645 1.00 28.50  ? 565  LEU A C     1 
ATOM   4944 O  O     . LEU C 3  559 ? 36.886 94.650  38.920 1.00 29.21  ? 565  LEU A O     1 
ATOM   4945 C  CB    . LEU C 3  559 ? 35.894 94.652  42.123 1.00 25.18  ? 565  LEU A CB    1 
ATOM   4946 C  CG    . LEU C 3  559 ? 37.384 94.389  42.374 1.00 23.97  ? 565  LEU A CG    1 
ATOM   4947 C  CD1   . LEU C 3  559 ? 38.211 95.643  42.094 1.00 21.16  ? 565  LEU A CD1   1 
ATOM   4948 C  CD2   . LEU C 3  559 ? 37.562 93.934  43.824 1.00 22.49  ? 565  LEU A CD2   1 
ATOM   4949 N  N     . ARG C 3  560 ? 35.335 93.130  39.490 1.00 30.34  ? 566  ARG A N     1 
ATOM   4950 C  CA    . ARG C 3  560 ? 35.722 92.184  38.440 1.00 33.15  ? 566  ARG A CA    1 
ATOM   4951 C  C     . ARG C 3  560 ? 35.712 92.826  37.051 1.00 33.81  ? 566  ARG A C     1 
ATOM   4952 O  O     . ARG C 3  560 ? 36.601 92.581  36.237 1.00 31.65  ? 566  ARG A O     1 
ATOM   4953 C  CB    . ARG C 3  560 ? 34.784 90.974  38.430 1.00 34.24  ? 566  ARG A CB    1 
ATOM   4954 C  CG    . ARG C 3  560 ? 35.056 89.938  39.505 1.00 36.45  ? 566  ARG A CG    1 
ATOM   4955 C  CD    . ARG C 3  560 ? 33.996 88.847  39.490 1.00 38.52  ? 566  ARG A CD    1 
ATOM   4956 N  NE    . ARG C 3  560 ? 34.290 87.777  40.443 1.00 41.57  ? 566  ARG A NE    1 
ATOM   4957 C  CZ    . ARG C 3  560 ? 33.428 86.818  40.781 1.00 42.11  ? 566  ARG A CZ    1 
ATOM   4958 N  NH1   . ARG C 3  560 ? 32.213 86.797  40.243 1.00 41.18  ? 566  ARG A NH1   1 
ATOM   4959 N  NH2   . ARG C 3  560 ? 33.778 85.885  41.662 1.00 39.91  ? 566  ARG A NH2   1 
ATOM   4960 N  N     . GLU C 3  561 ? 34.698 93.644  36.788 1.00 35.82  ? 567  GLU A N     1 
ATOM   4961 C  CA    . GLU C 3  561 ? 34.569 94.314  35.500 1.00 38.11  ? 567  GLU A CA    1 
ATOM   4962 C  C     . GLU C 3  561 ? 35.677 95.340  35.266 1.00 36.50  ? 567  GLU A C     1 
ATOM   4963 O  O     . GLU C 3  561 ? 36.295 95.358  34.205 1.00 36.91  ? 567  GLU A O     1 
ATOM   4964 C  CB    . GLU C 3  561 ? 33.210 95.015  35.400 1.00 43.43  ? 567  GLU A CB    1 
ATOM   4965 C  CG    . GLU C 3  561 ? 32.009 94.106  35.595 1.00 51.85  ? 567  GLU A CG    1 
ATOM   4966 C  CD    . GLU C 3  561 ? 30.708 94.886  35.726 1.00 56.56  ? 567  GLU A CD    1 
ATOM   4967 O  OE1   . GLU C 3  561 ? 30.639 95.792  36.586 1.00 59.76  ? 567  GLU A OE1   1 
ATOM   4968 O  OE2   . GLU C 3  561 ? 29.753 94.591  34.974 1.00 59.07  ? 567  GLU A OE2   1 
ATOM   4969 N  N     . SER C 3  562 ? 35.926 96.202  36.245 1.00 35.05  ? 568  SER A N     1 
ATOM   4970 C  CA    . SER C 3  562 ? 36.960 97.212  36.075 1.00 35.43  ? 568  SER A CA    1 
ATOM   4971 C  C     . SER C 3  562 ? 38.310 96.567  35.785 1.00 35.49  ? 568  SER A C     1 
ATOM   4972 O  O     . SER C 3  562 ? 39.048 97.033  34.919 1.00 35.02  ? 568  SER A O     1 
ATOM   4973 C  CB    . SER C 3  562 ? 37.044 98.111  37.311 1.00 34.97  ? 568  SER A CB    1 
ATOM   4974 O  OG    . SER C 3  562 ? 37.177 97.349  38.494 1.00 40.82  ? 568  SER A OG    1 
ATOM   4975 N  N     . ILE C 3  563 ? 38.628 95.488  36.496 1.00 35.43  ? 569  ILE A N     1 
ATOM   4976 C  CA    . ILE C 3  563 ? 39.894 94.797  36.274 1.00 35.12  ? 569  ILE A CA    1 
ATOM   4977 C  C     . ILE C 3  563 ? 39.979 94.357  34.816 1.00 36.01  ? 569  ILE A C     1 
ATOM   4978 O  O     . ILE C 3  563 ? 40.965 94.631  34.134 1.00 36.05  ? 569  ILE A O     1 
ATOM   4979 C  CB    . ILE C 3  563 ? 40.030 93.561  37.190 1.00 34.53  ? 569  ILE A CB    1 
ATOM   4980 C  CG1   . ILE C 3  563 ? 40.144 94.010  38.645 1.00 33.21  ? 569  ILE A CG1   1 
ATOM   4981 C  CG2   . ILE C 3  563 ? 41.250 92.741  36.796 1.00 33.05  ? 569  ILE A CG2   1 
ATOM   4982 C  CD1   . ILE C 3  563 ? 40.243 92.864  39.633 1.00 33.51  ? 569  ILE A CD1   1 
ATOM   4983 N  N     . GLN C 3  564 ? 38.937 93.679  34.343 1.00 37.99  ? 570  GLN A N     1 
ATOM   4984 C  CA    . GLN C 3  564 ? 38.883 93.209  32.961 1.00 41.36  ? 570  GLN A CA    1 
ATOM   4985 C  C     . GLN C 3  564 ? 39.043 94.354  31.959 1.00 42.79  ? 570  GLN A C     1 
ATOM   4986 O  O     . GLN C 3  564 ? 39.794 94.241  30.989 1.00 43.22  ? 570  GLN A O     1 
ATOM   4987 C  CB    . GLN C 3  564 ? 37.552 92.498  32.697 1.00 42.29  ? 570  GLN A CB    1 
ATOM   4988 C  CG    . GLN C 3  564 ? 37.590 90.979  32.827 1.00 45.07  ? 570  GLN A CG    1 
ATOM   4989 C  CD    . GLN C 3  564 ? 38.244 90.296  31.632 1.00 46.22  ? 570  GLN A CD    1 
ATOM   4990 O  OE1   . GLN C 3  564 ? 37.783 90.424  30.495 1.00 45.66  ? 570  GLN A OE1   1 
ATOM   4991 N  NE2   . GLN C 3  564 ? 39.318 89.561  31.887 1.00 45.88  ? 570  GLN A NE2   1 
ATOM   4992 N  N     . GLN C 3  565 ? 38.333 95.452  32.197 1.00 43.94  ? 571  GLN A N     1 
ATOM   4993 C  CA    . GLN C 3  565 ? 38.385 96.608  31.303 1.00 46.06  ? 571  GLN A CA    1 
ATOM   4994 C  C     . GLN C 3  565 ? 39.767 97.259  31.300 1.00 45.32  ? 571  GLN A C     1 
ATOM   4995 O  O     . GLN C 3  565 ? 40.124 97.995  30.380 1.00 44.89  ? 571  GLN A O     1 
ATOM   4996 C  CB    . GLN C 3  565 ? 37.331 97.640  31.719 1.00 47.56  ? 571  GLN A CB    1 
ATOM   4997 C  CG    . GLN C 3  565 ? 37.059 98.703  30.664 1.00 53.76  ? 571  GLN A CG    1 
ATOM   4998 C  CD    . GLN C 3  565 ? 37.489 100.092 31.094 1.00 57.04  ? 571  GLN A CD    1 
ATOM   4999 O  OE1   . GLN C 3  565 ? 38.668 100.340 31.372 1.00 59.31  ? 571  GLN A OE1   1 
ATOM   5000 N  NE2   . GLN C 3  565 ? 36.530 101.013 31.152 1.00 57.90  ? 571  GLN A NE2   1 
ATOM   5001 N  N     . THR C 3  566 ? 40.546 96.971  32.332 1.00 45.27  ? 572  THR A N     1 
ATOM   5002 C  CA    . THR C 3  566 ? 41.878 97.533  32.460 1.00 44.65  ? 572  THR A CA    1 
ATOM   5003 C  C     . THR C 3  566 ? 42.942 96.691  31.777 1.00 43.98  ? 572  THR A C     1 
ATOM   5004 O  O     . THR C 3  566 ? 43.921 97.224  31.255 1.00 45.05  ? 572  THR A O     1 
ATOM   5005 C  CB    . THR C 3  566 ? 42.267 97.673  33.941 1.00 45.54  ? 572  THR A CB    1 
ATOM   5006 O  OG1   . THR C 3  566 ? 41.362 98.576  34.587 1.00 47.32  ? 572  THR A OG1   1 
ATOM   5007 C  CG2   . THR C 3  566 ? 43.690 98.194  34.076 1.00 44.62  ? 572  THR A CG2   1 
ATOM   5008 N  N     . LEU C 3  567 ? 42.746 95.377  31.774 1.00 42.44  ? 573  LEU A N     1 
ATOM   5009 C  CA    . LEU C 3  567 ? 43.729 94.471  31.194 1.00 41.08  ? 573  LEU A CA    1 
ATOM   5010 C  C     . LEU C 3  567 ? 43.435 93.980  29.792 1.00 41.98  ? 573  LEU A C     1 
ATOM   5011 O  O     . LEU C 3  567 ? 44.341 93.852  28.973 1.00 41.51  ? 573  LEU A O     1 
ATOM   5012 C  CB    . LEU C 3  567 ? 43.896 93.245  32.093 1.00 38.18  ? 573  LEU A CB    1 
ATOM   5013 C  CG    . LEU C 3  567 ? 44.113 93.477  33.586 1.00 36.84  ? 573  LEU A CG    1 
ATOM   5014 C  CD1   . LEU C 3  567 ? 44.161 92.136  34.310 1.00 33.65  ? 573  LEU A CD1   1 
ATOM   5015 C  CD2   . LEU C 3  567 ? 45.403 94.263  33.792 1.00 34.73  ? 573  LEU A CD2   1 
ATOM   5016 N  N     . VAL C 3  568 ? 42.170 93.696  29.516 1.00 44.04  ? 574  VAL A N     1 
ATOM   5017 C  CA    . VAL C 3  568 ? 41.795 93.155  28.220 1.00 47.56  ? 574  VAL A CA    1 
ATOM   5018 C  C     . VAL C 3  568 ? 41.087 94.104  27.257 1.00 50.43  ? 574  VAL A C     1 
ATOM   5019 O  O     . VAL C 3  568 ? 40.422 95.052  27.670 1.00 50.00  ? 574  VAL A O     1 
ATOM   5020 C  CB    . VAL C 3  568 ? 40.910 91.911  28.420 1.00 46.79  ? 574  VAL A CB    1 
ATOM   5021 C  CG1   . VAL C 3  568 ? 40.662 91.221  27.092 1.00 45.96  ? 574  VAL A CG1   1 
ATOM   5022 C  CG2   . VAL C 3  568 ? 41.574 90.965  29.407 1.00 45.81  ? 574  VAL A CG2   1 
ATOM   5023 N  N     . GLU C 3  569 ? 41.258 93.841  25.963 1.00 55.06  ? 575  GLU A N     1 
ATOM   5024 C  CA    . GLU C 3  569 ? 40.602 94.624  24.924 1.00 58.63  ? 575  GLU A CA    1 
ATOM   5025 C  C     . GLU C 3  569 ? 39.804 93.659  24.051 1.00 59.18  ? 575  GLU A C     1 
ATOM   5026 O  O     . GLU C 3  569 ? 38.970 94.078  23.253 1.00 60.66  ? 575  GLU A O     1 
ATOM   5027 C  CB    . GLU C 3  569 ? 41.616 95.399  24.073 1.00 61.24  ? 575  GLU A CB    1 
ATOM   5028 C  CG    . GLU C 3  569 ? 42.551 94.555  23.233 1.00 65.61  ? 575  GLU A CG    1 
ATOM   5029 C  CD    . GLU C 3  569 ? 42.939 95.257  21.938 1.00 69.02  ? 575  GLU A CD    1 
ATOM   5030 O  OE1   . GLU C 3  569 ? 43.997 94.919  21.363 1.00 70.56  ? 575  GLU A OE1   1 
ATOM   5031 O  OE2   . GLU C 3  569 ? 42.173 96.140  21.489 1.00 70.37  ? 575  GLU A OE2   1 
ATOM   5032 N  N     . SER C 3  570 ? 40.077 92.365  24.218 1.00 59.54  ? 576  SER A N     1 
ATOM   5033 C  CA    . SER C 3  570 ? 39.388 91.296  23.493 1.00 60.81  ? 576  SER A CA    1 
ATOM   5034 C  C     . SER C 3  570 ? 40.118 89.964  23.677 1.00 61.63  ? 576  SER A C     1 
ATOM   5035 O  O     . SER C 3  570 ? 41.292 89.933  24.051 1.00 61.49  ? 576  SER A O     1 
ATOM   5036 C  CB    . SER C 3  570 ? 39.277 91.616  21.995 1.00 61.19  ? 576  SER A CB    1 
ATOM   5037 O  OG    . SER C 3  570 ? 40.529 91.508  21.340 1.00 61.88  ? 576  SER A OG    1 
ATOM   5038 N  N     . SER C 3  571 ? 39.416 88.866  23.414 1.00 62.59  ? 577  SER A N     1 
ATOM   5039 C  CA    . SER C 3  571 ? 39.997 87.535  23.549 1.00 63.36  ? 577  SER A CA    1 
ATOM   5040 C  C     . SER C 3  571 ? 39.307 86.523  22.634 1.00 64.15  ? 577  SER A C     1 
ATOM   5041 O  O     . SER C 3  571 ? 38.180 86.096  22.893 1.00 64.36  ? 577  SER A O     1 
ATOM   5042 C  CB    . SER C 3  571 ? 39.904 87.069  25.005 1.00 63.44  ? 577  SER A CB    1 
ATOM   5043 O  OG    . SER C 3  571 ? 38.579 87.184  25.493 1.00 63.23  ? 577  SER A OG    1 
ATOM   5044 N  N     . GLN C 3  578 ? 39.458 81.419  21.773 1.00 64.00  ? 584  GLN A N     1 
ATOM   5045 C  CA    . GLN C 3  578 ? 40.562 81.378  22.728 1.00 63.75  ? 584  GLN A CA    1 
ATOM   5046 C  C     . GLN C 3  578 ? 41.458 82.613  22.589 1.00 63.27  ? 584  GLN A C     1 
ATOM   5047 O  O     . GLN C 3  578 ? 40.987 83.676  22.181 1.00 63.82  ? 584  GLN A O     1 
ATOM   5048 C  CB    . GLN C 3  578 ? 41.390 80.106  22.510 1.00 64.65  ? 584  GLN A CB    1 
ATOM   5049 N  N     . GLN C 3  579 ? 42.738 82.452  22.940 1.00 61.85  ? 585  GLN A N     1 
ATOM   5050 C  CA    . GLN C 3  579 ? 43.772 83.498  22.866 1.00 59.82  ? 585  GLN A CA    1 
ATOM   5051 C  C     . GLN C 3  579 ? 43.298 84.914  23.252 1.00 58.23  ? 585  GLN A C     1 
ATOM   5052 O  O     . GLN C 3  579 ? 42.259 85.381  22.788 1.00 58.60  ? 585  GLN A O     1 
ATOM   5053 C  CB    . GLN C 3  579 ? 44.383 83.523  21.454 1.00 59.19  ? 585  GLN A CB    1 
ATOM   5054 C  CG    . GLN C 3  579 ? 44.746 82.147  20.855 1.00 57.98  ? 585  GLN A CG    1 
ATOM   5055 C  CD    . GLN C 3  579 ? 46.179 81.674  21.149 1.00 59.26  ? 585  GLN A CD    1 
ATOM   5056 O  OE1   . GLN C 3  579 ? 47.111 82.476  21.267 1.00 56.08  ? 585  GLN A OE1   1 
ATOM   5057 N  NE2   . GLN C 3  579 ? 46.357 80.356  21.233 1.00 58.51  ? 585  GLN A NE2   1 
ATOM   5058 N  N     . VAL C 3  580 ? 44.084 85.607  24.075 1.00 56.14  ? 586  VAL A N     1 
ATOM   5059 C  CA    . VAL C 3  580 ? 43.717 86.953  24.540 1.00 54.21  ? 586  VAL A CA    1 
ATOM   5060 C  C     . VAL C 3  580 ? 44.542 88.120  23.980 1.00 51.92  ? 586  VAL A C     1 
ATOM   5061 O  O     . VAL C 3  580 ? 45.739 87.986  23.743 1.00 52.04  ? 586  VAL A O     1 
ATOM   5062 C  CB    . VAL C 3  580 ? 43.795 87.029  26.097 1.00 54.31  ? 586  VAL A CB    1 
ATOM   5063 C  CG1   . VAL C 3  580 ? 43.413 88.422  26.583 1.00 53.71  ? 586  VAL A CG1   1 
ATOM   5064 C  CG2   . VAL C 3  580 ? 42.879 85.980  26.720 1.00 53.74  ? 586  VAL A CG2   1 
ATOM   5065 N  N     . LYS C 3  581 ? 43.883 89.260  23.773 1.00 49.75  ? 587  LYS A N     1 
ATOM   5066 C  CA    . LYS C 3  581 ? 44.541 90.480  23.298 1.00 48.64  ? 587  LYS A CA    1 
ATOM   5067 C  C     . LYS C 3  581 ? 44.625 91.421  24.497 1.00 47.06  ? 587  LYS A C     1 
ATOM   5068 O  O     . LYS C 3  581 ? 43.603 91.936  24.962 1.00 47.54  ? 587  LYS A O     1 
ATOM   5069 C  CB    . LYS C 3  581 ? 43.730 91.162  22.197 1.00 50.04  ? 587  LYS A CB    1 
ATOM   5070 C  CG    . LYS C 3  581 ? 44.070 90.726  20.789 1.00 51.92  ? 587  LYS A CG    1 
ATOM   5071 C  CD    . LYS C 3  581 ? 43.408 91.659  19.788 1.00 52.19  ? 587  LYS A CD    1 
ATOM   5072 C  CE    . LYS C 3  581 ? 43.752 91.291  18.360 1.00 52.82  ? 587  LYS A CE    1 
ATOM   5073 N  NZ    . LYS C 3  581 ? 43.111 92.245  17.416 1.00 51.12  ? 587  LYS A NZ    1 
ATOM   5074 N  N     . TRP C 3  582 ? 45.835 91.662  24.989 1.00 43.97  ? 588  TRP A N     1 
ATOM   5075 C  CA    . TRP C 3  582 ? 45.998 92.503  26.164 1.00 40.28  ? 588  TRP A CA    1 
ATOM   5076 C  C     . TRP C 3  582 ? 46.215 93.999  25.970 1.00 39.89  ? 588  TRP A C     1 
ATOM   5077 O  O     . TRP C 3  582 ? 46.895 94.448  25.047 1.00 38.69  ? 588  TRP A O     1 
ATOM   5078 C  CB    . TRP C 3  582 ? 47.132 91.965  27.036 1.00 37.79  ? 588  TRP A CB    1 
ATOM   5079 C  CG    . TRP C 3  582 ? 46.967 90.543  27.454 1.00 35.23  ? 588  TRP A CG    1 
ATOM   5080 C  CD1   . TRP C 3  582 ? 47.278 89.435  26.723 1.00 33.47  ? 588  TRP A CD1   1 
ATOM   5081 C  CD2   . TRP C 3  582 ? 46.451 90.068  28.705 1.00 34.21  ? 588  TRP A CD2   1 
ATOM   5082 N  NE1   . TRP C 3  582 ? 46.992 88.299  27.440 1.00 33.90  ? 588  TRP A NE1   1 
ATOM   5083 C  CE2   . TRP C 3  582 ? 46.480 88.657  28.660 1.00 33.29  ? 588  TRP A CE2   1 
ATOM   5084 C  CE3   . TRP C 3  582 ? 45.965 90.699  29.860 1.00 33.21  ? 588  TRP A CE3   1 
ATOM   5085 C  CZ2   . TRP C 3  582 ? 46.041 87.860  29.726 1.00 33.59  ? 588  TRP A CZ2   1 
ATOM   5086 C  CZ3   . TRP C 3  582 ? 45.529 89.908  30.920 1.00 33.66  ? 588  TRP A CZ3   1 
ATOM   5087 C  CH2   . TRP C 3  582 ? 45.569 88.500  30.844 1.00 33.55  ? 588  TRP A CH2   1 
ATOM   5088 N  N     . LYS C 3  583 ? 45.633 94.760  26.884 1.00 39.30  ? 589  LYS A N     1 
ATOM   5089 C  CA    . LYS C 3  583 ? 45.753 96.203  26.900 1.00 39.99  ? 589  LYS A CA    1 
ATOM   5090 C  C     . LYS C 3  583 ? 47.029 96.442  27.709 1.00 40.41  ? 589  LYS A C     1 
ATOM   5091 O  O     . LYS C 3  583 ? 47.864 97.277  27.362 1.00 39.73  ? 589  LYS A O     1 
ATOM   5092 C  CB    . LYS C 3  583 ? 44.531 96.794  27.602 1.00 40.72  ? 589  LYS A CB    1 
ATOM   5093 C  CG    . LYS C 3  583 ? 44.318 98.277  27.393 1.00 43.39  ? 589  LYS A CG    1 
ATOM   5094 C  CD    . LYS C 3  583 ? 42.931 98.700  27.869 1.00 43.26  ? 589  LYS A CD    1 
ATOM   5095 C  CE    . LYS C 3  583 ? 41.827 97.997  27.075 1.00 44.81  ? 589  LYS A CE    1 
ATOM   5096 N  NZ    . LYS C 3  583 ? 40.455 98.409  27.517 1.00 43.90  ? 589  LYS A NZ    1 
ATOM   5097 N  N     . ARG C 3  584 ? 47.165 95.669  28.785 1.00 41.28  ? 590  ARG A N     1 
ATOM   5098 C  CA    . ARG C 3  584 ? 48.317 95.705  29.685 1.00 40.02  ? 590  ARG A CA    1 
ATOM   5099 C  C     . ARG C 3  584 ? 48.270 94.360  30.409 1.00 39.52  ? 590  ARG A C     1 
ATOM   5100 O  O     . ARG C 3  584 ? 47.215 93.956  30.897 1.00 38.54  ? 590  ARG A O     1 
ATOM   5101 C  CB    . ARG C 3  584 ? 48.187 96.836  30.700 1.00 41.52  ? 590  ARG A CB    1 
ATOM   5102 C  CG    . ARG C 3  584 ? 49.488 97.156  31.422 1.00 45.81  ? 590  ARG A CG    1 
ATOM   5103 C  CD    . ARG C 3  584 ? 49.229 97.483  32.873 1.00 48.26  ? 590  ARG A CD    1 
ATOM   5104 N  NE    . ARG C 3  584 ? 48.227 98.530  33.008 1.00 53.05  ? 590  ARG A NE    1 
ATOM   5105 C  CZ    . ARG C 3  584 ? 47.513 98.745  34.107 1.00 54.26  ? 590  ARG A CZ    1 
ATOM   5106 N  NH1   . ARG C 3  584 ? 47.685 97.981  35.180 1.00 54.99  ? 590  ARG A NH1   1 
ATOM   5107 N  NH2   . ARG C 3  584 ? 46.620 99.726  34.131 1.00 55.76  ? 590  ARG A NH2   1 
ATOM   5108 N  N     . ARG C 3  585 ? 49.395 93.661  30.491 1.00 37.98  ? 591  ARG A N     1 
ATOM   5109 C  CA    . ARG C 3  585 ? 49.370 92.363  31.134 1.00 37.21  ? 591  ARG A CA    1 
ATOM   5110 C  C     . ARG C 3  585 ? 49.892 92.292  32.563 1.00 35.87  ? 591  ARG A C     1 
ATOM   5111 O  O     . ARG C 3  585 ? 50.378 91.249  32.996 1.00 35.23  ? 591  ARG A O     1 
ATOM   5112 C  CB    . ARG C 3  585 ? 50.098 91.336  30.272 1.00 39.67  ? 591  ARG A CB    1 
ATOM   5113 C  CG    . ARG C 3  585 ? 49.626 89.923  30.564 1.00 43.74  ? 591  ARG A CG    1 
ATOM   5114 C  CD    . ARG C 3  585 ? 50.172 88.917  29.582 1.00 46.45  ? 591  ARG A CD    1 
ATOM   5115 N  NE    . ARG C 3  585 ? 49.732 87.570  29.926 1.00 46.61  ? 591  ARG A NE    1 
ATOM   5116 C  CZ    . ARG C 3  585 ? 50.075 86.477  29.255 1.00 48.58  ? 591  ARG A CZ    1 
ATOM   5117 N  NH1   . ARG C 3  585 ? 50.871 86.567  28.196 1.00 49.33  ? 591  ARG A NH1   1 
ATOM   5118 N  NH2   . ARG C 3  585 ? 49.613 85.292  29.639 1.00 48.15  ? 591  ARG A NH2   1 
ATOM   5119 N  N     . TRP C 3  586 ? 49.786 93.393  33.297 1.00 33.91  ? 592  TRP A N     1 
ATOM   5120 C  CA    . TRP C 3  586 ? 50.231 93.402  34.684 1.00 33.96  ? 592  TRP A CA    1 
ATOM   5121 C  C     . TRP C 3  586 ? 49.448 94.367  35.562 1.00 33.89  ? 592  TRP A C     1 
ATOM   5122 O  O     . TRP C 3  586 ? 48.927 95.379  35.093 1.00 32.65  ? 592  TRP A O     1 
ATOM   5123 C  CB    . TRP C 3  586 ? 51.728 93.718  34.789 1.00 32.02  ? 592  TRP A CB    1 
ATOM   5124 C  CG    . TRP C 3  586 ? 52.155 94.955  34.079 1.00 32.15  ? 592  TRP A CG    1 
ATOM   5125 C  CD1   . TRP C 3  586 ? 52.631 95.042  32.806 1.00 31.38  ? 592  TRP A CD1   1 
ATOM   5126 C  CD2   . TRP C 3  586 ? 52.163 96.289  34.604 1.00 31.75  ? 592  TRP A CD2   1 
ATOM   5127 N  NE1   . TRP C 3  586 ? 52.941 96.346  32.503 1.00 31.78  ? 592  TRP A NE1   1 
ATOM   5128 C  CE2   . TRP C 3  586 ? 52.664 97.133  33.589 1.00 31.45  ? 592  TRP A CE2   1 
ATOM   5129 C  CE3   . TRP C 3  586 ? 51.798 96.853  35.832 1.00 32.27  ? 592  TRP A CE3   1 
ATOM   5130 C  CZ2   . TRP C 3  586 ? 52.811 98.509  33.763 1.00 31.74  ? 592  TRP A CZ2   1 
ATOM   5131 C  CZ3   . TRP C 3  586 ? 51.944 98.226  36.006 1.00 31.92  ? 592  TRP A CZ3   1 
ATOM   5132 C  CH2   . TRP C 3  586 ? 52.447 99.037  34.976 1.00 32.26  ? 592  TRP A CH2   1 
ATOM   5133 N  N     . ILE C 3  587 ? 49.370 94.014  36.841 1.00 34.36  ? 593  ILE A N     1 
ATOM   5134 C  CA    . ILE C 3  587 ? 48.685 94.785  37.866 1.00 33.87  ? 593  ILE A CA    1 
ATOM   5135 C  C     . ILE C 3  587 ? 49.753 95.561  38.630 1.00 32.98  ? 593  ILE A C     1 
ATOM   5136 O  O     . ILE C 3  587 ? 50.839 95.042  38.860 1.00 32.73  ? 593  ILE A O     1 
ATOM   5137 C  CB    . ILE C 3  587 ? 47.977 93.842  38.863 1.00 36.29  ? 593  ILE A CB    1 
ATOM   5138 C  CG1   . ILE C 3  587 ? 46.759 93.206  38.204 1.00 36.87  ? 593  ILE A CG1   1 
ATOM   5139 C  CG2   . ILE C 3  587 ? 47.601 94.592  40.125 1.00 38.04  ? 593  ILE A CG2   1 
ATOM   5140 C  CD1   . ILE C 3  587 ? 45.735 94.201  37.753 1.00 40.45  ? 593  ILE A CD1   1 
ATOM   5141 N  N     . LYS C 3  588 ? 49.457 96.797  39.020 1.00 32.53  ? 594  LYS A N     1 
ATOM   5142 C  CA    . LYS C 3  588 ? 50.426 97.582  39.779 1.00 30.72  ? 594  LYS A CA    1 
ATOM   5143 C  C     . LYS C 3  588 ? 50.246 97.180  41.227 1.00 29.33  ? 594  LYS A C     1 
ATOM   5144 O  O     . LYS C 3  588 ? 49.160 97.342  41.781 1.00 29.04  ? 594  LYS A O     1 
ATOM   5145 C  CB    . LYS C 3  588 ? 50.173 99.084  39.627 1.00 33.62  ? 594  LYS A CB    1 
ATOM   5146 C  CG    . LYS C 3  588 ? 51.055 99.940  40.540 1.00 36.10  ? 594  LYS A CG    1 
ATOM   5147 C  CD    . LYS C 3  588 ? 50.903 101.435 40.282 1.00 39.14  ? 594  LYS A CD    1 
ATOM   5148 C  CE    . LYS C 3  588 ? 51.499 101.832 38.935 1.00 43.66  ? 594  LYS A CE    1 
ATOM   5149 N  NZ    . LYS C 3  588 ? 51.434 103.316 38.700 1.00 46.68  ? 594  LYS A NZ    1 
ATOM   5150 N  N     . GLY C 3  589 ? 51.304 96.655  41.839 1.00 26.19  ? 595  GLY A N     1 
ATOM   5151 C  CA    . GLY C 3  589 ? 51.212 96.221  43.224 1.00 24.99  ? 595  GLY A CA    1 
ATOM   5152 C  C     . GLY C 3  589 ? 51.109 97.345  44.235 1.00 24.16  ? 595  GLY A C     1 
ATOM   5153 O  O     . GLY C 3  589 ? 51.283 98.514  43.895 1.00 24.55  ? 595  GLY A O     1 
ATOM   5154 N  N     . LEU C 3  590 ? 50.835 96.989  45.488 1.00 23.49  ? 596  LEU A N     1 
ATOM   5155 C  CA    . LEU C 3  590 ? 50.717 97.981  46.551 1.00 22.98  ? 596  LEU A CA    1 
ATOM   5156 C  C     . LEU C 3  590 ? 52.008 98.776  46.723 1.00 23.48  ? 596  LEU A C     1 
ATOM   5157 O  O     . LEU C 3  590 ? 51.966 99.933  47.140 1.00 23.21  ? 596  LEU A O     1 
ATOM   5158 C  CB    . LEU C 3  590 ? 50.354 97.315  47.882 1.00 22.08  ? 596  LEU A CB    1 
ATOM   5159 C  CG    . LEU C 3  590 ? 48.981 96.649  48.012 1.00 23.28  ? 596  LEU A CG    1 
ATOM   5160 C  CD1   . LEU C 3  590 ? 48.865 96.051  49.400 1.00 22.95  ? 596  LEU A CD1   1 
ATOM   5161 C  CD2   . LEU C 3  590 ? 47.862 97.663  47.781 1.00 22.40  ? 596  LEU A CD2   1 
ATOM   5162 N  N     . ASP C 3  591 ? 53.154 98.168  46.415 1.00 21.39  ? 597  ASP A N     1 
ATOM   5163 C  CA    . ASP C 3  591 ? 54.414 98.893  46.551 1.00 21.08  ? 597  ASP A CA    1 
ATOM   5164 C  C     . ASP C 3  591 ? 54.943 99.379  45.213 1.00 19.87  ? 597  ASP A C     1 
ATOM   5165 O  O     . ASP C 3  591 ? 56.098 99.769  45.104 1.00 20.09  ? 597  ASP A O     1 
ATOM   5166 C  CB    . ASP C 3  591 ? 55.478 98.048  47.256 1.00 22.61  ? 597  ASP A CB    1 
ATOM   5167 C  CG    . ASP C 3  591 ? 55.784 96.750  46.529 1.00 25.67  ? 597  ASP A CG    1 
ATOM   5168 O  OD1   . ASP C 3  591 ? 55.261 96.540  45.411 1.00 24.72  ? 597  ASP A OD1   1 
ATOM   5169 O  OD2   . ASP C 3  591 ? 56.557 95.941  47.088 1.00 24.98  ? 597  ASP A OD2   1 
ATOM   5170 N  N     . GLY C 3  592 ? 54.089 99.348  44.194 1.00 22.55  ? 598  GLY A N     1 
ATOM   5171 C  CA    . GLY C 3  592 ? 54.486 99.834  42.882 1.00 22.68  ? 598  GLY A CA    1 
ATOM   5172 C  C     . GLY C 3  592 ? 54.973 98.855  41.833 1.00 23.77  ? 598  GLY A C     1 
ATOM   5173 O  O     . GLY C 3  592 ? 55.015 99.196  40.653 1.00 24.66  ? 598  GLY A O     1 
ATOM   5174 N  N     . ARG C 3  593 ? 55.329 97.641  42.232 1.00 24.80  ? 599  ARG A N     1 
ATOM   5175 C  CA    . ARG C 3  593 ? 55.842 96.663  41.273 1.00 23.63  ? 599  ARG A CA    1 
ATOM   5176 C  C     . ARG C 3  593 ? 54.801 96.187  40.272 1.00 23.23  ? 599  ARG A C     1 
ATOM   5177 O  O     . ARG C 3  593 ? 53.596 96.350  40.476 1.00 22.10  ? 599  ARG A O     1 
ATOM   5178 C  CB    . ARG C 3  593 ? 56.389 95.440  42.009 1.00 23.04  ? 599  ARG A CB    1 
ATOM   5179 C  CG    . ARG C 3  593 ? 55.303 94.555  42.590 1.00 24.14  ? 599  ARG A CG    1 
ATOM   5180 C  CD    . ARG C 3  593 ? 55.637 94.180  44.028 1.00 27.75  ? 599  ARG A CD    1 
ATOM   5181 N  NE    . ARG C 3  593 ? 56.200 92.847  44.124 1.00 28.27  ? 599  ARG A NE    1 
ATOM   5182 C  CZ    . ARG C 3  593 ? 56.972 92.433  45.120 1.00 26.00  ? 599  ARG A CZ    1 
ATOM   5183 N  NH1   . ARG C 3  593 ? 57.284 93.251  46.113 1.00 21.15  ? 599  ARG A NH1   1 
ATOM   5184 N  NH2   . ARG C 3  593 ? 57.425 91.192  45.112 1.00 27.86  ? 599  ARG A NH2   1 
ATOM   5185 N  N     . LYS C 3  594 ? 55.288 95.587  39.190 1.00 22.70  ? 600  LYS A N     1 
ATOM   5186 C  CA    . LYS C 3  594 ? 54.428 95.026  38.162 1.00 24.02  ? 600  LYS A CA    1 
ATOM   5187 C  C     . LYS C 3  594 ? 54.104 93.606  38.589 1.00 24.77  ? 600  LYS A C     1 
ATOM   5188 O  O     . LYS C 3  594 ? 55.009 92.827  38.888 1.00 27.08  ? 600  LYS A O     1 
ATOM   5189 C  CB    . LYS C 3  594 ? 55.147 94.940  36.814 1.00 25.10  ? 600  LYS A CB    1 
ATOM   5190 C  CG    . LYS C 3  594 ? 55.502 96.247  36.139 1.00 27.50  ? 600  LYS A CG    1 
ATOM   5191 C  CD    . LYS C 3  594 ? 56.171 95.934  34.811 1.00 30.12  ? 600  LYS A CD    1 
ATOM   5192 C  CE    . LYS C 3  594 ? 56.658 97.173  34.091 1.00 33.57  ? 600  LYS A CE    1 
ATOM   5193 N  NZ    . LYS C 3  594 ? 57.360 96.798  32.818 1.00 34.97  ? 600  LYS A NZ    1 
ATOM   5194 N  N     . VAL C 3  595 ? 52.825 93.266  38.632 1.00 24.92  ? 601  VAL A N     1 
ATOM   5195 C  CA    . VAL C 3  595 ? 52.435 91.915  38.981 1.00 24.98  ? 601  VAL A CA    1 
ATOM   5196 C  C     . VAL C 3  595 ? 51.840 91.309  37.719 1.00 25.88  ? 601  VAL A C     1 
ATOM   5197 O  O     . VAL C 3  595 ? 50.761 91.696  37.274 1.00 27.28  ? 601  VAL A O     1 
ATOM   5198 C  CB    . VAL C 3  595 ? 51.405 91.891  40.116 1.00 26.21  ? 601  VAL A CB    1 
ATOM   5199 C  CG1   . VAL C 3  595 ? 51.135 90.447  40.534 1.00 25.55  ? 601  VAL A CG1   1 
ATOM   5200 C  CG2   . VAL C 3  595 ? 51.927 92.691  41.303 1.00 23.54  ? 601  VAL A CG2   1 
ATOM   5201 N  N     . HIS C 3  596 ? 52.578 90.379  37.126 1.00 25.69  ? 602  HIS A N     1 
ATOM   5202 C  CA    . HIS C 3  596 ? 52.159 89.725  35.899 1.00 26.73  ? 602  HIS A CA    1 
ATOM   5203 C  C     . HIS C 3  596 ? 50.864 88.953  36.073 1.00 27.84  ? 602  HIS A C     1 
ATOM   5204 O  O     . HIS C 3  596 ? 50.717 88.183  37.019 1.00 26.96  ? 602  HIS A O     1 
ATOM   5205 C  CB    . HIS C 3  596 ? 53.255 88.772  35.421 1.00 27.29  ? 602  HIS A CB    1 
ATOM   5206 C  CG    . HIS C 3  596 ? 52.909 88.020  34.172 1.00 30.28  ? 602  HIS A CG    1 
ATOM   5207 N  ND1   . HIS C 3  596 ? 52.739 88.638  32.952 1.00 27.68  ? 602  HIS A ND1   1 
ATOM   5208 C  CD2   . HIS C 3  596 ? 52.704 86.698  33.957 1.00 30.21  ? 602  HIS A CD2   1 
ATOM   5209 C  CE1   . HIS C 3  596 ? 52.444 87.730  32.039 1.00 28.88  ? 602  HIS A CE1   1 
ATOM   5210 N  NE2   . HIS C 3  596 ? 52.417 86.545  32.622 1.00 29.53  ? 602  HIS A NE2   1 
ATOM   5211 N  N     . VAL C 3  597 ? 49.926 89.180  35.157 1.00 28.29  ? 603  VAL A N     1 
ATOM   5212 C  CA    . VAL C 3  597 ? 48.641 88.491  35.166 1.00 27.37  ? 603  VAL A CA    1 
ATOM   5213 C  C     . VAL C 3  597 ? 48.760 87.388  34.128 1.00 28.46  ? 603  VAL A C     1 
ATOM   5214 O  O     . VAL C 3  597 ? 49.086 87.651  32.971 1.00 28.26  ? 603  VAL A O     1 
ATOM   5215 C  CB    . VAL C 3  597 ? 47.482 89.423  34.757 1.00 28.12  ? 603  VAL A CB    1 
ATOM   5216 C  CG1   . VAL C 3  597 ? 46.177 88.648  34.745 1.00 25.54  ? 603  VAL A CG1   1 
ATOM   5217 C  CG2   . VAL C 3  597 ? 47.392 90.600  35.721 1.00 27.72  ? 603  VAL A CG2   1 
ATOM   5218 N  N     . ARG C 3  598 ? 48.511 86.156  34.548 1.00 28.72  ? 604  ARG A N     1 
ATOM   5219 C  CA    . ARG C 3  598 ? 48.612 85.014  33.653 1.00 30.23  ? 604  ARG A CA    1 
ATOM   5220 C  C     . ARG C 3  598 ? 47.354 84.799  32.828 1.00 31.74  ? 604  ARG A C     1 
ATOM   5221 O  O     . ARG C 3  598 ? 47.431 84.434  31.658 1.00 32.39  ? 604  ARG A O     1 
ATOM   5222 C  CB    . ARG C 3  598 ? 48.918 83.744  34.452 1.00 28.10  ? 604  ARG A CB    1 
ATOM   5223 C  CG    . ARG C 3  598 ? 50.315 83.710  35.043 1.00 27.85  ? 604  ARG A CG    1 
ATOM   5224 C  CD    . ARG C 3  598 ? 50.518 82.471  35.894 1.00 28.20  ? 604  ARG A CD    1 
ATOM   5225 N  NE    . ARG C 3  598 ? 51.904 82.339  36.331 1.00 28.16  ? 604  ARG A NE    1 
ATOM   5226 C  CZ    . ARG C 3  598 ? 52.291 81.598  37.365 1.00 29.27  ? 604  ARG A CZ    1 
ATOM   5227 N  NH1   . ARG C 3  598 ? 51.396 80.921  38.076 1.00 23.73  ? 604  ARG A NH1   1 
ATOM   5228 N  NH2   . ARG C 3  598 ? 53.576 81.530  37.686 1.00 30.18  ? 604  ARG A NH2   1 
ATOM   5229 N  N     . SER C 3  599 ? 46.199 85.032  33.436 1.00 31.60  ? 605  SER A N     1 
ATOM   5230 C  CA    . SER C 3  599 ? 44.940 84.832  32.743 1.00 33.37  ? 605  SER A CA    1 
ATOM   5231 C  C     . SER C 3  599 ? 43.860 85.782  33.238 1.00 33.27  ? 605  SER A C     1 
ATOM   5232 O  O     . SER C 3  599 ? 43.777 86.084  34.429 1.00 34.38  ? 605  SER A O     1 
ATOM   5233 C  CB    . SER C 3  599 ? 44.480 83.386  32.927 1.00 34.68  ? 605  SER A CB    1 
ATOM   5234 O  OG    . SER C 3  599 ? 43.162 83.219  32.442 1.00 38.28  ? 605  SER A OG    1 
ATOM   5235 N  N     . PRO C 3  600 ? 43.001 86.250  32.323 1.00 32.17  ? 606  PRO A N     1 
ATOM   5236 C  CA    . PRO C 3  600 ? 41.927 87.172  32.686 1.00 30.58  ? 606  PRO A CA    1 
ATOM   5237 C  C     . PRO C 3  600 ? 41.030 86.659  33.800 1.00 31.20  ? 606  PRO A C     1 
ATOM   5238 O  O     . PRO C 3  600 ? 40.558 87.448  34.616 1.00 29.25  ? 606  PRO A O     1 
ATOM   5239 C  CB    . PRO C 3  600 ? 41.169 87.359  31.371 1.00 31.19  ? 606  PRO A CB    1 
ATOM   5240 C  CG    . PRO C 3  600 ? 42.245 87.186  30.332 1.00 30.95  ? 606  PRO A CG    1 
ATOM   5241 C  CD    . PRO C 3  600 ? 43.008 85.992  30.871 1.00 31.83  ? 606  PRO A CD    1 
ATOM   5242 N  N     . HIS C 3  601 ? 40.801 85.346  33.849 1.00 30.31  ? 607  HIS A N     1 
ATOM   5243 C  CA    . HIS C 3  601 ? 39.927 84.794  34.881 1.00 32.16  ? 607  HIS A CA    1 
ATOM   5244 C  C     . HIS C 3  601 ? 40.589 84.687  36.247 1.00 32.10  ? 607  HIS A C     1 
ATOM   5245 O  O     . HIS C 3  601 ? 39.908 84.526  37.253 1.00 35.82  ? 607  HIS A O     1 
ATOM   5246 C  CB    . HIS C 3  601 ? 39.367 83.419  34.466 1.00 33.31  ? 607  HIS A CB    1 
ATOM   5247 C  CG    . HIS C 3  601 ? 40.259 82.263  34.801 1.00 35.11  ? 607  HIS A CG    1 
ATOM   5248 N  ND1   . HIS C 3  601 ? 41.419 81.987  34.109 1.00 37.18  ? 607  HIS A ND1   1 
ATOM   5249 C  CD2   . HIS C 3  601 ? 40.150 81.300  35.749 1.00 36.55  ? 607  HIS A CD2   1 
ATOM   5250 C  CE1   . HIS C 3  601 ? 41.985 80.905  34.615 1.00 39.01  ? 607  HIS A CE1   1 
ATOM   5251 N  NE2   . HIS C 3  601 ? 41.235 80.468  35.611 1.00 38.19  ? 607  HIS A NE2   1 
ATOM   5252 N  N     . ALA C 3  602 ? 41.911 84.782  36.289 1.00 30.97  ? 608  ALA A N     1 
ATOM   5253 C  CA    . ALA C 3  602 ? 42.626 84.704  37.556 1.00 30.91  ? 608  ALA A CA    1 
ATOM   5254 C  C     . ALA C 3  602 ? 43.104 86.091  37.998 1.00 29.77  ? 608  ALA A C     1 
ATOM   5255 O  O     . ALA C 3  602 ? 43.779 86.227  39.025 1.00 28.87  ? 608  ALA A O     1 
ATOM   5256 C  CB    . ALA C 3  602 ? 43.809 83.759  37.423 1.00 31.31  ? 608  ALA A CB    1 
ATOM   5257 N  N     . ALA C 3  603 ? 42.732 87.110  37.223 1.00 26.61  ? 609  ALA A N     1 
ATOM   5258 C  CA    . ALA C 3  603 ? 43.127 88.492  37.485 1.00 25.49  ? 609  ALA A CA    1 
ATOM   5259 C  C     . ALA C 3  603 ? 42.756 88.976  38.873 1.00 26.20  ? 609  ALA A C     1 
ATOM   5260 O  O     . ALA C 3  603 ? 43.586 89.569  39.567 1.00 26.67  ? 609  ALA A O     1 
ATOM   5261 C  CB    . ALA C 3  603 ? 42.515 89.426  36.439 1.00 22.40  ? 609  ALA A CB    1 
ATOM   5262 N  N     . LEU C 3  604 ? 41.509 88.750  39.272 1.00 24.75  ? 610  LEU A N     1 
ATOM   5263 C  CA    . LEU C 3  604 ? 41.070 89.178  40.589 1.00 26.10  ? 610  LEU A CA    1 
ATOM   5264 C  C     . LEU C 3  604 ? 41.930 88.502  41.652 1.00 27.05  ? 610  LEU A C     1 
ATOM   5265 O  O     . LEU C 3  604 ? 42.289 89.123  42.653 1.00 26.15  ? 610  LEU A O     1 
ATOM   5266 C  CB    . LEU C 3  604 ? 39.600 88.828  40.822 1.00 25.37  ? 610  LEU A CB    1 
ATOM   5267 C  CG    . LEU C 3  604 ? 39.103 89.175  42.231 1.00 26.45  ? 610  LEU A CG    1 
ATOM   5268 C  CD1   . LEU C 3  604 ? 39.248 90.674  42.474 1.00 24.34  ? 610  LEU A CD1   1 
ATOM   5269 C  CD2   . LEU C 3  604 ? 37.649 88.745  42.390 1.00 28.21  ? 610  LEU A CD2   1 
ATOM   5270 N  N     . ASN C 3  605 ? 42.256 87.232  41.437 1.00 25.33  ? 611  ASN A N     1 
ATOM   5271 C  CA    . ASN C 3  605 ? 43.088 86.523  42.397 1.00 26.87  ? 611  ASN A CA    1 
ATOM   5272 C  C     . ASN C 3  605 ? 44.476 87.149  42.413 1.00 26.53  ? 611  ASN A C     1 
ATOM   5273 O  O     . ASN C 3  605 ? 45.083 87.319  43.469 1.00 27.60  ? 611  ASN A O     1 
ATOM   5274 C  CB    . ASN C 3  605 ? 43.172 85.037  42.050 1.00 27.48  ? 611  ASN A CB    1 
ATOM   5275 C  CG    . ASN C 3  605 ? 44.090 84.283  42.981 1.00 29.96  ? 611  ASN A CG    1 
ATOM   5276 O  OD1   . ASN C 3  605 ? 45.304 84.208  42.756 1.00 26.94  ? 611  ASN A OD1   1 
ATOM   5277 N  ND2   . ASN C 3  605 ? 43.521 83.735  44.053 1.00 25.84  ? 611  ASN A ND2   1 
ATOM   5278 N  N     . THR C 3  606 ? 44.977 87.511  41.240 1.00 27.38  ? 612  THR A N     1 
ATOM   5279 C  CA    . THR C 3  606 ? 46.282 88.142  41.165 1.00 25.89  ? 612  THR A CA    1 
ATOM   5280 C  C     . THR C 3  606 ? 46.263 89.418  41.997 1.00 25.78  ? 612  THR A C     1 
ATOM   5281 O  O     . THR C 3  606 ? 47.165 89.657  42.795 1.00 26.31  ? 612  THR A O     1 
ATOM   5282 C  CB    . THR C 3  606 ? 46.651 88.487  39.718 1.00 26.02  ? 612  THR A CB    1 
ATOM   5283 O  OG1   . THR C 3  606 ? 46.808 87.278  38.973 1.00 23.45  ? 612  THR A OG1   1 
ATOM   5284 C  CG2   . THR C 3  606 ? 47.953 89.267  39.668 1.00 25.44  ? 612  THR A CG2   1 
ATOM   5285 N  N     . LEU C 3  607 ? 45.222 90.222  41.825 1.00 24.11  ? 613  LEU A N     1 
ATOM   5286 C  CA    . LEU C 3  607 ? 45.095 91.474  42.561 1.00 23.38  ? 613  LEU A CA    1 
ATOM   5287 C  C     . LEU C 3  607 ? 45.029 91.278  44.069 1.00 25.14  ? 613  LEU A C     1 
ATOM   5288 O  O     . LEU C 3  607 ? 45.774 91.913  44.822 1.00 24.58  ? 613  LEU A O     1 
ATOM   5289 C  CB    . LEU C 3  607 ? 43.840 92.229  42.115 1.00 23.85  ? 613  LEU A CB    1 
ATOM   5290 C  CG    . LEU C 3  607 ? 43.540 93.529  42.864 1.00 24.15  ? 613  LEU A CG    1 
ATOM   5291 C  CD1   . LEU C 3  607 ? 44.541 94.590  42.432 1.00 25.29  ? 613  LEU A CD1   1 
ATOM   5292 C  CD2   . LEU C 3  607 ? 42.118 93.998  42.560 1.00 25.17  ? 613  LEU A CD2   1 
ATOM   5293 N  N     . LEU C 3  608 ? 44.136 90.401  44.514 1.00 24.37  ? 614  LEU A N     1 
ATOM   5294 C  CA    . LEU C 3  608 ? 43.969 90.162  45.941 1.00 24.85  ? 614  LEU A CA    1 
ATOM   5295 C  C     . LEU C 3  608 ? 45.097 89.359  46.592 1.00 24.40  ? 614  LEU A C     1 
ATOM   5296 O  O     . LEU C 3  608 ? 45.551 89.699  47.688 1.00 24.98  ? 614  LEU A O     1 
ATOM   5297 C  CB    . LEU C 3  608 ? 42.619 89.481  46.205 1.00 23.52  ? 614  LEU A CB    1 
ATOM   5298 C  CG    . LEU C 3  608 ? 41.357 90.202  45.701 1.00 24.04  ? 614  LEU A CG    1 
ATOM   5299 C  CD1   . LEU C 3  608 ? 40.112 89.450  46.182 1.00 23.38  ? 614  LEU A CD1   1 
ATOM   5300 C  CD2   . LEU C 3  608 ? 41.328 91.636  46.217 1.00 23.22  ? 614  LEU A CD2   1 
ATOM   5301 N  N     . GLN C 3  609 ? 45.554 88.296  45.939 1.00 23.29  ? 615  GLN A N     1 
ATOM   5302 C  CA    . GLN C 3  609 ? 46.628 87.501  46.524 1.00 20.51  ? 615  GLN A CA    1 
ATOM   5303 C  C     . GLN C 3  609 ? 47.910 88.328  46.612 1.00 19.73  ? 615  GLN A C     1 
ATOM   5304 O  O     . GLN C 3  609 ? 48.679 88.174  47.551 1.00 20.58  ? 615  GLN A O     1 
ATOM   5305 C  CB    . GLN C 3  609 ? 46.893 86.230  45.709 1.00 18.73  ? 615  GLN A CB    1 
ATOM   5306 C  CG    . GLN C 3  609 ? 47.730 85.187  46.472 1.00 17.95  ? 615  GLN A CG    1 
ATOM   5307 C  CD    . GLN C 3  609 ? 48.258 84.068  45.586 1.00 21.13  ? 615  GLN A CD    1 
ATOM   5308 O  OE1   . GLN C 3  609 ? 49.344 84.172  45.004 1.00 22.34  ? 615  GLN A OE1   1 
ATOM   5309 N  NE2   . GLN C 3  609 ? 47.484 82.995  45.468 1.00 17.43  ? 615  GLN A NE2   1 
ATOM   5310 N  N     . SER C 3  610 ? 48.133 89.209  45.642 1.00 21.12  ? 616  SER A N     1 
ATOM   5311 C  CA    . SER C 3  610 ? 49.334 90.049  45.638 1.00 22.99  ? 616  SER A CA    1 
ATOM   5312 C  C     . SER C 3  610 ? 49.295 91.064  46.771 1.00 24.16  ? 616  SER A C     1 
ATOM   5313 O  O     . SER C 3  610 ? 50.288 91.260  47.489 1.00 24.49  ? 616  SER A O     1 
ATOM   5314 C  CB    . SER C 3  610 ? 49.470 90.787  44.305 1.00 23.71  ? 616  SER A CB    1 
ATOM   5315 O  OG    . SER C 3  610 ? 50.630 91.607  44.294 1.00 22.80  ? 616  SER A OG    1 
ATOM   5316 N  N     . ALA C 3  611 ? 48.142 91.709  46.925 1.00 24.55  ? 617  ALA A N     1 
ATOM   5317 C  CA    . ALA C 3  611 ? 47.952 92.702  47.975 1.00 23.91  ? 617  ALA A CA    1 
ATOM   5318 C  C     . ALA C 3  611 ? 48.194 92.058  49.337 1.00 23.42  ? 617  ALA A C     1 
ATOM   5319 O  O     . ALA C 3  611 ? 48.894 92.613  50.181 1.00 22.26  ? 617  ALA A O     1 
ATOM   5320 C  CB    . ALA C 3  611 ? 46.536 93.276  47.905 1.00 22.11  ? 617  ALA A CB    1 
ATOM   5321 N  N     . GLY C 3  612 ? 47.610 90.881  49.542 1.00 24.32  ? 618  GLY A N     1 
ATOM   5322 C  CA    . GLY C 3  612 ? 47.781 90.185  50.804 1.00 22.56  ? 618  GLY A CA    1 
ATOM   5323 C  C     . GLY C 3  612 ? 49.216 89.743  51.016 1.00 23.40  ? 618  GLY A C     1 
ATOM   5324 O  O     . GLY C 3  612 ? 49.716 89.717  52.142 1.00 24.88  ? 618  GLY A O     1 
ATOM   5325 N  N     . ALA C 3  613 ? 49.891 89.391  49.930 1.00 23.16  ? 619  ALA A N     1 
ATOM   5326 C  CA    . ALA C 3  613 ? 51.278 88.954  50.023 1.00 21.16  ? 619  ALA A CA    1 
ATOM   5327 C  C     . ALA C 3  613 ? 52.207 90.128  50.340 1.00 21.82  ? 619  ALA A C     1 
ATOM   5328 O  O     . ALA C 3  613 ? 53.156 89.981  51.106 1.00 22.71  ? 619  ALA A O     1 
ATOM   5329 C  CB    . ALA C 3  613 ? 51.701 88.286  48.718 1.00 18.78  ? 619  ALA A CB    1 
ATOM   5330 N  N     . LEU C 3  614 ? 51.939 91.296  49.757 1.00 20.91  ? 620  LEU A N     1 
ATOM   5331 C  CA    . LEU C 3  614 ? 52.794 92.451  50.017 1.00 20.20  ? 620  LEU A CA    1 
ATOM   5332 C  C     . LEU C 3  614 ? 52.525 93.042  51.396 1.00 20.64  ? 620  LEU A C     1 
ATOM   5333 O  O     . LEU C 3  614 ? 53.429 93.576  52.039 1.00 18.31  ? 620  LEU A O     1 
ATOM   5334 C  CB    . LEU C 3  614 ? 52.620 93.520  48.935 1.00 19.74  ? 620  LEU A CB    1 
ATOM   5335 C  CG    . LEU C 3  614 ? 52.962 93.127  47.494 1.00 20.26  ? 620  LEU A CG    1 
ATOM   5336 C  CD1   . LEU C 3  614 ? 53.145 94.396  46.685 1.00 19.95  ? 620  LEU A CD1   1 
ATOM   5337 C  CD2   . LEU C 3  614 ? 54.238 92.294  47.433 1.00 16.99  ? 620  LEU A CD2   1 
ATOM   5338 N  N     . ILE C 3  615 ? 51.281 92.941  51.855 1.00 22.98  ? 621  ILE A N     1 
ATOM   5339 C  CA    . ILE C 3  615 ? 50.935 93.438  53.179 1.00 22.78  ? 621  ILE A CA    1 
ATOM   5340 C  C     . ILE C 3  615 ? 51.668 92.575  54.203 1.00 24.01  ? 621  ILE A C     1 
ATOM   5341 O  O     . ILE C 3  615 ? 52.318 93.089  55.113 1.00 24.70  ? 621  ILE A O     1 
ATOM   5342 C  CB    . ILE C 3  615 ? 49.423 93.345  53.430 1.00 23.10  ? 621  ILE A CB    1 
ATOM   5343 C  CG1   . ILE C 3  615 ? 48.742 94.596  52.867 1.00 22.04  ? 621  ILE A CG1   1 
ATOM   5344 C  CG2   . ILE C 3  615 ? 49.140 93.141  54.932 1.00 20.60  ? 621  ILE A CG2   1 
ATOM   5345 C  CD1   . ILE C 3  615 ? 47.230 94.519  52.842 1.00 19.26  ? 621  ILE A CD1   1 
ATOM   5346 N  N     . CYS C 3  616 ? 51.569 91.260  54.045 1.00 22.74  ? 622  CYS A N     1 
ATOM   5347 C  CA    . CYS C 3  616 ? 52.230 90.345  54.967 1.00 22.17  ? 622  CYS A CA    1 
ATOM   5348 C  C     . CYS C 3  616 ? 53.745 90.452  54.922 1.00 20.99  ? 622  CYS A C     1 
ATOM   5349 O  O     . CYS C 3  616 ? 54.420 90.272  55.929 1.00 21.38  ? 622  CYS A O     1 
ATOM   5350 C  CB    . CYS C 3  616 ? 51.811 88.912  54.671 1.00 21.87  ? 622  CYS A CB    1 
ATOM   5351 S  SG    . CYS C 3  616 ? 50.126 88.589  55.158 1.00 24.86  ? 622  CYS A SG    1 
ATOM   5352 N  N     . LYS C 3  617 ? 54.281 90.754  53.750 1.00 21.59  ? 623  LYS A N     1 
ATOM   5353 C  CA    . LYS C 3  617 ? 55.711 90.871  53.623 1.00 22.62  ? 623  LYS A CA    1 
ATOM   5354 C  C     . LYS C 3  617 ? 56.202 92.106  54.382 1.00 24.01  ? 623  LYS A C     1 
ATOM   5355 O  O     . LYS C 3  617 ? 57.179 92.030  55.132 1.00 25.00  ? 623  LYS A O     1 
ATOM   5356 C  CB    . LYS C 3  617 ? 56.090 90.924  52.145 1.00 22.31  ? 623  LYS A CB    1 
ATOM   5357 C  CG    . LYS C 3  617 ? 57.583 90.857  51.893 1.00 23.68  ? 623  LYS A CG    1 
ATOM   5358 C  CD    . LYS C 3  617 ? 57.893 90.594  50.434 1.00 22.65  ? 623  LYS A CD    1 
ATOM   5359 C  CE    . LYS C 3  617 ? 57.412 89.226  50.005 1.00 22.15  ? 623  LYS A CE    1 
ATOM   5360 N  NZ    . LYS C 3  617 ? 57.705 88.955  48.561 1.00 22.85  ? 623  LYS A NZ    1 
ATOM   5361 N  N     . LEU C 3  618 ? 55.523 93.238  54.205 1.00 24.56  ? 624  LEU A N     1 
ATOM   5362 C  CA    . LEU C 3  618 ? 55.911 94.463  54.900 1.00 22.02  ? 624  LEU A CA    1 
ATOM   5363 C  C     . LEU C 3  618 ? 55.647 94.264  56.390 1.00 22.16  ? 624  LEU A C     1 
ATOM   5364 O  O     . LEU C 3  618 ? 56.336 94.825  57.249 1.00 21.93  ? 624  LEU A O     1 
ATOM   5365 C  CB    . LEU C 3  618 ? 55.093 95.656  54.401 1.00 21.92  ? 624  LEU A CB    1 
ATOM   5366 C  CG    . LEU C 3  618 ? 55.837 96.982  54.215 1.00 23.19  ? 624  LEU A CG    1 
ATOM   5367 C  CD1   . LEU C 3  618 ? 54.826 98.113  54.141 1.00 22.83  ? 624  LEU A CD1   1 
ATOM   5368 C  CD2   . LEU C 3  618 ? 56.828 97.212  55.340 1.00 20.11  ? 624  LEU A CD2   1 
ATOM   5369 N  N     . TRP C 3  619 ? 54.637 93.457  56.689 1.00 20.86  ? 625  TRP A N     1 
ATOM   5370 C  CA    . TRP C 3  619 ? 54.275 93.159  58.071 1.00 20.64  ? 625  TRP A CA    1 
ATOM   5371 C  C     . TRP C 3  619 ? 55.377 92.435  58.860 1.00 21.63  ? 625  TRP A C     1 
ATOM   5372 O  O     . TRP C 3  619 ? 55.724 92.847  59.976 1.00 22.34  ? 625  TRP A O     1 
ATOM   5373 C  CB    . TRP C 3  619 ? 53.000 92.320  58.087 1.00 20.03  ? 625  TRP A CB    1 
ATOM   5374 C  CG    . TRP C 3  619 ? 52.636 91.755  59.424 1.00 21.51  ? 625  TRP A CG    1 
ATOM   5375 C  CD1   . TRP C 3  619 ? 52.464 92.443  60.590 1.00 21.43  ? 625  TRP A CD1   1 
ATOM   5376 C  CD2   . TRP C 3  619 ? 52.342 90.384  59.719 1.00 21.27  ? 625  TRP A CD2   1 
ATOM   5377 N  NE1   . TRP C 3  619 ? 52.079 91.584  61.593 1.00 21.40  ? 625  TRP A NE1   1 
ATOM   5378 C  CE2   . TRP C 3  619 ? 51.996 90.315  61.085 1.00 21.16  ? 625  TRP A CE2   1 
ATOM   5379 C  CE3   . TRP C 3  619 ? 52.335 89.205  58.957 1.00 22.73  ? 625  TRP A CE3   1 
ATOM   5380 C  CZ2   . TRP C 3  619 ? 51.643 89.112  61.711 1.00 22.21  ? 625  TRP A CZ2   1 
ATOM   5381 C  CZ3   . TRP C 3  619 ? 51.984 88.003  59.582 1.00 19.98  ? 625  TRP A CZ3   1 
ATOM   5382 C  CH2   . TRP C 3  619 ? 51.643 87.971  60.946 1.00 20.91  ? 625  TRP A CH2   1 
ATOM   5383 N  N     . ILE C 3  620 ? 55.932 91.365  58.300 1.00 19.54  ? 626  ILE A N     1 
ATOM   5384 C  CA    . ILE C 3  620 ? 56.956 90.632  59.035 1.00 20.24  ? 626  ILE A CA    1 
ATOM   5385 C  C     . ILE C 3  620 ? 58.186 91.508  59.200 1.00 22.15  ? 626  ILE A C     1 
ATOM   5386 O  O     . ILE C 3  620 ? 58.870 91.450  60.217 1.00 23.52  ? 626  ILE A O     1 
ATOM   5387 C  CB    . ILE C 3  620 ? 57.329 89.295  58.342 1.00 19.80  ? 626  ILE A CB    1 
ATOM   5388 C  CG1   . ILE C 3  620 ? 57.998 89.544  56.996 1.00 18.57  ? 626  ILE A CG1   1 
ATOM   5389 C  CG2   . ILE C 3  620 ? 56.086 88.467  58.130 1.00 16.28  ? 626  ILE A CG2   1 
ATOM   5390 C  CD1   . ILE C 3  620 ? 58.514 88.263  56.355 1.00 22.16  ? 626  ILE A CD1   1 
ATOM   5391 N  N     . ILE C 3  621 ? 58.446 92.346  58.206 1.00 22.32  ? 627  ILE A N     1 
ATOM   5392 C  CA    . ILE C 3  621 ? 59.586 93.252  58.255 1.00 22.49  ? 627  ILE A CA    1 
ATOM   5393 C  C     . ILE C 3  621 ? 59.395 94.272  59.382 1.00 23.10  ? 627  ILE A C     1 
ATOM   5394 O  O     . ILE C 3  621 ? 60.291 94.487  60.204 1.00 22.07  ? 627  ILE A O     1 
ATOM   5395 C  CB    . ILE C 3  621 ? 59.733 94.011  56.912 1.00 23.61  ? 627  ILE A CB    1 
ATOM   5396 C  CG1   . ILE C 3  621 ? 60.066 93.020  55.795 1.00 25.61  ? 627  ILE A CG1   1 
ATOM   5397 C  CG2   . ILE C 3  621 ? 60.804 95.088  57.027 1.00 24.07  ? 627  ILE A CG2   1 
ATOM   5398 C  CD1   . ILE C 3  621 ? 60.006 93.624  54.405 1.00 23.90  ? 627  ILE A CD1   1 
ATOM   5399 N  N     . LYS C 3  622 ? 58.217 94.893  59.413 1.00 22.48  ? 628  LYS A N     1 
ATOM   5400 C  CA    . LYS C 3  622 ? 57.913 95.902  60.420 1.00 22.42  ? 628  LYS A CA    1 
ATOM   5401 C  C     . LYS C 3  622 ? 57.863 95.303  61.818 1.00 21.55  ? 628  LYS A C     1 
ATOM   5402 O  O     . LYS C 3  622 ? 58.268 95.946  62.778 1.00 22.76  ? 628  LYS A O     1 
ATOM   5403 C  CB    . LYS C 3  622 ? 56.578 96.591  60.103 1.00 23.68  ? 628  LYS A CB    1 
ATOM   5404 C  CG    . LYS C 3  622 ? 56.287 97.815  60.964 1.00 25.51  ? 628  LYS A CG    1 
ATOM   5405 C  CD    . LYS C 3  622 ? 57.248 98.953  60.646 1.00 29.25  ? 628  LYS A CD    1 
ATOM   5406 C  CE    . LYS C 3  622 ? 57.032 100.128 61.582 1.00 34.16  ? 628  LYS A CE    1 
ATOM   5407 N  NZ    . LYS C 3  622 ? 58.022 101.226 61.352 1.00 39.81  ? 628  LYS A NZ    1 
ATOM   5408 N  N     . THR C 3  623 ? 57.363 94.076  61.933 1.00 21.60  ? 629  THR A N     1 
ATOM   5409 C  CA    . THR C 3  623 ? 57.283 93.410  63.229 1.00 20.70  ? 629  THR A CA    1 
ATOM   5410 C  C     . THR C 3  623 ? 58.682 93.215  63.811 1.00 22.41  ? 629  THR A C     1 
ATOM   5411 O  O     . THR C 3  623 ? 58.930 93.537  64.973 1.00 24.63  ? 629  THR A O     1 
ATOM   5412 C  CB    . THR C 3  623 ? 56.606 92.018  63.123 1.00 21.02  ? 629  THR A CB    1 
ATOM   5413 O  OG1   . THR C 3  623 ? 55.246 92.174  62.700 1.00 19.93  ? 629  THR A OG1   1 
ATOM   5414 C  CG2   . THR C 3  623 ? 56.622 91.307  64.466 1.00 17.59  ? 629  THR A CG2   1 
ATOM   5415 N  N     . GLU C 3  624 ? 59.607 92.698  63.013 1.00 22.44  ? 630  GLU A N     1 
ATOM   5416 C  CA    . GLU C 3  624 ? 60.942 92.479  63.540 1.00 23.00  ? 630  GLU A CA    1 
ATOM   5417 C  C     . GLU C 3  624 ? 61.620 93.786  63.905 1.00 22.58  ? 630  GLU A C     1 
ATOM   5418 O  O     . GLU C 3  624 ? 62.298 93.875  64.923 1.00 22.23  ? 630  GLU A O     1 
ATOM   5419 C  CB    . GLU C 3  624 ? 61.829 91.729  62.547 1.00 21.86  ? 630  GLU A CB    1 
ATOM   5420 C  CG    . GLU C 3  624 ? 63.145 91.300  63.203 1.00 21.69  ? 630  GLU A CG    1 
ATOM   5421 C  CD    . GLU C 3  624 ? 64.365 91.519  62.326 1.00 23.02  ? 630  GLU A CD    1 
ATOM   5422 O  OE1   . GLU C 3  624 ? 64.311 92.377  61.420 1.00 23.43  ? 630  GLU A OE1   1 
ATOM   5423 O  OE2   . GLU C 3  624 ? 65.387 90.841  62.556 1.00 20.90  ? 630  GLU A OE2   1 
ATOM   5424 N  N     . GLU C 3  625 ? 61.438 94.801  63.070 1.00 24.60  ? 631  GLU A N     1 
ATOM   5425 C  CA    . GLU C 3  625 ? 62.050 96.093  63.325 1.00 26.52  ? 631  GLU A CA    1 
ATOM   5426 C  C     . GLU C 3  625 ? 61.514 96.707  64.614 1.00 27.49  ? 631  GLU A C     1 
ATOM   5427 O  O     . GLU C 3  625 ? 62.274 97.271  65.403 1.00 24.73  ? 631  GLU A O     1 
ATOM   5428 C  CB    . GLU C 3  625 ? 61.807 97.044  62.154 1.00 28.98  ? 631  GLU A CB    1 
ATOM   5429 C  CG    . GLU C 3  625 ? 62.551 98.358  62.290 1.00 35.86  ? 631  GLU A CG    1 
ATOM   5430 C  CD    . GLU C 3  625 ? 62.620 99.134  60.984 1.00 41.69  ? 631  GLU A CD    1 
ATOM   5431 O  OE1   . GLU C 3  625 ? 61.563 99.591  60.492 1.00 42.27  ? 631  GLU A OE1   1 
ATOM   5432 O  OE2   . GLU C 3  625 ? 63.741 99.277  60.445 1.00 44.18  ? 631  GLU A OE2   1 
ATOM   5433 N  N     . MET C 3  626 ? 60.207 96.598  64.830 1.00 26.61  ? 632  MET A N     1 
ATOM   5434 C  CA    . MET C 3  626 ? 59.618 97.147  66.042 1.00 26.42  ? 632  MET A CA    1 
ATOM   5435 C  C     . MET C 3  626 ? 60.143 96.409  67.276 1.00 25.85  ? 632  MET A C     1 
ATOM   5436 O  O     . MET C 3  626 ? 60.364 97.016  68.321 1.00 26.53  ? 632  MET A O     1 
ATOM   5437 C  CB    . MET C 3  626 ? 58.093 97.061  65.985 1.00 26.96  ? 632  MET A CB    1 
ATOM   5438 C  CG    . MET C 3  626 ? 57.443 98.117  65.095 1.00 27.77  ? 632  MET A CG    1 
ATOM   5439 S  SD    . MET C 3  626 ? 55.635 97.967  65.078 1.00 30.69  ? 632  MET A SD    1 
ATOM   5440 C  CE    . MET C 3  626 ? 55.212 98.649  66.663 1.00 29.39  ? 632  MET A CE    1 
ATOM   5441 N  N     . LEU C 3  627 ? 60.350 95.103  67.155 1.00 23.57  ? 633  LEU A N     1 
ATOM   5442 C  CA    . LEU C 3  627 ? 60.867 94.332  68.278 1.00 23.26  ? 633  LEU A CA    1 
ATOM   5443 C  C     . LEU C 3  627 ? 62.289 94.780  68.585 1.00 23.81  ? 633  LEU A C     1 
ATOM   5444 O  O     . LEU C 3  627 ? 62.658 94.949  69.743 1.00 23.58  ? 633  LEU A O     1 
ATOM   5445 C  CB    . LEU C 3  627 ? 60.857 92.837  67.960 1.00 20.42  ? 633  LEU A CB    1 
ATOM   5446 C  CG    . LEU C 3  627 ? 59.476 92.197  67.825 1.00 20.05  ? 633  LEU A CG    1 
ATOM   5447 C  CD1   . LEU C 3  627 ? 59.630 90.768  67.358 1.00 18.90  ? 633  LEU A CD1   1 
ATOM   5448 C  CD2   . LEU C 3  627 ? 58.744 92.255  69.154 1.00 20.55  ? 633  LEU A CD2   1 
ATOM   5449 N  N     . VAL C 3  628 ? 63.082 94.971  67.537 1.00 25.15  ? 634  VAL A N     1 
ATOM   5450 C  CA    . VAL C 3  628 ? 64.459 95.406  67.694 1.00 27.13  ? 634  VAL A CA    1 
ATOM   5451 C  C     . VAL C 3  628 ? 64.539 96.783  68.347 1.00 29.11  ? 634  VAL A C     1 
ATOM   5452 O  O     . VAL C 3  628 ? 65.308 96.977  69.288 1.00 29.86  ? 634  VAL A O     1 
ATOM   5453 C  CB    . VAL C 3  628 ? 65.207 95.446  66.329 1.00 27.14  ? 634  VAL A CB    1 
ATOM   5454 C  CG1   . VAL C 3  628 ? 66.452 96.327  66.442 1.00 25.45  ? 634  VAL A CG1   1 
ATOM   5455 C  CG2   . VAL C 3  628 ? 65.612 94.027  65.911 1.00 24.33  ? 634  VAL A CG2   1 
ATOM   5456 N  N     . GLU C 3  629 ? 63.760 97.745  67.865 1.00 31.71  ? 635  GLU A N     1 
ATOM   5457 C  CA    . GLU C 3  629 ? 63.821 99.068  68.477 1.00 36.48  ? 635  GLU A CA    1 
ATOM   5458 C  C     . GLU C 3  629 ? 63.256 99.078  69.893 1.00 35.74  ? 635  GLU A C     1 
ATOM   5459 O  O     . GLU C 3  629 ? 63.362 100.071 70.603 1.00 39.75  ? 635  GLU A O     1 
ATOM   5460 C  CB    . GLU C 3  629 ? 63.144 100.131 67.598 1.00 38.44  ? 635  GLU A CB    1 
ATOM   5461 C  CG    . GLU C 3  629 ? 61.840 99.728  66.960 1.00 45.01  ? 635  GLU A CG    1 
ATOM   5462 C  CD    . GLU C 3  629 ? 61.397 100.720 65.892 1.00 46.67  ? 635  GLU A CD    1 
ATOM   5463 O  OE1   . GLU C 3  629 ? 62.221 101.058 65.009 1.00 47.41  ? 635  GLU A OE1   1 
ATOM   5464 O  OE2   . GLU C 3  629 ? 60.225 101.154 65.932 1.00 48.33  ? 635  GLU A OE2   1 
ATOM   5465 N  N     . LYS C 3  630 ? 62.666 97.962  70.306 1.00 35.16  ? 636  LYS A N     1 
ATOM   5466 C  CA    . LYS C 3  630 ? 62.139 97.841  71.659 1.00 33.48  ? 636  LYS A CA    1 
ATOM   5467 C  C     . LYS C 3  630 ? 63.221 97.219  72.541 1.00 32.43  ? 636  LYS A C     1 
ATOM   5468 O  O     . LYS C 3  630 ? 63.050 97.094  73.746 1.00 32.28  ? 636  LYS A O     1 
ATOM   5469 C  CB    . LYS C 3  630 ? 60.884 96.965  71.688 1.00 34.06  ? 636  LYS A CB    1 
ATOM   5470 C  CG    . LYS C 3  630 ? 59.630 97.666  71.189 1.00 34.67  ? 636  LYS A CG    1 
ATOM   5471 C  CD    . LYS C 3  630 ? 58.372 96.840  71.440 1.00 33.42  ? 636  LYS A CD    1 
ATOM   5472 C  CE    . LYS C 3  630 ? 57.126 97.602  70.992 1.00 33.85  ? 636  LYS A CE    1 
ATOM   5473 N  NZ    . LYS C 3  630 ? 55.877 96.804  71.160 1.00 36.04  ? 636  LYS A NZ    1 
ATOM   5474 N  N     . GLY C 3  631 ? 64.329 96.813  71.927 1.00 31.86  ? 637  GLY A N     1 
ATOM   5475 C  CA    . GLY C 3  631 ? 65.419 96.235  72.692 1.00 31.48  ? 637  GLY A CA    1 
ATOM   5476 C  C     . GLY C 3  631 ? 65.613 94.734  72.589 1.00 30.90  ? 637  GLY A C     1 
ATOM   5477 O  O     . GLY C 3  631 ? 66.594 94.202  73.105 1.00 31.37  ? 637  GLY A O     1 
ATOM   5478 N  N     . LEU C 3  632 ? 64.690 94.037  71.939 1.00 30.19  ? 638  LEU A N     1 
ATOM   5479 C  CA    . LEU C 3  632 ? 64.825 92.593  71.802 1.00 29.51  ? 638  LEU A CA    1 
ATOM   5480 C  C     . LEU C 3  632 ? 65.883 92.255  70.757 1.00 28.92  ? 638  LEU A C     1 
ATOM   5481 O  O     . LEU C 3  632 ? 66.071 92.993  69.785 1.00 29.75  ? 638  LEU A O     1 
ATOM   5482 C  CB    . LEU C 3  632 ? 63.485 91.956  71.413 1.00 30.09  ? 638  LEU A CB    1 
ATOM   5483 C  CG    . LEU C 3  632 ? 62.359 91.808  72.452 1.00 32.43  ? 638  LEU A CG    1 
ATOM   5484 C  CD1   . LEU C 3  632 ? 62.948 91.636  73.852 1.00 32.35  ? 638  LEU A CD1   1 
ATOM   5485 C  CD2   . LEU C 3  632 ? 61.463 93.000  72.414 1.00 31.72  ? 638  LEU A CD2   1 
ATOM   5486 N  N     . LYS C 3  633 ? 66.572 91.138  70.964 1.00 27.41  ? 639  LYS A N     1 
ATOM   5487 C  CA    . LYS C 3  633 ? 67.625 90.688  70.052 1.00 27.81  ? 639  LYS A CA    1 
ATOM   5488 C  C     . LYS C 3  633 ? 67.140 89.480  69.270 1.00 24.63  ? 639  LYS A C     1 
ATOM   5489 O  O     . LYS C 3  633 ? 66.589 88.543  69.844 1.00 22.76  ? 639  LYS A O     1 
ATOM   5490 C  CB    . LYS C 3  633 ? 68.884 90.311  70.843 1.00 30.83  ? 639  LYS A CB    1 
ATOM   5491 C  CG    . LYS C 3  633 ? 70.033 89.792  69.986 1.00 35.88  ? 639  LYS A CG    1 
ATOM   5492 C  CD    . LYS C 3  633 ? 71.188 89.310  70.857 1.00 41.16  ? 639  LYS A CD    1 
ATOM   5493 C  CE    . LYS C 3  633 ? 72.383 88.854  70.028 1.00 44.38  ? 639  LYS A CE    1 
ATOM   5494 N  NZ    . LYS C 3  633 ? 73.004 89.976  69.256 1.00 46.45  ? 639  LYS A NZ    1 
ATOM   5495 N  N     . HIS C 3  634 ? 67.363 89.495  67.962 1.00 23.81  ? 640  HIS A N     1 
ATOM   5496 C  CA    . HIS C 3  634 ? 66.922 88.402  67.099 1.00 22.20  ? 640  HIS A CA    1 
ATOM   5497 C  C     . HIS C 3  634 ? 67.961 87.293  67.033 1.00 21.49  ? 640  HIS A C     1 
ATOM   5498 O  O     . HIS C 3  634 ? 69.029 87.470  66.450 1.00 21.01  ? 640  HIS A O     1 
ATOM   5499 C  CB    . HIS C 3  634 ? 66.630 88.945  65.693 1.00 21.43  ? 640  HIS A CB    1 
ATOM   5500 C  CG    . HIS C 3  634 ? 65.868 87.996  64.821 1.00 24.25  ? 640  HIS A CG    1 
ATOM   5501 N  ND1   . HIS C 3  634 ? 65.235 88.398  63.665 1.00 21.70  ? 640  HIS A ND1   1 
ATOM   5502 C  CD2   . HIS C 3  634 ? 65.613 86.671  64.948 1.00 23.12  ? 640  HIS A CD2   1 
ATOM   5503 C  CE1   . HIS C 3  634 ? 64.619 87.364  63.121 1.00 22.69  ? 640  HIS A CE1   1 
ATOM   5504 N  NE2   . HIS C 3  634 ? 64.831 86.304  63.879 1.00 21.99  ? 640  HIS A NE2   1 
ATOM   5505 N  N     . GLY C 3  635 ? 67.644 86.152  67.639 1.00 21.56  ? 641  GLY A N     1 
ATOM   5506 C  CA    . GLY C 3  635 ? 68.560 85.021  67.637 1.00 21.92  ? 641  GLY A CA    1 
ATOM   5507 C  C     . GLY C 3  635 ? 68.388 84.112  68.844 1.00 23.01  ? 641  GLY A C     1 
ATOM   5508 O  O     . GLY C 3  635 ? 67.784 84.509  69.841 1.00 24.42  ? 641  GLY A O     1 
ATOM   5509 N  N     . TRP C 3  636 ? 68.900 82.888  68.758 1.00 22.33  ? 642  TRP A N     1 
ATOM   5510 C  CA    . TRP C 3  636 ? 68.805 81.946  69.877 1.00 22.14  ? 642  TRP A CA    1 
ATOM   5511 C  C     . TRP C 3  636 ? 69.687 82.411  71.041 1.00 23.00  ? 642  TRP A C     1 
ATOM   5512 O  O     . TRP C 3  636 ? 69.530 81.967  72.180 1.00 21.84  ? 642  TRP A O     1 
ATOM   5513 C  CB    . TRP C 3  636 ? 69.233 80.543  69.433 1.00 18.30  ? 642  TRP A CB    1 
ATOM   5514 C  CG    . TRP C 3  636 ? 68.398 79.990  68.311 1.00 17.92  ? 642  TRP A CG    1 
ATOM   5515 C  CD1   . TRP C 3  636 ? 68.828 79.654  67.062 1.00 14.61  ? 642  TRP A CD1   1 
ATOM   5516 C  CD2   . TRP C 3  636 ? 66.994 79.692  68.348 1.00 15.93  ? 642  TRP A CD2   1 
ATOM   5517 N  NE1   . TRP C 3  636 ? 67.783 79.161  66.318 1.00 17.35  ? 642  TRP A NE1   1 
ATOM   5518 C  CE2   . TRP C 3  636 ? 66.647 79.172  67.081 1.00 15.66  ? 642  TRP A CE2   1 
ATOM   5519 C  CE3   . TRP C 3  636 ? 66.000 79.814  69.329 1.00 16.45  ? 642  TRP A CE3   1 
ATOM   5520 C  CZ2   . TRP C 3  636 ? 65.342 78.771  66.765 1.00 14.93  ? 642  TRP A CZ2   1 
ATOM   5521 C  CZ3   . TRP C 3  636 ? 64.698 79.415  69.016 1.00 16.77  ? 642  TRP A CZ3   1 
ATOM   5522 C  CH2   . TRP C 3  636 ? 64.384 78.899  67.738 1.00 17.10  ? 642  TRP A CH2   1 
ATOM   5523 N  N     . ASP C 3  637 ? 70.622 83.303  70.743 1.00 23.65  ? 643  ASP A N     1 
ATOM   5524 C  CA    . ASP C 3  637 ? 71.510 83.839  71.763 1.00 24.87  ? 643  ASP A CA    1 
ATOM   5525 C  C     . ASP C 3  637 ? 70.927 85.173  72.210 1.00 24.98  ? 643  ASP A C     1 
ATOM   5526 O  O     . ASP C 3  637 ? 71.608 85.982  72.836 1.00 25.19  ? 643  ASP A O     1 
ATOM   5527 C  CB    . ASP C 3  637 ? 72.911 84.042  71.179 1.00 26.38  ? 643  ASP A CB    1 
ATOM   5528 C  CG    . ASP C 3  637 ? 72.907 84.954  69.960 1.00 30.88  ? 643  ASP A CG    1 
ATOM   5529 O  OD1   . ASP C 3  637 ? 71.829 85.108  69.339 1.00 29.75  ? 643  ASP A OD1   1 
ATOM   5530 O  OD2   . ASP C 3  637 ? 73.979 85.502  69.617 1.00 31.37  ? 643  ASP A OD2   1 
ATOM   5531 N  N     . GLY C 3  638 ? 69.654 85.388  71.881 1.00 24.88  ? 644  GLY A N     1 
ATOM   5532 C  CA    . GLY C 3  638 ? 68.991 86.626  72.236 1.00 23.24  ? 644  GLY A CA    1 
ATOM   5533 C  C     . GLY C 3  638 ? 67.644 86.475  72.918 1.00 24.30  ? 644  GLY A C     1 
ATOM   5534 O  O     . GLY C 3  638 ? 67.536 85.797  73.935 1.00 23.46  ? 644  GLY A O     1 
ATOM   5535 N  N     . ASP C 3  639 ? 66.615 87.097  72.339 1.00 24.03  ? 645  ASP A N     1 
ATOM   5536 C  CA    . ASP C 3  639 ? 65.265 87.081  72.898 1.00 22.26  ? 645  ASP A CA    1 
ATOM   5537 C  C     . ASP C 3  639 ? 64.194 86.390  72.067 1.00 21.98  ? 645  ASP A C     1 
ATOM   5538 O  O     . ASP C 3  639 ? 63.258 85.820  72.623 1.00 23.24  ? 645  ASP A O     1 
ATOM   5539 C  CB    . ASP C 3  639 ? 64.824 88.512  73.168 1.00 22.29  ? 645  ASP A CB    1 
ATOM   5540 C  CG    . ASP C 3  639 ? 65.813 89.256  74.034 1.00 23.66  ? 645  ASP A CG    1 
ATOM   5541 O  OD1   . ASP C 3  639 ? 66.042 88.804  75.176 1.00 23.38  ? 645  ASP A OD1   1 
ATOM   5542 O  OD2   . ASP C 3  639 ? 66.368 90.278  73.571 1.00 23.03  ? 645  ASP A OD2   1 
ATOM   5543 N  N     . PHE C 3  640 ? 64.305 86.455  70.743 1.00 20.89  ? 646  PHE A N     1 
ATOM   5544 C  CA    . PHE C 3  640 ? 63.309 85.811  69.886 1.00 20.81  ? 646  PHE A CA    1 
ATOM   5545 C  C     . PHE C 3  640 ? 63.950 85.356  68.584 1.00 20.33  ? 646  PHE A C     1 
ATOM   5546 O  O     . PHE C 3  640 ? 65.014 85.840  68.211 1.00 21.15  ? 646  PHE A O     1 
ATOM   5547 C  CB    . PHE C 3  640 ? 62.153 86.777  69.572 1.00 18.41  ? 646  PHE A CB    1 
ATOM   5548 C  CG    . PHE C 3  640 ? 62.551 87.924  68.688 1.00 20.62  ? 646  PHE A CG    1 
ATOM   5549 C  CD1   . PHE C 3  640 ? 63.140 89.067  69.223 1.00 20.33  ? 646  PHE A CD1   1 
ATOM   5550 C  CD2   . PHE C 3  640 ? 62.388 87.840  67.306 1.00 19.23  ? 646  PHE A CD2   1 
ATOM   5551 C  CE1   . PHE C 3  640 ? 63.566 90.109  68.388 1.00 20.52  ? 646  PHE A CE1   1 
ATOM   5552 C  CE2   . PHE C 3  640 ? 62.806 88.869  66.466 1.00 18.72  ? 646  PHE A CE2   1 
ATOM   5553 C  CZ    . PHE C 3  640 ? 63.398 90.007  67.007 1.00 20.22  ? 646  PHE A CZ    1 
ATOM   5554 N  N     . ALA C 3  641 ? 63.300 84.426  67.895 1.00 20.29  ? 647  ALA A N     1 
ATOM   5555 C  CA    . ALA C 3  641 ? 63.815 83.932  66.627 1.00 18.99  ? 647  ALA A CA    1 
ATOM   5556 C  C     . ALA C 3  641 ? 62.704 83.525  65.682 1.00 19.15  ? 647  ALA A C     1 
ATOM   5557 O  O     . ALA C 3  641 ? 61.861 82.705  66.041 1.00 18.46  ? 647  ALA A O     1 
ATOM   5558 C  CB    . ALA C 3  641 ? 64.734 82.745  66.857 1.00 20.20  ? 647  ALA A CB    1 
ATOM   5559 N  N     . TYR C 3  642 ? 62.695 84.105  64.481 1.00 17.28  ? 648  TYR A N     1 
ATOM   5560 C  CA    . TYR C 3  642 ? 61.704 83.726  63.480 1.00 17.00  ? 648  TYR A CA    1 
ATOM   5561 C  C     . TYR C 3  642 ? 61.985 82.259  63.138 1.00 18.20  ? 648  TYR A C     1 
ATOM   5562 O  O     . TYR C 3  642 ? 63.138 81.872  62.923 1.00 17.71  ? 648  TYR A O     1 
ATOM   5563 C  CB    . TYR C 3  642 ? 61.858 84.569  62.210 1.00 16.21  ? 648  TYR A CB    1 
ATOM   5564 C  CG    . TYR C 3  642 ? 61.099 85.878  62.214 1.00 17.87  ? 648  TYR A CG    1 
ATOM   5565 C  CD1   . TYR C 3  642 ? 61.164 86.750  63.301 1.00 17.25  ? 648  TYR A CD1   1 
ATOM   5566 C  CD2   . TYR C 3  642 ? 60.330 86.255  61.116 1.00 18.92  ? 648  TYR A CD2   1 
ATOM   5567 C  CE1   . TYR C 3  642 ? 60.486 87.954  63.292 1.00 16.65  ? 648  TYR A CE1   1 
ATOM   5568 C  CE2   . TYR C 3  642 ? 59.653 87.455  61.098 1.00 18.86  ? 648  TYR A CE2   1 
ATOM   5569 C  CZ    . TYR C 3  642 ? 59.732 88.299  62.184 1.00 17.26  ? 648  TYR A CZ    1 
ATOM   5570 O  OH    . TYR C 3  642 ? 59.047 89.485  62.155 1.00 19.68  ? 648  TYR A OH    1 
ATOM   5571 N  N     . MET C 3  643 ? 60.941 81.441  63.094 1.00 17.82  ? 649  MET A N     1 
ATOM   5572 C  CA    . MET C 3  643 ? 61.130 80.035  62.780 1.00 20.63  ? 649  MET A CA    1 
ATOM   5573 C  C     . MET C 3  643 ? 60.442 79.731  61.463 1.00 21.61  ? 649  MET A C     1 
ATOM   5574 O  O     . MET C 3  643 ? 60.867 78.849  60.722 1.00 22.86  ? 649  MET A O     1 
ATOM   5575 C  CB    . MET C 3  643 ? 60.554 79.151  63.895 1.00 18.12  ? 649  MET A CB    1 
ATOM   5576 C  CG    . MET C 3  643 ? 61.069 79.523  65.287 1.00 21.09  ? 649  MET A CG    1 
ATOM   5577 S  SD    . MET C 3  643 ? 60.499 78.419  66.588 1.00 22.15  ? 649  MET A SD    1 
ATOM   5578 C  CE    . MET C 3  643 ? 58.734 78.821  66.636 1.00 14.56  ? 649  MET A CE    1 
ATOM   5579 N  N     . ALA C 3  644 ? 59.374 80.462  61.169 1.00 20.41  ? 650  ALA A N     1 
ATOM   5580 C  CA    . ALA C 3  644 ? 58.675 80.236  59.920 1.00 21.46  ? 650  ALA A CA    1 
ATOM   5581 C  C     . ALA C 3  644 ? 57.704 81.334  59.528 1.00 20.47  ? 650  ALA A C     1 
ATOM   5582 O  O     . ALA C 3  644 ? 57.088 81.986  60.377 1.00 19.93  ? 650  ALA A O     1 
ATOM   5583 C  CB    . ALA C 3  644 ? 57.935 78.888  59.969 1.00 21.54  ? 650  ALA A CB    1 
ATOM   5584 N  N     . TRP C 3  645 ? 57.584 81.531  58.221 1.00 20.39  ? 651  TRP A N     1 
ATOM   5585 C  CA    . TRP C 3  645 ? 56.654 82.499  57.664 1.00 19.61  ? 651  TRP A CA    1 
ATOM   5586 C  C     . TRP C 3  645 ? 55.849 81.743  56.619 1.00 18.09  ? 651  TRP A C     1 
ATOM   5587 O  O     . TRP C 3  645 ? 56.384 81.332  55.582 1.00 17.37  ? 651  TRP A O     1 
ATOM   5588 C  CB    . TRP C 3  645 ? 57.387 83.676  57.024 1.00 18.96  ? 651  TRP A CB    1 
ATOM   5589 C  CG    . TRP C 3  645 ? 56.459 84.593  56.289 1.00 19.67  ? 651  TRP A CG    1 
ATOM   5590 C  CD1   . TRP C 3  645 ? 55.219 84.998  56.690 1.00 21.60  ? 651  TRP A CD1   1 
ATOM   5591 C  CD2   . TRP C 3  645 ? 56.702 85.228  55.033 1.00 21.49  ? 651  TRP A CD2   1 
ATOM   5592 N  NE1   . TRP C 3  645 ? 54.671 85.847  55.761 1.00 21.18  ? 651  TRP A NE1   1 
ATOM   5593 C  CE2   . TRP C 3  645 ? 55.559 86.007  54.735 1.00 23.39  ? 651  TRP A CE2   1 
ATOM   5594 C  CE3   . TRP C 3  645 ? 57.768 85.214  54.131 1.00 20.64  ? 651  TRP A CE3   1 
ATOM   5595 C  CZ2   . TRP C 3  645 ? 55.460 86.766  53.566 1.00 21.61  ? 651  TRP A CZ2   1 
ATOM   5596 C  CZ3   . TRP C 3  645 ? 57.670 85.964  52.973 1.00 22.82  ? 651  TRP A CZ3   1 
ATOM   5597 C  CH2   . TRP C 3  645 ? 56.520 86.732  52.699 1.00 23.90  ? 651  TRP A CH2   1 
ATOM   5598 N  N     . VAL C 3  646 ? 54.569 81.541  56.909 1.00 16.76  ? 652  VAL A N     1 
ATOM   5599 C  CA    . VAL C 3  646 ? 53.682 80.807  56.019 1.00 17.41  ? 652  VAL A CA    1 
ATOM   5600 C  C     . VAL C 3  646 ? 52.557 81.705  55.488 1.00 19.74  ? 652  VAL A C     1 
ATOM   5601 O  O     . VAL C 3  646 ? 51.429 81.684  55.983 1.00 21.18  ? 652  VAL A O     1 
ATOM   5602 C  CB    . VAL C 3  646 ? 53.105 79.576  56.761 1.00 18.29  ? 652  VAL A CB    1 
ATOM   5603 C  CG1   . VAL C 3  646 ? 52.143 78.822  55.878 1.00 17.50  ? 652  VAL A CG1   1 
ATOM   5604 C  CG2   . VAL C 3  646 ? 54.253 78.649  57.191 1.00 14.82  ? 652  VAL A CG2   1 
ATOM   5605 N  N     . HIS C 3  647 ? 52.907 82.512  54.488 1.00 19.77  ? 653  HIS A N     1 
ATOM   5606 C  CA    . HIS C 3  647 ? 51.994 83.436  53.829 1.00 20.00  ? 653  HIS A CA    1 
ATOM   5607 C  C     . HIS C 3  647 ? 51.480 84.568  54.707 1.00 21.49  ? 653  HIS A C     1 
ATOM   5608 O  O     . HIS C 3  647 ? 51.947 85.696  54.584 1.00 24.29  ? 653  HIS A O     1 
ATOM   5609 C  CB    . HIS C 3  647 ? 50.856 82.637  53.201 1.00 19.96  ? 653  HIS A CB    1 
ATOM   5610 C  CG    . HIS C 3  647 ? 51.349 81.555  52.296 1.00 18.64  ? 653  HIS A CG    1 
ATOM   5611 N  ND1   . HIS C 3  647 ? 52.182 81.813  51.228 1.00 20.12  ? 653  HIS A ND1   1 
ATOM   5612 C  CD2   . HIS C 3  647 ? 51.235 80.209  52.368 1.00 19.95  ? 653  HIS A CD2   1 
ATOM   5613 C  CE1   . HIS C 3  647 ? 52.567 80.671  50.688 1.00 21.21  ? 653  HIS A CE1   1 
ATOM   5614 N  NE2   . HIS C 3  647 ? 52.007 79.682  51.362 1.00 19.39  ? 653  HIS A NE2   1 
ATOM   5615 N  N     . ASP C 3  648 ? 50.537 84.292  55.594 1.00 22.10  ? 654  ASP A N     1 
ATOM   5616 C  CA    . ASP C 3  648 ? 50.034 85.358  56.449 1.00 24.94  ? 654  ASP A CA    1 
ATOM   5617 C  C     . ASP C 3  648 ? 50.144 84.984  57.927 1.00 25.06  ? 654  ASP A C     1 
ATOM   5618 O  O     . ASP C 3  648 ? 49.335 85.411  58.758 1.00 23.14  ? 654  ASP A O     1 
ATOM   5619 C  CB    . ASP C 3  648 ? 48.587 85.681  56.081 1.00 26.42  ? 654  ASP A CB    1 
ATOM   5620 C  CG    . ASP C 3  648 ? 47.641 84.575  56.457 1.00 28.46  ? 654  ASP A CG    1 
ATOM   5621 O  OD1   . ASP C 3  648 ? 48.075 83.401  56.466 1.00 28.79  ? 654  ASP A OD1   1 
ATOM   5622 O  OD2   . ASP C 3  648 ? 46.466 84.877  56.736 1.00 30.50  ? 654  ASP A OD2   1 
ATOM   5623 N  N     . GLU C 3  649 ? 51.151 84.176  58.247 1.00 25.04  ? 655  GLU A N     1 
ATOM   5624 C  CA    . GLU C 3  649 ? 51.378 83.770  59.619 1.00 23.80  ? 655  GLU A CA    1 
ATOM   5625 C  C     . GLU C 3  649 ? 52.867 83.598  59.896 1.00 23.76  ? 655  GLU A C     1 
ATOM   5626 O  O     . GLU C 3  649 ? 53.634 83.143  59.041 1.00 23.13  ? 655  GLU A O     1 
ATOM   5627 C  CB    . GLU C 3  649 ? 50.662 82.454  59.926 1.00 25.80  ? 655  GLU A CB    1 
ATOM   5628 C  CG    . GLU C 3  649 ? 51.570 81.240  59.834 1.00 31.30  ? 655  GLU A CG    1 
ATOM   5629 C  CD    . GLU C 3  649 ? 50.874 79.946  60.196 1.00 30.12  ? 655  GLU A CD    1 
ATOM   5630 O  OE1   . GLU C 3  649 ? 51.002 79.484  61.347 1.00 32.13  ? 655  GLU A OE1   1 
ATOM   5631 O  OE2   . GLU C 3  649 ? 50.188 79.390  59.320 1.00 32.29  ? 655  GLU A OE2   1 
ATOM   5632 N  N     . ILE C 3  650 ? 53.275 83.992  61.093 1.00 21.58  ? 656  ILE A N     1 
ATOM   5633 C  CA    . ILE C 3  650 ? 54.654 83.826  61.499 1.00 20.98  ? 656  ILE A CA    1 
ATOM   5634 C  C     . ILE C 3  650 ? 54.624 83.054  62.798 1.00 20.94  ? 656  ILE A C     1 
ATOM   5635 O  O     . ILE C 3  650 ? 53.709 83.223  63.616 1.00 19.47  ? 656  ILE A O     1 
ATOM   5636 C  CB    . ILE C 3  650 ? 55.373 85.163  61.758 1.00 21.62  ? 656  ILE A CB    1 
ATOM   5637 C  CG1   . ILE C 3  650 ? 54.522 86.046  62.681 1.00 19.66  ? 656  ILE A CG1   1 
ATOM   5638 C  CG2   . ILE C 3  650 ? 55.711 85.839  60.434 1.00 20.97  ? 656  ILE A CG2   1 
ATOM   5639 C  CD1   . ILE C 3  650 ? 55.188 87.365  63.044 1.00 20.79  ? 656  ILE A CD1   1 
ATOM   5640 N  N     . GLN C 3  651 ? 55.603 82.176  62.960 1.00 19.30  ? 657  GLN A N     1 
ATOM   5641 C  CA    . GLN C 3  651 ? 55.742 81.406  64.184 1.00 20.21  ? 657  GLN A CA    1 
ATOM   5642 C  C     . GLN C 3  651 ? 57.082 81.909  64.692 1.00 19.77  ? 657  GLN A C     1 
ATOM   5643 O  O     . GLN C 3  651 ? 58.056 81.929  63.945 1.00 19.08  ? 657  GLN A O     1 
ATOM   5644 C  CB    . GLN C 3  651 ? 55.771 79.909  63.884 1.00 19.31  ? 657  GLN A CB    1 
ATOM   5645 C  CG    . GLN C 3  651 ? 54.430 79.351  63.417 1.00 18.91  ? 657  GLN A CG    1 
ATOM   5646 C  CD    . GLN C 3  651 ? 53.324 79.556  64.448 1.00 22.14  ? 657  GLN A CD    1 
ATOM   5647 O  OE1   . GLN C 3  651 ? 53.571 79.522  65.651 1.00 20.81  ? 657  GLN A OE1   1 
ATOM   5648 N  NE2   . GLN C 3  651 ? 52.100 79.747  63.978 1.00 18.30  ? 657  GLN A NE2   1 
ATOM   5649 N  N     . VAL C 3  652 ? 57.121 82.345  65.948 1.00 21.31  ? 658  VAL A N     1 
ATOM   5650 C  CA    . VAL C 3  652 ? 58.337 82.906  66.532 1.00 19.08  ? 658  VAL A CA    1 
ATOM   5651 C  C     . VAL C 3  652 ? 58.696 82.305  67.889 1.00 20.02  ? 658  VAL A C     1 
ATOM   5652 O  O     . VAL C 3  652 ? 57.882 82.295  68.805 1.00 21.56  ? 658  VAL A O     1 
ATOM   5653 C  CB    . VAL C 3  652 ? 58.181 84.452  66.713 1.00 19.86  ? 658  VAL A CB    1 
ATOM   5654 C  CG1   . VAL C 3  652 ? 59.460 85.059  67.283 1.00 17.62  ? 658  VAL A CG1   1 
ATOM   5655 C  CG2   . VAL C 3  652 ? 57.829 85.110  65.372 1.00 19.99  ? 658  VAL A CG2   1 
ATOM   5656 N  N     . GLY C 3  653 ? 59.918 81.803  68.016 1.00 21.28  ? 659  GLY A N     1 
ATOM   5657 C  CA    . GLY C 3  653 ? 60.350 81.258  69.290 1.00 19.19  ? 659  GLY A CA    1 
ATOM   5658 C  C     . GLY C 3  653 ? 60.699 82.431  70.189 1.00 19.99  ? 659  GLY A C     1 
ATOM   5659 O  O     . GLY C 3  653 ? 61.268 83.427  69.730 1.00 19.98  ? 659  GLY A O     1 
ATOM   5660 N  N     . CYS C 3  654 ? 60.354 82.328  71.466 1.00 19.87  ? 660  CYS A N     1 
ATOM   5661 C  CA    . CYS C 3  654 ? 60.633 83.394  72.420 1.00 20.93  ? 660  CYS A CA    1 
ATOM   5662 C  C     . CYS C 3  654 ? 61.264 82.811  73.683 1.00 21.38  ? 660  CYS A C     1 
ATOM   5663 O  O     . CYS C 3  654 ? 60.815 81.785  74.198 1.00 20.58  ? 660  CYS A O     1 
ATOM   5664 C  CB    . CYS C 3  654 ? 59.334 84.140  72.755 1.00 19.59  ? 660  CYS A CB    1 
ATOM   5665 S  SG    . CYS C 3  654 ? 58.466 84.729  71.279 1.00 22.20  ? 660  CYS A SG    1 
ATOM   5666 N  N     . ARG C 3  655 ? 62.308 83.466  74.179 1.00 20.74  ? 661  ARG A N     1 
ATOM   5667 C  CA    . ARG C 3  655 ? 62.998 82.976  75.366 1.00 20.94  ? 661  ARG A CA    1 
ATOM   5668 C  C     . ARG C 3  655 ? 62.083 82.880  76.584 1.00 21.71  ? 661  ARG A C     1 
ATOM   5669 O  O     . ARG C 3  655 ? 62.268 82.001  77.430 1.00 21.84  ? 661  ARG A O     1 
ATOM   5670 C  CB    . ARG C 3  655 ? 64.207 83.864  75.679 1.00 18.90  ? 661  ARG A CB    1 
ATOM   5671 C  CG    . ARG C 3  655 ? 65.070 83.358  76.823 1.00 18.51  ? 661  ARG A CG    1 
ATOM   5672 C  CD    . ARG C 3  655 ? 66.445 84.023  76.798 1.00 17.73  ? 661  ARG A CD    1 
ATOM   5673 N  NE    . ARG C 3  655 ? 66.326 85.477  76.749 1.00 17.55  ? 661  ARG A NE    1 
ATOM   5674 C  CZ    . ARG C 3  655 ? 65.895 86.228  77.758 1.00 18.96  ? 661  ARG A CZ    1 
ATOM   5675 N  NH1   . ARG C 3  655 ? 65.550 85.668  78.915 1.00 14.86  ? 661  ARG A NH1   1 
ATOM   5676 N  NH2   . ARG C 3  655 ? 65.781 87.539  77.596 1.00 17.07  ? 661  ARG A NH2   1 
ATOM   5677 N  N     . THR C 3  656 ? 61.098 83.772  76.676 1.00 20.86  ? 662  THR A N     1 
ATOM   5678 C  CA    . THR C 3  656 ? 60.174 83.761  77.814 1.00 21.91  ? 662  THR A CA    1 
ATOM   5679 C  C     . THR C 3  656 ? 58.743 84.080  77.398 1.00 23.09  ? 662  THR A C     1 
ATOM   5680 O  O     . THR C 3  656 ? 58.500 84.607  76.312 1.00 22.96  ? 662  THR A O     1 
ATOM   5681 C  CB    . THR C 3  656 ? 60.563 84.802  78.875 1.00 20.25  ? 662  THR A CB    1 
ATOM   5682 O  OG1   . THR C 3  656 ? 60.189 86.106  78.411 1.00 22.04  ? 662  THR A OG1   1 
ATOM   5683 C  CG2   . THR C 3  656 ? 62.053 84.781  79.130 1.00 16.89  ? 662  THR A CG2   1 
ATOM   5684 N  N     . GLU C 3  657 ? 57.796 83.771  78.278 1.00 24.23  ? 663  GLU A N     1 
ATOM   5685 C  CA    . GLU C 3  657 ? 56.396 84.044  77.997 1.00 25.93  ? 663  GLU A CA    1 
ATOM   5686 C  C     . GLU C 3  657 ? 56.183 85.534  77.826 1.00 25.23  ? 663  GLU A C     1 
ATOM   5687 O  O     . GLU C 3  657 ? 55.487 85.956  76.914 1.00 27.47  ? 663  GLU A O     1 
ATOM   5688 C  CB    . GLU C 3  657 ? 55.498 83.533  79.123 1.00 27.64  ? 663  GLU A CB    1 
ATOM   5689 C  CG    . GLU C 3  657 ? 55.612 82.047  79.371 1.00 31.18  ? 663  GLU A CG    1 
ATOM   5690 C  CD    . GLU C 3  657 ? 54.282 81.426  79.738 1.00 35.03  ? 663  GLU A CD    1 
ATOM   5691 O  OE1   . GLU C 3  657 ? 53.463 82.121  80.389 1.00 33.64  ? 663  GLU A OE1   1 
ATOM   5692 O  OE2   . GLU C 3  657 ? 54.063 80.243  79.381 1.00 34.93  ? 663  GLU A OE2   1 
ATOM   5693 N  N     . GLU C 3  658 ? 56.783 86.331  78.703 1.00 25.58  ? 664  GLU A N     1 
ATOM   5694 C  CA    . GLU C 3  658 ? 56.642 87.775  78.607 1.00 27.36  ? 664  GLU A CA    1 
ATOM   5695 C  C     . GLU C 3  658 ? 57.055 88.288  77.228 1.00 26.06  ? 664  GLU A C     1 
ATOM   5696 O  O     . GLU C 3  658 ? 56.399 89.162  76.672 1.00 27.09  ? 664  GLU A O     1 
ATOM   5697 C  CB    . GLU C 3  658 ? 57.456 88.476  79.702 1.00 30.14  ? 664  GLU A CB    1 
ATOM   5698 C  CG    . GLU C 3  658 ? 57.949 89.860  79.296 1.00 38.56  ? 664  GLU A CG    1 
ATOM   5699 C  CD    . GLU C 3  658 ? 58.044 90.836  80.452 1.00 45.33  ? 664  GLU A CD    1 
ATOM   5700 O  OE1   . GLU C 3  658 ? 58.565 90.463  81.531 1.00 47.87  ? 664  GLU A OE1   1 
ATOM   5701 O  OE2   . GLU C 3  658 ? 57.602 91.993  80.272 1.00 50.06  ? 664  GLU A OE2   1 
ATOM   5702 N  N     . ILE C 3  659 ? 58.144 87.754  76.683 1.00 24.30  ? 665  ILE A N     1 
ATOM   5703 C  CA    . ILE C 3  659 ? 58.600 88.161  75.359 1.00 22.91  ? 665  ILE A CA    1 
ATOM   5704 C  C     . ILE C 3  659 ? 57.582 87.714  74.298 1.00 23.31  ? 665  ILE A C     1 
ATOM   5705 O  O     . ILE C 3  659 ? 57.339 88.421  73.322 1.00 24.63  ? 665  ILE A O     1 
ATOM   5706 C  CB    . ILE C 3  659 ? 60.006 87.575  75.052 1.00 22.50  ? 665  ILE A CB    1 
ATOM   5707 C  CG1   . ILE C 3  659 ? 61.044 88.250  75.958 1.00 20.75  ? 665  ILE A CG1   1 
ATOM   5708 C  CG2   . ILE C 3  659 ? 60.378 87.795  73.579 1.00 19.42  ? 665  ILE A CG2   1 
ATOM   5709 C  CD1   . ILE C 3  659 ? 62.446 87.661  75.856 1.00 19.53  ? 665  ILE A CD1   1 
ATOM   5710 N  N     . ALA C 3  660 ? 56.979 86.548  74.496 1.00 21.53  ? 666  ALA A N     1 
ATOM   5711 C  CA    . ALA C 3  660 ? 55.978 86.052  73.559 1.00 22.70  ? 666  ALA A CA    1 
ATOM   5712 C  C     . ALA C 3  660 ? 54.784 87.018  73.559 1.00 23.58  ? 666  ALA A C     1 
ATOM   5713 O  O     . ALA C 3  660 ? 54.266 87.379  72.498 1.00 23.47  ? 666  ALA A O     1 
ATOM   5714 C  CB    . ALA C 3  660 ? 55.527 84.645  73.961 1.00 17.85  ? 666  ALA A CB    1 
ATOM   5715 N  N     . GLN C 3  661 ? 54.356 87.444  74.745 1.00 23.90  ? 667  GLN A N     1 
ATOM   5716 C  CA    . GLN C 3  661 ? 53.241 88.377  74.844 1.00 25.96  ? 667  GLN A CA    1 
ATOM   5717 C  C     . GLN C 3  661 ? 53.611 89.653  74.080 1.00 24.90  ? 667  GLN A C     1 
ATOM   5718 O  O     . GLN C 3  661 ? 52.789 90.218  73.362 1.00 25.49  ? 667  GLN A O     1 
ATOM   5719 C  CB    . GLN C 3  661 ? 52.927 88.720  76.315 1.00 31.76  ? 667  GLN A CB    1 
ATOM   5720 C  CG    . GLN C 3  661 ? 51.598 89.489  76.501 1.00 40.37  ? 667  GLN A CG    1 
ATOM   5721 C  CD    . GLN C 3  661 ? 51.407 90.113  77.893 1.00 44.72  ? 667  GLN A CD    1 
ATOM   5722 O  OE1   . GLN C 3  661 ? 51.216 89.410  78.892 1.00 47.95  ? 667  GLN A OE1   1 
ATOM   5723 N  NE2   . GLN C 3  661 ? 51.452 91.444  77.952 1.00 42.74  ? 667  GLN A NE2   1 
ATOM   5724 N  N     . VAL C 3  662 ? 54.852 90.103  74.222 1.00 23.12  ? 668  VAL A N     1 
ATOM   5725 C  CA    . VAL C 3  662 ? 55.279 91.310  73.531 1.00 22.69  ? 668  VAL A CA    1 
ATOM   5726 C  C     . VAL C 3  662 ? 55.352 91.122  72.011 1.00 23.36  ? 668  VAL A C     1 
ATOM   5727 O  O     . VAL C 3  662 ? 55.024 92.038  71.258 1.00 24.04  ? 668  VAL A O     1 
ATOM   5728 C  CB    . VAL C 3  662 ? 56.636 91.810  74.081 1.00 23.62  ? 668  VAL A CB    1 
ATOM   5729 C  CG1   . VAL C 3  662 ? 57.208 92.889  73.174 1.00 21.13  ? 668  VAL A CG1   1 
ATOM   5730 C  CG2   . VAL C 3  662 ? 56.440 92.376  75.488 1.00 21.08  ? 668  VAL A CG2   1 
ATOM   5731 N  N     . VAL C 3  663 ? 55.762 89.941  71.552 1.00 22.06  ? 669  VAL A N     1 
ATOM   5732 C  CA    . VAL C 3  663 ? 55.836 89.688  70.114 1.00 22.39  ? 669  VAL A CA    1 
ATOM   5733 C  C     . VAL C 3  663 ? 54.431 89.721  69.510 1.00 23.15  ? 669  VAL A C     1 
ATOM   5734 O  O     . VAL C 3  663 ? 54.201 90.321  68.453 1.00 24.00  ? 669  VAL A O     1 
ATOM   5735 C  CB    . VAL C 3  663 ? 56.480 88.311  69.817 1.00 23.29  ? 669  VAL A CB    1 
ATOM   5736 C  CG1   . VAL C 3  663 ? 56.305 87.958  68.344 1.00 23.70  ? 669  VAL A CG1   1 
ATOM   5737 C  CG2   . VAL C 3  663 ? 57.960 88.346  70.171 1.00 23.45  ? 669  VAL A CG2   1 
ATOM   5738 N  N     . ILE C 3  664 ? 53.495 89.064  70.189 1.00 23.48  ? 670  ILE A N     1 
ATOM   5739 C  CA    . ILE C 3  664 ? 52.105 89.017  69.756 1.00 21.51  ? 670  ILE A CA    1 
ATOM   5740 C  C     . ILE C 3  664 ? 51.500 90.427  69.672 1.00 23.71  ? 670  ILE A C     1 
ATOM   5741 O  O     . ILE C 3  664 ? 50.858 90.775  68.677 1.00 23.20  ? 670  ILE A O     1 
ATOM   5742 C  CB    . ILE C 3  664 ? 51.284 88.133  70.724 1.00 21.62  ? 670  ILE A CB    1 
ATOM   5743 C  CG1   . ILE C 3  664 ? 51.618 86.657  70.462 1.00 21.24  ? 670  ILE A CG1   1 
ATOM   5744 C  CG2   . ILE C 3  664 ? 49.791 88.429  70.590 1.00 19.44  ? 670  ILE A CG2   1 
ATOM   5745 C  CD1   . ILE C 3  664 ? 51.040 85.682  71.478 1.00 20.00  ? 670  ILE A CD1   1 
ATOM   5746 N  N     . GLU C 3  665 ? 51.714 91.245  70.700 1.00 22.98  ? 671  GLU A N     1 
ATOM   5747 C  CA    . GLU C 3  665 ? 51.174 92.604  70.693 1.00 24.72  ? 671  GLU A CA    1 
ATOM   5748 C  C     . GLU C 3  665 ? 51.867 93.442  69.620 1.00 24.73  ? 671  GLU A C     1 
ATOM   5749 O  O     . GLU C 3  665 ? 51.243 94.266  68.951 1.00 23.50  ? 671  GLU A O     1 
ATOM   5750 C  CB    . GLU C 3  665 ? 51.371 93.271  72.060 1.00 25.47  ? 671  GLU A CB    1 
ATOM   5751 C  CG    . GLU C 3  665 ? 50.842 92.445  73.225 1.00 32.81  ? 671  GLU A CG    1 
ATOM   5752 C  CD    . GLU C 3  665 ? 51.112 93.087  74.580 1.00 35.43  ? 671  GLU A CD    1 
ATOM   5753 O  OE1   . GLU C 3  665 ? 52.257 93.527  74.823 1.00 33.87  ? 671  GLU A OE1   1 
ATOM   5754 O  OE2   . GLU C 3  665 ? 50.177 93.142  75.407 1.00 38.40  ? 671  GLU A OE2   1 
ATOM   5755 N  N     . THR C 3  666 ? 53.166 93.229  69.457 1.00 22.48  ? 672  THR A N     1 
ATOM   5756 C  CA    . THR C 3  666 ? 53.924 93.980  68.474 1.00 21.45  ? 672  THR A CA    1 
ATOM   5757 C  C     . THR C 3  666 ? 53.508 93.609  67.049 1.00 21.51  ? 672  THR A C     1 
ATOM   5758 O  O     . THR C 3  666 ? 53.478 94.467  66.159 1.00 20.44  ? 672  THR A O     1 
ATOM   5759 C  CB    . THR C 3  666 ? 55.422 93.740  68.664 1.00 22.78  ? 672  THR A CB    1 
ATOM   5760 O  OG1   . THR C 3  666 ? 55.763 93.994  70.033 1.00 21.46  ? 672  THR A OG1   1 
ATOM   5761 C  CG2   . THR C 3  666 ? 56.231 94.665  67.767 1.00 22.04  ? 672  THR A CG2   1 
ATOM   5762 N  N     . ALA C 3  667 ? 53.181 92.339  66.829 1.00 20.75  ? 673  ALA A N     1 
ATOM   5763 C  CA    . ALA C 3  667 ? 52.752 91.906  65.501 1.00 21.70  ? 673  ALA A CA    1 
ATOM   5764 C  C     . ALA C 3  667 ? 51.455 92.633  65.114 1.00 21.31  ? 673  ALA A C     1 
ATOM   5765 O  O     . ALA C 3  667 ? 51.279 93.026  63.965 1.00 20.96  ? 673  ALA A O     1 
ATOM   5766 C  CB    . ALA C 3  667 ? 52.551 90.400  65.480 1.00 19.77  ? 673  ALA A CB    1 
ATOM   5767 N  N     . GLN C 3  668 ? 50.560 92.827  66.082 1.00 22.06  ? 674  GLN A N     1 
ATOM   5768 C  CA    . GLN C 3  668 ? 49.297 93.527  65.842 1.00 22.08  ? 674  GLN A CA    1 
ATOM   5769 C  C     . GLN C 3  668 ? 49.581 94.992  65.521 1.00 24.21  ? 674  GLN A C     1 
ATOM   5770 O  O     . GLN C 3  668 ? 49.050 95.542  64.554 1.00 26.56  ? 674  GLN A O     1 
ATOM   5771 C  CB    . GLN C 3  668 ? 48.393 93.421  67.078 1.00 23.21  ? 674  GLN A CB    1 
ATOM   5772 C  CG    . GLN C 3  668 ? 47.094 94.237  67.019 1.00 23.35  ? 674  GLN A CG    1 
ATOM   5773 C  CD    . GLN C 3  668 ? 46.165 93.812  65.889 1.00 24.78  ? 674  GLN A CD    1 
ATOM   5774 O  OE1   . GLN C 3  668 ? 46.280 92.708  65.352 1.00 24.42  ? 674  GLN A OE1   1 
ATOM   5775 N  NE2   . GLN C 3  668 ? 45.221 94.681  65.541 1.00 23.28  ? 674  GLN A NE2   1 
ATOM   5776 N  N     . GLU C 3  669 ? 50.427 95.629  66.323 1.00 25.41  ? 675  GLU A N     1 
ATOM   5777 C  CA    . GLU C 3  669 ? 50.767 97.030  66.080 1.00 28.06  ? 675  GLU A CA    1 
ATOM   5778 C  C     . GLU C 3  669 ? 51.319 97.195  64.668 1.00 26.76  ? 675  GLU A C     1 
ATOM   5779 O  O     . GLU C 3  669 ? 50.905 98.089  63.928 1.00 27.22  ? 675  GLU A O     1 
ATOM   5780 C  CB    . GLU C 3  669 ? 51.814 97.526  67.090 1.00 31.31  ? 675  GLU A CB    1 
ATOM   5781 C  CG    . GLU C 3  669 ? 51.283 97.743  68.503 1.00 36.78  ? 675  GLU A CG    1 
ATOM   5782 C  CD    . GLU C 3  669 ? 52.380 98.112  69.499 1.00 41.92  ? 675  GLU A CD    1 
ATOM   5783 O  OE1   . GLU C 3  669 ? 53.078 99.130  69.287 1.00 43.90  ? 675  GLU A OE1   1 
ATOM   5784 O  OE2   . GLU C 3  669 ? 52.542 97.380  70.500 1.00 45.16  ? 675  GLU A OE2   1 
ATOM   5785 N  N     . ALA C 3  670 ? 52.251 96.322  64.300 1.00 24.79  ? 676  ALA A N     1 
ATOM   5786 C  CA    . ALA C 3  670 ? 52.876 96.373  62.984 1.00 22.52  ? 676  ALA A CA    1 
ATOM   5787 C  C     . ALA C 3  670 ? 51.864 96.203  61.849 1.00 21.47  ? 676  ALA A C     1 
ATOM   5788 O  O     . ALA C 3  670 ? 51.977 96.850  60.806 1.00 19.47  ? 676  ALA A O     1 
ATOM   5789 C  CB    . ALA C 3  670 ? 53.963 95.299  62.880 1.00 20.20  ? 676  ALA A CB    1 
ATOM   5790 N  N     . MET C 3  671 ? 50.889 95.322  62.041 1.00 20.34  ? 677  MET A N     1 
ATOM   5791 C  CA    . MET C 3  671 ? 49.883 95.099  61.009 1.00 22.70  ? 677  MET A CA    1 
ATOM   5792 C  C     . MET C 3  671 ? 49.088 96.379  60.783 1.00 22.75  ? 677  MET A C     1 
ATOM   5793 O  O     . MET C 3  671 ? 48.859 96.779  59.646 1.00 23.19  ? 677  MET A O     1 
ATOM   5794 C  CB    . MET C 3  671 ? 48.935 93.960  61.406 1.00 21.71  ? 677  MET A CB    1 
ATOM   5795 C  CG    . MET C 3  671 ? 47.850 93.658  60.368 1.00 22.81  ? 677  MET A CG    1 
ATOM   5796 S  SD    . MET C 3  671 ? 48.520 93.288  58.715 1.00 24.47  ? 677  MET A SD    1 
ATOM   5797 C  CE    . MET C 3  671 ? 48.915 91.524  58.879 1.00 24.67  ? 677  MET A CE    1 
ATOM   5798 N  N     . ARG C 3  672 ? 48.677 97.022  61.872 1.00 24.33  ? 678  ARG A N     1 
ATOM   5799 C  CA    . ARG C 3  672 ? 47.917 98.263  61.788 1.00 23.77  ? 678  ARG A CA    1 
ATOM   5800 C  C     . ARG C 3  672 ? 48.754 99.321  61.101 1.00 23.84  ? 678  ARG A C     1 
ATOM   5801 O  O     . ARG C 3  672 ? 48.235 100.142 60.349 1.00 24.68  ? 678  ARG A O     1 
ATOM   5802 C  CB    . ARG C 3  672 ? 47.531 98.741  63.187 1.00 25.71  ? 678  ARG A CB    1 
ATOM   5803 C  CG    . ARG C 3  672 ? 46.366 97.994  63.785 1.00 26.23  ? 678  ARG A CG    1 
ATOM   5804 C  CD    . ARG C 3  672 ? 45.065 98.513  63.210 1.00 32.79  ? 678  ARG A CD    1 
ATOM   5805 N  NE    . ARG C 3  672 ? 44.019 98.529  64.234 1.00 35.89  ? 678  ARG A NE    1 
ATOM   5806 C  CZ    . ARG C 3  672 ? 43.276 97.475  64.530 1.00 36.56  ? 678  ARG A CZ    1 
ATOM   5807 N  NH1   . ARG C 3  672 ? 43.472 96.350  63.868 1.00 37.66  ? 678  ARG A NH1   1 
ATOM   5808 N  NH2   . ARG C 3  672 ? 42.364 97.532  65.488 1.00 34.88  ? 678  ARG A NH2   1 
ATOM   5809 N  N     . TRP C 3  673 ? 50.056 99.296  61.364 1.00 22.23  ? 679  TRP A N     1 
ATOM   5810 C  CA    . TRP C 3  673 ? 50.972 100.247 60.760 1.00 21.79  ? 679  TRP A CA    1 
ATOM   5811 C  C     . TRP C 3  673 ? 51.017 100.030 59.238 1.00 21.95  ? 679  TRP A C     1 
ATOM   5812 O  O     . TRP C 3  673 ? 51.035 100.989 58.453 1.00 23.39  ? 679  TRP A O     1 
ATOM   5813 C  CB    . TRP C 3  673 ? 52.368 100.068 61.362 1.00 19.59  ? 679  TRP A CB    1 
ATOM   5814 C  CG    . TRP C 3  673 ? 53.378 101.035 60.835 1.00 20.44  ? 679  TRP A CG    1 
ATOM   5815 C  CD1   . TRP C 3  673 ? 53.722 102.235 61.384 1.00 20.52  ? 679  TRP A CD1   1 
ATOM   5816 C  CD2   . TRP C 3  673 ? 54.154 100.905 59.632 1.00 20.51  ? 679  TRP A CD2   1 
ATOM   5817 N  NE1   . TRP C 3  673 ? 54.662 102.863 60.601 1.00 20.52  ? 679  TRP A NE1   1 
ATOM   5818 C  CE2   . TRP C 3  673 ? 54.944 102.072 59.519 1.00 20.60  ? 679  TRP A CE2   1 
ATOM   5819 C  CE3   . TRP C 3  673 ? 54.258 99.917  58.641 1.00 19.42  ? 679  TRP A CE3   1 
ATOM   5820 C  CZ2   . TRP C 3  673 ? 55.829 102.283 58.450 1.00 19.00  ? 679  TRP A CZ2   1 
ATOM   5821 C  CZ3   . TRP C 3  673 ? 55.141 100.126 57.573 1.00 19.07  ? 679  TRP A CZ3   1 
ATOM   5822 C  CH2   . TRP C 3  673 ? 55.914 101.306 57.492 1.00 21.15  ? 679  TRP A CH2   1 
ATOM   5823 N  N     . VAL C 3  674 ? 51.039 98.772  58.814 1.00 21.87  ? 680  VAL A N     1 
ATOM   5824 C  CA    . VAL C 3  674 ? 51.068 98.481  57.382 1.00 21.48  ? 680  VAL A CA    1 
ATOM   5825 C  C     . VAL C 3  674 ? 49.785 99.000  56.735 1.00 20.71  ? 680  VAL A C     1 
ATOM   5826 O  O     . VAL C 3  674 ? 49.821 99.630  55.684 1.00 21.61  ? 680  VAL A O     1 
ATOM   5827 C  CB    . VAL C 3  674 ? 51.217 96.965  57.116 1.00 20.81  ? 680  VAL A CB    1 
ATOM   5828 C  CG1   . VAL C 3  674 ? 50.973 96.662  55.641 1.00 20.93  ? 680  VAL A CG1   1 
ATOM   5829 C  CG2   . VAL C 3  674 ? 52.626 96.513  57.508 1.00 20.08  ? 680  VAL A CG2   1 
ATOM   5830 N  N     . GLY C 3  675 ? 48.653 98.740  57.376 1.00 21.50  ? 681  GLY A N     1 
ATOM   5831 C  CA    . GLY C 3  675 ? 47.385 99.202  56.844 1.00 24.88  ? 681  GLY A CA    1 
ATOM   5832 C  C     . GLY C 3  675 ? 47.393 100.711 56.655 1.00 26.33  ? 681  GLY A C     1 
ATOM   5833 O  O     . GLY C 3  675 ? 46.990 101.207 55.605 1.00 26.29  ? 681  GLY A O     1 
ATOM   5834 N  N     . ASP C 3  676 ? 47.846 101.443 57.670 1.00 26.29  ? 682  ASP A N     1 
ATOM   5835 C  CA    . ASP C 3  676 ? 47.909 102.901 57.576 1.00 28.33  ? 682  ASP A CA    1 
ATOM   5836 C  C     . ASP C 3  676 ? 48.935 103.318 56.532 1.00 27.85  ? 682  ASP A C     1 
ATOM   5837 O  O     . ASP C 3  676 ? 48.718 104.268 55.785 1.00 27.68  ? 682  ASP A O     1 
ATOM   5838 C  CB    . ASP C 3  676 ? 48.299 103.519 58.922 1.00 30.80  ? 682  ASP A CB    1 
ATOM   5839 C  CG    . ASP C 3  676 ? 48.572 105.014 58.821 1.00 34.79  ? 682  ASP A CG    1 
ATOM   5840 O  OD1   . ASP C 3  676 ? 47.628 105.824 58.968 1.00 35.67  ? 682  ASP A OD1   1 
ATOM   5841 O  OD2   . ASP C 3  676 ? 49.743 105.384 58.580 1.00 38.13  ? 682  ASP A OD2   1 
ATOM   5842 N  N     . HIS C 3  677 ? 50.055 102.602 56.491 1.00 26.95  ? 683  HIS A N     1 
ATOM   5843 C  CA    . HIS C 3  677 ? 51.130 102.903 55.554 1.00 25.23  ? 683  HIS A CA    1 
ATOM   5844 C  C     . HIS C 3  677 ? 50.660 102.981 54.108 1.00 25.90  ? 683  HIS A C     1 
ATOM   5845 O  O     . HIS C 3  677 ? 51.143 103.807 53.334 1.00 25.71  ? 683  HIS A O     1 
ATOM   5846 C  CB    . HIS C 3  677 ? 52.229 101.843 55.654 1.00 25.60  ? 683  HIS A CB    1 
ATOM   5847 C  CG    . HIS C 3  677 ? 53.323 102.013 54.643 1.00 23.45  ? 683  HIS A CG    1 
ATOM   5848 N  ND1   . HIS C 3  677 ? 54.281 103.000 54.740 1.00 24.14  ? 683  HIS A ND1   1 
ATOM   5849 C  CD2   . HIS C 3  677 ? 53.598 101.333 53.504 1.00 21.67  ? 683  HIS A CD2   1 
ATOM   5850 C  CE1   . HIS C 3  677 ? 55.100 102.921 53.705 1.00 22.77  ? 683  HIS A CE1   1 
ATOM   5851 N  NE2   . HIS C 3  677 ? 54.707 101.917 52.940 1.00 24.35  ? 683  HIS A NE2   1 
ATOM   5852 N  N     . TRP C 3  678 ? 49.733 102.108 53.732 1.00 25.07  ? 684  TRP A N     1 
ATOM   5853 C  CA    . TRP C 3  678 ? 49.239 102.110 52.366 1.00 24.82  ? 684  TRP A CA    1 
ATOM   5854 C  C     . TRP C 3  678 ? 47.794 102.583 52.226 1.00 24.85  ? 684  TRP A C     1 
ATOM   5855 O  O     . TRP C 3  678 ? 47.113 102.230 51.268 1.00 23.26  ? 684  TRP A O     1 
ATOM   5856 C  CB    . TRP C 3  678 ? 49.394 100.717 51.740 1.00 23.42  ? 684  TRP A CB    1 
ATOM   5857 C  CG    . TRP C 3  678 ? 50.807 100.395 51.291 1.00 21.68  ? 684  TRP A CG    1 
ATOM   5858 C  CD1   . TRP C 3  678 ? 51.697 101.250 50.704 1.00 20.87  ? 684  TRP A CD1   1 
ATOM   5859 C  CD2   . TRP C 3  678 ? 51.449 99.113  51.323 1.00 19.62  ? 684  TRP A CD2   1 
ATOM   5860 N  NE1   . TRP C 3  678 ? 52.851 100.579 50.366 1.00 20.40  ? 684  TRP A NE1   1 
ATOM   5861 C  CE2   . TRP C 3  678 ? 52.724 99.265  50.735 1.00 19.12  ? 684  TRP A CE2   1 
ATOM   5862 C  CE3   . TRP C 3  678 ? 51.068 97.847  51.789 1.00 18.61  ? 684  TRP A CE3   1 
ATOM   5863 C  CZ2   . TRP C 3  678 ? 53.619 98.203  50.601 1.00 18.21  ? 684  TRP A CZ2   1 
ATOM   5864 C  CZ3   . TRP C 3  678 ? 51.956 96.792  51.653 1.00 17.45  ? 684  TRP A CZ3   1 
ATOM   5865 C  CH2   . TRP C 3  678 ? 53.217 96.976  51.065 1.00 19.60  ? 684  TRP A CH2   1 
ATOM   5866 N  N     . ASN C 3  679 ? 47.332 103.383 53.182 1.00 24.93  ? 685  ASN A N     1 
ATOM   5867 C  CA    . ASN C 3  679 ? 45.976 103.921 53.138 1.00 24.87  ? 685  ASN A CA    1 
ATOM   5868 C  C     . ASN C 3  679 ? 44.925 102.871 52.794 1.00 24.73  ? 685  ASN A C     1 
ATOM   5869 O  O     . ASN C 3  679 ? 44.042 103.112 51.966 1.00 24.67  ? 685  ASN A O     1 
ATOM   5870 C  CB    . ASN C 3  679 ? 45.909 105.050 52.110 1.00 24.60  ? 685  ASN A CB    1 
ATOM   5871 C  CG    . ASN C 3  679 ? 46.943 106.131 52.364 1.00 29.35  ? 685  ASN A CG    1 
ATOM   5872 O  OD1   . ASN C 3  679 ? 46.978 106.735 53.435 1.00 31.44  ? 685  ASN A OD1   1 
ATOM   5873 N  ND2   . ASN C 3  679 ? 47.793 106.380 51.375 1.00 30.67  ? 685  ASN A ND2   1 
ATOM   5874 N  N     . PHE C 3  680 ? 45.007 101.707 53.427 1.00 24.53  ? 686  PHE A N     1 
ATOM   5875 C  CA    . PHE C 3  680 ? 44.038 100.657 53.145 1.00 26.39  ? 686  PHE A CA    1 
ATOM   5876 C  C     . PHE C 3  680 ? 42.645 101.076 53.585 1.00 25.86  ? 686  PHE A C     1 
ATOM   5877 O  O     . PHE C 3  680 ? 42.488 101.763 54.588 1.00 26.25  ? 686  PHE A O     1 
ATOM   5878 C  CB    . PHE C 3  680 ? 44.440 99.353  53.830 1.00 24.58  ? 686  PHE A CB    1 
ATOM   5879 C  CG    . PHE C 3  680 ? 44.417 98.177  52.912 1.00 23.37  ? 686  PHE A CG    1 
ATOM   5880 C  CD1   . PHE C 3  680 ? 45.146 98.200  51.723 1.00 22.83  ? 686  PHE A CD1   1 
ATOM   5881 C  CD2   . PHE C 3  680 ? 43.668 97.052  53.218 1.00 22.54  ? 686  PHE A CD2   1 
ATOM   5882 C  CE1   . PHE C 3  680 ? 45.125 97.120  50.859 1.00 21.18  ? 686  PHE A CE1   1 
ATOM   5883 C  CE2   . PHE C 3  680 ? 43.643 95.965  52.359 1.00 22.99  ? 686  PHE A CE2   1 
ATOM   5884 C  CZ    . PHE C 3  680 ? 44.376 96.000  51.173 1.00 21.37  ? 686  PHE A CZ    1 
ATOM   5885 N  N     . ARG C 3  681 ? 41.639 100.656 52.824 1.00 26.41  ? 687  ARG A N     1 
ATOM   5886 C  CA    . ARG C 3  681 ? 40.253 101.015 53.107 1.00 27.45  ? 687  ARG A CA    1 
ATOM   5887 C  C     . ARG C 3  681 ? 39.548 100.033 54.016 1.00 26.19  ? 687  ARG A C     1 
ATOM   5888 O  O     . ARG C 3  681 ? 38.356 100.158 54.278 1.00 26.89  ? 687  ARG A O     1 
ATOM   5889 C  CB    . ARG C 3  681 ? 39.486 101.168 51.802 1.00 27.10  ? 687  ARG A CB    1 
ATOM   5890 C  CG    . ARG C 3  681 ? 40.025 102.296 50.948 1.00 30.67  ? 687  ARG A CG    1 
ATOM   5891 C  CD    . ARG C 3  681 ? 39.228 103.565 51.156 1.00 29.98  ? 687  ARG A CD    1 
ATOM   5892 N  NE    . ARG C 3  681 ? 38.507 103.911 49.938 1.00 33.25  ? 687  ARG A NE    1 
ATOM   5893 C  CZ    . ARG C 3  681 ? 37.249 104.333 49.901 1.00 30.90  ? 687  ARG A CZ    1 
ATOM   5894 N  NH1   . ARG C 3  681 ? 36.555 104.467 51.019 1.00 32.17  ? 687  ARG A NH1   1 
ATOM   5895 N  NH2   . ARG C 3  681 ? 36.684 104.610 48.739 1.00 31.08  ? 687  ARG A NH2   1 
ATOM   5896 N  N     . CYS C 3  682 ? 40.289 99.044  54.490 1.00 25.58  ? 688  CYS A N     1 
ATOM   5897 C  CA    . CYS C 3  682 ? 39.738 98.078  55.421 1.00 24.38  ? 688  CYS A CA    1 
ATOM   5898 C  C     . CYS C 3  682 ? 40.751 97.963  56.540 1.00 24.95  ? 688  CYS A C     1 
ATOM   5899 O  O     . CYS C 3  682 ? 41.960 97.890  56.288 1.00 27.06  ? 688  CYS A O     1 
ATOM   5900 C  CB    . CYS C 3  682 ? 39.538 96.710  54.765 1.00 23.35  ? 688  CYS A CB    1 
ATOM   5901 S  SG    . CYS C 3  682 ? 38.679 95.550  55.856 1.00 25.93  ? 688  CYS A SG    1 
ATOM   5902 N  N     . LEU C 3  683 ? 40.269 97.959  57.773 1.00 23.17  ? 689  LEU A N     1 
ATOM   5903 C  CA    . LEU C 3  683 ? 41.150 97.849  58.921 1.00 25.32  ? 689  LEU A CA    1 
ATOM   5904 C  C     . LEU C 3  683 ? 41.770 96.450  58.918 1.00 24.31  ? 689  LEU A C     1 
ATOM   5905 O  O     . LEU C 3  683 ? 41.081 95.461  58.700 1.00 25.34  ? 689  LEU A O     1 
ATOM   5906 C  CB    . LEU C 3  683 ? 40.360 98.088  60.211 1.00 24.91  ? 689  LEU A CB    1 
ATOM   5907 C  CG    . LEU C 3  683 ? 41.151 98.192  61.522 1.00 28.04  ? 689  LEU A CG    1 
ATOM   5908 C  CD1   . LEU C 3  683 ? 41.948 99.500  61.563 1.00 26.93  ? 689  LEU A CD1   1 
ATOM   5909 C  CD2   . LEU C 3  683 ? 40.176 98.132  62.694 1.00 26.60  ? 689  LEU A CD2   1 
ATOM   5910 N  N     . LEU C 3  684 ? 43.073 96.376  59.163 1.00 23.31  ? 690  LEU A N     1 
ATOM   5911 C  CA    . LEU C 3  684 ? 43.783 95.103  59.167 1.00 21.40  ? 690  LEU A CA    1 
ATOM   5912 C  C     . LEU C 3  684 ? 44.035 94.620  60.590 1.00 21.47  ? 690  LEU A C     1 
ATOM   5913 O  O     . LEU C 3  684 ? 44.376 95.418  61.456 1.00 21.56  ? 690  LEU A O     1 
ATOM   5914 C  CB    . LEU C 3  684 ? 45.109 95.258  58.422 1.00 21.51  ? 690  LEU A CB    1 
ATOM   5915 C  CG    . LEU C 3  684 ? 45.017 95.617  56.937 1.00 20.33  ? 690  LEU A CG    1 
ATOM   5916 C  CD1   . LEU C 3  684 ? 46.406 95.563  56.318 1.00 19.10  ? 690  LEU A CD1   1 
ATOM   5917 C  CD2   . LEU C 3  684 ? 44.090 94.628  56.228 1.00 18.63  ? 690  LEU A CD2   1 
ATOM   5918 N  N     . ASP C 3  685 ? 43.869 93.319  60.824 1.00 20.04  ? 691  ASP A N     1 
ATOM   5919 C  CA    . ASP C 3  685 ? 44.072 92.737  62.154 1.00 20.40  ? 691  ASP A CA    1 
ATOM   5920 C  C     . ASP C 3  685 ? 44.887 91.440  62.148 1.00 20.69  ? 691  ASP A C     1 
ATOM   5921 O  O     . ASP C 3  685 ? 45.138 90.850  61.097 1.00 20.25  ? 691  ASP A O     1 
ATOM   5922 C  CB    . ASP C 3  685 ? 42.722 92.432  62.814 1.00 22.13  ? 691  ASP A CB    1 
ATOM   5923 C  CG    . ASP C 3  685 ? 42.008 93.672  63.280 1.00 25.30  ? 691  ASP A CG    1 
ATOM   5924 O  OD1   . ASP C 3  685 ? 42.549 94.344  64.173 1.00 25.38  ? 691  ASP A OD1   1 
ATOM   5925 O  OD2   . ASP C 3  685 ? 40.912 93.975  62.760 1.00 26.77  ? 691  ASP A OD2   1 
ATOM   5926 N  N     . THR C 3  686 ? 45.280 91.001  63.341 1.00 19.01  ? 692  THR A N     1 
ATOM   5927 C  CA    . THR C 3  686 ? 46.014 89.755  63.501 1.00 22.02  ? 692  THR A CA    1 
ATOM   5928 C  C     . THR C 3  686 ? 45.460 89.033  64.723 1.00 24.97  ? 692  THR A C     1 
ATOM   5929 O  O     . THR C 3  686 ? 44.784 89.626  65.561 1.00 25.99  ? 692  THR A O     1 
ATOM   5930 C  CB    . THR C 3  686 ? 47.531 89.977  63.728 1.00 21.20  ? 692  THR A CB    1 
ATOM   5931 O  OG1   . THR C 3  686 ? 47.749 90.634  64.989 1.00 19.49  ? 692  THR A OG1   1 
ATOM   5932 C  CG2   . THR C 3  686 ? 48.118 90.808  62.608 1.00 18.48  ? 692  THR A CG2   1 
ATOM   5933 N  N     . GLU C 3  687 ? 45.734 87.741  64.810 1.00 27.71  ? 693  GLU A N     1 
ATOM   5934 C  CA    . GLU C 3  687 ? 45.289 86.954  65.944 1.00 30.04  ? 693  GLU A CA    1 
ATOM   5935 C  C     . GLU C 3  687 ? 46.524 86.194  66.407 1.00 28.96  ? 693  GLU A C     1 
ATOM   5936 O  O     . GLU C 3  687 ? 47.182 85.529  65.609 1.00 26.59  ? 693  GLU A O     1 
ATOM   5937 C  CB    . GLU C 3  687 ? 44.172 85.990  65.528 1.00 31.97  ? 693  GLU A CB    1 
ATOM   5938 C  CG    . GLU C 3  687 ? 43.537 85.253  66.697 1.00 39.84  ? 693  GLU A CG    1 
ATOM   5939 C  CD    . GLU C 3  687 ? 42.454 84.275  66.260 1.00 44.91  ? 693  GLU A CD    1 
ATOM   5940 O  OE1   . GLU C 3  687 ? 42.745 83.384  65.430 1.00 46.58  ? 693  GLU A OE1   1 
ATOM   5941 O  OE2   . GLU C 3  687 ? 41.309 84.396  66.745 1.00 46.28  ? 693  GLU A OE2   1 
ATOM   5942 N  N     . GLY C 3  688 ? 46.844 86.316  67.692 1.00 29.39  ? 694  GLY A N     1 
ATOM   5943 C  CA    . GLY C 3  688 ? 48.020 85.655  68.223 1.00 29.22  ? 694  GLY A CA    1 
ATOM   5944 C  C     . GLY C 3  688 ? 47.745 84.586  69.255 1.00 28.98  ? 694  GLY A C     1 
ATOM   5945 O  O     . GLY C 3  688 ? 46.796 84.680  70.028 1.00 30.24  ? 694  GLY A O     1 
ATOM   5946 N  N     . LYS C 3  689 ? 48.601 83.572  69.267 1.00 28.47  ? 695  LYS A N     1 
ATOM   5947 C  CA    . LYS C 3  689 ? 48.483 82.460  70.197 1.00 28.41  ? 695  LYS A CA    1 
ATOM   5948 C  C     . LYS C 3  689 ? 49.846 82.106  70.773 1.00 26.20  ? 695  LYS A C     1 
ATOM   5949 O  O     . LYS C 3  689 ? 50.823 81.973  70.043 1.00 28.16  ? 695  LYS A O     1 
ATOM   5950 C  CB    . LYS C 3  689 ? 47.923 81.231  69.482 1.00 30.66  ? 695  LYS A CB    1 
ATOM   5951 C  CG    . LYS C 3  689 ? 46.551 81.418  68.867 1.00 33.97  ? 695  LYS A CG    1 
ATOM   5952 C  CD    . LYS C 3  689 ? 46.187 80.201  68.022 1.00 37.05  ? 695  LYS A CD    1 
ATOM   5953 C  CE    . LYS C 3  689 ? 44.775 80.296  67.470 1.00 38.12  ? 695  LYS A CE    1 
ATOM   5954 N  NZ    . LYS C 3  689 ? 44.434 79.082  66.673 1.00 40.87  ? 695  LYS A NZ    1 
ATOM   5955 N  N     . MET C 3  690 ? 49.908 81.957  72.086 1.00 25.90  ? 696  MET A N     1 
ATOM   5956 C  CA    . MET C 3  690 ? 51.145 81.589  72.750 1.00 25.86  ? 696  MET A CA    1 
ATOM   5957 C  C     . MET C 3  690 ? 51.021 80.120  73.109 1.00 26.61  ? 696  MET A C     1 
ATOM   5958 O  O     . MET C 3  690 ? 49.941 79.657  73.477 1.00 28.30  ? 696  MET A O     1 
ATOM   5959 C  CB    . MET C 3  690 ? 51.347 82.410  74.024 1.00 25.64  ? 696  MET A CB    1 
ATOM   5960 C  CG    . MET C 3  690 ? 52.628 82.064  74.777 1.00 27.91  ? 696  MET A CG    1 
ATOM   5961 S  SD    . MET C 3  690 ? 52.836 83.048  76.287 1.00 32.32  ? 696  MET A SD    1 
ATOM   5962 C  CE    . MET C 3  690 ? 52.500 84.653  75.642 1.00 28.30  ? 696  MET A CE    1 
ATOM   5963 N  N     . GLY C 3  691 ? 52.120 79.385  72.999 1.00 25.62  ? 697  GLY A N     1 
ATOM   5964 C  CA    . GLY C 3  691 ? 52.086 77.972  73.318 1.00 24.00  ? 697  GLY A CA    1 
ATOM   5965 C  C     . GLY C 3  691 ? 53.457 77.367  73.115 1.00 24.26  ? 697  GLY A C     1 
ATOM   5966 O  O     . GLY C 3  691 ? 54.382 78.069  72.713 1.00 24.17  ? 697  GLY A O     1 
ATOM   5967 N  N     . PRO C 3  692 ? 53.624 76.065  73.381 1.00 23.54  ? 698  PRO A N     1 
ATOM   5968 C  CA    . PRO C 3  692 ? 54.912 75.383  73.220 1.00 23.04  ? 698  PRO A CA    1 
ATOM   5969 C  C     . PRO C 3  692 ? 55.254 74.969  71.785 1.00 22.48  ? 698  PRO A C     1 
ATOM   5970 O  O     . PRO C 3  692 ? 56.430 74.862  71.441 1.00 23.77  ? 698  PRO A O     1 
ATOM   5971 C  CB    . PRO C 3  692 ? 54.762 74.169  74.131 1.00 22.54  ? 698  PRO A CB    1 
ATOM   5972 C  CG    . PRO C 3  692 ? 53.332 73.809  73.916 1.00 22.23  ? 698  PRO A CG    1 
ATOM   5973 C  CD    . PRO C 3  692 ? 52.628 75.158  73.977 1.00 21.24  ? 698  PRO A CD    1 
ATOM   5974 N  N     . ASN C 3  693 ? 54.245 74.738  70.949 1.00 21.56  ? 699  ASN A N     1 
ATOM   5975 C  CA    . ASN C 3  693 ? 54.508 74.290  69.580 1.00 22.62  ? 699  ASN A CA    1 
ATOM   5976 C  C     . ASN C 3  693 ? 53.471 74.727  68.540 1.00 22.89  ? 699  ASN A C     1 
ATOM   5977 O  O     . ASN C 3  693 ? 52.509 75.433  68.860 1.00 22.11  ? 699  ASN A O     1 
ATOM   5978 C  CB    . ASN C 3  693 ? 54.636 72.760  69.567 1.00 22.83  ? 699  ASN A CB    1 
ATOM   5979 C  CG    . ASN C 3  693 ? 53.382 72.070  70.075 1.00 22.72  ? 699  ASN A CG    1 
ATOM   5980 O  OD1   . ASN C 3  693 ? 52.296 72.251  69.520 1.00 22.72  ? 699  ASN A OD1   1 
ATOM   5981 N  ND2   . ASN C 3  693 ? 53.523 71.279  71.138 1.00 21.93  ? 699  ASN A ND2   1 
ATOM   5982 N  N     . TRP C 3  694 ? 53.662 74.279  67.299 1.00 21.45  ? 700  TRP A N     1 
ATOM   5983 C  CA    . TRP C 3  694 ? 52.779 74.649  66.196 1.00 21.00  ? 700  TRP A CA    1 
ATOM   5984 C  C     . TRP C 3  694 ? 51.370 74.060  66.276 1.00 22.11  ? 700  TRP A C     1 
ATOM   5985 O  O     . TRP C 3  694 ? 50.449 74.597  65.674 1.00 23.18  ? 700  TRP A O     1 
ATOM   5986 C  CB    . TRP C 3  694 ? 53.410 74.251  64.861 1.00 19.31  ? 700  TRP A CB    1 
ATOM   5987 C  CG    . TRP C 3  694 ? 53.098 75.192  63.711 1.00 19.42  ? 700  TRP A CG    1 
ATOM   5988 C  CD1   . TRP C 3  694 ? 52.155 76.178  63.679 1.00 17.24  ? 700  TRP A CD1   1 
ATOM   5989 C  CD2   . TRP C 3  694 ? 53.780 75.251  62.454 1.00 18.88  ? 700  TRP A CD2   1 
ATOM   5990 N  NE1   . TRP C 3  694 ? 52.214 76.854  62.483 1.00 18.59  ? 700  TRP A NE1   1 
ATOM   5991 C  CE2   . TRP C 3  694 ? 53.203 76.301  61.711 1.00 18.62  ? 700  TRP A CE2   1 
ATOM   5992 C  CE3   . TRP C 3  694 ? 54.828 74.514  61.881 1.00 17.70  ? 700  TRP A CE3   1 
ATOM   5993 C  CZ2   . TRP C 3  694 ? 53.640 76.642  60.431 1.00 19.47  ? 700  TRP A CZ2   1 
ATOM   5994 C  CZ3   . TRP C 3  694 ? 55.263 74.851  60.612 1.00 19.65  ? 700  TRP A CZ3   1 
ATOM   5995 C  CH2   . TRP C 3  694 ? 54.666 75.907  59.897 1.00 18.07  ? 700  TRP A CH2   1 
ATOM   5996 N  N     . ALA C 3  695 ? 51.191 72.964  67.007 1.00 22.53  ? 701  ALA A N     1 
ATOM   5997 C  CA    . ALA C 3  695 ? 49.858 72.376  67.131 1.00 24.88  ? 701  ALA A CA    1 
ATOM   5998 C  C     . ALA C 3  695 ? 48.963 73.274  67.978 1.00 27.03  ? 701  ALA A C     1 
ATOM   5999 O  O     . ALA C 3  695 ? 47.747 73.306  67.794 1.00 29.55  ? 701  ALA A O     1 
ATOM   6000 C  CB    . ALA C 3  695 ? 49.936 71.000  67.763 1.00 25.37  ? 701  ALA A CB    1 
ATOM   6001 N  N     . ILE C 3  696 ? 49.573 74.007  68.901 1.00 26.90  ? 702  ILE A N     1 
ATOM   6002 C  CA    . ILE C 3  696 ? 48.835 74.902  69.787 1.00 27.29  ? 702  ILE A CA    1 
ATOM   6003 C  C     . ILE C 3  696 ? 48.822 76.349  69.300 1.00 28.70  ? 702  ILE A C     1 
ATOM   6004 O  O     . ILE C 3  696 ? 47.882 77.094  69.581 1.00 29.18  ? 702  ILE A O     1 
ATOM   6005 C  CB    . ILE C 3  696 ? 49.436 74.868  71.205 1.00 27.37  ? 702  ILE A CB    1 
ATOM   6006 C  CG1   . ILE C 3  696 ? 49.355 73.442  71.753 1.00 29.83  ? 702  ILE A CG1   1 
ATOM   6007 C  CG2   . ILE C 3  696 ? 48.701 75.840  72.119 1.00 26.92  ? 702  ILE A CG2   1 
ATOM   6008 C  CD1   . ILE C 3  696 ? 50.047 73.251  73.069 1.00 32.33  ? 702  ILE A CD1   1 
ATOM   6009 N  N     . CYS C 3  697 ? 49.850 76.742  68.556 1.00 27.88  ? 703  CYS A N     1 
ATOM   6010 C  CA    . CYS C 3  697 ? 49.949 78.111  68.071 1.00 29.38  ? 703  CYS A CA    1 
ATOM   6011 C  C     . CYS C 3  697 ? 49.403 78.440  66.688 1.00 30.90  ? 703  CYS A C     1 
ATOM   6012 O  O     . CYS C 3  697 ? 49.899 79.348  66.019 1.00 31.33  ? 703  CYS A O     1 
ATOM   6013 C  CB    . CYS C 3  697 ? 51.399 78.577  68.165 1.00 26.72  ? 703  CYS A CB    1 
ATOM   6014 S  SG    . CYS C 3  697 ? 51.945 78.686  69.867 1.00 29.31  ? 703  CYS A SG    1 
ATOM   6015 N  N     . HIS C 3  698 ? 48.382 77.716  66.255 1.00 34.62  ? 704  HIS A N     1 
ATOM   6016 C  CA    . HIS C 3  698 ? 47.769 77.985  64.959 1.00 37.90  ? 704  HIS A CA    1 
ATOM   6017 C  C     . HIS C 3  698 ? 46.475 77.209  64.855 1.00 37.49  ? 704  HIS A C     1 
ATOM   6018 O  O     . HIS C 3  698 ? 45.510 77.771  64.299 1.00 37.83  ? 704  HIS A O     1 
ATOM   6019 C  CB    . HIS C 3  698 ? 48.695 77.596  63.801 1.00 39.72  ? 704  HIS A CB    1 
ATOM   6020 C  CG    . HIS C 3  698 ? 48.190 78.026  62.457 1.00 41.29  ? 704  HIS A CG    1 
ATOM   6021 N  ND1   . HIS C 3  698 ? 48.104 79.351  62.083 1.00 42.56  ? 704  HIS A ND1   1 
ATOM   6022 C  CD2   . HIS C 3  698 ? 47.723 77.309  61.405 1.00 42.46  ? 704  HIS A CD2   1 
ATOM   6023 C  CE1   . HIS C 3  698 ? 47.607 79.433  60.860 1.00 42.08  ? 704  HIS A CE1   1 
ATOM   6024 N  NE2   . HIS C 3  698 ? 47.367 78.207  60.427 1.00 41.92  ? 704  HIS A NE2   1 
ATOM   6025 O  OXT   . HIS C 3  698 ? 46.458 76.051  65.324 1.00 37.94  ? 704  HIS A OXT   1 
ATOM   6026 N  N     . LYS D 4  3   ? 39.417 14.638  27.703 1.00 46.89  ? 3    LYS B N     1 
ATOM   6027 C  CA    . LYS D 4  3   ? 40.666 13.972  28.185 1.00 48.01  ? 3    LYS B CA    1 
ATOM   6028 C  C     . LYS D 4  3   ? 41.582 14.905  28.973 1.00 47.30  ? 3    LYS B C     1 
ATOM   6029 O  O     . LYS D 4  3   ? 42.352 14.455  29.823 1.00 47.96  ? 3    LYS B O     1 
ATOM   6030 C  CB    . LYS D 4  3   ? 41.442 13.377  27.008 1.00 49.40  ? 3    LYS B CB    1 
ATOM   6031 C  CG    . LYS D 4  3   ? 41.008 11.967  26.620 1.00 53.96  ? 3    LYS B CG    1 
ATOM   6032 C  CD    . LYS D 4  3   ? 41.839 11.440  25.448 1.00 55.41  ? 3    LYS B CD    1 
ATOM   6033 C  CE    . LYS D 4  3   ? 41.541 9.975   25.142 1.00 56.81  ? 3    LYS B CE    1 
ATOM   6034 N  NZ    . LYS D 4  3   ? 40.097 9.725   24.873 1.00 57.43  ? 3    LYS B NZ    1 
ATOM   6035 N  N     . ILE D 4  4   ? 41.506 16.201  28.691 1.00 45.67  ? 4    ILE B N     1 
ATOM   6036 C  CA    . ILE D 4  4   ? 42.336 17.169  29.401 1.00 44.22  ? 4    ILE B CA    1 
ATOM   6037 C  C     . ILE D 4  4   ? 41.724 17.541  30.749 1.00 42.06  ? 4    ILE B C     1 
ATOM   6038 O  O     . ILE D 4  4   ? 40.519 17.773  30.861 1.00 40.90  ? 4    ILE B O     1 
ATOM   6039 C  CB    . ILE D 4  4   ? 42.540 18.462  28.571 1.00 44.87  ? 4    ILE B CB    1 
ATOM   6040 C  CG1   . ILE D 4  4   ? 43.394 18.154  27.339 1.00 43.36  ? 4    ILE B CG1   1 
ATOM   6041 C  CG2   . ILE D 4  4   ? 43.200 19.540  29.432 1.00 43.00  ? 4    ILE B CG2   1 
ATOM   6042 C  CD1   . ILE D 4  4   ? 43.602 19.338  26.431 1.00 45.11  ? 4    ILE B CD1   1 
ATOM   6043 N  N     . ILE D 4  5   ? 42.568 17.595  31.772 1.00 39.50  ? 5    ILE B N     1 
ATOM   6044 C  CA    . ILE D 4  5   ? 42.122 17.936  33.112 1.00 38.55  ? 5    ILE B CA    1 
ATOM   6045 C  C     . ILE D 4  5   ? 42.236 19.435  33.362 1.00 38.09  ? 5    ILE B C     1 
ATOM   6046 O  O     . ILE D 4  5   ? 43.318 20.013  33.256 1.00 38.06  ? 5    ILE B O     1 
ATOM   6047 C  CB    . ILE D 4  5   ? 42.950 17.175  34.167 1.00 38.65  ? 5    ILE B CB    1 
ATOM   6048 C  CG1   . ILE D 4  5   ? 42.638 15.682  34.071 1.00 40.61  ? 5    ILE B CG1   1 
ATOM   6049 C  CG2   . ILE D 4  5   ? 42.648 17.697  35.564 1.00 38.30  ? 5    ILE B CG2   1 
ATOM   6050 C  CD1   . ILE D 4  5   ? 43.327 14.846  35.123 1.00 43.61  ? 5    ILE B CD1   1 
ATOM   6051 N  N     . HIS D 4  6   ? 41.114 20.063  33.687 1.00 37.37  ? 6    HIS B N     1 
ATOM   6052 C  CA    . HIS D 4  6   ? 41.096 21.492  33.964 1.00 36.37  ? 6    HIS B CA    1 
ATOM   6053 C  C     . HIS D 4  6   ? 41.323 21.703  35.463 1.00 34.91  ? 6    HIS B C     1 
ATOM   6054 O  O     . HIS D 4  6   ? 40.417 21.525  36.270 1.00 34.95  ? 6    HIS B O     1 
ATOM   6055 C  CB    . HIS D 4  6   ? 39.755 22.071  33.523 1.00 39.51  ? 6    HIS B CB    1 
ATOM   6056 C  CG    . HIS D 4  6   ? 39.478 21.892  32.062 1.00 44.48  ? 6    HIS B CG    1 
ATOM   6057 N  ND1   . HIS D 4  6   ? 40.219 22.519  31.080 1.00 45.56  ? 6    HIS B ND1   1 
ATOM   6058 C  CD2   . HIS D 4  6   ? 38.553 21.144  31.415 1.00 46.90  ? 6    HIS B CD2   1 
ATOM   6059 C  CE1   . HIS D 4  6   ? 39.760 22.164  29.893 1.00 46.88  ? 6    HIS B CE1   1 
ATOM   6060 N  NE2   . HIS D 4  6   ? 38.750 21.330  30.067 1.00 48.15  ? 6    HIS B NE2   1 
ATOM   6061 N  N     . LEU D 4  7   ? 42.541 22.085  35.825 1.00 32.59  ? 7    LEU B N     1 
ATOM   6062 C  CA    . LEU D 4  7   ? 42.917 22.280  37.223 1.00 30.87  ? 7    LEU B CA    1 
ATOM   6063 C  C     . LEU D 4  7   ? 42.493 23.593  37.866 1.00 29.71  ? 7    LEU B C     1 
ATOM   6064 O  O     . LEU D 4  7   ? 42.099 24.541  37.184 1.00 29.71  ? 7    LEU B O     1 
ATOM   6065 C  CB    . LEU D 4  7   ? 44.432 22.169  37.355 1.00 30.54  ? 7    LEU B CB    1 
ATOM   6066 C  CG    . LEU D 4  7   ? 45.082 20.920  36.769 1.00 31.53  ? 7    LEU B CG    1 
ATOM   6067 C  CD1   . LEU D 4  7   ? 46.582 21.159  36.624 1.00 30.31  ? 7    LEU B CD1   1 
ATOM   6068 C  CD2   . LEU D 4  7   ? 44.790 19.726  37.657 1.00 30.46  ? 7    LEU B CD2   1 
ATOM   6069 N  N     . THR D 4  8   ? 42.584 23.626  39.195 1.00 27.58  ? 8    THR B N     1 
ATOM   6070 C  CA    . THR D 4  8   ? 42.289 24.823  39.982 1.00 27.95  ? 8    THR B CA    1 
ATOM   6071 C  C     . THR D 4  8   ? 43.365 24.857  41.060 1.00 27.17  ? 8    THR B C     1 
ATOM   6072 O  O     . THR D 4  8   ? 44.046 23.853  41.287 1.00 26.77  ? 8    THR B O     1 
ATOM   6073 C  CB    . THR D 4  8   ? 40.921 24.767  40.695 1.00 27.87  ? 8    THR B CB    1 
ATOM   6074 O  OG1   . THR D 4  8   ? 40.958 23.771  41.727 1.00 28.45  ? 8    THR B OG1   1 
ATOM   6075 C  CG2   . THR D 4  8   ? 39.810 24.466  39.704 1.00 27.44  ? 8    THR B CG2   1 
ATOM   6076 N  N     . ASP D 4  9   ? 43.528 25.996  41.721 1.00 27.55  ? 9    ASP B N     1 
ATOM   6077 C  CA    . ASP D 4  9   ? 44.532 26.090  42.771 1.00 28.04  ? 9    ASP B CA    1 
ATOM   6078 C  C     . ASP D 4  9   ? 44.283 25.043  43.855 1.00 29.13  ? 9    ASP B C     1 
ATOM   6079 O  O     . ASP D 4  9   ? 45.220 24.378  44.309 1.00 28.51  ? 9    ASP B O     1 
ATOM   6080 C  CB    . ASP D 4  9   ? 44.535 27.487  43.409 1.00 28.87  ? 9    ASP B CB    1 
ATOM   6081 C  CG    . ASP D 4  9   ? 45.234 28.536  42.542 1.00 31.10  ? 9    ASP B CG    1 
ATOM   6082 O  OD1   . ASP D 4  9   ? 46.200 28.189  41.822 1.00 31.73  ? 9    ASP B OD1   1 
ATOM   6083 O  OD2   . ASP D 4  9   ? 44.829 29.712  42.598 1.00 29.91  ? 9    ASP B OD2   1 
ATOM   6084 N  N     . ASP D 4  10  ? 43.017 24.885  44.248 1.00 29.04  ? 10   ASP B N     1 
ATOM   6085 C  CA    . ASP D 4  10  ? 42.647 23.943  45.306 1.00 30.58  ? 10   ASP B CA    1 
ATOM   6086 C  C     . ASP D 4  10  ? 42.672 22.459  44.966 1.00 29.86  ? 10   ASP B C     1 
ATOM   6087 O  O     . ASP D 4  10  ? 42.663 21.624  45.865 1.00 30.95  ? 10   ASP B O     1 
ATOM   6088 C  CB    . ASP D 4  10  ? 41.266 24.284  45.869 1.00 30.88  ? 10   ASP B CB    1 
ATOM   6089 C  CG    . ASP D 4  10  ? 41.227 25.644  46.523 1.00 33.68  ? 10   ASP B CG    1 
ATOM   6090 O  OD1   . ASP D 4  10  ? 42.204 25.992  47.216 1.00 35.98  ? 10   ASP B OD1   1 
ATOM   6091 O  OD2   . ASP D 4  10  ? 40.217 26.361  46.355 1.00 36.15  ? 10   ASP B OD2   1 
ATOM   6092 N  N     . SER D 4  11  ? 42.683 22.112  43.687 1.00 30.74  ? 11   SER B N     1 
ATOM   6093 C  CA    . SER D 4  11  ? 42.715 20.697  43.329 1.00 32.05  ? 11   SER B CA    1 
ATOM   6094 C  C     . SER D 4  11  ? 44.070 20.317  42.755 1.00 32.79  ? 11   SER B C     1 
ATOM   6095 O  O     . SER D 4  11  ? 44.305 19.163  42.408 1.00 32.96  ? 11   SER B O     1 
ATOM   6096 C  CB    . SER D 4  11  ? 41.640 20.375  42.297 1.00 31.42  ? 11   SER B CB    1 
ATOM   6097 O  OG    . SER D 4  11  ? 42.058 20.772  41.007 1.00 32.47  ? 11   SER B OG    1 
ATOM   6098 N  N     . PHE D 4  12  ? 44.966 21.292  42.660 1.00 34.46  ? 12   PHE B N     1 
ATOM   6099 C  CA    . PHE D 4  12  ? 46.278 21.037  42.099 1.00 35.56  ? 12   PHE B CA    1 
ATOM   6100 C  C     . PHE D 4  12  ? 47.074 19.981  42.857 1.00 36.39  ? 12   PHE B C     1 
ATOM   6101 O  O     . PHE D 4  12  ? 47.643 19.071  42.248 1.00 35.98  ? 12   PHE B O     1 
ATOM   6102 C  CB    . PHE D 4  12  ? 47.076 22.339  42.017 1.00 36.05  ? 12   PHE B CB    1 
ATOM   6103 C  CG    . PHE D 4  12  ? 48.368 22.206  41.266 1.00 35.30  ? 12   PHE B CG    1 
ATOM   6104 C  CD1   . PHE D 4  12  ? 49.528 21.796  41.915 1.00 34.95  ? 12   PHE B CD1   1 
ATOM   6105 C  CD2   . PHE D 4  12  ? 48.419 22.474  39.902 1.00 35.42  ? 12   PHE B CD2   1 
ATOM   6106 C  CE1   . PHE D 4  12  ? 50.725 21.656  41.218 1.00 36.29  ? 12   PHE B CE1   1 
ATOM   6107 C  CE2   . PHE D 4  12  ? 49.612 22.337  39.192 1.00 36.24  ? 12   PHE B CE2   1 
ATOM   6108 C  CZ    . PHE D 4  12  ? 50.768 21.928  39.852 1.00 35.45  ? 12   PHE B CZ    1 
ATOM   6109 N  N     . ASP D 4  13  ? 47.108 20.091  44.180 1.00 37.69  ? 13   ASP B N     1 
ATOM   6110 C  CA    . ASP D 4  13  ? 47.857 19.141  44.995 1.00 39.58  ? 13   ASP B CA    1 
ATOM   6111 C  C     . ASP D 4  13  ? 47.480 17.684  44.737 1.00 39.08  ? 13   ASP B C     1 
ATOM   6112 O  O     . ASP D 4  13  ? 48.341 16.870  44.407 1.00 38.39  ? 13   ASP B O     1 
ATOM   6113 C  CB    . ASP D 4  13  ? 47.675 19.458  46.485 1.00 43.57  ? 13   ASP B CB    1 
ATOM   6114 C  CG    . ASP D 4  13  ? 48.568 18.607  47.382 1.00 47.20  ? 13   ASP B CG    1 
ATOM   6115 O  OD1   . ASP D 4  13  ? 48.525 17.362  47.270 1.00 49.66  ? 13   ASP B OD1   1 
ATOM   6116 O  OD2   . ASP D 4  13  ? 49.313 19.183  48.207 1.00 50.56  ? 13   ASP B OD2   1 
ATOM   6117 N  N     . THR D 4  14  ? 46.201 17.348  44.872 1.00 38.84  ? 14   THR B N     1 
ATOM   6118 C  CA    . THR D 4  14  ? 45.789 15.961  44.676 1.00 39.48  ? 14   THR B CA    1 
ATOM   6119 C  C     . THR D 4  14  ? 45.708 15.511  43.220 1.00 39.43  ? 14   THR B C     1 
ATOM   6120 O  O     . THR D 4  14  ? 45.894 14.330  42.932 1.00 41.41  ? 14   THR B O     1 
ATOM   6121 C  CB    . THR D 4  14  ? 44.429 15.659  45.357 1.00 39.01  ? 14   THR B CB    1 
ATOM   6122 O  OG1   . THR D 4  14  ? 43.364 16.173  44.557 1.00 41.97  ? 14   THR B OG1   1 
ATOM   6123 C  CG2   . THR D 4  14  ? 44.365 16.299  46.729 1.00 38.33  ? 14   THR B CG2   1 
ATOM   6124 N  N     . ASP D 4  15  ? 45.429 16.430  42.301 1.00 38.35  ? 15   ASP B N     1 
ATOM   6125 C  CA    . ASP D 4  15  ? 45.339 16.060  40.888 1.00 38.12  ? 15   ASP B CA    1 
ATOM   6126 C  C     . ASP D 4  15  ? 46.691 15.952  40.208 1.00 37.77  ? 15   ASP B C     1 
ATOM   6127 O  O     . ASP D 4  15  ? 46.827 15.281  39.188 1.00 36.48  ? 15   ASP B O     1 
ATOM   6128 C  CB    . ASP D 4  15  ? 44.502 17.070  40.101 1.00 38.86  ? 15   ASP B CB    1 
ATOM   6129 C  CG    . ASP D 4  15  ? 43.025 16.863  40.278 1.00 39.40  ? 15   ASP B CG    1 
ATOM   6130 O  OD1   . ASP D 4  15  ? 42.602 15.699  40.437 1.00 42.16  ? 15   ASP B OD1   1 
ATOM   6131 O  OD2   . ASP D 4  15  ? 42.286 17.864  40.237 1.00 40.01  ? 15   ASP B OD2   1 
ATOM   6132 N  N     . VAL D 4  16  ? 47.689 16.624  40.768 1.00 38.51  ? 16   VAL B N     1 
ATOM   6133 C  CA    . VAL D 4  16  ? 49.016 16.613  40.183 1.00 38.88  ? 16   VAL B CA    1 
ATOM   6134 C  C     . VAL D 4  16  ? 50.067 16.016  41.109 1.00 39.57  ? 16   VAL B C     1 
ATOM   6135 O  O     . VAL D 4  16  ? 50.668 14.989  40.791 1.00 40.96  ? 16   VAL B O     1 
ATOM   6136 C  CB    . VAL D 4  16  ? 49.451 18.049  39.796 1.00 39.25  ? 16   VAL B CB    1 
ATOM   6137 C  CG1   . VAL D 4  16  ? 50.853 18.030  39.196 1.00 39.18  ? 16   VAL B CG1   1 
ATOM   6138 C  CG2   . VAL D 4  16  ? 48.454 18.646  38.813 1.00 36.19  ? 16   VAL B CG2   1 
ATOM   6139 N  N     . LEU D 4  17  ? 50.273 16.658  42.255 1.00 38.49  ? 17   LEU B N     1 
ATOM   6140 C  CA    . LEU D 4  17  ? 51.280 16.233  43.225 1.00 40.40  ? 17   LEU B CA    1 
ATOM   6141 C  C     . LEU D 4  17  ? 51.096 14.864  43.883 1.00 44.13  ? 17   LEU B C     1 
ATOM   6142 O  O     . LEU D 4  17  ? 52.048 14.312  44.440 1.00 45.84  ? 17   LEU B O     1 
ATOM   6143 C  CB    . LEU D 4  17  ? 51.432 17.307  44.306 1.00 36.24  ? 17   LEU B CB    1 
ATOM   6144 C  CG    . LEU D 4  17  ? 51.833 18.681  43.755 1.00 32.94  ? 17   LEU B CG    1 
ATOM   6145 C  CD1   . LEU D 4  17  ? 52.006 19.682  44.890 1.00 30.82  ? 17   LEU B CD1   1 
ATOM   6146 C  CD2   . LEU D 4  17  ? 53.119 18.550  42.970 1.00 30.52  ? 17   LEU B CD2   1 
ATOM   6147 N  N     . LYS D 4  18  ? 49.884 14.321  43.834 1.00 47.04  ? 18   LYS B N     1 
ATOM   6148 C  CA    . LYS D 4  18  ? 49.613 13.009  44.417 1.00 49.87  ? 18   LYS B CA    1 
ATOM   6149 C  C     . LYS D 4  18  ? 49.126 12.103  43.301 1.00 50.99  ? 18   LYS B C     1 
ATOM   6150 O  O     . LYS D 4  18  ? 48.761 10.950  43.528 1.00 50.55  ? 18   LYS B O     1 
ATOM   6151 C  CB    . LYS D 4  18  ? 48.527 13.102  45.493 1.00 51.48  ? 18   LYS B CB    1 
ATOM   6152 C  CG    . LYS D 4  18  ? 48.879 13.961  46.697 1.00 53.32  ? 18   LYS B CG    1 
ATOM   6153 C  CD    . LYS D 4  18  ? 47.760 13.903  47.730 1.00 56.00  ? 18   LYS B CD    1 
ATOM   6154 C  CE    . LYS D 4  18  ? 48.076 14.735  48.964 1.00 57.30  ? 18   LYS B CE    1 
ATOM   6155 N  NZ    . LYS D 4  18  ? 47.003 14.614  49.996 1.00 58.22  ? 18   LYS B NZ    1 
ATOM   6156 N  N     . ALA D 4  19  ? 49.135 12.653  42.092 1.00 53.35  ? 19   ALA B N     1 
ATOM   6157 C  CA    . ALA D 4  19  ? 48.680 11.964  40.892 1.00 56.41  ? 19   ALA B CA    1 
ATOM   6158 C  C     . ALA D 4  19  ? 49.118 10.515  40.745 1.00 58.40  ? 19   ALA B C     1 
ATOM   6159 O  O     . ALA D 4  19  ? 48.311 9.660   40.375 1.00 59.07  ? 19   ALA B O     1 
ATOM   6160 C  CB    . ALA D 4  19  ? 49.107 12.751  39.659 1.00 56.51  ? 19   ALA B CB    1 
ATOM   6161 N  N     . ASP D 4  20  ? 50.385 10.230  41.028 1.00 60.02  ? 20   ASP B N     1 
ATOM   6162 C  CA    . ASP D 4  20  ? 50.880 8.866   40.875 1.00 62.68  ? 20   ASP B CA    1 
ATOM   6163 C  C     . ASP D 4  20  ? 50.692 8.514   39.400 1.00 62.26  ? 20   ASP B C     1 
ATOM   6164 O  O     . ASP D 4  20  ? 49.770 7.786   39.026 1.00 63.06  ? 20   ASP B O     1 
ATOM   6165 C  CB    . ASP D 4  20  ? 50.078 7.899   41.756 1.00 65.38  ? 20   ASP B CB    1 
ATOM   6166 C  CG    . ASP D 4  20  ? 50.948 7.159   42.758 1.00 67.48  ? 20   ASP B CG    1 
ATOM   6167 O  OD1   . ASP D 4  20  ? 51.648 7.827   43.557 1.00 68.13  ? 20   ASP B OD1   1 
ATOM   6168 O  OD2   . ASP D 4  20  ? 50.925 5.910   42.749 1.00 67.82  ? 20   ASP B OD2   1 
ATOM   6169 N  N     . GLY D 4  21  ? 51.575 9.060   38.573 1.00 61.61  ? 21   GLY B N     1 
ATOM   6170 C  CA    . GLY D 4  21  ? 51.522 8.844   37.140 1.00 58.89  ? 21   GLY B CA    1 
ATOM   6171 C  C     . GLY D 4  21  ? 52.141 10.068  36.494 1.00 57.31  ? 21   GLY B C     1 
ATOM   6172 O  O     . GLY D 4  21  ? 52.469 11.031  37.191 1.00 57.33  ? 21   GLY B O     1 
ATOM   6173 N  N     . ALA D 4  22  ? 52.311 10.045  35.177 1.00 55.45  ? 22   ALA B N     1 
ATOM   6174 C  CA    . ALA D 4  22  ? 52.902 11.183  34.477 1.00 52.56  ? 22   ALA B CA    1 
ATOM   6175 C  C     . ALA D 4  22  ? 51.835 12.227  34.173 1.00 50.16  ? 22   ALA B C     1 
ATOM   6176 O  O     . ALA D 4  22  ? 50.793 11.915  33.586 1.00 49.69  ? 22   ALA B O     1 
ATOM   6177 C  CB    . ALA D 4  22  ? 53.570 10.721  33.185 1.00 52.45  ? 22   ALA B CB    1 
ATOM   6178 N  N     . ILE D 4  23  ? 52.100 13.467  34.578 1.00 46.45  ? 23   ILE B N     1 
ATOM   6179 C  CA    . ILE D 4  23  ? 51.164 14.562  34.353 1.00 42.73  ? 23   ILE B CA    1 
ATOM   6180 C  C     . ILE D 4  23  ? 51.848 15.761  33.700 1.00 41.25  ? 23   ILE B C     1 
ATOM   6181 O  O     . ILE D 4  23  ? 52.796 16.321  34.248 1.00 41.10  ? 23   ILE B O     1 
ATOM   6182 C  CB    . ILE D 4  23  ? 50.541 15.062  35.680 1.00 42.34  ? 23   ILE B CB    1 
ATOM   6183 C  CG1   . ILE D 4  23  ? 50.007 13.887  36.502 1.00 42.52  ? 23   ILE B CG1   1 
ATOM   6184 C  CG2   . ILE D 4  23  ? 49.424 16.059  35.383 1.00 40.03  ? 23   ILE B CG2   1 
ATOM   6185 C  CD1   . ILE D 4  23  ? 48.824 13.179  35.881 1.00 44.29  ? 23   ILE B CD1   1 
ATOM   6186 N  N     . LEU D 4  24  ? 51.367 16.153  32.529 1.00 39.64  ? 24   LEU B N     1 
ATOM   6187 C  CA    . LEU D 4  24  ? 51.914 17.314  31.846 1.00 38.61  ? 24   LEU B CA    1 
ATOM   6188 C  C     . LEU D 4  24  ? 51.004 18.502  32.166 1.00 38.39  ? 24   LEU B C     1 
ATOM   6189 O  O     . LEU D 4  24  ? 49.832 18.513  31.786 1.00 38.32  ? 24   LEU B O     1 
ATOM   6190 C  CB    . LEU D 4  24  ? 51.939 17.092  30.334 1.00 38.10  ? 24   LEU B CB    1 
ATOM   6191 C  CG    . LEU D 4  24  ? 52.481 18.264  29.509 1.00 38.12  ? 24   LEU B CG    1 
ATOM   6192 C  CD1   . LEU D 4  24  ? 53.962 18.461  29.818 1.00 35.08  ? 24   LEU B CD1   1 
ATOM   6193 C  CD2   . LEU D 4  24  ? 52.273 17.989  28.019 1.00 38.52  ? 24   LEU B CD2   1 
ATOM   6194 N  N     . VAL D 4  25  ? 51.539 19.494  32.870 1.00 36.44  ? 25   VAL B N     1 
ATOM   6195 C  CA    . VAL D 4  25  ? 50.756 20.672  33.224 1.00 35.67  ? 25   VAL B CA    1 
ATOM   6196 C  C     . VAL D 4  25  ? 51.114 21.860  32.342 1.00 35.54  ? 25   VAL B C     1 
ATOM   6197 O  O     . VAL D 4  25  ? 52.286 22.198  32.172 1.00 35.98  ? 25   VAL B O     1 
ATOM   6198 C  CB    . VAL D 4  25  ? 50.972 21.067  34.696 1.00 34.82  ? 25   VAL B CB    1 
ATOM   6199 C  CG1   . VAL D 4  25  ? 50.194 22.336  35.016 1.00 33.47  ? 25   VAL B CG1   1 
ATOM   6200 C  CG2   . VAL D 4  25  ? 50.529 19.934  35.602 1.00 34.27  ? 25   VAL B CG2   1 
ATOM   6201 N  N     . ASP D 4  26  ? 50.084 22.490  31.791 1.00 33.17  ? 26   ASP B N     1 
ATOM   6202 C  CA    . ASP D 4  26  ? 50.247 23.636  30.921 1.00 31.93  ? 26   ASP B CA    1 
ATOM   6203 C  C     . ASP D 4  26  ? 49.789 24.924  31.605 1.00 32.55  ? 26   ASP B C     1 
ATOM   6204 O  O     . ASP D 4  26  ? 48.595 25.168  31.744 1.00 31.50  ? 26   ASP B O     1 
ATOM   6205 C  CB    . ASP D 4  26  ? 49.454 23.402  29.632 1.00 31.18  ? 26   ASP B CB    1 
ATOM   6206 C  CG    . ASP D 4  26  ? 49.303 24.654  28.801 1.00 31.60  ? 26   ASP B CG    1 
ATOM   6207 O  OD1   . ASP D 4  26  ? 50.270 25.437  28.741 1.00 30.04  ? 26   ASP B OD1   1 
ATOM   6208 O  OD2   . ASP D 4  26  ? 48.221 24.847  28.198 1.00 29.81  ? 26   ASP B OD2   1 
ATOM   6209 N  N     . PHE D 4  27  ? 50.748 25.730  32.052 1.00 32.43  ? 27   PHE B N     1 
ATOM   6210 C  CA    . PHE D 4  27  ? 50.442 27.002  32.691 1.00 31.90  ? 27   PHE B CA    1 
ATOM   6211 C  C     . PHE D 4  27  ? 50.219 27.996  31.567 1.00 32.05  ? 27   PHE B C     1 
ATOM   6212 O  O     . PHE D 4  27  ? 51.134 28.273  30.792 1.00 33.52  ? 27   PHE B O     1 
ATOM   6213 C  CB    . PHE D 4  27  ? 51.602 27.454  33.582 1.00 31.59  ? 27   PHE B CB    1 
ATOM   6214 C  CG    . PHE D 4  27  ? 51.778 26.610  34.800 1.00 31.54  ? 27   PHE B CG    1 
ATOM   6215 C  CD1   . PHE D 4  27  ? 52.462 25.404  34.731 1.00 32.73  ? 27   PHE B CD1   1 
ATOM   6216 C  CD2   . PHE D 4  27  ? 51.209 26.992  36.009 1.00 32.44  ? 27   PHE B CD2   1 
ATOM   6217 C  CE1   . PHE D 4  27  ? 52.578 24.582  35.851 1.00 33.09  ? 27   PHE B CE1   1 
ATOM   6218 C  CE2   . PHE D 4  27  ? 51.315 26.181  37.137 1.00 32.38  ? 27   PHE B CE2   1 
ATOM   6219 C  CZ    . PHE D 4  27  ? 52.003 24.970  37.056 1.00 33.92  ? 27   PHE B CZ    1 
ATOM   6220 N  N     . TRP D 4  28  ? 49.007 28.534  31.478 1.00 30.66  ? 28   TRP B N     1 
ATOM   6221 C  CA    . TRP D 4  28  ? 48.674 29.451  30.400 1.00 29.51  ? 28   TRP B CA    1 
ATOM   6222 C  C     . TRP D 4  28  ? 47.832 30.651  30.809 1.00 30.34  ? 28   TRP B C     1 
ATOM   6223 O  O     . TRP D 4  28  ? 47.524 30.853  31.982 1.00 33.17  ? 28   TRP B O     1 
ATOM   6224 C  CB    . TRP D 4  28  ? 47.925 28.690  29.306 1.00 28.52  ? 28   TRP B CB    1 
ATOM   6225 C  CG    . TRP D 4  28  ? 46.585 28.196  29.759 1.00 29.45  ? 28   TRP B CG    1 
ATOM   6226 C  CD1   . TRP D 4  28  ? 46.339 27.185  30.644 1.00 28.13  ? 28   TRP B CD1   1 
ATOM   6227 C  CD2   . TRP D 4  28  ? 45.303 28.709  29.369 1.00 29.43  ? 28   TRP B CD2   1 
ATOM   6228 N  NE1   . TRP D 4  28  ? 44.983 27.035  30.826 1.00 28.41  ? 28   TRP B NE1   1 
ATOM   6229 C  CE2   . TRP D 4  28  ? 44.325 27.956  30.057 1.00 28.82  ? 28   TRP B CE2   1 
ATOM   6230 C  CE3   . TRP D 4  28  ? 44.888 29.731  28.507 1.00 30.66  ? 28   TRP B CE3   1 
ATOM   6231 C  CZ2   . TRP D 4  28  ? 42.952 28.193  29.909 1.00 29.03  ? 28   TRP B CZ2   1 
ATOM   6232 C  CZ3   . TRP D 4  28  ? 43.521 29.969  28.359 1.00 32.38  ? 28   TRP B CZ3   1 
ATOM   6233 C  CH2   . TRP D 4  28  ? 42.569 29.198  29.060 1.00 31.57  ? 28   TRP B CH2   1 
ATOM   6234 N  N     . ALA D 4  29  ? 47.456 31.438  29.808 1.00 29.65  ? 29   ALA B N     1 
ATOM   6235 C  CA    . ALA D 4  29  ? 46.636 32.618  30.004 1.00 30.70  ? 29   ALA B CA    1 
ATOM   6236 C  C     . ALA D 4  29  ? 45.937 32.896  28.691 1.00 32.73  ? 29   ALA B C     1 
ATOM   6237 O  O     . ALA D 4  29  ? 46.498 32.676  27.618 1.00 34.60  ? 29   ALA B O     1 
ATOM   6238 C  CB    . ALA D 4  29  ? 47.497 33.808  30.407 1.00 31.82  ? 29   ALA B CB    1 
ATOM   6239 N  N     . GLU D 4  30  ? 44.710 33.386  28.783 1.00 35.07  ? 30   GLU B N     1 
ATOM   6240 C  CA    . GLU D 4  30  ? 43.898 33.686  27.613 1.00 38.29  ? 30   GLU B CA    1 
ATOM   6241 C  C     . GLU D 4  30  ? 44.484 34.776  26.705 1.00 38.36  ? 30   GLU B C     1 
ATOM   6242 O  O     . GLU D 4  30  ? 44.158 34.839  25.518 1.00 37.62  ? 30   GLU B O     1 
ATOM   6243 C  CB    . GLU D 4  30  ? 42.499 34.102  28.076 1.00 40.40  ? 30   GLU B CB    1 
ATOM   6244 C  CG    . GLU D 4  30  ? 41.463 34.181  26.974 1.00 47.25  ? 30   GLU B CG    1 
ATOM   6245 C  CD    . GLU D 4  30  ? 41.154 32.824  26.363 1.00 50.19  ? 30   GLU B CD    1 
ATOM   6246 O  OE1   . GLU D 4  30  ? 40.861 31.879  27.124 1.00 52.64  ? 30   GLU B OE1   1 
ATOM   6247 O  OE2   . GLU D 4  30  ? 41.194 32.702  25.120 1.00 53.35  ? 30   GLU B OE2   1 
ATOM   6248 N  N     . TRP D 4  31  ? 45.346 35.628  27.255 1.00 37.43  ? 31   TRP B N     1 
ATOM   6249 C  CA    . TRP D 4  31  ? 45.927 36.717  26.474 1.00 36.92  ? 31   TRP B CA    1 
ATOM   6250 C  C     . TRP D 4  31  ? 47.277 36.436  25.838 1.00 37.39  ? 31   TRP B C     1 
ATOM   6251 O  O     . TRP D 4  31  ? 47.876 37.327  25.246 1.00 38.94  ? 31   TRP B O     1 
ATOM   6252 C  CB    . TRP D 4  31  ? 46.032 37.989  27.332 1.00 35.53  ? 31   TRP B CB    1 
ATOM   6253 C  CG    . TRP D 4  31  ? 46.383 37.747  28.778 1.00 34.05  ? 31   TRP B CG    1 
ATOM   6254 C  CD1   . TRP D 4  31  ? 45.514 37.671  29.835 1.00 35.02  ? 31   TRP B CD1   1 
ATOM   6255 C  CD2   . TRP D 4  31  ? 47.691 37.537  29.324 1.00 33.94  ? 31   TRP B CD2   1 
ATOM   6256 N  NE1   . TRP D 4  31  ? 46.201 37.426  31.003 1.00 32.75  ? 31   TRP B NE1   1 
ATOM   6257 C  CE2   . TRP D 4  31  ? 47.538 37.339  30.717 1.00 33.60  ? 31   TRP B CE2   1 
ATOM   6258 C  CE3   . TRP D 4  31  ? 48.978 37.495  28.772 1.00 33.39  ? 31   TRP B CE3   1 
ATOM   6259 C  CZ2   . TRP D 4  31  ? 48.624 37.104  31.564 1.00 33.07  ? 31   TRP B CZ2   1 
ATOM   6260 C  CZ3   . TRP D 4  31  ? 50.058 37.260  29.616 1.00 32.94  ? 31   TRP B CZ3   1 
ATOM   6261 C  CH2   . TRP D 4  31  ? 49.872 37.067  30.997 1.00 34.12  ? 31   TRP B CH2   1 
ATOM   6262 N  N     . CYS D 4  32  ? 47.760 35.205  25.946 1.00 37.94  ? 32   CYS B N     1 
ATOM   6263 C  CA    . CYS D 4  32  ? 49.056 34.862  25.373 1.00 37.03  ? 32   CYS B CA    1 
ATOM   6264 C  C     . CYS D 4  32  ? 48.932 34.229  23.991 1.00 37.47  ? 32   CYS B C     1 
ATOM   6265 O  O     . CYS D 4  32  ? 48.218 33.240  23.814 1.00 35.62  ? 32   CYS B O     1 
ATOM   6266 C  CB    . CYS D 4  32  ? 49.797 33.915  26.312 1.00 36.74  ? 32   CYS B CB    1 
ATOM   6267 S  SG    . CYS D 4  32  ? 51.324 33.260  25.640 1.00 37.99  ? 32   CYS B SG    1 
ATOM   6268 N  N     . GLY D 4  33  ? 49.633 34.807  23.016 1.00 36.87  ? 33   GLY B N     1 
ATOM   6269 C  CA    . GLY D 4  33  ? 49.595 34.293  21.657 1.00 36.36  ? 33   GLY B CA    1 
ATOM   6270 C  C     . GLY D 4  33  ? 50.052 32.849  21.592 1.00 36.75  ? 33   GLY B C     1 
ATOM   6271 O  O     . GLY D 4  33  ? 49.314 31.985  21.119 1.00 36.24  ? 33   GLY B O     1 
ATOM   6272 N  N     . PRO D 4  34  ? 51.277 32.557  22.053 1.00 37.37  ? 34   PRO B N     1 
ATOM   6273 C  CA    . PRO D 4  34  ? 51.833 31.199  22.053 1.00 37.86  ? 34   PRO B CA    1 
ATOM   6274 C  C     . PRO D 4  34  ? 50.917 30.185  22.743 1.00 38.41  ? 34   PRO B C     1 
ATOM   6275 O  O     . PRO D 4  34  ? 50.814 29.034  22.309 1.00 37.46  ? 34   PRO B O     1 
ATOM   6276 C  CB    . PRO D 4  34  ? 53.158 31.379  22.787 1.00 37.30  ? 34   PRO B CB    1 
ATOM   6277 C  CG    . PRO D 4  34  ? 53.588 32.734  22.321 1.00 38.33  ? 34   PRO B CG    1 
ATOM   6278 C  CD    . PRO D 4  34  ? 52.303 33.536  22.455 1.00 37.74  ? 34   PRO B CD    1 
ATOM   6279 N  N     . CYS D 4  35  ? 50.257 30.613  23.817 1.00 38.35  ? 35   CYS B N     1 
ATOM   6280 C  CA    . CYS D 4  35  ? 49.350 29.730  24.550 1.00 39.26  ? 35   CYS B CA    1 
ATOM   6281 C  C     . CYS D 4  35  ? 48.188 29.286  23.659 1.00 39.71  ? 35   CYS B C     1 
ATOM   6282 O  O     . CYS D 4  35  ? 47.821 28.114  23.654 1.00 40.42  ? 35   CYS B O     1 
ATOM   6283 C  CB    . CYS D 4  35  ? 48.815 30.427  25.810 1.00 37.38  ? 35   CYS B CB    1 
ATOM   6284 S  SG    . CYS D 4  35  ? 50.023 30.592  27.164 1.00 35.04  ? 35   CYS B SG    1 
ATOM   6285 N  N     . LYS D 4  36  ? 47.615 30.216  22.903 1.00 40.21  ? 36   LYS B N     1 
ATOM   6286 C  CA    . LYS D 4  36  ? 46.515 29.868  22.017 1.00 43.27  ? 36   LYS B CA    1 
ATOM   6287 C  C     . LYS D 4  36  ? 47.017 28.926  20.924 1.00 44.52  ? 36   LYS B C     1 
ATOM   6288 O  O     . LYS D 4  36  ? 46.297 28.037  20.470 1.00 44.82  ? 36   LYS B O     1 
ATOM   6289 C  CB    . LYS D 4  36  ? 45.917 31.116  21.369 1.00 45.29  ? 36   LYS B CB    1 
ATOM   6290 C  CG    . LYS D 4  36  ? 44.717 30.809  20.487 1.00 48.05  ? 36   LYS B CG    1 
ATOM   6291 C  CD    . LYS D 4  36  ? 44.284 32.011  19.660 1.00 52.22  ? 36   LYS B CD    1 
ATOM   6292 C  CE    . LYS D 4  36  ? 43.188 31.623  18.672 1.00 52.07  ? 36   LYS B CE    1 
ATOM   6293 N  NZ    . LYS D 4  36  ? 42.867 32.729  17.728 1.00 55.43  ? 36   LYS B NZ    1 
ATOM   6294 N  N     . MET D 4  37  ? 48.262 29.122  20.505 1.00 45.12  ? 37   MET B N     1 
ATOM   6295 C  CA    . MET D 4  37  ? 48.849 28.286  19.467 1.00 45.25  ? 37   MET B CA    1 
ATOM   6296 C  C     . MET D 4  37  ? 48.928 26.824  19.868 1.00 45.16  ? 37   MET B C     1 
ATOM   6297 O  O     . MET D 4  37  ? 48.455 25.949  19.146 1.00 45.60  ? 37   MET B O     1 
ATOM   6298 C  CB    . MET D 4  37  ? 50.262 28.754  19.131 1.00 45.31  ? 37   MET B CB    1 
ATOM   6299 C  CG    . MET D 4  37  ? 50.347 30.053  18.368 1.00 45.96  ? 37   MET B CG    1 
ATOM   6300 S  SD    . MET D 4  37  ? 52.071 30.443  18.082 1.00 44.86  ? 37   MET B SD    1 
ATOM   6301 C  CE    . MET D 4  37  ? 52.528 29.131  16.954 1.00 45.01  ? 37   MET B CE    1 
ATOM   6302 N  N     . ILE D 4  38  ? 49.538 26.566  21.021 1.00 44.90  ? 38   ILE B N     1 
ATOM   6303 C  CA    . ILE D 4  38  ? 49.718 25.202  21.501 1.00 45.49  ? 38   ILE B CA    1 
ATOM   6304 C  C     . ILE D 4  38  ? 48.448 24.538  22.034 1.00 44.90  ? 38   ILE B C     1 
ATOM   6305 O  O     . ILE D 4  38  ? 48.396 23.317  22.166 1.00 45.14  ? 38   ILE B O     1 
ATOM   6306 C  CB    . ILE D 4  38  ? 50.820 25.143  22.593 1.00 45.96  ? 38   ILE B CB    1 
ATOM   6307 C  CG1   . ILE D 4  38  ? 51.364 23.718  22.704 1.00 46.84  ? 38   ILE B CG1   1 
ATOM   6308 C  CG2   . ILE D 4  38  ? 50.255 25.579  23.943 1.00 45.95  ? 38   ILE B CG2   1 
ATOM   6309 C  CD1   . ILE D 4  38  ? 52.625 23.606  23.550 1.00 48.35  ? 38   ILE B CD1   1 
ATOM   6310 N  N     . ALA D 4  39  ? 47.423 25.331  22.328 1.00 44.67  ? 39   ALA B N     1 
ATOM   6311 C  CA    . ALA D 4  39  ? 46.180 24.774  22.853 1.00 45.22  ? 39   ALA B CA    1 
ATOM   6312 C  C     . ALA D 4  39  ? 45.688 23.573  22.038 1.00 45.33  ? 39   ALA B C     1 
ATOM   6313 O  O     . ALA D 4  39  ? 45.475 22.493  22.587 1.00 45.18  ? 39   ALA B O     1 
ATOM   6314 C  CB    . ALA D 4  39  ? 45.097 25.853  22.914 1.00 43.44  ? 39   ALA B CB    1 
ATOM   6315 N  N     . PRO D 4  40  ? 45.505 23.743  20.718 1.00 45.01  ? 40   PRO B N     1 
ATOM   6316 C  CA    . PRO D 4  40  ? 45.034 22.624  19.898 1.00 44.89  ? 40   PRO B CA    1 
ATOM   6317 C  C     . PRO D 4  40  ? 45.989 21.430  19.866 1.00 44.55  ? 40   PRO B C     1 
ATOM   6318 O  O     . PRO D 4  40  ? 45.556 20.296  19.677 1.00 44.62  ? 40   PRO B O     1 
ATOM   6319 C  CB    . PRO D 4  40  ? 44.857 23.260  18.522 1.00 45.09  ? 40   PRO B CB    1 
ATOM   6320 C  CG    . PRO D 4  40  ? 44.506 24.678  18.855 1.00 44.90  ? 40   PRO B CG    1 
ATOM   6321 C  CD    . PRO D 4  40  ? 45.515 24.987  19.931 1.00 44.78  ? 40   PRO B CD    1 
ATOM   6322 N  N     . ILE D 4  41  ? 47.282 21.682  20.050 1.00 43.42  ? 41   ILE B N     1 
ATOM   6323 C  CA    . ILE D 4  41  ? 48.268 20.604  20.032 1.00 42.88  ? 41   ILE B CA    1 
ATOM   6324 C  C     . ILE D 4  41  ? 48.096 19.717  21.262 1.00 43.54  ? 41   ILE B C     1 
ATOM   6325 O  O     . ILE D 4  41  ? 48.270 18.500  21.198 1.00 43.03  ? 41   ILE B O     1 
ATOM   6326 C  CB    . ILE D 4  41  ? 49.706 21.152  20.029 1.00 42.79  ? 41   ILE B CB    1 
ATOM   6327 C  CG1   . ILE D 4  41  ? 49.828 22.309  19.030 1.00 43.38  ? 41   ILE B CG1   1 
ATOM   6328 C  CG2   . ILE D 4  41  ? 50.685 20.042  19.686 1.00 39.58  ? 41   ILE B CG2   1 
ATOM   6329 C  CD1   . ILE D 4  41  ? 49.466 21.956  17.611 1.00 43.28  ? 41   ILE B CD1   1 
ATOM   6330 N  N     . LEU D 4  42  ? 47.757 20.342  22.384 1.00 43.79  ? 42   LEU B N     1 
ATOM   6331 C  CA    . LEU D 4  42  ? 47.549 19.624  23.631 1.00 43.82  ? 42   LEU B CA    1 
ATOM   6332 C  C     . LEU D 4  42  ? 46.289 18.765  23.542 1.00 44.72  ? 42   LEU B C     1 
ATOM   6333 O  O     . LEU D 4  42  ? 46.270 17.631  24.021 1.00 44.42  ? 42   LEU B O     1 
ATOM   6334 C  CB    . LEU D 4  42  ? 47.427 20.618  24.787 1.00 42.66  ? 42   LEU B CB    1 
ATOM   6335 C  CG    . LEU D 4  42  ? 48.703 21.391  25.121 1.00 41.52  ? 42   LEU B CG    1 
ATOM   6336 C  CD1   . LEU D 4  42  ? 48.379 22.556  26.040 1.00 41.44  ? 42   LEU B CD1   1 
ATOM   6337 C  CD2   . LEU D 4  42  ? 49.707 20.453  25.772 1.00 40.80  ? 42   LEU B CD2   1 
ATOM   6338 N  N     . ASP D 4  43  ? 45.240 19.307  22.929 1.00 46.16  ? 43   ASP B N     1 
ATOM   6339 C  CA    . ASP D 4  43  ? 43.988 18.575  22.783 1.00 48.59  ? 43   ASP B CA    1 
ATOM   6340 C  C     . ASP D 4  43  ? 44.219 17.228  22.113 1.00 49.97  ? 43   ASP B C     1 
ATOM   6341 O  O     . ASP D 4  43  ? 43.552 16.247  22.429 1.00 49.75  ? 43   ASP B O     1 
ATOM   6342 C  CB    . ASP D 4  43  ? 42.979 19.380  21.960 1.00 49.42  ? 43   ASP B CB    1 
ATOM   6343 C  CG    . ASP D 4  43  ? 42.496 20.624  22.680 1.00 50.56  ? 43   ASP B CG    1 
ATOM   6344 O  OD1   . ASP D 4  43  ? 42.191 20.530  23.888 1.00 51.59  ? 43   ASP B OD1   1 
ATOM   6345 O  OD2   . ASP D 4  43  ? 42.410 21.693  22.038 1.00 51.21  ? 43   ASP B OD2   1 
ATOM   6346 N  N     . GLU D 4  44  ? 45.172 17.183  21.190 1.00 51.75  ? 44   GLU B N     1 
ATOM   6347 C  CA    . GLU D 4  44  ? 45.481 15.951  20.479 1.00 53.94  ? 44   GLU B CA    1 
ATOM   6348 C  C     . GLU D 4  44  ? 46.493 15.093  21.230 1.00 53.41  ? 44   GLU B C     1 
ATOM   6349 O  O     . GLU D 4  44  ? 46.373 13.870  21.251 1.00 54.09  ? 44   GLU B O     1 
ATOM   6350 C  CB    . GLU D 4  44  ? 46.006 16.268  19.078 1.00 55.81  ? 44   GLU B CB    1 
ATOM   6351 C  CG    . GLU D 4  44  ? 45.046 17.098  18.242 1.00 59.11  ? 44   GLU B CG    1 
ATOM   6352 C  CD    . GLU D 4  44  ? 45.535 17.301  16.822 1.00 62.31  ? 44   GLU B CD    1 
ATOM   6353 O  OE1   . GLU D 4  44  ? 46.691 17.750  16.647 1.00 63.49  ? 44   GLU B OE1   1 
ATOM   6354 O  OE2   . GLU D 4  44  ? 44.761 17.016  15.882 1.00 63.27  ? 44   GLU B OE2   1 
ATOM   6355 N  N     . ILE D 4  45  ? 47.491 15.728  21.839 1.00 52.41  ? 45   ILE B N     1 
ATOM   6356 C  CA    . ILE D 4  45  ? 48.498 14.990  22.592 1.00 51.70  ? 45   ILE B CA    1 
ATOM   6357 C  C     . ILE D 4  45  ? 47.817 14.175  23.683 1.00 52.88  ? 45   ILE B C     1 
ATOM   6358 O  O     . ILE D 4  45  ? 48.259 13.075  24.013 1.00 53.13  ? 45   ILE B O     1 
ATOM   6359 C  CB    . ILE D 4  45  ? 49.524 15.934  23.256 1.00 50.95  ? 45   ILE B CB    1 
ATOM   6360 C  CG1   . ILE D 4  45  ? 50.389 16.606  22.185 1.00 51.40  ? 45   ILE B CG1   1 
ATOM   6361 C  CG2   . ILE D 4  45  ? 50.388 15.159  24.238 1.00 48.50  ? 45   ILE B CG2   1 
ATOM   6362 C  CD1   . ILE D 4  45  ? 51.227 15.640  21.347 1.00 50.25  ? 45   ILE B CD1   1 
ATOM   6363 N  N     . ALA D 4  46  ? 46.738 14.720  24.236 1.00 53.82  ? 46   ALA B N     1 
ATOM   6364 C  CA    . ALA D 4  46  ? 45.994 14.039  25.291 1.00 55.18  ? 46   ALA B CA    1 
ATOM   6365 C  C     . ALA D 4  46  ? 45.394 12.747  24.747 1.00 56.19  ? 46   ALA B C     1 
ATOM   6366 O  O     . ALA D 4  46  ? 45.554 11.684  25.345 1.00 55.73  ? 46   ALA B O     1 
ATOM   6367 C  CB    . ALA D 4  46  ? 44.890 14.949  25.834 1.00 53.08  ? 46   ALA B CB    1 
ATOM   6368 N  N     . ASP D 4  47  ? 44.703 12.851  23.614 1.00 58.27  ? 47   ASP B N     1 
ATOM   6369 C  CA    . ASP D 4  47  ? 44.080 11.697  22.971 1.00 60.83  ? 47   ASP B CA    1 
ATOM   6370 C  C     . ASP D 4  47  ? 45.091 10.583  22.766 1.00 61.65  ? 47   ASP B C     1 
ATOM   6371 O  O     . ASP D 4  47  ? 44.939 9.477   23.285 1.00 61.43  ? 47   ASP B O     1 
ATOM   6372 C  CB    . ASP D 4  47  ? 43.509 12.089  21.607 1.00 62.68  ? 47   ASP B CB    1 
ATOM   6373 C  CG    . ASP D 4  47  ? 42.195 12.830  21.711 1.00 64.95  ? 47   ASP B CG    1 
ATOM   6374 O  OD1   . ASP D 4  47  ? 42.129 13.840  22.444 1.00 66.04  ? 47   ASP B OD1   1 
ATOM   6375 O  OD2   . ASP D 4  47  ? 41.226 12.403  21.049 1.00 66.35  ? 47   ASP B OD2   1 
ATOM   6376 N  N     . GLU D 4  48  ? 46.124 10.895  21.996 1.00 62.75  ? 48   GLU B N     1 
ATOM   6377 C  CA    . GLU D 4  48  ? 47.178 9.946   21.681 1.00 64.54  ? 48   GLU B CA    1 
ATOM   6378 C  C     . GLU D 4  48  ? 47.846 9.294   22.888 1.00 64.75  ? 48   GLU B C     1 
ATOM   6379 O  O     . GLU D 4  48  ? 47.800 8.075   23.046 1.00 66.56  ? 48   GLU B O     1 
ATOM   6380 C  CB    . GLU D 4  48  ? 48.239 10.633  20.822 1.00 66.36  ? 48   GLU B CB    1 
ATOM   6381 C  CG    . GLU D 4  48  ? 47.792 10.916  19.400 1.00 68.64  ? 48   GLU B CG    1 
ATOM   6382 C  CD    . GLU D 4  48  ? 48.811 11.728  18.623 1.00 70.82  ? 48   GLU B CD    1 
ATOM   6383 O  OE1   . GLU D 4  48  ? 50.026 11.467  18.773 1.00 70.88  ? 48   GLU B OE1   1 
ATOM   6384 O  OE2   . GLU D 4  48  ? 48.393 12.622  17.853 1.00 71.81  ? 48   GLU B OE2   1 
ATOM   6385 N  N     . TYR D 4  49  ? 48.468 10.102  23.737 1.00 63.63  ? 49   TYR B N     1 
ATOM   6386 C  CA    . TYR D 4  49  ? 49.165 9.572   24.900 1.00 63.53  ? 49   TYR B CA    1 
ATOM   6387 C  C     . TYR D 4  49  ? 48.275 9.050   26.021 1.00 63.36  ? 49   TYR B C     1 
ATOM   6388 O  O     . TYR D 4  49  ? 48.761 8.755   27.115 1.00 62.97  ? 49   TYR B O     1 
ATOM   6389 C  CB    . TYR D 4  49  ? 50.126 10.627  25.454 1.00 63.82  ? 49   TYR B CB    1 
ATOM   6390 C  CG    . TYR D 4  49  ? 51.367 10.813  24.611 1.00 63.61  ? 49   TYR B CG    1 
ATOM   6391 C  CD1   . TYR D 4  49  ? 51.277 11.241  23.287 1.00 63.43  ? 49   TYR B CD1   1 
ATOM   6392 C  CD2   . TYR D 4  49  ? 52.632 10.538  25.131 1.00 63.37  ? 49   TYR B CD2   1 
ATOM   6393 C  CE1   . TYR D 4  49  ? 52.416 11.388  22.501 1.00 63.85  ? 49   TYR B CE1   1 
ATOM   6394 C  CE2   . TYR D 4  49  ? 53.777 10.683  24.355 1.00 63.42  ? 49   TYR B CE2   1 
ATOM   6395 C  CZ    . TYR D 4  49  ? 53.661 11.107  23.042 1.00 63.46  ? 49   TYR B CZ    1 
ATOM   6396 O  OH    . TYR D 4  49  ? 54.789 11.242  22.267 1.00 64.50  ? 49   TYR B OH    1 
ATOM   6397 N  N     . GLN D 4  50  ? 46.980 8.923   25.761 1.00 63.47  ? 50   GLN B N     1 
ATOM   6398 C  CA    . GLN D 4  50  ? 46.082 8.428   26.795 1.00 64.06  ? 50   GLN B CA    1 
ATOM   6399 C  C     . GLN D 4  50  ? 46.494 7.023   27.209 1.00 63.58  ? 50   GLN B C     1 
ATOM   6400 O  O     . GLN D 4  50  ? 46.412 6.084   26.418 1.00 63.72  ? 50   GLN B O     1 
ATOM   6401 C  CB    . GLN D 4  50  ? 44.638 8.391   26.308 1.00 65.00  ? 50   GLN B CB    1 
ATOM   6402 C  CG    . GLN D 4  50  ? 43.657 8.177   27.446 1.00 67.92  ? 50   GLN B CG    1 
ATOM   6403 C  CD    . GLN D 4  50  ? 42.333 7.614   26.986 1.00 69.77  ? 50   GLN B CD    1 
ATOM   6404 O  OE1   . GLN D 4  50  ? 41.372 7.553   27.756 1.00 71.31  ? 50   GLN B OE1   1 
ATOM   6405 N  NE2   . GLN D 4  50  ? 42.273 7.187   25.727 1.00 69.85  ? 50   GLN B NE2   1 
ATOM   6406 N  N     . GLY D 4  51  ? 46.934 6.886   28.453 1.00 62.53  ? 51   GLY B N     1 
ATOM   6407 C  CA    . GLY D 4  51  ? 47.352 5.589   28.943 1.00 61.20  ? 51   GLY B CA    1 
ATOM   6408 C  C     . GLY D 4  51  ? 48.636 5.688   29.737 1.00 60.35  ? 51   GLY B C     1 
ATOM   6409 O  O     . GLY D 4  51  ? 48.776 5.059   30.785 1.00 59.56  ? 51   GLY B O     1 
ATOM   6410 N  N     . LYS D 4  52  ? 49.578 6.482   29.239 1.00 59.77  ? 52   LYS B N     1 
ATOM   6411 C  CA    . LYS D 4  52  ? 50.857 6.655   29.917 1.00 59.19  ? 52   LYS B CA    1 
ATOM   6412 C  C     . LYS D 4  52  ? 51.108 8.101   30.325 1.00 57.75  ? 52   LYS B C     1 
ATOM   6413 O  O     . LYS D 4  52  ? 52.156 8.420   30.891 1.00 58.19  ? 52   LYS B O     1 
ATOM   6414 C  CB    . LYS D 4  52  ? 51.999 6.149   29.027 1.00 60.74  ? 52   LYS B CB    1 
ATOM   6415 C  CG    . LYS D 4  52  ? 51.954 6.642   27.587 1.00 61.90  ? 52   LYS B CG    1 
ATOM   6416 C  CD    . LYS D 4  52  ? 53.029 5.963   26.741 1.00 62.27  ? 52   LYS B CD    1 
ATOM   6417 C  CE    . LYS D 4  52  ? 52.932 6.367   25.272 1.00 62.24  ? 52   LYS B CE    1 
ATOM   6418 N  NZ    . LYS D 4  52  ? 53.940 5.664   24.424 1.00 62.47  ? 52   LYS B NZ    1 
ATOM   6419 N  N     . LEU D 4  53  ? 50.141 8.971   30.049 1.00 56.10  ? 53   LEU B N     1 
ATOM   6420 C  CA    . LEU D 4  53  ? 50.272 10.381  30.395 1.00 53.55  ? 53   LEU B CA    1 
ATOM   6421 C  C     . LEU D 4  53  ? 48.938 11.122  30.476 1.00 51.81  ? 53   LEU B C     1 
ATOM   6422 O  O     . LEU D 4  53  ? 48.023 10.883  29.683 1.00 51.75  ? 53   LEU B O     1 
ATOM   6423 C  CB    . LEU D 4  53  ? 51.190 11.084  29.386 1.00 54.04  ? 53   LEU B CB    1 
ATOM   6424 C  CG    . LEU D 4  53  ? 51.347 12.601  29.533 1.00 53.49  ? 53   LEU B CG    1 
ATOM   6425 C  CD1   . LEU D 4  53  ? 52.812 12.964  29.642 1.00 53.41  ? 53   LEU B CD1   1 
ATOM   6426 C  CD2   . LEU D 4  53  ? 50.706 13.295  28.341 1.00 53.83  ? 53   LEU B CD2   1 
ATOM   6427 N  N     . THR D 4  54  ? 48.845 12.022  31.451 1.00 48.70  ? 54   THR B N     1 
ATOM   6428 C  CA    . THR D 4  54  ? 47.653 12.836  31.663 1.00 46.29  ? 54   THR B CA    1 
ATOM   6429 C  C     . THR D 4  54  ? 47.994 14.299  31.374 1.00 43.83  ? 54   THR B C     1 
ATOM   6430 O  O     . THR D 4  54  ? 48.974 14.825  31.902 1.00 42.50  ? 54   THR B O     1 
ATOM   6431 C  CB    . THR D 4  54  ? 47.160 12.748  33.127 1.00 46.91  ? 54   THR B CB    1 
ATOM   6432 O  OG1   . THR D 4  54  ? 46.802 11.396  33.446 1.00 47.72  ? 54   THR B OG1   1 
ATOM   6433 C  CG2   . THR D 4  54  ? 45.957 13.656  33.333 1.00 47.53  ? 54   THR B CG2   1 
ATOM   6434 N  N     . VAL D 4  55  ? 47.191 14.954  30.541 1.00 41.69  ? 55   VAL B N     1 
ATOM   6435 C  CA    . VAL D 4  55  ? 47.432 16.357  30.222 1.00 39.81  ? 55   VAL B CA    1 
ATOM   6436 C  C     . VAL D 4  55  ? 46.479 17.259  31.001 1.00 38.24  ? 55   VAL B C     1 
ATOM   6437 O  O     . VAL D 4  55  ? 45.259 17.116  30.907 1.00 37.66  ? 55   VAL B O     1 
ATOM   6438 C  CB    . VAL D 4  55  ? 47.266 16.631  28.708 1.00 40.72  ? 55   VAL B CB    1 
ATOM   6439 C  CG1   . VAL D 4  55  ? 47.317 18.137  28.434 1.00 40.08  ? 55   VAL B CG1   1 
ATOM   6440 C  CG2   . VAL D 4  55  ? 48.373 15.924  27.931 1.00 41.40  ? 55   VAL B CG2   1 
ATOM   6441 N  N     . ALA D 4  56  ? 47.045 18.187  31.766 1.00 35.60  ? 56   ALA B N     1 
ATOM   6442 C  CA    . ALA D 4  56  ? 46.252 19.111  32.564 1.00 34.62  ? 56   ALA B CA    1 
ATOM   6443 C  C     . ALA D 4  56  ? 46.620 20.567  32.282 1.00 34.71  ? 56   ALA B C     1 
ATOM   6444 O  O     . ALA D 4  56  ? 47.771 20.878  31.975 1.00 35.43  ? 56   ALA B O     1 
ATOM   6445 C  CB    . ALA D 4  56  ? 46.439 18.806  34.037 1.00 34.00  ? 56   ALA B CB    1 
ATOM   6446 N  N     . LYS D 4  57  ? 45.639 21.457  32.394 1.00 32.87  ? 57   LYS B N     1 
ATOM   6447 C  CA    . LYS D 4  57  ? 45.870 22.872  32.153 1.00 32.62  ? 57   LYS B CA    1 
ATOM   6448 C  C     . LYS D 4  57  ? 45.491 23.689  33.375 1.00 32.53  ? 57   LYS B C     1 
ATOM   6449 O  O     . LYS D 4  57  ? 44.532 23.362  34.080 1.00 32.93  ? 57   LYS B O     1 
ATOM   6450 C  CB    . LYS D 4  57  ? 45.052 23.355  30.947 1.00 31.62  ? 57   LYS B CB    1 
ATOM   6451 C  CG    . LYS D 4  57  ? 45.146 22.449  29.728 1.00 30.79  ? 57   LYS B CG    1 
ATOM   6452 C  CD    . LYS D 4  57  ? 45.068 23.224  28.414 1.00 32.74  ? 57   LYS B CD    1 
ATOM   6453 C  CE    . LYS D 4  57  ? 43.808 24.052  28.282 1.00 32.61  ? 57   LYS B CE    1 
ATOM   6454 N  NZ    . LYS D 4  57  ? 43.783 24.785  26.984 1.00 31.02  ? 57   LYS B NZ    1 
ATOM   6455 N  N     . LEU D 4  58  ? 46.255 24.747  33.628 1.00 31.99  ? 58   LEU B N     1 
ATOM   6456 C  CA    . LEU D 4  58  ? 45.993 25.635  34.754 1.00 31.35  ? 58   LEU B CA    1 
ATOM   6457 C  C     . LEU D 4  58  ? 46.102 27.080  34.291 1.00 30.67  ? 58   LEU B C     1 
ATOM   6458 O  O     . LEU D 4  58  ? 47.192 27.557  33.965 1.00 30.83  ? 58   LEU B O     1 
ATOM   6459 C  CB    . LEU D 4  58  ? 46.989 25.402  35.888 1.00 31.56  ? 58   LEU B CB    1 
ATOM   6460 C  CG    . LEU D 4  58  ? 46.667 26.206  37.154 1.00 34.15  ? 58   LEU B CG    1 
ATOM   6461 C  CD1   . LEU D 4  58  ? 45.530 25.535  37.916 1.00 33.79  ? 58   LEU B CD1   1 
ATOM   6462 C  CD2   . LEU D 4  58  ? 47.886 26.292  38.035 1.00 36.44  ? 58   LEU B CD2   1 
ATOM   6463 N  N     . ASN D 4  59  ? 44.967 27.768  34.256 1.00 29.02  ? 59   ASN B N     1 
ATOM   6464 C  CA    . ASN D 4  59  ? 44.923 29.164  33.844 1.00 29.60  ? 59   ASN B CA    1 
ATOM   6465 C  C     . ASN D 4  59  ? 45.418 30.040  34.993 1.00 30.11  ? 59   ASN B C     1 
ATOM   6466 O  O     . ASN D 4  59  ? 44.753 30.158  36.018 1.00 29.97  ? 59   ASN B O     1 
ATOM   6467 C  CB    . ASN D 4  59  ? 43.495 29.547  33.477 1.00 29.80  ? 59   ASN B CB    1 
ATOM   6468 C  CG    . ASN D 4  59  ? 43.374 30.991  33.058 1.00 30.32  ? 59   ASN B CG    1 
ATOM   6469 O  OD1   . ASN D 4  59  ? 43.666 31.897  33.834 1.00 31.93  ? 59   ASN B OD1   1 
ATOM   6470 N  ND2   . ASN D 4  59  ? 42.940 31.217  31.823 1.00 30.67  ? 59   ASN B ND2   1 
ATOM   6471 N  N     . ILE D 4  60  ? 46.576 30.669  34.814 1.00 30.31  ? 60   ILE B N     1 
ATOM   6472 C  CA    . ILE D 4  60  ? 47.151 31.492  35.866 1.00 30.89  ? 60   ILE B CA    1 
ATOM   6473 C  C     . ILE D 4  60  ? 46.372 32.737  36.284 1.00 32.56  ? 60   ILE B C     1 
ATOM   6474 O  O     . ILE D 4  60  ? 46.688 33.341  37.307 1.00 33.83  ? 60   ILE B O     1 
ATOM   6475 C  CB    . ILE D 4  60  ? 48.592 31.889  35.523 1.00 32.20  ? 60   ILE B CB    1 
ATOM   6476 C  CG1   . ILE D 4  60  ? 48.623 32.792  34.291 1.00 31.17  ? 60   ILE B CG1   1 
ATOM   6477 C  CG2   . ILE D 4  60  ? 49.414 30.631  35.282 1.00 30.56  ? 60   ILE B CG2   1 
ATOM   6478 C  CD1   . ILE D 4  60  ? 50.028 33.256  33.937 1.00 33.40  ? 60   ILE B CD1   1 
ATOM   6479 N  N     . ASP D 4  61  ? 45.365 33.131  35.513 1.00 32.97  ? 61   ASP B N     1 
ATOM   6480 C  CA    . ASP D 4  61  ? 44.559 34.289  35.891 1.00 34.48  ? 61   ASP B CA    1 
ATOM   6481 C  C     . ASP D 4  61  ? 43.498 33.858  36.898 1.00 34.49  ? 61   ASP B C     1 
ATOM   6482 O  O     . ASP D 4  61  ? 43.313 34.494  37.930 1.00 34.65  ? 61   ASP B O     1 
ATOM   6483 C  CB    . ASP D 4  61  ? 43.858 34.910  34.677 1.00 36.47  ? 61   ASP B CB    1 
ATOM   6484 C  CG    . ASP D 4  61  ? 44.808 35.677  33.784 1.00 39.22  ? 61   ASP B CG    1 
ATOM   6485 O  OD1   . ASP D 4  61  ? 45.673 36.391  34.323 1.00 39.63  ? 61   ASP B OD1   1 
ATOM   6486 O  OD2   . ASP D 4  61  ? 44.687 35.578  32.545 1.00 42.51  ? 61   ASP B OD2   1 
ATOM   6487 N  N     . GLN D 4  62  ? 42.806 32.768  36.589 1.00 34.05  ? 62   GLN B N     1 
ATOM   6488 C  CA    . GLN D 4  62  ? 41.755 32.251  37.455 1.00 34.32  ? 62   GLN B CA    1 
ATOM   6489 C  C     . GLN D 4  62  ? 42.344 31.535  38.672 1.00 33.06  ? 62   GLN B C     1 
ATOM   6490 O  O     . GLN D 4  62  ? 41.718 31.480  39.727 1.00 31.81  ? 62   GLN B O     1 
ATOM   6491 C  CB    . GLN D 4  62  ? 40.866 31.296  36.657 1.00 36.59  ? 62   GLN B CB    1 
ATOM   6492 C  CG    . GLN D 4  62  ? 40.663 31.754  35.218 1.00 42.30  ? 62   GLN B CG    1 
ATOM   6493 C  CD    . GLN D 4  62  ? 39.672 30.904  34.443 1.00 45.75  ? 62   GLN B CD    1 
ATOM   6494 O  OE1   . GLN D 4  62  ? 39.740 29.672  34.452 1.00 46.53  ? 62   GLN B OE1   1 
ATOM   6495 N  NE2   . GLN D 4  62  ? 38.748 31.564  33.752 1.00 47.04  ? 62   GLN B NE2   1 
ATOM   6496 N  N     . ASN D 4  63  ? 43.546 30.989  38.513 1.00 31.90  ? 63   ASN B N     1 
ATOM   6497 C  CA    . ASN D 4  63  ? 44.236 30.273  39.585 1.00 34.19  ? 63   ASN B CA    1 
ATOM   6498 C  C     . ASN D 4  63  ? 45.635 30.859  39.725 1.00 35.20  ? 63   ASN B C     1 
ATOM   6499 O  O     . ASN D 4  63  ? 46.606 30.289  39.229 1.00 34.09  ? 63   ASN B O     1 
ATOM   6500 C  CB    . ASN D 4  63  ? 44.329 28.790  39.246 1.00 33.47  ? 63   ASN B CB    1 
ATOM   6501 C  CG    . ASN D 4  63  ? 42.971 28.145  39.119 1.00 36.68  ? 63   ASN B CG    1 
ATOM   6502 O  OD1   . ASN D 4  63  ? 42.269 27.943  40.113 1.00 37.98  ? 63   ASN B OD1   1 
ATOM   6503 N  ND2   . ASN D 4  63  ? 42.579 27.834  37.891 1.00 38.22  ? 63   ASN B ND2   1 
ATOM   6504 N  N     . PRO D 4  64  ? 45.748 32.006  40.417 1.00 35.65  ? 64   PRO B N     1 
ATOM   6505 C  CA    . PRO D 4  64  ? 46.979 32.760  40.675 1.00 36.24  ? 64   PRO B CA    1 
ATOM   6506 C  C     . PRO D 4  64  ? 47.929 32.233  41.742 1.00 35.14  ? 64   PRO B C     1 
ATOM   6507 O  O     . PRO D 4  64  ? 49.048 32.723  41.868 1.00 35.10  ? 64   PRO B O     1 
ATOM   6508 C  CB    . PRO D 4  64  ? 46.446 34.136  41.046 1.00 36.99  ? 64   PRO B CB    1 
ATOM   6509 C  CG    . PRO D 4  64  ? 45.242 33.781  41.864 1.00 36.59  ? 64   PRO B CG    1 
ATOM   6510 C  CD    . PRO D 4  64  ? 44.587 32.706  41.005 1.00 36.69  ? 64   PRO B CD    1 
ATOM   6511 N  N     . GLY D 4  65  ? 47.501 31.237  42.504 1.00 34.69  ? 65   GLY B N     1 
ATOM   6512 C  CA    . GLY D 4  65  ? 48.355 30.743  43.570 1.00 33.62  ? 65   GLY B CA    1 
ATOM   6513 C  C     . GLY D 4  65  ? 49.378 29.664  43.270 1.00 33.85  ? 65   GLY B C     1 
ATOM   6514 O  O     . GLY D 4  65  ? 50.351 29.523  44.014 1.00 32.91  ? 65   GLY B O     1 
ATOM   6515 N  N     . THR D 4  66  ? 49.189 28.920  42.185 1.00 32.50  ? 66   THR B N     1 
ATOM   6516 C  CA    . THR D 4  66  ? 50.096 27.825  41.853 1.00 32.57  ? 66   THR B CA    1 
ATOM   6517 C  C     . THR D 4  66  ? 51.377 28.163  41.086 1.00 33.06  ? 66   THR B C     1 
ATOM   6518 O  O     . THR D 4  66  ? 52.463 27.738  41.477 1.00 31.03  ? 66   THR B O     1 
ATOM   6519 C  CB    . THR D 4  66  ? 49.349 26.736  41.067 1.00 32.38  ? 66   THR B CB    1 
ATOM   6520 O  OG1   . THR D 4  66  ? 48.155 26.382  41.776 1.00 32.89  ? 66   THR B OG1   1 
ATOM   6521 C  CG2   . THR D 4  66  ? 50.225 25.504  40.895 1.00 29.90  ? 66   THR B CG2   1 
ATOM   6522 N  N     . ALA D 4  67  ? 51.251 28.905  39.991 1.00 33.30  ? 67   ALA B N     1 
ATOM   6523 C  CA    . ALA D 4  67  ? 52.409 29.259  39.171 1.00 35.43  ? 67   ALA B CA    1 
ATOM   6524 C  C     . ALA D 4  67  ? 53.607 29.817  39.944 1.00 36.28  ? 67   ALA B C     1 
ATOM   6525 O  O     . ALA D 4  67  ? 54.742 29.387  39.730 1.00 34.94  ? 67   ALA B O     1 
ATOM   6526 C  CB    . ALA D 4  67  ? 51.992 30.243  38.070 1.00 35.49  ? 67   ALA B CB    1 
ATOM   6527 N  N     . PRO D 4  68  ? 53.375 30.778  40.852 1.00 37.56  ? 68   PRO B N     1 
ATOM   6528 C  CA    . PRO D 4  68  ? 54.487 31.354  41.620 1.00 39.53  ? 68   PRO B CA    1 
ATOM   6529 C  C     . PRO D 4  68  ? 55.412 30.339  42.295 1.00 41.33  ? 68   PRO B C     1 
ATOM   6530 O  O     . PRO D 4  68  ? 56.607 30.584  42.436 1.00 42.54  ? 68   PRO B O     1 
ATOM   6531 C  CB    . PRO D 4  68  ? 53.780 32.251  42.629 1.00 39.20  ? 68   PRO B CB    1 
ATOM   6532 C  CG    . PRO D 4  68  ? 52.582 32.726  41.859 1.00 39.70  ? 68   PRO B CG    1 
ATOM   6533 C  CD    . PRO D 4  68  ? 52.105 31.447  41.188 1.00 38.14  ? 68   PRO B CD    1 
ATOM   6534 N  N     . LYS D 4  69  ? 54.866 29.202  42.710 1.00 42.77  ? 69   LYS B N     1 
ATOM   6535 C  CA    . LYS D 4  69  ? 55.669 28.181  43.378 1.00 44.37  ? 69   LYS B CA    1 
ATOM   6536 C  C     . LYS D 4  69  ? 56.612 27.442  42.436 1.00 44.62  ? 69   LYS B C     1 
ATOM   6537 O  O     . LYS D 4  69  ? 57.420 26.628  42.875 1.00 46.28  ? 69   LYS B O     1 
ATOM   6538 C  CB    . LYS D 4  69  ? 54.759 27.172  44.082 1.00 46.17  ? 69   LYS B CB    1 
ATOM   6539 C  CG    . LYS D 4  69  ? 53.936 27.768  45.220 1.00 48.76  ? 69   LYS B CG    1 
ATOM   6540 C  CD    . LYS D 4  69  ? 52.968 26.747  45.802 1.00 50.57  ? 69   LYS B CD    1 
ATOM   6541 C  CE    . LYS D 4  69  ? 52.064 27.386  46.844 1.00 52.01  ? 69   LYS B CE    1 
ATOM   6542 N  NZ    . LYS D 4  69  ? 50.978 26.464  47.279 1.00 54.78  ? 69   LYS B NZ    1 
ATOM   6543 N  N     . TYR D 4  70  ? 56.507 27.721  41.143 1.00 44.67  ? 70   TYR B N     1 
ATOM   6544 C  CA    . TYR D 4  70  ? 57.364 27.075  40.158 1.00 44.12  ? 70   TYR B CA    1 
ATOM   6545 C  C     . TYR D 4  70  ? 58.164 28.107  39.369 1.00 44.33  ? 70   TYR B C     1 
ATOM   6546 O  O     . TYR D 4  70  ? 58.673 27.825  38.285 1.00 44.38  ? 70   TYR B O     1 
ATOM   6547 C  CB    . TYR D 4  70  ? 56.515 26.210  39.221 1.00 44.31  ? 70   TYR B CB    1 
ATOM   6548 C  CG    . TYR D 4  70  ? 55.872 25.040  39.933 1.00 44.50  ? 70   TYR B CG    1 
ATOM   6549 C  CD1   . TYR D 4  70  ? 56.645 23.977  40.399 1.00 44.70  ? 70   TYR B CD1   1 
ATOM   6550 C  CD2   . TYR D 4  70  ? 54.500 25.020  40.189 1.00 43.35  ? 70   TYR B CD2   1 
ATOM   6551 C  CE1   . TYR D 4  70  ? 56.072 22.923  41.107 1.00 44.91  ? 70   TYR B CE1   1 
ATOM   6552 C  CE2   . TYR D 4  70  ? 53.916 23.971  40.897 1.00 44.27  ? 70   TYR B CE2   1 
ATOM   6553 C  CZ    . TYR D 4  70  ? 54.709 22.928  41.355 1.00 45.88  ? 70   TYR B CZ    1 
ATOM   6554 O  OH    . TYR D 4  70  ? 54.144 21.897  42.074 1.00 46.99  ? 70   TYR B OH    1 
ATOM   6555 N  N     . GLY D 4  71  ? 58.271 29.306  39.934 1.00 44.64  ? 71   GLY B N     1 
ATOM   6556 C  CA    . GLY D 4  71  ? 59.019 30.377  39.300 1.00 45.54  ? 71   GLY B CA    1 
ATOM   6557 C  C     . GLY D 4  71  ? 58.697 30.610  37.836 1.00 45.84  ? 71   GLY B C     1 
ATOM   6558 O  O     . GLY D 4  71  ? 59.598 30.811  37.023 1.00 46.00  ? 71   GLY B O     1 
ATOM   6559 N  N     . ILE D 4  72  ? 57.413 30.583  37.496 1.00 45.59  ? 72   ILE B N     1 
ATOM   6560 C  CA    . ILE D 4  72  ? 56.989 30.809  36.121 1.00 45.00  ? 72   ILE B CA    1 
ATOM   6561 C  C     . ILE D 4  72  ? 57.514 32.159  35.649 1.00 45.59  ? 72   ILE B C     1 
ATOM   6562 O  O     . ILE D 4  72  ? 57.198 33.198  36.229 1.00 43.74  ? 72   ILE B O     1 
ATOM   6563 C  CB    . ILE D 4  72  ? 55.449 30.797  36.005 1.00 44.81  ? 72   ILE B CB    1 
ATOM   6564 C  CG1   . ILE D 4  72  ? 54.926 29.396  36.319 1.00 45.13  ? 72   ILE B CG1   1 
ATOM   6565 C  CG2   . ILE D 4  72  ? 55.015 31.245  34.621 1.00 43.59  ? 72   ILE B CG2   1 
ATOM   6566 C  CD1   . ILE D 4  72  ? 55.545 28.307  35.476 1.00 45.74  ? 72   ILE B CD1   1 
ATOM   6567 N  N     . ARG D 4  73  ? 58.312 32.138  34.589 1.00 46.75  ? 73   ARG B N     1 
ATOM   6568 C  CA    . ARG D 4  73  ? 58.886 33.363  34.054 1.00 48.46  ? 73   ARG B CA    1 
ATOM   6569 C  C     . ARG D 4  73  ? 58.342 33.652  32.652 1.00 45.88  ? 73   ARG B C     1 
ATOM   6570 O  O     . ARG D 4  73  ? 58.464 34.764  32.138 1.00 46.53  ? 73   ARG B O     1 
ATOM   6571 C  CB    . ARG D 4  73  ? 60.413 33.235  34.035 1.00 52.36  ? 73   ARG B CB    1 
ATOM   6572 C  CG    . ARG D 4  73  ? 61.156 34.510  34.389 1.00 59.89  ? 73   ARG B CG    1 
ATOM   6573 C  CD    . ARG D 4  73  ? 60.999 35.567  33.301 1.00 66.41  ? 73   ARG B CD    1 
ATOM   6574 N  NE    . ARG D 4  73  ? 61.650 35.171  32.052 1.00 70.46  ? 73   ARG B NE    1 
ATOM   6575 C  CZ    . ARG D 4  73  ? 61.566 35.854  30.914 1.00 73.07  ? 73   ARG B CZ    1 
ATOM   6576 N  NH1   . ARG D 4  73  ? 60.852 36.972  30.860 1.00 74.19  ? 73   ARG B NH1   1 
ATOM   6577 N  NH2   . ARG D 4  73  ? 62.202 35.423  29.829 1.00 74.89  ? 73   ARG B NH2   1 
ATOM   6578 N  N     . GLY D 4  74  ? 57.734 32.643  32.039 1.00 44.05  ? 74   GLY B N     1 
ATOM   6579 C  CA    . GLY D 4  74  ? 57.173 32.814  30.710 1.00 40.97  ? 74   GLY B CA    1 
ATOM   6580 C  C     . GLY D 4  74  ? 56.083 31.794  30.446 1.00 40.22  ? 74   GLY B C     1 
ATOM   6581 O  O     . GLY D 4  74  ? 56.045 30.753  31.089 1.00 39.09  ? 74   GLY B O     1 
ATOM   6582 N  N     . ILE D 4  75  ? 55.190 32.089  29.507 1.00 39.02  ? 75   ILE B N     1 
ATOM   6583 C  CA    . ILE D 4  75  ? 54.108 31.169  29.172 1.00 38.46  ? 75   ILE B CA    1 
ATOM   6584 C  C     . ILE D 4  75  ? 53.971 31.024  27.663 1.00 39.05  ? 75   ILE B C     1 
ATOM   6585 O  O     . ILE D 4  75  ? 54.304 31.937  26.914 1.00 40.01  ? 75   ILE B O     1 
ATOM   6586 C  CB    . ILE D 4  75  ? 52.760 31.639  29.759 1.00 36.57  ? 75   ILE B CB    1 
ATOM   6587 C  CG1   . ILE D 4  75  ? 52.511 33.103  29.403 1.00 35.18  ? 75   ILE B CG1   1 
ATOM   6588 C  CG2   . ILE D 4  75  ? 52.758 31.436  31.262 1.00 36.13  ? 75   ILE B CG2   1 
ATOM   6589 C  CD1   . ILE D 4  75  ? 51.160 33.623  29.866 1.00 35.28  ? 75   ILE B CD1   1 
ATOM   6590 N  N     . PRO D 4  76  ? 53.446 29.880  27.199 1.00 39.67  ? 76   PRO B N     1 
ATOM   6591 C  CA    . PRO D 4  76  ? 52.998 28.756  28.023 1.00 39.66  ? 76   PRO B CA    1 
ATOM   6592 C  C     . PRO D 4  76  ? 54.143 27.996  28.662 1.00 39.40  ? 76   PRO B C     1 
ATOM   6593 O  O     . PRO D 4  76  ? 55.177 27.786  28.034 1.00 40.23  ? 76   PRO B O     1 
ATOM   6594 C  CB    . PRO D 4  76  ? 52.240 27.891  27.025 1.00 40.83  ? 76   PRO B CB    1 
ATOM   6595 C  CG    . PRO D 4  76  ? 53.061 28.063  25.779 1.00 39.34  ? 76   PRO B CG    1 
ATOM   6596 C  CD    . PRO D 4  76  ? 53.306 29.562  25.765 1.00 39.84  ? 76   PRO B CD    1 
ATOM   6597 N  N     . THR D 4  77  ? 53.963 27.589  29.912 1.00 39.18  ? 77   THR B N     1 
ATOM   6598 C  CA    . THR D 4  77  ? 54.984 26.813  30.597 1.00 40.25  ? 77   THR B CA    1 
ATOM   6599 C  C     . THR D 4  77  ? 54.503 25.373  30.709 1.00 39.84  ? 77   THR B C     1 
ATOM   6600 O  O     . THR D 4  77  ? 53.413 25.112  31.210 1.00 41.47  ? 77   THR B O     1 
ATOM   6601 C  CB    . THR D 4  77  ? 55.274 27.359  32.000 1.00 39.49  ? 77   THR B CB    1 
ATOM   6602 O  OG1   . THR D 4  77  ? 55.955 28.608  31.885 1.00 40.30  ? 77   THR B OG1   1 
ATOM   6603 C  CG2   . THR D 4  77  ? 56.155 26.396  32.775 1.00 40.55  ? 77   THR B CG2   1 
ATOM   6604 N  N     . LEU D 4  78  ? 55.317 24.445  30.227 1.00 40.68  ? 78   LEU B N     1 
ATOM   6605 C  CA    . LEU D 4  78  ? 54.972 23.031  30.261 1.00 40.88  ? 78   LEU B CA    1 
ATOM   6606 C  C     . LEU D 4  78  ? 55.788 22.289  31.304 1.00 42.25  ? 78   LEU B C     1 
ATOM   6607 O  O     . LEU D 4  78  ? 56.999 22.149  31.171 1.00 42.03  ? 78   LEU B O     1 
ATOM   6608 C  CB    . LEU D 4  78  ? 55.210 22.408  28.884 1.00 40.70  ? 78   LEU B CB    1 
ATOM   6609 C  CG    . LEU D 4  78  ? 54.446 23.085  27.741 1.00 40.90  ? 78   LEU B CG    1 
ATOM   6610 C  CD1   . LEU D 4  78  ? 54.935 22.559  26.402 1.00 41.01  ? 78   LEU B CD1   1 
ATOM   6611 C  CD2   . LEU D 4  78  ? 52.951 22.839  27.911 1.00 41.10  ? 78   LEU B CD2   1 
ATOM   6612 N  N     . LEU D 4  79  ? 55.115 21.826  32.351 1.00 44.33  ? 79   LEU B N     1 
ATOM   6613 C  CA    . LEU D 4  79  ? 55.769 21.079  33.418 1.00 45.79  ? 79   LEU B CA    1 
ATOM   6614 C  C     . LEU D 4  79  ? 55.317 19.627  33.389 1.00 47.54  ? 79   LEU B C     1 
ATOM   6615 O  O     . LEU D 4  79  ? 54.120 19.339  33.446 1.00 47.72  ? 79   LEU B O     1 
ATOM   6616 C  CB    . LEU D 4  79  ? 55.420 21.670  34.784 1.00 45.83  ? 79   LEU B CB    1 
ATOM   6617 C  CG    . LEU D 4  79  ? 56.373 22.673  35.426 1.00 47.01  ? 79   LEU B CG    1 
ATOM   6618 C  CD1   . LEU D 4  79  ? 56.653 23.805  34.469 1.00 47.87  ? 79   LEU B CD1   1 
ATOM   6619 C  CD2   . LEU D 4  79  ? 55.761 23.195  36.720 1.00 46.38  ? 79   LEU B CD2   1 
ATOM   6620 N  N     . LEU D 4  80  ? 56.274 18.712  33.295 1.00 48.54  ? 80   LEU B N     1 
ATOM   6621 C  CA    . LEU D 4  80  ? 55.949 17.294  33.289 1.00 49.80  ? 80   LEU B CA    1 
ATOM   6622 C  C     . LEU D 4  80  ? 56.177 16.811  34.715 1.00 50.07  ? 80   LEU B C     1 
ATOM   6623 O  O     . LEU D 4  80  ? 57.318 16.690  35.158 1.00 50.47  ? 80   LEU B O     1 
ATOM   6624 C  CB    . LEU D 4  80  ? 56.866 16.536  32.329 1.00 49.84  ? 80   LEU B CB    1 
ATOM   6625 C  CG    . LEU D 4  80  ? 56.248 15.345  31.594 1.00 51.05  ? 80   LEU B CG    1 
ATOM   6626 C  CD1   . LEU D 4  80  ? 57.338 14.598  30.852 1.00 51.54  ? 80   LEU B CD1   1 
ATOM   6627 C  CD2   . LEU D 4  80  ? 55.555 14.420  32.573 1.00 52.77  ? 80   LEU B CD2   1 
ATOM   6628 N  N     . PHE D 4  81  ? 55.091 16.555  35.437 1.00 50.60  ? 81   PHE B N     1 
ATOM   6629 C  CA    . PHE D 4  81  ? 55.195 16.101  36.817 1.00 51.30  ? 81   PHE B CA    1 
ATOM   6630 C  C     . PHE D 4  81  ? 55.269 14.592  36.958 1.00 52.66  ? 81   PHE B C     1 
ATOM   6631 O  O     . PHE D 4  81  ? 54.616 13.850  36.224 1.00 52.84  ? 81   PHE B O     1 
ATOM   6632 C  CB    . PHE D 4  81  ? 54.020 16.610  37.651 1.00 48.65  ? 81   PHE B CB    1 
ATOM   6633 C  CG    . PHE D 4  81  ? 54.131 18.053  38.042 1.00 47.24  ? 81   PHE B CG    1 
ATOM   6634 C  CD1   . PHE D 4  81  ? 53.825 19.061  37.134 1.00 45.58  ? 81   PHE B CD1   1 
ATOM   6635 C  CD2   . PHE D 4  81  ? 54.520 18.405  39.332 1.00 45.64  ? 81   PHE B CD2   1 
ATOM   6636 C  CE1   . PHE D 4  81  ? 53.898 20.398  37.506 1.00 45.44  ? 81   PHE B CE1   1 
ATOM   6637 C  CE2   . PHE D 4  81  ? 54.597 19.741  39.713 1.00 45.04  ? 81   PHE B CE2   1 
ATOM   6638 C  CZ    . PHE D 4  81  ? 54.284 20.739  38.799 1.00 45.10  ? 81   PHE B CZ    1 
ATOM   6639 N  N     . LYS D 4  82  ? 56.069 14.153  37.923 1.00 55.04  ? 82   LYS B N     1 
ATOM   6640 C  CA    . LYS D 4  82  ? 56.249 12.738  38.207 1.00 57.22  ? 82   LYS B CA    1 
ATOM   6641 C  C     . LYS D 4  82  ? 56.302 12.576  39.724 1.00 57.37  ? 82   LYS B C     1 
ATOM   6642 O  O     . LYS D 4  82  ? 57.285 12.947  40.362 1.00 56.76  ? 82   LYS B O     1 
ATOM   6643 C  CB    . LYS D 4  82  ? 57.548 12.240  37.574 1.00 59.71  ? 82   LYS B CB    1 
ATOM   6644 C  CG    . LYS D 4  82  ? 57.768 10.749  37.708 1.00 63.69  ? 82   LYS B CG    1 
ATOM   6645 C  CD    . LYS D 4  82  ? 56.692 9.962   36.974 1.00 66.75  ? 82   LYS B CD    1 
ATOM   6646 C  CE    . LYS D 4  82  ? 56.867 8.466   37.190 1.00 67.89  ? 82   LYS B CE    1 
ATOM   6647 N  NZ    . LYS D 4  82  ? 56.799 8.118   38.638 1.00 69.19  ? 82   LYS B NZ    1 
ATOM   6648 N  N     . ASN D 4  83  ? 55.235 12.027  40.296 1.00 58.95  ? 83   ASN B N     1 
ATOM   6649 C  CA    . ASN D 4  83  ? 55.152 11.844  41.737 1.00 60.49  ? 83   ASN B CA    1 
ATOM   6650 C  C     . ASN D 4  83  ? 55.471 13.134  42.487 1.00 60.91  ? 83   ASN B C     1 
ATOM   6651 O  O     . ASN D 4  83  ? 56.495 13.239  43.163 1.00 61.14  ? 83   ASN B O     1 
ATOM   6652 C  CB    . ASN D 4  83  ? 56.090 10.726  42.196 1.00 62.75  ? 83   ASN B CB    1 
ATOM   6653 C  CG    . ASN D 4  83  ? 55.538 9.345   41.892 1.00 65.66  ? 83   ASN B CG    1 
ATOM   6654 O  OD1   . ASN D 4  83  ? 55.412 8.955   40.731 1.00 66.89  ? 83   ASN B OD1   1 
ATOM   6655 N  ND2   . ASN D 4  83  ? 55.195 8.600   42.940 1.00 66.85  ? 83   ASN B ND2   1 
ATOM   6656 N  N     . GLY D 4  84  ? 54.586 14.116  42.345 1.00 60.64  ? 84   GLY B N     1 
ATOM   6657 C  CA    . GLY D 4  84  ? 54.746 15.390  43.025 1.00 61.14  ? 84   GLY B CA    1 
ATOM   6658 C  C     . GLY D 4  84  ? 56.043 16.154  42.826 1.00 61.88  ? 84   GLY B C     1 
ATOM   6659 O  O     . GLY D 4  84  ? 56.332 17.085  43.583 1.00 61.89  ? 84   GLY B O     1 
ATOM   6660 N  N     . GLU D 4  85  ? 56.827 15.780  41.820 1.00 61.70  ? 85   GLU B N     1 
ATOM   6661 C  CA    . GLU D 4  85  ? 58.086 16.472  41.562 1.00 61.81  ? 85   GLU B CA    1 
ATOM   6662 C  C     . GLU D 4  85  ? 58.277 16.724  40.070 1.00 60.34  ? 85   GLU B C     1 
ATOM   6663 O  O     . GLU D 4  85  ? 58.031 15.843  39.244 1.00 59.01  ? 85   GLU B O     1 
ATOM   6664 C  CB    . GLU D 4  85  ? 59.249 15.656  42.135 1.00 63.83  ? 85   GLU B CB    1 
ATOM   6665 C  CG    . GLU D 4  85  ? 59.074 15.369  43.623 1.00 68.08  ? 85   GLU B CG    1 
ATOM   6666 C  CD    . GLU D 4  85  ? 60.143 14.461  44.201 1.00 70.93  ? 85   GLU B CD    1 
ATOM   6667 O  OE1   . GLU D 4  85  ? 60.438 13.415  43.579 1.00 72.73  ? 85   GLU B OE1   1 
ATOM   6668 O  OE2   . GLU D 4  85  ? 60.673 14.788  45.288 1.00 71.48  ? 85   GLU B OE2   1 
ATOM   6669 N  N     . VAL D 4  86  ? 58.693 17.941  39.729 1.00 58.96  ? 86   VAL B N     1 
ATOM   6670 C  CA    . VAL D 4  86  ? 58.910 18.307  38.336 1.00 58.71  ? 86   VAL B CA    1 
ATOM   6671 C  C     . VAL D 4  86  ? 60.000 17.430  37.726 1.00 58.86  ? 86   VAL B C     1 
ATOM   6672 O  O     . VAL D 4  86  ? 61.147 17.450  38.174 1.00 58.44  ? 86   VAL B O     1 
ATOM   6673 C  CB    . VAL D 4  86  ? 59.326 19.783  38.205 1.00 59.14  ? 86   VAL B CB    1 
ATOM   6674 C  CG1   . VAL D 4  86  ? 59.552 20.133  36.739 1.00 58.81  ? 86   VAL B CG1   1 
ATOM   6675 C  CG2   . VAL D 4  86  ? 58.255 20.677  38.810 1.00 58.41  ? 86   VAL B CG2   1 
ATOM   6676 N  N     . ALA D 4  87  ? 59.632 16.659  36.707 1.00 57.95  ? 87   ALA B N     1 
ATOM   6677 C  CA    . ALA D 4  87  ? 60.575 15.769  36.044 1.00 58.05  ? 87   ALA B CA    1 
ATOM   6678 C  C     . ALA D 4  87  ? 61.243 16.450  34.857 1.00 58.43  ? 87   ALA B C     1 
ATOM   6679 O  O     . ALA D 4  87  ? 62.330 16.054  34.434 1.00 58.89  ? 87   ALA B O     1 
ATOM   6680 C  CB    . ALA D 4  87  ? 59.861 14.499  35.583 1.00 57.85  ? 87   ALA B CB    1 
ATOM   6681 N  N     . ALA D 4  88  ? 60.587 17.476  34.324 1.00 57.64  ? 88   ALA B N     1 
ATOM   6682 C  CA    . ALA D 4  88  ? 61.110 18.209  33.180 1.00 56.51  ? 88   ALA B CA    1 
ATOM   6683 C  C     . ALA D 4  88  ? 60.260 19.440  32.912 1.00 56.07  ? 88   ALA B C     1 
ATOM   6684 O  O     . ALA D 4  88  ? 59.047 19.428  33.132 1.00 57.00  ? 88   ALA B O     1 
ATOM   6685 C  CB    . ALA D 4  88  ? 61.124 17.313  31.946 1.00 55.94  ? 88   ALA B CB    1 
ATOM   6686 N  N     . THR D 4  89  ? 60.901 20.499  32.433 1.00 54.19  ? 89   THR B N     1 
ATOM   6687 C  CA    . THR D 4  89  ? 60.201 21.738  32.132 1.00 52.47  ? 89   THR B CA    1 
ATOM   6688 C  C     . THR D 4  89  ? 60.644 22.338  30.799 1.00 52.07  ? 89   THR B C     1 
ATOM   6689 O  O     . THR D 4  89  ? 61.829 22.343  30.465 1.00 52.71  ? 89   THR B O     1 
ATOM   6690 C  CB    . THR D 4  89  ? 60.388 22.769  33.273 1.00 52.34  ? 89   THR B CB    1 
ATOM   6691 O  OG1   . THR D 4  89  ? 60.434 24.093  32.726 1.00 51.16  ? 89   THR B OG1   1 
ATOM   6692 C  CG2   . THR D 4  89  ? 61.656 22.481  34.060 1.00 53.08  ? 89   THR B CG2   1 
ATOM   6693 N  N     . LYS D 4  90  ? 59.674 22.832  30.037 1.00 50.92  ? 90   LYS B N     1 
ATOM   6694 C  CA    . LYS D 4  90  ? 59.937 23.429  28.736 1.00 50.69  ? 90   LYS B CA    1 
ATOM   6695 C  C     . LYS D 4  90  ? 58.982 24.607  28.536 1.00 49.45  ? 90   LYS B C     1 
ATOM   6696 O  O     . LYS D 4  90  ? 57.778 24.471  28.728 1.00 49.45  ? 90   LYS B O     1 
ATOM   6697 C  CB    . LYS D 4  90  ? 59.717 22.385  27.643 1.00 52.42  ? 90   LYS B CB    1 
ATOM   6698 C  CG    . LYS D 4  90  ? 60.536 22.608  26.395 1.00 55.21  ? 90   LYS B CG    1 
ATOM   6699 C  CD    . LYS D 4  90  ? 62.027 22.503  26.692 1.00 57.71  ? 90   LYS B CD    1 
ATOM   6700 C  CE    . LYS D 4  90  ? 62.392 21.138  27.251 1.00 59.35  ? 90   LYS B CE    1 
ATOM   6701 N  NZ    . LYS D 4  90  ? 63.856 21.033  27.509 1.00 62.03  ? 90   LYS B NZ    1 
ATOM   6702 N  N     . VAL D 4  91  ? 59.520 25.759  28.153 1.00 47.77  ? 91   VAL B N     1 
ATOM   6703 C  CA    . VAL D 4  91  ? 58.703 26.951  27.951 1.00 46.25  ? 91   VAL B CA    1 
ATOM   6704 C  C     . VAL D 4  91  ? 58.628 27.347  26.480 1.00 46.48  ? 91   VAL B C     1 
ATOM   6705 O  O     . VAL D 4  91  ? 59.649 27.605  25.853 1.00 46.73  ? 91   VAL B O     1 
ATOM   6706 C  CB    . VAL D 4  91  ? 59.272 28.148  28.747 1.00 45.67  ? 91   VAL B CB    1 
ATOM   6707 C  CG1   . VAL D 4  91  ? 58.369 29.364  28.587 1.00 46.26  ? 91   VAL B CG1   1 
ATOM   6708 C  CG2   . VAL D 4  91  ? 59.414 27.779  30.209 1.00 45.44  ? 91   VAL B CG2   1 
ATOM   6709 N  N     . GLY D 4  92  ? 57.417 27.396  25.934 1.00 46.62  ? 92   GLY B N     1 
ATOM   6710 C  CA    . GLY D 4  92  ? 57.255 27.775  24.542 1.00 46.56  ? 92   GLY B CA    1 
ATOM   6711 C  C     . GLY D 4  92  ? 56.247 26.949  23.763 1.00 46.70  ? 92   GLY B C     1 
ATOM   6712 O  O     . GLY D 4  92  ? 55.964 25.802  24.108 1.00 47.08  ? 92   GLY B O     1 
ATOM   6713 N  N     . ALA D 4  93  ? 55.712 27.541  22.698 1.00 46.49  ? 93   ALA B N     1 
ATOM   6714 C  CA    . ALA D 4  93  ? 54.730 26.878  21.849 1.00 46.26  ? 93   ALA B CA    1 
ATOM   6715 C  C     . ALA D 4  93  ? 55.382 25.871  20.912 1.00 46.67  ? 93   ALA B C     1 
ATOM   6716 O  O     . ALA D 4  93  ? 55.516 26.124  19.714 1.00 46.81  ? 93   ALA B O     1 
ATOM   6717 C  CB    . ALA D 4  93  ? 53.964 27.910  21.038 1.00 46.02  ? 93   ALA B CB    1 
ATOM   6718 N  N     . LEU D 4  94  ? 55.787 24.731  21.460 1.00 47.14  ? 94   LEU B N     1 
ATOM   6719 C  CA    . LEU D 4  94  ? 56.413 23.690  20.659 1.00 48.07  ? 94   LEU B CA    1 
ATOM   6720 C  C     . LEU D 4  94  ? 55.383 23.174  19.668 1.00 48.43  ? 94   LEU B C     1 
ATOM   6721 O  O     . LEU D 4  94  ? 54.182 23.252  19.914 1.00 49.69  ? 94   LEU B O     1 
ATOM   6722 C  CB    . LEU D 4  94  ? 56.882 22.531  21.543 1.00 46.72  ? 94   LEU B CB    1 
ATOM   6723 C  CG    . LEU D 4  94  ? 57.491 22.855  22.908 1.00 47.28  ? 94   LEU B CG    1 
ATOM   6724 C  CD1   . LEU D 4  94  ? 58.184 21.615  23.441 1.00 46.81  ? 94   LEU B CD1   1 
ATOM   6725 C  CD2   . LEU D 4  94  ? 58.476 24.001  22.798 1.00 47.29  ? 94   LEU B CD2   1 
ATOM   6726 N  N     . SER D 4  95  ? 55.854 22.654  18.545 1.00 48.92  ? 95   SER B N     1 
ATOM   6727 C  CA    . SER D 4  95  ? 54.961 22.116  17.533 1.00 49.74  ? 95   SER B CA    1 
ATOM   6728 C  C     . SER D 4  95  ? 54.550 20.714  17.964 1.00 50.15  ? 95   SER B C     1 
ATOM   6729 O  O     . SER D 4  95  ? 55.031 20.205  18.978 1.00 48.60  ? 95   SER B O     1 
ATOM   6730 C  CB    . SER D 4  95  ? 55.677 22.057  16.186 1.00 49.24  ? 95   SER B CB    1 
ATOM   6731 O  OG    . SER D 4  95  ? 56.915 21.376  16.314 1.00 51.03  ? 95   SER B OG    1 
ATOM   6732 N  N     . LYS D 4  96  ? 53.662 20.095  17.192 1.00 51.59  ? 96   LYS B N     1 
ATOM   6733 C  CA    . LYS D 4  96  ? 53.187 18.747  17.488 1.00 52.57  ? 96   LYS B CA    1 
ATOM   6734 C  C     . LYS D 4  96  ? 54.373 17.807  17.691 1.00 53.45  ? 96   LYS B C     1 
ATOM   6735 O  O     . LYS D 4  96  ? 54.543 17.231  18.766 1.00 52.94  ? 96   LYS B O     1 
ATOM   6736 C  CB    . LYS D 4  96  ? 52.316 18.238  16.333 1.00 52.39  ? 96   LYS B CB    1 
ATOM   6737 C  CG    . LYS D 4  96  ? 51.632 16.897  16.573 1.00 51.49  ? 96   LYS B CG    1 
ATOM   6738 C  CD    . LYS D 4  96  ? 50.382 17.043  17.425 1.00 52.62  ? 96   LYS B CD    1 
ATOM   6739 C  CE    . LYS D 4  96  ? 49.664 15.706  17.598 1.00 53.78  ? 96   LYS B CE    1 
ATOM   6740 N  NZ    . LYS D 4  96  ? 49.093 15.173  16.326 1.00 52.35  ? 96   LYS B NZ    1 
ATOM   6741 N  N     . GLY D 4  97  ? 55.196 17.668  16.654 1.00 55.00  ? 97   GLY B N     1 
ATOM   6742 C  CA    . GLY D 4  97  ? 56.354 16.792  16.730 1.00 55.90  ? 97   GLY B CA    1 
ATOM   6743 C  C     . GLY D 4  97  ? 57.265 17.081  17.908 1.00 56.88  ? 97   GLY B C     1 
ATOM   6744 O  O     . GLY D 4  97  ? 57.602 16.182  18.681 1.00 57.42  ? 97   GLY B O     1 
ATOM   6745 N  N     . GLN D 4  98  ? 57.667 18.340  18.045 1.00 57.63  ? 98   GLN B N     1 
ATOM   6746 C  CA    . GLN D 4  98  ? 58.545 18.759  19.133 1.00 58.41  ? 98   GLN B CA    1 
ATOM   6747 C  C     . GLN D 4  98  ? 58.044 18.319  20.507 1.00 58.41  ? 98   GLN B C     1 
ATOM   6748 O  O     . GLN D 4  98  ? 58.818 17.833  21.330 1.00 57.77  ? 98   GLN B O     1 
ATOM   6749 C  CB    . GLN D 4  98  ? 58.704 20.278  19.117 1.00 59.29  ? 98   GLN B CB    1 
ATOM   6750 C  CG    . GLN D 4  98  ? 59.417 20.813  17.890 1.00 60.05  ? 98   GLN B CG    1 
ATOM   6751 C  CD    . GLN D 4  98  ? 59.568 22.317  17.927 1.00 61.05  ? 98   GLN B CD    1 
ATOM   6752 O  OE1   . GLN D 4  98  ? 58.586 23.052  17.824 1.00 61.80  ? 98   GLN B OE1   1 
ATOM   6753 N  NE2   . GLN D 4  98  ? 60.801 22.785  18.087 1.00 60.59  ? 98   GLN B NE2   1 
ATOM   6754 N  N     . LEU D 4  99  ? 56.752 18.501  20.757 1.00 58.84  ? 99   LEU B N     1 
ATOM   6755 C  CA    . LEU D 4  99  ? 56.180 18.108  22.039 1.00 58.64  ? 99   LEU B CA    1 
ATOM   6756 C  C     . LEU D 4  99  ? 56.330 16.601  22.184 1.00 59.22  ? 99   LEU B C     1 
ATOM   6757 O  O     . LEU D 4  99  ? 56.690 16.102  23.250 1.00 59.60  ? 99   LEU B O     1 
ATOM   6758 C  CB    . LEU D 4  99  ? 54.698 18.480  22.111 1.00 57.73  ? 99   LEU B CB    1 
ATOM   6759 C  CG    . LEU D 4  99  ? 54.178 19.010  23.450 1.00 56.74  ? 99   LEU B CG    1 
ATOM   6760 C  CD1   . LEU D 4  99  ? 52.667 18.886  23.465 1.00 57.12  ? 99   LEU B CD1   1 
ATOM   6761 C  CD2   . LEU D 4  99  ? 54.778 18.231  24.610 1.00 56.86  ? 99   LEU B CD2   1 
ATOM   6762 N  N     . LYS D 4  100 ? 56.046 15.882  21.103 1.00 60.07  ? 100  LYS B N     1 
ATOM   6763 C  CA    . LYS D 4  100 ? 56.165 14.429  21.102 1.00 61.09  ? 100  LYS B CA    1 
ATOM   6764 C  C     . LYS D 4  100 ? 57.598 14.040  21.432 1.00 61.02  ? 100  LYS B C     1 
ATOM   6765 O  O     . LYS D 4  100 ? 57.833 13.148  22.248 1.00 61.43  ? 100  LYS B O     1 
ATOM   6766 C  CB    . LYS D 4  100 ? 55.769 13.861  19.739 1.00 61.36  ? 100  LYS B CB    1 
ATOM   6767 C  CG    . LYS D 4  100 ? 54.264 13.755  19.528 1.00 62.36  ? 100  LYS B CG    1 
ATOM   6768 C  CD    . LYS D 4  100 ? 53.901 13.347  18.100 1.00 65.34  ? 100  LYS B CD    1 
ATOM   6769 C  CE    . LYS D 4  100 ? 54.602 12.060  17.663 1.00 66.83  ? 100  LYS B CE    1 
ATOM   6770 N  NZ    . LYS D 4  100 ? 56.053 12.272  17.375 1.00 68.13  ? 100  LYS B NZ    1 
ATOM   6771 N  N     . GLU D 4  101 ? 58.555 14.712  20.799 1.00 61.36  ? 101  GLU B N     1 
ATOM   6772 C  CA    . GLU D 4  101 ? 59.961 14.434  21.059 1.00 61.37  ? 101  GLU B CA    1 
ATOM   6773 C  C     . GLU D 4  101 ? 60.228 14.598  22.547 1.00 60.03  ? 101  GLU B C     1 
ATOM   6774 O  O     . GLU D 4  101 ? 60.916 13.784  23.160 1.00 59.57  ? 101  GLU B O     1 
ATOM   6775 C  CB    . GLU D 4  101 ? 60.864 15.394  20.282 1.00 62.85  ? 101  GLU B CB    1 
ATOM   6776 C  CG    . GLU D 4  101 ? 61.040 15.067  18.809 1.00 66.15  ? 101  GLU B CG    1 
ATOM   6777 C  CD    . GLU D 4  101 ? 62.107 15.931  18.154 1.00 68.14  ? 101  GLU B CD    1 
ATOM   6778 O  OE1   . GLU D 4  101 ? 63.288 15.835  18.560 1.00 69.20  ? 101  GLU B OE1   1 
ATOM   6779 O  OE2   . GLU D 4  101 ? 61.764 16.713  17.239 1.00 68.86  ? 101  GLU B OE2   1 
ATOM   6780 N  N     . PHE D 4  102 ? 59.670 15.659  23.122 1.00 59.35  ? 102  PHE B N     1 
ATOM   6781 C  CA    . PHE D 4  102 ? 59.845 15.949  24.540 1.00 58.69  ? 102  PHE B CA    1 
ATOM   6782 C  C     . PHE D 4  102 ? 59.221 14.884  25.436 1.00 58.44  ? 102  PHE B C     1 
ATOM   6783 O  O     . PHE D 4  102 ? 59.840 14.432  26.399 1.00 57.95  ? 102  PHE B O     1 
ATOM   6784 C  CB    . PHE D 4  102 ? 59.234 17.311  24.874 1.00 57.17  ? 102  PHE B CB    1 
ATOM   6785 C  CG    . PHE D 4  102 ? 59.320 17.672  26.329 1.00 56.06  ? 102  PHE B CG    1 
ATOM   6786 C  CD1   . PHE D 4  102 ? 60.553 17.840  26.945 1.00 55.34  ? 102  PHE B CD1   1 
ATOM   6787 C  CD2   . PHE D 4  102 ? 58.169 17.843  27.084 1.00 55.25  ? 102  PHE B CD2   1 
ATOM   6788 C  CE1   . PHE D 4  102 ? 60.640 18.174  28.290 1.00 54.29  ? 102  PHE B CE1   1 
ATOM   6789 C  CE2   . PHE D 4  102 ? 58.246 18.177  28.429 1.00 55.37  ? 102  PHE B CE2   1 
ATOM   6790 C  CZ    . PHE D 4  102 ? 59.486 18.343  29.033 1.00 55.48  ? 102  PHE B CZ    1 
ATOM   6791 N  N     . LEU D 4  103 ? 57.995 14.487  25.114 1.00 58.87  ? 103  LEU B N     1 
ATOM   6792 C  CA    . LEU D 4  103 ? 57.286 13.488  25.901 1.00 59.41  ? 103  LEU B CA    1 
ATOM   6793 C  C     . LEU D 4  103 ? 57.894 12.089  25.807 1.00 60.69  ? 103  LEU B C     1 
ATOM   6794 O  O     . LEU D 4  103 ? 57.914 11.353  26.794 1.00 60.95  ? 103  LEU B O     1 
ATOM   6795 C  CB    . LEU D 4  103 ? 55.811 13.443  25.486 1.00 58.63  ? 103  LEU B CB    1 
ATOM   6796 C  CG    . LEU D 4  103 ? 55.014 14.737  25.684 1.00 57.04  ? 103  LEU B CG    1 
ATOM   6797 C  CD1   . LEU D 4  103 ? 53.577 14.516  25.261 1.00 56.82  ? 103  LEU B CD1   1 
ATOM   6798 C  CD2   . LEU D 4  103 ? 55.069 15.161  27.140 1.00 58.19  ? 103  LEU B CD2   1 
ATOM   6799 N  N     . ASP D 4  104 ? 58.388 11.714  24.630 1.00 61.23  ? 104  ASP B N     1 
ATOM   6800 C  CA    . ASP D 4  104 ? 58.983 10.390  24.472 1.00 62.18  ? 104  ASP B CA    1 
ATOM   6801 C  C     . ASP D 4  104 ? 60.333 10.325  25.180 1.00 62.02  ? 104  ASP B C     1 
ATOM   6802 O  O     . ASP D 4  104 ? 60.708 9.296   25.738 1.00 62.42  ? 104  ASP B O     1 
ATOM   6803 C  CB    . ASP D 4  104 ? 59.163 10.047  22.987 1.00 62.82  ? 104  ASP B CB    1 
ATOM   6804 C  CG    . ASP D 4  104 ? 57.847 10.044  22.220 1.00 65.06  ? 104  ASP B CG    1 
ATOM   6805 O  OD1   . ASP D 4  104 ? 56.829 9.566   22.771 1.00 64.94  ? 104  ASP B OD1   1 
ATOM   6806 O  OD2   . ASP D 4  104 ? 57.832 10.507  21.058 1.00 65.87  ? 104  ASP B OD2   1 
ATOM   6807 N  N     . ALA D 4  105 ? 61.048 11.443  25.170 1.00 62.01  ? 105  ALA B N     1 
ATOM   6808 C  CA    . ALA D 4  105 ? 62.363 11.518  25.788 1.00 62.50  ? 105  ALA B CA    1 
ATOM   6809 C  C     . ALA D 4  105 ? 62.331 11.508  27.311 1.00 63.01  ? 105  ALA B C     1 
ATOM   6810 O  O     . ALA D 4  105 ? 63.333 11.186  27.953 1.00 63.65  ? 105  ALA B O     1 
ATOM   6811 C  CB    . ALA D 4  105 ? 63.086 12.766  25.298 1.00 62.43  ? 105  ALA B CB    1 
ATOM   6812 N  N     . ASN D 4  106 ? 61.187 11.853  27.894 1.00 62.89  ? 106  ASN B N     1 
ATOM   6813 C  CA    . ASN D 4  106 ? 61.075 11.901  29.348 1.00 62.34  ? 106  ASN B CA    1 
ATOM   6814 C  C     . ASN D 4  106 ? 60.125 10.868  29.948 1.00 62.69  ? 106  ASN B C     1 
ATOM   6815 O  O     . ASN D 4  106 ? 60.011 10.754  31.171 1.00 62.07  ? 106  ASN B O     1 
ATOM   6816 C  CB    . ASN D 4  106 ? 60.665 13.309  29.775 1.00 60.86  ? 106  ASN B CB    1 
ATOM   6817 C  CG    . ASN D 4  106 ? 61.723 14.339  29.442 1.00 59.26  ? 106  ASN B CG    1 
ATOM   6818 O  OD1   . ASN D 4  106 ? 62.730 14.458  30.142 1.00 59.25  ? 106  ASN B OD1   1 
ATOM   6819 N  ND2   . ASN D 4  106 ? 61.511 15.078  28.360 1.00 57.41  ? 106  ASN B ND2   1 
ATOM   6820 N  N     . LEU D 4  107 ? 59.450 10.118  29.084 1.00 63.09  ? 107  LEU B N     1 
ATOM   6821 C  CA    . LEU D 4  107 ? 58.527 9.079   29.524 1.00 64.05  ? 107  LEU B CA    1 
ATOM   6822 C  C     . LEU D 4  107 ? 59.184 7.706   29.398 1.00 65.28  ? 107  LEU B C     1 
ATOM   6823 O  O     . LEU D 4  107 ? 60.387 7.658   29.055 1.00 65.46  ? 107  LEU B O     1 
ATOM   6824 C  CB    . LEU D 4  107 ? 57.242 9.118   28.692 1.00 63.90  ? 107  LEU B CB    1 
ATOM   6825 C  CG    . LEU D 4  107 ? 56.086 9.990   29.194 1.00 63.42  ? 107  LEU B CG    1 
ATOM   6826 C  CD1   . LEU D 4  107 ? 56.558 11.409  29.456 1.00 64.56  ? 107  LEU B CD1   1 
ATOM   6827 C  CD2   . LEU D 4  107 ? 54.975 9.979   28.160 1.00 63.67  ? 107  LEU B CD2   1 
HETATM 6828 MG MG    . MG  E 5  .   ? 44.942 84.466  58.124 1.00 42.08  ? 991  MG  A MG    1 
HETATM 6829 MG MG    . MG  F 5  .   ? 47.175 81.794  57.637 1.00 33.68  ? 992  MG  A MG    1 
HETATM 6830 MG MG    . MG  G 5  .   ? 78.726 83.321  44.406 1.00 29.82  ? 993  MG  A MG    1 
HETATM 6831 S  S     . SO4 H 6  .   ? 73.270 87.079  62.813 1.00 65.17  ? 994  SO4 A S     1 
HETATM 6832 O  O1    . SO4 H 6  .   ? 72.273 88.043  63.320 1.00 65.67  ? 994  SO4 A O1    1 
HETATM 6833 O  O2    . SO4 H 6  .   ? 74.627 87.577  63.115 1.00 65.10  ? 994  SO4 A O2    1 
HETATM 6834 O  O3    . SO4 H 6  .   ? 73.113 86.933  61.357 1.00 63.82  ? 994  SO4 A O3    1 
HETATM 6835 O  O4    . SO4 H 6  .   ? 73.070 85.768  63.463 1.00 64.38  ? 994  SO4 A O4    1 
HETATM 6836 S  S     . SO4 I 6  .   ? 64.576 88.488  29.216 1.00 67.33  ? 995  SO4 A S     1 
HETATM 6837 O  O1    . SO4 I 6  .   ? 63.379 88.798  30.032 1.00 66.87  ? 995  SO4 A O1    1 
HETATM 6838 O  O2    . SO4 I 6  .   ? 65.667 89.428  29.558 1.00 66.93  ? 995  SO4 A O2    1 
HETATM 6839 O  O3    . SO4 I 6  .   ? 64.243 88.629  27.782 1.00 66.00  ? 995  SO4 A O3    1 
HETATM 6840 O  O4    . SO4 I 6  .   ? 64.996 87.100  29.513 1.00 65.42  ? 995  SO4 A O4    1 
HETATM 6841 N  N1    . DCT J 7  .   ? 43.768 81.209  50.745 1.00 31.54  ? 823  DCT A N1    1 
HETATM 6842 C  C2    . DCT J 7  .   ? 43.323 80.707  49.506 1.00 30.37  ? 823  DCT A C2    1 
HETATM 6843 N  N3    . DCT J 7  .   ? 42.685 79.510  49.445 1.00 28.26  ? 823  DCT A N3    1 
HETATM 6844 C  C4    . DCT J 7  .   ? 42.475 78.808  50.559 1.00 28.99  ? 823  DCT A C4    1 
HETATM 6845 C  C5    . DCT J 7  .   ? 42.877 79.302  51.849 1.00 30.44  ? 823  DCT A C5    1 
HETATM 6846 C  C6    . DCT J 7  .   ? 43.520 80.500  51.894 1.00 32.33  ? 823  DCT A C6    1 
HETATM 6847 O  O2    . DCT J 7  .   ? 43.522 81.376  48.490 1.00 30.24  ? 823  DCT A O2    1 
HETATM 6848 N  N4    . DCT J 7  .   ? 41.882 77.600  50.436 1.00 28.95  ? 823  DCT A N4    1 
HETATM 6849 C  "C1'" . DCT J 7  .   ? 44.507 82.503  50.751 1.00 32.60  ? 823  DCT A "C1'" 1 
HETATM 6850 C  "C2'" . DCT J 7  .   ? 43.629 83.739  50.968 1.00 33.33  ? 823  DCT A "C2'" 1 
HETATM 6851 C  "C3'" . DCT J 7  .   ? 43.812 83.981  52.470 1.00 36.07  ? 823  DCT A "C3'" 1 
HETATM 6852 C  "C4'" . DCT J 7  .   ? 45.280 83.613  52.668 1.00 35.92  ? 823  DCT A "C4'" 1 
HETATM 6853 O  "O4'" . DCT J 7  .   ? 45.499 82.496  51.764 1.00 34.90  ? 823  DCT A "O4'" 1 
HETATM 6854 C  "C5'" . DCT J 7  .   ? 45.674 83.161  54.050 1.00 35.82  ? 823  DCT A "C5'" 1 
HETATM 6855 O  "O5'" . DCT J 7  .   ? 44.952 81.999  54.406 1.00 36.75  ? 823  DCT A "O5'" 1 
HETATM 6856 P  PA    . DCT J 7  .   ? 44.224 81.932  55.810 1.00 36.19  ? 823  DCT A PA    1 
HETATM 6857 O  O1A   . DCT J 7  .   ? 43.883 80.516  55.968 1.00 34.73  ? 823  DCT A O1A   1 
HETATM 6858 O  O2A   . DCT J 7  .   ? 45.088 82.613  56.827 1.00 35.15  ? 823  DCT A O2A   1 
HETATM 6859 O  O3A   . DCT J 7  .   ? 42.890 82.777  55.559 1.00 37.52  ? 823  DCT A O3A   1 
HETATM 6860 P  PB    . DCT J 7  .   ? 42.302 84.041  56.331 1.00 35.41  ? 823  DCT A PB    1 
HETATM 6861 O  O1B   . DCT J 7  .   ? 41.243 84.617  55.466 1.00 36.55  ? 823  DCT A O1B   1 
HETATM 6862 O  O2B   . DCT J 7  .   ? 43.431 84.901  56.781 1.00 36.71  ? 823  DCT A O2B   1 
HETATM 6863 O  O3B   . DCT J 7  .   ? 41.636 83.297  57.578 1.00 37.33  ? 823  DCT A O3B   1 
HETATM 6864 P  PG    . DCT J 7  .   ? 41.992 83.555  59.113 1.00 39.15  ? 823  DCT A PG    1 
HETATM 6865 O  O1G   . DCT J 7  .   ? 43.469 83.507  59.268 1.00 36.90  ? 823  DCT A O1G   1 
HETATM 6866 O  O2G   . DCT J 7  .   ? 41.243 84.757  59.568 1.00 37.59  ? 823  DCT A O2G   1 
HETATM 6867 O  O3G   . DCT J 7  .   ? 41.439 82.355  59.867 1.00 39.78  ? 823  DCT A O3G   1 
HETATM 6868 O  OH2   . 1PE K 8  .   ? 77.327 78.330  46.529 1.00 56.50  ? 901  1PE A OH2   1 
HETATM 6869 C  C12   . 1PE K 8  .   ? 78.269 78.496  47.617 1.00 54.77  ? 901  1PE A C12   1 
HETATM 6870 C  C22   . 1PE K 8  .   ? 79.614 77.784  47.274 1.00 54.54  ? 901  1PE A C22   1 
HETATM 6871 O  OH3   . 1PE K 8  .   ? 79.519 76.443  47.858 1.00 54.53  ? 901  1PE A OH3   1 
HETATM 6872 C  C13   . 1PE K 8  .   ? 80.342 74.267  48.192 1.00 54.29  ? 901  1PE A C13   1 
HETATM 6873 C  C23   . 1PE K 8  .   ? 80.741 75.619  47.611 1.00 54.27  ? 901  1PE A C23   1 
HETATM 6874 O  OH4   . 1PE K 8  .   ? 79.600 73.585  47.154 1.00 57.39  ? 901  1PE A OH4   1 
HETATM 6875 C  C14   . 1PE K 8  .   ? 78.383 71.590  46.494 1.00 61.47  ? 901  1PE A C14   1 
HETATM 6876 C  C24   . 1PE K 8  .   ? 79.150 72.245  47.609 1.00 58.59  ? 901  1PE A C24   1 
HETATM 6877 O  OH5   . 1PE K 8  .   ? 77.083 72.191  46.542 1.00 62.65  ? 901  1PE A OH5   1 
HETATM 6878 C  C15   . 1PE K 8  .   ? 74.901 72.257  45.543 1.00 63.41  ? 901  1PE A C15   1 
HETATM 6879 C  C25   . 1PE K 8  .   ? 76.252 71.622  45.485 1.00 63.18  ? 901  1PE A C25   1 
HETATM 6880 O  OH6   . 1PE K 8  .   ? 75.050 73.664  45.143 1.00 63.38  ? 901  1PE A OH6   1 
HETATM 6881 C  C16   . 1PE K 8  .   ? 74.000 75.551  46.249 1.00 63.05  ? 901  1PE A C16   1 
HETATM 6882 C  C26   . 1PE K 8  .   ? 73.896 74.529  45.132 1.00 63.17  ? 901  1PE A C26   1 
HETATM 6883 O  OH7   . 1PE K 8  .   ? 74.445 76.908  45.840 1.00 62.42  ? 901  1PE A OH7   1 
HETATM 6884 O  O1    . MES L 9  .   ? 92.799 90.494  67.060 1.00 49.83  ? 902  MES A O1    1 
HETATM 6885 C  C2    . MES L 9  .   ? 92.175 89.288  66.555 1.00 49.90  ? 902  MES A C2    1 
HETATM 6886 C  C3    . MES L 9  .   ? 92.584 89.026  65.097 1.00 49.16  ? 902  MES A C3    1 
HETATM 6887 N  N4    . MES L 9  .   ? 92.268 90.206  64.274 1.00 49.02  ? 902  MES A N4    1 
HETATM 6888 C  C5    . MES L 9  .   ? 92.889 91.435  64.809 1.00 49.62  ? 902  MES A C5    1 
HETATM 6889 C  C6    . MES L 9  .   ? 92.475 91.645  66.254 1.00 50.75  ? 902  MES A C6    1 
HETATM 6890 C  C7    . MES L 9  .   ? 92.661 89.958  62.869 1.00 46.62  ? 902  MES A C7    1 
HETATM 6891 C  C8    . MES L 9  .   ? 92.583 91.170  61.939 1.00 47.06  ? 902  MES A C8    1 
HETATM 6892 S  S     . MES L 9  .   ? 92.949 90.746  60.275 1.00 46.71  ? 902  MES A S     1 
HETATM 6893 O  O1S   . MES L 9  .   ? 93.390 91.994  59.654 1.00 46.61  ? 902  MES A O1S   1 
HETATM 6894 O  O2S   . MES L 9  .   ? 91.740 90.250  59.676 1.00 47.01  ? 902  MES A O2S   1 
HETATM 6895 O  O3S   . MES L 9  .   ? 94.018 89.754  60.302 1.00 48.59  ? 902  MES A O3S   1 
HETATM 6896 O  O     . HOH M 10 .   ? 42.444 73.245  43.932 1.00 36.94  ? 1007 HOH P O     1 
HETATM 6897 O  O     . HOH M 10 .   ? 43.710 74.860  52.061 1.00 45.22  ? 1145 HOH P O     1 
HETATM 6898 O  O     . HOH M 10 .   ? 53.386 67.752  38.771 1.00 34.66  ? 1235 HOH P O     1 
HETATM 6899 O  O     . HOH M 10 .   ? 43.198 66.685  41.732 1.00 58.12  ? 1283 HOH P O     1 
HETATM 6900 O  O     . HOH M 10 .   ? 43.775 72.109  53.270 1.00 41.16  ? 1294 HOH P O     1 
HETATM 6901 O  O     . HOH M 10 .   ? 46.481 62.848  53.139 1.00 37.96  ? 1342 HOH P O     1 
HETATM 6902 O  O     . HOH M 10 .   ? 50.084 69.269  39.854 1.00 37.72  ? 1355 HOH P O     1 
HETATM 6903 O  O     . HOH M 10 .   ? 43.884 72.410  46.674 1.00 45.03  ? 1409 HOH P O     1 
HETATM 6904 O  O     . HOH M 10 .   ? 42.531 62.329  54.941 1.00 53.89  ? 1421 HOH P O     1 
HETATM 6905 O  O     . HOH M 10 .   ? 47.105 64.890  35.792 1.00 46.15  ? 1432 HOH P O     1 
HETATM 6906 O  O     . HOH M 10 .   ? 55.052 66.271  36.682 1.00 63.14  ? 1459 HOH P O     1 
HETATM 6907 O  O     . HOH M 10 .   ? 55.041 66.545  27.690 1.00 50.21  ? 1478 HOH P O     1 
HETATM 6908 O  O     . HOH M 10 .   ? 46.125 56.691  37.111 1.00 36.19  ? 1515 HOH P O     1 
HETATM 6909 O  O     . HOH M 10 .   ? 40.558 70.795  45.175 1.00 64.12  ? 1607 HOH P O     1 
HETATM 6910 O  O     . HOH M 10 .   ? 41.932 72.715  50.668 1.00 59.90  ? 1619 HOH P O     1 
HETATM 6911 O  O     . HOH M 10 .   ? 49.824 62.789  46.760 1.00 43.66  ? 1650 HOH P O     1 
HETATM 6912 O  O     . HOH M 10 .   ? 44.549 71.536  49.515 1.00 41.94  ? 1652 HOH P O     1 
HETATM 6913 O  O     . HOH M 10 .   ? 45.966 74.946  60.040 1.00 43.50  ? 1653 HOH P O     1 
HETATM 6914 O  O     . HOH N 10 .   ? 59.769 78.482  43.928 1.00 21.74  ? 1057 HOH T O     1 
HETATM 6915 O  O     . HOH N 10 .   ? 45.426 74.080  43.070 1.00 29.76  ? 1077 HOH T O     1 
HETATM 6916 O  O     . HOH N 10 .   ? 53.292 75.663  49.351 1.00 15.92  ? 1091 HOH T O     1 
HETATM 6917 O  O     . HOH N 10 .   ? 61.008 54.912  49.487 1.00 54.34  ? 1102 HOH T O     1 
HETATM 6918 O  O     . HOH N 10 .   ? 48.270 83.824  38.562 1.00 33.04  ? 1110 HOH T O     1 
HETATM 6919 O  O     . HOH N 10 .   ? 61.284 72.186  44.496 1.00 22.71  ? 1136 HOH T O     1 
HETATM 6920 O  O     . HOH N 10 .   ? 54.707 71.079  40.439 1.00 40.18  ? 1141 HOH T O     1 
HETATM 6921 O  O     . HOH N 10 .   ? 51.556 72.480  40.791 1.00 66.82  ? 1171 HOH T O     1 
HETATM 6922 O  O     . HOH N 10 .   ? 55.067 65.726  51.267 1.00 31.17  ? 1203 HOH T O     1 
HETATM 6923 O  O     . HOH N 10 .   ? 52.812 74.823  38.411 1.00 64.53  ? 1207 HOH T O     1 
HETATM 6924 O  O     . HOH N 10 .   ? 41.482 74.061  47.881 1.00 53.48  ? 1228 HOH T O     1 
HETATM 6925 O  O     . HOH N 10 .   ? 56.483 81.086  39.642 1.00 35.03  ? 1238 HOH T O     1 
HETATM 6926 O  O     . HOH N 10 .   ? 51.181 77.390  40.978 1.00 43.93  ? 1241 HOH T O     1 
HETATM 6927 O  O     . HOH N 10 .   ? 53.357 64.134  47.968 1.00 35.33  ? 1243 HOH T O     1 
HETATM 6928 O  O     . HOH N 10 .   ? 61.537 65.898  45.509 1.00 40.09  ? 1248 HOH T O     1 
HETATM 6929 O  O     . HOH N 10 .   ? 47.850 72.232  42.617 1.00 34.04  ? 1252 HOH T O     1 
HETATM 6930 O  O     . HOH N 10 .   ? 61.047 75.080  44.545 1.00 37.93  ? 1339 HOH T O     1 
HETATM 6931 O  O     . HOH N 10 .   ? 49.438 74.489  41.470 1.00 44.26  ? 1350 HOH T O     1 
HETATM 6932 O  O     . HOH N 10 .   ? 57.994 66.211  51.239 1.00 38.70  ? 1397 HOH T O     1 
HETATM 6933 O  O     . HOH N 10 .   ? 36.312 71.724  37.308 1.00 44.18  ? 1404 HOH T O     1 
HETATM 6934 O  O     . HOH N 10 .   ? 40.376 83.365  27.920 1.00 51.16  ? 1456 HOH T O     1 
HETATM 6935 O  O     . HOH N 10 .   ? 61.499 53.753  40.076 1.00 61.95  ? 1553 HOH T O     1 
HETATM 6936 O  O     . HOH N 10 .   ? 39.197 72.614  40.306 1.00 53.52  ? 1581 HOH T O     1 
HETATM 6937 O  O     . HOH N 10 .   ? 62.545 49.487  34.601 1.00 62.21  ? 1592 HOH T O     1 
HETATM 6938 O  O     . HOH N 10 .   ? 34.319 78.607  30.274 1.00 65.93  ? 1601 HOH T O     1 
HETATM 6939 O  O     . HOH N 10 .   ? 58.210 55.501  50.645 1.00 45.12  ? 1625 HOH T O     1 
HETATM 6940 O  O     . HOH N 10 .   ? 50.862 57.501  42.321 1.00 45.42  ? 1636 HOH T O     1 
HETATM 6941 O  O     . HOH O 10 .   ? 62.953 89.277  48.812 1.00 17.65  ? 1004 HOH A O     1 
HETATM 6942 O  O     . HOH O 10 .   ? 63.348 78.492  60.014 1.00 20.38  ? 1005 HOH A O     1 
HETATM 6943 O  O     . HOH O 10 .   ? 65.063 82.950  52.537 1.00 16.18  ? 1006 HOH A O     1 
HETATM 6944 O  O     . HOH O 10 .   ? 78.150 87.474  44.306 1.00 22.99  ? 1008 HOH A O     1 
HETATM 6945 O  O     . HOH O 10 .   ? 58.770 66.820  54.072 1.00 26.18  ? 1009 HOH A O     1 
HETATM 6946 O  O     . HOH O 10 .   ? 60.287 80.342  33.528 1.00 28.86  ? 1010 HOH A O     1 
HETATM 6947 O  O     . HOH O 10 .   ? 69.742 94.652  51.569 1.00 18.56  ? 1012 HOH A O     1 
HETATM 6948 O  O     . HOH O 10 .   ? 78.569 90.005  57.147 1.00 21.51  ? 1013 HOH A O     1 
HETATM 6949 O  O     . HOH O 10 .   ? 55.532 83.058  53.401 1.00 19.22  ? 1014 HOH A O     1 
HETATM 6950 O  O     . HOH O 10 .   ? 70.289 85.547  48.753 1.00 20.75  ? 1015 HOH A O     1 
HETATM 6951 O  O     . HOH O 10 .   ? 66.621 85.277  51.748 1.00 24.61  ? 1016 HOH A O     1 
HETATM 6952 O  O     . HOH O 10 .   ? 82.606 87.717  62.167 1.00 31.26  ? 1019 HOH A O     1 
HETATM 6953 O  O     . HOH O 10 .   ? 57.701 69.151  52.036 1.00 23.43  ? 1020 HOH A O     1 
HETATM 6954 O  O     . HOH O 10 .   ? 52.680 74.565  57.092 1.00 23.62  ? 1022 HOH A O     1 
HETATM 6955 O  O     . HOH O 10 .   ? 51.552 76.796  51.363 1.00 19.66  ? 1024 HOH A O     1 
HETATM 6956 O  O     . HOH O 10 .   ? 34.302 98.000  51.178 1.00 20.24  ? 1025 HOH A O     1 
HETATM 6957 O  O     . HOH O 10 .   ? 65.279 83.476  35.372 1.00 22.96  ? 1026 HOH A O     1 
HETATM 6958 O  O     . HOH O 10 .   ? 62.576 89.430  44.978 1.00 26.09  ? 1027 HOH A O     1 
HETATM 6959 O  O     . HOH O 10 .   ? 65.506 80.647  80.502 1.00 18.29  ? 1028 HOH A O     1 
HETATM 6960 O  O     . HOH O 10 .   ? 71.656 82.661  55.334 1.00 20.65  ? 1029 HOH A O     1 
HETATM 6961 O  O     . HOH O 10 .   ? 61.176 77.795  47.643 1.00 22.15  ? 1030 HOH A O     1 
HETATM 6962 O  O     . HOH O 10 .   ? 65.746 93.140  56.804 1.00 17.33  ? 1031 HOH A O     1 
HETATM 6963 O  O     . HOH O 10 .   ? 69.166 82.701  78.902 1.00 25.70  ? 1032 HOH A O     1 
HETATM 6964 O  O     . HOH O 10 .   ? 29.198 95.747  49.616 1.00 34.18  ? 1033 HOH A O     1 
HETATM 6965 O  O     . HOH O 10 .   ? 71.048 103.153 37.085 1.00 30.56  ? 1034 HOH A O     1 
HETATM 6966 O  O     . HOH O 10 .   ? 56.471 66.567  69.839 1.00 30.86  ? 1035 HOH A O     1 
HETATM 6967 O  O     . HOH O 10 .   ? 58.777 80.245  56.107 1.00 21.36  ? 1036 HOH A O     1 
HETATM 6968 O  O     . HOH O 10 .   ? 69.882 85.585  26.251 1.00 33.06  ? 1037 HOH A O     1 
HETATM 6969 O  O     . HOH O 10 .   ? 38.726 89.019  59.244 1.00 27.71  ? 1038 HOH A O     1 
HETATM 6970 O  O     . HOH O 10 .   ? 63.228 94.532  33.036 1.00 33.40  ? 1040 HOH A O     1 
HETATM 6971 O  O     . HOH O 10 .   ? 47.096 96.775  43.502 1.00 28.50  ? 1041 HOH A O     1 
HETATM 6972 O  O     . HOH O 10 .   ? 47.371 94.175  44.804 1.00 20.89  ? 1042 HOH A O     1 
HETATM 6973 O  O     . HOH O 10 .   ? 61.426 88.503  79.445 1.00 30.31  ? 1043 HOH A O     1 
HETATM 6974 O  O     . HOH O 10 .   ? 49.849 101.555 47.401 1.00 26.75  ? 1044 HOH A O     1 
HETATM 6975 O  O     . HOH O 10 .   ? 56.938 69.641  54.865 1.00 22.05  ? 1045 HOH A O     1 
HETATM 6976 O  O     . HOH O 10 .   ? 58.496 93.686  36.839 1.00 26.85  ? 1046 HOH A O     1 
HETATM 6977 O  O     . HOH O 10 .   ? 62.853 93.828  59.716 1.00 27.69  ? 1048 HOH A O     1 
HETATM 6978 O  O     . HOH O 10 .   ? 54.690 65.122  67.990 1.00 24.11  ? 1049 HOH A O     1 
HETATM 6979 O  O     . HOH O 10 .   ? 67.945 71.755  57.980 1.00 22.49  ? 1050 HOH A O     1 
HETATM 6980 O  O     . HOH O 10 .   ? 67.882 86.779  29.073 1.00 31.65  ? 1051 HOH A O     1 
HETATM 6981 O  O     . HOH O 10 .   ? 70.682 82.983  39.373 1.00 23.60  ? 1052 HOH A O     1 
HETATM 6982 O  O     . HOH O 10 .   ? 63.264 76.562  45.764 1.00 36.26  ? 1053 HOH A O     1 
HETATM 6983 O  O     . HOH O 10 .   ? 77.274 84.666  45.457 1.00 24.77  ? 1054 HOH A O     1 
HETATM 6984 O  O     . HOH O 10 .   ? 58.273 85.361  81.238 1.00 26.79  ? 1055 HOH A O     1 
HETATM 6985 O  O     . HOH O 10 .   ? 60.951 75.847  53.722 1.00 23.61  ? 1056 HOH A O     1 
HETATM 6986 O  O     . HOH O 10 .   ? 88.467 98.951  55.789 1.00 31.28  ? 1058 HOH A O     1 
HETATM 6987 O  O     . HOH O 10 .   ? 90.584 98.643  51.693 1.00 31.80  ? 1059 HOH A O     1 
HETATM 6988 O  O     . HOH O 10 .   ? 45.158 87.779  69.662 1.00 34.62  ? 1060 HOH A O     1 
HETATM 6989 O  O     . HOH O 10 .   ? 51.309 64.176  54.645 1.00 24.14  ? 1061 HOH A O     1 
HETATM 6990 O  O     . HOH O 10 .   ? 55.520 77.509  49.044 1.00 20.65  ? 1062 HOH A O     1 
HETATM 6991 O  O     . HOH O 10 .   ? 72.446 83.652  62.159 1.00 31.05  ? 1063 HOH A O     1 
HETATM 6992 O  O     . HOH O 10 .   ? 62.591 78.782  43.813 1.00 22.15  ? 1065 HOH A O     1 
HETATM 6993 O  O     . HOH O 10 .   ? 75.825 101.480 57.354 1.00 36.67  ? 1066 HOH A O     1 
HETATM 6994 O  O     . HOH O 10 .   ? 73.830 88.847  57.661 1.00 26.60  ? 1067 HOH A O     1 
HETATM 6995 O  O     . HOH O 10 .   ? 45.062 97.015  67.566 1.00 32.03  ? 1068 HOH A O     1 
HETATM 6996 O  O     . HOH O 10 .   ? 94.773 89.809  53.497 1.00 40.00  ? 1069 HOH A O     1 
HETATM 6997 O  O     . HOH O 10 .   ? 66.789 97.541  51.833 1.00 27.80  ? 1070 HOH A O     1 
HETATM 6998 O  O     . HOH O 10 .   ? 63.945 79.839  78.038 1.00 24.12  ? 1071 HOH A O     1 
HETATM 6999 O  O     . HOH O 10 .   ? 68.219 84.040  38.167 1.00 32.14  ? 1072 HOH A O     1 
HETATM 7000 O  O     . HOH O 10 .   ? 69.483 79.465  73.052 1.00 26.13  ? 1073 HOH A O     1 
HETATM 7001 O  O     . HOH O 10 .   ? 48.219 63.080  65.625 1.00 29.31  ? 1074 HOH A O     1 
HETATM 7002 O  O     . HOH O 10 .   ? 57.140 91.806  40.163 1.00 27.19  ? 1075 HOH A O     1 
HETATM 7003 O  O     . HOH O 10 .   ? 43.852 91.329  58.467 1.00 26.95  ? 1076 HOH A O     1 
HETATM 7004 O  O     . HOH O 10 .   ? 44.561 83.425  46.939 1.00 21.32  ? 1078 HOH A O     1 
HETATM 7005 O  O     . HOH O 10 .   ? 54.315 83.882  34.954 1.00 30.00  ? 1079 HOH A O     1 
HETATM 7006 O  O     . HOH O 10 .   ? 64.136 78.389  48.173 1.00 28.84  ? 1080 HOH A O     1 
HETATM 7007 O  O     . HOH O 10 .   ? 50.098 93.910  45.853 1.00 32.15  ? 1081 HOH A O     1 
HETATM 7008 O  O     . HOH O 10 .   ? 62.178 82.793  41.685 1.00 23.44  ? 1082 HOH A O     1 
HETATM 7009 O  O     . HOH O 10 .   ? 52.011 103.860 58.968 1.00 31.92  ? 1083 HOH A O     1 
HETATM 7010 O  O     . HOH O 10 .   ? 36.015 89.222  60.393 1.00 32.42  ? 1084 HOH A O     1 
HETATM 7011 O  O     . HOH O 10 .   ? 81.106 78.808  40.550 1.00 37.30  ? 1085 HOH A O     1 
HETATM 7012 O  O     . HOH O 10 .   ? 58.259 100.437 52.495 1.00 29.39  ? 1087 HOH A O     1 
HETATM 7013 O  O     . HOH O 10 .   ? 44.866 37.641  41.445 1.00 38.78  ? 1088 HOH A O     1 
HETATM 7014 O  O     . HOH O 10 .   ? 72.357 78.340  61.487 1.00 30.98  ? 1089 HOH A O     1 
HETATM 7015 O  O     . HOH O 10 .   ? 53.936 79.638  47.504 1.00 23.24  ? 1090 HOH A O     1 
HETATM 7016 O  O     . HOH O 10 .   ? 62.691 78.919  57.146 1.00 22.45  ? 1092 HOH A O     1 
HETATM 7017 O  O     . HOH O 10 .   ? 68.136 86.789  36.785 1.00 25.63  ? 1093 HOH A O     1 
HETATM 7018 O  O     . HOH O 10 .   ? 51.126 56.383  47.501 1.00 32.28  ? 1094 HOH A O     1 
HETATM 7019 O  O     . HOH O 10 .   ? 70.286 88.001  57.193 1.00 25.34  ? 1098 HOH A O     1 
HETATM 7020 O  O     . HOH O 10 .   ? 66.552 83.314  27.913 1.00 30.62  ? 1099 HOH A O     1 
HETATM 7021 O  O     . HOH O 10 .   ? 71.104 82.568  66.655 1.00 24.85  ? 1100 HOH A O     1 
HETATM 7022 O  O     . HOH O 10 .   ? 75.509 103.419 43.591 1.00 37.90  ? 1101 HOH A O     1 
HETATM 7023 O  O     . HOH O 10 .   ? 63.297 101.376 47.489 1.00 25.94  ? 1103 HOH A O     1 
HETATM 7024 O  O     . HOH O 10 .   ? 40.280 101.905 58.236 1.00 42.58  ? 1104 HOH A O     1 
HETATM 7025 O  O     . HOH O 10 .   ? 78.671 86.617  41.604 1.00 29.33  ? 1105 HOH A O     1 
HETATM 7026 O  O     . HOH O 10 .   ? 48.969 89.302  67.298 1.00 21.43  ? 1106 HOH A O     1 
HETATM 7027 O  O     . HOH O 10 .   ? 82.938 102.395 45.309 1.00 33.74  ? 1107 HOH A O     1 
HETATM 7028 O  O     . HOH O 10 .   ? 85.847 93.819  60.861 1.00 30.46  ? 1108 HOH A O     1 
HETATM 7029 O  O     . HOH O 10 .   ? 68.797 104.705 35.797 1.00 43.40  ? 1109 HOH A O     1 
HETATM 7030 O  O     . HOH O 10 .   ? 65.141 113.632 44.941 1.00 47.82  ? 1111 HOH A O     1 
HETATM 7031 O  O     . HOH O 10 .   ? 77.652 81.334  44.556 1.00 25.41  ? 1113 HOH A O     1 
HETATM 7032 O  O     . HOH O 10 .   ? 42.808 38.984  59.341 1.00 49.55  ? 1114 HOH A O     1 
HETATM 7033 O  O     . HOH O 10 .   ? 58.278 79.610  41.590 1.00 29.49  ? 1115 HOH A O     1 
HETATM 7034 O  O     . HOH O 10 .   ? 68.570 91.678  66.684 1.00 30.96  ? 1116 HOH A O     1 
HETATM 7035 O  O     . HOH O 10 .   ? 68.675 80.143  37.296 1.00 30.66  ? 1117 HOH A O     1 
HETATM 7036 O  O     . HOH O 10 .   ? 68.523 76.451  55.002 1.00 35.22  ? 1119 HOH A O     1 
HETATM 7037 O  O     . HOH O 10 .   ? 91.722 78.422  51.092 1.00 39.17  ? 1120 HOH A O     1 
HETATM 7038 O  O     . HOH O 10 .   ? 47.033 99.591  44.658 1.00 32.57  ? 1122 HOH A O     1 
HETATM 7039 O  O     . HOH O 10 .   ? 32.179 89.438  59.765 1.00 29.64  ? 1123 HOH A O     1 
HETATM 7040 O  O     . HOH O 10 .   ? 73.867 90.462  48.760 1.00 24.11  ? 1124 HOH A O     1 
HETATM 7041 O  O     . HOH O 10 .   ? 52.733 86.256  51.903 1.00 27.27  ? 1125 HOH A O     1 
HETATM 7042 O  O     . HOH O 10 .   ? 89.169 96.224  45.635 1.00 29.90  ? 1126 HOH A O     1 
HETATM 7043 O  O     . HOH O 10 .   ? 72.293 88.605  55.100 1.00 30.06  ? 1127 HOH A O     1 
HETATM 7044 O  O     . HOH O 10 .   ? 45.517 98.201  41.160 1.00 34.47  ? 1128 HOH A O     1 
HETATM 7045 O  O     . HOH O 10 .   ? 69.288 66.251  65.597 1.00 37.38  ? 1129 HOH A O     1 
HETATM 7046 O  O     . HOH O 10 .   ? 75.934 91.037  57.931 1.00 26.62  ? 1130 HOH A O     1 
HETATM 7047 O  O     . HOH O 10 .   ? 65.725 85.092  39.419 1.00 38.06  ? 1131 HOH A O     1 
HETATM 7048 O  O     . HOH O 10 .   ? 67.904 72.185  72.075 1.00 32.76  ? 1132 HOH A O     1 
HETATM 7049 O  O     . HOH O 10 .   ? 62.286 78.000  40.769 1.00 39.21  ? 1133 HOH A O     1 
HETATM 7050 O  O     . HOH O 10 .   ? 80.310 96.708  58.268 1.00 38.85  ? 1134 HOH A O     1 
HETATM 7051 O  O     . HOH O 10 .   ? 62.647 100.260 30.986 1.00 38.86  ? 1135 HOH A O     1 
HETATM 7052 O  O     . HOH O 10 .   ? 49.281 86.555  38.736 1.00 30.02  ? 1137 HOH A O     1 
HETATM 7053 O  O     . HOH O 10 .   ? 70.451 79.959  54.629 1.00 30.99  ? 1138 HOH A O     1 
HETATM 7054 O  O     . HOH O 10 .   ? 59.497 98.287  32.906 1.00 36.18  ? 1140 HOH A O     1 
HETATM 7055 O  O     . HOH O 10 .   ? 70.345 82.144  63.572 1.00 28.27  ? 1142 HOH A O     1 
HETATM 7056 O  O     . HOH O 10 .   ? 80.196 104.031 42.676 1.00 37.92  ? 1143 HOH A O     1 
HETATM 7057 O  O     . HOH O 10 .   ? 45.241 100.281 46.904 1.00 32.82  ? 1144 HOH A O     1 
HETATM 7058 O  O     . HOH O 10 .   ? 39.492 99.421  43.379 1.00 37.36  ? 1146 HOH A O     1 
HETATM 7059 O  O     . HOH O 10 .   ? 67.967 78.185  48.900 1.00 33.64  ? 1147 HOH A O     1 
HETATM 7060 O  O     . HOH O 10 .   ? 78.612 71.875  51.755 1.00 39.20  ? 1149 HOH A O     1 
HETATM 7061 O  O     . HOH O 10 .   ? 42.951 58.856  51.611 1.00 40.94  ? 1150 HOH A O     1 
HETATM 7062 O  O     . HOH O 10 .   ? 49.212 95.702  70.109 1.00 47.26  ? 1151 HOH A O     1 
HETATM 7063 O  O     . HOH O 10 .   ? 76.133 87.746  59.175 1.00 30.56  ? 1152 HOH A O     1 
HETATM 7064 O  O     . HOH O 10 .   ? 54.005 83.846  50.808 1.00 25.28  ? 1153 HOH A O     1 
HETATM 7065 O  O     . HOH O 10 .   ? 49.064 81.098  64.094 1.00 26.16  ? 1154 HOH A O     1 
HETATM 7066 O  O     . HOH O 10 .   ? 69.817 82.181  75.108 1.00 37.37  ? 1155 HOH A O     1 
HETATM 7067 O  O     . HOH O 10 .   ? 86.979 98.161  46.330 1.00 32.94  ? 1157 HOH A O     1 
HETATM 7068 O  O     . HOH O 10 .   ? 44.685 98.650  59.474 1.00 39.86  ? 1158 HOH A O     1 
HETATM 7069 O  O     . HOH O 10 .   ? 64.564 95.517  57.844 1.00 26.50  ? 1159 HOH A O     1 
HETATM 7070 O  O     . HOH O 10 .   ? 70.996 78.209  36.569 1.00 35.26  ? 1160 HOH A O     1 
HETATM 7071 O  O     . HOH O 10 .   ? 75.455 81.498  46.407 1.00 24.86  ? 1161 HOH A O     1 
HETATM 7072 O  O     . HOH O 10 .   ? 51.215 80.505  47.761 1.00 27.53  ? 1162 HOH A O     1 
HETATM 7073 O  O     . HOH O 10 .   ? 39.141 42.187  42.200 1.00 38.69  ? 1163 HOH A O     1 
HETATM 7074 O  O     . HOH O 10 .   ? 59.423 95.060  34.242 1.00 31.72  ? 1164 HOH A O     1 
HETATM 7075 O  O     . HOH O 10 .   ? 89.652 98.937  42.304 1.00 31.92  ? 1167 HOH A O     1 
HETATM 7076 O  O     . HOH O 10 .   ? 72.170 95.022  59.520 1.00 38.04  ? 1168 HOH A O     1 
HETATM 7077 O  O     . HOH O 10 .   ? 55.631 49.608  56.477 1.00 35.46  ? 1169 HOH A O     1 
HETATM 7078 O  O     . HOH O 10 .   ? 47.961 97.878  67.902 1.00 47.53  ? 1170 HOH A O     1 
HETATM 7079 O  O     . HOH O 10 .   ? 82.309 59.893  31.937 1.00 55.61  ? 1172 HOH A O     1 
HETATM 7080 O  O     . HOH O 10 .   ? 57.910 103.994 45.183 1.00 25.25  ? 1173 HOH A O     1 
HETATM 7081 O  O     . HOH O 10 .   ? 67.133 89.724  60.463 1.00 25.33  ? 1174 HOH A O     1 
HETATM 7082 O  O     . HOH O 10 .   ? 74.570 77.595  51.759 1.00 31.68  ? 1175 HOH A O     1 
HETATM 7083 O  O     . HOH O 10 .   ? 92.050 95.895  48.612 1.00 37.52  ? 1176 HOH A O     1 
HETATM 7084 O  O     . HOH O 10 .   ? 48.209 74.532  64.209 1.00 32.31  ? 1177 HOH A O     1 
HETATM 7085 O  O     . HOH O 10 .   ? 68.431 64.450  59.063 1.00 40.41  ? 1178 HOH A O     1 
HETATM 7086 O  O     . HOH O 10 .   ? 67.826 96.497  58.609 1.00 40.31  ? 1180 HOH A O     1 
HETATM 7087 O  O     . HOH O 10 .   ? 71.610 100.412 33.352 1.00 36.80  ? 1181 HOH A O     1 
HETATM 7088 O  O     . HOH O 10 .   ? 81.493 75.404  59.613 1.00 50.57  ? 1182 HOH A O     1 
HETATM 7089 O  O     . HOH O 10 .   ? 94.343 87.621  55.550 1.00 32.31  ? 1184 HOH A O     1 
HETATM 7090 O  O     . HOH O 10 .   ? 56.584 101.047 33.673 1.00 44.01  ? 1185 HOH A O     1 
HETATM 7091 O  O     . HOH O 10 .   ? 53.939 97.636  29.763 1.00 55.56  ? 1187 HOH A O     1 
HETATM 7092 O  O     . HOH O 10 .   ? 58.585 104.847 48.104 1.00 53.19  ? 1188 HOH A O     1 
HETATM 7093 O  O     . HOH O 10 .   ? 48.220 86.341  49.702 1.00 39.48  ? 1191 HOH A O     1 
HETATM 7094 O  O     . HOH O 10 .   ? 53.993 43.875  25.393 1.00 52.29  ? 1192 HOH A O     1 
HETATM 7095 O  O     . HOH O 10 .   ? 77.619 106.484 56.222 1.00 46.37  ? 1193 HOH A O     1 
HETATM 7096 O  O     . HOH O 10 .   ? 86.959 103.276 45.311 1.00 63.46  ? 1194 HOH A O     1 
HETATM 7097 O  O     . HOH O 10 .   ? 56.497 90.148  42.524 1.00 28.11  ? 1195 HOH A O     1 
HETATM 7098 O  O     . HOH O 10 .   ? 54.426 77.149  76.204 1.00 38.78  ? 1196 HOH A O     1 
HETATM 7099 O  O     . HOH O 10 .   ? 28.033 94.962  37.566 1.00 45.90  ? 1197 HOH A O     1 
HETATM 7100 O  O     . HOH O 10 .   ? 61.761 55.660  63.431 1.00 37.50  ? 1198 HOH A O     1 
HETATM 7101 O  O     . HOH O 10 .   ? 77.961 103.748 46.292 1.00 36.92  ? 1200 HOH A O     1 
HETATM 7102 O  O     . HOH O 10 .   ? 42.267 62.536  50.661 1.00 58.65  ? 1201 HOH A O     1 
HETATM 7103 O  O     . HOH O 10 .   ? 59.796 106.569 43.798 1.00 64.31  ? 1202 HOH A O     1 
HETATM 7104 O  O     . HOH O 10 .   ? 62.017 68.000  72.579 1.00 44.01  ? 1204 HOH A O     1 
HETATM 7105 O  O     . HOH O 10 .   ? 52.656 43.560  55.299 1.00 39.57  ? 1208 HOH A O     1 
HETATM 7106 O  O     . HOH O 10 .   ? 80.544 71.922  42.278 1.00 36.11  ? 1209 HOH A O     1 
HETATM 7107 O  O     . HOH O 10 .   ? 89.180 100.315 44.910 1.00 39.96  ? 1210 HOH A O     1 
HETATM 7108 O  O     . HOH O 10 .   ? 66.529 101.714 29.889 1.00 48.57  ? 1212 HOH A O     1 
HETATM 7109 O  O     . HOH O 10 .   ? 49.814 86.214  52.087 1.00 31.85  ? 1218 HOH A O     1 
HETATM 7110 O  O     . HOH O 10 .   ? 77.297 103.280 55.420 1.00 35.44  ? 1219 HOH A O     1 
HETATM 7111 O  O     . HOH O 10 .   ? 68.249 93.941  62.889 1.00 48.74  ? 1220 HOH A O     1 
HETATM 7112 O  O     . HOH O 10 .   ? 50.681 100.753 64.913 1.00 33.27  ? 1221 HOH A O     1 
HETATM 7113 O  O     . HOH O 10 .   ? 51.896 94.365  28.645 1.00 41.19  ? 1222 HOH A O     1 
HETATM 7114 O  O     . HOH O 10 .   ? 65.972 92.245  59.583 1.00 31.83  ? 1223 HOH A O     1 
HETATM 7115 O  O     . HOH O 10 .   ? 24.193 80.719  40.390 1.00 59.44  ? 1224 HOH A O     1 
HETATM 7116 O  O     . HOH O 10 .   ? 97.562 82.753  48.822 1.00 46.20  ? 1226 HOH A O     1 
HETATM 7117 O  O     . HOH O 10 .   ? 87.275 92.196  65.345 1.00 39.48  ? 1227 HOH A O     1 
HETATM 7118 O  O     . HOH O 10 .   ? 72.536 81.356  74.306 1.00 42.08  ? 1230 HOH A O     1 
HETATM 7119 O  O     . HOH O 10 .   ? 59.998 63.345  72.198 1.00 47.84  ? 1231 HOH A O     1 
HETATM 7120 O  O     . HOH O 10 .   ? 89.370 102.135 50.892 1.00 54.21  ? 1232 HOH A O     1 
HETATM 7121 O  O     . HOH O 10 .   ? 45.153 60.937  51.058 1.00 41.00  ? 1233 HOH A O     1 
HETATM 7122 O  O     . HOH O 10 .   ? 57.765 63.570  75.156 1.00 57.99  ? 1234 HOH A O     1 
HETATM 7123 O  O     . HOH O 10 .   ? 42.802 57.262  60.540 1.00 47.57  ? 1236 HOH A O     1 
HETATM 7124 O  O     . HOH O 10 .   ? 77.433 70.864  41.434 1.00 45.16  ? 1240 HOH A O     1 
HETATM 7125 O  O     . HOH O 10 .   ? 58.437 80.827  79.813 1.00 39.51  ? 1244 HOH A O     1 
HETATM 7126 O  O     . HOH O 10 .   ? 80.252 92.653  32.921 1.00 27.28  ? 1245 HOH A O     1 
HETATM 7127 O  O     . HOH O 10 .   ? 75.455 74.720  39.422 1.00 31.81  ? 1246 HOH A O     1 
HETATM 7128 O  O     . HOH O 10 .   ? 44.206 80.916  59.855 1.00 39.75  ? 1249 HOH A O     1 
HETATM 7129 O  O     . HOH O 10 .   ? 71.750 79.752  64.453 1.00 47.35  ? 1250 HOH A O     1 
HETATM 7130 O  O     . HOH O 10 .   ? 80.375 87.675  29.972 1.00 48.84  ? 1253 HOH A O     1 
HETATM 7131 O  O     . HOH O 10 .   ? 81.112 86.621  64.629 1.00 36.19  ? 1254 HOH A O     1 
HETATM 7132 O  O     . HOH O 10 .   ? 38.168 72.437  53.558 1.00 54.31  ? 1255 HOH A O     1 
HETATM 7133 O  O     . HOH O 10 .   ? 67.816 91.978  75.056 1.00 33.71  ? 1256 HOH A O     1 
HETATM 7134 O  O     . HOH O 10 .   ? 92.593 98.599  42.044 1.00 39.04  ? 1257 HOH A O     1 
HETATM 7135 O  O     . HOH O 10 .   ? 59.061 69.750  43.346 1.00 61.66  ? 1258 HOH A O     1 
HETATM 7136 O  O     . HOH O 10 .   ? 77.173 83.448  59.539 1.00 31.99  ? 1261 HOH A O     1 
HETATM 7137 O  O     . HOH O 10 .   ? 84.930 107.224 55.545 1.00 59.38  ? 1262 HOH A O     1 
HETATM 7138 O  O     . HOH O 10 .   ? 67.287 66.026  49.128 1.00 62.36  ? 1263 HOH A O     1 
HETATM 7139 O  O     . HOH O 10 .   ? 90.085 71.312  45.219 1.00 39.11  ? 1264 HOH A O     1 
HETATM 7140 O  O     . HOH O 10 .   ? 48.534 40.564  46.038 1.00 46.46  ? 1267 HOH A O     1 
HETATM 7141 O  O     . HOH O 10 .   ? 66.066 85.680  46.510 1.00 21.84  ? 1268 HOH A O     1 
HETATM 7142 O  O     . HOH O 10 .   ? 47.300 101.584 48.728 1.00 36.66  ? 1269 HOH A O     1 
HETATM 7143 O  O     . HOH O 10 .   ? 66.093 72.156  68.720 1.00 30.80  ? 1270 HOH A O     1 
HETATM 7144 O  O     . HOH O 10 .   ? 36.598 102.258 53.966 1.00 47.44  ? 1271 HOH A O     1 
HETATM 7145 O  O     . HOH O 10 .   ? 40.026 90.019  34.306 1.00 36.34  ? 1272 HOH A O     1 
HETATM 7146 O  O     . HOH O 10 .   ? 33.907 90.525  34.698 1.00 44.10  ? 1274 HOH A O     1 
HETATM 7147 O  O     . HOH O 10 .   ? 59.786 85.294  41.269 1.00 48.53  ? 1275 HOH A O     1 
HETATM 7148 O  O     . HOH O 10 .   ? 34.033 57.441  39.011 1.00 50.51  ? 1276 HOH A O     1 
HETATM 7149 O  O     . HOH O 10 .   ? 78.366 103.084 35.678 1.00 52.11  ? 1277 HOH A O     1 
HETATM 7150 O  O     . HOH O 10 .   ? 46.618 98.154  38.252 1.00 40.17  ? 1279 HOH A O     1 
HETATM 7151 O  O     . HOH O 10 .   ? 38.019 90.366  36.565 1.00 47.53  ? 1280 HOH A O     1 
HETATM 7152 O  O     . HOH O 10 .   ? 92.946 95.940  39.561 1.00 43.11  ? 1281 HOH A O     1 
HETATM 7153 O  O     . HOH O 10 .   ? 56.241 91.016  34.609 1.00 62.01  ? 1282 HOH A O     1 
HETATM 7154 O  O     . HOH O 10 .   ? 73.416 72.181  62.560 1.00 39.38  ? 1284 HOH A O     1 
HETATM 7155 O  O     . HOH O 10 .   ? 69.309 80.719  40.481 1.00 30.65  ? 1285 HOH A O     1 
HETATM 7156 O  O     . HOH O 10 .   ? 44.462 36.962  9.956  1.00 45.50  ? 1286 HOH A O     1 
HETATM 7157 O  O     . HOH O 10 .   ? 63.809 87.412  46.717 1.00 26.04  ? 1287 HOH A O     1 
HETATM 7158 O  O     . HOH O 10 .   ? 69.248 81.293  47.361 1.00 34.06  ? 1288 HOH A O     1 
HETATM 7159 O  O     . HOH O 10 .   ? 82.520 100.621 57.991 1.00 48.55  ? 1289 HOH A O     1 
HETATM 7160 O  O     . HOH O 10 .   ? 57.009 33.058  39.188 1.00 47.99  ? 1290 HOH A O     1 
HETATM 7161 O  O     . HOH O 10 .   ? 46.715 85.594  36.725 1.00 32.85  ? 1291 HOH A O     1 
HETATM 7162 O  O     . HOH O 10 .   ? 38.490 97.783  65.882 1.00 48.00  ? 1293 HOH A O     1 
HETATM 7163 O  O     . HOH O 10 .   ? 60.427 99.634  56.784 1.00 52.40  ? 1295 HOH A O     1 
HETATM 7164 O  O     . HOH O 10 .   ? 61.779 102.927 49.515 1.00 39.40  ? 1296 HOH A O     1 
HETATM 7165 O  O     . HOH O 10 .   ? 55.686 85.906  30.609 1.00 40.24  ? 1297 HOH A O     1 
HETATM 7166 O  O     . HOH O 10 .   ? 73.986 94.538  30.897 1.00 37.28  ? 1298 HOH A O     1 
HETATM 7167 O  O     . HOH O 10 .   ? 29.560 87.908  50.107 1.00 54.41  ? 1299 HOH A O     1 
HETATM 7168 O  O     . HOH O 10 .   ? 34.697 75.169  62.754 1.00 44.67  ? 1300 HOH A O     1 
HETATM 7169 O  O     . HOH O 10 .   ? 50.879 43.584  59.868 1.00 38.81  ? 1301 HOH A O     1 
HETATM 7170 O  O     . HOH O 10 .   ? 75.157 85.269  60.461 1.00 32.03  ? 1303 HOH A O     1 
HETATM 7171 O  O     . HOH O 10 .   ? 70.741 67.816  57.480 1.00 52.29  ? 1304 HOH A O     1 
HETATM 7172 O  O     . HOH O 10 .   ? 92.851 87.498  38.707 1.00 45.01  ? 1305 HOH A O     1 
HETATM 7173 O  O     . HOH O 10 .   ? 67.324 101.870 54.882 1.00 63.32  ? 1308 HOH A O     1 
HETATM 7174 O  O     . HOH O 10 .   ? 77.442 83.953  29.914 1.00 57.22  ? 1309 HOH A O     1 
HETATM 7175 O  O     . HOH O 10 .   ? 60.783 28.007  23.439 1.00 45.15  ? 1310 HOH A O     1 
HETATM 7176 O  O     . HOH O 10 .   ? 77.002 85.823  63.932 1.00 55.68  ? 1311 HOH A O     1 
HETATM 7177 O  O     . HOH O 10 .   ? 36.845 56.902  37.877 1.00 46.22  ? 1312 HOH A O     1 
HETATM 7178 O  O     . HOH O 10 .   ? 99.011 85.680  41.424 1.00 44.13  ? 1313 HOH A O     1 
HETATM 7179 O  O     . HOH O 10 .   ? 81.084 95.449  62.768 1.00 48.96  ? 1314 HOH A O     1 
HETATM 7180 O  O     . HOH O 10 .   ? 45.057 80.045  62.697 1.00 45.46  ? 1315 HOH A O     1 
HETATM 7181 O  O     . HOH O 10 .   ? 37.145 98.200  57.957 1.00 32.39  ? 1316 HOH A O     1 
HETATM 7182 O  O     . HOH O 10 .   ? 67.921 95.384  69.538 1.00 37.15  ? 1317 HOH A O     1 
HETATM 7183 O  O     . HOH O 10 .   ? 87.411 89.389  67.818 1.00 61.62  ? 1318 HOH A O     1 
HETATM 7184 O  O     . HOH O 10 .   ? 38.893 91.671  63.522 1.00 36.08  ? 1319 HOH A O     1 
HETATM 7185 O  O     . HOH O 10 .   ? 90.731 90.501  38.944 1.00 37.34  ? 1320 HOH A O     1 
HETATM 7186 O  O     . HOH O 10 .   ? 76.253 78.077  41.088 1.00 36.48  ? 1321 HOH A O     1 
HETATM 7187 O  O     . HOH O 10 .   ? 68.275 94.002  59.987 1.00 34.83  ? 1322 HOH A O     1 
HETATM 7188 O  O     . HOH O 10 .   ? 75.683 107.269 51.567 1.00 34.27  ? 1323 HOH A O     1 
HETATM 7189 O  O     . HOH O 10 .   ? 91.777 79.636  62.861 1.00 49.13  ? 1326 HOH A O     1 
HETATM 7190 O  O     . HOH O 10 .   ? 60.274 77.743  56.041 1.00 24.98  ? 1328 HOH A O     1 
HETATM 7191 O  O     . HOH O 10 .   ? 34.041 40.319  43.759 1.00 51.37  ? 1329 HOH A O     1 
HETATM 7192 O  O     . HOH O 10 .   ? 69.365 70.230  33.803 1.00 66.37  ? 1330 HOH A O     1 
HETATM 7193 O  O     . HOH O 10 .   ? 67.394 85.771  49.119 1.00 23.76  ? 1331 HOH A O     1 
HETATM 7194 O  O     . HOH O 10 .   ? 67.840 82.527  35.670 1.00 29.86  ? 1332 HOH A O     1 
HETATM 7195 O  O     . HOH O 10 .   ? 49.337 80.537  57.320 1.00 30.21  ? 1333 HOH A O     1 
HETATM 7196 O  O     . HOH O 10 .   ? 58.654 82.635  82.277 1.00 53.20  ? 1335 HOH A O     1 
HETATM 7197 O  O     . HOH O 10 .   ? 67.480 91.472  63.920 1.00 35.68  ? 1338 HOH A O     1 
HETATM 7198 O  O     . HOH O 10 .   ? 66.099 80.612  47.636 1.00 28.54  ? 1340 HOH A O     1 
HETATM 7199 O  O     . HOH O 10 .   ? 92.838 92.741  57.028 1.00 43.44  ? 1341 HOH A O     1 
HETATM 7200 O  O     . HOH O 10 .   ? 54.209 104.731 56.875 1.00 34.78  ? 1343 HOH A O     1 
HETATM 7201 O  O     . HOH O 10 .   ? 92.200 95.989  51.706 1.00 46.92  ? 1344 HOH A O     1 
HETATM 7202 O  O     . HOH O 10 .   ? 47.459 73.140  61.789 1.00 26.47  ? 1345 HOH A O     1 
HETATM 7203 O  O     . HOH O 10 .   ? 66.887 73.470  53.347 1.00 32.80  ? 1346 HOH A O     1 
HETATM 7204 O  O     . HOH O 10 .   ? 60.793 101.900 52.050 1.00 63.95  ? 1347 HOH A O     1 
HETATM 7205 O  O     . HOH O 10 .   ? 84.946 87.738  68.415 1.00 45.36  ? 1349 HOH A O     1 
HETATM 7206 O  O     . HOH O 10 .   ? 50.389 48.475  36.584 1.00 45.90  ? 1351 HOH A O     1 
HETATM 7207 O  O     . HOH O 10 .   ? 55.340 68.072  72.144 1.00 39.47  ? 1352 HOH A O     1 
HETATM 7208 O  O     . HOH O 10 .   ? 46.820 90.026  68.969 1.00 47.22  ? 1353 HOH A O     1 
HETATM 7209 O  O     . HOH O 10 .   ? 38.944 36.096  51.751 1.00 38.58  ? 1354 HOH A O     1 
HETATM 7210 O  O     . HOH O 10 .   ? 86.798 99.375  49.116 1.00 28.25  ? 1356 HOH A O     1 
HETATM 7211 O  O     . HOH O 10 .   ? 88.417 97.474  58.272 1.00 44.07  ? 1357 HOH A O     1 
HETATM 7212 O  O     . HOH O 10 .   ? 70.983 92.423  60.596 1.00 36.05  ? 1358 HOH A O     1 
HETATM 7213 O  O     . HOH O 10 .   ? 49.605 102.231 36.563 1.00 49.13  ? 1359 HOH A O     1 
HETATM 7214 O  O     . HOH O 10 .   ? 81.724 94.578  59.840 1.00 38.23  ? 1361 HOH A O     1 
HETATM 7215 O  O     . HOH O 10 .   ? 72.188 89.453  60.067 1.00 39.29  ? 1362 HOH A O     1 
HETATM 7216 O  O     . HOH O 10 .   ? 80.015 91.507  30.085 1.00 45.02  ? 1363 HOH A O     1 
HETATM 7217 O  O     . HOH O 10 .   ? 90.804 100.003 54.314 1.00 64.11  ? 1364 HOH A O     1 
HETATM 7218 O  O     . HOH O 10 .   ? 79.150 105.387 58.955 1.00 63.79  ? 1365 HOH A O     1 
HETATM 7219 O  O     . HOH O 10 .   ? 28.444 95.279  46.850 1.00 44.79  ? 1366 HOH A O     1 
HETATM 7220 O  O     . HOH O 10 .   ? 45.405 97.932  23.690 1.00 47.55  ? 1368 HOH A O     1 
HETATM 7221 O  O     . HOH O 10 .   ? 73.620 78.428  58.679 1.00 49.99  ? 1369 HOH A O     1 
HETATM 7222 O  O     . HOH O 10 .   ? 57.704 82.054  33.049 1.00 53.83  ? 1371 HOH A O     1 
HETATM 7223 O  O     . HOH O 10 .   ? 46.138 84.886  40.304 1.00 36.48  ? 1374 HOH A O     1 
HETATM 7224 O  O     . HOH O 10 .   ? 49.570 53.267  38.573 1.00 50.53  ? 1375 HOH A O     1 
HETATM 7225 O  O     . HOH O 10 .   ? 49.447 56.943  44.931 1.00 36.65  ? 1376 HOH A O     1 
HETATM 7226 O  O     . HOH O 10 .   ? 72.699 79.822  52.355 1.00 39.11  ? 1378 HOH A O     1 
HETATM 7227 O  O     . HOH O 10 .   ? 71.813 74.299  80.879 1.00 46.42  ? 1379 HOH A O     1 
HETATM 7228 O  O     . HOH O 10 .   ? 73.386 110.342 39.579 1.00 44.85  ? 1381 HOH A O     1 
HETATM 7229 O  O     . HOH O 10 .   ? 79.309 95.294  32.513 1.00 48.11  ? 1382 HOH A O     1 
HETATM 7230 O  O     . HOH O 10 .   ? 32.374 56.940  42.593 1.00 46.93  ? 1383 HOH A O     1 
HETATM 7231 O  O     . HOH O 10 .   ? 68.558 60.790  54.157 1.00 43.60  ? 1384 HOH A O     1 
HETATM 7232 O  O     . HOH O 10 .   ? 75.868 89.664  61.363 1.00 34.68  ? 1385 HOH A O     1 
HETATM 7233 O  O     . HOH O 10 .   ? 35.600 82.853  28.164 1.00 48.73  ? 1386 HOH A O     1 
HETATM 7234 O  O     . HOH O 10 .   ? 26.013 86.299  53.449 1.00 60.04  ? 1388 HOH A O     1 
HETATM 7235 O  O     . HOH O 10 .   ? 66.590 102.925 34.834 1.00 36.67  ? 1389 HOH A O     1 
HETATM 7236 O  O     . HOH O 10 .   ? 27.506 85.517  56.174 1.00 51.89  ? 1390 HOH A O     1 
HETATM 7237 O  O     . HOH O 10 .   ? 46.416 47.884  62.817 1.00 39.31  ? 1391 HOH A O     1 
HETATM 7238 O  O     . HOH O 10 .   ? 43.884 71.702  60.576 1.00 47.96  ? 1392 HOH A O     1 
HETATM 7239 O  O     . HOH O 10 .   ? 54.130 78.133  38.848 1.00 36.54  ? 1393 HOH A O     1 
HETATM 7240 O  O     . HOH O 10 .   ? 45.725 101.110 60.823 1.00 46.32  ? 1396 HOH A O     1 
HETATM 7241 O  O     . HOH O 10 .   ? 36.833 86.444  40.060 1.00 44.48  ? 1398 HOH A O     1 
HETATM 7242 O  O     . HOH O 10 .   ? 66.127 94.007  33.189 1.00 55.97  ? 1399 HOH A O     1 
HETATM 7243 O  O     . HOH O 10 .   ? 74.263 100.992 34.575 1.00 42.29  ? 1400 HOH A O     1 
HETATM 7244 O  O     . HOH O 10 .   ? 77.784 101.150 59.769 1.00 38.81  ? 1401 HOH A O     1 
HETATM 7245 O  O     . HOH O 10 .   ? 76.727 95.873  31.071 1.00 58.15  ? 1405 HOH A O     1 
HETATM 7246 O  O     . HOH O 10 .   ? 79.996 83.517  31.596 1.00 49.66  ? 1406 HOH A O     1 
HETATM 7247 O  O     . HOH O 10 .   ? 93.748 91.484  40.938 1.00 42.12  ? 1407 HOH A O     1 
HETATM 7248 O  O     . HOH O 10 .   ? 87.945 90.873  33.940 1.00 43.76  ? 1411 HOH A O     1 
HETATM 7249 O  O     . HOH O 10 .   ? 32.553 81.474  41.746 1.00 37.96  ? 1412 HOH A O     1 
HETATM 7250 O  O     . HOH O 10 .   ? 68.732 104.962 53.746 1.00 47.25  ? 1413 HOH A O     1 
HETATM 7251 O  O     . HOH O 10 .   ? 74.165 81.291  62.189 1.00 47.86  ? 1414 HOH A O     1 
HETATM 7252 O  O     . HOH O 10 .   ? 77.685 81.792  40.422 1.00 37.95  ? 1415 HOH A O     1 
HETATM 7253 O  O     . HOH O 10 .   ? 86.376 80.408  33.215 1.00 52.21  ? 1416 HOH A O     1 
HETATM 7254 O  O     . HOH O 10 .   ? 72.284 79.919  49.331 1.00 34.11  ? 1418 HOH A O     1 
HETATM 7255 O  O     . HOH O 10 .   ? 61.569 104.897 47.167 1.00 72.45  ? 1419 HOH A O     1 
HETATM 7256 O  O     . HOH O 10 .   ? 41.168 98.017  41.158 1.00 50.48  ? 1420 HOH A O     1 
HETATM 7257 O  O     . HOH O 10 .   ? 43.657 40.603  38.908 1.00 39.79  ? 1424 HOH A O     1 
HETATM 7258 O  O     . HOH O 10 .   ? 39.229 50.966  32.226 1.00 45.24  ? 1425 HOH A O     1 
HETATM 7259 O  O     . HOH O 10 .   ? 44.293 59.441  63.101 1.00 50.79  ? 1426 HOH A O     1 
HETATM 7260 O  O     . HOH O 10 .   ? 72.260 85.409  66.450 1.00 48.12  ? 1428 HOH A O     1 
HETATM 7261 O  O     . HOH O 10 .   ? 72.517 86.885  26.436 1.00 49.90  ? 1429 HOH A O     1 
HETATM 7262 O  O     . HOH O 10 .   ? 67.530 73.891  82.991 1.00 29.51  ? 1430 HOH A O     1 
HETATM 7263 O  O     . HOH O 10 .   ? 48.748 109.483 53.228 1.00 59.85  ? 1431 HOH A O     1 
HETATM 7264 O  O     . HOH O 10 .   ? 44.482 84.907  61.844 1.00 41.80  ? 1433 HOH A O     1 
HETATM 7265 O  O     . HOH O 10 .   ? 37.175 48.234  55.857 1.00 38.90  ? 1434 HOH A O     1 
HETATM 7266 O  O     . HOH O 10 .   ? 40.353 85.358  40.004 1.00 37.03  ? 1435 HOH A O     1 
HETATM 7267 O  O     . HOH O 10 .   ? 37.716 80.036  25.744 1.00 46.50  ? 1437 HOH A O     1 
HETATM 7268 O  O     . HOH O 10 .   ? 79.127 106.554 47.596 1.00 51.53  ? 1438 HOH A O     1 
HETATM 7269 O  O     . HOH O 10 .   ? 46.891 82.876  65.493 1.00 46.38  ? 1439 HOH A O     1 
HETATM 7270 O  O     . HOH O 10 .   ? 63.742 111.661 47.308 1.00 60.12  ? 1440 HOH A O     1 
HETATM 7271 O  O     . HOH O 10 .   ? 98.961 85.307  47.084 1.00 53.15  ? 1441 HOH A O     1 
HETATM 7272 O  O     . HOH O 10 .   ? 60.813 75.581  41.439 1.00 38.15  ? 1444 HOH A O     1 
HETATM 7273 O  O     . HOH O 10 .   ? 32.447 105.263 46.156 1.00 47.52  ? 1445 HOH A O     1 
HETATM 7274 O  O     . HOH O 10 .   ? 59.951 46.882  39.406 1.00 54.48  ? 1447 HOH A O     1 
HETATM 7275 O  O     . HOH O 10 .   ? 60.345 87.309  82.128 1.00 38.44  ? 1449 HOH A O     1 
HETATM 7276 O  O     . HOH O 10 .   ? 70.120 89.299  28.532 1.00 51.53  ? 1450 HOH A O     1 
HETATM 7277 O  O     . HOH O 10 .   ? 55.285 44.904  54.655 1.00 48.21  ? 1452 HOH A O     1 
HETATM 7278 O  O     . HOH O 10 .   ? 46.389 93.966  71.768 1.00 70.98  ? 1453 HOH A O     1 
HETATM 7279 O  O     . HOH O 10 .   ? 41.697 37.110  46.228 1.00 51.86  ? 1454 HOH A O     1 
HETATM 7280 O  O     . HOH O 10 .   ? 49.269 102.679 62.951 1.00 42.46  ? 1455 HOH A O     1 
HETATM 7281 O  O     . HOH O 10 .   ? 56.702 48.277  65.506 1.00 44.78  ? 1457 HOH A O     1 
HETATM 7282 O  O     . HOH O 10 .   ? 39.009 87.611  37.729 1.00 49.33  ? 1458 HOH A O     1 
HETATM 7283 O  O     . HOH O 10 .   ? 57.034 102.699 38.376 1.00 42.30  ? 1460 HOH A O     1 
HETATM 7284 O  O     . HOH O 10 .   ? 65.396 97.132  60.279 1.00 50.66  ? 1461 HOH A O     1 
HETATM 7285 O  O     . HOH O 10 .   ? 53.783 91.267  32.822 1.00 42.49  ? 1462 HOH A O     1 
HETATM 7286 O  O     . HOH O 10 .   ? 55.675 54.497  68.321 1.00 50.23  ? 1463 HOH A O     1 
HETATM 7287 O  O     . HOH O 10 .   ? 68.353 77.580  52.179 1.00 52.58  ? 1464 HOH A O     1 
HETATM 7288 O  O     . HOH O 10 .   ? 82.767 76.113  62.398 1.00 61.35  ? 1466 HOH A O     1 
HETATM 7289 O  O     . HOH O 10 .   ? 32.415 52.839  51.533 1.00 55.36  ? 1467 HOH A O     1 
HETATM 7290 O  O     . HOH O 10 .   ? 49.686 55.238  40.699 1.00 42.85  ? 1468 HOH A O     1 
HETATM 7291 O  O     . HOH O 10 .   ? 95.579 92.839  48.299 1.00 61.59  ? 1470 HOH A O     1 
HETATM 7292 O  O     . HOH O 10 .   ? 54.326 43.451  48.865 1.00 51.00  ? 1472 HOH A O     1 
HETATM 7293 O  O     . HOH O 10 .   ? 53.913 102.479 33.043 1.00 39.03  ? 1473 HOH A O     1 
HETATM 7294 O  O     . HOH O 10 .   ? 52.765 41.481  58.601 1.00 42.82  ? 1474 HOH A O     1 
HETATM 7295 O  O     . HOH O 10 .   ? 29.312 44.912  49.019 1.00 48.73  ? 1475 HOH A O     1 
HETATM 7296 O  O     . HOH O 10 .   ? 78.388 83.269  62.330 1.00 53.64  ? 1476 HOH A O     1 
HETATM 7297 O  O     . HOH O 10 .   ? 49.497 58.557  48.995 1.00 29.08  ? 1479 HOH A O     1 
HETATM 7298 O  O     . HOH O 10 .   ? 88.185 96.445  42.738 1.00 39.75  ? 1481 HOH A O     1 
HETATM 7299 O  O     . HOH O 10 .   ? 55.748 99.054  25.283 1.00 54.44  ? 1482 HOH A O     1 
HETATM 7300 O  O     . HOH O 10 .   ? 82.614 109.373 51.314 1.00 51.78  ? 1483 HOH A O     1 
HETATM 7301 O  O     . HOH O 10 .   ? 95.750 89.146  40.958 1.00 54.22  ? 1485 HOH A O     1 
HETATM 7302 O  O     . HOH O 10 .   ? 58.922 70.936  76.396 1.00 49.55  ? 1486 HOH A O     1 
HETATM 7303 O  O     . HOH O 10 .   ? 60.574 65.874  74.209 1.00 55.62  ? 1487 HOH A O     1 
HETATM 7304 O  O     . HOH O 10 .   ? 43.362 77.395  23.713 1.00 51.85  ? 1489 HOH A O     1 
HETATM 7305 O  O     . HOH O 10 .   ? 77.297 105.409 34.069 1.00 55.17  ? 1490 HOH A O     1 
HETATM 7306 O  O     . HOH O 10 .   ? 55.136 79.142  31.231 1.00 52.45  ? 1492 HOH A O     1 
HETATM 7307 O  O     . HOH O 10 .   ? 67.532 103.747 32.113 1.00 41.04  ? 1494 HOH A O     1 
HETATM 7308 O  O     . HOH O 10 .   ? 89.845 101.590 59.248 1.00 53.03  ? 1495 HOH A O     1 
HETATM 7309 O  O     . HOH O 10 .   ? 54.847 47.880  54.106 1.00 46.99  ? 1497 HOH A O     1 
HETATM 7310 O  O     . HOH O 10 .   ? 44.637 94.793  69.380 1.00 58.90  ? 1499 HOH A O     1 
HETATM 7311 O  O     . HOH O 10 .   ? 81.316 104.474 47.519 1.00 33.13  ? 1500 HOH A O     1 
HETATM 7312 O  O     . HOH O 10 .   ? 42.672 35.935  58.277 1.00 57.02  ? 1504 HOH A O     1 
HETATM 7313 O  O     . HOH O 10 .   ? 41.064 66.798  26.033 1.00 69.12  ? 1505 HOH A O     1 
HETATM 7314 O  O     . HOH O 10 .   ? 37.724 55.770  28.108 1.00 66.23  ? 1506 HOH A O     1 
HETATM 7315 O  O     . HOH O 10 .   ? 51.804 84.128  31.457 1.00 37.10  ? 1508 HOH A O     1 
HETATM 7316 O  O     . HOH O 10 .   ? 31.536 55.589  38.805 1.00 51.29  ? 1509 HOH A O     1 
HETATM 7317 O  O     . HOH O 10 .   ? 66.450 61.897  61.681 1.00 43.16  ? 1510 HOH A O     1 
HETATM 7318 O  O     . HOH O 10 .   ? 70.514 78.457  46.989 1.00 57.38  ? 1511 HOH A O     1 
HETATM 7319 O  O     . HOH O 10 .   ? 63.419 69.711  43.644 1.00 55.31  ? 1512 HOH A O     1 
HETATM 7320 O  O     . HOH O 10 .   ? 32.897 98.226  36.978 1.00 40.81  ? 1513 HOH A O     1 
HETATM 7321 O  O     . HOH O 10 .   ? 47.938 91.462  71.272 1.00 41.47  ? 1514 HOH A O     1 
HETATM 7322 O  O     . HOH O 10 .   ? 60.393 73.218  82.115 1.00 51.38  ? 1516 HOH A O     1 
HETATM 7323 O  O     . HOH O 10 .   ? 49.834 74.112  76.043 1.00 53.91  ? 1517 HOH A O     1 
HETATM 7324 O  O     . HOH O 10 .   ? 91.679 82.225  53.282 1.00 30.30  ? 1518 HOH A O     1 
HETATM 7325 O  O     . HOH O 10 .   ? 56.738 50.579  51.171 1.00 45.27  ? 1519 HOH A O     1 
HETATM 7326 O  O     . HOH O 10 .   ? 28.913 55.076  54.488 1.00 49.24  ? 1520 HOH A O     1 
HETATM 7327 O  O     . HOH O 10 .   ? 62.352 97.630  58.609 1.00 58.88  ? 1521 HOH A O     1 
HETATM 7328 O  O     . HOH O 10 .   ? 86.740 105.495 36.187 1.00 62.72  ? 1522 HOH A O     1 
HETATM 7329 O  O     . HOH O 10 .   ? 75.966 80.530  59.922 1.00 51.75  ? 1526 HOH A O     1 
HETATM 7330 O  O     . HOH O 10 .   ? 83.023 108.457 48.402 1.00 53.81  ? 1529 HOH A O     1 
HETATM 7331 O  O     . HOH O 10 .   ? 67.695 94.129  29.017 1.00 62.96  ? 1531 HOH A O     1 
HETATM 7332 O  O     . HOH O 10 .   ? 91.573 69.167  38.604 1.00 51.56  ? 1532 HOH A O     1 
HETATM 7333 O  O     . HOH O 10 .   ? 71.460 70.059  69.960 1.00 50.52  ? 1534 HOH A O     1 
HETATM 7334 O  O     . HOH O 10 .   ? 50.254 54.741  35.957 1.00 52.36  ? 1535 HOH A O     1 
HETATM 7335 O  O     . HOH O 10 .   ? 34.310 82.375  54.687 1.00 38.84  ? 1536 HOH A O     1 
HETATM 7336 O  O     . HOH O 10 .   ? 77.942 2.914   17.792 1.00 56.25  ? 1538 HOH A O     1 
HETATM 7337 O  O     . HOH O 10 .   ? 57.462 75.727  76.093 1.00 35.65  ? 1539 HOH A O     1 
HETATM 7338 O  O     . HOH O 10 .   ? 48.249 35.456  44.995 1.00 48.94  ? 1540 HOH A O     1 
HETATM 7339 O  O     . HOH O 10 .   ? 71.070 73.709  77.009 1.00 46.52  ? 1541 HOH A O     1 
HETATM 7340 O  O     . HOH O 10 .   ? 53.862 62.962  51.002 1.00 40.30  ? 1542 HOH A O     1 
HETATM 7341 O  O     . HOH O 10 .   ? 20.728 79.465  52.072 1.00 60.88  ? 1543 HOH A O     1 
HETATM 7342 O  O     . HOH O 10 .   ? 71.796 78.293  71.552 1.00 46.00  ? 1544 HOH A O     1 
HETATM 7343 O  O     . HOH O 10 .   ? 68.489 70.224  49.767 1.00 49.15  ? 1546 HOH A O     1 
HETATM 7344 O  O     . HOH O 10 .   ? 83.656 94.177  32.812 1.00 56.25  ? 1547 HOH A O     1 
HETATM 7345 O  O     . HOH O 10 .   ? 83.313 76.284  28.883 1.00 56.52  ? 1548 HOH A O     1 
HETATM 7346 O  O     . HOH O 10 .   ? 92.166 84.747  37.544 1.00 49.80  ? 1549 HOH A O     1 
HETATM 7347 O  O     . HOH O 10 .   ? 19.363 83.291  47.021 1.00 67.88  ? 1550 HOH A O     1 
HETATM 7348 O  O     . HOH O 10 .   ? 95.768 76.133  47.735 1.00 55.99  ? 1551 HOH A O     1 
HETATM 7349 O  O     . HOH O 10 .   ? 70.874 70.272  53.760 1.00 54.27  ? 1552 HOH A O     1 
HETATM 7350 O  O     . HOH O 10 .   ? 70.298 78.144  56.945 1.00 36.58  ? 1554 HOH A O     1 
HETATM 7351 O  O     . HOH O 10 .   ? 52.704 47.555  34.609 1.00 54.51  ? 1556 HOH A O     1 
HETATM 7352 O  O     . HOH O 10 .   ? 33.283 62.329  48.668 1.00 54.86  ? 1557 HOH A O     1 
HETATM 7353 O  O     . HOH O 10 .   ? 58.517 54.691  72.286 1.00 57.33  ? 1558 HOH A O     1 
HETATM 7354 O  O     . HOH O 10 .   ? 41.460 39.768  42.868 1.00 59.79  ? 1560 HOH A O     1 
HETATM 7355 O  O     . HOH O 10 .   ? 52.564 45.508  47.478 1.00 44.51  ? 1562 HOH A O     1 
HETATM 7356 O  O     . HOH O 10 .   ? 29.443 102.911 54.474 1.00 55.38  ? 1563 HOH A O     1 
HETATM 7357 O  O     . HOH O 10 .   ? 60.844 79.929  78.109 1.00 45.23  ? 1565 HOH A O     1 
HETATM 7358 O  O     . HOH O 10 .   ? 62.524 69.347  77.722 1.00 52.22  ? 1566 HOH A O     1 
HETATM 7359 O  O     . HOH O 10 .   ? 29.280 77.601  36.594 1.00 45.51  ? 1567 HOH A O     1 
HETATM 7360 O  O     . HOH O 10 .   ? 70.107 63.226  56.564 1.00 67.00  ? 1568 HOH A O     1 
HETATM 7361 O  O     . HOH O 10 .   ? 43.140 36.441  43.639 1.00 53.47  ? 1569 HOH A O     1 
HETATM 7362 O  O     . HOH O 10 .   ? 28.628 100.733 40.299 1.00 66.61  ? 1570 HOH A O     1 
HETATM 7363 O  O     . HOH O 10 .   ? 34.328 101.228 56.142 1.00 50.27  ? 1571 HOH A O     1 
HETATM 7364 O  O     . HOH O 10 .   ? 75.865 72.008  64.531 1.00 48.38  ? 1572 HOH A O     1 
HETATM 7365 O  O     . HOH O 10 .   ? 69.031 72.235  55.177 1.00 42.51  ? 1574 HOH A O     1 
HETATM 7366 O  O     . HOH O 10 .   ? 41.997 63.230  63.584 1.00 54.34  ? 1575 HOH A O     1 
HETATM 7367 O  O     . HOH O 10 .   ? 52.491 64.275  70.238 1.00 53.39  ? 1576 HOH A O     1 
HETATM 7368 O  O     . HOH O 10 .   ? 93.613 100.542 49.040 1.00 53.46  ? 1578 HOH A O     1 
HETATM 7369 O  O     . HOH O 10 .   ? 43.556 100.047 57.113 1.00 55.03  ? 1582 HOH A O     1 
HETATM 7370 O  O     . HOH O 10 .   ? 70.942 76.969  65.131 1.00 55.40  ? 1585 HOH A O     1 
HETATM 7371 O  O     . HOH O 10 .   ? 88.362 72.998  57.856 1.00 51.86  ? 1586 HOH A O     1 
HETATM 7372 O  O     . HOH O 10 .   ? 67.874 7.580   19.133 1.00 60.61  ? 1587 HOH A O     1 
HETATM 7373 O  O     . HOH O 10 .   ? 89.344 81.294  65.758 1.00 49.55  ? 1590 HOH A O     1 
HETATM 7374 O  O     . HOH O 10 .   ? 71.429 13.922  33.487 1.00 62.18  ? 1591 HOH A O     1 
HETATM 7375 O  O     . HOH O 10 .   ? 61.888 91.340  30.286 1.00 46.42  ? 1593 HOH A O     1 
HETATM 7376 O  O     . HOH O 10 .   ? 77.876 93.041  28.524 1.00 49.55  ? 1594 HOH A O     1 
HETATM 7377 O  O     . HOH O 10 .   ? 60.447 76.831  79.864 1.00 43.46  ? 1602 HOH A O     1 
HETATM 7378 O  O     . HOH O 10 .   ? 66.852 54.175  54.296 1.00 53.74  ? 1603 HOH A O     1 
HETATM 7379 O  O     . HOH O 10 .   ? 56.341 48.432  46.258 1.00 58.91  ? 1604 HOH A O     1 
HETATM 7380 O  O     . HOH O 10 .   ? 24.782 97.407  58.596 1.00 59.40  ? 1606 HOH A O     1 
HETATM 7381 O  O     . HOH O 10 .   ? 64.903 68.778  71.227 1.00 57.99  ? 1614 HOH A O     1 
HETATM 7382 O  O     . HOH O 10 .   ? 60.845 52.212  68.564 1.00 55.16  ? 1615 HOH A O     1 
HETATM 7383 O  O     . HOH O 10 .   ? 36.486 89.274  22.486 1.00 56.96  ? 1616 HOH A O     1 
HETATM 7384 O  O     . HOH O 10 .   ? 50.203 76.817  58.582 1.00 26.66  ? 1617 HOH A O     1 
HETATM 7385 O  O     . HOH O 10 .   ? 46.189 79.517  58.006 1.00 35.07  ? 1618 HOH A O     1 
HETATM 7386 O  O     . HOH O 10 .   ? 80.390 82.147  43.380 1.00 29.32  ? 1620 HOH A O     1 
HETATM 7387 O  O     . HOH O 10 .   ? 77.671 83.855  42.548 1.00 28.11  ? 1621 HOH A O     1 
HETATM 7388 O  O     . HOH O 10 .   ? 79.623 83.280  46.315 1.00 19.13  ? 1622 HOH A O     1 
HETATM 7389 O  O     . HOH O 10 .   ? 60.854 80.387  40.700 1.00 51.15  ? 1623 HOH A O     1 
HETATM 7390 O  O     . HOH O 10 .   ? 56.001 99.148  31.345 1.00 51.72  ? 1624 HOH A O     1 
HETATM 7391 O  O     . HOH O 10 .   ? 61.091 68.802  45.300 1.00 50.80  ? 1626 HOH A O     1 
HETATM 7392 O  O     . HOH O 10 .   ? 64.908 58.398  57.629 1.00 43.57  ? 1628 HOH A O     1 
HETATM 7393 O  O     . HOH O 10 .   ? 64.182 55.536  56.531 1.00 46.56  ? 1629 HOH A O     1 
HETATM 7394 O  O     . HOH O 10 .   ? 58.678 101.616 55.399 1.00 52.90  ? 1633 HOH A O     1 
HETATM 7395 O  O     . HOH O 10 .   ? 69.589 85.170  75.419 1.00 47.87  ? 1635 HOH A O     1 
HETATM 7396 O  O     . HOH O 10 .   ? 44.958 92.106  67.714 1.00 45.59  ? 1638 HOH A O     1 
HETATM 7397 O  O     . HOH O 10 .   ? 65.512 94.974  62.369 1.00 47.50  ? 1643 HOH A O     1 
HETATM 7398 O  O     . HOH O 10 .   ? 61.155 92.153  33.196 1.00 50.92  ? 1646 HOH A O     1 
HETATM 7399 O  O     . HOH O 10 .   ? 62.133 84.816  39.278 1.00 44.34  ? 1647 HOH A O     1 
HETATM 7400 O  O     . HOH O 10 .   ? 25.772 84.218  59.435 1.00 43.18  ? 1649 HOH A O     1 
HETATM 7401 O  O     . HOH O 10 .   ? 44.461 82.703  63.795 1.00 45.61  ? 1654 HOH A O     1 
HETATM 7402 O  O     . HOH P 10 .   ? 42.373 25.590  32.105 1.00 23.38  ? 1017 HOH B O     1 
HETATM 7403 O  O     . HOH P 10 .   ? 45.986 22.269  45.711 1.00 35.80  ? 1112 HOH B O     1 
HETATM 7404 O  O     . HOH P 10 .   ? 51.432 36.921  23.398 1.00 38.59  ? 1148 HOH B O     1 
HETATM 7405 O  O     . HOH P 10 .   ? 40.812 26.783  43.574 1.00 23.99  ? 1156 HOH B O     1 
HETATM 7406 O  O     . HOH P 10 .   ? 49.225 30.433  39.243 1.00 42.32  ? 1165 HOH B O     1 
HETATM 7407 O  O     . HOH P 10 .   ? 42.249 15.714  48.738 1.00 38.93  ? 1190 HOH B O     1 
HETATM 7408 O  O     . HOH P 10 .   ? 43.008 28.451  24.161 1.00 45.60  ? 1199 HOH B O     1 
HETATM 7409 O  O     . HOH P 10 .   ? 46.184 29.935  16.663 1.00 55.06  ? 1205 HOH B O     1 
HETATM 7410 O  O     . HOH P 10 .   ? 40.517 27.270  49.512 1.00 38.18  ? 1206 HOH B O     1 
HETATM 7411 O  O     . HOH P 10 .   ? 47.845 26.906  46.063 1.00 42.68  ? 1225 HOH B O     1 
HETATM 7412 O  O     . HOH P 10 .   ? 41.912 18.196  46.438 1.00 38.87  ? 1239 HOH B O     1 
HETATM 7413 O  O     . HOH P 10 .   ? 43.465 34.056  30.953 1.00 38.29  ? 1247 HOH B O     1 
HETATM 7414 O  O     . HOH P 10 .   ? 45.688 34.183  17.397 1.00 50.88  ? 1260 HOH B O     1 
HETATM 7415 O  O     . HOH P 10 .   ? 44.839 27.287  26.385 1.00 29.92  ? 1266 HOH B O     1 
HETATM 7416 O  O     . HOH P 10 .   ? 58.571 29.811  32.838 1.00 49.57  ? 1273 HOH B O     1 
HETATM 7417 O  O     . HOH P 10 .   ? 47.791 35.985  36.286 1.00 43.62  ? 1325 HOH B O     1 
HETATM 7418 O  O     . HOH P 10 .   ? 44.546 19.625  46.228 1.00 41.56  ? 1360 HOH B O     1 
HETATM 7419 O  O     . HOH P 10 .   ? 42.496 26.190  35.043 1.00 35.48  ? 1387 HOH B O     1 
HETATM 7420 O  O     . HOH P 10 .   ? 47.359 41.118  30.782 1.00 43.14  ? 1408 HOH B O     1 
HETATM 7421 O  O     . HOH P 10 .   ? 36.853 24.401  33.627 1.00 48.37  ? 1410 HOH B O     1 
HETATM 7422 O  O     . HOH P 10 .   ? 40.268 27.919  32.494 1.00 48.07  ? 1427 HOH B O     1 
HETATM 7423 O  O     . HOH P 10 .   ? 40.469 34.063  31.361 1.00 60.65  ? 1469 HOH B O     1 
HETATM 7424 O  O     . HOH P 10 .   ? 35.737 21.201  32.788 1.00 61.97  ? 1503 HOH B O     1 
HETATM 7425 O  O     . HOH P 10 .   ? 61.428 26.103  39.798 1.00 41.74  ? 1524 HOH B O     1 
HETATM 7426 O  O     . HOH P 10 .   ? 56.084 20.721  43.896 1.00 56.07  ? 1580 HOH B O     1 
HETATM 7427 O  O     . HOH P 10 .   ? 43.266 3.924   27.568 1.00 48.38  ? 1588 HOH B O     1 
HETATM 7428 O  O     . HOH P 10 .   ? 57.673 17.671  49.276 1.00 52.49  ? 1612 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   801 ?   ?   ?   P . n 
A 1 2   DG  2   802 ?   ?   ?   P . n 
A 1 3   DA  3   803 ?   ?   ?   P . n 
A 1 4   DA  4   804 ?   ?   ?   P . n 
A 1 5   DA  5   805 ?   ?   ?   P . n 
A 1 6   DA  6   806 ?   ?   ?   P . n 
A 1 7   DC  7   807 ?   ?   ?   P . n 
A 1 8   DG  8   808 ?   ?   ?   P . n 
A 1 9   DA  9   809 ?   ?   ?   P . n 
A 1 10  DC  10  810 810 DC  CYT P . n 
A 1 11  DG  11  811 811 DG  GUA P . n 
A 1 12  DG  12  812 812 DG  GUA P . n 
A 1 13  DC  13  813 813 DC  CYT P . n 
A 1 14  DC  14  814 814 DC  CYT P . n 
A 1 15  DA  15  815 815 DA  ADE P . n 
A 1 16  DG  16  816 816 DG  GUA P . n 
A 1 17  DT  17  817 817 DT  THY P . n 
A 1 18  DG  18  818 818 DG  GUA P . n 
A 1 19  DC  19  819 819 DC  CYT P . n 
A 1 20  DC  20  820 820 DC  CYT P . n 
A 1 21  DA  21  821 821 DA  ADE P . n 
A 1 22  DDG 22  822 822 DDG 2DG P . n 
B 2 1   DC  1   851 ?   ?   ?   T . n 
B 2 2   DC  2   852 ?   ?   ?   T . n 
B 2 3   DC  3   853 853 DC  CYT T . n 
B 2 4   8OG 4   854 854 8OG 8OG T . n 
B 2 5   DC  5   855 855 DC  CYT T . n 
B 2 6   DT  6   856 856 DT  THY T . n 
B 2 7   DG  7   857 857 DG  GUA T . n 
B 2 8   DG  8   858 858 DG  GUA T . n 
B 2 9   DC  9   859 859 DC  CYT T . n 
B 2 10  DA  10  860 860 DA  ADE T . n 
B 2 11  DC  11  861 861 DC  CYT T . n 
B 2 12  DT  12  862 862 DT  THY T . n 
B 2 13  DG  13  863 863 DG  GUA T . n 
B 2 14  DG  14  864 864 DG  GUA T . n 
B 2 15  DC  15  865 865 DC  CYT T . n 
B 2 16  DC  16  866 866 DC  CYT T . n 
B 2 17  DG  17  867 867 DG  GUA T . n 
B 2 18  DT  18  868 868 DT  THY T . n 
B 2 19  DC  19  869 ?   ?   ?   T . n 
B 2 20  DG  20  870 ?   ?   ?   T . n 
B 2 21  DT  21  871 ?   ?   ?   T . n 
B 2 22  DT  22  872 ?   ?   ?   T . n 
B 2 23  DT  23  873 ?   ?   ?   T . n 
B 2 24  DT  24  874 ?   ?   ?   T . n 
B 2 25  DC  25  875 ?   ?   ?   T . n 
B 2 26  DG  26  876 ?   ?   ?   T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   SER 4   4   4   SER SER A . n 
C 3 5   ASP 5   5   5   ASP ASP A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   ALA 8   8   8   ALA ALA A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  GLU 13  13  13  GLU GLU A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  LYS 17  17  17  LYS LYS A . n 
C 3 18  PHE 18  18  18  PHE PHE A . n 
C 3 19  HIS 19  19  19  HIS HIS A . n 
C 3 20  CYS 20  20  20  CYS CYS A . n 
C 3 21  GLY 21  21  21  GLY GLY A . n 
C 3 22  VAL 22  22  22  VAL VAL A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  TYR 24  24  24  TYR TYR A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  TYR 26  26  26  TYR TYR A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ALA 29  29  29  ALA ALA A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  TYR 31  31  31  TYR TYR A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  SER 33  33  33  SER SER A . n 
C 3 34  TYR 34  34  34  TYR TYR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  PRO 36  36  36  PRO PRO A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  ASP 38  38  38  ASP ASP A . n 
C 3 39  PHE 39  39  39  PHE PHE A . n 
C 3 40  GLY 40  40  40  GLY GLY A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  LEU 43  43  43  LEU LEU A . n 
C 3 44  ASP 44  44  44  ASP ASP A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  LEU 46  46  46  LEU LEU A . n 
C 3 47  GLU 47  47  47  GLU GLU A . n 
C 3 48  ALA 48  48  48  ALA ALA A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  VAL 50  50  50  VAL VAL A . n 
C 3 51  ALA 51  51  51  ALA ALA A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  GLY 53  53  53  GLY GLY A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  ILE 56  56  56  ILE ILE A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  HIS 59  59  59  HIS HIS A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  GLY 61  61  61  GLY GLY A . n 
C 3 62  HIS 62  62  62  HIS HIS A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  TYR 64  64  64  TYR TYR A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  PRO 67  67  67  PRO PRO A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  THR 70  70  70  THR THR A . n 
C 3 71  LYS 71  71  71  LYS LYS A . n 
C 3 72  LEU 72  72  72  LEU LEU A . n 
C 3 73  ALA 73  73  73  ALA ALA A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  GLN 76  76  76  GLN GLN A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ASN 78  78  78  ASN ASN A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  GLU 80  80  80  GLU GLU A . n 
C 3 81  PHE 81  81  81  PHE PHE A . n 
C 3 82  HIS 82  82  82  HIS HIS A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  PRO 84  84  84  PRO PRO A . n 
C 3 85  ARG 85  85  85  ARG ARG A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  ASN 87  87  87  ASN ASN A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  ILE 89  89  89  ILE ILE A . n 
C 3 90  ASP 90  90  90  ASP ASP A . n 
C 3 91  THR 91  91  91  THR THR A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  VAL 93  93  93  VAL VAL A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  LEU 97  97  97  LEU LEU A . n 
C 3 98  ILE 98  98  98  ILE ILE A . n 
C 3 99  HIS 99  99  99  HIS HIS A . n 
C 3 100 SER 100 100 100 SER SER A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 LYS 103 103 103 LYS LYS A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 THR 105 105 105 THR THR A . n 
C 3 106 ASP 106 106 106 ASP ASP A . n 
C 3 107 MET 107 107 107 MET MET A . n 
C 3 108 GLY 108 108 108 GLY GLY A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 LEU 110 110 110 LEU LEU A . n 
C 3 111 ARG 111 111 111 ARG ARG A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 GLY 113 113 113 GLY GLY A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 PRO 116 116 116 PRO PRO A . n 
C 3 117 GLY 117 117 117 GLY GLY A . n 
C 3 118 ALA 118 124 124 ALA ALA A . n 
C 3 119 LEU 119 125 125 LEU LEU A . n 
C 3 120 GLU 120 126 126 GLU GLU A . n 
C 3 121 ALA 121 127 127 ALA ALA A . n 
C 3 122 TRP 122 128 128 TRP TRP A . n 
C 3 123 GLY 123 129 129 GLY GLY A . n 
C 3 124 TYR 124 130 130 TYR TYR A . n 
C 3 125 ARG 125 131 131 ARG ARG A . n 
C 3 126 LEU 126 132 132 LEU LEU A . n 
C 3 127 GLY 127 133 133 GLY GLY A . n 
C 3 128 GLU 128 134 134 GLU GLU A . n 
C 3 129 MET 129 135 135 MET MET A . n 
C 3 130 LYS 130 136 136 LYS LYS A . n 
C 3 131 GLY 131 137 137 GLY GLY A . n 
C 3 132 GLU 132 138 138 GLU GLU A . n 
C 3 133 TYR 133 139 139 TYR TYR A . n 
C 3 134 LYS 134 140 140 LYS LYS A . n 
C 3 135 ASP 135 141 141 ASP ASP A . n 
C 3 136 ASP 136 142 142 ASP ASP A . n 
C 3 137 PHE 137 143 143 PHE PHE A . n 
C 3 138 LYS 138 144 144 LYS LYS A . n 
C 3 139 ARG 139 145 145 ARG ARG A . n 
C 3 140 MET 140 146 146 MET MET A . n 
C 3 141 LEU 141 147 147 LEU LEU A . n 
C 3 142 GLU 142 148 148 GLU GLU A . n 
C 3 143 GLU 143 149 149 GLU GLU A . n 
C 3 144 GLN 144 150 150 GLN GLN A . n 
C 3 145 GLY 145 151 151 GLY GLY A . n 
C 3 146 GLU 146 152 152 GLU GLU A . n 
C 3 147 GLU 147 153 153 GLU GLU A . n 
C 3 148 TYR 148 154 154 TYR TYR A . n 
C 3 149 VAL 149 155 155 VAL VAL A . n 
C 3 150 ASP 150 156 156 ASP ASP A . n 
C 3 151 GLY 151 157 157 GLY GLY A . n 
C 3 152 MET 152 158 158 MET MET A . n 
C 3 153 GLU 153 159 159 GLU GLU A . n 
C 3 154 TRP 154 160 160 TRP TRP A . n 
C 3 155 TRP 155 161 161 TRP TRP A . n 
C 3 156 ASN 156 162 162 ASN ASN A . n 
C 3 157 PHE 157 163 163 PHE PHE A . n 
C 3 158 ASN 158 164 164 ASN ASN A . n 
C 3 159 GLU 159 165 165 GLU GLU A . n 
C 3 160 GLU 160 166 166 GLU GLU A . n 
C 3 161 MET 161 167 167 MET MET A . n 
C 3 162 MET 162 168 168 MET MET A . n 
C 3 163 ASP 163 169 169 ASP ASP A . n 
C 3 164 TYR 164 170 170 TYR TYR A . n 
C 3 165 ASN 165 171 171 ASN ASN A . n 
C 3 166 VAL 166 172 172 VAL VAL A . n 
C 3 167 GLN 167 173 173 GLN GLN A . n 
C 3 168 ASP 168 174 174 ASP ASP A . n 
C 3 169 VAL 169 175 175 VAL VAL A . n 
C 3 170 VAL 170 176 176 VAL VAL A . n 
C 3 171 VAL 171 177 177 VAL VAL A . n 
C 3 172 THR 172 178 178 THR THR A . n 
C 3 173 LYS 173 179 179 LYS LYS A . n 
C 3 174 ALA 174 180 180 ALA ALA A . n 
C 3 175 LEU 175 181 181 LEU LEU A . n 
C 3 176 LEU 176 182 182 LEU LEU A . n 
C 3 177 GLU 177 183 183 GLU GLU A . n 
C 3 178 LYS 178 184 184 LYS LYS A . n 
C 3 179 LEU 179 185 185 LEU LEU A . n 
C 3 180 LEU 180 186 186 LEU LEU A . n 
C 3 181 SER 181 187 187 SER SER A . n 
C 3 182 ASP 182 188 188 ASP ASP A . n 
C 3 183 LYS 183 189 189 LYS LYS A . n 
C 3 184 HIS 184 190 190 HIS HIS A . n 
C 3 185 TYR 185 191 191 TYR TYR A . n 
C 3 186 PHE 186 192 192 PHE PHE A . n 
C 3 187 PRO 187 193 193 PRO PRO A . n 
C 3 188 PRO 188 194 194 PRO PRO A . n 
C 3 189 GLU 189 195 195 GLU GLU A . n 
C 3 190 ILE 190 196 196 ILE ILE A . n 
C 3 191 ASP 191 197 197 ASP ASP A . n 
C 3 192 PHE 192 198 198 PHE PHE A . n 
C 3 193 THR 193 199 199 THR THR A . n 
C 3 194 ASP 194 200 200 ASP ASP A . n 
C 3 195 VAL 195 201 201 VAL VAL A . n 
C 3 196 GLY 196 202 202 GLY GLY A . n 
C 3 197 TYR 197 203 203 TYR TYR A . n 
C 3 198 THR 198 204 204 THR THR A . n 
C 3 199 THR 199 205 205 THR THR A . n 
C 3 200 PHE 200 206 206 PHE PHE A . n 
C 3 201 TRP 201 207 207 TRP TRP A . n 
C 3 202 SER 202 208 208 SER SER A . n 
C 3 203 GLU 203 209 209 GLU GLU A . n 
C 3 204 SER 204 210 210 SER SER A . n 
C 3 205 LEU 205 211 211 LEU LEU A . n 
C 3 206 GLU 206 212 212 GLU GLU A . n 
C 3 207 ALA 207 213 213 ALA ALA A . n 
C 3 208 VAL 208 214 214 VAL VAL A . n 
C 3 209 ASP 209 215 215 ASP ASP A . n 
C 3 210 ILE 210 216 216 ILE ILE A . n 
C 3 211 GLU 211 217 217 GLU GLU A . n 
C 3 212 HIS 212 218 218 HIS HIS A . n 
C 3 213 ARG 213 219 219 ARG ARG A . n 
C 3 214 ALA 214 220 220 ALA ALA A . n 
C 3 215 ALA 215 221 221 ALA ALA A . n 
C 3 216 TRP 216 222 222 TRP TRP A . n 
C 3 217 LEU 217 223 223 LEU LEU A . n 
C 3 218 LEU 218 224 224 LEU LEU A . n 
C 3 219 ALA 219 225 225 ALA ALA A . n 
C 3 220 LYS 220 226 226 LYS LYS A . n 
C 3 221 GLN 221 227 227 GLN GLN A . n 
C 3 222 GLU 222 228 228 GLU GLU A . n 
C 3 223 ARG 223 229 229 ARG ARG A . n 
C 3 224 ASN 224 230 230 ASN ASN A . n 
C 3 225 GLY 225 231 231 GLY GLY A . n 
C 3 226 PHE 226 232 232 PHE PHE A . n 
C 3 227 PRO 227 233 233 PRO PRO A . n 
C 3 228 PHE 228 234 234 PHE PHE A . n 
C 3 229 ASP 229 235 235 ASP ASP A . n 
C 3 230 THR 230 236 236 THR THR A . n 
C 3 231 LYS 231 237 237 LYS LYS A . n 
C 3 232 ALA 232 238 238 ALA ALA A . n 
C 3 233 ILE 233 239 239 ILE ILE A . n 
C 3 234 GLU 234 240 240 GLU GLU A . n 
C 3 235 GLU 235 241 241 GLU GLU A . n 
C 3 236 LEU 236 242 242 LEU LEU A . n 
C 3 237 TYR 237 243 243 TYR TYR A . n 
C 3 238 VAL 238 244 244 VAL VAL A . n 
C 3 239 GLU 239 245 245 GLU GLU A . n 
C 3 240 LEU 240 246 246 LEU LEU A . n 
C 3 241 ALA 241 247 247 ALA ALA A . n 
C 3 242 ALA 242 248 248 ALA ALA A . n 
C 3 243 ARG 243 249 249 ARG ARG A . n 
C 3 244 ARG 244 250 250 ARG ARG A . n 
C 3 245 SER 245 251 251 SER SER A . n 
C 3 246 GLU 246 252 252 GLU GLU A . n 
C 3 247 LEU 247 253 253 LEU LEU A . n 
C 3 248 LEU 248 254 254 LEU LEU A . n 
C 3 249 ARG 249 255 255 ARG ARG A . n 
C 3 250 LYS 250 256 256 LYS LYS A . n 
C 3 251 LEU 251 257 257 LEU LEU A . n 
C 3 252 THR 252 258 258 THR THR A . n 
C 3 253 GLU 253 259 259 GLU GLU A . n 
C 3 254 THR 254 260 260 THR THR A . n 
C 3 255 PHE 255 261 261 PHE PHE A . n 
C 3 256 GLY 256 262 262 GLY GLY A . n 
C 3 257 SER 257 263 263 SER SER A . n 
C 3 258 TRP 258 264 264 TRP TRP A . n 
C 3 259 TYR 259 265 265 TYR TYR A . n 
C 3 260 GLN 260 266 266 GLN GLN A . n 
C 3 261 PRO 261 267 267 PRO PRO A . n 
C 3 262 LYS 262 268 268 LYS LYS A . n 
C 3 263 GLY 263 269 269 GLY GLY A . n 
C 3 264 GLY 264 270 270 GLY GLY A . n 
C 3 265 THR 265 271 271 THR THR A . n 
C 3 266 GLU 266 272 272 GLU GLU A . n 
C 3 267 MET 267 273 273 MET MET A . n 
C 3 268 PHE 268 274 274 PHE PHE A . n 
C 3 269 CYS 269 275 275 CYS CYS A . n 
C 3 270 HIS 270 276 276 HIS HIS A . n 
C 3 271 PRO 271 277 277 PRO PRO A . n 
C 3 272 ARG 272 278 278 ARG ARG A . n 
C 3 273 THR 273 279 279 THR THR A . n 
C 3 274 GLY 274 280 280 GLY GLY A . n 
C 3 275 LYS 275 281 281 LYS LYS A . n 
C 3 276 PRO 276 282 282 PRO PRO A . n 
C 3 277 LEU 277 283 283 LEU LEU A . n 
C 3 278 PRO 278 284 284 PRO PRO A . n 
C 3 279 LYS 279 285 285 LYS LYS A . n 
C 3 280 TYR 280 286 286 TYR TYR A . n 
C 3 281 PRO 281 287 287 PRO PRO A . n 
C 3 282 ARG 282 288 288 ARG ARG A . n 
C 3 283 ILE 283 289 289 ILE ILE A . n 
C 3 284 LYS 284 290 290 LYS LYS A . n 
C 3 285 THR 285 291 291 THR THR A . n 
C 3 286 PRO 286 292 292 PRO PRO A . n 
C 3 287 LYS 287 293 293 LYS LYS A . n 
C 3 288 VAL 288 294 294 VAL VAL A . n 
C 3 289 GLY 289 295 295 GLY GLY A . n 
C 3 290 GLY 290 296 296 GLY GLY A . n 
C 3 291 ILE 291 297 297 ILE ILE A . n 
C 3 292 PHE 292 298 298 PHE PHE A . n 
C 3 293 LYS 293 299 299 LYS LYS A . n 
C 3 294 LYS 294 300 300 LYS LYS A . n 
C 3 295 PRO 295 301 301 PRO PRO A . n 
C 3 296 LYS 296 302 ?   ?   ?   A . n 
C 3 297 ASN 297 303 ?   ?   ?   A . n 
C 3 298 LYS 298 304 ?   ?   ?   A . n 
C 3 299 ALA 299 305 ?   ?   ?   A . n 
C 3 300 GLN 300 306 ?   ?   ?   A . n 
C 3 301 ARG 301 307 ?   ?   ?   A . n 
C 3 302 GLU 302 308 308 GLU GLU A . n 
C 3 303 GLY 303 309 309 GLY GLY A . n 
C 3 304 ARG 304 310 310 ARG ARG A . n 
C 3 305 GLU 305 311 311 GLU GLU A . n 
C 3 306 PRO 306 312 312 PRO PRO A . n 
C 3 307 CYS 307 313 313 CYS CYS A . n 
C 3 308 GLU 308 314 314 GLU GLU A . n 
C 3 309 LEU 309 315 315 LEU LEU A . n 
C 3 310 ASP 310 316 316 ASP ASP A . n 
C 3 311 THR 311 317 317 THR THR A . n 
C 3 312 ARG 312 318 318 ARG ARG A . n 
C 3 313 GLU 313 319 319 GLU GLU A . n 
C 3 314 TYR 314 320 320 TYR TYR A . n 
C 3 315 VAL 315 321 321 VAL VAL A . n 
C 3 316 ALA 316 322 322 ALA ALA A . n 
C 3 317 GLY 317 323 323 GLY GLY A . n 
C 3 318 ALA 318 324 324 ALA ALA A . n 
C 3 319 PRO 319 325 325 PRO PRO A . n 
C 3 320 TYR 320 326 326 TYR TYR A . n 
C 3 321 THR 321 327 327 THR THR A . n 
C 3 322 PRO 322 328 328 PRO PRO A . n 
C 3 323 VAL 323 329 329 VAL VAL A . n 
C 3 324 GLU 324 330 330 GLU GLU A . n 
C 3 325 HIS 325 331 331 HIS HIS A . n 
C 3 326 VAL 326 332 332 VAL VAL A . n 
C 3 327 VAL 327 333 333 VAL VAL A . n 
C 3 328 PHE 328 334 334 PHE PHE A . n 
C 3 329 ASN 329 335 335 ASN ASN A . n 
C 3 330 PRO 330 336 336 PRO PRO A . n 
C 3 331 SER 331 337 337 SER SER A . n 
C 3 332 SER 332 338 338 SER SER A . n 
C 3 333 ARG 333 339 339 ARG ARG A . n 
C 3 334 ASP 334 340 340 ASP ASP A . n 
C 3 335 HIS 335 341 341 HIS HIS A . n 
C 3 336 ILE 336 342 342 ILE ILE A . n 
C 3 337 GLN 337 343 343 GLN GLN A . n 
C 3 338 LYS 338 344 344 LYS LYS A . n 
C 3 339 LYS 339 345 345 LYS LYS A . n 
C 3 340 LEU 340 346 346 LEU LEU A . n 
C 3 341 GLN 341 347 347 GLN GLN A . n 
C 3 342 GLU 342 348 348 GLU GLU A . n 
C 3 343 ALA 343 349 349 ALA ALA A . n 
C 3 344 GLY 344 350 350 GLY GLY A . n 
C 3 345 TRP 345 351 351 TRP TRP A . n 
C 3 346 VAL 346 352 352 VAL VAL A . n 
C 3 347 PRO 347 353 353 PRO PRO A . n 
C 3 348 THR 348 354 354 THR THR A . n 
C 3 349 LYS 349 355 355 LYS LYS A . n 
C 3 350 TYR 350 356 356 TYR TYR A . n 
C 3 351 THR 351 357 357 THR THR A . n 
C 3 352 ASP 352 358 358 ASP ASP A . n 
C 3 353 LYS 353 359 359 LYS LYS A . n 
C 3 354 GLY 354 360 360 GLY GLY A . n 
C 3 355 ALA 355 361 361 ALA ALA A . n 
C 3 356 PRO 356 362 362 PRO PRO A . n 
C 3 357 VAL 357 363 363 VAL VAL A . n 
C 3 358 VAL 358 364 364 VAL VAL A . n 
C 3 359 ASP 359 365 365 ASP ASP A . n 
C 3 360 ASP 360 366 366 ASP ASP A . n 
C 3 361 GLU 361 367 367 GLU GLU A . n 
C 3 362 VAL 362 368 368 VAL VAL A . n 
C 3 363 LEU 363 369 369 LEU LEU A . n 
C 3 364 GLU 364 370 370 GLU GLU A . n 
C 3 365 GLY 365 371 371 GLY GLY A . n 
C 3 366 VAL 366 372 372 VAL VAL A . n 
C 3 367 ARG 367 373 373 ARG ARG A . n 
C 3 368 VAL 368 374 374 VAL VAL A . n 
C 3 369 ASP 369 375 375 ASP ASP A . n 
C 3 370 ASP 370 376 376 ASP ASP A . n 
C 3 371 PRO 371 377 377 PRO PRO A . n 
C 3 372 GLU 372 378 378 GLU GLU A . n 
C 3 373 LYS 373 379 379 LYS LYS A . n 
C 3 374 GLN 374 380 380 GLN GLN A . n 
C 3 375 ALA 375 381 381 ALA ALA A . n 
C 3 376 ALA 376 382 382 ALA ALA A . n 
C 3 377 ILE 377 383 383 ILE ILE A . n 
C 3 378 ASP 378 384 384 ASP ASP A . n 
C 3 379 LEU 379 385 385 LEU LEU A . n 
C 3 380 ILE 380 386 386 ILE ILE A . n 
C 3 381 LYS 381 387 387 LYS LYS A . n 
C 3 382 GLU 382 388 388 GLU GLU A . n 
C 3 383 TYR 383 389 389 TYR TYR A . n 
C 3 384 LEU 384 390 390 LEU LEU A . n 
C 3 385 MET 385 391 391 MET MET A . n 
C 3 386 ILE 386 392 392 ILE ILE A . n 
C 3 387 GLN 387 393 393 GLN GLN A . n 
C 3 388 LYS 388 394 394 LYS LYS A . n 
C 3 389 ARG 389 395 395 ARG ARG A . n 
C 3 390 ILE 390 396 396 ILE ILE A . n 
C 3 391 GLY 391 397 397 GLY GLY A . n 
C 3 392 GLN 392 398 398 GLN GLN A . n 
C 3 393 SER 393 399 399 SER SER A . n 
C 3 394 ALA 394 400 400 ALA ALA A . n 
C 3 395 GLU 395 401 401 GLU GLU A . n 
C 3 396 GLY 396 402 402 GLY GLY A . n 
C 3 397 ASP 397 403 403 ASP ASP A . n 
C 3 398 LYS 398 404 404 LYS LYS A . n 
C 3 399 ALA 399 405 405 ALA ALA A . n 
C 3 400 TRP 400 406 406 TRP TRP A . n 
C 3 401 LEU 401 407 407 LEU LEU A . n 
C 3 402 ARG 402 408 408 ARG ARG A . n 
C 3 403 TYR 403 409 409 TYR TYR A . n 
C 3 404 VAL 404 410 410 VAL VAL A . n 
C 3 405 ALA 405 411 411 ALA ALA A . n 
C 3 406 GLU 406 412 412 GLU GLU A . n 
C 3 407 ASP 407 413 413 ASP ASP A . n 
C 3 408 GLY 408 414 414 GLY GLY A . n 
C 3 409 LYS 409 415 415 LYS LYS A . n 
C 3 410 ILE 410 416 416 ILE ILE A . n 
C 3 411 HIS 411 417 417 HIS HIS A . n 
C 3 412 GLY 412 418 418 GLY GLY A . n 
C 3 413 SER 413 419 419 SER SER A . n 
C 3 414 VAL 414 420 420 VAL VAL A . n 
C 3 415 ASN 415 421 421 ASN ASN A . n 
C 3 416 PRO 416 422 422 PRO PRO A . n 
C 3 417 ASN 417 423 423 ASN ASN A . n 
C 3 418 GLY 418 424 424 GLY GLY A . n 
C 3 419 ALA 419 425 425 ALA ALA A . n 
C 3 420 VAL 420 426 426 VAL VAL A . n 
C 3 421 THR 421 427 427 THR THR A . n 
C 3 422 GLY 422 428 428 GLY GLY A . n 
C 3 423 ARG 423 429 429 ARG ARG A . n 
C 3 424 ALA 424 430 430 ALA ALA A . n 
C 3 425 THR 425 431 431 THR THR A . n 
C 3 426 HIS 426 432 432 HIS HIS A . n 
C 3 427 ALA 427 433 433 ALA ALA A . n 
C 3 428 PHE 428 434 434 PHE PHE A . n 
C 3 429 PRO 429 435 435 PRO PRO A . n 
C 3 430 ASN 430 436 436 ASN ASN A . n 
C 3 431 LEU 431 437 437 LEU LEU A . n 
C 3 432 ALA 432 438 438 ALA ALA A . n 
C 3 433 GLN 433 439 439 GLN GLN A . n 
C 3 434 ILE 434 440 440 ILE ILE A . n 
C 3 435 PRO 435 441 441 PRO PRO A . n 
C 3 436 GLY 436 442 442 GLY GLY A . n 
C 3 437 VAL 437 443 443 VAL VAL A . n 
C 3 438 ARG 438 444 444 ARG ARG A . n 
C 3 439 SER 439 445 445 SER SER A . n 
C 3 440 PRO 440 446 446 PRO PRO A . n 
C 3 441 TYR 441 447 447 TYR TYR A . n 
C 3 442 GLY 442 448 448 GLY GLY A . n 
C 3 443 GLU 443 449 449 GLU GLU A . n 
C 3 444 GLN 444 450 450 GLN GLN A . n 
C 3 445 CYS 445 451 451 CYS CYS A . n 
C 3 446 ARG 446 452 452 ARG ARG A . n 
C 3 447 ALA 447 453 453 ALA ALA A . n 
C 3 448 ALA 448 454 454 ALA ALA A . n 
C 3 449 PHE 449 455 455 PHE PHE A . n 
C 3 450 GLY 450 456 456 GLY GLY A . n 
C 3 451 ALA 451 457 457 ALA ALA A . n 
C 3 452 GLU 452 458 458 GLU GLU A . n 
C 3 453 HIS 453 459 459 HIS HIS A . n 
C 3 454 HIS 454 460 460 HIS HIS A . n 
C 3 455 LEU 455 461 461 LEU LEU A . n 
C 3 456 ASP 456 462 462 ASP ASP A . n 
C 3 457 GLY 457 463 463 GLY GLY A . n 
C 3 458 ILE 458 464 464 ILE ILE A . n 
C 3 459 THR 459 465 465 THR THR A . n 
C 3 460 GLY 460 466 466 GLY GLY A . n 
C 3 461 LYS 461 467 467 LYS LYS A . n 
C 3 462 PRO 462 468 468 PRO PRO A . n 
C 3 463 TRP 463 469 469 TRP TRP A . n 
C 3 464 VAL 464 470 470 VAL VAL A . n 
C 3 465 GLN 465 471 471 GLN GLN A . n 
C 3 466 ALA 466 472 472 ALA ALA A . n 
C 3 467 GLY 467 473 473 GLY GLY A . n 
C 3 468 ILE 468 474 474 ILE ILE A . n 
C 3 469 ASP 469 475 475 ASP ASP A . n 
C 3 470 ALA 470 476 476 ALA ALA A . n 
C 3 471 SER 471 477 477 SER SER A . n 
C 3 472 GLY 472 478 478 GLY GLY A . n 
C 3 473 LEU 473 479 479 LEU LEU A . n 
C 3 474 GLU 474 480 480 GLU GLU A . n 
C 3 475 LEU 475 481 481 LEU LEU A . n 
C 3 476 ARG 476 482 482 ARG ARG A . n 
C 3 477 CYS 477 483 483 CYS CYS A . n 
C 3 478 LEU 478 484 484 LEU LEU A . n 
C 3 479 ALA 479 485 485 ALA ALA A . n 
C 3 480 HIS 480 486 486 HIS HIS A . n 
C 3 481 PHE 481 487 487 PHE PHE A . n 
C 3 482 MET 482 488 488 MET MET A . n 
C 3 483 ALA 483 489 489 ALA ALA A . n 
C 3 484 ARG 484 490 490 ARG ARG A . n 
C 3 485 PHE 485 491 491 PHE PHE A . n 
C 3 486 ASP 486 492 492 ASP ASP A . n 
C 3 487 ASN 487 493 493 ASN ASN A . n 
C 3 488 GLY 488 494 494 GLY GLY A . n 
C 3 489 GLU 489 495 495 GLU GLU A . n 
C 3 490 TYR 490 496 496 TYR TYR A . n 
C 3 491 ALA 491 497 497 ALA ALA A . n 
C 3 492 HIS 492 498 498 HIS HIS A . n 
C 3 493 GLU 493 499 499 GLU GLU A . n 
C 3 494 ILE 494 500 500 ILE ILE A . n 
C 3 495 LEU 495 501 501 LEU LEU A . n 
C 3 496 ASN 496 502 502 ASN ASN A . n 
C 3 497 GLY 497 503 503 GLY GLY A . n 
C 3 498 ASP 498 504 504 ASP ASP A . n 
C 3 499 ILE 499 505 505 ILE ILE A . n 
C 3 500 HIS 500 506 506 HIS HIS A . n 
C 3 501 THR 501 507 507 THR THR A . n 
C 3 502 LYS 502 508 508 LYS LYS A . n 
C 3 503 ASN 503 509 509 ASN ASN A . n 
C 3 504 GLN 504 510 510 GLN GLN A . n 
C 3 505 ILE 505 511 511 ILE ILE A . n 
C 3 506 ALA 506 512 512 ALA ALA A . n 
C 3 507 ALA 507 513 513 ALA ALA A . n 
C 3 508 GLU 508 514 514 GLU GLU A . n 
C 3 509 LEU 509 515 515 LEU LEU A . n 
C 3 510 PRO 510 516 516 PRO PRO A . n 
C 3 511 THR 511 517 517 THR THR A . n 
C 3 512 ARG 512 518 518 ARG ARG A . n 
C 3 513 ASP 513 519 519 ASP ASP A . n 
C 3 514 ASN 514 520 520 ASN ASN A . n 
C 3 515 ALA 515 521 521 ALA ALA A . n 
C 3 516 LYS 516 522 522 LYS LYS A . n 
C 3 517 THR 517 523 523 THR THR A . n 
C 3 518 PHE 518 524 524 PHE PHE A . n 
C 3 519 ILE 519 525 525 ILE ILE A . n 
C 3 520 TYR 520 526 526 TYR TYR A . n 
C 3 521 GLY 521 527 527 GLY GLY A . n 
C 3 522 PHE 522 528 528 PHE PHE A . n 
C 3 523 LEU 523 529 529 LEU LEU A . n 
C 3 524 TYR 524 530 530 TYR TYR A . n 
C 3 525 GLY 525 531 531 GLY GLY A . n 
C 3 526 ALA 526 532 532 ALA ALA A . n 
C 3 527 GLY 527 533 533 GLY GLY A . n 
C 3 528 ASP 528 534 534 ASP ASP A . n 
C 3 529 GLU 529 535 535 GLU GLU A . n 
C 3 530 LYS 530 536 536 LYS LYS A . n 
C 3 531 ILE 531 537 537 ILE ILE A . n 
C 3 532 GLY 532 538 538 GLY GLY A . n 
C 3 533 GLN 533 539 539 GLN GLN A . n 
C 3 534 ILE 534 540 540 ILE ILE A . n 
C 3 535 VAL 535 541 541 VAL VAL A . n 
C 3 536 GLY 536 542 542 GLY GLY A . n 
C 3 537 ALA 537 543 543 ALA ALA A . n 
C 3 538 GLY 538 544 544 GLY GLY A . n 
C 3 539 LYS 539 545 545 LYS LYS A . n 
C 3 540 GLU 540 546 546 GLU GLU A . n 
C 3 541 ARG 541 547 547 ARG ARG A . n 
C 3 542 GLY 542 548 548 GLY GLY A . n 
C 3 543 LYS 543 549 549 LYS LYS A . n 
C 3 544 GLU 544 550 550 GLU GLU A . n 
C 3 545 LEU 545 551 551 LEU LEU A . n 
C 3 546 LYS 546 552 552 LYS LYS A . n 
C 3 547 LYS 547 553 553 LYS LYS A . n 
C 3 548 LYS 548 554 554 LYS LYS A . n 
C 3 549 PHE 549 555 555 PHE PHE A . n 
C 3 550 LEU 550 556 556 LEU LEU A . n 
C 3 551 GLU 551 557 557 GLU GLU A . n 
C 3 552 ASN 552 558 558 ASN ASN A . n 
C 3 553 THR 553 559 559 THR THR A . n 
C 3 554 PRO 554 560 560 PRO PRO A . n 
C 3 555 ALA 555 561 561 ALA ALA A . n 
C 3 556 ILE 556 562 562 ILE ILE A . n 
C 3 557 ALA 557 563 563 ALA ALA A . n 
C 3 558 ALA 558 564 564 ALA ALA A . n 
C 3 559 LEU 559 565 565 LEU LEU A . n 
C 3 560 ARG 560 566 566 ARG ARG A . n 
C 3 561 GLU 561 567 567 GLU GLU A . n 
C 3 562 SER 562 568 568 SER SER A . n 
C 3 563 ILE 563 569 569 ILE ILE A . n 
C 3 564 GLN 564 570 570 GLN GLN A . n 
C 3 565 GLN 565 571 571 GLN GLN A . n 
C 3 566 THR 566 572 572 THR THR A . n 
C 3 567 LEU 567 573 573 LEU LEU A . n 
C 3 568 VAL 568 574 574 VAL VAL A . n 
C 3 569 GLU 569 575 575 GLU GLU A . n 
C 3 570 SER 570 576 576 SER SER A . n 
C 3 571 SER 571 577 577 SER SER A . n 
C 3 572 GLN 572 578 ?   ?   ?   A . n 
C 3 573 TRP 573 579 ?   ?   ?   A . n 
C 3 574 VAL 574 580 ?   ?   ?   A . n 
C 3 575 ALA 575 581 ?   ?   ?   A . n 
C 3 576 GLY 576 582 ?   ?   ?   A . n 
C 3 577 GLU 577 583 ?   ?   ?   A . n 
C 3 578 GLN 578 584 584 GLN GLN A . n 
C 3 579 GLN 579 585 585 GLN GLN A . n 
C 3 580 VAL 580 586 586 VAL VAL A . n 
C 3 581 LYS 581 587 587 LYS LYS A . n 
C 3 582 TRP 582 588 588 TRP TRP A . n 
C 3 583 LYS 583 589 589 LYS LYS A . n 
C 3 584 ARG 584 590 590 ARG ARG A . n 
C 3 585 ARG 585 591 591 ARG ARG A . n 
C 3 586 TRP 586 592 592 TRP TRP A . n 
C 3 587 ILE 587 593 593 ILE ILE A . n 
C 3 588 LYS 588 594 594 LYS LYS A . n 
C 3 589 GLY 589 595 595 GLY GLY A . n 
C 3 590 LEU 590 596 596 LEU LEU A . n 
C 3 591 ASP 591 597 597 ASP ASP A . n 
C 3 592 GLY 592 598 598 GLY GLY A . n 
C 3 593 ARG 593 599 599 ARG ARG A . n 
C 3 594 LYS 594 600 600 LYS LYS A . n 
C 3 595 VAL 595 601 601 VAL VAL A . n 
C 3 596 HIS 596 602 602 HIS HIS A . n 
C 3 597 VAL 597 603 603 VAL VAL A . n 
C 3 598 ARG 598 604 604 ARG ARG A . n 
C 3 599 SER 599 605 605 SER SER A . n 
C 3 600 PRO 600 606 606 PRO PRO A . n 
C 3 601 HIS 601 607 607 HIS HIS A . n 
C 3 602 ALA 602 608 608 ALA ALA A . n 
C 3 603 ALA 603 609 609 ALA ALA A . n 
C 3 604 LEU 604 610 610 LEU LEU A . n 
C 3 605 ASN 605 611 611 ASN ASN A . n 
C 3 606 THR 606 612 612 THR THR A . n 
C 3 607 LEU 607 613 613 LEU LEU A . n 
C 3 608 LEU 608 614 614 LEU LEU A . n 
C 3 609 GLN 609 615 615 GLN GLN A . n 
C 3 610 SER 610 616 616 SER SER A . n 
C 3 611 ALA 611 617 617 ALA ALA A . n 
C 3 612 GLY 612 618 618 GLY GLY A . n 
C 3 613 ALA 613 619 619 ALA ALA A . n 
C 3 614 LEU 614 620 620 LEU LEU A . n 
C 3 615 ILE 615 621 621 ILE ILE A . n 
C 3 616 CYS 616 622 622 CYS CYS A . n 
C 3 617 LYS 617 623 623 LYS LYS A . n 
C 3 618 LEU 618 624 624 LEU LEU A . n 
C 3 619 TRP 619 625 625 TRP TRP A . n 
C 3 620 ILE 620 626 626 ILE ILE A . n 
C 3 621 ILE 621 627 627 ILE ILE A . n 
C 3 622 LYS 622 628 628 LYS LYS A . n 
C 3 623 THR 623 629 629 THR THR A . n 
C 3 624 GLU 624 630 630 GLU GLU A . n 
C 3 625 GLU 625 631 631 GLU GLU A . n 
C 3 626 MET 626 632 632 MET MET A . n 
C 3 627 LEU 627 633 633 LEU LEU A . n 
C 3 628 VAL 628 634 634 VAL VAL A . n 
C 3 629 GLU 629 635 635 GLU GLU A . n 
C 3 630 LYS 630 636 636 LYS LYS A . n 
C 3 631 GLY 631 637 637 GLY GLY A . n 
C 3 632 LEU 632 638 638 LEU LEU A . n 
C 3 633 LYS 633 639 639 LYS LYS A . n 
C 3 634 HIS 634 640 640 HIS HIS A . n 
C 3 635 GLY 635 641 641 GLY GLY A . n 
C 3 636 TRP 636 642 642 TRP TRP A . n 
C 3 637 ASP 637 643 643 ASP ASP A . n 
C 3 638 GLY 638 644 644 GLY GLY A . n 
C 3 639 ASP 639 645 645 ASP ASP A . n 
C 3 640 PHE 640 646 646 PHE PHE A . n 
C 3 641 ALA 641 647 647 ALA ALA A . n 
C 3 642 TYR 642 648 648 TYR TYR A . n 
C 3 643 MET 643 649 649 MET MET A . n 
C 3 644 ALA 644 650 650 ALA ALA A . n 
C 3 645 TRP 645 651 651 TRP TRP A . n 
C 3 646 VAL 646 652 652 VAL VAL A . n 
C 3 647 HIS 647 653 653 HIS HIS A . n 
C 3 648 ASP 648 654 654 ASP ASP A . n 
C 3 649 GLU 649 655 655 GLU GLU A . n 
C 3 650 ILE 650 656 656 ILE ILE A . n 
C 3 651 GLN 651 657 657 GLN GLN A . n 
C 3 652 VAL 652 658 658 VAL VAL A . n 
C 3 653 GLY 653 659 659 GLY GLY A . n 
C 3 654 CYS 654 660 660 CYS CYS A . n 
C 3 655 ARG 655 661 661 ARG ARG A . n 
C 3 656 THR 656 662 662 THR THR A . n 
C 3 657 GLU 657 663 663 GLU GLU A . n 
C 3 658 GLU 658 664 664 GLU GLU A . n 
C 3 659 ILE 659 665 665 ILE ILE A . n 
C 3 660 ALA 660 666 666 ALA ALA A . n 
C 3 661 GLN 661 667 667 GLN GLN A . n 
C 3 662 VAL 662 668 668 VAL VAL A . n 
C 3 663 VAL 663 669 669 VAL VAL A . n 
C 3 664 ILE 664 670 670 ILE ILE A . n 
C 3 665 GLU 665 671 671 GLU GLU A . n 
C 3 666 THR 666 672 672 THR THR A . n 
C 3 667 ALA 667 673 673 ALA ALA A . n 
C 3 668 GLN 668 674 674 GLN GLN A . n 
C 3 669 GLU 669 675 675 GLU GLU A . n 
C 3 670 ALA 670 676 676 ALA ALA A . n 
C 3 671 MET 671 677 677 MET MET A . n 
C 3 672 ARG 672 678 678 ARG ARG A . n 
C 3 673 TRP 673 679 679 TRP TRP A . n 
C 3 674 VAL 674 680 680 VAL VAL A . n 
C 3 675 GLY 675 681 681 GLY GLY A . n 
C 3 676 ASP 676 682 682 ASP ASP A . n 
C 3 677 HIS 677 683 683 HIS HIS A . n 
C 3 678 TRP 678 684 684 TRP TRP A . n 
C 3 679 ASN 679 685 685 ASN ASN A . n 
C 3 680 PHE 680 686 686 PHE PHE A . n 
C 3 681 ARG 681 687 687 ARG ARG A . n 
C 3 682 CYS 682 688 688 CYS CYS A . n 
C 3 683 LEU 683 689 689 LEU LEU A . n 
C 3 684 LEU 684 690 690 LEU LEU A . n 
C 3 685 ASP 685 691 691 ASP ASP A . n 
C 3 686 THR 686 692 692 THR THR A . n 
C 3 687 GLU 687 693 693 GLU GLU A . n 
C 3 688 GLY 688 694 694 GLY GLY A . n 
C 3 689 LYS 689 695 695 LYS LYS A . n 
C 3 690 MET 690 696 696 MET MET A . n 
C 3 691 GLY 691 697 697 GLY GLY A . n 
C 3 692 PRO 692 698 698 PRO PRO A . n 
C 3 693 ASN 693 699 699 ASN ASN A . n 
C 3 694 TRP 694 700 700 TRP TRP A . n 
C 3 695 ALA 695 701 701 ALA ALA A . n 
C 3 696 ILE 696 702 702 ILE ILE A . n 
C 3 697 CYS 697 703 703 CYS CYS A . n 
C 3 698 HIS 698 704 704 HIS HIS A . n 
D 4 1   SER 1   1   ?   ?   ?   B . n 
D 4 2   ASP 2   2   ?   ?   ?   B . n 
D 4 3   LYS 3   3   3   LYS LYS B . n 
D 4 4   ILE 4   4   4   ILE ILE B . n 
D 4 5   ILE 5   5   5   ILE ILE B . n 
D 4 6   HIS 6   6   6   HIS HIS B . n 
D 4 7   LEU 7   7   7   LEU LEU B . n 
D 4 8   THR 8   8   8   THR THR B . n 
D 4 9   ASP 9   9   9   ASP ASP B . n 
D 4 10  ASP 10  10  10  ASP ASP B . n 
D 4 11  SER 11  11  11  SER SER B . n 
D 4 12  PHE 12  12  12  PHE PHE B . n 
D 4 13  ASP 13  13  13  ASP ASP B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  LEU 17  17  17  LEU LEU B . n 
D 4 18  LYS 18  18  18  LYS LYS B . n 
D 4 19  ALA 19  19  19  ALA ALA B . n 
D 4 20  ASP 20  20  20  ASP ASP B . n 
D 4 21  GLY 21  21  21  GLY GLY B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  ILE 23  23  23  ILE ILE B . n 
D 4 24  LEU 24  24  24  LEU LEU B . n 
D 4 25  VAL 25  25  25  VAL VAL B . n 
D 4 26  ASP 26  26  26  ASP ASP B . n 
D 4 27  PHE 27  27  27  PHE PHE B . n 
D 4 28  TRP 28  28  28  TRP TRP B . n 
D 4 29  ALA 29  29  29  ALA ALA B . n 
D 4 30  GLU 30  30  30  GLU GLU B . n 
D 4 31  TRP 31  31  31  TRP TRP B . n 
D 4 32  CYS 32  32  32  CYS CYS B . n 
D 4 33  GLY 33  33  33  GLY GLY B . n 
D 4 34  PRO 34  34  34  PRO PRO B . n 
D 4 35  CYS 35  35  35  CYS CYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  MET 37  37  37  MET MET B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  ALA 39  39  39  ALA ALA B . n 
D 4 40  PRO 40  40  40  PRO PRO B . n 
D 4 41  ILE 41  41  41  ILE ILE B . n 
D 4 42  LEU 42  42  42  LEU LEU B . n 
D 4 43  ASP 43  43  43  ASP ASP B . n 
D 4 44  GLU 44  44  44  GLU GLU B . n 
D 4 45  ILE 45  45  45  ILE ILE B . n 
D 4 46  ALA 46  46  46  ALA ALA B . n 
D 4 47  ASP 47  47  47  ASP ASP B . n 
D 4 48  GLU 48  48  48  GLU GLU B . n 
D 4 49  TYR 49  49  49  TYR TYR B . n 
D 4 50  GLN 50  50  50  GLN GLN B . n 
D 4 51  GLY 51  51  51  GLY GLY B . n 
D 4 52  LYS 52  52  52  LYS LYS B . n 
D 4 53  LEU 53  53  53  LEU LEU B . n 
D 4 54  THR 54  54  54  THR THR B . n 
D 4 55  VAL 55  55  55  VAL VAL B . n 
D 4 56  ALA 56  56  56  ALA ALA B . n 
D 4 57  LYS 57  57  57  LYS LYS B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  ASN 59  59  59  ASN ASN B . n 
D 4 60  ILE 60  60  60  ILE ILE B . n 
D 4 61  ASP 61  61  61  ASP ASP B . n 
D 4 62  GLN 62  62  62  GLN GLN B . n 
D 4 63  ASN 63  63  63  ASN ASN B . n 
D 4 64  PRO 64  64  64  PRO PRO B . n 
D 4 65  GLY 65  65  65  GLY GLY B . n 
D 4 66  THR 66  66  66  THR THR B . n 
D 4 67  ALA 67  67  67  ALA ALA B . n 
D 4 68  PRO 68  68  68  PRO PRO B . n 
D 4 69  LYS 69  69  69  LYS LYS B . n 
D 4 70  TYR 70  70  70  TYR TYR B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ILE 72  72  72  ILE ILE B . n 
D 4 73  ARG 73  73  73  ARG ARG B . n 
D 4 74  GLY 74  74  74  GLY GLY B . n 
D 4 75  ILE 75  75  75  ILE ILE B . n 
D 4 76  PRO 76  76  76  PRO PRO B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  LEU 78  78  78  LEU LEU B . n 
D 4 79  LEU 79  79  79  LEU LEU B . n 
D 4 80  LEU 80  80  80  LEU LEU B . n 
D 4 81  PHE 81  81  81  PHE PHE B . n 
D 4 82  LYS 82  82  82  LYS LYS B . n 
D 4 83  ASN 83  83  83  ASN ASN B . n 
D 4 84  GLY 84  84  84  GLY GLY B . n 
D 4 85  GLU 85  85  85  GLU GLU B . n 
D 4 86  VAL 86  86  86  VAL VAL B . n 
D 4 87  ALA 87  87  87  ALA ALA B . n 
D 4 88  ALA 88  88  88  ALA ALA B . n 
D 4 89  THR 89  89  89  THR THR B . n 
D 4 90  LYS 90  90  90  LYS LYS B . n 
D 4 91  VAL 91  91  91  VAL VAL B . n 
D 4 92  GLY 92  92  92  GLY GLY B . n 
D 4 93  ALA 93  93  93  ALA ALA B . n 
D 4 94  LEU 94  94  94  LEU LEU B . n 
D 4 95  SER 95  95  95  SER SER B . n 
D 4 96  LYS 96  96  96  LYS LYS B . n 
D 4 97  GLY 97  97  97  GLY GLY B . n 
D 4 98  GLN 98  98  98  GLN GLN B . n 
D 4 99  LEU 99  99  99  LEU LEU B . n 
D 4 100 LYS 100 100 100 LYS LYS B . n 
D 4 101 GLU 101 101 101 GLU GLU B . n 
D 4 102 PHE 102 102 102 PHE PHE B . n 
D 4 103 LEU 103 103 103 LEU LEU B . n 
D 4 104 ASP 104 104 104 ASP ASP B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASN 106 106 106 ASN ASN B . n 
D 4 107 LEU 107 107 107 LEU LEU B . n 
D 4 108 ALA 108 108 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  MG  1   991  991  MG  MG2 A . 
F 5  MG  1   992  992  MG  MG2 A . 
G 5  MG  1   993  993  MG  MG2 A . 
H 6  SO4 1   994  994  SO4 SO4 A . 
I 6  SO4 1   995  995  SO4 SO4 A . 
J 7  DCT 1   823  823  DCT DC3 A . 
K 8  1PE 1   901  901  1PE 1PE A . 
L 9  MES 1   902  902  MES MES A . 
M 10 HOH 1   1007 1007 HOH HOH P . 
M 10 HOH 2   1145 1145 HOH HOH P . 
M 10 HOH 3   1235 1235 HOH HOH P . 
M 10 HOH 4   1283 1283 HOH HOH P . 
M 10 HOH 5   1294 1294 HOH HOH P . 
M 10 HOH 6   1342 1342 HOH HOH P . 
M 10 HOH 7   1355 1355 HOH HOH P . 
M 10 HOH 8   1409 1409 HOH HOH P . 
M 10 HOH 9   1421 1421 HOH HOH P . 
M 10 HOH 10  1432 1432 HOH HOH P . 
M 10 HOH 11  1459 1459 HOH HOH P . 
M 10 HOH 12  1478 1478 HOH HOH P . 
M 10 HOH 13  1515 1515 HOH HOH P . 
M 10 HOH 14  1607 1607 HOH HOH P . 
M 10 HOH 15  1619 1619 HOH HOH P . 
M 10 HOH 16  1650 1650 HOH HOH P . 
M 10 HOH 17  1652 1652 HOH HOH P . 
M 10 HOH 18  1653 1653 HOH HOH P . 
N 10 HOH 1   1057 1057 HOH HOH T . 
N 10 HOH 2   1077 1077 HOH HOH T . 
N 10 HOH 3   1091 1091 HOH HOH T . 
N 10 HOH 4   1102 1102 HOH HOH T . 
N 10 HOH 5   1110 1110 HOH HOH T . 
N 10 HOH 6   1136 1136 HOH HOH T . 
N 10 HOH 7   1141 1141 HOH HOH T . 
N 10 HOH 8   1171 1171 HOH HOH T . 
N 10 HOH 9   1203 1203 HOH HOH T . 
N 10 HOH 10  1207 1207 HOH HOH T . 
N 10 HOH 11  1228 1228 HOH HOH T . 
N 10 HOH 12  1238 1238 HOH HOH T . 
N 10 HOH 13  1241 1241 HOH HOH T . 
N 10 HOH 14  1243 1243 HOH HOH T . 
N 10 HOH 15  1248 1248 HOH HOH T . 
N 10 HOH 16  1252 1252 HOH HOH T . 
N 10 HOH 17  1339 1339 HOH HOH T . 
N 10 HOH 18  1350 1350 HOH HOH T . 
N 10 HOH 19  1397 1397 HOH HOH T . 
N 10 HOH 20  1404 1404 HOH HOH T . 
N 10 HOH 21  1456 1456 HOH HOH T . 
N 10 HOH 22  1553 1553 HOH HOH T . 
N 10 HOH 23  1581 1581 HOH HOH T . 
N 10 HOH 24  1592 1592 HOH HOH T . 
N 10 HOH 25  1601 1601 HOH HOH T . 
N 10 HOH 26  1625 1625 HOH HOH T . 
N 10 HOH 27  1636 1636 HOH HOH T . 
O 10 HOH 1   1004 1004 HOH HOH A . 
O 10 HOH 2   1005 1005 HOH HOH A . 
O 10 HOH 3   1006 1006 HOH HOH A . 
O 10 HOH 4   1008 1008 HOH HOH A . 
O 10 HOH 5   1009 1009 HOH HOH A . 
O 10 HOH 6   1010 1010 HOH HOH A . 
O 10 HOH 7   1012 1012 HOH HOH A . 
O 10 HOH 8   1013 1013 HOH HOH A . 
O 10 HOH 9   1014 1014 HOH HOH A . 
O 10 HOH 10  1015 1015 HOH HOH A . 
O 10 HOH 11  1016 1016 HOH HOH A . 
O 10 HOH 12  1019 1019 HOH HOH A . 
O 10 HOH 13  1020 1020 HOH HOH A . 
O 10 HOH 14  1022 1022 HOH HOH A . 
O 10 HOH 15  1024 1024 HOH HOH A . 
O 10 HOH 16  1025 1025 HOH HOH A . 
O 10 HOH 17  1026 1026 HOH HOH A . 
O 10 HOH 18  1027 1027 HOH HOH A . 
O 10 HOH 19  1028 1028 HOH HOH A . 
O 10 HOH 20  1029 1029 HOH HOH A . 
O 10 HOH 21  1030 1030 HOH HOH A . 
O 10 HOH 22  1031 1031 HOH HOH A . 
O 10 HOH 23  1032 1032 HOH HOH A . 
O 10 HOH 24  1033 1033 HOH HOH A . 
O 10 HOH 25  1034 1034 HOH HOH A . 
O 10 HOH 26  1035 1035 HOH HOH A . 
O 10 HOH 27  1036 1036 HOH HOH A . 
O 10 HOH 28  1037 1037 HOH HOH A . 
O 10 HOH 29  1038 1038 HOH HOH A . 
O 10 HOH 30  1040 1040 HOH HOH A . 
O 10 HOH 31  1041 1041 HOH HOH A . 
O 10 HOH 32  1042 1042 HOH HOH A . 
O 10 HOH 33  1043 1043 HOH HOH A . 
O 10 HOH 34  1044 1044 HOH HOH A . 
O 10 HOH 35  1045 1045 HOH HOH A . 
O 10 HOH 36  1046 1046 HOH HOH A . 
O 10 HOH 37  1048 1048 HOH HOH A . 
O 10 HOH 38  1049 1049 HOH HOH A . 
O 10 HOH 39  1050 1050 HOH HOH A . 
O 10 HOH 40  1051 1051 HOH HOH A . 
O 10 HOH 41  1052 1052 HOH HOH A . 
O 10 HOH 42  1053 1053 HOH HOH A . 
O 10 HOH 43  1054 1054 HOH HOH A . 
O 10 HOH 44  1055 1055 HOH HOH A . 
O 10 HOH 45  1056 1056 HOH HOH A . 
O 10 HOH 46  1058 1058 HOH HOH A . 
O 10 HOH 47  1059 1059 HOH HOH A . 
O 10 HOH 48  1060 1060 HOH HOH A . 
O 10 HOH 49  1061 1061 HOH HOH A . 
O 10 HOH 50  1062 1062 HOH HOH A . 
O 10 HOH 51  1063 1063 HOH HOH A . 
O 10 HOH 52  1065 1065 HOH HOH A . 
O 10 HOH 53  1066 1066 HOH HOH A . 
O 10 HOH 54  1067 1067 HOH HOH A . 
O 10 HOH 55  1068 1068 HOH HOH A . 
O 10 HOH 56  1069 1069 HOH HOH A . 
O 10 HOH 57  1070 1070 HOH HOH A . 
O 10 HOH 58  1071 1071 HOH HOH A . 
O 10 HOH 59  1072 1072 HOH HOH A . 
O 10 HOH 60  1073 1073 HOH HOH A . 
O 10 HOH 61  1074 1074 HOH HOH A . 
O 10 HOH 62  1075 1075 HOH HOH A . 
O 10 HOH 63  1076 1076 HOH HOH A . 
O 10 HOH 64  1078 1078 HOH HOH A . 
O 10 HOH 65  1079 1079 HOH HOH A . 
O 10 HOH 66  1080 1080 HOH HOH A . 
O 10 HOH 67  1081 1081 HOH HOH A . 
O 10 HOH 68  1082 1082 HOH HOH A . 
O 10 HOH 69  1083 1083 HOH HOH A . 
O 10 HOH 70  1084 1084 HOH HOH A . 
O 10 HOH 71  1085 1085 HOH HOH A . 
O 10 HOH 72  1087 1087 HOH HOH A . 
O 10 HOH 73  1088 1088 HOH HOH A . 
O 10 HOH 74  1089 1089 HOH HOH A . 
O 10 HOH 75  1090 1090 HOH HOH A . 
O 10 HOH 76  1092 1092 HOH HOH A . 
O 10 HOH 77  1093 1093 HOH HOH A . 
O 10 HOH 78  1094 1094 HOH HOH A . 
O 10 HOH 79  1098 1098 HOH HOH A . 
O 10 HOH 80  1099 1099 HOH HOH A . 
O 10 HOH 81  1100 1100 HOH HOH A . 
O 10 HOH 82  1101 1101 HOH HOH A . 
O 10 HOH 83  1103 1103 HOH HOH A . 
O 10 HOH 84  1104 1104 HOH HOH A . 
O 10 HOH 85  1105 1105 HOH HOH A . 
O 10 HOH 86  1106 1106 HOH HOH A . 
O 10 HOH 87  1107 1107 HOH HOH A . 
O 10 HOH 88  1108 1108 HOH HOH A . 
O 10 HOH 89  1109 1109 HOH HOH A . 
O 10 HOH 90  1111 1111 HOH HOH A . 
O 10 HOH 91  1113 1113 HOH HOH A . 
O 10 HOH 92  1114 1114 HOH HOH A . 
O 10 HOH 93  1115 1115 HOH HOH A . 
O 10 HOH 94  1116 1116 HOH HOH A . 
O 10 HOH 95  1117 1117 HOH HOH A . 
O 10 HOH 96  1119 1119 HOH HOH A . 
O 10 HOH 97  1120 1120 HOH HOH A . 
O 10 HOH 98  1122 1122 HOH HOH A . 
O 10 HOH 99  1123 1123 HOH HOH A . 
O 10 HOH 100 1124 1124 HOH HOH A . 
O 10 HOH 101 1125 1125 HOH HOH A . 
O 10 HOH 102 1126 1126 HOH HOH A . 
O 10 HOH 103 1127 1127 HOH HOH A . 
O 10 HOH 104 1128 1128 HOH HOH A . 
O 10 HOH 105 1129 1129 HOH HOH A . 
O 10 HOH 106 1130 1130 HOH HOH A . 
O 10 HOH 107 1131 1131 HOH HOH A . 
O 10 HOH 108 1132 1132 HOH HOH A . 
O 10 HOH 109 1133 1133 HOH HOH A . 
O 10 HOH 110 1134 1134 HOH HOH A . 
O 10 HOH 111 1135 1135 HOH HOH A . 
O 10 HOH 112 1137 1137 HOH HOH A . 
O 10 HOH 113 1138 1138 HOH HOH A . 
O 10 HOH 114 1140 1140 HOH HOH A . 
O 10 HOH 115 1142 1142 HOH HOH A . 
O 10 HOH 116 1143 1143 HOH HOH A . 
O 10 HOH 117 1144 1144 HOH HOH A . 
O 10 HOH 118 1146 1146 HOH HOH A . 
O 10 HOH 119 1147 1147 HOH HOH A . 
O 10 HOH 120 1149 1149 HOH HOH A . 
O 10 HOH 121 1150 1150 HOH HOH A . 
O 10 HOH 122 1151 1151 HOH HOH A . 
O 10 HOH 123 1152 1152 HOH HOH A . 
O 10 HOH 124 1153 1153 HOH HOH A . 
O 10 HOH 125 1154 1154 HOH HOH A . 
O 10 HOH 126 1155 1155 HOH HOH A . 
O 10 HOH 127 1157 1157 HOH HOH A . 
O 10 HOH 128 1158 1158 HOH HOH A . 
O 10 HOH 129 1159 1159 HOH HOH A . 
O 10 HOH 130 1160 1160 HOH HOH A . 
O 10 HOH 131 1161 1161 HOH HOH A . 
O 10 HOH 132 1162 1162 HOH HOH A . 
O 10 HOH 133 1163 1163 HOH HOH A . 
O 10 HOH 134 1164 1164 HOH HOH A . 
O 10 HOH 135 1167 1167 HOH HOH A . 
O 10 HOH 136 1168 1168 HOH HOH A . 
O 10 HOH 137 1169 1169 HOH HOH A . 
O 10 HOH 138 1170 1170 HOH HOH A . 
O 10 HOH 139 1172 1172 HOH HOH A . 
O 10 HOH 140 1173 1173 HOH HOH A . 
O 10 HOH 141 1174 1174 HOH HOH A . 
O 10 HOH 142 1175 1175 HOH HOH A . 
O 10 HOH 143 1176 1176 HOH HOH A . 
O 10 HOH 144 1177 1177 HOH HOH A . 
O 10 HOH 145 1178 1178 HOH HOH A . 
O 10 HOH 146 1180 1180 HOH HOH A . 
O 10 HOH 147 1181 1181 HOH HOH A . 
O 10 HOH 148 1182 1182 HOH HOH A . 
O 10 HOH 149 1184 1184 HOH HOH A . 
O 10 HOH 150 1185 1185 HOH HOH A . 
O 10 HOH 151 1187 1187 HOH HOH A . 
O 10 HOH 152 1188 1188 HOH HOH A . 
O 10 HOH 153 1191 1191 HOH HOH A . 
O 10 HOH 154 1192 1192 HOH HOH A . 
O 10 HOH 155 1193 1193 HOH HOH A . 
O 10 HOH 156 1194 1194 HOH HOH A . 
O 10 HOH 157 1195 1195 HOH HOH A . 
O 10 HOH 158 1196 1196 HOH HOH A . 
O 10 HOH 159 1197 1197 HOH HOH A . 
O 10 HOH 160 1198 1198 HOH HOH A . 
O 10 HOH 161 1200 1200 HOH HOH A . 
O 10 HOH 162 1201 1201 HOH HOH A . 
O 10 HOH 163 1202 1202 HOH HOH A . 
O 10 HOH 164 1204 1204 HOH HOH A . 
O 10 HOH 165 1208 1208 HOH HOH A . 
O 10 HOH 166 1209 1209 HOH HOH A . 
O 10 HOH 167 1210 1210 HOH HOH A . 
O 10 HOH 168 1212 1212 HOH HOH A . 
O 10 HOH 169 1218 1218 HOH HOH A . 
O 10 HOH 170 1219 1219 HOH HOH A . 
O 10 HOH 171 1220 1220 HOH HOH A . 
O 10 HOH 172 1221 1221 HOH HOH A . 
O 10 HOH 173 1222 1222 HOH HOH A . 
O 10 HOH 174 1223 1223 HOH HOH A . 
O 10 HOH 175 1224 1224 HOH HOH A . 
O 10 HOH 176 1226 1226 HOH HOH A . 
O 10 HOH 177 1227 1227 HOH HOH A . 
O 10 HOH 178 1230 1230 HOH HOH A . 
O 10 HOH 179 1231 1231 HOH HOH A . 
O 10 HOH 180 1232 1232 HOH HOH A . 
O 10 HOH 181 1233 1233 HOH HOH A . 
O 10 HOH 182 1234 1234 HOH HOH A . 
O 10 HOH 183 1236 1236 HOH HOH A . 
O 10 HOH 184 1240 1240 HOH HOH A . 
O 10 HOH 185 1244 1244 HOH HOH A . 
O 10 HOH 186 1245 1245 HOH HOH A . 
O 10 HOH 187 1246 1246 HOH HOH A . 
O 10 HOH 188 1249 1249 HOH HOH A . 
O 10 HOH 189 1250 1250 HOH HOH A . 
O 10 HOH 190 1253 1253 HOH HOH A . 
O 10 HOH 191 1254 1254 HOH HOH A . 
O 10 HOH 192 1255 1255 HOH HOH A . 
O 10 HOH 193 1256 1256 HOH HOH A . 
O 10 HOH 194 1257 1257 HOH HOH A . 
O 10 HOH 195 1258 1258 HOH HOH A . 
O 10 HOH 196 1261 1261 HOH HOH A . 
O 10 HOH 197 1262 1262 HOH HOH A . 
O 10 HOH 198 1263 1263 HOH HOH A . 
O 10 HOH 199 1264 1264 HOH HOH A . 
O 10 HOH 200 1267 1267 HOH HOH A . 
O 10 HOH 201 1268 1268 HOH HOH A . 
O 10 HOH 202 1269 1269 HOH HOH A . 
O 10 HOH 203 1270 1270 HOH HOH A . 
O 10 HOH 204 1271 1271 HOH HOH A . 
O 10 HOH 205 1272 1272 HOH HOH A . 
O 10 HOH 206 1274 1274 HOH HOH A . 
O 10 HOH 207 1275 1275 HOH HOH A . 
O 10 HOH 208 1276 1276 HOH HOH A . 
O 10 HOH 209 1277 1277 HOH HOH A . 
O 10 HOH 210 1279 1279 HOH HOH A . 
O 10 HOH 211 1280 1280 HOH HOH A . 
O 10 HOH 212 1281 1281 HOH HOH A . 
O 10 HOH 213 1282 1282 HOH HOH A . 
O 10 HOH 214 1284 1284 HOH HOH A . 
O 10 HOH 215 1285 1285 HOH HOH A . 
O 10 HOH 216 1286 1286 HOH HOH A . 
O 10 HOH 217 1287 1287 HOH HOH A . 
O 10 HOH 218 1288 1288 HOH HOH A . 
O 10 HOH 219 1289 1289 HOH HOH A . 
O 10 HOH 220 1290 1290 HOH HOH A . 
O 10 HOH 221 1291 1291 HOH HOH A . 
O 10 HOH 222 1293 1293 HOH HOH A . 
O 10 HOH 223 1295 1295 HOH HOH A . 
O 10 HOH 224 1296 1296 HOH HOH A . 
O 10 HOH 225 1297 1297 HOH HOH A . 
O 10 HOH 226 1298 1298 HOH HOH A . 
O 10 HOH 227 1299 1299 HOH HOH A . 
O 10 HOH 228 1300 1300 HOH HOH A . 
O 10 HOH 229 1301 1301 HOH HOH A . 
O 10 HOH 230 1303 1303 HOH HOH A . 
O 10 HOH 231 1304 1304 HOH HOH A . 
O 10 HOH 232 1305 1305 HOH HOH A . 
O 10 HOH 233 1308 1308 HOH HOH A . 
O 10 HOH 234 1309 1309 HOH HOH A . 
O 10 HOH 235 1310 1310 HOH HOH A . 
O 10 HOH 236 1311 1311 HOH HOH A . 
O 10 HOH 237 1312 1312 HOH HOH A . 
O 10 HOH 238 1313 1313 HOH HOH A . 
O 10 HOH 239 1314 1314 HOH HOH A . 
O 10 HOH 240 1315 1315 HOH HOH A . 
O 10 HOH 241 1316 1316 HOH HOH A . 
O 10 HOH 242 1317 1317 HOH HOH A . 
O 10 HOH 243 1318 1318 HOH HOH A . 
O 10 HOH 244 1319 1319 HOH HOH A . 
O 10 HOH 245 1320 1320 HOH HOH A . 
O 10 HOH 246 1321 1321 HOH HOH A . 
O 10 HOH 247 1322 1322 HOH HOH A . 
O 10 HOH 248 1323 1323 HOH HOH A . 
O 10 HOH 249 1326 1326 HOH HOH A . 
O 10 HOH 250 1328 1328 HOH HOH A . 
O 10 HOH 251 1329 1329 HOH HOH A . 
O 10 HOH 252 1330 1330 HOH HOH A . 
O 10 HOH 253 1331 1331 HOH HOH A . 
O 10 HOH 254 1332 1332 HOH HOH A . 
O 10 HOH 255 1333 1333 HOH HOH A . 
O 10 HOH 256 1335 1335 HOH HOH A . 
O 10 HOH 257 1338 1338 HOH HOH A . 
O 10 HOH 258 1340 1340 HOH HOH A . 
O 10 HOH 259 1341 1341 HOH HOH A . 
O 10 HOH 260 1343 1343 HOH HOH A . 
O 10 HOH 261 1344 1344 HOH HOH A . 
O 10 HOH 262 1345 1345 HOH HOH A . 
O 10 HOH 263 1346 1346 HOH HOH A . 
O 10 HOH 264 1347 1347 HOH HOH A . 
O 10 HOH 265 1349 1349 HOH HOH A . 
O 10 HOH 266 1351 1351 HOH HOH A . 
O 10 HOH 267 1352 1352 HOH HOH A . 
O 10 HOH 268 1353 1353 HOH HOH A . 
O 10 HOH 269 1354 1354 HOH HOH A . 
O 10 HOH 270 1356 1356 HOH HOH A . 
O 10 HOH 271 1357 1357 HOH HOH A . 
O 10 HOH 272 1358 1358 HOH HOH A . 
O 10 HOH 273 1359 1359 HOH HOH A . 
O 10 HOH 274 1361 1361 HOH HOH A . 
O 10 HOH 275 1362 1362 HOH HOH A . 
O 10 HOH 276 1363 1363 HOH HOH A . 
O 10 HOH 277 1364 1364 HOH HOH A . 
O 10 HOH 278 1365 1365 HOH HOH A . 
O 10 HOH 279 1366 1366 HOH HOH A . 
O 10 HOH 280 1368 1368 HOH HOH A . 
O 10 HOH 281 1369 1369 HOH HOH A . 
O 10 HOH 282 1371 1371 HOH HOH A . 
O 10 HOH 283 1374 1374 HOH HOH A . 
O 10 HOH 284 1375 1375 HOH HOH A . 
O 10 HOH 285 1376 1376 HOH HOH A . 
O 10 HOH 286 1378 1378 HOH HOH A . 
O 10 HOH 287 1379 1379 HOH HOH A . 
O 10 HOH 288 1381 1381 HOH HOH A . 
O 10 HOH 289 1382 1382 HOH HOH A . 
O 10 HOH 290 1383 1383 HOH HOH A . 
O 10 HOH 291 1384 1384 HOH HOH A . 
O 10 HOH 292 1385 1385 HOH HOH A . 
O 10 HOH 293 1386 1386 HOH HOH A . 
O 10 HOH 294 1388 1388 HOH HOH A . 
O 10 HOH 295 1389 1389 HOH HOH A . 
O 10 HOH 296 1390 1390 HOH HOH A . 
O 10 HOH 297 1391 1391 HOH HOH A . 
O 10 HOH 298 1392 1392 HOH HOH A . 
O 10 HOH 299 1393 1393 HOH HOH A . 
O 10 HOH 300 1396 1396 HOH HOH A . 
O 10 HOH 301 1398 1398 HOH HOH A . 
O 10 HOH 302 1399 1399 HOH HOH A . 
O 10 HOH 303 1400 1400 HOH HOH A . 
O 10 HOH 304 1401 1401 HOH HOH A . 
O 10 HOH 305 1405 1405 HOH HOH A . 
O 10 HOH 306 1406 1406 HOH HOH A . 
O 10 HOH 307 1407 1407 HOH HOH A . 
O 10 HOH 308 1411 1411 HOH HOH A . 
O 10 HOH 309 1412 1412 HOH HOH A . 
O 10 HOH 310 1413 1413 HOH HOH A . 
O 10 HOH 311 1414 1414 HOH HOH A . 
O 10 HOH 312 1415 1415 HOH HOH A . 
O 10 HOH 313 1416 1416 HOH HOH A . 
O 10 HOH 314 1418 1418 HOH HOH A . 
O 10 HOH 315 1419 1419 HOH HOH A . 
O 10 HOH 316 1420 1420 HOH HOH A . 
O 10 HOH 317 1424 1424 HOH HOH A . 
O 10 HOH 318 1425 1425 HOH HOH A . 
O 10 HOH 319 1426 1426 HOH HOH A . 
O 10 HOH 320 1428 1428 HOH HOH A . 
O 10 HOH 321 1429 1429 HOH HOH A . 
O 10 HOH 322 1430 1430 HOH HOH A . 
O 10 HOH 323 1431 1431 HOH HOH A . 
O 10 HOH 324 1433 1433 HOH HOH A . 
O 10 HOH 325 1434 1434 HOH HOH A . 
O 10 HOH 326 1435 1435 HOH HOH A . 
O 10 HOH 327 1437 1437 HOH HOH A . 
O 10 HOH 328 1438 1438 HOH HOH A . 
O 10 HOH 329 1439 1439 HOH HOH A . 
O 10 HOH 330 1440 1440 HOH HOH A . 
O 10 HOH 331 1441 1441 HOH HOH A . 
O 10 HOH 332 1444 1444 HOH HOH A . 
O 10 HOH 333 1445 1445 HOH HOH A . 
O 10 HOH 334 1447 1447 HOH HOH A . 
O 10 HOH 335 1449 1449 HOH HOH A . 
O 10 HOH 336 1450 1450 HOH HOH A . 
O 10 HOH 337 1452 1452 HOH HOH A . 
O 10 HOH 338 1453 1453 HOH HOH A . 
O 10 HOH 339 1454 1454 HOH HOH A . 
O 10 HOH 340 1455 1455 HOH HOH A . 
O 10 HOH 341 1457 1457 HOH HOH A . 
O 10 HOH 342 1458 1458 HOH HOH A . 
O 10 HOH 343 1460 1460 HOH HOH A . 
O 10 HOH 344 1461 1461 HOH HOH A . 
O 10 HOH 345 1462 1462 HOH HOH A . 
O 10 HOH 346 1463 1463 HOH HOH A . 
O 10 HOH 347 1464 1464 HOH HOH A . 
O 10 HOH 348 1466 1466 HOH HOH A . 
O 10 HOH 349 1467 1467 HOH HOH A . 
O 10 HOH 350 1468 1468 HOH HOH A . 
O 10 HOH 351 1470 1470 HOH HOH A . 
O 10 HOH 352 1472 1472 HOH HOH A . 
O 10 HOH 353 1473 1473 HOH HOH A . 
O 10 HOH 354 1474 1474 HOH HOH A . 
O 10 HOH 355 1475 1475 HOH HOH A . 
O 10 HOH 356 1476 1476 HOH HOH A . 
O 10 HOH 357 1479 1479 HOH HOH A . 
O 10 HOH 358 1481 1481 HOH HOH A . 
O 10 HOH 359 1482 1482 HOH HOH A . 
O 10 HOH 360 1483 1483 HOH HOH A . 
O 10 HOH 361 1485 1485 HOH HOH A . 
O 10 HOH 362 1486 1486 HOH HOH A . 
O 10 HOH 363 1487 1487 HOH HOH A . 
O 10 HOH 364 1489 1489 HOH HOH A . 
O 10 HOH 365 1490 1490 HOH HOH A . 
O 10 HOH 366 1492 1492 HOH HOH A . 
O 10 HOH 367 1494 1494 HOH HOH A . 
O 10 HOH 368 1495 1495 HOH HOH A . 
O 10 HOH 369 1497 1497 HOH HOH A . 
O 10 HOH 370 1499 1499 HOH HOH A . 
O 10 HOH 371 1500 1500 HOH HOH A . 
O 10 HOH 372 1504 1504 HOH HOH A . 
O 10 HOH 373 1505 1505 HOH HOH A . 
O 10 HOH 374 1506 1506 HOH HOH A . 
O 10 HOH 375 1508 1508 HOH HOH A . 
O 10 HOH 376 1509 1509 HOH HOH A . 
O 10 HOH 377 1510 1510 HOH HOH A . 
O 10 HOH 378 1511 1511 HOH HOH A . 
O 10 HOH 379 1512 1512 HOH HOH A . 
O 10 HOH 380 1513 1513 HOH HOH A . 
O 10 HOH 381 1514 1514 HOH HOH A . 
O 10 HOH 382 1516 1516 HOH HOH A . 
O 10 HOH 383 1517 1517 HOH HOH A . 
O 10 HOH 384 1518 1518 HOH HOH A . 
O 10 HOH 385 1519 1519 HOH HOH A . 
O 10 HOH 386 1520 1520 HOH HOH A . 
O 10 HOH 387 1521 1521 HOH HOH A . 
O 10 HOH 388 1522 1522 HOH HOH A . 
O 10 HOH 389 1526 1526 HOH HOH A . 
O 10 HOH 390 1529 1529 HOH HOH A . 
O 10 HOH 391 1531 1531 HOH HOH A . 
O 10 HOH 392 1532 1532 HOH HOH A . 
O 10 HOH 393 1534 1534 HOH HOH A . 
O 10 HOH 394 1535 1535 HOH HOH A . 
O 10 HOH 395 1536 1536 HOH HOH A . 
O 10 HOH 396 1538 1538 HOH HOH A . 
O 10 HOH 397 1539 1539 HOH HOH A . 
O 10 HOH 398 1540 1540 HOH HOH A . 
O 10 HOH 399 1541 1541 HOH HOH A . 
O 10 HOH 400 1542 1542 HOH HOH A . 
O 10 HOH 401 1543 1543 HOH HOH A . 
O 10 HOH 402 1544 1544 HOH HOH A . 
O 10 HOH 403 1546 1546 HOH HOH A . 
O 10 HOH 404 1547 1547 HOH HOH A . 
O 10 HOH 405 1548 1548 HOH HOH A . 
O 10 HOH 406 1549 1549 HOH HOH A . 
O 10 HOH 407 1550 1550 HOH HOH A . 
O 10 HOH 408 1551 1551 HOH HOH A . 
O 10 HOH 409 1552 1552 HOH HOH A . 
O 10 HOH 410 1554 1554 HOH HOH A . 
O 10 HOH 411 1556 1556 HOH HOH A . 
O 10 HOH 412 1557 1557 HOH HOH A . 
O 10 HOH 413 1558 1558 HOH HOH A . 
O 10 HOH 414 1560 1560 HOH HOH A . 
O 10 HOH 415 1562 1562 HOH HOH A . 
O 10 HOH 416 1563 1563 HOH HOH A . 
O 10 HOH 417 1565 1565 HOH HOH A . 
O 10 HOH 418 1566 1566 HOH HOH A . 
O 10 HOH 419 1567 1567 HOH HOH A . 
O 10 HOH 420 1568 1568 HOH HOH A . 
O 10 HOH 421 1569 1569 HOH HOH A . 
O 10 HOH 422 1570 1570 HOH HOH A . 
O 10 HOH 423 1571 1571 HOH HOH A . 
O 10 HOH 424 1572 1572 HOH HOH A . 
O 10 HOH 425 1574 1574 HOH HOH A . 
O 10 HOH 426 1575 1575 HOH HOH A . 
O 10 HOH 427 1576 1576 HOH HOH A . 
O 10 HOH 428 1578 1578 HOH HOH A . 
O 10 HOH 429 1582 1582 HOH HOH A . 
O 10 HOH 430 1585 1585 HOH HOH A . 
O 10 HOH 431 1586 1586 HOH HOH A . 
O 10 HOH 432 1587 1587 HOH HOH A . 
O 10 HOH 433 1590 1590 HOH HOH A . 
O 10 HOH 434 1591 1591 HOH HOH A . 
O 10 HOH 435 1593 1593 HOH HOH A . 
O 10 HOH 436 1594 1594 HOH HOH A . 
O 10 HOH 437 1602 1602 HOH HOH A . 
O 10 HOH 438 1603 1603 HOH HOH A . 
O 10 HOH 439 1604 1604 HOH HOH A . 
O 10 HOH 440 1606 1606 HOH HOH A . 
O 10 HOH 441 1614 1614 HOH HOH A . 
O 10 HOH 442 1615 1615 HOH HOH A . 
O 10 HOH 443 1616 1616 HOH HOH A . 
O 10 HOH 444 1617 1617 HOH HOH A . 
O 10 HOH 445 1618 1618 HOH HOH A . 
O 10 HOH 446 1620 1620 HOH HOH A . 
O 10 HOH 447 1621 1621 HOH HOH A . 
O 10 HOH 448 1622 1622 HOH HOH A . 
O 10 HOH 449 1623 1623 HOH HOH A . 
O 10 HOH 450 1624 1624 HOH HOH A . 
O 10 HOH 451 1626 1626 HOH HOH A . 
O 10 HOH 452 1628 1628 HOH HOH A . 
O 10 HOH 453 1629 1629 HOH HOH A . 
O 10 HOH 454 1633 1633 HOH HOH A . 
O 10 HOH 455 1635 1635 HOH HOH A . 
O 10 HOH 456 1638 1638 HOH HOH A . 
O 10 HOH 457 1643 1643 HOH HOH A . 
O 10 HOH 458 1646 1646 HOH HOH A . 
O 10 HOH 459 1647 1647 HOH HOH A . 
O 10 HOH 460 1649 1649 HOH HOH A . 
O 10 HOH 461 1654 1654 HOH HOH A . 
P 10 HOH 1   1017 1017 HOH HOH B . 
P 10 HOH 2   1112 1112 HOH HOH B . 
P 10 HOH 3   1148 1148 HOH HOH B . 
P 10 HOH 4   1156 1156 HOH HOH B . 
P 10 HOH 5   1165 1165 HOH HOH B . 
P 10 HOH 6   1190 1190 HOH HOH B . 
P 10 HOH 7   1199 1199 HOH HOH B . 
P 10 HOH 8   1205 1205 HOH HOH B . 
P 10 HOH 9   1206 1206 HOH HOH B . 
P 10 HOH 10  1225 1225 HOH HOH B . 
P 10 HOH 11  1239 1239 HOH HOH B . 
P 10 HOH 12  1247 1247 HOH HOH B . 
P 10 HOH 13  1260 1260 HOH HOH B . 
P 10 HOH 14  1266 1266 HOH HOH B . 
P 10 HOH 15  1273 1273 HOH HOH B . 
P 10 HOH 16  1325 1325 HOH HOH B . 
P 10 HOH 17  1360 1360 HOH HOH B . 
P 10 HOH 18  1387 1387 HOH HOH B . 
P 10 HOH 19  1408 1408 HOH HOH B . 
P 10 HOH 20  1410 1410 HOH HOH B . 
P 10 HOH 21  1427 1427 HOH HOH B . 
P 10 HOH 22  1469 1469 HOH HOH B . 
P 10 HOH 23  1503 1503 HOH HOH B . 
P 10 HOH 24  1524 1524 HOH HOH B . 
P 10 HOH 25  1580 1580 HOH HOH B . 
P 10 HOH 26  1588 1588 HOH HOH B . 
P 10 HOH 27  1612 1612 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A DDG 22 P DDG 822 ? DG ? 
2 B 8OG 4  T 8OG 854 ? DG ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O   ? C ALA 470 ? A ALA 476  ? 1_555 83.3  ? 
2  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 90.0  ? 
3  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 97.3  ? 
4  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O2A ? J DCT .   ? A DCT 823  ? 1_555 106.1 ? 
5  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O2A ? J DCT .   ? A DCT 823  ? 1_555 167.3 ? 
6  OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O2A ? J DCT .   ? A DCT 823  ? 1_555 74.6  ? 
7  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O2B ? J DCT .   ? A DCT 823  ? 1_555 172.5 ? 
8  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O2B ? J DCT .   ? A DCT 823  ? 1_555 89.6  ? 
9  OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O2B ? J DCT .   ? A DCT 823  ? 1_555 93.4  ? 
10 O2A ? J DCT .   ? A DCT 823  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O2B ? J DCT .   ? A DCT 823  ? 1_555 81.2  ? 
11 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O1G ? J DCT .   ? A DCT 823  ? 1_555 92.2  ? 
12 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O1G ? J DCT .   ? A DCT 823  ? 1_555 99.2  ? 
13 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O1G ? J DCT .   ? A DCT 823  ? 1_555 163.5 ? 
14 O2A ? J DCT .   ? A DCT 823  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O1G ? J DCT .   ? A DCT 823  ? 1_555 89.1  ? 
15 O2B ? J DCT .   ? A DCT 823  ? 1_555 MG ? E MG . ? A MG 991 ? 1_555 O1G ? J DCT .   ? A DCT 823  ? 1_555 86.4  ? 
16 O   ? O HOH .   ? A HOH 1333 ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 O2A ? J DCT .   ? A DCT 823  ? 1_555 151.6 ? 
17 O   ? O HOH .   ? A HOH 1333 ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 86.9  ? 
18 O2A ? J DCT .   ? A DCT 823  ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 85.7  ? 
19 O   ? O HOH .   ? A HOH 1333 ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 99.9  ? 
20 O2A ? J DCT .   ? A DCT 823  ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 108.5 ? 
21 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 106.6 ? 
22 O   ? O HOH .   ? A HOH 1333 ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 O   ? O HOH .   ? A HOH 1618 ? 1_555 84.4  ? 
23 O2A ? J DCT .   ? A DCT 823  ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 O   ? O HOH .   ? A HOH 1618 ? 1_555 91.0  ? 
24 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 O   ? O HOH .   ? A HOH 1618 ? 1_555 155.4 ? 
25 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 992 ? 1_555 O   ? O HOH .   ? A HOH 1618 ? 1_555 97.6  ? 
26 O   ? O HOH .   ? A HOH 1621 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1054 ? 1_555 86.5  ? 
27 O   ? O HOH .   ? A HOH 1621 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1113 ? 1_555 92.4  ? 
28 O   ? O HOH .   ? A HOH 1054 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1113 ? 1_555 100.9 ? 
29 O   ? O HOH .   ? A HOH 1621 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1622 ? 1_555 166.4 ? 
30 O   ? O HOH .   ? A HOH 1054 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1622 ? 1_555 82.1  ? 
31 O   ? O HOH .   ? A HOH 1113 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1622 ? 1_555 97.2  ? 
32 O   ? O HOH .   ? A HOH 1621 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1620 ? 1_555 95.4  ? 
33 O   ? O HOH .   ? A HOH 1054 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1620 ? 1_555 173.1 ? 
34 O   ? O HOH .   ? A HOH 1113 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1620 ? 1_555 85.6  ? 
35 O   ? O HOH .   ? A HOH 1622 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 O   ? O HOH .   ? A HOH 1620 ? 1_555 95.0  ? 
36 O   ? O HOH .   ? A HOH 1621 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 87.5  ? 
37 O   ? O HOH .   ? A HOH 1054 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 81.0  ? 
38 O   ? O HOH .   ? A HOH 1113 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 178.2 ? 
39 O   ? O HOH .   ? A HOH 1622 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 83.3  ? 
40 O   ? O HOH .   ? A HOH 1620 ? 1_555 MG ? G MG . ? A MG 993 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 92.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-31 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Experimental preparation'  
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            exptl_crystal_grow 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_exptl_crystal_grow.temp' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 64  ? ? -112.91 -77.46  
2  1 HIS A 99  ? ? -106.30 52.93   
3  1 ASP A 156 ? ? 13.67   -78.39  
4  1 ARG A 278 ? ? -76.89  -80.56  
5  1 ILE A 289 ? ? -112.22 -168.63 
6  1 ARG A 310 ? ? 83.85   50.28   
7  1 GLU A 311 ? ? -165.97 90.63   
8  1 PRO A 312 ? ? -9.21   110.16  
9  1 THR A 317 ? ? -59.77  -7.61   
10 1 THR A 354 ? ? -93.98  -60.74  
11 1 LYS A 359 ? ? -173.57 6.42    
12 1 ALA A 400 ? ? -132.14 -39.89  
13 1 HIS A 417 ? ? -101.09 69.45   
14 1 SER A 576 ? ? 167.95  161.05  
15 1 GLN A 585 ? ? 38.33   133.99  
16 1 VAL A 652 ? ? -116.26 79.09   
17 1 HIS A 653 ? ? 65.84   -76.37  
18 1 ASP B 20  ? ? 60.37   76.02   
19 1 ALA B 88  ? ? -171.95 147.00  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC P 820 ? ? 0.060 'SIDE CHAIN' 
2 1 DA P 821 ? ? 0.059 'SIDE CHAIN' 
3 1 DC T 855 ? ? 0.067 'SIDE CHAIN' 
4 1 DG T 857 ? ? 0.059 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 P DC  810 ? P     ? A DC  10  P     
2  1 Y 1 P DC  810 ? OP1   ? A DC  10  OP1   
3  1 Y 1 P DC  810 ? OP2   ? A DC  10  OP2   
4  1 Y 1 P DC  810 ? "O5'" ? A DC  10  "O5'" 
5  1 Y 1 T DT  868 ? N1    ? B DT  18  N1    
6  1 Y 1 T DT  868 ? C2    ? B DT  18  C2    
7  1 Y 1 T DT  868 ? O2    ? B DT  18  O2    
8  1 Y 1 T DT  868 ? N3    ? B DT  18  N3    
9  1 Y 1 T DT  868 ? C4    ? B DT  18  C4    
10 1 Y 1 T DT  868 ? O4    ? B DT  18  O4    
11 1 Y 1 T DT  868 ? C5    ? B DT  18  C5    
12 1 Y 1 T DT  868 ? C7    ? B DT  18  C7    
13 1 Y 1 T DT  868 ? C6    ? B DT  18  C6    
14 1 Y 1 A LYS 293 ? CG    ? C LYS 287 CG    
15 1 Y 1 A LYS 293 ? CD    ? C LYS 287 CD    
16 1 Y 1 A LYS 293 ? CE    ? C LYS 287 CE    
17 1 Y 1 A LYS 293 ? NZ    ? C LYS 287 NZ    
18 1 Y 1 A ARG 310 ? CG    ? C ARG 304 CG    
19 1 Y 1 A ARG 310 ? CD    ? C ARG 304 CD    
20 1 Y 1 A ARG 310 ? NE    ? C ARG 304 NE    
21 1 Y 1 A ARG 310 ? CZ    ? C ARG 304 CZ    
22 1 Y 1 A ARG 310 ? NH1   ? C ARG 304 NH1   
23 1 Y 1 A ARG 310 ? NH2   ? C ARG 304 NH2   
24 1 Y 1 A GLU 314 ? CG    ? C GLU 308 CG    
25 1 Y 1 A GLU 314 ? CD    ? C GLU 308 CD    
26 1 Y 1 A GLU 314 ? OE1   ? C GLU 308 OE1   
27 1 Y 1 A GLU 314 ? OE2   ? C GLU 308 OE2   
28 1 Y 1 A ARG 318 ? CG    ? C ARG 312 CG    
29 1 Y 1 A ARG 318 ? CD    ? C ARG 312 CD    
30 1 Y 1 A ARG 318 ? NE    ? C ARG 312 NE    
31 1 Y 1 A ARG 318 ? CZ    ? C ARG 312 CZ    
32 1 Y 1 A ARG 318 ? NH1   ? C ARG 312 NH1   
33 1 Y 1 A ARG 318 ? NH2   ? C ARG 312 NH2   
34 1 Y 1 A ARG 339 ? NE    ? C ARG 333 NE    
35 1 Y 1 A ARG 339 ? CZ    ? C ARG 333 CZ    
36 1 Y 1 A ARG 339 ? NH1   ? C ARG 333 NH1   
37 1 Y 1 A ARG 339 ? NH2   ? C ARG 333 NH2   
38 1 Y 1 A GLN 584 ? CG    ? C GLN 578 CG    
39 1 Y 1 A GLN 584 ? CD    ? C GLN 578 CD    
40 1 Y 1 A GLN 584 ? OE1   ? C GLN 578 OE1   
41 1 Y 1 A GLN 584 ? NE2   ? C GLN 578 NE2   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P DC  801 ? A DC  1   
2  1 Y 1 P DG  802 ? A DG  2   
3  1 Y 1 P DA  803 ? A DA  3   
4  1 Y 1 P DA  804 ? A DA  4   
5  1 Y 1 P DA  805 ? A DA  5   
6  1 Y 1 P DA  806 ? A DA  6   
7  1 Y 1 P DC  807 ? A DC  7   
8  1 Y 1 P DG  808 ? A DG  8   
9  1 Y 1 P DA  809 ? A DA  9   
10 1 Y 1 T DC  851 ? B DC  1   
11 1 Y 1 T DC  852 ? B DC  2   
12 1 Y 1 T DC  869 ? B DC  19  
13 1 Y 1 T DG  870 ? B DG  20  
14 1 Y 1 T DT  871 ? B DT  21  
15 1 Y 1 T DT  872 ? B DT  22  
16 1 Y 1 T DT  873 ? B DT  23  
17 1 Y 1 T DT  874 ? B DT  24  
18 1 Y 1 T DC  875 ? B DC  25  
19 1 Y 1 T DG  876 ? B DG  26  
20 1 Y 1 A LYS 302 ? C LYS 296 
21 1 Y 1 A ASN 303 ? C ASN 297 
22 1 Y 1 A LYS 304 ? C LYS 298 
23 1 Y 1 A ALA 305 ? C ALA 299 
24 1 Y 1 A GLN 306 ? C GLN 300 
25 1 Y 1 A ARG 307 ? C ARG 301 
26 1 Y 1 A GLN 578 ? C GLN 572 
27 1 Y 1 A TRP 579 ? C TRP 573 
28 1 Y 1 A VAL 580 ? C VAL 574 
29 1 Y 1 A ALA 581 ? C ALA 575 
30 1 Y 1 A GLY 582 ? C GLY 576 
31 1 Y 1 A GLU 583 ? C GLU 577 
32 1 Y 1 B SER 1   ? D SER 1   
33 1 Y 1 B ASP 2   ? D ASP 2   
34 1 Y 1 B ALA 108 ? D ALA 108 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1TK0 'double helix'         
1TK0 'a-form double helix'  
1TK0 'b-form double helix'  
1TK0 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC  10 1_555 B DG 17 1_555 0.509  -0.552 0.289  -2.396  -3.974  -1.833 1  P_DC810:DG867_T  P 810 ? T 867 ? 19 1 
1 A DG  11 1_555 B DC 16 1_555 -1.077 -0.054 -0.240 -2.020  -6.744  0.486  2  P_DG811:DC866_T  P 811 ? T 866 ? 19 1 
1 A DC  13 1_555 B DG 14 1_555 -0.100 -0.015 -0.025 -1.881  -4.430  -0.768 3  P_DC813:DG864_T  P 813 ? T 864 ? 19 1 
1 A DC  14 1_555 B DG 13 1_555 0.085  -0.024 -0.128 -5.471  -5.306  -2.034 4  P_DC814:DG863_T  P 814 ? T 863 ? 19 1 
1 A DA  15 1_555 B DT 12 1_555 -0.008 0.321  0.086  -8.109  -7.351  -4.431 5  P_DA815:DT862_T  P 815 ? T 862 ? 20 1 
1 A DG  16 1_555 B DC 11 1_555 0.013  -0.250 -0.581 -14.660 -15.251 3.423  6  P_DG816:DC861_T  P 816 ? T 861 ? 19 1 
1 A DT  17 1_555 B DA 10 1_555 -0.012 0.029  -0.213 -0.469  -5.974  3.258  7  P_DT817:DA860_T  P 817 ? T 860 ? 20 1 
1 A DG  18 1_555 B DC 9  1_555 -0.293 -0.173 -0.605 -1.224  3.416   2.218  8  P_DG818:DC859_T  P 818 ? T 859 ? 19 1 
1 A DC  19 1_555 B DG 8  1_555 0.069  -0.188 -0.430 6.794   3.174   -3.138 9  P_DC819:DG858_T  P 819 ? T 858 ? 19 1 
1 A DC  20 1_555 B DG 7  1_555 -0.041 -0.322 -0.281 5.468   -9.512  0.860  10 P_DC820:DG857_T  P 820 ? T 857 ? 19 1 
1 A DA  21 1_555 B DT 6  1_555 0.139  -0.255 0.232  -0.618  -5.177  1.149  11 P_DA821:DT856_T  P 821 ? T 856 ? 20 1 
1 A DDG 22 1_555 B DC 5  1_555 -0.116 -0.148 -0.328 -1.458  -7.455  -0.134 12 P_DDG822:DC855_T P 822 ? T 855 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 10 1_555 B DG 17 1_555 A DG  11 1_555 B DC 16 1_555 0.303  0.345  3.394 8.061   12.195 30.054 -1.576 0.911  3.262 21.958 
-14.516 33.347 1  PP_DC810DG811:DC866DG867_TT  P 810 ? T 867 ? P 811 ? T 866 ? 
1 A DG 11 1_555 B DC 16 1_555 A DC  13 1_555 B DG 14 1_555 -0.152 -1.050 6.482 -8.327  15.567 68.782 -1.972 -0.438 6.138 13.555 
7.251   70.741 2  PP_DG811DC813:DG864DC866_TT  P 811 ? T 866 ? P 813 ? T 864 ? 
1 A DC 13 1_555 B DG 14 1_555 A DC  14 1_555 B DG 13 1_555 0.846  -0.478 3.282 2.281   7.679  32.864 -2.060 -1.088 3.144 13.327 
-3.960  33.800 3  PP_DC813DC814:DG863DG864_TT  P 813 ? T 864 ? P 814 ? T 863 ? 
1 A DC 14 1_555 B DG 13 1_555 A DA  15 1_555 B DT 12 1_555 -0.848 0.143  3.330 -4.253  9.650  32.792 -1.327 0.742  3.319 16.567 
7.302   34.402 4  PP_DC814DA815:DT862DG863_TT  P 814 ? T 863 ? P 815 ? T 862 ? 
1 A DA 15 1_555 B DT 12 1_555 A DG  16 1_555 B DC 11 1_555 0.150  -0.335 3.695 4.292   4.339  34.732 -1.280 0.470  3.620 7.199  
-7.121  35.247 5  PP_DA815DG816:DC861DT862_TT  P 815 ? T 862 ? P 816 ? T 861 ? 
1 A DG 16 1_555 B DC 11 1_555 A DT  17 1_555 B DA 10 1_555 0.507  -0.307 2.880 -1.520  7.559  29.016 -1.941 -1.251 2.687 14.759 
2.967   30.002 6  PP_DG816DT817:DA860DC861_TT  P 816 ? T 861 ? P 817 ? T 860 ? 
1 A DT 17 1_555 B DA 10 1_555 A DG  18 1_555 B DC 9  1_555 0.875  0.180  3.433 3.575   6.075  33.485 -0.719 -0.885 3.484 10.401 
-6.121  34.198 7  PP_DT817DG818:DC859DA860_TT  P 817 ? T 860 ? P 818 ? T 859 ? 
1 A DG 18 1_555 B DC 9  1_555 A DC  19 1_555 B DG 8  1_555 -0.554 -0.467 3.206 -0.718  4.113  26.925 -1.991 1.001  3.114 8.767  
1.531   27.241 8  PP_DG818DC819:DG858DC859_TT  P 818 ? T 859 ? P 819 ? T 858 ? 
1 A DC 19 1_555 B DG 8  1_555 A DC  20 1_555 B DG 7  1_555 -0.177 -0.654 3.647 -10.419 7.563  38.496 -1.881 -1.033 3.398 11.099 
15.290  40.514 9  PP_DC819DC820:DG857DG858_TT  P 819 ? T 858 ? P 820 ? T 857 ? 
1 A DC 20 1_555 B DG 7  1_555 A DA  21 1_555 B DT 6  1_555 -0.559 -1.459 3.471 -3.627  13.656 25.237 -5.864 0.341  2.432 28.576 
7.590   28.867 10 PP_DC820DA821:DT856DG857_TT  P 820 ? T 857 ? P 821 ? T 856 ? 
1 A DA 21 1_555 B DT 6  1_555 A DDG 22 1_555 B DC 5  1_555 -0.134 -0.875 3.469 4.812   4.347  33.533 -2.208 1.023  3.283 7.447  
-8.245  34.136 11 PP_DA821DDG822:DC855DT856_TT P 821 ? T 856 ? P 822 ? T 855 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  'MAGNESIUM ION'                         MG  
6  'SULFATE ION'                           SO4 
7  
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
DCT 
8  'PENTAETHYLENE GLYCOL'                  1PE 
9  '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'  MES 
10 water                                   HOH 
#