data_1TK8
# 
_entry.id   1TK8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TK8         
NDB   PD0556       
RCSB  RCSB022713   
WWPDB D_1000022713 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1T8E . unspecified 
PDB 1TK0 . unspecified 
PDB 1TK5 . unspecified 
PDB 1TKD . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TK8 
_pdbx_database_status.recvd_initial_deposition_date   2004-06-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brieba, L.G.'    1 
'Eichman, B.F.'   2 
'Kokoska, R.J.'   3 
'Doublie, S.'     4 
'Kunkel, T.A.'    5 
'Ellenberger, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the dual coding potential of 8-oxoguanosine by a high-fidelity DNA polymerase.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            23 
_citation.page_first                3452 
_citation.page_last                 3461 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15297882 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600354 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brieba, L.G.'    1 
primary 'Eichman, B.F.'   2 
primary 'Kokoska, R.J.'   3 
primary 'Doublie, S.'     4 
primary 'Kunkel, T.A.'    5 
primary 'Ellenberger, T.' 6 
# 
_cell.entry_id           1TK8 
_cell.length_a           106.177 
_cell.length_b           215.710 
_cell.length_c           52.155 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TK8 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn "5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*(2DA))-3'"             6748.397  1   ? ? 
? 'primer strand'   
2  polymer     syn "5'-D(*CP*CP*CP*AP*(8OG)P*TP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*TP*CP*G)-3'" 7963.088  1   ? ? 
? 'template strand' 
3  polymer     man 'DNA polymerase'                                                                             79089.789 1   
2.7.7.7 ? ? ?                 
4  polymer     man 'Thioredoxin 1'                                                                              11687.388 1   ? ? 
? ?                 
5  non-polymer syn 'MAGNESIUM ION'                                                                              24.305    4   ? ? 
? ?                 
6  non-polymer syn 'SULFATE ION'                                                                                96.063    2   ? ? 
? ?                 
7  non-polymer syn "2',3'-DIDEOXY-THYMIDINE-5'-TRIPHOSPHATE"                                                    466.169   1   ? ? 
? ?                 
8  non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                                       195.237   1   ? ? 
? ?                 
9  non-polymer syn 'PENTAETHYLENE GLYCOL'                                                                       238.278   1   ? ? 
? ?                 
10 water       nat water                                                                                        18.015    532 ? ? 
? ?                 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'T7 DNA polymerase' 
4 'TRX1, TRX'         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(DA)(2DA)
;
CGAAAACGACGGCCAGTGCCAA P ? 
2 polydeoxyribonucleotide no yes 
;(DC)(DC)(DC)(DA)(8OG)(DT)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DT)(DC)
(DG)(DT)(DT)(DT)(DT)(DC)(DG)
;
CCCAGTGGCACTGGCCGTCGTTTTCG T ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DC  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DA  n 
1 22  2DA n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   DA  n 
2 5   8OG n 
2 6   DT  n 
2 7   DG  n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DG  n 
2 14  DG  n 
2 15  DC  n 
2 16  DC  n 
2 17  DG  n 
2 18  DT  n 
2 19  DC  n 
2 20  DG  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DT  n 
2 25  DC  n 
2 26  DG  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? 'T7-like viruses' 5 ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 
Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? ? ? ? ? pGP5   ? ? 
4 1 sample ? ? ? ? Escherichia       
'TRXA, TSNC, FIPA, B3781, C4701, Z5291, ECS4714, STM3915, STMD1.75, STY3639, T3381, SF3854, S3905' ? ? ? ? ? ? 'Escherichia coli' 
562   ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? ? ? ? ? pTrx-3 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPT7  P00581 3 
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEW
WNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIE
ELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREY
VAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSA
EGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLE
LRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTP
AIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKH
GWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
1 ? 
2 UNP THIO_ECOLI P0AA25 4 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
1 ? 
3 PDB 1TK8       1TK8   1 ? ? ? 
4 PDB 1TK8       1TK8   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TK8 A 1 ? 698 ? P00581 1   ? 704 ? 1   704 
2 2 1TK8 B 1 ? 108 ? P0AA25 1   ? 108 ? 1   108 
3 3 1TK8 P 1 ? 22  ? 1TK8   801 ? 822 ? 801 822 
4 4 1TK8 T 1 ? 26  ? 1TK8   851 ? 876 ? 851 876 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1TK8 ? A ? ? UNP P00581 LYS 118 DELETION ? 1 
1 1TK8 ? A ? ? UNP P00581 ARG 119 DELETION ? 2 
1 1TK8 ? A ? ? UNP P00581 PHE 120 DELETION ? 3 
1 1TK8 ? A ? ? UNP P00581 GLY 121 DELETION ? 4 
1 1TK8 ? A ? ? UNP P00581 SER 122 DELETION ? 5 
1 1TK8 ? A ? ? UNP P00581 HIS 123 DELETION ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer               . 'PENTAETHYLENE GLYCOL'                      PEG400 'C10 H22 O6'        238.278 
2DA 'DNA linking'             n "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE"   ? 'C10 H14 N5 O5 P'   315.222 
8OG 'DNA linking'             n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
"8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 'C10 H14 N5 O8 P'   363.221 
ALA 'L-peptide linking'       y ALANINE                                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking'       y ARGININE                                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'       y ASPARAGINE                                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'       y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'       y CYSTEINE                                    ? 'C3 H7 N O2 S'      121.158 
D3T 'DNA OH 3 prime terminus' n "2',3'-DIDEOXY-THYMIDINE-5'-TRIPHOSPHATE"   ? 'C10 H17 N2 O13 P3' 466.169 
DA  'DNA linking'             y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'             y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'             y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'             y "THYMIDINE-5'-MONOPHOSPHATE"                ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking'       y GLUTAMINE                                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'       y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'         y GLYCINE                                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'       y HISTIDINE                                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer               . WATER                                       ? 'H2 O'              18.015  
ILE 'L-peptide linking'       y ISOLEUCINE                                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'       y LEUCINE                                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'       y LYSINE                                      ? 'C6 H15 N2 O2 1'    147.195 
MES non-polymer               . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'      ? 'C6 H13 N O4 S'     195.237 
MET 'L-peptide linking'       y METHIONINE                                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer               . 'MAGNESIUM ION'                             ? 'Mg 2'              24.305  
PHE 'L-peptide linking'       y PHENYLALANINE                               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'       y PROLINE                                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'       y SERINE                                      ? 'C3 H7 N O3'        105.093 
SO4 non-polymer               . 'SULFATE ION'                               ? 'O4 S -2'           96.063  
THR 'L-peptide linking'       y THREONINE                                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'       y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'       y TYROSINE                                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'       y VALINE                                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1TK8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3 
_exptl_crystal.density_percent_sol   58.3 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, Ammonium Sulfate, PEG400, Ethylene Glycol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-01-28 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X26C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X26C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     1TK8 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   52299 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.063 
_reflns.pdbx_netI_over_sigmaI        23.6 
_reflns.B_iso_Wilson_estimate        29.4 
_reflns.pdbx_redundancy              5.9 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   96.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.083 
_reflns_shell.meanI_over_sigI_obs    12.7 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.percent_possible_obs   77 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1TK8 
_refine.ls_number_reflns_obs                     42315 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2139911.09 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.97 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.206 
_refine.ls_R_factor_all                          0.25825 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2057 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               28.5 
_refine.aniso_B[1][1]                            4.25 
_refine.aniso_B[2][2]                            -1.28 
_refine.aniso_B[3][3]                            -2.97 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.321392 
_refine.solvent_model_param_bsol                 27.6837 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1T7P' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1TK8 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.31 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6298 
_refine_hist.pdbx_number_atoms_nucleic_acid   758 
_refine_hist.pdbx_number_atoms_ligand         70 
_refine_hist.number_atoms_solvent             532 
_refine_hist.number_atoms_total               7658 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        39.97 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.89  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.23  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.01  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.01  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.96  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             6545 
_refine_ls_shell.R_factor_R_work                  0.222 
_refine_ls_shell.percent_reflns_obs               99.3 
_refine_ls_shell.R_factor_R_free                  0.313 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             351 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP            'X-RAY DIFFRACTION' 
2 DNA-RNA-TT5.PARAM DNA-RNA-TT_4TD_NEW.TOP 'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP                'X-RAY DIFFRACTION' 
4 WATER.PARAM       WATER.TOP              'X-RAY DIFFRACTION' 
5 LIGAND.PAR        LIGAND.TOP             'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1TK8 
_struct.title                     'T7 DNA polymerase ternary complex with 8 oxo guanosine and dAMP at the elongation site' 
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)/THIOREDOXIN 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TK8 
_struct_keywords.pdbx_keywords   'TRANSFERASE/ELECTRON TRANSPORT/DNA' 
_struct_keywords.text            '8-oxoguanosine DNA polymerase, TRANSFERASE-ELECTRON TRANSPORT-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 5  ? 
H N N 5  ? 
I N N 6  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 9  ? 
N N N 10 ? 
O N N 10 ? 
P N N 10 ? 
Q N N 10 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 11  ? VAL C 15  ? LEU A 11  VAL A 15  5 ? 5  
HELX_P HELX_P2  2  ARG C 35  ? SER C 37  ? ARG A 35  SER A 37  5 ? 3  
HELX_P HELX_P3  3  ASP C 38  ? ARG C 52  ? ASP A 38  ARG A 52  1 ? 15 
HELX_P HELX_P4  4  TYR C 64  ? ASN C 78  ? TYR A 64  ASN A 78  1 ? 15 
HELX_P HELX_P5  5  PRO C 84  ? GLU C 86  ? PRO A 84  GLU A 86  5 ? 3  
HELX_P HELX_P6  6  THR C 91  ? HIS C 99  ? THR A 91  HIS A 99  1 ? 9  
HELX_P HELX_P7  7  ARG C 111 ? LEU C 115 ? ARG A 111 LEU A 115 5 ? 5  
HELX_P HELX_P8  8  GLU C 120 ? GLN C 144 ? GLU A 126 GLN A 150 1 ? 25 
HELX_P HELX_P9  9  GLY C 151 ? TRP C 155 ? GLY A 157 TRP A 161 5 ? 5  
HELX_P HELX_P10 10 ASN C 158 ? SER C 181 ? ASN A 164 SER A 187 1 ? 24 
HELX_P HELX_P11 11 GLY C 196 ? SER C 204 ? GLY A 202 SER A 210 1 ? 9  
HELX_P HELX_P12 12 LEU C 205 ? GLY C 225 ? LEU A 211 GLY A 231 1 ? 21 
HELX_P HELX_P13 13 ASP C 229 ? PHE C 255 ? ASP A 235 PHE A 261 1 ? 27 
HELX_P HELX_P14 14 SER C 332 ? GLU C 342 ? SER A 338 GLU A 348 1 ? 11 
HELX_P HELX_P15 15 ASP C 359 ? VAL C 366 ? ASP A 365 VAL A 372 1 ? 8  
HELX_P HELX_P16 16 ASP C 370 ? ALA C 394 ? ASP A 376 ALA A 400 1 ? 25 
HELX_P HELX_P17 17 ALA C 399 ? VAL C 404 ? ALA A 405 VAL A 410 1 ? 6  
HELX_P HELX_P18 18 TYR C 441 ? ALA C 448 ? TYR A 447 ALA A 454 1 ? 8  
HELX_P HELX_P19 19 PHE C 449 ? HIS C 454 ? PHE A 455 HIS A 460 5 ? 6  
HELX_P HELX_P20 20 GLY C 472 ? ASN C 487 ? GLY A 478 ASN A 493 1 ? 16 
HELX_P HELX_P21 21 GLY C 488 ? ILE C 494 ? GLY A 494 ILE A 500 1 ? 7  
HELX_P HELX_P22 22 ASP C 498 ? GLU C 508 ? ASP A 504 GLU A 514 1 ? 11 
HELX_P HELX_P23 23 THR C 511 ? TYR C 524 ? THR A 517 TYR A 530 1 ? 14 
HELX_P HELX_P24 24 GLY C 527 ? GLY C 536 ? GLY A 533 GLY A 542 1 ? 10 
HELX_P HELX_P25 25 GLY C 538 ? THR C 553 ? GLY A 544 THR A 559 1 ? 16 
HELX_P HELX_P26 26 PRO C 554 ? LEU C 567 ? PRO A 560 LEU A 573 1 ? 14 
HELX_P HELX_P27 27 ALA C 602 ? LYS C 630 ? ALA A 608 LYS A 636 1 ? 29 
HELX_P HELX_P28 28 THR C 656 ? TRP C 678 ? THR A 662 TRP A 684 1 ? 23 
HELX_P HELX_P29 29 THR D 8   ? VAL D 16  ? THR B 8   VAL B 16  1 ? 9  
HELX_P HELX_P30 30 CYS D 32  ? TYR D 49  ? CYS B 32  TYR B 49  1 ? 18 
HELX_P HELX_P31 31 THR D 66  ? GLY D 71  ? THR B 66  GLY B 71  5 ? 6  
HELX_P HELX_P32 32 SER D 95  ? LEU D 107 ? SER B 95  LEU B 107 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? K D3T .  O2B   ? ? ? 1_555 F MG  .   MG  ? ? A D3T 823 A MG  901  1_555 ? ? ? ? ? ? ?                 1.990 ? 
metalc2  metalc ? ? K D3T .  O1G   ? ? ? 1_555 F MG  .   MG  ? ? A D3T 823 A MG  901  1_555 ? ? ? ? ? ? ?                 1.941 ? 
metalc3  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 469 OD1 ? ? A MG  901 A ASP 475  1_555 ? ? ? ? ? ? ?                 2.210 ? 
metalc4  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ALA 470 O   ? ? A MG  901 A ALA 476  1_555 ? ? ? ? ? ? ?                 2.283 ? 
metalc5  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 648 OD2 ? ? A MG  901 A ASP 654  1_555 ? ? ? ? ? ? ?                 2.121 ? 
metalc6  metalc ? ? F MG  .  MG    ? ? ? 1_555 K D3T .   O2A ? ? A MG  901 A D3T 823  1_555 ? ? ? ? ? ? ?                 2.145 ? 
metalc7  metalc ? ? G MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  902 A HOH 1008 1_555 ? ? ? ? ? ? ?                 2.445 ? 
metalc8  metalc ? ? G MG  .  MG    ? ? ? 1_555 K D3T .   O2A ? ? A MG  902 A D3T 823  1_555 ? ? ? ? ? ? ?                 2.560 ? 
metalc9  metalc ? ? G MG  .  MG    ? ? ? 1_555 C ASP 648 OD1 ? ? A MG  902 A ASP 654  1_555 ? ? ? ? ? ? ?                 2.175 ? 
metalc10 metalc ? ? G MG  .  MG    ? ? ? 1_555 C ASP 469 OD2 ? ? A MG  902 A ASP 475  1_555 ? ? ? ? ? ? ?                 2.316 ? 
metalc11 metalc ? ? G MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  902 A HOH 1284 1_555 ? ? ? ? ? ? ?                 2.573 ? 
metalc12 metalc ? ? H MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1524 1_555 ? ? ? ? ? ? ?                 2.116 ? 
metalc13 metalc ? ? H MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1067 1_555 ? ? ? ? ? ? ?                 2.162 ? 
metalc14 metalc ? ? H MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1525 1_555 ? ? ? ? ? ? ?                 2.150 ? 
metalc15 metalc ? ? H MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1508 1_555 ? ? ? ? ? ? ?                 2.178 ? 
metalc16 metalc ? ? H MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1145 1_555 ? ? ? ? ? ? ?                 2.123 ? 
metalc17 metalc ? ? H MG  .  MG    ? ? ? 1_555 C ASP 5   OD1 ? ? A MG  903 A ASP 5    1_555 ? ? ? ? ? ? ?                 2.096 ? 
covale1  covale ? ? A DA  21 "O3'" ? ? ? 1_555 A 2DA 22  P   ? ? P DA  821 P 2DA 822  1_555 ? ? ? ? ? ? ?                 1.603 ? 
covale2  covale ? ? B DA  4  "O3'" ? ? ? 1_555 B 8OG 5   P   ? ? T DA  854 T 8OG 855  1_555 ? ? ? ? ? ? ?                 1.604 ? 
covale3  covale ? ? B 8OG 5  "O3'" ? ? ? 1_555 B DT  6   P   ? ? T 8OG 855 T DT  856  1_555 ? ? ? ? ? ? ?                 1.606 ? 
metalc18 metalc ? ? E MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? T MG  904 T HOH 1488 1_555 ? ? ? ? ? ? ?                 2.351 ? 
metalc19 metalc ? ? E MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? T MG  904 T HOH 1487 1_555 ? ? ? ? ? ? ?                 2.106 ? 
metalc20 metalc ? ? E MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? T MG  904 T HOH 1489 1_555 ? ? ? ? ? ? ?                 2.273 ? 
metalc21 metalc ? ? E MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? T MG  904 T HOH 1257 1_555 ? ? ? ? ? ? ?                 2.701 ? 
metalc22 metalc ? ? E MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? T MG  904 T HOH 1222 1_555 ? ? ? ? ? ? ?                 2.264 ? 
metalc23 metalc ? ? E MG  .  MG    ? ? ? 1_555 O HOH .   O   ? ? T MG  904 T HOH 1221 1_555 ? ? ? ? ? ? ?                 2.101 ? 
hydrog1  hydrog ? ? A DC  7  N3    ? ? ? 1_555 B DG  20  N1  ? ? P DC  807 T DG  870  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog2  hydrog ? ? A DC  7  N4    ? ? ? 1_555 B DG  20  O6  ? ? P DC  807 T DG  870  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog3  hydrog ? ? A DC  7  O2    ? ? ? 1_555 B DG  20  N2  ? ? P DC  807 T DG  870  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog4  hydrog ? ? A DG  8  N1    ? ? ? 1_555 B DC  19  N3  ? ? P DG  808 T DC  869  1_555 ? ? ? ? ? ? 'DG-DC PAIR'      ?     ? 
hydrog5  hydrog ? ? A DA  9  N1    ? ? ? 1_555 B DT  18  N3  ? ? P DA  809 T DT  868  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog6  hydrog ? ? A DA  9  N6    ? ? ? 1_555 B DT  18  O4  ? ? P DA  809 T DT  868  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog7  hydrog ? ? A DC  10 O2    ? ? ? 1_555 B DG  17  N2  ? ? P DC  810 T DG  867  1_555 ? ? ? ? ? ? 'DC-DG PAIR'      ?     ? 
hydrog8  hydrog ? ? A DG  11 N1    ? ? ? 1_555 B DC  16  N3  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog9  hydrog ? ? A DG  11 N2    ? ? ? 1_555 B DC  16  O2  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog10 hydrog ? ? A DG  11 O6    ? ? ? 1_555 B DC  16  N4  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog11 hydrog ? ? A DG  12 N1    ? ? ? 1_555 B DC  15  N3  ? ? P DG  812 T DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog12 hydrog ? ? A DG  12 N2    ? ? ? 1_555 B DC  15  O2  ? ? P DG  812 T DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog13 hydrog ? ? A DG  12 O6    ? ? ? 1_555 B DC  15  N4  ? ? P DG  812 T DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog14 hydrog ? ? A DC  13 N3    ? ? ? 1_555 B DG  14  N1  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog15 hydrog ? ? A DC  13 N4    ? ? ? 1_555 B DG  14  O6  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog16 hydrog ? ? A DC  13 O2    ? ? ? 1_555 B DG  14  N2  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog17 hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  13  N1  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog18 hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  13  O6  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog19 hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  13  N2  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog20 hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  12  N3  ? ? P DA  815 T DT  862  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog21 hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  12  O4  ? ? P DA  815 T DT  862  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog22 hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  11  N3  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog23 hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  11  O2  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog24 hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  11  N4  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog25 hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  10  N1  ? ? P DT  817 T DA  860  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog26 hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  10  N6  ? ? P DT  817 T DA  860  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog27 hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  9   N3  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog28 hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  9   O2  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog29 hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  9   N4  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog30 hydrog ? ? A DC  19 N3    ? ? ? 1_555 B DG  8   N1  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog31 hydrog ? ? A DC  19 N4    ? ? ? 1_555 B DG  8   O6  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog32 hydrog ? ? A DC  19 O2    ? ? ? 1_555 B DG  8   N2  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog33 hydrog ? ? A DC  20 N3    ? ? ? 1_555 B DG  7   N1  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog34 hydrog ? ? A DC  20 N4    ? ? ? 1_555 B DG  7   O6  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog35 hydrog ? ? A DC  20 O2    ? ? ? 1_555 B DG  7   N2  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog36 hydrog ? ? A DA  21 N1    ? ? ? 1_555 B DT  6   N3  ? ? P DA  821 T DT  856  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog37 hydrog ? ? A DA  21 N6    ? ? ? 1_555 B DT  6   O4  ? ? P DA  821 T DT  856  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog38 hydrog ? ? A 2DA 22 N6    ? ? ? 1_555 B 8OG 5   O6  ? ? P 2DA 822 T 8OG 855  1_555 ? ? ? ? ? ? '2DA-8OG MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 C . ? PHE 434 A PRO 429 C ? PRO 435 A 1 -0.30 
2 ILE 75  D . ? ILE 75  B PRO 76  D ? PRO 76  B 1 0.06  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 2 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR C 31  ? TYR C 34  ? TYR A 31  TYR A 34  
A 2 PHE C 18  ? ASP C 25  ? PHE A 18  ASP A 25  
A 3 ILE C 2   ? ALA C 8   ? ILE A 2   ALA A 8   
A 4 ILE C 56  ? PHE C 58  ? ILE A 56  PHE A 58  
A 5 CYS C 88  ? ASP C 90  ? CYS A 88  ASP A 90  
B 1 PHE C 226 ? PRO C 227 ? PHE A 232 PRO A 233 
B 2 LYS C 409 ? ILE C 410 ? LYS A 415 ILE A 416 
C 1 TRP C 258 ? PRO C 261 ? TRP A 264 PRO A 267 
C 2 THR C 321 ? VAL C 326 ? THR A 327 VAL A 332 
C 3 GLY D 74  ? ILE D 75  ? GLY B 74  ILE B 75  
D 1 SER C 413 ? ASN C 415 ? SER A 419 ASN A 421 
D 2 THR C 425 ? ALA C 427 ? THR A 431 ALA A 433 
E 1 PHE C 640 ? TRP C 645 ? PHE A 646 TRP A 651 
E 2 GLU C 649 ? CYS C 654 ? GLU A 655 CYS A 660 
E 3 VAL C 464 ? ALA C 470 ? VAL A 470 ALA A 476 
E 4 THR C 686 ? GLY C 691 ? THR A 692 GLY A 697 
F 1 VAL C 568 ? SER C 570 ? VAL A 574 SER A 576 
F 2 LYS C 581 ? TRP C 582 ? LYS A 587 TRP A 588 
G 1 TRP C 586 ? LYS C 588 ? TRP A 592 LYS A 594 
G 2 LYS C 594 ? HIS C 596 ? LYS A 600 HIS A 602 
H 1 ILE D 5   ? HIS D 6   ? ILE B 5   HIS B 6   
H 2 THR D 54  ? ASN D 59  ? THR B 54  ASN B 59  
H 3 ALA D 22  ? TRP D 28  ? ALA B 22  TRP B 28  
H 4 THR D 77  ? LYS D 82  ? THR B 77  LYS B 82  
H 5 VAL D 86  ? VAL D 91  ? VAL B 86  VAL B 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR C 34  ? O TYR A 34  N GLY C 21  ? N GLY A 21  
A 2 3 O HIS C 19  ? O HIS A 19  N GLU C 7   ? N GLU A 7   
A 3 4 N SER C 4   ? N SER A 4   O VAL C 57  ? O VAL A 57  
A 4 5 N ILE C 56  ? N ILE A 56  O ILE C 89  ? O ILE A 89  
B 1 2 N PHE C 226 ? N PHE A 232 O ILE C 410 ? O ILE A 416 
C 1 2 N TRP C 258 ? N TRP A 264 O VAL C 326 ? O VAL A 332 
C 2 3 N THR C 321 ? N THR A 327 O ILE D 75  ? O ILE B 75  
D 1 2 N SER C 413 ? N SER A 419 O ALA C 427 ? O ALA A 433 
E 1 2 N ALA C 641 ? N ALA A 647 O GLY C 653 ? O GLY A 659 
E 2 3 O CYS C 654 ? O CYS A 660 N VAL C 464 ? N VAL A 470 
E 3 4 N GLY C 467 ? N GLY A 473 O LYS C 689 ? O LYS A 695 
F 1 2 N SER C 570 ? N SER A 576 O LYS C 581 ? O LYS A 587 
G 1 2 N ILE C 587 ? N ILE A 593 O VAL C 595 ? O VAL A 601 
H 1 2 N ILE D 5   ? N ILE B 5   O VAL D 55  ? O VAL B 55  
H 2 3 O ALA D 56  ? O ALA B 56  N LEU D 24  ? N LEU B 24  
H 3 4 N ILE D 23  ? N ILE B 23  O PHE D 81  ? O PHE B 81  
H 4 5 N LEU D 80  ? N LEU B 80  O ALA D 87  ? O ALA B 87  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 901'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 902'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 903'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG T 904'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 905' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 906' 
AC7 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE D3T A 823' 
AC8 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MES A 991' 
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE 1PE A 992' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP C 469 ? ASP A 475  . ? 1_555 ? 
2  AC1 5  ALA C 470 ? ALA A 476  . ? 1_555 ? 
3  AC1 5  ASP C 648 ? ASP A 654  . ? 1_555 ? 
4  AC1 5  D3T K .   ? D3T A 823  . ? 1_555 ? 
5  AC1 5  MG  G .   ? MG  A 902  . ? 1_555 ? 
6  AC2 7  ASP C 469 ? ASP A 475  . ? 1_555 ? 
7  AC2 7  ASP C 648 ? ASP A 654  . ? 1_555 ? 
8  AC2 7  D3T K .   ? D3T A 823  . ? 1_555 ? 
9  AC2 7  MG  F .   ? MG  A 901  . ? 1_555 ? 
10 AC2 7  HOH P .   ? HOH A 1008 . ? 1_555 ? 
11 AC2 7  HOH P .   ? HOH A 1284 . ? 1_555 ? 
12 AC2 7  2DA A 22  ? 2DA P 822  . ? 1_555 ? 
13 AC3 6  ASP C 5   ? ASP A 5    . ? 1_555 ? 
14 AC3 6  HOH P .   ? HOH A 1067 . ? 1_555 ? 
15 AC3 6  HOH P .   ? HOH A 1145 . ? 1_555 ? 
16 AC3 6  HOH P .   ? HOH A 1508 . ? 1_555 ? 
17 AC3 6  HOH P .   ? HOH A 1524 . ? 1_555 ? 
18 AC3 6  HOH P .   ? HOH A 1525 . ? 1_555 ? 
19 AC4 6  HOH O .   ? HOH T 1221 . ? 1_555 ? 
20 AC4 6  HOH O .   ? HOH T 1222 . ? 1_555 ? 
21 AC4 6  HOH O .   ? HOH T 1257 . ? 1_555 ? 
22 AC4 6  HOH O .   ? HOH T 1487 . ? 1_555 ? 
23 AC4 6  HOH O .   ? HOH T 1488 . ? 1_555 ? 
24 AC4 6  HOH O .   ? HOH T 1489 . ? 1_555 ? 
25 AC5 5  LYS C 220 ? LYS A 226  . ? 1_555 ? 
26 AC5 5  ARG C 223 ? ARG A 229  . ? 1_555 ? 
27 AC5 5  HOH P .   ? HOH A 1297 . ? 1_555 ? 
28 AC5 5  HOH P .   ? HOH A 1550 . ? 1_555 ? 
29 AC5 5  HOH P .   ? HOH A 1552 . ? 1_555 ? 
30 AC6 4  LYS C 178 ? LYS A 184  . ? 1_555 ? 
31 AC6 4  ARG C 655 ? ARG A 661  . ? 1_556 ? 
32 AC6 4  HOH P .   ? HOH A 1103 . ? 1_556 ? 
33 AC6 4  HOH P .   ? HOH A 1164 . ? 1_555 ? 
34 AC7 20 ARG C 423 ? ARG A 429  . ? 1_555 ? 
35 AC7 20 ASP C 469 ? ASP A 475  . ? 1_555 ? 
36 AC7 20 ALA C 470 ? ALA A 476  . ? 1_555 ? 
37 AC7 20 SER C 471 ? SER A 477  . ? 1_555 ? 
38 AC7 20 GLY C 472 ? GLY A 478  . ? 1_555 ? 
39 AC7 20 LEU C 473 ? LEU A 479  . ? 1_555 ? 
40 AC7 20 GLU C 474 ? GLU A 480  . ? 1_555 ? 
41 AC7 20 HIS C 500 ? HIS A 506  . ? 1_555 ? 
42 AC7 20 ARG C 512 ? ARG A 518  . ? 1_555 ? 
43 AC7 20 LYS C 516 ? LYS A 522  . ? 1_555 ? 
44 AC7 20 TYR C 520 ? TYR A 526  . ? 1_555 ? 
45 AC7 20 ASP C 648 ? ASP A 654  . ? 1_555 ? 
46 AC7 20 MG  F .   ? MG  A 901  . ? 1_555 ? 
47 AC7 20 MG  G .   ? MG  A 902  . ? 1_555 ? 
48 AC7 20 HOH P .   ? HOH A 1142 . ? 1_555 ? 
49 AC7 20 HOH P .   ? HOH A 1284 . ? 1_555 ? 
50 AC7 20 HOH P .   ? HOH A 1436 . ? 1_555 ? 
51 AC7 20 HOH P .   ? HOH A 1531 . ? 1_555 ? 
52 AC7 20 2DA A 22  ? 2DA P 822  . ? 1_555 ? 
53 AC7 20 DA  B 4   ? DA  T 854  . ? 1_555 ? 
54 AC8 9  GLY C 40  ? GLY A 40   . ? 1_555 ? 
55 AC8 9  LEU C 77  ? LEU A 77   . ? 1_555 ? 
56 AC8 9  ASN C 78  ? ASN A 78   . ? 1_555 ? 
57 AC8 9  ARG C 79  ? ARG A 79   . ? 1_555 ? 
58 AC8 9  HOH P .   ? HOH A 1042 . ? 1_555 ? 
59 AC8 9  ILE D 5   ? ILE B 5    . ? 4_466 ? 
60 AC8 9  SER D 11  ? SER B 11   . ? 4_466 ? 
61 AC8 9  THR D 14  ? THR B 14   . ? 4_466 ? 
62 AC8 9  ASP D 15  ? ASP B 15   . ? 4_466 ? 
63 AC9 6  ALA C 10  ? ALA A 10   . ? 1_555 ? 
64 AC9 6  TYR C 64  ? TYR A 64   . ? 1_555 ? 
65 AC9 6  MET C 107 ? MET A 107  . ? 1_555 ? 
66 AC9 6  LYS C 130 ? LYS A 136  . ? 1_555 ? 
67 AC9 6  TRP C 154 ? TRP A 160  . ? 1_555 ? 
68 AC9 6  HOH P .   ? HOH A 1428 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1TK8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TK8 
_atom_sites.fract_transf_matrix[1][1]   0.009418 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004636 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019174 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DA  A 1  6   ? 29.260 147.063 56.980 1.00 100.16 ? 806  DA  P P     1 
ATOM   2    O  OP1   . DA  A 1  6   ? 29.738 146.416 58.274 1.00 100.16 ? 806  DA  P OP1   1 
ATOM   3    O  OP2   . DA  A 1  6   ? 28.656 148.443 57.185 1.00 99.48  ? 806  DA  P OP2   1 
ATOM   4    O  "O5'" . DA  A 1  6   ? 30.587 147.264 56.050 1.00 100.16 ? 806  DA  P "O5'" 1 
ATOM   5    C  "C5'" . DA  A 1  6   ? 31.597 146.236 55.977 1.00 100.16 ? 806  DA  P "C5'" 1 
ATOM   6    C  "C4'" . DA  A 1  6   ? 31.841 145.827 54.539 1.00 100.16 ? 806  DA  P "C4'" 1 
ATOM   7    O  "O4'" . DA  A 1  6   ? 30.618 145.951 53.767 1.00 100.16 ? 806  DA  P "O4'" 1 
ATOM   8    C  "C3'" . DA  A 1  6   ? 32.848 146.659 53.762 1.00 100.16 ? 806  DA  P "C3'" 1 
ATOM   9    O  "O3'" . DA  A 1  6   ? 34.161 146.184 54.039 1.00 99.96  ? 806  DA  P "O3'" 1 
ATOM   10   C  "C2'" . DA  A 1  6   ? 32.461 146.376 52.312 1.00 100.01 ? 806  DA  P "C2'" 1 
ATOM   11   C  "C1'" . DA  A 1  6   ? 30.943 146.200 52.410 1.00 100.16 ? 806  DA  P "C1'" 1 
ATOM   12   N  N9    . DA  A 1  6   ? 30.166 147.346 51.927 1.00 100.16 ? 806  DA  P N9    1 
ATOM   13   C  C8    . DA  A 1  6   ? 29.505 148.305 52.658 1.00 100.16 ? 806  DA  P C8    1 
ATOM   14   N  N7    . DA  A 1  6   ? 28.876 149.190 51.922 1.00 100.16 ? 806  DA  P N7    1 
ATOM   15   C  C5    . DA  A 1  6   ? 29.143 148.792 50.619 1.00 100.16 ? 806  DA  P C5    1 
ATOM   16   C  C6    . DA  A 1  6   ? 28.759 149.317 49.368 1.00 100.16 ? 806  DA  P C6    1 
ATOM   17   N  N6    . DA  A 1  6   ? 27.989 150.400 49.222 1.00 100.16 ? 806  DA  P N6    1 
ATOM   18   N  N1    . DA  A 1  6   ? 29.199 148.683 48.258 1.00 100.16 ? 806  DA  P N1    1 
ATOM   19   C  C2    . DA  A 1  6   ? 29.970 147.598 48.404 1.00 100.16 ? 806  DA  P C2    1 
ATOM   20   N  N3    . DA  A 1  6   ? 30.396 147.010 49.521 1.00 100.16 ? 806  DA  P N3    1 
ATOM   21   C  C4    . DA  A 1  6   ? 29.942 147.663 50.606 1.00 100.16 ? 806  DA  P C4    1 
ATOM   22   P  P     . DC  A 1  7   ? 35.436 147.065 53.619 1.00 100.16 ? 807  DC  P P     1 
ATOM   23   O  OP1   . DC  A 1  7   ? 36.646 146.275 53.968 1.00 100.16 ? 807  DC  P OP1   1 
ATOM   24   O  OP2   . DC  A 1  7   ? 35.264 148.432 54.177 1.00 100.16 ? 807  DC  P OP2   1 
ATOM   25   O  "O5'" . DC  A 1  7   ? 35.340 147.144 52.029 1.00 100.16 ? 807  DC  P "O5'" 1 
ATOM   26   C  "C5'" . DC  A 1  7   ? 35.366 145.956 51.233 1.00 100.16 ? 807  DC  P "C5'" 1 
ATOM   27   C  "C4'" . DC  A 1  7   ? 35.547 146.297 49.772 1.00 100.15 ? 807  DC  P "C4'" 1 
ATOM   28   O  "O4'" . DC  A 1  7   ? 34.373 146.994 49.279 1.00 99.99  ? 807  DC  P "O4'" 1 
ATOM   29   C  "C3'" . DC  A 1  7   ? 36.745 147.199 49.462 1.00 100.11 ? 807  DC  P "C3'" 1 
ATOM   30   O  "O3'" . DC  A 1  7   ? 37.423 146.753 48.283 1.00 99.87  ? 807  DC  P "O3'" 1 
ATOM   31   C  "C2'" . DC  A 1  7   ? 36.112 148.556 49.212 1.00 100.16 ? 807  DC  P "C2'" 1 
ATOM   32   C  "C1'" . DC  A 1  7   ? 34.779 148.169 48.596 1.00 100.16 ? 807  DC  P "C1'" 1 
ATOM   33   N  N1    . DC  A 1  7   ? 33.706 149.179 48.717 1.00 100.09 ? 807  DC  P N1    1 
ATOM   34   C  C2    . DC  A 1  7   ? 32.948 149.503 47.575 1.00 100.16 ? 807  DC  P C2    1 
ATOM   35   O  O2    . DC  A 1  7   ? 33.170 148.905 46.505 1.00 99.94  ? 807  DC  P O2    1 
ATOM   36   N  N3    . DC  A 1  7   ? 31.993 150.457 47.668 1.00 100.16 ? 807  DC  P N3    1 
ATOM   37   C  C4    . DC  A 1  7   ? 31.773 151.072 48.833 1.00 100.16 ? 807  DC  P C4    1 
ATOM   38   N  N4    . DC  A 1  7   ? 30.829 152.017 48.871 1.00 100.15 ? 807  DC  P N4    1 
ATOM   39   C  C5    . DC  A 1  7   ? 32.511 150.749 50.009 1.00 100.16 ? 807  DC  P C5    1 
ATOM   40   C  C6    . DC  A 1  7   ? 33.457 149.806 49.908 1.00 100.05 ? 807  DC  P C6    1 
ATOM   41   P  P     . DG  A 1  8   ? 38.938 147.225 48.004 1.00 100.16 ? 808  DG  P P     1 
ATOM   42   O  OP1   . DG  A 1  8   ? 39.758 145.999 47.815 1.00 100.16 ? 808  DG  P OP1   1 
ATOM   43   O  OP2   . DG  A 1  8   ? 39.335 148.220 49.034 1.00 100.16 ? 808  DG  P OP2   1 
ATOM   44   O  "O5'" . DG  A 1  8   ? 38.852 147.985 46.606 1.00 100.12 ? 808  DG  P "O5'" 1 
ATOM   45   C  "C5'" . DG  A 1  8   ? 38.276 147.354 45.464 1.00 100.08 ? 808  DG  P "C5'" 1 
ATOM   46   C  "C4'" . DG  A 1  8   ? 37.887 148.390 44.435 1.00 100.16 ? 808  DG  P "C4'" 1 
ATOM   47   O  "O4'" . DG  A 1  8   ? 36.838 149.237 44.967 1.00 100.16 ? 808  DG  P "O4'" 1 
ATOM   48   C  "C3'" . DG  A 1  8   ? 39.017 149.333 44.018 1.00 100.15 ? 808  DG  P "C3'" 1 
ATOM   49   O  "O3'" . DG  A 1  8   ? 38.906 149.640 42.627 1.00 100.11 ? 808  DG  P "O3'" 1 
ATOM   50   C  "C2'" . DG  A 1  8   ? 38.747 150.583 44.834 1.00 100.13 ? 808  DG  P "C2'" 1 
ATOM   51   C  "C1'" . DG  A 1  8   ? 37.230 150.598 44.864 1.00 100.16 ? 808  DG  P "C1'" 1 
ATOM   52   N  N9    . DG  A 1  8   ? 36.629 151.336 45.971 1.00 100.16 ? 808  DG  P N9    1 
ATOM   53   C  C8    . DG  A 1  8   ? 36.952 151.260 47.307 1.00 100.16 ? 808  DG  P C8    1 
ATOM   54   N  N7    . DG  A 1  8   ? 36.235 152.056 48.055 1.00 100.16 ? 808  DG  P N7    1 
ATOM   55   C  C5    . DG  A 1  8   ? 35.386 152.696 47.161 1.00 100.16 ? 808  DG  P C5    1 
ATOM   56   C  C6    . DG  A 1  8   ? 34.380 153.674 47.386 1.00 100.09 ? 808  DG  P C6    1 
ATOM   57   O  O6    . DG  A 1  8   ? 34.027 154.187 48.455 1.00 99.79  ? 808  DG  P O6    1 
ATOM   58   N  N1    . DG  A 1  8   ? 33.759 154.049 46.198 1.00 100.16 ? 808  DG  P N1    1 
ATOM   59   C  C2    . DG  A 1  8   ? 34.064 153.551 44.954 1.00 100.16 ? 808  DG  P C2    1 
ATOM   60   N  N2    . DG  A 1  8   ? 33.352 154.039 43.926 1.00 100.12 ? 808  DG  P N2    1 
ATOM   61   N  N3    . DG  A 1  8   ? 34.998 152.642 44.732 1.00 100.16 ? 808  DG  P N3    1 
ATOM   62   C  C4    . DG  A 1  8   ? 35.615 152.262 45.872 1.00 100.16 ? 808  DG  P C4    1 
ATOM   63   P  P     . DA  A 1  9   ? 40.204 150.118 41.814 1.00 100.16 ? 809  DA  P P     1 
ATOM   64   O  OP1   . DA  A 1  9   ? 40.868 148.900 41.283 1.00 100.16 ? 809  DA  P OP1   1 
ATOM   65   O  OP2   . DA  A 1  9   ? 40.969 151.059 42.675 1.00 100.16 ? 809  DA  P OP2   1 
ATOM   66   O  "O5'" . DA  A 1  9   ? 39.607 150.940 40.587 1.00 100.16 ? 809  DA  P "O5'" 1 
ATOM   67   C  "C5'" . DA  A 1  9   ? 38.655 150.353 39.703 1.00 99.90  ? 809  DA  P "C5'" 1 
ATOM   68   C  "C4'" . DA  A 1  9   ? 37.790 151.426 39.084 1.00 99.95  ? 809  DA  P "C4'" 1 
ATOM   69   O  "O4'" . DA  A 1  9   ? 37.000 152.058 40.121 1.00 99.94  ? 809  DA  P "O4'" 1 
ATOM   70   C  "C3'" . DA  A 1  9   ? 38.565 152.550 38.396 1.00 99.56  ? 809  DA  P "C3'" 1 
ATOM   71   O  "O3'" . DA  A 1  9   ? 37.887 152.961 37.204 1.00 99.80  ? 809  DA  P "O3'" 1 
ATOM   72   C  "C2'" . DA  A 1  9   ? 38.582 153.658 39.434 1.00 99.43  ? 809  DA  P "C2'" 1 
ATOM   73   C  "C1'" . DA  A 1  9   ? 37.270 153.452 40.175 1.00 99.46  ? 809  DA  P "C1'" 1 
ATOM   74   N  N9    . DA  A 1  9   ? 37.318 153.847 41.586 1.00 99.28  ? 809  DA  P N9    1 
ATOM   75   C  C8    . DA  A 1  9   ? 38.093 153.303 42.584 1.00 98.84  ? 809  DA  P C8    1 
ATOM   76   N  N7    . DA  A 1  9   ? 37.932 153.876 43.752 1.00 98.51  ? 809  DA  P N7    1 
ATOM   77   C  C5    . DA  A 1  9   ? 36.985 154.861 43.512 1.00 98.21  ? 809  DA  P C5    1 
ATOM   78   C  C6    . DA  A 1  9   ? 36.386 155.819 44.349 1.00 97.62  ? 809  DA  P C6    1 
ATOM   79   N  N6    . DA  A 1  9   ? 36.668 155.945 45.648 1.00 97.11  ? 809  DA  P N6    1 
ATOM   80   N  N1    . DA  A 1  9   ? 35.476 156.653 43.800 1.00 97.33  ? 809  DA  P N1    1 
ATOM   81   C  C2    . DA  A 1  9   ? 35.196 156.526 42.496 1.00 97.45  ? 809  DA  P C2    1 
ATOM   82   N  N3    . DA  A 1  9   ? 35.692 155.669 41.606 1.00 98.10  ? 809  DA  P N3    1 
ATOM   83   C  C4    . DA  A 1  9   ? 36.593 154.853 42.183 1.00 98.70  ? 809  DA  P C4    1 
ATOM   84   P  P     . DC  A 1  10  ? 38.526 154.109 36.276 1.00 100.16 ? 810  DC  P P     1 
ATOM   85   O  OP1   . DC  A 1  10  ? 37.871 154.020 34.943 1.00 100.16 ? 810  DC  P OP1   1 
ATOM   86   O  OP2   . DC  A 1  10  ? 40.007 154.038 36.370 1.00 100.16 ? 810  DC  P OP2   1 
ATOM   87   O  "O5'" . DC  A 1  10  ? 38.041 155.456 36.975 1.00 98.55  ? 810  DC  P "O5'" 1 
ATOM   88   C  "C5'" . DC  A 1  10  ? 36.666 155.836 36.937 1.00 95.94  ? 810  DC  P "C5'" 1 
ATOM   89   C  "C4'" . DC  A 1  10  ? 36.496 157.260 37.411 1.00 93.60  ? 810  DC  P "C4'" 1 
ATOM   90   O  "O4'" . DC  A 1  10  ? 36.612 157.331 38.852 1.00 92.54  ? 810  DC  P "O4'" 1 
ATOM   91   C  "C3'" . DC  A 1  10  ? 37.513 158.255 36.848 1.00 92.56  ? 810  DC  P "C3'" 1 
ATOM   92   O  "O3'" . DC  A 1  10  ? 36.862 159.485 36.536 1.00 92.24  ? 810  DC  P "O3'" 1 
ATOM   93   C  "C2'" . DC  A 1  10  ? 38.467 158.470 38.008 1.00 91.75  ? 810  DC  P "C2'" 1 
ATOM   94   C  "C1'" . DC  A 1  10  ? 37.525 158.357 39.195 1.00 91.54  ? 810  DC  P "C1'" 1 
ATOM   95   N  N1    . DC  A 1  10  ? 38.140 158.013 40.493 1.00 90.87  ? 810  DC  P N1    1 
ATOM   96   C  C2    . DC  A 1  10  ? 37.721 158.708 41.642 1.00 90.14  ? 810  DC  P C2    1 
ATOM   97   O  O2    . DC  A 1  10  ? 36.839 159.579 41.538 1.00 88.94  ? 810  DC  P O2    1 
ATOM   98   N  N3    . DC  A 1  10  ? 38.287 158.412 42.835 1.00 89.80  ? 810  DC  P N3    1 
ATOM   99   C  C4    . DC  A 1  10  ? 39.229 157.468 42.913 1.00 89.69  ? 810  DC  P C4    1 
ATOM   100  N  N4    . DC  A 1  10  ? 39.760 157.213 44.111 1.00 88.87  ? 810  DC  P N4    1 
ATOM   101  C  C5    . DC  A 1  10  ? 39.667 156.743 41.765 1.00 89.89  ? 810  DC  P C5    1 
ATOM   102  C  C6    . DC  A 1  10  ? 39.101 157.043 40.588 1.00 90.49  ? 810  DC  P C6    1 
ATOM   103  P  P     . DG  A 1  11  ? 37.310 160.319 35.239 1.00 92.13  ? 811  DG  P P     1 
ATOM   104  O  OP1   . DG  A 1  11  ? 36.486 159.875 34.084 1.00 91.80  ? 811  DG  P OP1   1 
ATOM   105  O  OP2   . DG  A 1  11  ? 38.790 160.263 35.148 1.00 92.23  ? 811  DG  P OP2   1 
ATOM   106  O  "O5'" . DG  A 1  11  ? 36.893 161.810 35.606 1.00 90.96  ? 811  DG  P "O5'" 1 
ATOM   107  C  "C5'" . DG  A 1  11  ? 35.592 162.098 36.116 1.00 89.61  ? 811  DG  P "C5'" 1 
ATOM   108  C  "C4'" . DG  A 1  11  ? 35.677 163.116 37.231 1.00 88.64  ? 811  DG  P "C4'" 1 
ATOM   109  O  "O4'" . DG  A 1  11  ? 36.188 162.522 38.452 1.00 87.58  ? 811  DG  P "O4'" 1 
ATOM   110  C  "C3'" . DG  A 1  11  ? 36.583 164.309 36.928 1.00 88.45  ? 811  DG  P "C3'" 1 
ATOM   111  O  "O3'" . DG  A 1  11  ? 35.975 165.509 37.389 1.00 88.40  ? 811  DG  P "O3'" 1 
ATOM   112  C  "C2'" . DG  A 1  11  ? 37.823 164.031 37.757 1.00 87.90  ? 811  DG  P "C2'" 1 
ATOM   113  C  "C1'" . DG  A 1  11  ? 37.219 163.349 38.968 1.00 86.77  ? 811  DG  P "C1'" 1 
ATOM   114  N  N9    . DG  A 1  11  ? 38.136 162.520 39.745 1.00 85.63  ? 811  DG  P N9    1 
ATOM   115  C  C8    . DG  A 1  11  ? 38.953 161.513 39.283 1.00 85.13  ? 811  DG  P C8    1 
ATOM   116  N  N7    . DG  A 1  11  ? 39.664 160.956 40.225 1.00 84.29  ? 811  DG  P N7    1 
ATOM   117  C  C5    . DG  A 1  11  ? 39.295 161.632 41.383 1.00 84.00  ? 811  DG  P C5    1 
ATOM   118  C  C6    . DG  A 1  11  ? 39.728 161.464 42.726 1.00 82.98  ? 811  DG  P C6    1 
ATOM   119  O  O6    . DG  A 1  11  ? 40.547 160.655 43.177 1.00 82.18  ? 811  DG  P O6    1 
ATOM   120  N  N1    . DG  A 1  11  ? 39.100 162.362 43.581 1.00 82.58  ? 811  DG  P N1    1 
ATOM   121  C  C2    . DG  A 1  11  ? 38.172 163.299 43.200 1.00 83.38  ? 811  DG  P C2    1 
ATOM   122  N  N2    . DG  A 1  11  ? 37.685 164.081 44.176 1.00 83.28  ? 811  DG  P N2    1 
ATOM   123  N  N3    . DG  A 1  11  ? 37.754 163.461 41.955 1.00 83.91  ? 811  DG  P N3    1 
ATOM   124  C  C4    . DG  A 1  11  ? 38.354 162.600 41.103 1.00 84.69  ? 811  DG  P C4    1 
ATOM   125  P  P     . DG  A 1  12  ? 36.148 166.854 36.541 1.00 88.76  ? 812  DG  P P     1 
ATOM   126  O  OP1   . DG  A 1  12  ? 35.034 166.930 35.558 1.00 89.04  ? 812  DG  P OP1   1 
ATOM   127  O  OP2   . DG  A 1  12  ? 37.557 166.902 36.065 1.00 88.50  ? 812  DG  P OP2   1 
ATOM   128  O  "O5'" . DG  A 1  12  ? 35.934 167.995 37.625 1.00 86.71  ? 812  DG  P "O5'" 1 
ATOM   129  C  "C5'" . DG  A 1  12  ? 37.030 168.758 38.107 1.00 83.43  ? 812  DG  P "C5'" 1 
ATOM   130  C  "C4'" . DG  A 1  12  ? 36.965 168.857 39.611 1.00 81.22  ? 812  DG  P "C4'" 1 
ATOM   131  O  "O4'" . DG  A 1  12  ? 37.377 167.600 40.211 1.00 79.80  ? 812  DG  P "O4'" 1 
ATOM   132  C  "C3'" . DG  A 1  12  ? 37.887 169.925 40.187 1.00 79.94  ? 812  DG  P "C3'" 1 
ATOM   133  O  "O3'" . DG  A 1  12  ? 37.206 170.626 41.226 1.00 78.66  ? 812  DG  P "O3'" 1 
ATOM   134  C  "C2'" . DG  A 1  12  ? 39.072 169.141 40.719 1.00 79.62  ? 812  DG  P "C2'" 1 
ATOM   135  C  "C1'" . DG  A 1  12  ? 38.447 167.819 41.127 1.00 78.53  ? 812  DG  P "C1'" 1 
ATOM   136  N  N9    . DG  A 1  12  ? 39.370 166.687 41.039 1.00 76.17  ? 812  DG  P N9    1 
ATOM   137  C  C8    . DG  A 1  12  ? 39.779 166.037 39.897 1.00 75.46  ? 812  DG  P C8    1 
ATOM   138  N  N7    . DG  A 1  12  ? 40.625 165.071 40.131 1.00 74.20  ? 812  DG  P N7    1 
ATOM   139  C  C5    . DG  A 1  12  ? 40.785 165.076 41.510 1.00 73.49  ? 812  DG  P C5    1 
ATOM   140  C  C6    . DG  A 1  12  ? 41.585 164.253 42.344 1.00 72.57  ? 812  DG  P C6    1 
ATOM   141  O  O6    . DG  A 1  12  ? 42.334 163.324 42.021 1.00 71.96  ? 812  DG  P O6    1 
ATOM   142  N  N1    . DG  A 1  12  ? 41.454 164.602 43.684 1.00 71.75  ? 812  DG  P N1    1 
ATOM   143  C  C2    . DG  A 1  12  ? 40.659 165.612 44.162 1.00 72.00  ? 812  DG  P C2    1 
ATOM   144  N  N2    . DG  A 1  12  ? 40.675 165.794 45.488 1.00 71.46  ? 812  DG  P N2    1 
ATOM   145  N  N3    . DG  A 1  12  ? 39.905 166.386 43.396 1.00 72.90  ? 812  DG  P N3    1 
ATOM   146  C  C4    . DG  A 1  12  ? 40.016 166.065 42.089 1.00 74.00  ? 812  DG  P C4    1 
ATOM   147  P  P     . DC  A 1  13  ? 37.583 172.157 41.530 1.00 78.84  ? 813  DC  P P     1 
ATOM   148  O  OP1   . DC  A 1  13  ? 36.324 172.923 41.713 1.00 79.18  ? 813  DC  P OP1   1 
ATOM   149  O  OP2   . DC  A 1  13  ? 38.571 172.600 40.508 1.00 78.13  ? 813  DC  P OP2   1 
ATOM   150  O  "O5'" . DC  A 1  13  ? 38.323 172.065 42.935 1.00 76.18  ? 813  DC  P "O5'" 1 
ATOM   151  C  "C5'" . DC  A 1  13  ? 39.056 170.896 43.279 1.00 72.73  ? 813  DC  P "C5'" 1 
ATOM   152  C  "C4'" . DC  A 1  13  ? 39.941 171.163 44.469 1.00 70.07  ? 813  DC  P "C4'" 1 
ATOM   153  O  "O4'" . DC  A 1  13  ? 40.731 169.975 44.703 1.00 69.41  ? 813  DC  P "O4'" 1 
ATOM   154  C  "C3'" . DC  A 1  13  ? 40.935 172.300 44.253 1.00 69.10  ? 813  DC  P "C3'" 1 
ATOM   155  O  "O3'" . DC  A 1  13  ? 41.090 173.049 45.466 1.00 67.90  ? 813  DC  P "O3'" 1 
ATOM   156  C  "C2'" . DC  A 1  13  ? 42.203 171.594 43.802 1.00 68.48  ? 813  DC  P "C2'" 1 
ATOM   157  C  "C1'" . DC  A 1  13  ? 42.108 170.213 44.445 1.00 68.01  ? 813  DC  P "C1'" 1 
ATOM   158  N  N1    . DC  A 1  13  ? 42.603 169.107 43.594 1.00 66.45  ? 813  DC  P N1    1 
ATOM   159  C  C2    . DC  A 1  13  ? 43.458 168.138 44.154 1.00 65.40  ? 813  DC  P C2    1 
ATOM   160  O  O2    . DC  A 1  13  ? 43.757 168.215 45.356 1.00 64.35  ? 813  DC  P O2    1 
ATOM   161  N  N3    . DC  A 1  13  ? 43.930 167.140 43.368 1.00 64.43  ? 813  DC  P N3    1 
ATOM   162  C  C4    . DC  A 1  13  ? 43.579 167.080 42.081 1.00 64.14  ? 813  DC  P C4    1 
ATOM   163  N  N4    . DC  A 1  13  ? 44.076 166.086 41.342 1.00 63.30  ? 813  DC  P N4    1 
ATOM   164  C  C5    . DC  A 1  13  ? 42.705 168.039 41.491 1.00 64.46  ? 813  DC  P C5    1 
ATOM   165  C  C6    . DC  A 1  13  ? 42.244 169.024 42.275 1.00 65.65  ? 813  DC  P C6    1 
ATOM   166  P  P     . DC  A 1  14  ? 42.190 174.219 45.555 1.00 66.48  ? 814  DC  P P     1 
ATOM   167  O  OP1   . DC  A 1  14  ? 41.920 175.025 46.774 1.00 66.26  ? 814  DC  P OP1   1 
ATOM   168  O  OP2   . DC  A 1  14  ? 42.277 174.894 44.231 1.00 66.12  ? 814  DC  P OP2   1 
ATOM   169  O  "O5'" . DC  A 1  14  ? 43.531 173.397 45.791 1.00 63.81  ? 814  DC  P "O5'" 1 
ATOM   170  C  "C5'" . DC  A 1  14  ? 43.608 172.426 46.837 1.00 58.57  ? 814  DC  P "C5'" 1 
ATOM   171  C  "C4'" . DC  A 1  14  ? 45.025 171.921 46.977 1.00 55.98  ? 814  DC  P "C4'" 1 
ATOM   172  O  "O4'" . DC  A 1  14  ? 45.286 170.782 46.118 1.00 53.49  ? 814  DC  P "O4'" 1 
ATOM   173  C  "C3'" . DC  A 1  14  ? 46.074 172.970 46.627 1.00 54.50  ? 814  DC  P "C3'" 1 
ATOM   174  O  "O3'" . DC  A 1  14  ? 47.113 172.966 47.585 1.00 53.97  ? 814  DC  P "O3'" 1 
ATOM   175  C  "C2'" . DC  A 1  14  ? 46.612 172.513 45.283 1.00 52.98  ? 814  DC  P "C2'" 1 
ATOM   176  C  "C1'" . DC  A 1  14  ? 46.483 171.004 45.391 1.00 50.25  ? 814  DC  P "C1'" 1 
ATOM   177  N  N1    . DC  A 1  14  ? 46.380 170.290 44.102 1.00 46.94  ? 814  DC  P N1    1 
ATOM   178  C  C2    . DC  A 1  14  ? 47.101 169.098 43.928 1.00 42.92  ? 814  DC  P C2    1 
ATOM   179  O  O2    . DC  A 1  14  ? 47.791 168.666 44.861 1.00 41.03  ? 814  DC  P O2    1 
ATOM   180  N  N3    . DC  A 1  14  ? 47.024 168.450 42.747 1.00 42.38  ? 814  DC  P N3    1 
ATOM   181  C  C4    . DC  A 1  14  ? 46.268 168.939 41.764 1.00 42.33  ? 814  DC  P C4    1 
ATOM   182  N  N4    . DC  A 1  14  ? 46.226 168.264 40.616 1.00 41.74  ? 814  DC  P N4    1 
ATOM   183  C  C5    . DC  A 1  14  ? 45.521 170.142 41.913 1.00 43.78  ? 814  DC  P C5    1 
ATOM   184  C  C6    . DC  A 1  14  ? 45.602 170.777 43.086 1.00 44.68  ? 814  DC  P C6    1 
ATOM   185  P  P     . DA  A 1  15  ? 48.045 174.252 47.720 1.00 54.52  ? 815  DA  P P     1 
ATOM   186  O  OP1   . DA  A 1  15  ? 47.378 175.245 48.604 1.00 55.14  ? 815  DA  P OP1   1 
ATOM   187  O  OP2   . DA  A 1  15  ? 48.445 174.641 46.337 1.00 52.40  ? 815  DA  P OP2   1 
ATOM   188  O  "O5'" . DA  A 1  15  ? 49.313 173.682 48.474 1.00 51.26  ? 815  DA  P "O5'" 1 
ATOM   189  C  "C5'" . DA  A 1  15  ? 50.592 173.861 47.921 1.00 49.80  ? 815  DA  P "C5'" 1 
ATOM   190  C  "C4'" . DA  A 1  15  ? 51.290 172.532 47.799 1.00 46.65  ? 815  DA  P "C4'" 1 
ATOM   191  O  "O4'" . DA  A 1  15  ? 50.625 171.665 46.838 1.00 46.00  ? 815  DA  P "O4'" 1 
ATOM   192  C  "C3'" . DA  A 1  15  ? 52.714 172.713 47.296 1.00 45.18  ? 815  DA  P "C3'" 1 
ATOM   193  O  "O3'" . DA  A 1  15  ? 53.587 171.932 48.101 1.00 44.02  ? 815  DA  P "O3'" 1 
ATOM   194  C  "C2'" . DA  A 1  15  ? 52.654 172.253 45.849 1.00 44.06  ? 815  DA  P "C2'" 1 
ATOM   195  C  "C1'" . DA  A 1  15  ? 51.573 171.192 45.887 1.00 42.05  ? 815  DA  P "C1'" 1 
ATOM   196  N  N9    . DA  A 1  15  ? 50.890 170.978 44.605 1.00 38.81  ? 815  DA  P N9    1 
ATOM   197  C  C8    . DA  A 1  15  ? 49.921 171.760 44.021 1.00 38.34  ? 815  DA  P C8    1 
ATOM   198  N  N7    . DA  A 1  15  ? 49.499 171.306 42.864 1.00 36.06  ? 815  DA  P N7    1 
ATOM   199  C  C5    . DA  A 1  15  ? 50.235 170.146 42.670 1.00 35.73  ? 815  DA  P C5    1 
ATOM   200  C  C6    . DA  A 1  15  ? 50.250 169.198 41.627 1.00 34.83  ? 815  DA  P C6    1 
ATOM   201  N  N6    . DA  A 1  15  ? 49.459 169.263 40.553 1.00 33.52  ? 815  DA  P N6    1 
ATOM   202  N  N1    . DA  A 1  15  ? 51.112 168.164 41.729 1.00 34.80  ? 815  DA  P N1    1 
ATOM   203  C  C2    . DA  A 1  15  ? 51.892 168.088 42.815 1.00 35.77  ? 815  DA  P C2    1 
ATOM   204  N  N3    . DA  A 1  15  ? 51.963 168.908 43.865 1.00 37.29  ? 815  DA  P N3    1 
ATOM   205  C  C4    . DA  A 1  15  ? 51.100 169.932 43.730 1.00 36.98  ? 815  DA  P C4    1 
ATOM   206  P  P     . DG  A 1  16  ? 55.090 172.433 48.350 1.00 45.46  ? 816  DG  P P     1 
ATOM   207  O  OP1   . DG  A 1  16  ? 55.480 172.082 49.744 1.00 45.50  ? 816  DG  P OP1   1 
ATOM   208  O  OP2   . DG  A 1  16  ? 55.189 173.845 47.886 1.00 43.81  ? 816  DG  P OP2   1 
ATOM   209  O  "O5'" . DG  A 1  16  ? 55.909 171.518 47.346 1.00 42.30  ? 816  DG  P "O5'" 1 
ATOM   210  C  "C5'" . DG  A 1  16  ? 55.240 170.951 46.235 1.00 36.85  ? 816  DG  P "C5'" 1 
ATOM   211  C  "C4'" . DG  A 1  16  ? 56.095 169.913 45.562 1.00 33.29  ? 816  DG  P "C4'" 1 
ATOM   212  O  "O4'" . DG  A 1  16  ? 55.357 169.474 44.402 1.00 31.25  ? 816  DG  P "O4'" 1 
ATOM   213  C  "C3'" . DG  A 1  16  ? 57.410 170.463 45.029 1.00 30.71  ? 816  DG  P "C3'" 1 
ATOM   214  O  "O3'" . DG  A 1  16  ? 58.359 169.387 44.991 1.00 29.70  ? 816  DG  P "O3'" 1 
ATOM   215  C  "C2'" . DG  A 1  16  ? 57.015 170.981 43.657 1.00 28.88  ? 816  DG  P "C2'" 1 
ATOM   216  C  "C1'" . DG  A 1  16  ? 55.941 169.992 43.218 1.00 28.01  ? 816  DG  P "C1'" 1 
ATOM   217  N  N9    . DG  A 1  16  ? 54.865 170.554 42.407 1.00 24.20  ? 816  DG  P N9    1 
ATOM   218  C  C8    . DG  A 1  16  ? 54.147 171.697 42.656 1.00 24.44  ? 816  DG  P C8    1 
ATOM   219  N  N7    . DG  A 1  16  ? 53.248 171.947 41.743 1.00 24.05  ? 816  DG  P N7    1 
ATOM   220  C  C5    . DG  A 1  16  ? 53.377 170.905 40.839 1.00 22.23  ? 816  DG  P C5    1 
ATOM   221  C  C6    . DG  A 1  16  ? 52.672 170.639 39.636 1.00 21.62  ? 816  DG  P C6    1 
ATOM   222  O  O6    . DG  A 1  16  ? 51.769 171.295 39.112 1.00 19.45  ? 816  DG  P O6    1 
ATOM   223  N  N1    . DG  A 1  16  ? 53.124 169.471 39.028 1.00 21.31  ? 816  DG  P N1    1 
ATOM   224  C  C2    . DG  A 1  16  ? 54.126 168.668 39.510 1.00 20.31  ? 816  DG  P C2    1 
ATOM   225  N  N2    . DG  A 1  16  ? 54.418 167.586 38.784 1.00 20.99  ? 816  DG  P N2    1 
ATOM   226  N  N3    . DG  A 1  16  ? 54.794 168.907 40.625 1.00 21.93  ? 816  DG  P N3    1 
ATOM   227  C  C4    . DG  A 1  16  ? 54.371 170.034 41.235 1.00 23.48  ? 816  DG  P C4    1 
ATOM   228  P  P     . DT  A 1  17  ? 59.914 169.683 44.703 1.00 31.11  ? 817  DT  P P     1 
ATOM   229  O  OP1   . DT  A 1  17  ? 60.703 168.735 45.526 1.00 33.79  ? 817  DT  P OP1   1 
ATOM   230  O  OP2   . DT  A 1  17  ? 60.177 171.142 44.803 1.00 29.09  ? 817  DT  P OP2   1 
ATOM   231  O  "O5'" . DT  A 1  17  ? 60.095 169.239 43.189 1.00 30.89  ? 817  DT  P "O5'" 1 
ATOM   232  C  "C5'" . DT  A 1  17  ? 59.015 169.375 42.287 1.00 29.71  ? 817  DT  P "C5'" 1 
ATOM   233  C  "C4'" . DT  A 1  17  ? 59.432 169.002 40.891 1.00 28.60  ? 817  DT  P "C4'" 1 
ATOM   234  O  "O4'" . DT  A 1  17  ? 58.309 169.311 40.038 1.00 28.52  ? 817  DT  P "O4'" 1 
ATOM   235  C  "C3'" . DT  A 1  17  ? 60.612 169.798 40.337 1.00 27.04  ? 817  DT  P "C3'" 1 
ATOM   236  O  "O3'" . DT  A 1  17  ? 61.325 168.945 39.434 1.00 24.86  ? 817  DT  P "O3'" 1 
ATOM   237  C  "C2'" . DT  A 1  17  ? 59.938 170.970 39.640 1.00 25.31  ? 817  DT  P "C2'" 1 
ATOM   238  C  "C1'" . DT  A 1  17  ? 58.637 170.355 39.136 1.00 26.90  ? 817  DT  P "C1'" 1 
ATOM   239  N  N1    . DT  A 1  17  ? 57.457 171.252 39.046 1.00 24.91  ? 817  DT  P N1    1 
ATOM   240  C  C2    . DT  A 1  17  ? 56.557 171.017 38.027 1.00 25.40  ? 817  DT  P C2    1 
ATOM   241  O  O2    . DT  A 1  17  ? 56.693 170.122 37.206 1.00 25.77  ? 817  DT  P O2    1 
ATOM   242  N  N3    . DT  A 1  17  ? 55.485 171.875 38.001 1.00 25.54  ? 817  DT  P N3    1 
ATOM   243  C  C4    . DT  A 1  17  ? 55.228 172.923 38.867 1.00 25.71  ? 817  DT  P C4    1 
ATOM   244  O  O4    . DT  A 1  17  ? 54.225 173.613 38.713 1.00 26.16  ? 817  DT  P O4    1 
ATOM   245  C  C5    . DT  A 1  17  ? 56.207 173.113 39.909 1.00 25.77  ? 817  DT  P C5    1 
ATOM   246  C  C7    . DT  A 1  17  ? 56.009 174.222 40.896 1.00 24.66  ? 817  DT  P C7    1 
ATOM   247  C  C6    . DT  A 1  17  ? 57.259 172.280 39.946 1.00 25.87  ? 817  DT  P C6    1 
ATOM   248  P  P     . DG  A 1  18  ? 62.781 169.358 38.894 1.00 25.20  ? 818  DG  P P     1 
ATOM   249  O  OP1   . DG  A 1  18  ? 63.645 168.149 38.960 1.00 27.99  ? 818  DG  P OP1   1 
ATOM   250  O  OP2   . DG  A 1  18  ? 63.221 170.615 39.551 1.00 26.51  ? 818  DG  P OP2   1 
ATOM   251  O  "O5'" . DG  A 1  18  ? 62.514 169.671 37.361 1.00 22.24  ? 818  DG  P "O5'" 1 
ATOM   252  C  "C5'" . DG  A 1  18  ? 61.264 170.201 36.981 1.00 23.58  ? 818  DG  P "C5'" 1 
ATOM   253  C  "C4'" . DG  A 1  18  ? 61.087 170.161 35.487 1.00 21.90  ? 818  DG  P "C4'" 1 
ATOM   254  O  "O4'" . DG  A 1  18  ? 59.755 170.671 35.255 1.00 23.47  ? 818  DG  P "O4'" 1 
ATOM   255  C  "C3'" . DG  A 1  18  ? 62.032 171.084 34.723 1.00 22.08  ? 818  DG  P "C3'" 1 
ATOM   256  O  "O3'" . DG  A 1  18  ? 62.302 170.542 33.428 1.00 20.62  ? 818  DG  P "O3'" 1 
ATOM   257  C  "C2'" . DG  A 1  18  ? 61.264 172.389 34.648 1.00 21.52  ? 818  DG  P "C2'" 1 
ATOM   258  C  "C1'" . DG  A 1  18  ? 59.802 171.953 34.655 1.00 23.43  ? 818  DG  P "C1'" 1 
ATOM   259  N  N9    . DG  A 1  18  ? 58.916 172.836 35.414 1.00 24.60  ? 818  DG  P N9    1 
ATOM   260  C  C8    . DG  A 1  18  ? 59.186 173.461 36.611 1.00 24.89  ? 818  DG  P C8    1 
ATOM   261  N  N7    . DG  A 1  18  ? 58.218 174.239 37.013 1.00 25.18  ? 818  DG  P N7    1 
ATOM   262  C  C5    . DG  A 1  18  ? 57.245 174.114 36.029 1.00 24.73  ? 818  DG  P C5    1 
ATOM   263  C  C6    . DG  A 1  18  ? 55.976 174.734 35.907 1.00 25.77  ? 818  DG  P C6    1 
ATOM   264  O  O6    . DG  A 1  18  ? 55.447 175.563 36.656 1.00 28.34  ? 818  DG  P O6    1 
ATOM   265  N  N1    . DG  A 1  18  ? 55.306 174.308 34.765 1.00 25.61  ? 818  DG  P N1    1 
ATOM   266  C  C2    . DG  A 1  18  ? 55.795 173.409 33.853 1.00 25.94  ? 818  DG  P C2    1 
ATOM   267  N  N2    . DG  A 1  18  ? 54.987 173.108 32.824 1.00 24.58  ? 818  DG  P N2    1 
ATOM   268  N  N3    . DG  A 1  18  ? 56.984 172.839 33.943 1.00 25.86  ? 818  DG  P N3    1 
ATOM   269  C  C4    . DG  A 1  18  ? 57.650 173.234 35.048 1.00 24.84  ? 818  DG  P C4    1 
ATOM   270  P  P     . DC  A 1  19  ? 63.346 171.274 32.443 1.00 20.10  ? 819  DC  P P     1 
ATOM   271  O  OP1   . DC  A 1  19  ? 64.137 170.186 31.819 1.00 22.27  ? 819  DC  P OP1   1 
ATOM   272  O  OP2   . DC  A 1  19  ? 64.045 172.370 33.158 1.00 21.97  ? 819  DC  P OP2   1 
ATOM   273  O  "O5'" . DC  A 1  19  ? 62.406 171.931 31.337 1.00 18.72  ? 819  DC  P "O5'" 1 
ATOM   274  C  "C5'" . DC  A 1  19  ? 61.461 171.137 30.624 1.00 17.36  ? 819  DC  P "C5'" 1 
ATOM   275  C  "C4'" . DC  A 1  19  ? 60.537 172.013 29.811 1.00 20.47  ? 819  DC  P "C4'" 1 
ATOM   276  O  "O4'" . DC  A 1  19  ? 59.577 172.690 30.664 1.00 18.82  ? 819  DC  P "O4'" 1 
ATOM   277  C  "C3'" . DC  A 1  19  ? 61.238 173.104 28.996 1.00 20.32  ? 819  DC  P "C3'" 1 
ATOM   278  O  "O3'" . DC  A 1  19  ? 60.649 173.210 27.699 1.00 22.15  ? 819  DC  P "O3'" 1 
ATOM   279  C  "C2'" . DC  A 1  19  ? 60.950 174.368 29.784 1.00 19.50  ? 819  DC  P "C2'" 1 
ATOM   280  C  "C1'" . DC  A 1  19  ? 59.570 174.074 30.342 1.00 19.02  ? 819  DC  P "C1'" 1 
ATOM   281  N  N1    . DC  A 1  19  ? 59.211 174.843 31.551 1.00 18.94  ? 819  DC  P N1    1 
ATOM   282  C  C2    . DC  A 1  19  ? 57.967 175.489 31.595 1.00 16.93  ? 819  DC  P C2    1 
ATOM   283  O  O2    . DC  A 1  19  ? 57.185 175.350 30.652 1.00 17.76  ? 819  DC  P O2    1 
ATOM   284  N  N3    . DC  A 1  19  ? 57.651 176.244 32.663 1.00 18.39  ? 819  DC  P N3    1 
ATOM   285  C  C4    . DC  A 1  19  ? 58.512 176.360 33.674 1.00 19.90  ? 819  DC  P C4    1 
ATOM   286  N  N4    . DC  A 1  19  ? 58.165 177.138 34.703 1.00 19.28  ? 819  DC  P N4    1 
ATOM   287  C  C5    . DC  A 1  19  ? 59.769 175.689 33.676 1.00 18.45  ? 819  DC  P C5    1 
ATOM   288  C  C6    . DC  A 1  19  ? 60.075 174.948 32.605 1.00 18.53  ? 819  DC  P C6    1 
ATOM   289  P  P     . DC  A 1  20  ? 61.416 174.016 26.534 1.00 23.66  ? 820  DC  P P     1 
ATOM   290  O  OP1   . DC  A 1  20  ? 61.806 173.029 25.500 1.00 24.83  ? 820  DC  P OP1   1 
ATOM   291  O  OP2   . DC  A 1  20  ? 62.451 174.912 27.121 1.00 21.00  ? 820  DC  P OP2   1 
ATOM   292  O  "O5'" . DC  A 1  20  ? 60.285 174.956 25.939 1.00 22.02  ? 820  DC  P "O5'" 1 
ATOM   293  C  "C5'" . DC  A 1  20  ? 58.996 174.446 25.609 1.00 18.28  ? 820  DC  P "C5'" 1 
ATOM   294  C  "C4'" . DC  A 1  20  ? 58.073 175.583 25.238 1.00 18.02  ? 820  DC  P "C4'" 1 
ATOM   295  O  "O4'" . DC  A 1  20  ? 57.256 175.872 26.401 1.00 15.84  ? 820  DC  P "O4'" 1 
ATOM   296  C  "C3'" . DC  A 1  20  ? 58.815 176.882 24.925 1.00 16.48  ? 820  DC  P "C3'" 1 
ATOM   297  O  "O3'" . DC  A 1  20  ? 58.947 177.229 23.567 1.00 16.12  ? 820  DC  P "O3'" 1 
ATOM   298  C  "C2'" . DC  A 1  20  ? 58.013 177.971 25.602 1.00 16.43  ? 820  DC  P "C2'" 1 
ATOM   299  C  "C1'" . DC  A 1  20  ? 57.114 177.276 26.595 1.00 16.05  ? 820  DC  P "C1'" 1 
ATOM   300  N  N1    . DC  A 1  20  ? 57.667 177.629 27.914 1.00 16.45  ? 820  DC  P N1    1 
ATOM   301  C  C2    . DC  A 1  20  ? 57.028 178.613 28.673 1.00 14.18  ? 820  DC  P C2    1 
ATOM   302  O  O2    . DC  A 1  20  ? 55.955 179.073 28.271 1.00 12.03  ? 820  DC  P O2    1 
ATOM   303  N  N3    . DC  A 1  20  ? 57.600 179.034 29.823 1.00 14.53  ? 820  DC  P N3    1 
ATOM   304  C  C4    . DC  A 1  20  ? 58.757 178.500 30.230 1.00 14.89  ? 820  DC  P C4    1 
ATOM   305  N  N4    . DC  A 1  20  ? 59.302 178.961 31.355 1.00 12.94  ? 820  DC  P N4    1 
ATOM   306  C  C5    . DC  A 1  20  ? 59.407 177.470 29.498 1.00 15.88  ? 820  DC  P C5    1 
ATOM   307  C  C6    . DC  A 1  20  ? 58.828 177.057 28.364 1.00 15.45  ? 820  DC  P C6    1 
ATOM   308  P  P     . DA  A 1  21  ? 60.023 178.352 23.178 1.00 15.98  ? 821  DA  P P     1 
ATOM   309  O  OP1   . DA  A 1  21  ? 60.280 178.280 21.721 1.00 19.84  ? 821  DA  P OP1   1 
ATOM   310  O  OP2   . DA  A 1  21  ? 61.147 178.208 24.124 1.00 16.24  ? 821  DA  P OP2   1 
ATOM   311  O  "O5'" . DA  A 1  21  ? 59.250 179.710 23.510 1.00 16.90  ? 821  DA  P "O5'" 1 
ATOM   312  C  "C5'" . DA  A 1  21  ? 57.904 179.898 23.053 1.00 15.02  ? 821  DA  P "C5'" 1 
ATOM   313  C  "C4'" . DA  A 1  21  ? 57.401 181.279 23.400 1.00 14.51  ? 821  DA  P "C4'" 1 
ATOM   314  O  "O4'" . DA  A 1  21  ? 57.055 181.328 24.810 1.00 13.92  ? 821  DA  P "O4'" 1 
ATOM   315  C  "C3'" . DA  A 1  21  ? 58.433 182.378 23.157 1.00 14.81  ? 821  DA  P "C3'" 1 
ATOM   316  O  "O3'" . DA  A 1  21  ? 58.076 183.320 22.166 1.00 16.55  ? 821  DA  P "O3'" 1 
ATOM   317  C  "C2'" . DA  A 1  21  ? 58.578 183.106 24.478 1.00 16.02  ? 821  DA  P "C2'" 1 
ATOM   318  C  "C1'" . DA  A 1  21  ? 57.516 182.535 25.404 1.00 14.01  ? 821  DA  P "C1'" 1 
ATOM   319  N  N9    . DA  A 1  21  ? 58.192 182.205 26.658 1.00 12.88  ? 821  DA  P N9    1 
ATOM   320  C  C8    . DA  A 1  21  ? 59.050 181.159 26.896 1.00 11.58  ? 821  DA  P C8    1 
ATOM   321  N  N7    . DA  A 1  21  ? 59.625 181.209 28.069 1.00 12.07  ? 821  DA  P N7    1 
ATOM   322  C  C5    . DA  A 1  21  ? 59.087 182.344 28.656 1.00 11.36  ? 821  DA  P C5    1 
ATOM   323  C  C6    . DA  A 1  21  ? 59.312 182.963 29.899 1.00 13.49  ? 821  DA  P C6    1 
ATOM   324  N  N6    . DA  A 1  21  ? 60.195 182.522 30.800 1.00 11.42  ? 821  DA  P N6    1 
ATOM   325  N  N1    . DA  A 1  21  ? 58.602 184.076 30.180 1.00 14.23  ? 821  DA  P N1    1 
ATOM   326  C  C2    . DA  A 1  21  ? 57.742 184.536 29.263 1.00 13.82  ? 821  DA  P C2    1 
ATOM   327  N  N3    . DA  A 1  21  ? 57.458 184.053 28.059 1.00 11.92  ? 821  DA  P N3    1 
ATOM   328  C  C4    . DA  A 1  21  ? 58.174 182.945 27.813 1.00 10.74  ? 821  DA  P C4    1 
HETATM 329  P  P     . 2DA A 1  22  ? 59.224 184.250 21.544 1.00 14.49  ? 822  2DA P P     1 
HETATM 330  O  OP1   . 2DA A 1  22  ? 58.834 184.571 20.148 1.00 17.50  ? 822  2DA P OP1   1 
HETATM 331  O  OP2   . 2DA A 1  22  ? 60.526 183.588 21.805 1.00 14.97  ? 822  2DA P OP2   1 
HETATM 332  O  "O5'" . 2DA A 1  22  ? 59.140 185.565 22.447 1.00 15.39  ? 822  2DA P "O5'" 1 
HETATM 333  C  "C5'" . 2DA A 1  22  ? 57.955 186.368 22.446 1.00 11.46  ? 822  2DA P "C5'" 1 
HETATM 334  C  "C4'" . 2DA A 1  22  ? 58.009 187.423 23.528 1.00 11.25  ? 822  2DA P "C4'" 1 
HETATM 335  O  "O4'" . 2DA A 1  22  ? 57.880 186.812 24.836 1.00 11.10  ? 822  2DA P "O4'" 1 
HETATM 336  C  "C3'" . 2DA A 1  22  ? 59.276 188.254 23.624 1.00 11.40  ? 822  2DA P "C3'" 1 
HETATM 337  C  "C2'" . 2DA A 1  22  ? 59.190 188.785 25.051 1.00 11.68  ? 822  2DA P "C2'" 1 
HETATM 338  C  "C1'" . 2DA A 1  22  ? 58.569 187.597 25.791 1.00 10.47  ? 822  2DA P "C1'" 1 
HETATM 339  N  N9    . 2DA A 1  22  ? 59.552 186.748 26.466 1.00 11.35  ? 822  2DA P N9    1 
HETATM 340  C  C8    . 2DA A 1  22  ? 60.232 185.682 25.941 1.00 10.91  ? 822  2DA P C8    1 
HETATM 341  N  N7    . 2DA A 1  22  ? 61.046 185.107 26.786 1.00 11.94  ? 822  2DA P N7    1 
HETATM 342  C  C5    . 2DA A 1  22  ? 60.897 185.843 27.949 1.00 12.06  ? 822  2DA P C5    1 
HETATM 343  C  C6    . 2DA A 1  22  ? 61.497 185.739 29.215 1.00 13.61  ? 822  2DA P C6    1 
HETATM 344  N  N6    . 2DA A 1  22  ? 62.403 184.803 29.529 1.00 12.52  ? 822  2DA P N6    1 
HETATM 345  N  N1    . 2DA A 1  22  ? 61.135 186.637 30.158 1.00 11.08  ? 822  2DA P N1    1 
HETATM 346  C  C2    . 2DA A 1  22  ? 60.231 187.569 29.839 1.00 13.03  ? 822  2DA P C2    1 
HETATM 347  N  N3    . 2DA A 1  22  ? 59.596 187.768 28.684 1.00 13.04  ? 822  2DA P N3    1 
HETATM 348  C  C4    . 2DA A 1  22  ? 59.980 186.859 27.769 1.00 12.02  ? 822  2DA P C4    1 
ATOM   349  P  P     . DC  B 2  3   ? 72.924 187.958 43.134 1.00 60.31  ? 853  DC  T P     1 
ATOM   350  O  OP1   . DC  B 2  3   ? 72.840 188.038 44.654 1.00 60.26  ? 853  DC  T OP1   1 
ATOM   351  O  OP2   . DC  B 2  3   ? 72.892 189.329 42.469 1.00 59.18  ? 853  DC  T OP2   1 
ATOM   352  O  "O5'" . DC  B 2  3   ? 71.581 187.170 42.637 1.00 56.07  ? 853  DC  T "O5'" 1 
ATOM   353  C  "C5'" . DC  B 2  3   ? 71.555 185.728 42.510 1.00 51.59  ? 853  DC  T "C5'" 1 
ATOM   354  C  "C4'" . DC  B 2  3   ? 70.202 185.198 42.933 1.00 47.55  ? 853  DC  T "C4'" 1 
ATOM   355  O  "O4'" . DC  B 2  3   ? 69.907 185.756 44.229 1.00 47.15  ? 853  DC  T "O4'" 1 
ATOM   356  C  "C3'" . DC  B 2  3   ? 69.049 185.570 42.002 1.00 44.83  ? 853  DC  T "C3'" 1 
ATOM   357  O  "O3'" . DC  B 2  3   ? 68.676 184.427 41.211 1.00 39.55  ? 853  DC  T "O3'" 1 
ATOM   358  C  "C2'" . DC  B 2  3   ? 67.874 185.833 42.952 1.00 46.18  ? 853  DC  T "C2'" 1 
ATOM   359  C  "C1'" . DC  B 2  3   ? 68.554 186.134 44.292 1.00 46.70  ? 853  DC  T "C1'" 1 
ATOM   360  N  N1    . DC  B 2  3   ? 68.477 187.507 44.823 1.00 47.34  ? 853  DC  T N1    1 
ATOM   361  C  C2    . DC  B 2  3   ? 67.337 187.895 45.541 1.00 48.83  ? 853  DC  T C2    1 
ATOM   362  O  O2    . DC  B 2  3   ? 66.381 187.106 45.632 1.00 51.03  ? 853  DC  T O2    1 
ATOM   363  N  N3    . DC  B 2  3   ? 67.306 189.119 46.116 1.00 49.55  ? 853  DC  T N3    1 
ATOM   364  C  C4    . DC  B 2  3   ? 68.345 189.947 45.982 1.00 49.78  ? 853  DC  T C4    1 
ATOM   365  N  N4    . DC  B 2  3   ? 68.287 191.132 46.595 1.00 50.48  ? 853  DC  T N4    1 
ATOM   366  C  C5    . DC  B 2  3   ? 69.494 189.595 45.218 1.00 49.58  ? 853  DC  T C5    1 
ATOM   367  C  C6    . DC  B 2  3   ? 69.516 188.381 44.657 1.00 48.73  ? 853  DC  T C6    1 
ATOM   368  P  P     . DA  B 2  4   ? 69.630 183.874 40.034 1.00 35.11  ? 854  DA  T P     1 
ATOM   369  O  OP1   . DA  B 2  4   ? 69.132 182.511 39.730 1.00 34.26  ? 854  DA  T OP1   1 
ATOM   370  O  OP2   . DA  B 2  4   ? 71.057 184.073 40.368 1.00 35.46  ? 854  DA  T OP2   1 
ATOM   371  O  "O5'" . DA  B 2  4   ? 69.292 184.770 38.768 1.00 33.76  ? 854  DA  T "O5'" 1 
ATOM   372  C  "C5'" . DA  B 2  4   ? 67.968 184.843 38.277 1.00 28.59  ? 854  DA  T "C5'" 1 
ATOM   373  C  "C4'" . DA  B 2  4   ? 67.562 186.286 38.120 1.00 26.81  ? 854  DA  T "C4'" 1 
ATOM   374  O  "O4'" . DA  B 2  4   ? 67.933 186.717 36.788 1.00 23.86  ? 854  DA  T "O4'" 1 
ATOM   375  C  "C3'" . DA  B 2  4   ? 66.056 186.472 38.242 1.00 25.30  ? 854  DA  T "C3'" 1 
ATOM   376  O  "O3'" . DA  B 2  4   ? 65.702 187.429 39.227 1.00 25.76  ? 854  DA  T "O3'" 1 
ATOM   377  C  "C2'" . DA  B 2  4   ? 65.571 186.871 36.864 1.00 23.16  ? 854  DA  T "C2'" 1 
ATOM   378  C  "C1'" . DA  B 2  4   ? 66.808 187.166 36.043 1.00 22.89  ? 854  DA  T "C1'" 1 
ATOM   379  N  N9    . DA  B 2  4   ? 66.765 186.400 34.796 1.00 21.41  ? 854  DA  T N9    1 
ATOM   380  C  C8    . DA  B 2  4   ? 67.292 185.157 34.558 1.00 21.58  ? 854  DA  T C8    1 
ATOM   381  N  N7    . DA  B 2  4   ? 67.042 184.697 33.355 1.00 23.51  ? 854  DA  T N7    1 
ATOM   382  C  C5    . DA  B 2  4   ? 66.314 185.712 32.754 1.00 20.44  ? 854  DA  T C5    1 
ATOM   383  C  C6    . DA  B 2  4   ? 65.750 185.838 31.473 1.00 21.36  ? 854  DA  T C6    1 
ATOM   384  N  N6    . DA  B 2  4   ? 65.834 184.897 30.533 1.00 19.71  ? 854  DA  T N6    1 
ATOM   385  N  N1    . DA  B 2  4   ? 65.084 186.980 31.187 1.00 22.61  ? 854  DA  T N1    1 
ATOM   386  C  C2    . DA  B 2  4   ? 64.997 187.923 32.136 1.00 21.78  ? 854  DA  T C2    1 
ATOM   387  N  N3    . DA  B 2  4   ? 65.486 187.918 33.377 1.00 20.75  ? 854  DA  T N3    1 
ATOM   388  C  C4    . DA  B 2  4   ? 66.142 186.771 33.626 1.00 20.64  ? 854  DA  T C4    1 
HETATM 389  P  P     . 8OG B 2  5   ? 64.315 187.250 40.012 1.00 27.73  ? 855  8OG T P     1 
HETATM 390  O  OP1   . 8OG B 2  5   ? 64.415 187.896 41.344 1.00 28.78  ? 855  8OG T OP1   1 
HETATM 391  O  OP2   . 8OG B 2  5   ? 63.898 185.822 39.919 1.00 25.88  ? 855  8OG T OP2   1 
HETATM 392  O  "O5'" . 8OG B 2  5   ? 63.295 188.060 39.100 1.00 26.58  ? 855  8OG T "O5'" 1 
HETATM 393  C  "C5'" . 8OG B 2  5   ? 63.584 189.386 38.673 1.00 23.10  ? 855  8OG T "C5'" 1 
HETATM 394  C  "C4'" . 8OG B 2  5   ? 62.445 189.906 37.831 1.00 22.80  ? 855  8OG T "C4'" 1 
HETATM 395  O  "O4'" . 8OG B 2  5   ? 62.613 189.553 36.433 1.00 20.81  ? 855  8OG T "O4'" 1 
HETATM 396  C  "C3'" . 8OG B 2  5   ? 61.085 189.351 38.258 1.00 21.80  ? 855  8OG T "C3'" 1 
HETATM 397  O  "O3'" . 8OG B 2  5   ? 60.121 190.403 38.286 1.00 21.17  ? 855  8OG T "O3'" 1 
HETATM 398  C  "C2'" . 8OG B 2  5   ? 60.768 188.328 37.178 1.00 20.05  ? 855  8OG T "C2'" 1 
HETATM 399  C  "C1'" . 8OG B 2  5   ? 61.418 188.957 35.963 1.00 18.31  ? 855  8OG T "C1'" 1 
HETATM 400  N  N9    . 8OG B 2  5   ? 61.748 188.055 34.857 1.00 18.96  ? 855  8OG T N9    1 
HETATM 401  C  C8    . 8OG B 2  5   ? 61.504 188.270 33.511 1.00 15.56  ? 855  8OG T C8    1 
HETATM 402  N  N7    . 8OG B 2  5   ? 61.862 187.258 32.771 1.00 16.11  ? 855  8OG T N7    1 
HETATM 403  C  C5    . 8OG B 2  5   ? 62.382 186.331 33.659 1.00 18.23  ? 855  8OG T C5    1 
HETATM 404  C  C6    . 8OG B 2  5   ? 62.918 185.041 33.425 1.00 19.22  ? 855  8OG T C6    1 
HETATM 405  O  O6    . 8OG B 2  5   ? 63.028 184.437 32.356 1.00 17.56  ? 855  8OG T O6    1 
HETATM 406  N  N1    . 8OG B 2  5   ? 63.344 184.443 34.601 1.00 20.02  ? 855  8OG T N1    1 
HETATM 407  C  C2    . 8OG B 2  5   ? 63.256 185.002 35.845 1.00 18.69  ? 855  8OG T C2    1 
HETATM 408  N  N2    . 8OG B 2  5   ? 63.730 184.258 36.859 1.00 19.59  ? 855  8OG T N2    1 
HETATM 409  N  N3    . 8OG B 2  5   ? 62.747 186.200 36.082 1.00 19.71  ? 855  8OG T N3    1 
HETATM 410  C  C4    . 8OG B 2  5   ? 62.334 186.805 34.949 1.00 19.43  ? 855  8OG T C4    1 
HETATM 411  O  O8    . 8OG B 2  5   ? 60.994 189.302 33.102 1.00 11.72  ? 855  8OG T O8    1 
ATOM   412  P  P     . DT  B 2  6   ? 58.609 190.091 38.730 1.00 21.16  ? 856  DT  T P     1 
ATOM   413  O  OP1   . DT  B 2  6   ? 58.039 191.361 39.251 1.00 21.09  ? 856  DT  T OP1   1 
ATOM   414  O  OP2   . DT  B 2  6   ? 58.594 188.872 39.574 1.00 14.61  ? 856  DT  T OP2   1 
ATOM   415  O  "O5'" . DT  B 2  6   ? 57.894 189.736 37.356 1.00 18.97  ? 856  DT  T "O5'" 1 
ATOM   416  C  "C5'" . DT  B 2  6   ? 57.723 190.727 36.346 1.00 16.62  ? 856  DT  T "C5'" 1 
ATOM   417  C  "C4'" . DT  B 2  6   ? 56.758 190.232 35.295 1.00 16.36  ? 856  DT  T "C4'" 1 
ATOM   418  O  "O4'" . DT  B 2  6   ? 57.489 189.448 34.310 1.00 12.97  ? 856  DT  T "O4'" 1 
ATOM   419  C  "C3'" . DT  B 2  6   ? 55.701 189.306 35.894 1.00 14.77  ? 856  DT  T "C3'" 1 
ATOM   420  O  "O3'" . DT  B 2  6   ? 54.360 189.748 35.799 1.00 15.99  ? 856  DT  T "O3'" 1 
ATOM   421  C  "C2'" . DT  B 2  6   ? 55.835 188.010 35.131 1.00 17.89  ? 856  DT  T "C2'" 1 
ATOM   422  C  "C1'" . DT  B 2  6   ? 56.734 188.309 33.949 1.00 14.81  ? 856  DT  T "C1'" 1 
ATOM   423  N  N1    . DT  B 2  6   ? 57.652 187.163 33.763 1.00 14.61  ? 856  DT  T N1    1 
ATOM   424  C  C2    . DT  B 2  6   ? 57.768 186.576 32.520 1.00 15.05  ? 856  DT  T C2    1 
ATOM   425  O  O2    . DT  B 2  6   ? 57.242 187.019 31.511 1.00 10.61  ? 856  DT  T O2    1 
ATOM   426  N  N3    . DT  B 2  6   ? 58.534 185.434 32.503 1.00 14.72  ? 856  DT  T N3    1 
ATOM   427  C  C4    . DT  B 2  6   ? 59.192 184.847 33.568 1.00 14.97  ? 856  DT  T C4    1 
ATOM   428  O  O4    . DT  B 2  6   ? 59.815 183.798 33.402 1.00 15.56  ? 856  DT  T O4    1 
ATOM   429  C  C5    . DT  B 2  6   ? 59.072 185.549 34.825 1.00 15.54  ? 856  DT  T C5    1 
ATOM   430  C  C7    . DT  B 2  6   ? 59.772 185.013 36.036 1.00 14.23  ? 856  DT  T C7    1 
ATOM   431  C  C6    . DT  B 2  6   ? 58.330 186.657 34.853 1.00 14.41  ? 856  DT  T C6    1 
ATOM   432  P  P     . DG  B 2  7   ? 53.235 189.008 36.685 1.00 11.55  ? 857  DG  T P     1 
ATOM   433  O  OP1   . DG  B 2  7   ? 52.295 189.997 37.254 1.00 12.64  ? 857  DG  T OP1   1 
ATOM   434  O  OP2   . DG  B 2  7   ? 53.948 188.081 37.593 1.00 13.76  ? 857  DG  T OP2   1 
ATOM   435  O  "O5'" . DG  B 2  7   ? 52.460 188.116 35.622 1.00 13.13  ? 857  DG  T "O5'" 1 
ATOM   436  C  "C5'" . DG  B 2  7   ? 53.003 186.871 35.208 1.00 13.70  ? 857  DG  T "C5'" 1 
ATOM   437  C  "C4'" . DG  B 2  7   ? 52.379 186.431 33.909 1.00 15.29  ? 857  DG  T "C4'" 1 
ATOM   438  O  "O4'" . DG  B 2  7   ? 53.481 186.134 33.017 1.00 14.70  ? 857  DG  T "O4'" 1 
ATOM   439  C  "C3'" . DG  B 2  7   ? 51.568 185.146 34.064 1.00 15.00  ? 857  DG  T "C3'" 1 
ATOM   440  O  "O3'" . DG  B 2  7   ? 50.248 185.181 33.560 1.00 14.58  ? 857  DG  T "O3'" 1 
ATOM   441  C  "C2'" . DG  B 2  7   ? 52.321 184.095 33.287 1.00 18.24  ? 857  DG  T "C2'" 1 
ATOM   442  C  "C1'" . DG  B 2  7   ? 53.394 184.820 32.504 1.00 16.66  ? 857  DG  T "C1'" 1 
ATOM   443  N  N9    . DG  B 2  7   ? 54.632 184.118 32.818 1.00 18.11  ? 857  DG  T N9    1 
ATOM   444  C  C8    . DG  B 2  7   ? 55.361 184.164 33.986 1.00 17.41  ? 857  DG  T C8    1 
ATOM   445  N  N7    . DG  B 2  7   ? 56.310 183.269 34.026 1.00 16.04  ? 857  DG  T N7    1 
ATOM   446  C  C5    . DG  B 2  7   ? 56.220 182.626 32.799 1.00 17.68  ? 857  DG  T C5    1 
ATOM   447  C  C6    . DG  B 2  7   ? 56.954 181.542 32.277 1.00 16.72  ? 857  DG  T C6    1 
ATOM   448  O  O6    . DG  B 2  7   ? 57.850 180.892 32.820 1.00 15.81  ? 857  DG  T O6    1 
ATOM   449  N  N1    . DG  B 2  7   ? 56.540 181.219 30.988 1.00 16.90  ? 857  DG  T N1    1 
ATOM   450  C  C2    . DG  B 2  7   ? 55.537 181.859 30.298 1.00 16.89  ? 857  DG  T C2    1 
ATOM   451  N  N2    . DG  B 2  7   ? 55.281 181.436 29.055 1.00 15.76  ? 857  DG  T N2    1 
ATOM   452  N  N3    . DG  B 2  7   ? 54.835 182.848 30.788 1.00 16.87  ? 857  DG  T N3    1 
ATOM   453  C  C4    . DG  B 2  7   ? 55.223 183.177 32.029 1.00 16.27  ? 857  DG  T C4    1 
ATOM   454  P  P     . DG  B 2  8   ? 49.250 183.991 33.966 1.00 14.52  ? 858  DG  T P     1 
ATOM   455  O  OP1   . DG  B 2  8   ? 47.854 184.456 33.812 1.00 16.26  ? 858  DG  T OP1   1 
ATOM   456  O  OP2   . DG  B 2  8   ? 49.693 183.429 35.269 1.00 11.74  ? 858  DG  T OP2   1 
ATOM   457  O  "O5'" . DG  B 2  8   ? 49.548 182.862 32.883 1.00 14.19  ? 858  DG  T "O5'" 1 
ATOM   458  C  "C5'" . DG  B 2  8   ? 49.369 183.113 31.497 1.00 12.88  ? 858  DG  T "C5'" 1 
ATOM   459  C  "C4'" . DG  B 2  8   ? 49.343 181.811 30.730 1.00 14.60  ? 858  DG  T "C4'" 1 
ATOM   460  O  "O4'" . DG  B 2  8   ? 50.646 181.184 30.772 1.00 14.08  ? 858  DG  T "O4'" 1 
ATOM   461  C  "C3'" . DG  B 2  8   ? 48.347 180.761 31.222 1.00 11.69  ? 858  DG  T "C3'" 1 
ATOM   462  O  "O3'" . DG  B 2  8   ? 47.794 180.102 30.073 1.00 12.45  ? 858  DG  T "O3'" 1 
ATOM   463  C  "C2'" . DG  B 2  8   ? 49.208 179.839 32.070 1.00 12.25  ? 858  DG  T "C2'" 1 
ATOM   464  C  "C1'" . DG  B 2  8   ? 50.573 179.904 31.383 1.00 13.64  ? 858  DG  T "C1'" 1 
ATOM   465  N  N9    . DG  B 2  8   ? 51.724 179.793 32.281 1.00 13.74  ? 858  DG  T N9    1 
ATOM   466  C  C8    . DG  B 2  8   ? 51.923 180.496 33.446 1.00 14.62  ? 858  DG  T C8    1 
ATOM   467  N  N7    . DG  B 2  8   ? 53.061 180.220 34.025 1.00 13.86  ? 858  DG  T N7    1 
ATOM   468  C  C5    . DG  B 2  8   ? 53.649 179.270 33.203 1.00 11.27  ? 858  DG  T C5    1 
ATOM   469  C  C6    . DG  B 2  8   ? 54.901 178.593 33.325 1.00 12.01  ? 858  DG  T C6    1 
ATOM   470  O  O6    . DG  B 2  8   ? 55.758 178.703 34.216 1.00 9.77   ? 858  DG  T O6    1 
ATOM   471  N  N1    . DG  B 2  8   ? 55.107 177.708 32.273 1.00 9.14   ? 858  DG  T N1    1 
ATOM   472  C  C2    . DG  B 2  8   ? 54.225 177.489 31.246 1.00 12.83  ? 858  DG  T C2    1 
ATOM   473  N  N2    . DG  B 2  8   ? 54.595 176.565 30.340 1.00 10.40  ? 858  DG  T N2    1 
ATOM   474  N  N3    . DG  B 2  8   ? 53.057 178.120 31.117 1.00 14.02  ? 858  DG  T N3    1 
ATOM   475  C  C4    . DG  B 2  8   ? 52.837 178.987 32.124 1.00 12.75  ? 858  DG  T C4    1 
ATOM   476  P  P     . DC  B 2  9   ? 46.632 178.997 30.237 1.00 10.83  ? 859  DC  T P     1 
ATOM   477  O  OP1   . DC  B 2  9   ? 45.915 178.942 28.946 1.00 14.15  ? 859  DC  T OP1   1 
ATOM   478  O  OP2   . DC  B 2  9   ? 45.872 179.217 31.486 1.00 13.42  ? 859  DC  T OP2   1 
ATOM   479  O  "O5'" . DC  B 2  9   ? 47.441 177.638 30.391 1.00 12.32  ? 859  DC  T "O5'" 1 
ATOM   480  C  "C5'" . DC  B 2  9   ? 48.358 177.236 29.381 1.00 13.57  ? 859  DC  T "C5'" 1 
ATOM   481  C  "C4'" . DC  B 2  9   ? 49.068 175.967 29.785 1.00 15.00  ? 859  DC  T "C4'" 1 
ATOM   482  O  "O4'" . DC  B 2  9   ? 50.184 176.225 30.676 1.00 15.03  ? 859  DC  T "O4'" 1 
ATOM   483  C  "C3'" . DC  B 2  9   ? 48.193 174.923 30.482 1.00 14.59  ? 859  DC  T "C3'" 1 
ATOM   484  O  "O3'" . DC  B 2  9   ? 48.517 173.653 29.945 1.00 15.70  ? 859  DC  T "O3'" 1 
ATOM   485  C  "C2'" . DC  B 2  9   ? 48.664 174.981 31.926 1.00 12.65  ? 859  DC  T "C2'" 1 
ATOM   486  C  "C1'" . DC  B 2  9   ? 50.139 175.283 31.732 1.00 13.80  ? 859  DC  T "C1'" 1 
ATOM   487  N  N1    . DC  B 2  9   ? 50.881 175.835 32.884 1.00 14.60  ? 859  DC  T N1    1 
ATOM   488  C  C2    . DC  B 2  9   ? 52.208 175.426 33.078 1.00 14.21  ? 859  DC  T C2    1 
ATOM   489  O  O2    . DC  B 2  9   ? 52.716 174.621 32.281 1.00 18.85  ? 859  DC  T O2    1 
ATOM   490  N  N3    . DC  B 2  9   ? 52.903 175.911 34.127 1.00 14.68  ? 859  DC  T N3    1 
ATOM   491  C  C4    . DC  B 2  9   ? 52.328 176.769 34.968 1.00 14.41  ? 859  DC  T C4    1 
ATOM   492  N  N4    . DC  B 2  9   ? 53.055 177.212 35.990 1.00 13.51  ? 859  DC  T N4    1 
ATOM   493  C  C5    . DC  B 2  9   ? 50.982 177.207 34.796 1.00 13.45  ? 859  DC  T C5    1 
ATOM   494  C  C6    . DC  B 2  9   ? 50.302 176.721 33.750 1.00 13.31  ? 859  DC  T C6    1 
ATOM   495  P  P     . DA  B 2  10  ? 47.383 172.528 29.788 1.00 15.48  ? 860  DA  T P     1 
ATOM   496  O  OP1   . DA  B 2  10  ? 46.709 172.716 28.475 1.00 17.16  ? 860  DA  T OP1   1 
ATOM   497  O  OP2   . DA  B 2  10  ? 46.572 172.453 31.023 1.00 19.33  ? 860  DA  T OP2   1 
ATOM   498  O  "O5'" . DA  B 2  10  ? 48.283 171.230 29.692 1.00 19.83  ? 860  DA  T "O5'" 1 
ATOM   499  C  "C5'" . DA  B 2  10  ? 49.411 171.211 28.813 1.00 21.24  ? 860  DA  T "C5'" 1 
ATOM   500  C  "C4'" . DA  B 2  10  ? 50.440 170.226 29.309 1.00 24.53  ? 860  DA  T "C4'" 1 
ATOM   501  O  "O4'" . DA  B 2  10  ? 51.238 170.789 30.381 1.00 24.09  ? 860  DA  T "O4'" 1 
ATOM   502  C  "C3'" . DA  B 2  10  ? 49.822 168.944 29.854 1.00 25.92  ? 860  DA  T "C3'" 1 
ATOM   503  O  "O3'" . DA  B 2  10  ? 50.541 167.819 29.359 1.00 28.97  ? 860  DA  T "O3'" 1 
ATOM   504  C  "C2'" . DA  B 2  10  ? 49.909 169.111 31.365 1.00 23.36  ? 860  DA  T "C2'" 1 
ATOM   505  C  "C1'" . DA  B 2  10  ? 51.140 169.997 31.553 1.00 23.33  ? 860  DA  T "C1'" 1 
ATOM   506  N  N9    . DA  B 2  10  ? 51.084 170.914 32.699 1.00 22.99  ? 860  DA  T N9    1 
ATOM   507  C  C8    . DA  B 2  10  ? 50.092 171.814 33.015 1.00 22.25  ? 860  DA  T C8    1 
ATOM   508  N  N7    . DA  B 2  10  ? 50.338 172.515 34.098 1.00 22.14  ? 860  DA  T N7    1 
ATOM   509  C  C5    . DA  B 2  10  ? 51.570 172.044 34.526 1.00 21.38  ? 860  DA  T C5    1 
ATOM   510  C  C6    . DA  B 2  10  ? 52.383 172.387 35.620 1.00 21.53  ? 860  DA  T C6    1 
ATOM   511  N  N6    . DA  B 2  10  ? 52.066 173.323 36.515 1.00 23.95  ? 860  DA  T N6    1 
ATOM   512  N  N1    . DA  B 2  10  ? 53.550 171.729 35.766 1.00 22.00  ? 860  DA  T N1    1 
ATOM   513  C  C2    . DA  B 2  10  ? 53.873 170.794 34.865 1.00 22.95  ? 860  DA  T C2    1 
ATOM   514  N  N3    . DA  B 2  10  ? 53.197 170.384 33.793 1.00 22.31  ? 860  DA  T N3    1 
ATOM   515  C  C4    . DA  B 2  10  ? 52.039 171.055 33.679 1.00 21.83  ? 860  DA  T C4    1 
ATOM   516  P  P     . DC  B 2  11  ? 49.826 166.385 29.291 1.00 32.27  ? 861  DC  T P     1 
ATOM   517  O  OP1   . DC  B 2  11  ? 50.058 165.824 27.938 1.00 34.94  ? 861  DC  T OP1   1 
ATOM   518  O  OP2   . DC  B 2  11  ? 48.429 166.518 29.810 1.00 31.10  ? 861  DC  T OP2   1 
ATOM   519  O  "O5'" . DC  B 2  11  ? 50.679 165.541 30.334 1.00 31.78  ? 861  DC  T "O5'" 1 
ATOM   520  C  "C5'" . DC  B 2  11  ? 51.384 166.221 31.358 1.00 31.65  ? 861  DC  T "C5'" 1 
ATOM   521  C  "C4'" . DC  B 2  11  ? 52.208 165.262 32.178 1.00 29.98  ? 861  DC  T "C4'" 1 
ATOM   522  O  "O4'" . DC  B 2  11  ? 52.764 166.082 33.230 1.00 29.38  ? 861  DC  T "O4'" 1 
ATOM   523  C  "C3'" . DC  B 2  11  ? 51.384 164.175 32.866 1.00 28.98  ? 861  DC  T "C3'" 1 
ATOM   524  O  "O3'" . DC  B 2  11  ? 52.103 162.945 32.981 1.00 26.82  ? 861  DC  T "O3'" 1 
ATOM   525  C  "C2'" . DC  B 2  11  ? 51.065 164.757 34.227 1.00 31.07  ? 861  DC  T "C2'" 1 
ATOM   526  C  "C1'" . DC  B 2  11  ? 52.167 165.781 34.479 1.00 30.05  ? 861  DC  T "C1'" 1 
ATOM   527  N  N1    . DC  B 2  11  ? 51.647 167.037 35.057 1.00 27.27  ? 861  DC  T N1    1 
ATOM   528  C  C2    . DC  B 2  11  ? 52.394 167.687 36.040 1.00 26.69  ? 861  DC  T C2    1 
ATOM   529  O  O2    . DC  B 2  11  ? 53.532 167.276 36.299 1.00 27.10  ? 861  DC  T O2    1 
ATOM   530  N  N3    . DC  B 2  11  ? 51.860 168.757 36.674 1.00 26.61  ? 861  DC  T N3    1 
ATOM   531  C  C4    . DC  B 2  11  ? 50.648 169.200 36.331 1.00 26.23  ? 861  DC  T C4    1 
ATOM   532  N  N4    . DC  B 2  11  ? 50.140 170.230 37.014 1.00 26.25  ? 861  DC  T N4    1 
ATOM   533  C  C5    . DC  B 2  11  ? 49.898 168.601 35.281 1.00 25.29  ? 861  DC  T C5    1 
ATOM   534  C  C6    . DC  B 2  11  ? 50.429 167.535 34.675 1.00 26.06  ? 861  DC  T C6    1 
ATOM   535  P  P     . DT  B 2  12  ? 51.441 161.700 33.765 1.00 25.81  ? 862  DT  T P     1 
ATOM   536  O  OP1   . DT  B 2  12  ? 51.931 160.458 33.124 1.00 27.89  ? 862  DT  T OP1   1 
ATOM   537  O  OP2   . DT  B 2  12  ? 49.978 161.919 33.901 1.00 25.13  ? 862  DT  T OP2   1 
ATOM   538  O  "O5'" . DT  B 2  12  ? 52.094 161.808 35.211 1.00 23.69  ? 862  DT  T "O5'" 1 
ATOM   539  C  "C5'" . DT  B 2  12  ? 53.507 161.901 35.346 1.00 24.02  ? 862  DT  T "C5'" 1 
ATOM   540  C  "C4'" . DT  B 2  12  ? 53.900 161.954 36.801 1.00 24.32  ? 862  DT  T "C4'" 1 
ATOM   541  O  "O4'" . DT  B 2  12  ? 53.529 163.231 37.367 1.00 25.60  ? 862  DT  T "O4'" 1 
ATOM   542  C  "C3'" . DT  B 2  12  ? 53.269 160.884 37.687 1.00 24.39  ? 862  DT  T "C3'" 1 
ATOM   543  O  "O3'" . DT  B 2  12  ? 54.265 160.388 38.576 1.00 27.35  ? 862  DT  T "O3'" 1 
ATOM   544  C  "C2'" . DT  B 2  12  ? 52.173 161.632 38.429 1.00 26.14  ? 862  DT  T "C2'" 1 
ATOM   545  C  "C1'" . DT  B 2  12  ? 52.717 163.054 38.512 1.00 24.87  ? 862  DT  T "C1'" 1 
ATOM   546  N  N1    . DT  B 2  12  ? 51.701 164.134 38.505 1.00 25.97  ? 862  DT  T N1    1 
ATOM   547  C  C2    . DT  B 2  12  ? 51.789 165.132 39.464 1.00 27.13  ? 862  DT  T C2    1 
ATOM   548  O  O2    . DT  B 2  12  ? 52.639 165.151 40.343 1.00 27.23  ? 862  DT  T O2    1 
ATOM   549  N  N3    . DT  B 2  12  ? 50.831 166.112 39.358 1.00 26.10  ? 862  DT  T N3    1 
ATOM   550  C  C4    . DT  B 2  12  ? 49.807 166.186 38.429 1.00 25.66  ? 862  DT  T C4    1 
ATOM   551  O  O4    . DT  B 2  12  ? 49.022 167.135 38.456 1.00 28.05  ? 862  DT  T O4    1 
ATOM   552  C  C5    . DT  B 2  12  ? 49.757 165.098 37.476 1.00 24.23  ? 862  DT  T C5    1 
ATOM   553  C  C7    . DT  B 2  12  ? 48.663 165.076 36.456 1.00 19.09  ? 862  DT  T C7    1 
ATOM   554  C  C6    . DT  B 2  12  ? 50.699 164.147 37.555 1.00 24.87  ? 862  DT  T C6    1 
ATOM   555  P  P     . DG  B 2  13  ? 54.008 159.035 39.396 1.00 27.99  ? 863  DG  T P     1 
ATOM   556  O  OP1   . DG  B 2  13  ? 55.342 158.441 39.664 1.00 28.86  ? 863  DG  T OP1   1 
ATOM   557  O  OP2   . DG  B 2  13  ? 52.974 158.224 38.714 1.00 28.00  ? 863  DG  T OP2   1 
ATOM   558  O  "O5'" . DG  B 2  13  ? 53.421 159.575 40.770 1.00 28.03  ? 863  DG  T "O5'" 1 
ATOM   559  C  "C5'" . DG  B 2  13  ? 54.231 160.388 41.615 1.00 29.77  ? 863  DG  T "C5'" 1 
ATOM   560  C  "C4'" . DG  B 2  13  ? 53.422 160.917 42.774 1.00 32.18  ? 863  DG  T "C4'" 1 
ATOM   561  O  "O4'" . DG  B 2  13  ? 52.540 161.979 42.344 1.00 30.78  ? 863  DG  T "O4'" 1 
ATOM   562  C  "C3'" . DG  B 2  13  ? 52.538 159.886 43.478 1.00 33.79  ? 863  DG  T "C3'" 1 
ATOM   563  O  "O3'" . DG  B 2  13  ? 52.637 160.111 44.880 1.00 37.91  ? 863  DG  T "O3'" 1 
ATOM   564  C  "C2'" . DG  B 2  13  ? 51.140 160.227 42.983 1.00 31.40  ? 863  DG  T "C2'" 1 
ATOM   565  C  "C1'" . DG  B 2  13  ? 51.245 161.733 42.864 1.00 31.53  ? 863  DG  T "C1'" 1 
ATOM   566  N  N9    . DG  B 2  13  ? 50.271 162.426 42.022 1.00 30.67  ? 863  DG  T N9    1 
ATOM   567  C  C8    . DG  B 2  13  ? 49.703 162.003 40.845 1.00 30.26  ? 863  DG  T C8    1 
ATOM   568  N  N7    . DG  B 2  13  ? 48.877 162.878 40.333 1.00 31.01  ? 863  DG  T N7    1 
ATOM   569  C  C5    . DG  B 2  13  ? 48.901 163.940 41.229 1.00 29.83  ? 863  DG  T C5    1 
ATOM   570  C  C6    . DG  B 2  13  ? 48.205 165.189 41.210 1.00 30.26  ? 863  DG  T C6    1 
ATOM   571  O  O6    . DG  B 2  13  ? 47.401 165.616 40.369 1.00 27.70  ? 863  DG  T O6    1 
ATOM   572  N  N1    . DG  B 2  13  ? 48.523 165.966 42.320 1.00 28.19  ? 863  DG  T N1    1 
ATOM   573  C  C2    . DG  B 2  13  ? 49.390 165.597 43.321 1.00 30.18  ? 863  DG  T C2    1 
ATOM   574  N  N2    . DG  B 2  13  ? 49.557 166.478 44.323 1.00 30.07  ? 863  DG  T N2    1 
ATOM   575  N  N3    . DG  B 2  13  ? 50.043 164.448 43.346 1.00 29.61  ? 863  DG  T N3    1 
ATOM   576  C  C4    . DG  B 2  13  ? 49.751 163.674 42.278 1.00 29.84  ? 863  DG  T C4    1 
ATOM   577  P  P     . DG  B 2  14  ? 52.037 159.043 45.912 1.00 41.70  ? 864  DG  T P     1 
ATOM   578  O  OP1   . DG  B 2  14  ? 53.181 158.403 46.616 1.00 41.51  ? 864  DG  T OP1   1 
ATOM   579  O  OP2   . DG  B 2  14  ? 51.020 158.198 45.230 1.00 39.38  ? 864  DG  T OP2   1 
ATOM   580  O  "O5'" . DG  B 2  14  ? 51.277 159.968 46.956 1.00 43.13  ? 864  DG  T "O5'" 1 
ATOM   581  C  "C5'" . DG  B 2  14  ? 51.970 161.000 47.651 1.00 45.62  ? 864  DG  T "C5'" 1 
ATOM   582  C  "C4'" . DG  B 2  14  ? 50.987 161.852 48.416 1.00 48.38  ? 864  DG  T "C4'" 1 
ATOM   583  O  "O4'" . DG  B 2  14  ? 50.244 162.680 47.485 1.00 47.69  ? 864  DG  T "O4'" 1 
ATOM   584  C  "C3'" . DG  B 2  14  ? 49.950 161.032 49.184 1.00 50.69  ? 864  DG  T "C3'" 1 
ATOM   585  O  "O3'" . DG  B 2  14  ? 49.722 161.581 50.486 1.00 55.36  ? 864  DG  T "O3'" 1 
ATOM   586  C  "C2'" . DG  B 2  14  ? 48.711 161.102 48.305 1.00 49.12  ? 864  DG  T "C2'" 1 
ATOM   587  C  "C1'" . DG  B 2  14  ? 48.849 162.458 47.633 1.00 47.38  ? 864  DG  T "C1'" 1 
ATOM   588  N  N9    . DG  B 2  14  ? 48.231 162.546 46.310 1.00 44.86  ? 864  DG  T N9    1 
ATOM   589  C  C8    . DG  B 2  14  ? 48.358 161.653 45.272 1.00 45.09  ? 864  DG  T C8    1 
ATOM   590  N  N7    . DG  B 2  14  ? 47.667 161.990 44.217 1.00 43.72  ? 864  DG  T N7    1 
ATOM   591  C  C5    . DG  B 2  14  ? 47.050 163.179 44.576 1.00 42.90  ? 864  DG  T C5    1 
ATOM   592  C  C6    . DG  B 2  14  ? 46.165 164.014 43.841 1.00 42.06  ? 864  DG  T C6    1 
ATOM   593  O  O6    . DG  B 2  14  ? 45.732 163.859 42.691 1.00 41.11  ? 864  DG  T O6    1 
ATOM   594  N  N1    . DG  B 2  14  ? 45.779 165.126 44.583 1.00 41.26  ? 864  DG  T N1    1 
ATOM   595  C  C2    . DG  B 2  14  ? 46.186 165.399 45.866 1.00 41.72  ? 864  DG  T C2    1 
ATOM   596  N  N2    . DG  B 2  14  ? 45.704 166.520 46.414 1.00 40.58  ? 864  DG  T N2    1 
ATOM   597  N  N3    . DG  B 2  14  ? 47.005 164.628 46.563 1.00 42.39  ? 864  DG  T N3    1 
ATOM   598  C  C4    . DG  B 2  14  ? 47.394 163.542 45.863 1.00 43.69  ? 864  DG  T C4    1 
ATOM   599  P  P     . DC  B 2  15  ? 48.560 160.972 51.417 1.00 58.59  ? 865  DC  T P     1 
ATOM   600  O  OP1   . DC  B 2  15  ? 48.834 161.380 52.818 1.00 58.81  ? 865  DC  T OP1   1 
ATOM   601  O  OP2   . DC  B 2  15  ? 48.391 159.530 51.091 1.00 58.06  ? 865  DC  T OP2   1 
ATOM   602  O  "O5'" . DC  B 2  15  ? 47.268 161.747 50.910 1.00 57.17  ? 865  DC  T "O5'" 1 
ATOM   603  C  "C5'" . DC  B 2  15  ? 47.179 163.159 51.060 1.00 59.06  ? 865  DC  T "C5'" 1 
ATOM   604  C  "C4'" . DC  B 2  15  ? 45.751 163.612 50.889 1.00 60.84  ? 865  DC  T "C4'" 1 
ATOM   605  O  "O4'" . DC  B 2  15  ? 45.423 163.723 49.484 1.00 60.13  ? 865  DC  T "O4'" 1 
ATOM   606  C  "C3'" . DC  B 2  15  ? 44.714 162.670 51.503 1.00 62.47  ? 865  DC  T "C3'" 1 
ATOM   607  O  "O3'" . DC  B 2  15  ? 43.714 163.419 52.193 1.00 66.12  ? 865  DC  T "O3'" 1 
ATOM   608  C  "C2'" . DC  B 2  15  ? 44.112 161.971 50.296 1.00 61.11  ? 865  DC  T "C2'" 1 
ATOM   609  C  "C1'" . DC  B 2  15  ? 44.200 163.057 49.237 1.00 59.84  ? 865  DC  T "C1'" 1 
ATOM   610  N  N1    . DC  B 2  15  ? 44.198 162.598 47.835 1.00 57.86  ? 865  DC  T N1    1 
ATOM   611  C  C2    . DC  B 2  15  ? 43.470 163.334 46.883 1.00 56.86  ? 865  DC  T C2    1 
ATOM   612  O  O2    . DC  B 2  15  ? 42.877 164.370 47.237 1.00 56.11  ? 865  DC  T O2    1 
ATOM   613  N  N3    . DC  B 2  15  ? 43.434 162.901 45.603 1.00 56.22  ? 865  DC  T N3    1 
ATOM   614  C  C4    . DC  B 2  15  ? 44.091 161.793 45.254 1.00 55.93  ? 865  DC  T C4    1 
ATOM   615  N  N4    . DC  B 2  15  ? 44.019 161.399 43.982 1.00 55.98  ? 865  DC  T N4    1 
ATOM   616  C  C5    . DC  B 2  15  ? 44.851 161.038 46.193 1.00 56.12  ? 865  DC  T C5    1 
ATOM   617  C  C6    . DC  B 2  15  ? 44.878 161.472 47.459 1.00 57.01  ? 865  DC  T C6    1 
ATOM   618  P  P     . DC  B 2  16  ? 42.690 162.667 53.177 1.00 68.30  ? 866  DC  T P     1 
ATOM   619  O  OP1   . DC  B 2  16  ? 42.773 163.352 54.494 1.00 68.38  ? 866  DC  T OP1   1 
ATOM   620  O  OP2   . DC  B 2  16  ? 42.908 161.199 53.101 1.00 68.38  ? 866  DC  T OP2   1 
ATOM   621  O  "O5'" . DC  B 2  16  ? 41.279 162.990 52.520 1.00 69.38  ? 866  DC  T "O5'" 1 
ATOM   622  C  "C5'" . DC  B 2  16  ? 40.910 164.335 52.216 1.00 72.55  ? 866  DC  T "C5'" 1 
ATOM   623  C  "C4'" . DC  B 2  16  ? 39.667 164.353 51.360 1.00 74.21  ? 866  DC  T "C4'" 1 
ATOM   624  O  "O4'" . DC  B 2  16  ? 39.987 163.989 49.993 1.00 74.22  ? 866  DC  T "O4'" 1 
ATOM   625  C  "C3'" . DC  B 2  16  ? 38.594 163.368 51.827 1.00 75.85  ? 866  DC  T "C3'" 1 
ATOM   626  O  "O3'" . DC  B 2  16  ? 37.296 163.949 51.716 1.00 78.58  ? 866  DC  T "O3'" 1 
ATOM   627  C  "C2'" . DC  B 2  16  ? 38.729 162.214 50.852 1.00 74.88  ? 866  DC  T "C2'" 1 
ATOM   628  C  "C1'" . DC  B 2  16  ? 39.128 162.940 49.577 1.00 73.43  ? 866  DC  T "C1'" 1 
ATOM   629  N  N1    . DC  B 2  16  ? 39.832 162.125 48.564 1.00 71.82  ? 866  DC  T N1    1 
ATOM   630  C  C2    . DC  B 2  16  ? 39.512 162.312 47.207 1.00 70.20  ? 866  DC  T C2    1 
ATOM   631  O  O2    . DC  B 2  16  ? 38.686 163.185 46.894 1.00 69.56  ? 866  DC  T O2    1 
ATOM   632  N  N3    . DC  B 2  16  ? 40.117 161.540 46.273 1.00 69.55  ? 866  DC  T N3    1 
ATOM   633  C  C4    . DC  B 2  16  ? 41.013 160.621 46.643 1.00 69.43  ? 866  DC  T C4    1 
ATOM   634  N  N4    . DC  B 2  16  ? 41.574 159.872 45.688 1.00 67.67  ? 866  DC  T N4    1 
ATOM   635  C  C5    . DC  B 2  16  ? 41.373 160.425 48.011 1.00 69.86  ? 866  DC  T C5    1 
ATOM   636  C  C6    . DC  B 2  16  ? 40.766 161.191 48.928 1.00 70.97  ? 866  DC  T C6    1 
ATOM   637  P  P     . DG  B 2  17  ? 36.198 163.654 52.847 1.00 80.11  ? 867  DG  T P     1 
ATOM   638  O  OP1   . DG  B 2  17  ? 36.335 164.728 53.866 1.00 79.97  ? 867  DG  T OP1   1 
ATOM   639  O  OP2   . DG  B 2  17  ? 36.304 162.230 53.261 1.00 79.96  ? 867  DG  T OP2   1 
ATOM   640  O  "O5'" . DG  B 2  17  ? 34.817 163.849 52.079 1.00 81.36  ? 867  DG  T "O5'" 1 
ATOM   641  C  "C5'" . DG  B 2  17  ? 34.508 165.081 51.429 1.00 82.94  ? 867  DG  T "C5'" 1 
ATOM   642  C  "C4'" . DG  B 2  17  ? 33.774 164.820 50.134 1.00 84.34  ? 867  DG  T "C4'" 1 
ATOM   643  O  "O4'" . DG  B 2  17  ? 34.661 164.145 49.207 1.00 84.53  ? 867  DG  T "O4'" 1 
ATOM   644  C  "C3'" . DG  B 2  17  ? 32.536 163.928 50.261 1.00 85.43  ? 867  DG  T "C3'" 1 
ATOM   645  O  "O3'" . DG  B 2  17  ? 31.502 164.393 49.385 1.00 87.16  ? 867  DG  T "O3'" 1 
ATOM   646  C  "C2'" . DG  B 2  17  ? 33.037 162.568 49.812 1.00 84.65  ? 867  DG  T "C2'" 1 
ATOM   647  C  "C1'" . DG  B 2  17  ? 34.061 162.940 48.754 1.00 84.15  ? 867  DG  T "C1'" 1 
ATOM   648  N  N9    . DG  B 2  17  ? 35.116 161.951 48.555 1.00 83.05  ? 867  DG  T N9    1 
ATOM   649  C  C8    . DG  B 2  17  ? 35.883 161.343 49.524 1.00 82.43  ? 867  DG  T C8    1 
ATOM   650  N  N7    . DG  B 2  17  ? 36.741 160.488 49.039 1.00 82.17  ? 867  DG  T N7    1 
ATOM   651  C  C5    . DG  B 2  17  ? 36.535 160.534 47.665 1.00 81.81  ? 867  DG  T C5    1 
ATOM   652  C  C6    . DG  B 2  17  ? 37.175 159.823 46.614 1.00 81.31  ? 867  DG  T C6    1 
ATOM   653  O  O6    . DG  B 2  17  ? 38.083 158.984 46.689 1.00 81.63  ? 867  DG  T O6    1 
ATOM   654  N  N1    . DG  B 2  17  ? 36.657 160.174 45.371 1.00 80.44  ? 867  DG  T N1    1 
ATOM   655  C  C2    . DG  B 2  17  ? 35.654 161.089 45.163 1.00 80.62  ? 867  DG  T C2    1 
ATOM   656  N  N2    . DG  B 2  17  ? 35.291 161.289 43.886 1.00 80.53  ? 867  DG  T N2    1 
ATOM   657  N  N3    . DG  B 2  17  ? 35.050 161.759 46.132 1.00 80.59  ? 867  DG  T N3    1 
ATOM   658  C  C4    . DG  B 2  17  ? 35.537 161.434 47.351 1.00 81.92  ? 867  DG  T C4    1 
ATOM   659  P  P     . DT  B 2  18  ? 30.083 163.634 49.341 1.00 88.89  ? 868  DT  T P     1 
ATOM   660  O  OP2   . DT  B 2  18  ? 30.120 162.443 50.230 1.00 88.80  ? 868  DT  T OP2   1 
ATOM   661  O  "O5'" . DT  B 2  18  ? 29.980 163.124 47.837 1.00 89.57  ? 868  DT  T "O5'" 1 
ATOM   662  C  "C5'" . DT  B 2  18  ? 30.110 164.039 46.753 1.00 90.69  ? 868  DT  T "C5'" 1 
ATOM   663  C  "C4'" . DT  B 2  18  ? 30.126 163.300 45.436 1.00 91.65  ? 868  DT  T "C4'" 1 
ATOM   664  O  "O4'" . DT  B 2  18  ? 31.310 162.466 45.357 1.00 90.66  ? 868  DT  T "O4'" 1 
ATOM   665  C  "C3'" . DT  B 2  18  ? 28.933 162.375 45.186 1.00 92.32  ? 868  DT  T "C3'" 1 
ATOM   666  O  "O3'" . DT  B 2  18  ? 28.513 162.490 43.819 1.00 95.19  ? 868  DT  T "O3'" 1 
ATOM   667  C  "C2'" . DT  B 2  18  ? 29.496 160.991 45.459 1.00 91.12  ? 868  DT  T "C2'" 1 
ATOM   668  C  "C1'" . DT  B 2  18  ? 30.937 161.144 45.001 1.00 89.72  ? 868  DT  T "C1'" 1 
ATOM   669  N  N1    . DT  B 2  18  ? 31.906 160.205 45.616 1.00 88.12  ? 868  DT  T N1    1 
ATOM   670  C  C2    . DT  B 2  18  ? 32.653 159.394 44.780 1.00 86.71  ? 868  DT  T C2    1 
ATOM   671  O  O2    . DT  B 2  18  ? 32.566 159.419 43.561 1.00 85.65  ? 868  DT  T O2    1 
ATOM   672  N  N3    . DT  B 2  18  ? 33.514 158.546 45.429 1.00 85.65  ? 868  DT  T N3    1 
ATOM   673  C  C4    . DT  B 2  18  ? 33.704 158.425 46.792 1.00 85.72  ? 868  DT  T C4    1 
ATOM   674  O  O4    . DT  B 2  18  ? 34.512 157.608 47.226 1.00 85.62  ? 868  DT  T O4    1 
ATOM   675  C  C5    . DT  B 2  18  ? 32.896 159.306 47.608 1.00 86.11  ? 868  DT  T C5    1 
ATOM   676  C  C7    . DT  B 2  18  ? 33.034 159.248 49.097 1.00 85.48  ? 868  DT  T C7    1 
ATOM   677  C  C6    . DT  B 2  18  ? 32.052 160.141 46.989 1.00 87.30  ? 868  DT  T C6    1 
ATOM   678  P  P     . DC  B 2  19  ? 27.122 161.834 43.346 1.00 97.10  ? 869  DC  T P     1 
ATOM   679  O  OP1   . DC  B 2  19  ? 26.615 162.654 42.213 1.00 96.55  ? 869  DC  T OP1   1 
ATOM   680  O  OP2   . DC  B 2  19  ? 26.261 161.622 44.540 1.00 96.80  ? 869  DC  T OP2   1 
ATOM   681  O  "O5'" . DC  B 2  19  ? 27.550 160.408 42.773 1.00 97.79  ? 869  DC  T "O5'" 1 
ATOM   682  C  "C5'" . DC  B 2  19  ? 28.237 160.298 41.525 1.00 98.83  ? 869  DC  T "C5'" 1 
ATOM   683  C  "C4'" . DC  B 2  19  ? 28.487 158.846 41.180 1.00 99.39  ? 869  DC  T "C4'" 1 
ATOM   684  O  "O4'" . DC  B 2  19  ? 29.459 158.280 42.093 1.00 99.45  ? 869  DC  T "O4'" 1 
ATOM   685  C  "C3'" . DC  B 2  19  ? 27.261 157.930 41.241 1.00 99.60  ? 869  DC  T "C3'" 1 
ATOM   686  O  "O3'" . DC  B 2  19  ? 27.315 156.975 40.176 1.00 100.11 ? 869  DC  T "O3'" 1 
ATOM   687  C  "C2'" . DC  B 2  19  ? 27.437 157.208 42.564 1.00 99.65  ? 869  DC  T "C2'" 1 
ATOM   688  C  "C1'" . DC  B 2  19  ? 28.949 157.071 42.628 1.00 99.52  ? 869  DC  T "C1'" 1 
ATOM   689  N  N1    . DC  B 2  19  ? 29.543 156.865 43.965 1.00 99.55  ? 869  DC  T N1    1 
ATOM   690  C  C2    . DC  B 2  19  ? 30.754 156.158 44.060 1.00 99.12  ? 869  DC  T C2    1 
ATOM   691  O  O2    . DC  B 2  19  ? 31.301 155.750 43.019 1.00 98.52  ? 869  DC  T O2    1 
ATOM   692  N  N3    . DC  B 2  19  ? 31.297 155.939 45.282 1.00 98.72  ? 869  DC  T N3    1 
ATOM   693  C  C4    . DC  B 2  19  ? 30.686 156.396 46.378 1.00 98.41  ? 869  DC  T C4    1 
ATOM   694  N  N4    . DC  B 2  19  ? 31.255 156.147 47.560 1.00 97.51  ? 869  DC  T N4    1 
ATOM   695  C  C5    . DC  B 2  19  ? 29.463 157.127 46.310 1.00 98.75  ? 869  DC  T C5    1 
ATOM   696  C  C6    . DC  B 2  19  ? 28.933 157.338 45.097 1.00 99.43  ? 869  DC  T C6    1 
ATOM   697  P  P     . DG  B 2  20  ? 25.972 156.230 39.696 1.00 100.16 ? 870  DG  T P     1 
ATOM   698  O  OP1   . DG  B 2  20  ? 25.403 157.018 38.571 1.00 100.16 ? 870  DG  T OP1   1 
ATOM   699  O  OP2   . DG  B 2  20  ? 25.132 155.940 40.888 1.00 99.67  ? 870  DG  T OP2   1 
ATOM   700  O  "O5'" . DG  B 2  20  ? 26.500 154.844 39.109 1.00 100.16 ? 870  DG  T "O5'" 1 
ATOM   701  C  "C5'" . DG  B 2  20  ? 27.498 154.813 38.087 1.00 100.09 ? 870  DG  T "C5'" 1 
ATOM   702  C  "C4'" . DG  B 2  20  ? 28.431 153.640 38.293 1.00 100.16 ? 870  DG  T "C4'" 1 
ATOM   703  O  "O4'" . DG  B 2  20  ? 29.107 153.782 39.568 1.00 100.16 ? 870  DG  T "O4'" 1 
ATOM   704  C  "C3'" . DG  B 2  20  ? 27.764 152.262 38.321 1.00 100.16 ? 870  DG  T "C3'" 1 
ATOM   705  O  "O3'" . DG  B 2  20  ? 28.595 151.295 37.663 1.00 100.16 ? 870  DG  T "O3'" 1 
ATOM   706  C  "C2'" . DG  B 2  20  ? 27.673 151.947 39.802 1.00 100.16 ? 870  DG  T "C2'" 1 
ATOM   707  C  "C1'" . DG  B 2  20  ? 28.929 152.605 40.340 1.00 100.03 ? 870  DG  T "C1'" 1 
ATOM   708  N  N9    . DG  B 2  20  ? 28.839 152.987 41.746 1.00 100.15 ? 870  DG  T N9    1 
ATOM   709  C  C8    . DG  B 2  20  ? 27.929 153.844 42.322 1.00 100.15 ? 870  DG  T C8    1 
ATOM   710  N  N7    . DG  B 2  20  ? 28.076 153.956 43.614 1.00 100.13 ? 870  DG  T N7    1 
ATOM   711  C  C5    . DG  B 2  20  ? 29.153 153.130 43.911 1.00 100.08 ? 870  DG  T C5    1 
ATOM   712  C  C6    . DG  B 2  20  ? 29.773 152.836 45.157 1.00 99.75  ? 870  DG  T C6    1 
ATOM   713  O  O6    . DG  B 2  20  ? 29.477 153.255 46.286 1.00 99.27  ? 870  DG  T O6    1 
ATOM   714  N  N1    . DG  B 2  20  ? 30.838 151.954 45.000 1.00 99.73  ? 870  DG  T N1    1 
ATOM   715  C  C2    . DG  B 2  20  ? 31.252 151.417 43.805 1.00 100.00 ? 870  DG  T C2    1 
ATOM   716  N  N2    . DG  B 2  20  ? 32.306 150.587 43.860 1.00 100.16 ? 870  DG  T N2    1 
ATOM   717  N  N3    . DG  B 2  20  ? 30.679 151.676 42.640 1.00 99.84  ? 870  DG  T N3    1 
ATOM   718  C  C4    . DG  B 2  20  ? 29.643 152.534 42.767 1.00 100.16 ? 870  DG  T C4    1 
ATOM   719  P  P     . DT  B 2  21  ? 28.076 149.779 37.478 1.00 100.16 ? 871  DT  T P     1 
ATOM   720  O  OP1   . DT  B 2  21  ? 28.381 149.377 36.078 1.00 100.16 ? 871  DT  T OP1   1 
ATOM   721  O  OP2   . DT  B 2  21  ? 26.679 149.673 37.983 1.00 100.16 ? 871  DT  T OP2   1 
ATOM   722  O  "O5'" . DT  B 2  21  ? 29.015 148.932 38.449 1.00 100.16 ? 871  DT  T "O5'" 1 
ATOM   723  C  "C5'" . DT  B 2  21  ? 30.425 148.868 38.229 1.00 100.03 ? 871  DT  T "C5'" 1 
ATOM   724  C  "C4'" . DT  B 2  21  ? 31.084 147.976 39.257 1.00 100.16 ? 871  DT  T "C4'" 1 
ATOM   725  O  "O4'" . DT  B 2  21  ? 30.932 148.558 40.575 1.00 100.16 ? 871  DT  T "O4'" 1 
ATOM   726  C  "C3'" . DT  B 2  21  ? 30.536 146.549 39.357 1.00 100.16 ? 871  DT  T "C3'" 1 
ATOM   727  O  "O3'" . DT  B 2  21  ? 31.618 145.628 39.563 1.00 100.16 ? 871  DT  T "O3'" 1 
ATOM   728  C  "C2'" . DT  B 2  21  ? 29.650 146.599 40.589 1.00 100.16 ? 871  DT  T "C2'" 1 
ATOM   729  C  "C1'" . DT  B 2  21  ? 30.400 147.588 41.464 1.00 100.16 ? 871  DT  T "C1'" 1 
ATOM   730  N  N1    . DT  B 2  21  ? 29.584 148.289 42.479 1.00 100.16 ? 871  DT  T N1    1 
ATOM   731  C  C2    . DT  B 2  21  ? 30.007 148.244 43.795 1.00 100.16 ? 871  DT  T C2    1 
ATOM   732  O  O2    . DT  B 2  21  ? 31.020 147.660 44.159 1.00 100.16 ? 871  DT  T O2    1 
ATOM   733  N  N3    . DT  B 2  21  ? 29.196 148.915 44.677 1.00 100.12 ? 871  DT  T N3    1 
ATOM   734  C  C4    . DT  B 2  21  ? 28.034 149.607 44.388 1.00 99.70  ? 871  DT  T C4    1 
ATOM   735  O  O4    . DT  B 2  21  ? 27.412 150.161 45.294 1.00 99.35  ? 871  DT  T O4    1 
ATOM   736  C  C5    . DT  B 2  21  ? 27.649 149.612 42.990 1.00 99.68  ? 871  DT  T C5    1 
ATOM   737  C  C7    . DT  B 2  21  ? 26.403 150.330 42.578 1.00 99.53  ? 871  DT  T C7    1 
ATOM   738  C  C6    . DT  B 2  21  ? 28.434 148.964 42.120 1.00 99.86  ? 871  DT  T C6    1 
ATOM   739  P  P     . DT  B 2  22  ? 31.341 144.042 39.545 1.00 100.16 ? 872  DT  T P     1 
ATOM   740  O  OP1   . DT  B 2  22  ? 32.414 143.426 38.720 1.00 100.16 ? 872  DT  T OP1   1 
ATOM   741  O  OP2   . DT  B 2  22  ? 29.917 143.799 39.193 1.00 100.16 ? 872  DT  T OP2   1 
ATOM   742  O  "O5'" . DT  B 2  22  ? 31.561 143.598 41.063 1.00 100.16 ? 872  DT  T "O5'" 1 
ATOM   743  C  "C5'" . DT  B 2  22  ? 32.865 143.621 41.652 1.00 100.16 ? 872  DT  T "C5'" 1 
ATOM   744  C  "C4'" . DT  B 2  22  ? 32.828 143.096 43.071 1.00 100.16 ? 872  DT  T "C4'" 1 
ATOM   745  O  "O4'" . DT  B 2  22  ? 32.096 144.014 43.921 1.00 100.16 ? 872  DT  T "O4'" 1 
ATOM   746  C  "C3'" . DT  B 2  22  ? 32.183 141.719 43.269 1.00 100.07 ? 872  DT  T "C3'" 1 
ATOM   747  O  "O3'" . DT  B 2  22  ? 32.936 140.948 44.214 1.00 98.57  ? 872  DT  T "O3'" 1 
ATOM   748  C  "C2'" . DT  B 2  22  ? 30.820 142.049 43.851 1.00 100.16 ? 872  DT  T "C2'" 1 
ATOM   749  C  "C1'" . DT  B 2  22  ? 31.123 143.297 44.666 1.00 100.16 ? 872  DT  T "C1'" 1 
ATOM   750  N  N1    . DT  B 2  22  ? 29.973 144.200 44.922 1.00 100.16 ? 872  DT  T N1    1 
ATOM   751  C  C2    . DT  B 2  22  ? 29.728 144.582 46.229 1.00 100.16 ? 872  DT  T C2    1 
ATOM   752  O  O2    . DT  B 2  22  ? 30.407 144.214 47.177 1.00 100.16 ? 872  DT  T O2    1 
ATOM   753  N  N3    . DT  B 2  22  ? 28.648 145.416 46.387 1.00 100.16 ? 872  DT  T N3    1 
ATOM   754  C  C4    . DT  B 2  22  ? 27.807 145.893 45.401 1.00 100.16 ? 872  DT  T C4    1 
ATOM   755  O  O4    . DT  B 2  22  ? 26.876 146.638 45.702 1.00 100.16 ? 872  DT  T O4    1 
ATOM   756  C  C5    . DT  B 2  22  ? 28.118 145.451 44.056 1.00 100.11 ? 872  DT  T C5    1 
ATOM   757  C  C7    . DT  B 2  22  ? 27.257 145.909 42.920 1.00 99.71  ? 872  DT  T C7    1 
ATOM   758  C  C6    . DT  B 2  22  ? 29.172 144.642 43.887 1.00 100.13 ? 872  DT  T C6    1 
ATOM   759  N  N     . MET C 3  1   ? 26.168 210.143 33.395 1.00 15.43  ? 1    MET A N     1 
ATOM   760  C  CA    . MET C 3  1   ? 26.822 208.806 33.554 1.00 12.92  ? 1    MET A CA    1 
ATOM   761  C  C     . MET C 3  1   ? 25.838 207.763 34.058 1.00 11.71  ? 1    MET A C     1 
ATOM   762  O  O     . MET C 3  1   ? 25.066 208.022 34.978 1.00 11.90  ? 1    MET A O     1 
ATOM   763  C  CB    . MET C 3  1   ? 27.999 208.899 34.542 1.00 12.80  ? 1    MET A CB    1 
ATOM   764  C  CG    . MET C 3  1   ? 28.645 207.542 34.875 1.00 12.17  ? 1    MET A CG    1 
ATOM   765  S  SD    . MET C 3  1   ? 30.046 207.614 36.039 1.00 13.60  ? 1    MET A SD    1 
ATOM   766  C  CE    . MET C 3  1   ? 31.414 207.744 34.937 1.00 7.06   ? 1    MET A CE    1 
ATOM   767  N  N     . ILE C 3  2   ? 25.857 206.585 33.447 1.00 11.80  ? 2    ILE A N     1 
ATOM   768  C  CA    . ILE C 3  2   ? 24.988 205.502 33.891 1.00 11.80  ? 2    ILE A CA    1 
ATOM   769  C  C     . ILE C 3  2   ? 25.824 204.245 34.111 1.00 11.39  ? 2    ILE A C     1 
ATOM   770  O  O     . ILE C 3  2   ? 26.905 204.098 33.544 1.00 13.51  ? 2    ILE A O     1 
ATOM   771  C  CB    . ILE C 3  2   ? 23.872 205.206 32.873 1.00 11.43  ? 2    ILE A CB    1 
ATOM   772  C  CG1   . ILE C 3  2   ? 24.462 204.653 31.574 1.00 12.22  ? 2    ILE A CG1   1 
ATOM   773  C  CG2   . ILE C 3  2   ? 23.086 206.475 32.607 1.00 11.02  ? 2    ILE A CG2   1 
ATOM   774  C  CD1   . ILE C 3  2   ? 23.416 204.321 30.510 1.00 9.69   ? 2    ILE A CD1   1 
ATOM   775  N  N     . VAL C 3  3   ? 25.339 203.354 34.964 1.00 11.25  ? 3    VAL A N     1 
ATOM   776  C  CA    . VAL C 3  3   ? 26.040 202.106 35.238 1.00 10.75  ? 3    VAL A CA    1 
ATOM   777  C  C     . VAL C 3  3   ? 25.067 201.022 34.809 1.00 11.92  ? 3    VAL A C     1 
ATOM   778  O  O     . VAL C 3  3   ? 23.877 201.073 35.142 1.00 12.01  ? 3    VAL A O     1 
ATOM   779  C  CB    . VAL C 3  3   ? 26.382 201.979 36.733 1.00 9.64   ? 3    VAL A CB    1 
ATOM   780  C  CG1   . VAL C 3  3   ? 27.142 200.694 36.995 1.00 7.58   ? 3    VAL A CG1   1 
ATOM   781  C  CG2   . VAL C 3  3   ? 27.215 203.162 37.153 1.00 8.19   ? 3    VAL A CG2   1 
ATOM   782  N  N     . SER C 3  4   ? 25.562 200.050 34.055 1.00 11.64  ? 4    SER A N     1 
ATOM   783  C  CA    . SER C 3  4   ? 24.697 199.004 33.546 1.00 10.56  ? 4    SER A CA    1 
ATOM   784  C  C     . SER C 3  4   ? 25.340 197.627 33.505 1.00 11.23  ? 4    SER A C     1 
ATOM   785  O  O     . SER C 3  4   ? 26.545 197.459 33.722 1.00 9.01   ? 4    SER A O     1 
ATOM   786  C  CB    . SER C 3  4   ? 24.229 199.388 32.137 1.00 9.03   ? 4    SER A CB    1 
ATOM   787  O  OG    . SER C 3  4   ? 23.062 198.682 31.760 1.00 9.71   ? 4    SER A OG    1 
ATOM   788  N  N     . ASP C 3  5   ? 24.501 196.642 33.219 1.00 12.15  ? 5    ASP A N     1 
ATOM   789  C  CA    . ASP C 3  5   ? 24.921 195.259 33.114 1.00 13.41  ? 5    ASP A CA    1 
ATOM   790  C  C     . ASP C 3  5   ? 23.771 194.496 32.481 1.00 13.22  ? 5    ASP A C     1 
ATOM   791  O  O     . ASP C 3  5   ? 22.612 194.870 32.648 1.00 14.05  ? 5    ASP A O     1 
ATOM   792  C  CB    . ASP C 3  5   ? 25.221 194.687 34.496 1.00 13.84  ? 5    ASP A CB    1 
ATOM   793  C  CG    . ASP C 3  5   ? 25.600 193.224 34.439 1.00 18.80  ? 5    ASP A CG    1 
ATOM   794  O  OD1   . ASP C 3  5   ? 26.585 192.896 33.737 1.00 18.76  ? 5    ASP A OD1   1 
ATOM   795  O  OD2   . ASP C 3  5   ? 24.912 192.401 35.088 1.00 19.34  ? 5    ASP A OD2   1 
ATOM   796  N  N     . ILE C 3  6   ? 24.078 193.434 31.752 1.00 12.35  ? 6    ILE A N     1 
ATOM   797  C  CA    . ILE C 3  6   ? 23.015 192.659 31.135 1.00 14.16  ? 6    ILE A CA    1 
ATOM   798  C  C     . ILE C 3  6   ? 23.160 191.192 31.476 1.00 15.79  ? 6    ILE A C     1 
ATOM   799  O  O     . ILE C 3  6   ? 24.198 190.755 31.972 1.00 16.22  ? 6    ILE A O     1 
ATOM   800  C  CB    . ILE C 3  6   ? 23.025 192.774 29.589 1.00 13.98  ? 6    ILE A CB    1 
ATOM   801  C  CG1   . ILE C 3  6   ? 24.184 191.963 29.008 1.00 11.66  ? 6    ILE A CG1   1 
ATOM   802  C  CG2   . ILE C 3  6   ? 23.167 194.229 29.170 1.00 15.75  ? 6    ILE A CG2   1 
ATOM   803  C  CD1   . ILE C 3  6   ? 24.207 191.958 27.489 1.00 13.65  ? 6    ILE A CD1   1 
ATOM   804  N  N     . GLU C 3  7   ? 22.099 190.442 31.212 1.00 15.58  ? 7    GLU A N     1 
ATOM   805  C  CA    . GLU C 3  7   ? 22.093 189.007 31.422 1.00 15.81  ? 7    GLU A CA    1 
ATOM   806  C  C     . GLU C 3  7   ? 21.594 188.462 30.087 1.00 16.27  ? 7    GLU A C     1 
ATOM   807  O  O     . GLU C 3  7   ? 20.597 188.939 29.548 1.00 16.67  ? 7    GLU A O     1 
ATOM   808  C  CB    . GLU C 3  7   ? 21.141 188.626 32.558 1.00 19.05  ? 7    GLU A CB    1 
ATOM   809  C  CG    . GLU C 3  7   ? 21.510 189.238 33.912 1.00 23.19  ? 7    GLU A CG    1 
ATOM   810  C  CD    . GLU C 3  7   ? 22.721 188.581 34.564 1.00 24.92  ? 7    GLU A CD    1 
ATOM   811  O  OE1   . GLU C 3  7   ? 23.597 188.073 33.839 1.00 27.57  ? 7    GLU A OE1   1 
ATOM   812  O  OE2   . GLU C 3  7   ? 22.805 188.585 35.811 1.00 29.73  ? 7    GLU A OE2   1 
ATOM   813  N  N     . ALA C 3  8   ? 22.313 187.494 29.536 1.00 14.93  ? 8    ALA A N     1 
ATOM   814  C  CA    . ALA C 3  8   ? 21.945 186.907 28.267 1.00 14.19  ? 8    ALA A CA    1 
ATOM   815  C  C     . ALA C 3  8   ? 22.040 185.387 28.381 1.00 14.71  ? 8    ALA A C     1 
ATOM   816  O  O     . ALA C 3  8   ? 22.473 184.861 29.406 1.00 14.96  ? 8    ALA A O     1 
ATOM   817  C  CB    . ALA C 3  8   ? 22.856 187.438 27.171 1.00 14.25  ? 8    ALA A CB    1 
ATOM   818  N  N     . ASN C 3  9   ? 21.656 184.678 27.328 1.00 14.00  ? 9    ASN A N     1 
ATOM   819  C  CA    . ASN C 3  9   ? 21.645 183.225 27.377 1.00 14.15  ? 9    ASN A CA    1 
ATOM   820  C  C     . ASN C 3  9   ? 22.945 182.465 27.176 1.00 14.81  ? 9    ASN A C     1 
ATOM   821  O  O     . ASN C 3  9   ? 22.962 181.251 27.343 1.00 17.19  ? 9    ASN A O     1 
ATOM   822  C  CB    . ASN C 3  9   ? 20.591 182.690 26.404 1.00 14.45  ? 9    ASN A CB    1 
ATOM   823  C  CG    . ASN C 3  9   ? 20.927 182.975 24.951 1.00 14.64  ? 9    ASN A CG    1 
ATOM   824  O  OD1   . ASN C 3  9   ? 21.793 183.794 24.644 1.00 16.02  ? 9    ASN A OD1   1 
ATOM   825  N  ND2   . ASN C 3  9   ? 20.222 182.307 24.046 1.00 14.13  ? 9    ASN A ND2   1 
ATOM   826  N  N     . ALA C 3  10  ? 24.037 183.144 26.837 1.00 15.44  ? 10   ALA A N     1 
ATOM   827  C  CA    . ALA C 3  10  ? 25.299 182.426 26.631 1.00 14.01  ? 10   ALA A CA    1 
ATOM   828  C  C     . ALA C 3  10  ? 26.494 183.354 26.517 1.00 14.52  ? 10   ALA A C     1 
ATOM   829  O  O     . ALA C 3  10  ? 26.344 184.571 26.569 1.00 15.80  ? 10   ALA A O     1 
ATOM   830  C  CB    . ALA C 3  10  ? 25.199 181.562 25.376 1.00 10.85  ? 10   ALA A CB    1 
ATOM   831  N  N     . LEU C 3  11  ? 27.683 182.775 26.382 1.00 16.61  ? 11   LEU A N     1 
ATOM   832  C  CA    . LEU C 3  11  ? 28.891 183.575 26.218 1.00 18.38  ? 11   LEU A CA    1 
ATOM   833  C  C     . LEU C 3  11  ? 28.803 184.227 24.834 1.00 18.50  ? 11   LEU A C     1 
ATOM   834  O  O     . LEU C 3  11  ? 28.025 183.794 23.985 1.00 17.42  ? 11   LEU A O     1 
ATOM   835  C  CB    . LEU C 3  11  ? 30.148 182.701 26.315 1.00 20.01  ? 11   LEU A CB    1 
ATOM   836  C  CG    . LEU C 3  11  ? 30.451 182.010 27.655 1.00 22.84  ? 11   LEU A CG    1 
ATOM   837  C  CD1   . LEU C 3  11  ? 31.674 181.108 27.507 1.00 21.07  ? 11   LEU A CD1   1 
ATOM   838  C  CD2   . LEU C 3  11  ? 30.694 183.053 28.736 1.00 21.75  ? 11   LEU A CD2   1 
ATOM   839  N  N     . LEU C 3  12  ? 29.601 185.264 24.613 1.00 19.07  ? 12   LEU A N     1 
ATOM   840  C  CA    . LEU C 3  12  ? 29.585 185.991 23.355 1.00 19.07  ? 12   LEU A CA    1 
ATOM   841  C  C     . LEU C 3  12  ? 29.554 185.117 22.109 1.00 20.54  ? 12   LEU A C     1 
ATOM   842  O  O     . LEU C 3  12  ? 28.790 185.379 21.181 1.00 20.39  ? 12   LEU A O     1 
ATOM   843  C  CB    . LEU C 3  12  ? 30.787 186.930 23.287 1.00 17.97  ? 12   LEU A CB    1 
ATOM   844  C  CG    . LEU C 3  12  ? 30.852 187.809 22.038 1.00 17.29  ? 12   LEU A CG    1 
ATOM   845  C  CD1   . LEU C 3  12  ? 29.681 188.780 22.019 1.00 15.40  ? 12   LEU A CD1   1 
ATOM   846  C  CD2   . LEU C 3  12  ? 32.171 188.563 22.033 1.00 19.31  ? 12   LEU A CD2   1 
ATOM   847  N  N     . GLU C 3  13  ? 30.383 184.080 22.094 1.00 22.32  ? 13   GLU A N     1 
ATOM   848  C  CA    . GLU C 3  13  ? 30.482 183.176 20.949 1.00 24.65  ? 13   GLU A CA    1 
ATOM   849  C  C     . GLU C 3  13  ? 29.141 182.670 20.416 1.00 23.94  ? 13   GLU A C     1 
ATOM   850  O  O     . GLU C 3  13  ? 28.950 182.567 19.205 1.00 22.80  ? 13   GLU A O     1 
ATOM   851  C  CB    . GLU C 3  13  ? 31.361 181.977 21.308 1.00 28.13  ? 13   GLU A CB    1 
ATOM   852  C  CG    . GLU C 3  13  ? 32.725 182.356 21.884 1.00 37.58  ? 13   GLU A CG    1 
ATOM   853  C  CD    . GLU C 3  13  ? 32.637 183.079 23.232 1.00 40.68  ? 13   GLU A CD    1 
ATOM   854  O  OE1   . GLU C 3  13  ? 32.093 182.486 24.187 1.00 44.18  ? 13   GLU A OE1   1 
ATOM   855  O  OE2   . GLU C 3  13  ? 33.114 184.235 23.339 1.00 40.67  ? 13   GLU A OE2   1 
ATOM   856  N  N     . SER C 3  14  ? 28.210 182.357 21.310 1.00 22.01  ? 14   SER A N     1 
ATOM   857  C  CA    . SER C 3  14  ? 26.924 181.846 20.869 1.00 21.76  ? 14   SER A CA    1 
ATOM   858  C  C     . SER C 3  14  ? 25.697 182.473 21.521 1.00 21.13  ? 14   SER A C     1 
ATOM   859  O  O     . SER C 3  14  ? 24.629 181.867 21.541 1.00 22.66  ? 14   SER A O     1 
ATOM   860  C  CB    . SER C 3  14  ? 26.886 180.327 21.061 1.00 21.88  ? 14   SER A CB    1 
ATOM   861  O  OG    . SER C 3  14  ? 27.138 179.979 22.405 1.00 20.98  ? 14   SER A OG    1 
ATOM   862  N  N     . VAL C 3  15  ? 25.831 183.683 22.044 1.00 19.28  ? 15   VAL A N     1 
ATOM   863  C  CA    . VAL C 3  15  ? 24.687 184.324 22.672 1.00 18.78  ? 15   VAL A CA    1 
ATOM   864  C  C     . VAL C 3  15  ? 23.637 184.651 21.596 1.00 18.71  ? 15   VAL A C     1 
ATOM   865  O  O     . VAL C 3  15  ? 23.973 185.142 20.520 1.00 18.50  ? 15   VAL A O     1 
ATOM   866  C  CB    . VAL C 3  15  ? 25.121 185.613 23.442 1.00 17.95  ? 15   VAL A CB    1 
ATOM   867  C  CG1   . VAL C 3  15  ? 25.622 186.670 22.470 1.00 16.06  ? 15   VAL A CG1   1 
ATOM   868  C  CG2   . VAL C 3  15  ? 23.968 186.134 24.280 1.00 15.09  ? 15   VAL A CG2   1 
ATOM   869  N  N     . THR C 3  16  ? 22.371 184.346 21.878 1.00 17.74  ? 16   THR A N     1 
ATOM   870  C  CA    . THR C 3  16  ? 21.293 184.614 20.924 1.00 17.75  ? 16   THR A CA    1 
ATOM   871  C  C     . THR C 3  16  ? 20.076 185.263 21.561 1.00 17.95  ? 16   THR A C     1 
ATOM   872  O  O     . THR C 3  16  ? 19.124 185.598 20.863 1.00 17.46  ? 16   THR A O     1 
ATOM   873  C  CB    . THR C 3  16  ? 20.811 183.328 20.209 1.00 15.88  ? 16   THR A CB    1 
ATOM   874  O  OG1   . THR C 3  16  ? 20.229 182.435 21.164 1.00 15.96  ? 16   THR A OG1   1 
ATOM   875  C  CG2   . THR C 3  16  ? 21.970 182.639 19.522 1.00 15.10  ? 16   THR A CG2   1 
ATOM   876  N  N     . LYS C 3  17  ? 20.097 185.431 22.880 1.00 18.46  ? 17   LYS A N     1 
ATOM   877  C  CA    . LYS C 3  17  ? 18.967 186.050 23.559 1.00 20.35  ? 17   LYS A CA    1 
ATOM   878  C  C     . LYS C 3  17  ? 19.338 186.924 24.750 1.00 19.49  ? 17   LYS A C     1 
ATOM   879  O  O     . LYS C 3  17  ? 20.096 186.525 25.637 1.00 18.99  ? 17   LYS A O     1 
ATOM   880  C  CB    . LYS C 3  17  ? 17.956 184.989 24.034 1.00 23.51  ? 17   LYS A CB    1 
ATOM   881  C  CG    . LYS C 3  17  ? 17.282 184.183 22.928 1.00 27.79  ? 17   LYS A CG    1 
ATOM   882  C  CD    . LYS C 3  17  ? 15.830 183.836 23.291 1.00 32.12  ? 17   LYS A CD    1 
ATOM   883  C  CE    . LYS C 3  17  ? 15.725 182.861 24.462 1.00 34.46  ? 17   LYS A CE    1 
ATOM   884  N  NZ    . LYS C 3  17  ? 16.079 181.464 24.064 1.00 35.69  ? 17   LYS A NZ    1 
ATOM   885  N  N     . PHE C 3  18  ? 18.783 188.127 24.757 1.00 18.85  ? 18   PHE A N     1 
ATOM   886  C  CA    . PHE C 3  18  ? 18.980 189.084 25.840 1.00 17.25  ? 18   PHE A CA    1 
ATOM   887  C  C     . PHE C 3  18  ? 17.903 188.710 26.861 1.00 18.39  ? 18   PHE A C     1 
ATOM   888  O  O     . PHE C 3  18  ? 16.732 188.590 26.498 1.00 17.43  ? 18   PHE A O     1 
ATOM   889  C  CB    . PHE C 3  18  ? 18.731 190.491 25.302 1.00 15.82  ? 18   PHE A CB    1 
ATOM   890  C  CG    . PHE C 3  18  ? 18.553 191.539 26.358 1.00 13.60  ? 18   PHE A CG    1 
ATOM   891  C  CD1   . PHE C 3  18  ? 19.649 192.177 26.921 1.00 14.82  ? 18   PHE A CD1   1 
ATOM   892  C  CD2   . PHE C 3  18  ? 17.283 191.943 26.736 1.00 13.31  ? 18   PHE A CD2   1 
ATOM   893  C  CE1   . PHE C 3  18  ? 19.480 193.215 27.844 1.00 14.59  ? 18   PHE A CE1   1 
ATOM   894  C  CE2   . PHE C 3  18  ? 17.102 192.974 27.655 1.00 14.86  ? 18   PHE A CE2   1 
ATOM   895  C  CZ    . PHE C 3  18  ? 18.205 193.613 28.209 1.00 14.33  ? 18   PHE A CZ    1 
ATOM   896  N  N     . HIS C 3  19  ? 18.287 188.483 28.112 1.00 17.14  ? 19   HIS A N     1 
ATOM   897  C  CA    . HIS C 3  19  ? 17.301 188.143 29.126 1.00 18.43  ? 19   HIS A CA    1 
ATOM   898  C  C     . HIS C 3  19  ? 16.853 189.411 29.836 1.00 18.88  ? 19   HIS A C     1 
ATOM   899  O  O     . HIS C 3  19  ? 15.667 189.697 29.921 1.00 18.19  ? 19   HIS A O     1 
ATOM   900  C  CB    . HIS C 3  19  ? 17.868 187.154 30.146 1.00 20.24  ? 19   HIS A CB    1 
ATOM   901  C  CG    . HIS C 3  19  ? 18.022 185.761 29.619 1.00 22.14  ? 19   HIS A CG    1 
ATOM   902  N  ND1   . HIS C 3  19  ? 17.045 185.134 28.873 1.00 21.20  ? 19   HIS A ND1   1 
ATOM   903  C  CD2   . HIS C 3  19  ? 19.028 184.865 29.749 1.00 20.66  ? 19   HIS A CD2   1 
ATOM   904  C  CE1   . HIS C 3  19  ? 17.445 183.914 28.565 1.00 21.13  ? 19   HIS A CE1   1 
ATOM   905  N  NE2   . HIS C 3  19  ? 18.645 183.726 29.084 1.00 22.73  ? 19   HIS A NE2   1 
ATOM   906  N  N     . CYS C 3  20  ? 17.807 190.177 30.344 1.00 17.75  ? 20   CYS A N     1 
ATOM   907  C  CA    . CYS C 3  20  ? 17.460 191.406 31.020 1.00 16.13  ? 20   CYS A CA    1 
ATOM   908  C  C     . CYS C 3  20  ? 18.650 192.333 31.181 1.00 16.48  ? 20   CYS A C     1 
ATOM   909  O  O     . CYS C 3  20  ? 19.789 191.980 30.872 1.00 14.68  ? 20   CYS A O     1 
ATOM   910  C  CB    . CYS C 3  20  ? 16.858 191.094 32.386 1.00 14.48  ? 20   CYS A CB    1 
ATOM   911  S  SG    . CYS C 3  20  ? 17.957 190.182 33.456 1.00 16.98  ? 20   CYS A SG    1 
ATOM   912  N  N     . GLY C 3  21  ? 18.361 193.534 31.664 1.00 17.31  ? 21   GLY A N     1 
ATOM   913  C  CA    . GLY C 3  21  ? 19.394 194.521 31.884 1.00 16.38  ? 21   GLY A CA    1 
ATOM   914  C  C     . GLY C 3  21  ? 18.919 195.509 32.927 1.00 16.81  ? 21   GLY A C     1 
ATOM   915  O  O     . GLY C 3  21  ? 17.720 195.711 33.109 1.00 16.84  ? 21   GLY A O     1 
ATOM   916  N  N     . VAL C 3  22  ? 19.862 196.117 33.625 1.00 16.05  ? 22   VAL A N     1 
ATOM   917  C  CA    . VAL C 3  22  ? 19.534 197.089 34.645 1.00 14.75  ? 22   VAL A CA    1 
ATOM   918  C  C     . VAL C 3  22  ? 20.366 198.327 34.387 1.00 15.02  ? 22   VAL A C     1 
ATOM   919  O  O     . VAL C 3  22  ? 21.510 198.230 33.923 1.00 13.51  ? 22   VAL A O     1 
ATOM   920  C  CB    . VAL C 3  22  ? 19.867 196.563 36.056 1.00 14.06  ? 22   VAL A CB    1 
ATOM   921  C  CG1   . VAL C 3  22  ? 19.734 197.691 37.076 1.00 11.61  ? 22   VAL A CG1   1 
ATOM   922  C  CG2   . VAL C 3  22  ? 18.950 195.403 36.409 1.00 11.68  ? 22   VAL A CG2   1 
ATOM   923  N  N     . ILE C 3  23  ? 19.785 199.486 34.672 1.00 13.12  ? 23   ILE A N     1 
ATOM   924  C  CA    . ILE C 3  23  ? 20.498 200.742 34.493 1.00 13.45  ? 23   ILE A CA    1 
ATOM   925  C  C     . ILE C 3  23  ? 20.348 201.666 35.689 1.00 14.11  ? 23   ILE A C     1 
ATOM   926  O  O     . ILE C 3  23  ? 19.246 201.879 36.201 1.00 12.71  ? 23   ILE A O     1 
ATOM   927  C  CB    . ILE C 3  23  ? 20.030 201.513 33.248 1.00 12.18  ? 23   ILE A CB    1 
ATOM   928  C  CG1   . ILE C 3  23  ? 20.316 200.693 31.990 1.00 11.66  ? 23   ILE A CG1   1 
ATOM   929  C  CG2   . ILE C 3  23  ? 20.743 202.873 33.186 1.00 7.73   ? 23   ILE A CG2   1 
ATOM   930  C  CD1   . ILE C 3  23  ? 19.986 201.414 30.699 1.00 12.58  ? 23   ILE A CD1   1 
ATOM   931  N  N     . TYR C 3  24  ? 21.480 202.182 36.149 1.00 14.82  ? 24   TYR A N     1 
ATOM   932  C  CA    . TYR C 3  24  ? 21.496 203.125 37.244 1.00 15.72  ? 24   TYR A CA    1 
ATOM   933  C  C     . TYR C 3  24  ? 21.947 204.442 36.634 1.00 16.59  ? 24   TYR A C     1 
ATOM   934  O  O     . TYR C 3  24  ? 23.039 204.534 36.073 1.00 15.91  ? 24   TYR A O     1 
ATOM   935  C  CB    . TYR C 3  24  ? 22.485 202.725 38.332 1.00 15.34  ? 24   TYR A CB    1 
ATOM   936  C  CG    . TYR C 3  24  ? 22.550 203.777 39.404 1.00 16.90  ? 24   TYR A CG    1 
ATOM   937  C  CD1   . TYR C 3  24  ? 21.536 203.887 40.361 1.00 19.07  ? 24   TYR A CD1   1 
ATOM   938  C  CD2   . TYR C 3  24  ? 23.572 204.720 39.415 1.00 17.24  ? 24   TYR A CD2   1 
ATOM   939  C  CE1   . TYR C 3  24  ? 21.538 204.918 41.301 1.00 18.26  ? 24   TYR A CE1   1 
ATOM   940  C  CE2   . TYR C 3  24  ? 23.585 205.754 40.346 1.00 21.70  ? 24   TYR A CE2   1 
ATOM   941  C  CZ    . TYR C 3  24  ? 22.562 205.849 41.286 1.00 21.53  ? 24   TYR A CZ    1 
ATOM   942  O  OH    . TYR C 3  24  ? 22.560 206.888 42.191 1.00 22.07  ? 24   TYR A OH    1 
ATOM   943  N  N     . ASP C 3  25  ? 21.104 205.458 36.734 1.00 18.29  ? 25   ASP A N     1 
ATOM   944  C  CA    . ASP C 3  25  ? 21.434 206.759 36.174 1.00 17.45  ? 25   ASP A CA    1 
ATOM   945  C  C     . ASP C 3  25  ? 21.783 207.733 37.292 1.00 17.66  ? 25   ASP A C     1 
ATOM   946  O  O     . ASP C 3  25  ? 20.955 208.014 38.155 1.00 17.22  ? 25   ASP A O     1 
ATOM   947  C  CB    . ASP C 3  25  ? 20.247 207.299 35.377 1.00 17.46  ? 25   ASP A CB    1 
ATOM   948  C  CG    . ASP C 3  25  ? 20.626 208.462 34.493 1.00 20.46  ? 25   ASP A CG    1 
ATOM   949  O  OD1   . ASP C 3  25  ? 21.484 209.264 34.912 1.00 20.00  ? 25   ASP A OD1   1 
ATOM   950  O  OD2   . ASP C 3  25  ? 20.064 208.584 33.383 1.00 22.79  ? 25   ASP A OD2   1 
ATOM   951  N  N     . TYR C 3  26  ? 23.008 208.247 37.277 1.00 17.89  ? 26   TYR A N     1 
ATOM   952  C  CA    . TYR C 3  26  ? 23.434 209.199 38.295 1.00 18.20  ? 26   TYR A CA    1 
ATOM   953  C  C     . TYR C 3  26  ? 22.561 210.454 38.317 1.00 19.01  ? 26   TYR A C     1 
ATOM   954  O  O     . TYR C 3  26  ? 22.295 211.005 39.381 1.00 19.90  ? 26   TYR A O     1 
ATOM   955  C  CB    . TYR C 3  26  ? 24.902 209.587 38.078 1.00 16.66  ? 26   TYR A CB    1 
ATOM   956  C  CG    . TYR C 3  26  ? 25.880 208.634 38.726 1.00 17.26  ? 26   TYR A CG    1 
ATOM   957  C  CD1   . TYR C 3  26  ? 26.180 208.729 40.087 1.00 16.63  ? 26   TYR A CD1   1 
ATOM   958  C  CD2   . TYR C 3  26  ? 26.470 207.605 37.994 1.00 15.77  ? 26   TYR A CD2   1 
ATOM   959  C  CE1   . TYR C 3  26  ? 27.045 207.817 40.704 1.00 15.37  ? 26   TYR A CE1   1 
ATOM   960  C  CE2   . TYR C 3  26  ? 27.333 206.689 38.602 1.00 14.76  ? 26   TYR A CE2   1 
ATOM   961  C  CZ    . TYR C 3  26  ? 27.617 206.798 39.951 1.00 14.27  ? 26   TYR A CZ    1 
ATOM   962  O  OH    . TYR C 3  26  ? 28.467 205.889 40.544 1.00 13.25  ? 26   TYR A OH    1 
ATOM   963  N  N     . SER C 3  27  ? 22.099 210.895 37.151 1.00 20.60  ? 27   SER A N     1 
ATOM   964  C  CA    . SER C 3  27  ? 21.271 212.100 37.075 1.00 22.31  ? 27   SER A CA    1 
ATOM   965  C  C     . SER C 3  27  ? 19.906 211.956 37.761 1.00 22.20  ? 27   SER A C     1 
ATOM   966  O  O     . SER C 3  27  ? 19.306 212.960 38.156 1.00 22.50  ? 27   SER A O     1 
ATOM   967  C  CB    . SER C 3  27  ? 21.066 212.522 35.616 1.00 21.47  ? 27   SER A CB    1 
ATOM   968  O  OG    . SER C 3  27  ? 20.119 211.692 34.968 1.00 26.84  ? 27   SER A OG    1 
ATOM   969  N  N     . THR C 3  28  ? 19.419 210.722 37.901 1.00 19.96  ? 28   THR A N     1 
ATOM   970  C  CA    . THR C 3  28  ? 18.129 210.479 38.553 1.00 19.79  ? 28   THR A CA    1 
ATOM   971  C  C     . THR C 3  28  ? 18.303 209.754 39.882 1.00 21.34  ? 28   THR A C     1 
ATOM   972  O  O     . THR C 3  28  ? 17.416 209.782 40.738 1.00 23.23  ? 28   THR A O     1 
ATOM   973  C  CB    . THR C 3  28  ? 17.181 209.596 37.689 1.00 19.03  ? 28   THR A CB    1 
ATOM   974  O  OG1   . THR C 3  28  ? 17.775 208.304 37.496 1.00 19.82  ? 28   THR A OG1   1 
ATOM   975  C  CG2   . THR C 3  28  ? 16.912 210.233 36.342 1.00 15.95  ? 28   THR A CG2   1 
ATOM   976  N  N     . ALA C 3  29  ? 19.441 209.089 40.043 1.00 22.95  ? 29   ALA A N     1 
ATOM   977  C  CA    . ALA C 3  29  ? 19.730 208.328 41.253 1.00 23.75  ? 29   ALA A CA    1 
ATOM   978  C  C     . ALA C 3  29  ? 18.787 207.130 41.384 1.00 24.33  ? 29   ALA A C     1 
ATOM   979  O  O     . ALA C 3  29  ? 18.535 206.644 42.483 1.00 25.30  ? 29   ALA A O     1 
ATOM   980  C  CB    . ALA C 3  29  ? 19.612 209.225 42.480 1.00 23.22  ? 29   ALA A CB    1 
ATOM   981  N  N     . GLU C 3  30  ? 18.269 206.647 40.261 1.00 26.25  ? 30   GLU A N     1 
ATOM   982  C  CA    . GLU C 3  30  ? 17.365 205.503 40.297 1.00 26.92  ? 30   GLU A CA    1 
ATOM   983  C  C     . GLU C 3  30  ? 17.791 204.348 39.396 1.00 24.90  ? 30   GLU A C     1 
ATOM   984  O  O     . GLU C 3  30  ? 18.504 204.531 38.403 1.00 23.45  ? 30   GLU A O     1 
ATOM   985  C  CB    . GLU C 3  30  ? 15.949 205.936 39.918 1.00 30.22  ? 30   GLU A CB    1 
ATOM   986  C  CG    . GLU C 3  30  ? 15.409 207.068 40.765 1.00 36.25  ? 30   GLU A CG    1 
ATOM   987  C  CD    . GLU C 3  30  ? 13.935 207.304 40.529 1.00 41.05  ? 30   GLU A CD    1 
ATOM   988  O  OE1   . GLU C 3  30  ? 13.511 207.262 39.351 1.00 43.44  ? 30   GLU A OE1   1 
ATOM   989  O  OE2   . GLU C 3  30  ? 13.203 207.540 41.516 1.00 42.29  ? 30   GLU A OE2   1 
ATOM   990  N  N     . TYR C 3  31  ? 17.352 203.153 39.768 1.00 22.20  ? 31   TYR A N     1 
ATOM   991  C  CA    . TYR C 3  31  ? 17.641 201.957 39.000 1.00 21.03  ? 31   TYR A CA    1 
ATOM   992  C  C     . TYR C 3  31  ? 16.417 201.628 38.172 1.00 21.75  ? 31   TYR A C     1 
ATOM   993  O  O     . TYR C 3  31  ? 15.285 201.785 38.635 1.00 22.85  ? 31   TYR A O     1 
ATOM   994  C  CB    . TYR C 3  31  ? 17.923 200.764 39.908 1.00 18.84  ? 31   TYR A CB    1 
ATOM   995  C  CG    . TYR C 3  31  ? 19.180 200.857 40.736 1.00 17.60  ? 31   TYR A CG    1 
ATOM   996  C  CD1   . TYR C 3  31  ? 19.220 201.624 41.903 1.00 15.20  ? 31   TYR A CD1   1 
ATOM   997  C  CD2   . TYR C 3  31  ? 20.319 200.138 40.381 1.00 14.95  ? 31   TYR A CD2   1 
ATOM   998  C  CE1   . TYR C 3  31  ? 20.358 201.662 42.691 1.00 12.72  ? 31   TYR A CE1   1 
ATOM   999  C  CE2   . TYR C 3  31  ? 21.460 200.175 41.165 1.00 14.83  ? 31   TYR A CE2   1 
ATOM   1000 C  CZ    . TYR C 3  31  ? 21.470 200.936 42.317 1.00 14.10  ? 31   TYR A CZ    1 
ATOM   1001 O  OH    . TYR C 3  31  ? 22.595 200.957 43.109 1.00 20.29  ? 31   TYR A OH    1 
ATOM   1002 N  N     . VAL C 3  32  ? 16.650 201.162 36.950 1.00 21.95  ? 32   VAL A N     1 
ATOM   1003 C  CA    . VAL C 3  32  ? 15.567 200.781 36.057 1.00 20.40  ? 32   VAL A CA    1 
ATOM   1004 C  C     . VAL C 3  32  ? 15.864 199.396 35.495 1.00 20.73  ? 32   VAL A C     1 
ATOM   1005 O  O     . VAL C 3  32  ? 16.967 199.126 35.010 1.00 20.87  ? 32   VAL A O     1 
ATOM   1006 C  CB    . VAL C 3  32  ? 15.411 201.781 34.894 1.00 21.54  ? 32   VAL A CB    1 
ATOM   1007 C  CG1   . VAL C 3  32  ? 14.336 201.290 33.926 1.00 20.40  ? 32   VAL A CG1   1 
ATOM   1008 C  CG2   . VAL C 3  32  ? 15.040 203.163 35.444 1.00 18.80  ? 32   VAL A CG2   1 
ATOM   1009 N  N     . SER C 3  33  ? 14.875 198.515 35.578 1.00 19.19  ? 33   SER A N     1 
ATOM   1010 C  CA    . SER C 3  33  ? 15.036 197.163 35.084 1.00 17.51  ? 33   SER A CA    1 
ATOM   1011 C  C     . SER C 3  33  ? 14.358 196.984 33.744 1.00 16.28  ? 33   SER A C     1 
ATOM   1012 O  O     . SER C 3  33  ? 13.287 197.523 33.501 1.00 16.43  ? 33   SER A O     1 
ATOM   1013 C  CB    . SER C 3  33  ? 14.456 196.158 36.081 1.00 19.46  ? 33   SER A CB    1 
ATOM   1014 O  OG    . SER C 3  33  ? 15.216 196.121 37.275 1.00 20.06  ? 33   SER A OG    1 
ATOM   1015 N  N     . TYR C 3  34  ? 15.006 196.222 32.873 1.00 16.77  ? 34   TYR A N     1 
ATOM   1016 C  CA    . TYR C 3  34  ? 14.478 195.928 31.553 1.00 15.33  ? 34   TYR A CA    1 
ATOM   1017 C  C     . TYR C 3  34  ? 14.370 194.420 31.454 1.00 16.54  ? 34   TYR A C     1 
ATOM   1018 O  O     . TYR C 3  34  ? 15.346 193.701 31.701 1.00 15.54  ? 34   TYR A O     1 
ATOM   1019 C  CB    . TYR C 3  34  ? 15.416 196.455 30.468 1.00 13.14  ? 34   TYR A CB    1 
ATOM   1020 C  CG    . TYR C 3  34  ? 15.634 197.937 30.560 1.00 12.44  ? 34   TYR A CG    1 
ATOM   1021 C  CD1   . TYR C 3  34  ? 16.546 198.473 31.473 1.00 11.39  ? 34   TYR A CD1   1 
ATOM   1022 C  CD2   . TYR C 3  34  ? 14.882 198.818 29.779 1.00 11.00  ? 34   TYR A CD2   1 
ATOM   1023 C  CE1   . TYR C 3  34  ? 16.701 199.854 31.605 1.00 12.51  ? 34   TYR A CE1   1 
ATOM   1024 C  CE2   . TYR C 3  34  ? 15.025 200.200 29.908 1.00 9.83   ? 34   TYR A CE2   1 
ATOM   1025 C  CZ    . TYR C 3  34  ? 15.935 200.710 30.818 1.00 10.78  ? 34   TYR A CZ    1 
ATOM   1026 O  OH    . TYR C 3  34  ? 16.091 202.068 30.934 1.00 10.80  ? 34   TYR A OH    1 
ATOM   1027 N  N     . ARG C 3  35  ? 13.184 193.935 31.112 1.00 17.71  ? 35   ARG A N     1 
ATOM   1028 C  CA    . ARG C 3  35  ? 12.990 192.498 30.992 1.00 19.52  ? 35   ARG A CA    1 
ATOM   1029 C  C     . ARG C 3  35  ? 13.130 192.100 29.528 1.00 19.32  ? 35   ARG A C     1 
ATOM   1030 O  O     . ARG C 3  35  ? 13.265 192.969 28.667 1.00 20.04  ? 35   ARG A O     1 
ATOM   1031 C  CB    . ARG C 3  35  ? 11.646 192.115 31.610 1.00 20.60  ? 35   ARG A CB    1 
ATOM   1032 C  CG    . ARG C 3  35  ? 11.701 192.271 33.127 1.00 22.77  ? 35   ARG A CG    1 
ATOM   1033 C  CD    . ARG C 3  35  ? 10.409 191.935 33.838 1.00 26.54  ? 35   ARG A CD    1 
ATOM   1034 N  NE    . ARG C 3  35  ? 10.619 191.905 35.284 1.00 29.75  ? 35   ARG A NE    1 
ATOM   1035 C  CZ    . ARG C 3  35  ? 10.902 192.975 36.024 1.00 31.79  ? 35   ARG A CZ    1 
ATOM   1036 N  NH1   . ARG C 3  35  ? 11.004 194.170 35.456 1.00 31.96  ? 35   ARG A NH1   1 
ATOM   1037 N  NH2   . ARG C 3  35  ? 11.104 192.849 37.331 1.00 31.74  ? 35   ARG A NH2   1 
ATOM   1038 N  N     . PRO C 3  36  ? 13.106 190.794 29.220 1.00 19.10  ? 36   PRO A N     1 
ATOM   1039 C  CA    . PRO C 3  36  ? 13.265 190.399 27.812 1.00 19.80  ? 36   PRO A CA    1 
ATOM   1040 C  C     . PRO C 3  36  ? 12.525 191.182 26.738 1.00 20.41  ? 36   PRO A C     1 
ATOM   1041 O  O     . PRO C 3  36  ? 13.049 191.360 25.642 1.00 22.87  ? 36   PRO A O     1 
ATOM   1042 C  CB    . PRO C 3  36  ? 12.934 188.899 27.812 1.00 16.24  ? 36   PRO A CB    1 
ATOM   1043 C  CG    . PRO C 3  36  ? 12.224 188.668 29.101 1.00 19.18  ? 36   PRO A CG    1 
ATOM   1044 C  CD    . PRO C 3  36  ? 12.849 189.623 30.073 1.00 18.47  ? 36   PRO A CD    1 
ATOM   1045 N  N     . SER C 3  37  ? 11.327 191.663 27.039 1.00 20.21  ? 37   SER A N     1 
ATOM   1046 C  CA    . SER C 3  37  ? 10.564 192.427 26.058 1.00 20.09  ? 37   SER A CA    1 
ATOM   1047 C  C     . SER C 3  37  ? 10.892 193.926 26.076 1.00 19.29  ? 37   SER A C     1 
ATOM   1048 O  O     . SER C 3  37  ? 10.336 194.699 25.288 1.00 16.63  ? 37   SER A O     1 
ATOM   1049 C  CB    . SER C 3  37  ? 9.072  192.226 26.305 1.00 21.29  ? 37   SER A CB    1 
ATOM   1050 O  OG    . SER C 3  37  ? 8.792  192.392 27.681 1.00 25.27  ? 37   SER A OG    1 
ATOM   1051 N  N     . ASP C 3  38  ? 11.792 194.331 26.971 1.00 18.92  ? 38   ASP A N     1 
ATOM   1052 C  CA    . ASP C 3  38  ? 12.194 195.731 27.091 1.00 18.76  ? 38   ASP A CA    1 
ATOM   1053 C  C     . ASP C 3  38  ? 13.543 195.982 26.425 1.00 19.48  ? 38   ASP A C     1 
ATOM   1054 O  O     . ASP C 3  38  ? 14.102 197.078 26.531 1.00 20.32  ? 38   ASP A O     1 
ATOM   1055 C  CB    . ASP C 3  38  ? 12.297 196.142 28.562 1.00 19.86  ? 38   ASP A CB    1 
ATOM   1056 C  CG    . ASP C 3  38  ? 10.966 196.054 29.298 1.00 22.61  ? 38   ASP A CG    1 
ATOM   1057 O  OD1   . ASP C 3  38  ? 9.943  196.474 28.716 1.00 25.06  ? 38   ASP A OD1   1 
ATOM   1058 O  OD2   . ASP C 3  38  ? 10.946 195.582 30.463 1.00 22.14  ? 38   ASP A OD2   1 
ATOM   1059 N  N     . PHE C 3  39  ? 14.067 194.966 25.745 1.00 18.25  ? 39   PHE A N     1 
ATOM   1060 C  CA    . PHE C 3  39  ? 15.358 195.071 25.074 1.00 17.20  ? 39   PHE A CA    1 
ATOM   1061 C  C     . PHE C 3  39  ? 15.466 196.334 24.206 1.00 17.46  ? 39   PHE A C     1 
ATOM   1062 O  O     . PHE C 3  39  ? 16.443 197.080 24.294 1.00 17.84  ? 39   PHE A O     1 
ATOM   1063 C  CB    . PHE C 3  39  ? 15.602 193.811 24.238 1.00 15.60  ? 39   PHE A CB    1 
ATOM   1064 C  CG    . PHE C 3  39  ? 16.976 193.729 23.642 1.00 14.97  ? 39   PHE A CG    1 
ATOM   1065 C  CD1   . PHE C 3  39  ? 18.086 194.233 24.328 1.00 15.96  ? 39   PHE A CD1   1 
ATOM   1066 C  CD2   . PHE C 3  39  ? 17.171 193.126 22.408 1.00 14.16  ? 39   PHE A CD2   1 
ATOM   1067 C  CE1   . PHE C 3  39  ? 19.364 194.134 23.787 1.00 14.23  ? 39   PHE A CE1   1 
ATOM   1068 C  CE2   . PHE C 3  39  ? 18.446 193.023 21.856 1.00 13.29  ? 39   PHE A CE2   1 
ATOM   1069 C  CZ    . PHE C 3  39  ? 19.544 193.529 22.549 1.00 14.06  ? 39   PHE A CZ    1 
ATOM   1070 N  N     . GLY C 3  40  ? 14.464 196.583 23.376 1.00 17.01  ? 40   GLY A N     1 
ATOM   1071 C  CA    . GLY C 3  40  ? 14.500 197.775 22.547 1.00 15.78  ? 40   GLY A CA    1 
ATOM   1072 C  C     . GLY C 3  40  ? 14.672 199.021 23.399 1.00 17.03  ? 40   GLY A C     1 
ATOM   1073 O  O     . GLY C 3  40  ? 15.501 199.884 23.094 1.00 17.43  ? 40   GLY A O     1 
ATOM   1074 N  N     . ALA C 3  41  ? 13.895 199.107 24.477 1.00 14.91  ? 41   ALA A N     1 
ATOM   1075 C  CA    . ALA C 3  41  ? 13.944 200.249 25.387 1.00 15.35  ? 41   ALA A CA    1 
ATOM   1076 C  C     . ALA C 3  41  ? 15.301 200.334 26.072 1.00 15.78  ? 41   ALA A C     1 
ATOM   1077 O  O     . ALA C 3  41  ? 15.841 201.424 26.266 1.00 16.75  ? 41   ALA A O     1 
ATOM   1078 C  CB    . ALA C 3  41  ? 12.826 200.141 26.435 1.00 11.95  ? 41   ALA A CB    1 
ATOM   1079 N  N     . TYR C 3  42  ? 15.853 199.181 26.440 1.00 15.22  ? 42   TYR A N     1 
ATOM   1080 C  CA    . TYR C 3  42  ? 17.158 199.152 27.086 1.00 13.84  ? 42   TYR A CA    1 
ATOM   1081 C  C     . TYR C 3  42  ? 18.206 199.796 26.178 1.00 13.05  ? 42   TYR A C     1 
ATOM   1082 O  O     . TYR C 3  42  ? 18.966 200.657 26.617 1.00 11.30  ? 42   TYR A O     1 
ATOM   1083 C  CB    . TYR C 3  42  ? 17.570 197.717 27.403 1.00 12.97  ? 42   TYR A CB    1 
ATOM   1084 C  CG    . TYR C 3  42  ? 18.979 197.618 27.919 1.00 11.84  ? 42   TYR A CG    1 
ATOM   1085 C  CD1   . TYR C 3  42  ? 19.320 198.137 29.165 1.00 12.32  ? 42   TYR A CD1   1 
ATOM   1086 C  CD2   . TYR C 3  42  ? 19.992 197.059 27.135 1.00 11.73  ? 42   TYR A CD2   1 
ATOM   1087 C  CE1   . TYR C 3  42  ? 20.637 198.107 29.618 1.00 11.35  ? 42   TYR A CE1   1 
ATOM   1088 C  CE2   . TYR C 3  42  ? 21.309 197.028 27.579 1.00 11.95  ? 42   TYR A CE2   1 
ATOM   1089 C  CZ    . TYR C 3  42  ? 21.624 197.555 28.824 1.00 11.55  ? 42   TYR A CZ    1 
ATOM   1090 O  OH    . TYR C 3  42  ? 22.927 197.534 29.272 1.00 11.08  ? 42   TYR A OH    1 
ATOM   1091 N  N     . LEU C 3  43  ? 18.242 199.369 24.916 1.00 12.32  ? 43   LEU A N     1 
ATOM   1092 C  CA    . LEU C 3  43  ? 19.188 199.912 23.950 1.00 12.01  ? 43   LEU A CA    1 
ATOM   1093 C  C     . LEU C 3  43  ? 18.929 201.399 23.725 1.00 14.08  ? 43   LEU A C     1 
ATOM   1094 O  O     . LEU C 3  43  ? 19.875 202.182 23.567 1.00 14.87  ? 43   LEU A O     1 
ATOM   1095 C  CB    . LEU C 3  43  ? 19.085 199.170 22.614 1.00 12.82  ? 43   LEU A CB    1 
ATOM   1096 C  CG    . LEU C 3  43  ? 19.433 197.676 22.560 1.00 13.59  ? 43   LEU A CG    1 
ATOM   1097 C  CD1   . LEU C 3  43  ? 19.033 197.103 21.198 1.00 13.94  ? 43   LEU A CD1   1 
ATOM   1098 C  CD2   . LEU C 3  43  ? 20.918 197.477 22.811 1.00 12.02  ? 43   LEU A CD2   1 
ATOM   1099 N  N     . ASP C 3  44  ? 17.658 201.799 23.708 1.00 14.04  ? 44   ASP A N     1 
ATOM   1100 C  CA    . ASP C 3  44  ? 17.340 203.216 23.504 1.00 14.70  ? 44   ASP A CA    1 
ATOM   1101 C  C     . ASP C 3  44  ? 17.950 204.051 24.614 1.00 13.10  ? 44   ASP A C     1 
ATOM   1102 O  O     . ASP C 3  44  ? 18.434 205.156 24.371 1.00 14.21  ? 44   ASP A O     1 
ATOM   1103 C  CB    . ASP C 3  44  ? 15.824 203.473 23.483 1.00 15.35  ? 44   ASP A CB    1 
ATOM   1104 C  CG    . ASP C 3  44  ? 15.148 202.964 22.214 1.00 18.55  ? 44   ASP A CG    1 
ATOM   1105 O  OD1   . ASP C 3  44  ? 15.849 202.641 21.228 1.00 18.43  ? 44   ASP A OD1   1 
ATOM   1106 O  OD2   . ASP C 3  44  ? 13.897 202.893 22.207 1.00 21.87  ? 44   ASP A OD2   1 
ATOM   1107 N  N     . ALA C 3  45  ? 17.918 203.523 25.833 1.00 9.88   ? 45   ALA A N     1 
ATOM   1108 C  CA    . ALA C 3  45  ? 18.461 204.236 26.976 1.00 9.66   ? 45   ALA A CA    1 
ATOM   1109 C  C     . ALA C 3  45  ? 19.982 204.386 26.873 1.00 10.97  ? 45   ALA A C     1 
ATOM   1110 O  O     . ALA C 3  45  ? 20.534 205.433 27.221 1.00 9.55   ? 45   ALA A O     1 
ATOM   1111 C  CB    . ALA C 3  45  ? 18.085 203.520 28.260 1.00 6.77   ? 45   ALA A CB    1 
ATOM   1112 N  N     . LEU C 3  46  ? 20.667 203.353 26.394 1.00 9.58   ? 46   LEU A N     1 
ATOM   1113 C  CA    . LEU C 3  46  ? 22.114 203.461 26.274 1.00 10.67  ? 46   LEU A CA    1 
ATOM   1114 C  C     . LEU C 3  46  ? 22.461 204.487 25.207 1.00 12.78  ? 46   LEU A C     1 
ATOM   1115 O  O     . LEU C 3  46  ? 23.393 205.273 25.386 1.00 15.91  ? 46   LEU A O     1 
ATOM   1116 C  CB    . LEU C 3  46  ? 22.742 202.113 25.924 1.00 6.93   ? 46   LEU A CB    1 
ATOM   1117 C  CG    . LEU C 3  46  ? 22.509 200.996 26.936 1.00 7.21   ? 46   LEU A CG    1 
ATOM   1118 C  CD1   . LEU C 3  46  ? 23.314 199.793 26.518 1.00 9.55   ? 46   LEU A CD1   1 
ATOM   1119 C  CD2   . LEU C 3  46  ? 22.913 201.443 28.338 1.00 6.55   ? 46   LEU A CD2   1 
ATOM   1120 N  N     . GLU C 3  47  ? 21.711 204.498 24.106 1.00 13.24  ? 47   GLU A N     1 
ATOM   1121 C  CA    . GLU C 3  47  ? 21.982 205.458 23.045 1.00 15.78  ? 47   GLU A CA    1 
ATOM   1122 C  C     . GLU C 3  47  ? 21.658 206.881 23.469 1.00 15.97  ? 47   GLU A C     1 
ATOM   1123 O  O     . GLU C 3  47  ? 22.290 207.825 22.999 1.00 18.20  ? 47   GLU A O     1 
ATOM   1124 C  CB    . GLU C 3  47  ? 21.226 205.090 21.762 1.00 17.74  ? 47   GLU A CB    1 
ATOM   1125 C  CG    . GLU C 3  47  ? 21.763 203.803 21.119 1.00 22.47  ? 47   GLU A CG    1 
ATOM   1126 C  CD    . GLU C 3  47  ? 21.193 203.513 19.740 1.00 22.09  ? 47   GLU A CD    1 
ATOM   1127 O  OE1   . GLU C 3  47  ? 19.961 203.604 19.552 1.00 22.24  ? 47   GLU A OE1   1 
ATOM   1128 O  OE2   . GLU C 3  47  ? 21.989 203.176 18.844 1.00 25.45  ? 47   GLU A OE2   1 
ATOM   1129 N  N     . ALA C 3  48  ? 20.689 207.040 24.362 1.00 15.57  ? 48   ALA A N     1 
ATOM   1130 C  CA    . ALA C 3  48  ? 20.329 208.373 24.849 1.00 16.41  ? 48   ALA A CA    1 
ATOM   1131 C  C     . ALA C 3  48  ? 21.490 208.950 25.657 1.00 15.21  ? 48   ALA A C     1 
ATOM   1132 O  O     . ALA C 3  48  ? 21.760 210.151 25.602 1.00 16.73  ? 48   ALA A O     1 
ATOM   1133 C  CB    . ALA C 3  48  ? 19.072 208.303 25.723 1.00 13.58  ? 48   ALA A CB    1 
ATOM   1134 N  N     . GLU C 3  49  ? 22.168 208.090 26.412 1.00 14.61  ? 49   GLU A N     1 
ATOM   1135 C  CA    . GLU C 3  49  ? 23.306 208.523 27.218 1.00 16.11  ? 49   GLU A CA    1 
ATOM   1136 C  C     . GLU C 3  49  ? 24.443 208.911 26.275 1.00 15.66  ? 49   GLU A C     1 
ATOM   1137 O  O     . GLU C 3  49  ? 25.184 209.857 26.536 1.00 15.78  ? 49   GLU A O     1 
ATOM   1138 C  CB    . GLU C 3  49  ? 23.751 207.405 28.161 1.00 14.18  ? 49   GLU A CB    1 
ATOM   1139 C  CG    . GLU C 3  49  ? 24.938 207.752 29.068 1.00 18.69  ? 49   GLU A CG    1 
ATOM   1140 C  CD    . GLU C 3  49  ? 24.669 208.928 30.001 1.00 20.16  ? 49   GLU A CD    1 
ATOM   1141 O  OE1   . GLU C 3  49  ? 23.501 209.152 30.369 1.00 22.54  ? 49   GLU A OE1   1 
ATOM   1142 O  OE2   . GLU C 3  49  ? 25.630 209.623 30.383 1.00 20.83  ? 49   GLU A OE2   1 
ATOM   1143 N  N     . VAL C 3  50  ? 24.570 208.185 25.169 1.00 14.63  ? 50   VAL A N     1 
ATOM   1144 C  CA    . VAL C 3  50  ? 25.602 208.495 24.192 1.00 15.47  ? 50   VAL A CA    1 
ATOM   1145 C  C     . VAL C 3  50  ? 25.302 209.831 23.515 1.00 16.69  ? 50   VAL A C     1 
ATOM   1146 O  O     . VAL C 3  50  ? 26.203 210.642 23.302 1.00 17.57  ? 50   VAL A O     1 
ATOM   1147 C  CB    . VAL C 3  50  ? 25.696 207.415 23.091 1.00 16.88  ? 50   VAL A CB    1 
ATOM   1148 C  CG1   . VAL C 3  50  ? 26.701 207.844 22.042 1.00 16.00  ? 50   VAL A CG1   1 
ATOM   1149 C  CG2   . VAL C 3  50  ? 26.108 206.069 23.694 1.00 15.56  ? 50   VAL A CG2   1 
ATOM   1150 N  N     . ALA C 3  51  ? 24.036 210.061 23.179 1.00 16.41  ? 51   ALA A N     1 
ATOM   1151 C  CA    . ALA C 3  51  ? 23.642 211.301 22.511 1.00 18.12  ? 51   ALA A CA    1 
ATOM   1152 C  C     . ALA C 3  51  ? 23.874 212.533 23.385 1.00 18.96  ? 51   ALA A C     1 
ATOM   1153 O  O     . ALA C 3  51  ? 24.100 213.627 22.873 1.00 20.33  ? 51   ALA A O     1 
ATOM   1154 C  CB    . ALA C 3  51  ? 22.179 211.227 22.077 1.00 14.48  ? 51   ALA A CB    1 
ATOM   1155 N  N     . ARG C 3  52  ? 23.822 212.357 24.702 1.00 19.19  ? 52   ARG A N     1 
ATOM   1156 C  CA    . ARG C 3  52  ? 24.048 213.469 25.626 1.00 19.03  ? 52   ARG A CA    1 
ATOM   1157 C  C     . ARG C 3  52  ? 25.536 213.680 25.904 1.00 17.85  ? 52   ARG A C     1 
ATOM   1158 O  O     . ARG C 3  52  ? 25.894 214.456 26.784 1.00 17.53  ? 52   ARG A O     1 
ATOM   1159 C  CB    . ARG C 3  52  ? 23.335 213.209 26.955 1.00 20.78  ? 52   ARG A CB    1 
ATOM   1160 C  CG    . ARG C 3  52  ? 21.834 213.120 26.825 1.00 27.82  ? 52   ARG A CG    1 
ATOM   1161 C  CD    . ARG C 3  52  ? 21.135 212.997 28.174 1.00 33.02  ? 52   ARG A CD    1 
ATOM   1162 N  NE    . ARG C 3  52  ? 20.643 211.644 28.440 1.00 36.13  ? 52   ARG A NE    1 
ATOM   1163 C  CZ    . ARG C 3  52  ? 21.164 210.832 29.353 1.00 37.74  ? 52   ARG A CZ    1 
ATOM   1164 N  NH1   . ARG C 3  52  ? 22.194 211.241 30.084 1.00 38.38  ? 52   ARG A NH1   1 
ATOM   1165 N  NH2   . ARG C 3  52  ? 20.656 209.620 29.544 1.00 36.12  ? 52   ARG A NH2   1 
ATOM   1166 N  N     . GLY C 3  53  ? 26.398 212.995 25.155 1.00 16.23  ? 53   GLY A N     1 
ATOM   1167 C  CA    . GLY C 3  53  ? 27.827 213.118 25.383 1.00 12.93  ? 53   GLY A CA    1 
ATOM   1168 C  C     . GLY C 3  53  ? 28.188 212.517 26.733 1.00 12.43  ? 53   GLY A C     1 
ATOM   1169 O  O     . GLY C 3  53  ? 29.194 212.879 27.332 1.00 11.53  ? 53   GLY A O     1 
ATOM   1170 N  N     . GLY C 3  54  ? 27.359 211.591 27.211 1.00 11.40  ? 54   GLY A N     1 
ATOM   1171 C  CA    . GLY C 3  54  ? 27.596 210.965 28.503 1.00 12.14  ? 54   GLY A CA    1 
ATOM   1172 C  C     . GLY C 3  54  ? 28.501 209.740 28.539 1.00 13.16  ? 54   GLY A C     1 
ATOM   1173 O  O     . GLY C 3  54  ? 29.225 209.453 27.587 1.00 14.70  ? 54   GLY A O     1 
ATOM   1174 N  N     . LEU C 3  55  ? 28.439 209.010 29.650 1.00 12.69  ? 55   LEU A N     1 
ATOM   1175 C  CA    . LEU C 3  55  ? 29.255 207.827 29.864 1.00 10.50  ? 55   LEU A CA    1 
ATOM   1176 C  C     . LEU C 3  55  ? 28.456 206.607 30.338 1.00 11.42  ? 55   LEU A C     1 
ATOM   1177 O  O     . LEU C 3  55  ? 27.474 206.726 31.083 1.00 10.22  ? 55   LEU A O     1 
ATOM   1178 C  CB    . LEU C 3  55  ? 30.353 208.156 30.879 1.00 11.95  ? 55   LEU A CB    1 
ATOM   1179 C  CG    . LEU C 3  55  ? 31.427 209.144 30.396 1.00 12.62  ? 55   LEU A CG    1 
ATOM   1180 C  CD1   . LEU C 3  55  ? 32.048 209.890 31.565 1.00 10.40  ? 55   LEU A CD1   1 
ATOM   1181 C  CD2   . LEU C 3  55  ? 32.481 208.377 29.619 1.00 8.95   ? 55   LEU A CD2   1 
ATOM   1182 N  N     . ILE C 3  56  ? 28.893 205.431 29.895 1.00 10.21  ? 56   ILE A N     1 
ATOM   1183 C  CA    . ILE C 3  56  ? 28.256 204.173 30.256 1.00 9.65   ? 56   ILE A CA    1 
ATOM   1184 C  C     . ILE C 3  56  ? 29.289 203.279 30.932 1.00 10.79  ? 56   ILE A C     1 
ATOM   1185 O  O     . ILE C 3  56  ? 30.350 202.990 30.357 1.00 11.60  ? 56   ILE A O     1 
ATOM   1186 C  CB    . ILE C 3  56  ? 27.720 203.447 29.007 1.00 10.92  ? 56   ILE A CB    1 
ATOM   1187 C  CG1   . ILE C 3  56  ? 26.828 204.398 28.208 1.00 10.68  ? 56   ILE A CG1   1 
ATOM   1188 C  CG2   . ILE C 3  56  ? 26.942 202.192 29.418 1.00 6.93   ? 56   ILE A CG2   1 
ATOM   1189 C  CD1   . ILE C 3  56  ? 26.355 203.818 26.883 1.00 15.24  ? 56   ILE A CD1   1 
ATOM   1190 N  N     . VAL C 3  57  ? 28.987 202.835 32.148 1.00 9.45   ? 57   VAL A N     1 
ATOM   1191 C  CA    . VAL C 3  57  ? 29.911 201.977 32.882 1.00 8.20   ? 57   VAL A CA    1 
ATOM   1192 C  C     . VAL C 3  57  ? 29.448 200.524 32.969 1.00 9.30   ? 57   VAL A C     1 
ATOM   1193 O  O     . VAL C 3  57  ? 28.320 200.239 33.377 1.00 8.85   ? 57   VAL A O     1 
ATOM   1194 C  CB    . VAL C 3  57  ? 30.112 202.480 34.320 1.00 9.31   ? 57   VAL A CB    1 
ATOM   1195 C  CG1   . VAL C 3  57  ? 31.134 201.607 35.030 1.00 7.42   ? 57   VAL A CG1   1 
ATOM   1196 C  CG2   . VAL C 3  57  ? 30.537 203.948 34.313 1.00 9.70   ? 57   VAL A CG2   1 
ATOM   1197 N  N     . PHE C 3  58  ? 30.323 199.606 32.579 1.00 7.95   ? 58   PHE A N     1 
ATOM   1198 C  CA    . PHE C 3  58  ? 30.014 198.187 32.659 1.00 8.42   ? 58   PHE A CA    1 
ATOM   1199 C  C     . PHE C 3  58  ? 31.154 197.587 33.439 1.00 9.58   ? 58   PHE A C     1 
ATOM   1200 O  O     . PHE C 3  58  ? 32.134 198.260 33.738 1.00 12.10  ? 58   PHE A O     1 
ATOM   1201 C  CB    . PHE C 3  58  ? 30.021 197.516 31.280 1.00 8.55   ? 58   PHE A CB    1 
ATOM   1202 C  CG    . PHE C 3  58  ? 28.867 197.887 30.396 1.00 11.85  ? 58   PHE A CG    1 
ATOM   1203 C  CD1   . PHE C 3  58  ? 27.606 197.320 30.592 1.00 13.52  ? 58   PHE A CD1   1 
ATOM   1204 C  CD2   . PHE C 3  58  ? 29.047 198.778 29.338 1.00 11.36  ? 58   PHE A CD2   1 
ATOM   1205 C  CE1   . PHE C 3  58  ? 26.541 197.633 29.746 1.00 12.05  ? 58   PHE A CE1   1 
ATOM   1206 C  CE2   . PHE C 3  58  ? 27.992 199.097 28.486 1.00 12.35  ? 58   PHE A CE2   1 
ATOM   1207 C  CZ    . PHE C 3  58  ? 26.734 198.522 28.690 1.00 12.04  ? 58   PHE A CZ    1 
ATOM   1208 N  N     . HIS C 3  59  ? 31.018 196.315 33.781 1.00 11.24  ? 59   HIS A N     1 
ATOM   1209 C  CA    . HIS C 3  59  ? 32.090 195.598 34.432 1.00 9.91   ? 59   HIS A CA    1 
ATOM   1210 C  C     . HIS C 3  59  ? 32.352 194.491 33.416 1.00 10.63  ? 59   HIS A C     1 
ATOM   1211 O  O     . HIS C 3  59  ? 31.570 193.552 33.295 1.00 10.54  ? 59   HIS A O     1 
ATOM   1212 C  CB    . HIS C 3  59  ? 31.658 195.006 35.768 1.00 10.39  ? 59   HIS A CB    1 
ATOM   1213 C  CG    . HIS C 3  59  ? 32.781 194.345 36.505 1.00 13.53  ? 59   HIS A CG    1 
ATOM   1214 N  ND1   . HIS C 3  59  ? 33.827 195.056 37.059 1.00 12.22  ? 59   HIS A ND1   1 
ATOM   1215 C  CD2   . HIS C 3  59  ? 33.057 193.037 36.723 1.00 12.09  ? 59   HIS A CD2   1 
ATOM   1216 C  CE1   . HIS C 3  59  ? 34.698 194.213 37.585 1.00 12.11  ? 59   HIS A CE1   1 
ATOM   1217 N  NE2   . HIS C 3  59  ? 34.255 192.983 37.394 1.00 14.24  ? 59   HIS A NE2   1 
ATOM   1218 N  N     . ASN C 3  60  ? 33.437 194.636 32.660 1.00 11.11  ? 60   ASN A N     1 
ATOM   1219 C  CA    . ASN C 3  60  ? 33.813 193.681 31.624 1.00 10.40  ? 60   ASN A CA    1 
ATOM   1220 C  C     . ASN C 3  60  ? 32.918 193.887 30.401 1.00 11.54  ? 60   ASN A C     1 
ATOM   1221 O  O     . ASN C 3  60  ? 32.637 192.960 29.643 1.00 11.41  ? 60   ASN A O     1 
ATOM   1222 C  CB    . ASN C 3  60  ? 33.692 192.251 32.144 1.00 8.28   ? 60   ASN A CB    1 
ATOM   1223 C  CG    . ASN C 3  60  ? 34.340 191.245 31.225 1.00 8.82   ? 60   ASN A CG    1 
ATOM   1224 O  OD1   . ASN C 3  60  ? 35.449 191.453 30.752 1.00 8.59   ? 60   ASN A OD1   1 
ATOM   1225 N  ND2   . ASN C 3  60  ? 33.654 190.140 30.975 1.00 8.53   ? 60   ASN A ND2   1 
ATOM   1226 N  N     . GLY C 3  61  ? 32.470 195.124 30.219 1.00 12.95  ? 61   GLY A N     1 
ATOM   1227 C  CA    . GLY C 3  61  ? 31.621 195.443 29.090 1.00 10.86  ? 61   GLY A CA    1 
ATOM   1228 C  C     . GLY C 3  61  ? 32.419 195.476 27.807 1.00 11.54  ? 61   GLY A C     1 
ATOM   1229 O  O     . GLY C 3  61  ? 31.899 195.181 26.732 1.00 11.89  ? 61   GLY A O     1 
ATOM   1230 N  N     . HIS C 3  62  ? 33.694 195.832 27.907 1.00 11.37  ? 62   HIS A N     1 
ATOM   1231 C  CA    . HIS C 3  62  ? 34.526 195.890 26.712 1.00 11.97  ? 62   HIS A CA    1 
ATOM   1232 C  C     . HIS C 3  62  ? 34.604 194.543 26.003 1.00 11.49  ? 62   HIS A C     1 
ATOM   1233 O  O     . HIS C 3  62  ? 34.526 194.479 24.790 1.00 10.10  ? 62   HIS A O     1 
ATOM   1234 C  CB    . HIS C 3  62  ? 35.926 196.393 27.067 1.00 10.51  ? 62   HIS A CB    1 
ATOM   1235 C  CG    . HIS C 3  62  ? 36.028 197.886 27.120 1.00 10.43  ? 62   HIS A CG    1 
ATOM   1236 N  ND1   . HIS C 3  62  ? 35.061 198.677 27.703 1.00 11.00  ? 62   HIS A ND1   1 
ATOM   1237 C  CD2   . HIS C 3  62  ? 36.971 198.735 26.646 1.00 10.74  ? 62   HIS A CD2   1 
ATOM   1238 C  CE1   . HIS C 3  62  ? 35.399 199.947 27.582 1.00 9.90   ? 62   HIS A CE1   1 
ATOM   1239 N  NE2   . HIS C 3  62  ? 36.555 200.011 26.945 1.00 11.78  ? 62   HIS A NE2   1 
ATOM   1240 N  N     . LYS C 3  63  ? 34.731 193.462 26.761 1.00 12.87  ? 63   LYS A N     1 
ATOM   1241 C  CA    . LYS C 3  63  ? 34.821 192.142 26.155 1.00 13.66  ? 63   LYS A CA    1 
ATOM   1242 C  C     . LYS C 3  63  ? 33.481 191.440 26.018 1.00 13.11  ? 63   LYS A C     1 
ATOM   1243 O  O     . LYS C 3  63  ? 33.282 190.659 25.096 1.00 13.14  ? 63   LYS A O     1 
ATOM   1244 C  CB    . LYS C 3  63  ? 35.780 191.254 26.955 1.00 17.26  ? 63   LYS A CB    1 
ATOM   1245 C  CG    . LYS C 3  63  ? 37.250 191.612 26.769 1.00 19.38  ? 63   LYS A CG    1 
ATOM   1246 C  CD    . LYS C 3  63  ? 38.176 190.734 27.611 1.00 24.06  ? 63   LYS A CD    1 
ATOM   1247 C  CE    . LYS C 3  63  ? 38.114 189.262 27.212 1.00 24.69  ? 63   LYS A CE    1 
ATOM   1248 N  NZ    . LYS C 3  63  ? 39.285 188.508 27.753 1.00 23.39  ? 63   LYS A NZ    1 
ATOM   1249 N  N     . TYR C 3  64  ? 32.545 191.724 26.915 1.00 12.50  ? 64   TYR A N     1 
ATOM   1250 C  CA    . TYR C 3  64  ? 31.260 191.047 26.824 1.00 13.31  ? 64   TYR A CA    1 
ATOM   1251 C  C     . TYR C 3  64  ? 30.055 191.884 26.411 1.00 11.16  ? 64   TYR A C     1 
ATOM   1252 O  O     . TYR C 3  64  ? 29.646 191.862 25.252 1.00 12.04  ? 64   TYR A O     1 
ATOM   1253 C  CB    . TYR C 3  64  ? 30.934 190.329 28.143 1.00 12.24  ? 64   TYR A CB    1 
ATOM   1254 C  CG    . TYR C 3  64  ? 29.697 189.479 28.021 1.00 12.24  ? 64   TYR A CG    1 
ATOM   1255 C  CD1   . TYR C 3  64  ? 29.708 188.313 27.257 1.00 12.68  ? 64   TYR A CD1   1 
ATOM   1256 C  CD2   . TYR C 3  64  ? 28.486 189.896 28.570 1.00 13.14  ? 64   TYR A CD2   1 
ATOM   1257 C  CE1   . TYR C 3  64  ? 28.550 187.590 27.033 1.00 13.68  ? 64   TYR A CE1   1 
ATOM   1258 C  CE2   . TYR C 3  64  ? 27.313 189.177 28.354 1.00 12.85  ? 64   TYR A CE2   1 
ATOM   1259 C  CZ    . TYR C 3  64  ? 27.351 188.027 27.584 1.00 15.96  ? 64   TYR A CZ    1 
ATOM   1260 O  OH    . TYR C 3  64  ? 26.192 187.307 27.367 1.00 16.44  ? 64   TYR A OH    1 
ATOM   1261 N  N     . ASP C 3  65  ? 29.495 192.612 27.373 1.00 10.53  ? 65   ASP A N     1 
ATOM   1262 C  CA    . ASP C 3  65  ? 28.299 193.429 27.173 1.00 9.94   ? 65   ASP A CA    1 
ATOM   1263 C  C     . ASP C 3  65  ? 28.195 194.233 25.883 1.00 10.16  ? 65   ASP A C     1 
ATOM   1264 O  O     . ASP C 3  65  ? 27.245 194.060 25.123 1.00 8.76   ? 65   ASP A O     1 
ATOM   1265 C  CB    . ASP C 3  65  ? 28.105 194.355 28.377 1.00 9.69   ? 65   ASP A CB    1 
ATOM   1266 C  CG    . ASP C 3  65  ? 28.077 193.592 29.686 1.00 10.34  ? 65   ASP A CG    1 
ATOM   1267 O  OD1   . ASP C 3  65  ? 29.084 192.923 29.991 1.00 10.71  ? 65   ASP A OD1   1 
ATOM   1268 O  OD2   . ASP C 3  65  ? 27.053 193.647 30.399 1.00 10.94  ? 65   ASP A OD2   1 
ATOM   1269 N  N     . VAL C 3  66  ? 29.156 195.111 25.628 1.00 9.86   ? 66   VAL A N     1 
ATOM   1270 C  CA    . VAL C 3  66  ? 29.094 195.924 24.425 1.00 9.09   ? 66   VAL A CA    1 
ATOM   1271 C  C     . VAL C 3  66  ? 28.970 195.082 23.153 1.00 10.03  ? 66   VAL A C     1 
ATOM   1272 O  O     . VAL C 3  66  ? 28.005 195.242 22.402 1.00 11.22  ? 66   VAL A O     1 
ATOM   1273 C  CB    . VAL C 3  66  ? 30.296 196.868 24.350 1.00 8.22   ? 66   VAL A CB    1 
ATOM   1274 C  CG1   . VAL C 3  66  ? 30.223 197.730 23.092 1.00 6.41   ? 66   VAL A CG1   1 
ATOM   1275 C  CG2   . VAL C 3  66  ? 30.301 197.761 25.585 1.00 7.64   ? 66   VAL A CG2   1 
ATOM   1276 N  N     . PRO C 3  67  ? 29.927 194.168 22.896 1.00 9.98   ? 67   PRO A N     1 
ATOM   1277 C  CA    . PRO C 3  67  ? 29.836 193.338 21.685 1.00 8.78   ? 67   PRO A CA    1 
ATOM   1278 C  C     . PRO C 3  67  ? 28.554 192.505 21.698 1.00 9.39   ? 67   PRO A C     1 
ATOM   1279 O  O     . PRO C 3  67  ? 27.905 192.337 20.669 1.00 9.81   ? 67   PRO A O     1 
ATOM   1280 C  CB    . PRO C 3  67  ? 31.073 192.451 21.764 1.00 8.31   ? 67   PRO A CB    1 
ATOM   1281 C  CG    . PRO C 3  67  ? 32.017 193.223 22.658 1.00 11.71  ? 67   PRO A CG    1 
ATOM   1282 C  CD    . PRO C 3  67  ? 31.117 193.817 23.690 1.00 9.00   ? 67   PRO A CD    1 
ATOM   1283 N  N     . ALA C 3  68  ? 28.197 191.984 22.868 1.00 8.33   ? 68   ALA A N     1 
ATOM   1284 C  CA    . ALA C 3  68  ? 26.989 191.177 23.004 1.00 9.39   ? 68   ALA A CA    1 
ATOM   1285 C  C     . ALA C 3  68  ? 25.753 191.949 22.553 1.00 9.50   ? 68   ALA A C     1 
ATOM   1286 O  O     . ALA C 3  68  ? 24.903 191.424 21.831 1.00 11.34  ? 68   ALA A O     1 
ATOM   1287 C  CB    . ALA C 3  68  ? 26.811 190.730 24.448 1.00 4.59   ? 68   ALA A CB    1 
ATOM   1288 N  N     . LEU C 3  69  ? 25.656 193.199 22.987 1.00 10.50  ? 69   LEU A N     1 
ATOM   1289 C  CA    . LEU C 3  69  ? 24.523 194.033 22.635 1.00 9.74   ? 69   LEU A CA    1 
ATOM   1290 C  C     . LEU C 3  69  ? 24.491 194.285 21.141 1.00 10.13  ? 69   LEU A C     1 
ATOM   1291 O  O     . LEU C 3  69  ? 23.424 194.261 20.533 1.00 10.87  ? 69   LEU A O     1 
ATOM   1292 C  CB    . LEU C 3  69  ? 24.575 195.348 23.410 1.00 7.50   ? 69   LEU A CB    1 
ATOM   1293 C  CG    . LEU C 3  69  ? 24.293 195.154 24.904 1.00 8.73   ? 69   LEU A CG    1 
ATOM   1294 C  CD1   . LEU C 3  69  ? 24.437 196.479 25.644 1.00 7.13   ? 69   LEU A CD1   1 
ATOM   1295 C  CD2   . LEU C 3  69  ? 22.883 194.590 25.081 1.00 5.66   ? 69   LEU A CD2   1 
ATOM   1296 N  N     . THR C 3  70  ? 25.654 194.517 20.544 1.00 9.90   ? 70   THR A N     1 
ATOM   1297 C  CA    . THR C 3  70  ? 25.709 194.745 19.102 1.00 10.47  ? 70   THR A CA    1 
ATOM   1298 C  C     . THR C 3  70  ? 25.166 193.521 18.369 1.00 12.12  ? 70   THR A C     1 
ATOM   1299 O  O     . THR C 3  70  ? 24.391 193.637 17.421 1.00 13.02  ? 70   THR A O     1 
ATOM   1300 C  CB    . THR C 3  70  ? 27.159 194.983 18.614 1.00 10.42  ? 70   THR A CB    1 
ATOM   1301 O  OG1   . THR C 3  70  ? 27.582 196.299 18.989 1.00 9.17   ? 70   THR A OG1   1 
ATOM   1302 C  CG2   . THR C 3  70  ? 27.251 194.831 17.093 1.00 6.46   ? 70   THR A CG2   1 
ATOM   1303 N  N     . LYS C 3  71  ? 25.587 192.346 18.819 1.00 11.95  ? 71   LYS A N     1 
ATOM   1304 C  CA    . LYS C 3  71  ? 25.179 191.095 18.205 1.00 13.36  ? 71   LYS A CA    1 
ATOM   1305 C  C     . LYS C 3  71  ? 23.707 190.773 18.428 1.00 13.22  ? 71   LYS A C     1 
ATOM   1306 O  O     . LYS C 3  71  ? 23.000 190.436 17.488 1.00 14.05  ? 71   LYS A O     1 
ATOM   1307 C  CB    . LYS C 3  71  ? 26.051 189.960 18.735 1.00 13.78  ? 71   LYS A CB    1 
ATOM   1308 C  CG    . LYS C 3  71  ? 25.637 188.586 18.270 1.00 14.35  ? 71   LYS A CG    1 
ATOM   1309 C  CD    . LYS C 3  71  ? 26.593 187.533 18.790 1.00 17.00  ? 71   LYS A CD    1 
ATOM   1310 C  CE    . LYS C 3  71  ? 26.171 186.151 18.333 1.00 17.17  ? 71   LYS A CE    1 
ATOM   1311 N  NZ    . LYS C 3  71  ? 27.148 185.128 18.786 1.00 20.86  ? 71   LYS A NZ    1 
ATOM   1312 N  N     . LEU C 3  72  ? 23.248 190.880 19.669 1.00 14.51  ? 72   LEU A N     1 
ATOM   1313 C  CA    . LEU C 3  72  ? 21.857 190.588 19.991 1.00 15.17  ? 72   LEU A CA    1 
ATOM   1314 C  C     . LEU C 3  72  ? 20.887 191.570 19.320 1.00 15.28  ? 72   LEU A C     1 
ATOM   1315 O  O     . LEU C 3  72  ? 19.803 191.174 18.882 1.00 15.80  ? 72   LEU A O     1 
ATOM   1316 C  CB    . LEU C 3  72  ? 21.657 190.591 21.512 1.00 13.30  ? 72   LEU A CB    1 
ATOM   1317 C  CG    . LEU C 3  72  ? 22.459 189.521 22.279 1.00 15.11  ? 72   LEU A CG    1 
ATOM   1318 C  CD1   . LEU C 3  72  ? 22.297 189.720 23.785 1.00 11.52  ? 72   LEU A CD1   1 
ATOM   1319 C  CD2   . LEU C 3  72  ? 21.985 188.133 21.873 1.00 11.97  ? 72   LEU A CD2   1 
ATOM   1320 N  N     . ALA C 3  73  ? 21.276 192.837 19.222 1.00 14.55  ? 73   ALA A N     1 
ATOM   1321 C  CA    . ALA C 3  73  ? 20.413 193.831 18.596 1.00 16.00  ? 73   ALA A CA    1 
ATOM   1322 C  C     . ALA C 3  73  ? 20.197 193.460 17.139 1.00 17.72  ? 73   ALA A C     1 
ATOM   1323 O  O     . ALA C 3  73  ? 19.131 193.695 16.576 1.00 17.62  ? 73   ALA A O     1 
ATOM   1324 C  CB    . ALA C 3  73  ? 21.033 195.211 18.690 1.00 13.99  ? 73   ALA A CB    1 
ATOM   1325 N  N     . LYS C 3  74  ? 21.216 192.871 16.529 1.00 19.06  ? 74   LYS A N     1 
ATOM   1326 C  CA    . LYS C 3  74  ? 21.111 192.483 15.140 1.00 20.09  ? 74   LYS A CA    1 
ATOM   1327 C  C     . LYS C 3  74  ? 20.212 191.260 14.995 1.00 21.22  ? 74   LYS A C     1 
ATOM   1328 O  O     . LYS C 3  74  ? 19.291 191.257 14.177 1.00 21.11  ? 74   LYS A O     1 
ATOM   1329 C  CB    . LYS C 3  74  ? 22.500 192.195 14.571 1.00 21.08  ? 74   LYS A CB    1 
ATOM   1330 C  CG    . LYS C 3  74  ? 22.514 191.959 13.080 1.00 23.28  ? 74   LYS A CG    1 
ATOM   1331 C  CD    . LYS C 3  74  ? 21.818 193.097 12.347 1.00 27.37  ? 74   LYS A CD    1 
ATOM   1332 C  CE    . LYS C 3  74  ? 21.684 192.797 10.863 1.00 30.76  ? 74   LYS A CE    1 
ATOM   1333 N  NZ    . LYS C 3  74  ? 20.621 193.633 10.215 1.00 35.12  ? 74   LYS A NZ    1 
ATOM   1334 N  N     . LEU C 3  75  ? 20.472 190.233 15.800 1.00 19.64  ? 75   LEU A N     1 
ATOM   1335 C  CA    . LEU C 3  75  ? 19.698 189.002 15.754 1.00 21.08  ? 75   LEU A CA    1 
ATOM   1336 C  C     . LEU C 3  75  ? 18.243 189.138 16.183 1.00 20.70  ? 75   LEU A C     1 
ATOM   1337 O  O     . LEU C 3  75  ? 17.332 188.693 15.481 1.00 21.61  ? 75   LEU A O     1 
ATOM   1338 C  CB    . LEU C 3  75  ? 20.350 187.929 16.631 1.00 23.32  ? 75   LEU A CB    1 
ATOM   1339 C  CG    . LEU C 3  75  ? 21.659 187.315 16.136 1.00 27.63  ? 75   LEU A CG    1 
ATOM   1340 C  CD1   . LEU C 3  75  ? 22.299 186.508 17.256 1.00 27.45  ? 75   LEU A CD1   1 
ATOM   1341 C  CD2   . LEU C 3  75  ? 21.384 186.440 14.915 1.00 26.64  ? 75   LEU A CD2   1 
ATOM   1342 N  N     . GLN C 3  76  ? 18.023 189.748 17.338 1.00 17.91  ? 76   GLN A N     1 
ATOM   1343 C  CA    . GLN C 3  76  ? 16.678 189.872 17.860 1.00 18.15  ? 76   GLN A CA    1 
ATOM   1344 C  C     . GLN C 3  76  ? 15.818 190.987 17.287 1.00 19.67  ? 76   GLN A C     1 
ATOM   1345 O  O     . GLN C 3  76  ? 14.638 190.768 16.998 1.00 17.83  ? 76   GLN A O     1 
ATOM   1346 C  CB    . GLN C 3  76  ? 16.728 190.010 19.377 1.00 16.25  ? 76   GLN A CB    1 
ATOM   1347 C  CG    . GLN C 3  76  ? 17.199 188.768 20.103 1.00 16.01  ? 76   GLN A CG    1 
ATOM   1348 C  CD    . GLN C 3  76  ? 17.284 188.989 21.596 1.00 16.69  ? 76   GLN A CD    1 
ATOM   1349 O  OE1   . GLN C 3  76  ? 18.369 189.126 22.152 1.00 16.09  ? 76   GLN A OE1   1 
ATOM   1350 N  NE2   . GLN C 3  76  ? 16.132 189.050 22.252 1.00 16.35  ? 76   GLN A NE2   1 
ATOM   1351 N  N     . LEU C 3  77  ? 16.405 192.168 17.115 1.00 19.48  ? 77   LEU A N     1 
ATOM   1352 C  CA    . LEU C 3  77  ? 15.666 193.324 16.628 1.00 19.57  ? 77   LEU A CA    1 
ATOM   1353 C  C     . LEU C 3  77  ? 16.025 193.786 15.230 1.00 20.11  ? 77   LEU A C     1 
ATOM   1354 O  O     . LEU C 3  77  ? 15.399 194.702 14.698 1.00 20.21  ? 77   LEU A O     1 
ATOM   1355 C  CB    . LEU C 3  77  ? 15.873 194.486 17.593 1.00 19.58  ? 77   LEU A CB    1 
ATOM   1356 C  CG    . LEU C 3  77  ? 15.439 194.222 19.031 1.00 21.06  ? 77   LEU A CG    1 
ATOM   1357 C  CD1   . LEU C 3  77  ? 15.822 195.410 19.903 1.00 17.64  ? 77   LEU A CD1   1 
ATOM   1358 C  CD2   . LEU C 3  77  ? 13.937 193.977 19.067 1.00 19.37  ? 77   LEU A CD2   1 
ATOM   1359 N  N     . ASN C 3  78  ? 17.025 193.155 14.635 1.00 21.19  ? 78   ASN A N     1 
ATOM   1360 C  CA    . ASN C 3  78  ? 17.469 193.547 13.310 1.00 23.21  ? 78   ASN A CA    1 
ATOM   1361 C  C     . ASN C 3  78  ? 17.801 195.036 13.360 1.00 22.89  ? 78   ASN A C     1 
ATOM   1362 O  O     . ASN C 3  78  ? 17.412 195.807 12.483 1.00 23.99  ? 78   ASN A O     1 
ATOM   1363 C  CB    . ASN C 3  78  ? 16.373 193.287 12.278 1.00 26.53  ? 78   ASN A CB    1 
ATOM   1364 C  CG    . ASN C 3  78  ? 16.889 193.369 10.860 1.00 30.82  ? 78   ASN A CG    1 
ATOM   1365 O  OD1   . ASN C 3  78  ? 17.783 192.617 10.468 1.00 33.84  ? 78   ASN A OD1   1 
ATOM   1366 N  ND2   . ASN C 3  78  ? 16.339 194.290 10.083 1.00 34.17  ? 78   ASN A ND2   1 
ATOM   1367 N  N     . ARG C 3  79  ? 18.519 195.424 14.409 1.00 21.50  ? 79   ARG A N     1 
ATOM   1368 C  CA    . ARG C 3  79  ? 18.922 196.804 14.629 1.00 19.84  ? 79   ARG A CA    1 
ATOM   1369 C  C     . ARG C 3  79  ? 20.445 196.897 14.677 1.00 20.98  ? 79   ARG A C     1 
ATOM   1370 O  O     . ARG C 3  79  ? 21.118 195.986 15.164 1.00 20.05  ? 79   ARG A O     1 
ATOM   1371 C  CB    . ARG C 3  79  ? 18.361 197.321 15.966 1.00 19.72  ? 79   ARG A CB    1 
ATOM   1372 C  CG    . ARG C 3  79  ? 18.572 198.816 16.175 1.00 19.71  ? 79   ARG A CG    1 
ATOM   1373 C  CD    . ARG C 3  79  ? 18.737 199.261 17.635 1.00 17.24  ? 79   ARG A CD    1 
ATOM   1374 N  NE    . ARG C 3  79  ? 17.513 199.292 18.432 1.00 16.32  ? 79   ARG A NE    1 
ATOM   1375 C  CZ    . ARG C 3  79  ? 17.241 200.235 19.341 1.00 15.95  ? 79   ARG A CZ    1 
ATOM   1376 N  NH1   . ARG C 3  79  ? 18.101 201.225 19.555 1.00 7.83   ? 79   ARG A NH1   1 
ATOM   1377 N  NH2   . ARG C 3  79  ? 16.122 200.180 20.061 1.00 12.51  ? 79   ARG A NH2   1 
ATOM   1378 N  N     . GLU C 3  80  ? 20.981 197.994 14.154 1.00 21.68  ? 80   GLU A N     1 
ATOM   1379 C  CA    . GLU C 3  80  ? 22.416 198.242 14.183 1.00 19.84  ? 80   GLU A CA    1 
ATOM   1380 C  C     . GLU C 3  80  ? 22.652 198.974 15.506 1.00 19.18  ? 80   GLU A C     1 
ATOM   1381 O  O     . GLU C 3  80  ? 22.017 199.995 15.778 1.00 17.88  ? 80   GLU A O     1 
ATOM   1382 C  CB    . GLU C 3  80  ? 22.840 199.148 13.026 1.00 21.52  ? 80   GLU A CB    1 
ATOM   1383 C  CG    . GLU C 3  80  ? 22.784 198.516 11.645 1.00 25.17  ? 80   GLU A CG    1 
ATOM   1384 C  CD    . GLU C 3  80  ? 23.669 197.291 11.518 1.00 27.97  ? 80   GLU A CD    1 
ATOM   1385 O  OE1   . GLU C 3  80  ? 24.806 197.311 12.039 1.00 29.40  ? 80   GLU A OE1   1 
ATOM   1386 O  OE2   . GLU C 3  80  ? 23.234 196.308 10.885 1.00 31.13  ? 80   GLU A OE2   1 
ATOM   1387 N  N     . PHE C 3  81  ? 23.549 198.449 16.329 1.00 17.58  ? 81   PHE A N     1 
ATOM   1388 C  CA    . PHE C 3  81  ? 23.845 199.053 17.623 1.00 15.69  ? 81   PHE A CA    1 
ATOM   1389 C  C     . PHE C 3  81  ? 25.347 199.011 17.827 1.00 16.50  ? 81   PHE A C     1 
ATOM   1390 O  O     . PHE C 3  81  ? 25.954 197.935 17.813 1.00 17.18  ? 81   PHE A O     1 
ATOM   1391 C  CB    . PHE C 3  81  ? 23.160 198.265 18.731 1.00 15.04  ? 81   PHE A CB    1 
ATOM   1392 C  CG    . PHE C 3  81  ? 23.344 198.851 20.096 1.00 14.53  ? 81   PHE A CG    1 
ATOM   1393 C  CD1   . PHE C 3  81  ? 22.639 199.986 20.476 1.00 13.28  ? 81   PHE A CD1   1 
ATOM   1394 C  CD2   . PHE C 3  81  ? 24.198 198.252 21.015 1.00 13.46  ? 81   PHE A CD2   1 
ATOM   1395 C  CE1   . PHE C 3  81  ? 22.772 200.517 21.748 1.00 12.26  ? 81   PHE A CE1   1 
ATOM   1396 C  CE2   . PHE C 3  81  ? 24.343 198.777 22.297 1.00 13.61  ? 81   PHE A CE2   1 
ATOM   1397 C  CZ    . PHE C 3  81  ? 23.623 199.914 22.662 1.00 12.98  ? 81   PHE A CZ    1 
ATOM   1398 N  N     . HIS C 3  82  ? 25.953 200.177 18.012 1.00 15.81  ? 82   HIS A N     1 
ATOM   1399 C  CA    . HIS C 3  82  ? 27.396 200.239 18.194 1.00 16.16  ? 82   HIS A CA    1 
ATOM   1400 C  C     . HIS C 3  82  ? 27.789 201.349 19.149 1.00 15.49  ? 82   HIS A C     1 
ATOM   1401 O  O     . HIS C 3  82  ? 27.965 202.491 18.730 1.00 16.33  ? 82   HIS A O     1 
ATOM   1402 C  CB    . HIS C 3  82  ? 28.072 200.472 16.842 1.00 17.16  ? 82   HIS A CB    1 
ATOM   1403 C  CG    . HIS C 3  82  ? 27.639 199.509 15.782 1.00 19.64  ? 82   HIS A CG    1 
ATOM   1404 N  ND1   . HIS C 3  82  ? 28.118 198.217 15.706 1.00 19.81  ? 82   HIS A ND1   1 
ATOM   1405 C  CD2   . HIS C 3  82  ? 26.731 199.632 14.785 1.00 18.74  ? 82   HIS A CD2   1 
ATOM   1406 C  CE1   . HIS C 3  82  ? 27.526 197.588 14.709 1.00 18.95  ? 82   HIS A CE1   1 
ATOM   1407 N  NE2   . HIS C 3  82  ? 26.679 198.425 14.133 1.00 21.98  ? 82   HIS A NE2   1 
ATOM   1408 N  N     . LEU C 3  83  ? 27.917 201.031 20.431 1.00 14.07  ? 83   LEU A N     1 
ATOM   1409 C  CA    . LEU C 3  83  ? 28.318 202.055 21.382 1.00 13.50  ? 83   LEU A CA    1 
ATOM   1410 C  C     . LEU C 3  83  ? 29.725 202.485 21.013 1.00 13.08  ? 83   LEU A C     1 
ATOM   1411 O  O     . LEU C 3  83  ? 30.587 201.644 20.751 1.00 13.08  ? 83   LEU A O     1 
ATOM   1412 C  CB    . LEU C 3  83  ? 28.312 201.514 22.810 1.00 12.59  ? 83   LEU A CB    1 
ATOM   1413 C  CG    . LEU C 3  83  ? 26.940 201.216 23.393 1.00 13.21  ? 83   LEU A CG    1 
ATOM   1414 C  CD1   . LEU C 3  83  ? 27.114 200.628 24.772 1.00 13.55  ? 83   LEU A CD1   1 
ATOM   1415 C  CD2   . LEU C 3  83  ? 26.110 202.492 23.444 1.00 11.21  ? 83   LEU A CD2   1 
ATOM   1416 N  N     . PRO C 3  84  ? 29.974 203.801 20.967 1.00 11.84  ? 84   PRO A N     1 
ATOM   1417 C  CA    . PRO C 3  84  ? 31.302 204.314 20.623 1.00 11.54  ? 84   PRO A CA    1 
ATOM   1418 C  C     . PRO C 3  84  ? 32.246 204.000 21.773 1.00 11.27  ? 84   PRO A C     1 
ATOM   1419 O  O     . PRO C 3  84  ? 31.844 204.021 22.936 1.00 11.91  ? 84   PRO A O     1 
ATOM   1420 C  CB    . PRO C 3  84  ? 31.070 205.822 20.469 1.00 10.96  ? 84   PRO A CB    1 
ATOM   1421 C  CG    . PRO C 3  84  ? 29.602 205.930 20.175 1.00 12.24  ? 84   PRO A CG    1 
ATOM   1422 C  CD    . PRO C 3  84  ? 29.015 204.904 21.111 1.00 12.64  ? 84   PRO A CD    1 
ATOM   1423 N  N     . ARG C 3  85  ? 33.499 203.718 21.449 1.00 10.92  ? 85   ARG A N     1 
ATOM   1424 C  CA    . ARG C 3  85  ? 34.501 203.396 22.460 1.00 12.30  ? 85   ARG A CA    1 
ATOM   1425 C  C     . ARG C 3  85  ? 34.680 204.480 23.532 1.00 11.92  ? 85   ARG A C     1 
ATOM   1426 O  O     . ARG C 3  85  ? 34.770 204.175 24.726 1.00 9.56   ? 85   ARG A O     1 
ATOM   1427 C  CB    . ARG C 3  85  ? 35.844 203.149 21.783 1.00 12.57  ? 85   ARG A CB    1 
ATOM   1428 C  CG    . ARG C 3  85  ? 36.973 202.888 22.745 1.00 15.26  ? 85   ARG A CG    1 
ATOM   1429 C  CD    . ARG C 3  85  ? 38.202 203.658 22.320 1.00 17.18  ? 85   ARG A CD    1 
ATOM   1430 N  NE    . ARG C 3  85  ? 38.416 204.825 23.167 1.00 17.97  ? 85   ARG A NE    1 
ATOM   1431 C  CZ    . ARG C 3  85  ? 38.613 206.058 22.711 1.00 18.26  ? 85   ARG A CZ    1 
ATOM   1432 N  NH1   . ARG C 3  85  ? 38.622 206.300 21.401 1.00 13.64  ? 85   ARG A NH1   1 
ATOM   1433 N  NH2   . ARG C 3  85  ? 38.807 207.049 23.573 1.00 18.70  ? 85   ARG A NH2   1 
ATOM   1434 N  N     . GLU C 3  86  ? 34.735 205.734 23.089 1.00 11.24  ? 86   GLU A N     1 
ATOM   1435 C  CA    . GLU C 3  86  ? 34.938 206.876 23.974 1.00 12.75  ? 86   GLU A CA    1 
ATOM   1436 C  C     . GLU C 3  86  ? 33.836 207.111 24.999 1.00 11.96  ? 86   GLU A C     1 
ATOM   1437 O  O     . GLU C 3  86  ? 34.026 207.893 25.931 1.00 9.55   ? 86   GLU A O     1 
ATOM   1438 C  CB    . GLU C 3  86  ? 35.135 208.161 23.160 1.00 13.43  ? 86   GLU A CB    1 
ATOM   1439 C  CG    . GLU C 3  86  ? 33.970 208.500 22.250 1.00 17.47  ? 86   GLU A CG    1 
ATOM   1440 C  CD    . GLU C 3  86  ? 34.209 208.080 20.810 1.00 22.82  ? 86   GLU A CD    1 
ATOM   1441 O  OE1   . GLU C 3  86  ? 34.790 206.986 20.579 1.00 20.78  ? 86   GLU A OE1   1 
ATOM   1442 O  OE2   . GLU C 3  86  ? 33.797 208.850 19.906 1.00 24.77  ? 86   GLU A OE2   1 
ATOM   1443 N  N     . ASN C 3  87  ? 32.692 206.449 24.837 1.00 12.39  ? 87   ASN A N     1 
ATOM   1444 C  CA    . ASN C 3  87  ? 31.595 206.619 25.793 1.00 11.68  ? 87   ASN A CA    1 
ATOM   1445 C  C     . ASN C 3  87  ? 31.550 205.488 26.814 1.00 12.07  ? 87   ASN A C     1 
ATOM   1446 O  O     . ASN C 3  87  ? 30.729 205.519 27.738 1.00 11.76  ? 87   ASN A O     1 
ATOM   1447 C  CB    . ASN C 3  87  ? 30.236 206.654 25.083 1.00 10.31  ? 87   ASN A CB    1 
ATOM   1448 C  CG    . ASN C 3  87  ? 30.098 207.815 24.143 1.00 11.90  ? 87   ASN A CG    1 
ATOM   1449 O  OD1   . ASN C 3  87  ? 30.224 207.659 22.930 1.00 13.60  ? 87   ASN A OD1   1 
ATOM   1450 N  ND2   . ASN C 3  87  ? 29.841 208.997 24.694 1.00 10.75  ? 87   ASN A ND2   1 
ATOM   1451 N  N     . CYS C 3  88  ? 32.420 204.493 26.657 1.00 10.48  ? 88   CYS A N     1 
ATOM   1452 C  CA    . CYS C 3  88  ? 32.403 203.354 27.569 1.00 12.06  ? 88   CYS A CA    1 
ATOM   1453 C  C     . CYS C 3  88  ? 33.529 203.276 28.587 1.00 11.79  ? 88   CYS A C     1 
ATOM   1454 O  O     . CYS C 3  88  ? 34.694 203.534 28.282 1.00 13.22  ? 88   CYS A O     1 
ATOM   1455 C  CB    . CYS C 3  88  ? 32.374 202.048 26.773 1.00 9.93   ? 88   CYS A CB    1 
ATOM   1456 S  SG    . CYS C 3  88  ? 31.015 201.951 25.612 1.00 12.99  ? 88   CYS A SG    1 
ATOM   1457 N  N     . ILE C 3  89  ? 33.154 202.902 29.804 1.00 10.59  ? 89   ILE A N     1 
ATOM   1458 C  CA    . ILE C 3  89  ? 34.091 202.737 30.902 1.00 9.64   ? 89   ILE A CA    1 
ATOM   1459 C  C     . ILE C 3  89  ? 33.932 201.300 31.387 1.00 8.25   ? 89   ILE A C     1 
ATOM   1460 O  O     . ILE C 3  89  ? 32.824 200.780 31.439 1.00 8.34   ? 89   ILE A O     1 
ATOM   1461 C  CB    . ILE C 3  89  ? 33.757 203.703 32.050 1.00 10.80  ? 89   ILE A CB    1 
ATOM   1462 C  CG1   . ILE C 3  89  ? 34.068 205.133 31.622 1.00 9.02   ? 89   ILE A CG1   1 
ATOM   1463 C  CG2   . ILE C 3  89  ? 34.526 203.319 33.307 1.00 9.90   ? 89   ILE A CG2   1 
ATOM   1464 C  CD1   . ILE C 3  89  ? 33.703 206.167 32.682 1.00 8.30   ? 89   ILE A CD1   1 
ATOM   1465 N  N     . ASP C 3  90  ? 35.038 200.656 31.731 1.00 9.63   ? 90   ASP A N     1 
ATOM   1466 C  CA    . ASP C 3  90  ? 34.996 199.282 32.210 1.00 9.73   ? 90   ASP A CA    1 
ATOM   1467 C  C     . ASP C 3  90  ? 35.665 199.228 33.584 1.00 10.58  ? 90   ASP A C     1 
ATOM   1468 O  O     . ASP C 3  90  ? 36.871 199.477 33.702 1.00 10.32  ? 90   ASP A O     1 
ATOM   1469 C  CB    . ASP C 3  90  ? 35.735 198.369 31.224 1.00 9.22   ? 90   ASP A CB    1 
ATOM   1470 C  CG    . ASP C 3  90  ? 35.488 196.887 31.490 1.00 12.52  ? 90   ASP A CG    1 
ATOM   1471 O  OD1   . ASP C 3  90  ? 35.546 196.470 32.669 1.00 10.40  ? 90   ASP A OD1   1 
ATOM   1472 O  OD2   . ASP C 3  90  ? 35.247 196.138 30.511 1.00 12.56  ? 90   ASP A OD2   1 
ATOM   1473 N  N     . THR C 3  91  ? 34.891 198.906 34.620 1.00 11.01  ? 91   THR A N     1 
ATOM   1474 C  CA    . THR C 3  91  ? 35.443 198.841 35.973 1.00 11.64  ? 91   THR A CA    1 
ATOM   1475 C  C     . THR C 3  91  ? 36.470 197.730 36.145 1.00 11.94  ? 91   THR A C     1 
ATOM   1476 O  O     . THR C 3  91  ? 37.309 197.798 37.038 1.00 13.28  ? 91   THR A O     1 
ATOM   1477 C  CB    . THR C 3  91  ? 34.338 198.679 37.059 1.00 11.43  ? 91   THR A CB    1 
ATOM   1478 O  OG1   . THR C 3  91  ? 33.392 197.682 36.655 1.00 12.53  ? 91   THR A OG1   1 
ATOM   1479 C  CG2   . THR C 3  91  ? 33.627 199.995 37.295 1.00 11.50  ? 91   THR A CG2   1 
ATOM   1480 N  N     . LEU C 3  92  ? 36.408 196.707 35.301 1.00 11.17  ? 92   LEU A N     1 
ATOM   1481 C  CA    . LEU C 3  92  ? 37.373 195.626 35.398 1.00 11.52  ? 92   LEU A CA    1 
ATOM   1482 C  C     . LEU C 3  92  ? 38.705 196.138 34.863 1.00 12.99  ? 92   LEU A C     1 
ATOM   1483 O  O     . LEU C 3  92  ? 39.759 195.829 35.417 1.00 12.59  ? 92   LEU A O     1 
ATOM   1484 C  CB    . LEU C 3  92  ? 36.930 194.406 34.588 1.00 12.92  ? 92   LEU A CB    1 
ATOM   1485 C  CG    . LEU C 3  92  ? 37.896 193.211 34.618 1.00 12.47  ? 92   LEU A CG    1 
ATOM   1486 C  CD1   . LEU C 3  92  ? 38.170 192.803 36.051 1.00 11.60  ? 92   LEU A CD1   1 
ATOM   1487 C  CD2   . LEU C 3  92  ? 37.304 192.050 33.857 1.00 12.99  ? 92   LEU A CD2   1 
ATOM   1488 N  N     . VAL C 3  93  ? 38.652 196.912 33.779 1.00 12.38  ? 93   VAL A N     1 
ATOM   1489 C  CA    . VAL C 3  93  ? 39.861 197.485 33.204 1.00 11.90  ? 93   VAL A CA    1 
ATOM   1490 C  C     . VAL C 3  93  ? 40.472 198.453 34.221 1.00 13.36  ? 93   VAL A C     1 
ATOM   1491 O  O     . VAL C 3  93  ? 41.685 198.446 34.437 1.00 13.48  ? 93   VAL A O     1 
ATOM   1492 C  CB    . VAL C 3  93  ? 39.568 198.261 31.907 1.00 11.29  ? 93   VAL A CB    1 
ATOM   1493 C  CG1   . VAL C 3  93  ? 40.863 198.826 31.348 1.00 7.15   ? 93   VAL A CG1   1 
ATOM   1494 C  CG2   . VAL C 3  93  ? 38.909 197.347 30.890 1.00 10.39  ? 93   VAL A CG2   1 
ATOM   1495 N  N     . LEU C 3  94  ? 39.632 199.281 34.844 1.00 12.84  ? 94   LEU A N     1 
ATOM   1496 C  CA    . LEU C 3  94  ? 40.112 200.228 35.851 1.00 13.69  ? 94   LEU A CA    1 
ATOM   1497 C  C     . LEU C 3  94  ? 40.715 199.480 37.021 1.00 13.80  ? 94   LEU A C     1 
ATOM   1498 O  O     . LEU C 3  94  ? 41.784 199.825 37.515 1.00 14.65  ? 94   LEU A O     1 
ATOM   1499 C  CB    . LEU C 3  94  ? 38.975 201.094 36.401 1.00 12.52  ? 94   LEU A CB    1 
ATOM   1500 C  CG    . LEU C 3  94  ? 38.626 202.434 35.754 1.00 13.09  ? 94   LEU A CG    1 
ATOM   1501 C  CD1   . LEU C 3  94  ? 37.528 203.095 36.572 1.00 10.29  ? 94   LEU A CD1   1 
ATOM   1502 C  CD2   . LEU C 3  94  ? 39.854 203.327 35.692 1.00 12.30  ? 94   LEU A CD2   1 
ATOM   1503 N  N     . SER C 3  95  ? 40.008 198.451 37.463 1.00 13.36  ? 95   SER A N     1 
ATOM   1504 C  CA    . SER C 3  95  ? 40.437 197.662 38.600 1.00 14.04  ? 95   SER A CA    1 
ATOM   1505 C  C     . SER C 3  95  ? 41.773 196.976 38.351 1.00 13.11  ? 95   SER A C     1 
ATOM   1506 O  O     . SER C 3  95  ? 42.596 196.849 39.255 1.00 11.87  ? 95   SER A O     1 
ATOM   1507 C  CB    . SER C 3  95  ? 39.364 196.634 38.940 1.00 15.10  ? 95   SER A CB    1 
ATOM   1508 O  OG    . SER C 3  95  ? 39.597 196.087 40.221 1.00 23.44  ? 95   SER A OG    1 
ATOM   1509 N  N     . ARG C 3  96  ? 42.001 196.554 37.116 1.00 12.28  ? 96   ARG A N     1 
ATOM   1510 C  CA    . ARG C 3  96  ? 43.246 195.885 36.791 1.00 11.40  ? 96   ARG A CA    1 
ATOM   1511 C  C     . ARG C 3  96  ? 44.392 196.865 36.662 1.00 11.80  ? 96   ARG A C     1 
ATOM   1512 O  O     . ARG C 3  96  ? 45.563 196.482 36.742 1.00 10.90  ? 96   ARG A O     1 
ATOM   1513 C  CB    . ARG C 3  96  ? 43.087 195.070 35.512 1.00 10.23  ? 96   ARG A CB    1 
ATOM   1514 C  CG    . ARG C 3  96  ? 42.313 193.795 35.734 1.00 9.04   ? 96   ARG A CG    1 
ATOM   1515 C  CD    . ARG C 3  96  ? 41.982 193.105 34.437 1.00 12.78  ? 96   ARG A CD    1 
ATOM   1516 N  NE    . ARG C 3  96  ? 41.397 191.793 34.682 1.00 13.83  ? 96   ARG A NE    1 
ATOM   1517 C  CZ    . ARG C 3  96  ? 40.919 191.000 33.732 1.00 14.49  ? 96   ARG A CZ    1 
ATOM   1518 N  NH1   . ARG C 3  96  ? 40.954 191.386 32.465 1.00 12.96  ? 96   ARG A NH1   1 
ATOM   1519 N  NH2   . ARG C 3  96  ? 40.412 189.818 34.050 1.00 15.71  ? 96   ARG A NH2   1 
ATOM   1520 N  N     . LEU C 3  97  ? 44.053 198.134 36.465 1.00 11.47  ? 97   LEU A N     1 
ATOM   1521 C  CA    . LEU C 3  97  ? 45.065 199.171 36.353 1.00 10.08  ? 97   LEU A CA    1 
ATOM   1522 C  C     . LEU C 3  97  ? 45.476 199.635 37.744 1.00 11.81  ? 97   LEU A C     1 
ATOM   1523 O  O     . LEU C 3  97  ? 46.644 199.616 38.094 1.00 13.05  ? 97   LEU A O     1 
ATOM   1524 C  CB    . LEU C 3  97  ? 44.524 200.363 35.566 1.00 8.44   ? 97   LEU A CB    1 
ATOM   1525 C  CG    . LEU C 3  97  ? 45.321 201.663 35.745 1.00 7.68   ? 97   LEU A CG    1 
ATOM   1526 C  CD1   . LEU C 3  97  ? 46.747 201.467 35.217 1.00 3.14   ? 97   LEU A CD1   1 
ATOM   1527 C  CD2   . LEU C 3  97  ? 44.616 202.810 35.025 1.00 6.73   ? 97   LEU A CD2   1 
ATOM   1528 N  N     . ILE C 3  98  ? 44.493 200.033 38.539 1.00 14.55  ? 98   ILE A N     1 
ATOM   1529 C  CA    . ILE C 3  98  ? 44.722 200.537 39.882 1.00 16.52  ? 98   ILE A CA    1 
ATOM   1530 C  C     . ILE C 3  98  ? 45.202 199.483 40.880 1.00 19.27  ? 98   ILE A C     1 
ATOM   1531 O  O     . ILE C 3  98  ? 45.968 199.795 41.791 1.00 21.64  ? 98   ILE A O     1 
ATOM   1532 C  CB    . ILE C 3  98  ? 43.443 201.237 40.387 1.00 15.16  ? 98   ILE A CB    1 
ATOM   1533 C  CG1   . ILE C 3  98  ? 43.105 202.390 39.428 1.00 15.32  ? 98   ILE A CG1   1 
ATOM   1534 C  CG2   . ILE C 3  98  ? 43.637 201.763 41.790 1.00 14.56  ? 98   ILE A CG2   1 
ATOM   1535 C  CD1   . ILE C 3  98  ? 41.854 203.163 39.771 1.00 14.47  ? 98   ILE A CD1   1 
ATOM   1536 N  N     . HIS C 3  99  ? 44.758 198.243 40.709 1.00 21.08  ? 99   HIS A N     1 
ATOM   1537 C  CA    . HIS C 3  99  ? 45.171 197.148 41.589 1.00 21.32  ? 99   HIS A CA    1 
ATOM   1538 C  C     . HIS C 3  99  ? 45.961 196.144 40.758 1.00 22.02  ? 99   HIS A C     1 
ATOM   1539 O  O     . HIS C 3  99  ? 45.694 194.939 40.790 1.00 19.88  ? 99   HIS A O     1 
ATOM   1540 C  CB    . HIS C 3  99  ? 43.950 196.456 42.198 1.00 22.10  ? 99   HIS A CB    1 
ATOM   1541 C  CG    . HIS C 3  99  ? 43.125 197.346 43.071 1.00 26.21  ? 99   HIS A CG    1 
ATOM   1542 N  ND1   . HIS C 3  99  ? 43.602 197.887 44.248 1.00 27.86  ? 99   HIS A ND1   1 
ATOM   1543 C  CD2   . HIS C 3  99  ? 41.853 197.794 42.942 1.00 27.82  ? 99   HIS A CD2   1 
ATOM   1544 C  CE1   . HIS C 3  99  ? 42.660 198.628 44.803 1.00 28.58  ? 99   HIS A CE1   1 
ATOM   1545 N  NE2   . HIS C 3  99  ? 41.588 198.589 44.031 1.00 29.31  ? 99   HIS A NE2   1 
ATOM   1546 N  N     . SER C 3  100 ? 46.926 196.654 39.999 1.00 22.84  ? 100  SER A N     1 
ATOM   1547 C  CA    . SER C 3  100 ? 47.751 195.816 39.141 1.00 24.89  ? 100  SER A CA    1 
ATOM   1548 C  C     . SER C 3  100 ? 48.559 194.793 39.930 1.00 24.83  ? 100  SER A C     1 
ATOM   1549 O  O     . SER C 3  100 ? 49.002 193.788 39.380 1.00 24.12  ? 100  SER A O     1 
ATOM   1550 C  CB    . SER C 3  100 ? 48.691 196.687 38.300 1.00 24.71  ? 100  SER A CB    1 
ATOM   1551 O  OG    . SER C 3  100 ? 49.542 197.465 39.121 1.00 27.80  ? 100  SER A OG    1 
ATOM   1552 N  N     . ASN C 3  101 ? 48.754 195.049 41.218 1.00 26.14  ? 101  ASN A N     1 
ATOM   1553 C  CA    . ASN C 3  101 ? 49.512 194.132 42.063 1.00 28.28  ? 101  ASN A CA    1 
ATOM   1554 C  C     . ASN C 3  101 ? 48.704 192.887 42.428 1.00 28.38  ? 101  ASN A C     1 
ATOM   1555 O  O     . ASN C 3  101 ? 49.270 191.865 42.816 1.00 29.66  ? 101  ASN A O     1 
ATOM   1556 C  CB    . ASN C 3  101 ? 49.964 194.848 43.345 1.00 30.89  ? 101  ASN A CB    1 
ATOM   1557 C  CG    . ASN C 3  101 ? 48.800 195.458 44.126 1.00 33.03  ? 101  ASN A CG    1 
ATOM   1558 O  OD1   . ASN C 3  101 ? 47.864 196.007 43.539 1.00 34.07  ? 101  ASN A OD1   1 
ATOM   1559 N  ND2   . ASN C 3  101 ? 48.868 195.382 45.454 1.00 31.27  ? 101  ASN A ND2   1 
ATOM   1560 N  N     . LEU C 3  102 ? 47.384 192.967 42.290 1.00 26.15  ? 102  LEU A N     1 
ATOM   1561 C  CA    . LEU C 3  102 ? 46.523 191.843 42.633 1.00 24.91  ? 102  LEU A CA    1 
ATOM   1562 C  C     . LEU C 3  102 ? 46.126 190.965 41.451 1.00 24.54  ? 102  LEU A C     1 
ATOM   1563 O  O     . LEU C 3  102 ? 46.307 191.335 40.290 1.00 24.64  ? 102  LEU A O     1 
ATOM   1564 C  CB    . LEU C 3  102 ? 45.253 192.354 43.319 1.00 23.36  ? 102  LEU A CB    1 
ATOM   1565 C  CG    . LEU C 3  102 ? 45.440 193.244 44.551 1.00 23.49  ? 102  LEU A CG    1 
ATOM   1566 C  CD1   . LEU C 3  102 ? 44.073 193.559 45.147 1.00 22.88  ? 102  LEU A CD1   1 
ATOM   1567 C  CD2   . LEU C 3  102 ? 46.317 192.549 45.575 1.00 19.68  ? 102  LEU A CD2   1 
ATOM   1568 N  N     . LYS C 3  103 ? 45.581 189.794 41.767 1.00 23.42  ? 103  LYS A N     1 
ATOM   1569 C  CA    . LYS C 3  103 ? 45.111 188.850 40.759 1.00 22.18  ? 103  LYS A CA    1 
ATOM   1570 C  C     . LYS C 3  103 ? 43.588 188.932 40.778 1.00 22.87  ? 103  LYS A C     1 
ATOM   1571 O  O     . LYS C 3  103 ? 43.011 189.613 41.628 1.00 23.07  ? 103  LYS A O     1 
ATOM   1572 C  CB    . LYS C 3  103 ? 45.506 187.419 41.137 1.00 23.50  ? 103  LYS A CB    1 
ATOM   1573 C  CG    . LYS C 3  103 ? 46.996 187.144 41.302 1.00 23.38  ? 103  LYS A CG    1 
ATOM   1574 C  CD    . LYS C 3  103 ? 47.708 187.084 39.956 1.00 23.16  ? 103  LYS A CD    1 
ATOM   1575 C  CE    . LYS C 3  103 ? 49.099 186.508 40.113 1.00 24.00  ? 103  LYS A CE    1 
ATOM   1576 N  NZ    . LYS C 3  103 ? 49.837 186.467 38.830 1.00 24.51  ? 103  LYS A NZ    1 
ATOM   1577 N  N     . ASP C 3  104 ? 42.939 188.251 39.841 1.00 22.14  ? 104  ASP A N     1 
ATOM   1578 C  CA    . ASP C 3  104 ? 41.481 188.187 39.810 1.00 23.06  ? 104  ASP A CA    1 
ATOM   1579 C  C     . ASP C 3  104 ? 41.093 186.915 39.074 1.00 22.86  ? 104  ASP A C     1 
ATOM   1580 O  O     . ASP C 3  104 ? 41.898 186.356 38.330 1.00 22.61  ? 104  ASP A O     1 
ATOM   1581 C  CB    . ASP C 3  104 ? 40.838 189.443 39.180 1.00 25.12  ? 104  ASP A CB    1 
ATOM   1582 C  CG    . ASP C 3  104 ? 41.094 189.574 37.693 1.00 26.72  ? 104  ASP A CG    1 
ATOM   1583 O  OD1   . ASP C 3  104 ? 40.757 188.641 36.940 1.00 26.88  ? 104  ASP A OD1   1 
ATOM   1584 O  OD2   . ASP C 3  104 ? 41.617 190.630 37.274 1.00 28.47  ? 104  ASP A OD2   1 
ATOM   1585 N  N     . THR C 3  105 ? 39.875 186.444 39.306 1.00 23.47  ? 105  THR A N     1 
ATOM   1586 C  CA    . THR C 3  105 ? 39.402 185.202 38.700 1.00 24.16  ? 105  THR A CA    1 
ATOM   1587 C  C     . THR C 3  105 ? 39.071 185.302 37.220 1.00 24.27  ? 105  THR A C     1 
ATOM   1588 O  O     . THR C 3  105 ? 38.584 184.337 36.625 1.00 23.31  ? 105  THR A O     1 
ATOM   1589 C  CB    . THR C 3  105 ? 38.154 184.689 39.426 1.00 24.05  ? 105  THR A CB    1 
ATOM   1590 O  OG1   . THR C 3  105 ? 37.110 185.666 39.321 1.00 23.28  ? 105  THR A OG1   1 
ATOM   1591 C  CG2   . THR C 3  105 ? 38.461 184.437 40.895 1.00 24.21  ? 105  THR A CG2   1 
ATOM   1592 N  N     . ASP C 3  106 ? 39.334 186.465 36.632 1.00 24.68  ? 106  ASP A N     1 
ATOM   1593 C  CA    . ASP C 3  106 ? 39.054 186.699 35.221 1.00 26.28  ? 106  ASP A CA    1 
ATOM   1594 C  C     . ASP C 3  106 ? 37.586 186.412 34.944 1.00 26.17  ? 106  ASP A C     1 
ATOM   1595 O  O     . ASP C 3  106 ? 37.233 185.770 33.955 1.00 25.81  ? 106  ASP A O     1 
ATOM   1596 C  CB    . ASP C 3  106 ? 39.947 185.813 34.351 1.00 29.47  ? 106  ASP A CB    1 
ATOM   1597 C  CG    . ASP C 3  106 ? 39.872 186.175 32.885 1.00 33.95  ? 106  ASP A CG    1 
ATOM   1598 O  OD1   . ASP C 3  106 ? 39.358 187.272 32.568 1.00 36.19  ? 106  ASP A OD1   1 
ATOM   1599 O  OD2   . ASP C 3  106 ? 40.339 185.372 32.048 1.00 37.63  ? 106  ASP A OD2   1 
ATOM   1600 N  N     . MET C 3  107 ? 36.742 186.900 35.847 1.00 26.67  ? 107  MET A N     1 
ATOM   1601 C  CA    . MET C 3  107 ? 35.296 186.743 35.782 1.00 26.59  ? 107  MET A CA    1 
ATOM   1602 C  C     . MET C 3  107 ? 34.798 185.314 35.968 1.00 27.83  ? 107  MET A C     1 
ATOM   1603 O  O     . MET C 3  107 ? 33.868 184.878 35.287 1.00 29.70  ? 107  MET A O     1 
ATOM   1604 C  CB    . MET C 3  107 ? 34.761 187.330 34.471 1.00 25.61  ? 107  MET A CB    1 
ATOM   1605 C  CG    . MET C 3  107 ? 34.780 188.843 34.443 1.00 24.46  ? 107  MET A CG    1 
ATOM   1606 S  SD    . MET C 3  107 ? 33.830 189.522 35.827 1.00 26.63  ? 107  MET A SD    1 
ATOM   1607 C  CE    . MET C 3  107 ? 32.189 189.774 35.031 1.00 24.38  ? 107  MET A CE    1 
ATOM   1608 N  N     . GLY C 3  108 ? 35.415 184.587 36.893 1.00 27.50  ? 108  GLY A N     1 
ATOM   1609 C  CA    . GLY C 3  108 ? 34.988 183.225 37.157 1.00 28.25  ? 108  GLY A CA    1 
ATOM   1610 C  C     . GLY C 3  108 ? 35.624 182.123 36.327 1.00 30.06  ? 108  GLY A C     1 
ATOM   1611 O  O     . GLY C 3  108 ? 35.305 180.945 36.515 1.00 30.49  ? 108  GLY A O     1 
ATOM   1612 N  N     . LEU C 3  109 ? 36.508 182.478 35.401 1.00 29.27  ? 109  LEU A N     1 
ATOM   1613 C  CA    . LEU C 3  109 ? 37.155 181.450 34.593 1.00 29.54  ? 109  LEU A CA    1 
ATOM   1614 C  C     . LEU C 3  109 ? 38.248 180.761 35.395 1.00 28.37  ? 109  LEU A C     1 
ATOM   1615 O  O     . LEU C 3  109 ? 38.613 179.626 35.111 1.00 30.03  ? 109  LEU A O     1 
ATOM   1616 C  CB    . LEU C 3  109 ? 37.755 182.047 33.318 1.00 29.18  ? 109  LEU A CB    1 
ATOM   1617 C  CG    . LEU C 3  109 ? 36.776 182.319 32.175 1.00 31.72  ? 109  LEU A CG    1 
ATOM   1618 C  CD1   . LEU C 3  109 ? 37.521 182.915 30.987 1.00 31.34  ? 109  LEU A CD1   1 
ATOM   1619 C  CD2   . LEU C 3  109 ? 36.095 181.015 31.772 1.00 31.68  ? 109  LEU A CD2   1 
ATOM   1620 N  N     . LEU C 3  110 ? 38.765 181.455 36.401 1.00 27.89  ? 110  LEU A N     1 
ATOM   1621 C  CA    . LEU C 3  110 ? 39.824 180.915 37.238 1.00 28.29  ? 110  LEU A CA    1 
ATOM   1622 C  C     . LEU C 3  110 ? 39.296 180.660 38.639 1.00 30.62  ? 110  LEU A C     1 
ATOM   1623 O  O     . LEU C 3  110 ? 38.449 181.405 39.141 1.00 29.83  ? 110  LEU A O     1 
ATOM   1624 C  CB    . LEU C 3  110 ? 41.000 181.893 37.289 1.00 26.65  ? 110  LEU A CB    1 
ATOM   1625 C  CG    . LEU C 3  110 ? 41.577 182.283 35.921 1.00 26.88  ? 110  LEU A CG    1 
ATOM   1626 C  CD1   . LEU C 3  110 ? 42.553 183.441 36.067 1.00 25.74  ? 110  LEU A CD1   1 
ATOM   1627 C  CD2   . LEU C 3  110 ? 42.261 181.081 35.301 1.00 24.26  ? 110  LEU A CD2   1 
ATOM   1628 N  N     . ARG C 3  111 ? 39.789 179.593 39.259 1.00 33.64  ? 111  ARG A N     1 
ATOM   1629 C  CA    . ARG C 3  111 ? 39.374 179.229 40.607 1.00 36.82  ? 111  ARG A CA    1 
ATOM   1630 C  C     . ARG C 3  111 ? 40.004 180.197 41.603 1.00 36.04  ? 111  ARG A C     1 
ATOM   1631 O  O     . ARG C 3  111 ? 41.216 180.410 41.585 1.00 37.07  ? 111  ARG A O     1 
ATOM   1632 C  CB    . ARG C 3  111 ? 39.827 177.803 40.928 1.00 41.60  ? 111  ARG A CB    1 
ATOM   1633 C  CG    . ARG C 3  111 ? 39.503 176.788 39.843 1.00 48.07  ? 111  ARG A CG    1 
ATOM   1634 C  CD    . ARG C 3  111 ? 40.035 175.391 40.184 1.00 53.54  ? 111  ARG A CD    1 
ATOM   1635 N  NE    . ARG C 3  111 ? 41.487 175.355 40.376 1.00 57.97  ? 111  ARG A NE    1 
ATOM   1636 C  CZ    . ARG C 3  111 ? 42.192 174.239 40.557 1.00 59.77  ? 111  ARG A CZ    1 
ATOM   1637 N  NH1   . ARG C 3  111 ? 41.582 173.060 40.569 1.00 61.35  ? 111  ARG A NH1   1 
ATOM   1638 N  NH2   . ARG C 3  111 ? 43.508 174.299 40.732 1.00 60.50  ? 111  ARG A NH2   1 
ATOM   1639 N  N     . SER C 3  112 ? 39.177 180.779 42.465 1.00 34.99  ? 112  SER A N     1 
ATOM   1640 C  CA    . SER C 3  112 ? 39.647 181.720 43.476 1.00 34.05  ? 112  SER A CA    1 
ATOM   1641 C  C     . SER C 3  112 ? 40.788 181.132 44.296 1.00 32.48  ? 112  SER A C     1 
ATOM   1642 O  O     . SER C 3  112 ? 41.849 181.734 44.420 1.00 31.63  ? 112  SER A O     1 
ATOM   1643 C  CB    . SER C 3  112 ? 38.511 182.087 44.433 1.00 34.99  ? 112  SER A CB    1 
ATOM   1644 O  OG    . SER C 3  112 ? 37.348 182.471 43.729 1.00 40.83  ? 112  SER A OG    1 
ATOM   1645 N  N     . GLY C 3  113 ? 40.555 179.947 44.850 1.00 32.29  ? 113  GLY A N     1 
ATOM   1646 C  CA    . GLY C 3  113 ? 41.546 179.296 45.690 1.00 31.94  ? 113  GLY A CA    1 
ATOM   1647 C  C     . GLY C 3  113 ? 42.921 179.029 45.109 1.00 31.36  ? 113  GLY A C     1 
ATOM   1648 O  O     . GLY C 3  113 ? 43.884 178.839 45.853 1.00 31.29  ? 113  GLY A O     1 
ATOM   1649 N  N     . LYS C 3  114 ? 43.030 179.018 43.788 1.00 31.68  ? 114  LYS A N     1 
ATOM   1650 C  CA    . LYS C 3  114 ? 44.312 178.743 43.153 1.00 32.01  ? 114  LYS A CA    1 
ATOM   1651 C  C     . LYS C 3  114 ? 45.179 179.988 42.981 1.00 30.62  ? 114  LYS A C     1 
ATOM   1652 O  O     . LYS C 3  114 ? 46.373 179.885 42.706 1.00 31.88  ? 114  LYS A O     1 
ATOM   1653 C  CB    . LYS C 3  114 ? 44.079 178.080 41.793 1.00 35.48  ? 114  LYS A CB    1 
ATOM   1654 C  CG    . LYS C 3  114 ? 45.336 177.529 41.153 1.00 38.95  ? 114  LYS A CG    1 
ATOM   1655 C  CD    . LYS C 3  114 ? 45.025 176.762 39.877 1.00 41.80  ? 114  LYS A CD    1 
ATOM   1656 C  CE    . LYS C 3  114 ? 46.294 176.155 39.275 1.00 44.02  ? 114  LYS A CE    1 
ATOM   1657 N  NZ    . LYS C 3  114 ? 47.307 177.193 38.915 1.00 43.99  ? 114  LYS A NZ    1 
ATOM   1658 N  N     . LEU C 3  115 ? 44.584 181.161 43.157 1.00 28.10  ? 115  LEU A N     1 
ATOM   1659 C  CA    . LEU C 3  115 ? 45.309 182.416 42.993 1.00 26.64  ? 115  LEU A CA    1 
ATOM   1660 C  C     . LEU C 3  115 ? 46.080 182.841 44.239 1.00 26.09  ? 115  LEU A C     1 
ATOM   1661 O  O     . LEU C 3  115 ? 45.630 182.634 45.365 1.00 27.13  ? 115  LEU A O     1 
ATOM   1662 C  CB    . LEU C 3  115 ? 44.333 183.529 42.610 1.00 24.88  ? 115  LEU A CB    1 
ATOM   1663 C  CG    . LEU C 3  115 ? 43.532 183.259 41.340 1.00 24.37  ? 115  LEU A CG    1 
ATOM   1664 C  CD1   . LEU C 3  115 ? 42.357 184.215 41.253 1.00 23.33  ? 115  LEU A CD1   1 
ATOM   1665 C  CD2   . LEU C 3  115 ? 44.451 183.389 40.136 1.00 24.43  ? 115  LEU A CD2   1 
ATOM   1666 N  N     . PRO C 3  116 ? 47.269 183.430 44.048 1.00 24.02  ? 116  PRO A N     1 
ATOM   1667 C  CA    . PRO C 3  116 ? 48.077 183.882 45.186 1.00 23.25  ? 116  PRO A CA    1 
ATOM   1668 C  C     . PRO C 3  116 ? 47.634 185.272 45.651 1.00 22.28  ? 116  PRO A C     1 
ATOM   1669 O  O     . PRO C 3  116 ? 47.042 186.029 44.885 1.00 21.16  ? 116  PRO A O     1 
ATOM   1670 C  CB    . PRO C 3  116 ? 49.498 183.871 44.624 1.00 21.91  ? 116  PRO A CB    1 
ATOM   1671 C  CG    . PRO C 3  116 ? 49.282 184.216 43.178 1.00 22.08  ? 116  PRO A CG    1 
ATOM   1672 C  CD    . PRO C 3  116 ? 48.068 183.397 42.810 1.00 22.31  ? 116  PRO A CD    1 
ATOM   1673 N  N     . GLY C 3  117 ? 47.894 185.595 46.913 1.00 23.47  ? 117  GLY A N     1 
ATOM   1674 C  CA    . GLY C 3  117 ? 47.521 186.903 47.430 1.00 21.54  ? 117  GLY A CA    1 
ATOM   1675 C  C     . GLY C 3  117 ? 46.040 187.125 47.678 1.00 21.34  ? 117  GLY A C     1 
ATOM   1676 O  O     . GLY C 3  117 ? 45.244 186.184 47.703 1.00 22.30  ? 117  GLY A O     1 
ATOM   1677 N  N     . ALA C 3  118 ? 45.667 188.387 47.855 1.00 19.07  ? 124  ALA A N     1 
ATOM   1678 C  CA    . ALA C 3  118 ? 44.280 188.744 48.119 1.00 17.67  ? 124  ALA A CA    1 
ATOM   1679 C  C     . ALA C 3  118 ? 43.544 189.189 46.860 1.00 16.41  ? 124  ALA A C     1 
ATOM   1680 O  O     . ALA C 3  118 ? 44.149 189.430 45.817 1.00 16.01  ? 124  ALA A O     1 
ATOM   1681 C  CB    . ALA C 3  118 ? 44.227 189.851 49.167 1.00 17.74  ? 124  ALA A CB    1 
ATOM   1682 N  N     . LEU C 3  119 ? 42.227 189.297 46.964 1.00 14.89  ? 125  LEU A N     1 
ATOM   1683 C  CA    . LEU C 3  119 ? 41.417 189.726 45.837 1.00 16.39  ? 125  LEU A CA    1 
ATOM   1684 C  C     . LEU C 3  119 ? 40.536 190.881 46.299 1.00 16.39  ? 125  LEU A C     1 
ATOM   1685 O  O     . LEU C 3  119 ? 40.071 190.885 47.439 1.00 15.47  ? 125  LEU A O     1 
ATOM   1686 C  CB    . LEU C 3  119 ? 40.542 188.568 45.336 1.00 15.28  ? 125  LEU A CB    1 
ATOM   1687 C  CG    . LEU C 3  119 ? 41.228 187.217 45.093 1.00 15.70  ? 125  LEU A CG    1 
ATOM   1688 C  CD1   . LEU C 3  119 ? 40.182 186.185 44.694 1.00 15.82  ? 125  LEU A CD1   1 
ATOM   1689 C  CD2   . LEU C 3  119 ? 42.293 187.347 44.015 1.00 14.57  ? 125  LEU A CD2   1 
ATOM   1690 N  N     . GLU C 3  120 ? 40.323 191.862 45.423 1.00 17.63  ? 126  GLU A N     1 
ATOM   1691 C  CA    . GLU C 3  120 ? 39.477 193.012 45.750 1.00 17.93  ? 126  GLU A CA    1 
ATOM   1692 C  C     . GLU C 3  120 ? 38.056 192.467 45.956 1.00 17.67  ? 126  GLU A C     1 
ATOM   1693 O  O     . GLU C 3  120 ? 37.565 191.677 45.149 1.00 20.12  ? 126  GLU A O     1 
ATOM   1694 C  CB    . GLU C 3  120 ? 39.529 194.035 44.612 1.00 16.41  ? 126  GLU A CB    1 
ATOM   1695 C  CG    . GLU C 3  120 ? 38.997 195.419 44.983 1.00 17.88  ? 126  GLU A CG    1 
ATOM   1696 C  CD    . GLU C 3  120 ? 37.485 195.472 44.974 1.00 19.46  ? 126  GLU A CD    1 
ATOM   1697 O  OE1   . GLU C 3  120 ? 36.896 195.136 43.922 1.00 17.33  ? 126  GLU A OE1   1 
ATOM   1698 O  OE2   . GLU C 3  120 ? 36.889 195.849 46.009 1.00 19.65  ? 126  GLU A OE2   1 
ATOM   1699 N  N     . ALA C 3  121 ? 37.402 192.879 47.033 1.00 14.89  ? 127  ALA A N     1 
ATOM   1700 C  CA    . ALA C 3  121 ? 36.077 192.361 47.356 1.00 16.14  ? 127  ALA A CA    1 
ATOM   1701 C  C     . ALA C 3  121 ? 34.965 192.531 46.319 1.00 15.51  ? 127  ALA A C     1 
ATOM   1702 O  O     . ALA C 3  121 ? 34.371 191.541 45.897 1.00 15.86  ? 127  ALA A O     1 
ATOM   1703 C  CB    . ALA C 3  121 ? 35.621 192.915 48.710 1.00 16.33  ? 127  ALA A CB    1 
ATOM   1704 N  N     . TRP C 3  122 ? 34.676 193.767 45.918 1.00 15.86  ? 128  TRP A N     1 
ATOM   1705 C  CA    . TRP C 3  122 ? 33.615 194.026 44.944 1.00 14.80  ? 128  TRP A CA    1 
ATOM   1706 C  C     . TRP C 3  122 ? 33.806 193.247 43.648 1.00 15.62  ? 128  TRP A C     1 
ATOM   1707 O  O     . TRP C 3  122 ? 32.869 192.627 43.137 1.00 12.05  ? 128  TRP A O     1 
ATOM   1708 C  CB    . TRP C 3  122 ? 33.536 195.518 44.636 1.00 15.78  ? 128  TRP A CB    1 
ATOM   1709 C  CG    . TRP C 3  122 ? 33.199 196.354 45.836 1.00 21.59  ? 128  TRP A CG    1 
ATOM   1710 C  CD1   . TRP C 3  122 ? 33.918 197.403 46.327 1.00 19.85  ? 128  TRP A CD1   1 
ATOM   1711 C  CD2   . TRP C 3  122 ? 32.056 196.216 46.695 1.00 22.97  ? 128  TRP A CD2   1 
ATOM   1712 N  NE1   . TRP C 3  122 ? 33.299 197.927 47.436 1.00 22.11  ? 128  TRP A NE1   1 
ATOM   1713 C  CE2   . TRP C 3  122 ? 32.153 197.220 47.684 1.00 23.45  ? 128  TRP A CE2   1 
ATOM   1714 C  CE3   . TRP C 3  122 ? 30.961 195.341 46.725 1.00 24.46  ? 128  TRP A CE3   1 
ATOM   1715 C  CZ2   . TRP C 3  122 ? 31.194 197.378 48.695 1.00 24.87  ? 128  TRP A CZ2   1 
ATOM   1716 C  CZ3   . TRP C 3  122 ? 30.002 195.498 47.736 1.00 26.02  ? 128  TRP A CZ3   1 
ATOM   1717 C  CH2   . TRP C 3  122 ? 30.129 196.509 48.704 1.00 24.47  ? 128  TRP A CH2   1 
ATOM   1718 N  N     . GLY C 3  123 ? 35.025 193.284 43.119 1.00 15.87  ? 129  GLY A N     1 
ATOM   1719 C  CA    . GLY C 3  123 ? 35.316 192.579 41.887 1.00 16.82  ? 129  GLY A CA    1 
ATOM   1720 C  C     . GLY C 3  123 ? 35.200 191.080 42.071 1.00 18.69  ? 129  GLY A C     1 
ATOM   1721 O  O     . GLY C 3  123 ? 34.780 190.356 41.157 1.00 18.90  ? 129  GLY A O     1 
ATOM   1722 N  N     . TYR C 3  124 ? 35.585 190.604 43.251 1.00 17.11  ? 130  TYR A N     1 
ATOM   1723 C  CA    . TYR C 3  124 ? 35.494 189.184 43.526 1.00 17.11  ? 130  TYR A CA    1 
ATOM   1724 C  C     . TYR C 3  124 ? 34.017 188.816 43.449 1.00 17.26  ? 130  TYR A C     1 
ATOM   1725 O  O     . TYR C 3  124 ? 33.653 187.797 42.866 1.00 15.48  ? 130  TYR A O     1 
ATOM   1726 C  CB    . TYR C 3  124 ? 36.042 188.858 44.916 1.00 17.89  ? 130  TYR A CB    1 
ATOM   1727 C  CG    . TYR C 3  124 ? 35.784 187.427 45.320 1.00 19.40  ? 130  TYR A CG    1 
ATOM   1728 C  CD1   . TYR C 3  124 ? 36.598 186.395 44.864 1.00 20.58  ? 130  TYR A CD1   1 
ATOM   1729 C  CD2   . TYR C 3  124 ? 34.682 187.099 46.104 1.00 21.02  ? 130  TYR A CD2   1 
ATOM   1730 C  CE1   . TYR C 3  124 ? 36.320 185.066 45.177 1.00 22.22  ? 130  TYR A CE1   1 
ATOM   1731 C  CE2   . TYR C 3  124 ? 34.391 185.777 46.417 1.00 24.08  ? 130  TYR A CE2   1 
ATOM   1732 C  CZ    . TYR C 3  124 ? 35.212 184.765 45.950 1.00 24.04  ? 130  TYR A CZ    1 
ATOM   1733 O  OH    . TYR C 3  124 ? 34.904 183.455 46.242 1.00 26.09  ? 130  TYR A OH    1 
ATOM   1734 N  N     . ARG C 3  125 ? 33.173 189.655 44.044 1.00 17.52  ? 131  ARG A N     1 
ATOM   1735 C  CA    . ARG C 3  125 ? 31.734 189.429 44.026 1.00 20.94  ? 131  ARG A CA    1 
ATOM   1736 C  C     . ARG C 3  125 ? 31.221 189.300 42.595 1.00 21.08  ? 131  ARG A C     1 
ATOM   1737 O  O     . ARG C 3  125 ? 30.584 188.305 42.241 1.00 21.78  ? 131  ARG A O     1 
ATOM   1738 C  CB    . ARG C 3  125 ? 31.002 190.577 44.724 1.00 24.02  ? 131  ARG A CB    1 
ATOM   1739 C  CG    . ARG C 3  125 ? 30.789 190.344 46.198 1.00 30.58  ? 131  ARG A CG    1 
ATOM   1740 C  CD    . ARG C 3  125 ? 29.901 189.133 46.374 1.00 37.34  ? 131  ARG A CD    1 
ATOM   1741 N  NE    . ARG C 3  125 ? 29.867 188.664 47.749 1.00 41.59  ? 131  ARG A NE    1 
ATOM   1742 C  CZ    . ARG C 3  125 ? 29.574 187.415 48.084 1.00 44.63  ? 131  ARG A CZ    1 
ATOM   1743 N  NH1   . ARG C 3  125 ? 29.296 186.537 47.129 1.00 45.16  ? 131  ARG A NH1   1 
ATOM   1744 N  NH2   . ARG C 3  125 ? 29.570 187.045 49.362 1.00 46.09  ? 131  ARG A NH2   1 
ATOM   1745 N  N     . LEU C 3  126 ? 31.505 190.308 41.777 1.00 18.02  ? 132  LEU A N     1 
ATOM   1746 C  CA    . LEU C 3  126 ? 31.065 190.301 40.389 1.00 17.63  ? 132  LEU A CA    1 
ATOM   1747 C  C     . LEU C 3  126 ? 31.526 189.053 39.638 1.00 15.89  ? 132  LEU A C     1 
ATOM   1748 O  O     . LEU C 3  126 ? 30.786 188.506 38.822 1.00 14.38  ? 132  LEU A O     1 
ATOM   1749 C  CB    . LEU C 3  126 ? 31.558 191.564 39.678 1.00 15.62  ? 132  LEU A CB    1 
ATOM   1750 C  CG    . LEU C 3  126 ? 30.863 192.820 40.206 1.00 17.20  ? 132  LEU A CG    1 
ATOM   1751 C  CD1   . LEU C 3  126 ? 31.599 194.076 39.766 1.00 14.31  ? 132  LEU A CD1   1 
ATOM   1752 C  CD2   . LEU C 3  126 ? 29.410 192.820 39.719 1.00 16.02  ? 132  LEU A CD2   1 
ATOM   1753 N  N     . GLY C 3  127 ? 32.739 188.597 39.920 1.00 15.34  ? 133  GLY A N     1 
ATOM   1754 C  CA    . GLY C 3  127 ? 33.243 187.416 39.242 1.00 15.64  ? 133  GLY A CA    1 
ATOM   1755 C  C     . GLY C 3  127 ? 32.607 186.112 39.698 1.00 17.37  ? 133  GLY A C     1 
ATOM   1756 O  O     . GLY C 3  127 ? 32.723 185.096 39.020 1.00 17.37  ? 133  GLY A O     1 
ATOM   1757 N  N     . GLU C 3  128 ? 31.927 186.131 40.838 1.00 18.10  ? 134  GLU A N     1 
ATOM   1758 C  CA    . GLU C 3  128 ? 31.302 184.921 41.355 1.00 21.49  ? 134  GLU A CA    1 
ATOM   1759 C  C     . GLU C 3  128 ? 29.795 184.860 41.126 1.00 22.94  ? 134  GLU A C     1 
ATOM   1760 O  O     . GLU C 3  128 ? 29.172 183.834 41.402 1.00 23.75  ? 134  GLU A O     1 
ATOM   1761 C  CB    . GLU C 3  128 ? 31.569 184.782 42.860 1.00 22.04  ? 134  GLU A CB    1 
ATOM   1762 C  CG    . GLU C 3  128 ? 33.026 184.654 43.235 1.00 25.20  ? 134  GLU A CG    1 
ATOM   1763 C  CD    . GLU C 3  128 ? 33.685 183.451 42.595 1.00 29.56  ? 134  GLU A CD    1 
ATOM   1764 O  OE1   . GLU C 3  128 ? 33.230 182.312 42.864 1.00 30.79  ? 134  GLU A OE1   1 
ATOM   1765 O  OE2   . GLU C 3  128 ? 34.657 183.643 41.828 1.00 29.23  ? 134  GLU A OE2   1 
ATOM   1766 N  N     . MET C 3  129 ? 29.215 185.945 40.623 1.00 24.14  ? 135  MET A N     1 
ATOM   1767 C  CA    . MET C 3  129 ? 27.772 185.998 40.402 1.00 27.22  ? 135  MET A CA    1 
ATOM   1768 C  C     . MET C 3  129 ? 27.223 184.842 39.571 1.00 28.02  ? 135  MET A C     1 
ATOM   1769 O  O     . MET C 3  129 ? 26.164 184.296 39.893 1.00 27.82  ? 135  MET A O     1 
ATOM   1770 C  CB    . MET C 3  129 ? 27.380 187.331 39.755 1.00 30.31  ? 135  MET A CB    1 
ATOM   1771 C  CG    . MET C 3  129 ? 27.710 188.566 40.602 1.00 38.88  ? 135  MET A CG    1 
ATOM   1772 S  SD    . MET C 3  129 ? 26.591 188.881 42.007 1.00 43.43  ? 135  MET A SD    1 
ATOM   1773 C  CE    . MET C 3  129 ? 27.168 187.644 43.175 1.00 42.71  ? 135  MET A CE    1 
ATOM   1774 N  N     . LYS C 3  130 ? 27.928 184.460 38.507 1.00 26.99  ? 136  LYS A N     1 
ATOM   1775 C  CA    . LYS C 3  130 ? 27.446 183.364 37.677 1.00 27.02  ? 136  LYS A CA    1 
ATOM   1776 C  C     . LYS C 3  130 ? 27.388 182.039 38.423 1.00 25.66  ? 136  LYS A C     1 
ATOM   1777 O  O     . LYS C 3  130 ? 26.368 181.358 38.383 1.00 26.33  ? 136  LYS A O     1 
ATOM   1778 C  CB    . LYS C 3  130 ? 28.295 183.214 36.416 1.00 26.49  ? 136  LYS A CB    1 
ATOM   1779 C  CG    . LYS C 3  130 ? 28.073 184.325 35.423 1.00 27.36  ? 136  LYS A CG    1 
ATOM   1780 C  CD    . LYS C 3  130 ? 28.908 184.149 34.167 1.00 27.85  ? 136  LYS A CD    1 
ATOM   1781 C  CE    . LYS C 3  130 ? 28.472 182.943 33.365 1.00 26.10  ? 136  LYS A CE    1 
ATOM   1782 N  NZ    . LYS C 3  130 ? 29.109 182.974 32.023 1.00 23.83  ? 136  LYS A NZ    1 
ATOM   1783 N  N     . GLY C 3  131 ? 28.468 181.677 39.106 1.00 25.15  ? 137  GLY A N     1 
ATOM   1784 C  CA    . GLY C 3  131 ? 28.476 180.420 39.838 1.00 24.93  ? 137  GLY A CA    1 
ATOM   1785 C  C     . GLY C 3  131 ? 27.546 180.464 41.036 1.00 26.00  ? 137  GLY A C     1 
ATOM   1786 O  O     . GLY C 3  131 ? 26.973 179.454 41.449 1.00 25.83  ? 137  GLY A O     1 
ATOM   1787 N  N     . GLU C 3  132 ? 27.391 181.657 41.587 1.00 25.61  ? 138  GLU A N     1 
ATOM   1788 C  CA    . GLU C 3  132 ? 26.551 181.872 42.747 1.00 27.80  ? 138  GLU A CA    1 
ATOM   1789 C  C     . GLU C 3  132 ? 25.076 181.751 42.366 1.00 28.52  ? 138  GLU A C     1 
ATOM   1790 O  O     . GLU C 3  132 ? 24.281 181.161 43.098 1.00 27.48  ? 138  GLU A O     1 
ATOM   1791 C  CB    . GLU C 3  132 ? 26.853 183.257 43.306 1.00 30.89  ? 138  GLU A CB    1 
ATOM   1792 C  CG    . GLU C 3  132 ? 26.359 183.511 44.702 1.00 38.38  ? 138  GLU A CG    1 
ATOM   1793 C  CD    . GLU C 3  132 ? 26.872 184.834 45.231 1.00 43.00  ? 138  GLU A CD    1 
ATOM   1794 O  OE1   . GLU C 3  132 ? 28.112 185.011 45.251 1.00 45.27  ? 138  GLU A OE1   1 
ATOM   1795 O  OE2   . GLU C 3  132 ? 26.044 185.693 45.617 1.00 44.36  ? 138  GLU A OE2   1 
ATOM   1796 N  N     . TYR C 3  133 ? 24.719 182.312 41.211 1.00 29.18  ? 139  TYR A N     1 
ATOM   1797 C  CA    . TYR C 3  133 ? 23.346 182.267 40.714 1.00 27.71  ? 139  TYR A CA    1 
ATOM   1798 C  C     . TYR C 3  133 ? 22.980 180.839 40.351 1.00 28.52  ? 139  TYR A C     1 
ATOM   1799 O  O     . TYR C 3  133 ? 21.839 180.417 40.529 1.00 27.51  ? 139  TYR A O     1 
ATOM   1800 C  CB    . TYR C 3  133 ? 23.198 183.160 39.479 1.00 24.89  ? 139  TYR A CB    1 
ATOM   1801 C  CG    . TYR C 3  133 ? 22.023 182.800 38.600 1.00 21.22  ? 139  TYR A CG    1 
ATOM   1802 C  CD1   . TYR C 3  133 ? 20.712 182.957 39.050 1.00 19.19  ? 139  TYR A CD1   1 
ATOM   1803 C  CD2   . TYR C 3  133 ? 22.224 182.289 37.316 1.00 19.61  ? 139  TYR A CD2   1 
ATOM   1804 C  CE1   . TYR C 3  133 ? 19.629 182.615 38.243 1.00 17.52  ? 139  TYR A CE1   1 
ATOM   1805 C  CE2   . TYR C 3  133 ? 21.152 181.944 36.501 1.00 18.25  ? 139  TYR A CE2   1 
ATOM   1806 C  CZ    . TYR C 3  133 ? 19.856 182.110 36.970 1.00 18.24  ? 139  TYR A CZ    1 
ATOM   1807 O  OH    . TYR C 3  133 ? 18.795 181.781 36.162 1.00 16.40  ? 139  TYR A OH    1 
ATOM   1808 N  N     . LYS C 3  134 ? 23.961 180.106 39.835 1.00 29.14  ? 140  LYS A N     1 
ATOM   1809 C  CA    . LYS C 3  134 ? 23.766 178.721 39.447 1.00 31.12  ? 140  LYS A CA    1 
ATOM   1810 C  C     . LYS C 3  134 ? 23.464 177.877 40.678 1.00 32.76  ? 140  LYS A C     1 
ATOM   1811 O  O     . LYS C 3  134 ? 22.633 176.971 40.627 1.00 34.38  ? 140  LYS A O     1 
ATOM   1812 C  CB    . LYS C 3  134 ? 25.013 178.187 38.736 1.00 31.93  ? 140  LYS A CB    1 
ATOM   1813 C  CG    . LYS C 3  134 ? 24.949 176.710 38.392 1.00 31.68  ? 140  LYS A CG    1 
ATOM   1814 C  CD    . LYS C 3  134 ? 26.278 176.207 37.862 1.00 30.83  ? 140  LYS A CD    1 
ATOM   1815 C  CE    . LYS C 3  134 ? 26.283 174.685 37.782 1.00 32.52  ? 140  LYS A CE    1 
ATOM   1816 N  NZ    . LYS C 3  134 ? 27.566 174.138 37.248 1.00 32.52  ? 140  LYS A NZ    1 
ATOM   1817 N  N     . ASP C 3  135 ? 24.134 178.164 41.790 1.00 34.03  ? 141  ASP A N     1 
ATOM   1818 C  CA    . ASP C 3  135 ? 23.877 177.404 43.005 1.00 34.62  ? 141  ASP A CA    1 
ATOM   1819 C  C     . ASP C 3  135 ? 22.449 177.632 43.497 1.00 35.69  ? 141  ASP A C     1 
ATOM   1820 O  O     . ASP C 3  135 ? 21.758 176.681 43.850 1.00 35.77  ? 141  ASP A O     1 
ATOM   1821 C  CB    . ASP C 3  135 ? 24.870 177.774 44.107 1.00 34.78  ? 141  ASP A CB    1 
ATOM   1822 C  CG    . ASP C 3  135 ? 26.257 177.242 43.836 1.00 35.95  ? 141  ASP A CG    1 
ATOM   1823 O  OD1   . ASP C 3  135 ? 26.363 176.176 43.196 1.00 37.12  ? 141  ASP A OD1   1 
ATOM   1824 O  OD2   . ASP C 3  135 ? 27.241 177.876 44.272 1.00 37.84  ? 141  ASP A OD2   1 
ATOM   1825 N  N     . ASP C 3  136 ? 22.007 178.887 43.516 1.00 35.54  ? 142  ASP A N     1 
ATOM   1826 C  CA    . ASP C 3  136 ? 20.654 179.199 43.959 1.00 36.24  ? 142  ASP A CA    1 
ATOM   1827 C  C     . ASP C 3  136 ? 19.633 178.541 43.043 1.00 35.38  ? 142  ASP A C     1 
ATOM   1828 O  O     . ASP C 3  136 ? 18.623 178.016 43.501 1.00 35.72  ? 142  ASP A O     1 
ATOM   1829 C  CB    . ASP C 3  136 ? 20.425 180.708 43.963 1.00 39.90  ? 142  ASP A CB    1 
ATOM   1830 C  CG    . ASP C 3  136 ? 21.254 181.417 45.009 1.00 43.41  ? 142  ASP A CG    1 
ATOM   1831 O  OD1   . ASP C 3  136 ? 22.490 181.229 45.020 1.00 47.75  ? 142  ASP A OD1   1 
ATOM   1832 O  OD2   . ASP C 3  136 ? 20.674 182.165 45.822 1.00 46.29  ? 142  ASP A OD2   1 
ATOM   1833 N  N     . PHE C 3  137 ? 19.904 178.573 41.744 1.00 34.71  ? 143  PHE A N     1 
ATOM   1834 C  CA    . PHE C 3  137 ? 19.004 177.976 40.767 1.00 33.76  ? 143  PHE A CA    1 
ATOM   1835 C  C     . PHE C 3  137 ? 18.871 176.476 41.015 1.00 35.48  ? 143  PHE A C     1 
ATOM   1836 O  O     . PHE C 3  137 ? 17.765 175.949 41.066 1.00 36.12  ? 143  PHE A O     1 
ATOM   1837 C  CB    . PHE C 3  137 ? 19.528 178.209 39.352 1.00 29.48  ? 143  PHE A CB    1 
ATOM   1838 C  CG    . PHE C 3  137 ? 18.541 177.863 38.280 1.00 25.33  ? 143  PHE A CG    1 
ATOM   1839 C  CD1   . PHE C 3  137 ? 17.573 178.782 37.890 1.00 22.54  ? 143  PHE A CD1   1 
ATOM   1840 C  CD2   . PHE C 3  137 ? 18.568 176.616 37.669 1.00 22.40  ? 143  PHE A CD2   1 
ATOM   1841 C  CE1   . PHE C 3  137 ? 16.649 178.466 36.907 1.00 21.86  ? 143  PHE A CE1   1 
ATOM   1842 C  CE2   . PHE C 3  137 ? 17.643 176.289 36.681 1.00 23.32  ? 143  PHE A CE2   1 
ATOM   1843 C  CZ    . PHE C 3  137 ? 16.683 177.216 36.300 1.00 22.08  ? 143  PHE A CZ    1 
ATOM   1844 N  N     . LYS C 3  138 ? 20.006 175.797 41.163 1.00 38.26  ? 144  LYS A N     1 
ATOM   1845 C  CA    . LYS C 3  138 ? 20.024 174.357 41.410 1.00 40.61  ? 144  LYS A CA    1 
ATOM   1846 C  C     . LYS C 3  138 ? 19.325 173.990 42.707 1.00 42.88  ? 144  LYS A C     1 
ATOM   1847 O  O     . LYS C 3  138 ? 18.567 173.023 42.761 1.00 43.53  ? 144  LYS A O     1 
ATOM   1848 C  CB    . LYS C 3  138 ? 21.460 173.843 41.467 1.00 40.01  ? 144  LYS A CB    1 
ATOM   1849 C  CG    . LYS C 3  138 ? 22.146 173.808 40.128 1.00 40.47  ? 144  LYS A CG    1 
ATOM   1850 C  CD    . LYS C 3  138 ? 23.550 173.258 40.248 1.00 40.98  ? 144  LYS A CD    1 
ATOM   1851 C  CE    . LYS C 3  138 ? 23.548 171.834 40.759 1.00 40.55  ? 144  LYS A CE    1 
ATOM   1852 N  NZ    . LYS C 3  138 ? 24.929 171.280 40.748 1.00 42.32  ? 144  LYS A NZ    1 
ATOM   1853 N  N     . ARG C 3  139 ? 19.598 174.761 43.754 1.00 45.31  ? 145  ARG A N     1 
ATOM   1854 C  CA    . ARG C 3  139 ? 18.996 174.529 45.057 1.00 48.14  ? 145  ARG A CA    1 
ATOM   1855 C  C     . ARG C 3  139 ? 17.475 174.612 44.975 1.00 49.37  ? 145  ARG A C     1 
ATOM   1856 O  O     . ARG C 3  139 ? 16.775 173.795 45.572 1.00 48.92  ? 145  ARG A O     1 
ATOM   1857 C  CB    . ARG C 3  139 ? 19.546 175.542 46.071 1.00 48.87  ? 145  ARG A CB    1 
ATOM   1858 C  CG    . ARG C 3  139 ? 18.531 176.076 47.073 1.00 51.95  ? 145  ARG A CG    1 
ATOM   1859 C  CD    . ARG C 3  139 ? 19.177 176.963 48.137 1.00 53.29  ? 145  ARG A CD    1 
ATOM   1860 N  NE    . ARG C 3  139 ? 20.064 177.990 47.586 1.00 56.16  ? 145  ARG A NE    1 
ATOM   1861 C  CZ    . ARG C 3  139 ? 21.343 177.795 47.267 1.00 57.13  ? 145  ARG A CZ    1 
ATOM   1862 N  NH1   . ARG C 3  139 ? 21.905 176.604 47.441 1.00 57.83  ? 145  ARG A NH1   1 
ATOM   1863 N  NH2   . ARG C 3  139 ? 22.067 178.794 46.778 1.00 57.25  ? 145  ARG A NH2   1 
ATOM   1864 N  N     . MET C 3  140 ? 16.964 175.587 44.229 1.00 51.08  ? 146  MET A N     1 
ATOM   1865 C  CA    . MET C 3  140 ? 15.520 175.743 44.090 1.00 54.15  ? 146  MET A CA    1 
ATOM   1866 C  C     . MET C 3  140 ? 14.888 174.595 43.302 1.00 54.78  ? 146  MET A C     1 
ATOM   1867 O  O     . MET C 3  140 ? 13.784 174.158 43.620 1.00 54.26  ? 146  MET A O     1 
ATOM   1868 C  CB    . MET C 3  140 ? 15.182 177.087 43.431 1.00 55.29  ? 146  MET A CB    1 
ATOM   1869 C  CG    . MET C 3  140 ? 15.593 178.300 44.265 1.00 59.27  ? 146  MET A CG    1 
ATOM   1870 S  SD    . MET C 3  140 ? 15.036 179.913 43.623 1.00 62.93  ? 146  MET A SD    1 
ATOM   1871 C  CE    . MET C 3  140 ? 13.838 180.404 44.886 1.00 62.53  ? 146  MET A CE    1 
ATOM   1872 N  N     . LEU C 3  141 ? 15.584 174.099 42.283 1.00 55.53  ? 147  LEU A N     1 
ATOM   1873 C  CA    . LEU C 3  141 ? 15.050 172.998 41.489 1.00 57.11  ? 147  LEU A CA    1 
ATOM   1874 C  C     . LEU C 3  141 ? 14.914 171.729 42.319 1.00 58.53  ? 147  LEU A C     1 
ATOM   1875 O  O     . LEU C 3  141 ? 13.899 171.033 42.245 1.00 59.00  ? 147  LEU A O     1 
ATOM   1876 C  CB    . LEU C 3  141 ? 15.938 172.712 40.275 1.00 55.59  ? 147  LEU A CB    1 
ATOM   1877 C  CG    . LEU C 3  141 ? 15.806 173.661 39.083 1.00 55.12  ? 147  LEU A CG    1 
ATOM   1878 C  CD1   . LEU C 3  141 ? 16.609 173.114 37.909 1.00 53.89  ? 147  LEU A CD1   1 
ATOM   1879 C  CD2   . LEU C 3  141 ? 14.340 173.802 38.699 1.00 53.91  ? 147  LEU A CD2   1 
ATOM   1880 N  N     . GLU C 3  142 ? 15.941 171.430 43.107 1.00 59.76  ? 148  GLU A N     1 
ATOM   1881 C  CA    . GLU C 3  142 ? 15.928 170.245 43.950 1.00 61.12  ? 148  GLU A CA    1 
ATOM   1882 C  C     . GLU C 3  142 ? 14.938 170.423 45.097 1.00 61.49  ? 148  GLU A C     1 
ATOM   1883 O  O     . GLU C 3  142 ? 14.606 169.470 45.801 1.00 61.43  ? 148  GLU A O     1 
ATOM   1884 C  CB    . GLU C 3  142 ? 17.340 169.965 44.469 1.00 62.39  ? 148  GLU A CB    1 
ATOM   1885 C  CG    . GLU C 3  142 ? 18.306 169.573 43.352 1.00 64.48  ? 148  GLU A CG    1 
ATOM   1886 C  CD    . GLU C 3  142 ? 19.756 169.558 43.792 1.00 65.68  ? 148  GLU A CD    1 
ATOM   1887 O  OE1   . GLU C 3  142 ? 20.072 168.859 44.779 1.00 66.58  ? 148  GLU A OE1   1 
ATOM   1888 O  OE2   . GLU C 3  142 ? 20.580 170.242 43.145 1.00 65.62  ? 148  GLU A OE2   1 
ATOM   1889 N  N     . GLU C 3  143 ? 14.466 171.653 45.275 1.00 61.99  ? 149  GLU A N     1 
ATOM   1890 C  CA    . GLU C 3  143 ? 13.484 171.947 46.309 1.00 62.34  ? 149  GLU A CA    1 
ATOM   1891 C  C     . GLU C 3  143 ? 12.112 171.594 45.760 1.00 61.46  ? 149  GLU A C     1 
ATOM   1892 O  O     . GLU C 3  143 ? 11.202 171.256 46.514 1.00 61.75  ? 149  GLU A O     1 
ATOM   1893 C  CB    . GLU C 3  143 ? 13.503 173.433 46.690 1.00 63.74  ? 149  GLU A CB    1 
ATOM   1894 C  CG    . GLU C 3  143 ? 14.565 173.831 47.711 1.00 66.24  ? 149  GLU A CG    1 
ATOM   1895 C  CD    . GLU C 3  143 ? 14.401 175.266 48.198 1.00 67.71  ? 149  GLU A CD    1 
ATOM   1896 O  OE1   . GLU C 3  143 ? 14.531 176.201 47.378 1.00 68.86  ? 149  GLU A OE1   1 
ATOM   1897 O  OE2   . GLU C 3  143 ? 14.138 175.461 49.404 1.00 68.55  ? 149  GLU A OE2   1 
ATOM   1898 N  N     . GLN C 3  144 ? 11.974 171.672 44.439 1.00 60.51  ? 150  GLN A N     1 
ATOM   1899 C  CA    . GLN C 3  144 ? 10.708 171.372 43.782 1.00 60.34  ? 150  GLN A CA    1 
ATOM   1900 C  C     . GLN C 3  144 ? 10.717 170.014 43.089 1.00 60.17  ? 150  GLN A C     1 
ATOM   1901 O  O     . GLN C 3  144 ? 9.864  169.742 42.248 1.00 60.35  ? 150  GLN A O     1 
ATOM   1902 C  CB    . GLN C 3  144 ? 10.367 172.455 42.755 1.00 60.97  ? 150  GLN A CB    1 
ATOM   1903 C  CG    . GLN C 3  144 ? 10.537 173.877 43.260 1.00 62.35  ? 150  GLN A CG    1 
ATOM   1904 C  CD    . GLN C 3  144 ? 9.883  174.104 44.608 1.00 63.10  ? 150  GLN A CD    1 
ATOM   1905 O  OE1   . GLN C 3  144 ? 8.682  173.889 44.773 1.00 64.76  ? 150  GLN A OE1   1 
ATOM   1906 N  NE2   . GLN C 3  144 ? 10.672 174.543 45.580 1.00 63.28  ? 150  GLN A NE2   1 
ATOM   1907 N  N     . GLY C 3  145 ? 11.686 169.170 43.434 1.00 59.94  ? 151  GLY A N     1 
ATOM   1908 C  CA    . GLY C 3  145 ? 11.764 167.847 42.835 1.00 59.56  ? 151  GLY A CA    1 
ATOM   1909 C  C     . GLY C 3  145 ? 12.436 167.784 41.474 1.00 59.59  ? 151  GLY A C     1 
ATOM   1910 O  O     . GLY C 3  145 ? 13.135 166.816 41.162 1.00 60.09  ? 151  GLY A O     1 
ATOM   1911 N  N     . GLU C 3  146 ? 12.224 168.814 40.661 1.00 59.18  ? 152  GLU A N     1 
ATOM   1912 C  CA    . GLU C 3  146 ? 12.803 168.892 39.322 1.00 58.50  ? 152  GLU A CA    1 
ATOM   1913 C  C     . GLU C 3  146 ? 14.314 168.661 39.311 1.00 57.23  ? 152  GLU A C     1 
ATOM   1914 O  O     . GLU C 3  146 ? 15.015 169.026 40.253 1.00 57.50  ? 152  GLU A O     1 
ATOM   1915 C  CB    . GLU C 3  146 ? 12.494 170.258 38.714 1.00 60.17  ? 152  GLU A CB    1 
ATOM   1916 C  CG    . GLU C 3  146 ? 11.011 170.523 38.512 1.00 62.93  ? 152  GLU A CG    1 
ATOM   1917 C  CD    . GLU C 3  146 ? 10.704 172.000 38.329 1.00 65.81  ? 152  GLU A CD    1 
ATOM   1918 O  OE1   . GLU C 3  146 ? 10.837 172.760 39.314 1.00 66.97  ? 152  GLU A OE1   1 
ATOM   1919 O  OE2   . GLU C 3  146 ? 10.334 172.402 37.204 1.00 66.59  ? 152  GLU A OE2   1 
ATOM   1920 N  N     . GLU C 3  147 ? 14.812 168.056 38.238 1.00 55.84  ? 153  GLU A N     1 
ATOM   1921 C  CA    . GLU C 3  147 ? 16.238 167.782 38.108 1.00 54.70  ? 153  GLU A CA    1 
ATOM   1922 C  C     . GLU C 3  147 ? 16.969 168.941 37.437 1.00 53.30  ? 153  GLU A C     1 
ATOM   1923 O  O     . GLU C 3  147 ? 16.362 169.744 36.723 1.00 53.10  ? 153  GLU A O     1 
ATOM   1924 C  CB    . GLU C 3  147 ? 16.461 166.514 37.287 1.00 56.26  ? 153  GLU A CB    1 
ATOM   1925 C  CG    . GLU C 3  147 ? 15.824 165.273 37.873 1.00 60.87  ? 153  GLU A CG    1 
ATOM   1926 C  CD    . GLU C 3  147 ? 16.110 164.032 37.045 1.00 63.81  ? 153  GLU A CD    1 
ATOM   1927 O  OE1   . GLU C 3  147 ? 15.730 164.008 35.852 1.00 65.05  ? 153  GLU A OE1   1 
ATOM   1928 O  OE2   . GLU C 3  147 ? 16.718 163.081 37.588 1.00 65.30  ? 153  GLU A OE2   1 
ATOM   1929 N  N     . TYR C 3  148 ? 18.277 169.021 37.673 1.00 50.04  ? 154  TYR A N     1 
ATOM   1930 C  CA    . TYR C 3  148 ? 19.102 170.068 37.085 1.00 46.13  ? 154  TYR A CA    1 
ATOM   1931 C  C     . TYR C 3  148 ? 19.782 169.513 35.845 1.00 45.20  ? 154  TYR A C     1 
ATOM   1932 O  O     . TYR C 3  148 ? 20.058 168.317 35.771 1.00 44.71  ? 154  TYR A O     1 
ATOM   1933 C  CB    . TYR C 3  148 ? 20.167 170.540 38.074 1.00 43.61  ? 154  TYR A CB    1 
ATOM   1934 C  CG    . TYR C 3  148 ? 21.123 171.546 37.473 1.00 41.69  ? 154  TYR A CG    1 
ATOM   1935 C  CD1   . TYR C 3  148 ? 20.703 172.848 37.173 1.00 38.78  ? 154  TYR A CD1   1 
ATOM   1936 C  CD2   . TYR C 3  148 ? 22.432 171.183 37.154 1.00 38.74  ? 154  TYR A CD2   1 
ATOM   1937 C  CE1   . TYR C 3  148 ? 21.563 173.756 36.567 1.00 36.61  ? 154  TYR A CE1   1 
ATOM   1938 C  CE2   . TYR C 3  148 ? 23.298 172.082 36.548 1.00 37.54  ? 154  TYR A CE2   1 
ATOM   1939 C  CZ    . TYR C 3  148 ? 22.860 173.365 36.256 1.00 37.41  ? 154  TYR A CZ    1 
ATOM   1940 O  OH    . TYR C 3  148 ? 23.723 174.249 35.654 1.00 34.42  ? 154  TYR A OH    1 
ATOM   1941 N  N     . VAL C 3  149 ? 20.056 170.382 34.877 1.00 45.25  ? 155  VAL A N     1 
ATOM   1942 C  CA    . VAL C 3  149 ? 20.698 169.962 33.635 1.00 45.18  ? 155  VAL A CA    1 
ATOM   1943 C  C     . VAL C 3  149 ? 21.818 170.897 33.186 1.00 45.33  ? 155  VAL A C     1 
ATOM   1944 O  O     . VAL C 3  149 ? 21.717 172.115 33.330 1.00 45.33  ? 155  VAL A O     1 
ATOM   1945 C  CB    . VAL C 3  149 ? 19.668 169.878 32.482 1.00 45.25  ? 155  VAL A CB    1 
ATOM   1946 C  CG1   . VAL C 3  149 ? 20.294 169.200 31.268 1.00 44.11  ? 155  VAL A CG1   1 
ATOM   1947 C  CG2   . VAL C 3  149 ? 18.426 169.141 32.943 1.00 43.57  ? 155  VAL A CG2   1 
ATOM   1948 N  N     . ASP C 3  150 ? 22.875 170.308 32.633 1.00 46.35  ? 156  ASP A N     1 
ATOM   1949 C  CA    . ASP C 3  150 ? 24.029 171.040 32.110 1.00 47.34  ? 156  ASP A CA    1 
ATOM   1950 C  C     . ASP C 3  150 ? 24.143 172.463 32.627 1.00 45.74  ? 156  ASP A C     1 
ATOM   1951 O  O     . ASP C 3  150 ? 24.862 172.719 33.591 1.00 48.46  ? 156  ASP A O     1 
ATOM   1952 C  CB    . ASP C 3  150 ? 23.977 171.073 30.575 1.00 51.98  ? 156  ASP A CB    1 
ATOM   1953 C  CG    . ASP C 3  150 ? 24.238 169.707 29.944 1.00 56.00  ? 156  ASP A CG    1 
ATOM   1954 O  OD1   . ASP C 3  150 ? 23.538 168.728 30.301 1.00 58.77  ? 156  ASP A OD1   1 
ATOM   1955 O  OD2   . ASP C 3  150 ? 25.143 169.617 29.085 1.00 57.44  ? 156  ASP A OD2   1 
ATOM   1956 N  N     . GLY C 3  151 ? 23.441 173.387 31.973 1.00 41.73  ? 157  GLY A N     1 
ATOM   1957 C  CA    . GLY C 3  151 ? 23.478 174.783 32.383 1.00 36.89  ? 157  GLY A CA    1 
ATOM   1958 C  C     . GLY C 3  151 ? 22.162 175.488 32.101 1.00 33.89  ? 157  GLY A C     1 
ATOM   1959 O  O     . GLY C 3  151 ? 22.131 176.647 31.688 1.00 32.41  ? 157  GLY A O     1 
ATOM   1960 N  N     . MET C 3  152 ? 21.068 174.777 32.340 1.00 30.36  ? 158  MET A N     1 
ATOM   1961 C  CA    . MET C 3  152 ? 19.733 175.306 32.102 1.00 27.70  ? 158  MET A CA    1 
ATOM   1962 C  C     . MET C 3  152 ? 19.419 176.628 32.804 1.00 24.38  ? 158  MET A C     1 
ATOM   1963 O  O     . MET C 3  152 ? 18.463 177.307 32.437 1.00 23.18  ? 158  MET A O     1 
ATOM   1964 C  CB    . MET C 3  152 ? 18.691 174.261 32.500 1.00 27.70  ? 158  MET A CB    1 
ATOM   1965 C  CG    . MET C 3  152 ? 18.689 173.929 33.974 1.00 28.98  ? 158  MET A CG    1 
ATOM   1966 S  SD    . MET C 3  152 ? 17.492 172.644 34.348 1.00 33.76  ? 158  MET A SD    1 
ATOM   1967 C  CE    . MET C 3  152 ? 15.950 173.565 34.326 1.00 30.63  ? 158  MET A CE    1 
ATOM   1968 N  N     . GLU C 3  153 ? 20.212 176.999 33.805 1.00 21.99  ? 159  GLU A N     1 
ATOM   1969 C  CA    . GLU C 3  153 ? 19.959 178.244 34.524 1.00 20.70  ? 159  GLU A CA    1 
ATOM   1970 C  C     . GLU C 3  153 ? 20.015 179.446 33.576 1.00 20.33  ? 159  GLU A C     1 
ATOM   1971 O  O     . GLU C 3  153 ? 19.516 180.521 33.894 1.00 19.86  ? 159  GLU A O     1 
ATOM   1972 C  CB    . GLU C 3  153 ? 20.983 178.443 35.650 1.00 19.70  ? 159  GLU A CB    1 
ATOM   1973 C  CG    . GLU C 3  153 ? 22.397 178.726 35.163 1.00 19.30  ? 159  GLU A CG    1 
ATOM   1974 C  CD    . GLU C 3  153 ? 23.270 177.492 35.168 1.00 20.70  ? 159  GLU A CD    1 
ATOM   1975 O  OE1   . GLU C 3  153 ? 22.729 176.382 35.000 1.00 20.26  ? 159  GLU A OE1   1 
ATOM   1976 O  OE2   . GLU C 3  153 ? 24.500 177.628 35.332 1.00 22.66  ? 159  GLU A OE2   1 
ATOM   1977 N  N     . TRP C 3  154 ? 20.615 179.262 32.408 1.00 19.77  ? 160  TRP A N     1 
ATOM   1978 C  CA    . TRP C 3  154 ? 20.727 180.358 31.454 1.00 21.38  ? 160  TRP A CA    1 
ATOM   1979 C  C     . TRP C 3  154 ? 19.817 180.283 30.235 1.00 21.29  ? 160  TRP A C     1 
ATOM   1980 O  O     . TRP C 3  154 ? 19.844 181.190 29.400 1.00 20.91  ? 160  TRP A O     1 
ATOM   1981 C  CB    . TRP C 3  154 ? 22.171 180.483 30.966 1.00 20.46  ? 160  TRP A CB    1 
ATOM   1982 C  CG    . TRP C 3  154 ? 23.107 180.879 32.045 1.00 21.68  ? 160  TRP A CG    1 
ATOM   1983 C  CD1   . TRP C 3  154 ? 24.102 180.121 32.589 1.00 23.16  ? 160  TRP A CD1   1 
ATOM   1984 C  CD2   . TRP C 3  154 ? 23.116 182.120 32.748 1.00 19.58  ? 160  TRP A CD2   1 
ATOM   1985 N  NE1   . TRP C 3  154 ? 24.731 180.815 33.590 1.00 22.14  ? 160  TRP A NE1   1 
ATOM   1986 C  CE2   . TRP C 3  154 ? 24.145 182.047 33.709 1.00 21.02  ? 160  TRP A CE2   1 
ATOM   1987 C  CE3   . TRP C 3  154 ? 22.353 183.289 32.660 1.00 19.64  ? 160  TRP A CE3   1 
ATOM   1988 C  CZ2   . TRP C 3  154 ? 24.435 183.104 34.582 1.00 21.68  ? 160  TRP A CZ2   1 
ATOM   1989 C  CZ3   . TRP C 3  154 ? 22.642 184.342 33.528 1.00 22.22  ? 160  TRP A CZ3   1 
ATOM   1990 C  CH2   . TRP C 3  154 ? 23.676 184.238 34.476 1.00 20.72  ? 160  TRP A CH2   1 
ATOM   1991 N  N     . TRP C 3  155 ? 19.019 179.224 30.120 1.00 19.52  ? 161  TRP A N     1 
ATOM   1992 C  CA    . TRP C 3  155 ? 18.162 179.090 28.953 1.00 19.22  ? 161  TRP A CA    1 
ATOM   1993 C  C     . TRP C 3  155 ? 17.023 180.090 28.932 1.00 20.25  ? 161  TRP A C     1 
ATOM   1994 O  O     . TRP C 3  155 ? 16.680 180.629 27.885 1.00 21.16  ? 161  TRP A O     1 
ATOM   1995 C  CB    . TRP C 3  155 ? 17.581 177.686 28.866 1.00 20.30  ? 161  TRP A CB    1 
ATOM   1996 C  CG    . TRP C 3  155 ? 18.597 176.591 28.777 1.00 22.25  ? 161  TRP A CG    1 
ATOM   1997 C  CD1   . TRP C 3  155 ? 19.917 176.709 28.440 1.00 20.20  ? 161  TRP A CD1   1 
ATOM   1998 C  CD2   . TRP C 3  155 ? 18.366 175.196 29.010 1.00 21.56  ? 161  TRP A CD2   1 
ATOM   1999 N  NE1   . TRP C 3  155 ? 20.521 175.475 28.453 1.00 20.31  ? 161  TRP A NE1   1 
ATOM   2000 C  CE2   . TRP C 3  155 ? 19.594 174.528 28.799 1.00 20.57  ? 161  TRP A CE2   1 
ATOM   2001 C  CE3   . TRP C 3  155 ? 17.238 174.446 29.376 1.00 19.96  ? 161  TRP A CE3   1 
ATOM   2002 C  CZ2   . TRP C 3  155 ? 19.728 173.143 28.942 1.00 20.65  ? 161  TRP A CZ2   1 
ATOM   2003 C  CZ3   . TRP C 3  155 ? 17.371 173.067 29.517 1.00 20.96  ? 161  TRP A CZ3   1 
ATOM   2004 C  CH2   . TRP C 3  155 ? 18.611 172.431 29.300 1.00 21.19  ? 161  TRP A CH2   1 
ATOM   2005 N  N     . ASN C 3  156 ? 16.432 180.339 30.089 1.00 20.50  ? 162  ASN A N     1 
ATOM   2006 C  CA    . ASN C 3  156 ? 15.320 181.263 30.158 1.00 21.30  ? 162  ASN A CA    1 
ATOM   2007 C  C     . ASN C 3  156 ? 15.493 182.321 31.226 1.00 22.06  ? 162  ASN A C     1 
ATOM   2008 O  O     . ASN C 3  156 ? 16.218 182.128 32.202 1.00 23.50  ? 162  ASN A O     1 
ATOM   2009 C  CB    . ASN C 3  156 ? 14.024 180.495 30.415 1.00 20.45  ? 162  ASN A CB    1 
ATOM   2010 C  CG    . ASN C 3  156 ? 13.670 179.577 29.277 1.00 20.63  ? 162  ASN A CG    1 
ATOM   2011 O  OD1   . ASN C 3  156 ? 13.381 180.029 28.170 1.00 22.98  ? 162  ASN A OD1   1 
ATOM   2012 N  ND2   . ASN C 3  156 ? 13.705 178.277 29.534 1.00 20.55  ? 162  ASN A ND2   1 
ATOM   2013 N  N     . PHE C 3  157 ? 14.819 183.447 31.026 1.00 21.99  ? 163  PHE A N     1 
ATOM   2014 C  CA    . PHE C 3  157 ? 14.858 184.547 31.974 1.00 21.07  ? 163  PHE A CA    1 
ATOM   2015 C  C     . PHE C 3  157 ? 13.920 184.220 33.137 1.00 21.97  ? 163  PHE A C     1 
ATOM   2016 O  O     . PHE C 3  157 ? 12.892 183.568 32.953 1.00 20.85  ? 163  PHE A O     1 
ATOM   2017 C  CB    . PHE C 3  157 ? 14.391 185.832 31.295 1.00 20.58  ? 163  PHE A CB    1 
ATOM   2018 C  CG    . PHE C 3  157 ? 13.876 186.871 32.252 1.00 19.85  ? 163  PHE A CG    1 
ATOM   2019 C  CD1   . PHE C 3  157 ? 14.749 187.593 33.057 1.00 18.81  ? 163  PHE A CD1   1 
ATOM   2020 C  CD2   . PHE C 3  157 ? 12.510 187.108 32.364 1.00 19.64  ? 163  PHE A CD2   1 
ATOM   2021 C  CE1   . PHE C 3  157 ? 14.273 188.536 33.962 1.00 19.58  ? 163  PHE A CE1   1 
ATOM   2022 C  CE2   . PHE C 3  157 ? 12.020 188.048 33.264 1.00 19.76  ? 163  PHE A CE2   1 
ATOM   2023 C  CZ    . PHE C 3  157 ? 12.902 188.764 34.066 1.00 20.40  ? 163  PHE A CZ    1 
ATOM   2024 N  N     . ASN C 3  158 ? 14.291 184.657 34.332 1.00 20.85  ? 164  ASN A N     1 
ATOM   2025 C  CA    . ASN C 3  158 ? 13.464 184.448 35.509 1.00 20.78  ? 164  ASN A CA    1 
ATOM   2026 C  C     . ASN C 3  158 ? 13.818 185.572 36.467 1.00 21.41  ? 164  ASN A C     1 
ATOM   2027 O  O     . ASN C 3  158 ? 14.855 186.211 36.306 1.00 22.58  ? 164  ASN A O     1 
ATOM   2028 C  CB    . ASN C 3  158 ? 13.728 183.074 36.130 1.00 18.21  ? 164  ASN A CB    1 
ATOM   2029 C  CG    . ASN C 3  158 ? 15.161 182.889 36.564 1.00 19.16  ? 164  ASN A CG    1 
ATOM   2030 O  OD1   . ASN C 3  158 ? 15.667 183.635 37.401 1.00 17.29  ? 164  ASN A OD1   1 
ATOM   2031 N  ND2   . ASN C 3  158 ? 15.825 181.881 36.003 1.00 18.54  ? 164  ASN A ND2   1 
ATOM   2032 N  N     . GLU C 3  159 ? 12.957 185.831 37.443 1.00 22.45  ? 165  GLU A N     1 
ATOM   2033 C  CA    . GLU C 3  159 ? 13.194 186.914 38.392 1.00 22.92  ? 165  GLU A CA    1 
ATOM   2034 C  C     . GLU C 3  159 ? 14.456 186.777 39.232 1.00 22.21  ? 165  GLU A C     1 
ATOM   2035 O  O     . GLU C 3  159 ? 15.037 187.779 39.632 1.00 24.05  ? 165  GLU A O     1 
ATOM   2036 C  CB    . GLU C 3  159 ? 11.974 187.109 39.300 1.00 23.75  ? 165  GLU A CB    1 
ATOM   2037 C  CG    . GLU C 3  159 ? 10.857 187.936 38.659 1.00 26.51  ? 165  GLU A CG    1 
ATOM   2038 C  CD    . GLU C 3  159 ? 11.341 189.297 38.155 1.00 30.08  ? 165  GLU A CD    1 
ATOM   2039 O  OE1   . GLU C 3  159 ? 11.925 190.070 38.955 1.00 29.39  ? 165  GLU A OE1   1 
ATOM   2040 O  OE2   . GLU C 3  159 ? 11.133 189.599 36.957 1.00 30.64  ? 165  GLU A OE2   1 
ATOM   2041 N  N     . GLU C 3  160 ? 14.891 185.556 39.509 1.00 21.90  ? 166  GLU A N     1 
ATOM   2042 C  CA    . GLU C 3  160 ? 16.111 185.396 40.288 1.00 22.59  ? 166  GLU A CA    1 
ATOM   2043 C  C     . GLU C 3  160 ? 17.269 185.985 39.487 1.00 21.50  ? 166  GLU A C     1 
ATOM   2044 O  O     . GLU C 3  160 ? 18.170 186.617 40.037 1.00 21.53  ? 166  GLU A O     1 
ATOM   2045 C  CB    . GLU C 3  160 ? 16.371 183.921 40.590 1.00 23.83  ? 166  GLU A CB    1 
ATOM   2046 C  CG    . GLU C 3  160 ? 15.522 183.374 41.728 1.00 27.95  ? 166  GLU A CG    1 
ATOM   2047 N  N     . MET C 3  161 ? 17.224 185.770 38.178 1.00 21.06  ? 167  MET A N     1 
ATOM   2048 C  CA    . MET C 3  161 ? 18.236 186.281 37.261 1.00 19.93  ? 167  MET A CA    1 
ATOM   2049 C  C     . MET C 3  161 ? 18.189 187.805 37.286 1.00 17.69  ? 167  MET A C     1 
ATOM   2050 O  O     . MET C 3  161 ? 19.223 188.470 37.322 1.00 16.35  ? 167  MET A O     1 
ATOM   2051 C  CB    . MET C 3  161 ? 17.946 185.777 35.847 1.00 19.39  ? 167  MET A CB    1 
ATOM   2052 C  CG    . MET C 3  161 ? 18.936 186.223 34.794 1.00 17.67  ? 167  MET A CG    1 
ATOM   2053 S  SD    . MET C 3  161 ? 18.381 185.660 33.167 1.00 18.53  ? 167  MET A SD    1 
ATOM   2054 C  CE    . MET C 3  161 ? 18.668 183.896 33.321 1.00 13.62  ? 167  MET A CE    1 
ATOM   2055 N  N     . MET C 3  162 ? 16.973 188.341 37.272 1.00 16.86  ? 168  MET A N     1 
ATOM   2056 C  CA    . MET C 3  162 ? 16.747 189.782 37.300 1.00 17.97  ? 168  MET A CA    1 
ATOM   2057 C  C     . MET C 3  162 ? 17.335 190.404 38.574 1.00 19.48  ? 168  MET A C     1 
ATOM   2058 O  O     . MET C 3  162 ? 18.000 191.446 38.520 1.00 18.18  ? 168  MET A O     1 
ATOM   2059 C  CB    . MET C 3  162 ? 15.244 190.070 37.225 1.00 15.04  ? 168  MET A CB    1 
ATOM   2060 C  CG    . MET C 3  162 ? 14.863 191.543 37.122 1.00 17.18  ? 168  MET A CG    1 
ATOM   2061 S  SD    . MET C 3  162 ? 15.031 192.261 35.460 1.00 18.14  ? 168  MET A SD    1 
ATOM   2062 C  CE    . MET C 3  162 ? 16.546 193.147 35.641 1.00 14.49  ? 168  MET A CE    1 
ATOM   2063 N  N     . ASP C 3  163 ? 17.093 189.768 39.719 1.00 19.52  ? 169  ASP A N     1 
ATOM   2064 C  CA    . ASP C 3  163 ? 17.611 190.285 40.982 1.00 21.35  ? 169  ASP A CA    1 
ATOM   2065 C  C     . ASP C 3  163 ? 19.132 190.358 40.975 1.00 21.30  ? 169  ASP A C     1 
ATOM   2066 O  O     . ASP C 3  163 ? 19.716 191.346 41.430 1.00 20.83  ? 169  ASP A O     1 
ATOM   2067 C  CB    . ASP C 3  163 ? 17.141 189.430 42.160 1.00 23.97  ? 169  ASP A CB    1 
ATOM   2068 C  CG    . ASP C 3  163 ? 15.660 189.590 42.438 1.00 26.54  ? 169  ASP A CG    1 
ATOM   2069 O  OD1   . ASP C 3  163 ? 15.141 190.721 42.303 1.00 29.14  ? 169  ASP A OD1   1 
ATOM   2070 O  OD2   . ASP C 3  163 ? 15.015 188.588 42.807 1.00 29.48  ? 169  ASP A OD2   1 
ATOM   2071 N  N     . TYR C 3  164 ? 19.770 189.311 40.462 1.00 19.85  ? 170  TYR A N     1 
ATOM   2072 C  CA    . TYR C 3  164 ? 21.222 189.276 40.377 1.00 20.05  ? 170  TYR A CA    1 
ATOM   2073 C  C     . TYR C 3  164 ? 21.694 190.398 39.456 1.00 19.75  ? 170  TYR A C     1 
ATOM   2074 O  O     . TYR C 3  164 ? 22.687 191.075 39.733 1.00 20.38  ? 170  TYR A O     1 
ATOM   2075 C  CB    . TYR C 3  164 ? 21.678 187.919 39.840 1.00 21.81  ? 170  TYR A CB    1 
ATOM   2076 C  CG    . TYR C 3  164 ? 22.023 186.928 40.925 1.00 24.97  ? 170  TYR A CG    1 
ATOM   2077 C  CD1   . TYR C 3  164 ? 23.232 187.021 41.612 1.00 26.41  ? 170  TYR A CD1   1 
ATOM   2078 C  CD2   . TYR C 3  164 ? 21.139 185.905 41.279 1.00 25.31  ? 170  TYR A CD2   1 
ATOM   2079 C  CE1   . TYR C 3  164 ? 23.560 186.124 42.622 1.00 27.31  ? 170  TYR A CE1   1 
ATOM   2080 C  CE2   . TYR C 3  164 ? 21.456 185.001 42.293 1.00 25.63  ? 170  TYR A CE2   1 
ATOM   2081 C  CZ    . TYR C 3  164 ? 22.669 185.118 42.957 1.00 27.34  ? 170  TYR A CZ    1 
ATOM   2082 O  OH    . TYR C 3  164 ? 23.007 184.228 43.950 1.00 28.73  ? 170  TYR A OH    1 
ATOM   2083 N  N     . ASN C 3  165 ? 20.973 190.592 38.359 1.00 18.88  ? 171  ASN A N     1 
ATOM   2084 C  CA    . ASN C 3  165 ? 21.304 191.640 37.407 1.00 18.01  ? 171  ASN A CA    1 
ATOM   2085 C  C     . ASN C 3  165 ? 21.315 192.975 38.168 1.00 17.97  ? 171  ASN A C     1 
ATOM   2086 O  O     . ASN C 3  165 ? 22.182 193.816 37.947 1.00 17.61  ? 171  ASN A O     1 
ATOM   2087 C  CB    . ASN C 3  165 ? 20.259 191.657 36.281 1.00 16.95  ? 171  ASN A CB    1 
ATOM   2088 C  CG    . ASN C 3  165 ? 20.694 192.472 35.072 1.00 17.57  ? 171  ASN A CG    1 
ATOM   2089 O  OD1   . ASN C 3  165 ? 19.908 192.696 34.156 1.00 19.12  ? 171  ASN A OD1   1 
ATOM   2090 N  ND2   . ASN C 3  165 ? 21.950 192.909 35.057 1.00 19.46  ? 171  ASN A ND2   1 
ATOM   2091 N  N     . VAL C 3  166 ? 20.359 193.156 39.077 1.00 19.16  ? 172  VAL A N     1 
ATOM   2092 C  CA    . VAL C 3  166 ? 20.282 194.387 39.865 1.00 20.05  ? 172  VAL A CA    1 
ATOM   2093 C  C     . VAL C 3  166 ? 21.479 194.489 40.814 1.00 21.51  ? 172  VAL A C     1 
ATOM   2094 O  O     . VAL C 3  166 ? 22.087 195.550 40.943 1.00 23.50  ? 172  VAL A O     1 
ATOM   2095 C  CB    . VAL C 3  166 ? 18.969 194.463 40.696 1.00 19.51  ? 172  VAL A CB    1 
ATOM   2096 C  CG1   . VAL C 3  166 ? 19.016 195.653 41.635 1.00 19.30  ? 172  VAL A CG1   1 
ATOM   2097 C  CG2   . VAL C 3  166 ? 17.764 194.606 39.776 1.00 16.39  ? 172  VAL A CG2   1 
ATOM   2098 N  N     . GLN C 3  167 ? 21.821 193.386 41.469 1.00 22.36  ? 173  GLN A N     1 
ATOM   2099 C  CA    . GLN C 3  167 ? 22.955 193.368 42.385 1.00 23.62  ? 173  GLN A CA    1 
ATOM   2100 C  C     . GLN C 3  167 ? 24.263 193.687 41.676 1.00 23.00  ? 173  GLN A C     1 
ATOM   2101 O  O     . GLN C 3  167 ? 25.100 194.413 42.207 1.00 21.92  ? 173  GLN A O     1 
ATOM   2102 C  CB    . GLN C 3  167 ? 23.074 192.007 43.069 1.00 26.56  ? 173  GLN A CB    1 
ATOM   2103 C  CG    . GLN C 3  167 ? 22.184 191.856 44.271 1.00 32.27  ? 173  GLN A CG    1 
ATOM   2104 C  CD    . GLN C 3  167 ? 22.390 192.979 45.267 1.00 36.57  ? 173  GLN A CD    1 
ATOM   2105 O  OE1   . GLN C 3  167 ? 21.675 193.986 45.244 1.00 36.65  ? 173  GLN A OE1   1 
ATOM   2106 N  NE2   . GLN C 3  167 ? 23.386 192.822 46.141 1.00 38.02  ? 173  GLN A NE2   1 
ATOM   2107 N  N     . ASP C 3  168 ? 24.459 193.132 40.486 1.00 22.09  ? 174  ASP A N     1 
ATOM   2108 C  CA    . ASP C 3  168 ? 25.682 193.427 39.763 1.00 22.50  ? 174  ASP A CA    1 
ATOM   2109 C  C     . ASP C 3  168 ? 25.809 194.943 39.655 1.00 20.32  ? 174  ASP A C     1 
ATOM   2110 O  O     . ASP C 3  168 ? 26.862 195.511 39.942 1.00 20.13  ? 174  ASP A O     1 
ATOM   2111 C  CB    . ASP C 3  168 ? 25.673 192.802 38.359 1.00 25.75  ? 174  ASP A CB    1 
ATOM   2112 C  CG    . ASP C 3  168 ? 25.964 191.302 38.381 1.00 30.57  ? 174  ASP A CG    1 
ATOM   2113 O  OD1   . ASP C 3  168 ? 26.472 190.806 39.414 1.00 32.77  ? 174  ASP A OD1   1 
ATOM   2114 O  OD2   . ASP C 3  168 ? 25.700 190.617 37.367 1.00 31.39  ? 174  ASP A OD2   1 
ATOM   2115 N  N     . VAL C 3  169 ? 24.726 195.606 39.275 1.00 17.00  ? 175  VAL A N     1 
ATOM   2116 C  CA    . VAL C 3  169 ? 24.791 197.047 39.129 1.00 16.71  ? 175  VAL A CA    1 
ATOM   2117 C  C     . VAL C 3  169 ? 25.078 197.797 40.422 1.00 15.67  ? 175  VAL A C     1 
ATOM   2118 O  O     . VAL C 3  169 ? 25.885 198.718 40.413 1.00 15.09  ? 175  VAL A O     1 
ATOM   2119 C  CB    . VAL C 3  169 ? 23.513 197.610 38.482 1.00 17.53  ? 175  VAL A CB    1 
ATOM   2120 C  CG1   . VAL C 3  169 ? 23.606 199.123 38.385 1.00 15.93  ? 175  VAL A CG1   1 
ATOM   2121 C  CG2   . VAL C 3  169 ? 23.341 197.018 37.087 1.00 15.47  ? 175  VAL A CG2   1 
ATOM   2122 N  N     . VAL C 3  170 ? 24.451 197.426 41.537 1.00 14.83  ? 176  VAL A N     1 
ATOM   2123 C  CA    . VAL C 3  170 ? 24.743 198.158 42.767 1.00 15.05  ? 176  VAL A CA    1 
ATOM   2124 C  C     . VAL C 3  170 ? 26.201 197.888 43.148 1.00 14.48  ? 176  VAL A C     1 
ATOM   2125 O  O     . VAL C 3  170 ? 26.914 198.785 43.593 1.00 16.06  ? 176  VAL A O     1 
ATOM   2126 C  CB    . VAL C 3  170 ? 23.784 197.783 43.957 1.00 16.32  ? 176  VAL A CB    1 
ATOM   2127 C  CG1   . VAL C 3  170 ? 22.528 197.133 43.435 1.00 15.93  ? 176  VAL A CG1   1 
ATOM   2128 C  CG2   . VAL C 3  170 ? 24.495 196.911 44.976 1.00 15.01  ? 176  VAL A CG2   1 
ATOM   2129 N  N     . VAL C 3  171 ? 26.654 196.659 42.943 1.00 12.79  ? 177  VAL A N     1 
ATOM   2130 C  CA    . VAL C 3  171 ? 28.029 196.315 43.252 1.00 12.66  ? 177  VAL A CA    1 
ATOM   2131 C  C     . VAL C 3  171 ? 29.001 196.998 42.290 1.00 13.00  ? 177  VAL A C     1 
ATOM   2132 O  O     . VAL C 3  171 ? 30.075 197.439 42.698 1.00 13.90  ? 177  VAL A O     1 
ATOM   2133 C  CB    . VAL C 3  171 ? 28.239 194.786 43.219 1.00 11.61  ? 177  VAL A CB    1 
ATOM   2134 C  CG1   . VAL C 3  171 ? 29.724 194.455 43.179 1.00 10.18  ? 177  VAL A CG1   1 
ATOM   2135 C  CG2   . VAL C 3  171 ? 27.600 194.162 44.454 1.00 9.42   ? 177  VAL A CG2   1 
ATOM   2136 N  N     . THR C 3  172 ? 28.634 197.094 41.017 1.00 13.28  ? 178  THR A N     1 
ATOM   2137 C  CA    . THR C 3  172 ? 29.510 197.741 40.042 1.00 12.65  ? 178  THR A CA    1 
ATOM   2138 C  C     . THR C 3  172 ? 29.591 199.223 40.361 1.00 14.87  ? 178  THR A C     1 
ATOM   2139 O  O     . THR C 3  172 ? 30.643 199.851 40.212 1.00 15.64  ? 178  THR A O     1 
ATOM   2140 C  CB    . THR C 3  172 ? 28.987 197.570 38.616 1.00 12.08  ? 178  THR A CB    1 
ATOM   2141 O  OG1   . THR C 3  172 ? 29.037 196.184 38.262 1.00 11.42  ? 178  THR A OG1   1 
ATOM   2142 C  CG2   . THR C 3  172 ? 29.824 198.368 37.642 1.00 9.41   ? 178  THR A CG2   1 
ATOM   2143 N  N     . LYS C 3  173 ? 28.469 199.779 40.803 1.00 15.80  ? 179  LYS A N     1 
ATOM   2144 C  CA    . LYS C 3  173 ? 28.422 201.177 41.170 1.00 17.05  ? 179  LYS A CA    1 
ATOM   2145 C  C     . LYS C 3  173 ? 29.386 201.424 42.332 1.00 18.33  ? 179  LYS A C     1 
ATOM   2146 O  O     . LYS C 3  173 ? 30.150 202.390 42.322 1.00 18.70  ? 179  LYS A O     1 
ATOM   2147 C  CB    . LYS C 3  173 ? 27.010 201.565 41.585 1.00 18.39  ? 179  LYS A CB    1 
ATOM   2148 C  CG    . LYS C 3  173 ? 26.901 202.997 42.063 1.00 20.90  ? 179  LYS A CG    1 
ATOM   2149 C  CD    . LYS C 3  173 ? 25.476 203.331 42.461 1.00 25.99  ? 179  LYS A CD    1 
ATOM   2150 C  CE    . LYS C 3  173 ? 25.396 204.746 43.020 1.00 29.34  ? 179  LYS A CE    1 
ATOM   2151 N  NZ    . LYS C 3  173 ? 26.182 204.893 44.281 1.00 30.74  ? 179  LYS A NZ    1 
ATOM   2152 N  N     . ALA C 3  174 ? 29.358 200.544 43.329 1.00 17.79  ? 180  ALA A N     1 
ATOM   2153 C  CA    . ALA C 3  174 ? 30.238 200.698 44.485 1.00 17.80  ? 180  ALA A CA    1 
ATOM   2154 C  C     . ALA C 3  174 ? 31.706 200.561 44.084 1.00 15.95  ? 180  ALA A C     1 
ATOM   2155 O  O     . ALA C 3  174 ? 32.550 201.344 44.523 1.00 15.54  ? 180  ALA A O     1 
ATOM   2156 C  CB    . ALA C 3  174 ? 29.882 199.674 45.567 1.00 17.06  ? 180  ALA A CB    1 
ATOM   2157 N  N     . LEU C 3  175 ? 32.002 199.568 43.249 1.00 13.94  ? 181  LEU A N     1 
ATOM   2158 C  CA    . LEU C 3  175 ? 33.364 199.345 42.786 1.00 13.21  ? 181  LEU A CA    1 
ATOM   2159 C  C     . LEU C 3  175 ? 33.839 200.617 42.071 1.00 13.57  ? 181  LEU A C     1 
ATOM   2160 O  O     . LEU C 3  175 ? 34.930 201.124 42.336 1.00 12.13  ? 181  LEU A O     1 
ATOM   2161 C  CB    . LEU C 3  175 ? 33.401 198.162 41.816 1.00 11.75  ? 181  LEU A CB    1 
ATOM   2162 C  CG    . LEU C 3  175 ? 34.679 197.324 41.622 1.00 13.12  ? 181  LEU A CG    1 
ATOM   2163 C  CD1   . LEU C 3  175 ? 34.808 197.010 40.146 1.00 11.16  ? 181  LEU A CD1   1 
ATOM   2164 C  CD2   . LEU C 3  175 ? 35.921 198.031 42.101 1.00 7.95   ? 181  LEU A CD2   1 
ATOM   2165 N  N     . LEU C 3  176 ? 33.009 201.128 41.164 1.00 14.07  ? 182  LEU A N     1 
ATOM   2166 C  CA    . LEU C 3  176 ? 33.338 202.342 40.415 1.00 15.42  ? 182  LEU A CA    1 
ATOM   2167 C  C     . LEU C 3  176 ? 33.721 203.501 41.328 1.00 17.29  ? 182  LEU A C     1 
ATOM   2168 O  O     . LEU C 3  176 ? 34.763 204.124 41.141 1.00 19.43  ? 182  LEU A O     1 
ATOM   2169 C  CB    . LEU C 3  176 ? 32.154 202.762 39.544 1.00 14.86  ? 182  LEU A CB    1 
ATOM   2170 C  CG    . LEU C 3  176 ? 32.185 204.150 38.895 1.00 13.20  ? 182  LEU A CG    1 
ATOM   2171 C  CD1   . LEU C 3  176 ? 33.332 204.283 37.893 1.00 11.56  ? 182  LEU A CD1   1 
ATOM   2172 C  CD2   . LEU C 3  176 ? 30.850 204.374 38.214 1.00 13.70  ? 182  LEU A CD2   1 
ATOM   2173 N  N     . GLU C 3  177 ? 32.875 203.794 42.310 1.00 18.64  ? 183  GLU A N     1 
ATOM   2174 C  CA    . GLU C 3  177 ? 33.143 204.885 43.243 1.00 20.77  ? 183  GLU A CA    1 
ATOM   2175 C  C     . GLU C 3  177 ? 34.403 204.656 44.083 1.00 20.43  ? 183  GLU A C     1 
ATOM   2176 O  O     . GLU C 3  177 ? 35.056 205.605 44.521 1.00 21.25  ? 183  GLU A O     1 
ATOM   2177 C  CB    . GLU C 3  177 ? 31.920 205.113 44.134 1.00 20.27  ? 183  GLU A CB    1 
ATOM   2178 C  CG    . GLU C 3  177 ? 30.880 206.005 43.461 1.00 25.49  ? 183  GLU A CG    1 
ATOM   2179 C  CD    . GLU C 3  177 ? 29.483 205.855 44.032 1.00 26.25  ? 183  GLU A CD    1 
ATOM   2180 O  OE1   . GLU C 3  177 ? 29.357 205.611 45.249 1.00 29.30  ? 183  GLU A OE1   1 
ATOM   2181 O  OE2   . GLU C 3  177 ? 28.509 205.997 43.262 1.00 27.74  ? 183  GLU A OE2   1 
ATOM   2182 N  N     . LYS C 3  178 ? 34.751 203.393 44.289 1.00 17.53  ? 184  LYS A N     1 
ATOM   2183 C  CA    . LYS C 3  178 ? 35.937 203.056 45.052 1.00 17.06  ? 184  LYS A CA    1 
ATOM   2184 C  C     . LYS C 3  178 ? 37.181 203.376 44.218 1.00 16.54  ? 184  LYS A C     1 
ATOM   2185 O  O     . LYS C 3  178 ? 38.175 203.887 44.732 1.00 16.81  ? 184  LYS A O     1 
ATOM   2186 C  CB    . LYS C 3  178 ? 35.903 201.574 45.407 1.00 17.30  ? 184  LYS A CB    1 
ATOM   2187 C  CG    . LYS C 3  178 ? 37.111 201.059 46.154 1.00 22.55  ? 184  LYS A CG    1 
ATOM   2188 C  CD    . LYS C 3  178 ? 36.929 199.575 46.487 1.00 26.01  ? 184  LYS A CD    1 
ATOM   2189 C  CE    . LYS C 3  178 ? 38.085 199.027 47.306 1.00 27.35  ? 184  LYS A CE    1 
ATOM   2190 N  NZ    . LYS C 3  178 ? 37.874 197.584 47.646 1.00 30.64  ? 184  LYS A NZ    1 
ATOM   2191 N  N     . LEU C 3  179 ? 37.114 203.080 42.925 1.00 14.70  ? 185  LEU A N     1 
ATOM   2192 C  CA    . LEU C 3  179 ? 38.229 203.330 42.028 1.00 12.70  ? 185  LEU A CA    1 
ATOM   2193 C  C     . LEU C 3  179 ? 38.380 204.827 41.768 1.00 11.84  ? 185  LEU A C     1 
ATOM   2194 O  O     . LEU C 3  179 ? 39.492 205.345 41.669 1.00 10.28  ? 185  LEU A O     1 
ATOM   2195 C  CB    . LEU C 3  179 ? 38.010 202.572 40.713 1.00 12.90  ? 185  LEU A CB    1 
ATOM   2196 C  CG    . LEU C 3  179 ? 37.859 201.050 40.882 1.00 14.66  ? 185  LEU A CG    1 
ATOM   2197 C  CD1   . LEU C 3  179 ? 37.385 200.414 39.595 1.00 11.34  ? 185  LEU A CD1   1 
ATOM   2198 C  CD2   . LEU C 3  179 ? 39.188 200.454 41.310 1.00 15.07  ? 185  LEU A CD2   1 
ATOM   2199 N  N     . LEU C 3  180 ? 37.259 205.527 41.672 1.00 10.60  ? 186  LEU A N     1 
ATOM   2200 C  CA    . LEU C 3  180 ? 37.301 206.961 41.425 1.00 13.12  ? 186  LEU A CA    1 
ATOM   2201 C  C     . LEU C 3  180 ? 37.872 207.706 42.627 1.00 15.13  ? 186  LEU A C     1 
ATOM   2202 O  O     . LEU C 3  180 ? 38.344 208.832 42.494 1.00 17.12  ? 186  LEU A O     1 
ATOM   2203 C  CB    . LEU C 3  180 ? 35.901 207.496 41.095 1.00 9.78   ? 186  LEU A CB    1 
ATOM   2204 C  CG    . LEU C 3  180 ? 35.311 206.954 39.792 1.00 10.04  ? 186  LEU A CG    1 
ATOM   2205 C  CD1   . LEU C 3  180 ? 33.948 207.572 39.523 1.00 5.52   ? 186  LEU A CD1   1 
ATOM   2206 C  CD2   . LEU C 3  180 ? 36.281 207.256 38.646 1.00 7.81   ? 186  LEU A CD2   1 
ATOM   2207 N  N     . SER C 3  181 ? 37.839 207.077 43.798 1.00 15.66  ? 187  SER A N     1 
ATOM   2208 C  CA    . SER C 3  181 ? 38.362 207.728 44.989 1.00 16.23  ? 187  SER A CA    1 
ATOM   2209 C  C     . SER C 3  181 ? 39.884 207.692 45.059 1.00 16.48  ? 187  SER A C     1 
ATOM   2210 O  O     . SER C 3  181 ? 40.474 208.270 45.962 1.00 16.87  ? 187  SER A O     1 
ATOM   2211 C  CB    . SER C 3  181 ? 37.762 207.109 46.257 1.00 14.49  ? 187  SER A CB    1 
ATOM   2212 O  OG    . SER C 3  181 ? 38.285 205.819 46.485 1.00 21.13  ? 187  SER A OG    1 
ATOM   2213 N  N     . ASP C 3  182 ? 40.524 206.996 44.128 1.00 16.92  ? 188  ASP A N     1 
ATOM   2214 C  CA    . ASP C 3  182 ? 41.985 206.938 44.138 1.00 17.54  ? 188  ASP A CA    1 
ATOM   2215 C  C     . ASP C 3  182 ? 42.525 208.235 43.553 1.00 18.20  ? 188  ASP A C     1 
ATOM   2216 O  O     . ASP C 3  182 ? 42.466 208.446 42.337 1.00 16.56  ? 188  ASP A O     1 
ATOM   2217 C  CB    . ASP C 3  182 ? 42.498 205.758 43.320 1.00 17.51  ? 188  ASP A CB    1 
ATOM   2218 C  CG    . ASP C 3  182 ? 43.973 205.492 43.556 1.00 17.02  ? 188  ASP A CG    1 
ATOM   2219 O  OD1   . ASP C 3  182 ? 44.775 206.419 43.360 1.00 18.38  ? 188  ASP A OD1   1 
ATOM   2220 O  OD2   . ASP C 3  182 ? 44.319 204.358 43.948 1.00 16.25  ? 188  ASP A OD2   1 
ATOM   2221 N  N     . LYS C 3  183 ? 43.066 209.086 44.422 1.00 18.47  ? 189  LYS A N     1 
ATOM   2222 C  CA    . LYS C 3  183 ? 43.580 210.384 44.009 1.00 20.07  ? 189  LYS A CA    1 
ATOM   2223 C  C     . LYS C 3  183 ? 44.709 210.374 42.999 1.00 18.01  ? 189  LYS A C     1 
ATOM   2224 O  O     . LYS C 3  183 ? 44.900 211.352 42.290 1.00 16.17  ? 189  LYS A O     1 
ATOM   2225 C  CB    . LYS C 3  183 ? 43.983 211.186 45.238 1.00 24.86  ? 189  LYS A CB    1 
ATOM   2226 C  CG    . LYS C 3  183 ? 42.782 211.887 45.818 1.00 30.65  ? 189  LYS A CG    1 
ATOM   2227 C  CD    . LYS C 3  183 ? 42.977 212.394 47.244 1.00 35.50  ? 189  LYS A CD    1 
ATOM   2228 C  CE    . LYS C 3  183 ? 41.725 213.191 47.687 1.00 40.26  ? 189  LYS A CE    1 
ATOM   2229 N  NZ    . LYS C 3  183 ? 41.623 213.555 49.141 1.00 43.89  ? 189  LYS A NZ    1 
ATOM   2230 N  N     . HIS C 3  184 ? 45.446 209.271 42.926 1.00 17.12  ? 190  HIS A N     1 
ATOM   2231 C  CA    . HIS C 3  184 ? 46.556 209.161 41.987 1.00 16.85  ? 190  HIS A CA    1 
ATOM   2232 C  C     . HIS C 3  184 ? 46.061 209.120 40.540 1.00 15.96  ? 190  HIS A C     1 
ATOM   2233 O  O     . HIS C 3  184 ? 46.727 209.627 39.637 1.00 17.10  ? 190  HIS A O     1 
ATOM   2234 C  CB    . HIS C 3  184 ? 47.408 207.907 42.263 1.00 17.66  ? 190  HIS A CB    1 
ATOM   2235 C  CG    . HIS C 3  184 ? 48.658 207.836 41.434 1.00 19.91  ? 190  HIS A CG    1 
ATOM   2236 N  ND1   . HIS C 3  184 ? 49.792 208.568 41.719 1.00 22.57  ? 190  HIS A ND1   1 
ATOM   2237 C  CD2   . HIS C 3  184 ? 48.945 207.121 40.319 1.00 21.44  ? 190  HIS A CD2   1 
ATOM   2238 C  CE1   . HIS C 3  184 ? 50.725 208.302 40.819 1.00 22.51  ? 190  HIS A CE1   1 
ATOM   2239 N  NE2   . HIS C 3  184 ? 50.236 207.426 39.960 1.00 21.29  ? 190  HIS A NE2   1 
ATOM   2240 N  N     . TYR C 3  185 ? 44.886 208.540 40.318 1.00 13.92  ? 191  TYR A N     1 
ATOM   2241 C  CA    . TYR C 3  185 ? 44.362 208.422 38.967 1.00 12.49  ? 191  TYR A CA    1 
ATOM   2242 C  C     . TYR C 3  185 ? 43.264 209.404 38.633 1.00 14.26  ? 191  TYR A C     1 
ATOM   2243 O  O     . TYR C 3  185 ? 43.058 209.721 37.462 1.00 14.13  ? 191  TYR A O     1 
ATOM   2244 C  CB    . TYR C 3  185 ? 43.878 206.991 38.720 1.00 9.96   ? 191  TYR A CB    1 
ATOM   2245 C  CG    . TYR C 3  185 ? 44.969 205.949 38.859 1.00 10.48  ? 191  TYR A CG    1 
ATOM   2246 C  CD1   . TYR C 3  185 ? 45.344 205.466 40.115 1.00 10.80  ? 191  TYR A CD1   1 
ATOM   2247 C  CD2   . TYR C 3  185 ? 45.661 205.480 37.737 1.00 10.85  ? 191  TYR A CD2   1 
ATOM   2248 C  CE1   . TYR C 3  185 ? 46.371 204.550 40.251 1.00 9.84   ? 191  TYR A CE1   1 
ATOM   2249 C  CE2   . TYR C 3  185 ? 46.696 204.564 37.864 1.00 8.87   ? 191  TYR A CE2   1 
ATOM   2250 C  CZ    . TYR C 3  185 ? 47.042 204.104 39.115 1.00 10.44  ? 191  TYR A CZ    1 
ATOM   2251 O  OH    . TYR C 3  185 ? 48.050 203.173 39.208 1.00 12.87  ? 191  TYR A OH    1 
ATOM   2252 N  N     . PHE C 3  186 ? 42.561 209.880 39.658 1.00 13.55  ? 192  PHE A N     1 
ATOM   2253 C  CA    . PHE C 3  186 ? 41.483 210.835 39.453 1.00 15.12  ? 192  PHE A CA    1 
ATOM   2254 C  C     . PHE C 3  186 ? 41.587 212.029 40.403 1.00 17.52  ? 192  PHE A C     1 
ATOM   2255 O  O     . PHE C 3  186 ? 41.474 211.882 41.620 1.00 15.08  ? 192  PHE A O     1 
ATOM   2256 C  CB    . PHE C 3  186 ? 40.137 210.141 39.644 1.00 11.99  ? 192  PHE A CB    1 
ATOM   2257 C  CG    . PHE C 3  186 ? 39.916 208.998 38.704 1.00 13.67  ? 192  PHE A CG    1 
ATOM   2258 C  CD1   . PHE C 3  186 ? 39.468 209.227 37.405 1.00 9.79   ? 192  PHE A CD1   1 
ATOM   2259 C  CD2   . PHE C 3  186 ? 40.175 207.684 39.109 1.00 10.96  ? 192  PHE A CD2   1 
ATOM   2260 C  CE1   . PHE C 3  186 ? 39.278 208.167 36.526 1.00 9.96   ? 192  PHE A CE1   1 
ATOM   2261 C  CE2   . PHE C 3  186 ? 39.987 206.616 38.235 1.00 10.04  ? 192  PHE A CE2   1 
ATOM   2262 C  CZ    . PHE C 3  186 ? 39.536 206.859 36.939 1.00 10.51  ? 192  PHE A CZ    1 
ATOM   2263 N  N     . PRO C 3  187 ? 41.819 213.230 39.852 1.00 20.61  ? 193  PRO A N     1 
ATOM   2264 C  CA    . PRO C 3  187 ? 41.935 214.461 40.642 1.00 22.30  ? 193  PRO A CA    1 
ATOM   2265 C  C     . PRO C 3  187 ? 40.716 214.610 41.546 1.00 24.65  ? 193  PRO A C     1 
ATOM   2266 O  O     . PRO C 3  187 ? 39.576 214.445 41.107 1.00 24.84  ? 193  PRO A O     1 
ATOM   2267 C  CB    . PRO C 3  187 ? 42.002 215.549 39.574 1.00 21.62  ? 193  PRO A CB    1 
ATOM   2268 C  CG    . PRO C 3  187 ? 42.734 214.859 38.471 1.00 23.07  ? 193  PRO A CG    1 
ATOM   2269 C  CD    . PRO C 3  187 ? 42.065 213.502 38.425 1.00 21.24  ? 193  PRO A CD    1 
ATOM   2270 N  N     . PRO C 3  188 ? 40.947 214.922 42.825 1.00 26.47  ? 194  PRO A N     1 
ATOM   2271 C  CA    . PRO C 3  188 ? 39.880 215.092 43.815 1.00 27.52  ? 194  PRO A CA    1 
ATOM   2272 C  C     . PRO C 3  188 ? 38.924 216.241 43.499 1.00 28.45  ? 194  PRO A C     1 
ATOM   2273 O  O     . PRO C 3  188 ? 37.742 216.172 43.824 1.00 28.92  ? 194  PRO A O     1 
ATOM   2274 C  CB    . PRO C 3  188 ? 40.643 215.349 45.118 1.00 28.49  ? 194  PRO A CB    1 
ATOM   2275 C  CG    . PRO C 3  188 ? 42.051 214.862 44.840 1.00 28.84  ? 194  PRO A CG    1 
ATOM   2276 C  CD    . PRO C 3  188 ? 42.266 215.217 43.407 1.00 26.84  ? 194  PRO A CD    1 
ATOM   2277 N  N     . GLU C 3  189 ? 39.445 217.293 42.870 1.00 28.40  ? 195  GLU A N     1 
ATOM   2278 C  CA    . GLU C 3  189 ? 38.649 218.481 42.548 1.00 30.21  ? 195  GLU A CA    1 
ATOM   2279 C  C     . GLU C 3  189 ? 37.516 218.236 41.560 1.00 29.06  ? 195  GLU A C     1 
ATOM   2280 O  O     . GLU C 3  189 ? 36.710 219.134 41.311 1.00 28.96  ? 195  GLU A O     1 
ATOM   2281 C  CB    . GLU C 3  189 ? 39.533 219.592 41.958 1.00 31.91  ? 195  GLU A CB    1 
ATOM   2282 C  CG    . GLU C 3  189 ? 40.779 219.962 42.755 1.00 38.16  ? 195  GLU A CG    1 
ATOM   2283 C  CD    . GLU C 3  189 ? 41.840 218.870 42.732 1.00 41.52  ? 195  GLU A CD    1 
ATOM   2284 O  OE1   . GLU C 3  189 ? 42.190 218.397 41.627 1.00 42.12  ? 195  GLU A OE1   1 
ATOM   2285 O  OE2   . GLU C 3  189 ? 42.328 218.492 43.822 1.00 43.61  ? 195  GLU A OE2   1 
ATOM   2286 N  N     . ILE C 3  190 ? 37.457 217.030 41.002 1.00 26.35  ? 196  ILE A N     1 
ATOM   2287 C  CA    . ILE C 3  190 ? 36.452 216.698 39.997 1.00 23.64  ? 196  ILE A CA    1 
ATOM   2288 C  C     . ILE C 3  190 ? 35.568 215.510 40.350 1.00 23.07  ? 196  ILE A C     1 
ATOM   2289 O  O     . ILE C 3  190 ? 36.056 214.475 40.793 1.00 23.85  ? 196  ILE A O     1 
ATOM   2290 C  CB    . ILE C 3  190 ? 37.146 216.390 38.645 1.00 23.11  ? 196  ILE A CB    1 
ATOM   2291 C  CG1   . ILE C 3  190 ? 37.973 217.598 38.205 1.00 22.49  ? 196  ILE A CG1   1 
ATOM   2292 C  CG2   . ILE C 3  190 ? 36.117 216.010 37.589 1.00 22.41  ? 196  ILE A CG2   1 
ATOM   2293 C  CD1   . ILE C 3  190 ? 38.900 217.309 37.057 1.00 21.44  ? 196  ILE A CD1   1 
ATOM   2294 N  N     . ASP C 3  191 ? 34.264 215.663 40.149 1.00 22.29  ? 197  ASP A N     1 
ATOM   2295 C  CA    . ASP C 3  191 ? 33.317 214.576 40.396 1.00 21.31  ? 197  ASP A CA    1 
ATOM   2296 C  C     . ASP C 3  191 ? 33.202 213.838 39.062 1.00 19.06  ? 197  ASP A C     1 
ATOM   2297 O  O     . ASP C 3  191 ? 32.434 214.242 38.187 1.00 19.11  ? 197  ASP A O     1 
ATOM   2298 C  CB    . ASP C 3  191 ? 31.946 215.133 40.792 1.00 22.88  ? 197  ASP A CB    1 
ATOM   2299 C  CG    . ASP C 3  191 ? 30.930 214.039 41.098 1.00 27.71  ? 197  ASP A CG    1 
ATOM   2300 O  OD1   . ASP C 3  191 ? 31.210 212.844 40.836 1.00 27.03  ? 197  ASP A OD1   1 
ATOM   2301 O  OD2   . ASP C 3  191 ? 29.836 214.381 41.595 1.00 31.04  ? 197  ASP A OD2   1 
ATOM   2302 N  N     . PHE C 3  192 ? 33.962 212.764 38.898 1.00 16.79  ? 198  PHE A N     1 
ATOM   2303 C  CA    . PHE C 3  192 ? 33.933 212.030 37.645 1.00 13.82  ? 198  PHE A CA    1 
ATOM   2304 C  C     . PHE C 3  192 ? 32.624 211.338 37.298 1.00 14.89  ? 198  PHE A C     1 
ATOM   2305 O  O     . PHE C 3  192 ? 32.486 210.826 36.199 1.00 14.65  ? 198  PHE A O     1 
ATOM   2306 C  CB    . PHE C 3  192 ? 35.082 211.026 37.597 1.00 13.06  ? 198  PHE A CB    1 
ATOM   2307 C  CG    . PHE C 3  192 ? 36.418 211.665 37.389 1.00 11.82  ? 198  PHE A CG    1 
ATOM   2308 C  CD1   . PHE C 3  192 ? 37.152 212.132 38.461 1.00 11.42  ? 198  PHE A CD1   1 
ATOM   2309 C  CD2   . PHE C 3  192 ? 36.916 211.856 36.103 1.00 12.84  ? 198  PHE A CD2   1 
ATOM   2310 C  CE1   . PHE C 3  192 ? 38.369 212.787 38.263 1.00 12.95  ? 198  PHE A CE1   1 
ATOM   2311 C  CE2   . PHE C 3  192 ? 38.122 212.508 35.897 1.00 13.22  ? 198  PHE A CE2   1 
ATOM   2312 C  CZ    . PHE C 3  192 ? 38.850 212.975 36.983 1.00 12.71  ? 198  PHE A CZ    1 
ATOM   2313 N  N     . THR C 3  193 ? 31.667 211.310 38.222 1.00 16.69  ? 199  THR A N     1 
ATOM   2314 C  CA    . THR C 3  193 ? 30.377 210.691 37.937 1.00 16.78  ? 199  THR A CA    1 
ATOM   2315 C  C     . THR C 3  193 ? 29.443 211.781 37.429 1.00 17.93  ? 199  THR A C     1 
ATOM   2316 O  O     . THR C 3  193 ? 28.259 211.544 37.199 1.00 19.10  ? 199  THR A O     1 
ATOM   2317 C  CB    . THR C 3  193 ? 29.716 210.074 39.196 1.00 17.37  ? 199  THR A CB    1 
ATOM   2318 O  OG1   . THR C 3  193 ? 29.405 211.114 40.130 1.00 18.91  ? 199  THR A OG1   1 
ATOM   2319 C  CG2   . THR C 3  193 ? 30.632 209.057 39.856 1.00 16.32  ? 199  THR A CG2   1 
ATOM   2320 N  N     . ASP C 3  194 ? 29.975 212.985 37.260 1.00 18.38  ? 200  ASP A N     1 
ATOM   2321 C  CA    . ASP C 3  194 ? 29.148 214.090 36.801 1.00 19.64  ? 200  ASP A CA    1 
ATOM   2322 C  C     . ASP C 3  194 ? 29.827 214.950 35.739 1.00 19.29  ? 200  ASP A C     1 
ATOM   2323 O  O     . ASP C 3  194 ? 29.813 216.176 35.826 1.00 20.03  ? 200  ASP A O     1 
ATOM   2324 C  CB    . ASP C 3  194 ? 28.744 214.956 37.995 1.00 20.92  ? 200  ASP A CB    1 
ATOM   2325 C  CG    . ASP C 3  194 ? 27.806 216.080 37.607 1.00 25.74  ? 200  ASP A CG    1 
ATOM   2326 O  OD1   . ASP C 3  194 ? 26.784 215.794 36.934 1.00 26.28  ? 200  ASP A OD1   1 
ATOM   2327 O  OD2   . ASP C 3  194 ? 28.089 217.246 37.974 1.00 25.82  ? 200  ASP A OD2   1 
ATOM   2328 N  N     . VAL C 3  195 ? 30.417 214.300 34.739 1.00 18.08  ? 201  VAL A N     1 
ATOM   2329 C  CA    . VAL C 3  195 ? 31.094 214.998 33.655 1.00 15.66  ? 201  VAL A CA    1 
ATOM   2330 C  C     . VAL C 3  195 ? 30.895 214.251 32.340 1.00 14.89  ? 201  VAL A C     1 
ATOM   2331 O  O     . VAL C 3  195 ? 30.593 213.061 32.338 1.00 14.23  ? 201  VAL A O     1 
ATOM   2332 C  CB    . VAL C 3  195 ? 32.613 215.111 33.924 1.00 16.04  ? 201  VAL A CB    1 
ATOM   2333 C  CG1   . VAL C 3  195 ? 32.864 215.985 35.141 1.00 12.92  ? 201  VAL A CG1   1 
ATOM   2334 C  CG2   . VAL C 3  195 ? 33.210 213.721 34.133 1.00 11.12  ? 201  VAL A CG2   1 
ATOM   2335 N  N     . GLY C 3  196 ? 31.060 214.955 31.225 1.00 13.31  ? 202  GLY A N     1 
ATOM   2336 C  CA    . GLY C 3  196 ? 30.922 214.322 29.924 1.00 12.55  ? 202  GLY A CA    1 
ATOM   2337 C  C     . GLY C 3  196 ? 32.116 213.415 29.660 1.00 13.83  ? 202  GLY A C     1 
ATOM   2338 O  O     . GLY C 3  196 ? 33.095 213.425 30.420 1.00 13.20  ? 202  GLY A O     1 
ATOM   2339 N  N     . TYR C 3  197 ? 32.063 212.646 28.577 1.00 12.36  ? 203  TYR A N     1 
ATOM   2340 C  CA    . TYR C 3  197 ? 33.151 211.727 28.289 1.00 13.93  ? 203  TYR A CA    1 
ATOM   2341 C  C     . TYR C 3  197 ? 34.490 212.408 28.002 1.00 14.77  ? 203  TYR A C     1 
ATOM   2342 O  O     . TYR C 3  197 ? 35.528 211.957 28.489 1.00 15.81  ? 203  TYR A O     1 
ATOM   2343 C  CB    . TYR C 3  197 ? 32.759 210.773 27.146 1.00 12.61  ? 203  TYR A CB    1 
ATOM   2344 C  CG    . TYR C 3  197 ? 32.861 211.348 25.759 1.00 11.65  ? 203  TYR A CG    1 
ATOM   2345 C  CD1   . TYR C 3  197 ? 34.078 211.349 25.073 1.00 12.48  ? 203  TYR A CD1   1 
ATOM   2346 C  CD2   . TYR C 3  197 ? 31.744 211.902 25.125 1.00 12.68  ? 203  TYR A CD2   1 
ATOM   2347 C  CE1   . TYR C 3  197 ? 34.181 211.889 23.790 1.00 11.97  ? 203  TYR A CE1   1 
ATOM   2348 C  CE2   . TYR C 3  197 ? 31.835 212.443 23.841 1.00 9.54   ? 203  TYR A CE2   1 
ATOM   2349 C  CZ    . TYR C 3  197 ? 33.053 212.433 23.186 1.00 12.80  ? 203  TYR A CZ    1 
ATOM   2350 O  OH    . TYR C 3  197 ? 33.151 212.976 21.932 1.00 16.62  ? 203  TYR A OH    1 
ATOM   2351 N  N     . THR C 3  198 ? 34.483 213.489 27.231 1.00 13.83  ? 204  THR A N     1 
ATOM   2352 C  CA    . THR C 3  198 ? 35.738 214.162 26.927 1.00 16.18  ? 204  THR A CA    1 
ATOM   2353 C  C     . THR C 3  198 ? 36.465 214.589 28.199 1.00 14.81  ? 204  THR A C     1 
ATOM   2354 O  O     . THR C 3  198 ? 37.677 214.442 28.311 1.00 16.70  ? 204  THR A O     1 
ATOM   2355 C  CB    . THR C 3  198 ? 35.527 215.398 26.040 1.00 20.22  ? 204  THR A CB    1 
ATOM   2356 O  OG1   . THR C 3  198 ? 34.862 215.006 24.829 1.00 24.15  ? 204  THR A OG1   1 
ATOM   2357 C  CG2   . THR C 3  198 ? 36.879 216.024 25.684 1.00 20.50  ? 204  THR A CG2   1 
ATOM   2358 N  N     . THR C 3  199 ? 35.723 215.104 29.167 1.00 13.46  ? 205  THR A N     1 
ATOM   2359 C  CA    . THR C 3  199 ? 36.323 215.528 30.416 1.00 13.14  ? 205  THR A CA    1 
ATOM   2360 C  C     . THR C 3  199 ? 36.884 214.320 31.157 1.00 14.39  ? 205  THR A C     1 
ATOM   2361 O  O     . THR C 3  199 ? 38.000 214.361 31.679 1.00 16.16  ? 205  THR A O     1 
ATOM   2362 C  CB    . THR C 3  199 ? 35.284 216.237 31.296 1.00 12.06  ? 205  THR A CB    1 
ATOM   2363 O  OG1   . THR C 3  199 ? 34.875 217.443 30.650 1.00 12.91  ? 205  THR A OG1   1 
ATOM   2364 C  CG2   . THR C 3  199 ? 35.849 216.565 32.657 1.00 9.86   ? 205  THR A CG2   1 
ATOM   2365 N  N     . PHE C 3  200 ? 36.120 213.236 31.183 1.00 13.11  ? 206  PHE A N     1 
ATOM   2366 C  CA    . PHE C 3  200 ? 36.558 212.032 31.877 1.00 14.67  ? 206  PHE A CA    1 
ATOM   2367 C  C     . PHE C 3  200 ? 37.928 211.549 31.413 1.00 14.48  ? 206  PHE A C     1 
ATOM   2368 O  O     . PHE C 3  200 ? 38.771 211.205 32.234 1.00 16.06  ? 206  PHE A O     1 
ATOM   2369 C  CB    . PHE C 3  200 ? 35.524 210.911 31.709 1.00 13.77  ? 206  PHE A CB    1 
ATOM   2370 C  CG    . PHE C 3  200 ? 35.788 209.710 32.568 1.00 12.76  ? 206  PHE A CG    1 
ATOM   2371 C  CD1   . PHE C 3  200 ? 36.669 208.716 32.152 1.00 14.77  ? 206  PHE A CD1   1 
ATOM   2372 C  CD2   . PHE C 3  200 ? 35.161 209.577 33.804 1.00 12.95  ? 206  PHE A CD2   1 
ATOM   2373 C  CE1   . PHE C 3  200 ? 36.920 207.605 32.959 1.00 13.13  ? 206  PHE A CE1   1 
ATOM   2374 C  CE2   . PHE C 3  200 ? 35.401 208.479 34.617 1.00 9.56   ? 206  PHE A CE2   1 
ATOM   2375 C  CZ    . PHE C 3  200 ? 36.281 207.491 34.198 1.00 12.18  ? 206  PHE A CZ    1 
ATOM   2376 N  N     . TRP C 3  201 ? 38.160 211.529 30.105 1.00 14.66  ? 207  TRP A N     1 
ATOM   2377 C  CA    . TRP C 3  201 ? 39.450 211.063 29.598 1.00 16.26  ? 207  TRP A CA    1 
ATOM   2378 C  C     . TRP C 3  201 ? 40.555 212.106 29.745 1.00 17.88  ? 207  TRP A C     1 
ATOM   2379 O  O     . TRP C 3  201 ? 41.682 211.772 30.114 1.00 18.75  ? 207  TRP A O     1 
ATOM   2380 C  CB    . TRP C 3  201 ? 39.339 210.644 28.124 1.00 13.71  ? 207  TRP A CB    1 
ATOM   2381 C  CG    . TRP C 3  201 ? 38.262 209.611 27.852 1.00 13.64  ? 207  TRP A CG    1 
ATOM   2382 C  CD1   . TRP C 3  201 ? 37.187 209.754 27.022 1.00 12.05  ? 207  TRP A CD1   1 
ATOM   2383 C  CD2   . TRP C 3  201 ? 38.152 208.297 28.425 1.00 11.21  ? 207  TRP A CD2   1 
ATOM   2384 N  NE1   . TRP C 3  201 ? 36.418 208.620 27.044 1.00 13.09  ? 207  TRP A NE1   1 
ATOM   2385 C  CE2   . TRP C 3  201 ? 36.984 207.710 27.894 1.00 12.50  ? 207  TRP A CE2   1 
ATOM   2386 C  CE3   . TRP C 3  201 ? 38.925 207.562 29.335 1.00 12.96  ? 207  TRP A CE3   1 
ATOM   2387 C  CZ2   . TRP C 3  201 ? 36.567 206.419 28.242 1.00 12.10  ? 207  TRP A CZ2   1 
ATOM   2388 C  CZ3   . TRP C 3  201 ? 38.511 206.278 29.681 1.00 11.73  ? 207  TRP A CZ3   1 
ATOM   2389 C  CH2   . TRP C 3  201 ? 37.339 205.720 29.133 1.00 12.65  ? 207  TRP A CH2   1 
ATOM   2390 N  N     . SER C 3  202 ? 40.232 213.371 29.485 1.00 18.48  ? 208  SER A N     1 
ATOM   2391 C  CA    . SER C 3  202 ? 41.240 214.423 29.569 1.00 19.65  ? 208  SER A CA    1 
ATOM   2392 C  C     . SER C 3  202 ? 41.676 214.811 30.982 1.00 19.11  ? 208  SER A C     1 
ATOM   2393 O  O     . SER C 3  202 ? 42.837 215.162 31.192 1.00 18.71  ? 208  SER A O     1 
ATOM   2394 C  CB    . SER C 3  202 ? 40.770 215.670 28.817 1.00 19.03  ? 208  SER A CB    1 
ATOM   2395 O  OG    . SER C 3  202 ? 39.664 216.260 29.458 1.00 24.41  ? 208  SER A OG    1 
ATOM   2396 N  N     . GLU C 3  203 ? 40.761 214.740 31.947 1.00 19.59  ? 209  GLU A N     1 
ATOM   2397 C  CA    . GLU C 3  203 ? 41.077 215.094 33.333 1.00 18.99  ? 209  GLU A CA    1 
ATOM   2398 C  C     . GLU C 3  203 ? 41.677 213.957 34.160 1.00 17.92  ? 209  GLU A C     1 
ATOM   2399 O  O     . GLU C 3  203 ? 42.237 214.201 35.224 1.00 17.78  ? 209  GLU A O     1 
ATOM   2400 C  CB    . GLU C 3  203 ? 39.830 215.602 34.058 1.00 21.23  ? 209  GLU A CB    1 
ATOM   2401 C  CG    . GLU C 3  203 ? 39.179 216.833 33.446 1.00 26.84  ? 209  GLU A CG    1 
ATOM   2402 C  CD    . GLU C 3  203 ? 40.118 218.013 33.352 1.00 29.85  ? 209  GLU A CD    1 
ATOM   2403 O  OE1   . GLU C 3  203 ? 40.922 218.203 34.286 1.00 31.75  ? 209  GLU A OE1   1 
ATOM   2404 O  OE2   . GLU C 3  203 ? 40.041 218.759 32.352 1.00 33.40  ? 209  GLU A OE2   1 
ATOM   2405 N  N     . SER C 3  204 ? 41.543 212.716 33.693 1.00 17.91  ? 210  SER A N     1 
ATOM   2406 C  CA    . SER C 3  204 ? 42.090 211.573 34.428 1.00 16.42  ? 210  SER A CA    1 
ATOM   2407 C  C     . SER C 3  204 ? 43.509 211.277 33.960 1.00 13.93  ? 210  SER A C     1 
ATOM   2408 O  O     . SER C 3  204 ? 43.914 211.721 32.890 1.00 14.02  ? 210  SER A O     1 
ATOM   2409 C  CB    . SER C 3  204 ? 41.206 210.332 34.236 1.00 16.73  ? 210  SER A CB    1 
ATOM   2410 O  OG    . SER C 3  204 ? 41.048 210.008 32.866 1.00 21.02  ? 210  SER A OG    1 
ATOM   2411 N  N     . LEU C 3  205 ? 44.264 210.536 34.761 1.00 13.52  ? 211  LEU A N     1 
ATOM   2412 C  CA    . LEU C 3  205 ? 45.644 210.198 34.407 1.00 13.21  ? 211  LEU A CA    1 
ATOM   2413 C  C     . LEU C 3  205 ? 45.662 209.540 33.023 1.00 12.71  ? 211  LEU A C     1 
ATOM   2414 O  O     . LEU C 3  205 ? 44.752 208.784 32.680 1.00 12.11  ? 211  LEU A O     1 
ATOM   2415 C  CB    . LEU C 3  205 ? 46.240 209.248 35.454 1.00 11.34  ? 211  LEU A CB    1 
ATOM   2416 C  CG    . LEU C 3  205 ? 47.769 209.138 35.527 1.00 13.92  ? 211  LEU A CG    1 
ATOM   2417 C  CD1   . LEU C 3  205 ? 48.355 210.431 36.086 1.00 5.59   ? 211  LEU A CD1   1 
ATOM   2418 C  CD2   . LEU C 3  205 ? 48.158 207.955 36.414 1.00 12.37  ? 211  LEU A CD2   1 
ATOM   2419 N  N     . GLU C 3  206 ? 46.689 209.842 32.229 1.00 12.83  ? 212  GLU A N     1 
ATOM   2420 C  CA    . GLU C 3  206 ? 46.814 209.289 30.883 1.00 12.17  ? 212  GLU A CA    1 
ATOM   2421 C  C     . GLU C 3  206 ? 46.593 207.777 30.838 1.00 11.86  ? 212  GLU A C     1 
ATOM   2422 O  O     . GLU C 3  206 ? 45.983 207.268 29.905 1.00 11.77  ? 212  GLU A O     1 
ATOM   2423 C  CB    . GLU C 3  206 ? 48.189 209.628 30.293 1.00 12.47  ? 212  GLU A CB    1 
ATOM   2424 C  CG    . GLU C 3  206 ? 48.497 208.904 28.986 1.00 15.45  ? 212  GLU A CG    1 
ATOM   2425 C  CD    . GLU C 3  206 ? 49.842 209.297 28.397 1.00 17.88  ? 212  GLU A CD    1 
ATOM   2426 O  OE1   . GLU C 3  206 ? 50.734 209.724 29.165 1.00 19.50  ? 212  GLU A OE1   1 
ATOM   2427 O  OE2   . GLU C 3  206 ? 50.014 209.167 27.165 1.00 19.19  ? 212  GLU A OE2   1 
ATOM   2428 N  N     . ALA C 3  207 ? 47.074 207.070 31.857 1.00 11.38  ? 213  ALA A N     1 
ATOM   2429 C  CA    . ALA C 3  207 ? 46.936 205.618 31.935 1.00 11.31  ? 213  ALA A CA    1 
ATOM   2430 C  C     . ALA C 3  207 ? 45.490 205.125 31.860 1.00 11.46  ? 213  ALA A C     1 
ATOM   2431 O  O     . ALA C 3  207 ? 45.226 204.029 31.365 1.00 9.60   ? 213  ALA A O     1 
ATOM   2432 C  CB    . ALA C 3  207 ? 47.582 205.109 33.214 1.00 9.59   ? 213  ALA A CB    1 
ATOM   2433 N  N     . VAL C 3  208 ? 44.551 205.921 32.357 1.00 9.84   ? 214  VAL A N     1 
ATOM   2434 C  CA    . VAL C 3  208 ? 43.163 205.499 32.312 1.00 10.69  ? 214  VAL A CA    1 
ATOM   2435 C  C     . VAL C 3  208 ? 42.692 205.388 30.869 1.00 12.15  ? 214  VAL A C     1 
ATOM   2436 O  O     . VAL C 3  208 ? 41.982 204.443 30.505 1.00 12.17  ? 214  VAL A O     1 
ATOM   2437 C  CB    . VAL C 3  208 ? 42.248 206.474 33.060 1.00 9.10   ? 214  VAL A CB    1 
ATOM   2438 C  CG1   . VAL C 3  208 ? 40.813 205.993 32.982 1.00 7.03   ? 214  VAL A CG1   1 
ATOM   2439 C  CG2   . VAL C 3  208 ? 42.689 206.577 34.513 1.00 8.73   ? 214  VAL A CG2   1 
ATOM   2440 N  N     . ASP C 3  209 ? 43.105 206.342 30.044 1.00 12.22  ? 215  ASP A N     1 
ATOM   2441 C  CA    . ASP C 3  209 ? 42.708 206.336 28.647 1.00 13.66  ? 215  ASP A CA    1 
ATOM   2442 C  C     . ASP C 3  209 ? 43.370 205.182 27.890 1.00 13.97  ? 215  ASP A C     1 
ATOM   2443 O  O     . ASP C 3  209 ? 42.698 204.428 27.175 1.00 13.82  ? 215  ASP A O     1 
ATOM   2444 C  CB    . ASP C 3  209 ? 43.060 207.676 28.002 1.00 15.25  ? 215  ASP A CB    1 
ATOM   2445 C  CG    . ASP C 3  209 ? 42.545 207.794 26.590 1.00 15.64  ? 215  ASP A CG    1 
ATOM   2446 O  OD1   . ASP C 3  209 ? 41.435 207.296 26.309 1.00 19.59  ? 215  ASP A OD1   1 
ATOM   2447 O  OD2   . ASP C 3  209 ? 43.243 208.397 25.757 1.00 19.03  ? 215  ASP A OD2   1 
ATOM   2448 N  N     . ILE C 3  210 ? 44.679 205.037 28.063 1.00 11.56  ? 216  ILE A N     1 
ATOM   2449 C  CA    . ILE C 3  210 ? 45.419 203.976 27.399 1.00 13.02  ? 216  ILE A CA    1 
ATOM   2450 C  C     . ILE C 3  210 ? 44.836 202.586 27.689 1.00 13.06  ? 216  ILE A C     1 
ATOM   2451 O  O     . ILE C 3  210 ? 44.627 201.784 26.769 1.00 10.86  ? 216  ILE A O     1 
ATOM   2452 C  CB    . ILE C 3  210 ? 46.912 204.009 27.810 1.00 14.68  ? 216  ILE A CB    1 
ATOM   2453 C  CG1   . ILE C 3  210 ? 47.574 205.258 27.226 1.00 15.92  ? 216  ILE A CG1   1 
ATOM   2454 C  CG2   . ILE C 3  210 ? 47.629 202.750 27.322 1.00 14.90  ? 216  ILE A CG2   1 
ATOM   2455 C  CD1   . ILE C 3  210 ? 49.061 205.365 27.529 1.00 19.39  ? 216  ILE A CD1   1 
ATOM   2456 N  N     . GLU C 3  211 ? 44.568 202.306 28.963 1.00 10.89  ? 217  GLU A N     1 
ATOM   2457 C  CA    . GLU C 3  211 ? 44.014 201.015 29.346 1.00 10.72  ? 217  GLU A CA    1 
ATOM   2458 C  C     . GLU C 3  211 ? 42.674 200.706 28.680 1.00 9.80   ? 217  GLU A C     1 
ATOM   2459 O  O     . GLU C 3  211 ? 42.445 199.576 28.245 1.00 10.92  ? 217  GLU A O     1 
ATOM   2460 C  CB    . GLU C 3  211 ? 43.867 200.926 30.865 1.00 10.20  ? 217  GLU A CB    1 
ATOM   2461 C  CG    . GLU C 3  211 ? 45.180 200.705 31.582 1.00 13.88  ? 217  GLU A CG    1 
ATOM   2462 C  CD    . GLU C 3  211 ? 45.949 199.525 31.024 1.00 14.79  ? 217  GLU A CD    1 
ATOM   2463 O  OE1   . GLU C 3  211 ? 45.336 198.452 30.839 1.00 16.25  ? 217  GLU A OE1   1 
ATOM   2464 O  OE2   . GLU C 3  211 ? 47.166 199.669 30.775 1.00 16.37  ? 217  GLU A OE2   1 
ATOM   2465 N  N     . HIS C 3  212 ? 41.788 201.696 28.591 1.00 8.43   ? 218  HIS A N     1 
ATOM   2466 C  CA    . HIS C 3  212 ? 40.494 201.456 27.969 1.00 7.69   ? 218  HIS A CA    1 
ATOM   2467 C  C     . HIS C 3  212 ? 40.619 201.260 26.467 1.00 6.67   ? 218  HIS A C     1 
ATOM   2468 O  O     . HIS C 3  212 ? 39.909 200.444 25.897 1.00 6.66   ? 218  HIS A O     1 
ATOM   2469 C  CB    . HIS C 3  212 ? 39.509 202.594 28.277 1.00 7.10   ? 218  HIS A CB    1 
ATOM   2470 C  CG    . HIS C 3  212 ? 38.898 202.506 29.640 1.00 7.54   ? 218  HIS A CG    1 
ATOM   2471 N  ND1   . HIS C 3  212 ? 39.572 202.865 30.784 1.00 8.22   ? 218  HIS A ND1   1 
ATOM   2472 C  CD2   . HIS C 3  212 ? 37.681 202.061 30.039 1.00 9.55   ? 218  HIS A CD2   1 
ATOM   2473 C  CE1   . HIS C 3  212 ? 38.797 202.645 31.835 1.00 9.08   ? 218  HIS A CE1   1 
ATOM   2474 N  NE2   . HIS C 3  212 ? 37.647 202.156 31.409 1.00 9.47   ? 218  HIS A NE2   1 
ATOM   2475 N  N     . ARG C 3  213 ? 41.516 202.007 25.825 1.00 7.67   ? 219  ARG A N     1 
ATOM   2476 C  CA    . ARG C 3  213 ? 41.717 201.859 24.381 1.00 8.26   ? 219  ARG A CA    1 
ATOM   2477 C  C     . ARG C 3  213 ? 42.351 200.496 24.089 1.00 9.48   ? 219  ARG A C     1 
ATOM   2478 O  O     . ARG C 3  213 ? 42.003 199.837 23.102 1.00 9.47   ? 219  ARG A O     1 
ATOM   2479 C  CB    . ARG C 3  213 ? 42.623 202.971 23.829 1.00 6.92   ? 219  ARG A CB    1 
ATOM   2480 C  CG    . ARG C 3  213 ? 41.937 204.323 23.629 1.00 8.24   ? 219  ARG A CG    1 
ATOM   2481 C  CD    . ARG C 3  213 ? 42.976 205.417 23.404 1.00 9.63   ? 219  ARG A CD    1 
ATOM   2482 N  NE    . ARG C 3  213 ? 42.400 206.745 23.214 1.00 12.08  ? 219  ARG A NE    1 
ATOM   2483 C  CZ    . ARG C 3  213 ? 41.978 207.232 22.045 1.00 16.93  ? 219  ARG A CZ    1 
ATOM   2484 N  NH1   . ARG C 3  213 ? 42.063 206.501 20.940 1.00 17.02  ? 219  ARG A NH1   1 
ATOM   2485 N  NH2   . ARG C 3  213 ? 41.469 208.459 21.976 1.00 14.38  ? 219  ARG A NH2   1 
ATOM   2486 N  N     . ALA C 3  214 ? 43.283 200.068 24.939 1.00 8.32   ? 220  ALA A N     1 
ATOM   2487 C  CA    . ALA C 3  214 ? 43.930 198.778 24.729 1.00 9.33   ? 220  ALA A CA    1 
ATOM   2488 C  C     . ALA C 3  214 ? 42.897 197.650 24.860 1.00 10.55  ? 220  ALA A C     1 
ATOM   2489 O  O     . ALA C 3  214 ? 42.798 196.779 23.994 1.00 11.35  ? 220  ALA A O     1 
ATOM   2490 C  CB    . ALA C 3  214 ? 45.064 198.585 25.733 1.00 8.47   ? 220  ALA A CB    1 
ATOM   2491 N  N     . ALA C 3  215 ? 42.119 197.679 25.938 1.00 9.66   ? 221  ALA A N     1 
ATOM   2492 C  CA    . ALA C 3  215 ? 41.098 196.659 26.169 1.00 9.03   ? 221  ALA A CA    1 
ATOM   2493 C  C     . ALA C 3  215 ? 40.081 196.599 25.030 1.00 8.22   ? 221  ALA A C     1 
ATOM   2494 O  O     . ALA C 3  215 ? 39.633 195.519 24.645 1.00 5.92   ? 221  ALA A O     1 
ATOM   2495 C  CB    . ALA C 3  215 ? 40.378 196.926 27.494 1.00 6.04   ? 221  ALA A CB    1 
ATOM   2496 N  N     . TRP C 3  216 ? 39.714 197.757 24.489 1.00 8.20   ? 222  TRP A N     1 
ATOM   2497 C  CA    . TRP C 3  216 ? 38.740 197.795 23.405 1.00 9.17   ? 222  TRP A CA    1 
ATOM   2498 C  C     . TRP C 3  216 ? 39.348 197.172 22.150 1.00 10.08  ? 222  TRP A C     1 
ATOM   2499 O  O     . TRP C 3  216 ? 38.718 196.344 21.489 1.00 9.82   ? 222  TRP A O     1 
ATOM   2500 C  CB    . TRP C 3  216 ? 38.294 199.241 23.153 1.00 7.42   ? 222  TRP A CB    1 
ATOM   2501 C  CG    . TRP C 3  216 ? 37.173 199.393 22.154 1.00 9.95   ? 222  TRP A CG    1 
ATOM   2502 C  CD1   . TRP C 3  216 ? 37.287 199.454 20.793 1.00 8.76   ? 222  TRP A CD1   1 
ATOM   2503 C  CD2   . TRP C 3  216 ? 35.777 199.556 22.445 1.00 9.19   ? 222  TRP A CD2   1 
ATOM   2504 N  NE1   . TRP C 3  216 ? 36.051 199.655 20.219 1.00 7.40   ? 222  TRP A NE1   1 
ATOM   2505 C  CE2   . TRP C 3  216 ? 35.107 199.723 21.209 1.00 9.10   ? 222  TRP A CE2   1 
ATOM   2506 C  CE3   . TRP C 3  216 ? 35.029 199.583 23.630 1.00 10.44  ? 222  TRP A CE3   1 
ATOM   2507 C  CZ2   . TRP C 3  216 ? 33.720 199.920 21.123 1.00 6.44   ? 222  TRP A CZ2   1 
ATOM   2508 C  CZ3   . TRP C 3  216 ? 33.639 199.780 23.543 1.00 11.14  ? 222  TRP A CZ3   1 
ATOM   2509 C  CH2   . TRP C 3  216 ? 33.008 199.948 22.294 1.00 7.40   ? 222  TRP A CH2   1 
ATOM   2510 N  N     . LEU C 3  217 ? 40.583 197.558 21.839 1.00 11.46  ? 223  LEU A N     1 
ATOM   2511 C  CA    . LEU C 3  217 ? 41.291 197.029 20.679 1.00 10.13  ? 223  LEU A CA    1 
ATOM   2512 C  C     . LEU C 3  217 ? 41.503 195.526 20.818 1.00 11.70  ? 223  LEU A C     1 
ATOM   2513 O  O     . LEU C 3  217 ? 41.257 194.762 19.877 1.00 11.69  ? 223  LEU A O     1 
ATOM   2514 C  CB    . LEU C 3  217 ? 42.643 197.719 20.538 1.00 9.78   ? 223  LEU A CB    1 
ATOM   2515 C  CG    . LEU C 3  217 ? 43.642 197.109 19.556 1.00 10.41  ? 223  LEU A CG    1 
ATOM   2516 C  CD1   . LEU C 3  217 ? 43.036 197.039 18.156 1.00 8.65   ? 223  LEU A CD1   1 
ATOM   2517 C  CD2   . LEU C 3  217 ? 44.908 197.953 19.556 1.00 8.46   ? 223  LEU A CD2   1 
ATOM   2518 N  N     . LEU C 3  218 ? 41.957 195.102 21.995 1.00 10.09  ? 224  LEU A N     1 
ATOM   2519 C  CA    . LEU C 3  218 ? 42.208 193.687 22.236 1.00 11.07  ? 224  LEU A CA    1 
ATOM   2520 C  C     . LEU C 3  218 ? 40.921 192.855 22.283 1.00 10.88  ? 224  LEU A C     1 
ATOM   2521 O  O     . LEU C 3  218 ? 40.928 191.688 21.909 1.00 12.90  ? 224  LEU A O     1 
ATOM   2522 C  CB    . LEU C 3  218 ? 43.033 193.514 23.518 1.00 8.64   ? 224  LEU A CB    1 
ATOM   2523 C  CG    . LEU C 3  218 ? 44.477 194.026 23.379 1.00 9.10   ? 224  LEU A CG    1 
ATOM   2524 C  CD1   . LEU C 3  218 ? 45.138 194.147 24.738 1.00 6.19   ? 224  LEU A CD1   1 
ATOM   2525 C  CD2   . LEU C 3  218 ? 45.271 193.082 22.475 1.00 6.16   ? 224  LEU A CD2   1 
ATOM   2526 N  N     . ALA C 3  219 ? 39.818 193.440 22.735 1.00 10.98  ? 225  ALA A N     1 
ATOM   2527 C  CA    . ALA C 3  219 ? 38.556 192.702 22.757 1.00 11.99  ? 225  ALA A CA    1 
ATOM   2528 C  C     . ALA C 3  219 ? 38.282 192.303 21.307 1.00 13.43  ? 225  ALA A C     1 
ATOM   2529 O  O     . ALA C 3  219 ? 37.938 191.157 21.009 1.00 15.98  ? 225  ALA A O     1 
ATOM   2530 C  CB    . ALA C 3  219 ? 37.442 193.580 23.277 1.00 10.60  ? 225  ALA A CB    1 
ATOM   2531 N  N     . LYS C 3  220 ? 38.467 193.266 20.411 1.00 11.80  ? 226  LYS A N     1 
ATOM   2532 C  CA    . LYS C 3  220 ? 38.282 193.072 18.979 1.00 11.68  ? 226  LYS A CA    1 
ATOM   2533 C  C     . LYS C 3  220 ? 39.195 191.977 18.409 1.00 12.18  ? 226  LYS A C     1 
ATOM   2534 O  O     . LYS C 3  220 ? 38.767 191.167 17.575 1.00 9.95   ? 226  LYS A O     1 
ATOM   2535 C  CB    . LYS C 3  220 ? 38.567 194.388 18.262 1.00 12.02  ? 226  LYS A CB    1 
ATOM   2536 C  CG    . LYS C 3  220 ? 38.660 194.275 16.762 1.00 10.39  ? 226  LYS A CG    1 
ATOM   2537 C  CD    . LYS C 3  220 ? 37.320 194.008 16.115 1.00 8.38   ? 226  LYS A CD    1 
ATOM   2538 C  CE    . LYS C 3  220 ? 37.442 194.315 14.634 1.00 11.10  ? 226  LYS A CE    1 
ATOM   2539 N  NZ    . LYS C 3  220 ? 36.161 194.217 13.904 1.00 13.03  ? 226  LYS A NZ    1 
ATOM   2540 N  N     . GLN C 3  221 ? 40.455 191.972 18.843 1.00 10.50  ? 227  GLN A N     1 
ATOM   2541 C  CA    . GLN C 3  221 ? 41.412 190.975 18.380 1.00 9.42   ? 227  GLN A CA    1 
ATOM   2542 C  C     . GLN C 3  221 ? 40.943 189.588 18.791 1.00 10.83  ? 227  GLN A C     1 
ATOM   2543 O  O     . GLN C 3  221 ? 41.093 188.634 18.036 1.00 11.55  ? 227  GLN A O     1 
ATOM   2544 C  CB    . GLN C 3  221 ? 42.795 191.241 18.970 1.00 10.91  ? 227  GLN A CB    1 
ATOM   2545 C  CG    . GLN C 3  221 ? 43.807 190.147 18.683 1.00 11.93  ? 227  GLN A CG    1 
ATOM   2546 C  CD    . GLN C 3  221 ? 45.132 190.371 19.381 1.00 12.58  ? 227  GLN A CD    1 
ATOM   2547 O  OE1   . GLN C 3  221 ? 45.962 191.158 18.932 1.00 12.92  ? 227  GLN A OE1   1 
ATOM   2548 N  NE2   . GLN C 3  221 ? 45.333 189.680 20.495 1.00 13.68  ? 227  GLN A NE2   1 
ATOM   2549 N  N     . GLU C 3  222 ? 40.377 189.472 19.987 1.00 11.44  ? 228  GLU A N     1 
ATOM   2550 C  CA    . GLU C 3  222 ? 39.888 188.179 20.453 1.00 13.17  ? 228  GLU A CA    1 
ATOM   2551 C  C     . GLU C 3  222 ? 38.806 187.679 19.501 1.00 13.10  ? 228  GLU A C     1 
ATOM   2552 O  O     . GLU C 3  222 ? 38.831 186.530 19.060 1.00 13.98  ? 228  GLU A O     1 
ATOM   2553 C  CB    . GLU C 3  222 ? 39.323 188.291 21.874 1.00 13.34  ? 228  GLU A CB    1 
ATOM   2554 C  CG    . GLU C 3  222 ? 40.385 188.299 22.965 1.00 17.58  ? 228  GLU A CG    1 
ATOM   2555 C  CD    . GLU C 3  222 ? 39.804 188.118 24.367 1.00 21.21  ? 228  GLU A CD    1 
ATOM   2556 O  OE1   . GLU C 3  222 ? 38.793 187.385 24.517 1.00 23.75  ? 228  GLU A OE1   1 
ATOM   2557 O  OE2   . GLU C 3  222 ? 40.371 188.690 25.324 1.00 19.40  ? 228  GLU A OE2   1 
ATOM   2558 N  N     . ARG C 3  223 ? 37.862 188.560 19.189 1.00 12.92  ? 229  ARG A N     1 
ATOM   2559 C  CA    . ARG C 3  223 ? 36.766 188.248 18.281 1.00 10.77  ? 229  ARG A CA    1 
ATOM   2560 C  C     . ARG C 3  223 ? 37.290 187.866 16.903 1.00 10.33  ? 229  ARG A C     1 
ATOM   2561 O  O     . ARG C 3  223 ? 36.724 186.999 16.244 1.00 11.07  ? 229  ARG A O     1 
ATOM   2562 C  CB    . ARG C 3  223 ? 35.832 189.453 18.149 1.00 11.16  ? 229  ARG A CB    1 
ATOM   2563 C  CG    . ARG C 3  223 ? 34.837 189.632 19.286 1.00 10.90  ? 229  ARG A CG    1 
ATOM   2564 C  CD    . ARG C 3  223 ? 34.070 190.942 19.103 1.00 12.54  ? 229  ARG A CD    1 
ATOM   2565 N  NE    . ARG C 3  223 ? 34.501 191.895 20.117 1.00 17.49  ? 229  ARG A NE    1 
ATOM   2566 C  CZ    . ARG C 3  223 ? 34.721 193.182 19.902 1.00 17.19  ? 229  ARG A CZ    1 
ATOM   2567 N  NH1   . ARG C 3  223 ? 34.555 193.702 18.695 1.00 13.67  ? 229  ARG A NH1   1 
ATOM   2568 N  NH2   . ARG C 3  223 ? 35.118 193.943 20.909 1.00 22.31  ? 229  ARG A NH2   1 
ATOM   2569 N  N     . ASN C 3  224 ? 38.363 188.520 16.465 1.00 8.56   ? 230  ASN A N     1 
ATOM   2570 C  CA    . ASN C 3  224 ? 38.945 188.220 15.163 1.00 7.80   ? 230  ASN A CA    1 
ATOM   2571 C  C     . ASN C 3  224 ? 39.430 186.793 15.166 1.00 8.82   ? 230  ASN A C     1 
ATOM   2572 O  O     . ASN C 3  224 ? 39.165 186.035 14.237 1.00 7.45   ? 230  ASN A O     1 
ATOM   2573 C  CB    . ASN C 3  224 ? 40.158 189.106 14.858 1.00 8.71   ? 230  ASN A CB    1 
ATOM   2574 C  CG    . ASN C 3  224 ? 39.799 190.562 14.645 1.00 9.74   ? 230  ASN A CG    1 
ATOM   2575 O  OD1   . ASN C 3  224 ? 38.653 190.903 14.351 1.00 8.02   ? 230  ASN A OD1   1 
ATOM   2576 N  ND2   . ASN C 3  224 ? 40.793 191.429 14.768 1.00 6.34   ? 230  ASN A ND2   1 
ATOM   2577 N  N     . GLY C 3  225 ? 40.156 186.441 16.224 1.00 8.28   ? 231  GLY A N     1 
ATOM   2578 C  CA    . GLY C 3  225 ? 40.713 185.109 16.339 1.00 8.43   ? 231  GLY A CA    1 
ATOM   2579 C  C     . GLY C 3  225 ? 41.944 184.979 15.460 1.00 8.84   ? 231  GLY A C     1 
ATOM   2580 O  O     . GLY C 3  225 ? 42.208 185.841 14.622 1.00 9.27   ? 231  GLY A O     1 
ATOM   2581 N  N     . PHE C 3  226 ? 42.704 183.907 15.656 1.00 9.01   ? 232  PHE A N     1 
ATOM   2582 C  CA    . PHE C 3  226 ? 43.911 183.658 14.870 1.00 9.03   ? 232  PHE A CA    1 
ATOM   2583 C  C     . PHE C 3  226 ? 43.635 182.472 13.928 1.00 9.26   ? 232  PHE A C     1 
ATOM   2584 O  O     . PHE C 3  226 ? 43.374 181.355 14.384 1.00 8.28   ? 232  PHE A O     1 
ATOM   2585 C  CB    . PHE C 3  226 ? 45.072 183.314 15.810 1.00 9.47   ? 232  PHE A CB    1 
ATOM   2586 C  CG    . PHE C 3  226 ? 46.438 183.662 15.267 1.00 11.14  ? 232  PHE A CG    1 
ATOM   2587 C  CD1   . PHE C 3  226 ? 46.765 183.418 13.937 1.00 12.10  ? 232  PHE A CD1   1 
ATOM   2588 C  CD2   . PHE C 3  226 ? 47.413 184.202 16.105 1.00 12.25  ? 232  PHE A CD2   1 
ATOM   2589 C  CE1   . PHE C 3  226 ? 48.045 183.703 13.446 1.00 14.15  ? 232  PHE A CE1   1 
ATOM   2590 C  CE2   . PHE C 3  226 ? 48.697 184.491 15.626 1.00 11.62  ? 232  PHE A CE2   1 
ATOM   2591 C  CZ    . PHE C 3  226 ? 49.011 184.242 14.297 1.00 13.02  ? 232  PHE A CZ    1 
ATOM   2592 N  N     . PRO C 3  227 ? 43.664 182.700 12.603 1.00 9.89   ? 233  PRO A N     1 
ATOM   2593 C  CA    . PRO C 3  227 ? 43.410 181.600 11.655 1.00 9.79   ? 233  PRO A CA    1 
ATOM   2594 C  C     . PRO C 3  227 ? 44.321 180.410 11.953 1.00 11.40  ? 233  PRO A C     1 
ATOM   2595 O  O     . PRO C 3  227 ? 45.548 180.534 11.955 1.00 12.41  ? 233  PRO A O     1 
ATOM   2596 C  CB    . PRO C 3  227 ? 43.684 182.247 10.302 1.00 9.32   ? 233  PRO A CB    1 
ATOM   2597 C  CG    . PRO C 3  227 ? 43.198 183.660 10.526 1.00 9.30   ? 233  PRO A CG    1 
ATOM   2598 C  CD    . PRO C 3  227 ? 43.800 183.985 11.894 1.00 9.92   ? 233  PRO A CD    1 
ATOM   2599 N  N     . PHE C 3  228 ? 43.710 179.252 12.178 1.00 11.66  ? 234  PHE A N     1 
ATOM   2600 C  CA    . PHE C 3  228 ? 44.441 178.049 12.565 1.00 11.05  ? 234  PHE A CA    1 
ATOM   2601 C  C     . PHE C 3  228 ? 44.280 176.877 11.601 1.00 11.99  ? 234  PHE A C     1 
ATOM   2602 O  O     . PHE C 3  228 ? 43.174 176.571 11.163 1.00 14.31  ? 234  PHE A O     1 
ATOM   2603 C  CB    . PHE C 3  228 ? 43.949 177.660 13.963 1.00 10.50  ? 234  PHE A CB    1 
ATOM   2604 C  CG    . PHE C 3  228 ? 44.612 176.458 14.543 1.00 7.53   ? 234  PHE A CG    1 
ATOM   2605 C  CD1   . PHE C 3  228 ? 45.908 176.534 15.047 1.00 9.03   ? 234  PHE A CD1   1 
ATOM   2606 C  CD2   . PHE C 3  228 ? 43.919 175.270 14.654 1.00 5.01   ? 234  PHE A CD2   1 
ATOM   2607 C  CE1   . PHE C 3  228 ? 46.499 175.441 15.661 1.00 8.08   ? 234  PHE A CE1   1 
ATOM   2608 C  CE2   . PHE C 3  228 ? 44.494 174.170 15.265 1.00 7.55   ? 234  PHE A CE2   1 
ATOM   2609 C  CZ    . PHE C 3  228 ? 45.790 174.256 15.773 1.00 9.20   ? 234  PHE A CZ    1 
ATOM   2610 N  N     . ASP C 3  229 ? 45.388 176.206 11.296 1.00 13.75  ? 235  ASP A N     1 
ATOM   2611 C  CA    . ASP C 3  229 ? 45.383 175.061 10.383 1.00 13.67  ? 235  ASP A CA    1 
ATOM   2612 C  C     . ASP C 3  229 ? 45.158 173.751 11.156 1.00 14.64  ? 235  ASP A C     1 
ATOM   2613 O  O     . ASP C 3  229 ? 46.104 173.015 11.460 1.00 14.71  ? 235  ASP A O     1 
ATOM   2614 C  CB    . ASP C 3  229 ? 46.718 174.996 9.627  1.00 14.22  ? 235  ASP A CB    1 
ATOM   2615 C  CG    . ASP C 3  229 ? 46.673 174.046 8.431  1.00 15.59  ? 235  ASP A CG    1 
ATOM   2616 O  OD1   . ASP C 3  229 ? 45.782 173.166 8.388  1.00 14.05  ? 235  ASP A OD1   1 
ATOM   2617 O  OD2   . ASP C 3  229 ? 47.539 174.179 7.539  1.00 16.62  ? 235  ASP A OD2   1 
ATOM   2618 N  N     . THR C 3  230 ? 43.899 173.465 11.468 1.00 14.48  ? 236  THR A N     1 
ATOM   2619 C  CA    . THR C 3  230 ? 43.545 172.266 12.213 1.00 14.38  ? 236  THR A CA    1 
ATOM   2620 C  C     . THR C 3  230 ? 44.121 171.006 11.590 1.00 15.64  ? 236  THR A C     1 
ATOM   2621 O  O     . THR C 3  230 ? 44.766 170.205 12.264 1.00 16.37  ? 236  THR A O     1 
ATOM   2622 C  CB    . THR C 3  230 ? 42.023 172.116 12.296 1.00 14.57  ? 236  THR A CB    1 
ATOM   2623 O  OG1   . THR C 3  230 ? 41.471 173.257 12.961 1.00 13.29  ? 236  THR A OG1   1 
ATOM   2624 C  CG2   . THR C 3  230 ? 41.648 170.858 13.051 1.00 12.64  ? 236  THR A CG2   1 
ATOM   2625 N  N     . LYS C 3  231 ? 43.884 170.836 10.296 1.00 17.39  ? 237  LYS A N     1 
ATOM   2626 C  CA    . LYS C 3  231 ? 44.363 169.667 9.569  1.00 17.91  ? 237  LYS A CA    1 
ATOM   2627 C  C     . LYS C 3  231 ? 45.843 169.408 9.837  1.00 15.83  ? 237  LYS A C     1 
ATOM   2628 O  O     . LYS C 3  231 ? 46.224 168.312 10.224 1.00 14.74  ? 237  LYS A O     1 
ATOM   2629 C  CB    . LYS C 3  231 ? 44.124 169.874 8.072  1.00 21.95  ? 237  LYS A CB    1 
ATOM   2630 C  CG    . LYS C 3  231 ? 43.522 168.683 7.338  1.00 27.72  ? 237  LYS A CG    1 
ATOM   2631 C  CD    . LYS C 3  231 ? 44.586 167.818 6.673  1.00 33.42  ? 237  LYS A CD    1 
ATOM   2632 C  CE    . LYS C 3  231 ? 43.963 166.819 5.684  1.00 36.25  ? 237  LYS A CE    1 
ATOM   2633 N  NZ    . LYS C 3  231 ? 42.966 165.906 6.329  1.00 37.68  ? 237  LYS A NZ    1 
ATOM   2634 N  N     . ALA C 3  232 ? 46.670 170.430 9.643  1.00 14.83  ? 238  ALA A N     1 
ATOM   2635 C  CA    . ALA C 3  232 ? 48.110 170.305 9.848  1.00 14.92  ? 238  ALA A CA    1 
ATOM   2636 C  C     . ALA C 3  232 ? 48.478 169.877 11.263 1.00 15.53  ? 238  ALA A C     1 
ATOM   2637 O  O     . ALA C 3  232 ? 49.398 169.085 11.457 1.00 16.00  ? 238  ALA A O     1 
ATOM   2638 C  CB    . ALA C 3  232 ? 48.804 171.620 9.509  1.00 11.34  ? 238  ALA A CB    1 
ATOM   2639 N  N     . ILE C 3  233 ? 47.760 170.390 12.253 1.00 16.08  ? 239  ILE A N     1 
ATOM   2640 C  CA    . ILE C 3  233 ? 48.061 170.042 13.635 1.00 17.46  ? 239  ILE A CA    1 
ATOM   2641 C  C     . ILE C 3  233 ? 47.631 168.626 13.984 1.00 18.34  ? 239  ILE A C     1 
ATOM   2642 O  O     . ILE C 3  233 ? 48.325 167.932 14.724 1.00 19.48  ? 239  ILE A O     1 
ATOM   2643 C  CB    . ILE C 3  233 ? 47.427 171.069 14.609 1.00 16.44  ? 239  ILE A CB    1 
ATOM   2644 C  CG1   . ILE C 3  233 ? 48.114 172.423 14.406 1.00 13.97  ? 239  ILE A CG1   1 
ATOM   2645 C  CG2   . ILE C 3  233 ? 47.564 170.605 16.059 1.00 13.03  ? 239  ILE A CG2   1 
ATOM   2646 C  CD1   . ILE C 3  233 ? 49.641 172.351 14.417 1.00 11.06  ? 239  ILE A CD1   1 
ATOM   2647 N  N     . GLU C 3  234 ? 46.495 168.192 13.450 1.00 18.98  ? 240  GLU A N     1 
ATOM   2648 C  CA    . GLU C 3  234 ? 46.034 166.837 13.709 1.00 20.66  ? 240  GLU A CA    1 
ATOM   2649 C  C     . GLU C 3  234 ? 47.016 165.858 13.074 1.00 20.68  ? 240  GLU A C     1 
ATOM   2650 O  O     . GLU C 3  234 ? 47.211 164.760 13.589 1.00 20.77  ? 240  GLU A O     1 
ATOM   2651 C  CB    . GLU C 3  234 ? 44.626 166.616 13.145 1.00 22.60  ? 240  GLU A CB    1 
ATOM   2652 C  CG    . GLU C 3  234 ? 43.566 167.489 13.795 1.00 25.83  ? 240  GLU A CG    1 
ATOM   2653 C  CD    . GLU C 3  234 ? 42.200 167.291 13.181 1.00 28.91  ? 240  GLU A CD    1 
ATOM   2654 O  OE1   . GLU C 3  234 ? 42.116 167.254 11.936 1.00 30.03  ? 240  GLU A OE1   1 
ATOM   2655 O  OE2   . GLU C 3  234 ? 41.206 167.184 13.936 1.00 32.73  ? 240  GLU A OE2   1 
ATOM   2656 N  N     . GLU C 3  235 ? 47.645 166.255 11.967 1.00 20.14  ? 241  GLU A N     1 
ATOM   2657 C  CA    . GLU C 3  235 ? 48.616 165.379 11.313 1.00 22.12  ? 241  GLU A CA    1 
ATOM   2658 C  C     . GLU C 3  235 ? 49.899 165.358 12.138 1.00 21.49  ? 241  GLU A C     1 
ATOM   2659 O  O     . GLU C 3  235 ? 50.597 164.346 12.187 1.00 22.54  ? 241  GLU A O     1 
ATOM   2660 C  CB    . GLU C 3  235 ? 48.920 165.846 9.885  1.00 25.60  ? 241  GLU A CB    1 
ATOM   2661 C  CG    . GLU C 3  235 ? 47.678 166.027 9.010  1.00 31.74  ? 241  GLU A CG    1 
ATOM   2662 C  CD    . GLU C 3  235 ? 48.004 166.353 7.553  1.00 35.34  ? 241  GLU A CD    1 
ATOM   2663 O  OE1   . GLU C 3  235 ? 48.920 167.171 7.306  1.00 35.85  ? 241  GLU A OE1   1 
ATOM   2664 O  OE2   . GLU C 3  235 ? 47.326 165.800 6.654  1.00 37.16  ? 241  GLU A OE2   1 
ATOM   2665 N  N     . LEU C 3  236 ? 50.210 166.478 12.785 1.00 20.34  ? 242  LEU A N     1 
ATOM   2666 C  CA    . LEU C 3  236 ? 51.397 166.560 13.634 1.00 19.51  ? 242  LEU A CA    1 
ATOM   2667 C  C     . LEU C 3  236 ? 51.154 165.729 14.893 1.00 19.31  ? 242  LEU A C     1 
ATOM   2668 O  O     . LEU C 3  236 ? 52.077 165.142 15.458 1.00 17.89  ? 242  LEU A O     1 
ATOM   2669 C  CB    . LEU C 3  236 ? 51.672 168.003 14.048 1.00 16.24  ? 242  LEU A CB    1 
ATOM   2670 C  CG    . LEU C 3  236 ? 52.760 168.166 15.116 1.00 18.09  ? 242  LEU A CG    1 
ATOM   2671 C  CD1   . LEU C 3  236 ? 54.130 167.809 14.537 1.00 18.39  ? 242  LEU A CD1   1 
ATOM   2672 C  CD2   . LEU C 3  236 ? 52.761 169.603 15.623 1.00 17.85  ? 242  LEU A CD2   1 
ATOM   2673 N  N     . TYR C 3  237 ? 49.898 165.687 15.323 1.00 19.02  ? 243  TYR A N     1 
ATOM   2674 C  CA    . TYR C 3  237 ? 49.522 164.943 16.515 1.00 20.05  ? 243  TYR A CA    1 
ATOM   2675 C  C     . TYR C 3  237 ? 49.729 163.453 16.268 1.00 20.78  ? 243  TYR A C     1 
ATOM   2676 O  O     . TYR C 3  237 ? 50.255 162.731 17.123 1.00 21.25  ? 243  TYR A O     1 
ATOM   2677 C  CB    . TYR C 3  237 ? 48.064 165.242 16.868 1.00 18.16  ? 243  TYR A CB    1 
ATOM   2678 C  CG    . TYR C 3  237 ? 47.543 164.472 18.054 1.00 17.39  ? 243  TYR A CG    1 
ATOM   2679 C  CD1   . TYR C 3  237 ? 48.385 164.131 19.113 1.00 15.72  ? 243  TYR A CD1   1 
ATOM   2680 C  CD2   . TYR C 3  237 ? 46.195 164.112 18.137 1.00 14.94  ? 243  TYR A CD2   1 
ATOM   2681 C  CE1   . TYR C 3  237 ? 47.900 163.447 20.229 1.00 15.74  ? 243  TYR A CE1   1 
ATOM   2682 C  CE2   . TYR C 3  237 ? 45.699 163.433 19.244 1.00 14.45  ? 243  TYR A CE2   1 
ATOM   2683 C  CZ    . TYR C 3  237 ? 46.559 163.103 20.289 1.00 16.34  ? 243  TYR A CZ    1 
ATOM   2684 O  OH    . TYR C 3  237 ? 46.076 162.437 21.392 1.00 17.93  ? 243  TYR A OH    1 
ATOM   2685 N  N     . VAL C 3  238 ? 49.316 163.004 15.088 1.00 20.76  ? 244  VAL A N     1 
ATOM   2686 C  CA    . VAL C 3  238 ? 49.474 161.613 14.701 1.00 20.60  ? 244  VAL A CA    1 
ATOM   2687 C  C     . VAL C 3  238 ? 50.954 161.248 14.719 1.00 21.53  ? 244  VAL A C     1 
ATOM   2688 O  O     . VAL C 3  238 ? 51.348 160.255 15.322 1.00 22.40  ? 244  VAL A O     1 
ATOM   2689 C  CB    . VAL C 3  238 ? 48.897 161.377 13.293 1.00 20.98  ? 244  VAL A CB    1 
ATOM   2690 C  CG1   . VAL C 3  238 ? 49.373 160.028 12.740 1.00 17.20  ? 244  VAL A CG1   1 
ATOM   2691 C  CG2   . VAL C 3  238 ? 47.375 161.430 13.359 1.00 16.89  ? 244  VAL A CG2   1 
ATOM   2692 N  N     . GLU C 3  239 ? 51.767 162.068 14.062 1.00 22.37  ? 245  GLU A N     1 
ATOM   2693 C  CA    . GLU C 3  239 ? 53.203 161.840 14.008 1.00 23.93  ? 245  GLU A CA    1 
ATOM   2694 C  C     . GLU C 3  239 ? 53.841 161.814 15.398 1.00 24.68  ? 245  GLU A C     1 
ATOM   2695 O  O     . GLU C 3  239 ? 54.691 160.965 15.678 1.00 26.93  ? 245  GLU A O     1 
ATOM   2696 C  CB    . GLU C 3  239 ? 53.883 162.918 13.156 1.00 24.25  ? 245  GLU A CB    1 
ATOM   2697 C  CG    . GLU C 3  239 ? 55.391 162.993 13.368 1.00 26.90  ? 245  GLU A CG    1 
ATOM   2698 C  CD    . GLU C 3  239 ? 56.044 164.134 12.611 1.00 29.82  ? 245  GLU A CD    1 
ATOM   2699 O  OE1   . GLU C 3  239 ? 55.331 165.083 12.225 1.00 31.72  ? 245  GLU A OE1   1 
ATOM   2700 O  OE2   . GLU C 3  239 ? 57.276 164.089 12.418 1.00 31.47  ? 245  GLU A OE2   1 
ATOM   2701 N  N     . LEU C 3  240 ? 53.444 162.745 16.261 1.00 23.25  ? 246  LEU A N     1 
ATOM   2702 C  CA    . LEU C 3  240 ? 53.991 162.807 17.616 1.00 22.67  ? 246  LEU A CA    1 
ATOM   2703 C  C     . LEU C 3  240 ? 53.513 161.637 18.482 1.00 22.22  ? 246  LEU A C     1 
ATOM   2704 O  O     . LEU C 3  240 ? 54.244 161.163 19.353 1.00 23.17  ? 246  LEU A O     1 
ATOM   2705 C  CB    . LEU C 3  240 ? 53.602 164.125 18.293 1.00 20.03  ? 246  LEU A CB    1 
ATOM   2706 C  CG    . LEU C 3  240 ? 54.123 165.426 17.677 1.00 19.03  ? 246  LEU A CG    1 
ATOM   2707 C  CD1   . LEU C 3  240 ? 53.454 166.591 18.381 1.00 16.87  ? 246  LEU A CD1   1 
ATOM   2708 C  CD2   . LEU C 3  240 ? 55.643 165.517 17.793 1.00 15.98  ? 246  LEU A CD2   1 
ATOM   2709 N  N     . ALA C 3  241 ? 52.290 161.177 18.245 1.00 19.97  ? 247  ALA A N     1 
ATOM   2710 C  CA    . ALA C 3  241 ? 51.745 160.065 19.013 1.00 18.71  ? 247  ALA A CA    1 
ATOM   2711 C  C     . ALA C 3  241 ? 52.497 158.792 18.655 1.00 19.06  ? 247  ALA A C     1 
ATOM   2712 O  O     . ALA C 3  241 ? 52.779 157.958 19.520 1.00 19.20  ? 247  ALA A O     1 
ATOM   2713 C  CB    . ALA C 3  241 ? 50.268 159.897 18.715 1.00 17.33  ? 247  ALA A CB    1 
ATOM   2714 N  N     . ALA C 3  242 ? 52.811 158.652 17.371 1.00 18.37  ? 248  ALA A N     1 
ATOM   2715 C  CA    . ALA C 3  242 ? 53.539 157.492 16.877 1.00 19.11  ? 248  ALA A CA    1 
ATOM   2716 C  C     . ALA C 3  242 ? 54.909 157.466 17.550 1.00 18.90  ? 248  ALA A C     1 
ATOM   2717 O  O     . ALA C 3  242 ? 55.314 156.453 18.121 1.00 18.74  ? 248  ALA A O     1 
ATOM   2718 C  CB    . ALA C 3  242 ? 53.691 157.575 15.359 1.00 16.68  ? 248  ALA A CB    1 
ATOM   2719 N  N     . ARG C 3  243 ? 55.610 158.592 17.496 1.00 18.42  ? 249  ARG A N     1 
ATOM   2720 C  CA    . ARG C 3  243 ? 56.921 158.679 18.114 1.00 19.65  ? 249  ARG A CA    1 
ATOM   2721 C  C     . ARG C 3  243 ? 56.833 158.403 19.611 1.00 19.93  ? 249  ARG A C     1 
ATOM   2722 O  O     . ARG C 3  243 ? 57.704 157.742 20.179 1.00 19.29  ? 249  ARG A O     1 
ATOM   2723 C  CB    . ARG C 3  243 ? 57.537 160.054 17.875 1.00 20.78  ? 249  ARG A CB    1 
ATOM   2724 C  CG    . ARG C 3  243 ? 58.967 160.168 18.373 1.00 22.99  ? 249  ARG A CG    1 
ATOM   2725 C  CD    . ARG C 3  243 ? 59.824 159.045 17.811 1.00 21.94  ? 249  ARG A CD    1 
ATOM   2726 N  NE    . ARG C 3  243 ? 61.221 159.170 18.207 1.00 20.03  ? 249  ARG A NE    1 
ATOM   2727 C  CZ    . ARG C 3  243 ? 62.144 158.249 17.956 1.00 22.01  ? 249  ARG A CZ    1 
ATOM   2728 N  NH1   . ARG C 3  243 ? 61.803 157.141 17.313 1.00 21.74  ? 249  ARG A NH1   1 
ATOM   2729 N  NH2   . ARG C 3  243 ? 63.401 158.431 18.347 1.00 20.99  ? 249  ARG A NH2   1 
ATOM   2730 N  N     . ARG C 3  244 ? 55.783 158.901 20.254 1.00 18.99  ? 250  ARG A N     1 
ATOM   2731 C  CA    . ARG C 3  244 ? 55.626 158.661 21.680 1.00 20.16  ? 250  ARG A CA    1 
ATOM   2732 C  C     . ARG C 3  244 ? 55.491 157.160 21.934 1.00 20.40  ? 250  ARG A C     1 
ATOM   2733 O  O     . ARG C 3  244 ? 56.202 156.601 22.768 1.00 20.79  ? 250  ARG A O     1 
ATOM   2734 C  CB    . ARG C 3  244 ? 54.392 159.387 22.232 1.00 17.67  ? 250  ARG A CB    1 
ATOM   2735 C  CG    . ARG C 3  244 ? 54.206 159.202 23.734 1.00 14.65  ? 250  ARG A CG    1 
ATOM   2736 C  CD    . ARG C 3  244 ? 53.084 160.077 24.276 1.00 15.92  ? 250  ARG A CD    1 
ATOM   2737 N  NE    . ARG C 3  244 ? 51.831 159.860 23.560 1.00 15.12  ? 250  ARG A NE    1 
ATOM   2738 C  CZ    . ARG C 3  244 ? 50.735 160.599 23.712 1.00 16.54  ? 250  ARG A CZ    1 
ATOM   2739 N  NH1   . ARG C 3  244 ? 50.719 161.620 24.561 1.00 15.46  ? 250  ARG A NH1   1 
ATOM   2740 N  NH2   . ARG C 3  244 ? 49.652 160.321 23.003 1.00 16.59  ? 250  ARG A NH2   1 
ATOM   2741 N  N     . SER C 3  245 ? 54.584 156.513 21.208 1.00 20.09  ? 251  SER A N     1 
ATOM   2742 C  CA    . SER C 3  245 ? 54.365 155.079 21.371 1.00 20.29  ? 251  SER A CA    1 
ATOM   2743 C  C     . SER C 3  245 ? 55.642 154.273 21.177 1.00 20.05  ? 251  SER A C     1 
ATOM   2744 O  O     . SER C 3  245 ? 55.912 153.328 21.918 1.00 19.09  ? 251  SER A O     1 
ATOM   2745 C  CB    . SER C 3  245 ? 53.307 154.584 20.389 1.00 21.27  ? 251  SER A CB    1 
ATOM   2746 O  OG    . SER C 3  245 ? 52.038 155.139 20.693 1.00 26.43  ? 251  SER A OG    1 
ATOM   2747 N  N     . GLU C 3  246 ? 56.425 154.651 20.175 1.00 19.90  ? 252  GLU A N     1 
ATOM   2748 C  CA    . GLU C 3  246 ? 57.663 153.954 19.885 1.00 20.08  ? 252  GLU A CA    1 
ATOM   2749 C  C     . GLU C 3  246 ? 58.651 154.117 21.033 1.00 19.83  ? 252  GLU A C     1 
ATOM   2750 O  O     . GLU C 3  246 ? 59.262 153.143 21.474 1.00 21.94  ? 252  GLU A O     1 
ATOM   2751 C  CB    . GLU C 3  246 ? 58.256 154.479 18.577 1.00 22.04  ? 252  GLU A CB    1 
ATOM   2752 C  CG    . GLU C 3  246 ? 59.508 153.751 18.107 1.00 26.63  ? 252  GLU A CG    1 
ATOM   2753 C  CD    . GLU C 3  246 ? 59.352 152.234 18.095 1.00 27.34  ? 252  GLU A CD    1 
ATOM   2754 O  OE1   . GLU C 3  246 ? 58.229 151.745 17.837 1.00 28.28  ? 252  GLU A OE1   1 
ATOM   2755 O  OE2   . GLU C 3  246 ? 60.363 151.535 18.330 1.00 28.28  ? 252  GLU A OE2   1 
ATOM   2756 N  N     . LEU C 3  247 ? 58.801 155.339 21.528 1.00 17.67  ? 253  LEU A N     1 
ATOM   2757 C  CA    . LEU C 3  247 ? 59.714 155.583 22.633 1.00 17.95  ? 253  LEU A CA    1 
ATOM   2758 C  C     . LEU C 3  247 ? 59.268 154.830 23.884 1.00 18.16  ? 253  LEU A C     1 
ATOM   2759 O  O     . LEU C 3  247 ? 60.095 154.289 24.622 1.00 16.82  ? 253  LEU A O     1 
ATOM   2760 C  CB    . LEU C 3  247 ? 59.791 157.075 22.933 1.00 17.94  ? 253  LEU A CB    1 
ATOM   2761 C  CG    . LEU C 3  247 ? 60.421 157.911 21.820 1.00 19.23  ? 253  LEU A CG    1 
ATOM   2762 C  CD1   . LEU C 3  247 ? 60.237 159.386 22.132 1.00 19.07  ? 253  LEU A CD1   1 
ATOM   2763 C  CD2   . LEU C 3  247 ? 61.894 157.557 21.680 1.00 18.62  ? 253  LEU A CD2   1 
ATOM   2764 N  N     . LEU C 3  248 ? 57.959 154.801 24.118 1.00 16.90  ? 254  LEU A N     1 
ATOM   2765 C  CA    . LEU C 3  248 ? 57.415 154.116 25.281 1.00 17.01  ? 254  LEU A CA    1 
ATOM   2766 C  C     . LEU C 3  248 ? 57.742 152.628 25.208 1.00 18.48  ? 254  LEU A C     1 
ATOM   2767 O  O     . LEU C 3  248 ? 58.115 152.008 26.208 1.00 18.11  ? 254  LEU A O     1 
ATOM   2768 C  CB    . LEU C 3  248 ? 55.895 154.318 25.362 1.00 14.99  ? 254  LEU A CB    1 
ATOM   2769 C  CG    . LEU C 3  248 ? 55.209 153.648 26.561 1.00 15.63  ? 254  LEU A CG    1 
ATOM   2770 C  CD1   . LEU C 3  248 ? 55.864 154.128 27.853 1.00 15.18  ? 254  LEU A CD1   1 
ATOM   2771 C  CD2   . LEU C 3  248 ? 53.721 153.967 26.570 1.00 12.16  ? 254  LEU A CD2   1 
ATOM   2772 N  N     . ARG C 3  249 ? 57.609 152.065 24.011 1.00 20.05  ? 255  ARG A N     1 
ATOM   2773 C  CA    . ARG C 3  249 ? 57.882 150.651 23.789 1.00 21.05  ? 255  ARG A CA    1 
ATOM   2774 C  C     . ARG C 3  249 ? 59.339 150.330 24.111 1.00 20.86  ? 255  ARG A C     1 
ATOM   2775 O  O     . ARG C 3  249 ? 59.624 149.368 24.818 1.00 19.70  ? 255  ARG A O     1 
ATOM   2776 C  CB    . ARG C 3  249 ? 57.581 150.283 22.333 1.00 22.45  ? 255  ARG A CB    1 
ATOM   2777 C  CG    . ARG C 3  249 ? 57.616 148.791 22.034 1.00 20.23  ? 255  ARG A CG    1 
ATOM   2778 C  CD    . ARG C 3  249 ? 57.511 148.556 20.541 1.00 21.36  ? 255  ARG A CD    1 
ATOM   2779 N  NE    . ARG C 3  249 ? 58.712 149.015 19.849 1.00 22.04  ? 255  ARG A NE    1 
ATOM   2780 C  CZ    . ARG C 3  249 ? 59.867 148.355 19.851 1.00 21.99  ? 255  ARG A CZ    1 
ATOM   2781 N  NH1   . ARG C 3  249 ? 59.970 147.204 20.504 1.00 20.69  ? 255  ARG A NH1   1 
ATOM   2782 N  NH2   . ARG C 3  249 ? 60.922 148.847 19.211 1.00 19.89  ? 255  ARG A NH2   1 
ATOM   2783 N  N     . LYS C 3  250 ? 60.259 151.136 23.586 1.00 21.22  ? 256  LYS A N     1 
ATOM   2784 C  CA    . LYS C 3  250 ? 61.678 150.922 23.837 1.00 21.52  ? 256  LYS A CA    1 
ATOM   2785 C  C     . LYS C 3  250 ? 62.033 151.129 25.302 1.00 21.96  ? 256  LYS A C     1 
ATOM   2786 O  O     . LYS C 3  250 ? 62.778 150.343 25.883 1.00 22.17  ? 256  LYS A O     1 
ATOM   2787 C  CB    . LYS C 3  250 ? 62.526 151.858 22.980 1.00 21.44  ? 256  LYS A CB    1 
ATOM   2788 C  CG    . LYS C 3  250 ? 62.716 151.384 21.556 1.00 27.38  ? 256  LYS A CG    1 
ATOM   2789 C  CD    . LYS C 3  250 ? 63.678 152.284 20.798 1.00 29.95  ? 256  LYS A CD    1 
ATOM   2790 C  CE    . LYS C 3  250 ? 63.959 151.747 19.402 1.00 33.61  ? 256  LYS A CE    1 
ATOM   2791 N  NZ    . LYS C 3  250 ? 64.639 150.416 19.449 1.00 35.83  ? 256  LYS A NZ    1 
ATOM   2792 N  N     . LEU C 3  251 ? 61.503 152.191 25.897 1.00 22.33  ? 257  LEU A N     1 
ATOM   2793 C  CA    . LEU C 3  251 ? 61.782 152.492 27.293 1.00 22.15  ? 257  LEU A CA    1 
ATOM   2794 C  C     . LEU C 3  251 ? 61.236 151.420 28.231 1.00 23.74  ? 257  LEU A C     1 
ATOM   2795 O  O     . LEU C 3  251 ? 61.860 151.099 29.241 1.00 21.95  ? 257  LEU A O     1 
ATOM   2796 C  CB    . LEU C 3  251 ? 61.203 153.863 27.662 1.00 20.93  ? 257  LEU A CB    1 
ATOM   2797 C  CG    . LEU C 3  251 ? 61.988 155.056 27.100 1.00 21.60  ? 257  LEU A CG    1 
ATOM   2798 C  CD1   . LEU C 3  251 ? 61.284 156.358 27.433 1.00 16.88  ? 257  LEU A CD1   1 
ATOM   2799 C  CD2   . LEU C 3  251 ? 63.401 155.049 27.684 1.00 21.51  ? 257  LEU A CD2   1 
ATOM   2800 N  N     . THR C 3  252 ? 60.078 150.859 27.897 1.00 25.12  ? 258  THR A N     1 
ATOM   2801 C  CA    . THR C 3  252 ? 59.493 149.831 28.742 1.00 28.09  ? 258  THR A CA    1 
ATOM   2802 C  C     . THR C 3  252 ? 60.260 148.521 28.616 1.00 29.16  ? 258  THR A C     1 
ATOM   2803 O  O     . THR C 3  252 ? 60.316 147.734 29.562 1.00 29.40  ? 258  THR A O     1 
ATOM   2804 C  CB    . THR C 3  252 ? 58.010 149.607 28.408 1.00 28.17  ? 258  THR A CB    1 
ATOM   2805 O  OG1   . THR C 3  252 ? 57.865 149.367 27.007 1.00 31.34  ? 258  THR A OG1   1 
ATOM   2806 C  CG2   . THR C 3  252 ? 57.196 150.828 28.791 1.00 27.28  ? 258  THR A CG2   1 
ATOM   2807 N  N     . GLU C 3  253 ? 60.863 148.293 27.454 1.00 30.27  ? 259  GLU A N     1 
ATOM   2808 C  CA    . GLU C 3  253 ? 61.644 147.079 27.236 1.00 31.44  ? 259  GLU A CA    1 
ATOM   2809 C  C     . GLU C 3  253 ? 62.894 147.197 28.103 1.00 30.54  ? 259  GLU A C     1 
ATOM   2810 O  O     . GLU C 3  253 ? 63.317 146.235 28.742 1.00 30.51  ? 259  GLU A O     1 
ATOM   2811 C  CB    . GLU C 3  253 ? 62.030 146.959 25.756 1.00 35.49  ? 259  GLU A CB    1 
ATOM   2812 C  CG    . GLU C 3  253 ? 62.691 145.639 25.334 1.00 43.53  ? 259  GLU A CG    1 
ATOM   2813 C  CD    . GLU C 3  253 ? 64.195 145.577 25.620 1.00 48.45  ? 259  GLU A CD    1 
ATOM   2814 O  OE1   . GLU C 3  253 ? 64.926 146.500 25.187 1.00 49.68  ? 259  GLU A OE1   1 
ATOM   2815 O  OE2   . GLU C 3  253 ? 64.649 144.599 26.265 1.00 49.96  ? 259  GLU A OE2   1 
ATOM   2816 N  N     . THR C 3  254 ? 63.459 148.400 28.143 1.00 27.90  ? 260  THR A N     1 
ATOM   2817 C  CA    . THR C 3  254 ? 64.664 148.662 28.916 1.00 25.74  ? 260  THR A CA    1 
ATOM   2818 C  C     . THR C 3  254 ? 64.429 148.736 30.420 1.00 25.71  ? 260  THR A C     1 
ATOM   2819 O  O     . THR C 3  254 ? 65.199 148.180 31.201 1.00 26.46  ? 260  THR A O     1 
ATOM   2820 C  CB    . THR C 3  254 ? 65.324 149.964 28.458 1.00 24.95  ? 260  THR A CB    1 
ATOM   2821 O  OG1   . THR C 3  254 ? 65.794 149.805 27.114 1.00 23.50  ? 260  THR A OG1   1 
ATOM   2822 C  CG2   . THR C 3  254 ? 66.488 150.328 29.370 1.00 22.51  ? 260  THR A CG2   1 
ATOM   2823 N  N     . PHE C 3  255 ? 63.380 149.439 30.825 1.00 24.06  ? 261  PHE A N     1 
ATOM   2824 C  CA    . PHE C 3  255 ? 63.055 149.567 32.239 1.00 23.41  ? 261  PHE A CA    1 
ATOM   2825 C  C     . PHE C 3  255 ? 61.756 148.812 32.493 1.00 25.24  ? 261  PHE A C     1 
ATOM   2826 O  O     . PHE C 3  255 ? 60.681 149.256 32.086 1.00 27.55  ? 261  PHE A O     1 
ATOM   2827 C  CB    . PHE C 3  255 ? 62.897 151.039 32.605 1.00 21.07  ? 261  PHE A CB    1 
ATOM   2828 C  CG    . PHE C 3  255 ? 64.129 151.851 32.363 1.00 20.68  ? 261  PHE A CG    1 
ATOM   2829 C  CD1   . PHE C 3  255 ? 65.286 151.626 33.108 1.00 21.03  ? 261  PHE A CD1   1 
ATOM   2830 C  CD2   . PHE C 3  255 ? 64.146 152.834 31.381 1.00 18.37  ? 261  PHE A CD2   1 
ATOM   2831 C  CE1   . PHE C 3  255 ? 66.438 152.372 32.874 1.00 18.80  ? 261  PHE A CE1   1 
ATOM   2832 C  CE2   . PHE C 3  255 ? 65.292 153.579 31.144 1.00 15.91  ? 261  PHE A CE2   1 
ATOM   2833 C  CZ    . PHE C 3  255 ? 66.436 153.349 31.888 1.00 17.23  ? 261  PHE A CZ    1 
ATOM   2834 N  N     . GLY C 3  256 ? 61.860 147.666 33.159 1.00 24.93  ? 262  GLY A N     1 
ATOM   2835 C  CA    . GLY C 3  256 ? 60.686 146.857 33.427 1.00 24.77  ? 262  GLY A CA    1 
ATOM   2836 C  C     . GLY C 3  256 ? 59.780 147.386 34.516 1.00 24.93  ? 262  GLY A C     1 
ATOM   2837 O  O     . GLY C 3  256 ? 60.135 148.319 35.238 1.00 25.70  ? 262  GLY A O     1 
ATOM   2838 N  N     . SER C 3  257 ? 58.600 146.781 34.623 1.00 24.79  ? 263  SER A N     1 
ATOM   2839 C  CA    . SER C 3  257 ? 57.606 147.155 35.623 1.00 24.79  ? 263  SER A CA    1 
ATOM   2840 C  C     . SER C 3  257 ? 58.000 146.596 36.990 1.00 25.12  ? 263  SER A C     1 
ATOM   2841 O  O     . SER C 3  257 ? 58.882 145.744 37.085 1.00 25.71  ? 263  SER A O     1 
ATOM   2842 C  CB    . SER C 3  257 ? 56.242 146.608 35.218 1.00 24.60  ? 263  SER A CB    1 
ATOM   2843 O  OG    . SER C 3  257 ? 56.282 145.192 35.129 1.00 30.90  ? 263  SER A OG    1 
ATOM   2844 N  N     . TRP C 3  258 ? 57.346 147.069 38.045 1.00 24.41  ? 264  TRP A N     1 
ATOM   2845 C  CA    . TRP C 3  258 ? 57.660 146.606 39.388 1.00 25.25  ? 264  TRP A CA    1 
ATOM   2846 C  C     . TRP C 3  258 ? 56.476 146.769 40.322 1.00 26.48  ? 264  TRP A C     1 
ATOM   2847 O  O     . TRP C 3  258 ? 55.490 147.417 39.978 1.00 27.51  ? 264  TRP A O     1 
ATOM   2848 C  CB    . TRP C 3  258 ? 58.848 147.388 39.940 1.00 26.34  ? 264  TRP A CB    1 
ATOM   2849 C  CG    . TRP C 3  258 ? 58.553 148.844 40.151 1.00 28.14  ? 264  TRP A CG    1 
ATOM   2850 C  CD1   . TRP C 3  258 ? 58.087 149.431 41.294 1.00 27.95  ? 264  TRP A CD1   1 
ATOM   2851 C  CD2   . TRP C 3  258 ? 58.661 149.891 39.177 1.00 27.54  ? 264  TRP A CD2   1 
ATOM   2852 N  NE1   . TRP C 3  258 ? 57.897 150.778 41.089 1.00 28.54  ? 264  TRP A NE1   1 
ATOM   2853 C  CE2   . TRP C 3  258 ? 58.241 151.086 39.799 1.00 27.12  ? 264  TRP A CE2   1 
ATOM   2854 C  CE3   . TRP C 3  258 ? 59.071 149.934 37.836 1.00 28.18  ? 264  TRP A CE3   1 
ATOM   2855 C  CZ2   . TRP C 3  258 ? 58.219 152.313 39.127 1.00 27.63  ? 264  TRP A CZ2   1 
ATOM   2856 C  CZ3   . TRP C 3  258 ? 59.048 151.159 37.165 1.00 26.91  ? 264  TRP A CZ3   1 
ATOM   2857 C  CH2   . TRP C 3  258 ? 58.625 152.328 37.814 1.00 26.94  ? 264  TRP A CH2   1 
ATOM   2858 N  N     . TYR C 3  259 ? 56.580 146.185 41.511 1.00 26.96  ? 265  TYR A N     1 
ATOM   2859 C  CA    . TYR C 3  259 ? 55.508 146.277 42.488 1.00 26.71  ? 265  TYR A CA    1 
ATOM   2860 C  C     . TYR C 3  259 ? 55.819 147.257 43.607 1.00 26.80  ? 265  TYR A C     1 
ATOM   2861 O  O     . TYR C 3  259 ? 56.957 147.362 44.067 1.00 25.99  ? 265  TYR A O     1 
ATOM   2862 C  CB    . TYR C 3  259 ? 55.206 144.904 43.091 1.00 27.34  ? 265  TYR A CB    1 
ATOM   2863 C  CG    . TYR C 3  259 ? 54.445 143.981 42.169 1.00 27.96  ? 265  TYR A CG    1 
ATOM   2864 C  CD1   . TYR C 3  259 ? 55.096 143.286 41.148 1.00 27.81  ? 265  TYR A CD1   1 
ATOM   2865 C  CD2   . TYR C 3  259 ? 53.066 143.817 42.307 1.00 27.39  ? 265  TYR A CD2   1 
ATOM   2866 C  CE1   . TYR C 3  259 ? 54.391 142.450 40.288 1.00 28.70  ? 265  TYR A CE1   1 
ATOM   2867 C  CE2   . TYR C 3  259 ? 52.352 142.988 41.454 1.00 28.03  ? 265  TYR A CE2   1 
ATOM   2868 C  CZ    . TYR C 3  259 ? 53.018 142.306 40.446 1.00 29.38  ? 265  TYR A CZ    1 
ATOM   2869 O  OH    . TYR C 3  259 ? 52.312 141.486 39.595 1.00 31.25  ? 265  TYR A OH    1 
ATOM   2870 N  N     . GLN C 3  260 ? 54.787 147.975 44.031 1.00 27.27  ? 266  GLN A N     1 
ATOM   2871 C  CA    . GLN C 3  260 ? 54.895 148.953 45.106 1.00 29.01  ? 266  GLN A CA    1 
ATOM   2872 C  C     . GLN C 3  260 ? 53.764 148.733 46.089 1.00 27.97  ? 266  GLN A C     1 
ATOM   2873 O  O     . GLN C 3  260 ? 52.683 148.271 45.717 1.00 27.07  ? 266  GLN A O     1 
ATOM   2874 C  CB    . GLN C 3  260 ? 54.765 150.387 44.577 1.00 30.38  ? 266  GLN A CB    1 
ATOM   2875 C  CG    . GLN C 3  260 ? 55.991 150.963 43.906 1.00 33.32  ? 266  GLN A CG    1 
ATOM   2876 C  CD    . GLN C 3  260 ? 55.771 152.395 43.445 1.00 35.19  ? 266  GLN A CD    1 
ATOM   2877 O  OE1   . GLN C 3  260 ? 56.693 153.050 42.960 1.00 35.51  ? 266  GLN A OE1   1 
ATOM   2878 N  NE2   . GLN C 3  260 ? 54.539 152.887 43.594 1.00 35.51  ? 266  GLN A NE2   1 
ATOM   2879 N  N     . PRO C 3  261 ? 54.004 149.048 47.366 1.00 28.58  ? 267  PRO A N     1 
ATOM   2880 C  CA    . PRO C 3  261 ? 52.941 148.871 48.356 1.00 29.13  ? 267  PRO A CA    1 
ATOM   2881 C  C     . PRO C 3  261 ? 51.867 149.909 48.052 1.00 29.60  ? 267  PRO A C     1 
ATOM   2882 O  O     . PRO C 3  261 ? 52.180 151.025 47.640 1.00 29.40  ? 267  PRO A O     1 
ATOM   2883 C  CB    . PRO C 3  261 ? 53.657 149.118 49.686 1.00 28.65  ? 267  PRO A CB    1 
ATOM   2884 C  CG    . PRO C 3  261 ? 54.810 150.004 49.307 1.00 28.85  ? 267  PRO A CG    1 
ATOM   2885 C  CD    . PRO C 3  261 ? 55.277 149.419 48.006 1.00 27.41  ? 267  PRO A CD    1 
ATOM   2886 N  N     . LYS C 3  262 ? 50.607 149.532 48.224 1.00 31.28  ? 268  LYS A N     1 
ATOM   2887 C  CA    . LYS C 3  262 ? 49.502 150.443 47.952 1.00 34.45  ? 268  LYS A CA    1 
ATOM   2888 C  C     . LYS C 3  262 ? 48.190 149.938 48.536 1.00 35.39  ? 268  LYS A C     1 
ATOM   2889 O  O     . LYS C 3  262 ? 47.780 148.807 48.276 1.00 36.20  ? 268  LYS A O     1 
ATOM   2890 C  CB    . LYS C 3  262 ? 49.349 150.641 46.439 1.00 36.42  ? 268  LYS A CB    1 
ATOM   2891 C  CG    . LYS C 3  262 ? 48.005 151.219 46.011 1.00 38.98  ? 268  LYS A CG    1 
ATOM   2892 C  CD    . LYS C 3  262 ? 47.743 152.570 46.657 1.00 43.74  ? 268  LYS A CD    1 
ATOM   2893 C  CE    . LYS C 3  262 ? 48.576 153.673 46.023 1.00 46.04  ? 268  LYS A CE    1 
ATOM   2894 N  NZ    . LYS C 3  262 ? 48.162 153.913 44.611 1.00 48.62  ? 268  LYS A NZ    1 
ATOM   2895 N  N     . GLY C 3  263 ? 47.535 150.781 49.328 1.00 36.00  ? 269  GLY A N     1 
ATOM   2896 C  CA    . GLY C 3  263 ? 46.266 150.395 49.916 1.00 37.81  ? 269  GLY A CA    1 
ATOM   2897 C  C     . GLY C 3  263 ? 46.375 149.833 51.319 1.00 39.79  ? 269  GLY A C     1 
ATOM   2898 O  O     . GLY C 3  263 ? 45.381 149.376 51.889 1.00 39.94  ? 269  GLY A O     1 
ATOM   2899 N  N     . GLY C 3  264 ? 47.583 149.857 51.877 1.00 40.59  ? 270  GLY A N     1 
ATOM   2900 C  CA    . GLY C 3  264 ? 47.776 149.356 53.225 1.00 41.33  ? 270  GLY A CA    1 
ATOM   2901 C  C     . GLY C 3  264 ? 47.188 150.333 54.224 1.00 41.45  ? 270  GLY A C     1 
ATOM   2902 O  O     . GLY C 3  264 ? 47.377 151.542 54.101 1.00 41.27  ? 270  GLY A O     1 
ATOM   2903 N  N     . THR C 3  265 ? 46.476 149.816 55.218 1.00 41.87  ? 271  THR A N     1 
ATOM   2904 C  CA    . THR C 3  265 ? 45.855 150.667 56.225 1.00 43.18  ? 271  THR A CA    1 
ATOM   2905 C  C     . THR C 3  265 ? 46.498 150.567 57.609 1.00 43.68  ? 271  THR A C     1 
ATOM   2906 O  O     . THR C 3  265 ? 46.806 151.585 58.225 1.00 44.35  ? 271  THR A O     1 
ATOM   2907 C  CB    . THR C 3  265 ? 44.354 150.346 56.358 1.00 43.33  ? 271  THR A CB    1 
ATOM   2908 O  OG1   . THR C 3  265 ? 44.185 148.941 56.589 1.00 45.13  ? 271  THR A OG1   1 
ATOM   2909 C  CG2   . THR C 3  265 ? 43.612 150.736 55.091 1.00 44.01  ? 271  THR A CG2   1 
ATOM   2910 N  N     . GLU C 3  266 ? 46.708 149.342 58.086 1.00 43.74  ? 272  GLU A N     1 
ATOM   2911 C  CA    . GLU C 3  266 ? 47.291 149.114 59.406 1.00 43.04  ? 272  GLU A CA    1 
ATOM   2912 C  C     . GLU C 3  266 ? 48.807 149.261 59.440 1.00 42.42  ? 272  GLU A C     1 
ATOM   2913 O  O     . GLU C 3  266 ? 49.485 149.175 58.419 1.00 42.31  ? 272  GLU A O     1 
ATOM   2914 C  CB    . GLU C 3  266 ? 46.935 147.713 59.905 1.00 43.93  ? 272  GLU A CB    1 
ATOM   2915 C  CG    . GLU C 3  266 ? 45.577 147.218 59.454 1.00 45.89  ? 272  GLU A CG    1 
ATOM   2916 C  CD    . GLU C 3  266 ? 45.383 145.737 59.722 1.00 47.06  ? 272  GLU A CD    1 
ATOM   2917 O  OE1   . GLU C 3  266 ? 44.476 145.136 59.106 1.00 48.00  ? 272  GLU A OE1   1 
ATOM   2918 O  OE2   . GLU C 3  266 ? 46.133 145.175 60.551 1.00 47.31  ? 272  GLU A OE2   1 
ATOM   2919 N  N     . MET C 3  267 ? 49.325 149.467 60.643 1.00 41.94  ? 273  MET A N     1 
ATOM   2920 C  CA    . MET C 3  267 ? 50.754 149.617 60.883 1.00 40.80  ? 273  MET A CA    1 
ATOM   2921 C  C     . MET C 3  267 ? 51.399 148.248 61.088 1.00 40.12  ? 273  MET A C     1 
ATOM   2922 O  O     . MET C 3  267 ? 50.829 147.393 61.762 1.00 39.28  ? 273  MET A O     1 
ATOM   2923 C  CB    . MET C 3  267 ? 50.965 150.450 62.145 1.00 41.56  ? 273  MET A CB    1 
ATOM   2924 C  CG    . MET C 3  267 ? 52.400 150.525 62.610 1.00 42.88  ? 273  MET A CG    1 
ATOM   2925 S  SD    . MET C 3  267 ? 53.353 151.553 61.511 1.00 45.51  ? 273  MET A SD    1 
ATOM   2926 C  CE    . MET C 3  267 ? 52.869 153.188 62.114 1.00 45.06  ? 273  MET A CE    1 
ATOM   2927 N  N     . PHE C 3  268 ? 52.582 148.033 60.521 1.00 39.87  ? 274  PHE A N     1 
ATOM   2928 C  CA    . PHE C 3  268 ? 53.256 146.757 60.717 1.00 40.39  ? 274  PHE A CA    1 
ATOM   2929 C  C     . PHE C 3  268 ? 54.023 146.798 62.033 1.00 41.16  ? 274  PHE A C     1 
ATOM   2930 O  O     . PHE C 3  268 ? 54.787 147.728 62.286 1.00 39.49  ? 274  PHE A O     1 
ATOM   2931 C  CB    . PHE C 3  268 ? 54.236 146.451 59.586 1.00 39.98  ? 274  PHE A CB    1 
ATOM   2932 C  CG    . PHE C 3  268 ? 54.925 145.121 59.742 1.00 39.10  ? 274  PHE A CG    1 
ATOM   2933 C  CD1   . PHE C 3  268 ? 54.197 143.937 59.669 1.00 39.01  ? 274  PHE A CD1   1 
ATOM   2934 C  CD2   . PHE C 3  268 ? 56.288 145.051 60.014 1.00 39.34  ? 274  PHE A CD2   1 
ATOM   2935 C  CE1   . PHE C 3  268 ? 54.816 142.698 59.869 1.00 38.02  ? 274  PHE A CE1   1 
ATOM   2936 C  CE2   . PHE C 3  268 ? 56.917 143.818 60.216 1.00 38.37  ? 274  PHE A CE2   1 
ATOM   2937 C  CZ    . PHE C 3  268 ? 56.177 142.641 60.143 1.00 37.43  ? 274  PHE A CZ    1 
ATOM   2938 N  N     . CYS C 3  269 ? 53.820 145.782 62.864 1.00 42.97  ? 275  CYS A N     1 
ATOM   2939 C  CA    . CYS C 3  269 ? 54.483 145.714 64.158 1.00 45.69  ? 275  CYS A CA    1 
ATOM   2940 C  C     . CYS C 3  269 ? 55.338 144.462 64.319 1.00 46.12  ? 275  CYS A C     1 
ATOM   2941 O  O     . CYS C 3  269 ? 54.978 143.378 63.853 1.00 46.56  ? 275  CYS A O     1 
ATOM   2942 C  CB    . CYS C 3  269 ? 53.441 145.770 65.276 1.00 46.31  ? 275  CYS A CB    1 
ATOM   2943 S  SG    . CYS C 3  269 ? 52.428 147.274 65.259 1.00 52.45  ? 275  CYS A SG    1 
ATOM   2944 N  N     . HIS C 3  270 ? 56.478 144.624 64.981 1.00 46.84  ? 276  HIS A N     1 
ATOM   2945 C  CA    . HIS C 3  270 ? 57.387 143.512 65.221 1.00 47.34  ? 276  HIS A CA    1 
ATOM   2946 C  C     . HIS C 3  270 ? 56.596 142.402 65.898 1.00 47.00  ? 276  HIS A C     1 
ATOM   2947 O  O     . HIS C 3  270 ? 55.965 142.622 66.927 1.00 47.37  ? 276  HIS A O     1 
ATOM   2948 C  CB    . HIS C 3  270 ? 58.528 143.958 66.129 1.00 48.16  ? 276  HIS A CB    1 
ATOM   2949 C  CG    . HIS C 3  270 ? 59.739 143.081 66.053 1.00 50.40  ? 276  HIS A CG    1 
ATOM   2950 N  ND1   . HIS C 3  270 ? 60.684 143.206 65.057 1.00 51.05  ? 276  HIS A ND1   1 
ATOM   2951 C  CD2   . HIS C 3  270 ? 60.145 142.050 66.831 1.00 50.57  ? 276  HIS A CD2   1 
ATOM   2952 C  CE1   . HIS C 3  270 ? 61.620 142.288 65.225 1.00 51.44  ? 276  HIS A CE1   1 
ATOM   2953 N  NE2   . HIS C 3  270 ? 61.317 141.573 66.293 1.00 51.70  ? 276  HIS A NE2   1 
ATOM   2954 N  N     . PRO C 3  271 ? 56.605 141.190 65.320 1.00 47.27  ? 277  PRO A N     1 
ATOM   2955 C  CA    . PRO C 3  271 ? 55.872 140.056 65.894 1.00 47.56  ? 277  PRO A CA    1 
ATOM   2956 C  C     . PRO C 3  271 ? 56.287 139.737 67.330 1.00 47.84  ? 277  PRO A C     1 
ATOM   2957 O  O     . PRO C 3  271 ? 55.461 139.320 68.145 1.00 47.39  ? 277  PRO A O     1 
ATOM   2958 C  CB    . PRO C 3  271 ? 56.202 138.907 64.945 1.00 47.03  ? 277  PRO A CB    1 
ATOM   2959 C  CG    . PRO C 3  271 ? 56.382 139.612 63.640 1.00 47.84  ? 277  PRO A CG    1 
ATOM   2960 C  CD    . PRO C 3  271 ? 57.216 140.803 64.040 1.00 47.02  ? 277  PRO A CD    1 
ATOM   2961 N  N     . ARG C 3  272 ? 57.565 139.927 67.648 1.00 47.21  ? 278  ARG A N     1 
ATOM   2962 C  CA    . ARG C 3  272 ? 58.056 139.649 69.000 1.00 47.94  ? 278  ARG A CA    1 
ATOM   2963 C  C     . ARG C 3  272 ? 57.898 140.865 69.905 1.00 48.48  ? 278  ARG A C     1 
ATOM   2964 O  O     . ARG C 3  272 ? 57.120 140.843 70.862 1.00 47.67  ? 278  ARG A O     1 
ATOM   2965 C  CB    . ARG C 3  272 ? 59.536 139.240 68.955 1.00 47.13  ? 278  ARG A CB    1 
ATOM   2966 N  N     . THR C 3  273 ? 58.670 141.907 69.602 1.00 49.41  ? 279  THR A N     1 
ATOM   2967 C  CA    . THR C 3  273 ? 58.656 143.148 70.369 1.00 49.90  ? 279  THR A CA    1 
ATOM   2968 C  C     . THR C 3  273 ? 57.286 143.806 70.371 1.00 50.54  ? 279  THR A C     1 
ATOM   2969 O  O     . THR C 3  273 ? 56.820 144.302 71.399 1.00 50.37  ? 279  THR A O     1 
ATOM   2970 C  CB    . THR C 3  273 ? 59.683 144.174 69.813 1.00 50.88  ? 279  THR A CB    1 
ATOM   2971 O  OG1   . THR C 3  273 ? 60.995 143.852 70.288 1.00 51.58  ? 279  THR A OG1   1 
ATOM   2972 C  CG2   . THR C 3  273 ? 59.330 145.579 70.254 1.00 51.56  ? 279  THR A CG2   1 
ATOM   2973 N  N     . GLY C 3  274 ? 56.652 143.820 69.204 1.00 50.60  ? 280  GLY A N     1 
ATOM   2974 C  CA    . GLY C 3  274 ? 55.344 144.431 69.085 1.00 49.14  ? 280  GLY A CA    1 
ATOM   2975 C  C     . GLY C 3  274 ? 55.445 145.922 68.832 1.00 49.29  ? 280  GLY A C     1 
ATOM   2976 O  O     . GLY C 3  274 ? 54.426 146.604 68.741 1.00 49.66  ? 280  GLY A O     1 
ATOM   2977 N  N     . LYS C 3  275 ? 56.665 146.435 68.712 1.00 49.30  ? 281  LYS A N     1 
ATOM   2978 C  CA    . LYS C 3  275 ? 56.841 147.860 68.478 1.00 50.80  ? 281  LYS A CA    1 
ATOM   2979 C  C     . LYS C 3  275 ? 56.528 148.228 67.034 1.00 51.04  ? 281  LYS A C     1 
ATOM   2980 O  O     . LYS C 3  275 ? 56.903 147.516 66.101 1.00 52.10  ? 281  LYS A O     1 
ATOM   2981 C  CB    . LYS C 3  275 ? 58.266 148.300 68.827 1.00 51.04  ? 281  LYS A CB    1 
ATOM   2982 C  CG    . LYS C 3  275 ? 59.318 147.975 67.780 1.00 52.37  ? 281  LYS A CG    1 
ATOM   2983 C  CD    . LYS C 3  275 ? 60.670 148.579 68.156 1.00 52.54  ? 281  LYS A CD    1 
ATOM   2984 C  CE    . LYS C 3  275 ? 61.761 148.178 67.171 1.00 53.48  ? 281  LYS A CE    1 
ATOM   2985 N  NZ    . LYS C 3  275 ? 63.115 148.624 67.608 1.00 53.99  ? 281  LYS A NZ    1 
ATOM   2986 N  N     . PRO C 3  276 ? 55.826 149.352 66.834 1.00 50.91  ? 282  PRO A N     1 
ATOM   2987 C  CA    . PRO C 3  276 ? 55.456 149.825 65.498 1.00 50.46  ? 282  PRO A CA    1 
ATOM   2988 C  C     . PRO C 3  276 ? 56.669 150.049 64.598 1.00 49.73  ? 282  PRO A C     1 
ATOM   2989 O  O     . PRO C 3  276 ? 57.718 150.508 65.056 1.00 50.07  ? 282  PRO A O     1 
ATOM   2990 C  CB    . PRO C 3  276 ? 54.710 151.125 65.793 1.00 51.35  ? 282  PRO A CB    1 
ATOM   2991 C  CG    . PRO C 3  276 ? 54.075 150.846 67.128 1.00 50.75  ? 282  PRO A CG    1 
ATOM   2992 C  CD    . PRO C 3  276 ? 55.219 150.204 67.873 1.00 51.04  ? 282  PRO A CD    1 
ATOM   2993 N  N     . LEU C 3  277 ? 56.515 149.715 63.320 1.00 48.18  ? 283  LEU A N     1 
ATOM   2994 C  CA    . LEU C 3  277 ? 57.580 149.883 62.338 1.00 47.61  ? 283  LEU A CA    1 
ATOM   2995 C  C     . LEU C 3  277 ? 57.061 150.731 61.173 1.00 48.20  ? 283  LEU A C     1 
ATOM   2996 O  O     . LEU C 3  277 ? 56.886 150.240 60.058 1.00 48.09  ? 283  LEU A O     1 
ATOM   2997 C  CB    . LEU C 3  277 ? 58.044 148.516 61.837 1.00 45.97  ? 283  LEU A CB    1 
ATOM   2998 C  CG    . LEU C 3  277 ? 58.683 147.614 62.894 1.00 45.05  ? 283  LEU A CG    1 
ATOM   2999 C  CD1   . LEU C 3  277 ? 58.798 146.191 62.377 1.00 44.20  ? 283  LEU A CD1   1 
ATOM   3000 C  CD2   . LEU C 3  277 ? 60.044 148.169 63.261 1.00 44.00  ? 283  LEU A CD2   1 
ATOM   3001 N  N     . PRO C 3  278 ? 56.811 152.028 61.426 1.00 48.18  ? 284  PRO A N     1 
ATOM   3002 C  CA    . PRO C 3  278 ? 56.306 152.996 60.444 1.00 47.24  ? 284  PRO A CA    1 
ATOM   3003 C  C     . PRO C 3  278 ? 57.009 152.978 59.094 1.00 45.76  ? 284  PRO A C     1 
ATOM   3004 O  O     . PRO C 3  278 ? 56.395 153.287 58.074 1.00 44.72  ? 284  PRO A O     1 
ATOM   3005 C  CB    . PRO C 3  278 ? 56.480 154.332 61.158 1.00 47.34  ? 284  PRO A CB    1 
ATOM   3006 C  CG    . PRO C 3  278 ? 56.247 153.962 62.582 1.00 48.36  ? 284  PRO A CG    1 
ATOM   3007 C  CD    . PRO C 3  278 ? 57.041 152.686 62.725 1.00 47.72  ? 284  PRO A CD    1 
ATOM   3008 N  N     . LYS C 3  279 ? 58.290 152.624 59.086 1.00 44.76  ? 285  LYS A N     1 
ATOM   3009 C  CA    . LYS C 3  279 ? 59.043 152.584 57.839 1.00 44.61  ? 285  LYS A CA    1 
ATOM   3010 C  C     . LYS C 3  279 ? 58.689 151.384 56.969 1.00 42.47  ? 285  LYS A C     1 
ATOM   3011 O  O     . LYS C 3  279 ? 58.922 151.395 55.765 1.00 41.60  ? 285  LYS A O     1 
ATOM   3012 C  CB    . LYS C 3  279 ? 60.543 152.614 58.128 1.00 47.50  ? 285  LYS A CB    1 
ATOM   3013 C  CG    . LYS C 3  279 ? 61.074 154.003 58.483 1.00 50.97  ? 285  LYS A CG    1 
ATOM   3014 C  CD    . LYS C 3  279 ? 61.508 154.802 57.245 1.00 54.55  ? 285  LYS A CD    1 
ATOM   3015 C  CE    . LYS C 3  279 ? 60.353 155.103 56.292 1.00 56.74  ? 285  LYS A CE    1 
ATOM   3016 N  NZ    . LYS C 3  279 ? 60.807 155.828 55.065 1.00 56.16  ? 285  LYS A NZ    1 
ATOM   3017 N  N     . TYR C 3  280 ? 58.127 150.347 57.578 1.00 41.69  ? 286  TYR A N     1 
ATOM   3018 C  CA    . TYR C 3  280 ? 57.713 149.174 56.817 1.00 41.04  ? 286  TYR A CA    1 
ATOM   3019 C  C     . TYR C 3  280 ? 56.388 149.514 56.142 1.00 39.85  ? 286  TYR A C     1 
ATOM   3020 O  O     . TYR C 3  280 ? 55.562 150.234 56.706 1.00 40.15  ? 286  TYR A O     1 
ATOM   3021 C  CB    . TYR C 3  280 ? 57.533 147.966 57.740 1.00 41.16  ? 286  TYR A CB    1 
ATOM   3022 C  CG    . TYR C 3  280 ? 58.719 147.030 57.768 1.00 43.29  ? 286  TYR A CG    1 
ATOM   3023 C  CD1   . TYR C 3  280 ? 58.975 146.164 56.705 1.00 43.80  ? 286  TYR A CD1   1 
ATOM   3024 C  CD2   . TYR C 3  280 ? 59.599 147.020 58.850 1.00 45.13  ? 286  TYR A CD2   1 
ATOM   3025 C  CE1   . TYR C 3  280 ? 60.076 145.311 56.718 1.00 44.80  ? 286  TYR A CE1   1 
ATOM   3026 C  CE2   . TYR C 3  280 ? 60.707 146.173 58.873 1.00 45.64  ? 286  TYR A CE2   1 
ATOM   3027 C  CZ    . TYR C 3  280 ? 60.938 145.323 57.805 1.00 45.32  ? 286  TYR A CZ    1 
ATOM   3028 O  OH    . TYR C 3  280 ? 62.032 144.491 57.826 1.00 46.32  ? 286  TYR A OH    1 
ATOM   3029 N  N     . PRO C 3  281 ? 56.171 149.015 54.919 1.00 38.96  ? 287  PRO A N     1 
ATOM   3030 C  CA    . PRO C 3  281 ? 54.924 149.291 54.198 1.00 37.60  ? 287  PRO A CA    1 
ATOM   3031 C  C     . PRO C 3  281 ? 53.694 148.926 55.023 1.00 36.93  ? 287  PRO A C     1 
ATOM   3032 O  O     . PRO C 3  281 ? 53.709 147.951 55.774 1.00 36.27  ? 287  PRO A O     1 
ATOM   3033 C  CB    . PRO C 3  281 ? 55.052 148.423 52.953 1.00 37.16  ? 287  PRO A CB    1 
ATOM   3034 C  CG    . PRO C 3  281 ? 56.527 148.403 52.717 1.00 38.65  ? 287  PRO A CG    1 
ATOM   3035 C  CD    . PRO C 3  281 ? 57.082 148.199 54.100 1.00 38.32  ? 287  PRO A CD    1 
ATOM   3036 N  N     . ARG C 3  282 ? 52.632 149.713 54.888 1.00 36.67  ? 288  ARG A N     1 
ATOM   3037 C  CA    . ARG C 3  282 ? 51.396 149.443 55.611 1.00 36.52  ? 288  ARG A CA    1 
ATOM   3038 C  C     . ARG C 3  282 ? 50.859 148.073 55.188 1.00 35.03  ? 288  ARG A C     1 
ATOM   3039 O  O     . ARG C 3  282 ? 51.046 147.655 54.045 1.00 32.95  ? 288  ARG A O     1 
ATOM   3040 C  CB    . ARG C 3  282 ? 50.370 150.537 55.308 1.00 39.52  ? 288  ARG A CB    1 
ATOM   3041 C  CG    . ARG C 3  282 ? 50.717 151.905 55.908 1.00 44.01  ? 288  ARG A CG    1 
ATOM   3042 C  CD    . ARG C 3  282 ? 50.514 151.940 57.428 1.00 44.87  ? 288  ARG A CD    1 
ATOM   3043 N  NE    . ARG C 3  282 ? 51.762 152.117 58.169 1.00 46.76  ? 288  ARG A NE    1 
ATOM   3044 C  CZ    . ARG C 3  282 ? 52.527 153.205 58.110 1.00 47.02  ? 288  ARG A CZ    1 
ATOM   3045 N  NH1   . ARG C 3  282 ? 52.178 154.228 57.342 1.00 47.31  ? 288  ARG A NH1   1 
ATOM   3046 N  NH2   . ARG C 3  282 ? 53.644 153.270 58.820 1.00 47.37  ? 288  ARG A NH2   1 
ATOM   3047 N  N     . ILE C 3  283 ? 50.201 147.372 56.107 1.00 34.00  ? 289  ILE A N     1 
ATOM   3048 C  CA    . ILE C 3  283 ? 49.669 146.050 55.801 1.00 34.57  ? 289  ILE A CA    1 
ATOM   3049 C  C     . ILE C 3  283 ? 48.156 145.946 55.971 1.00 36.83  ? 289  ILE A C     1 
ATOM   3050 O  O     . ILE C 3  283 ? 47.484 146.931 56.274 1.00 37.78  ? 289  ILE A O     1 
ATOM   3051 C  CB    . ILE C 3  283 ? 50.329 144.958 56.677 1.00 32.91  ? 289  ILE A CB    1 
ATOM   3052 C  CG1   . ILE C 3  283 ? 49.929 145.141 58.138 1.00 31.21  ? 289  ILE A CG1   1 
ATOM   3053 C  CG2   . ILE C 3  283 ? 51.841 145.033 56.554 1.00 32.27  ? 289  ILE A CG2   1 
ATOM   3054 C  CD1   . ILE C 3  283 ? 50.369 144.006 59.031 1.00 30.32  ? 289  ILE A CD1   1 
ATOM   3055 N  N     . LYS C 3  284 ? 47.633 144.739 55.774 1.00 38.55  ? 290  LYS A N     1 
ATOM   3056 C  CA    . LYS C 3  284 ? 46.203 144.472 55.893 1.00 40.63  ? 290  LYS A CA    1 
ATOM   3057 C  C     . LYS C 3  284 ? 46.022 143.085 56.512 1.00 41.49  ? 290  LYS A C     1 
ATOM   3058 O  O     . LYS C 3  284 ? 46.471 142.082 55.955 1.00 41.59  ? 290  LYS A O     1 
ATOM   3059 C  CB    . LYS C 3  284 ? 45.550 144.507 54.506 1.00 42.62  ? 290  LYS A CB    1 
ATOM   3060 C  CG    . LYS C 3  284 ? 44.059 144.846 54.474 1.00 45.27  ? 290  LYS A CG    1 
ATOM   3061 C  CD    . LYS C 3  284 ? 43.195 143.777 55.103 1.00 48.21  ? 290  LYS A CD    1 
ATOM   3062 C  CE    . LYS C 3  284 ? 41.721 144.122 54.970 1.00 50.13  ? 290  LYS A CE    1 
ATOM   3063 N  NZ    . LYS C 3  284 ? 40.875 143.108 55.647 1.00 50.70  ? 290  LYS A NZ    1 
ATOM   3064 N  N     . THR C 3  285 ? 45.376 143.037 57.670 1.00 41.67  ? 291  THR A N     1 
ATOM   3065 C  CA    . THR C 3  285 ? 45.125 141.780 58.355 1.00 41.96  ? 291  THR A CA    1 
ATOM   3066 C  C     . THR C 3  285 ? 43.665 141.397 58.164 1.00 43.25  ? 291  THR A C     1 
ATOM   3067 O  O     . THR C 3  285 ? 42.792 141.899 58.866 1.00 42.17  ? 291  THR A O     1 
ATOM   3068 C  CB    . THR C 3  285 ? 45.398 141.897 59.862 1.00 41.70  ? 291  THR A CB    1 
ATOM   3069 O  OG1   . THR C 3  285 ? 46.769 142.251 60.076 1.00 40.97  ? 291  THR A OG1   1 
ATOM   3070 C  CG2   . THR C 3  285 ? 45.101 140.577 60.558 1.00 41.72  ? 291  THR A CG2   1 
ATOM   3071 N  N     . PRO C 3  286 ? 43.382 140.496 57.209 1.00 45.39  ? 292  PRO A N     1 
ATOM   3072 C  CA    . PRO C 3  286 ? 42.003 140.065 56.949 1.00 47.13  ? 292  PRO A CA    1 
ATOM   3073 C  C     . PRO C 3  286 ? 41.301 139.647 58.236 1.00 49.50  ? 292  PRO A C     1 
ATOM   3074 O  O     . PRO C 3  286 ? 41.933 139.113 59.150 1.00 49.56  ? 292  PRO A O     1 
ATOM   3075 C  CB    . PRO C 3  286 ? 42.179 138.909 55.963 1.00 46.14  ? 292  PRO A CB    1 
ATOM   3076 C  CG    . PRO C 3  286 ? 43.534 138.372 56.307 1.00 46.74  ? 292  PRO A CG    1 
ATOM   3077 C  CD    . PRO C 3  286 ? 44.337 139.632 56.499 1.00 44.93  ? 292  PRO A CD    1 
ATOM   3078 N  N     . LYS C 3  287 ? 39.998 139.901 58.305 1.00 51.56  ? 293  LYS A N     1 
ATOM   3079 C  CA    . LYS C 3  287 ? 39.224 139.571 59.495 1.00 54.09  ? 293  LYS A CA    1 
ATOM   3080 C  C     . LYS C 3  287 ? 38.518 138.226 59.384 1.00 54.96  ? 293  LYS A C     1 
ATOM   3081 O  O     . LYS C 3  287 ? 38.337 137.532 60.385 1.00 55.26  ? 293  LYS A O     1 
ATOM   3082 C  CB    . LYS C 3  287 ? 38.200 140.672 59.775 1.00 54.99  ? 293  LYS A CB    1 
ATOM   3083 C  CG    . LYS C 3  287 ? 38.821 142.036 60.011 1.00 55.76  ? 293  LYS A CG    1 
ATOM   3084 C  CD    . LYS C 3  287 ? 37.764 143.061 60.378 1.00 58.25  ? 293  LYS A CD    1 
ATOM   3085 C  CE    . LYS C 3  287 ? 38.393 144.407 60.701 1.00 58.90  ? 293  LYS A CE    1 
ATOM   3086 N  NZ    . LYS C 3  287 ? 37.396 145.368 61.255 1.00 60.52  ? 293  LYS A NZ    1 
ATOM   3087 N  N     . VAL C 3  288 ? 38.114 137.862 58.171 1.00 55.51  ? 294  VAL A N     1 
ATOM   3088 C  CA    . VAL C 3  288 ? 37.436 136.590 57.950 1.00 56.28  ? 294  VAL A CA    1 
ATOM   3089 C  C     . VAL C 3  288 ? 38.269 135.713 57.021 1.00 56.42  ? 294  VAL A C     1 
ATOM   3090 O  O     . VAL C 3  288 ? 39.144 136.208 56.308 1.00 57.09  ? 294  VAL A O     1 
ATOM   3091 C  CB    . VAL C 3  288 ? 36.041 136.799 57.322 1.00 56.48  ? 294  VAL A CB    1 
ATOM   3092 C  CG1   . VAL C 3  288 ? 35.297 135.470 57.241 1.00 57.00  ? 294  VAL A CG1   1 
ATOM   3093 C  CG2   . VAL C 3  288 ? 35.250 137.799 58.142 1.00 57.25  ? 294  VAL A CG2   1 
ATOM   3094 N  N     . GLY C 3  289 ? 37.998 134.411 57.039 1.00 55.76  ? 295  GLY A N     1 
ATOM   3095 C  CA    . GLY C 3  289 ? 38.730 133.496 56.185 1.00 54.31  ? 295  GLY A CA    1 
ATOM   3096 C  C     . GLY C 3  289 ? 39.636 132.529 56.923 1.00 53.91  ? 295  GLY A C     1 
ATOM   3097 O  O     . GLY C 3  289 ? 40.338 132.898 57.867 1.00 54.18  ? 295  GLY A O     1 
ATOM   3098 N  N     . GLY C 3  290 ? 39.611 131.278 56.480 1.00 53.65  ? 296  GLY A N     1 
ATOM   3099 C  CA    . GLY C 3  290 ? 40.432 130.236 57.070 1.00 53.53  ? 296  GLY A CA    1 
ATOM   3100 C  C     . GLY C 3  290 ? 40.685 129.194 55.999 1.00 53.68  ? 296  GLY A C     1 
ATOM   3101 O  O     . GLY C 3  290 ? 40.259 129.373 54.857 1.00 54.09  ? 296  GLY A O     1 
ATOM   3102 N  N     . ILE C 3  291 ? 41.374 128.111 56.341 1.00 53.39  ? 297  ILE A N     1 
ATOM   3103 C  CA    . ILE C 3  291 ? 41.645 127.069 55.356 1.00 53.66  ? 297  ILE A CA    1 
ATOM   3104 C  C     . ILE C 3  291 ? 40.359 126.343 54.954 1.00 53.73  ? 297  ILE A C     1 
ATOM   3105 O  O     . ILE C 3  291 ? 40.176 125.993 53.788 1.00 52.72  ? 297  ILE A O     1 
ATOM   3106 C  CB    . ILE C 3  291 ? 42.675 126.040 55.884 1.00 53.32  ? 297  ILE A CB    1 
ATOM   3107 C  CG1   . ILE C 3  291 ? 44.083 126.640 55.853 1.00 53.11  ? 297  ILE A CG1   1 
ATOM   3108 C  CG2   . ILE C 3  291 ? 42.652 124.789 55.024 1.00 53.83  ? 297  ILE A CG2   1 
ATOM   3109 C  CD1   . ILE C 3  291 ? 44.282 127.815 56.770 1.00 54.19  ? 297  ILE A CD1   1 
ATOM   3110 N  N     . PHE C 3  292 ? 39.471 126.118 55.919 1.00 55.04  ? 298  PHE A N     1 
ATOM   3111 C  CA    . PHE C 3  292 ? 38.207 125.445 55.635 1.00 56.27  ? 298  PHE A CA    1 
ATOM   3112 C  C     . PHE C 3  292 ? 37.024 126.355 55.920 1.00 56.94  ? 298  PHE A C     1 
ATOM   3113 O  O     . PHE C 3  292 ? 37.175 127.423 56.511 1.00 57.18  ? 298  PHE A O     1 
ATOM   3114 C  CB    . PHE C 3  292 ? 38.048 124.180 56.483 1.00 55.85  ? 298  PHE A CB    1 
ATOM   3115 C  CG    . PHE C 3  292 ? 39.193 123.221 56.371 1.00 56.49  ? 298  PHE A CG    1 
ATOM   3116 C  CD1   . PHE C 3  292 ? 40.297 123.336 57.211 1.00 56.89  ? 298  PHE A CD1   1 
ATOM   3117 C  CD2   . PHE C 3  292 ? 39.166 122.196 55.430 1.00 55.32  ? 298  PHE A CD2   1 
ATOM   3118 C  CE1   . PHE C 3  292 ? 41.360 122.441 57.117 1.00 57.79  ? 298  PHE A CE1   1 
ATOM   3119 C  CE2   . PHE C 3  292 ? 40.222 121.297 55.325 1.00 56.53  ? 298  PHE A CE2   1 
ATOM   3120 C  CZ    . PHE C 3  292 ? 41.323 121.417 56.170 1.00 56.95  ? 298  PHE A CZ    1 
ATOM   3121 N  N     . LYS C 3  293 ? 35.845 125.918 55.492 1.00 58.11  ? 299  LYS A N     1 
ATOM   3122 C  CA    . LYS C 3  293 ? 34.618 126.664 55.725 1.00 58.36  ? 299  LYS A CA    1 
ATOM   3123 C  C     . LYS C 3  293 ? 34.052 126.184 57.056 1.00 58.79  ? 299  LYS A C     1 
ATOM   3124 O  O     . LYS C 3  293 ? 34.366 125.082 57.506 1.00 58.22  ? 299  LYS A O     1 
ATOM   3125 C  CB    . LYS C 3  293 ? 33.602 126.387 54.615 1.00 58.57  ? 299  LYS A CB    1 
ATOM   3126 C  CG    . LYS C 3  293 ? 34.043 126.812 53.227 1.00 58.88  ? 299  LYS A CG    1 
ATOM   3127 C  CD    . LYS C 3  293 ? 32.927 126.592 52.217 1.00 59.16  ? 299  LYS A CD    1 
ATOM   3128 C  CE    . LYS C 3  293 ? 33.261 127.207 50.867 1.00 58.99  ? 299  LYS A CE    1 
ATOM   3129 N  NZ    . LYS C 3  293 ? 32.117 127.095 49.921 1.00 57.64  ? 299  LYS A NZ    1 
ATOM   3130 N  N     . LYS C 3  294 ? 33.227 127.008 57.691 1.00 59.94  ? 300  LYS A N     1 
ATOM   3131 C  CA    . LYS C 3  294 ? 32.623 126.625 58.959 1.00 60.10  ? 300  LYS A CA    1 
ATOM   3132 C  C     . LYS C 3  294 ? 31.760 125.388 58.701 1.00 60.98  ? 300  LYS A C     1 
ATOM   3133 O  O     . LYS C 3  294 ? 31.090 125.301 57.670 1.00 60.64  ? 300  LYS A O     1 
ATOM   3134 C  CB    . LYS C 3  294 ? 31.762 127.770 59.497 1.00 59.35  ? 300  LYS A CB    1 
ATOM   3135 N  N     . PRO C 3  295 ? 31.772 124.413 59.629 1.00 62.06  ? 301  PRO A N     1 
ATOM   3136 C  CA    . PRO C 3  295 ? 30.978 123.187 59.470 1.00 63.24  ? 301  PRO A CA    1 
ATOM   3137 C  C     . PRO C 3  295 ? 29.491 123.461 59.240 1.00 64.67  ? 301  PRO A C     1 
ATOM   3138 O  O     . PRO C 3  295 ? 28.887 124.287 59.924 1.00 65.31  ? 301  PRO A O     1 
ATOM   3139 C  CB    . PRO C 3  295 ? 31.251 122.426 60.768 1.00 62.41  ? 301  PRO A CB    1 
ATOM   3140 C  CG    . PRO C 3  295 ? 31.551 123.517 61.751 1.00 62.15  ? 301  PRO A CG    1 
ATOM   3141 C  CD    . PRO C 3  295 ? 32.424 124.444 60.950 1.00 62.07  ? 301  PRO A CD    1 
ATOM   3142 N  N     . LYS C 3  296 ? 28.911 122.761 58.269 1.00 65.78  ? 302  LYS A N     1 
ATOM   3143 C  CA    . LYS C 3  296 ? 27.506 122.936 57.921 1.00 67.60  ? 302  LYS A CA    1 
ATOM   3144 C  C     . LYS C 3  296 ? 26.637 121.777 58.392 1.00 68.44  ? 302  LYS A C     1 
ATOM   3145 O  O     . LYS C 3  296 ? 25.437 121.939 58.603 1.00 68.51  ? 302  LYS A O     1 
ATOM   3146 C  CB    . LYS C 3  296 ? 27.370 123.104 56.404 1.00 68.04  ? 302  LYS A CB    1 
ATOM   3147 C  CG    . LYS C 3  296 ? 28.164 124.280 55.855 1.00 69.57  ? 302  LYS A CG    1 
ATOM   3148 C  CD    . LYS C 3  296 ? 28.208 124.298 54.333 1.00 69.82  ? 302  LYS A CD    1 
ATOM   3149 C  CE    . LYS C 3  296 ? 29.095 125.436 53.836 1.00 69.95  ? 302  LYS A CE    1 
ATOM   3150 N  NZ    . LYS C 3  296 ? 29.247 125.450 52.355 1.00 70.24  ? 302  LYS A NZ    1 
ATOM   3151 N  N     . ASN C 3  297 ? 27.244 120.606 58.551 1.00 69.73  ? 303  ASN A N     1 
ATOM   3152 C  CA    . ASN C 3  297 ? 26.515 119.426 59.001 1.00 70.25  ? 303  ASN A CA    1 
ATOM   3153 C  C     . ASN C 3  297 ? 26.782 119.193 60.481 1.00 70.17  ? 303  ASN A C     1 
ATOM   3154 O  O     . ASN C 3  297 ? 27.631 119.852 61.078 1.00 69.57  ? 303  ASN A O     1 
ATOM   3155 C  CB    . ASN C 3  297 ? 26.953 118.196 58.203 1.00 70.82  ? 303  ASN A CB    1 
ATOM   3156 C  CG    . ASN C 3  297 ? 26.749 118.368 56.713 1.00 72.16  ? 303  ASN A CG    1 
ATOM   3157 O  OD1   . ASN C 3  297 ? 25.622 118.505 56.237 1.00 73.44  ? 303  ASN A OD1   1 
ATOM   3158 N  ND2   . ASN C 3  297 ? 27.846 118.368 55.967 1.00 73.47  ? 303  ASN A ND2   1 
ATOM   3159 N  N     . LYS C 3  298 ? 26.049 118.257 61.071 1.00 70.66  ? 304  LYS A N     1 
ATOM   3160 C  CA    . LYS C 3  298 ? 26.227 117.939 62.480 1.00 71.30  ? 304  LYS A CA    1 
ATOM   3161 C  C     . LYS C 3  298 ? 27.517 117.140 62.659 1.00 72.07  ? 304  LYS A C     1 
ATOM   3162 O  O     . LYS C 3  298 ? 28.412 117.547 63.402 1.00 72.24  ? 304  LYS A O     1 
ATOM   3163 C  CB    . LYS C 3  298 ? 25.040 117.124 63.000 1.00 70.71  ? 304  LYS A CB    1 
ATOM   3164 C  CG    . LYS C 3  298 ? 25.222 116.631 64.426 1.00 70.41  ? 304  LYS A CG    1 
ATOM   3165 C  CD    . LYS C 3  298 ? 24.130 115.658 64.835 1.00 70.17  ? 304  LYS A CD    1 
ATOM   3166 C  CE    . LYS C 3  298 ? 24.448 115.033 66.180 1.00 69.23  ? 304  LYS A CE    1 
ATOM   3167 N  NZ    . LYS C 3  298 ? 25.784 114.380 66.152 1.00 69.60  ? 304  LYS A NZ    1 
ATOM   3168 N  N     . ALA C 3  299 ? 27.603 116.004 61.970 1.00 72.36  ? 305  ALA A N     1 
ATOM   3169 C  CA    . ALA C 3  299 ? 28.778 115.139 62.044 1.00 71.87  ? 305  ALA A CA    1 
ATOM   3170 C  C     . ALA C 3  299 ? 30.004 115.879 61.519 1.00 71.12  ? 305  ALA A C     1 
ATOM   3171 O  O     . ALA C 3  299 ? 31.095 115.790 62.085 1.00 70.20  ? 305  ALA A O     1 
ATOM   3172 C  CB    . ALA C 3  299 ? 28.538 113.871 61.233 1.00 72.06  ? 305  ALA A CB    1 
ATOM   3173 N  N     . GLN C 3  300 ? 29.809 116.614 60.430 1.00 70.49  ? 306  GLN A N     1 
ATOM   3174 C  CA    . GLN C 3  300 ? 30.881 117.390 59.825 1.00 69.74  ? 306  GLN A CA    1 
ATOM   3175 C  C     . GLN C 3  300 ? 31.395 118.388 60.860 1.00 69.42  ? 306  GLN A C     1 
ATOM   3176 O  O     . GLN C 3  300 ? 32.553 118.802 60.832 1.00 69.51  ? 306  GLN A O     1 
ATOM   3177 C  CB    . GLN C 3  300 ? 30.344 118.148 58.612 1.00 69.50  ? 306  GLN A CB    1 
ATOM   3178 C  CG    . GLN C 3  300 ? 31.398 118.853 57.783 1.00 67.70  ? 306  GLN A CG    1 
ATOM   3179 C  CD    . GLN C 3  300 ? 30.804 119.937 56.911 1.00 67.08  ? 306  GLN A CD    1 
ATOM   3180 O  OE1   . GLN C 3  300 ? 30.460 121.013 57.395 1.00 67.01  ? 306  GLN A OE1   1 
ATOM   3181 N  NE2   . GLN C 3  300 ? 30.665 119.656 55.622 1.00 65.61  ? 306  GLN A NE2   1 
ATOM   3182 N  N     . ARG C 3  301 ? 30.507 118.768 61.772 1.00 68.70  ? 307  ARG A N     1 
ATOM   3183 C  CA    . ARG C 3  301 ? 30.818 119.718 62.831 1.00 67.55  ? 307  ARG A CA    1 
ATOM   3184 C  C     . ARG C 3  301 ? 31.470 119.000 64.011 1.00 68.27  ? 307  ARG A C     1 
ATOM   3185 O  O     . ARG C 3  301 ? 31.836 119.624 65.007 1.00 67.78  ? 307  ARG A O     1 
ATOM   3186 C  CB    . ARG C 3  301 ? 29.527 120.416 63.273 1.00 65.31  ? 307  ARG A CB    1 
ATOM   3187 C  CG    . ARG C 3  301 ? 29.701 121.503 64.315 1.00 62.88  ? 307  ARG A CG    1 
ATOM   3188 C  CD    . ARG C 3  301 ? 28.408 122.288 64.503 1.00 60.96  ? 307  ARG A CD    1 
ATOM   3189 N  NE    . ARG C 3  301 ? 27.276 121.430 64.848 1.00 58.84  ? 307  ARG A NE    1 
ATOM   3190 C  CZ    . ARG C 3  301 ? 26.205 121.253 64.079 1.00 56.80  ? 307  ARG A CZ    1 
ATOM   3191 N  NH1   . ARG C 3  301 ? 25.225 120.452 64.476 1.00 54.72  ? 307  ARG A NH1   1 
ATOM   3192 N  NH2   . ARG C 3  301 ? 26.108 121.878 62.914 1.00 55.07  ? 307  ARG A NH2   1 
ATOM   3193 N  N     . GLU C 3  302 ? 31.622 117.685 63.885 1.00 68.93  ? 308  GLU A N     1 
ATOM   3194 C  CA    . GLU C 3  302 ? 32.223 116.875 64.938 1.00 69.58  ? 308  GLU A CA    1 
ATOM   3195 C  C     . GLU C 3  302 ? 33.502 116.183 64.476 1.00 70.45  ? 308  GLU A C     1 
ATOM   3196 O  O     . GLU C 3  302 ? 34.187 115.532 65.266 1.00 70.02  ? 308  GLU A O     1 
ATOM   3197 C  CB    . GLU C 3  302 ? 31.220 115.825 65.413 1.00 69.23  ? 308  GLU A CB    1 
ATOM   3198 C  CG    . GLU C 3  302 ? 29.974 116.408 66.045 1.00 68.24  ? 308  GLU A CG    1 
ATOM   3199 C  CD    . GLU C 3  302 ? 28.881 115.375 66.222 1.00 68.02  ? 308  GLU A CD    1 
ATOM   3200 O  OE1   . GLU C 3  302 ? 27.840 115.708 66.824 1.00 68.49  ? 308  GLU A OE1   1 
ATOM   3201 O  OE2   . GLU C 3  302 ? 29.060 114.232 65.752 1.00 67.40  ? 308  GLU A OE2   1 
ATOM   3202 N  N     . GLY C 3  303 ? 33.819 116.324 63.195 1.00 71.40  ? 309  GLY A N     1 
ATOM   3203 C  CA    . GLY C 3  303 ? 35.012 115.697 62.663 1.00 72.50  ? 309  GLY A CA    1 
ATOM   3204 C  C     . GLY C 3  303 ? 34.705 114.385 61.970 1.00 73.52  ? 309  GLY A C     1 
ATOM   3205 O  O     . GLY C 3  303 ? 35.548 113.491 61.917 1.00 73.93  ? 309  GLY A O     1 
ATOM   3206 N  N     . ARG C 3  304 ? 33.489 114.265 61.447 1.00 74.32  ? 310  ARG A N     1 
ATOM   3207 C  CA    . ARG C 3  304 ? 33.073 113.054 60.747 1.00 74.89  ? 310  ARG A CA    1 
ATOM   3208 C  C     . ARG C 3  304 ? 33.491 113.161 59.285 1.00 75.29  ? 310  ARG A C     1 
ATOM   3209 O  O     . ARG C 3  304 ? 34.161 112.275 58.755 1.00 75.80  ? 310  ARG A O     1 
ATOM   3210 C  CB    . ARG C 3  304 ? 31.558 112.878 60.835 1.00 75.00  ? 310  ARG A CB    1 
ATOM   3211 N  N     . GLU C 3  305 ? 33.087 114.251 58.639 1.00 75.36  ? 311  GLU A N     1 
ATOM   3212 C  CA    . GLU C 3  305 ? 33.436 114.484 57.246 1.00 75.47  ? 311  GLU A CA    1 
ATOM   3213 C  C     . GLU C 3  305 ? 34.250 115.766 57.185 1.00 74.51  ? 311  GLU A C     1 
ATOM   3214 O  O     . GLU C 3  305 ? 33.901 116.757 57.823 1.00 75.06  ? 311  GLU A O     1 
ATOM   3215 C  CB    . GLU C 3  305 ? 32.176 114.633 56.391 1.00 76.53  ? 311  GLU A CB    1 
ATOM   3216 C  CG    . GLU C 3  305 ? 31.096 113.609 56.697 1.00 78.99  ? 311  GLU A CG    1 
ATOM   3217 C  CD    . GLU C 3  305 ? 30.104 113.447 55.561 1.00 80.02  ? 311  GLU A CD    1 
ATOM   3218 O  OE1   . GLU C 3  305 ? 29.037 112.831 55.784 1.00 80.37  ? 311  GLU A OE1   1 
ATOM   3219 O  OE2   . GLU C 3  305 ? 30.395 113.927 54.444 1.00 80.33  ? 311  GLU A OE2   1 
ATOM   3220 N  N     . PRO C 3  306 ? 35.357 115.763 56.429 1.00 73.45  ? 312  PRO A N     1 
ATOM   3221 C  CA    . PRO C 3  306 ? 36.177 116.975 56.333 1.00 71.72  ? 312  PRO A CA    1 
ATOM   3222 C  C     . PRO C 3  306 ? 35.345 118.161 55.845 1.00 69.95  ? 312  PRO A C     1 
ATOM   3223 O  O     . PRO C 3  306 ? 34.477 118.006 54.986 1.00 69.17  ? 312  PRO A O     1 
ATOM   3224 C  CB    . PRO C 3  306 ? 37.264 116.576 55.336 1.00 72.40  ? 312  PRO A CB    1 
ATOM   3225 C  CG    . PRO C 3  306 ? 37.417 115.102 55.587 1.00 72.78  ? 312  PRO A CG    1 
ATOM   3226 C  CD    . PRO C 3  306 ? 35.979 114.650 55.691 1.00 73.14  ? 312  PRO A CD    1 
ATOM   3227 N  N     . CYS C 3  307 ? 35.600 119.339 56.404 1.00 68.04  ? 313  CYS A N     1 
ATOM   3228 C  CA    . CYS C 3  307 ? 34.868 120.533 56.009 1.00 66.64  ? 313  CYS A CA    1 
ATOM   3229 C  C     . CYS C 3  307 ? 35.247 120.988 54.606 1.00 65.71  ? 313  CYS A C     1 
ATOM   3230 O  O     . CYS C 3  307 ? 36.289 120.601 54.071 1.00 64.80  ? 313  CYS A O     1 
ATOM   3231 C  CB    . CYS C 3  307 ? 35.130 121.677 56.987 1.00 67.09  ? 313  CYS A CB    1 
ATOM   3232 S  SG    . CYS C 3  307 ? 34.317 121.518 58.585 1.00 68.22  ? 313  CYS A SG    1 
ATOM   3233 N  N     . GLU C 3  308 ? 34.386 121.813 54.017 1.00 64.61  ? 314  GLU A N     1 
ATOM   3234 C  CA    . GLU C 3  308 ? 34.612 122.352 52.682 1.00 63.49  ? 314  GLU A CA    1 
ATOM   3235 C  C     . GLU C 3  308 ? 35.786 123.321 52.708 1.00 62.32  ? 314  GLU A C     1 
ATOM   3236 O  O     . GLU C 3  308 ? 35.914 124.125 53.632 1.00 61.58  ? 314  GLU A O     1 
ATOM   3237 C  CB    . GLU C 3  308 ? 33.363 123.090 52.201 1.00 64.72  ? 314  GLU A CB    1 
ATOM   3238 C  CG    . GLU C 3  308 ? 32.371 122.239 51.428 1.00 66.76  ? 314  GLU A CG    1 
ATOM   3239 C  CD    . GLU C 3  308 ? 30.959 122.805 51.476 1.00 67.64  ? 314  GLU A CD    1 
ATOM   3240 O  OE1   . GLU C 3  308 ? 30.141 122.293 52.272 1.00 67.65  ? 314  GLU A OE1   1 
ATOM   3241 O  OE2   . GLU C 3  308 ? 30.669 123.765 50.730 1.00 68.36  ? 314  GLU A OE2   1 
ATOM   3242 N  N     . LEU C 3  309 ? 36.643 123.239 51.696 1.00 60.52  ? 315  LEU A N     1 
ATOM   3243 C  CA    . LEU C 3  309 ? 37.786 124.134 51.605 1.00 59.18  ? 315  LEU A CA    1 
ATOM   3244 C  C     . LEU C 3  309 ? 37.297 125.555 51.358 1.00 59.18  ? 315  LEU A C     1 
ATOM   3245 O  O     . LEU C 3  309 ? 36.301 125.767 50.662 1.00 58.54  ? 315  LEU A O     1 
ATOM   3246 C  CB    . LEU C 3  309 ? 38.715 123.711 50.465 1.00 57.78  ? 315  LEU A CB    1 
ATOM   3247 C  CG    . LEU C 3  309 ? 39.641 122.523 50.723 1.00 56.91  ? 315  LEU A CG    1 
ATOM   3248 C  CD1   . LEU C 3  309 ? 40.418 122.193 49.461 1.00 56.68  ? 315  LEU A CD1   1 
ATOM   3249 C  CD2   . LEU C 3  309 ? 40.591 122.856 51.857 1.00 56.10  ? 315  LEU A CD2   1 
ATOM   3250 N  N     . ASP C 3  310 ? 37.996 126.525 51.936 1.00 58.99  ? 316  ASP A N     1 
ATOM   3251 C  CA    . ASP C 3  310 ? 37.632 127.923 51.766 1.00 59.04  ? 316  ASP A CA    1 
ATOM   3252 C  C     . ASP C 3  310 ? 38.384 128.487 50.567 1.00 59.43  ? 316  ASP A C     1 
ATOM   3253 O  O     . ASP C 3  310 ? 39.544 128.885 50.682 1.00 59.58  ? 316  ASP A O     1 
ATOM   3254 C  CB    . ASP C 3  310 ? 37.982 128.719 53.027 1.00 58.92  ? 316  ASP A CB    1 
ATOM   3255 C  CG    . ASP C 3  310 ? 37.509 130.160 52.958 1.00 59.45  ? 316  ASP A CG    1 
ATOM   3256 O  OD1   . ASP C 3  310 ? 37.801 130.936 53.895 1.00 58.34  ? 316  ASP A OD1   1 
ATOM   3257 O  OD2   . ASP C 3  310 ? 36.840 130.518 51.965 1.00 60.18  ? 316  ASP A OD2   1 
ATOM   3258 N  N     . THR C 3  311 ? 37.720 128.503 49.415 1.00 59.99  ? 317  THR A N     1 
ATOM   3259 C  CA    . THR C 3  311 ? 38.313 129.017 48.185 1.00 60.20  ? 317  THR A CA    1 
ATOM   3260 C  C     . THR C 3  311 ? 38.770 130.463 48.351 1.00 59.51  ? 317  THR A C     1 
ATOM   3261 O  O     . THR C 3  311 ? 39.668 130.913 47.644 1.00 59.30  ? 317  THR A O     1 
ATOM   3262 C  CB    . THR C 3  311 ? 37.303 128.914 47.001 1.00 61.52  ? 317  THR A CB    1 
ATOM   3263 O  OG1   . THR C 3  311 ? 37.436 127.631 46.374 1.00 62.23  ? 317  THR A OG1   1 
ATOM   3264 C  CG2   . THR C 3  311 ? 37.539 130.013 45.962 1.00 61.75  ? 317  THR A CG2   1 
ATOM   3265 N  N     . ARG C 3  312 ? 38.153 131.169 49.298 1.00 59.06  ? 318  ARG A N     1 
ATOM   3266 C  CA    . ARG C 3  312 ? 38.459 132.570 49.586 1.00 57.66  ? 318  ARG A CA    1 
ATOM   3267 C  C     . ARG C 3  312 ? 39.789 133.032 49.003 1.00 57.12  ? 318  ARG A C     1 
ATOM   3268 O  O     . ARG C 3  312 ? 39.867 133.354 47.818 1.00 58.96  ? 318  ARG A O     1 
ATOM   3269 C  CB    . ARG C 3  312 ? 38.450 132.813 51.098 1.00 58.44  ? 318  ARG A CB    1 
ATOM   3270 N  N     . GLU C 3  313 ? 40.826 133.060 49.837 1.00 54.40  ? 319  GLU A N     1 
ATOM   3271 C  CA    . GLU C 3  313 ? 42.161 133.484 49.423 1.00 52.14  ? 319  GLU A CA    1 
ATOM   3272 C  C     . GLU C 3  313 ? 42.939 134.014 50.615 1.00 50.16  ? 319  GLU A C     1 
ATOM   3273 O  O     . GLU C 3  313 ? 44.167 134.005 50.619 1.00 50.17  ? 319  GLU A O     1 
ATOM   3274 C  CB    . GLU C 3  313 ? 42.082 134.574 48.349 1.00 53.34  ? 319  GLU A CB    1 
ATOM   3275 C  CG    . GLU C 3  313 ? 43.426 135.152 47.948 1.00 55.49  ? 319  GLU A CG    1 
ATOM   3276 C  CD    . GLU C 3  313 ? 43.397 135.808 46.579 1.00 57.24  ? 319  GLU A CD    1 
ATOM   3277 O  OE1   . GLU C 3  313 ? 43.193 135.085 45.578 1.00 57.26  ? 319  GLU A OE1   1 
ATOM   3278 O  OE2   . GLU C 3  313 ? 43.580 137.043 46.501 1.00 57.74  ? 319  GLU A OE2   1 
ATOM   3279 N  N     . TYR C 3  314 ? 42.216 134.472 51.629 1.00 47.60  ? 320  TYR A N     1 
ATOM   3280 C  CA    . TYR C 3  314 ? 42.847 135.008 52.826 1.00 46.07  ? 320  TYR A CA    1 
ATOM   3281 C  C     . TYR C 3  314 ? 42.564 134.147 54.055 1.00 44.89  ? 320  TYR A C     1 
ATOM   3282 O  O     . TYR C 3  314 ? 41.721 133.250 54.027 1.00 44.16  ? 320  TYR A O     1 
ATOM   3283 C  CB    . TYR C 3  314 ? 42.356 136.432 53.079 1.00 45.55  ? 320  TYR A CB    1 
ATOM   3284 C  CG    . TYR C 3  314 ? 42.651 137.400 51.956 1.00 45.56  ? 320  TYR A CG    1 
ATOM   3285 C  CD1   . TYR C 3  314 ? 43.956 137.805 51.682 1.00 45.52  ? 320  TYR A CD1   1 
ATOM   3286 C  CD2   . TYR C 3  314 ? 41.620 137.934 51.182 1.00 45.09  ? 320  TYR A CD2   1 
ATOM   3287 C  CE1   . TYR C 3  314 ? 44.230 138.725 50.667 1.00 45.53  ? 320  TYR A CE1   1 
ATOM   3288 C  CE2   . TYR C 3  314 ? 41.880 138.853 50.166 1.00 45.53  ? 320  TYR A CE2   1 
ATOM   3289 C  CZ    . TYR C 3  314 ? 43.187 139.247 49.914 1.00 46.49  ? 320  TYR A CZ    1 
ATOM   3290 O  OH    . TYR C 3  314 ? 43.452 140.175 48.929 1.00 45.36  ? 320  TYR A OH    1 
ATOM   3291 N  N     . VAL C 3  315 ? 43.289 134.427 55.130 1.00 43.21  ? 321  VAL A N     1 
ATOM   3292 C  CA    . VAL C 3  315 ? 43.138 133.706 56.385 1.00 41.37  ? 321  VAL A CA    1 
ATOM   3293 C  C     . VAL C 3  315 ? 43.158 134.738 57.504 1.00 40.97  ? 321  VAL A C     1 
ATOM   3294 O  O     . VAL C 3  315 ? 44.118 135.501 57.638 1.00 40.32  ? 321  VAL A O     1 
ATOM   3295 C  CB    . VAL C 3  315 ? 44.292 132.700 56.593 1.00 40.77  ? 321  VAL A CB    1 
ATOM   3296 C  CG1   . VAL C 3  315 ? 44.190 132.065 57.964 1.00 40.63  ? 321  VAL A CG1   1 
ATOM   3297 C  CG2   . VAL C 3  315 ? 44.243 131.630 55.521 1.00 39.91  ? 321  VAL A CG2   1 
ATOM   3298 N  N     . ALA C 3  316 ? 42.092 134.762 58.298 1.00 40.38  ? 322  ALA A N     1 
ATOM   3299 C  CA    . ALA C 3  316 ? 41.972 135.714 59.397 1.00 40.52  ? 322  ALA A CA    1 
ATOM   3300 C  C     . ALA C 3  316 ? 43.217 135.747 60.281 1.00 40.21  ? 322  ALA A C     1 
ATOM   3301 O  O     . ALA C 3  316 ? 43.669 134.714 60.781 1.00 39.86  ? 322  ALA A O     1 
ATOM   3302 C  CB    . ALA C 3  316 ? 40.744 135.388 60.235 1.00 39.79  ? 322  ALA A CB    1 
ATOM   3303 N  N     . GLY C 3  317 ? 43.771 136.943 60.461 1.00 39.65  ? 323  GLY A N     1 
ATOM   3304 C  CA    . GLY C 3  317 ? 44.955 137.096 61.287 1.00 38.61  ? 323  GLY A CA    1 
ATOM   3305 C  C     . GLY C 3  317 ? 46.272 137.075 60.529 1.00 37.79  ? 323  GLY A C     1 
ATOM   3306 O  O     . GLY C 3  317 ? 47.273 137.591 61.024 1.00 37.40  ? 323  GLY A O     1 
ATOM   3307 N  N     . ALA C 3  318 ? 46.276 136.480 59.337 1.00 36.94  ? 324  ALA A N     1 
ATOM   3308 C  CA    . ALA C 3  318 ? 47.485 136.389 58.513 1.00 35.29  ? 324  ALA A CA    1 
ATOM   3309 C  C     . ALA C 3  318 ? 47.678 137.664 57.689 1.00 32.74  ? 324  ALA A C     1 
ATOM   3310 O  O     . ALA C 3  318 ? 47.050 137.847 56.648 1.00 32.43  ? 324  ALA A O     1 
ATOM   3311 C  CB    . ALA C 3  318 ? 47.397 135.172 57.595 1.00 35.86  ? 324  ALA A CB    1 
ATOM   3312 N  N     . PRO C 3  319 ? 48.573 138.551 58.142 1.00 30.76  ? 325  PRO A N     1 
ATOM   3313 C  CA    . PRO C 3  319 ? 48.872 139.824 57.483 1.00 30.33  ? 325  PRO A CA    1 
ATOM   3314 C  C     . PRO C 3  319 ? 49.613 139.733 56.155 1.00 30.08  ? 325  PRO A C     1 
ATOM   3315 O  O     . PRO C 3  319 ? 50.395 138.814 55.924 1.00 30.53  ? 325  PRO A O     1 
ATOM   3316 C  CB    . PRO C 3  319 ? 49.694 140.557 58.531 1.00 29.85  ? 325  PRO A CB    1 
ATOM   3317 C  CG    . PRO C 3  319 ? 50.498 139.438 59.122 1.00 29.11  ? 325  PRO A CG    1 
ATOM   3318 C  CD    . PRO C 3  319 ? 49.468 138.342 59.297 1.00 30.04  ? 325  PRO A CD    1 
ATOM   3319 N  N     . TYR C 3  320 ? 49.363 140.708 55.291 1.00 28.76  ? 326  TYR A N     1 
ATOM   3320 C  CA    . TYR C 3  320 ? 50.019 140.770 53.998 1.00 26.96  ? 326  TYR A CA    1 
ATOM   3321 C  C     . TYR C 3  320 ? 50.133 142.218 53.552 1.00 27.35  ? 326  TYR A C     1 
ATOM   3322 O  O     . TYR C 3  320 ? 49.407 143.086 54.031 1.00 28.45  ? 326  TYR A O     1 
ATOM   3323 C  CB    . TYR C 3  320 ? 49.236 139.985 52.958 1.00 26.53  ? 326  TYR A CB    1 
ATOM   3324 C  CG    . TYR C 3  320 ? 47.925 140.613 52.549 1.00 25.35  ? 326  TYR A CG    1 
ATOM   3325 C  CD1   . TYR C 3  320 ? 46.730 140.264 53.180 1.00 25.29  ? 326  TYR A CD1   1 
ATOM   3326 C  CD2   . TYR C 3  320 ? 47.873 141.523 51.495 1.00 25.16  ? 326  TYR A CD2   1 
ATOM   3327 C  CE1   . TYR C 3  320 ? 45.513 140.801 52.762 1.00 24.86  ? 326  TYR A CE1   1 
ATOM   3328 C  CE2   . TYR C 3  320 ? 46.668 142.065 51.069 1.00 25.74  ? 326  TYR A CE2   1 
ATOM   3329 C  CZ    . TYR C 3  320 ? 45.493 141.699 51.701 1.00 25.59  ? 326  TYR A CZ    1 
ATOM   3330 O  OH    . TYR C 3  320 ? 44.304 142.210 51.243 1.00 24.96  ? 326  TYR A OH    1 
ATOM   3331 N  N     . THR C 3  321 ? 51.043 142.479 52.627 1.00 26.61  ? 327  THR A N     1 
ATOM   3332 C  CA    . THR C 3  321 ? 51.237 143.829 52.138 1.00 25.55  ? 327  THR A CA    1 
ATOM   3333 C  C     . THR C 3  321 ? 50.519 144.048 50.815 1.00 26.54  ? 327  THR A C     1 
ATOM   3334 O  O     . THR C 3  321 ? 50.811 143.390 49.820 1.00 27.89  ? 327  THR A O     1 
ATOM   3335 C  CB    . THR C 3  321 ? 52.736 144.141 51.959 1.00 24.84  ? 327  THR A CB    1 
ATOM   3336 O  OG1   . THR C 3  321 ? 53.381 144.146 53.240 1.00 24.66  ? 327  THR A OG1   1 
ATOM   3337 C  CG2   . THR C 3  321 ? 52.926 145.490 51.304 1.00 24.35  ? 327  THR A CG2   1 
ATOM   3338 N  N     . PRO C 3  322 ? 49.537 144.959 50.797 1.00 26.73  ? 328  PRO A N     1 
ATOM   3339 C  CA    . PRO C 3  322 ? 48.795 145.247 49.566 1.00 26.89  ? 328  PRO A CA    1 
ATOM   3340 C  C     . PRO C 3  322 ? 49.747 145.914 48.576 1.00 26.22  ? 328  PRO A C     1 
ATOM   3341 O  O     . PRO C 3  322 ? 50.530 146.784 48.957 1.00 26.01  ? 328  PRO A O     1 
ATOM   3342 C  CB    . PRO C 3  322 ? 47.701 146.198 50.041 1.00 25.39  ? 328  PRO A CB    1 
ATOM   3343 C  CG    . PRO C 3  322 ? 47.440 145.716 51.429 1.00 28.08  ? 328  PRO A CG    1 
ATOM   3344 C  CD    . PRO C 3  322 ? 48.846 145.536 51.962 1.00 26.44  ? 328  PRO A CD    1 
ATOM   3345 N  N     . VAL C 3  323 ? 49.690 145.511 47.314 1.00 25.61  ? 329  VAL A N     1 
ATOM   3346 C  CA    . VAL C 3  323 ? 50.585 146.095 46.319 1.00 25.41  ? 329  VAL A CA    1 
ATOM   3347 C  C     . VAL C 3  323 ? 49.904 146.355 44.993 1.00 25.35  ? 329  VAL A C     1 
ATOM   3348 O  O     . VAL C 3  323 ? 48.826 145.830 44.716 1.00 25.45  ? 329  VAL A O     1 
ATOM   3349 C  CB    . VAL C 3  323 ? 51.805 145.180 46.044 1.00 24.54  ? 329  VAL A CB    1 
ATOM   3350 C  CG1   . VAL C 3  323 ? 52.679 145.065 47.290 1.00 24.00  ? 329  VAL A CG1   1 
ATOM   3351 C  CG2   . VAL C 3  323 ? 51.326 143.806 45.612 1.00 24.18  ? 329  VAL A CG2   1 
ATOM   3352 N  N     . GLU C 3  324 ? 50.537 147.189 44.181 1.00 25.83  ? 330  GLU A N     1 
ATOM   3353 C  CA    . GLU C 3  324 ? 50.020 147.498 42.858 1.00 27.85  ? 330  GLU A CA    1 
ATOM   3354 C  C     . GLU C 3  324 ? 51.162 147.296 41.874 1.00 26.69  ? 330  GLU A C     1 
ATOM   3355 O  O     . GLU C 3  324 ? 52.330 147.455 42.230 1.00 26.87  ? 330  GLU A O     1 
ATOM   3356 C  CB    . GLU C 3  324 ? 49.515 148.946 42.779 1.00 29.53  ? 330  GLU A CB    1 
ATOM   3357 C  CG    . GLU C 3  324 ? 50.572 150.012 43.033 1.00 32.61  ? 330  GLU A CG    1 
ATOM   3358 C  CD    . GLU C 3  324 ? 50.155 151.383 42.513 1.00 36.10  ? 330  GLU A CD    1 
ATOM   3359 O  OE1   . GLU C 3  324 ? 48.951 151.713 42.601 1.00 37.01  ? 330  GLU A OE1   1 
ATOM   3360 O  OE2   . GLU C 3  324 ? 51.033 152.134 42.027 1.00 37.42  ? 330  GLU A OE2   1 
ATOM   3361 N  N     . HIS C 3  325 ? 50.823 146.931 40.645 1.00 25.59  ? 331  HIS A N     1 
ATOM   3362 C  CA    . HIS C 3  325 ? 51.823 146.719 39.612 1.00 25.78  ? 331  HIS A CA    1 
ATOM   3363 C  C     . HIS C 3  325 ? 52.017 148.040 38.877 1.00 25.46  ? 331  HIS A C     1 
ATOM   3364 O  O     . HIS C 3  325 ? 51.064 148.595 38.334 1.00 26.19  ? 331  HIS A O     1 
ATOM   3365 C  CB    . HIS C 3  325 ? 51.337 145.656 38.627 1.00 27.75  ? 331  HIS A CB    1 
ATOM   3366 C  CG    . HIS C 3  325 ? 52.360 145.263 37.607 1.00 31.01  ? 331  HIS A CG    1 
ATOM   3367 N  ND1   . HIS C 3  325 ? 52.030 144.943 36.308 1.00 32.14  ? 331  HIS A ND1   1 
ATOM   3368 C  CD2   . HIS C 3  325 ? 53.702 145.115 37.702 1.00 31.29  ? 331  HIS A CD2   1 
ATOM   3369 C  CE1   . HIS C 3  325 ? 53.125 144.616 35.646 1.00 32.15  ? 331  HIS A CE1   1 
ATOM   3370 N  NE2   . HIS C 3  325 ? 54.153 144.711 36.469 1.00 31.86  ? 331  HIS A NE2   1 
ATOM   3371 N  N     . VAL C 3  326 ? 53.239 148.555 38.853 1.00 24.75  ? 332  VAL A N     1 
ATOM   3372 C  CA    . VAL C 3  326 ? 53.477 149.817 38.165 1.00 25.82  ? 332  VAL A CA    1 
ATOM   3373 C  C     . VAL C 3  326 ? 54.400 149.699 36.955 1.00 24.92  ? 332  VAL A C     1 
ATOM   3374 O  O     . VAL C 3  326 ? 55.482 149.116 37.033 1.00 23.83  ? 332  VAL A O     1 
ATOM   3375 C  CB    . VAL C 3  326 ? 54.025 150.891 39.140 1.00 26.42  ? 332  VAL A CB    1 
ATOM   3376 C  CG1   . VAL C 3  326 ? 55.039 150.280 40.069 1.00 27.80  ? 332  VAL A CG1   1 
ATOM   3377 C  CG2   . VAL C 3  326 ? 54.654 152.032 38.363 1.00 25.81  ? 332  VAL A CG2   1 
ATOM   3378 N  N     . VAL C 3  327 ? 53.943 150.263 35.839 1.00 23.66  ? 333  VAL A N     1 
ATOM   3379 C  CA    . VAL C 3  327 ? 54.678 150.267 34.575 1.00 22.94  ? 333  VAL A CA    1 
ATOM   3380 C  C     . VAL C 3  327 ? 55.452 151.578 34.416 1.00 21.76  ? 333  VAL A C     1 
ATOM   3381 O  O     . VAL C 3  327 ? 54.920 152.653 34.665 1.00 22.91  ? 333  VAL A O     1 
ATOM   3382 C  CB    . VAL C 3  327 ? 53.700 150.110 33.390 1.00 23.78  ? 333  VAL A CB    1 
ATOM   3383 C  CG1   . VAL C 3  327 ? 54.428 150.287 32.062 1.00 24.96  ? 333  VAL A CG1   1 
ATOM   3384 C  CG2   . VAL C 3  327 ? 53.046 148.748 33.463 1.00 24.76  ? 333  VAL A CG2   1 
ATOM   3385 N  N     . PHE C 3  328 ? 56.707 151.486 33.994 1.00 21.52  ? 334  PHE A N     1 
ATOM   3386 C  CA    . PHE C 3  328 ? 57.547 152.667 33.829 1.00 19.88  ? 334  PHE A CA    1 
ATOM   3387 C  C     . PHE C 3  328 ? 56.837 153.758 33.038 1.00 21.76  ? 334  PHE A C     1 
ATOM   3388 O  O     . PHE C 3  328 ? 56.312 153.511 31.955 1.00 24.84  ? 334  PHE A O     1 
ATOM   3389 C  CB    . PHE C 3  328 ? 58.854 152.293 33.129 1.00 15.84  ? 334  PHE A CB    1 
ATOM   3390 C  CG    . PHE C 3  328 ? 59.815 153.439 32.976 1.00 14.42  ? 334  PHE A CG    1 
ATOM   3391 C  CD1   . PHE C 3  328 ? 60.413 154.025 34.091 1.00 14.98  ? 334  PHE A CD1   1 
ATOM   3392 C  CD2   . PHE C 3  328 ? 60.139 153.926 31.709 1.00 14.15  ? 334  PHE A CD2   1 
ATOM   3393 C  CE1   . PHE C 3  328 ? 61.326 155.080 33.949 1.00 14.36  ? 334  PHE A CE1   1 
ATOM   3394 C  CE2   . PHE C 3  328 ? 61.048 154.978 31.551 1.00 13.66  ? 334  PHE A CE2   1 
ATOM   3395 C  CZ    . PHE C 3  328 ? 61.644 155.557 32.674 1.00 14.10  ? 334  PHE A CZ    1 
ATOM   3396 N  N     . ASN C 3  329 ? 56.816 154.962 33.596 1.00 20.68  ? 335  ASN A N     1 
ATOM   3397 C  CA    . ASN C 3  329 ? 56.189 156.104 32.945 1.00 19.30  ? 335  ASN A CA    1 
ATOM   3398 C  C     . ASN C 3  329 ? 57.303 157.110 32.683 1.00 19.00  ? 335  ASN A C     1 
ATOM   3399 O  O     . ASN C 3  329 ? 57.753 157.784 33.603 1.00 19.10  ? 335  ASN A O     1 
ATOM   3400 C  CB    . ASN C 3  329 ? 55.156 156.739 33.865 1.00 18.72  ? 335  ASN A CB    1 
ATOM   3401 C  CG    . ASN C 3  329 ? 54.329 157.797 33.165 1.00 19.23  ? 335  ASN A CG    1 
ATOM   3402 O  OD1   . ASN C 3  329 ? 54.788 158.435 32.220 1.00 16.72  ? 335  ASN A OD1   1 
ATOM   3403 N  ND2   . ASN C 3  329 ? 53.104 157.998 33.636 1.00 20.24  ? 335  ASN A ND2   1 
ATOM   3404 N  N     . PRO C 3  330 ? 57.760 157.225 31.425 1.00 17.41  ? 336  PRO A N     1 
ATOM   3405 C  CA    . PRO C 3  330 ? 58.831 158.162 31.087 1.00 16.89  ? 336  PRO A CA    1 
ATOM   3406 C  C     . PRO C 3  330 ? 58.511 159.588 31.511 1.00 18.05  ? 336  PRO A C     1 
ATOM   3407 O  O     . PRO C 3  330 ? 59.411 160.418 31.630 1.00 18.60  ? 336  PRO A O     1 
ATOM   3408 C  CB    . PRO C 3  330 ? 58.950 158.019 29.570 1.00 17.54  ? 336  PRO A CB    1 
ATOM   3409 C  CG    . PRO C 3  330 ? 58.500 156.629 29.321 1.00 16.26  ? 336  PRO A CG    1 
ATOM   3410 C  CD    . PRO C 3  330 ? 57.304 156.505 30.225 1.00 16.57  ? 336  PRO A CD    1 
ATOM   3411 N  N     . SER C 3  331 ? 57.231 159.870 31.735 1.00 17.95  ? 337  SER A N     1 
ATOM   3412 C  CA    . SER C 3  331 ? 56.804 161.203 32.153 1.00 19.26  ? 337  SER A CA    1 
ATOM   3413 C  C     . SER C 3  331 ? 56.925 161.414 33.655 1.00 19.81  ? 337  SER A C     1 
ATOM   3414 O  O     . SER C 3  331 ? 56.707 162.521 34.146 1.00 19.73  ? 337  SER A O     1 
ATOM   3415 C  CB    . SER C 3  331 ? 55.353 161.462 31.735 1.00 19.04  ? 337  SER A CB    1 
ATOM   3416 O  OG    . SER C 3  331 ? 55.283 161.967 30.413 1.00 21.54  ? 337  SER A OG    1 
ATOM   3417 N  N     . SER C 3  332 ? 57.273 160.356 34.381 1.00 19.71  ? 338  SER A N     1 
ATOM   3418 C  CA    . SER C 3  332 ? 57.403 160.443 35.831 1.00 21.34  ? 338  SER A CA    1 
ATOM   3419 C  C     . SER C 3  332 ? 58.837 160.665 36.280 1.00 22.99  ? 338  SER A C     1 
ATOM   3420 O  O     . SER C 3  332 ? 59.671 159.764 36.189 1.00 23.79  ? 338  SER A O     1 
ATOM   3421 C  CB    . SER C 3  332 ? 56.858 159.171 36.485 1.00 21.92  ? 338  SER A CB    1 
ATOM   3422 O  OG    . SER C 3  332 ? 57.054 159.190 37.887 1.00 21.61  ? 338  SER A OG    1 
ATOM   3423 N  N     . ARG C 3  333 ? 59.116 161.870 36.768 1.00 24.47  ? 339  ARG A N     1 
ATOM   3424 C  CA    . ARG C 3  333 ? 60.448 162.209 37.244 1.00 27.06  ? 339  ARG A CA    1 
ATOM   3425 C  C     . ARG C 3  333 ? 60.828 161.217 38.342 1.00 26.97  ? 339  ARG A C     1 
ATOM   3426 O  O     . ARG C 3  333 ? 62.001 160.879 38.520 1.00 26.54  ? 339  ARG A O     1 
ATOM   3427 C  CB    . ARG C 3  333 ? 60.463 163.633 37.808 1.00 29.32  ? 339  ARG A CB    1 
ATOM   3428 C  CG    . ARG C 3  333 ? 59.729 164.656 36.965 1.00 34.48  ? 339  ARG A CG    1 
ATOM   3429 C  CD    . ARG C 3  333 ? 60.511 165.112 35.744 1.00 40.51  ? 339  ARG A CD    1 
ATOM   3430 N  NE    . ARG C 3  333 ? 59.643 165.915 34.876 1.00 48.21  ? 339  ARG A NE    1 
ATOM   3431 C  CZ    . ARG C 3  333 ? 60.056 166.726 33.902 1.00 48.60  ? 339  ARG A CZ    1 
ATOM   3432 N  NH1   . ARG C 3  333 ? 61.356 166.872 33.642 1.00 48.44  ? 339  ARG A NH1   1 
ATOM   3433 N  NH2   . ARG C 3  333 ? 59.158 167.393 33.183 1.00 45.68  ? 339  ARG A NH2   1 
ATOM   3434 N  N     . ASP C 3  334 ? 59.824 160.755 39.079 1.00 27.40  ? 340  ASP A N     1 
ATOM   3435 C  CA    . ASP C 3  334 ? 60.044 159.802 40.157 1.00 28.14  ? 340  ASP A CA    1 
ATOM   3436 C  C     . ASP C 3  334 ? 60.515 158.474 39.565 1.00 25.90  ? 340  ASP A C     1 
ATOM   3437 O  O     . ASP C 3  334 ? 61.502 157.902 40.023 1.00 24.13  ? 340  ASP A O     1 
ATOM   3438 C  CB    . ASP C 3  334 ? 58.748 159.618 40.955 1.00 34.33  ? 340  ASP A CB    1 
ATOM   3439 C  CG    . ASP C 3  334 ? 58.957 158.838 42.241 1.00 38.78  ? 340  ASP A CG    1 
ATOM   3440 O  OD1   . ASP C 3  334 ? 60.020 159.010 42.874 1.00 41.40  ? 340  ASP A OD1   1 
ATOM   3441 O  OD2   . ASP C 3  334 ? 58.054 158.062 42.626 1.00 42.44  ? 340  ASP A OD2   1 
ATOM   3442 N  N     . HIS C 3  335 ? 59.817 157.997 38.536 1.00 23.86  ? 341  HIS A N     1 
ATOM   3443 C  CA    . HIS C 3  335 ? 60.198 156.751 37.877 1.00 20.99  ? 341  HIS A CA    1 
ATOM   3444 C  C     . HIS C 3  335 ? 61.589 156.863 37.263 1.00 21.01  ? 341  HIS A C     1 
ATOM   3445 O  O     . HIS C 3  335 ? 62.414 155.957 37.397 1.00 19.57  ? 341  HIS A O     1 
ATOM   3446 C  CB    . HIS C 3  335 ? 59.208 156.390 36.768 1.00 18.82  ? 341  HIS A CB    1 
ATOM   3447 C  CG    . HIS C 3  335 ? 57.915 155.827 37.263 1.00 16.60  ? 341  HIS A CG    1 
ATOM   3448 N  ND1   . HIS C 3  335 ? 56.961 155.305 36.415 1.00 18.32  ? 341  HIS A ND1   1 
ATOM   3449 C  CD2   . HIS C 3  335 ? 57.405 155.720 38.512 1.00 16.99  ? 341  HIS A CD2   1 
ATOM   3450 C  CE1   . HIS C 3  335 ? 55.920 154.903 37.120 1.00 18.58  ? 341  HIS A CE1   1 
ATOM   3451 N  NE2   . HIS C 3  335 ? 56.163 155.143 38.397 1.00 17.77  ? 341  HIS A NE2   1 
ATOM   3452 N  N     . ILE C 3  336 ? 61.852 157.973 36.584 1.00 20.63  ? 342  ILE A N     1 
ATOM   3453 C  CA    . ILE C 3  336 ? 63.150 158.154 35.956 1.00 21.39  ? 342  ILE A CA    1 
ATOM   3454 C  C     . ILE C 3  336 ? 64.267 158.113 36.992 1.00 21.78  ? 342  ILE A C     1 
ATOM   3455 O  O     . ILE C 3  336 ? 65.282 157.450 36.798 1.00 21.64  ? 342  ILE A O     1 
ATOM   3456 C  CB    . ILE C 3  336 ? 63.212 159.473 35.189 1.00 20.72  ? 342  ILE A CB    1 
ATOM   3457 C  CG1   . ILE C 3  336 ? 62.133 159.487 34.101 1.00 23.26  ? 342  ILE A CG1   1 
ATOM   3458 C  CG2   . ILE C 3  336 ? 64.576 159.632 34.549 1.00 22.27  ? 342  ILE A CG2   1 
ATOM   3459 C  CD1   . ILE C 3  336 ? 61.969 160.830 33.397 1.00 21.27  ? 342  ILE A CD1   1 
ATOM   3460 N  N     . GLN C 3  337 ? 64.063 158.812 38.099 1.00 22.86  ? 343  GLN A N     1 
ATOM   3461 C  CA    . GLN C 3  337 ? 65.046 158.860 39.171 1.00 24.19  ? 343  GLN A CA    1 
ATOM   3462 C  C     . GLN C 3  337 ? 65.279 157.481 39.787 1.00 23.23  ? 343  GLN A C     1 
ATOM   3463 O  O     . GLN C 3  337 ? 66.412 157.104 40.082 1.00 22.21  ? 343  GLN A O     1 
ATOM   3464 C  CB    . GLN C 3  337 ? 64.589 159.864 40.240 1.00 25.80  ? 343  GLN A CB    1 
ATOM   3465 C  CG    . GLN C 3  337 ? 65.122 159.586 41.624 1.00 30.64  ? 343  GLN A CG    1 
ATOM   3466 C  CD    . GLN C 3  337 ? 64.213 158.681 42.427 1.00 32.30  ? 343  GLN A CD    1 
ATOM   3467 O  OE1   . GLN C 3  337 ? 64.676 157.890 43.244 1.00 37.62  ? 343  GLN A OE1   1 
ATOM   3468 N  NE2   . GLN C 3  337 ? 62.910 158.809 42.214 1.00 32.02  ? 343  GLN A NE2   1 
ATOM   3469 N  N     . LYS C 3  338 ? 64.202 156.731 39.975 1.00 23.20  ? 344  LYS A N     1 
ATOM   3470 C  CA    . LYS C 3  338 ? 64.291 155.397 40.550 1.00 23.75  ? 344  LYS A CA    1 
ATOM   3471 C  C     . LYS C 3  338 ? 65.141 154.483 39.666 1.00 24.65  ? 344  LYS A C     1 
ATOM   3472 O  O     . LYS C 3  338 ? 66.096 153.866 40.133 1.00 27.17  ? 344  LYS A O     1 
ATOM   3473 C  CB    . LYS C 3  338 ? 62.888 154.817 40.710 1.00 24.07  ? 344  LYS A CB    1 
ATOM   3474 C  CG    . LYS C 3  338 ? 62.825 153.400 41.242 1.00 25.89  ? 344  LYS A CG    1 
ATOM   3475 C  CD    . LYS C 3  338 ? 61.401 152.873 41.125 1.00 27.52  ? 344  LYS A CD    1 
ATOM   3476 C  CE    . LYS C 3  338 ? 61.295 151.406 41.520 1.00 31.16  ? 344  LYS A CE    1 
ATOM   3477 N  NZ    . LYS C 3  338 ? 61.432 151.205 42.991 1.00 35.23  ? 344  LYS A NZ    1 
ATOM   3478 N  N     . LYS C 3  339 ? 64.803 154.406 38.384 1.00 24.10  ? 345  LYS A N     1 
ATOM   3479 C  CA    . LYS C 3  339 ? 65.542 153.558 37.461 1.00 23.36  ? 345  LYS A CA    1 
ATOM   3480 C  C     . LYS C 3  339 ? 67.001 153.958 37.273 1.00 23.43  ? 345  LYS A C     1 
ATOM   3481 O  O     . LYS C 3  339 ? 67.883 153.098 37.232 1.00 24.13  ? 345  LYS A O     1 
ATOM   3482 C  CB    . LYS C 3  339 ? 64.843 153.517 36.100 1.00 23.27  ? 345  LYS A CB    1 
ATOM   3483 C  CG    . LYS C 3  339 ? 63.499 152.804 36.116 1.00 24.40  ? 345  LYS A CG    1 
ATOM   3484 C  CD    . LYS C 3  339 ? 63.650 151.354 36.546 1.00 25.49  ? 345  LYS A CD    1 
ATOM   3485 C  CE    . LYS C 3  339 ? 62.315 150.641 36.528 1.00 28.13  ? 345  LYS A CE    1 
ATOM   3486 N  NZ    . LYS C 3  339 ? 62.461 149.176 36.767 1.00 32.69  ? 345  LYS A NZ    1 
ATOM   3487 N  N     . LEU C 3  340 ? 67.273 155.252 37.156 1.00 22.96  ? 346  LEU A N     1 
ATOM   3488 C  CA    . LEU C 3  340 ? 68.650 155.678 36.966 1.00 22.73  ? 346  LEU A CA    1 
ATOM   3489 C  C     . LEU C 3  340 ? 69.540 155.426 38.183 1.00 23.47  ? 346  LEU A C     1 
ATOM   3490 O  O     . LEU C 3  340 ? 70.709 155.087 38.029 1.00 23.98  ? 346  LEU A O     1 
ATOM   3491 C  CB    . LEU C 3  340 ? 68.705 157.146 36.551 1.00 22.58  ? 346  LEU A CB    1 
ATOM   3492 C  CG    . LEU C 3  340 ? 68.081 157.434 35.181 1.00 24.45  ? 346  LEU A CG    1 
ATOM   3493 C  CD1   . LEU C 3  340 ? 68.383 158.870 34.786 1.00 22.37  ? 346  LEU A CD1   1 
ATOM   3494 C  CD2   . LEU C 3  340 ? 68.630 156.470 34.132 1.00 22.51  ? 346  LEU A CD2   1 
ATOM   3495 N  N     . GLN C 3  341 ? 69.010 155.580 39.393 1.00 23.67  ? 347  GLN A N     1 
ATOM   3496 C  CA    . GLN C 3  341 ? 69.841 155.315 40.560 1.00 24.44  ? 347  GLN A CA    1 
ATOM   3497 C  C     . GLN C 3  341 ? 70.074 153.814 40.670 1.00 24.45  ? 347  GLN A C     1 
ATOM   3498 O  O     . GLN C 3  341 ? 71.122 153.378 41.140 1.00 24.31  ? 347  GLN A O     1 
ATOM   3499 C  CB    . GLN C 3  341 ? 69.204 155.864 41.843 1.00 24.49  ? 347  GLN A CB    1 
ATOM   3500 C  CG    . GLN C 3  341 ? 69.272 157.386 41.938 1.00 24.53  ? 347  GLN A CG    1 
ATOM   3501 C  CD    . GLN C 3  341 ? 68.968 157.917 43.332 1.00 25.31  ? 347  GLN A CD    1 
ATOM   3502 O  OE1   . GLN C 3  341 ? 69.749 157.729 44.267 1.00 23.17  ? 347  GLN A OE1   1 
ATOM   3503 N  NE2   . GLN C 3  341 ? 67.823 158.586 43.476 1.00 26.30  ? 347  GLN A NE2   1 
ATOM   3504 N  N     . GLU C 3  342 ? 69.107 153.021 40.215 1.00 25.51  ? 348  GLU A N     1 
ATOM   3505 C  CA    . GLU C 3  342 ? 69.255 151.572 40.252 1.00 26.29  ? 348  GLU A CA    1 
ATOM   3506 C  C     . GLU C 3  342 ? 70.264 151.151 39.198 1.00 27.42  ? 348  GLU A C     1 
ATOM   3507 O  O     . GLU C 3  342 ? 70.647 149.982 39.127 1.00 30.44  ? 348  GLU A O     1 
ATOM   3508 C  CB    . GLU C 3  342 ? 67.923 150.875 39.987 1.00 25.96  ? 348  GLU A CB    1 
ATOM   3509 C  CG    . GLU C 3  342 ? 66.835 151.276 40.966 1.00 29.54  ? 348  GLU A CG    1 
ATOM   3510 C  CD    . GLU C 3  342 ? 65.623 150.360 40.935 1.00 30.78  ? 348  GLU A CD    1 
ATOM   3511 O  OE1   . GLU C 3  342 ? 65.253 149.882 39.838 1.00 28.54  ? 348  GLU A OE1   1 
ATOM   3512 O  OE2   . GLU C 3  342 ? 65.031 150.132 42.017 1.00 31.16  ? 348  GLU A OE2   1 
ATOM   3513 N  N     . ALA C 3  343 ? 70.692 152.111 38.382 1.00 25.13  ? 349  ALA A N     1 
ATOM   3514 C  CA    . ALA C 3  343 ? 71.662 151.848 37.333 1.00 23.75  ? 349  ALA A CA    1 
ATOM   3515 C  C     . ALA C 3  343 ? 73.015 152.447 37.684 1.00 24.36  ? 349  ALA A C     1 
ATOM   3516 O  O     . ALA C 3  343 ? 73.915 152.490 36.848 1.00 25.01  ? 349  ALA A O     1 
ATOM   3517 C  CB    . ALA C 3  343 ? 71.172 152.412 36.008 1.00 22.94  ? 349  ALA A CB    1 
ATOM   3518 N  N     . GLY C 3  344 ? 73.150 152.932 38.916 1.00 25.25  ? 350  GLY A N     1 
ATOM   3519 C  CA    . GLY C 3  344 ? 74.420 153.492 39.346 1.00 25.64  ? 350  GLY A CA    1 
ATOM   3520 C  C     . GLY C 3  344 ? 74.514 154.999 39.470 1.00 26.30  ? 350  GLY A C     1 
ATOM   3521 O  O     . GLY C 3  344 ? 75.447 155.507 40.093 1.00 26.14  ? 350  GLY A O     1 
ATOM   3522 N  N     . TRP C 3  345 ? 73.560 155.719 38.888 1.00 27.36  ? 351  TRP A N     1 
ATOM   3523 C  CA    . TRP C 3  345 ? 73.573 157.177 38.937 1.00 27.66  ? 351  TRP A CA    1 
ATOM   3524 C  C     . TRP C 3  345 ? 73.477 157.726 40.353 1.00 28.62  ? 351  TRP A C     1 
ATOM   3525 O  O     . TRP C 3  345 ? 72.600 157.333 41.122 1.00 29.04  ? 351  TRP A O     1 
ATOM   3526 C  CB    . TRP C 3  345 ? 72.434 157.752 38.092 1.00 26.13  ? 351  TRP A CB    1 
ATOM   3527 C  CG    . TRP C 3  345 ? 72.323 159.253 38.192 1.00 27.19  ? 351  TRP A CG    1 
ATOM   3528 C  CD1   . TRP C 3  345 ? 73.322 160.167 37.999 1.00 25.38  ? 351  TRP A CD1   1 
ATOM   3529 C  CD2   . TRP C 3  345 ? 71.141 160.011 38.502 1.00 26.52  ? 351  TRP A CD2   1 
ATOM   3530 N  NE1   . TRP C 3  345 ? 72.836 161.443 38.169 1.00 25.81  ? 351  TRP A NE1   1 
ATOM   3531 C  CE2   . TRP C 3  345 ? 71.503 161.377 38.476 1.00 25.10  ? 351  TRP A CE2   1 
ATOM   3532 C  CE3   . TRP C 3  345 ? 69.813 159.667 38.796 1.00 25.00  ? 351  TRP A CE3   1 
ATOM   3533 C  CZ2   . TRP C 3  345 ? 70.587 162.400 38.731 1.00 23.77  ? 351  TRP A CZ2   1 
ATOM   3534 C  CZ3   . TRP C 3  345 ? 68.901 160.688 39.052 1.00 26.86  ? 351  TRP A CZ3   1 
ATOM   3535 C  CH2   . TRP C 3  345 ? 69.295 162.038 39.017 1.00 25.00  ? 351  TRP A CH2   1 
ATOM   3536 N  N     . VAL C 3  346 ? 74.386 158.642 40.684 1.00 29.34  ? 352  VAL A N     1 
ATOM   3537 C  CA    . VAL C 3  346 ? 74.415 159.269 42.002 1.00 31.73  ? 352  VAL A CA    1 
ATOM   3538 C  C     . VAL C 3  346 ? 74.049 160.748 41.877 1.00 32.86  ? 352  VAL A C     1 
ATOM   3539 O  O     . VAL C 3  346 ? 74.880 161.567 41.489 1.00 32.86  ? 352  VAL A O     1 
ATOM   3540 C  CB    . VAL C 3  346 ? 75.814 159.172 42.638 1.00 32.20  ? 352  VAL A CB    1 
ATOM   3541 C  CG1   . VAL C 3  346 ? 75.779 159.724 44.049 1.00 30.82  ? 352  VAL A CG1   1 
ATOM   3542 C  CG2   . VAL C 3  346 ? 76.287 157.734 42.640 1.00 33.04  ? 352  VAL A CG2   1 
ATOM   3543 N  N     . PRO C 3  347 ? 72.800 161.107 42.213 1.00 34.00  ? 353  PRO A N     1 
ATOM   3544 C  CA    . PRO C 3  347 ? 72.333 162.493 42.130 1.00 35.15  ? 353  PRO A CA    1 
ATOM   3545 C  C     . PRO C 3  347 ? 73.204 163.487 42.895 1.00 36.93  ? 353  PRO A C     1 
ATOM   3546 O  O     . PRO C 3  347 ? 73.625 163.226 44.020 1.00 37.63  ? 353  PRO A O     1 
ATOM   3547 C  CB    . PRO C 3  347 ? 70.923 162.415 42.704 1.00 34.70  ? 353  PRO A CB    1 
ATOM   3548 C  CG    . PRO C 3  347 ? 70.494 161.029 42.357 1.00 35.48  ? 353  PRO A CG    1 
ATOM   3549 C  CD    . PRO C 3  347 ? 71.721 160.225 42.691 1.00 34.30  ? 353  PRO A CD    1 
ATOM   3550 N  N     . THR C 3  348 ? 73.460 164.630 42.266 1.00 39.08  ? 354  THR A N     1 
ATOM   3551 C  CA    . THR C 3  348 ? 74.256 165.701 42.854 1.00 40.41  ? 354  THR A CA    1 
ATOM   3552 C  C     . THR C 3  348 ? 73.351 166.793 43.419 1.00 40.75  ? 354  THR A C     1 
ATOM   3553 O  O     . THR C 3  348 ? 73.528 167.226 44.557 1.00 41.82  ? 354  THR A O     1 
ATOM   3554 C  CB    . THR C 3  348 ? 75.195 166.334 41.806 1.00 41.52  ? 354  THR A CB    1 
ATOM   3555 O  OG1   . THR C 3  348 ? 76.308 165.464 41.581 1.00 43.74  ? 354  THR A OG1   1 
ATOM   3556 C  CG2   . THR C 3  348 ? 75.699 167.690 42.274 1.00 42.03  ? 354  THR A CG2   1 
ATOM   3557 N  N     . LYS C 3  349 ? 72.379 167.238 42.627 1.00 40.00  ? 355  LYS A N     1 
ATOM   3558 C  CA    . LYS C 3  349 ? 71.475 168.284 43.084 1.00 39.56  ? 355  LYS A CA    1 
ATOM   3559 C  C     . LYS C 3  349 ? 70.061 167.800 43.373 1.00 38.34  ? 355  LYS A C     1 
ATOM   3560 O  O     . LYS C 3  349 ? 69.495 167.004 42.628 1.00 37.26  ? 355  LYS A O     1 
ATOM   3561 C  CB    . LYS C 3  349 ? 71.444 169.430 42.074 1.00 40.73  ? 355  LYS A CB    1 
ATOM   3562 C  CG    . LYS C 3  349 ? 71.026 169.045 40.678 1.00 43.13  ? 355  LYS A CG    1 
ATOM   3563 C  CD    . LYS C 3  349 ? 71.009 170.276 39.769 1.00 46.68  ? 355  LYS A CD    1 
ATOM   3564 C  CE    . LYS C 3  349 ? 70.091 171.372 40.326 1.00 47.12  ? 355  LYS A CE    1 
ATOM   3565 N  NZ    . LYS C 3  349 ? 69.850 172.477 39.356 1.00 47.86  ? 355  LYS A NZ    1 
ATOM   3566 N  N     . TYR C 3  350 ? 69.498 168.296 44.469 1.00 38.23  ? 356  TYR A N     1 
ATOM   3567 C  CA    . TYR C 3  350 ? 68.157 167.921 44.892 1.00 39.27  ? 356  TYR A CA    1 
ATOM   3568 C  C     . TYR C 3  350 ? 67.266 169.152 45.015 1.00 40.72  ? 356  TYR A C     1 
ATOM   3569 O  O     . TYR C 3  350 ? 67.752 170.279 44.996 1.00 41.00  ? 356  TYR A O     1 
ATOM   3570 C  CB    . TYR C 3  350 ? 68.217 167.195 46.242 1.00 39.06  ? 356  TYR A CB    1 
ATOM   3571 C  CG    . TYR C 3  350 ? 69.004 165.902 46.217 1.00 38.44  ? 356  TYR A CG    1 
ATOM   3572 C  CD1   . TYR C 3  350 ? 70.379 165.904 45.990 1.00 38.11  ? 356  TYR A CD1   1 
ATOM   3573 C  CD2   . TYR C 3  350 ? 68.368 164.672 46.394 1.00 38.00  ? 356  TYR A CD2   1 
ATOM   3574 C  CE1   . TYR C 3  350 ? 71.102 164.716 45.935 1.00 38.92  ? 356  TYR A CE1   1 
ATOM   3575 C  CE2   . TYR C 3  350 ? 69.084 163.477 46.342 1.00 38.85  ? 356  TYR A CE2   1 
ATOM   3576 C  CZ    . TYR C 3  350 ? 70.448 163.508 46.111 1.00 38.74  ? 356  TYR A CZ    1 
ATOM   3577 O  OH    . TYR C 3  350 ? 71.160 162.333 46.040 1.00 41.29  ? 356  TYR A OH    1 
ATOM   3578 N  N     . THR C 3  351 ? 65.961 168.929 45.137 1.00 42.26  ? 357  THR A N     1 
ATOM   3579 C  CA    . THR C 3  351 ? 65.006 170.024 45.272 1.00 44.17  ? 357  THR A CA    1 
ATOM   3580 C  C     . THR C 3  351 ? 64.967 170.468 46.727 1.00 45.58  ? 357  THR A C     1 
ATOM   3581 O  O     . THR C 3  351 ? 65.459 169.763 47.609 1.00 45.85  ? 357  THR A O     1 
ATOM   3582 C  CB    . THR C 3  351 ? 63.577 169.596 44.882 1.00 44.20  ? 357  THR A CB    1 
ATOM   3583 O  OG1   . THR C 3  351 ? 63.130 168.573 45.777 1.00 43.68  ? 357  THR A OG1   1 
ATOM   3584 C  CG2   . THR C 3  351 ? 63.537 169.072 43.455 1.00 44.97  ? 357  THR A CG2   1 
ATOM   3585 N  N     . ASP C 3  352 ? 64.373 171.630 46.977 1.00 46.57  ? 358  ASP A N     1 
ATOM   3586 C  CA    . ASP C 3  352 ? 64.280 172.141 48.336 1.00 48.11  ? 358  ASP A CA    1 
ATOM   3587 C  C     . ASP C 3  352 ? 63.343 171.254 49.148 1.00 47.69  ? 358  ASP A C     1 
ATOM   3588 O  O     . ASP C 3  352 ? 63.117 171.504 50.332 1.00 47.69  ? 358  ASP A O     1 
ATOM   3589 C  CB    . ASP C 3  352 ? 63.767 173.591 48.346 1.00 50.72  ? 358  ASP A CB    1 
ATOM   3590 C  CG    . ASP C 3  352 ? 64.575 174.514 47.434 1.00 52.78  ? 358  ASP A CG    1 
ATOM   3591 O  OD1   . ASP C 3  352 ? 65.819 174.380 47.387 1.00 52.87  ? 358  ASP A OD1   1 
ATOM   3592 O  OD2   . ASP C 3  352 ? 63.965 175.384 46.772 1.00 52.82  ? 358  ASP A OD2   1 
ATOM   3593 N  N     . LYS C 3  353 ? 62.805 170.217 48.507 1.00 46.68  ? 359  LYS A N     1 
ATOM   3594 C  CA    . LYS C 3  353 ? 61.899 169.291 49.179 1.00 45.75  ? 359  LYS A CA    1 
ATOM   3595 C  C     . LYS C 3  353 ? 62.525 167.910 49.370 1.00 45.32  ? 359  LYS A C     1 
ATOM   3596 O  O     . LYS C 3  353 ? 61.956 167.051 50.045 1.00 47.08  ? 359  LYS A O     1 
ATOM   3597 C  CB    . LYS C 3  353 ? 60.591 169.160 48.398 1.00 46.62  ? 359  LYS A CB    1 
ATOM   3598 C  CG    . LYS C 3  353 ? 59.529 168.331 49.112 1.00 48.79  ? 359  LYS A CG    1 
ATOM   3599 C  CD    . LYS C 3  353 ? 58.249 168.205 48.294 1.00 50.57  ? 359  LYS A CD    1 
ATOM   3600 C  CE    . LYS C 3  353 ? 57.202 167.363 49.027 1.00 50.96  ? 359  LYS A CE    1 
ATOM   3601 N  NZ    . LYS C 3  353 ? 55.971 167.139 48.205 1.00 49.55  ? 359  LYS A NZ    1 
ATOM   3602 N  N     . GLY C 3  354 ? 63.690 167.686 48.773 1.00 43.52  ? 360  GLY A N     1 
ATOM   3603 C  CA    . GLY C 3  354 ? 64.349 166.403 48.945 1.00 40.81  ? 360  GLY A CA    1 
ATOM   3604 C  C     . GLY C 3  354 ? 64.435 165.509 47.726 1.00 38.70  ? 360  GLY A C     1 
ATOM   3605 O  O     . GLY C 3  354 ? 65.255 164.592 47.681 1.00 37.51  ? 360  GLY A O     1 
ATOM   3606 N  N     . ALA C 3  355 ? 63.589 165.764 46.736 1.00 37.07  ? 361  ALA A N     1 
ATOM   3607 C  CA    . ALA C 3  355 ? 63.601 164.958 45.526 1.00 34.90  ? 361  ALA A CA    1 
ATOM   3608 C  C     . ALA C 3  355 ? 64.768 165.361 44.635 1.00 32.85  ? 361  ALA A C     1 
ATOM   3609 O  O     . ALA C 3  355 ? 65.119 166.535 44.541 1.00 32.16  ? 361  ALA A O     1 
ATOM   3610 C  CB    . ALA C 3  355 ? 62.283 165.120 44.772 1.00 34.68  ? 361  ALA A CB    1 
ATOM   3611 N  N     . PRO C 3  356 ? 65.400 164.385 43.980 1.00 31.85  ? 362  PRO A N     1 
ATOM   3612 C  CA    . PRO C 3  356 ? 66.524 164.725 43.107 1.00 31.15  ? 362  PRO A CA    1 
ATOM   3613 C  C     . PRO C 3  356 ? 66.014 165.449 41.861 1.00 30.11  ? 362  PRO A C     1 
ATOM   3614 O  O     . PRO C 3  356 ? 64.967 165.099 41.312 1.00 30.75  ? 362  PRO A O     1 
ATOM   3615 C  CB    . PRO C 3  356 ? 67.131 163.362 42.791 1.00 30.86  ? 362  PRO A CB    1 
ATOM   3616 C  CG    . PRO C 3  356 ? 65.933 162.471 42.774 1.00 30.89  ? 362  PRO A CG    1 
ATOM   3617 C  CD    . PRO C 3  356 ? 65.152 162.932 43.988 1.00 31.60  ? 362  PRO A CD    1 
ATOM   3618 N  N     . VAL C 3  357 ? 66.746 166.466 41.426 1.00 27.95  ? 363  VAL A N     1 
ATOM   3619 C  CA    . VAL C 3  357 ? 66.357 167.230 40.251 1.00 26.68  ? 363  VAL A CA    1 
ATOM   3620 C  C     . VAL C 3  357 ? 66.500 166.390 38.985 1.00 26.44  ? 363  VAL A C     1 
ATOM   3621 O  O     . VAL C 3  357 ? 67.545 165.794 38.741 1.00 25.94  ? 363  VAL A O     1 
ATOM   3622 C  CB    . VAL C 3  357 ? 67.222 168.505 40.120 1.00 27.23  ? 363  VAL A CB    1 
ATOM   3623 C  CG1   . VAL C 3  357 ? 66.933 169.206 38.796 1.00 24.84  ? 363  VAL A CG1   1 
ATOM   3624 C  CG2   . VAL C 3  357 ? 66.937 169.443 41.294 1.00 25.36  ? 363  VAL A CG2   1 
ATOM   3625 N  N     . VAL C 3  358 ? 65.442 166.343 38.183 1.00 26.86  ? 364  VAL A N     1 
ATOM   3626 C  CA    . VAL C 3  358 ? 65.464 165.577 36.945 1.00 26.22  ? 364  VAL A CA    1 
ATOM   3627 C  C     . VAL C 3  358 ? 64.994 166.428 35.773 1.00 28.14  ? 364  VAL A C     1 
ATOM   3628 O  O     . VAL C 3  358 ? 63.895 166.240 35.244 1.00 28.51  ? 364  VAL A O     1 
ATOM   3629 C  CB    . VAL C 3  358 ? 64.573 164.322 37.047 1.00 26.07  ? 364  VAL A CB    1 
ATOM   3630 C  CG1   . VAL C 3  358 ? 64.673 163.501 35.767 1.00 25.20  ? 364  VAL A CG1   1 
ATOM   3631 C  CG2   . VAL C 3  358 ? 64.994 163.489 38.246 1.00 23.54  ? 364  VAL A CG2   1 
ATOM   3632 N  N     . ASP C 3  359 ? 65.834 167.380 35.386 1.00 29.51  ? 365  ASP A N     1 
ATOM   3633 C  CA    . ASP C 3  359 ? 65.551 168.264 34.266 1.00 30.68  ? 365  ASP A CA    1 
ATOM   3634 C  C     . ASP C 3  359 ? 66.527 167.948 33.140 1.00 31.34  ? 365  ASP A C     1 
ATOM   3635 O  O     . ASP C 3  359 ? 67.412 167.105 33.295 1.00 29.32  ? 365  ASP A O     1 
ATOM   3636 C  CB    . ASP C 3  359 ? 65.689 169.734 34.681 1.00 31.98  ? 365  ASP A CB    1 
ATOM   3637 C  CG    . ASP C 3  359 ? 67.023 170.041 35.342 1.00 32.36  ? 365  ASP A CG    1 
ATOM   3638 O  OD1   . ASP C 3  359 ? 68.064 169.532 34.876 1.00 32.40  ? 365  ASP A OD1   1 
ATOM   3639 O  OD2   . ASP C 3  359 ? 67.033 170.810 36.327 1.00 35.18  ? 365  ASP A OD2   1 
ATOM   3640 N  N     . ASP C 3  360 ? 66.379 168.637 32.014 1.00 32.98  ? 366  ASP A N     1 
ATOM   3641 C  CA    . ASP C 3  360 ? 67.237 168.401 30.859 1.00 34.40  ? 366  ASP A CA    1 
ATOM   3642 C  C     . ASP C 3  360 ? 68.730 168.528 31.159 1.00 34.42  ? 366  ASP A C     1 
ATOM   3643 O  O     . ASP C 3  360 ? 69.542 167.811 30.576 1.00 34.76  ? 366  ASP A O     1 
ATOM   3644 C  CB    . ASP C 3  360 ? 66.854 169.346 29.718 1.00 36.65  ? 366  ASP A CB    1 
ATOM   3645 C  CG    . ASP C 3  360 ? 66.856 168.653 28.368 1.00 40.42  ? 366  ASP A CG    1 
ATOM   3646 O  OD1   . ASP C 3  360 ? 66.046 167.716 28.176 1.00 43.83  ? 366  ASP A OD1   1 
ATOM   3647 O  OD2   . ASP C 3  360 ? 67.672 169.035 27.501 1.00 42.56  ? 366  ASP A OD2   1 
ATOM   3648 N  N     . GLU C 3  361 ? 69.091 169.434 32.061 1.00 35.45  ? 367  GLU A N     1 
ATOM   3649 C  CA    . GLU C 3  361 ? 70.492 169.627 32.426 1.00 35.89  ? 367  GLU A CA    1 
ATOM   3650 C  C     . GLU C 3  361 ? 71.092 168.364 33.016 1.00 34.72  ? 367  GLU A C     1 
ATOM   3651 O  O     . GLU C 3  361 ? 72.089 167.856 32.510 1.00 35.16  ? 367  GLU A O     1 
ATOM   3652 C  CB    . GLU C 3  361 ? 70.647 170.729 33.462 1.00 39.38  ? 367  GLU A CB    1 
ATOM   3653 C  CG    . GLU C 3  361 ? 70.142 172.078 33.060 1.00 43.82  ? 367  GLU A CG    1 
ATOM   3654 C  CD    . GLU C 3  361 ? 70.241 173.057 34.209 1.00 47.88  ? 367  GLU A CD    1 
ATOM   3655 O  OE1   . GLU C 3  361 ? 71.382 173.336 34.651 1.00 47.62  ? 367  GLU A OE1   1 
ATOM   3656 O  OE2   . GLU C 3  361 ? 69.180 173.532 34.673 1.00 49.62  ? 367  GLU A OE2   1 
ATOM   3657 N  N     . VAL C 3  362 ? 70.495 167.867 34.097 1.00 33.29  ? 368  VAL A N     1 
ATOM   3658 C  CA    . VAL C 3  362 ? 71.010 166.666 34.745 1.00 32.93  ? 368  VAL A CA    1 
ATOM   3659 C  C     . VAL C 3  362 ? 70.983 165.458 33.812 1.00 31.39  ? 368  VAL A C     1 
ATOM   3660 O  O     . VAL C 3  362 ? 71.992 164.768 33.666 1.00 32.60  ? 368  VAL A O     1 
ATOM   3661 C  CB    . VAL C 3  362 ? 70.234 166.316 36.051 1.00 31.99  ? 368  VAL A CB    1 
ATOM   3662 C  CG1   . VAL C 3  362 ? 70.008 167.567 36.871 1.00 31.74  ? 368  VAL A CG1   1 
ATOM   3663 C  CG2   . VAL C 3  362 ? 68.922 165.641 35.731 1.00 34.22  ? 368  VAL A CG2   1 
ATOM   3664 N  N     . LEU C 3  363 ? 69.845 165.209 33.170 1.00 28.36  ? 369  LEU A N     1 
ATOM   3665 C  CA    . LEU C 3  363 ? 69.735 164.068 32.272 1.00 27.12  ? 369  LEU A CA    1 
ATOM   3666 C  C     . LEU C 3  363 ? 70.911 164.063 31.311 1.00 28.11  ? 369  LEU A C     1 
ATOM   3667 O  O     . LEU C 3  363 ? 71.530 163.025 31.073 1.00 28.38  ? 369  LEU A O     1 
ATOM   3668 C  CB    . LEU C 3  363 ? 68.414 164.119 31.500 1.00 24.06  ? 369  LEU A CB    1 
ATOM   3669 C  CG    . LEU C 3  363 ? 67.160 163.859 32.341 1.00 21.44  ? 369  LEU A CG    1 
ATOM   3670 C  CD1   . LEU C 3  363 ? 65.919 164.128 31.512 1.00 22.58  ? 369  LEU A CD1   1 
ATOM   3671 C  CD2   . LEU C 3  363 ? 67.164 162.432 32.844 1.00 19.48  ? 369  LEU A CD2   1 
ATOM   3672 N  N     . GLU C 3  364 ? 71.229 165.236 30.778 1.00 29.51  ? 370  GLU A N     1 
ATOM   3673 C  CA    . GLU C 3  364 ? 72.337 165.375 29.847 1.00 31.52  ? 370  GLU A CA    1 
ATOM   3674 C  C     . GLU C 3  364 ? 73.644 164.905 30.485 1.00 32.14  ? 370  GLU A C     1 
ATOM   3675 O  O     . GLU C 3  364 ? 74.482 164.277 29.835 1.00 32.09  ? 370  GLU A O     1 
ATOM   3676 C  CB    . GLU C 3  364 ? 72.485 166.837 29.432 1.00 34.00  ? 370  GLU A CB    1 
ATOM   3677 C  CG    . GLU C 3  364 ? 73.135 167.013 28.083 1.00 40.34  ? 370  GLU A CG    1 
ATOM   3678 C  CD    . GLU C 3  364 ? 72.278 166.447 26.968 1.00 44.17  ? 370  GLU A CD    1 
ATOM   3679 O  OE1   . GLU C 3  364 ? 71.175 166.997 26.729 1.00 46.29  ? 370  GLU A OE1   1 
ATOM   3680 O  OE2   . GLU C 3  364 ? 72.700 165.450 26.337 1.00 46.30  ? 370  GLU A OE2   1 
ATOM   3681 N  N     . GLY C 3  365 ? 73.811 165.206 31.768 1.00 31.71  ? 371  GLY A N     1 
ATOM   3682 C  CA    . GLY C 3  365 ? 75.034 164.830 32.452 1.00 32.36  ? 371  GLY A CA    1 
ATOM   3683 C  C     . GLY C 3  365 ? 75.062 163.481 33.143 1.00 31.85  ? 371  GLY A C     1 
ATOM   3684 O  O     . GLY C 3  365 ? 76.088 163.105 33.710 1.00 32.33  ? 371  GLY A O     1 
ATOM   3685 N  N     . VAL C 3  366 ? 73.955 162.746 33.113 1.00 31.48  ? 372  VAL A N     1 
ATOM   3686 C  CA    . VAL C 3  366 ? 73.929 161.438 33.760 1.00 31.86  ? 372  VAL A CA    1 
ATOM   3687 C  C     . VAL C 3  366 ? 74.801 160.420 33.024 1.00 31.74  ? 372  VAL A C     1 
ATOM   3688 O  O     . VAL C 3  366 ? 74.834 160.383 31.794 1.00 31.65  ? 372  VAL A O     1 
ATOM   3689 C  CB    . VAL C 3  366 ? 72.490 160.886 33.862 1.00 31.01  ? 372  VAL A CB    1 
ATOM   3690 C  CG1   . VAL C 3  366 ? 72.514 159.459 34.392 1.00 29.34  ? 372  VAL A CG1   1 
ATOM   3691 C  CG2   . VAL C 3  366 ? 71.665 161.768 34.786 1.00 31.68  ? 372  VAL A CG2   1 
ATOM   3692 N  N     . ARG C 3  367 ? 75.510 159.602 33.795 1.00 32.32  ? 373  ARG A N     1 
ATOM   3693 C  CA    . ARG C 3  367 ? 76.380 158.566 33.243 1.00 33.45  ? 373  ARG A CA    1 
ATOM   3694 C  C     . ARG C 3  367 ? 76.213 157.269 34.025 1.00 33.29  ? 373  ARG A C     1 
ATOM   3695 O  O     . ARG C 3  367 ? 76.467 157.230 35.228 1.00 35.40  ? 373  ARG A O     1 
ATOM   3696 C  CB    . ARG C 3  367 ? 77.846 159.001 33.314 1.00 33.57  ? 373  ARG A CB    1 
ATOM   3697 C  CG    . ARG C 3  367 ? 78.197 160.190 32.437 1.00 33.13  ? 373  ARG A CG    1 
ATOM   3698 C  CD    . ARG C 3  367 ? 78.105 159.842 30.965 1.00 33.95  ? 373  ARG A CD    1 
ATOM   3699 N  NE    . ARG C 3  367 ? 78.507 160.971 30.135 1.00 35.93  ? 373  ARG A NE    1 
ATOM   3700 C  CZ    . ARG C 3  367 ? 77.851 162.126 30.081 1.00 37.42  ? 373  ARG A CZ    1 
ATOM   3701 N  NH1   . ARG C 3  367 ? 76.756 162.301 30.807 1.00 38.78  ? 373  ARG A NH1   1 
ATOM   3702 N  NH2   . ARG C 3  367 ? 78.297 163.110 29.314 1.00 37.25  ? 373  ARG A NH2   1 
ATOM   3703 N  N     . VAL C 3  368 ? 75.767 156.219 33.341 1.00 32.13  ? 374  VAL A N     1 
ATOM   3704 C  CA    . VAL C 3  368 ? 75.593 154.904 33.953 1.00 31.67  ? 374  VAL A CA    1 
ATOM   3705 C  C     . VAL C 3  368 ? 76.368 153.895 33.105 1.00 33.34  ? 374  VAL A C     1 
ATOM   3706 O  O     . VAL C 3  368 ? 76.504 154.064 31.892 1.00 33.23  ? 374  VAL A O     1 
ATOM   3707 C  CB    . VAL C 3  368 ? 74.097 154.488 34.033 1.00 29.98  ? 374  VAL A CB    1 
ATOM   3708 C  CG1   . VAL C 3  368 ? 73.368 155.381 35.018 1.00 30.08  ? 374  VAL A CG1   1 
ATOM   3709 C  CG2   . VAL C 3  368 ? 73.444 154.565 32.666 1.00 26.60  ? 374  VAL A CG2   1 
ATOM   3710 N  N     . ASP C 3  369 ? 76.877 152.847 33.741 1.00 34.48  ? 375  ASP A N     1 
ATOM   3711 C  CA    . ASP C 3  369 ? 77.665 151.853 33.032 1.00 35.63  ? 375  ASP A CA    1 
ATOM   3712 C  C     . ASP C 3  369 ? 76.970 151.138 31.883 1.00 34.86  ? 375  ASP A C     1 
ATOM   3713 O  O     . ASP C 3  369 ? 77.490 151.113 30.770 1.00 35.51  ? 375  ASP A O     1 
ATOM   3714 C  CB    . ASP C 3  369 ? 78.216 150.830 34.021 1.00 38.52  ? 375  ASP A CB    1 
ATOM   3715 C  CG    . ASP C 3  369 ? 79.237 151.434 34.958 1.00 41.75  ? 375  ASP A CG    1 
ATOM   3716 O  OD1   . ASP C 3  369 ? 80.164 152.109 34.457 1.00 43.09  ? 375  ASP A OD1   1 
ATOM   3717 O  OD2   . ASP C 3  369 ? 79.118 151.238 36.188 1.00 44.91  ? 375  ASP A OD2   1 
ATOM   3718 N  N     . ASP C 3  370 ? 75.806 150.551 32.144 1.00 33.86  ? 376  ASP A N     1 
ATOM   3719 C  CA    . ASP C 3  370 ? 75.077 149.838 31.102 1.00 32.60  ? 376  ASP A CA    1 
ATOM   3720 C  C     . ASP C 3  370 ? 74.820 150.738 29.903 1.00 31.22  ? 376  ASP A C     1 
ATOM   3721 O  O     . ASP C 3  370 ? 74.092 151.722 30.001 1.00 32.44  ? 376  ASP A O     1 
ATOM   3722 C  CB    . ASP C 3  370 ? 73.738 149.325 31.626 1.00 32.80  ? 376  ASP A CB    1 
ATOM   3723 C  CG    . ASP C 3  370 ? 72.937 148.615 30.554 1.00 33.91  ? 376  ASP A CG    1 
ATOM   3724 O  OD1   . ASP C 3  370 ? 73.320 147.495 30.172 1.00 35.88  ? 376  ASP A OD1   1 
ATOM   3725 O  OD2   . ASP C 3  370 ? 71.933 149.178 30.075 1.00 35.09  ? 376  ASP A OD2   1 
ATOM   3726 N  N     . PRO C 3  371 ? 75.406 150.401 28.749 1.00 29.89  ? 377  PRO A N     1 
ATOM   3727 C  CA    . PRO C 3  371 ? 75.237 151.190 27.526 1.00 28.68  ? 377  PRO A CA    1 
ATOM   3728 C  C     . PRO C 3  371 ? 73.808 151.335 26.996 1.00 27.27  ? 377  PRO A C     1 
ATOM   3729 O  O     . PRO C 3  371 ? 73.486 152.344 26.367 1.00 29.22  ? 377  PRO A O     1 
ATOM   3730 C  CB    . PRO C 3  371 ? 76.170 150.495 26.534 1.00 27.53  ? 377  PRO A CB    1 
ATOM   3731 C  CG    . PRO C 3  371 ? 76.221 149.090 27.032 1.00 30.19  ? 377  PRO A CG    1 
ATOM   3732 C  CD    . PRO C 3  371 ? 76.313 149.264 28.518 1.00 29.72  ? 377  PRO A CD    1 
ATOM   3733 N  N     . GLU C 3  372 ? 72.953 150.351 27.248 1.00 24.76  ? 378  GLU A N     1 
ATOM   3734 C  CA    . GLU C 3  372 ? 71.576 150.428 26.771 1.00 23.57  ? 378  GLU A CA    1 
ATOM   3735 C  C     . GLU C 3  372 ? 70.781 151.470 27.557 1.00 23.02  ? 378  GLU A C     1 
ATOM   3736 O  O     . GLU C 3  372 ? 69.975 152.211 26.991 1.00 21.42  ? 378  GLU A O     1 
ATOM   3737 C  CB    . GLU C 3  372 ? 70.880 149.069 26.885 1.00 24.47  ? 378  GLU A CB    1 
ATOM   3738 C  CG    . GLU C 3  372 ? 69.496 149.041 26.239 1.00 27.47  ? 378  GLU A CG    1 
ATOM   3739 C  CD    . GLU C 3  372 ? 68.756 147.724 26.436 1.00 29.20  ? 378  GLU A CD    1 
ATOM   3740 O  OE1   . GLU C 3  372 ? 69.375 146.658 26.242 1.00 27.68  ? 378  GLU A OE1   1 
ATOM   3741 O  OE2   . GLU C 3  372 ? 67.548 147.757 26.767 1.00 29.78  ? 378  GLU A OE2   1 
ATOM   3742 N  N     . LYS C 3  373 ? 71.002 151.511 28.868 1.00 22.19  ? 379  LYS A N     1 
ATOM   3743 C  CA    . LYS C 3  373 ? 70.319 152.464 29.730 1.00 21.25  ? 379  LYS A CA    1 
ATOM   3744 C  C     . LYS C 3  373 ? 70.891 153.858 29.504 1.00 20.78  ? 379  LYS A C     1 
ATOM   3745 O  O     . LYS C 3  373 ? 70.174 154.850 29.575 1.00 18.84  ? 379  LYS A O     1 
ATOM   3746 C  CB    . LYS C 3  373 ? 70.487 152.068 31.195 1.00 23.21  ? 379  LYS A CB    1 
ATOM   3747 C  CG    . LYS C 3  373 ? 69.811 150.767 31.561 1.00 23.03  ? 379  LYS A CG    1 
ATOM   3748 C  CD    . LYS C 3  373 ? 70.190 150.365 32.968 1.00 26.08  ? 379  LYS A CD    1 
ATOM   3749 C  CE    . LYS C 3  373 ? 69.580 149.032 33.358 1.00 26.65  ? 379  LYS A CE    1 
ATOM   3750 N  NZ    . LYS C 3  373 ? 68.108 149.052 33.171 1.00 28.38  ? 379  LYS A NZ    1 
ATOM   3751 N  N     . GLN C 3  374 ? 72.190 153.927 29.233 1.00 20.34  ? 380  GLN A N     1 
ATOM   3752 C  CA    . GLN C 3  374 ? 72.836 155.205 28.971 1.00 21.98  ? 380  GLN A CA    1 
ATOM   3753 C  C     . GLN C 3  374 ? 72.159 155.846 27.761 1.00 23.13  ? 380  GLN A C     1 
ATOM   3754 O  O     . GLN C 3  374 ? 71.915 157.048 27.737 1.00 23.85  ? 380  GLN A O     1 
ATOM   3755 C  CB    . GLN C 3  374 ? 74.325 155.000 28.677 1.00 21.07  ? 380  GLN A CB    1 
ATOM   3756 C  CG    . GLN C 3  374 ? 75.089 156.283 28.411 1.00 18.99  ? 380  GLN A CG    1 
ATOM   3757 C  CD    . GLN C 3  374 ? 74.963 157.278 29.550 1.00 22.17  ? 380  GLN A CD    1 
ATOM   3758 O  OE1   . GLN C 3  374 ? 75.302 156.975 30.699 1.00 21.84  ? 380  GLN A OE1   1 
ATOM   3759 N  NE2   . GLN C 3  374 ? 74.468 158.474 29.237 1.00 19.52  ? 380  GLN A NE2   1 
ATOM   3760 N  N     . ALA C 3  375 ? 71.855 155.022 26.763 1.00 22.79  ? 381  ALA A N     1 
ATOM   3761 C  CA    . ALA C 3  375 ? 71.207 155.480 25.543 1.00 22.75  ? 381  ALA A CA    1 
ATOM   3762 C  C     . ALA C 3  375 ? 69.734 155.810 25.787 1.00 23.99  ? 381  ALA A C     1 
ATOM   3763 O  O     . ALA C 3  375 ? 69.160 156.674 25.121 1.00 24.70  ? 381  ALA A O     1 
ATOM   3764 C  CB    . ALA C 3  375 ? 71.328 154.413 24.472 1.00 19.77  ? 381  ALA A CB    1 
ATOM   3765 N  N     . ALA C 3  376 ? 69.129 155.113 26.744 1.00 23.44  ? 382  ALA A N     1 
ATOM   3766 C  CA    . ALA C 3  376 ? 67.726 155.323 27.073 1.00 23.57  ? 382  ALA A CA    1 
ATOM   3767 C  C     . ALA C 3  376 ? 67.513 156.735 27.597 1.00 22.92  ? 382  ALA A C     1 
ATOM   3768 O  O     . ALA C 3  376 ? 66.415 157.287 27.508 1.00 22.22  ? 382  ALA A O     1 
ATOM   3769 C  CB    . ALA C 3  376 ? 67.271 154.301 28.113 1.00 23.50  ? 382  ALA A CB    1 
ATOM   3770 N  N     . ILE C 3  377 ? 68.568 157.319 28.150 1.00 21.95  ? 383  ILE A N     1 
ATOM   3771 C  CA    . ILE C 3  377 ? 68.462 158.668 28.673 1.00 22.00  ? 383  ILE A CA    1 
ATOM   3772 C  C     . ILE C 3  377 ? 68.075 159.647 27.566 1.00 22.74  ? 383  ILE A C     1 
ATOM   3773 O  O     . ILE C 3  377 ? 67.339 160.601 27.809 1.00 22.96  ? 383  ILE A O     1 
ATOM   3774 C  CB    . ILE C 3  377 ? 69.769 159.092 29.353 1.00 19.82  ? 383  ILE A CB    1 
ATOM   3775 C  CG1   . ILE C 3  377 ? 69.926 158.290 30.642 1.00 19.91  ? 383  ILE A CG1   1 
ATOM   3776 C  CG2   . ILE C 3  377 ? 69.764 160.593 29.645 1.00 19.10  ? 383  ILE A CG2   1 
ATOM   3777 C  CD1   . ILE C 3  377 ? 71.094 158.703 31.483 1.00 22.71  ? 383  ILE A CD1   1 
ATOM   3778 N  N     . ASP C 3  378 ? 68.547 159.404 26.349 1.00 23.20  ? 384  ASP A N     1 
ATOM   3779 C  CA    . ASP C 3  378 ? 68.194 160.283 25.244 1.00 25.09  ? 384  ASP A CA    1 
ATOM   3780 C  C     . ASP C 3  378 ? 66.727 160.110 24.880 1.00 24.57  ? 384  ASP A C     1 
ATOM   3781 O  O     . ASP C 3  378 ? 66.020 161.091 24.631 1.00 24.93  ? 384  ASP A O     1 
ATOM   3782 C  CB    . ASP C 3  378 ? 69.066 160.009 24.017 1.00 27.35  ? 384  ASP A CB    1 
ATOM   3783 C  CG    . ASP C 3  378 ? 70.458 160.586 24.158 1.00 31.25  ? 384  ASP A CG    1 
ATOM   3784 O  OD1   . ASP C 3  378 ? 70.573 161.748 24.605 1.00 33.16  ? 384  ASP A OD1   1 
ATOM   3785 O  OD2   . ASP C 3  378 ? 71.437 159.888 23.818 1.00 34.75  ? 384  ASP A OD2   1 
ATOM   3786 N  N     . LEU C 3  379 ? 66.267 158.862 24.858 1.00 22.05  ? 385  LEU A N     1 
ATOM   3787 C  CA    . LEU C 3  379 ? 64.878 158.582 24.528 1.00 19.25  ? 385  LEU A CA    1 
ATOM   3788 C  C     . LEU C 3  379 ? 63.941 159.251 25.535 1.00 18.18  ? 385  LEU A C     1 
ATOM   3789 O  O     . LEU C 3  379 ? 62.835 159.666 25.189 1.00 17.87  ? 385  LEU A O     1 
ATOM   3790 C  CB    . LEU C 3  379 ? 64.638 157.067 24.501 1.00 17.60  ? 385  LEU A CB    1 
ATOM   3791 C  CG    . LEU C 3  379 ? 65.549 156.271 23.555 1.00 18.47  ? 385  LEU A CG    1 
ATOM   3792 C  CD1   . LEU C 3  379 ? 65.106 154.821 23.535 1.00 16.93  ? 385  LEU A CD1   1 
ATOM   3793 C  CD2   . LEU C 3  379 ? 65.501 156.855 22.146 1.00 17.62  ? 385  LEU A CD2   1 
ATOM   3794 N  N     . ILE C 3  380 ? 64.395 159.357 26.780 1.00 17.17  ? 386  ILE A N     1 
ATOM   3795 C  CA    . ILE C 3  380 ? 63.600 159.975 27.835 1.00 17.76  ? 386  ILE A CA    1 
ATOM   3796 C  C     . ILE C 3  380 ? 63.508 161.482 27.615 1.00 18.39  ? 386  ILE A C     1 
ATOM   3797 O  O     . ILE C 3  380 ? 62.446 162.080 27.809 1.00 16.75  ? 386  ILE A O     1 
ATOM   3798 C  CB    . ILE C 3  380 ? 64.214 159.693 29.228 1.00 17.16  ? 386  ILE A CB    1 
ATOM   3799 C  CG1   . ILE C 3  380 ? 64.152 158.193 29.523 1.00 15.26  ? 386  ILE A CG1   1 
ATOM   3800 C  CG2   . ILE C 3  380 ? 63.484 160.484 30.297 1.00 12.37  ? 386  ILE A CG2   1 
ATOM   3801 C  CD1   . ILE C 3  380 ? 64.897 157.787 30.779 1.00 12.95  ? 386  ILE A CD1   1 
ATOM   3802 N  N     . LYS C 3  381 ? 64.621 162.091 27.210 1.00 19.04  ? 387  LYS A N     1 
ATOM   3803 C  CA    . LYS C 3  381 ? 64.638 163.522 26.949 1.00 20.41  ? 387  LYS A CA    1 
ATOM   3804 C  C     . LYS C 3  381 ? 63.721 163.814 25.769 1.00 20.48  ? 387  LYS A C     1 
ATOM   3805 O  O     . LYS C 3  381 ? 62.905 164.731 25.827 1.00 22.28  ? 387  LYS A O     1 
ATOM   3806 C  CB    . LYS C 3  381 ? 66.054 164.014 26.634 1.00 21.81  ? 387  LYS A CB    1 
ATOM   3807 C  CG    . LYS C 3  381 ? 67.029 163.863 27.787 1.00 26.61  ? 387  LYS A CG    1 
ATOM   3808 C  CD    . LYS C 3  381 ? 67.959 165.072 27.901 1.00 31.08  ? 387  LYS A CD    1 
ATOM   3809 C  CE    . LYS C 3  381 ? 68.785 165.279 26.642 1.00 32.58  ? 387  LYS A CE    1 
ATOM   3810 N  NZ    . LYS C 3  381 ? 69.649 164.101 26.352 1.00 36.86  ? 387  LYS A NZ    1 
ATOM   3811 N  N     . GLU C 3  382 ? 63.849 163.029 24.703 1.00 19.44  ? 388  GLU A N     1 
ATOM   3812 C  CA    . GLU C 3  382 ? 63.009 163.216 23.527 1.00 19.42  ? 388  GLU A CA    1 
ATOM   3813 C  C     . GLU C 3  382 ? 61.543 163.047 23.931 1.00 19.44  ? 388  GLU A C     1 
ATOM   3814 O  O     . GLU C 3  382 ? 60.676 163.820 23.519 1.00 19.99  ? 388  GLU A O     1 
ATOM   3815 C  CB    . GLU C 3  382 ? 63.355 162.190 22.440 1.00 18.95  ? 388  GLU A CB    1 
ATOM   3816 C  CG    . GLU C 3  382 ? 62.680 162.465 21.106 1.00 21.67  ? 388  GLU A CG    1 
ATOM   3817 C  CD    . GLU C 3  382 ? 62.962 161.403 20.053 1.00 25.94  ? 388  GLU A CD    1 
ATOM   3818 O  OE1   . GLU C 3  382 ? 64.027 160.748 20.113 1.00 28.62  ? 388  GLU A OE1   1 
ATOM   3819 O  OE2   . GLU C 3  382 ? 62.120 161.232 19.145 1.00 26.11  ? 388  GLU A OE2   1 
ATOM   3820 N  N     . TYR C 3  383 ? 61.279 162.039 24.750 1.00 17.39  ? 389  TYR A N     1 
ATOM   3821 C  CA    . TYR C 3  383 ? 59.922 161.748 25.198 1.00 19.22  ? 389  TYR A CA    1 
ATOM   3822 C  C     . TYR C 3  383 ? 59.304 162.915 25.967 1.00 19.68  ? 389  TYR A C     1 
ATOM   3823 O  O     . TYR C 3  383 ? 58.158 163.302 25.717 1.00 19.10  ? 389  TYR A O     1 
ATOM   3824 C  CB    . TYR C 3  383 ? 59.932 160.487 26.067 1.00 18.02  ? 389  TYR A CB    1 
ATOM   3825 C  CG    . TYR C 3  383 ? 58.568 159.994 26.480 1.00 17.69  ? 389  TYR A CG    1 
ATOM   3826 C  CD1   . TYR C 3  383 ? 57.860 160.608 27.514 1.00 16.70  ? 389  TYR A CD1   1 
ATOM   3827 C  CD2   . TYR C 3  383 ? 57.984 158.900 25.840 1.00 16.19  ? 389  TYR A CD2   1 
ATOM   3828 C  CE1   . TYR C 3  383 ? 56.607 160.140 27.898 1.00 15.84  ? 389  TYR A CE1   1 
ATOM   3829 C  CE2   . TYR C 3  383 ? 56.737 158.431 26.213 1.00 14.70  ? 389  TYR A CE2   1 
ATOM   3830 C  CZ    . TYR C 3  383 ? 56.052 159.053 27.240 1.00 15.42  ? 389  TYR A CZ    1 
ATOM   3831 O  OH    . TYR C 3  383 ? 54.807 158.589 27.594 1.00 16.37  ? 389  TYR A OH    1 
ATOM   3832 N  N     . LEU C 3  384 ? 60.062 163.469 26.908 1.00 19.19  ? 390  LEU A N     1 
ATOM   3833 C  CA    . LEU C 3  384 ? 59.566 164.585 27.696 1.00 18.53  ? 390  LEU A CA    1 
ATOM   3834 C  C     . LEU C 3  384 ? 59.208 165.728 26.759 1.00 18.82  ? 390  LEU A C     1 
ATOM   3835 O  O     . LEU C 3  384 ? 58.205 166.412 26.952 1.00 18.29  ? 390  LEU A O     1 
ATOM   3836 C  CB    . LEU C 3  384 ? 60.625 165.024 28.702 1.00 17.11  ? 390  LEU A CB    1 
ATOM   3837 C  CG    . LEU C 3  384 ? 60.832 164.001 29.823 1.00 17.46  ? 390  LEU A CG    1 
ATOM   3838 C  CD1   . LEU C 3  384 ? 62.118 164.287 30.565 1.00 15.28  ? 390  LEU A CD1   1 
ATOM   3839 C  CD2   . LEU C 3  384 ? 59.635 164.038 30.759 1.00 15.86  ? 390  LEU A CD2   1 
ATOM   3840 N  N     . MET C 3  385 ? 60.020 165.915 25.725 1.00 19.06  ? 391  MET A N     1 
ATOM   3841 C  CA    . MET C 3  385 ? 59.772 166.975 24.763 1.00 19.34  ? 391  MET A CA    1 
ATOM   3842 C  C     . MET C 3  385 ? 58.548 166.655 23.903 1.00 19.73  ? 391  MET A C     1 
ATOM   3843 O  O     . MET C 3  385 ? 57.705 167.525 23.674 1.00 19.33  ? 391  MET A O     1 
ATOM   3844 C  CB    . MET C 3  385 ? 61.004 167.194 23.884 1.00 20.12  ? 391  MET A CB    1 
ATOM   3845 C  CG    . MET C 3  385 ? 60.836 168.323 22.883 1.00 23.83  ? 391  MET A CG    1 
ATOM   3846 S  SD    . MET C 3  385 ? 60.816 167.697 21.198 1.00 26.72  ? 391  MET A SD    1 
ATOM   3847 C  CE    . MET C 3  385 ? 59.169 167.211 21.043 1.00 28.24  ? 391  MET A CE    1 
ATOM   3848 N  N     . ILE C 3  386 ? 58.445 165.414 23.428 1.00 18.12  ? 392  ILE A N     1 
ATOM   3849 C  CA    . ILE C 3  386 ? 57.299 165.024 22.620 1.00 19.03  ? 392  ILE A CA    1 
ATOM   3850 C  C     . ILE C 3  386 ? 56.013 165.313 23.408 1.00 19.23  ? 392  ILE A C     1 
ATOM   3851 O  O     . ILE C 3  386 ? 55.045 165.822 22.851 1.00 20.00  ? 392  ILE A O     1 
ATOM   3852 C  CB    . ILE C 3  386 ? 57.345 163.511 22.235 1.00 20.75  ? 392  ILE A CB    1 
ATOM   3853 C  CG1   . ILE C 3  386 ? 58.552 163.217 21.335 1.00 21.34  ? 392  ILE A CG1   1 
ATOM   3854 C  CG2   . ILE C 3  386 ? 56.075 163.121 21.489 1.00 21.88  ? 392  ILE A CG2   1 
ATOM   3855 C  CD1   . ILE C 3  386 ? 58.553 163.972 20.030 1.00 20.17  ? 392  ILE A CD1   1 
ATOM   3856 N  N     . GLN C 3  387 ? 56.005 165.005 24.704 1.00 19.61  ? 393  GLN A N     1 
ATOM   3857 C  CA    . GLN C 3  387 ? 54.823 165.255 25.535 1.00 20.43  ? 393  GLN A CA    1 
ATOM   3858 C  C     . GLN C 3  387 ? 54.486 166.732 25.617 1.00 19.87  ? 393  GLN A C     1 
ATOM   3859 O  O     . GLN C 3  387 ? 53.318 167.123 25.543 1.00 18.07  ? 393  GLN A O     1 
ATOM   3860 C  CB    . GLN C 3  387 ? 55.020 164.713 26.951 1.00 22.07  ? 393  GLN A CB    1 
ATOM   3861 C  CG    . GLN C 3  387 ? 54.515 163.298 27.118 1.00 26.43  ? 393  GLN A CG    1 
ATOM   3862 C  CD    . GLN C 3  387 ? 53.024 163.175 26.839 1.00 26.94  ? 393  GLN A CD    1 
ATOM   3863 O  OE1   . GLN C 3  387 ? 52.521 162.084 26.583 1.00 28.07  ? 393  GLN A OE1   1 
ATOM   3864 N  NE2   . GLN C 3  387 ? 52.311 164.295 26.897 1.00 28.85  ? 393  GLN A NE2   1 
ATOM   3865 N  N     . LYS C 3  388 ? 55.524 167.543 25.785 1.00 18.81  ? 394  LYS A N     1 
ATOM   3866 C  CA    . LYS C 3  388 ? 55.377 168.986 25.865 1.00 17.86  ? 394  LYS A CA    1 
ATOM   3867 C  C     . LYS C 3  388 ? 54.591 169.449 24.636 1.00 17.28  ? 394  LYS A C     1 
ATOM   3868 O  O     . LYS C 3  388 ? 53.639 170.221 24.747 1.00 17.82  ? 394  LYS A O     1 
ATOM   3869 C  CB    . LYS C 3  388 ? 56.765 169.631 25.876 1.00 20.70  ? 394  LYS A CB    1 
ATOM   3870 C  CG    . LYS C 3  388 ? 56.787 171.100 26.229 1.00 21.86  ? 394  LYS A CG    1 
ATOM   3871 C  CD    . LYS C 3  388 ? 56.480 171.295 27.697 1.00 23.80  ? 394  LYS A CD    1 
ATOM   3872 C  CE    . LYS C 3  388 ? 56.760 172.724 28.124 1.00 24.25  ? 394  LYS A CE    1 
ATOM   3873 N  NZ    . LYS C 3  388 ? 56.328 172.957 29.527 1.00 24.48  ? 394  LYS A NZ    1 
ATOM   3874 N  N     . ARG C 3  389 ? 54.983 168.950 23.466 1.00 15.34  ? 395  ARG A N     1 
ATOM   3875 C  CA    . ARG C 3  389 ? 54.327 169.313 22.214 1.00 14.79  ? 395  ARG A CA    1 
ATOM   3876 C  C     . ARG C 3  389 ? 52.915 168.747 22.065 1.00 14.67  ? 395  ARG A C     1 
ATOM   3877 O  O     . ARG C 3  389 ? 52.009 169.428 21.573 1.00 13.61  ? 395  ARG A O     1 
ATOM   3878 C  CB    . ARG C 3  389 ? 55.192 168.867 21.038 1.00 14.84  ? 395  ARG A CB    1 
ATOM   3879 C  CG    . ARG C 3  389 ? 56.558 169.524 21.023 1.00 11.97  ? 395  ARG A CG    1 
ATOM   3880 C  CD    . ARG C 3  389 ? 56.438 171.014 20.780 1.00 13.54  ? 395  ARG A CD    1 
ATOM   3881 N  NE    . ARG C 3  389 ? 57.752 171.629 20.660 1.00 17.11  ? 395  ARG A NE    1 
ATOM   3882 C  CZ    . ARG C 3  389 ? 58.574 171.848 21.680 1.00 16.44  ? 395  ARG A CZ    1 
ATOM   3883 N  NH1   . ARG C 3  389 ? 58.214 171.512 22.907 1.00 15.81  ? 395  ARG A NH1   1 
ATOM   3884 N  NH2   . ARG C 3  389 ? 59.772 172.376 21.464 1.00 18.20  ? 395  ARG A NH2   1 
ATOM   3885 N  N     . ILE C 3  390 ? 52.727 167.502 22.484 1.00 13.78  ? 396  ILE A N     1 
ATOM   3886 C  CA    . ILE C 3  390 ? 51.416 166.870 22.392 1.00 14.82  ? 396  ILE A CA    1 
ATOM   3887 C  C     . ILE C 3  390 ? 50.439 167.550 23.358 1.00 13.20  ? 396  ILE A C     1 
ATOM   3888 O  O     . ILE C 3  390 ? 49.291 167.826 23.004 1.00 11.88  ? 396  ILE A O     1 
ATOM   3889 C  CB    . ILE C 3  390 ? 51.505 165.357 22.720 1.00 15.42  ? 396  ILE A CB    1 
ATOM   3890 C  CG1   . ILE C 3  390 ? 52.363 164.655 21.658 1.00 16.81  ? 396  ILE A CG1   1 
ATOM   3891 C  CG2   . ILE C 3  390 ? 50.115 164.752 22.796 1.00 12.05  ? 396  ILE A CG2   1 
ATOM   3892 C  CD1   . ILE C 3  390 ? 52.642 163.190 21.944 1.00 17.67  ? 396  ILE A CD1   1 
ATOM   3893 N  N     . GLY C 3  391 ? 50.907 167.828 24.572 1.00 13.11  ? 397  GLY A N     1 
ATOM   3894 C  CA    . GLY C 3  391 ? 50.063 168.474 25.565 1.00 12.67  ? 397  GLY A CA    1 
ATOM   3895 C  C     . GLY C 3  391 ? 49.558 169.839 25.120 1.00 13.19  ? 397  GLY A C     1 
ATOM   3896 O  O     . GLY C 3  391 ? 48.380 170.147 25.267 1.00 12.50  ? 397  GLY A O     1 
ATOM   3897 N  N     . GLN C 3  392 ? 50.451 170.654 24.570 1.00 12.74  ? 398  GLN A N     1 
ATOM   3898 C  CA    . GLN C 3  392 ? 50.093 171.986 24.106 1.00 15.14  ? 398  GLN A CA    1 
ATOM   3899 C  C     . GLN C 3  392 ? 49.281 171.993 22.796 1.00 15.67  ? 398  GLN A C     1 
ATOM   3900 O  O     . GLN C 3  392 ? 48.417 172.849 22.591 1.00 15.81  ? 398  GLN A O     1 
ATOM   3901 C  CB    . GLN C 3  392 ? 51.371 172.826 23.939 1.00 13.37  ? 398  GLN A CB    1 
ATOM   3902 C  CG    . GLN C 3  392 ? 51.154 174.225 23.385 1.00 14.79  ? 398  GLN A CG    1 
ATOM   3903 C  CD    . GLN C 3  392 ? 52.406 175.098 23.481 1.00 19.45  ? 398  GLN A CD    1 
ATOM   3904 O  OE1   . GLN C 3  392 ? 53.530 174.594 23.444 1.00 19.28  ? 398  GLN A OE1   1 
ATOM   3905 N  NE2   . GLN C 3  392 ? 52.214 176.415 23.589 1.00 19.28  ? 398  GLN A NE2   1 
ATOM   3906 N  N     . SER C 3  393 ? 49.544 171.032 21.918 1.00 15.13  ? 399  SER A N     1 
ATOM   3907 C  CA    . SER C 3  393 ? 48.848 170.992 20.636 1.00 14.65  ? 399  SER A CA    1 
ATOM   3908 C  C     . SER C 3  393 ? 47.573 170.168 20.612 1.00 15.96  ? 399  SER A C     1 
ATOM   3909 O  O     . SER C 3  393 ? 46.603 170.548 19.952 1.00 16.76  ? 399  SER A O     1 
ATOM   3910 C  CB    . SER C 3  393 ? 49.776 170.455 19.542 1.00 12.58  ? 399  SER A CB    1 
ATOM   3911 O  OG    . SER C 3  393 ? 50.002 169.061 19.694 1.00 8.83   ? 399  SER A OG    1 
ATOM   3912 N  N     . ALA C 3  394 ? 47.555 169.046 21.326 1.00 15.54  ? 400  ALA A N     1 
ATOM   3913 C  CA    . ALA C 3  394 ? 46.378 168.203 21.264 1.00 15.65  ? 400  ALA A CA    1 
ATOM   3914 C  C     . ALA C 3  394 ? 45.718 167.683 22.533 1.00 15.92  ? 400  ALA A C     1 
ATOM   3915 O  O     . ALA C 3  394 ? 44.491 167.714 22.630 1.00 15.78  ? 400  ALA A O     1 
ATOM   3916 C  CB    . ALA C 3  394 ? 46.670 167.029 20.338 1.00 15.70  ? 400  ALA A CB    1 
ATOM   3917 N  N     . GLU C 3  395 ? 46.505 167.221 23.502 1.00 14.90  ? 401  GLU A N     1 
ATOM   3918 C  CA    . GLU C 3  395 ? 45.922 166.619 24.701 1.00 16.32  ? 401  GLU A CA    1 
ATOM   3919 C  C     . GLU C 3  395 ? 45.694 167.436 25.960 1.00 17.53  ? 401  GLU A C     1 
ATOM   3920 O  O     . GLU C 3  395 ? 44.839 167.074 26.766 1.00 16.90  ? 401  GLU A O     1 
ATOM   3921 C  CB    . GLU C 3  395 ? 46.709 165.357 25.063 1.00 15.87  ? 401  GLU A CB    1 
ATOM   3922 C  CG    . GLU C 3  395 ? 46.823 164.381 23.899 1.00 15.03  ? 401  GLU A CG    1 
ATOM   3923 C  CD    . GLU C 3  395 ? 47.486 163.075 24.274 1.00 16.26  ? 401  GLU A CD    1 
ATOM   3924 O  OE1   . GLU C 3  395 ? 48.169 163.019 25.319 1.00 14.71  ? 401  GLU A OE1   1 
ATOM   3925 O  OE2   . GLU C 3  395 ? 47.335 162.102 23.506 1.00 17.98  ? 401  GLU A OE2   1 
ATOM   3926 N  N     . GLY C 3  396 ? 46.442 168.521 26.145 1.00 18.93  ? 402  GLY A N     1 
ATOM   3927 C  CA    . GLY C 3  396 ? 46.260 169.334 27.340 1.00 18.14  ? 402  GLY A CA    1 
ATOM   3928 C  C     . GLY C 3  396 ? 44.852 169.896 27.441 1.00 18.80  ? 402  GLY A C     1 
ATOM   3929 O  O     . GLY C 3  396 ? 44.095 169.842 26.474 1.00 17.10  ? 402  GLY A O     1 
ATOM   3930 N  N     . ASP C 3  397 ? 44.485 170.426 28.607 1.00 19.96  ? 403  ASP A N     1 
ATOM   3931 C  CA    . ASP C 3  397 ? 43.151 171.003 28.772 1.00 22.55  ? 403  ASP A CA    1 
ATOM   3932 C  C     . ASP C 3  397 ? 42.988 172.237 27.906 1.00 21.08  ? 403  ASP A C     1 
ATOM   3933 O  O     . ASP C 3  397 ? 41.883 172.545 27.461 1.00 21.07  ? 403  ASP A O     1 
ATOM   3934 C  CB    . ASP C 3  397 ? 42.879 171.397 30.224 1.00 26.56  ? 403  ASP A CB    1 
ATOM   3935 C  CG    . ASP C 3  397 ? 42.588 170.205 31.104 1.00 32.36  ? 403  ASP A CG    1 
ATOM   3936 O  OD1   . ASP C 3  397 ? 43.548 169.574 31.594 1.00 37.68  ? 403  ASP A OD1   1 
ATOM   3937 O  OD2   . ASP C 3  397 ? 41.395 169.889 31.295 1.00 35.10  ? 403  ASP A OD2   1 
ATOM   3938 N  N     . LYS C 3  398 ? 44.091 172.939 27.673 1.00 18.53  ? 404  LYS A N     1 
ATOM   3939 C  CA    . LYS C 3  398 ? 44.065 174.148 26.864 1.00 18.69  ? 404  LYS A CA    1 
ATOM   3940 C  C     . LYS C 3  398 ? 44.692 173.883 25.503 1.00 17.48  ? 404  LYS A C     1 
ATOM   3941 O  O     . LYS C 3  398 ? 45.194 174.795 24.859 1.00 17.28  ? 404  LYS A O     1 
ATOM   3942 C  CB    . LYS C 3  398 ? 44.835 175.272 27.562 1.00 19.84  ? 404  LYS A CB    1 
ATOM   3943 C  CG    . LYS C 3  398 ? 44.539 175.421 29.044 1.00 19.27  ? 404  LYS A CG    1 
ATOM   3944 C  CD    . LYS C 3  398 ? 43.103 175.826 29.293 1.00 22.69  ? 404  LYS A CD    1 
ATOM   3945 C  CE    . LYS C 3  398 ? 42.854 176.024 30.781 1.00 23.92  ? 404  LYS A CE    1 
ATOM   3946 N  NZ    . LYS C 3  398 ? 43.881 176.919 31.404 1.00 25.41  ? 404  LYS A NZ    1 
ATOM   3947 N  N     . ALA C 3  399 ? 44.668 172.630 25.071 1.00 16.62  ? 405  ALA A N     1 
ATOM   3948 C  CA    . ALA C 3  399 ? 45.243 172.262 23.781 1.00 16.82  ? 405  ALA A CA    1 
ATOM   3949 C  C     . ALA C 3  399 ? 44.627 173.058 22.632 1.00 14.82  ? 405  ALA A C     1 
ATOM   3950 O  O     . ALA C 3  399 ? 43.424 173.320 22.624 1.00 13.70  ? 405  ALA A O     1 
ATOM   3951 C  CB    . ALA C 3  399 ? 45.051 170.761 23.535 1.00 16.01  ? 405  ALA A CB    1 
ATOM   3952 N  N     . TRP C 3  400 ? 45.457 173.428 21.657 1.00 13.76  ? 406  TRP A N     1 
ATOM   3953 C  CA    . TRP C 3  400 ? 44.987 174.185 20.498 1.00 12.87  ? 406  TRP A CA    1 
ATOM   3954 C  C     . TRP C 3  400 ? 43.791 173.510 19.844 1.00 13.77  ? 406  TRP A C     1 
ATOM   3955 O  O     . TRP C 3  400 ? 42.803 174.163 19.536 1.00 16.21  ? 406  TRP A O     1 
ATOM   3956 C  CB    . TRP C 3  400 ? 46.097 174.341 19.451 1.00 9.84   ? 406  TRP A CB    1 
ATOM   3957 C  CG    . TRP C 3  400 ? 47.372 174.934 19.981 1.00 7.13   ? 406  TRP A CG    1 
ATOM   3958 C  CD1   . TRP C 3  400 ? 47.502 175.819 21.017 1.00 6.62   ? 406  TRP A CD1   1 
ATOM   3959 C  CD2   . TRP C 3  400 ? 48.698 174.692 19.492 1.00 4.42   ? 406  TRP A CD2   1 
ATOM   3960 N  NE1   . TRP C 3  400 ? 48.826 176.136 21.204 1.00 4.67   ? 406  TRP A NE1   1 
ATOM   3961 C  CE2   . TRP C 3  400 ? 49.582 175.459 20.285 1.00 3.90   ? 406  TRP A CE2   1 
ATOM   3962 C  CE3   . TRP C 3  400 ? 49.223 173.903 18.459 1.00 4.15   ? 406  TRP A CE3   1 
ATOM   3963 C  CZ2   . TRP C 3  400 ? 50.964 175.458 20.084 1.00 4.63   ? 406  TRP A CZ2   1 
ATOM   3964 C  CZ3   . TRP C 3  400 ? 50.597 173.900 18.253 1.00 5.98   ? 406  TRP A CZ3   1 
ATOM   3965 C  CH2   . TRP C 3  400 ? 51.455 174.675 19.066 1.00 7.18   ? 406  TRP A CH2   1 
ATOM   3966 N  N     . LEU C 3  401 ? 43.878 172.201 19.635 1.00 14.66  ? 407  LEU A N     1 
ATOM   3967 C  CA    . LEU C 3  401 ? 42.790 171.462 19.004 1.00 15.73  ? 407  LEU A CA    1 
ATOM   3968 C  C     . LEU C 3  401 ? 41.482 171.474 19.784 1.00 15.89  ? 407  LEU A C     1 
ATOM   3969 O  O     . LEU C 3  401 ? 40.426 171.206 19.216 1.00 16.91  ? 407  LEU A O     1 
ATOM   3970 C  CB    . LEU C 3  401 ? 43.208 170.015 18.742 1.00 16.38  ? 407  LEU A CB    1 
ATOM   3971 C  CG    . LEU C 3  401 ? 44.323 169.832 17.715 1.00 18.11  ? 407  LEU A CG    1 
ATOM   3972 C  CD1   . LEU C 3  401 ? 44.691 168.360 17.628 1.00 16.60  ? 407  LEU A CD1   1 
ATOM   3973 C  CD2   . LEU C 3  401 ? 43.869 170.360 16.357 1.00 16.44  ? 407  LEU A CD2   1 
ATOM   3974 N  N     . ARG C 3  402 ? 41.540 171.764 21.079 1.00 16.93  ? 408  ARG A N     1 
ATOM   3975 C  CA    . ARG C 3  402 ? 40.317 171.820 21.883 1.00 19.36  ? 408  ARG A CA    1 
ATOM   3976 C  C     . ARG C 3  402 ? 39.750 173.233 21.849 1.00 19.88  ? 408  ARG A C     1 
ATOM   3977 O  O     . ARG C 3  402 ? 38.639 173.470 22.322 1.00 20.53  ? 408  ARG A O     1 
ATOM   3978 C  CB    . ARG C 3  402 ? 40.582 171.448 23.346 1.00 19.47  ? 408  ARG A CB    1 
ATOM   3979 C  CG    . ARG C 3  402 ? 41.041 170.026 23.577 1.00 22.02  ? 408  ARG A CG    1 
ATOM   3980 C  CD    . ARG C 3  402 ? 41.286 169.775 25.056 1.00 23.93  ? 408  ARG A CD    1 
ATOM   3981 N  NE    . ARG C 3  402 ? 41.836 168.445 25.296 1.00 26.83  ? 408  ARG A NE    1 
ATOM   3982 C  CZ    . ARG C 3  402 ? 41.183 167.311 25.059 1.00 29.41  ? 408  ARG A CZ    1 
ATOM   3983 N  NH1   . ARG C 3  402 ? 39.945 167.338 24.578 1.00 29.76  ? 408  ARG A NH1   1 
ATOM   3984 N  NH2   . ARG C 3  402 ? 41.773 166.147 25.294 1.00 29.47  ? 408  ARG A NH2   1 
ATOM   3985 N  N     . TYR C 3  403 ? 40.513 174.164 21.283 1.00 19.46  ? 409  TYR A N     1 
ATOM   3986 C  CA    . TYR C 3  403 ? 40.090 175.553 21.218 1.00 21.25  ? 409  TYR A CA    1 
ATOM   3987 C  C     . TYR C 3  403 ? 39.727 176.124 19.854 1.00 23.06  ? 409  TYR A C     1 
ATOM   3988 O  O     . TYR C 3  403 ? 39.188 177.226 19.777 1.00 23.89  ? 409  TYR A O     1 
ATOM   3989 C  CB    . TYR C 3  403 ? 41.145 176.438 21.883 1.00 21.33  ? 409  TYR A CB    1 
ATOM   3990 C  CG    . TYR C 3  403 ? 40.912 176.558 23.360 1.00 20.86  ? 409  TYR A CG    1 
ATOM   3991 C  CD1   . TYR C 3  403 ? 40.149 177.597 23.879 1.00 21.79  ? 409  TYR A CD1   1 
ATOM   3992 C  CD2   . TYR C 3  403 ? 41.366 175.578 24.230 1.00 22.70  ? 409  TYR A CD2   1 
ATOM   3993 C  CE1   . TYR C 3  403 ? 39.832 177.657 25.228 1.00 20.36  ? 409  TYR A CE1   1 
ATOM   3994 C  CE2   . TYR C 3  403 ? 41.055 175.624 25.582 1.00 25.67  ? 409  TYR A CE2   1 
ATOM   3995 C  CZ    . TYR C 3  403 ? 40.285 176.667 26.073 1.00 24.76  ? 409  TYR A CZ    1 
ATOM   3996 O  OH    . TYR C 3  403 ? 39.959 176.696 27.409 1.00 28.20  ? 409  TYR A OH    1 
ATOM   3997 N  N     . VAL C 3  404 ? 40.019 175.403 18.778 1.00 23.46  ? 410  VAL A N     1 
ATOM   3998 C  CA    . VAL C 3  404 ? 39.664 175.904 17.456 1.00 25.08  ? 410  VAL A CA    1 
ATOM   3999 C  C     . VAL C 3  404 ? 38.154 176.069 17.459 1.00 23.46  ? 410  VAL A C     1 
ATOM   4000 O  O     . VAL C 3  404 ? 37.446 175.193 17.941 1.00 23.68  ? 410  VAL A O     1 
ATOM   4001 C  CB    . VAL C 3  404 ? 40.049 174.908 16.337 1.00 27.00  ? 410  VAL A CB    1 
ATOM   4002 C  CG1   . VAL C 3  404 ? 41.486 174.512 16.486 1.00 29.98  ? 410  VAL A CG1   1 
ATOM   4003 C  CG2   . VAL C 3  404 ? 39.160 173.673 16.390 1.00 28.76  ? 410  VAL A CG2   1 
ATOM   4004 N  N     . ALA C 3  405 ? 37.663 177.191 16.944 1.00 23.01  ? 411  ALA A N     1 
ATOM   4005 C  CA    . ALA C 3  405 ? 36.224 177.435 16.898 1.00 23.81  ? 411  ALA A CA    1 
ATOM   4006 C  C     . ALA C 3  405 ? 35.694 177.069 15.517 1.00 25.34  ? 411  ALA A C     1 
ATOM   4007 O  O     . ALA C 3  405 ? 36.469 176.704 14.631 1.00 26.58  ? 411  ALA A O     1 
ATOM   4008 C  CB    . ALA C 3  405 ? 35.932 178.898 17.201 1.00 22.74  ? 411  ALA A CB    1 
ATOM   4009 N  N     . GLU C 3  406 ? 34.380 177.166 15.335 1.00 27.39  ? 412  GLU A N     1 
ATOM   4010 C  CA    . GLU C 3  406 ? 33.757 176.849 14.052 1.00 29.36  ? 412  GLU A CA    1 
ATOM   4011 C  C     . GLU C 3  406 ? 34.293 177.706 12.912 1.00 28.15  ? 412  GLU A C     1 
ATOM   4012 O  O     . GLU C 3  406 ? 34.394 177.238 11.777 1.00 28.80  ? 412  GLU A O     1 
ATOM   4013 C  CB    . GLU C 3  406 ? 32.239 177.016 14.136 1.00 33.82  ? 412  GLU A CB    1 
ATOM   4014 C  CG    . GLU C 3  406 ? 31.526 175.871 14.845 1.00 40.74  ? 412  GLU A CG    1 
ATOM   4015 C  CD    . GLU C 3  406 ? 31.535 174.577 14.039 1.00 44.56  ? 412  GLU A CD    1 
ATOM   4016 O  OE1   . GLU C 3  406 ? 30.944 174.552 12.933 1.00 46.00  ? 412  GLU A OE1   1 
ATOM   4017 O  OE2   . GLU C 3  406 ? 32.134 173.584 14.512 1.00 46.71  ? 412  GLU A OE2   1 
ATOM   4018 N  N     . ASP C 3  407 ? 34.641 178.955 13.204 1.00 25.31  ? 413  ASP A N     1 
ATOM   4019 C  CA    . ASP C 3  407 ? 35.159 179.831 12.161 1.00 22.45  ? 413  ASP A CA    1 
ATOM   4020 C  C     . ASP C 3  407 ? 36.604 179.516 11.796 1.00 20.43  ? 413  ASP A C     1 
ATOM   4021 O  O     . ASP C 3  407 ? 37.252 180.291 11.104 1.00 19.86  ? 413  ASP A O     1 
ATOM   4022 C  CB    . ASP C 3  407 ? 35.037 181.308 12.566 1.00 21.89  ? 413  ASP A CB    1 
ATOM   4023 C  CG    . ASP C 3  407 ? 35.781 181.638 13.847 1.00 23.15  ? 413  ASP A CG    1 
ATOM   4024 O  OD1   . ASP C 3  407 ? 36.749 180.924 14.191 1.00 22.31  ? 413  ASP A OD1   1 
ATOM   4025 O  OD2   . ASP C 3  407 ? 35.401 182.633 14.506 1.00 25.89  ? 413  ASP A OD2   1 
ATOM   4026 N  N     . GLY C 3  408 ? 37.109 178.380 12.263 1.00 18.63  ? 414  GLY A N     1 
ATOM   4027 C  CA    . GLY C 3  408 ? 38.475 177.997 11.940 1.00 17.09  ? 414  GLY A CA    1 
ATOM   4028 C  C     . GLY C 3  408 ? 39.572 178.822 12.593 1.00 17.31  ? 414  GLY A C     1 
ATOM   4029 O  O     . GLY C 3  408 ? 40.724 178.799 12.146 1.00 16.65  ? 414  GLY A O     1 
ATOM   4030 N  N     . LYS C 3  409 ? 39.225 179.554 13.647 1.00 16.22  ? 415  LYS A N     1 
ATOM   4031 C  CA    . LYS C 3  409 ? 40.202 180.371 14.349 1.00 15.90  ? 415  LYS A CA    1 
ATOM   4032 C  C     . LYS C 3  409 ? 40.255 180.040 15.826 1.00 14.18  ? 415  LYS A C     1 
ATOM   4033 O  O     . LYS C 3  409 ? 39.296 179.525 16.393 1.00 13.00  ? 415  LYS A O     1 
ATOM   4034 C  CB    . LYS C 3  409 ? 39.877 181.865 14.227 1.00 17.99  ? 415  LYS A CB    1 
ATOM   4035 C  CG    . LYS C 3  409 ? 40.167 182.507 12.884 1.00 20.88  ? 415  LYS A CG    1 
ATOM   4036 C  CD    . LYS C 3  409 ? 39.044 182.282 11.891 1.00 24.95  ? 415  LYS A CD    1 
ATOM   4037 C  CE    . LYS C 3  409 ? 39.265 183.073 10.604 1.00 24.92  ? 415  LYS A CE    1 
ATOM   4038 N  NZ    . LYS C 3  409 ? 38.416 182.572 9.487  1.00 24.65  ? 415  LYS A NZ    1 
ATOM   4039 N  N     . ILE C 3  410 ? 41.397 180.335 16.438 1.00 13.12  ? 416  ILE A N     1 
ATOM   4040 C  CA    . ILE C 3  410 ? 41.562 180.148 17.866 1.00 12.54  ? 416  ILE A CA    1 
ATOM   4041 C  C     . ILE C 3  410 ? 41.410 181.555 18.432 1.00 13.84  ? 416  ILE A C     1 
ATOM   4042 O  O     . ILE C 3  410 ? 42.127 182.470 18.030 1.00 15.36  ? 416  ILE A O     1 
ATOM   4043 C  CB    . ILE C 3  410 ? 42.954 179.601 18.221 1.00 11.50  ? 416  ILE A CB    1 
ATOM   4044 C  CG1   . ILE C 3  410 ? 43.082 178.160 17.720 1.00 10.98  ? 416  ILE A CG1   1 
ATOM   4045 C  CG2   . ILE C 3  410 ? 43.175 179.695 19.726 1.00 8.01   ? 416  ILE A CG2   1 
ATOM   4046 C  CD1   . ILE C 3  410 ? 44.364 177.473 18.113 1.00 9.93   ? 416  ILE A CD1   1 
ATOM   4047 N  N     . HIS C 3  411 ? 40.460 181.731 19.342 1.00 13.91  ? 417  HIS A N     1 
ATOM   4048 C  CA    . HIS C 3  411 ? 40.201 183.032 19.949 1.00 13.86  ? 417  HIS A CA    1 
ATOM   4049 C  C     . HIS C 3  411 ? 40.835 183.137 21.325 1.00 13.62  ? 417  HIS A C     1 
ATOM   4050 O  O     . HIS C 3  411 ? 40.138 183.175 22.341 1.00 12.69  ? 417  HIS A O     1 
ATOM   4051 C  CB    . HIS C 3  411 ? 38.692 183.262 20.046 1.00 11.84  ? 417  HIS A CB    1 
ATOM   4052 C  CG    . HIS C 3  411 ? 38.004 183.215 18.723 1.00 12.26  ? 417  HIS A CG    1 
ATOM   4053 N  ND1   . HIS C 3  411 ? 37.777 184.342 17.961 1.00 14.62  ? 417  HIS A ND1   1 
ATOM   4054 C  CD2   . HIS C 3  411 ? 37.573 182.168 17.982 1.00 12.93  ? 417  HIS A CD2   1 
ATOM   4055 C  CE1   . HIS C 3  411 ? 37.238 183.991 16.807 1.00 13.03  ? 417  HIS A CE1   1 
ATOM   4056 N  NE2   . HIS C 3  411 ? 37.105 182.677 16.794 1.00 15.95  ? 417  HIS A NE2   1 
ATOM   4057 N  N     . GLY C 3  412 ? 42.163 183.195 21.342 1.00 13.63  ? 418  GLY A N     1 
ATOM   4058 C  CA    . GLY C 3  412 ? 42.890 183.292 22.591 1.00 13.22  ? 418  GLY A CA    1 
ATOM   4059 C  C     . GLY C 3  412 ? 42.458 184.478 23.426 1.00 13.50  ? 418  GLY A C     1 
ATOM   4060 O  O     . GLY C 3  412 ? 42.169 185.554 22.908 1.00 12.18  ? 418  GLY A O     1 
ATOM   4061 N  N     . SER C 3  413 ? 42.422 184.278 24.735 1.00 13.43  ? 419  SER A N     1 
ATOM   4062 C  CA    . SER C 3  413 ? 42.017 185.330 25.650 1.00 14.36  ? 419  SER A CA    1 
ATOM   4063 C  C     . SER C 3  413 ? 43.208 186.192 26.062 1.00 12.71  ? 419  SER A C     1 
ATOM   4064 O  O     . SER C 3  413 ? 44.345 185.729 26.080 1.00 12.18  ? 419  SER A O     1 
ATOM   4065 C  CB    . SER C 3  413 ? 41.365 184.717 26.886 1.00 13.55  ? 419  SER A CB    1 
ATOM   4066 O  OG    . SER C 3  413 ? 40.948 185.740 27.765 1.00 19.47  ? 419  SER A OG    1 
ATOM   4067 N  N     . VAL C 3  414 ? 42.941 187.449 26.394 1.00 10.99  ? 420  VAL A N     1 
ATOM   4068 C  CA    . VAL C 3  414 ? 44.004 188.358 26.795 1.00 10.14  ? 420  VAL A CA    1 
ATOM   4069 C  C     . VAL C 3  414 ? 43.581 189.292 27.925 1.00 10.97  ? 420  VAL A C     1 
ATOM   4070 O  O     . VAL C 3  414 ? 42.533 189.922 27.868 1.00 12.31  ? 420  VAL A O     1 
ATOM   4071 C  CB    . VAL C 3  414 ? 44.484 189.223 25.588 1.00 10.35  ? 420  VAL A CB    1 
ATOM   4072 C  CG1   . VAL C 3  414 ? 45.567 190.191 26.026 1.00 5.66   ? 420  VAL A CG1   1 
ATOM   4073 C  CG2   . VAL C 3  414 ? 45.019 188.322 24.468 1.00 9.13   ? 420  VAL A CG2   1 
ATOM   4074 N  N     . ASN C 3  415 ? 44.396 189.354 28.969 1.00 11.32  ? 421  ASN A N     1 
ATOM   4075 C  CA    . ASN C 3  415 ? 44.143 190.254 30.085 1.00 12.22  ? 421  ASN A CA    1 
ATOM   4076 C  C     . ASN C 3  415 ? 45.126 191.372 29.753 1.00 11.34  ? 421  ASN A C     1 
ATOM   4077 O  O     . ASN C 3  415 ? 46.303 191.280 30.071 1.00 13.24  ? 421  ASN A O     1 
ATOM   4078 C  CB    . ASN C 3  415 ? 44.513 189.585 31.413 1.00 11.69  ? 421  ASN A CB    1 
ATOM   4079 C  CG    . ASN C 3  415 ? 44.255 190.486 32.605 1.00 15.23  ? 421  ASN A CG    1 
ATOM   4080 O  OD1   . ASN C 3  415 ? 44.455 191.704 32.527 1.00 14.88  ? 421  ASN A OD1   1 
ATOM   4081 N  ND2   . ASN C 3  415 ? 43.827 189.894 33.724 1.00 12.67  ? 421  ASN A ND2   1 
ATOM   4082 N  N     . PRO C 3  416 ? 44.652 192.437 29.102 1.00 12.46  ? 422  PRO A N     1 
ATOM   4083 C  CA    . PRO C 3  416 ? 45.505 193.566 28.708 1.00 12.54  ? 422  PRO A CA    1 
ATOM   4084 C  C     . PRO C 3  416 ? 46.484 194.102 29.743 1.00 13.57  ? 422  PRO A C     1 
ATOM   4085 O  O     . PRO C 3  416 ? 47.544 194.613 29.380 1.00 14.60  ? 422  PRO A O     1 
ATOM   4086 C  CB    . PRO C 3  416 ? 44.499 194.627 28.260 1.00 12.16  ? 422  PRO A CB    1 
ATOM   4087 C  CG    . PRO C 3  416 ? 43.324 193.814 27.794 1.00 13.60  ? 422  PRO A CG    1 
ATOM   4088 C  CD    . PRO C 3  416 ? 43.232 192.761 28.880 1.00 12.68  ? 422  PRO A CD    1 
ATOM   4089 N  N     . ASN C 3  417 ? 46.139 193.996 31.023 1.00 14.83  ? 423  ASN A N     1 
ATOM   4090 C  CA    . ASN C 3  417 ? 47.013 194.501 32.080 1.00 14.65  ? 423  ASN A CA    1 
ATOM   4091 C  C     . ASN C 3  417 ? 47.178 193.459 33.191 1.00 14.73  ? 423  ASN A C     1 
ATOM   4092 O  O     . ASN C 3  417 ? 47.131 193.783 34.376 1.00 16.45  ? 423  ASN A O     1 
ATOM   4093 C  CB    . ASN C 3  417 ? 46.423 195.799 32.649 1.00 15.36  ? 423  ASN A CB    1 
ATOM   4094 C  CG    . ASN C 3  417 ? 47.448 196.630 33.397 1.00 16.03  ? 423  ASN A CG    1 
ATOM   4095 O  OD1   . ASN C 3  417 ? 48.500 196.960 32.859 1.00 20.09  ? 423  ASN A OD1   1 
ATOM   4096 N  ND2   . ASN C 3  417 ? 47.147 196.971 34.638 1.00 15.48  ? 423  ASN A ND2   1 
ATOM   4097 N  N     . GLY C 3  418 ? 47.391 192.210 32.789 1.00 14.23  ? 424  GLY A N     1 
ATOM   4098 C  CA    . GLY C 3  418 ? 47.526 191.118 33.738 1.00 13.80  ? 424  GLY A CA    1 
ATOM   4099 C  C     . GLY C 3  418 ? 48.788 191.021 34.571 1.00 13.63  ? 424  GLY A C     1 
ATOM   4100 O  O     . GLY C 3  418 ? 48.750 190.473 35.667 1.00 14.17  ? 424  GLY A O     1 
ATOM   4101 N  N     . ALA C 3  419 ? 49.905 191.530 34.065 1.00 13.63  ? 425  ALA A N     1 
ATOM   4102 C  CA    . ALA C 3  419 ? 51.165 191.477 34.809 1.00 12.84  ? 425  ALA A CA    1 
ATOM   4103 C  C     . ALA C 3  419 ? 51.393 192.780 35.570 1.00 13.46  ? 425  ALA A C     1 
ATOM   4104 O  O     . ALA C 3  419 ? 51.043 193.854 35.075 1.00 14.14  ? 425  ALA A O     1 
ATOM   4105 C  CB    . ALA C 3  419 ? 52.314 191.239 33.853 1.00 10.95  ? 425  ALA A CB    1 
ATOM   4106 N  N     . VAL C 3  420 ? 51.986 192.694 36.759 1.00 13.75  ? 426  VAL A N     1 
ATOM   4107 C  CA    . VAL C 3  420 ? 52.260 193.892 37.561 1.00 14.79  ? 426  VAL A CA    1 
ATOM   4108 C  C     . VAL C 3  420 ? 52.892 195.024 36.761 1.00 13.04  ? 426  VAL A C     1 
ATOM   4109 O  O     . VAL C 3  420 ? 52.512 196.177 36.908 1.00 15.41  ? 426  VAL A O     1 
ATOM   4110 C  CB    . VAL C 3  420 ? 53.226 193.619 38.745 1.00 15.03  ? 426  VAL A CB    1 
ATOM   4111 C  CG1   . VAL C 3  420 ? 52.450 193.214 39.967 1.00 19.01  ? 426  VAL A CG1   1 
ATOM   4112 C  CG2   . VAL C 3  420 ? 54.248 192.558 38.357 1.00 13.31  ? 426  VAL A CG2   1 
ATOM   4113 N  N     . THR C 3  421 ? 53.859 194.685 35.922 1.00 11.68  ? 427  THR A N     1 
ATOM   4114 C  CA    . THR C 3  421 ? 54.572 195.674 35.128 1.00 11.45  ? 427  THR A CA    1 
ATOM   4115 C  C     . THR C 3  421 ? 53.724 196.441 34.123 1.00 13.10  ? 427  THR A C     1 
ATOM   4116 O  O     . THR C 3  421 ? 54.128 197.499 33.639 1.00 13.04  ? 427  THR A O     1 
ATOM   4117 C  CB    . THR C 3  421 ? 55.715 195.016 34.368 1.00 10.09  ? 427  THR A CB    1 
ATOM   4118 O  OG1   . THR C 3  421 ? 55.204 193.911 33.614 1.00 9.74   ? 427  THR A OG1   1 
ATOM   4119 C  CG2   . THR C 3  421 ? 56.764 194.522 35.329 1.00 10.09  ? 427  THR A CG2   1 
ATOM   4120 N  N     . GLY C 3  422 ? 52.550 195.917 33.804 1.00 13.04  ? 428  GLY A N     1 
ATOM   4121 C  CA    . GLY C 3  422 ? 51.724 196.597 32.830 1.00 12.90  ? 428  GLY A CA    1 
ATOM   4122 C  C     . GLY C 3  422 ? 51.697 195.816 31.529 1.00 13.74  ? 428  GLY A C     1 
ATOM   4123 O  O     . GLY C 3  422 ? 51.138 196.274 30.535 1.00 14.89  ? 428  GLY A O     1 
ATOM   4124 N  N     . ARG C 3  423 ? 52.334 194.649 31.525 1.00 12.24  ? 429  ARG A N     1 
ATOM   4125 C  CA    . ARG C 3  423 ? 52.317 193.786 30.349 1.00 12.96  ? 429  ARG A CA    1 
ATOM   4126 C  C     . ARG C 3  423 ? 50.971 193.079 30.406 1.00 12.70  ? 429  ARG A C     1 
ATOM   4127 O  O     . ARG C 3  423 ? 50.292 193.118 31.433 1.00 13.22  ? 429  ARG A O     1 
ATOM   4128 C  CB    . ARG C 3  423 ? 53.398 192.702 30.420 1.00 12.07  ? 429  ARG A CB    1 
ATOM   4129 C  CG    . ARG C 3  423 ? 54.735 193.046 29.824 1.00 13.14  ? 429  ARG A CG    1 
ATOM   4130 C  CD    . ARG C 3  423 ? 55.549 191.770 29.645 1.00 12.62  ? 429  ARG A CD    1 
ATOM   4131 N  NE    . ARG C 3  423 ? 56.853 192.026 29.047 1.00 13.30  ? 429  ARG A NE    1 
ATOM   4132 C  CZ    . ARG C 3  423 ? 57.713 191.075 28.699 1.00 14.02  ? 429  ARG A CZ    1 
ATOM   4133 N  NH1   . ARG C 3  423 ? 57.404 189.798 28.889 1.00 12.79  ? 429  ARG A NH1   1 
ATOM   4134 N  NH2   . ARG C 3  423 ? 58.884 191.403 28.167 1.00 11.82  ? 429  ARG A NH2   1 
ATOM   4135 N  N     . ALA C 3  424 ? 50.601 192.417 29.315 1.00 10.99  ? 430  ALA A N     1 
ATOM   4136 C  CA    . ALA C 3  424 ? 49.356 191.663 29.270 1.00 10.89  ? 430  ALA A CA    1 
ATOM   4137 C  C     . ALA C 3  424 ? 49.695 190.198 29.537 1.00 11.23  ? 430  ALA A C     1 
ATOM   4138 O  O     . ALA C 3  424 ? 50.861 189.799 29.456 1.00 10.35  ? 430  ALA A O     1 
ATOM   4139 C  CB    . ALA C 3  424 ? 48.718 191.790 27.898 1.00 9.61   ? 430  ALA A CB    1 
ATOM   4140 N  N     . THR C 3  425 ? 48.684 189.408 29.879 1.00 9.26   ? 431  THR A N     1 
ATOM   4141 C  CA    . THR C 3  425 ? 48.878 187.979 30.091 1.00 8.08   ? 431  THR A CA    1 
ATOM   4142 C  C     . THR C 3  425 ? 47.996 187.340 29.036 1.00 8.56   ? 431  THR A C     1 
ATOM   4143 O  O     . THR C 3  425 ? 47.007 187.929 28.617 1.00 9.07   ? 431  THR A O     1 
ATOM   4144 C  CB    . THR C 3  425 ? 48.446 187.516 31.503 1.00 9.66   ? 431  THR A CB    1 
ATOM   4145 O  OG1   . THR C 3  425 ? 47.059 187.807 31.716 1.00 6.12   ? 431  THR A OG1   1 
ATOM   4146 C  CG2   . THR C 3  425 ? 49.292 188.219 32.571 1.00 8.74   ? 431  THR A CG2   1 
ATOM   4147 N  N     . HIS C 3  426 ? 48.358 186.147 28.590 1.00 10.12  ? 432  HIS A N     1 
ATOM   4148 C  CA    . HIS C 3  426 ? 47.604 185.478 27.545 1.00 9.85   ? 432  HIS A CA    1 
ATOM   4149 C  C     . HIS C 3  426 ? 47.201 184.086 27.995 1.00 11.64  ? 432  HIS A C     1 
ATOM   4150 O  O     . HIS C 3  426 ? 47.983 183.390 28.636 1.00 14.20  ? 432  HIS A O     1 
ATOM   4151 C  CB    . HIS C 3  426 ? 48.467 185.408 26.291 1.00 8.41   ? 432  HIS A CB    1 
ATOM   4152 C  CG    . HIS C 3  426 ? 49.154 186.698 25.969 1.00 8.40   ? 432  HIS A CG    1 
ATOM   4153 N  ND1   . HIS C 3  426 ? 50.115 187.255 26.788 1.00 6.41   ? 432  HIS A ND1   1 
ATOM   4154 C  CD2   . HIS C 3  426 ? 48.990 187.563 24.941 1.00 7.90   ? 432  HIS A CD2   1 
ATOM   4155 C  CE1   . HIS C 3  426 ? 50.510 188.407 26.280 1.00 7.34   ? 432  HIS A CE1   1 
ATOM   4156 N  NE2   . HIS C 3  426 ? 49.843 188.619 25.159 1.00 8.18   ? 432  HIS A NE2   1 
ATOM   4157 N  N     . ALA C 3  427 ? 45.986 183.671 27.657 1.00 10.21  ? 433  ALA A N     1 
ATOM   4158 C  CA    . ALA C 3  427 ? 45.536 182.358 28.077 1.00 10.25  ? 433  ALA A CA    1 
ATOM   4159 C  C     . ALA C 3  427 ? 44.314 181.834 27.331 1.00 10.35  ? 433  ALA A C     1 
ATOM   4160 O  O     . ALA C 3  427 ? 43.624 182.571 26.633 1.00 9.71   ? 433  ALA A O     1 
ATOM   4161 C  CB    . ALA C 3  427 ? 45.249 182.383 29.573 1.00 10.12  ? 433  ALA A CB    1 
ATOM   4162 N  N     . PHE C 3  428 ? 44.064 180.541 27.498 1.00 10.58  ? 434  PHE A N     1 
ATOM   4163 C  CA    . PHE C 3  428 ? 42.922 179.873 26.901 1.00 12.24  ? 434  PHE A CA    1 
ATOM   4164 C  C     . PHE C 3  428 ? 42.830 179.902 25.382 1.00 11.44  ? 434  PHE A C     1 
ATOM   4165 O  O     . PHE C 3  428 ? 41.809 180.326 24.835 1.00 13.93  ? 434  PHE A O     1 
ATOM   4166 C  CB    . PHE C 3  428 ? 41.626 180.450 27.477 1.00 13.66  ? 434  PHE A CB    1 
ATOM   4167 C  CG    . PHE C 3  428 ? 41.625 180.564 28.967 1.00 16.49  ? 434  PHE A CG    1 
ATOM   4168 C  CD1   . PHE C 3  428 ? 42.134 179.538 29.757 1.00 19.96  ? 434  PHE A CD1   1 
ATOM   4169 C  CD2   . PHE C 3  428 ? 41.097 181.693 29.585 1.00 18.19  ? 434  PHE A CD2   1 
ATOM   4170 C  CE1   . PHE C 3  428 ? 42.117 179.638 31.142 1.00 20.32  ? 434  PHE A CE1   1 
ATOM   4171 C  CE2   . PHE C 3  428 ? 41.070 181.808 30.969 1.00 18.30  ? 434  PHE A CE2   1 
ATOM   4172 C  CZ    . PHE C 3  428 ? 41.581 180.778 31.752 1.00 20.87  ? 434  PHE A CZ    1 
ATOM   4173 N  N     . PRO C 3  429 ? 43.891 179.476 24.676 1.00 9.69   ? 435  PRO A N     1 
ATOM   4174 C  CA    . PRO C 3  429 ? 45.172 178.975 25.189 1.00 8.45   ? 435  PRO A CA    1 
ATOM   4175 C  C     . PRO C 3  429 ? 46.135 180.155 25.206 1.00 8.36   ? 435  PRO A C     1 
ATOM   4176 O  O     . PRO C 3  429 ? 45.789 181.235 24.733 1.00 6.57   ? 435  PRO A O     1 
ATOM   4177 C  CB    . PRO C 3  429 ? 45.564 177.939 24.154 1.00 7.05   ? 435  PRO A CB    1 
ATOM   4178 C  CG    . PRO C 3  429 ? 45.121 178.599 22.885 1.00 8.67   ? 435  PRO A CG    1 
ATOM   4179 C  CD    . PRO C 3  429 ? 43.768 179.203 23.231 1.00 7.14   ? 435  PRO A CD    1 
ATOM   4180 N  N     . ASN C 3  430 ? 47.333 179.963 25.742 1.00 9.65   ? 436  ASN A N     1 
ATOM   4181 C  CA    . ASN C 3  430 ? 48.305 181.052 25.789 1.00 9.86   ? 436  ASN A CA    1 
ATOM   4182 C  C     . ASN C 3  430 ? 49.004 181.193 24.445 1.00 9.86   ? 436  ASN A C     1 
ATOM   4183 O  O     . ASN C 3  430 ? 49.949 180.456 24.159 1.00 10.53  ? 436  ASN A O     1 
ATOM   4184 C  CB    . ASN C 3  430 ? 49.350 180.800 26.879 1.00 8.59   ? 436  ASN A CB    1 
ATOM   4185 C  CG    . ASN C 3  430 ? 50.382 181.917 26.967 1.00 10.88  ? 436  ASN A CG    1 
ATOM   4186 O  OD1   . ASN C 3  430 ? 50.372 182.854 26.161 1.00 9.84   ? 436  ASN A OD1   1 
ATOM   4187 N  ND2   . ASN C 3  430 ? 51.286 181.817 27.941 1.00 7.32   ? 436  ASN A ND2   1 
ATOM   4188 N  N     . LEU C 3  431 ? 48.554 182.143 23.628 1.00 9.38   ? 437  LEU A N     1 
ATOM   4189 C  CA    . LEU C 3  431 ? 49.161 182.345 22.316 1.00 11.89  ? 437  LEU A CA    1 
ATOM   4190 C  C     . LEU C 3  431 ? 50.524 183.033 22.387 1.00 11.85  ? 437  LEU A C     1 
ATOM   4191 O  O     . LEU C 3  431 ? 51.165 183.259 21.361 1.00 10.38  ? 437  LEU A O     1 
ATOM   4192 C  CB    . LEU C 3  431 ? 48.218 183.134 21.403 1.00 11.61  ? 437  LEU A CB    1 
ATOM   4193 C  CG    . LEU C 3  431 ? 46.892 182.424 21.086 1.00 14.64  ? 437  LEU A CG    1 
ATOM   4194 C  CD1   . LEU C 3  431 ? 46.150 183.188 19.996 1.00 17.01  ? 437  LEU A CD1   1 
ATOM   4195 C  CD2   . LEU C 3  431 ? 47.159 180.994 20.627 1.00 13.33  ? 437  LEU A CD2   1 
ATOM   4196 N  N     . ALA C 3  432 ? 50.967 183.347 23.602 1.00 11.28  ? 438  ALA A N     1 
ATOM   4197 C  CA    . ALA C 3  432 ? 52.263 183.989 23.797 1.00 12.04  ? 438  ALA A CA    1 
ATOM   4198 C  C     . ALA C 3  432 ? 53.356 182.985 24.190 1.00 12.85  ? 438  ALA A C     1 
ATOM   4199 O  O     . ALA C 3  432 ? 54.443 183.385 24.604 1.00 12.70  ? 438  ALA A O     1 
ATOM   4200 C  CB    . ALA C 3  432 ? 52.154 185.089 24.855 1.00 9.51   ? 438  ALA A CB    1 
ATOM   4201 N  N     . GLN C 3  433 ? 53.069 181.687 24.076 1.00 12.57  ? 439  GLN A N     1 
ATOM   4202 C  CA    . GLN C 3  433 ? 54.070 180.666 24.401 1.00 13.50  ? 439  GLN A CA    1 
ATOM   4203 C  C     . GLN C 3  433 ? 54.105 179.566 23.338 1.00 14.28  ? 439  GLN A C     1 
ATOM   4204 O  O     . GLN C 3  433 ? 54.386 178.408 23.644 1.00 14.70  ? 439  GLN A O     1 
ATOM   4205 C  CB    . GLN C 3  433 ? 53.809 180.047 25.789 1.00 11.67  ? 439  GLN A CB    1 
ATOM   4206 C  CG    . GLN C 3  433 ? 52.536 179.196 25.895 1.00 13.67  ? 439  GLN A CG    1 
ATOM   4207 C  CD    . GLN C 3  433 ? 52.246 178.723 27.323 1.00 15.29  ? 439  GLN A CD    1 
ATOM   4208 O  OE1   . GLN C 3  433 ? 51.169 178.199 27.608 1.00 11.74  ? 439  GLN A OE1   1 
ATOM   4209 N  NE2   . GLN C 3  433 ? 53.213 178.906 28.223 1.00 13.69  ? 439  GLN A NE2   1 
ATOM   4210 N  N     . ILE C 3  434 ? 53.798 179.926 22.093 1.00 14.20  ? 440  ILE A N     1 
ATOM   4211 C  CA    . ILE C 3  434 ? 53.822 178.957 20.996 1.00 13.40  ? 440  ILE A CA    1 
ATOM   4212 C  C     . ILE C 3  434 ? 55.295 178.633 20.768 1.00 13.68  ? 440  ILE A C     1 
ATOM   4213 O  O     . ILE C 3  434 ? 56.129 179.536 20.757 1.00 14.33  ? 440  ILE A O     1 
ATOM   4214 C  CB    . ILE C 3  434 ? 53.248 179.554 19.675 1.00 12.48  ? 440  ILE A CB    1 
ATOM   4215 C  CG1   . ILE C 3  434 ? 51.805 180.024 19.878 1.00 12.55  ? 440  ILE A CG1   1 
ATOM   4216 C  CG2   . ILE C 3  434 ? 53.293 178.511 18.564 1.00 11.74  ? 440  ILE A CG2   1 
ATOM   4217 C  CD1   . ILE C 3  434 ? 50.811 178.911 20.159 1.00 9.03   ? 440  ILE A CD1   1 
ATOM   4218 N  N     . PRO C 3  435 ? 55.639 177.345 20.595 1.00 14.05  ? 441  PRO A N     1 
ATOM   4219 C  CA    . PRO C 3  435 ? 57.042 176.979 20.371 1.00 14.27  ? 441  PRO A CA    1 
ATOM   4220 C  C     . PRO C 3  435 ? 57.649 177.798 19.233 1.00 15.23  ? 441  PRO A C     1 
ATOM   4221 O  O     . PRO C 3  435 ? 57.008 177.997 18.204 1.00 15.07  ? 441  PRO A O     1 
ATOM   4222 C  CB    . PRO C 3  435 ? 56.957 175.496 20.033 1.00 13.77  ? 441  PRO A CB    1 
ATOM   4223 C  CG    . PRO C 3  435 ? 55.785 175.036 20.847 1.00 11.26  ? 441  PRO A CG    1 
ATOM   4224 C  CD    . PRO C 3  435 ? 54.779 176.146 20.621 1.00 13.64  ? 441  PRO A CD    1 
ATOM   4225 N  N     . GLY C 3  436 ? 58.875 178.281 19.431 1.00 16.36  ? 442  GLY A N     1 
ATOM   4226 C  CA    . GLY C 3  436 ? 59.543 179.069 18.406 1.00 15.77  ? 442  GLY A CA    1 
ATOM   4227 C  C     . GLY C 3  436 ? 59.954 178.199 17.236 1.00 17.33  ? 442  GLY A C     1 
ATOM   4228 O  O     . GLY C 3  436 ? 60.139 176.999 17.405 1.00 16.42  ? 442  GLY A O     1 
ATOM   4229 N  N     . VAL C 3  437 ? 60.102 178.793 16.054 1.00 18.77  ? 443  VAL A N     1 
ATOM   4230 C  CA    . VAL C 3  437 ? 60.475 178.034 14.863 1.00 20.37  ? 443  VAL A CA    1 
ATOM   4231 C  C     . VAL C 3  437 ? 61.781 177.253 14.990 1.00 22.17  ? 443  VAL A C     1 
ATOM   4232 O  O     . VAL C 3  437 ? 61.948 176.209 14.354 1.00 24.29  ? 443  VAL A O     1 
ATOM   4233 C  CB    . VAL C 3  437 ? 60.611 178.943 13.624 1.00 21.20  ? 443  VAL A CB    1 
ATOM   4234 C  CG1   . VAL C 3  437 ? 59.270 179.525 13.250 1.00 21.74  ? 443  VAL A CG1   1 
ATOM   4235 C  CG2   . VAL C 3  437 ? 61.609 180.052 13.904 1.00 20.73  ? 443  VAL A CG2   1 
ATOM   4236 N  N     . ARG C 3  438 ? 62.701 177.744 15.810 1.00 23.09  ? 444  ARG A N     1 
ATOM   4237 C  CA    . ARG C 3  438 ? 63.987 177.081 15.959 1.00 26.05  ? 444  ARG A CA    1 
ATOM   4238 C  C     . ARG C 3  438 ? 64.030 176.042 17.062 1.00 26.73  ? 444  ARG A C     1 
ATOM   4239 O  O     . ARG C 3  438 ? 65.108 175.622 17.481 1.00 30.44  ? 444  ARG A O     1 
ATOM   4240 C  CB    . ARG C 3  438 ? 65.094 178.116 16.174 1.00 28.90  ? 444  ARG A CB    1 
ATOM   4241 C  CG    . ARG C 3  438 ? 65.183 179.132 15.045 1.00 32.37  ? 444  ARG A CG    1 
ATOM   4242 C  CD    . ARG C 3  438 ? 66.183 180.238 15.340 1.00 36.58  ? 444  ARG A CD    1 
ATOM   4243 N  NE    . ARG C 3  438 ? 65.893 181.420 14.531 1.00 40.88  ? 444  ARG A NE    1 
ATOM   4244 C  CZ    . ARG C 3  438 ? 64.951 182.312 14.822 1.00 42.48  ? 444  ARG A CZ    1 
ATOM   4245 N  NH1   . ARG C 3  438 ? 64.210 182.168 15.911 1.00 45.08  ? 444  ARG A NH1   1 
ATOM   4246 N  NH2   . ARG C 3  438 ? 64.732 183.340 14.014 1.00 44.29  ? 444  ARG A NH2   1 
ATOM   4247 N  N     . SER C 3  439 ? 62.867 175.637 17.554 1.00 24.98  ? 445  SER A N     1 
ATOM   4248 C  CA    . SER C 3  439 ? 62.824 174.599 18.575 1.00 24.20  ? 445  SER A CA    1 
ATOM   4249 C  C     . SER C 3  439 ? 62.222 173.401 17.855 1.00 22.44  ? 445  SER A C     1 
ATOM   4250 O  O     . SER C 3  439 ? 61.645 173.553 16.780 1.00 21.96  ? 445  SER A O     1 
ATOM   4251 C  CB    . SER C 3  439 ? 61.937 175.018 19.747 1.00 24.82  ? 445  SER A CB    1 
ATOM   4252 O  OG    . SER C 3  439 ? 60.587 175.118 19.344 1.00 28.09  ? 445  SER A OG    1 
ATOM   4253 N  N     . PRO C 3  440 ? 62.358 172.194 18.419 1.00 21.85  ? 446  PRO A N     1 
ATOM   4254 C  CA    . PRO C 3  440 ? 61.787 171.021 17.745 1.00 19.99  ? 446  PRO A CA    1 
ATOM   4255 C  C     . PRO C 3  440 ? 60.288 171.154 17.456 1.00 20.76  ? 446  PRO A C     1 
ATOM   4256 O  O     . PRO C 3  440 ? 59.511 171.556 18.333 1.00 19.70  ? 446  PRO A O     1 
ATOM   4257 C  CB    . PRO C 3  440 ? 62.095 169.882 18.717 1.00 19.64  ? 446  PRO A CB    1 
ATOM   4258 C  CG    . PRO C 3  440 ? 63.374 170.327 19.368 1.00 19.34  ? 446  PRO A CG    1 
ATOM   4259 C  CD    . PRO C 3  440 ? 63.118 171.801 19.620 1.00 21.19  ? 446  PRO A CD    1 
ATOM   4260 N  N     . TYR C 3  441 ? 59.898 170.821 16.221 1.00 20.54  ? 447  TYR A N     1 
ATOM   4261 C  CA    . TYR C 3  441 ? 58.504 170.876 15.783 1.00 20.44  ? 447  TYR A CA    1 
ATOM   4262 C  C     . TYR C 3  441 ? 57.952 172.295 15.734 1.00 21.72  ? 447  TYR A C     1 
ATOM   4263 O  O     . TYR C 3  441 ? 56.764 172.511 15.453 1.00 20.06  ? 447  TYR A O     1 
ATOM   4264 C  CB    . TYR C 3  441 ? 57.644 170.006 16.702 1.00 21.06  ? 447  TYR A CB    1 
ATOM   4265 C  CG    . TYR C 3  441 ? 58.020 168.543 16.623 1.00 23.00  ? 447  TYR A CG    1 
ATOM   4266 C  CD1   . TYR C 3  441 ? 57.731 167.796 15.479 1.00 20.56  ? 447  TYR A CD1   1 
ATOM   4267 C  CD2   . TYR C 3  441 ? 58.722 167.923 17.657 1.00 19.95  ? 447  TYR A CD2   1 
ATOM   4268 C  CE1   . TYR C 3  441 ? 58.131 166.481 15.363 1.00 19.63  ? 447  TYR A CE1   1 
ATOM   4269 C  CE2   . TYR C 3  441 ? 59.131 166.600 17.547 1.00 21.25  ? 447  TYR A CE2   1 
ATOM   4270 C  CZ    . TYR C 3  441 ? 58.832 165.886 16.394 1.00 21.55  ? 447  TYR A CZ    1 
ATOM   4271 O  OH    . TYR C 3  441 ? 59.244 164.577 16.262 1.00 24.31  ? 447  TYR A OH    1 
ATOM   4272 N  N     . GLY C 3  442 ? 58.834 173.255 15.996 1.00 22.04  ? 448  GLY A N     1 
ATOM   4273 C  CA    . GLY C 3  442 ? 58.460 174.658 15.999 1.00 23.30  ? 448  GLY A CA    1 
ATOM   4274 C  C     . GLY C 3  442 ? 57.914 175.196 14.691 1.00 23.66  ? 448  GLY A C     1 
ATOM   4275 O  O     . GLY C 3  442 ? 56.907 175.901 14.693 1.00 24.35  ? 448  GLY A O     1 
ATOM   4276 N  N     . GLU C 3  443 ? 58.562 174.884 13.574 1.00 23.36  ? 449  GLU A N     1 
ATOM   4277 C  CA    . GLU C 3  443 ? 58.068 175.377 12.299 1.00 25.30  ? 449  GLU A CA    1 
ATOM   4278 C  C     . GLU C 3  443 ? 56.661 174.880 12.023 1.00 23.15  ? 449  GLU A C     1 
ATOM   4279 O  O     . GLU C 3  443 ? 55.815 175.648 11.572 1.00 21.73  ? 449  GLU A O     1 
ATOM   4280 C  CB    . GLU C 3  443 ? 59.020 175.011 11.157 1.00 28.73  ? 449  GLU A CB    1 
ATOM   4281 C  CG    . GLU C 3  443 ? 60.264 175.888 11.177 1.00 39.13  ? 449  GLU A CG    1 
ATOM   4282 C  CD    . GLU C 3  443 ? 60.955 176.005 9.830  1.00 45.36  ? 449  GLU A CD    1 
ATOM   4283 O  OE1   . GLU C 3  443 ? 61.654 175.043 9.429  1.00 48.84  ? 449  GLU A OE1   1 
ATOM   4284 O  OE2   . GLU C 3  443 ? 60.796 177.066 9.174  1.00 46.33  ? 449  GLU A OE2   1 
ATOM   4285 N  N     . GLN C 3  444 ? 56.401 173.608 12.309 1.00 20.99  ? 450  GLN A N     1 
ATOM   4286 C  CA    . GLN C 3  444 ? 55.062 173.060 12.103 1.00 20.13  ? 450  GLN A CA    1 
ATOM   4287 C  C     . GLN C 3  444 ? 54.038 173.748 13.023 1.00 18.66  ? 450  GLN A C     1 
ATOM   4288 O  O     . GLN C 3  444 ? 52.945 174.106 12.581 1.00 16.05  ? 450  GLN A O     1 
ATOM   4289 C  CB    . GLN C 3  444 ? 55.063 171.541 12.339 1.00 21.16  ? 450  GLN A CB    1 
ATOM   4290 C  CG    . GLN C 3  444 ? 55.587 170.730 11.154 1.00 22.09  ? 450  GLN A CG    1 
ATOM   4291 C  CD    . GLN C 3  444 ? 55.955 169.294 11.519 1.00 23.89  ? 450  GLN A CD    1 
ATOM   4292 O  OE1   . GLN C 3  444 ? 56.954 169.050 12.202 1.00 24.19  ? 450  GLN A OE1   1 
ATOM   4293 N  NE2   . GLN C 3  444 ? 55.149 168.340 11.061 1.00 21.98  ? 450  GLN A NE2   1 
ATOM   4294 N  N     . CYS C 3  445 ? 54.392 173.950 14.292 1.00 17.19  ? 451  CYS A N     1 
ATOM   4295 C  CA    . CYS C 3  445 ? 53.469 174.603 15.221 1.00 18.44  ? 451  CYS A CA    1 
ATOM   4296 C  C     . CYS C 3  445 ? 53.192 176.030 14.770 1.00 17.78  ? 451  CYS A C     1 
ATOM   4297 O  O     . CYS C 3  445 ? 52.048 176.449 14.589 1.00 18.09  ? 451  CYS A O     1 
ATOM   4298 C  CB    . CYS C 3  445 ? 54.056 174.652 16.634 1.00 18.71  ? 451  CYS A CB    1 
ATOM   4299 S  SG    . CYS C 3  445 ? 54.232 173.068 17.465 1.00 21.72  ? 451  CYS A SG    1 
ATOM   4300 N  N     . ARG C 3  446 ? 54.275 176.764 14.593 1.00 16.41  ? 452  ARG A N     1 
ATOM   4301 C  CA    . ARG C 3  446 ? 54.236 178.150 14.195 1.00 14.63  ? 452  ARG A CA    1 
ATOM   4302 C  C     . ARG C 3  446 ? 53.509 178.399 12.871 1.00 15.96  ? 452  ARG A C     1 
ATOM   4303 O  O     . ARG C 3  446 ? 52.843 179.425 12.713 1.00 16.41  ? 452  ARG A O     1 
ATOM   4304 C  CB    . ARG C 3  446 ? 55.670 178.655 14.110 1.00 16.76  ? 452  ARG A CB    1 
ATOM   4305 C  CG    . ARG C 3  446 ? 55.866 180.022 14.672 1.00 19.91  ? 452  ARG A CG    1 
ATOM   4306 C  CD    . ARG C 3  446 ? 55.897 180.047 16.191 1.00 18.15  ? 452  ARG A CD    1 
ATOM   4307 N  NE    . ARG C 3  446 ? 55.899 181.442 16.605 1.00 20.66  ? 452  ARG A NE    1 
ATOM   4308 C  CZ    . ARG C 3  446 ? 56.275 181.898 17.789 1.00 18.24  ? 452  ARG A CZ    1 
ATOM   4309 N  NH1   . ARG C 3  446 ? 56.694 181.070 18.729 1.00 18.05  ? 452  ARG A NH1   1 
ATOM   4310 N  NH2   . ARG C 3  446 ? 56.248 183.203 18.012 1.00 19.45  ? 452  ARG A NH2   1 
ATOM   4311 N  N     . ALA C 3  447 ? 53.628 177.469 11.924 1.00 15.01  ? 453  ALA A N     1 
ATOM   4312 C  CA    . ALA C 3  447 ? 52.985 177.625 10.616 1.00 14.73  ? 453  ALA A CA    1 
ATOM   4313 C  C     . ALA C 3  447 ? 51.484 177.359 10.638 1.00 13.46  ? 453  ALA A C     1 
ATOM   4314 O  O     . ALA C 3  447 ? 50.765 177.744 9.713  1.00 12.18  ? 453  ALA A O     1 
ATOM   4315 C  CB    . ALA C 3  447 ? 53.651 176.711 9.583  1.00 15.48  ? 453  ALA A CB    1 
ATOM   4316 N  N     . ALA C 3  448 ? 51.010 176.696 11.683 1.00 11.08  ? 454  ALA A N     1 
ATOM   4317 C  CA    . ALA C 3  448 ? 49.585 176.408 11.777 1.00 12.80  ? 454  ALA A CA    1 
ATOM   4318 C  C     . ALA C 3  448 ? 48.788 177.677 12.090 1.00 11.82  ? 454  ALA A C     1 
ATOM   4319 O  O     . ALA C 3  448 ? 47.574 177.709 11.907 1.00 12.64  ? 454  ALA A O     1 
ATOM   4320 C  CB    . ALA C 3  448 ? 49.328 175.339 12.842 1.00 12.86  ? 454  ALA A CB    1 
ATOM   4321 N  N     . PHE C 3  449 ? 49.471 178.714 12.571 1.00 11.20  ? 455  PHE A N     1 
ATOM   4322 C  CA    . PHE C 3  449 ? 48.816 179.987 12.875 1.00 10.31  ? 455  PHE A CA    1 
ATOM   4323 C  C     . PHE C 3  449 ? 49.183 180.961 11.763 1.00 11.91  ? 455  PHE A C     1 
ATOM   4324 O  O     . PHE C 3  449 ? 50.339 181.370 11.636 1.00 13.97  ? 455  PHE A O     1 
ATOM   4325 C  CB    . PHE C 3  449 ? 49.287 180.548 14.219 1.00 10.21  ? 455  PHE A CB    1 
ATOM   4326 C  CG    . PHE C 3  449 ? 48.913 179.700 15.398 1.00 8.38   ? 455  PHE A CG    1 
ATOM   4327 C  CD1   . PHE C 3  449 ? 49.633 178.552 15.704 1.00 9.03   ? 455  PHE A CD1   1 
ATOM   4328 C  CD2   . PHE C 3  449 ? 47.825 180.035 16.183 1.00 5.67   ? 455  PHE A CD2   1 
ATOM   4329 C  CE1   . PHE C 3  449 ? 49.268 177.744 16.779 1.00 10.49  ? 455  PHE A CE1   1 
ATOM   4330 C  CE2   . PHE C 3  449 ? 47.447 179.240 17.259 1.00 10.32  ? 455  PHE A CE2   1 
ATOM   4331 C  CZ    . PHE C 3  449 ? 48.175 178.084 17.559 1.00 11.05  ? 455  PHE A CZ    1 
ATOM   4332 N  N     . GLY C 3  450 ? 48.215 181.334 10.940 1.00 12.33  ? 456  GLY A N     1 
ATOM   4333 C  CA    . GLY C 3  450 ? 48.546 182.240 9.862  1.00 12.27  ? 456  GLY A CA    1 
ATOM   4334 C  C     . GLY C 3  450 ? 47.369 182.708 9.056  1.00 11.34  ? 456  GLY A C     1 
ATOM   4335 O  O     . GLY C 3  450 ? 46.364 182.009 8.931  1.00 12.10  ? 456  GLY A O     1 
ATOM   4336 N  N     . ALA C 3  451 ? 47.511 183.906 8.506  1.00 12.55  ? 457  ALA A N     1 
ATOM   4337 C  CA    . ALA C 3  451 ? 46.468 184.519 7.701  1.00 12.65  ? 457  ALA A CA    1 
ATOM   4338 C  C     . ALA C 3  451 ? 46.185 183.697 6.461  1.00 13.62  ? 457  ALA A C     1 
ATOM   4339 O  O     . ALA C 3  451 ? 45.071 183.720 5.948  1.00 16.20  ? 457  ALA A O     1 
ATOM   4340 C  CB    . ALA C 3  451 ? 46.879 185.925 7.299  1.00 12.07  ? 457  ALA A CB    1 
ATOM   4341 N  N     . GLU C 3  452 ? 47.182 182.966 5.975  1.00 14.17  ? 458  GLU A N     1 
ATOM   4342 C  CA    . GLU C 3  452 ? 46.978 182.169 4.776  1.00 16.81  ? 458  GLU A CA    1 
ATOM   4343 C  C     . GLU C 3  452 ? 45.822 181.211 5.012  1.00 16.81  ? 458  GLU A C     1 
ATOM   4344 O  O     . GLU C 3  452 ? 45.089 180.876 4.080  1.00 16.62  ? 458  GLU A O     1 
ATOM   4345 C  CB    . GLU C 3  452 ? 48.239 181.377 4.414  1.00 18.51  ? 458  GLU A CB    1 
ATOM   4346 C  CG    . GLU C 3  452 ? 48.480 180.163 5.280  1.00 21.94  ? 458  GLU A CG    1 
ATOM   4347 C  CD    . GLU C 3  452 ? 49.723 179.396 4.878  1.00 25.07  ? 458  GLU A CD    1 
ATOM   4348 O  OE1   . GLU C 3  452 ? 49.862 179.069 3.676  1.00 27.70  ? 458  GLU A OE1   1 
ATOM   4349 O  OE2   . GLU C 3  452 ? 50.557 179.113 5.766  1.00 25.20  ? 458  GLU A OE2   1 
ATOM   4350 N  N     . HIS C 3  453 ? 45.659 180.789 6.267  1.00 16.26  ? 459  HIS A N     1 
ATOM   4351 C  CA    . HIS C 3  453 ? 44.601 179.856 6.640  1.00 14.66  ? 459  HIS A CA    1 
ATOM   4352 C  C     . HIS C 3  453 ? 43.228 180.507 6.702  1.00 15.11  ? 459  HIS A C     1 
ATOM   4353 O  O     . HIS C 3  453 ? 42.252 179.877 7.111  1.00 15.83  ? 459  HIS A O     1 
ATOM   4354 C  CB    . HIS C 3  453 ? 44.938 179.183 7.970  1.00 14.84  ? 459  HIS A CB    1 
ATOM   4355 C  CG    . HIS C 3  453 ? 46.293 178.545 7.980  1.00 17.27  ? 459  HIS A CG    1 
ATOM   4356 N  ND1   . HIS C 3  453 ? 46.680 177.611 7.043  1.00 16.74  ? 459  HIS A ND1   1 
ATOM   4357 C  CD2   . HIS C 3  453 ? 47.374 178.759 8.768  1.00 16.86  ? 459  HIS A CD2   1 
ATOM   4358 C  CE1   . HIS C 3  453 ? 47.942 177.280 7.248  1.00 16.80  ? 459  HIS A CE1   1 
ATOM   4359 N  NE2   . HIS C 3  453 ? 48.387 177.963 8.289  1.00 19.18  ? 459  HIS A NE2   1 
ATOM   4360 N  N     . HIS C 3  454 ? 43.150 181.773 6.312  1.00 13.17  ? 460  HIS A N     1 
ATOM   4361 C  CA    . HIS C 3  454 ? 41.863 182.448 6.280  1.00 12.47  ? 460  HIS A CA    1 
ATOM   4362 C  C     . HIS C 3  454 ? 41.574 182.800 4.834  1.00 12.72  ? 460  HIS A C     1 
ATOM   4363 O  O     . HIS C 3  454 ? 42.383 183.453 4.166  1.00 10.94  ? 460  HIS A O     1 
ATOM   4364 C  CB    . HIS C 3  454 ? 41.858 183.737 7.088  1.00 13.93  ? 460  HIS A CB    1 
ATOM   4365 C  CG    . HIS C 3  454 ? 40.600 184.533 6.912  1.00 16.73  ? 460  HIS A CG    1 
ATOM   4366 N  ND1   . HIS C 3  454 ? 39.393 184.147 7.457  1.00 15.19  ? 460  HIS A ND1   1 
ATOM   4367 C  CD2   . HIS C 3  454 ? 40.342 185.645 6.182  1.00 15.70  ? 460  HIS A CD2   1 
ATOM   4368 C  CE1   . HIS C 3  454 ? 38.449 184.984 7.069  1.00 15.05  ? 460  HIS A CE1   1 
ATOM   4369 N  NE2   . HIS C 3  454 ? 38.999 185.903 6.293  1.00 16.00  ? 460  HIS A NE2   1 
ATOM   4370 N  N     . LEU C 3  455 ? 40.426 182.359 4.345  1.00 12.66  ? 461  LEU A N     1 
ATOM   4371 C  CA    . LEU C 3  455 ? 40.050 182.652 2.979  1.00 13.66  ? 461  LEU A CA    1 
ATOM   4372 C  C     . LEU C 3  455 ? 39.085 183.821 3.044  1.00 13.76  ? 461  LEU A C     1 
ATOM   4373 O  O     . LEU C 3  455 ? 38.142 183.815 3.841  1.00 14.74  ? 461  LEU A O     1 
ATOM   4374 C  CB    . LEU C 3  455 ? 39.405 181.418 2.330  1.00 15.18  ? 461  LEU A CB    1 
ATOM   4375 C  CG    . LEU C 3  455 ? 40.292 180.159 2.361  1.00 16.29  ? 461  LEU A CG    1 
ATOM   4376 C  CD1   . LEU C 3  455 ? 39.552 178.972 1.776  1.00 16.93  ? 461  LEU A CD1   1 
ATOM   4377 C  CD2   . LEU C 3  455 ? 41.576 180.412 1.583  1.00 16.61  ? 461  LEU A CD2   1 
ATOM   4378 N  N     . ASP C 3  456 ? 39.350 184.840 2.228  1.00 12.77  ? 462  ASP A N     1 
ATOM   4379 C  CA    . ASP C 3  456 ? 38.523 186.039 2.186  1.00 12.08  ? 462  ASP A CA    1 
ATOM   4380 C  C     . ASP C 3  456 ? 37.066 185.652 1.994  1.00 12.53  ? 462  ASP A C     1 
ATOM   4381 O  O     . ASP C 3  456 ? 36.757 184.759 1.210  1.00 14.28  ? 462  ASP A O     1 
ATOM   4382 C  CB    . ASP C 3  456 ? 38.959 186.939 1.035  1.00 12.14  ? 462  ASP A CB    1 
ATOM   4383 C  CG    . ASP C 3  456 ? 38.213 188.248 1.016  1.00 12.98  ? 462  ASP A CG    1 
ATOM   4384 O  OD1   . ASP C 3  456 ? 38.472 189.092 1.896  1.00 13.85  ? 462  ASP A OD1   1 
ATOM   4385 O  OD2   . ASP C 3  456 ? 37.355 188.430 0.134  1.00 16.15  ? 462  ASP A OD2   1 
ATOM   4386 N  N     . GLY C 3  457 ? 36.176 186.332 2.702  1.00 12.05  ? 463  GLY A N     1 
ATOM   4387 C  CA    . GLY C 3  457 ? 34.763 186.027 2.594  1.00 14.59  ? 463  GLY A CA    1 
ATOM   4388 C  C     . GLY C 3  457 ? 34.153 186.221 1.216  1.00 17.16  ? 463  GLY A C     1 
ATOM   4389 O  O     . GLY C 3  457 ? 33.187 185.536 0.880  1.00 17.95  ? 463  GLY A O     1 
ATOM   4390 N  N     . ILE C 3  458 ? 34.709 187.134 0.417  1.00 17.60  ? 464  ILE A N     1 
ATOM   4391 C  CA    . ILE C 3  458 ? 34.184 187.416 -0.920 1.00 17.38  ? 464  ILE A CA    1 
ATOM   4392 C  C     . ILE C 3  458 ? 34.884 186.641 -2.032 1.00 17.67  ? 464  ILE A C     1 
ATOM   4393 O  O     . ILE C 3  458 ? 34.257 185.878 -2.768 1.00 18.84  ? 464  ILE A O     1 
ATOM   4394 C  CB    . ILE C 3  458 ? 34.305 188.927 -1.275 1.00 19.24  ? 464  ILE A CB    1 
ATOM   4395 C  CG1   . ILE C 3  458 ? 33.562 189.776 -0.245 1.00 18.90  ? 464  ILE A CG1   1 
ATOM   4396 C  CG2   . ILE C 3  458 ? 33.745 189.193 -2.674 1.00 16.96  ? 464  ILE A CG2   1 
ATOM   4397 C  CD1   . ILE C 3  458 ? 32.093 189.516 -0.199 1.00 22.37  ? 464  ILE A CD1   1 
ATOM   4398 N  N     . THR C 3  459 ? 36.188 186.843 -2.150 1.00 15.69  ? 465  THR A N     1 
ATOM   4399 C  CA    . THR C 3  459 ? 36.965 186.208 -3.198 1.00 15.65  ? 465  THR A CA    1 
ATOM   4400 C  C     . THR C 3  459 ? 37.454 184.803 -2.900 1.00 16.00  ? 465  THR A C     1 
ATOM   4401 O  O     . THR C 3  459 ? 37.832 184.076 -3.815 1.00 15.81  ? 465  THR A O     1 
ATOM   4402 C  CB    . THR C 3  459 ? 38.187 187.039 -3.528 1.00 16.20  ? 465  THR A CB    1 
ATOM   4403 O  OG1   . THR C 3  459 ? 39.090 186.991 -2.417 1.00 14.29  ? 465  THR A OG1   1 
ATOM   4404 C  CG2   . THR C 3  459 ? 37.787 188.479 -3.801 1.00 13.64  ? 465  THR A CG2   1 
ATOM   4405 N  N     . GLY C 3  460 ? 37.469 184.425 -1.627 1.00 16.28  ? 466  GLY A N     1 
ATOM   4406 C  CA    . GLY C 3  460 ? 37.930 183.100 -1.269 1.00 15.19  ? 466  GLY A CA    1 
ATOM   4407 C  C     . GLY C 3  460 ? 39.440 182.955 -1.363 1.00 17.34  ? 466  GLY A C     1 
ATOM   4408 O  O     . GLY C 3  460 ? 39.959 181.838 -1.306 1.00 20.57  ? 466  GLY A O     1 
ATOM   4409 N  N     . LYS C 3  461 ? 40.153 184.070 -1.510 1.00 15.86  ? 467  LYS A N     1 
ATOM   4410 C  CA    . LYS C 3  461 ? 41.613 184.028 -1.597 1.00 15.71  ? 467  LYS A CA    1 
ATOM   4411 C  C     . LYS C 3  461 ? 42.213 184.146 -0.200 1.00 16.02  ? 467  LYS A C     1 
ATOM   4412 O  O     . LYS C 3  461 ? 41.738 184.923 0.628  1.00 16.31  ? 467  LYS A O     1 
ATOM   4413 C  CB    . LYS C 3  461 ? 42.146 185.178 -2.462 1.00 16.53  ? 467  LYS A CB    1 
ATOM   4414 C  CG    . LYS C 3  461 ? 41.580 185.226 -3.877 1.00 18.47  ? 467  LYS A CG    1 
ATOM   4415 C  CD    . LYS C 3  461 ? 41.809 183.915 -4.616 1.00 18.32  ? 467  LYS A CD    1 
ATOM   4416 C  CE    . LYS C 3  461 ? 43.284 183.612 -4.759 1.00 18.09  ? 467  LYS A CE    1 
ATOM   4417 N  NZ    . LYS C 3  461 ? 43.502 182.243 -5.284 1.00 19.34  ? 467  LYS A NZ    1 
ATOM   4418 N  N     . PRO C 3  462 ? 43.271 183.381 0.079  1.00 14.44  ? 468  PRO A N     1 
ATOM   4419 C  CA    . PRO C 3  462 ? 43.887 183.458 1.408  1.00 13.67  ? 468  PRO A CA    1 
ATOM   4420 C  C     . PRO C 3  462 ? 44.404 184.844 1.756  1.00 13.05  ? 468  PRO A C     1 
ATOM   4421 O  O     . PRO C 3  462 ? 44.863 185.584 0.891  1.00 12.84  ? 468  PRO A O     1 
ATOM   4422 C  CB    . PRO C 3  462 ? 45.002 182.406 1.346  1.00 12.01  ? 468  PRO A CB    1 
ATOM   4423 C  CG    . PRO C 3  462 ? 45.281 182.257 -0.122 1.00 14.92  ? 468  PRO A CG    1 
ATOM   4424 C  CD    . PRO C 3  462 ? 43.925 182.365 -0.762 1.00 13.17  ? 468  PRO A CD    1 
ATOM   4425 N  N     . TRP C 3  463 ? 44.309 185.202 3.030  1.00 13.22  ? 469  TRP A N     1 
ATOM   4426 C  CA    . TRP C 3  463 ? 44.798 186.496 3.472  1.00 11.28  ? 469  TRP A CA    1 
ATOM   4427 C  C     . TRP C 3  463 ? 46.307 186.402 3.653  1.00 10.86  ? 469  TRP A C     1 
ATOM   4428 O  O     . TRP C 3  463 ? 46.870 185.312 3.605  1.00 9.70   ? 469  TRP A O     1 
ATOM   4429 C  CB    . TRP C 3  463 ? 44.116 186.903 4.781  1.00 11.07  ? 469  TRP A CB    1 
ATOM   4430 C  CG    . TRP C 3  463 ? 42.849 187.677 4.562  1.00 11.36  ? 469  TRP A CG    1 
ATOM   4431 C  CD1   . TRP C 3  463 ? 41.905 187.456 3.592  1.00 9.20   ? 469  TRP A CD1   1 
ATOM   4432 C  CD2   . TRP C 3  463 ? 42.376 188.790 5.335  1.00 9.00   ? 469  TRP A CD2   1 
ATOM   4433 N  NE1   . TRP C 3  463 ? 40.881 188.364 3.717  1.00 7.89   ? 469  TRP A NE1   1 
ATOM   4434 C  CE2   . TRP C 3  463 ? 41.143 189.191 4.778  1.00 8.96   ? 469  TRP A CE2   1 
ATOM   4435 C  CE3   . TRP C 3  463 ? 42.875 189.485 6.444  1.00 9.83   ? 469  TRP A CE3   1 
ATOM   4436 C  CZ2   . TRP C 3  463 ? 40.399 190.260 5.294  1.00 10.90  ? 469  TRP A CZ2   1 
ATOM   4437 C  CZ3   . TRP C 3  463 ? 42.135 190.550 6.957  1.00 10.27  ? 469  TRP A CZ3   1 
ATOM   4438 C  CH2   . TRP C 3  463 ? 40.912 190.926 6.381  1.00 10.26  ? 469  TRP A CH2   1 
ATOM   4439 N  N     . VAL C 3  464 ? 46.951 187.551 3.845  1.00 10.44  ? 470  VAL A N     1 
ATOM   4440 C  CA    . VAL C 3  464 ? 48.390 187.629 4.025  1.00 10.35  ? 470  VAL A CA    1 
ATOM   4441 C  C     . VAL C 3  464 ? 48.691 188.128 5.435  1.00 12.58  ? 470  VAL A C     1 
ATOM   4442 O  O     . VAL C 3  464 ? 47.861 188.792 6.072  1.00 11.95  ? 470  VAL A O     1 
ATOM   4443 C  CB    . VAL C 3  464 ? 49.012 188.584 2.983  1.00 12.87  ? 470  VAL A CB    1 
ATOM   4444 C  CG1   . VAL C 3  464 ? 50.453 188.899 3.340  1.00 11.85  ? 470  VAL A CG1   1 
ATOM   4445 C  CG2   . VAL C 3  464 ? 48.948 187.936 1.602  1.00 12.98  ? 470  VAL A CG2   1 
ATOM   4446 N  N     . GLN C 3  465 ? 49.890 187.826 5.915  1.00 11.46  ? 471  GLN A N     1 
ATOM   4447 C  CA    . GLN C 3  465 ? 50.272 188.200 7.262  1.00 11.66  ? 471  GLN A CA    1 
ATOM   4448 C  C     . GLN C 3  465 ? 51.386 189.228 7.349  1.00 12.32  ? 471  GLN A C     1 
ATOM   4449 O  O     . GLN C 3  465 ? 52.363 189.190 6.591  1.00 11.76  ? 471  GLN A O     1 
ATOM   4450 C  CB    . GLN C 3  465 ? 50.677 186.939 8.033  1.00 12.58  ? 471  GLN A CB    1 
ATOM   4451 C  CG    . GLN C 3  465 ? 50.753 187.103 9.545  1.00 10.89  ? 471  GLN A CG    1 
ATOM   4452 C  CD    . GLN C 3  465 ? 50.863 185.763 10.253 1.00 12.57  ? 471  GLN A CD    1 
ATOM   4453 O  OE1   . GLN C 3  465 ? 50.140 184.812 9.927  1.00 8.97   ? 471  GLN A OE1   1 
ATOM   4454 N  NE2   . GLN C 3  465 ? 51.759 185.682 11.233 1.00 10.21  ? 471  GLN A NE2   1 
ATOM   4455 N  N     . ALA C 3  466 ? 51.226 190.146 8.292  1.00 11.24  ? 472  ALA A N     1 
ATOM   4456 C  CA    . ALA C 3  466 ? 52.214 191.184 8.534  1.00 11.96  ? 472  ALA A CA    1 
ATOM   4457 C  C     . ALA C 3  466 ? 52.639 191.083 9.992  1.00 11.98  ? 472  ALA A C     1 
ATOM   4458 O  O     . ALA C 3  466 ? 51.845 191.339 10.894 1.00 13.74  ? 472  ALA A O     1 
ATOM   4459 C  CB    . ALA C 3  466 ? 51.622 192.560 8.253  1.00 11.17  ? 472  ALA A CB    1 
ATOM   4460 N  N     . GLY C 3  467 ? 53.885 190.689 10.216 1.00 12.59  ? 473  GLY A N     1 
ATOM   4461 C  CA    . GLY C 3  467 ? 54.394 190.575 11.567 1.00 12.38  ? 473  GLY A CA    1 
ATOM   4462 C  C     . GLY C 3  467 ? 55.397 191.672 11.869 1.00 15.04  ? 473  GLY A C     1 
ATOM   4463 O  O     . GLY C 3  467 ? 56.385 191.824 11.144 1.00 16.37  ? 473  GLY A O     1 
ATOM   4464 N  N     . ILE C 3  468 ? 55.146 192.440 12.932 1.00 14.74  ? 474  ILE A N     1 
ATOM   4465 C  CA    . ILE C 3  468 ? 56.040 193.523 13.340 1.00 13.02  ? 474  ILE A CA    1 
ATOM   4466 C  C     . ILE C 3  468 ? 56.449 193.367 14.809 1.00 15.10  ? 474  ILE A C     1 
ATOM   4467 O  O     . ILE C 3  468 ? 55.616 193.157 15.698 1.00 14.85  ? 474  ILE A O     1 
ATOM   4468 C  CB    . ILE C 3  468 ? 55.387 194.913 13.158 1.00 12.27  ? 474  ILE A CB    1 
ATOM   4469 C  CG1   . ILE C 3  468 ? 54.838 195.066 11.737 1.00 10.13  ? 474  ILE A CG1   1 
ATOM   4470 C  CG2   . ILE C 3  468 ? 56.420 196.002 13.414 1.00 8.60   ? 474  ILE A CG2   1 
ATOM   4471 C  CD1   . ILE C 3  468 ? 53.455 194.499 11.536 1.00 10.56  ? 474  ILE A CD1   1 
ATOM   4472 N  N     . ASP C 3  469 ? 57.744 193.489 15.062 1.00 16.21  ? 475  ASP A N     1 
ATOM   4473 C  CA    . ASP C 3  469 ? 58.270 193.323 16.406 1.00 18.13  ? 475  ASP A CA    1 
ATOM   4474 C  C     . ASP C 3  469 ? 59.174 194.500 16.721 1.00 18.21  ? 475  ASP A C     1 
ATOM   4475 O  O     . ASP C 3  469 ? 59.951 194.922 15.866 1.00 18.62  ? 475  ASP A O     1 
ATOM   4476 C  CB    . ASP C 3  469 ? 59.054 192.006 16.469 1.00 20.42  ? 475  ASP A CB    1 
ATOM   4477 C  CG    . ASP C 3  469 ? 59.688 191.756 17.826 1.00 26.20  ? 475  ASP A CG    1 
ATOM   4478 O  OD1   . ASP C 3  469 ? 60.492 192.598 18.279 1.00 30.77  ? 475  ASP A OD1   1 
ATOM   4479 O  OD2   . ASP C 3  469 ? 59.388 190.707 18.439 1.00 28.83  ? 475  ASP A OD2   1 
ATOM   4480 N  N     . ALA C 3  470 ? 59.068 195.034 17.935 1.00 16.33  ? 476  ALA A N     1 
ATOM   4481 C  CA    . ALA C 3  470 ? 59.902 196.168 18.333 1.00 17.86  ? 476  ALA A CA    1 
ATOM   4482 C  C     . ALA C 3  470 ? 61.356 195.707 18.481 1.00 17.44  ? 476  ALA A C     1 
ATOM   4483 O  O     . ALA C 3  470 ? 61.632 194.657 19.061 1.00 16.82  ? 476  ALA A O     1 
ATOM   4484 C  CB    . ALA C 3  470 ? 59.395 196.769 19.644 1.00 16.87  ? 476  ALA A CB    1 
ATOM   4485 N  N     . SER C 3  471 ? 62.280 196.507 17.960 1.00 17.93  ? 477  SER A N     1 
ATOM   4486 C  CA    . SER C 3  471 ? 63.707 196.178 17.996 1.00 17.15  ? 477  SER A CA    1 
ATOM   4487 C  C     . SER C 3  471 ? 64.428 196.488 19.309 1.00 14.93  ? 477  SER A C     1 
ATOM   4488 O  O     . SER C 3  471 ? 64.485 197.644 19.732 1.00 14.02  ? 477  SER A O     1 
ATOM   4489 C  CB    . SER C 3  471 ? 64.407 196.901 16.849 1.00 17.34  ? 477  SER A CB    1 
ATOM   4490 O  OG    . SER C 3  471 ? 63.737 196.644 15.628 1.00 18.71  ? 477  SER A OG    1 
ATOM   4491 N  N     . GLY C 3  472 ? 64.991 195.447 19.924 1.00 15.27  ? 478  GLY A N     1 
ATOM   4492 C  CA    . GLY C 3  472 ? 65.719 195.581 21.184 1.00 16.21  ? 478  GLY A CA    1 
ATOM   4493 C  C     . GLY C 3  472 ? 65.029 196.517 22.155 1.00 17.16  ? 478  GLY A C     1 
ATOM   4494 O  O     . GLY C 3  472 ? 65.662 197.340 22.817 1.00 19.04  ? 478  GLY A O     1 
ATOM   4495 N  N     . LEU C 3  473 ? 63.715 196.380 22.239 1.00 16.96  ? 479  LEU A N     1 
ATOM   4496 C  CA    . LEU C 3  473 ? 62.884 197.230 23.077 1.00 15.69  ? 479  LEU A CA    1 
ATOM   4497 C  C     . LEU C 3  473 ? 63.383 197.526 24.491 1.00 14.01  ? 479  LEU A C     1 
ATOM   4498 O  O     . LEU C 3  473 ? 63.625 198.683 24.830 1.00 11.70  ? 479  LEU A O     1 
ATOM   4499 C  CB    . LEU C 3  473 ? 61.477 196.642 23.143 1.00 18.63  ? 479  LEU A CB    1 
ATOM   4500 C  CG    . LEU C 3  473 ? 60.430 197.413 23.943 1.00 20.97  ? 479  LEU A CG    1 
ATOM   4501 C  CD1   . LEU C 3  473 ? 60.057 198.694 23.220 1.00 21.49  ? 479  LEU A CD1   1 
ATOM   4502 C  CD2   . LEU C 3  473 ? 59.211 196.528 24.133 1.00 23.32  ? 479  LEU A CD2   1 
ATOM   4503 N  N     . GLU C 3  474 ? 63.545 196.501 25.320 1.00 12.79  ? 480  GLU A N     1 
ATOM   4504 C  CA    . GLU C 3  474 ? 63.973 196.760 26.688 1.00 14.06  ? 480  GLU A CA    1 
ATOM   4505 C  C     . GLU C 3  474 ? 65.400 197.259 26.846 1.00 13.48  ? 480  GLU A C     1 
ATOM   4506 O  O     . GLU C 3  474 ? 65.719 197.908 27.840 1.00 11.96  ? 480  GLU A O     1 
ATOM   4507 C  CB    . GLU C 3  474 ? 63.674 195.549 27.583 1.00 13.85  ? 480  GLU A CB    1 
ATOM   4508 C  CG    . GLU C 3  474 ? 62.230 195.629 28.116 1.00 15.08  ? 480  GLU A CG    1 
ATOM   4509 C  CD    . GLU C 3  474 ? 61.706 194.339 28.731 1.00 14.36  ? 480  GLU A CD    1 
ATOM   4510 O  OE1   . GLU C 3  474 ? 62.359 193.792 29.647 1.00 13.03  ? 480  GLU A OE1   1 
ATOM   4511 O  OE2   . GLU C 3  474 ? 60.627 193.882 28.298 1.00 12.65  ? 480  GLU A OE2   1 
ATOM   4512 N  N     . LEU C 3  475 ? 66.255 196.984 25.866 1.00 13.43  ? 481  LEU A N     1 
ATOM   4513 C  CA    . LEU C 3  475 ? 67.617 197.493 25.927 1.00 12.93  ? 481  LEU A CA    1 
ATOM   4514 C  C     . LEU C 3  475 ? 67.593 198.987 25.552 1.00 14.55  ? 481  LEU A C     1 
ATOM   4515 O  O     . LEU C 3  475 ? 68.417 199.767 26.045 1.00 15.29  ? 481  LEU A O     1 
ATOM   4516 C  CB    . LEU C 3  475 ? 68.546 196.720 24.986 1.00 12.17  ? 481  LEU A CB    1 
ATOM   4517 C  CG    . LEU C 3  475 ? 69.033 195.363 25.502 1.00 11.67  ? 481  LEU A CG    1 
ATOM   4518 C  CD1   . LEU C 3  475 ? 70.092 194.807 24.563 1.00 11.34  ? 481  LEU A CD1   1 
ATOM   4519 C  CD2   . LEU C 3  475 ? 69.617 195.526 26.895 1.00 10.69  ? 481  LEU A CD2   1 
ATOM   4520 N  N     . ARG C 3  476 ? 66.649 199.385 24.694 1.00 12.83  ? 482  ARG A N     1 
ATOM   4521 C  CA    . ARG C 3  476 ? 66.531 200.791 24.306 1.00 13.85  ? 482  ARG A CA    1 
ATOM   4522 C  C     . ARG C 3  476 ? 65.946 201.539 25.490 1.00 15.16  ? 482  ARG A C     1 
ATOM   4523 O  O     . ARG C 3  476 ? 66.286 202.700 25.733 1.00 15.46  ? 482  ARG A O     1 
ATOM   4524 C  CB    . ARG C 3  476 ? 65.641 200.966 23.064 1.00 13.43  ? 482  ARG A CB    1 
ATOM   4525 C  CG    . ARG C 3  476 ? 66.185 200.235 21.837 1.00 13.68  ? 482  ARG A CG    1 
ATOM   4526 C  CD    . ARG C 3  476 ? 65.740 200.833 20.514 1.00 12.36  ? 482  ARG A CD    1 
ATOM   4527 N  NE    . ARG C 3  476 ? 66.263 200.055 19.393 1.00 12.43  ? 482  ARG A NE    1 
ATOM   4528 C  CZ    . ARG C 3  476 ? 66.320 200.483 18.133 1.00 14.92  ? 482  ARG A CZ    1 
ATOM   4529 N  NH1   . ARG C 3  476 ? 65.889 201.697 17.818 1.00 11.60  ? 482  ARG A NH1   1 
ATOM   4530 N  NH2   . ARG C 3  476 ? 66.800 199.686 17.182 1.00 13.74  ? 482  ARG A NH2   1 
ATOM   4531 N  N     . CYS C 3  477 ? 65.072 200.861 26.234 1.00 15.64  ? 483  CYS A N     1 
ATOM   4532 C  CA    . CYS C 3  477 ? 64.472 201.443 27.429 1.00 14.48  ? 483  CYS A CA    1 
ATOM   4533 C  C     . CYS C 3  477 ? 65.610 201.705 28.415 1.00 15.39  ? 483  CYS A C     1 
ATOM   4534 O  O     . CYS C 3  477 ? 65.643 202.740 29.093 1.00 15.04  ? 483  CYS A O     1 
ATOM   4535 C  CB    . CYS C 3  477 ? 63.468 200.475 28.053 1.00 15.24  ? 483  CYS A CB    1 
ATOM   4536 S  SG    . CYS C 3  477 ? 61.872 200.402 27.223 1.00 12.25  ? 483  CYS A SG    1 
ATOM   4537 N  N     . LEU C 3  478 ? 66.543 200.758 28.481 1.00 14.43  ? 484  LEU A N     1 
ATOM   4538 C  CA    . LEU C 3  478 ? 67.703 200.883 29.354 1.00 14.80  ? 484  LEU A CA    1 
ATOM   4539 C  C     . LEU C 3  478 ? 68.502 202.107 28.924 1.00 15.98  ? 484  LEU A C     1 
ATOM   4540 O  O     . LEU C 3  478 ? 68.896 202.923 29.755 1.00 16.52  ? 484  LEU A O     1 
ATOM   4541 C  CB    . LEU C 3  478 ? 68.594 199.642 29.254 1.00 14.22  ? 484  LEU A CB    1 
ATOM   4542 C  CG    . LEU C 3  478 ? 69.937 199.757 29.988 1.00 14.61  ? 484  LEU A CG    1 
ATOM   4543 C  CD1   . LEU C 3  478 ? 69.680 199.965 31.475 1.00 13.96  ? 484  LEU A CD1   1 
ATOM   4544 C  CD2   . LEU C 3  478 ? 70.776 198.510 29.763 1.00 11.19  ? 484  LEU A CD2   1 
ATOM   4545 N  N     . ALA C 3  479 ? 68.733 202.237 27.619 1.00 15.19  ? 485  ALA A N     1 
ATOM   4546 C  CA    . ALA C 3  479 ? 69.490 203.374 27.100 1.00 15.36  ? 485  ALA A CA    1 
ATOM   4547 C  C     . ALA C 3  479 ? 68.811 204.675 27.502 1.00 15.37  ? 485  ALA A C     1 
ATOM   4548 O  O     . ALA C 3  479 ? 69.476 205.623 27.912 1.00 15.96  ? 485  ALA A O     1 
ATOM   4549 C  CB    . ALA C 3  479 ? 69.603 203.291 25.579 1.00 14.59  ? 485  ALA A CB    1 
ATOM   4550 N  N     . HIS C 3  480 ? 67.485 204.712 27.379 1.00 14.45  ? 486  HIS A N     1 
ATOM   4551 C  CA    . HIS C 3  480 ? 66.707 205.897 27.731 1.00 14.46  ? 486  HIS A CA    1 
ATOM   4552 C  C     . HIS C 3  480 ? 66.968 206.296 29.178 1.00 15.35  ? 486  HIS A C     1 
ATOM   4553 O  O     . HIS C 3  480 ? 67.380 207.417 29.455 1.00 16.42  ? 486  HIS A O     1 
ATOM   4554 C  CB    . HIS C 3  480 ? 65.207 205.623 27.524 1.00 12.39  ? 486  HIS A CB    1 
ATOM   4555 C  CG    . HIS C 3  480 ? 64.300 206.600 28.208 1.00 11.11  ? 486  HIS A CG    1 
ATOM   4556 N  ND1   . HIS C 3  480 ? 64.047 207.862 27.713 1.00 12.74  ? 486  HIS A ND1   1 
ATOM   4557 C  CD2   . HIS C 3  480 ? 63.573 206.496 29.349 1.00 11.18  ? 486  HIS A CD2   1 
ATOM   4558 C  CE1   . HIS C 3  480 ? 63.204 208.490 28.514 1.00 10.43  ? 486  HIS A CE1   1 
ATOM   4559 N  NE2   . HIS C 3  480 ? 62.900 207.683 29.516 1.00 9.14   ? 486  HIS A NE2   1 
ATOM   4560 N  N     . PHE C 3  481 ? 66.751 205.363 30.096 1.00 16.53  ? 487  PHE A N     1 
ATOM   4561 C  CA    . PHE C 3  481 ? 66.930 205.639 31.514 1.00 16.99  ? 487  PHE A CA    1 
ATOM   4562 C  C     . PHE C 3  481 ? 68.351 205.916 32.002 1.00 17.24  ? 487  PHE A C     1 
ATOM   4563 O  O     . PHE C 3  481 ? 68.522 206.563 33.029 1.00 16.51  ? 487  PHE A O     1 
ATOM   4564 C  CB    . PHE C 3  481 ? 66.293 204.514 32.339 1.00 16.42  ? 487  PHE A CB    1 
ATOM   4565 C  CG    . PHE C 3  481 ? 64.788 204.530 32.313 1.00 13.26  ? 487  PHE A CG    1 
ATOM   4566 C  CD1   . PHE C 3  481 ? 64.084 205.576 32.897 1.00 11.51  ? 487  PHE A CD1   1 
ATOM   4567 C  CD2   . PHE C 3  481 ? 64.077 203.506 31.694 1.00 12.43  ? 487  PHE A CD2   1 
ATOM   4568 C  CE1   . PHE C 3  481 ? 62.690 205.604 32.868 1.00 12.20  ? 487  PHE A CE1   1 
ATOM   4569 C  CE2   . PHE C 3  481 ? 62.679 203.521 31.656 1.00 11.49  ? 487  PHE A CE2   1 
ATOM   4570 C  CZ    . PHE C 3  481 ? 61.984 204.569 32.243 1.00 10.57  ? 487  PHE A CZ    1 
ATOM   4571 N  N     . MET C 3  482 ? 69.377 205.432 31.308 1.00 17.18  ? 488  MET A N     1 
ATOM   4572 C  CA    . MET C 3  482 ? 70.713 205.747 31.787 1.00 18.23  ? 488  MET A CA    1 
ATOM   4573 C  C     . MET C 3  482 ? 71.339 206.921 31.057 1.00 17.13  ? 488  MET A C     1 
ATOM   4574 O  O     . MET C 3  482 ? 72.477 207.296 31.339 1.00 15.88  ? 488  MET A O     1 
ATOM   4575 C  CB    . MET C 3  482 ? 71.655 204.529 31.768 1.00 19.67  ? 488  MET A CB    1 
ATOM   4576 C  CG    . MET C 3  482 ? 71.450 203.495 30.695 1.00 21.24  ? 488  MET A CG    1 
ATOM   4577 S  SD    . MET C 3  482 ? 72.633 202.101 30.915 1.00 19.99  ? 488  MET A SD    1 
ATOM   4578 C  CE    . MET C 3  482 ? 73.220 201.937 29.262 1.00 17.00  ? 488  MET A CE    1 
ATOM   4579 N  N     . ALA C 3  483 ? 70.576 207.520 30.145 1.00 14.86  ? 489  ALA A N     1 
ATOM   4580 C  CA    . ALA C 3  483 ? 71.055 208.673 29.389 1.00 16.26  ? 489  ALA A CA    1 
ATOM   4581 C  C     . ALA C 3  483 ? 71.390 209.836 30.324 1.00 15.71  ? 489  ALA A C     1 
ATOM   4582 O  O     . ALA C 3  483 ? 72.226 210.674 30.004 1.00 17.22  ? 489  ALA A O     1 
ATOM   4583 C  CB    . ALA C 3  483 ? 70.005 209.115 28.369 1.00 16.92  ? 489  ALA A CB    1 
ATOM   4584 N  N     . ARG C 3  484 ? 70.739 209.892 31.478 1.00 15.30  ? 490  ARG A N     1 
ATOM   4585 C  CA    . ARG C 3  484 ? 71.021 210.969 32.414 1.00 17.76  ? 490  ARG A CA    1 
ATOM   4586 C  C     . ARG C 3  484 ? 72.378 210.728 33.072 1.00 16.29  ? 490  ARG A C     1 
ATOM   4587 O  O     . ARG C 3  484 ? 72.958 211.642 33.651 1.00 14.95  ? 490  ARG A O     1 
ATOM   4588 C  CB    . ARG C 3  484 ? 69.932 211.070 33.490 1.00 19.55  ? 490  ARG A CB    1 
ATOM   4589 C  CG    . ARG C 3  484 ? 70.160 210.198 34.710 1.00 23.73  ? 490  ARG A CG    1 
ATOM   4590 C  CD    . ARG C 3  484 ? 69.072 210.425 35.743 1.00 28.49  ? 490  ARG A CD    1 
ATOM   4591 N  NE    . ARG C 3  484 ? 69.495 210.027 37.083 1.00 33.15  ? 490  ARG A NE    1 
ATOM   4592 C  CZ    . ARG C 3  484 ? 68.657 209.801 38.089 1.00 35.58  ? 490  ARG A CZ    1 
ATOM   4593 N  NH1   . ARG C 3  484 ? 67.349 209.930 37.903 1.00 36.59  ? 490  ARG A NH1   1 
ATOM   4594 N  NH2   . ARG C 3  484 ? 69.124 209.455 39.283 1.00 36.65  ? 490  ARG A NH2   1 
ATOM   4595 N  N     . PHE C 3  485 ? 72.870 209.496 32.976 1.00 13.78  ? 491  PHE A N     1 
ATOM   4596 C  CA    . PHE C 3  485 ? 74.161 209.124 33.548 1.00 15.53  ? 491  PHE A CA    1 
ATOM   4597 C  C     . PHE C 3  485 ? 75.285 209.079 32.502 1.00 17.21  ? 491  PHE A C     1 
ATOM   4598 O  O     . PHE C 3  485 ? 76.443 209.366 32.821 1.00 18.43  ? 491  PHE A O     1 
ATOM   4599 C  CB    . PHE C 3  485 ? 74.082 207.745 34.206 1.00 13.14  ? 491  PHE A CB    1 
ATOM   4600 C  CG    . PHE C 3  485 ? 73.159 207.678 35.384 1.00 14.79  ? 491  PHE A CG    1 
ATOM   4601 C  CD1   . PHE C 3  485 ? 73.495 208.292 36.585 1.00 12.50  ? 491  PHE A CD1   1 
ATOM   4602 C  CD2   . PHE C 3  485 ? 71.963 206.978 35.302 1.00 11.50  ? 491  PHE A CD2   1 
ATOM   4603 C  CE1   . PHE C 3  485 ? 72.653 208.205 37.689 1.00 12.91  ? 491  PHE A CE1   1 
ATOM   4604 C  CE2   . PHE C 3  485 ? 71.117 206.889 36.397 1.00 13.60  ? 491  PHE A CE2   1 
ATOM   4605 C  CZ    . PHE C 3  485 ? 71.463 207.503 37.596 1.00 12.95  ? 491  PHE A CZ    1 
ATOM   4606 N  N     . ASP C 3  486 ? 74.953 208.718 31.266 1.00 15.88  ? 492  ASP A N     1 
ATOM   4607 C  CA    . ASP C 3  486 ? 75.968 208.609 30.223 1.00 17.90  ? 492  ASP A CA    1 
ATOM   4608 C  C     . ASP C 3  486 ? 75.740 209.531 29.024 1.00 18.52  ? 492  ASP A C     1 
ATOM   4609 O  O     . ASP C 3  486 ? 76.423 209.408 28.011 1.00 18.94  ? 492  ASP A O     1 
ATOM   4610 C  CB    . ASP C 3  486 ? 76.047 207.149 29.744 1.00 18.12  ? 492  ASP A CB    1 
ATOM   4611 C  CG    . ASP C 3  486 ? 74.916 206.780 28.786 1.00 19.29  ? 492  ASP A CG    1 
ATOM   4612 O  OD1   . ASP C 3  486 ? 73.813 207.353 28.915 1.00 19.40  ? 492  ASP A OD1   1 
ATOM   4613 O  OD2   . ASP C 3  486 ? 75.126 205.914 27.910 1.00 17.50  ? 492  ASP A OD2   1 
ATOM   4614 N  N     . ASN C 3  487 ? 74.781 210.443 29.140 1.00 19.41  ? 493  ASN A N     1 
ATOM   4615 C  CA    . ASN C 3  487 ? 74.458 211.382 28.066 1.00 20.61  ? 493  ASN A CA    1 
ATOM   4616 C  C     . ASN C 3  487 ? 74.083 210.744 26.732 1.00 22.02  ? 493  ASN A C     1 
ATOM   4617 O  O     . ASN C 3  487 ? 74.516 211.201 25.670 1.00 23.62  ? 493  ASN A O     1 
ATOM   4618 C  CB    . ASN C 3  487 ? 75.611 212.357 27.847 1.00 21.36  ? 493  ASN A CB    1 
ATOM   4619 C  CG    . ASN C 3  487 ? 75.907 213.176 29.077 1.00 23.87  ? 493  ASN A CG    1 
ATOM   4620 O  OD1   . ASN C 3  487 ? 75.017 213.812 29.639 1.00 24.78  ? 493  ASN A OD1   1 
ATOM   4621 N  ND2   . ASN C 3  487 ? 77.159 213.167 29.505 1.00 24.60  ? 493  ASN A ND2   1 
ATOM   4622 N  N     . GLY C 3  488 ? 73.279 209.689 26.788 1.00 21.76  ? 494  GLY A N     1 
ATOM   4623 C  CA    . GLY C 3  488 ? 72.830 209.038 25.572 1.00 21.71  ? 494  GLY A CA    1 
ATOM   4624 C  C     . GLY C 3  488 ? 73.886 208.245 24.841 1.00 23.40  ? 494  GLY A C     1 
ATOM   4625 O  O     . GLY C 3  488 ? 73.692 207.858 23.686 1.00 24.02  ? 494  GLY A O     1 
ATOM   4626 N  N     . GLU C 3  489 ? 75.003 207.998 25.512 1.00 23.44  ? 495  GLU A N     1 
ATOM   4627 C  CA    . GLU C 3  489 ? 76.092 207.233 24.922 1.00 24.95  ? 495  GLU A CA    1 
ATOM   4628 C  C     . GLU C 3  489 ? 75.607 205.857 24.467 1.00 24.98  ? 495  GLU A C     1 
ATOM   4629 O  O     . GLU C 3  489 ? 75.822 205.461 23.322 1.00 24.34  ? 495  GLU A O     1 
ATOM   4630 C  CB    . GLU C 3  489 ? 77.214 207.080 25.941 1.00 27.76  ? 495  GLU A CB    1 
ATOM   4631 C  CG    . GLU C 3  489 ? 78.408 206.282 25.473 1.00 33.22  ? 495  GLU A CG    1 
ATOM   4632 C  CD    . GLU C 3  489 ? 79.464 206.200 26.559 1.00 37.85  ? 495  GLU A CD    1 
ATOM   4633 O  OE1   . GLU C 3  489 ? 79.944 207.273 26.994 1.00 41.10  ? 495  GLU A OE1   1 
ATOM   4634 O  OE2   . GLU C 3  489 ? 79.805 205.075 26.985 1.00 36.31  ? 495  GLU A OE2   1 
ATOM   4635 N  N     . TYR C 3  490 ? 74.952 205.126 25.365 1.00 22.99  ? 496  TYR A N     1 
ATOM   4636 C  CA    . TYR C 3  490 ? 74.443 203.809 25.018 1.00 22.28  ? 496  TYR A CA    1 
ATOM   4637 C  C     . TYR C 3  490 ? 73.322 203.912 23.979 1.00 22.65  ? 496  TYR A C     1 
ATOM   4638 O  O     . TYR C 3  490 ? 73.208 203.072 23.084 1.00 20.94  ? 496  TYR A O     1 
ATOM   4639 C  CB    . TYR C 3  490 ? 73.926 203.097 26.266 1.00 21.14  ? 496  TYR A CB    1 
ATOM   4640 C  CG    . TYR C 3  490 ? 73.571 201.653 26.022 1.00 19.47  ? 496  TYR A CG    1 
ATOM   4641 C  CD1   . TYR C 3  490 ? 74.555 200.719 25.719 1.00 19.82  ? 496  TYR A CD1   1 
ATOM   4642 C  CD2   . TYR C 3  490 ? 72.245 201.222 26.073 1.00 19.52  ? 496  TYR A CD2   1 
ATOM   4643 C  CE1   . TYR C 3  490 ? 74.230 199.387 25.469 1.00 22.07  ? 496  TYR A CE1   1 
ATOM   4644 C  CE2   . TYR C 3  490 ? 71.905 199.894 25.829 1.00 19.87  ? 496  TYR A CE2   1 
ATOM   4645 C  CZ    . TYR C 3  490 ? 72.902 198.981 25.526 1.00 21.52  ? 496  TYR A CZ    1 
ATOM   4646 O  OH    . TYR C 3  490 ? 72.579 197.668 25.280 1.00 21.74  ? 496  TYR A OH    1 
ATOM   4647 N  N     . ALA C 3  491 ? 72.501 204.950 24.103 1.00 23.88  ? 497  ALA A N     1 
ATOM   4648 C  CA    . ALA C 3  491 ? 71.394 205.175 23.177 1.00 25.90  ? 497  ALA A CA    1 
ATOM   4649 C  C     . ALA C 3  491 ? 71.900 205.335 21.745 1.00 27.34  ? 497  ALA A C     1 
ATOM   4650 O  O     . ALA C 3  491 ? 71.178 205.053 20.786 1.00 26.66  ? 497  ALA A O     1 
ATOM   4651 C  CB    . ALA C 3  491 ? 70.604 206.415 23.595 1.00 24.02  ? 497  ALA A CB    1 
ATOM   4652 N  N     . HIS C 3  492 ? 73.141 205.791 21.602 1.00 28.53  ? 498  HIS A N     1 
ATOM   4653 C  CA    . HIS C 3  492 ? 73.727 205.971 20.283 1.00 29.36  ? 498  HIS A CA    1 
ATOM   4654 C  C     . HIS C 3  492 ? 74.419 204.691 19.829 1.00 30.56  ? 498  HIS A C     1 
ATOM   4655 O  O     . HIS C 3  492 ? 74.301 204.288 18.676 1.00 31.81  ? 498  HIS A O     1 
ATOM   4656 C  CB    . HIS C 3  492 ? 74.739 207.116 20.293 1.00 30.87  ? 498  HIS A CB    1 
ATOM   4657 C  CG    . HIS C 3  492 ? 75.374 207.358 18.960 1.00 32.29  ? 498  HIS A CG    1 
ATOM   4658 N  ND1   . HIS C 3  492 ? 74.744 208.056 17.953 1.00 32.40  ? 498  HIS A ND1   1 
ATOM   4659 C  CD2   . HIS C 3  492 ? 76.543 206.917 18.438 1.00 31.39  ? 498  HIS A CD2   1 
ATOM   4660 C  CE1   . HIS C 3  492 ? 75.495 208.031 16.867 1.00 32.82  ? 498  HIS A CE1   1 
ATOM   4661 N  NE2   . HIS C 3  492 ? 76.592 207.345 17.134 1.00 32.60  ? 498  HIS A NE2   1 
ATOM   4662 N  N     . GLU C 3  493 ? 75.146 204.060 20.742 1.00 32.01  ? 499  GLU A N     1 
ATOM   4663 C  CA    . GLU C 3  493 ? 75.865 202.820 20.451 1.00 34.24  ? 499  GLU A CA    1 
ATOM   4664 C  C     . GLU C 3  493 ? 74.913 201.703 20.019 1.00 35.10  ? 499  GLU A C     1 
ATOM   4665 O  O     . GLU C 3  493 ? 75.205 200.944 19.093 1.00 34.13  ? 499  GLU A O     1 
ATOM   4666 C  CB    . GLU C 3  493 ? 76.637 202.371 21.697 1.00 36.21  ? 499  GLU A CB    1 
ATOM   4667 C  CG    . GLU C 3  493 ? 77.318 201.004 21.592 1.00 43.60  ? 499  GLU A CG    1 
ATOM   4668 C  CD    . GLU C 3  493 ? 77.565 200.349 22.968 1.00 47.95  ? 499  GLU A CD    1 
ATOM   4669 O  OE1   . GLU C 3  493 ? 78.164 201.007 23.856 1.00 48.12  ? 499  GLU A OE1   1 
ATOM   4670 O  OE2   . GLU C 3  493 ? 77.163 199.171 23.156 1.00 46.42  ? 499  GLU A OE2   1 
ATOM   4671 N  N     . ILE C 3  494 ? 73.769 201.623 20.693 1.00 35.78  ? 500  ILE A N     1 
ATOM   4672 C  CA    . ILE C 3  494 ? 72.780 200.584 20.436 1.00 35.95  ? 500  ILE A CA    1 
ATOM   4673 C  C     . ILE C 3  494 ? 72.271 200.497 19.007 1.00 36.67  ? 500  ILE A C     1 
ATOM   4674 O  O     . ILE C 3  494 ? 71.882 199.423 18.557 1.00 37.53  ? 500  ILE A O     1 
ATOM   4675 C  CB    . ILE C 3  494 ? 71.562 200.726 21.386 1.00 36.28  ? 500  ILE A CB    1 
ATOM   4676 C  CG1   . ILE C 3  494 ? 70.989 199.347 21.709 1.00 36.56  ? 500  ILE A CG1   1 
ATOM   4677 C  CG2   . ILE C 3  494 ? 70.470 201.564 20.732 1.00 35.83  ? 500  ILE A CG2   1 
ATOM   4678 C  CD1   . ILE C 3  494 ? 69.905 199.372 22.772 1.00 37.43  ? 500  ILE A CD1   1 
ATOM   4679 N  N     . LEU C 3  495 ? 72.257 201.606 18.281 1.00 37.46  ? 501  LEU A N     1 
ATOM   4680 C  CA    . LEU C 3  495 ? 71.758 201.535 16.918 1.00 38.92  ? 501  LEU A CA    1 
ATOM   4681 C  C     . LEU C 3  495 ? 72.841 201.417 15.850 1.00 39.87  ? 501  LEU A C     1 
ATOM   4682 O  O     . LEU C 3  495 ? 72.590 201.629 14.661 1.00 40.90  ? 501  LEU A O     1 
ATOM   4683 C  CB    . LEU C 3  495 ? 70.807 202.705 16.633 1.00 38.45  ? 501  LEU A CB    1 
ATOM   4684 C  CG    . LEU C 3  495 ? 71.023 204.045 17.326 1.00 39.19  ? 501  LEU A CG    1 
ATOM   4685 C  CD1   . LEU C 3  495 ? 72.143 204.810 16.638 1.00 41.59  ? 501  LEU A CD1   1 
ATOM   4686 C  CD2   . LEU C 3  495 ? 69.734 204.841 17.270 1.00 37.43  ? 501  LEU A CD2   1 
ATOM   4687 N  N     . ASN C 3  496 ? 74.044 201.052 16.284 1.00 39.36  ? 502  ASN A N     1 
ATOM   4688 C  CA    . ASN C 3  496 ? 75.169 200.858 15.375 1.00 39.33  ? 502  ASN A CA    1 
ATOM   4689 C  C     . ASN C 3  496 ? 75.210 199.367 15.058 1.00 38.05  ? 502  ASN A C     1 
ATOM   4690 O  O     . ASN C 3  496 ? 76.042 198.632 15.588 1.00 38.36  ? 502  ASN A O     1 
ATOM   4691 C  CB    . ASN C 3  496 ? 76.477 201.277 16.047 1.00 40.79  ? 502  ASN A CB    1 
ATOM   4692 C  CG    . ASN C 3  496 ? 77.691 200.879 15.242 1.00 42.14  ? 502  ASN A CG    1 
ATOM   4693 O  OD1   . ASN C 3  496 ? 77.829 201.260 14.078 1.00 44.36  ? 502  ASN A OD1   1 
ATOM   4694 N  ND2   . ASN C 3  496 ? 78.580 200.106 15.853 1.00 41.74  ? 502  ASN A ND2   1 
ATOM   4695 N  N     . GLY C 3  497 ? 74.307 198.925 14.190 1.00 36.59  ? 503  GLY A N     1 
ATOM   4696 C  CA    . GLY C 3  497 ? 74.240 197.513 13.862 1.00 34.92  ? 503  GLY A CA    1 
ATOM   4697 C  C     . GLY C 3  497 ? 73.366 196.859 14.917 1.00 33.56  ? 503  GLY A C     1 
ATOM   4698 O  O     . GLY C 3  497 ? 73.053 197.488 15.927 1.00 33.68  ? 503  GLY A O     1 
ATOM   4699 N  N     . ASP C 3  498 ? 72.962 195.612 14.707 1.00 31.65  ? 504  ASP A N     1 
ATOM   4700 C  CA    . ASP C 3  498 ? 72.117 194.949 15.690 1.00 29.49  ? 504  ASP A CA    1 
ATOM   4701 C  C     . ASP C 3  498 ? 72.811 194.806 17.039 1.00 26.80  ? 504  ASP A C     1 
ATOM   4702 O  O     . ASP C 3  498 ? 73.909 194.263 17.121 1.00 26.02  ? 504  ASP A O     1 
ATOM   4703 C  CB    . ASP C 3  498 ? 71.698 193.567 15.213 1.00 30.37  ? 504  ASP A CB    1 
ATOM   4704 C  CG    . ASP C 3  498 ? 70.674 192.943 16.131 1.00 32.43  ? 504  ASP A CG    1 
ATOM   4705 O  OD1   . ASP C 3  498 ? 69.549 193.479 16.177 1.00 32.85  ? 504  ASP A OD1   1 
ATOM   4706 O  OD2   . ASP C 3  498 ? 70.987 191.940 16.813 1.00 33.00  ? 504  ASP A OD2   1 
ATOM   4707 N  N     . ILE C 3  499 ? 72.149 195.274 18.093 1.00 24.74  ? 505  ILE A N     1 
ATOM   4708 C  CA    . ILE C 3  499 ? 72.701 195.211 19.445 1.00 23.70  ? 505  ILE A CA    1 
ATOM   4709 C  C     . ILE C 3  499 ? 72.922 193.783 19.945 1.00 23.86  ? 505  ILE A C     1 
ATOM   4710 O  O     . ILE C 3  499 ? 73.955 193.488 20.541 1.00 24.53  ? 505  ILE A O     1 
ATOM   4711 C  CB    . ILE C 3  499 ? 71.792 195.965 20.467 1.00 22.12  ? 505  ILE A CB    1 
ATOM   4712 C  CG1   . ILE C 3  499 ? 72.401 195.899 21.874 1.00 19.58  ? 505  ILE A CG1   1 
ATOM   4713 C  CG2   . ILE C 3  499 ? 70.392 195.368 20.470 1.00 19.03  ? 505  ILE A CG2   1 
ATOM   4714 C  CD1   . ILE C 3  499 ? 73.685 196.693 22.033 1.00 17.29  ? 505  ILE A CD1   1 
ATOM   4715 N  N     . HIS C 3  500 ? 71.965 192.895 19.698 1.00 24.39  ? 506  HIS A N     1 
ATOM   4716 C  CA    . HIS C 3  500 ? 72.095 191.518 20.159 1.00 25.40  ? 506  HIS A CA    1 
ATOM   4717 C  C     . HIS C 3  500 ? 73.192 190.764 19.430 1.00 25.66  ? 506  HIS A C     1 
ATOM   4718 O  O     . HIS C 3  500 ? 73.916 189.987 20.045 1.00 26.01  ? 506  HIS A O     1 
ATOM   4719 C  CB    . HIS C 3  500 ? 70.760 190.773 20.041 1.00 22.68  ? 506  HIS A CB    1 
ATOM   4720 C  CG    . HIS C 3  500 ? 69.701 191.300 20.959 1.00 21.59  ? 506  HIS A CG    1 
ATOM   4721 N  ND1   . HIS C 3  500 ? 69.902 191.448 22.316 1.00 18.31  ? 506  HIS A ND1   1 
ATOM   4722 C  CD2   . HIS C 3  500 ? 68.444 191.742 20.717 1.00 20.76  ? 506  HIS A CD2   1 
ATOM   4723 C  CE1   . HIS C 3  500 ? 68.818 191.961 22.866 1.00 18.53  ? 506  HIS A CE1   1 
ATOM   4724 N  NE2   . HIS C 3  500 ? 67.917 192.150 21.918 1.00 18.11  ? 506  HIS A NE2   1 
ATOM   4725 N  N     . THR C 3  501 ? 73.319 190.982 18.126 1.00 27.93  ? 507  THR A N     1 
ATOM   4726 C  CA    . THR C 3  501 ? 74.374 190.315 17.371 1.00 29.43  ? 507  THR A CA    1 
ATOM   4727 C  C     . THR C 3  501 ? 75.717 190.889 17.810 1.00 30.70  ? 507  THR A C     1 
ATOM   4728 O  O     . THR C 3  501 ? 76.717 190.179 17.876 1.00 31.89  ? 507  THR A O     1 
ATOM   4729 C  CB    . THR C 3  501 ? 74.228 190.533 15.859 1.00 29.71  ? 507  THR A CB    1 
ATOM   4730 O  OG1   . THR C 3  501 ? 73.100 189.797 15.372 1.00 31.40  ? 507  THR A OG1   1 
ATOM   4731 C  CG2   . THR C 3  501 ? 75.478 190.070 15.141 1.00 28.27  ? 507  THR A CG2   1 
ATOM   4732 N  N     . LYS C 3  502 ? 75.733 192.179 18.118 1.00 31.18  ? 508  LYS A N     1 
ATOM   4733 C  CA    . LYS C 3  502 ? 76.959 192.819 18.558 1.00 33.36  ? 508  LYS A CA    1 
ATOM   4734 C  C     . LYS C 3  502 ? 77.384 192.189 19.885 1.00 33.39  ? 508  LYS A C     1 
ATOM   4735 O  O     . LYS C 3  502 ? 78.572 191.969 20.114 1.00 35.45  ? 508  LYS A O     1 
ATOM   4736 C  CB    . LYS C 3  502 ? 76.747 194.331 18.715 1.00 35.17  ? 508  LYS A CB    1 
ATOM   4737 C  CG    . LYS C 3  502 ? 78.022 195.154 18.564 1.00 37.62  ? 508  LYS A CG    1 
ATOM   4738 C  CD    . LYS C 3  502 ? 77.730 196.646 18.365 1.00 40.70  ? 508  LYS A CD    1 
ATOM   4739 C  CE    . LYS C 3  502 ? 77.511 197.362 19.685 1.00 41.59  ? 508  LYS A CE    1 
ATOM   4740 N  NZ    . LYS C 3  502 ? 76.420 196.737 20.474 1.00 45.03  ? 508  LYS A NZ    1 
ATOM   4741 N  N     . ASN C 3  503 ? 76.415 191.886 20.750 1.00 32.93  ? 509  ASN A N     1 
ATOM   4742 C  CA    . ASN C 3  503 ? 76.722 191.268 22.041 1.00 31.39  ? 509  ASN A CA    1 
ATOM   4743 C  C     . ASN C 3  503 ? 77.049 189.792 21.864 1.00 31.68  ? 509  ASN A C     1 
ATOM   4744 O  O     . ASN C 3  503 ? 77.949 189.264 22.517 1.00 31.33  ? 509  ASN A O     1 
ATOM   4745 C  CB    . ASN C 3  503 ? 75.550 191.387 23.020 1.00 28.65  ? 509  ASN A CB    1 
ATOM   4746 C  CG    . ASN C 3  503 ? 75.332 192.800 23.512 1.00 27.14  ? 509  ASN A CG    1 
ATOM   4747 O  OD1   . ASN C 3  503 ? 76.277 193.556 23.714 1.00 28.31  ? 509  ASN A OD1   1 
ATOM   4748 N  ND2   . ASN C 3  503 ? 74.074 193.155 23.733 1.00 28.64  ? 509  ASN A ND2   1 
ATOM   4749 N  N     . GLN C 3  504 ? 76.298 189.131 20.990 1.00 31.67  ? 510  GLN A N     1 
ATOM   4750 C  CA    . GLN C 3  504 ? 76.495 187.717 20.717 1.00 32.31  ? 510  GLN A CA    1 
ATOM   4751 C  C     . GLN C 3  504 ? 77.967 187.448 20.440 1.00 33.66  ? 510  GLN A C     1 
ATOM   4752 O  O     . GLN C 3  504 ? 78.579 186.578 21.059 1.00 33.18  ? 510  GLN A O     1 
ATOM   4753 C  CB    . GLN C 3  504 ? 75.653 187.292 19.511 1.00 31.24  ? 510  GLN A CB    1 
ATOM   4754 C  CG    . GLN C 3  504 ? 76.061 185.955 18.912 1.00 29.87  ? 510  GLN A CG    1 
ATOM   4755 C  CD    . GLN C 3  504 ? 75.198 185.542 17.739 1.00 29.50  ? 510  GLN A CD    1 
ATOM   4756 O  OE1   . GLN C 3  504 ? 74.780 186.372 16.935 1.00 30.32  ? 510  GLN A OE1   1 
ATOM   4757 N  NE2   . GLN C 3  504 ? 74.944 184.248 17.623 1.00 31.05  ? 510  GLN A NE2   1 
ATOM   4758 N  N     . ILE C 3  505 ? 78.527 188.214 19.510 1.00 35.28  ? 511  ILE A N     1 
ATOM   4759 C  CA    . ILE C 3  505 ? 79.926 188.078 19.132 1.00 36.04  ? 511  ILE A CA    1 
ATOM   4760 C  C     . ILE C 3  505 ? 80.844 188.403 20.303 1.00 36.87  ? 511  ILE A C     1 
ATOM   4761 O  O     . ILE C 3  505 ? 81.695 187.601 20.676 1.00 38.83  ? 511  ILE A O     1 
ATOM   4762 C  CB    . ILE C 3  505 ? 80.265 189.014 17.953 1.00 35.88  ? 511  ILE A CB    1 
ATOM   4763 C  CG1   . ILE C 3  505 ? 79.478 188.583 16.715 1.00 36.01  ? 511  ILE A CG1   1 
ATOM   4764 C  CG2   . ILE C 3  505 ? 81.756 188.996 17.679 1.00 34.89  ? 511  ILE A CG2   1 
ATOM   4765 C  CD1   . ILE C 3  505 ? 79.643 189.507 15.533 1.00 36.03  ? 511  ILE A CD1   1 
ATOM   4766 N  N     . ALA C 3  506 ? 80.662 189.581 20.886 1.00 36.87  ? 512  ALA A N     1 
ATOM   4767 C  CA    . ALA C 3  506 ? 81.489 190.011 22.004 1.00 37.23  ? 512  ALA A CA    1 
ATOM   4768 C  C     . ALA C 3  506 ? 81.468 189.026 23.165 1.00 38.00  ? 512  ALA A C     1 
ATOM   4769 O  O     . ALA C 3  506 ? 82.432 188.936 23.925 1.00 38.95  ? 512  ALA A O     1 
ATOM   4770 C  CB    . ALA C 3  506 ? 81.039 191.385 22.483 1.00 37.45  ? 512  ALA A CB    1 
ATOM   4771 N  N     . ALA C 3  507 ? 80.368 188.294 23.308 1.00 38.42  ? 513  ALA A N     1 
ATOM   4772 C  CA    . ALA C 3  507 ? 80.234 187.331 24.397 1.00 38.18  ? 513  ALA A CA    1 
ATOM   4773 C  C     . ALA C 3  507 ? 80.654 185.945 23.937 1.00 38.59  ? 513  ALA A C     1 
ATOM   4774 O  O     . ALA C 3  507 ? 80.777 185.024 24.744 1.00 37.25  ? 513  ALA A O     1 
ATOM   4775 C  CB    . ALA C 3  507 ? 78.800 187.303 24.893 1.00 38.75  ? 513  ALA A CB    1 
ATOM   4776 N  N     . GLU C 3  508 ? 80.869 185.810 22.632 1.00 38.62  ? 514  GLU A N     1 
ATOM   4777 C  CA    . GLU C 3  508 ? 81.276 184.541 22.046 1.00 39.68  ? 514  GLU A CA    1 
ATOM   4778 C  C     . GLU C 3  508 ? 80.195 183.491 22.275 1.00 38.88  ? 514  GLU A C     1 
ATOM   4779 O  O     . GLU C 3  508 ? 80.463 182.408 22.797 1.00 41.10  ? 514  GLU A O     1 
ATOM   4780 C  CB    . GLU C 3  508 ? 82.601 184.083 22.663 1.00 41.22  ? 514  GLU A CB    1 
ATOM   4781 C  CG    . GLU C 3  508 ? 83.721 185.101 22.521 1.00 43.88  ? 514  GLU A CG    1 
ATOM   4782 C  CD    . GLU C 3  508 ? 85.002 184.670 23.210 1.00 45.14  ? 514  GLU A CD    1 
ATOM   4783 O  OE1   . GLU C 3  508 ? 85.599 183.663 22.775 1.00 47.28  ? 514  GLU A OE1   1 
ATOM   4784 O  OE2   . GLU C 3  508 ? 85.410 185.336 24.187 1.00 44.74  ? 514  GLU A OE2   1 
ATOM   4785 N  N     . LEU C 3  509 ? 78.972 183.824 21.878 1.00 36.89  ? 515  LEU A N     1 
ATOM   4786 C  CA    . LEU C 3  509 ? 77.841 182.927 22.035 1.00 34.95  ? 515  LEU A CA    1 
ATOM   4787 C  C     . LEU C 3  509 ? 77.423 182.372 20.677 1.00 35.52  ? 515  LEU A C     1 
ATOM   4788 O  O     . LEU C 3  509 ? 77.593 183.029 19.650 1.00 35.32  ? 515  LEU A O     1 
ATOM   4789 C  CB    . LEU C 3  509 ? 76.685 183.673 22.700 1.00 34.39  ? 515  LEU A CB    1 
ATOM   4790 C  CG    . LEU C 3  509 ? 77.046 184.216 24.086 1.00 31.96  ? 515  LEU A CG    1 
ATOM   4791 C  CD1   . LEU C 3  509 ? 75.915 185.071 24.621 1.00 30.39  ? 515  LEU A CD1   1 
ATOM   4792 C  CD2   . LEU C 3  509 ? 77.341 183.056 25.022 1.00 30.26  ? 515  LEU A CD2   1 
ATOM   4793 N  N     . PRO C 3  510 ? 76.866 181.151 20.660 1.00 35.25  ? 516  PRO A N     1 
ATOM   4794 C  CA    . PRO C 3  510 ? 76.418 180.467 19.443 1.00 34.82  ? 516  PRO A CA    1 
ATOM   4795 C  C     . PRO C 3  510 ? 75.295 181.120 18.650 1.00 35.39  ? 516  PRO A C     1 
ATOM   4796 O  O     . PRO C 3  510 ? 75.427 181.323 17.446 1.00 36.02  ? 516  PRO A O     1 
ATOM   4797 C  CB    . PRO C 3  510 ? 76.036 179.078 19.954 1.00 34.79  ? 516  PRO A CB    1 
ATOM   4798 C  CG    . PRO C 3  510 ? 75.538 179.358 21.333 1.00 35.34  ? 516  PRO A CG    1 
ATOM   4799 C  CD    . PRO C 3  510 ? 76.575 180.333 21.852 1.00 35.39  ? 516  PRO A CD    1 
ATOM   4800 N  N     . THR C 3  511 ? 74.186 181.439 19.309 1.00 34.82  ? 517  THR A N     1 
ATOM   4801 C  CA    . THR C 3  511 ? 73.059 182.051 18.613 1.00 34.63  ? 517  THR A CA    1 
ATOM   4802 C  C     . THR C 3  511 ? 72.749 183.464 19.085 1.00 34.00  ? 517  THR A C     1 
ATOM   4803 O  O     . THR C 3  511 ? 73.228 183.902 20.131 1.00 33.58  ? 517  THR A O     1 
ATOM   4804 C  CB    . THR C 3  511 ? 71.789 181.211 18.776 1.00 34.83  ? 517  THR A CB    1 
ATOM   4805 O  OG1   . THR C 3  511 ? 71.586 180.928 20.166 1.00 36.68  ? 517  THR A OG1   1 
ATOM   4806 C  CG2   . THR C 3  511 ? 71.907 179.908 18.001 1.00 34.30  ? 517  THR A CG2   1 
ATOM   4807 N  N     . ARG C 3  512 ? 71.955 184.178 18.293 1.00 33.32  ? 518  ARG A N     1 
ATOM   4808 C  CA    . ARG C 3  512 ? 71.552 185.536 18.634 1.00 30.91  ? 518  ARG A CA    1 
ATOM   4809 C  C     . ARG C 3  512 ? 70.555 185.420 19.780 1.00 30.97  ? 518  ARG A C     1 
ATOM   4810 O  O     . ARG C 3  512 ? 70.538 186.255 20.684 1.00 31.08  ? 518  ARG A O     1 
ATOM   4811 C  CB    . ARG C 3  512 ? 70.900 186.215 17.427 1.00 29.71  ? 518  ARG A CB    1 
ATOM   4812 C  CG    . ARG C 3  512 ? 70.410 187.634 17.690 1.00 27.54  ? 518  ARG A CG    1 
ATOM   4813 C  CD    . ARG C 3  512 ? 69.943 188.310 16.401 1.00 24.22  ? 518  ARG A CD    1 
ATOM   4814 N  NE    . ARG C 3  512 ? 69.461 189.669 16.638 1.00 24.22  ? 518  ARG A NE    1 
ATOM   4815 C  CZ    . ARG C 3  512 ? 68.300 189.961 17.220 1.00 23.35  ? 518  ARG A CZ    1 
ATOM   4816 N  NH1   . ARG C 3  512 ? 67.491 188.987 17.621 1.00 23.45  ? 518  ARG A NH1   1 
ATOM   4817 N  NH2   . ARG C 3  512 ? 67.956 191.225 17.420 1.00 20.52  ? 518  ARG A NH2   1 
ATOM   4818 N  N     . ASP C 3  513 ? 69.733 184.372 19.741 1.00 30.26  ? 519  ASP A N     1 
ATOM   4819 C  CA    . ASP C 3  513 ? 68.749 184.145 20.794 1.00 30.83  ? 519  ASP A CA    1 
ATOM   4820 C  C     . ASP C 3  513 ? 69.459 183.969 22.127 1.00 29.43  ? 519  ASP A C     1 
ATOM   4821 O  O     . ASP C 3  513 ? 69.010 184.469 23.155 1.00 28.02  ? 519  ASP A O     1 
ATOM   4822 C  CB    . ASP C 3  513 ? 67.908 182.894 20.514 1.00 32.66  ? 519  ASP A CB    1 
ATOM   4823 C  CG    . ASP C 3  513 ? 66.839 183.122 19.459 1.00 35.74  ? 519  ASP A CG    1 
ATOM   4824 O  OD1   . ASP C 3  513 ? 66.216 184.211 19.448 1.00 36.74  ? 519  ASP A OD1   1 
ATOM   4825 O  OD2   . ASP C 3  513 ? 66.606 182.196 18.652 1.00 38.68  ? 519  ASP A OD2   1 
ATOM   4826 N  N     . ASN C 3  514 ? 70.574 183.251 22.105 1.00 28.09  ? 520  ASN A N     1 
ATOM   4827 C  CA    . ASN C 3  514 ? 71.326 183.023 23.325 1.00 28.20  ? 520  ASN A CA    1 
ATOM   4828 C  C     . ASN C 3  514 ? 71.836 184.357 23.868 1.00 27.17  ? 520  ASN A C     1 
ATOM   4829 O  O     . ASN C 3  514 ? 71.889 184.565 25.083 1.00 26.51  ? 520  ASN A O     1 
ATOM   4830 C  CB    . ASN C 3  514 ? 72.512 182.091 23.058 1.00 29.43  ? 520  ASN A CB    1 
ATOM   4831 C  CG    . ASN C 3  514 ? 73.176 181.615 24.339 1.00 30.20  ? 520  ASN A CG    1 
ATOM   4832 O  OD1   . ASN C 3  514 ? 74.403 181.549 24.432 1.00 30.32  ? 520  ASN A OD1   1 
ATOM   4833 N  ND2   . ASN C 3  514 ? 72.361 181.271 25.334 1.00 29.92  ? 520  ASN A ND2   1 
ATOM   4834 N  N     . ALA C 3  515 ? 72.211 185.259 22.963 1.00 25.97  ? 521  ALA A N     1 
ATOM   4835 C  CA    . ALA C 3  515 ? 72.717 186.564 23.368 1.00 24.03  ? 521  ALA A CA    1 
ATOM   4836 C  C     . ALA C 3  515 ? 71.613 187.342 24.073 1.00 22.69  ? 521  ALA A C     1 
ATOM   4837 O  O     . ALA C 3  515 ? 71.872 188.084 25.018 1.00 23.87  ? 521  ALA A O     1 
ATOM   4838 C  CB    . ALA C 3  515 ? 73.229 187.338 22.157 1.00 22.28  ? 521  ALA A CB    1 
ATOM   4839 N  N     . LYS C 3  516 ? 70.378 187.149 23.623 1.00 21.35  ? 522  LYS A N     1 
ATOM   4840 C  CA    . LYS C 3  516 ? 69.233 187.830 24.216 1.00 21.05  ? 522  LYS A CA    1 
ATOM   4841 C  C     . LYS C 3  516 ? 68.906 187.330 25.618 1.00 20.67  ? 522  LYS A C     1 
ATOM   4842 O  O     . LYS C 3  516 ? 68.725 188.135 26.533 1.00 21.91  ? 522  LYS A O     1 
ATOM   4843 C  CB    . LYS C 3  516 ? 68.007 187.680 23.313 1.00 19.72  ? 522  LYS A CB    1 
ATOM   4844 C  CG    . LYS C 3  516 ? 68.122 188.453 22.020 1.00 18.29  ? 522  LYS A CG    1 
ATOM   4845 C  CD    . LYS C 3  516 ? 67.190 187.912 20.957 1.00 22.21  ? 522  LYS A CD    1 
ATOM   4846 C  CE    . LYS C 3  516 ? 65.731 188.148 21.284 1.00 22.71  ? 522  LYS A CE    1 
ATOM   4847 N  NZ    . LYS C 3  516 ? 64.878 187.766 20.126 1.00 22.00  ? 522  LYS A NZ    1 
ATOM   4848 N  N     . THR C 3  517 ? 68.838 186.014 25.802 1.00 19.55  ? 523  THR A N     1 
ATOM   4849 C  CA    . THR C 3  517 ? 68.519 185.484 27.122 1.00 18.28  ? 523  THR A CA    1 
ATOM   4850 C  C     . THR C 3  517 ? 69.653 185.788 28.096 1.00 19.39  ? 523  THR A C     1 
ATOM   4851 O  O     . THR C 3  517 ? 69.441 185.894 29.307 1.00 19.88  ? 523  THR A O     1 
ATOM   4852 C  CB    . THR C 3  517 ? 68.217 183.952 27.095 1.00 16.81  ? 523  THR A CB    1 
ATOM   4853 O  OG1   . THR C 3  517 ? 69.082 183.278 28.011 1.00 19.03  ? 523  THR A OG1   1 
ATOM   4854 C  CG2   . THR C 3  517 ? 68.378 183.372 25.697 1.00 13.65  ? 523  THR A CG2   1 
ATOM   4855 N  N     . PHE C 3  518 ? 70.856 185.947 27.556 1.00 19.30  ? 524  PHE A N     1 
ATOM   4856 C  CA    . PHE C 3  518 ? 72.019 186.275 28.369 1.00 19.29  ? 524  PHE A CA    1 
ATOM   4857 C  C     . PHE C 3  518 ? 71.982 187.726 28.845 1.00 19.41  ? 524  PHE A C     1 
ATOM   4858 O  O     . PHE C 3  518 ? 72.077 188.004 30.037 1.00 20.28  ? 524  PHE A O     1 
ATOM   4859 C  CB    . PHE C 3  518 ? 73.311 186.086 27.570 1.00 20.09  ? 524  PHE A CB    1 
ATOM   4860 C  CG    . PHE C 3  518 ? 74.476 186.869 28.123 1.00 21.69  ? 524  PHE A CG    1 
ATOM   4861 C  CD1   . PHE C 3  518 ? 75.110 186.467 29.297 1.00 21.74  ? 524  PHE A CD1   1 
ATOM   4862 C  CD2   . PHE C 3  518 ? 74.901 188.044 27.501 1.00 22.73  ? 524  PHE A CD2   1 
ATOM   4863 C  CE1   . PHE C 3  518 ? 76.147 187.219 29.848 1.00 20.71  ? 524  PHE A CE1   1 
ATOM   4864 C  CE2   . PHE C 3  518 ? 75.939 188.810 28.045 1.00 22.90  ? 524  PHE A CE2   1 
ATOM   4865 C  CZ    . PHE C 3  518 ? 76.564 188.394 29.223 1.00 23.16  ? 524  PHE A CZ    1 
ATOM   4866 N  N     . ILE C 3  519 ? 71.860 188.654 27.901 1.00 18.89  ? 525  ILE A N     1 
ATOM   4867 C  CA    . ILE C 3  519 ? 71.875 190.070 28.245 1.00 18.96  ? 525  ILE A CA    1 
ATOM   4868 C  C     . ILE C 3  519 ? 70.761 190.458 29.208 1.00 18.66  ? 525  ILE A C     1 
ATOM   4869 O  O     . ILE C 3  519 ? 70.995 191.212 30.154 1.00 19.11  ? 525  ILE A O     1 
ATOM   4870 C  CB    . ILE C 3  519 ? 71.807 190.960 26.981 1.00 18.05  ? 525  ILE A CB    1 
ATOM   4871 C  CG1   . ILE C 3  519 ? 72.318 192.364 27.313 1.00 19.23  ? 525  ILE A CG1   1 
ATOM   4872 C  CG2   . ILE C 3  519 ? 70.386 191.022 26.450 1.00 18.48  ? 525  ILE A CG2   1 
ATOM   4873 C  CD1   . ILE C 3  519 ? 73.816 192.430 27.620 1.00 15.24  ? 525  ILE A CD1   1 
ATOM   4874 N  N     . TYR C 3  520 ? 69.561 189.931 28.983 1.00 16.89  ? 526  TYR A N     1 
ATOM   4875 C  CA    . TYR C 3  520 ? 68.441 190.237 29.850 1.00 17.13  ? 526  TYR A CA    1 
ATOM   4876 C  C     . TYR C 3  520 ? 68.538 189.532 31.191 1.00 18.07  ? 526  TYR A C     1 
ATOM   4877 O  O     . TYR C 3  520 ? 68.140 190.085 32.209 1.00 20.55  ? 526  TYR A O     1 
ATOM   4878 C  CB    . TYR C 3  520 ? 67.123 189.913 29.145 1.00 16.16  ? 526  TYR A CB    1 
ATOM   4879 C  CG    . TYR C 3  520 ? 66.790 190.937 28.078 1.00 16.35  ? 526  TYR A CG    1 
ATOM   4880 C  CD1   . TYR C 3  520 ? 66.683 192.286 28.403 1.00 14.66  ? 526  TYR A CD1   1 
ATOM   4881 C  CD2   . TYR C 3  520 ? 66.627 190.568 26.741 1.00 15.96  ? 526  TYR A CD2   1 
ATOM   4882 C  CE1   . TYR C 3  520 ? 66.426 193.249 27.433 1.00 13.43  ? 526  TYR A CE1   1 
ATOM   4883 C  CE2   . TYR C 3  520 ? 66.370 191.525 25.757 1.00 14.19  ? 526  TYR A CE2   1 
ATOM   4884 C  CZ    . TYR C 3  520 ? 66.270 192.867 26.114 1.00 13.94  ? 526  TYR A CZ    1 
ATOM   4885 O  OH    . TYR C 3  520 ? 66.001 193.829 25.163 1.00 9.90   ? 526  TYR A OH    1 
ATOM   4886 N  N     . GLY C 3  521 ? 69.072 188.316 31.205 1.00 19.86  ? 527  GLY A N     1 
ATOM   4887 C  CA    . GLY C 3  521 ? 69.219 187.613 32.468 1.00 18.45  ? 527  GLY A CA    1 
ATOM   4888 C  C     . GLY C 3  521 ? 70.272 188.360 33.270 1.00 18.26  ? 527  GLY A C     1 
ATOM   4889 O  O     . GLY C 3  521 ? 70.178 188.505 34.490 1.00 18.73  ? 527  GLY A O     1 
ATOM   4890 N  N     . PHE C 3  522 ? 71.286 188.841 32.562 1.00 17.45  ? 528  PHE A N     1 
ATOM   4891 C  CA    . PHE C 3  522 ? 72.367 189.592 33.175 1.00 18.07  ? 528  PHE A CA    1 
ATOM   4892 C  C     . PHE C 3  522 ? 71.834 190.925 33.681 1.00 19.35  ? 528  PHE A C     1 
ATOM   4893 O  O     . PHE C 3  522 ? 71.947 191.251 34.867 1.00 18.66  ? 528  PHE A O     1 
ATOM   4894 C  CB    . PHE C 3  522 ? 73.479 189.841 32.149 1.00 17.85  ? 528  PHE A CB    1 
ATOM   4895 C  CG    . PHE C 3  522 ? 74.264 191.100 32.398 1.00 15.43  ? 528  PHE A CG    1 
ATOM   4896 C  CD1   . PHE C 3  522 ? 75.135 191.193 33.473 1.00 17.97  ? 528  PHE A CD1   1 
ATOM   4897 C  CD2   . PHE C 3  522 ? 74.106 192.202 31.573 1.00 15.73  ? 528  PHE A CD2   1 
ATOM   4898 C  CE1   . PHE C 3  522 ? 75.838 192.368 33.724 1.00 18.43  ? 528  PHE A CE1   1 
ATOM   4899 C  CE2   . PHE C 3  522 ? 74.802 193.383 31.813 1.00 17.88  ? 528  PHE A CE2   1 
ATOM   4900 C  CZ    . PHE C 3  522 ? 75.671 193.466 32.892 1.00 16.73  ? 528  PHE A CZ    1 
ATOM   4901 N  N     . LEU C 3  523 ? 71.244 191.691 32.770 1.00 19.21  ? 529  LEU A N     1 
ATOM   4902 C  CA    . LEU C 3  523 ? 70.711 192.995 33.116 1.00 21.43  ? 529  LEU A CA    1 
ATOM   4903 C  C     . LEU C 3  523 ? 69.747 192.953 34.308 1.00 22.67  ? 529  LEU A C     1 
ATOM   4904 O  O     . LEU C 3  523 ? 69.754 193.861 35.140 1.00 22.83  ? 529  LEU A O     1 
ATOM   4905 C  CB    . LEU C 3  523 ? 70.006 193.609 31.907 1.00 22.48  ? 529  LEU A CB    1 
ATOM   4906 C  CG    . LEU C 3  523 ? 69.525 195.049 32.086 1.00 22.50  ? 529  LEU A CG    1 
ATOM   4907 C  CD1   . LEU C 3  523 ? 70.735 195.963 32.200 1.00 22.52  ? 529  LEU A CD1   1 
ATOM   4908 C  CD2   . LEU C 3  523 ? 68.666 195.460 30.902 1.00 23.37  ? 529  LEU A CD2   1 
ATOM   4909 N  N     . TYR C 3  524 ? 68.939 191.896 34.405 1.00 21.45  ? 530  TYR A N     1 
ATOM   4910 C  CA    . TYR C 3  524 ? 67.964 191.799 35.485 1.00 21.09  ? 530  TYR A CA    1 
ATOM   4911 C  C     . TYR C 3  524 ? 68.366 191.126 36.806 1.00 22.72  ? 530  TYR A C     1 
ATOM   4912 O  O     . TYR C 3  524 ? 67.504 190.876 37.658 1.00 20.78  ? 530  TYR A O     1 
ATOM   4913 C  CB    . TYR C 3  524 ? 66.663 191.186 34.950 1.00 19.31  ? 530  TYR A CB    1 
ATOM   4914 C  CG    . TYR C 3  524 ? 65.998 192.066 33.914 1.00 19.38  ? 530  TYR A CG    1 
ATOM   4915 C  CD1   . TYR C 3  524 ? 65.970 193.449 34.073 1.00 18.69  ? 530  TYR A CD1   1 
ATOM   4916 C  CD2   . TYR C 3  524 ? 65.435 191.528 32.763 1.00 19.43  ? 530  TYR A CD2   1 
ATOM   4917 C  CE1   . TYR C 3  524 ? 65.411 194.273 33.113 1.00 19.89  ? 530  TYR A CE1   1 
ATOM   4918 C  CE2   . TYR C 3  524 ? 64.867 192.349 31.789 1.00 19.07  ? 530  TYR A CE2   1 
ATOM   4919 C  CZ    . TYR C 3  524 ? 64.865 193.718 31.969 1.00 19.85  ? 530  TYR A CZ    1 
ATOM   4920 O  OH    . TYR C 3  524 ? 64.354 194.540 30.993 1.00 19.21  ? 530  TYR A OH    1 
ATOM   4921 N  N     . GLY C 3  525 ? 69.656 190.827 36.978 1.00 23.56  ? 531  GLY A N     1 
ATOM   4922 C  CA    . GLY C 3  525 ? 70.112 190.264 38.241 1.00 24.08  ? 531  GLY A CA    1 
ATOM   4923 C  C     . GLY C 3  525 ? 70.521 188.810 38.368 1.00 26.05  ? 531  GLY A C     1 
ATOM   4924 O  O     . GLY C 3  525 ? 70.636 188.303 39.487 1.00 24.71  ? 531  GLY A O     1 
ATOM   4925 N  N     . ALA C 3  526 ? 70.744 188.134 37.245 1.00 26.72  ? 532  ALA A N     1 
ATOM   4926 C  CA    . ALA C 3  526 ? 71.156 186.739 37.280 1.00 26.33  ? 532  ALA A CA    1 
ATOM   4927 C  C     . ALA C 3  526 ? 72.492 186.604 38.016 1.00 27.85  ? 532  ALA A C     1 
ATOM   4928 O  O     . ALA C 3  526 ? 73.364 187.468 37.906 1.00 27.57  ? 532  ALA A O     1 
ATOM   4929 C  CB    . ALA C 3  526 ? 71.282 186.206 35.870 1.00 24.15  ? 532  ALA A CB    1 
ATOM   4930 N  N     . GLY C 3  527 ? 72.646 185.522 38.773 1.00 29.05  ? 533  GLY A N     1 
ATOM   4931 C  CA    . GLY C 3  527 ? 73.885 185.302 39.502 1.00 30.10  ? 533  GLY A CA    1 
ATOM   4932 C  C     . GLY C 3  527 ? 74.956 184.754 38.581 1.00 30.26  ? 533  GLY A C     1 
ATOM   4933 O  O     . GLY C 3  527 ? 74.667 184.427 37.428 1.00 29.73  ? 533  GLY A O     1 
ATOM   4934 N  N     . ASP C 3  528 ? 76.186 184.644 39.074 1.00 31.54  ? 534  ASP A N     1 
ATOM   4935 C  CA    . ASP C 3  528 ? 77.285 184.138 38.252 1.00 32.30  ? 534  ASP A CA    1 
ATOM   4936 C  C     . ASP C 3  528 ? 76.967 182.779 37.640 1.00 31.92  ? 534  ASP A C     1 
ATOM   4937 O  O     . ASP C 3  528 ? 77.208 182.547 36.455 1.00 32.19  ? 534  ASP A O     1 
ATOM   4938 C  CB    . ASP C 3  528 ? 78.580 184.040 39.069 1.00 33.73  ? 534  ASP A CB    1 
ATOM   4939 C  CG    . ASP C 3  528 ? 79.135 185.401 39.467 1.00 35.66  ? 534  ASP A CG    1 
ATOM   4940 O  OD1   . ASP C 3  528 ? 79.191 186.305 38.610 1.00 37.84  ? 534  ASP A OD1   1 
ATOM   4941 O  OD2   . ASP C 3  528 ? 79.540 185.569 40.636 1.00 38.35  ? 534  ASP A OD2   1 
ATOM   4942 N  N     . GLU C 3  529 ? 76.413 181.880 38.445 1.00 32.91  ? 535  GLU A N     1 
ATOM   4943 C  CA    . GLU C 3  529 ? 76.077 180.549 37.956 1.00 34.50  ? 535  GLU A CA    1 
ATOM   4944 C  C     . GLU C 3  529 ? 74.921 180.567 36.949 1.00 32.67  ? 535  GLU A C     1 
ATOM   4945 O  O     . GLU C 3  529 ? 74.960 179.869 35.935 1.00 31.97  ? 535  GLU A O     1 
ATOM   4946 C  CB    . GLU C 3  529 ? 75.738 179.624 39.127 1.00 36.74  ? 535  GLU A CB    1 
ATOM   4947 C  CG    . GLU C 3  529 ? 75.537 178.180 38.699 1.00 44.84  ? 535  GLU A CG    1 
ATOM   4948 C  CD    . GLU C 3  529 ? 75.169 177.267 39.851 1.00 49.22  ? 535  GLU A CD    1 
ATOM   4949 O  OE1   . GLU C 3  529 ? 76.034 177.025 40.725 1.00 51.02  ? 535  GLU A OE1   1 
ATOM   4950 O  OE2   . GLU C 3  529 ? 74.010 176.796 39.881 1.00 51.91  ? 535  GLU A OE2   1 
ATOM   4951 N  N     . LYS C 3  530 ? 73.892 181.360 37.224 1.00 31.50  ? 536  LYS A N     1 
ATOM   4952 C  CA    . LYS C 3  530 ? 72.766 181.435 36.305 1.00 30.52  ? 536  LYS A CA    1 
ATOM   4953 C  C     . LYS C 3  530 ? 73.293 181.899 34.950 1.00 29.27  ? 536  LYS A C     1 
ATOM   4954 O  O     . LYS C 3  530 ? 72.903 181.369 33.909 1.00 29.28  ? 536  LYS A O     1 
ATOM   4955 C  CB    . LYS C 3  530 ? 71.703 182.410 36.822 1.00 31.79  ? 536  LYS A CB    1 
ATOM   4956 C  CG    . LYS C 3  530 ? 70.387 182.333 36.066 1.00 32.82  ? 536  LYS A CG    1 
ATOM   4957 C  CD    . LYS C 3  530 ? 69.665 181.036 36.382 1.00 35.83  ? 536  LYS A CD    1 
ATOM   4958 C  CE    . LYS C 3  530 ? 69.122 180.365 35.127 1.00 38.46  ? 536  LYS A CE    1 
ATOM   4959 N  NZ    . LYS C 3  530 ? 68.093 181.176 34.415 1.00 43.53  ? 536  LYS A NZ    1 
ATOM   4960 N  N     . ILE C 3  531 ? 74.188 182.883 34.965 1.00 28.90  ? 537  ILE A N     1 
ATOM   4961 C  CA    . ILE C 3  531 ? 74.764 183.386 33.719 1.00 29.22  ? 537  ILE A CA    1 
ATOM   4962 C  C     . ILE C 3  531 ? 75.521 182.252 33.034 1.00 29.82  ? 537  ILE A C     1 
ATOM   4963 O  O     . ILE C 3  531 ? 75.556 182.162 31.807 1.00 29.97  ? 537  ILE A O     1 
ATOM   4964 C  CB    . ILE C 3  531 ? 75.738 184.558 33.968 1.00 28.01  ? 537  ILE A CB    1 
ATOM   4965 C  CG1   . ILE C 3  531 ? 74.979 185.765 34.524 1.00 28.54  ? 537  ILE A CG1   1 
ATOM   4966 C  CG2   . ILE C 3  531 ? 76.427 184.946 32.673 1.00 26.48  ? 537  ILE A CG2   1 
ATOM   4967 C  CD1   . ILE C 3  531 ? 73.912 186.298 33.589 1.00 28.25  ? 537  ILE A CD1   1 
ATOM   4968 N  N     . GLY C 3  532 ? 76.122 181.382 33.837 1.00 30.32  ? 538  GLY A N     1 
ATOM   4969 C  CA    . GLY C 3  532 ? 76.855 180.262 33.281 1.00 30.42  ? 538  GLY A CA    1 
ATOM   4970 C  C     . GLY C 3  532 ? 75.919 179.305 32.574 1.00 30.69  ? 538  GLY A C     1 
ATOM   4971 O  O     . GLY C 3  532 ? 76.137 178.944 31.412 1.00 30.49  ? 538  GLY A O     1 
ATOM   4972 N  N     . GLN C 3  533 ? 74.867 178.901 33.277 1.00 30.12  ? 539  GLN A N     1 
ATOM   4973 C  CA    . GLN C 3  533 ? 73.891 177.980 32.721 1.00 31.46  ? 539  GLN A CA    1 
ATOM   4974 C  C     . GLN C 3  533 ? 73.373 178.482 31.380 1.00 32.14  ? 539  GLN A C     1 
ATOM   4975 O  O     . GLN C 3  533 ? 73.358 177.744 30.394 1.00 32.52  ? 539  GLN A O     1 
ATOM   4976 C  CB    . GLN C 3  533 ? 72.719 177.810 33.685 1.00 33.64  ? 539  GLN A CB    1 
ATOM   4977 C  CG    . GLN C 3  533 ? 71.618 176.930 33.138 1.00 37.10  ? 539  GLN A CG    1 
ATOM   4978 C  CD    . GLN C 3  533 ? 70.392 176.923 34.019 1.00 40.90  ? 539  GLN A CD    1 
ATOM   4979 O  OE1   . GLN C 3  533 ? 70.444 176.492 35.175 1.00 41.08  ? 539  GLN A OE1   1 
ATOM   4980 N  NE2   . GLN C 3  533 ? 69.273 177.409 33.481 1.00 42.50  ? 539  GLN A NE2   1 
ATOM   4981 N  N     . ILE C 3  534 ? 72.948 179.744 31.359 1.00 31.42  ? 540  ILE A N     1 
ATOM   4982 C  CA    . ILE C 3  534 ? 72.417 180.372 30.156 1.00 29.70  ? 540  ILE A CA    1 
ATOM   4983 C  C     . ILE C 3  534 ? 73.379 180.283 28.972 1.00 29.77  ? 540  ILE A C     1 
ATOM   4984 O  O     . ILE C 3  534 ? 72.965 180.032 27.841 1.00 26.70  ? 540  ILE A O     1 
ATOM   4985 C  CB    . ILE C 3  534 ? 72.083 181.866 30.425 1.00 28.82  ? 540  ILE A CB    1 
ATOM   4986 C  CG1   . ILE C 3  534 ? 70.862 181.961 31.338 1.00 28.60  ? 540  ILE A CG1   1 
ATOM   4987 C  CG2   . ILE C 3  534 ? 71.845 182.606 29.118 1.00 27.93  ? 540  ILE A CG2   1 
ATOM   4988 C  CD1   . ILE C 3  534 ? 70.402 183.369 31.595 1.00 28.71  ? 540  ILE A CD1   1 
ATOM   4989 N  N     . VAL C 3  535 ? 74.664 180.489 29.239 1.00 31.38  ? 541  VAL A N     1 
ATOM   4990 C  CA    . VAL C 3  535 ? 75.671 180.449 28.187 1.00 32.90  ? 541  VAL A CA    1 
ATOM   4991 C  C     . VAL C 3  535 ? 76.327 179.072 28.069 1.00 34.33  ? 541  VAL A C     1 
ATOM   4992 O  O     . VAL C 3  535 ? 77.271 178.885 27.309 1.00 33.74  ? 541  VAL A O     1 
ATOM   4993 C  CB    . VAL C 3  535 ? 76.755 181.526 28.431 1.00 31.87  ? 541  VAL A CB    1 
ATOM   4994 C  CG1   . VAL C 3  535 ? 76.101 182.893 28.541 1.00 31.19  ? 541  VAL A CG1   1 
ATOM   4995 C  CG2   . VAL C 3  535 ? 77.537 181.214 29.700 1.00 30.77  ? 541  VAL A CG2   1 
ATOM   4996 N  N     . GLY C 3  536 ? 75.814 178.107 28.823 1.00 36.80  ? 542  GLY A N     1 
ATOM   4997 C  CA    . GLY C 3  536 ? 76.363 176.764 28.779 1.00 38.18  ? 542  GLY A CA    1 
ATOM   4998 C  C     . GLY C 3  536 ? 77.774 176.659 29.326 1.00 39.09  ? 542  GLY A C     1 
ATOM   4999 O  O     . GLY C 3  536 ? 78.635 176.037 28.708 1.00 40.77  ? 542  GLY A O     1 
ATOM   5000 N  N     . ALA C 3  537 ? 78.018 177.265 30.483 1.00 38.94  ? 543  ALA A N     1 
ATOM   5001 C  CA    . ALA C 3  537 ? 79.339 177.223 31.105 1.00 38.05  ? 543  ALA A CA    1 
ATOM   5002 C  C     . ALA C 3  537 ? 79.197 177.230 32.621 1.00 38.29  ? 543  ALA A C     1 
ATOM   5003 O  O     . ALA C 3  537 ? 78.116 176.965 33.146 1.00 37.88  ? 543  ALA A O     1 
ATOM   5004 C  CB    . ALA C 3  537 ? 80.177 178.406 30.647 1.00 35.26  ? 543  ALA A CB    1 
ATOM   5005 N  N     . GLY C 3  538 ? 80.282 177.539 33.322 1.00 39.41  ? 544  GLY A N     1 
ATOM   5006 C  CA    . GLY C 3  538 ? 80.235 177.550 34.774 1.00 41.08  ? 544  GLY A CA    1 
ATOM   5007 C  C     . GLY C 3  538 ? 80.214 178.929 35.399 1.00 42.68  ? 544  GLY A C     1 
ATOM   5008 O  O     . GLY C 3  538 ? 80.329 179.941 34.704 1.00 43.43  ? 544  GLY A O     1 
ATOM   5009 N  N     . LYS C 3  539 ? 80.074 178.968 36.721 1.00 43.49  ? 545  LYS A N     1 
ATOM   5010 C  CA    . LYS C 3  539 ? 80.030 180.226 37.449 1.00 44.70  ? 545  LYS A CA    1 
ATOM   5011 C  C     . LYS C 3  539 ? 81.216 181.108 37.096 1.00 45.26  ? 545  LYS A C     1 
ATOM   5012 O  O     . LYS C 3  539 ? 81.109 182.333 37.097 1.00 45.87  ? 545  LYS A O     1 
ATOM   5013 C  CB    . LYS C 3  539 ? 80.016 179.967 38.956 1.00 45.67  ? 545  LYS A CB    1 
ATOM   5014 C  CG    . LYS C 3  539 ? 81.219 179.202 39.453 1.00 48.94  ? 545  LYS A CG    1 
ATOM   5015 C  CD    . LYS C 3  539 ? 81.223 179.084 40.968 1.00 52.62  ? 545  LYS A CD    1 
ATOM   5016 C  CE    . LYS C 3  539 ? 82.457 178.322 41.459 1.00 55.59  ? 545  LYS A CE    1 
ATOM   5017 N  NZ    . LYS C 3  539 ? 83.743 178.964 41.026 1.00 56.51  ? 545  LYS A NZ    1 
ATOM   5018 N  N     . GLU C 3  540 ? 82.347 180.480 36.795 1.00 46.00  ? 546  GLU A N     1 
ATOM   5019 C  CA    . GLU C 3  540 ? 83.554 181.218 36.452 1.00 47.45  ? 546  GLU A CA    1 
ATOM   5020 C  C     . GLU C 3  540 ? 83.320 182.071 35.211 1.00 45.90  ? 546  GLU A C     1 
ATOM   5021 O  O     . GLU C 3  540 ? 83.626 183.261 35.193 1.00 46.43  ? 546  GLU A O     1 
ATOM   5022 C  CB    . GLU C 3  540 ? 84.724 180.257 36.199 1.00 50.40  ? 546  GLU A CB    1 
ATOM   5023 C  CG    . GLU C 3  540 ? 85.062 179.318 37.360 1.00 54.87  ? 546  GLU A CG    1 
ATOM   5024 C  CD    . GLU C 3  540 ? 84.189 178.067 37.395 1.00 57.73  ? 546  GLU A CD    1 
ATOM   5025 O  OE1   . GLU C 3  540 ? 84.056 177.404 36.343 1.00 59.24  ? 546  GLU A OE1   1 
ATOM   5026 O  OE2   . GLU C 3  540 ? 83.648 177.735 38.475 1.00 58.74  ? 546  GLU A OE2   1 
ATOM   5027 N  N     . ARG C 3  541 ? 82.775 181.451 34.172 1.00 45.04  ? 547  ARG A N     1 
ATOM   5028 C  CA    . ARG C 3  541 ? 82.494 182.141 32.922 1.00 44.52  ? 547  ARG A CA    1 
ATOM   5029 C  C     . ARG C 3  541 ? 81.432 183.207 33.166 1.00 44.64  ? 547  ARG A C     1 
ATOM   5030 O  O     . ARG C 3  541 ? 81.379 184.225 32.475 1.00 43.34  ? 547  ARG A O     1 
ATOM   5031 C  CB    . ARG C 3  541 ? 82.007 181.132 31.880 1.00 43.78  ? 547  ARG A CB    1 
ATOM   5032 C  CG    . ARG C 3  541 ? 81.678 181.721 30.524 1.00 45.79  ? 547  ARG A CG    1 
ATOM   5033 C  CD    . ARG C 3  541 ? 82.858 182.474 29.923 1.00 46.74  ? 547  ARG A CD    1 
ATOM   5034 N  NE    . ARG C 3  541 ? 82.536 183.008 28.601 1.00 47.07  ? 547  ARG A NE    1 
ATOM   5035 C  CZ    . ARG C 3  541 ? 83.284 183.893 27.951 1.00 47.95  ? 547  ARG A CZ    1 
ATOM   5036 N  NH1   . ARG C 3  541 ? 84.403 184.350 28.498 1.00 47.91  ? 547  ARG A NH1   1 
ATOM   5037 N  NH2   . ARG C 3  541 ? 82.906 184.331 26.758 1.00 47.85  ? 547  ARG A NH2   1 
ATOM   5038 N  N     . GLY C 3  542 ? 80.593 182.958 34.167 1.00 45.43  ? 548  GLY A N     1 
ATOM   5039 C  CA    . GLY C 3  542 ? 79.536 183.889 34.509 1.00 44.66  ? 548  GLY A CA    1 
ATOM   5040 C  C     . GLY C 3  542 ? 80.094 185.204 35.001 1.00 44.38  ? 548  GLY A C     1 
ATOM   5041 O  O     . GLY C 3  542 ? 79.716 186.262 34.501 1.00 43.74  ? 548  GLY A O     1 
ATOM   5042 N  N     . LYS C 3  543 ? 80.999 185.138 35.976 1.00 44.73  ? 549  LYS A N     1 
ATOM   5043 C  CA    . LYS C 3  543 ? 81.611 186.341 36.533 1.00 44.97  ? 549  LYS A CA    1 
ATOM   5044 C  C     . LYS C 3  543 ? 82.311 187.173 35.469 1.00 44.69  ? 549  LYS A C     1 
ATOM   5045 O  O     . LYS C 3  543 ? 82.270 188.402 35.511 1.00 44.19  ? 549  LYS A O     1 
ATOM   5046 C  CB    . LYS C 3  543 ? 82.623 185.979 37.617 1.00 46.09  ? 549  LYS A CB    1 
ATOM   5047 C  CG    . LYS C 3  543 ? 82.015 185.404 38.872 1.00 48.79  ? 549  LYS A CG    1 
ATOM   5048 C  CD    . LYS C 3  543 ? 83.050 185.278 39.971 1.00 50.71  ? 549  LYS A CD    1 
ATOM   5049 C  CE    . LYS C 3  543 ? 83.665 186.625 40.302 1.00 51.24  ? 549  LYS A CE    1 
ATOM   5050 N  NZ    . LYS C 3  543 ? 84.663 186.497 41.397 1.00 54.82  ? 549  LYS A NZ    1 
ATOM   5051 N  N     . GLU C 3  544 ? 82.961 186.499 34.524 1.00 44.81  ? 550  GLU A N     1 
ATOM   5052 C  CA    . GLU C 3  544 ? 83.671 187.188 33.451 1.00 45.31  ? 550  GLU A CA    1 
ATOM   5053 C  C     . GLU C 3  544 ? 82.721 188.055 32.637 1.00 42.79  ? 550  GLU A C     1 
ATOM   5054 O  O     . GLU C 3  544 ? 82.880 189.275 32.581 1.00 42.53  ? 550  GLU A O     1 
ATOM   5055 C  CB    . GLU C 3  544 ? 84.353 186.182 32.518 1.00 48.27  ? 550  GLU A CB    1 
ATOM   5056 C  CG    . GLU C 3  544 ? 85.441 185.347 33.164 1.00 52.75  ? 550  GLU A CG    1 
ATOM   5057 C  CD    . GLU C 3  544 ? 86.206 184.511 32.150 1.00 55.32  ? 550  GLU A CD    1 
ATOM   5058 O  OE1   . GLU C 3  544 ? 86.823 185.104 31.236 1.00 56.53  ? 550  GLU A OE1   1 
ATOM   5059 O  OE2   . GLU C 3  544 ? 86.190 183.264 32.264 1.00 56.15  ? 550  GLU A OE2   1 
ATOM   5060 N  N     . LEU C 3  545 ? 81.741 187.417 32.003 1.00 39.98  ? 551  LEU A N     1 
ATOM   5061 C  CA    . LEU C 3  545 ? 80.763 188.126 31.186 1.00 39.03  ? 551  LEU A CA    1 
ATOM   5062 C  C     . LEU C 3  545 ? 80.086 189.218 31.997 1.00 37.40  ? 551  LEU A C     1 
ATOM   5063 O  O     . LEU C 3  545 ? 79.779 190.288 31.477 1.00 35.57  ? 551  LEU A O     1 
ATOM   5064 C  CB    . LEU C 3  545 ? 79.718 187.147 30.638 1.00 39.02  ? 551  LEU A CB    1 
ATOM   5065 C  CG    . LEU C 3  545 ? 80.116 186.356 29.385 1.00 40.00  ? 551  LEU A CG    1 
ATOM   5066 C  CD1   . LEU C 3  545 ? 81.548 185.871 29.508 1.00 42.79  ? 551  LEU A CD1   1 
ATOM   5067 C  CD2   . LEU C 3  545 ? 79.165 185.180 29.194 1.00 39.31  ? 551  LEU A CD2   1 
ATOM   5068 N  N     . LYS C 3  546 ? 79.866 188.939 33.277 1.00 36.95  ? 552  LYS A N     1 
ATOM   5069 C  CA    . LYS C 3  546 ? 79.241 189.898 34.174 1.00 37.15  ? 552  LYS A CA    1 
ATOM   5070 C  C     . LYS C 3  546 ? 80.079 191.168 34.302 1.00 36.98  ? 552  LYS A C     1 
ATOM   5071 O  O     . LYS C 3  546 ? 79.592 192.271 34.044 1.00 36.21  ? 552  LYS A O     1 
ATOM   5072 C  CB    . LYS C 3  546 ? 79.050 189.270 35.555 1.00 39.68  ? 552  LYS A CB    1 
ATOM   5073 C  CG    . LYS C 3  546 ? 77.920 188.252 35.637 1.00 42.90  ? 552  LYS A CG    1 
ATOM   5074 C  CD    . LYS C 3  546 ? 76.627 188.919 36.064 1.00 45.32  ? 552  LYS A CD    1 
ATOM   5075 C  CE    . LYS C 3  546 ? 76.713 189.422 37.499 1.00 44.71  ? 552  LYS A CE    1 
ATOM   5076 N  NZ    . LYS C 3  546 ? 76.693 188.297 38.473 1.00 44.09  ? 552  LYS A NZ    1 
ATOM   5077 N  N     . LYS C 3  547 ? 81.343 191.014 34.692 1.00 36.07  ? 553  LYS A N     1 
ATOM   5078 C  CA    . LYS C 3  547 ? 82.214 192.173 34.863 1.00 36.01  ? 553  LYS A CA    1 
ATOM   5079 C  C     . LYS C 3  547 ? 82.586 192.834 33.539 1.00 33.68  ? 553  LYS A C     1 
ATOM   5080 O  O     . LYS C 3  547 ? 82.889 194.027 33.508 1.00 31.64  ? 553  LYS A O     1 
ATOM   5081 C  CB    . LYS C 3  547 ? 83.486 191.793 35.636 1.00 37.69  ? 553  LYS A CB    1 
ATOM   5082 C  CG    . LYS C 3  547 ? 84.467 190.915 34.878 1.00 41.63  ? 553  LYS A CG    1 
ATOM   5083 C  CD    . LYS C 3  547 ? 85.696 190.554 35.733 1.00 44.25  ? 553  LYS A CD    1 
ATOM   5084 C  CE    . LYS C 3  547 ? 86.589 191.760 36.046 1.00 43.95  ? 553  LYS A CE    1 
ATOM   5085 N  NZ    . LYS C 3  547 ? 85.933 192.783 36.909 1.00 44.99  ? 553  LYS A NZ    1 
ATOM   5086 N  N     . LYS C 3  548 ? 82.560 192.068 32.450 1.00 30.82  ? 554  LYS A N     1 
ATOM   5087 C  CA    . LYS C 3  548 ? 82.889 192.631 31.148 1.00 29.56  ? 554  LYS A CA    1 
ATOM   5088 C  C     . LYS C 3  548 ? 81.795 193.593 30.676 1.00 28.09  ? 554  LYS A C     1 
ATOM   5089 O  O     . LYS C 3  548 ? 82.085 194.697 30.211 1.00 27.62  ? 554  LYS A O     1 
ATOM   5090 C  CB    . LYS C 3  548 ? 83.081 191.538 30.090 1.00 29.93  ? 554  LYS A CB    1 
ATOM   5091 C  CG    . LYS C 3  548 ? 83.512 192.130 28.749 1.00 34.41  ? 554  LYS A CG    1 
ATOM   5092 C  CD    . LYS C 3  548 ? 83.645 191.123 27.607 1.00 37.39  ? 554  LYS A CD    1 
ATOM   5093 C  CE    . LYS C 3  548 ? 84.155 191.841 26.343 1.00 40.00  ? 554  LYS A CE    1 
ATOM   5094 N  NZ    . LYS C 3  548 ? 84.325 190.966 25.146 1.00 40.82  ? 554  LYS A NZ    1 
ATOM   5095 N  N     . PHE C 3  549 ? 80.539 193.176 30.792 1.00 26.13  ? 555  PHE A N     1 
ATOM   5096 C  CA    . PHE C 3  549 ? 79.436 194.022 30.364 1.00 26.33  ? 555  PHE A CA    1 
ATOM   5097 C  C     . PHE C 3  549 ? 79.138 195.142 31.353 1.00 27.00  ? 555  PHE A C     1 
ATOM   5098 O  O     . PHE C 3  549 ? 78.744 196.240 30.957 1.00 26.09  ? 555  PHE A O     1 
ATOM   5099 C  CB    . PHE C 3  549 ? 78.184 193.179 30.106 1.00 23.32  ? 555  PHE A CB    1 
ATOM   5100 C  CG    . PHE C 3  549 ? 78.233 192.418 28.812 1.00 23.80  ? 555  PHE A CG    1 
ATOM   5101 C  CD1   . PHE C 3  549 ? 78.986 191.254 28.699 1.00 24.67  ? 555  PHE A CD1   1 
ATOM   5102 C  CD2   . PHE C 3  549 ? 77.562 192.892 27.687 1.00 23.79  ? 555  PHE A CD2   1 
ATOM   5103 C  CE1   . PHE C 3  549 ? 79.072 190.572 27.484 1.00 24.53  ? 555  PHE A CE1   1 
ATOM   5104 C  CE2   . PHE C 3  549 ? 77.640 192.220 26.467 1.00 23.34  ? 555  PHE A CE2   1 
ATOM   5105 C  CZ    . PHE C 3  549 ? 78.399 191.056 26.366 1.00 24.67  ? 555  PHE A CZ    1 
ATOM   5106 N  N     . LEU C 3  550 ? 79.343 194.871 32.637 1.00 28.37  ? 556  LEU A N     1 
ATOM   5107 C  CA    . LEU C 3  550 ? 79.100 195.875 33.659 1.00 30.96  ? 556  LEU A CA    1 
ATOM   5108 C  C     . LEU C 3  550 ? 80.187 196.949 33.575 1.00 32.49  ? 556  LEU A C     1 
ATOM   5109 O  O     . LEU C 3  550 ? 79.959 198.109 33.916 1.00 32.83  ? 556  LEU A O     1 
ATOM   5110 C  CB    . LEU C 3  550 ? 79.094 195.216 35.038 1.00 31.89  ? 556  LEU A CB    1 
ATOM   5111 C  CG    . LEU C 3  550 ? 78.143 195.786 36.090 1.00 34.28  ? 556  LEU A CG    1 
ATOM   5112 C  CD1   . LEU C 3  550 ? 76.778 196.073 35.476 1.00 34.14  ? 556  LEU A CD1   1 
ATOM   5113 C  CD2   . LEU C 3  550 ? 78.004 194.783 37.226 1.00 34.11  ? 556  LEU A CD2   1 
ATOM   5114 N  N     . GLU C 3  551 ? 81.371 196.559 33.110 1.00 34.07  ? 557  GLU A N     1 
ATOM   5115 C  CA    . GLU C 3  551 ? 82.478 197.498 32.969 1.00 35.06  ? 557  GLU A CA    1 
ATOM   5116 C  C     . GLU C 3  551 ? 82.311 198.311 31.690 1.00 33.95  ? 557  GLU A C     1 
ATOM   5117 O  O     . GLU C 3  551 ? 82.660 199.488 31.648 1.00 33.23  ? 557  GLU A O     1 
ATOM   5118 C  CB    . GLU C 3  551 ? 83.817 196.759 32.928 1.00 38.59  ? 557  GLU A CB    1 
ATOM   5119 C  CG    . GLU C 3  551 ? 84.730 197.033 34.120 1.00 46.32  ? 557  GLU A CG    1 
ATOM   5120 C  CD    . GLU C 3  551 ? 84.390 196.198 35.349 1.00 50.65  ? 557  GLU A CD    1 
ATOM   5121 O  OE1   . GLU C 3  551 ? 83.208 196.190 35.764 1.00 53.08  ? 557  GLU A OE1   1 
ATOM   5122 O  OE2   . GLU C 3  551 ? 85.314 195.553 35.903 1.00 52.20  ? 557  GLU A OE2   1 
ATOM   5123 N  N     . ASN C 3  552 ? 81.772 197.681 30.649 1.00 33.64  ? 558  ASN A N     1 
ATOM   5124 C  CA    . ASN C 3  552 ? 81.556 198.358 29.372 1.00 33.87  ? 558  ASN A CA    1 
ATOM   5125 C  C     . ASN C 3  552 ? 80.539 199.502 29.491 1.00 32.33  ? 558  ASN A C     1 
ATOM   5126 O  O     . ASN C 3  552 ? 80.670 200.526 28.819 1.00 30.62  ? 558  ASN A O     1 
ATOM   5127 C  CB    . ASN C 3  552 ? 81.095 197.359 28.309 1.00 35.96  ? 558  ASN A CB    1 
ATOM   5128 C  CG    . ASN C 3  552 ? 80.987 197.989 26.932 1.00 39.40  ? 558  ASN A CG    1 
ATOM   5129 O  OD1   . ASN C 3  552 ? 81.922 198.644 26.462 1.00 40.02  ? 558  ASN A OD1   1 
ATOM   5130 N  ND2   . ASN C 3  552 ? 79.849 197.786 26.271 1.00 40.85  ? 558  ASN A ND2   1 
ATOM   5131 N  N     . THR C 3  553 ? 79.523 199.326 30.333 1.00 31.02  ? 559  THR A N     1 
ATOM   5132 C  CA    . THR C 3  553 ? 78.534 200.379 30.543 1.00 30.52  ? 559  THR A CA    1 
ATOM   5133 C  C     . THR C 3  553 ? 78.248 200.523 32.033 1.00 29.01  ? 559  THR A C     1 
ATOM   5134 O  O     . THR C 3  553 ? 77.267 199.989 32.549 1.00 29.46  ? 559  THR A O     1 
ATOM   5135 C  CB    . THR C 3  553 ? 77.207 200.108 29.790 1.00 30.26  ? 559  THR A CB    1 
ATOM   5136 O  OG1   . THR C 3  553 ? 76.635 198.875 30.236 1.00 32.77  ? 559  THR A OG1   1 
ATOM   5137 C  CG2   . THR C 3  553 ? 77.451 200.033 28.290 1.00 33.07  ? 559  THR A CG2   1 
ATOM   5138 N  N     . PRO C 3  554 ? 79.121 201.247 32.748 1.00 27.51  ? 560  PRO A N     1 
ATOM   5139 C  CA    . PRO C 3  554 ? 78.966 201.466 34.189 1.00 25.74  ? 560  PRO A CA    1 
ATOM   5140 C  C     . PRO C 3  554 ? 77.690 202.224 34.554 1.00 24.11  ? 560  PRO A C     1 
ATOM   5141 O  O     . PRO C 3  554 ? 77.332 202.321 35.731 1.00 24.45  ? 560  PRO A O     1 
ATOM   5142 C  CB    . PRO C 3  554 ? 80.234 202.234 34.558 1.00 27.33  ? 560  PRO A CB    1 
ATOM   5143 C  CG    . PRO C 3  554 ? 80.571 202.967 33.288 1.00 27.35  ? 560  PRO A CG    1 
ATOM   5144 C  CD    . PRO C 3  554 ? 80.339 201.905 32.246 1.00 26.81  ? 560  PRO A CD    1 
ATOM   5145 N  N     . ALA C 3  555 ? 77.007 202.760 33.549 1.00 20.56  ? 561  ALA A N     1 
ATOM   5146 C  CA    . ALA C 3  555 ? 75.762 203.480 33.789 1.00 17.94  ? 561  ALA A CA    1 
ATOM   5147 C  C     . ALA C 3  555 ? 74.723 202.501 34.347 1.00 15.55  ? 561  ALA A C     1 
ATOM   5148 O  O     . ALA C 3  555 ? 73.770 202.905 35.018 1.00 13.88  ? 561  ALA A O     1 
ATOM   5149 C  CB    . ALA C 3  555 ? 75.252 204.108 32.492 1.00 16.44  ? 561  ALA A CB    1 
ATOM   5150 N  N     . ILE C 3  556 ? 74.907 201.213 34.069 1.00 11.38  ? 562  ILE A N     1 
ATOM   5151 C  CA    . ILE C 3  556 ? 73.968 200.216 34.572 1.00 12.13  ? 562  ILE A CA    1 
ATOM   5152 C  C     . ILE C 3  556 ? 73.992 200.240 36.093 1.00 12.16  ? 562  ILE A C     1 
ATOM   5153 O  O     . ILE C 3  556 ? 72.945 200.242 36.737 1.00 13.21  ? 562  ILE A O     1 
ATOM   5154 C  CB    . ILE C 3  556 ? 74.306 198.785 34.081 1.00 9.52   ? 562  ILE A CB    1 
ATOM   5155 C  CG1   . ILE C 3  556 ? 74.124 198.689 32.561 1.00 10.30  ? 562  ILE A CG1   1 
ATOM   5156 C  CG2   . ILE C 3  556 ? 73.407 197.784 34.767 1.00 9.46   ? 562  ILE A CG2   1 
ATOM   5157 C  CD1   . ILE C 3  556 ? 74.566 197.352 31.965 1.00 10.62  ? 562  ILE A CD1   1 
ATOM   5158 N  N     . ALA C 3  557 ? 75.187 200.268 36.669 1.00 12.14  ? 563  ALA A N     1 
ATOM   5159 C  CA    . ALA C 3  557 ? 75.307 200.308 38.122 1.00 12.80  ? 563  ALA A CA    1 
ATOM   5160 C  C     . ALA C 3  557 ? 74.669 201.593 38.665 1.00 11.84  ? 563  ALA A C     1 
ATOM   5161 O  O     . ALA C 3  557 ? 73.921 201.556 39.645 1.00 12.35  ? 563  ALA A O     1 
ATOM   5162 C  CB    . ALA C 3  557 ? 76.783 200.224 38.542 1.00 8.03   ? 563  ALA A CB    1 
ATOM   5163 N  N     . ALA C 3  558 ? 74.952 202.722 38.018 1.00 11.42  ? 564  ALA A N     1 
ATOM   5164 C  CA    . ALA C 3  558 ? 74.404 204.016 38.449 1.00 12.71  ? 564  ALA A CA    1 
ATOM   5165 C  C     . ALA C 3  558 ? 72.874 204.029 38.436 1.00 12.89  ? 564  ALA A C     1 
ATOM   5166 O  O     . ALA C 3  558 ? 72.241 204.543 39.360 1.00 12.60  ? 564  ALA A O     1 
ATOM   5167 C  CB    . ALA C 3  558 ? 74.941 205.143 37.563 1.00 10.35  ? 564  ALA A CB    1 
ATOM   5168 N  N     . LEU C 3  559 ? 72.286 203.470 37.382 1.00 13.20  ? 565  LEU A N     1 
ATOM   5169 C  CA    . LEU C 3  559 ? 70.836 203.412 37.266 1.00 13.96  ? 565  LEU A CA    1 
ATOM   5170 C  C     . LEU C 3  559 ? 70.274 202.524 38.375 1.00 15.00  ? 565  LEU A C     1 
ATOM   5171 O  O     . LEU C 3  559 ? 69.317 202.898 39.039 1.00 17.23  ? 565  LEU A O     1 
ATOM   5172 C  CB    . LEU C 3  559 ? 70.441 202.867 35.893 1.00 12.14  ? 565  LEU A CB    1 
ATOM   5173 C  CG    . LEU C 3  559 ? 68.950 202.707 35.579 1.00 12.51  ? 565  LEU A CG    1 
ATOM   5174 C  CD1   . LEU C 3  559 ? 68.189 204.009 35.877 1.00 7.46   ? 565  LEU A CD1   1 
ATOM   5175 C  CD2   . LEU C 3  559 ? 68.801 202.318 34.102 1.00 8.90   ? 565  LEU A CD2   1 
ATOM   5176 N  N     . ARG C 3  560 ? 70.884 201.360 38.582 1.00 16.76  ? 566  ARG A N     1 
ATOM   5177 C  CA    . ARG C 3  560 ? 70.450 200.429 39.626 1.00 19.22  ? 566  ARG A CA    1 
ATOM   5178 C  C     . ARG C 3  560 ? 70.473 201.074 41.011 1.00 20.96  ? 566  ARG A C     1 
ATOM   5179 O  O     . ARG C 3  560 ? 69.567 200.870 41.826 1.00 20.51  ? 566  ARG A O     1 
ATOM   5180 C  CB    . ARG C 3  560 ? 71.355 199.194 39.665 1.00 17.40  ? 566  ARG A CB    1 
ATOM   5181 C  CG    . ARG C 3  560 ? 71.172 198.216 38.529 1.00 17.17  ? 566  ARG A CG    1 
ATOM   5182 C  CD    . ARG C 3  560 ? 72.171 197.076 38.662 1.00 17.25  ? 566  ARG A CD    1 
ATOM   5183 N  NE    . ARG C 3  560 ? 71.891 195.970 37.753 1.00 17.15  ? 566  ARG A NE    1 
ATOM   5184 C  CZ    . ARG C 3  560 ? 72.791 195.060 37.393 1.00 14.70  ? 566  ARG A CZ    1 
ATOM   5185 N  NH1   . ARG C 3  560 ? 74.028 195.136 37.864 1.00 11.72  ? 566  ARG A NH1   1 
ATOM   5186 N  NH2   . ARG C 3  560 ? 72.453 194.069 36.576 1.00 12.20  ? 566  ARG A NH2   1 
ATOM   5187 N  N     . GLU C 3  561 ? 71.523 201.841 41.279 1.00 22.62  ? 567  GLU A N     1 
ATOM   5188 C  CA    . GLU C 3  561 ? 71.660 202.495 42.569 1.00 25.42  ? 567  GLU A CA    1 
ATOM   5189 C  C     . GLU C 3  561 ? 70.632 203.603 42.764 1.00 23.55  ? 567  GLU A C     1 
ATOM   5190 O  O     . GLU C 3  561 ? 70.045 203.725 43.836 1.00 23.14  ? 567  GLU A O     1 
ATOM   5191 C  CB    . GLU C 3  561 ? 73.073 203.061 42.721 1.00 30.74  ? 567  GLU A CB    1 
ATOM   5192 C  CG    . GLU C 3  561 ? 74.168 202.018 42.572 1.00 38.59  ? 567  GLU A CG    1 
ATOM   5193 C  CD    . GLU C 3  561 ? 75.554 202.637 42.474 1.00 44.67  ? 567  GLU A CD    1 
ATOM   5194 O  OE1   . GLU C 3  561 ? 75.709 203.634 41.727 1.00 47.15  ? 567  GLU A OE1   1 
ATOM   5195 O  OE2   . GLU C 3  561 ? 76.486 202.120 43.133 1.00 45.84  ? 567  GLU A OE2   1 
ATOM   5196 N  N     . SER C 3  562 ? 70.401 204.409 41.734 1.00 22.08  ? 568  SER A N     1 
ATOM   5197 C  CA    . SER C 3  562 ? 69.438 205.486 41.878 1.00 23.01  ? 568  SER A CA    1 
ATOM   5198 C  C     . SER C 3  562 ? 68.058 204.916 42.175 1.00 22.50  ? 568  SER A C     1 
ATOM   5199 O  O     . SER C 3  562 ? 67.319 205.471 42.981 1.00 22.23  ? 568  SER A O     1 
ATOM   5200 C  CB    . SER C 3  562 ? 69.398 206.356 40.620 1.00 23.91  ? 568  SER A CB    1 
ATOM   5201 O  OG    . SER C 3  562 ? 69.052 205.597 39.480 1.00 30.17  ? 568  SER A OG    1 
ATOM   5202 N  N     . ILE C 3  563 ? 67.714 203.803 41.528 1.00 23.63  ? 569  ILE A N     1 
ATOM   5203 C  CA    . ILE C 3  563 ? 66.418 203.173 41.752 1.00 23.15  ? 569  ILE A CA    1 
ATOM   5204 C  C     . ILE C 3  563 ? 66.313 202.775 43.219 1.00 24.27  ? 569  ILE A C     1 
ATOM   5205 O  O     . ILE C 3  563 ? 65.299 203.032 43.865 1.00 24.25  ? 569  ILE A O     1 
ATOM   5206 C  CB    . ILE C 3  563 ? 66.242 201.913 40.884 1.00 23.73  ? 569  ILE A CB    1 
ATOM   5207 C  CG1   . ILE C 3  563 ? 66.200 202.301 39.408 1.00 24.39  ? 569  ILE A CG1   1 
ATOM   5208 C  CG2   . ILE C 3  563 ? 64.959 201.190 41.262 1.00 21.24  ? 569  ILE A CG2   1 
ATOM   5209 C  CD1   . ILE C 3  563 ? 66.097 201.109 38.472 1.00 24.89  ? 569  ILE A CD1   1 
ATOM   5210 N  N     . GLN C 3  564 ? 67.367 202.150 43.736 1.00 24.68  ? 570  GLN A N     1 
ATOM   5211 C  CA    . GLN C 3  564 ? 67.405 201.727 45.131 1.00 27.14  ? 570  GLN A CA    1 
ATOM   5212 C  C     . GLN C 3  564 ? 67.200 202.921 46.052 1.00 28.51  ? 570  GLN A C     1 
ATOM   5213 O  O     . GLN C 3  564 ? 66.381 202.879 46.969 1.00 28.85  ? 570  GLN A O     1 
ATOM   5214 C  CB    . GLN C 3  564 ? 68.754 201.079 45.450 1.00 27.23  ? 570  GLN A CB    1 
ATOM   5215 C  CG    . GLN C 3  564 ? 68.771 199.567 45.366 1.00 30.52  ? 570  GLN A CG    1 
ATOM   5216 C  CD    . GLN C 3  564 ? 68.174 198.900 46.599 1.00 32.81  ? 570  GLN A CD    1 
ATOM   5217 O  OE1   . GLN C 3  564 ? 68.623 199.125 47.725 1.00 30.96  ? 570  GLN A OE1   1 
ATOM   5218 N  NE2   . GLN C 3  564 ? 67.161 198.068 46.388 1.00 34.41  ? 570  GLN A NE2   1 
ATOM   5219 N  N     . GLN C 3  565 ? 67.956 203.982 45.787 1.00 30.23  ? 571  GLN A N     1 
ATOM   5220 C  CA    . GLN C 3  565 ? 67.911 205.213 46.571 1.00 32.03  ? 571  GLN A CA    1 
ATOM   5221 C  C     . GLN C 3  565 ? 66.493 205.779 46.628 1.00 30.81  ? 571  GLN A C     1 
ATOM   5222 O  O     . GLN C 3  565 ? 66.095 206.390 47.619 1.00 30.51  ? 571  GLN A O     1 
ATOM   5223 C  CB    . GLN C 3  565 ? 68.868 206.238 45.949 1.00 34.59  ? 571  GLN A CB    1 
ATOM   5224 C  CG    . GLN C 3  565 ? 69.354 207.351 46.872 1.00 39.50  ? 571  GLN A CG    1 
ATOM   5225 C  CD    . GLN C 3  565 ? 68.312 208.428 47.134 1.00 43.46  ? 571  GLN A CD    1 
ATOM   5226 O  OE1   . GLN C 3  565 ? 67.591 208.856 46.225 1.00 45.06  ? 571  GLN A OE1   1 
ATOM   5227 N  NE2   . GLN C 3  565 ? 68.247 208.893 48.380 1.00 45.79  ? 571  GLN A NE2   1 
ATOM   5228 N  N     . THR C 3  566 ? 65.733 205.552 45.563 1.00 28.85  ? 572  THR A N     1 
ATOM   5229 C  CA    . THR C 3  566 ? 64.364 206.040 45.468 1.00 27.98  ? 572  THR A CA    1 
ATOM   5230 C  C     . THR C 3  566 ? 63.344 205.140 46.156 1.00 27.81  ? 572  THR A C     1 
ATOM   5231 O  O     . THR C 3  566 ? 62.373 205.621 46.734 1.00 28.44  ? 572  THR A O     1 
ATOM   5232 C  CB    . THR C 3  566 ? 63.942 206.179 43.998 1.00 28.81  ? 572  THR A CB    1 
ATOM   5233 O  OG1   . THR C 3  566 ? 64.806 207.115 43.344 1.00 30.82  ? 572  THR A OG1   1 
ATOM   5234 C  CG2   . THR C 3  566 ? 62.499 206.652 43.897 1.00 28.69  ? 572  THR A CG2   1 
ATOM   5235 N  N     . LEU C 3  567 ? 63.568 203.833 46.098 1.00 26.66  ? 573  LEU A N     1 
ATOM   5236 C  CA    . LEU C 3  567 ? 62.635 202.882 46.686 1.00 26.83  ? 573  LEU A CA    1 
ATOM   5237 C  C     . LEU C 3  567 ? 62.941 202.448 48.112 1.00 27.48  ? 573  LEU A C     1 
ATOM   5238 O  O     . LEU C 3  567 ? 62.054 202.419 48.959 1.00 25.29  ? 573  LEU A O     1 
ATOM   5239 C  CB    . LEU C 3  567 ? 62.553 201.630 45.810 1.00 25.86  ? 573  LEU A CB    1 
ATOM   5240 C  CG    . LEU C 3  567 ? 62.196 201.818 44.334 1.00 27.99  ? 573  LEU A CG    1 
ATOM   5241 C  CD1   . LEU C 3  567 ? 62.157 200.453 43.650 1.00 27.99  ? 573  LEU A CD1   1 
ATOM   5242 C  CD2   . LEU C 3  567 ? 60.845 202.529 44.207 1.00 26.53  ? 573  LEU A CD2   1 
ATOM   5243 N  N     . VAL C 3  568 ? 64.200 202.118 48.372 1.00 28.90  ? 574  VAL A N     1 
ATOM   5244 C  CA    . VAL C 3  568 ? 64.597 201.615 49.677 1.00 32.01  ? 574  VAL A CA    1 
ATOM   5245 C  C     . VAL C 3  568 ? 65.272 202.592 50.623 1.00 35.72  ? 574  VAL A C     1 
ATOM   5246 O  O     . VAL C 3  568 ? 66.219 203.282 50.254 1.00 37.12  ? 574  VAL A O     1 
ATOM   5247 C  CB    . VAL C 3  568 ? 65.532 200.404 49.511 1.00 30.95  ? 574  VAL A CB    1 
ATOM   5248 C  CG1   . VAL C 3  568 ? 65.859 199.805 50.864 1.00 28.71  ? 574  VAL A CG1   1 
ATOM   5249 C  CG2   . VAL C 3  568 ? 64.887 199.375 48.592 1.00 29.62  ? 574  VAL A CG2   1 
ATOM   5250 N  N     . GLU C 3  569 ? 64.781 202.647 51.856 1.00 39.71  ? 575  GLU A N     1 
ATOM   5251 C  CA    . GLU C 3  569 ? 65.395 203.515 52.846 1.00 44.21  ? 575  GLU A CA    1 
ATOM   5252 C  C     . GLU C 3  569 ? 66.219 202.636 53.787 1.00 43.98  ? 575  GLU A C     1 
ATOM   5253 O  O     . GLU C 3  569 ? 67.139 203.113 54.449 1.00 44.36  ? 575  GLU A O     1 
ATOM   5254 C  CB    . GLU C 3  569 ? 64.334 204.309 53.628 1.00 48.11  ? 575  GLU A CB    1 
ATOM   5255 C  CG    . GLU C 3  569 ? 63.416 203.501 54.539 1.00 52.64  ? 575  GLU A CG    1 
ATOM   5256 C  CD    . GLU C 3  569 ? 62.480 204.394 55.365 1.00 57.12  ? 575  GLU A CD    1 
ATOM   5257 O  OE1   . GLU C 3  569 ? 61.634 205.104 54.766 1.00 56.81  ? 575  GLU A OE1   1 
ATOM   5258 O  OE2   . GLU C 3  569 ? 62.592 204.387 56.615 1.00 58.39  ? 575  GLU A OE2   1 
ATOM   5259 N  N     . SER C 3  570 ? 65.896 201.344 53.806 1.00 43.77  ? 576  SER A N     1 
ATOM   5260 C  CA    . SER C 3  570 ? 66.575 200.371 54.656 1.00 44.47  ? 576  SER A CA    1 
ATOM   5261 C  C     . SER C 3  570 ? 66.144 198.937 54.336 1.00 45.17  ? 576  SER A C     1 
ATOM   5262 O  O     . SER C 3  570 ? 65.011 198.698 53.912 1.00 45.69  ? 576  SER A O     1 
ATOM   5263 C  CB    . SER C 3  570 ? 66.274 200.677 56.126 1.00 45.57  ? 576  SER A CB    1 
ATOM   5264 O  OG    . SER C 3  570 ? 66.658 199.606 56.974 1.00 47.04  ? 576  SER A OG    1 
ATOM   5265 N  N     . SER C 3  571 ? 67.049 197.983 54.547 1.00 45.02  ? 577  SER A N     1 
ATOM   5266 C  CA    . SER C 3  571 ? 66.752 196.573 54.293 1.00 45.85  ? 577  SER A CA    1 
ATOM   5267 C  C     . SER C 3  571 ? 67.605 195.647 55.158 1.00 45.91  ? 577  SER A C     1 
ATOM   5268 O  O     . SER C 3  571 ? 68.830 195.771 55.201 1.00 46.35  ? 577  SER A O     1 
ATOM   5269 C  CB    . SER C 3  571 ? 66.975 196.242 52.815 1.00 46.13  ? 577  SER A CB    1 
ATOM   5270 O  OG    . SER C 3  571 ? 68.301 196.545 52.418 1.00 46.39  ? 577  SER A OG    1 
ATOM   5271 N  N     . GLN C 3  578 ? 64.069 188.683 52.581 1.00 51.39  ? 584  GLN A N     1 
ATOM   5272 C  CA    . GLN C 3  578 ? 64.669 189.839 53.238 1.00 51.66  ? 584  GLN A CA    1 
ATOM   5273 C  C     . GLN C 3  578 ? 63.584 190.844 53.616 1.00 51.07  ? 584  GLN A C     1 
ATOM   5274 O  O     . GLN C 3  578 ? 62.717 191.163 52.801 1.00 51.79  ? 584  GLN A O     1 
ATOM   5275 C  CB    . GLN C 3  578 ? 65.684 190.506 52.307 1.00 51.61  ? 584  GLN A CB    1 
ATOM   5276 C  CG    . GLN C 3  578 ? 65.052 191.234 51.144 1.00 51.61  ? 584  GLN A CG    1 
ATOM   5277 C  CD    . GLN C 3  578 ? 66.077 191.712 50.148 1.00 51.75  ? 584  GLN A CD    1 
ATOM   5278 O  OE1   . GLN C 3  578 ? 66.928 192.551 50.454 1.00 50.50  ? 584  GLN A OE1   1 
ATOM   5279 N  NE2   . GLN C 3  578 ? 66.003 191.176 48.941 1.00 53.51  ? 584  GLN A NE2   1 
ATOM   5280 N  N     . GLN C 3  579 ? 63.620 191.333 54.853 1.00 50.01  ? 585  GLN A N     1 
ATOM   5281 C  CA    . GLN C 3  579 ? 62.628 192.307 55.302 1.00 48.26  ? 585  GLN A CA    1 
ATOM   5282 C  C     . GLN C 3  579 ? 63.158 193.688 54.927 1.00 45.99  ? 585  GLN A C     1 
ATOM   5283 O  O     . GLN C 3  579 ? 64.248 194.084 55.349 1.00 44.53  ? 585  GLN A O     1 
ATOM   5284 C  CB    . GLN C 3  579 ? 62.413 192.197 56.818 1.00 49.55  ? 585  GLN A CB    1 
ATOM   5285 C  CG    . GLN C 3  579 ? 61.847 190.848 57.304 1.00 51.79  ? 585  GLN A CG    1 
ATOM   5286 C  CD    . GLN C 3  579 ? 60.429 190.566 56.806 1.00 54.20  ? 585  GLN A CD    1 
ATOM   5287 O  OE1   . GLN C 3  579 ? 59.539 191.415 56.903 1.00 54.87  ? 585  GLN A OE1   1 
ATOM   5288 N  NE2   . GLN C 3  579 ? 60.207 189.357 56.305 1.00 56.03  ? 585  GLN A NE2   1 
ATOM   5289 N  N     . VAL C 3  580 ? 62.384 194.408 54.121 1.00 43.06  ? 586  VAL A N     1 
ATOM   5290 C  CA    . VAL C 3  580 ? 62.770 195.732 53.638 1.00 39.77  ? 586  VAL A CA    1 
ATOM   5291 C  C     . VAL C 3  580 ? 61.898 196.860 54.181 1.00 37.31  ? 586  VAL A C     1 
ATOM   5292 O  O     . VAL C 3  580 ? 60.697 196.687 54.359 1.00 37.05  ? 586  VAL A O     1 
ATOM   5293 C  CB    . VAL C 3  580 ? 62.679 195.787 52.085 1.00 39.68  ? 586  VAL A CB    1 
ATOM   5294 C  CG1   . VAL C 3  580 ? 63.026 197.181 51.585 1.00 38.67  ? 586  VAL A CG1   1 
ATOM   5295 C  CG2   . VAL C 3  580 ? 63.596 194.737 51.471 1.00 39.46  ? 586  VAL A CG2   1 
ATOM   5296 N  N     . LYS C 3  581 ? 62.510 198.010 54.447 1.00 33.79  ? 587  LYS A N     1 
ATOM   5297 C  CA    . LYS C 3  581 ? 61.774 199.182 54.906 1.00 32.71  ? 587  LYS A CA    1 
ATOM   5298 C  C     . LYS C 3  581 ? 61.710 200.095 53.691 1.00 30.15  ? 587  LYS A C     1 
ATOM   5299 O  O     . LYS C 3  581 ? 62.723 200.636 53.255 1.00 30.58  ? 587  LYS A O     1 
ATOM   5300 C  CB    . LYS C 3  581 ? 62.500 199.891 56.050 1.00 35.03  ? 587  LYS A CB    1 
ATOM   5301 C  CG    . LYS C 3  581 ? 62.452 199.147 57.375 1.00 37.77  ? 587  LYS A CG    1 
ATOM   5302 C  CD    . LYS C 3  581 ? 62.989 200.014 58.501 1.00 40.11  ? 587  LYS A CD    1 
ATOM   5303 C  CE    . LYS C 3  581 ? 62.964 199.283 59.829 1.00 41.08  ? 587  LYS A CE    1 
ATOM   5304 N  NZ    . LYS C 3  581 ? 63.509 200.151 60.910 1.00 43.16  ? 587  LYS A NZ    1 
ATOM   5305 N  N     . TRP C 3  582 ? 60.514 200.261 53.145 1.00 27.50  ? 588  TRP A N     1 
ATOM   5306 C  CA    . TRP C 3  582 ? 60.342 201.064 51.951 1.00 24.97  ? 588  TRP A CA    1 
ATOM   5307 C  C     . TRP C 3  582 ? 60.101 202.550 52.116 1.00 25.29  ? 588  TRP A C     1 
ATOM   5308 O  O     . TRP C 3  582 ? 59.404 203.001 53.026 1.00 24.40  ? 588  TRP A O     1 
ATOM   5309 C  CB    . TRP C 3  582 ? 59.210 200.493 51.101 1.00 23.19  ? 588  TRP A CB    1 
ATOM   5310 C  CG    . TRP C 3  582 ? 59.421 199.084 50.681 1.00 20.62  ? 588  TRP A CG    1 
ATOM   5311 C  CD1   . TRP C 3  582 ? 59.147 197.964 51.404 1.00 19.41  ? 588  TRP A CD1   1 
ATOM   5312 C  CD2   . TRP C 3  582 ? 59.949 198.637 49.427 1.00 20.48  ? 588  TRP A CD2   1 
ATOM   5313 N  NE1   . TRP C 3  582 ? 59.467 196.842 50.677 1.00 19.56  ? 588  TRP A NE1   1 
ATOM   5314 C  CE2   . TRP C 3  582 ? 59.963 197.226 49.460 1.00 19.56  ? 588  TRP A CE2   1 
ATOM   5315 C  CE3   . TRP C 3  582 ? 60.412 199.293 48.279 1.00 17.76  ? 588  TRP A CE3   1 
ATOM   5316 C  CZ2   . TRP C 3  582 ? 60.421 196.456 48.389 1.00 19.89  ? 588  TRP A CZ2   1 
ATOM   5317 C  CZ3   . TRP C 3  582 ? 60.868 198.530 47.213 1.00 18.15  ? 588  TRP A CZ3   1 
ATOM   5318 C  CH2   . TRP C 3  582 ? 60.869 197.123 47.276 1.00 20.16  ? 588  TRP A CH2   1 
ATOM   5319 N  N     . LYS C 3  583 ? 60.688 203.299 51.193 1.00 26.42  ? 589  LYS A N     1 
ATOM   5320 C  CA    . LYS C 3  583 ? 60.547 204.741 51.137 1.00 28.44  ? 589  LYS A CA    1 
ATOM   5321 C  C     . LYS C 3  583 ? 59.252 204.915 50.338 1.00 29.04  ? 589  LYS A C     1 
ATOM   5322 O  O     . LYS C 3  583 ? 58.345 205.655 50.728 1.00 29.86  ? 589  LYS A O     1 
ATOM   5323 C  CB    . LYS C 3  583 ? 61.749 205.327 50.393 1.00 30.17  ? 589  LYS A CB    1 
ATOM   5324 C  CG    . LYS C 3  583 ? 61.966 206.818 50.565 1.00 33.20  ? 589  LYS A CG    1 
ATOM   5325 C  CD    . LYS C 3  583 ? 63.322 207.235 49.995 1.00 34.13  ? 589  LYS A CD    1 
ATOM   5326 C  CE    . LYS C 3  583 ? 64.473 206.585 50.766 1.00 35.76  ? 589  LYS A CE    1 
ATOM   5327 N  NZ    . LYS C 3  583 ? 65.816 207.014 50.267 1.00 34.39  ? 589  LYS A NZ    1 
ATOM   5328 N  N     . ARG C 3  584 ? 59.179 204.193 49.224 1.00 29.14  ? 590  ARG A N     1 
ATOM   5329 C  CA    . ARG C 3  584 ? 58.015 204.178 48.338 1.00 28.60  ? 590  ARG A CA    1 
ATOM   5330 C  C     . ARG C 3  584 ? 58.055 202.791 47.701 1.00 28.01  ? 590  ARG A C     1 
ATOM   5331 O  O     . ARG C 3  584 ? 59.131 202.314 47.335 1.00 27.49  ? 590  ARG A O     1 
ATOM   5332 C  CB    . ARG C 3  584 ? 58.143 205.238 47.244 1.00 30.25  ? 590  ARG A CB    1 
ATOM   5333 C  CG    . ARG C 3  584 ? 56.826 205.557 46.539 1.00 34.39  ? 590  ARG A CG    1 
ATOM   5334 C  CD    . ARG C 3  584 ? 57.047 205.894 45.085 1.00 36.45  ? 590  ARG A CD    1 
ATOM   5335 N  NE    . ARG C 3  584 ? 57.956 207.019 44.912 1.00 41.77  ? 590  ARG A NE    1 
ATOM   5336 C  CZ    . ARG C 3  584 ? 58.746 207.185 43.854 1.00 44.74  ? 590  ARG A CZ    1 
ATOM   5337 N  NH1   . ARG C 3  584 ? 58.744 206.290 42.869 1.00 44.47  ? 590  ARG A NH1   1 
ATOM   5338 N  NH2   . ARG C 3  584 ? 59.537 208.250 43.777 1.00 46.05  ? 590  ARG A NH2   1 
ATOM   5339 N  N     . ARG C 3  585 ? 56.911 202.129 47.561 1.00 25.82  ? 591  ARG A N     1 
ATOM   5340 C  CA    . ARG C 3  585 ? 56.950 200.800 46.970 1.00 24.45  ? 591  ARG A CA    1 
ATOM   5341 C  C     . ARG C 3  585 ? 56.468 200.702 45.531 1.00 23.02  ? 591  ARG A C     1 
ATOM   5342 O  O     . ARG C 3  585 ? 56.046 199.637 45.084 1.00 22.17  ? 591  ARG A O     1 
ATOM   5343 C  CB    . ARG C 3  585 ? 56.190 199.791 47.831 1.00 25.62  ? 591  ARG A CB    1 
ATOM   5344 C  CG    . ARG C 3  585 ? 56.560 198.363 47.448 1.00 29.51  ? 591  ARG A CG    1 
ATOM   5345 C  CD    . ARG C 3  585 ? 56.236 197.341 48.513 1.00 31.23  ? 591  ARG A CD    1 
ATOM   5346 N  NE    . ARG C 3  585 ? 56.715 196.026 48.103 1.00 32.03  ? 591  ARG A NE    1 
ATOM   5347 C  CZ    . ARG C 3  585 ? 56.530 194.911 48.798 1.00 34.02  ? 591  ARG A CZ    1 
ATOM   5348 N  NH1   . ARG C 3  585 ? 55.869 194.944 49.949 1.00 36.91  ? 591  ARG A NH1   1 
ATOM   5349 N  NH2   . ARG C 3  585 ? 57.017 193.763 48.347 1.00 33.48  ? 591  ARG A NH2   1 
ATOM   5350 N  N     . TRP C 3  586 ? 56.540 201.807 44.801 1.00 21.54  ? 592  TRP A N     1 
ATOM   5351 C  CA    . TRP C 3  586 ? 56.119 201.790 43.412 1.00 22.14  ? 592  TRP A CA    1 
ATOM   5352 C  C     . TRP C 3  586 ? 56.941 202.714 42.525 1.00 22.49  ? 592  TRP A C     1 
ATOM   5353 O  O     . TRP C 3  586 ? 57.499 203.712 42.983 1.00 21.64  ? 592  TRP A O     1 
ATOM   5354 C  CB    . TRP C 3  586 ? 54.627 202.141 43.282 1.00 20.87  ? 592  TRP A CB    1 
ATOM   5355 C  CG    . TRP C 3  586 ? 54.220 203.426 43.942 1.00 19.34  ? 592  TRP A CG    1 
ATOM   5356 C  CD1   . TRP C 3  586 ? 53.772 203.585 45.221 1.00 18.40  ? 592  TRP A CD1   1 
ATOM   5357 C  CD2   . TRP C 3  586 ? 54.211 204.730 43.350 1.00 18.28  ? 592  TRP A CD2   1 
ATOM   5358 N  NE1   . TRP C 3  586 ? 53.480 204.905 45.461 1.00 17.59  ? 592  TRP A NE1   1 
ATOM   5359 C  CE2   . TRP C 3  586 ? 53.739 205.629 44.330 1.00 16.71  ? 592  TRP A CE2   1 
ATOM   5360 C  CE3   . TRP C 3  586 ? 54.556 205.225 42.088 1.00 18.13  ? 592  TRP A CE3   1 
ATOM   5361 C  CZ2   . TRP C 3  586 ? 53.599 206.997 44.087 1.00 18.21  ? 592  TRP A CZ2   1 
ATOM   5362 C  CZ3   . TRP C 3  586 ? 54.419 206.587 41.843 1.00 20.46  ? 592  TRP A CZ3   1 
ATOM   5363 C  CH2   . TRP C 3  586 ? 53.942 207.459 42.841 1.00 19.16  ? 592  TRP A CH2   1 
ATOM   5364 N  N     . ILE C 3  587 ? 57.011 202.342 41.250 1.00 22.41  ? 593  ILE A N     1 
ATOM   5365 C  CA    . ILE C 3  587 ? 57.722 203.083 40.221 1.00 21.03  ? 593  ILE A CA    1 
ATOM   5366 C  C     . ILE C 3  587 ? 56.656 203.852 39.456 1.00 20.49  ? 593  ILE A C     1 
ATOM   5367 O  O     . ILE C 3  587 ? 55.541 203.368 39.295 1.00 20.54  ? 593  ILE A O     1 
ATOM   5368 C  CB    . ILE C 3  587 ? 58.418 202.120 39.224 1.00 22.95  ? 593  ILE A CB    1 
ATOM   5369 C  CG1   . ILE C 3  587 ? 59.576 201.390 39.902 1.00 21.83  ? 593  ILE A CG1   1 
ATOM   5370 C  CG2   . ILE C 3  587 ? 58.888 202.883 38.007 1.00 23.55  ? 593  ILE A CG2   1 
ATOM   5371 C  CD1   . ILE C 3  587 ? 60.673 202.298 40.362 1.00 24.47  ? 593  ILE A CD1   1 
ATOM   5372 N  N     . LYS C 3  588 ? 56.991 205.046 38.988 1.00 21.23  ? 594  LYS A N     1 
ATOM   5373 C  CA    . LYS C 3  588 ? 56.042 205.844 38.221 1.00 21.22  ? 594  LYS A CA    1 
ATOM   5374 C  C     . LYS C 3  588 ? 56.180 205.454 36.758 1.00 20.72  ? 594  LYS A C     1 
ATOM   5375 O  O     . LYS C 3  588 ? 57.180 205.772 36.127 1.00 21.27  ? 594  LYS A O     1 
ATOM   5376 C  CB    . LYS C 3  588 ? 56.341 207.333 38.377 1.00 22.77  ? 594  LYS A CB    1 
ATOM   5377 C  CG    . LYS C 3  588 ? 55.379 208.232 37.624 1.00 25.43  ? 594  LYS A CG    1 
ATOM   5378 C  CD    . LYS C 3  588 ? 55.729 209.699 37.837 1.00 28.97  ? 594  LYS A CD    1 
ATOM   5379 N  N     . GLY C 3  589 ? 55.175 204.771 36.222 1.00 19.03  ? 595  GLY A N     1 
ATOM   5380 C  CA    . GLY C 3  589 ? 55.230 204.344 34.835 1.00 14.94  ? 595  GLY A CA    1 
ATOM   5381 C  C     . GLY C 3  589 ? 55.176 205.486 33.846 1.00 12.68  ? 595  GLY A C     1 
ATOM   5382 O  O     . GLY C 3  589 ? 54.813 206.603 34.205 1.00 11.57  ? 595  GLY A O     1 
ATOM   5383 N  N     . LEU C 3  590 ? 55.519 205.196 32.594 1.00 12.18  ? 596  LEU A N     1 
ATOM   5384 C  CA    . LEU C 3  590 ? 55.531 206.203 31.537 1.00 13.38  ? 596  LEU A CA    1 
ATOM   5385 C  C     . LEU C 3  590 ? 54.217 206.969 31.370 1.00 14.64  ? 596  LEU A C     1 
ATOM   5386 O  O     . LEU C 3  590 ? 54.220 208.119 30.931 1.00 15.18  ? 596  LEU A O     1 
ATOM   5387 C  CB    . LEU C 3  590 ? 55.910 205.565 30.190 1.00 11.24  ? 596  LEU A CB    1 
ATOM   5388 C  CG    . LEU C 3  590 ? 57.333 205.027 29.994 1.00 11.67  ? 596  LEU A CG    1 
ATOM   5389 C  CD1   . LEU C 3  590 ? 57.449 204.408 28.608 1.00 9.03   ? 596  LEU A CD1   1 
ATOM   5390 C  CD2   . LEU C 3  590 ? 58.349 206.153 30.154 1.00 10.57  ? 596  LEU A CD2   1 
ATOM   5391 N  N     . ASP C 3  591 ? 53.094 206.339 31.698 1.00 13.68  ? 597  ASP A N     1 
ATOM   5392 C  CA    . ASP C 3  591 ? 51.811 207.014 31.553 1.00 14.98  ? 597  ASP A CA    1 
ATOM   5393 C  C     . ASP C 3  591 ? 51.257 207.476 32.894 1.00 13.98  ? 597  ASP A C     1 
ATOM   5394 O  O     . ASP C 3  591 ? 50.058 207.727 33.018 1.00 13.55  ? 597  ASP A O     1 
ATOM   5395 C  CB    . ASP C 3  591 ? 50.793 206.100 30.870 1.00 17.13  ? 597  ASP A CB    1 
ATOM   5396 C  CG    . ASP C 3  591 ? 50.516 204.844 31.670 1.00 19.81  ? 597  ASP A CG    1 
ATOM   5397 O  OD1   . ASP C 3  591 ? 51.040 204.732 32.801 1.00 19.67  ? 597  ASP A OD1   1 
ATOM   5398 O  OD2   . ASP C 3  591 ? 49.774 203.975 31.169 1.00 20.84  ? 597  ASP A OD2   1 
ATOM   5399 N  N     . GLY C 3  592 ? 52.134 207.560 33.894 1.00 13.07  ? 598  GLY A N     1 
ATOM   5400 C  CA    . GLY C 3  592 ? 51.734 208.028 35.210 1.00 12.22  ? 598  GLY A CA    1 
ATOM   5401 C  C     . GLY C 3  592 ? 51.296 207.016 36.252 1.00 12.36  ? 598  GLY A C     1 
ATOM   5402 O  O     . GLY C 3  592 ? 51.332 207.307 37.451 1.00 11.96  ? 598  GLY A O     1 
ATOM   5403 N  N     . ARG C 3  593 ? 50.890 205.829 35.818 1.00 11.31  ? 599  ARG A N     1 
ATOM   5404 C  CA    . ARG C 3  593 ? 50.433 204.815 36.759 1.00 13.76  ? 599  ARG A CA    1 
ATOM   5405 C  C     . ARG C 3  593 ? 51.494 204.401 37.771 1.00 13.71  ? 599  ARG A C     1 
ATOM   5406 O  O     . ARG C 3  593 ? 52.702 204.563 37.554 1.00 12.99  ? 599  ARG A O     1 
ATOM   5407 C  CB    . ARG C 3  593 ? 49.976 203.558 36.014 1.00 14.72  ? 599  ARG A CB    1 
ATOM   5408 C  CG    . ARG C 3  593 ? 51.131 202.718 35.489 1.00 14.09  ? 599  ARG A CG    1 
ATOM   5409 C  CD    . ARG C 3  593 ? 50.875 202.305 34.059 1.00 15.78  ? 599  ARG A CD    1 
ATOM   5410 N  NE    . ARG C 3  593 ? 50.238 201.005 33.976 1.00 17.13  ? 599  ARG A NE    1 
ATOM   5411 C  CZ    . ARG C 3  593 ? 49.417 200.638 33.003 1.00 16.08  ? 599  ARG A CZ    1 
ATOM   5412 N  NH1   . ARG C 3  593 ? 49.122 201.477 32.022 1.00 13.43  ? 599  ARG A NH1   1 
ATOM   5413 N  NH2   . ARG C 3  593 ? 48.895 199.426 33.014 1.00 18.41  ? 599  ARG A NH2   1 
ATOM   5414 N  N     . LYS C 3  594 ? 51.021 203.855 38.882 1.00 14.19  ? 600  LYS A N     1 
ATOM   5415 C  CA    . LYS C 3  594 ? 51.914 203.349 39.912 1.00 15.97  ? 600  LYS A CA    1 
ATOM   5416 C  C     . LYS C 3  594 ? 52.243 201.933 39.473 1.00 15.85  ? 600  LYS A C     1 
ATOM   5417 O  O     . LYS C 3  594 ? 51.356 201.207 39.037 1.00 17.33  ? 600  LYS A O     1 
ATOM   5418 C  CB    . LYS C 3  594 ? 51.208 203.266 41.263 1.00 15.43  ? 600  LYS A CB    1 
ATOM   5419 C  CG    . LYS C 3  594 ? 50.783 204.575 41.884 1.00 16.57  ? 600  LYS A CG    1 
ATOM   5420 C  CD    . LYS C 3  594 ? 50.102 204.266 43.204 1.00 19.29  ? 600  LYS A CD    1 
ATOM   5421 C  CE    . LYS C 3  594 ? 49.801 205.498 44.021 1.00 21.84  ? 600  LYS A CE    1 
ATOM   5422 N  NZ    . LYS C 3  594 ? 49.202 205.073 45.326 1.00 23.21  ? 600  LYS A NZ    1 
ATOM   5423 N  N     . VAL C 3  595 ? 53.504 201.537 39.566 1.00 15.86  ? 601  VAL A N     1 
ATOM   5424 C  CA    . VAL C 3  595 ? 53.880 200.178 39.203 1.00 15.47  ? 601  VAL A CA    1 
ATOM   5425 C  C     . VAL C 3  595 ? 54.517 199.545 40.435 1.00 14.77  ? 601  VAL A C     1 
ATOM   5426 O  O     . VAL C 3  595 ? 55.620 199.910 40.833 1.00 16.90  ? 601  VAL A O     1 
ATOM   5427 C  CB    . VAL C 3  595 ? 54.884 200.148 38.035 1.00 16.94  ? 601  VAL A CB    1 
ATOM   5428 C  CG1   . VAL C 3  595 ? 55.104 198.704 37.595 1.00 15.36  ? 601  VAL A CG1   1 
ATOM   5429 C  CG2   . VAL C 3  595 ? 54.366 200.986 36.868 1.00 15.25  ? 601  VAL A CG2   1 
ATOM   5430 N  N     . HIS C 3  596 ? 53.804 198.606 41.042 1.00 14.73  ? 602  HIS A N     1 
ATOM   5431 C  CA    . HIS C 3  596 ? 54.260 197.924 42.247 1.00 14.73  ? 602  HIS A CA    1 
ATOM   5432 C  C     . HIS C 3  596 ? 55.606 197.228 42.069 1.00 15.64  ? 602  HIS A C     1 
ATOM   5433 O  O     . HIS C 3  596 ? 55.833 196.561 41.060 1.00 16.11  ? 602  HIS A O     1 
ATOM   5434 C  CB    . HIS C 3  596 ? 53.208 196.893 42.668 1.00 16.14  ? 602  HIS A CB    1 
ATOM   5435 C  CG    . HIS C 3  596 ? 53.562 196.124 43.907 1.00 18.15  ? 602  HIS A CG    1 
ATOM   5436 N  ND1   . HIS C 3  596 ? 53.463 196.663 45.174 1.00 16.78  ? 602  HIS A ND1   1 
ATOM   5437 C  CD2   . HIS C 3  596 ? 53.995 194.851 44.073 1.00 14.95  ? 602  HIS A CD2   1 
ATOM   5438 C  CE1   . HIS C 3  596 ? 53.818 195.755 46.064 1.00 15.15  ? 602  HIS A CE1   1 
ATOM   5439 N  NE2   . HIS C 3  596 ? 54.145 194.646 45.424 1.00 15.48  ? 602  HIS A NE2   1 
ATOM   5440 N  N     . VAL C 3  597 ? 56.498 197.394 43.042 1.00 13.94  ? 603  VAL A N     1 
ATOM   5441 C  CA    . VAL C 3  597 ? 57.802 196.737 42.999 1.00 14.60  ? 603  VAL A CA    1 
ATOM   5442 C  C     . VAL C 3  597 ? 57.770 195.628 44.045 1.00 14.69  ? 603  VAL A C     1 
ATOM   5443 O  O     . VAL C 3  597 ? 57.632 195.888 45.238 1.00 13.60  ? 603  VAL A O     1 
ATOM   5444 C  CB    . VAL C 3  597 ? 58.950 197.714 43.323 1.00 15.15  ? 603  VAL A CB    1 
ATOM   5445 C  CG1   . VAL C 3  597 ? 60.272 196.968 43.385 1.00 14.11  ? 603  VAL A CG1   1 
ATOM   5446 C  CG2   . VAL C 3  597 ? 59.022 198.793 42.260 1.00 17.77  ? 603  VAL A CG2   1 
ATOM   5447 N  N     . ARG C 3  598 ? 57.870 194.389 43.589 1.00 16.07  ? 604  ARG A N     1 
ATOM   5448 C  CA    . ARG C 3  598 ? 57.827 193.246 44.490 1.00 17.88  ? 604  ARG A CA    1 
ATOM   5449 C  C     . ARG C 3  598 ? 59.113 193.101 45.284 1.00 18.74  ? 604  ARG A C     1 
ATOM   5450 O  O     . ARG C 3  598 ? 59.092 192.668 46.433 1.00 18.40  ? 604  ARG A O     1 
ATOM   5451 C  CB    . ARG C 3  598 ? 57.592 191.952 43.702 1.00 17.59  ? 604  ARG A CB    1 
ATOM   5452 C  CG    . ARG C 3  598 ? 56.199 191.812 43.115 1.00 20.53  ? 604  ARG A CG    1 
ATOM   5453 C  CD    . ARG C 3  598 ? 56.108 190.655 42.120 1.00 19.92  ? 604  ARG A CD    1 
ATOM   5454 N  NE    . ARG C 3  598 ? 54.742 190.526 41.616 1.00 23.67  ? 604  ARG A NE    1 
ATOM   5455 C  CZ    . ARG C 3  598 ? 54.381 189.798 40.562 1.00 22.20  ? 604  ARG A CZ    1 
ATOM   5456 N  NH1   . ARG C 3  598 ? 55.283 189.115 39.870 1.00 19.73  ? 604  ARG A NH1   1 
ATOM   5457 N  NH2   . ARG C 3  598 ? 53.108 189.761 40.196 1.00 22.95  ? 604  ARG A NH2   1 
ATOM   5458 N  N     . SER C 3  599 ? 60.228 193.480 44.673 1.00 19.21  ? 605  SER A N     1 
ATOM   5459 C  CA    . SER C 3  599 ? 61.518 193.330 45.317 1.00 20.89  ? 605  SER A CA    1 
ATOM   5460 C  C     . SER C 3  599 ? 62.537 194.382 44.887 1.00 20.44  ? 605  SER A C     1 
ATOM   5461 O  O     . SER C 3  599 ? 62.578 194.788 43.726 1.00 20.61  ? 605  SER A O     1 
ATOM   5462 C  CB    . SER C 3  599 ? 62.053 191.936 45.005 1.00 21.03  ? 605  SER A CB    1 
ATOM   5463 O  OG    . SER C 3  599 ? 63.348 191.756 45.532 1.00 29.10  ? 605  SER A OG    1 
ATOM   5464 N  N     . PRO C 3  600 ? 63.380 194.835 45.828 1.00 19.19  ? 606  PRO A N     1 
ATOM   5465 C  CA    . PRO C 3  600 ? 64.398 195.844 45.518 1.00 18.82  ? 606  PRO A CA    1 
ATOM   5466 C  C     . PRO C 3  600 ? 65.281 195.340 44.389 1.00 17.95  ? 606  PRO A C     1 
ATOM   5467 O  O     . PRO C 3  600 ? 65.633 196.073 43.473 1.00 16.07  ? 606  PRO A O     1 
ATOM   5468 C  CB    . PRO C 3  600 ? 65.173 195.970 46.830 1.00 17.60  ? 606  PRO A CB    1 
ATOM   5469 C  CG    . PRO C 3  600 ? 64.130 195.659 47.861 1.00 18.93  ? 606  PRO A CG    1 
ATOM   5470 C  CD    . PRO C 3  600 ? 63.413 194.476 47.257 1.00 17.49  ? 606  PRO A CD    1 
ATOM   5471 N  N     . HIS C 3  601 ? 65.620 194.065 44.464 1.00 18.97  ? 607  HIS A N     1 
ATOM   5472 C  CA    . HIS C 3  601 ? 66.473 193.444 43.469 1.00 22.67  ? 607  HIS A CA    1 
ATOM   5473 C  C     . HIS C 3  601 ? 65.853 193.390 42.075 1.00 23.70  ? 607  HIS A C     1 
ATOM   5474 O  O     . HIS C 3  601 ? 66.561 193.459 41.070 1.00 24.58  ? 607  HIS A O     1 
ATOM   5475 C  CB    . HIS C 3  601 ? 66.856 192.044 43.951 1.00 25.82  ? 607  HIS A CB    1 
ATOM   5476 C  CG    . HIS C 3  601 ? 67.148 191.081 42.851 1.00 31.28  ? 607  HIS A CG    1 
ATOM   5477 N  ND1   . HIS C 3  601 ? 66.174 190.283 42.289 1.00 32.24  ? 607  HIS A ND1   1 
ATOM   5478 C  CD2   . HIS C 3  601 ? 68.294 190.813 42.178 1.00 32.51  ? 607  HIS A CD2   1 
ATOM   5479 C  CE1   . HIS C 3  601 ? 66.708 189.567 41.315 1.00 34.29  ? 607  HIS A CE1   1 
ATOM   5480 N  NE2   . HIS C 3  601 ? 67.992 189.869 41.227 1.00 34.68  ? 607  HIS A NE2   1 
ATOM   5481 N  N     . ALA C 3  602 ? 64.530 193.284 42.020 1.00 23.42  ? 608  ALA A N     1 
ATOM   5482 C  CA    . ALA C 3  602 ? 63.817 193.213 40.751 1.00 21.40  ? 608  ALA A CA    1 
ATOM   5483 C  C     . ALA C 3  602 ? 63.410 194.584 40.204 1.00 19.87  ? 608  ALA A C     1 
ATOM   5484 O  O     . ALA C 3  602 ? 62.875 194.678 39.098 1.00 20.20  ? 608  ALA A O     1 
ATOM   5485 C  CB    . ALA C 3  602 ? 62.584 192.335 40.911 1.00 22.05  ? 608  ALA A CB    1 
ATOM   5486 N  N     . ALA C 3  603 ? 63.666 195.638 40.971 1.00 17.18  ? 609  ALA A N     1 
ATOM   5487 C  CA    . ALA C 3  603 ? 63.299 196.991 40.554 1.00 14.68  ? 609  ALA A CA    1 
ATOM   5488 C  C     . ALA C 3  603 ? 63.683 197.338 39.115 1.00 14.36  ? 609  ALA A C     1 
ATOM   5489 O  O     . ALA C 3  603 ? 62.850 197.845 38.360 1.00 14.50  ? 609  ALA A O     1 
ATOM   5490 C  CB    . ALA C 3  603 ? 63.899 198.013 41.507 1.00 12.76  ? 609  ALA A CB    1 
ATOM   5491 N  N     . LEU C 3  604 ? 64.931 197.086 38.727 1.00 12.28  ? 610  LEU A N     1 
ATOM   5492 C  CA    . LEU C 3  604 ? 65.343 197.403 37.360 1.00 12.43  ? 610  LEU A CA    1 
ATOM   5493 C  C     . LEU C 3  604 ? 64.439 196.713 36.334 1.00 11.91  ? 610  LEU A C     1 
ATOM   5494 O  O     . LEU C 3  604 ? 64.083 197.306 35.314 1.00 10.90  ? 610  LEU A O     1 
ATOM   5495 C  CB    . LEU C 3  604 ? 66.799 197.004 37.112 1.00 9.54   ? 610  LEU A CB    1 
ATOM   5496 C  CG    . LEU C 3  604 ? 67.328 197.369 35.716 1.00 11.05  ? 610  LEU A CG    1 
ATOM   5497 C  CD1   . LEU C 3  604 ? 67.154 198.869 35.480 1.00 5.95   ? 610  LEU A CD1   1 
ATOM   5498 C  CD2   . LEU C 3  604 ? 68.796 196.953 35.579 1.00 6.15   ? 610  LEU A CD2   1 
ATOM   5499 N  N     . ASN C 3  605 ? 64.060 195.468 36.610 1.00 11.26  ? 611  ASN A N     1 
ATOM   5500 C  CA    . ASN C 3  605 ? 63.189 194.733 35.703 1.00 12.22  ? 611  ASN A CA    1 
ATOM   5501 C  C     . ASN C 3  605 ? 61.783 195.341 35.698 1.00 13.43  ? 611  ASN A C     1 
ATOM   5502 O  O     . ASN C 3  605 ? 61.098 195.342 34.671 1.00 15.28  ? 611  ASN A O     1 
ATOM   5503 C  CB    . ASN C 3  605 ? 63.134 193.251 36.091 1.00 10.98  ? 611  ASN A CB    1 
ATOM   5504 C  CG    . ASN C 3  605 ? 62.064 192.484 35.329 1.00 11.86  ? 611  ASN A CG    1 
ATOM   5505 O  OD1   . ASN C 3  605 ? 60.919 192.372 35.780 1.00 6.08   ? 611  ASN A OD1   1 
ATOM   5506 N  ND2   . ASN C 3  605 ? 62.429 191.965 34.157 1.00 12.14  ? 611  ASN A ND2   1 
ATOM   5507 N  N     . THR C 3  606 ? 61.353 195.863 36.840 1.00 12.70  ? 612  THR A N     1 
ATOM   5508 C  CA    . THR C 3  606 ? 60.044 196.485 36.918 1.00 12.82  ? 612  THR A CA    1 
ATOM   5509 C  C     . THR C 3  606 ? 60.060 197.733 36.058 1.00 12.86  ? 612  THR A C     1 
ATOM   5510 O  O     . THR C 3  606 ? 59.166 197.950 35.250 1.00 15.56  ? 612  THR A O     1 
ATOM   5511 C  CB    . THR C 3  606 ? 59.699 196.881 38.351 1.00 12.51  ? 612  THR A CB    1 
ATOM   5512 O  OG1   . THR C 3  606 ? 59.748 195.717 39.179 1.00 14.10  ? 612  THR A OG1   1 
ATOM   5513 C  CG2   . THR C 3  606 ? 58.304 197.486 38.417 1.00 10.18  ? 612  THR A CG2   1 
ATOM   5514 N  N     . LEU C 3  607 ? 61.094 198.545 36.235 1.00 13.08  ? 613  LEU A N     1 
ATOM   5515 C  CA    . LEU C 3  607 ? 61.250 199.782 35.483 1.00 13.35  ? 613  LEU A CA    1 
ATOM   5516 C  C     . LEU C 3  607 ? 61.320 199.577 33.968 1.00 14.91  ? 613  LEU A C     1 
ATOM   5517 O  O     . LEU C 3  607 ? 60.646 200.282 33.215 1.00 15.49  ? 613  LEU A O     1 
ATOM   5518 C  CB    . LEU C 3  607 ? 62.515 200.511 35.935 1.00 14.02  ? 613  LEU A CB    1 
ATOM   5519 C  CG    . LEU C 3  607 ? 62.911 201.748 35.123 1.00 17.11  ? 613  LEU A CG    1 
ATOM   5520 C  CD1   . LEU C 3  607 ? 61.893 202.862 35.360 1.00 16.59  ? 613  LEU A CD1   1 
ATOM   5521 C  CD2   . LEU C 3  607 ? 64.306 202.213 35.528 1.00 16.61  ? 613  LEU A CD2   1 
ATOM   5522 N  N     . LEU C 3  608 ? 62.125 198.619 33.513 1.00 12.72  ? 614  LEU A N     1 
ATOM   5523 C  CA    . LEU C 3  608 ? 62.253 198.415 32.079 1.00 13.41  ? 614  LEU A CA    1 
ATOM   5524 C  C     . LEU C 3  608 ? 61.117 197.614 31.434 1.00 14.03  ? 614  LEU A C     1 
ATOM   5525 O  O     . LEU C 3  608 ? 60.659 197.957 30.337 1.00 13.66  ? 614  LEU A O     1 
ATOM   5526 C  CB    . LEU C 3  608 ? 63.609 197.780 31.758 1.00 13.13  ? 614  LEU A CB    1 
ATOM   5527 C  CG    . LEU C 3  608 ? 64.844 198.538 32.279 1.00 11.05  ? 614  LEU A CG    1 
ATOM   5528 C  CD1   . LEU C 3  608 ? 66.112 197.885 31.744 1.00 9.30   ? 614  LEU A CD1   1 
ATOM   5529 C  CD2   . LEU C 3  608 ? 64.789 199.998 31.842 1.00 12.77  ? 614  LEU A CD2   1 
ATOM   5530 N  N     . GLN C 3  609 ? 60.642 196.567 32.105 1.00 13.02  ? 615  GLN A N     1 
ATOM   5531 C  CA    . GLN C 3  609 ? 59.565 195.775 31.530 1.00 11.44  ? 615  GLN A CA    1 
ATOM   5532 C  C     . GLN C 3  609 ? 58.328 196.655 31.415 1.00 10.93  ? 615  GLN A C     1 
ATOM   5533 O  O     . GLN C 3  609 ? 57.597 196.592 30.428 1.00 11.10  ? 615  GLN A O     1 
ATOM   5534 C  CB    . GLN C 3  609 ? 59.247 194.546 32.391 1.00 10.99  ? 615  GLN A CB    1 
ATOM   5535 C  CG    . GLN C 3  609 ? 58.470 193.468 31.623 1.00 11.36  ? 615  GLN A CG    1 
ATOM   5536 C  CD    . GLN C 3  609 ? 58.038 192.290 32.489 1.00 9.84   ? 615  GLN A CD    1 
ATOM   5537 O  OE1   . GLN C 3  609 ? 57.045 192.359 33.218 1.00 8.47   ? 615  GLN A OE1   1 
ATOM   5538 N  NE2   . GLN C 3  609 ? 58.790 191.206 32.413 1.00 8.27   ? 615  GLN A NE2   1 
ATOM   5539 N  N     . SER C 3  610 ? 58.106 197.496 32.416 1.00 10.61  ? 616  SER A N     1 
ATOM   5540 C  CA    . SER C 3  610 ? 56.944 198.372 32.394 1.00 10.04  ? 616  SER A CA    1 
ATOM   5541 C  C     . SER C 3  610 ? 57.066 199.369 31.252 1.00 9.86   ? 616  SER A C     1 
ATOM   5542 O  O     . SER C 3  610 ? 56.124 199.553 30.480 1.00 8.85   ? 616  SER A O     1 
ATOM   5543 C  CB    . SER C 3  610 ? 56.799 199.114 33.723 1.00 8.34   ? 616  SER A CB    1 
ATOM   5544 O  OG    . SER C 3  610 ? 55.585 199.844 33.750 1.00 7.08   ? 616  SER A OG    1 
ATOM   5545 N  N     . ALA C 3  611 ? 58.229 200.004 31.140 1.00 9.81   ? 617  ALA A N     1 
ATOM   5546 C  CA    . ALA C 3  611 ? 58.446 200.980 30.076 1.00 9.11   ? 617  ALA A CA    1 
ATOM   5547 C  C     . ALA C 3  611 ? 58.142 200.322 28.732 1.00 8.70   ? 617  ALA A C     1 
ATOM   5548 O  O     . ALA C 3  611 ? 57.395 200.865 27.922 1.00 8.34   ? 617  ALA A O     1 
ATOM   5549 C  CB    . ALA C 3  611 ? 59.888 201.495 30.108 1.00 8.70   ? 617  ALA A CB    1 
ATOM   5550 N  N     . GLY C 3  612 ? 58.709 199.140 28.508 1.00 8.75   ? 618  GLY A N     1 
ATOM   5551 C  CA    . GLY C 3  612 ? 58.465 198.437 27.262 1.00 9.93   ? 618  GLY A CA    1 
ATOM   5552 C  C     . GLY C 3  612 ? 57.004 198.060 27.059 1.00 12.01  ? 618  GLY A C     1 
ATOM   5553 O  O     . GLY C 3  612 ? 56.483 198.111 25.941 1.00 13.51  ? 618  GLY A O     1 
ATOM   5554 N  N     . ALA C 3  613 ? 56.332 197.689 28.142 1.00 10.60  ? 619  ALA A N     1 
ATOM   5555 C  CA    . ALA C 3  613 ? 54.937 197.294 28.051 1.00 11.84  ? 619  ALA A CA    1 
ATOM   5556 C  C     . ALA C 3  613 ? 54.043 198.458 27.659 1.00 13.75  ? 619  ALA A C     1 
ATOM   5557 O  O     . ALA C 3  613 ? 53.195 198.325 26.782 1.00 15.59  ? 619  ALA A O     1 
ATOM   5558 C  CB    . ALA C 3  613 ? 54.472 196.705 29.374 1.00 12.16  ? 619  ALA A CB    1 
ATOM   5559 N  N     . LEU C 3  614 ? 54.222 199.598 28.316 1.00 14.06  ? 620  LEU A N     1 
ATOM   5560 C  CA    . LEU C 3  614 ? 53.412 200.762 28.009 1.00 12.99  ? 620  LEU A CA    1 
ATOM   5561 C  C     . LEU C 3  614 ? 53.728 201.298 26.616 1.00 13.37  ? 620  LEU A C     1 
ATOM   5562 O  O     . LEU C 3  614 ? 52.832 201.738 25.904 1.00 12.96  ? 620  LEU A O     1 
ATOM   5563 C  CB    . LEU C 3  614 ? 53.620 201.856 29.064 1.00 13.47  ? 620  LEU A CB    1 
ATOM   5564 C  CG    . LEU C 3  614 ? 53.200 201.499 30.493 1.00 12.69  ? 620  LEU A CG    1 
ATOM   5565 C  CD1   . LEU C 3  614 ? 53.019 202.776 31.282 1.00 11.68  ? 620  LEU A CD1   1 
ATOM   5566 C  CD2   . LEU C 3  614 ? 51.897 200.714 30.484 1.00 9.61   ? 620  LEU A CD2   1 
ATOM   5567 N  N     . ILE C 3  615 ? 54.997 201.262 26.221 1.00 12.13  ? 621  ILE A N     1 
ATOM   5568 C  CA    . ILE C 3  615 ? 55.350 201.735 24.893 1.00 11.16  ? 621  ILE A CA    1 
ATOM   5569 C  C     . ILE C 3  615 ? 54.625 200.871 23.872 1.00 12.19  ? 621  ILE A C     1 
ATOM   5570 O  O     . ILE C 3  615 ? 53.955 201.379 22.979 1.00 13.37  ? 621  ILE A O     1 
ATOM   5571 C  CB    . ILE C 3  615 ? 56.864 201.641 24.635 1.00 10.77  ? 621  ILE A CB    1 
ATOM   5572 C  CG1   . ILE C 3  615 ? 57.568 202.836 25.273 1.00 7.71   ? 621  ILE A CG1   1 
ATOM   5573 C  CG2   . ILE C 3  615 ? 57.140 201.570 23.127 1.00 9.13   ? 621  ILE A CG2   1 
ATOM   5574 C  CD1   . ILE C 3  615 ? 59.066 202.769 25.173 1.00 8.09   ? 621  ILE A CD1   1 
ATOM   5575 N  N     . CYS C 3  616 ? 54.758 199.557 24.011 1.00 11.99  ? 622  CYS A N     1 
ATOM   5576 C  CA    . CYS C 3  616 ? 54.108 198.642 23.086 1.00 13.46  ? 622  CYS A CA    1 
ATOM   5577 C  C     . CYS C 3  616 ? 52.592 198.764 23.103 1.00 12.29  ? 622  CYS A C     1 
ATOM   5578 O  O     . CYS C 3  616 ? 51.942 198.664 22.061 1.00 10.63  ? 622  CYS A O     1 
ATOM   5579 C  CB    . CYS C 3  616 ? 54.512 197.204 23.403 1.00 14.41  ? 622  CYS A CB    1 
ATOM   5580 S  SG    . CYS C 3  616 ? 56.228 196.853 22.974 1.00 19.65  ? 622  CYS A SG    1 
ATOM   5581 N  N     . LYS C 3  617 ? 52.026 198.986 24.283 1.00 11.17  ? 623  LYS A N     1 
ATOM   5582 C  CA    . LYS C 3  617 ? 50.586 199.103 24.388 1.00 12.50  ? 623  LYS A CA    1 
ATOM   5583 C  C     . LYS C 3  617 ? 50.102 200.343 23.625 1.00 14.15  ? 623  LYS A C     1 
ATOM   5584 O  O     . LYS C 3  617 ? 49.131 200.279 22.858 1.00 14.78  ? 623  LYS A O     1 
ATOM   5585 C  CB    . LYS C 3  617 ? 50.178 199.155 25.861 1.00 12.93  ? 623  LYS A CB    1 
ATOM   5586 C  CG    . LYS C 3  617 ? 48.707 198.875 26.107 1.00 14.56  ? 623  LYS A CG    1 
ATOM   5587 C  CD    . LYS C 3  617 ? 48.392 198.709 27.587 1.00 14.67  ? 623  LYS A CD    1 
ATOM   5588 C  CE    . LYS C 3  617 ? 49.017 197.450 28.169 1.00 15.48  ? 623  LYS A CE    1 
ATOM   5589 N  NZ    . LYS C 3  617 ? 48.676 197.271 29.621 1.00 16.42  ? 623  LYS A NZ    1 
ATOM   5590 N  N     . LEU C 3  618 ? 50.788 201.466 23.815 1.00 13.62  ? 624  LEU A N     1 
ATOM   5591 C  CA    . LEU C 3  618 ? 50.413 202.696 23.126 1.00 12.65  ? 624  LEU A CA    1 
ATOM   5592 C  C     . LEU C 3  618 ? 50.685 202.505 21.633 1.00 12.43  ? 624  LEU A C     1 
ATOM   5593 O  O     . LEU C 3  618 ? 50.022 203.085 20.774 1.00 12.39  ? 624  LEU A O     1 
ATOM   5594 C  CB    . LEU C 3  618 ? 51.242 203.872 23.638 1.00 10.53  ? 624  LEU A CB    1 
ATOM   5595 C  CG    . LEU C 3  618 ? 50.507 205.201 23.800 1.00 12.83  ? 624  LEU A CG    1 
ATOM   5596 C  CD1   . LEU C 3  618 ? 51.529 206.330 23.842 1.00 13.63  ? 624  LEU A CD1   1 
ATOM   5597 C  CD2   . LEU C 3  618 ? 49.528 205.419 22.666 1.00 8.68   ? 624  LEU A CD2   1 
ATOM   5598 N  N     . TRP C 3  619 ? 51.673 201.676 21.339 1.00 11.23  ? 625  TRP A N     1 
ATOM   5599 C  CA    . TRP C 3  619 ? 52.065 201.387 19.968 1.00 10.55  ? 625  TRP A CA    1 
ATOM   5600 C  C     . TRP C 3  619 ? 50.972 200.675 19.157 1.00 10.50  ? 625  TRP A C     1 
ATOM   5601 O  O     . TRP C 3  619 ? 50.602 201.140 18.072 1.00 8.37   ? 625  TRP A O     1 
ATOM   5602 C  CB    . TRP C 3  619 ? 53.354 200.557 19.988 1.00 9.03   ? 625  TRP A CB    1 
ATOM   5603 C  CG    . TRP C 3  619 ? 53.768 199.999 18.666 1.00 10.43  ? 625  TRP A CG    1 
ATOM   5604 C  CD1   . TRP C 3  619 ? 53.954 200.688 17.503 1.00 8.72   ? 625  TRP A CD1   1 
ATOM   5605 C  CD2   . TRP C 3  619 ? 54.114 198.640 18.389 1.00 9.40   ? 625  TRP A CD2   1 
ATOM   5606 N  NE1   . TRP C 3  619 ? 54.400 199.840 16.522 1.00 8.64   ? 625  TRP A NE1   1 
ATOM   5607 C  CE2   . TRP C 3  619 ? 54.508 198.577 17.037 1.00 8.45   ? 625  TRP A CE2   1 
ATOM   5608 C  CE3   . TRP C 3  619 ? 54.136 197.468 19.157 1.00 10.70  ? 625  TRP A CE3   1 
ATOM   5609 C  CZ2   . TRP C 3  619 ? 54.920 197.388 16.429 1.00 9.79   ? 625  TRP A CZ2   1 
ATOM   5610 C  CZ3   . TRP C 3  619 ? 54.550 196.280 18.551 1.00 12.26  ? 625  TRP A CZ3   1 
ATOM   5611 C  CH2   . TRP C 3  619 ? 54.937 196.254 17.198 1.00 10.91  ? 625  TRP A CH2   1 
ATOM   5612 N  N     . ILE C 3  620 ? 50.450 199.560 19.671 1.00 9.28   ? 626  ILE A N     1 
ATOM   5613 C  CA    . ILE C 3  620 ? 49.418 198.834 18.939 1.00 10.71  ? 626  ILE A CA    1 
ATOM   5614 C  C     . ILE C 3  620 ? 48.156 199.684 18.810 1.00 11.81  ? 626  ILE A C     1 
ATOM   5615 O  O     . ILE C 3  620 ? 47.441 199.616 17.808 1.00 13.22  ? 626  ILE A O     1 
ATOM   5616 C  CB    . ILE C 3  620 ? 49.091 197.474 19.604 1.00 11.20  ? 626  ILE A CB    1 
ATOM   5617 C  CG1   . ILE C 3  620 ? 48.422 197.674 20.960 1.00 11.36  ? 626  ILE A CG1   1 
ATOM   5618 C  CG2   . ILE C 3  620 ? 50.376 196.665 19.774 1.00 8.78   ? 626  ILE A CG2   1 
ATOM   5619 C  CD1   . ILE C 3  620 ? 48.096 196.372 21.659 1.00 11.65  ? 626  ILE A CD1   1 
ATOM   5620 N  N     . ILE C 3  621 ? 47.897 200.502 19.823 1.00 12.40  ? 627  ILE A N     1 
ATOM   5621 C  CA    . ILE C 3  621 ? 46.747 201.396 19.810 1.00 11.49  ? 627  ILE A CA    1 
ATOM   5622 C  C     . ILE C 3  621 ? 46.925 202.425 18.692 1.00 12.14  ? 627  ILE A C     1 
ATOM   5623 O  O     . ILE C 3  621 ? 46.049 202.598 17.843 1.00 11.87  ? 627  ILE A O     1 
ATOM   5624 C  CB    . ILE C 3  621 ? 46.627 202.140 21.155 1.00 12.65  ? 627  ILE A CB    1 
ATOM   5625 C  CG1   . ILE C 3  621 ? 46.176 201.161 22.243 1.00 12.10  ? 627  ILE A CG1   1 
ATOM   5626 C  CG2   . ILE C 3  621 ? 45.688 203.322 21.024 1.00 8.48   ? 627  ILE A CG2   1 
ATOM   5627 C  CD1   . ILE C 3  621 ? 46.152 201.768 23.619 1.00 9.81   ? 627  ILE A CD1   1 
ATOM   5628 N  N     . LYS C 3  622 ? 48.068 203.104 18.698 1.00 10.96  ? 628  LYS A N     1 
ATOM   5629 C  CA    . LYS C 3  622 ? 48.360 204.116 17.691 1.00 12.03  ? 628  LYS A CA    1 
ATOM   5630 C  C     . LYS C 3  622 ? 48.446 203.518 16.287 1.00 12.21  ? 628  LYS A C     1 
ATOM   5631 O  O     . LYS C 3  622 ? 48.042 204.154 15.320 1.00 12.40  ? 628  LYS A O     1 
ATOM   5632 C  CB    . LYS C 3  622 ? 49.673 204.836 18.032 1.00 13.94  ? 628  LYS A CB    1 
ATOM   5633 C  CG    . LYS C 3  622 ? 50.042 205.982 17.094 1.00 16.72  ? 628  LYS A CG    1 
ATOM   5634 C  CD    . LYS C 3  622 ? 49.060 207.143 17.175 1.00 18.08  ? 628  LYS A CD    1 
ATOM   5635 C  CE    . LYS C 3  622 ? 49.425 208.214 16.157 1.00 22.29  ? 628  LYS A CE    1 
ATOM   5636 N  NZ    . LYS C 3  622 ? 48.372 209.265 15.994 1.00 26.34  ? 628  LYS A NZ    1 
ATOM   5637 N  N     . THR C 3  623 ? 48.970 202.301 16.169 1.00 11.37  ? 629  THR A N     1 
ATOM   5638 C  CA    . THR C 3  623 ? 49.084 201.666 14.865 1.00 9.59   ? 629  THR A CA    1 
ATOM   5639 C  C     . THR C 3  623 ? 47.702 201.480 14.258 1.00 12.85  ? 629  THR A C     1 
ATOM   5640 O  O     . THR C 3  623 ? 47.453 201.897 13.124 1.00 14.64  ? 629  THR A O     1 
ATOM   5641 C  CB    . THR C 3  623 ? 49.786 200.297 14.955 1.00 6.87   ? 629  THR A CB    1 
ATOM   5642 O  OG1   . THR C 3  623 ? 51.153 200.489 15.319 1.00 6.13   ? 629  THR A OG1   1 
ATOM   5643 C  CG2   . THR C 3  623 ? 49.744 199.581 13.627 1.00 3.59   ? 629  THR A CG2   1 
ATOM   5644 N  N     . GLU C 3  624 ? 46.795 200.869 15.012 1.00 14.48  ? 630  GLU A N     1 
ATOM   5645 C  CA    . GLU C 3  624 ? 45.456 200.652 14.496 1.00 16.02  ? 630  GLU A CA    1 
ATOM   5646 C  C     . GLU C 3  624 ? 44.750 201.954 14.151 1.00 16.44  ? 630  GLU A C     1 
ATOM   5647 O  O     . GLU C 3  624 ? 44.029 202.023 13.165 1.00 17.31  ? 630  GLU A O     1 
ATOM   5648 C  CB    . GLU C 3  624 ? 44.579 199.893 15.486 1.00 15.83  ? 630  GLU A CB    1 
ATOM   5649 C  CG    . GLU C 3  624 ? 43.238 199.541 14.843 1.00 19.11  ? 630  GLU A CG    1 
ATOM   5650 C  CD    . GLU C 3  624 ? 42.059 199.716 15.769 1.00 19.88  ? 630  GLU A CD    1 
ATOM   5651 O  OE1   . GLU C 3  624 ? 42.124 200.583 16.667 1.00 22.63  ? 630  GLU A OE1   1 
ATOM   5652 O  OE2   . GLU C 3  624 ? 41.058 198.997 15.586 1.00 20.67  ? 630  GLU A OE2   1 
ATOM   5653 N  N     . GLU C 3  625 ? 44.949 202.979 14.970 1.00 17.33  ? 631  GLU A N     1 
ATOM   5654 C  CA    . GLU C 3  625 ? 44.312 204.266 14.735 1.00 19.02  ? 631  GLU A CA    1 
ATOM   5655 C  C     . GLU C 3  625 ? 44.818 204.884 13.430 1.00 17.95  ? 631  GLU A C     1 
ATOM   5656 O  O     . GLU C 3  625 ? 44.032 205.396 12.630 1.00 17.39  ? 631  GLU A O     1 
ATOM   5657 C  CB    . GLU C 3  625 ? 44.572 205.198 15.923 1.00 21.04  ? 631  GLU A CB    1 
ATOM   5658 C  CG    . GLU C 3  625 ? 43.854 206.540 15.864 1.00 27.80  ? 631  GLU A CG    1 
ATOM   5659 C  CD    . GLU C 3  625 ? 43.908 207.289 17.198 1.00 34.69  ? 631  GLU A CD    1 
ATOM   5660 O  OE1   . GLU C 3  625 ? 45.003 207.367 17.806 1.00 37.43  ? 631  GLU A OE1   1 
ATOM   5661 O  OE2   . GLU C 3  625 ? 42.856 207.806 17.640 1.00 36.65  ? 631  GLU A OE2   1 
ATOM   5662 N  N     . MET C 3  626 ? 46.127 204.836 13.212 1.00 16.53  ? 632  MET A N     1 
ATOM   5663 C  CA    . MET C 3  626 ? 46.694 205.381 11.987 1.00 17.49  ? 632  MET A CA    1 
ATOM   5664 C  C     . MET C 3  626 ? 46.158 204.608 10.778 1.00 17.87  ? 632  MET A C     1 
ATOM   5665 O  O     . MET C 3  626 ? 45.891 205.194 9.730  1.00 19.19  ? 632  MET A O     1 
ATOM   5666 C  CB    . MET C 3  626 ? 48.225 205.318 12.021 1.00 16.80  ? 632  MET A CB    1 
ATOM   5667 C  CG    . MET C 3  626 ? 48.866 206.443 12.820 1.00 16.91  ? 632  MET A CG    1 
ATOM   5668 S  SD    . MET C 3  626 ? 50.651 206.246 13.047 1.00 20.72  ? 632  MET A SD    1 
ATOM   5669 C  CE    . MET C 3  626 ? 51.291 207.047 11.597 1.00 20.66  ? 632  MET A CE    1 
ATOM   5670 N  N     . LEU C 3  627 ? 45.992 203.297 10.921 1.00 16.64  ? 633  LEU A N     1 
ATOM   5671 C  CA    . LEU C 3  627 ? 45.469 202.501 9.819  1.00 17.86  ? 633  LEU A CA    1 
ATOM   5672 C  C     . LEU C 3  627 ? 44.045 202.934 9.495  1.00 18.17  ? 633  LEU A C     1 
ATOM   5673 O  O     . LEU C 3  627 ? 43.697 203.139 8.332  1.00 17.80  ? 633  LEU A O     1 
ATOM   5674 C  CB    . LEU C 3  627 ? 45.503 201.008 10.164 1.00 15.67  ? 633  LEU A CB    1 
ATOM   5675 C  CG    . LEU C 3  627 ? 46.915 200.427 10.180 1.00 16.35  ? 633  LEU A CG    1 
ATOM   5676 C  CD1   . LEU C 3  627 ? 46.901 198.992 10.684 1.00 16.94  ? 633  LEU A CD1   1 
ATOM   5677 C  CD2   . LEU C 3  627 ? 47.494 200.505 8.773  1.00 15.53  ? 633  LEU A CD2   1 
ATOM   5678 N  N     . VAL C 3  628 ? 43.225 203.081 10.529 1.00 19.01  ? 634  VAL A N     1 
ATOM   5679 C  CA    . VAL C 3  628 ? 41.845 203.494 10.339 1.00 20.22  ? 634  VAL A CA    1 
ATOM   5680 C  C     . VAL C 3  628 ? 41.764 204.875 9.691  1.00 21.95  ? 634  VAL A C     1 
ATOM   5681 O  O     . VAL C 3  628 ? 40.926 205.099 8.821  1.00 22.22  ? 634  VAL A O     1 
ATOM   5682 C  CB    . VAL C 3  628 ? 41.059 203.514 11.679 1.00 20.29  ? 634  VAL A CB    1 
ATOM   5683 C  CG1   . VAL C 3  628 ? 39.660 204.103 11.457 1.00 17.09  ? 634  VAL A CG1   1 
ATOM   5684 C  CG2   . VAL C 3  628 ? 40.933 202.099 12.237 1.00 15.92  ? 634  VAL A CG2   1 
ATOM   5685 N  N     . GLU C 3  629 ? 42.631 205.799 10.098 1.00 25.08  ? 635  GLU A N     1 
ATOM   5686 C  CA    . GLU C 3  629 ? 42.599 207.140 9.516  1.00 28.47  ? 635  GLU A CA    1 
ATOM   5687 C  C     . GLU C 3  629 ? 43.083 207.127 8.071  1.00 27.92  ? 635  GLU A C     1 
ATOM   5688 O  O     . GLU C 3  629 ? 42.899 208.099 7.345  1.00 28.07  ? 635  GLU A O     1 
ATOM   5689 C  CB    . GLU C 3  629 ? 43.426 208.131 10.347 1.00 31.63  ? 635  GLU A CB    1 
ATOM   5690 C  CG    . GLU C 3  629 ? 44.912 207.829 10.428 1.00 40.06  ? 635  GLU A CG    1 
ATOM   5691 C  CD    . GLU C 3  629 ? 45.655 208.784 11.365 1.00 44.80  ? 635  GLU A CD    1 
ATOM   5692 O  OE1   . GLU C 3  629 ? 45.190 208.980 12.518 1.00 45.27  ? 635  GLU A OE1   1 
ATOM   5693 O  OE2   . GLU C 3  629 ? 46.705 209.329 10.950 1.00 44.32  ? 635  GLU A OE2   1 
ATOM   5694 N  N     . LYS C 3  630 ? 43.695 206.023 7.654  1.00 27.53  ? 636  LYS A N     1 
ATOM   5695 C  CA    . LYS C 3  630 ? 44.158 205.896 6.278  1.00 27.51  ? 636  LYS A CA    1 
ATOM   5696 C  C     . LYS C 3  630 ? 43.077 205.229 5.435  1.00 26.78  ? 636  LYS A C     1 
ATOM   5697 O  O     . LYS C 3  630 ? 43.301 204.917 4.269  1.00 28.05  ? 636  LYS A O     1 
ATOM   5698 C  CB    . LYS C 3  630 ? 45.451 205.073 6.200  1.00 29.58  ? 636  LYS A CB    1 
ATOM   5699 C  CG    . LYS C 3  630 ? 46.688 205.784 6.742  1.00 30.47  ? 636  LYS A CG    1 
ATOM   5700 C  CD    . LYS C 3  630 ? 47.953 204.946 6.536  1.00 29.94  ? 636  LYS A CD    1 
ATOM   5701 C  CE    . LYS C 3  630 ? 49.192 205.688 7.017  1.00 27.86  ? 636  LYS A CE    1 
ATOM   5702 N  NZ    . LYS C 3  630 ? 50.429 204.881 6.842  1.00 29.87  ? 636  LYS A NZ    1 
ATOM   5703 N  N     . GLY C 3  631 ? 41.909 205.002 6.036  1.00 25.66  ? 637  GLY A N     1 
ATOM   5704 C  CA    . GLY C 3  631 ? 40.804 204.387 5.320  1.00 22.13  ? 637  GLY A CA    1 
ATOM   5705 C  C     . GLY C 3  631 ? 40.681 202.878 5.437  1.00 21.31  ? 637  GLY A C     1 
ATOM   5706 O  O     . GLY C 3  631 ? 39.717 202.296 4.951  1.00 21.38  ? 637  GLY A O     1 
ATOM   5707 N  N     . LEU C 3  632 ? 41.648 202.228 6.069  1.00 20.19  ? 638  LEU A N     1 
ATOM   5708 C  CA    . LEU C 3  632 ? 41.589 200.776 6.211  1.00 18.72  ? 638  LEU A CA    1 
ATOM   5709 C  C     . LEU C 3  632 ? 40.570 200.413 7.280  1.00 18.28  ? 638  LEU A C     1 
ATOM   5710 O  O     . LEU C 3  632 ? 40.447 201.112 8.280  1.00 19.12  ? 638  LEU A O     1 
ATOM   5711 C  CB    . LEU C 3  632 ? 42.967 200.223 6.593  1.00 17.57  ? 638  LEU A CB    1 
ATOM   5712 C  CG    . LEU C 3  632 ? 44.127 200.446 5.613  1.00 18.70  ? 638  LEU A CG    1 
ATOM   5713 C  CD1   . LEU C 3  632 ? 43.780 199.862 4.259  1.00 21.13  ? 638  LEU A CD1   1 
ATOM   5714 C  CD2   . LEU C 3  632 ? 44.399 201.933 5.469  1.00 24.33  ? 638  LEU A CD2   1 
ATOM   5715 N  N     . LYS C 3  633 ? 39.827 199.332 7.065  1.00 18.18  ? 639  LYS A N     1 
ATOM   5716 C  CA    . LYS C 3  633 ? 38.827 198.889 8.035  1.00 19.69  ? 639  LYS A CA    1 
ATOM   5717 C  C     . LYS C 3  633 ? 39.304 197.648 8.792  1.00 17.69  ? 639  LYS A C     1 
ATOM   5718 O  O     . LYS C 3  633 ? 39.833 196.706 8.192  1.00 18.25  ? 639  LYS A O     1 
ATOM   5719 C  CB    . LYS C 3  633 ? 37.499 198.579 7.340  1.00 23.22  ? 639  LYS A CB    1 
ATOM   5720 C  CG    . LYS C 3  633 ? 36.463 197.950 8.270  1.00 27.15  ? 639  LYS A CG    1 
ATOM   5721 C  CD    . LYS C 3  633 ? 35.169 197.613 7.539  1.00 32.73  ? 639  LYS A CD    1 
ATOM   5722 C  CE    . LYS C 3  633 ? 34.205 196.848 8.445  1.00 35.28  ? 639  LYS A CE    1 
ATOM   5723 N  NZ    . LYS C 3  633 ? 33.970 197.549 9.752  1.00 37.34  ? 639  LYS A NZ    1 
ATOM   5724 N  N     . HIS C 3  634 ? 39.096 197.648 10.106 1.00 14.34  ? 640  HIS A N     1 
ATOM   5725 C  CA    . HIS C 3  634 ? 39.521 196.545 10.963 1.00 11.45  ? 640  HIS A CA    1 
ATOM   5726 C  C     . HIS C 3  634 ? 38.472 195.448 11.025 1.00 11.84  ? 640  HIS A C     1 
ATOM   5727 O  O     . HIS C 3  634 ? 37.400 195.641 11.595 1.00 12.60  ? 640  HIS A O     1 
ATOM   5728 C  CB    . HIS C 3  634 ? 39.802 197.069 12.380 1.00 9.89   ? 640  HIS A CB    1 
ATOM   5729 C  CG    . HIS C 3  634 ? 40.567 196.111 13.241 1.00 10.75  ? 640  HIS A CG    1 
ATOM   5730 N  ND1   . HIS C 3  634 ? 41.107 196.472 14.458 1.00 9.43   ? 640  HIS A ND1   1 
ATOM   5731 C  CD2   . HIS C 3  634 ? 40.922 194.819 13.042 1.00 10.68  ? 640  HIS A CD2   1 
ATOM   5732 C  CE1   . HIS C 3  634 ? 41.768 195.448 14.966 1.00 9.85   ? 640  HIS A CE1   1 
ATOM   5733 N  NE2   . HIS C 3  634 ? 41.674 194.432 14.125 1.00 10.87  ? 640  HIS A NE2   1 
ATOM   5734 N  N     . GLY C 3  635 ? 38.788 194.297 10.440 1.00 11.81  ? 641  GLY A N     1 
ATOM   5735 C  CA    . GLY C 3  635 ? 37.859 193.178 10.444 1.00 10.69  ? 641  GLY A CA    1 
ATOM   5736 C  C     . GLY C 3  635 ? 38.026 192.244 9.256  1.00 11.08  ? 641  GLY A C     1 
ATOM   5737 O  O     . GLY C 3  635 ? 38.591 192.619 8.227  1.00 11.46  ? 641  GLY A O     1 
ATOM   5738 N  N     . TRP C 3  636 ? 37.535 191.020 9.395  1.00 9.64   ? 642  TRP A N     1 
ATOM   5739 C  CA    . TRP C 3  636 ? 37.639 190.041 8.327  1.00 11.24  ? 642  TRP A CA    1 
ATOM   5740 C  C     . TRP C 3  636 ? 36.783 190.480 7.144  1.00 12.60  ? 642  TRP A C     1 
ATOM   5741 O  O     . TRP C 3  636 ? 36.942 189.991 6.031  1.00 11.82  ? 642  TRP A O     1 
ATOM   5742 C  CB    . TRP C 3  636 ? 37.190 188.665 8.822  1.00 9.50   ? 642  TRP A CB    1 
ATOM   5743 C  CG    . TRP C 3  636 ? 38.052 188.093 9.923  1.00 9.52   ? 642  TRP A CG    1 
ATOM   5744 C  CD1   . TRP C 3  636 ? 37.639 187.695 11.162 1.00 8.58   ? 642  TRP A CD1   1 
ATOM   5745 C  CD2   . TRP C 3  636 ? 39.463 187.825 9.868  1.00 8.27   ? 642  TRP A CD2   1 
ATOM   5746 N  NE1   . TRP C 3  636 ? 38.698 187.194 11.878 1.00 7.81   ? 642  TRP A NE1   1 
ATOM   5747 C  CE2   . TRP C 3  636 ? 39.829 187.261 11.111 1.00 7.44   ? 642  TRP A CE2   1 
ATOM   5748 C  CE3   . TRP C 3  636 ? 40.452 188.005 8.888  1.00 8.42   ? 642  TRP A CE3   1 
ATOM   5749 C  CZ2   . TRP C 3  636 ? 41.146 186.875 11.405 1.00 6.63   ? 642  TRP A CZ2   1 
ATOM   5750 C  CZ3   . TRP C 3  636 ? 41.762 187.621 9.179  1.00 8.50   ? 642  TRP A CZ3   1 
ATOM   5751 C  CH2   . TRP C 3  636 ? 42.096 187.062 10.431 1.00 6.52   ? 642  TRP A CH2   1 
ATOM   5752 N  N     . ASP C 3  637 ? 35.873 191.411 7.396  1.00 14.42  ? 643  ASP A N     1 
ATOM   5753 C  CA    . ASP C 3  637 ? 35.001 191.928 6.351  1.00 16.20  ? 643  ASP A CA    1 
ATOM   5754 C  C     . ASP C 3  637 ? 35.579 193.262 5.903  1.00 17.36  ? 643  ASP A C     1 
ATOM   5755 O  O     . ASP C 3  637 ? 34.878 194.093 5.319  1.00 17.71  ? 643  ASP A O     1 
ATOM   5756 C  CB    . ASP C 3  637 ? 33.585 192.124 6.900  1.00 17.27  ? 643  ASP A CB    1 
ATOM   5757 C  CG    . ASP C 3  637 ? 33.541 193.101 8.074  1.00 21.47  ? 643  ASP A CG    1 
ATOM   5758 O  OD1   . ASP C 3  637 ? 34.603 193.355 8.689  1.00 20.50  ? 643  ASP A OD1   1 
ATOM   5759 O  OD2   . ASP C 3  637 ? 32.441 193.607 8.391  1.00 22.65  ? 643  ASP A OD2   1 
ATOM   5760 N  N     . GLY C 3  638 ? 36.867 193.455 6.180  1.00 17.52  ? 644  GLY A N     1 
ATOM   5761 C  CA    . GLY C 3  638 ? 37.527 194.698 5.820  1.00 16.08  ? 644  GLY A CA    1 
ATOM   5762 C  C     . GLY C 3  638 ? 38.895 194.531 5.190  1.00 15.80  ? 644  GLY A C     1 
ATOM   5763 O  O     . GLY C 3  638 ? 39.073 193.729 4.279  1.00 16.95  ? 644  GLY A O     1 
ATOM   5764 N  N     . ASP C 3  639 ? 39.876 195.269 5.695  1.00 15.18  ? 645  ASP A N     1 
ATOM   5765 C  CA    . ASP C 3  639 ? 41.218 195.226 5.135  1.00 14.42  ? 645  ASP A CA    1 
ATOM   5766 C  C     . ASP C 3  639 ? 42.269 194.534 5.994  1.00 14.39  ? 645  ASP A C     1 
ATOM   5767 O  O     . ASP C 3  639 ? 43.173 193.889 5.465  1.00 13.29  ? 645  ASP A O     1 
ATOM   5768 C  CB    . ASP C 3  639 ? 41.657 196.652 4.822  1.00 16.24  ? 645  ASP A CB    1 
ATOM   5769 C  CG    . ASP C 3  639 ? 40.638 197.390 3.970  1.00 18.88  ? 645  ASP A CG    1 
ATOM   5770 O  OD1   . ASP C 3  639 ? 40.422 196.973 2.808  1.00 19.58  ? 645  ASP A OD1   1 
ATOM   5771 O  OD2   . ASP C 3  639 ? 40.039 198.373 4.463  1.00 19.88  ? 645  ASP A OD2   1 
ATOM   5772 N  N     . PHE C 3  640 ? 42.157 194.666 7.313  1.00 12.97  ? 646  PHE A N     1 
ATOM   5773 C  CA    . PHE C 3  640 ? 43.126 194.043 8.204  1.00 12.20  ? 646  PHE A CA    1 
ATOM   5774 C  C     . PHE C 3  640 ? 42.474 193.521 9.476  1.00 12.20  ? 646  PHE A C     1 
ATOM   5775 O  O     . PHE C 3  640 ? 41.353 193.910 9.819  1.00 12.29  ? 646  PHE A O     1 
ATOM   5776 C  CB    . PHE C 3  640 ? 44.220 195.039 8.582  1.00 11.21  ? 646  PHE A CB    1 
ATOM   5777 C  CG    . PHE C 3  640 ? 43.749 196.137 9.491  1.00 12.57  ? 646  PHE A CG    1 
ATOM   5778 C  CD1   . PHE C 3  640 ? 43.059 197.233 8.983  1.00 10.81  ? 646  PHE A CD1   1 
ATOM   5779 C  CD2   . PHE C 3  640 ? 43.984 196.068 10.860 1.00 11.26  ? 646  PHE A CD2   1 
ATOM   5780 C  CE1   . PHE C 3  640 ? 42.614 198.245 9.826  1.00 10.86  ? 646  PHE A CE1   1 
ATOM   5781 C  CE2   . PHE C 3  640 ? 43.542 197.076 11.714 1.00 10.53  ? 646  PHE A CE2   1 
ATOM   5782 C  CZ    . PHE C 3  640 ? 42.858 198.164 11.197 1.00 11.18  ? 646  PHE A CZ    1 
ATOM   5783 N  N     . ALA C 3  641 ? 43.190 192.650 10.181 1.00 10.43  ? 647  ALA A N     1 
ATOM   5784 C  CA    . ALA C 3  641 ? 42.681 192.082 11.418 1.00 9.94   ? 647  ALA A CA    1 
ATOM   5785 C  C     . ALA C 3  641 ? 43.793 191.706 12.382 1.00 11.21  ? 647  ALA A C     1 
ATOM   5786 O  O     . ALA C 3  641 ? 44.665 190.902 12.055 1.00 10.97  ? 647  ALA A O     1 
ATOM   5787 C  CB    . ALA C 3  641 ? 41.835 190.857 11.121 1.00 10.67  ? 647  ALA A CB    1 
ATOM   5788 N  N     . TYR C 3  642 ? 43.763 192.299 13.570 1.00 10.42  ? 648  TYR A N     1 
ATOM   5789 C  CA    . TYR C 3  642 ? 44.746 191.972 14.590 1.00 10.59  ? 648  TYR A CA    1 
ATOM   5790 C  C     . TYR C 3  642 ? 44.487 190.511 14.959 1.00 11.32  ? 648  TYR A C     1 
ATOM   5791 O  O     . TYR C 3  642 ? 43.359 190.138 15.275 1.00 10.33  ? 648  TYR A O     1 
ATOM   5792 C  CB    . TYR C 3  642 ? 44.545 192.855 15.823 1.00 9.95   ? 648  TYR A CB    1 
ATOM   5793 C  CG    . TYR C 3  642 ? 45.317 194.161 15.808 1.00 9.79   ? 648  TYR A CG    1 
ATOM   5794 C  CD1   . TYR C 3  642 ? 45.390 194.943 14.657 1.00 10.01  ? 648  TYR A CD1   1 
ATOM   5795 C  CD2   . TYR C 3  642 ? 45.958 194.622 16.957 1.00 10.15  ? 648  TYR A CD2   1 
ATOM   5796 C  CE1   . TYR C 3  642 ? 46.078 196.143 14.647 1.00 9.52   ? 648  TYR A CE1   1 
ATOM   5797 C  CE2   . TYR C 3  642 ? 46.649 195.825 16.957 1.00 11.31  ? 648  TYR A CE2   1 
ATOM   5798 C  CZ    . TYR C 3  642 ? 46.704 196.578 15.799 1.00 10.48  ? 648  TYR A CZ    1 
ATOM   5799 O  OH    . TYR C 3  642 ? 47.386 197.763 15.796 1.00 9.94   ? 648  TYR A OH    1 
ATOM   5800 N  N     . MET C 3  643 ? 45.525 189.683 14.904 1.00 10.89  ? 649  MET A N     1 
ATOM   5801 C  CA    . MET C 3  643 ? 45.373 188.280 15.244 1.00 9.75   ? 649  MET A CA    1 
ATOM   5802 C  C     . MET C 3  643 ? 46.051 187.982 16.578 1.00 10.14  ? 649  MET A C     1 
ATOM   5803 O  O     . MET C 3  643 ? 45.574 187.153 17.356 1.00 8.93   ? 649  MET A O     1 
ATOM   5804 C  CB    . MET C 3  643 ? 45.971 187.402 14.144 1.00 9.46   ? 649  MET A CB    1 
ATOM   5805 C  CG    . MET C 3  643 ? 45.429 187.705 12.755 1.00 11.13  ? 649  MET A CG    1 
ATOM   5806 S  SD    . MET C 3  643 ? 46.081 186.597 11.494 1.00 13.05  ? 649  MET A SD    1 
ATOM   5807 C  CE    . MET C 3  643 ? 47.824 187.096 11.439 1.00 5.01   ? 649  MET A CE    1 
ATOM   5808 N  N     . ALA C 3  644 ? 47.160 188.661 16.849 1.00 8.27   ? 650  ALA A N     1 
ATOM   5809 C  CA    . ALA C 3  644 ? 47.859 188.432 18.100 1.00 8.06   ? 650  ALA A CA    1 
ATOM   5810 C  C     . ALA C 3  644 ? 48.822 189.544 18.499 1.00 6.40   ? 650  ALA A C     1 
ATOM   5811 O  O     . ALA C 3  644 ? 49.410 190.223 17.661 1.00 4.43   ? 650  ALA A O     1 
ATOM   5812 C  CB    . ALA C 3  644 ? 48.609 187.096 18.036 1.00 6.94   ? 650  ALA A CB    1 
ATOM   5813 N  N     . TRP C 3  645 ? 48.962 189.719 19.804 1.00 6.85   ? 651  TRP A N     1 
ATOM   5814 C  CA    . TRP C 3  645 ? 49.872 190.698 20.369 1.00 8.79   ? 651  TRP A CA    1 
ATOM   5815 C  C     . TRP C 3  645 ? 50.684 189.956 21.423 1.00 8.83   ? 651  TRP A C     1 
ATOM   5816 O  O     . TRP C 3  645 ? 50.161 189.585 22.476 1.00 9.98   ? 651  TRP A O     1 
ATOM   5817 C  CB    . TRP C 3  645 ? 49.097 191.854 21.006 1.00 8.68   ? 651  TRP A CB    1 
ATOM   5818 C  CG    . TRP C 3  645 ? 49.979 192.806 21.754 1.00 9.62   ? 651  TRP A CG    1 
ATOM   5819 C  CD1   . TRP C 3  645 ? 51.194 193.272 21.360 1.00 11.48  ? 651  TRP A CD1   1 
ATOM   5820 C  CD2   . TRP C 3  645 ? 49.712 193.409 23.025 1.00 11.25  ? 651  TRP A CD2   1 
ATOM   5821 N  NE1   . TRP C 3  645 ? 51.707 194.128 22.303 1.00 11.24  ? 651  TRP A NE1   1 
ATOM   5822 C  CE2   . TRP C 3  645 ? 50.817 194.230 23.337 1.00 12.38  ? 651  TRP A CE2   1 
ATOM   5823 C  CE3   . TRP C 3  645 ? 48.646 193.334 23.932 1.00 11.71  ? 651  TRP A CE3   1 
ATOM   5824 C  CZ2   . TRP C 3  645 ? 50.890 194.973 24.520 1.00 13.02  ? 651  TRP A CZ2   1 
ATOM   5825 C  CZ3   . TRP C 3  645 ? 48.718 194.070 25.108 1.00 13.21  ? 651  TRP A CZ3   1 
ATOM   5826 C  CH2   . TRP C 3  645 ? 49.834 194.880 25.392 1.00 13.49  ? 651  TRP A CH2   1 
ATOM   5827 N  N     . VAL C 3  646 ? 51.955 189.717 21.132 1.00 8.59   ? 652  VAL A N     1 
ATOM   5828 C  CA    . VAL C 3  646 ? 52.820 189.001 22.067 1.00 10.13  ? 652  VAL A CA    1 
ATOM   5829 C  C     . VAL C 3  646 ? 53.924 189.923 22.571 1.00 11.82  ? 652  VAL A C     1 
ATOM   5830 O  O     . VAL C 3  646 ? 55.059 189.895 22.082 1.00 14.01  ? 652  VAL A O     1 
ATOM   5831 C  CB    . VAL C 3  646 ? 53.429 187.748 21.398 1.00 8.44   ? 652  VAL A CB    1 
ATOM   5832 C  CG1   . VAL C 3  646 ? 54.360 187.035 22.356 1.00 6.47   ? 652  VAL A CG1   1 
ATOM   5833 C  CG2   . VAL C 3  646 ? 52.300 186.805 20.961 1.00 7.81   ? 652  VAL A CG2   1 
ATOM   5834 N  N     . HIS C 3  647 ? 53.552 190.759 23.535 1.00 11.84  ? 653  HIS A N     1 
ATOM   5835 C  CA    . HIS C 3  647 ? 54.442 191.724 24.160 1.00 11.98  ? 653  HIS A CA    1 
ATOM   5836 C  C     . HIS C 3  647 ? 54.912 192.843 23.237 1.00 12.60  ? 653  HIS A C     1 
ATOM   5837 O  O     . HIS C 3  647 ? 54.258 193.871 23.154 1.00 15.67  ? 653  HIS A O     1 
ATOM   5838 C  CB    . HIS C 3  647 ? 55.613 190.982 24.805 1.00 12.53  ? 653  HIS A CB    1 
ATOM   5839 C  CG    . HIS C 3  647 ? 55.175 189.915 25.759 1.00 13.22  ? 653  HIS A CG    1 
ATOM   5840 N  ND1   . HIS C 3  647 ? 54.360 190.177 26.843 1.00 11.65  ? 653  HIS A ND1   1 
ATOM   5841 C  CD2   . HIS C 3  647 ? 55.385 188.577 25.761 1.00 12.76  ? 653  HIS A CD2   1 
ATOM   5842 C  CE1   . HIS C 3  647 ? 54.088 189.046 27.467 1.00 12.42  ? 653  HIS A CE1   1 
ATOM   5843 N  NE2   . HIS C 3  647 ? 54.697 188.059 26.832 1.00 11.31  ? 653  HIS A NE2   1 
ATOM   5844 N  N     . ASP C 3  648 ? 56.026 192.673 22.540 1.00 13.15  ? 654  ASP A N     1 
ATOM   5845 C  CA    . ASP C 3  648 ? 56.495 193.739 21.655 1.00 14.49  ? 654  ASP A CA    1 
ATOM   5846 C  C     . ASP C 3  648 ? 56.355 193.304 20.199 1.00 15.43  ? 654  ASP A C     1 
ATOM   5847 O  O     . ASP C 3  648 ? 57.129 193.713 19.330 1.00 15.48  ? 654  ASP A O     1 
ATOM   5848 C  CB    . ASP C 3  648 ? 57.956 194.060 21.962 1.00 14.36  ? 654  ASP A CB    1 
ATOM   5849 C  CG    . ASP C 3  648 ? 58.897 192.974 21.490 1.00 17.63  ? 654  ASP A CG    1 
ATOM   5850 O  OD1   . ASP C 3  648 ? 58.514 191.784 21.559 1.00 16.87  ? 654  ASP A OD1   1 
ATOM   5851 O  OD2   . ASP C 3  648 ? 60.020 193.311 21.057 1.00 20.54  ? 654  ASP A OD2   1 
ATOM   5852 N  N     . GLU C 3  649 ? 55.353 192.473 19.944 1.00 16.44  ? 655  GLU A N     1 
ATOM   5853 C  CA    . GLU C 3  649 ? 55.120 191.938 18.615 1.00 17.29  ? 655  GLU A CA    1 
ATOM   5854 C  C     . GLU C 3  649 ? 53.638 191.792 18.270 1.00 17.49  ? 655  GLU A C     1 
ATOM   5855 O  O     . GLU C 3  649 ? 52.827 191.379 19.102 1.00 17.67  ? 655  GLU A O     1 
ATOM   5856 C  CB    . GLU C 3  649 ? 55.793 190.568 18.507 1.00 16.44  ? 655  GLU A CB    1 
ATOM   5857 C  CG    . GLU C 3  649 ? 55.423 189.773 17.268 1.00 17.70  ? 655  GLU A CG    1 
ATOM   5858 C  CD    . GLU C 3  649 ? 55.668 188.277 17.441 1.00 20.14  ? 655  GLU A CD    1 
ATOM   5859 O  OE1   . GLU C 3  649 ? 55.504 187.516 16.463 1.00 18.69  ? 655  GLU A OE1   1 
ATOM   5860 O  OE2   . GLU C 3  649 ? 56.017 187.856 18.562 1.00 20.78  ? 655  GLU A OE2   1 
ATOM   5861 N  N     . ILE C 3  650 ? 53.293 192.143 17.037 1.00 15.98  ? 656  ILE A N     1 
ATOM   5862 C  CA    . ILE C 3  650 ? 51.927 191.995 16.565 1.00 15.27  ? 656  ILE A CA    1 
ATOM   5863 C  C     . ILE C 3  650 ? 51.948 191.220 15.256 1.00 15.62  ? 656  ILE A C     1 
ATOM   5864 O  O     . ILE C 3  650 ? 52.888 191.323 14.456 1.00 14.11  ? 656  ILE A O     1 
ATOM   5865 C  CB    . ILE C 3  650 ? 51.212 193.350 16.316 1.00 14.22  ? 656  ILE A CB    1 
ATOM   5866 C  CG1   . ILE C 3  650 ? 52.067 194.245 15.426 1.00 13.74  ? 656  ILE A CG1   1 
ATOM   5867 C  CG2   . ILE C 3  650 ? 50.881 194.020 17.639 1.00 14.82  ? 656  ILE A CG2   1 
ATOM   5868 C  CD1   . ILE C 3  650 ? 51.401 195.569 15.095 1.00 15.77  ? 656  ILE A CD1   1 
ATOM   5869 N  N     . GLN C 3  651 ? 50.910 190.421 15.067 1.00 14.14  ? 657  GLN A N     1 
ATOM   5870 C  CA    . GLN C 3  651 ? 50.751 189.629 13.867 1.00 12.95  ? 657  GLN A CA    1 
ATOM   5871 C  C     . GLN C 3  651 ? 49.397 190.079 13.360 1.00 12.84  ? 657  GLN A C     1 
ATOM   5872 O  O     . GLN C 3  651 ? 48.387 189.937 14.054 1.00 10.96  ? 657  GLN A O     1 
ATOM   5873 C  CB    . GLN C 3  651 ? 50.738 188.138 14.204 1.00 12.53  ? 657  GLN A CB    1 
ATOM   5874 C  CG    . GLN C 3  651 ? 52.083 187.580 14.646 1.00 11.07  ? 657  GLN A CG    1 
ATOM   5875 C  CD    . GLN C 3  651 ? 53.167 187.780 13.600 1.00 11.98  ? 657  GLN A CD    1 
ATOM   5876 O  OE1   . GLN C 3  651 ? 52.915 187.671 12.410 1.00 12.42  ? 657  GLN A OE1   1 
ATOM   5877 N  NE2   . GLN C 3  651 ? 54.381 188.060 14.047 1.00 11.61  ? 657  GLN A NE2   1 
ATOM   5878 N  N     . VAL C 3  652 ? 49.387 190.644 12.156 1.00 12.36  ? 658  VAL A N     1 
ATOM   5879 C  CA    . VAL C 3  652 ? 48.159 191.150 11.564 1.00 11.50  ? 658  VAL A CA    1 
ATOM   5880 C  C     . VAL C 3  652 ? 47.813 190.498 10.234 1.00 12.33  ? 658  VAL A C     1 
ATOM   5881 O  O     . VAL C 3  652 ? 48.657 190.395 9.340  1.00 13.16  ? 658  VAL A O     1 
ATOM   5882 C  CB    . VAL C 3  652 ? 48.266 192.679 11.352 1.00 11.08  ? 658  VAL A CB    1 
ATOM   5883 C  CG1   . VAL C 3  652 ? 46.990 193.222 10.747 1.00 6.00   ? 658  VAL A CG1   1 
ATOM   5884 C  CG2   . VAL C 3  652 ? 48.578 193.364 12.682 1.00 10.82  ? 658  VAL A CG2   1 
ATOM   5885 N  N     . GLY C 3  653 ? 46.569 190.053 10.112 1.00 11.59  ? 659  GLY A N     1 
ATOM   5886 C  CA    . GLY C 3  653 ? 46.121 189.461 8.867  1.00 11.54  ? 659  GLY A CA    1 
ATOM   5887 C  C     . GLY C 3  653 ? 45.726 190.603 7.944  1.00 13.06  ? 659  GLY A C     1 
ATOM   5888 O  O     . GLY C 3  653 ? 45.114 191.583 8.386  1.00 12.39  ? 659  GLY A O     1 
ATOM   5889 N  N     . CYS C 3  654 ? 46.081 190.499 6.667  1.00 12.46  ? 660  CYS A N     1 
ATOM   5890 C  CA    . CYS C 3  654 ? 45.756 191.551 5.704  1.00 12.47  ? 660  CYS A CA    1 
ATOM   5891 C  C     . CYS C 3  654 ? 45.125 190.938 4.460  1.00 13.22  ? 660  CYS A C     1 
ATOM   5892 O  O     . CYS C 3  654 ? 45.547 189.877 3.991  1.00 14.67  ? 660  CYS A O     1 
ATOM   5893 C  CB    . CYS C 3  654 ? 47.022 192.327 5.318  1.00 11.20  ? 660  CYS A CB    1 
ATOM   5894 S  SG    . CYS C 3  654 ? 48.011 192.905 6.727  1.00 14.40  ? 660  CYS A SG    1 
ATOM   5895 N  N     . ARG C 3  655 ? 44.113 191.604 3.922  1.00 12.20  ? 661  ARG A N     1 
ATOM   5896 C  CA    . ARG C 3  655 ? 43.429 191.095 2.747  1.00 10.44  ? 661  ARG A CA    1 
ATOM   5897 C  C     . ARG C 3  655 ? 44.342 191.033 1.518  1.00 11.36  ? 661  ARG A C     1 
ATOM   5898 O  O     . ARG C 3  655 ? 44.139 190.191 0.642  1.00 11.18  ? 661  ARG A O     1 
ATOM   5899 C  CB    . ARG C 3  655 ? 42.188 191.951 2.467  1.00 7.77   ? 661  ARG A CB    1 
ATOM   5900 C  CG    . ARG C 3  655 ? 41.320 191.461 1.325  1.00 7.83   ? 661  ARG A CG    1 
ATOM   5901 C  CD    . ARG C 3  655 ? 39.976 192.188 1.289  1.00 7.42   ? 661  ARG A CD    1 
ATOM   5902 N  NE    . ARG C 3  655 ? 40.138 193.642 1.297  1.00 6.21   ? 661  ARG A NE    1 
ATOM   5903 C  CZ    . ARG C 3  655 ? 40.652 194.347 0.295  1.00 4.87   ? 661  ARG A CZ    1 
ATOM   5904 N  NH1   . ARG C 3  655 ? 41.054 193.746 -0.821 1.00 1.16   ? 661  ARG A NH1   1 
ATOM   5905 N  NH2   . ARG C 3  655 ? 40.795 195.656 0.427  1.00 5.96   ? 661  ARG A NH2   1 
ATOM   5906 N  N     . THR C 3  656 ? 45.351 191.904 1.455  1.00 10.88  ? 662  THR A N     1 
ATOM   5907 C  CA    . THR C 3  656 ? 46.268 191.924 0.305  1.00 11.04  ? 662  THR A CA    1 
ATOM   5908 C  C     . THR C 3  656 ? 47.702 192.258 0.705  1.00 12.98  ? 662  THR A C     1 
ATOM   5909 O  O     . THR C 3  656 ? 47.946 192.796 1.782  1.00 14.18  ? 662  THR A O     1 
ATOM   5910 C  CB    . THR C 3  656 ? 45.863 192.985 -0.734 1.00 10.16  ? 662  THR A CB    1 
ATOM   5911 O  OG1   . THR C 3  656 ? 46.233 194.286 -0.246 1.00 9.20   ? 662  THR A OG1   1 
ATOM   5912 C  CG2   . THR C 3  656 ? 44.371 192.951 -0.992 1.00 8.67   ? 662  THR A CG2   1 
ATOM   5913 N  N     . GLU C 3  657 ? 48.646 191.956 -0.179 1.00 15.51  ? 663  GLU A N     1 
ATOM   5914 C  CA    . GLU C 3  657 ? 50.049 192.251 0.077  1.00 18.21  ? 663  GLU A CA    1 
ATOM   5915 C  C     . GLU C 3  657 ? 50.231 193.749 0.249  1.00 17.17  ? 663  GLU A C     1 
ATOM   5916 O  O     . GLU C 3  657 ? 50.941 194.196 1.143  1.00 18.86  ? 663  GLU A O     1 
ATOM   5917 C  CB    . GLU C 3  657 ? 50.933 191.781 -1.079 1.00 20.63  ? 663  GLU A CB    1 
ATOM   5918 C  CG    . GLU C 3  657 ? 50.919 190.296 -1.325 1.00 25.93  ? 663  GLU A CG    1 
ATOM   5919 C  CD    . GLU C 3  657 ? 52.287 189.762 -1.721 1.00 29.98  ? 663  GLU A CD    1 
ATOM   5920 O  OE1   . GLU C 3  657 ? 53.022 190.475 -2.448 1.00 30.97  ? 663  GLU A OE1   1 
ATOM   5921 O  OE2   . GLU C 3  657 ? 52.623 188.625 -1.307 1.00 31.40  ? 663  GLU A OE2   1 
ATOM   5922 N  N     . GLU C 3  658 ? 49.589 194.521 -0.618 1.00 17.51  ? 664  GLU A N     1 
ATOM   5923 C  CA    . GLU C 3  658 ? 49.676 195.975 -0.562 1.00 18.57  ? 664  GLU A CA    1 
ATOM   5924 C  C     . GLU C 3  658 ? 49.328 196.479 0.841  1.00 15.95  ? 664  GLU A C     1 
ATOM   5925 O  O     . GLU C 3  658 ? 50.042 197.303 1.405  1.00 16.74  ? 664  GLU A O     1 
ATOM   5926 C  CB    . GLU C 3  658 ? 48.742 196.587 -1.617 1.00 20.88  ? 664  GLU A CB    1 
ATOM   5927 C  CG    . GLU C 3  658 ? 48.587 198.092 -1.535 1.00 30.62  ? 664  GLU A CG    1 
ATOM   5928 C  CD    . GLU C 3  658 ? 48.002 198.698 -2.810 1.00 36.86  ? 664  GLU A CD    1 
ATOM   5929 O  OE1   . GLU C 3  658 ? 47.027 198.132 -3.353 1.00 40.21  ? 664  GLU A OE1   1 
ATOM   5930 O  OE2   . GLU C 3  658 ? 48.513 199.747 -3.268 1.00 39.36  ? 664  GLU A OE2   1 
ATOM   5931 N  N     . ILE C 3  659 ? 48.237 195.966 1.402  1.00 14.72  ? 665  ILE A N     1 
ATOM   5932 C  CA    . ILE C 3  659 ? 47.793 196.340 2.743  1.00 12.96  ? 665  ILE A CA    1 
ATOM   5933 C  C     . ILE C 3  659 ? 48.826 195.898 3.784  1.00 12.84  ? 665  ILE A C     1 
ATOM   5934 O  O     . ILE C 3  659 ? 49.133 196.631 4.720  1.00 13.07  ? 665  ILE A O     1 
ATOM   5935 C  CB    . ILE C 3  659 ? 46.408 195.710 3.049  1.00 12.18  ? 665  ILE A CB    1 
ATOM   5936 C  CG1   . ILE C 3  659 ? 45.344 196.378 2.159  1.00 13.45  ? 665  ILE A CG1   1 
ATOM   5937 C  CG2   . ILE C 3  659 ? 46.057 195.873 4.518  1.00 9.91   ? 665  ILE A CG2   1 
ATOM   5938 C  CD1   . ILE C 3  659 ? 43.967 195.734 2.216  1.00 10.40  ? 665  ILE A CD1   1 
ATOM   5939 N  N     . ALA C 3  660 ? 49.364 194.699 3.611  1.00 13.06  ? 666  ALA A N     1 
ATOM   5940 C  CA    . ALA C 3  660 ? 50.377 194.193 4.523  1.00 14.62  ? 666  ALA A CA    1 
ATOM   5941 C  C     . ALA C 3  660 ? 51.572 195.154 4.507  1.00 16.38  ? 666  ALA A C     1 
ATOM   5942 O  O     . ALA C 3  660 ? 52.132 195.468 5.554  1.00 17.43  ? 666  ALA A O     1 
ATOM   5943 C  CB    . ALA C 3  660 ? 50.809 192.803 4.100  1.00 10.65  ? 666  ALA A CB    1 
ATOM   5944 N  N     . GLN C 3  661 ? 51.952 195.622 3.320  1.00 16.90  ? 667  GLN A N     1 
ATOM   5945 C  CA    . GLN C 3  661 ? 53.068 196.555 3.200  1.00 17.86  ? 667  GLN A CA    1 
ATOM   5946 C  C     . GLN C 3  661 ? 52.735 197.845 3.961  1.00 15.42  ? 667  GLN A C     1 
ATOM   5947 O  O     . GLN C 3  661 ? 53.595 198.415 4.625  1.00 15.16  ? 667  GLN A O     1 
ATOM   5948 C  CB    . GLN C 3  661 ? 53.374 196.870 1.721  1.00 20.51  ? 667  GLN A CB    1 
ATOM   5949 C  CG    . GLN C 3  661 ? 54.640 197.724 1.516  1.00 27.87  ? 667  GLN A CG    1 
ATOM   5950 C  CD    . GLN C 3  661 ? 54.861 198.188 0.067  1.00 31.49  ? 667  GLN A CD    1 
ATOM   5951 O  OE1   . GLN C 3  661 ? 55.003 197.375 -0.854 1.00 32.95  ? 667  GLN A OE1   1 
ATOM   5952 N  NE2   . GLN C 3  661 ? 54.896 199.503 -0.131 1.00 31.05  ? 667  GLN A NE2   1 
ATOM   5953 N  N     . VAL C 3  662 ? 51.490 198.302 3.874  1.00 12.07  ? 668  VAL A N     1 
ATOM   5954 C  CA    . VAL C 3  662 ? 51.103 199.521 4.584  1.00 11.92  ? 668  VAL A CA    1 
ATOM   5955 C  C     . VAL C 3  662 ? 51.014 199.304 6.104  1.00 12.22  ? 668  VAL A C     1 
ATOM   5956 O  O     . VAL C 3  662 ? 51.304 200.218 6.879  1.00 11.72  ? 668  VAL A O     1 
ATOM   5957 C  CB    . VAL C 3  662 ? 49.758 200.095 4.053  1.00 11.61  ? 668  VAL A CB    1 
ATOM   5958 C  CG1   . VAL C 3  662 ? 49.238 201.159 5.001  1.00 9.67   ? 668  VAL A CG1   1 
ATOM   5959 C  CG2   . VAL C 3  662 ? 49.961 200.708 2.661  1.00 8.22   ? 668  VAL A CG2   1 
ATOM   5960 N  N     . VAL C 3  663 ? 50.622 198.107 6.537  1.00 10.81  ? 669  VAL A N     1 
ATOM   5961 C  CA    . VAL C 3  663 ? 50.545 197.831 7.969  1.00 11.75  ? 669  VAL A CA    1 
ATOM   5962 C  C     . VAL C 3  663 ? 51.953 197.862 8.585  1.00 13.15  ? 669  VAL A C     1 
ATOM   5963 O  O     . VAL C 3  663 ? 52.159 198.372 9.690  1.00 12.00  ? 669  VAL A O     1 
ATOM   5964 C  CB    . VAL C 3  663 ? 49.898 196.452 8.254  1.00 10.38  ? 669  VAL A CB    1 
ATOM   5965 C  CG1   . VAL C 3  663 ? 50.009 196.119 9.735  1.00 4.95   ? 669  VAL A CG1   1 
ATOM   5966 C  CG2   . VAL C 3  663 ? 48.434 196.468 7.831  1.00 7.87   ? 669  VAL A CG2   1 
ATOM   5967 N  N     . ILE C 3  664 ? 52.916 197.311 7.856  1.00 14.44  ? 670  ILE A N     1 
ATOM   5968 C  CA    . ILE C 3  664 ? 54.300 197.272 8.304  1.00 15.35  ? 670  ILE A CA    1 
ATOM   5969 C  C     . ILE C 3  664 ? 54.892 198.684 8.412  1.00 16.02  ? 670  ILE A C     1 
ATOM   5970 O  O     . ILE C 3  664 ? 55.542 199.021 9.401  1.00 15.86  ? 670  ILE A O     1 
ATOM   5971 C  CB    . ILE C 3  664 ? 55.140 196.396 7.336  1.00 15.79  ? 670  ILE A CB    1 
ATOM   5972 C  CG1   . ILE C 3  664 ? 54.806 194.919 7.579  1.00 14.08  ? 670  ILE A CG1   1 
ATOM   5973 C  CG2   . ILE C 3  664 ? 56.631 196.681 7.495  1.00 12.32  ? 670  ILE A CG2   1 
ATOM   5974 C  CD1   . ILE C 3  664 ? 55.384 193.976 6.551  1.00 13.79  ? 670  ILE A CD1   1 
ATOM   5975 N  N     . GLU C 3  665 ? 54.650 199.514 7.405  1.00 16.19  ? 671  GLU A N     1 
ATOM   5976 C  CA    . GLU C 3  665 ? 55.166 200.878 7.411  1.00 17.74  ? 671  GLU A CA    1 
ATOM   5977 C  C     . GLU C 3  665 ? 54.451 201.740 8.453  1.00 17.12  ? 671  GLU A C     1 
ATOM   5978 O  O     . GLU C 3  665 ? 55.053 202.623 9.073  1.00 17.81  ? 671  GLU A O     1 
ATOM   5979 C  CB    . GLU C 3  665 ? 54.987 201.514 6.031  1.00 19.77  ? 671  GLU A CB    1 
ATOM   5980 C  CG    . GLU C 3  665 ? 55.583 200.708 4.886  1.00 24.89  ? 671  GLU A CG    1 
ATOM   5981 C  CD    . GLU C 3  665 ? 55.263 201.310 3.526  1.00 27.90  ? 671  GLU A CD    1 
ATOM   5982 O  OE1   . GLU C 3  665 ? 54.086 201.668 3.292  1.00 29.06  ? 671  GLU A OE1   1 
ATOM   5983 O  OE2   . GLU C 3  665 ? 56.184 201.419 2.687  1.00 30.06  ? 671  GLU A OE2   1 
ATOM   5984 N  N     . THR C 3  666 ? 53.162 201.491 8.639  1.00 13.98  ? 672  THR A N     1 
ATOM   5985 C  CA    . THR C 3  666 ? 52.386 202.260 9.597  1.00 13.78  ? 672  THR A CA    1 
ATOM   5986 C  C     . THR C 3  666 ? 52.807 201.933 11.025 1.00 14.03  ? 672  THR A C     1 
ATOM   5987 O  O     . THR C 3  666 ? 52.812 202.807 11.898 1.00 13.98  ? 672  THR A O     1 
ATOM   5988 C  CB    . THR C 3  666 ? 50.883 201.993 9.420  1.00 12.72  ? 672  THR A CB    1 
ATOM   5989 O  OG1   . THR C 3  666 ? 50.506 202.335 8.083  1.00 13.56  ? 672  THR A OG1   1 
ATOM   5990 C  CG2   . THR C 3  666 ? 50.071 202.824 10.384 1.00 10.47  ? 672  THR A CG2   1 
ATOM   5991 N  N     . ALA C 3  667 ? 53.167 200.677 11.262 1.00 12.90  ? 673  ALA A N     1 
ATOM   5992 C  CA    . ALA C 3  667 ? 53.603 200.269 12.587 1.00 13.88  ? 673  ALA A CA    1 
ATOM   5993 C  C     . ALA C 3  667 ? 54.917 200.980 12.950 1.00 13.69  ? 673  ALA A C     1 
ATOM   5994 O  O     . ALA C 3  667 ? 55.147 201.312 14.106 1.00 13.57  ? 673  ALA A O     1 
ATOM   5995 C  CB    . ALA C 3  667 ? 53.773 198.747 12.642 1.00 12.15  ? 673  ALA A CB    1 
ATOM   5996 N  N     . GLN C 3  668 ? 55.769 201.223 11.957 1.00 13.68  ? 674  GLN A N     1 
ATOM   5997 C  CA    . GLN C 3  668 ? 57.041 201.899 12.188 1.00 14.14  ? 674  GLN A CA    1 
ATOM   5998 C  C     . GLN C 3  668 ? 56.776 203.376 12.488 1.00 16.08  ? 674  GLN A C     1 
ATOM   5999 O  O     . GLN C 3  668 ? 57.398 203.959 13.381 1.00 16.51  ? 674  GLN A O     1 
ATOM   6000 C  CB    . GLN C 3  668 ? 57.946 201.723 10.958 1.00 13.02  ? 674  GLN A CB    1 
ATOM   6001 C  CG    . GLN C 3  668 ? 59.282 202.463 10.978 1.00 12.03  ? 674  GLN A CG    1 
ATOM   6002 C  CD    . GLN C 3  668 ? 60.156 202.125 12.179 1.00 11.55  ? 674  GLN A CD    1 
ATOM   6003 O  OE1   . GLN C 3  668 ? 60.050 201.051 12.765 1.00 13.27  ? 674  GLN A OE1   1 
ATOM   6004 N  NE2   . GLN C 3  668 ? 61.039 203.046 12.536 1.00 9.70   ? 674  GLN A NE2   1 
ATOM   6005 N  N     . GLU C 3  669 ? 55.840 203.981 11.760 1.00 17.12  ? 675  GLU A N     1 
ATOM   6006 C  CA    . GLU C 3  669 ? 55.502 205.388 12.000 1.00 18.44  ? 675  GLU A CA    1 
ATOM   6007 C  C     . GLU C 3  669 ? 54.935 205.552 13.410 1.00 17.20  ? 675  GLU A C     1 
ATOM   6008 O  O     . GLU C 3  669 ? 55.258 206.511 14.117 1.00 17.46  ? 675  GLU A O     1 
ATOM   6009 C  CB    . GLU C 3  669 ? 54.469 205.879 10.983 1.00 21.49  ? 675  GLU A CB    1 
ATOM   6010 C  CG    . GLU C 3  669 ? 55.028 206.124 9.591  1.00 28.80  ? 675  GLU A CG    1 
ATOM   6011 C  CD    . GLU C 3  669 ? 53.937 206.266 8.534  1.00 33.20  ? 675  GLU A CD    1 
ATOM   6012 O  OE1   . GLU C 3  669 ? 53.032 207.113 8.709  1.00 34.76  ? 675  GLU A OE1   1 
ATOM   6013 O  OE2   . GLU C 3  669 ? 53.991 205.529 7.521  1.00 36.26  ? 675  GLU A OE2   1 
ATOM   6014 N  N     . ALA C 3  670 ? 54.094 204.602 13.808 1.00 13.58  ? 676  ALA A N     1 
ATOM   6015 C  CA    . ALA C 3  670 ? 53.466 204.613 15.118 1.00 12.02  ? 676  ALA A CA    1 
ATOM   6016 C  C     . ALA C 3  670 ? 54.486 204.467 16.251 1.00 12.52  ? 676  ALA A C     1 
ATOM   6017 O  O     . ALA C 3  670 ? 54.383 205.132 17.281 1.00 10.75  ? 676  ALA A O     1 
ATOM   6018 C  CB    . ALA C 3  670 ? 52.437 203.494 15.198 1.00 12.35  ? 676  ALA A CB    1 
ATOM   6019 N  N     . MET C 3  671 ? 55.467 203.589 16.072 1.00 12.10  ? 677  MET A N     1 
ATOM   6020 C  CA    . MET C 3  671 ? 56.470 203.391 17.107 1.00 11.85  ? 677  MET A CA    1 
ATOM   6021 C  C     . MET C 3  671 ? 57.253 204.684 17.331 1.00 13.81  ? 677  MET A C     1 
ATOM   6022 O  O     . MET C 3  671 ? 57.479 205.096 18.472 1.00 13.20  ? 677  MET A O     1 
ATOM   6023 C  CB    . MET C 3  671 ? 57.419 202.259 16.716 1.00 11.03  ? 677  MET A CB    1 
ATOM   6024 C  CG    . MET C 3  671 ? 58.497 201.954 17.761 1.00 13.58  ? 677  MET A CG    1 
ATOM   6025 S  SD    . MET C 3  671 ? 57.813 201.577 19.388 1.00 16.33  ? 677  MET A SD    1 
ATOM   6026 C  CE    . MET C 3  671 ? 57.373 199.843 19.186 1.00 12.43  ? 677  MET A CE    1 
ATOM   6027 N  N     . ARG C 3  672 ? 57.659 205.331 16.241 1.00 13.97  ? 678  ARG A N     1 
ATOM   6028 C  CA    . ARG C 3  672 ? 58.416 206.572 16.349 1.00 14.66  ? 678  ARG A CA    1 
ATOM   6029 C  C     . ARG C 3  672 ? 57.525 207.649 16.962 1.00 13.84  ? 678  ARG A C     1 
ATOM   6030 O  O     . ARG C 3  672 ? 58.004 208.530 17.675 1.00 13.30  ? 678  ARG A O     1 
ATOM   6031 C  CB    . ARG C 3  672 ? 58.943 206.996 14.969 1.00 13.63  ? 678  ARG A CB    1 
ATOM   6032 C  CG    . ARG C 3  672 ? 59.786 205.910 14.283 1.00 17.97  ? 678  ARG A CG    1 
ATOM   6033 C  CD    . ARG C 3  672 ? 61.198 205.797 14.855 1.00 17.61  ? 678  ARG A CD    1 
ATOM   6034 N  NE    . ARG C 3  672 ? 62.094 206.679 14.118 1.00 26.82  ? 678  ARG A NE    1 
ATOM   6035 C  CZ    . ARG C 3  672 ? 63.048 206.278 13.283 1.00 24.85  ? 678  ARG A CZ    1 
ATOM   6036 N  NH1   . ARG C 3  672 ? 63.273 204.993 13.066 1.00 24.67  ? 678  ARG A NH1   1 
ATOM   6037 N  NH2   . ARG C 3  672 ? 63.752 207.179 12.623 1.00 29.85  ? 678  ARG A NH2   1 
ATOM   6038 N  N     . TRP C 3  673 ? 56.225 207.572 16.704 1.00 13.33  ? 679  TRP A N     1 
ATOM   6039 C  CA    . TRP C 3  673 ? 55.305 208.552 17.281 1.00 13.29  ? 679  TRP A CA    1 
ATOM   6040 C  C     . TRP C 3  673 ? 55.302 208.350 18.805 1.00 14.24  ? 679  TRP A C     1 
ATOM   6041 O  O     . TRP C 3  673 ? 55.401 209.308 19.578 1.00 15.08  ? 679  TRP A O     1 
ATOM   6042 C  CB    . TRP C 3  673 ? 53.897 208.354 16.718 1.00 10.82  ? 679  TRP A CB    1 
ATOM   6043 C  CG    . TRP C 3  673 ? 52.901 209.346 17.235 1.00 12.33  ? 679  TRP A CG    1 
ATOM   6044 C  CD1   . TRP C 3  673 ? 52.586 210.552 16.684 1.00 9.96   ? 679  TRP A CD1   1 
ATOM   6045 C  CD2   . TRP C 3  673 ? 52.104 209.226 18.426 1.00 11.63  ? 679  TRP A CD2   1 
ATOM   6046 N  NE1   . TRP C 3  673 ? 51.645 211.191 17.453 1.00 10.06  ? 679  TRP A NE1   1 
ATOM   6047 C  CE2   . TRP C 3  673 ? 51.331 210.404 18.528 1.00 12.01  ? 679  TRP A CE2   1 
ATOM   6048 C  CE3   . TRP C 3  673 ? 51.972 208.239 19.413 1.00 11.89  ? 679  TRP A CE3   1 
ATOM   6049 C  CZ2   . TRP C 3  673 ? 50.431 210.627 19.585 1.00 9.63   ? 679  TRP A CZ2   1 
ATOM   6050 C  CZ3   . TRP C 3  673 ? 51.078 208.458 20.465 1.00 11.53  ? 679  TRP A CZ3   1 
ATOM   6051 C  CH2   . TRP C 3  673 ? 50.320 209.649 20.538 1.00 13.35  ? 679  TRP A CH2   1 
ATOM   6052 N  N     . VAL C 3  674 ? 55.204 207.093 19.233 1.00 13.35  ? 680  VAL A N     1 
ATOM   6053 C  CA    . VAL C 3  674 ? 55.207 206.770 20.656 1.00 14.91  ? 680  VAL A CA    1 
ATOM   6054 C  C     . VAL C 3  674 ? 56.499 207.265 21.316 1.00 16.31  ? 680  VAL A C     1 
ATOM   6055 O  O     . VAL C 3  674 ? 56.476 207.807 22.421 1.00 17.67  ? 680  VAL A O     1 
ATOM   6056 C  CB    . VAL C 3  674 ? 55.050 205.244 20.876 1.00 14.52  ? 680  VAL A CB    1 
ATOM   6057 C  CG1   . VAL C 3  674 ? 55.175 204.911 22.352 1.00 15.48  ? 680  VAL A CG1   1 
ATOM   6058 C  CG2   . VAL C 3  674 ? 53.690 204.782 20.358 1.00 12.90  ? 680  VAL A CG2   1 
ATOM   6059 N  N     . GLY C 3  675 ? 57.623 207.092 20.630 1.00 16.20  ? 681  GLY A N     1 
ATOM   6060 C  CA    . GLY C 3  675 ? 58.888 207.546 21.177 1.00 15.10  ? 681  GLY A CA    1 
ATOM   6061 C  C     . GLY C 3  675 ? 58.914 209.054 21.354 1.00 15.73  ? 681  GLY A C     1 
ATOM   6062 O  O     . GLY C 3  675 ? 59.396 209.564 22.365 1.00 16.60  ? 681  GLY A O     1 
ATOM   6063 N  N     . ASP C 3  676 ? 58.398 209.778 20.370 1.00 15.50  ? 682  ASP A N     1 
ATOM   6064 C  CA    . ASP C 3  676 ? 58.372 211.232 20.455 1.00 15.47  ? 682  ASP A CA    1 
ATOM   6065 C  C     . ASP C 3  676 ? 57.368 211.663 21.514 1.00 14.28  ? 682  ASP A C     1 
ATOM   6066 O  O     . ASP C 3  676 ? 57.594 212.621 22.242 1.00 13.33  ? 682  ASP A O     1 
ATOM   6067 C  CB    . ASP C 3  676 ? 57.967 211.845 19.117 1.00 18.84  ? 682  ASP A CB    1 
ATOM   6068 C  CG    . ASP C 3  676 ? 57.843 213.356 19.187 1.00 24.03  ? 682  ASP A CG    1 
ATOM   6069 O  OD1   . ASP C 3  676 ? 58.879 214.050 19.077 1.00 30.58  ? 682  ASP A OD1   1 
ATOM   6070 O  OD2   . ASP C 3  676 ? 56.713 213.855 19.366 1.00 24.47  ? 682  ASP A OD2   1 
ATOM   6071 N  N     . HIS C 3  677 ? 56.259 210.936 21.590 1.00 13.91  ? 683  HIS A N     1 
ATOM   6072 C  CA    . HIS C 3  677 ? 55.193 211.232 22.536 1.00 13.44  ? 683  HIS A CA    1 
ATOM   6073 C  C     . HIS C 3  677 ? 55.653 211.261 23.990 1.00 13.38  ? 683  HIS A C     1 
ATOM   6074 O  O     . HIS C 3  677 ? 55.191 212.091 24.768 1.00 12.87  ? 683  HIS A O     1 
ATOM   6075 C  CB    . HIS C 3  677 ? 54.072 210.204 22.389 1.00 12.44  ? 683  HIS A CB    1 
ATOM   6076 C  CG    . HIS C 3  677 ? 52.988 210.344 23.413 1.00 12.16  ? 683  HIS A CG    1 
ATOM   6077 N  ND1   . HIS C 3  677 ? 51.981 211.279 23.310 1.00 11.88  ? 683  HIS A ND1   1 
ATOM   6078 C  CD2   . HIS C 3  677 ? 52.741 209.648 24.549 1.00 11.31  ? 683  HIS A CD2   1 
ATOM   6079 C  CE1   . HIS C 3  677 ? 51.156 211.148 24.335 1.00 11.76  ? 683  HIS A CE1   1 
ATOM   6080 N  NE2   . HIS C 3  677 ? 51.595 210.166 25.101 1.00 9.43   ? 683  HIS A NE2   1 
ATOM   6081 N  N     . TRP C 3  678 ? 56.546 210.348 24.364 1.00 12.42  ? 684  TRP A N     1 
ATOM   6082 C  CA    . TRP C 3  678 ? 57.018 210.313 25.740 1.00 11.77  ? 684  TRP A CA    1 
ATOM   6083 C  C     . TRP C 3  678 ? 58.446 210.802 25.896 1.00 12.14  ? 684  TRP A C     1 
ATOM   6084 O  O     . TRP C 3  678 ? 59.122 210.464 26.864 1.00 12.28  ? 684  TRP A O     1 
ATOM   6085 C  CB    . TRP C 3  678 ? 56.864 208.905 26.338 1.00 8.72   ? 684  TRP A CB    1 
ATOM   6086 C  CG    . TRP C 3  678 ? 55.456 208.607 26.794 1.00 8.07   ? 684  TRP A CG    1 
ATOM   6087 C  CD1   . TRP C 3  678 ? 54.568 209.497 27.321 1.00 7.95   ? 684  TRP A CD1   1 
ATOM   6088 C  CD2   . TRP C 3  678 ? 54.782 207.335 26.776 1.00 8.64   ? 684  TRP A CD2   1 
ATOM   6089 N  NE1   . TRP C 3  678 ? 53.387 208.867 27.628 1.00 7.81   ? 684  TRP A NE1   1 
ATOM   6090 C  CE2   . TRP C 3  678 ? 53.488 207.542 27.305 1.00 6.52   ? 684  TRP A CE2   1 
ATOM   6091 C  CE3   . TRP C 3  678 ? 55.146 206.046 26.365 1.00 7.29   ? 684  TRP A CE3   1 
ATOM   6092 C  CZ2   . TRP C 3  678 ? 52.554 206.511 27.435 1.00 6.89   ? 684  TRP A CZ2   1 
ATOM   6093 C  CZ3   . TRP C 3  678 ? 54.215 205.016 26.495 1.00 8.99   ? 684  TRP A CZ3   1 
ATOM   6094 C  CH2   . TRP C 3  678 ? 52.933 205.259 27.026 1.00 8.73   ? 684  TRP A CH2   1 
ATOM   6095 N  N     . ASN C 3  679 ? 58.896 211.608 24.941 1.00 12.41  ? 685  ASN A N     1 
ATOM   6096 C  CA    . ASN C 3  679 ? 60.241 212.166 24.985 1.00 13.81  ? 685  ASN A CA    1 
ATOM   6097 C  C     . ASN C 3  679 ? 61.298 211.114 25.291 1.00 14.25  ? 685  ASN A C     1 
ATOM   6098 O  O     . ASN C 3  679 ? 62.135 211.306 26.170 1.00 14.83  ? 685  ASN A O     1 
ATOM   6099 C  CB    . ASN C 3  679 ? 60.305 213.269 26.041 1.00 15.46  ? 685  ASN A CB    1 
ATOM   6100 C  CG    . ASN C 3  679 ? 59.358 214.412 25.742 1.00 20.70  ? 685  ASN A CG    1 
ATOM   6101 O  OD1   . ASN C 3  679 ? 59.402 214.997 24.660 1.00 24.03  ? 685  ASN A OD1   1 
ATOM   6102 N  ND2   . ASN C 3  679 ? 58.496 214.739 26.698 1.00 22.38  ? 685  ASN A ND2   1 
ATOM   6103 N  N     . PHE C 3  680 ? 61.272 210.005 24.567 1.00 13.67  ? 686  PHE A N     1 
ATOM   6104 C  CA    . PHE C 3  680 ? 62.246 208.966 24.826 1.00 14.88  ? 686  PHE A CA    1 
ATOM   6105 C  C     . PHE C 3  680 ? 63.641 209.373 24.383 1.00 16.08  ? 686  PHE A C     1 
ATOM   6106 O  O     . PHE C 3  680 ? 63.823 209.961 23.322 1.00 18.35  ? 686  PHE A O     1 
ATOM   6107 C  CB    . PHE C 3  680 ? 61.827 207.661 24.159 1.00 13.74  ? 686  PHE A CB    1 
ATOM   6108 C  CG    . PHE C 3  680 ? 61.810 206.493 25.099 1.00 11.06  ? 686  PHE A CG    1 
ATOM   6109 C  CD1   . PHE C 3  680 ? 61.103 206.565 26.297 1.00 9.63   ? 686  PHE A CD1   1 
ATOM   6110 C  CD2   . PHE C 3  680 ? 62.466 205.313 24.779 1.00 11.47  ? 686  PHE A CD2   1 
ATOM   6111 C  CE1   . PHE C 3  680 ? 61.045 205.478 27.159 1.00 10.32  ? 686  PHE A CE1   1 
ATOM   6112 C  CE2   . PHE C 3  680 ? 62.415 204.214 25.638 1.00 11.10  ? 686  PHE A CE2   1 
ATOM   6113 C  CZ    . PHE C 3  680 ? 61.703 204.297 26.829 1.00 10.54  ? 686  PHE A CZ    1 
ATOM   6114 N  N     . ARG C 3  681 ? 64.627 209.056 25.212 1.00 17.44  ? 687  ARG A N     1 
ATOM   6115 C  CA    . ARG C 3  681 ? 66.010 209.410 24.934 1.00 17.09  ? 687  ARG A CA    1 
ATOM   6116 C  C     . ARG C 3  681 ? 66.750 208.401 24.064 1.00 16.99  ? 687  ARG A C     1 
ATOM   6117 O  O     . ARG C 3  681 ? 67.963 208.479 23.892 1.00 17.90  ? 687  ARG A O     1 
ATOM   6118 C  CB    . ARG C 3  681 ? 66.740 209.637 26.252 1.00 18.84  ? 687  ARG A CB    1 
ATOM   6119 C  CG    . ARG C 3  681 ? 66.219 210.842 27.008 1.00 18.36  ? 687  ARG A CG    1 
ATOM   6120 C  CD    . ARG C 3  681 ? 67.217 211.970 26.925 1.00 20.19  ? 687  ARG A CD    1 
ATOM   6121 N  NE    . ARG C 3  681 ? 67.922 212.112 28.188 1.00 21.04  ? 687  ARG A NE    1 
ATOM   6122 C  CZ    . ARG C 3  681 ? 69.164 212.559 28.304 1.00 21.19  ? 687  ARG A CZ    1 
ATOM   6123 N  NH1   . ARG C 3  681 ? 69.851 212.910 27.231 1.00 20.52  ? 687  ARG A NH1   1 
ATOM   6124 N  NH2   . ARG C 3  681 ? 69.716 212.642 29.501 1.00 21.64  ? 687  ARG A NH2   1 
ATOM   6125 N  N     . CYS C 3  682 ? 66.019 207.438 23.525 1.00 16.25  ? 688  CYS A N     1 
ATOM   6126 C  CA    . CYS C 3  682 ? 66.614 206.474 22.614 1.00 15.54  ? 688  CYS A CA    1 
ATOM   6127 C  C     . CYS C 3  682 ? 65.627 206.356 21.465 1.00 14.94  ? 688  CYS A C     1 
ATOM   6128 O  O     . CYS C 3  682 ? 64.418 206.310 21.684 1.00 15.06  ? 688  CYS A O     1 
ATOM   6129 C  CB    . CYS C 3  682 ? 66.814 205.106 23.272 1.00 14.79  ? 688  CYS A CB    1 
ATOM   6130 S  SG    . CYS C 3  682 ? 67.658 203.897 22.184 1.00 18.69  ? 688  CYS A SG    1 
ATOM   6131 N  N     . LEU C 3  683 ? 66.134 206.342 20.241 1.00 15.74  ? 689  LEU A N     1 
ATOM   6132 C  CA    . LEU C 3  683 ? 65.269 206.217 19.077 1.00 17.12  ? 689  LEU A CA    1 
ATOM   6133 C  C     . LEU C 3  683 ? 64.645 204.819 19.112 1.00 17.31  ? 689  LEU A C     1 
ATOM   6134 O  O     . LEU C 3  683 ? 65.324 203.832 19.415 1.00 16.62  ? 689  LEU A O     1 
ATOM   6135 C  CB    . LEU C 3  683 ? 66.088 206.408 17.798 1.00 16.61  ? 689  LEU A CB    1 
ATOM   6136 C  CG    . LEU C 3  683 ? 65.313 206.536 16.484 1.00 19.75  ? 689  LEU A CG    1 
ATOM   6137 C  CD1   . LEU C 3  683 ? 64.553 207.861 16.442 1.00 16.60  ? 689  LEU A CD1   1 
ATOM   6138 C  CD2   . LEU C 3  683 ? 66.294 206.438 15.315 1.00 20.29  ? 689  LEU A CD2   1 
ATOM   6139 N  N     . LEU C 3  684 ? 63.353 204.733 18.815 1.00 17.47  ? 690  LEU A N     1 
ATOM   6140 C  CA    . LEU C 3  684 ? 62.664 203.448 18.827 1.00 17.39  ? 690  LEU A CA    1 
ATOM   6141 C  C     . LEU C 3  684 ? 62.433 202.930 17.419 1.00 16.89  ? 690  LEU A C     1 
ATOM   6142 O  O     . LEU C 3  684 ? 62.186 203.708 16.504 1.00 19.08  ? 690  LEU A O     1 
ATOM   6143 C  CB    . LEU C 3  684 ? 61.325 203.571 19.557 1.00 16.91  ? 690  LEU A CB    1 
ATOM   6144 C  CG    . LEU C 3  684 ? 61.407 203.938 21.041 1.00 16.21  ? 690  LEU A CG    1 
ATOM   6145 C  CD1   . LEU C 3  684 ? 60.008 203.975 21.636 1.00 16.29  ? 690  LEU A CD1   1 
ATOM   6146 C  CD2   . LEU C 3  684 ? 62.266 202.914 21.775 1.00 14.71  ? 690  LEU A CD2   1 
ATOM   6147 N  N     . ASP C 3  685 ? 62.501 201.613 17.253 1.00 15.75  ? 691  ASP A N     1 
ATOM   6148 C  CA    . ASP C 3  685 ? 62.308 201.001 15.946 1.00 16.04  ? 691  ASP A CA    1 
ATOM   6149 C  C     . ASP C 3  685 ? 61.527 199.693 15.972 1.00 16.66  ? 691  ASP A C     1 
ATOM   6150 O  O     . ASP C 3  685 ? 61.304 199.096 17.029 1.00 17.67  ? 691  ASP A O     1 
ATOM   6151 C  CB    . ASP C 3  685 ? 63.667 200.749 15.284 1.00 15.11  ? 691  ASP A CB    1 
ATOM   6152 C  CG    . ASP C 3  685 ? 64.337 202.028 14.838 1.00 17.23  ? 691  ASP A CG    1 
ATOM   6153 O  OD1   . ASP C 3  685 ? 63.659 202.830 14.161 1.00 15.50  ? 691  ASP A OD1   1 
ATOM   6154 O  OD2   . ASP C 3  685 ? 65.534 202.230 15.154 1.00 16.15  ? 691  ASP A OD2   1 
ATOM   6155 N  N     . THR C 3  686 ? 61.126 199.249 14.786 1.00 15.15  ? 692  THR A N     1 
ATOM   6156 C  CA    . THR C 3  686 ? 60.393 198.005 14.628 1.00 14.59  ? 692  THR A CA    1 
ATOM   6157 C  C     . THR C 3  686 ? 60.942 197.317 13.386 1.00 17.12  ? 692  THR A C     1 
ATOM   6158 O  O     . THR C 3  686 ? 61.538 197.956 12.521 1.00 17.74  ? 692  THR A O     1 
ATOM   6159 C  CB    . THR C 3  686 ? 58.885 198.249 14.392 1.00 13.73  ? 692  THR A CB    1 
ATOM   6160 O  OG1   . THR C 3  686 ? 58.703 198.922 13.140 1.00 11.01  ? 692  THR A OG1   1 
ATOM   6161 C  CG2   . THR C 3  686 ? 58.281 199.095 15.503 1.00 11.95  ? 692  THR A CG2   1 
ATOM   6162 N  N     . GLU C 3  687 ? 60.745 196.010 13.305 1.00 20.11  ? 693  GLU A N     1 
ATOM   6163 C  CA    . GLU C 3  687 ? 61.180 195.244 12.152 1.00 21.28  ? 693  GLU A CA    1 
ATOM   6164 C  C     . GLU C 3  687 ? 59.930 194.493 11.705 1.00 20.77  ? 693  GLU A C     1 
ATOM   6165 O  O     . GLU C 3  687 ? 59.264 193.838 12.516 1.00 17.31  ? 693  GLU A O     1 
ATOM   6166 C  CB    . GLU C 3  687 ? 62.292 194.256 12.532 1.00 24.16  ? 693  GLU A CB    1 
ATOM   6167 C  CG    . GLU C 3  687 ? 63.234 193.931 11.366 1.00 31.12  ? 693  GLU A CG    1 
ATOM   6168 C  CD    . GLU C 3  687 ? 64.215 192.791 11.661 1.00 35.15  ? 693  GLU A CD    1 
ATOM   6169 O  OE1   . GLU C 3  687 ? 63.789 191.613 11.660 1.00 35.73  ? 693  GLU A OE1   1 
ATOM   6170 O  OE2   . GLU C 3  687 ? 65.414 193.074 11.896 1.00 37.03  ? 693  GLU A OE2   1 
ATOM   6171 N  N     . GLY C 3  688 ? 59.601 194.605 10.422 1.00 20.98  ? 694  GLY A N     1 
ATOM   6172 C  CA    . GLY C 3  688 ? 58.419 193.935 9.912  1.00 21.14  ? 694  GLY A CA    1 
ATOM   6173 C  C     . GLY C 3  688 ? 58.697 192.902 8.842  1.00 21.04  ? 694  GLY A C     1 
ATOM   6174 O  O     . GLY C 3  688 ? 59.693 192.983 8.120  1.00 22.85  ? 694  GLY A O     1 
ATOM   6175 N  N     . LYS C 3  689 ? 57.801 191.927 8.736  1.00 20.29  ? 695  LYS A N     1 
ATOM   6176 C  CA    . LYS C 3  689 ? 57.928 190.860 7.753  1.00 19.43  ? 695  LYS A CA    1 
ATOM   6177 C  C     . LYS C 3  689 ? 56.567 190.477 7.196  1.00 19.35  ? 695  LYS A C     1 
ATOM   6178 O  O     . LYS C 3  689 ? 55.580 190.388 7.931  1.00 18.19  ? 695  LYS A O     1 
ATOM   6179 C  CB    . LYS C 3  689 ? 58.553 189.623 8.389  1.00 21.03  ? 695  LYS A CB    1 
ATOM   6180 C  CG    . LYS C 3  689 ? 59.927 189.844 8.969  1.00 23.30  ? 695  LYS A CG    1 
ATOM   6181 C  CD    . LYS C 3  689 ? 60.397 188.586 9.674  1.00 26.89  ? 695  LYS A CD    1 
ATOM   6182 C  CE    . LYS C 3  689 ? 61.823 188.720 10.180 1.00 26.85  ? 695  LYS A CE    1 
ATOM   6183 N  NZ    . LYS C 3  689 ? 62.223 187.473 10.873 1.00 29.15  ? 695  LYS A NZ    1 
ATOM   6184 N  N     . MET C 3  690 ? 56.522 190.243 5.892  1.00 19.14  ? 696  MET A N     1 
ATOM   6185 C  CA    . MET C 3  690 ? 55.294 189.840 5.228  1.00 19.84  ? 696  MET A CA    1 
ATOM   6186 C  C     . MET C 3  690 ? 55.421 188.356 4.888  1.00 19.75  ? 696  MET A C     1 
ATOM   6187 O  O     . MET C 3  690 ? 56.476 187.911 4.435  1.00 22.35  ? 696  MET A O     1 
ATOM   6188 C  CB    . MET C 3  690 ? 55.092 190.661 3.951  1.00 19.52  ? 696  MET A CB    1 
ATOM   6189 C  CG    . MET C 3  690 ? 53.783 190.384 3.239  1.00 22.79  ? 696  MET A CG    1 
ATOM   6190 S  SD    . MET C 3  690 ? 53.620 191.344 1.723  1.00 27.16  ? 696  MET A SD    1 
ATOM   6191 C  CE    . MET C 3  690 ? 53.581 193.007 2.389  1.00 25.18  ? 696  MET A CE    1 
ATOM   6192 N  N     . GLY C 3  691 ? 54.358 187.590 5.110  1.00 19.19  ? 697  GLY A N     1 
ATOM   6193 C  CA    . GLY C 3  691 ? 54.404 186.168 4.810  1.00 17.77  ? 697  GLY A CA    1 
ATOM   6194 C  C     . GLY C 3  691 ? 53.057 185.503 5.023  1.00 18.35  ? 697  GLY A C     1 
ATOM   6195 O  O     . GLY C 3  691 ? 52.105 186.165 5.428  1.00 17.94  ? 697  GLY A O     1 
ATOM   6196 N  N     . PRO C 3  692 ? 52.940 184.192 4.763  1.00 17.86  ? 698  PRO A N     1 
ATOM   6197 C  CA    . PRO C 3  692 ? 51.670 183.479 4.942  1.00 17.25  ? 698  PRO A CA    1 
ATOM   6198 C  C     . PRO C 3  692 ? 51.293 183.131 6.384  1.00 16.58  ? 698  PRO A C     1 
ATOM   6199 O  O     . PRO C 3  692 ? 50.116 183.152 6.738  1.00 16.98  ? 698  PRO A O     1 
ATOM   6200 C  CB    . PRO C 3  692 ? 51.862 182.223 4.093  1.00 16.77  ? 698  PRO A CB    1 
ATOM   6201 C  CG    . PRO C 3  692 ? 53.319 181.942 4.271  1.00 16.11  ? 698  PRO A CG    1 
ATOM   6202 C  CD    . PRO C 3  692 ? 53.940 183.321 4.118  1.00 17.43  ? 698  PRO A CD    1 
ATOM   6203 N  N     . ASN C 3  693 ? 52.284 182.808 7.212  1.00 15.59  ? 699  ASN A N     1 
ATOM   6204 C  CA    . ASN C 3  693 ? 52.004 182.422 8.589  1.00 16.79  ? 699  ASN A CA    1 
ATOM   6205 C  C     . ASN C 3  693 ? 53.005 182.952 9.626  1.00 15.79  ? 699  ASN A C     1 
ATOM   6206 O  O     . ASN C 3  693 ? 53.867 183.769 9.309  1.00 14.72  ? 699  ASN A O     1 
ATOM   6207 C  CB    . ASN C 3  693 ? 51.935 180.897 8.669  1.00 17.82  ? 699  ASN A CB    1 
ATOM   6208 C  CG    . ASN C 3  693 ? 53.186 180.239 8.133  1.00 18.69  ? 699  ASN A CG    1 
ATOM   6209 O  OD1   . ASN C 3  693 ? 54.294 180.530 8.594  1.00 20.24  ? 699  ASN A OD1   1 
ATOM   6210 N  ND2   . ASN C 3  693 ? 53.024 179.356 7.148  1.00 15.96  ? 699  ASN A ND2   1 
ATOM   6211 N  N     . TRP C 3  694 ? 52.887 182.467 10.863 1.00 13.62  ? 700  TRP A N     1 
ATOM   6212 C  CA    . TRP C 3  694 ? 53.759 182.897 11.951 1.00 13.60  ? 700  TRP A CA    1 
ATOM   6213 C  C     . TRP C 3  694 ? 55.173 182.340 11.852 1.00 15.03  ? 700  TRP A C     1 
ATOM   6214 O  O     . TRP C 3  694 ? 56.101 182.909 12.408 1.00 16.75  ? 700  TRP A O     1 
ATOM   6215 C  CB    . TRP C 3  694 ? 53.161 182.491 13.297 1.00 13.63  ? 700  TRP A CB    1 
ATOM   6216 C  CG    . TRP C 3  694 ? 53.459 183.444 14.422 1.00 12.25  ? 700  TRP A CG    1 
ATOM   6217 C  CD1   . TRP C 3  694 ? 54.395 184.437 14.431 1.00 11.13  ? 700  TRP A CD1   1 
ATOM   6218 C  CD2   . TRP C 3  694 ? 52.784 183.519 15.686 1.00 11.65  ? 700  TRP A CD2   1 
ATOM   6219 N  NE1   . TRP C 3  694 ? 54.339 185.129 15.614 1.00 10.40  ? 700  TRP A NE1   1 
ATOM   6220 C  CE2   . TRP C 3  694 ? 53.360 184.587 16.404 1.00 12.43  ? 700  TRP A CE2   1 
ATOM   6221 C  CE3   . TRP C 3  694 ? 51.746 182.787 16.279 1.00 10.74  ? 700  TRP A CE3   1 
ATOM   6222 C  CZ2   . TRP C 3  694 ? 52.931 184.949 17.692 1.00 13.12  ? 700  TRP A CZ2   1 
ATOM   6223 C  CZ3   . TRP C 3  694 ? 51.317 183.143 17.554 1.00 11.58  ? 700  TRP A CZ3   1 
ATOM   6224 C  CH2   . TRP C 3  694 ? 51.910 184.219 18.248 1.00 12.42  ? 700  TRP A CH2   1 
ATOM   6225 N  N     . ALA C 3  695 ? 55.348 181.226 11.156 1.00 16.10  ? 701  ALA A N     1 
ATOM   6226 C  CA    . ALA C 3  695 ? 56.685 180.653 11.016 1.00 17.98  ? 701  ALA A CA    1 
ATOM   6227 C  C     . ALA C 3  695 ? 57.569 181.577 10.189 1.00 18.96  ? 701  ALA A C     1 
ATOM   6228 O  O     . ALA C 3  695 ? 58.762 181.712 10.451 1.00 20.81  ? 701  ALA A O     1 
ATOM   6229 C  CB    . ALA C 3  695 ? 56.612 179.284 10.355 1.00 17.53  ? 701  ALA A CB    1 
ATOM   6230 N  N     . ILE C 3  696 ? 56.977 182.220 9.191  1.00 19.92  ? 702  ILE A N     1 
ATOM   6231 C  CA    . ILE C 3  696 ? 57.721 183.124 8.326  1.00 19.05  ? 702  ILE A CA    1 
ATOM   6232 C  C     . ILE C 3  696 ? 57.695 184.563 8.822  1.00 20.03  ? 702  ILE A C     1 
ATOM   6233 O  O     . ILE C 3  696 ? 58.644 185.311 8.610  1.00 19.98  ? 702  ILE A O     1 
ATOM   6234 C  CB    . ILE C 3  696 ? 57.160 183.060 6.891  1.00 21.28  ? 702  ILE A CB    1 
ATOM   6235 C  CG1   . ILE C 3  696 ? 57.386 181.652 6.333  1.00 23.58  ? 702  ILE A CG1   1 
ATOM   6236 C  CG2   . ILE C 3  696 ? 57.815 184.120 6.002  1.00 17.52  ? 702  ILE A CG2   1 
ATOM   6237 C  CD1   . ILE C 3  696 ? 56.550 181.337 5.117  1.00 26.50  ? 702  ILE A CD1   1 
ATOM   6238 N  N     . CYS C 3  697 ? 56.627 184.948 9.511  1.00 21.15  ? 703  CYS A N     1 
ATOM   6239 C  CA    . CYS C 3  697 ? 56.509 186.320 9.990  1.00 24.14  ? 703  CYS A CA    1 
ATOM   6240 C  C     . CYS C 3  697 ? 57.101 186.669 11.356 1.00 26.82  ? 703  CYS A C     1 
ATOM   6241 O  O     . CYS C 3  697 ? 56.802 187.729 11.904 1.00 26.56  ? 703  CYS A O     1 
ATOM   6242 C  CB    . CYS C 3  697 ? 55.042 186.759 9.937  1.00 22.44  ? 703  CYS A CB    1 
ATOM   6243 S  SG    . CYS C 3  697 ? 54.411 186.932 8.252  1.00 22.34  ? 703  CYS A SG    1 
ATOM   6244 N  N     . HIS C 3  698 ? 57.938 185.801 11.915 1.00 31.09  ? 704  HIS A N     1 
ATOM   6245 C  CA    . HIS C 3  698 ? 58.564 186.114 13.201 1.00 35.22  ? 704  HIS A CA    1 
ATOM   6246 C  C     . HIS C 3  698 ? 59.952 185.525 13.287 1.00 36.09  ? 704  HIS A C     1 
ATOM   6247 O  O     . HIS C 3  698 ? 60.877 186.294 13.616 1.00 37.20  ? 704  HIS A O     1 
ATOM   6248 C  CB    . HIS C 3  698 ? 57.734 185.606 14.389 1.00 37.14  ? 704  HIS A CB    1 
ATOM   6249 C  CG    . HIS C 3  698 ? 58.307 185.979 15.725 1.00 38.81  ? 704  HIS A CG    1 
ATOM   6250 N  ND1   . HIS C 3  698 ? 58.451 187.289 16.137 1.00 41.32  ? 704  HIS A ND1   1 
ATOM   6251 C  CD2   . HIS C 3  698 ? 58.796 185.216 16.733 1.00 39.65  ? 704  HIS A CD2   1 
ATOM   6252 C  CE1   . HIS C 3  698 ? 59.005 187.315 17.337 1.00 40.40  ? 704  HIS A CE1   1 
ATOM   6253 N  NE2   . HIS C 3  698 ? 59.225 186.070 17.722 1.00 38.58  ? 704  HIS A NE2   1 
ATOM   6254 O  OXT   . HIS C 3  698 ? 60.084 184.305 13.036 1.00 39.27  ? 704  HIS A OXT   1 
ATOM   6255 N  N     . LYS D 4  3   ? 67.006 123.303 50.846 1.00 40.79  ? 3    LYS B N     1 
ATOM   6256 C  CA    . LYS D 4  3   ? 65.968 122.456 50.189 1.00 40.67  ? 3    LYS B CA    1 
ATOM   6257 C  C     . LYS D 4  3   ? 64.961 123.289 49.395 1.00 38.83  ? 3    LYS B C     1 
ATOM   6258 O  O     . LYS D 4  3   ? 64.168 122.750 48.622 1.00 38.33  ? 3    LYS B O     1 
ATOM   6259 C  CB    . LYS D 4  3   ? 65.234 121.616 51.237 1.00 43.08  ? 3    LYS B CB    1 
ATOM   6260 C  CG    . LYS D 4  3   ? 66.163 120.767 52.092 1.00 48.41  ? 3    LYS B CG    1 
ATOM   6261 C  CD    . LYS D 4  3   ? 65.383 119.831 53.011 1.00 52.61  ? 3    LYS B CD    1 
ATOM   6262 C  CE    . LYS D 4  3   ? 66.305 119.115 53.998 1.00 53.06  ? 3    LYS B CE    1 
ATOM   6263 N  NZ    . LYS D 4  3   ? 66.968 120.074 54.934 1.00 52.65  ? 3    LYS B NZ    1 
ATOM   6264 N  N     . ILE D 4  4   ? 64.993 124.604 49.587 1.00 36.68  ? 4    ILE B N     1 
ATOM   6265 C  CA    . ILE D 4  4   ? 64.092 125.501 48.868 1.00 34.74  ? 4    ILE B CA    1 
ATOM   6266 C  C     . ILE D 4  4   ? 64.678 125.842 47.500 1.00 32.37  ? 4    ILE B C     1 
ATOM   6267 O  O     . ILE D 4  4   ? 65.882 126.063 47.372 1.00 33.15  ? 4    ILE B O     1 
ATOM   6268 C  CB    . ILE D 4  4   ? 63.865 126.819 49.649 1.00 34.26  ? 4    ILE B CB    1 
ATOM   6269 C  CG1   . ILE D 4  4   ? 63.054 126.540 50.916 1.00 33.36  ? 4    ILE B CG1   1 
ATOM   6270 C  CG2   . ILE D 4  4   ? 63.137 127.827 48.774 1.00 33.67  ? 4    ILE B CG2   1 
ATOM   6271 C  CD1   . ILE D 4  4   ? 62.942 127.728 51.838 1.00 31.74  ? 4    ILE B CD1   1 
ATOM   6272 N  N     . ILE D 4  5   ? 63.828 125.878 46.481 1.00 30.14  ? 5    ILE B N     1 
ATOM   6273 C  CA    . ILE D 4  5   ? 64.284 126.203 45.137 1.00 27.95  ? 5    ILE B CA    1 
ATOM   6274 C  C     . ILE D 4  5   ? 64.164 127.700 44.922 1.00 26.63  ? 5    ILE B C     1 
ATOM   6275 O  O     . ILE D 4  5   ? 63.091 128.274 45.097 1.00 26.44  ? 5    ILE B O     1 
ATOM   6276 C  CB    . ILE D 4  5   ? 63.445 125.493 44.061 1.00 28.42  ? 5    ILE B CB    1 
ATOM   6277 C  CG1   . ILE D 4  5   ? 63.566 123.978 44.210 1.00 28.52  ? 5    ILE B CG1   1 
ATOM   6278 C  CG2   . ILE D 4  5   ? 63.927 125.910 42.679 1.00 29.38  ? 5    ILE B CG2   1 
ATOM   6279 C  CD1   . ILE D 4  5   ? 62.762 123.217 43.184 1.00 31.43  ? 5    ILE B CD1   1 
ATOM   6280 N  N     . HIS D 4  6   ? 65.271 128.328 44.550 1.00 25.08  ? 6    HIS B N     1 
ATOM   6281 C  CA    . HIS D 4  6   ? 65.286 129.762 44.311 1.00 23.88  ? 6    HIS B CA    1 
ATOM   6282 C  C     . HIS D 4  6   ? 65.079 130.011 42.819 1.00 22.63  ? 6    HIS B C     1 
ATOM   6283 O  O     . HIS D 4  6   ? 65.992 129.840 42.012 1.00 23.30  ? 6    HIS B O     1 
ATOM   6284 C  CB    . HIS D 4  6   ? 66.614 130.335 44.805 1.00 25.87  ? 6    HIS B CB    1 
ATOM   6285 C  CG    . HIS D 4  6   ? 66.878 130.052 46.253 1.00 29.28  ? 6    HIS B CG    1 
ATOM   6286 N  ND1   . HIS D 4  6   ? 66.167 130.653 47.271 1.00 30.38  ? 6    HIS B ND1   1 
ATOM   6287 C  CD2   . HIS D 4  6   ? 67.729 129.185 46.851 1.00 29.69  ? 6    HIS B CD2   1 
ATOM   6288 C  CE1   . HIS D 4  6   ? 66.567 130.167 48.432 1.00 29.96  ? 6    HIS B CE1   1 
ATOM   6289 N  NE2   . HIS D 4  6   ? 67.515 129.274 48.205 1.00 30.84  ? 6    HIS B NE2   1 
ATOM   6290 N  N     . LEU D 4  7   ? 63.862 130.411 42.467 1.00 18.45  ? 7    LEU B N     1 
ATOM   6291 C  CA    . LEU D 4  7   ? 63.481 130.653 41.085 1.00 16.51  ? 7    LEU B CA    1 
ATOM   6292 C  C     . LEU D 4  7   ? 63.959 131.968 40.476 1.00 16.75  ? 7    LEU B C     1 
ATOM   6293 O  O     . LEU D 4  7   ? 64.428 132.867 41.178 1.00 16.13  ? 7    LEU B O     1 
ATOM   6294 C  CB    . LEU D 4  7   ? 61.956 130.603 40.957 1.00 15.07  ? 7    LEU B CB    1 
ATOM   6295 C  CG    . LEU D 4  7   ? 61.217 129.400 41.543 1.00 15.40  ? 7    LEU B CG    1 
ATOM   6296 C  CD1   . LEU D 4  7   ? 59.724 129.690 41.516 1.00 13.93  ? 7    LEU B CD1   1 
ATOM   6297 C  CD2   . LEU D 4  7   ? 61.548 128.134 40.764 1.00 13.38  ? 7    LEU B CD2   1 
ATOM   6298 N  N     . THR D 4  8   ? 63.831 132.041 39.150 1.00 15.25  ? 8    THR B N     1 
ATOM   6299 C  CA    . THR D 4  8   ? 64.160 133.217 38.355 1.00 16.00  ? 8    THR B CA    1 
ATOM   6300 C  C     . THR D 4  8   ? 63.086 133.210 37.275 1.00 16.93  ? 8    THR B C     1 
ATOM   6301 O  O     . THR D 4  8   ? 62.454 132.176 37.043 1.00 14.35  ? 8    THR B O     1 
ATOM   6302 C  CB    . THR D 4  8   ? 65.518 133.112 37.632 1.00 15.76  ? 8    THR B CB    1 
ATOM   6303 O  OG1   . THR D 4  8   ? 65.447 132.077 36.639 1.00 17.43  ? 8    THR B OG1   1 
ATOM   6304 C  CG2   . THR D 4  8   ? 66.644 132.829 38.621 1.00 15.49  ? 8    THR B CG2   1 
ATOM   6305 N  N     . ASP D 4  9   ? 62.883 134.352 36.623 1.00 16.79  ? 9    ASP B N     1 
ATOM   6306 C  CA    . ASP D 4  9   ? 61.894 134.455 35.569 1.00 19.30  ? 9    ASP B CA    1 
ATOM   6307 C  C     . ASP D 4  9   ? 62.132 133.417 34.490 1.00 20.75  ? 9    ASP B C     1 
ATOM   6308 O  O     . ASP D 4  9   ? 61.200 132.749 34.052 1.00 21.35  ? 9    ASP B O     1 
ATOM   6309 C  CB    . ASP D 4  9   ? 61.921 135.841 34.911 1.00 20.06  ? 9    ASP B CB    1 
ATOM   6310 C  CG    . ASP D 4  9   ? 61.217 136.899 35.736 1.00 23.38  ? 9    ASP B CG    1 
ATOM   6311 O  OD1   . ASP D 4  9   ? 60.220 136.556 36.411 1.00 22.51  ? 9    ASP B OD1   1 
ATOM   6312 O  OD2   . ASP D 4  9   ? 61.645 138.078 35.696 1.00 25.74  ? 9    ASP B OD2   1 
ATOM   6313 N  N     . ASP D 4  10  ? 63.384 133.281 34.065 1.00 22.35  ? 10   ASP B N     1 
ATOM   6314 C  CA    . ASP D 4  10  ? 63.721 132.350 32.995 1.00 23.48  ? 10   ASP B CA    1 
ATOM   6315 C  C     . ASP D 4  10  ? 63.623 130.870 33.326 1.00 24.11  ? 10   ASP B C     1 
ATOM   6316 O  O     . ASP D 4  10  ? 63.473 130.058 32.418 1.00 24.84  ? 10   ASP B O     1 
ATOM   6317 C  CB    . ASP D 4  10  ? 65.125 132.645 32.458 1.00 26.24  ? 10   ASP B CB    1 
ATOM   6318 C  CG    . ASP D 4  10  ? 65.244 134.038 31.875 1.00 30.34  ? 10   ASP B CG    1 
ATOM   6319 O  OD1   . ASP D 4  10  ? 64.287 134.477 31.206 1.00 32.40  ? 10   ASP B OD1   1 
ATOM   6320 O  OD2   . ASP D 4  10  ? 66.293 134.693 32.076 1.00 32.45  ? 10   ASP B OD2   1 
ATOM   6321 N  N     . SER D 4  11  ? 63.718 130.509 34.603 1.00 23.90  ? 11   SER B N     1 
ATOM   6322 C  CA    . SER D 4  11  ? 63.642 129.097 34.975 1.00 24.82  ? 11   SER B CA    1 
ATOM   6323 C  C     . SER D 4  11  ? 62.291 128.716 35.555 1.00 23.80  ? 11   SER B C     1 
ATOM   6324 O  O     . SER D 4  11  ? 62.031 127.542 35.810 1.00 23.63  ? 11   SER B O     1 
ATOM   6325 C  CB    . SER D 4  11  ? 64.728 128.747 35.997 1.00 25.42  ? 11   SER B CB    1 
ATOM   6326 O  OG    . SER D 4  11  ? 64.353 129.157 37.299 1.00 25.92  ? 11   SER B OG    1 
ATOM   6327 N  N     . PHE D 4  12  ? 61.432 129.705 35.760 1.00 22.89  ? 12   PHE B N     1 
ATOM   6328 C  CA    . PHE D 4  12  ? 60.120 129.447 36.333 1.00 23.63  ? 12   PHE B CA    1 
ATOM   6329 C  C     . PHE D 4  12  ? 59.290 128.458 35.519 1.00 23.92  ? 12   PHE B C     1 
ATOM   6330 O  O     . PHE D 4  12  ? 58.621 127.595 36.077 1.00 23.26  ? 12   PHE B O     1 
ATOM   6331 C  CB    . PHE D 4  12  ? 59.362 130.764 36.498 1.00 22.11  ? 12   PHE B CB    1 
ATOM   6332 C  CG    . PHE D 4  12  ? 58.068 130.628 37.240 1.00 22.44  ? 12   PHE B CG    1 
ATOM   6333 C  CD1   . PHE D 4  12  ? 56.916 130.200 36.590 1.00 20.23  ? 12   PHE B CD1   1 
ATOM   6334 C  CD2   . PHE D 4  12  ? 58.001 130.931 38.599 1.00 23.01  ? 12   PHE B CD2   1 
ATOM   6335 C  CE1   . PHE D 4  12  ? 55.712 130.077 37.277 1.00 20.10  ? 12   PHE B CE1   1 
ATOM   6336 C  CE2   . PHE D 4  12  ? 56.802 130.812 39.298 1.00 21.97  ? 12   PHE B CE2   1 
ATOM   6337 C  CZ    . PHE D 4  12  ? 55.652 130.383 38.632 1.00 21.49  ? 12   PHE B CZ    1 
ATOM   6338 N  N     . ASP D 4  13  ? 59.343 128.577 34.200 1.00 26.57  ? 13   ASP B N     1 
ATOM   6339 C  CA    . ASP D 4  13  ? 58.573 127.694 33.342 1.00 29.48  ? 13   ASP B CA    1 
ATOM   6340 C  C     . ASP D 4  13  ? 58.920 126.214 33.529 1.00 30.15  ? 13   ASP B C     1 
ATOM   6341 O  O     . ASP D 4  13  ? 58.029 125.399 33.772 1.00 31.40  ? 13   ASP B O     1 
ATOM   6342 C  CB    . ASP D 4  13  ? 58.760 128.094 31.880 1.00 34.52  ? 13   ASP B CB    1 
ATOM   6343 C  CG    . ASP D 4  13  ? 57.714 127.479 30.967 1.00 41.36  ? 13   ASP B CG    1 
ATOM   6344 O  OD1   . ASP D 4  13  ? 57.582 126.234 30.955 1.00 43.11  ? 13   ASP B OD1   1 
ATOM   6345 O  OD2   . ASP D 4  13  ? 57.021 128.246 30.257 1.00 44.59  ? 13   ASP B OD2   1 
ATOM   6346 N  N     . THR D 4  14  ? 60.197 125.852 33.433 1.00 29.38  ? 14   THR B N     1 
ATOM   6347 C  CA    . THR D 4  14  ? 60.546 124.444 33.587 1.00 28.86  ? 14   THR B CA    1 
ATOM   6348 C  C     . THR D 4  14  ? 60.621 123.977 35.039 1.00 28.35  ? 14   THR B C     1 
ATOM   6349 O  O     . THR D 4  14  ? 60.400 122.805 35.318 1.00 31.63  ? 14   THR B O     1 
ATOM   6350 C  CB    . THR D 4  14  ? 61.881 124.076 32.875 1.00 27.86  ? 14   THR B CB    1 
ATOM   6351 O  OG1   . THR D 4  14  ? 62.973 124.221 33.785 1.00 29.33  ? 14   THR B OG1   1 
ATOM   6352 C  CG2   . THR D 4  14  ? 62.108 124.960 31.663 1.00 25.90  ? 14   THR B CG2   1 
ATOM   6353 N  N     . ASP D 4  15  ? 60.925 124.874 35.966 1.00 27.07  ? 15   ASP B N     1 
ATOM   6354 C  CA    . ASP D 4  15  ? 61.001 124.482 37.370 1.00 26.65  ? 15   ASP B CA    1 
ATOM   6355 C  C     . ASP D 4  15  ? 59.640 124.312 38.029 1.00 26.50  ? 15   ASP B C     1 
ATOM   6356 O  O     . ASP D 4  15  ? 59.479 123.505 38.943 1.00 23.43  ? 15   ASP B O     1 
ATOM   6357 C  CB    . ASP D 4  15  ? 61.779 125.512 38.179 1.00 29.43  ? 15   ASP B CB    1 
ATOM   6358 C  CG    . ASP D 4  15  ? 63.261 125.349 38.045 1.00 31.25  ? 15   ASP B CG    1 
ATOM   6359 O  OD1   . ASP D 4  15  ? 63.728 124.196 38.073 1.00 35.21  ? 15   ASP B OD1   1 
ATOM   6360 O  OD2   . ASP D 4  15  ? 63.959 126.372 37.929 1.00 33.99  ? 15   ASP B OD2   1 
ATOM   6361 N  N     . VAL D 4  16  ? 58.664 125.083 37.564 1.00 26.83  ? 16   VAL B N     1 
ATOM   6362 C  CA    . VAL D 4  16  ? 57.334 125.038 38.140 1.00 27.31  ? 16   VAL B CA    1 
ATOM   6363 C  C     . VAL D 4  16  ? 56.269 124.450 37.224 1.00 27.61  ? 16   VAL B C     1 
ATOM   6364 O  O     . VAL D 4  16  ? 55.671 123.426 37.542 1.00 28.30  ? 16   VAL B O     1 
ATOM   6365 C  CB    . VAL D 4  16  ? 56.897 126.457 38.581 1.00 27.43  ? 16   VAL B CB    1 
ATOM   6366 C  CG1   . VAL D 4  16  ? 55.477 126.425 39.139 1.00 27.28  ? 16   VAL B CG1   1 
ATOM   6367 C  CG2   . VAL D 4  16  ? 57.866 126.987 39.628 1.00 25.91  ? 16   VAL B CG2   1 
ATOM   6368 N  N     . LEU D 4  17  ? 56.037 125.100 36.090 1.00 27.58  ? 17   LEU B N     1 
ATOM   6369 C  CA    . LEU D 4  17  ? 55.018 124.659 35.149 1.00 29.98  ? 17   LEU B CA    1 
ATOM   6370 C  C     . LEU D 4  17  ? 55.216 123.267 34.538 1.00 33.28  ? 17   LEU B C     1 
ATOM   6371 O  O     . LEU D 4  17  ? 54.298 122.725 33.914 1.00 35.01  ? 17   LEU B O     1 
ATOM   6372 C  CB    . LEU D 4  17  ? 54.870 125.700 34.034 1.00 25.95  ? 17   LEU B CB    1 
ATOM   6373 C  CG    . LEU D 4  17  ? 54.455 127.085 34.537 1.00 25.27  ? 17   LEU B CG    1 
ATOM   6374 C  CD1   . LEU D 4  17  ? 54.260 128.022 33.366 1.00 23.99  ? 17   LEU B CD1   1 
ATOM   6375 C  CD2   . LEU D 4  17  ? 53.167 126.976 35.340 1.00 23.85  ? 17   LEU B CD2   1 
ATOM   6376 N  N     . LYS D 4  18  ? 56.399 122.687 34.713 1.00 35.66  ? 18   LYS B N     1 
ATOM   6377 C  CA    . LYS D 4  18  ? 56.679 121.365 34.161 1.00 38.06  ? 18   LYS B CA    1 
ATOM   6378 C  C     . LYS D 4  18  ? 57.260 120.440 35.216 1.00 39.86  ? 18   LYS B C     1 
ATOM   6379 O  O     . LYS D 4  18  ? 57.736 119.351 34.898 1.00 39.86  ? 18   LYS B O     1 
ATOM   6380 C  CB    . LYS D 4  18  ? 57.673 121.472 33.008 1.00 39.32  ? 18   LYS B CB    1 
ATOM   6381 C  CG    . LYS D 4  18  ? 57.229 122.358 31.869 1.00 41.27  ? 18   LYS B CG    1 
ATOM   6382 C  CD    . LYS D 4  18  ? 58.343 122.476 30.850 1.00 42.56  ? 18   LYS B CD    1 
ATOM   6383 C  CE    . LYS D 4  18  ? 57.953 123.373 29.694 1.00 44.86  ? 18   LYS B CE    1 
ATOM   6384 N  NZ    . LYS D 4  18  ? 59.049 123.440 28.689 1.00 46.63  ? 18   LYS B NZ    1 
ATOM   6385 N  N     . ALA D 4  19  ? 57.213 120.878 36.469 1.00 41.63  ? 19   ALA B N     1 
ATOM   6386 C  CA    . ALA D 4  19  ? 57.758 120.111 37.583 1.00 44.68  ? 19   ALA B CA    1 
ATOM   6387 C  C     . ALA D 4  19  ? 57.211 118.697 37.761 1.00 47.26  ? 19   ALA B C     1 
ATOM   6388 O  O     . ALA D 4  19  ? 57.934 117.814 38.227 1.00 47.46  ? 19   ALA B O     1 
ATOM   6389 C  CB    . ALA D 4  19  ? 57.578 120.890 38.876 1.00 45.55  ? 19   ALA B CB    1 
ATOM   6390 N  N     . ASP D 4  20  ? 55.950 118.472 37.401 1.00 49.01  ? 20   ASP B N     1 
ATOM   6391 C  CA    . ASP D 4  20  ? 55.353 117.145 37.568 1.00 51.85  ? 20   ASP B CA    1 
ATOM   6392 C  C     . ASP D 4  20  ? 55.483 116.699 39.025 1.00 50.56  ? 20   ASP B C     1 
ATOM   6393 O  O     . ASP D 4  20  ? 56.141 115.709 39.343 1.00 51.39  ? 20   ASP B O     1 
ATOM   6394 C  CB    . ASP D 4  20  ? 56.029 116.128 36.639 1.00 55.34  ? 20   ASP B CB    1 
ATOM   6395 C  CG    . ASP D 4  20  ? 55.344 116.031 35.284 1.00 58.71  ? 20   ASP B CG    1 
ATOM   6396 O  OD1   . ASP D 4  20  ? 55.079 117.091 34.670 1.00 60.15  ? 20   ASP B OD1   1 
ATOM   6397 O  OD2   . ASP D 4  20  ? 55.071 114.894 34.834 1.00 59.73  ? 20   ASP B OD2   1 
ATOM   6398 N  N     . GLY D 4  21  ? 54.838 117.461 39.898 1.00 49.24  ? 21   GLY B N     1 
ATOM   6399 C  CA    . GLY D 4  21  ? 54.852 117.203 41.323 1.00 46.44  ? 21   GLY B CA    1 
ATOM   6400 C  C     . GLY D 4  21  ? 54.210 118.423 41.954 1.00 44.75  ? 21   GLY B C     1 
ATOM   6401 O  O     . GLY D 4  21  ? 53.825 119.349 41.238 1.00 46.01  ? 21   GLY B O     1 
ATOM   6402 N  N     . ALA D 4  22  ? 54.080 118.449 43.274 1.00 41.04  ? 22   ALA B N     1 
ATOM   6403 C  CA    . ALA D 4  22  ? 53.473 119.605 43.917 1.00 37.08  ? 22   ALA B CA    1 
ATOM   6404 C  C     . ALA D 4  22  ? 54.548 120.647 44.225 1.00 34.28  ? 22   ALA B C     1 
ATOM   6405 O  O     . ALA D 4  22  ? 55.552 120.351 44.877 1.00 32.92  ? 22   ALA B O     1 
ATOM   6406 C  CB    . ALA D 4  22  ? 52.748 119.182 45.195 1.00 37.15  ? 22   ALA B CB    1 
ATOM   6407 N  N     . ILE D 4  23  ? 54.336 121.864 43.738 1.00 30.95  ? 23   ILE B N     1 
ATOM   6408 C  CA    . ILE D 4  23  ? 55.281 122.950 43.958 1.00 27.36  ? 23   ILE B CA    1 
ATOM   6409 C  C     . ILE D 4  23  ? 54.586 124.132 44.625 1.00 26.25  ? 23   ILE B C     1 
ATOM   6410 O  O     . ILE D 4  23  ? 53.593 124.657 44.106 1.00 25.18  ? 23   ILE B O     1 
ATOM   6411 C  CB    . ILE D 4  23  ? 55.888 123.461 42.624 1.00 27.02  ? 23   ILE B CB    1 
ATOM   6412 C  CG1   . ILE D 4  23  ? 56.394 122.288 41.776 1.00 27.50  ? 23   ILE B CG1   1 
ATOM   6413 C  CG2   . ILE D 4  23  ? 57.022 124.435 42.914 1.00 23.41  ? 23   ILE B CG2   1 
ATOM   6414 C  CD1   . ILE D 4  23  ? 57.500 121.468 42.431 1.00 29.88  ? 23   ILE B CD1   1 
ATOM   6415 N  N     . LEU D 4  24  ? 55.101 124.546 45.778 1.00 24.29  ? 24   LEU B N     1 
ATOM   6416 C  CA    . LEU D 4  24  ? 54.545 125.695 46.483 1.00 23.82  ? 24   LEU B CA    1 
ATOM   6417 C  C     . LEU D 4  24  ? 55.443 126.883 46.168 1.00 24.27  ? 24   LEU B C     1 
ATOM   6418 O  O     . LEU D 4  24  ? 56.604 126.914 46.574 1.00 24.63  ? 24   LEU B O     1 
ATOM   6419 C  CB    . LEU D 4  24  ? 54.537 125.474 47.996 1.00 22.88  ? 24   LEU B CB    1 
ATOM   6420 C  CG    . LEU D 4  24  ? 54.032 126.676 48.808 1.00 23.51  ? 24   LEU B CG    1 
ATOM   6421 C  CD1   . LEU D 4  24  ? 52.541 126.836 48.563 1.00 22.20  ? 24   LEU B CD1   1 
ATOM   6422 C  CD2   . LEU D 4  24  ? 54.310 126.487 50.302 1.00 20.40  ? 24   LEU B CD2   1 
ATOM   6423 N  N     . VAL D 4  25  ? 54.917 127.853 45.433 1.00 23.68  ? 25   VAL B N     1 
ATOM   6424 C  CA    . VAL D 4  25  ? 55.707 129.024 45.098 1.00 23.69  ? 25   VAL B CA    1 
ATOM   6425 C  C     . VAL D 4  25  ? 55.357 130.197 46.002 1.00 23.17  ? 25   VAL B C     1 
ATOM   6426 O  O     . VAL D 4  25  ? 54.188 130.481 46.269 1.00 24.31  ? 25   VAL B O     1 
ATOM   6427 C  CB    . VAL D 4  25  ? 55.501 129.446 43.633 1.00 23.38  ? 25   VAL B CB    1 
ATOM   6428 C  CG1   . VAL D 4  25  ? 56.373 130.652 43.320 1.00 25.06  ? 25   VAL B CG1   1 
ATOM   6429 C  CG2   . VAL D 4  25  ? 55.851 128.299 42.709 1.00 23.97  ? 25   VAL B CG2   1 
ATOM   6430 N  N     . ASP D 4  26  ? 56.382 130.880 46.477 1.00 21.55  ? 26   ASP B N     1 
ATOM   6431 C  CA    . ASP D 4  26  ? 56.178 132.020 47.342 1.00 21.70  ? 26   ASP B CA    1 
ATOM   6432 C  C     . ASP D 4  26  ? 56.686 133.289 46.671 1.00 21.71  ? 26   ASP B C     1 
ATOM   6433 O  O     . ASP D 4  26  ? 57.875 133.411 46.395 1.00 23.70  ? 26   ASP B O     1 
ATOM   6434 C  CB    . ASP D 4  26  ? 56.902 131.790 48.669 1.00 22.69  ? 26   ASP B CB    1 
ATOM   6435 C  CG    . ASP D 4  26  ? 57.126 133.070 49.435 1.00 24.27  ? 26   ASP B CG    1 
ATOM   6436 O  OD1   . ASP D 4  26  ? 56.230 133.941 49.404 1.00 25.70  ? 26   ASP B OD1   1 
ATOM   6437 O  OD2   . ASP D 4  26  ? 58.192 133.203 50.072 1.00 24.82  ? 26   ASP B OD2   1 
ATOM   6438 N  N     . PHE D 4  27  ? 55.780 134.217 46.383 1.00 21.03  ? 27   PHE B N     1 
ATOM   6439 C  CA    . PHE D 4  27  ? 56.165 135.477 45.765 1.00 21.67  ? 27   PHE B CA    1 
ATOM   6440 C  C     . PHE D 4  27  ? 56.393 136.441 46.907 1.00 22.53  ? 27   PHE B C     1 
ATOM   6441 O  O     . PHE D 4  27  ? 55.470 136.743 47.660 1.00 24.62  ? 27   PHE B O     1 
ATOM   6442 C  CB    . PHE D 4  27  ? 55.061 136.016 44.851 1.00 21.58  ? 27   PHE B CB    1 
ATOM   6443 C  CG    . PHE D 4  27  ? 54.755 135.132 43.676 1.00 20.14  ? 27   PHE B CG    1 
ATOM   6444 C  CD1   . PHE D 4  27  ? 53.914 134.038 43.815 1.00 19.63  ? 27   PHE B CD1   1 
ATOM   6445 C  CD2   . PHE D 4  27  ? 55.322 135.390 42.432 1.00 19.64  ? 27   PHE B CD2   1 
ATOM   6446 C  CE1   . PHE D 4  27  ? 53.636 133.209 42.726 1.00 23.30  ? 27   PHE B CE1   1 
ATOM   6447 C  CE2   . PHE D 4  27  ? 55.056 134.572 41.336 1.00 21.83  ? 27   PHE B CE2   1 
ATOM   6448 C  CZ    . PHE D 4  27  ? 54.210 133.478 41.482 1.00 22.58  ? 27   PHE B CZ    1 
ATOM   6449 N  N     . TRP D 4  28  ? 57.625 136.916 47.043 1.00 22.34  ? 28   TRP B N     1 
ATOM   6450 C  CA    . TRP D 4  28  ? 57.961 137.826 48.128 1.00 21.40  ? 28   TRP B CA    1 
ATOM   6451 C  C     . TRP D 4  28  ? 58.799 139.019 47.681 1.00 22.13  ? 28   TRP B C     1 
ATOM   6452 O  O     . TRP D 4  28  ? 59.142 139.164 46.504 1.00 21.96  ? 28   TRP B O     1 
ATOM   6453 C  CB    . TRP D 4  28  ? 58.738 137.069 49.205 1.00 20.30  ? 28   TRP B CB    1 
ATOM   6454 C  CG    . TRP D 4  28  ? 60.067 136.549 48.715 1.00 19.20  ? 28   TRP B CG    1 
ATOM   6455 C  CD1   . TRP D 4  28  ? 60.276 135.539 47.818 1.00 19.27  ? 28   TRP B CD1   1 
ATOM   6456 C  CD2   . TRP D 4  28  ? 61.365 137.031 49.085 1.00 17.84  ? 28   TRP B CD2   1 
ATOM   6457 N  NE1   . TRP D 4  28  ? 61.627 135.362 47.610 1.00 17.40  ? 28   TRP B NE1   1 
ATOM   6458 C  CE2   . TRP D 4  28  ? 62.315 136.265 48.373 1.00 16.48  ? 28   TRP B CE2   1 
ATOM   6459 C  CE3   . TRP D 4  28  ? 61.818 138.038 49.949 1.00 17.29  ? 28   TRP B CE3   1 
ATOM   6460 C  CZ2   . TRP D 4  28  ? 63.690 136.474 48.498 1.00 17.12  ? 28   TRP B CZ2   1 
ATOM   6461 C  CZ3   . TRP D 4  28  ? 63.187 138.244 50.074 1.00 15.88  ? 28   TRP B CZ3   1 
ATOM   6462 C  CH2   . TRP D 4  28  ? 64.106 137.465 49.351 1.00 15.96  ? 28   TRP B CH2   1 
ATOM   6463 N  N     . ALA D 4  29  ? 59.128 139.866 48.648 1.00 21.18  ? 29   ALA B N     1 
ATOM   6464 C  CA    . ALA D 4  29  ? 59.951 141.039 48.413 1.00 23.25  ? 29   ALA B CA    1 
ATOM   6465 C  C     . ALA D 4  29  ? 60.664 141.305 49.725 1.00 24.46  ? 29   ALA B C     1 
ATOM   6466 O  O     . ALA D 4  29  ? 60.113 141.052 50.797 1.00 25.39  ? 29   ALA B O     1 
ATOM   6467 C  CB    . ALA D 4  29  ? 59.098 142.226 48.021 1.00 23.26  ? 29   ALA B CB    1 
ATOM   6468 N  N     . GLU D 4  30  ? 61.884 141.815 49.644 1.00 26.37  ? 30   GLU B N     1 
ATOM   6469 C  CA    . GLU D 4  30  ? 62.666 142.078 50.842 1.00 28.99  ? 30   GLU B CA    1 
ATOM   6470 C  C     . GLU D 4  30  ? 62.092 143.195 51.721 1.00 27.95  ? 30   GLU B C     1 
ATOM   6471 O  O     . GLU D 4  30  ? 62.398 143.268 52.911 1.00 27.41  ? 30   GLU B O     1 
ATOM   6472 C  CB    . GLU D 4  30  ? 64.109 142.416 50.453 1.00 31.52  ? 30   GLU B CB    1 
ATOM   6473 C  CG    . GLU D 4  30  ? 65.082 142.386 51.617 1.00 38.65  ? 30   GLU B CG    1 
ATOM   6474 C  CD    . GLU D 4  30  ? 65.302 140.979 52.150 1.00 42.93  ? 30   GLU B CD    1 
ATOM   6475 O  OE1   . GLU D 4  30  ? 65.917 140.161 51.429 1.00 46.06  ? 30   GLU B OE1   1 
ATOM   6476 O  OE2   . GLU D 4  30  ? 64.855 140.688 53.282 1.00 45.29  ? 30   GLU B OE2   1 
ATOM   6477 N  N     . TRP D 4  31  ? 61.253 144.049 51.142 1.00 26.23  ? 31   TRP B N     1 
ATOM   6478 C  CA    . TRP D 4  31  ? 60.674 145.173 51.874 1.00 25.00  ? 31   TRP B CA    1 
ATOM   6479 C  C     . TRP D 4  31  ? 59.306 144.917 52.504 1.00 26.38  ? 31   TRP B C     1 
ATOM   6480 O  O     . TRP D 4  31  ? 58.651 145.845 52.983 1.00 27.78  ? 31   TRP B O     1 
ATOM   6481 C  CB    . TRP D 4  31  ? 60.582 146.395 50.953 1.00 22.34  ? 31   TRP B CB    1 
ATOM   6482 C  CG    . TRP D 4  31  ? 60.154 146.073 49.536 1.00 21.88  ? 31   TRP B CG    1 
ATOM   6483 C  CD1   . TRP D 4  31  ? 60.973 145.850 48.461 1.00 21.03  ? 31   TRP B CD1   1 
ATOM   6484 C  CD2   . TRP D 4  31  ? 58.811 145.916 49.053 1.00 19.66  ? 31   TRP B CD2   1 
ATOM   6485 N  NE1   . TRP D 4  31  ? 60.223 145.564 47.341 1.00 18.80  ? 31   TRP B NE1   1 
ATOM   6486 C  CE2   . TRP D 4  31  ? 58.897 145.598 47.675 1.00 19.42  ? 31   TRP B CE2   1 
ATOM   6487 C  CE3   . TRP D 4  31  ? 57.546 146.012 49.648 1.00 18.37  ? 31   TRP B CE3   1 
ATOM   6488 C  CZ2   . TRP D 4  31  ? 57.766 145.375 46.886 1.00 19.91  ? 31   TRP B CZ2   1 
ATOM   6489 C  CZ3   . TRP D 4  31  ? 56.419 145.791 48.863 1.00 19.54  ? 31   TRP B CZ3   1 
ATOM   6490 C  CH2   . TRP D 4  31  ? 56.538 145.476 47.494 1.00 21.86  ? 31   TRP B CH2   1 
ATOM   6491 N  N     . CYS D 4  32  ? 58.879 143.663 52.517 1.00 26.83  ? 32   CYS B N     1 
ATOM   6492 C  CA    . CYS D 4  32  ? 57.576 143.309 53.075 1.00 27.06  ? 32   CYS B CA    1 
ATOM   6493 C  C     . CYS D 4  32  ? 57.693 142.675 54.457 1.00 26.44  ? 32   CYS B C     1 
ATOM   6494 O  O     . CYS D 4  32  ? 58.447 141.721 54.646 1.00 25.76  ? 32   CYS B O     1 
ATOM   6495 C  CB    . CYS D 4  32  ? 56.863 142.347 52.123 1.00 26.53  ? 32   CYS B CB    1 
ATOM   6496 S  SG    . CYS D 4  32  ? 55.310 141.692 52.741 1.00 28.64  ? 32   CYS B SG    1 
ATOM   6497 N  N     . GLY D 4  33  ? 56.940 143.206 55.417 1.00 26.45  ? 33   GLY B N     1 
ATOM   6498 C  CA    . GLY D 4  33  ? 56.971 142.674 56.770 1.00 25.57  ? 33   GLY B CA    1 
ATOM   6499 C  C     . GLY D 4  33  ? 56.479 141.240 56.829 1.00 25.81  ? 33   GLY B C     1 
ATOM   6500 O  O     . GLY D 4  33  ? 57.185 140.359 57.303 1.00 25.68  ? 33   GLY B O     1 
ATOM   6501 N  N     . PRO D 4  34  ? 55.258 140.972 56.355 1.00 25.89  ? 34   PRO B N     1 
ATOM   6502 C  CA    . PRO D 4  34  ? 54.729 139.607 56.380 1.00 27.01  ? 34   PRO B CA    1 
ATOM   6503 C  C     . PRO D 4  34  ? 55.634 138.595 55.657 1.00 27.61  ? 34   PRO B C     1 
ATOM   6504 O  O     . PRO D 4  34  ? 55.715 137.425 56.055 1.00 27.45  ? 34   PRO B O     1 
ATOM   6505 C  CB    . PRO D 4  34  ? 53.367 139.761 55.709 1.00 27.29  ? 34   PRO B CB    1 
ATOM   6506 C  CG    . PRO D 4  34  ? 52.944 141.125 56.158 1.00 26.22  ? 34   PRO B CG    1 
ATOM   6507 C  CD    . PRO D 4  34  ? 54.212 141.932 55.967 1.00 26.16  ? 34   PRO B CD    1 
ATOM   6508 N  N     . CYS D 4  35  ? 56.313 139.039 54.600 1.00 25.86  ? 35   CYS B N     1 
ATOM   6509 C  CA    . CYS D 4  35  ? 57.201 138.144 53.858 1.00 25.45  ? 35   CYS B CA    1 
ATOM   6510 C  C     . CYS D 4  35  ? 58.349 137.657 54.732 1.00 26.31  ? 35   CYS B C     1 
ATOM   6511 O  O     . CYS D 4  35  ? 58.725 136.483 54.688 1.00 23.89  ? 35   CYS B O     1 
ATOM   6512 C  CB    . CYS D 4  35  ? 57.760 138.837 52.612 1.00 22.57  ? 35   CYS B CB    1 
ATOM   6513 S  SG    . CYS D 4  35  ? 56.582 138.940 51.242 1.00 23.84  ? 35   CYS B SG    1 
ATOM   6514 N  N     . LYS D 4  36  ? 58.903 138.559 55.533 1.00 27.51  ? 36   LYS B N     1 
ATOM   6515 C  CA    . LYS D 4  36  ? 59.998 138.187 56.407 1.00 30.43  ? 36   LYS B CA    1 
ATOM   6516 C  C     . LYS D 4  36  ? 59.509 137.239 57.498 1.00 31.21  ? 36   LYS B C     1 
ATOM   6517 O  O     . LYS D 4  36  ? 60.276 136.428 58.015 1.00 33.47  ? 36   LYS B O     1 
ATOM   6518 C  CB    . LYS D 4  36  ? 60.620 139.421 57.050 1.00 31.49  ? 36   LYS B CB    1 
ATOM   6519 C  CG    . LYS D 4  36  ? 61.855 139.082 57.856 1.00 36.51  ? 36   LYS B CG    1 
ATOM   6520 C  CD    . LYS D 4  36  ? 62.224 140.175 58.848 1.00 39.00  ? 36   LYS B CD    1 
ATOM   6521 C  CE    . LYS D 4  36  ? 63.369 139.719 59.739 1.00 37.76  ? 36   LYS B CE    1 
ATOM   6522 N  NZ    . LYS D 4  36  ? 63.624 140.683 60.832 1.00 39.84  ? 36   LYS B NZ    1 
ATOM   6523 N  N     . MET D 4  37  ? 58.229 137.340 57.844 1.00 30.75  ? 37   MET B N     1 
ATOM   6524 C  CA    . MET D 4  37  ? 57.648 136.491 58.880 1.00 30.05  ? 37   MET B CA    1 
ATOM   6525 C  C     . MET D 4  37  ? 57.561 135.041 58.447 1.00 30.09  ? 37   MET B C     1 
ATOM   6526 O  O     . MET D 4  37  ? 58.041 134.144 59.138 1.00 30.98  ? 37   MET B O     1 
ATOM   6527 C  CB    . MET D 4  37  ? 56.229 136.955 59.237 1.00 30.08  ? 37   MET B CB    1 
ATOM   6528 C  CG    . MET D 4  37  ? 56.131 138.206 60.096 1.00 31.63  ? 37   MET B CG    1 
ATOM   6529 S  SD    . MET D 4  37  ? 54.403 138.725 60.321 1.00 32.63  ? 37   MET B SD    1 
ATOM   6530 C  CE    . MET D 4  37  ? 53.771 137.411 61.392 1.00 31.65  ? 37   MET B CE    1 
ATOM   6531 N  N     . ILE D 4  38  ? 56.932 134.827 57.296 1.00 29.46  ? 38   ILE B N     1 
ATOM   6532 C  CA    . ILE D 4  38  ? 56.710 133.490 56.757 1.00 28.24  ? 38   ILE B CA    1 
ATOM   6533 C  C     . ILE D 4  38  ? 57.948 132.779 56.217 1.00 28.29  ? 38   ILE B C     1 
ATOM   6534 O  O     . ILE D 4  38  ? 57.927 131.564 56.046 1.00 27.57  ? 38   ILE B O     1 
ATOM   6535 C  CB    . ILE D 4  38  ? 55.636 133.532 55.643 1.00 28.68  ? 38   ILE B CB    1 
ATOM   6536 C  CG1   . ILE D 4  38  ? 54.906 132.194 55.563 1.00 26.59  ? 38   ILE B CG1   1 
ATOM   6537 C  CG2   . ILE D 4  38  ? 56.281 133.865 54.297 1.00 25.69  ? 38   ILE B CG2   1 
ATOM   6538 C  CD1   . ILE D 4  38  ? 53.749 132.214 54.592 1.00 27.50  ? 38   ILE B CD1   1 
ATOM   6539 N  N     . ALA D 4  39  ? 59.019 133.522 55.951 1.00 27.94  ? 39   ALA B N     1 
ATOM   6540 C  CA    . ALA D 4  39  ? 60.239 132.912 55.423 1.00 28.60  ? 39   ALA B CA    1 
ATOM   6541 C  C     . ALA D 4  39  ? 60.713 131.743 56.290 1.00 29.66  ? 39   ALA B C     1 
ATOM   6542 O  O     . ALA D 4  39  ? 60.812 130.615 55.811 1.00 30.23  ? 39   ALA B O     1 
ATOM   6543 C  CB    . ALA D 4  39  ? 61.355 133.962 55.283 1.00 24.84  ? 39   ALA B CB    1 
ATOM   6544 N  N     . PRO D 4  40  ? 61.000 131.993 57.580 1.00 30.04  ? 40   PRO B N     1 
ATOM   6545 C  CA    . PRO D 4  40  ? 61.459 130.912 58.454 1.00 31.12  ? 40   PRO B CA    1 
ATOM   6546 C  C     . PRO D 4  40  ? 60.536 129.702 58.413 1.00 31.04  ? 40   PRO B C     1 
ATOM   6547 O  O     . PRO D 4  40  ? 60.993 128.563 58.443 1.00 31.27  ? 40   PRO B O     1 
ATOM   6548 C  CB    . PRO D 4  40  ? 61.478 131.572 59.831 1.00 31.25  ? 40   PRO B CB    1 
ATOM   6549 C  CG    . PRO D 4  40  ? 61.823 132.978 59.516 1.00 30.90  ? 40   PRO B CG    1 
ATOM   6550 C  CD    . PRO D 4  40  ? 60.925 133.257 58.330 1.00 31.54  ? 40   PRO B CD    1 
ATOM   6551 N  N     . ILE D 4  41  ? 59.235 129.968 58.335 1.00 31.58  ? 41   ILE B N     1 
ATOM   6552 C  CA    . ILE D 4  41  ? 58.221 128.928 58.304 1.00 31.57  ? 41   ILE B CA    1 
ATOM   6553 C  C     . ILE D 4  41  ? 58.315 128.070 57.045 1.00 34.10  ? 41   ILE B C     1 
ATOM   6554 O  O     . ILE D 4  41  ? 57.995 126.880 57.070 1.00 34.83  ? 41   ILE B O     1 
ATOM   6555 C  CB    . ILE D 4  41  ? 56.811 129.538 58.369 1.00 31.39  ? 41   ILE B CB    1 
ATOM   6556 C  CG1   . ILE D 4  41  ? 56.772 130.650 59.417 1.00 31.11  ? 41   ILE B CG1   1 
ATOM   6557 C  CG2   . ILE D 4  41  ? 55.791 128.461 58.682 1.00 30.75  ? 41   ILE B CG2   1 
ATOM   6558 C  CD1   . ILE D 4  41  ? 57.338 130.260 60.748 1.00 32.54  ? 41   ILE B CD1   1 
ATOM   6559 N  N     . LEU D 4  42  ? 58.747 128.674 55.943 1.00 35.19  ? 42   LEU B N     1 
ATOM   6560 C  CA    . LEU D 4  42  ? 58.874 127.944 54.690 1.00 36.90  ? 42   LEU B CA    1 
ATOM   6561 C  C     . LEU D 4  42  ? 60.085 127.014 54.739 1.00 38.79  ? 42   LEU B C     1 
ATOM   6562 O  O     . LEU D 4  42  ? 60.087 125.953 54.106 1.00 39.09  ? 42   LEU B O     1 
ATOM   6563 C  CB    . LEU D 4  42  ? 58.996 128.921 53.515 1.00 35.40  ? 42   LEU B CB    1 
ATOM   6564 C  CG    . LEU D 4  42  ? 57.724 129.704 53.169 1.00 35.60  ? 42   LEU B CG    1 
ATOM   6565 C  CD1   . LEU D 4  42  ? 58.033 130.785 52.141 1.00 34.66  ? 42   LEU B CD1   1 
ATOM   6566 C  CD2   . LEU D 4  42  ? 56.670 128.745 52.635 1.00 33.89  ? 42   LEU B CD2   1 
ATOM   6567 N  N     . ASP D 4  43  ? 61.109 127.411 55.491 1.00 39.64  ? 43   ASP B N     1 
ATOM   6568 C  CA    . ASP D 4  43  ? 62.308 126.591 55.627 1.00 42.47  ? 43   ASP B CA    1 
ATOM   6569 C  C     . ASP D 4  43  ? 61.941 125.275 56.301 1.00 43.27  ? 43   ASP B C     1 
ATOM   6570 O  O     . ASP D 4  43  ? 62.270 124.199 55.809 1.00 42.82  ? 43   ASP B O     1 
ATOM   6571 C  CB    . ASP D 4  43  ? 63.367 127.312 56.463 1.00 43.67  ? 43   ASP B CB    1 
ATOM   6572 C  CG    . ASP D 4  43  ? 63.882 128.569 55.792 1.00 45.23  ? 43   ASP B CG    1 
ATOM   6573 O  OD1   . ASP D 4  43  ? 64.123 128.526 54.567 1.00 46.36  ? 43   ASP B OD1   1 
ATOM   6574 O  OD2   . ASP D 4  43  ? 64.057 129.594 56.487 1.00 45.11  ? 43   ASP B OD2   1 
ATOM   6575 N  N     . GLU D 4  44  ? 61.253 125.370 57.431 1.00 45.11  ? 44   GLU B N     1 
ATOM   6576 C  CA    . GLU D 4  44  ? 60.832 124.187 58.164 1.00 46.00  ? 44   GLU B CA    1 
ATOM   6577 C  C     . GLU D 4  44  ? 59.922 123.333 57.288 1.00 45.78  ? 44   GLU B C     1 
ATOM   6578 O  O     . GLU D 4  44  ? 60.089 122.117 57.211 1.00 47.06  ? 44   GLU B O     1 
ATOM   6579 C  CB    . GLU D 4  44  ? 60.092 124.594 59.440 1.00 48.06  ? 44   GLU B CB    1 
ATOM   6580 C  CG    . GLU D 4  44  ? 60.893 125.498 60.365 1.00 50.86  ? 44   GLU B CG    1 
ATOM   6581 C  CD    . GLU D 4  44  ? 60.143 125.827 61.644 1.00 54.01  ? 44   GLU B CD    1 
ATOM   6582 O  OE1   . GLU D 4  44  ? 58.967 126.248 61.556 1.00 54.99  ? 44   GLU B OE1   1 
ATOM   6583 O  OE2   . GLU D 4  44  ? 60.730 125.670 62.737 1.00 54.48  ? 44   GLU B OE2   1 
ATOM   6584 N  N     . ILE D 4  45  ? 58.960 123.973 56.628 1.00 44.98  ? 45   ILE B N     1 
ATOM   6585 C  CA    . ILE D 4  45  ? 58.030 123.261 55.758 1.00 43.96  ? 45   ILE B CA    1 
ATOM   6586 C  C     . ILE D 4  45  ? 58.767 122.482 54.680 1.00 44.76  ? 45   ILE B C     1 
ATOM   6587 O  O     . ILE D 4  45  ? 58.469 121.317 54.439 1.00 45.92  ? 45   ILE B O     1 
ATOM   6588 C  CB    . ILE D 4  45  ? 57.041 124.227 55.065 1.00 42.84  ? 45   ILE B CB    1 
ATOM   6589 C  CG1   . ILE D 4  45  ? 56.080 124.823 56.096 1.00 41.47  ? 45   ILE B CG1   1 
ATOM   6590 C  CG2   . ILE D 4  45  ? 56.262 123.490 53.982 1.00 40.37  ? 45   ILE B CG2   1 
ATOM   6591 C  CD1   . ILE D 4  45  ? 55.129 123.819 56.712 1.00 40.07  ? 45   ILE B CD1   1 
ATOM   6592 N  N     . ALA D 4  46  ? 59.729 123.125 54.029 1.00 46.42  ? 46   ALA B N     1 
ATOM   6593 C  CA    . ALA D 4  46  ? 60.494 122.469 52.974 1.00 47.39  ? 46   ALA B CA    1 
ATOM   6594 C  C     . ALA D 4  46  ? 60.966 121.083 53.414 1.00 48.15  ? 46   ALA B C     1 
ATOM   6595 O  O     . ALA D 4  46  ? 60.853 120.117 52.657 1.00 48.28  ? 46   ALA B O     1 
ATOM   6596 C  CB    . ALA D 4  46  ? 61.687 123.332 52.574 1.00 46.42  ? 46   ALA B CB    1 
ATOM   6597 N  N     . ASP D 4  47  ? 61.489 120.989 54.635 1.00 48.40  ? 47   ASP B N     1 
ATOM   6598 C  CA    . ASP D 4  47  ? 61.970 119.718 55.174 1.00 49.83  ? 47   ASP B CA    1 
ATOM   6599 C  C     . ASP D 4  47  ? 60.828 118.736 55.382 1.00 49.62  ? 47   ASP B C     1 
ATOM   6600 O  O     . ASP D 4  47  ? 60.680 117.766 54.643 1.00 49.45  ? 47   ASP B O     1 
ATOM   6601 C  CB    . ASP D 4  47  ? 62.668 119.938 56.513 1.00 51.64  ? 47   ASP B CB    1 
ATOM   6602 C  CG    . ASP D 4  47  ? 63.902 120.795 56.388 1.00 54.67  ? 47   ASP B CG    1 
ATOM   6603 O  OD1   . ASP D 4  47  ? 63.796 121.898 55.815 1.00 56.00  ? 47   ASP B OD1   1 
ATOM   6604 O  OD2   . ASP D 4  47  ? 64.974 120.369 56.867 1.00 55.93  ? 47   ASP B OD2   1 
ATOM   6605 N  N     . GLU D 4  48  ? 60.028 119.002 56.407 1.00 49.51  ? 48   GLU B N     1 
ATOM   6606 C  CA    . GLU D 4  48  ? 58.891 118.165 56.758 1.00 49.74  ? 48   GLU B CA    1 
ATOM   6607 C  C     . GLU D 4  48  ? 58.108 117.610 55.572 1.00 49.33  ? 48   GLU B C     1 
ATOM   6608 O  O     . GLU D 4  48  ? 57.627 116.477 55.619 1.00 50.90  ? 48   GLU B O     1 
ATOM   6609 C  CB    . GLU D 4  48  ? 57.949 118.951 57.669 1.00 51.27  ? 48   GLU B CB    1 
ATOM   6610 C  CG    . GLU D 4  48  ? 58.535 119.234 59.037 1.00 53.68  ? 48   GLU B CG    1 
ATOM   6611 C  CD    . GLU D 4  48  ? 57.686 120.188 59.850 1.00 55.17  ? 48   GLU B CD    1 
ATOM   6612 O  OE1   . GLU D 4  48  ? 56.446 120.016 59.861 1.00 55.36  ? 48   GLU B OE1   1 
ATOM   6613 O  OE2   . GLU D 4  48  ? 58.264 121.102 60.483 1.00 55.46  ? 48   GLU B OE2   1 
ATOM   6614 N  N     . TYR D 4  49  ? 57.976 118.396 54.511 1.00 47.64  ? 49   TYR B N     1 
ATOM   6615 C  CA    . TYR D 4  49  ? 57.228 117.947 53.345 1.00 46.95  ? 49   TYR B CA    1 
ATOM   6616 C  C     . TYR D 4  49  ? 58.099 117.479 52.193 1.00 46.81  ? 49   TYR B C     1 
ATOM   6617 O  O     . TYR D 4  49  ? 57.626 117.334 51.063 1.00 45.97  ? 49   TYR B O     1 
ATOM   6618 C  CB    . TYR D 4  49  ? 56.286 119.054 52.871 1.00 46.07  ? 49   TYR B CB    1 
ATOM   6619 C  CG    . TYR D 4  49  ? 55.125 119.267 53.807 1.00 45.43  ? 49   TYR B CG    1 
ATOM   6620 C  CD1   . TYR D 4  49  ? 55.330 119.719 55.111 1.00 45.03  ? 49   TYR B CD1   1 
ATOM   6621 C  CD2   . TYR D 4  49  ? 53.823 118.972 53.408 1.00 45.71  ? 49   TYR B CD2   1 
ATOM   6622 C  CE1   . TYR D 4  49  ? 54.265 119.867 55.995 1.00 45.47  ? 49   TYR B CE1   1 
ATOM   6623 C  CE2   . TYR D 4  49  ? 52.752 119.118 54.282 1.00 45.33  ? 49   TYR B CE2   1 
ATOM   6624 C  CZ    . TYR D 4  49  ? 52.979 119.564 55.572 1.00 45.34  ? 49   TYR B CZ    1 
ATOM   6625 O  OH    . TYR D 4  49  ? 51.921 119.703 56.439 1.00 46.05  ? 49   TYR B OH    1 
ATOM   6626 N  N     . GLN D 4  50  ? 59.370 117.231 52.482 1.00 47.73  ? 50   GLN B N     1 
ATOM   6627 C  CA    . GLN D 4  50  ? 60.291 116.769 51.458 1.00 49.14  ? 50   GLN B CA    1 
ATOM   6628 C  C     . GLN D 4  50  ? 59.839 115.406 50.969 1.00 48.94  ? 50   GLN B C     1 
ATOM   6629 O  O     . GLN D 4  50  ? 59.688 114.472 51.756 1.00 48.08  ? 50   GLN B O     1 
ATOM   6630 C  CB    . GLN D 4  50  ? 61.708 116.674 52.012 1.00 51.12  ? 50   GLN B CB    1 
ATOM   6631 C  CG    . GLN D 4  50  ? 62.747 116.407 50.945 1.00 55.66  ? 50   GLN B CG    1 
ATOM   6632 C  CD    . GLN D 4  50  ? 64.159 116.669 51.425 1.00 57.98  ? 50   GLN B CD    1 
ATOM   6633 O  OE1   . GLN D 4  50  ? 65.108 116.625 50.638 1.00 60.08  ? 50   GLN B OE1   1 
ATOM   6634 N  NE2   . GLN D 4  50  ? 64.310 116.943 52.720 1.00 57.94  ? 50   GLN B NE2   1 
ATOM   6635 N  N     . GLY D 4  51  ? 59.610 115.302 49.666 1.00 48.43  ? 51   GLY B N     1 
ATOM   6636 C  CA    . GLY D 4  51  ? 59.165 114.046 49.102 1.00 48.79  ? 51   GLY B CA    1 
ATOM   6637 C  C     . GLY D 4  51  ? 57.819 114.186 48.426 1.00 49.00  ? 51   GLY B C     1 
ATOM   6638 O  O     . GLY D 4  51  ? 57.623 113.690 47.314 1.00 48.45  ? 51   GLY B O     1 
ATOM   6639 N  N     . LYS D 4  52  ? 56.885 114.860 49.091 1.00 49.36  ? 52   LYS B N     1 
ATOM   6640 C  CA    . LYS D 4  52  ? 55.556 115.053 48.520 1.00 49.01  ? 52   LYS B CA    1 
ATOM   6641 C  C     . LYS D 4  52  ? 55.282 116.503 48.123 1.00 47.20  ? 52   LYS B C     1 
ATOM   6642 O  O     . LYS D 4  52  ? 54.225 116.808 47.568 1.00 47.36  ? 52   LYS B O     1 
ATOM   6643 C  CB    . LYS D 4  52  ? 54.478 114.561 49.494 1.00 50.75  ? 52   LYS B CB    1 
ATOM   6644 C  CG    . LYS D 4  52  ? 54.533 115.162 50.893 1.00 53.37  ? 52   LYS B CG    1 
ATOM   6645 C  CD    . LYS D 4  52  ? 53.388 114.607 51.744 1.00 56.22  ? 52   LYS B CD    1 
ATOM   6646 C  CE    . LYS D 4  52  ? 53.420 115.140 53.173 1.00 57.98  ? 52   LYS B CE    1 
ATOM   6647 N  NZ    . LYS D 4  52  ? 52.301 114.610 54.010 1.00 57.62  ? 52   LYS B NZ    1 
ATOM   6648 N  N     . LEU D 4  53  ? 56.238 117.387 48.397 1.00 44.84  ? 53   LEU B N     1 
ATOM   6649 C  CA    . LEU D 4  53  ? 56.100 118.803 48.058 1.00 42.93  ? 53   LEU B CA    1 
ATOM   6650 C  C     . LEU D 4  53  ? 57.435 119.530 47.936 1.00 41.68  ? 53   LEU B C     1 
ATOM   6651 O  O     . LEU D 4  53  ? 58.357 119.309 48.726 1.00 41.64  ? 53   LEU B O     1 
ATOM   6652 C  CB    . LEU D 4  53  ? 55.255 119.531 49.109 1.00 42.96  ? 53   LEU B CB    1 
ATOM   6653 C  CG    . LEU D 4  53  ? 55.211 121.058 48.964 1.00 41.65  ? 53   LEU B CG    1 
ATOM   6654 C  CD1   . LEU D 4  53  ? 54.247 121.431 47.858 1.00 40.96  ? 53   LEU B CD1   1 
ATOM   6655 C  CD2   . LEU D 4  53  ? 54.779 121.697 50.271 1.00 42.42  ? 53   LEU B CD2   1 
ATOM   6656 N  N     . THR D 4  54  ? 57.523 120.410 46.944 1.00 39.73  ? 54   THR B N     1 
ATOM   6657 C  CA    . THR D 4  54  ? 58.725 121.205 46.730 1.00 37.63  ? 54   THR B CA    1 
ATOM   6658 C  C     . THR D 4  54  ? 58.379 122.672 46.977 1.00 35.67  ? 54   THR B C     1 
ATOM   6659 O  O     . THR D 4  54  ? 57.400 123.186 46.435 1.00 35.67  ? 54   THR B O     1 
ATOM   6660 C  CB    . THR D 4  54  ? 59.252 121.073 45.294 1.00 38.30  ? 54   THR B CB    1 
ATOM   6661 O  OG1   . THR D 4  54  ? 59.594 119.709 45.026 1.00 40.16  ? 54   THR B OG1   1 
ATOM   6662 C  CG2   . THR D 4  54  ? 60.483 121.940 45.111 1.00 38.66  ? 54   THR B CG2   1 
ATOM   6663 N  N     . VAL D 4  55  ? 59.183 123.339 47.797 1.00 33.12  ? 55   VAL B N     1 
ATOM   6664 C  CA    . VAL D 4  55  ? 58.962 124.743 48.110 1.00 30.80  ? 55   VAL B CA    1 
ATOM   6665 C  C     . VAL D 4  55  ? 59.890 125.633 47.286 1.00 29.96  ? 55   VAL B C     1 
ATOM   6666 O  O     . VAL D 4  55  ? 61.110 125.476 47.318 1.00 29.42  ? 55   VAL B O     1 
ATOM   6667 C  CB    . VAL D 4  55  ? 59.188 125.011 49.617 1.00 30.95  ? 55   VAL B CB    1 
ATOM   6668 C  CG1   . VAL D 4  55  ? 59.118 126.502 49.907 1.00 27.80  ? 55   VAL B CG1   1 
ATOM   6669 C  CG2   . VAL D 4  55  ? 58.140 124.263 50.436 1.00 30.57  ? 55   VAL B CG2   1 
ATOM   6670 N  N     . ALA D 4  56  ? 59.304 126.568 46.546 1.00 28.33  ? 56   ALA B N     1 
ATOM   6671 C  CA    . ALA D 4  56  ? 60.083 127.474 45.716 1.00 26.66  ? 56   ALA B CA    1 
ATOM   6672 C  C     . ALA D 4  56  ? 59.738 128.923 46.026 1.00 25.67  ? 56   ALA B C     1 
ATOM   6673 O  O     . ALA D 4  56  ? 58.597 129.241 46.358 1.00 24.13  ? 56   ALA B O     1 
ATOM   6674 C  CB    . ALA D 4  56  ? 59.828 127.182 44.250 1.00 26.13  ? 56   ALA B CB    1 
ATOM   6675 N  N     . LYS D 4  57  ? 60.733 129.797 45.912 1.00 24.41  ? 57   LYS B N     1 
ATOM   6676 C  CA    . LYS D 4  57  ? 60.543 131.213 46.182 1.00 23.62  ? 57   LYS B CA    1 
ATOM   6677 C  C     . LYS D 4  57  ? 60.929 132.045 44.972 1.00 23.60  ? 57   LYS B C     1 
ATOM   6678 O  O     . LYS D 4  57  ? 61.921 131.757 44.300 1.00 22.66  ? 57   LYS B O     1 
ATOM   6679 C  CB    . LYS D 4  57  ? 61.385 131.650 47.388 1.00 22.84  ? 57   LYS B CB    1 
ATOM   6680 C  CG    . LYS D 4  57  ? 61.078 130.883 48.664 1.00 27.02  ? 57   LYS B CG    1 
ATOM   6681 C  CD    . LYS D 4  57  ? 61.233 131.747 49.921 1.00 29.64  ? 57   LYS B CD    1 
ATOM   6682 C  CE    . LYS D 4  57  ? 62.666 132.177 50.180 1.00 30.91  ? 57   LYS B CE    1 
ATOM   6683 N  NZ    . LYS D 4  57  ? 62.768 132.998 51.429 1.00 30.06  ? 57   LYS B NZ    1 
ATOM   6684 N  N     . LEU D 4  58  ? 60.133 133.075 44.697 1.00 23.25  ? 58   LEU B N     1 
ATOM   6685 C  CA    . LEU D 4  58  ? 60.389 133.974 43.579 1.00 21.19  ? 58   LEU B CA    1 
ATOM   6686 C  C     . LEU D 4  58  ? 60.314 135.407 44.077 1.00 21.43  ? 58   LEU B C     1 
ATOM   6687 O  O     . LEU D 4  58  ? 59.243 135.874 44.489 1.00 21.87  ? 58   LEU B O     1 
ATOM   6688 C  CB    . LEU D 4  58  ? 59.354 133.779 42.470 1.00 22.01  ? 58   LEU B CB    1 
ATOM   6689 C  CG    . LEU D 4  58  ? 59.620 134.638 41.229 1.00 24.21  ? 58   LEU B CG    1 
ATOM   6690 C  CD1   . LEU D 4  58  ? 60.870 134.128 40.510 1.00 24.60  ? 58   LEU B CD1   1 
ATOM   6691 C  CD2   . LEU D 4  58  ? 58.427 134.591 40.305 1.00 24.01  ? 58   LEU B CD2   1 
ATOM   6692 N  N     . ASN D 4  59  ? 61.453 136.094 44.049 1.00 19.16  ? 59   ASN B N     1 
ATOM   6693 C  CA    . ASN D 4  59  ? 61.536 137.481 44.487 1.00 18.73  ? 59   ASN B CA    1 
ATOM   6694 C  C     . ASN D 4  59  ? 61.034 138.395 43.369 1.00 17.53  ? 59   ASN B C     1 
ATOM   6695 O  O     . ASN D 4  59  ? 61.692 138.545 42.348 1.00 17.28  ? 59   ASN B O     1 
ATOM   6696 C  CB    . ASN D 4  59  ? 62.983 137.819 44.835 1.00 20.55  ? 59   ASN B CB    1 
ATOM   6697 C  CG    . ASN D 4  59  ? 63.157 139.263 45.259 1.00 24.09  ? 59   ASN B CG    1 
ATOM   6698 O  OD1   . ASN D 4  59  ? 62.853 140.187 44.499 1.00 23.69  ? 59   ASN B OD1   1 
ATOM   6699 N  ND2   . ASN D 4  59  ? 63.648 139.467 46.480 1.00 24.42  ? 59   ASN B ND2   1 
ATOM   6700 N  N     . ILE D 4  60  ? 59.870 139.005 43.572 1.00 17.41  ? 60   ILE B N     1 
ATOM   6701 C  CA    . ILE D 4  60  ? 59.267 139.877 42.567 1.00 17.52  ? 60   ILE B CA    1 
ATOM   6702 C  C     . ILE D 4  60  ? 60.092 141.093 42.146 1.00 18.15  ? 60   ILE B C     1 
ATOM   6703 O  O     . ILE D 4  60  ? 59.777 141.734 41.146 1.00 17.30  ? 60   ILE B O     1 
ATOM   6704 C  CB    . ILE D 4  60  ? 57.874 140.354 43.012 1.00 16.95  ? 60   ILE B CB    1 
ATOM   6705 C  CG1   . ILE D 4  60  ? 57.976 141.192 44.280 1.00 15.90  ? 60   ILE B CG1   1 
ATOM   6706 C  CG2   . ILE D 4  60  ? 56.986 139.156 43.258 1.00 16.35  ? 60   ILE B CG2   1 
ATOM   6707 C  CD1   . ILE D 4  60  ? 56.644 141.681 44.764 1.00 18.24  ? 60   ILE B CD1   1 
ATOM   6708 N  N     . ASP D 4  61  ? 61.135 141.419 42.902 1.00 19.54  ? 61   ASP B N     1 
ATOM   6709 C  CA    . ASP D 4  61  ? 62.000 142.541 42.541 1.00 22.85  ? 61   ASP B CA    1 
ATOM   6710 C  C     . ASP D 4  61  ? 63.064 142.078 41.552 1.00 24.62  ? 61   ASP B C     1 
ATOM   6711 O  O     . ASP D 4  61  ? 63.277 142.715 40.521 1.00 26.31  ? 61   ASP B O     1 
ATOM   6712 C  CB    . ASP D 4  61  ? 62.690 143.129 43.772 1.00 24.57  ? 61   ASP B CB    1 
ATOM   6713 C  CG    . ASP D 4  61  ? 61.853 144.184 44.456 1.00 27.13  ? 61   ASP B CG    1 
ATOM   6714 O  OD1   . ASP D 4  61  ? 61.319 145.056 43.743 1.00 29.42  ? 61   ASP B OD1   1 
ATOM   6715 O  OD2   . ASP D 4  61  ? 61.736 144.153 45.699 1.00 29.75  ? 61   ASP B OD2   1 
ATOM   6716 N  N     . GLN D 4  62  ? 63.737 140.976 41.877 1.00 23.92  ? 62   GLN B N     1 
ATOM   6717 C  CA    . GLN D 4  62  ? 64.768 140.427 41.006 1.00 25.02  ? 62   GLN B CA    1 
ATOM   6718 C  C     . GLN D 4  62  ? 64.151 139.833 39.744 1.00 23.71  ? 62   GLN B C     1 
ATOM   6719 O  O     . GLN D 4  62  ? 64.763 139.845 38.686 1.00 23.44  ? 62   GLN B O     1 
ATOM   6720 C  CB    . GLN D 4  62  ? 65.561 139.347 41.745 1.00 27.58  ? 62   GLN B CB    1 
ATOM   6721 C  CG    . GLN D 4  62  ? 66.549 139.898 42.765 1.00 33.62  ? 62   GLN B CG    1 
ATOM   6722 C  CD    . GLN D 4  62  ? 66.741 138.976 43.958 1.00 36.62  ? 62   GLN B CD    1 
ATOM   6723 O  OE1   . GLN D 4  62  ? 66.812 137.752 43.814 1.00 38.89  ? 62   GLN B OE1   1 
ATOM   6724 N  NE2   . GLN D 4  62  ? 66.838 139.562 45.144 1.00 38.00  ? 62   GLN B NE2   1 
ATOM   6725 N  N     . ASN D 4  63  ? 62.933 139.321 39.866 1.00 23.62  ? 63   ASN B N     1 
ATOM   6726 C  CA    . ASN D 4  63  ? 62.234 138.716 38.743 1.00 24.52  ? 63   ASN B CA    1 
ATOM   6727 C  C     . ASN D 4  63  ? 60.857 139.343 38.681 1.00 26.25  ? 63   ASN B C     1 
ATOM   6728 O  O     . ASN D 4  63  ? 59.927 138.875 39.338 1.00 26.47  ? 63   ASN B O     1 
ATOM   6729 C  CB    . ASN D 4  63  ? 62.100 137.217 38.963 1.00 22.47  ? 63   ASN B CB    1 
ATOM   6730 C  CG    . ASN D 4  63  ? 63.411 136.579 39.324 1.00 25.25  ? 63   ASN B CG    1 
ATOM   6731 O  OD1   . ASN D 4  63  ? 64.295 136.407 38.476 1.00 24.76  ? 63   ASN B OD1   1 
ATOM   6732 N  ND2   . ASN D 4  63  ? 63.563 136.239 40.599 1.00 24.48  ? 63   ASN B ND2   1 
ATOM   6733 N  N     . PRO D 4  64  ? 60.709 140.415 37.887 1.00 27.08  ? 64   PRO B N     1 
ATOM   6734 C  CA    . PRO D 4  64  ? 59.438 141.129 37.735 1.00 26.80  ? 64   PRO B CA    1 
ATOM   6735 C  C     . PRO D 4  64  ? 58.488 140.635 36.646 1.00 26.17  ? 64   PRO B C     1 
ATOM   6736 O  O     . PRO D 4  64  ? 57.364 141.118 36.545 1.00 27.22  ? 64   PRO B O     1 
ATOM   6737 C  CB    . PRO D 4  64  ? 59.894 142.558 37.477 1.00 28.18  ? 64   PRO B CB    1 
ATOM   6738 C  CG    . PRO D 4  64  ? 61.095 142.340 36.593 1.00 27.76  ? 64   PRO B CG    1 
ATOM   6739 C  CD    . PRO D 4  64  ? 61.816 141.181 37.277 1.00 27.39  ? 64   PRO B CD    1 
ATOM   6740 N  N     . GLY D 4  65  ? 58.919 139.668 35.847 1.00 25.70  ? 65   GLY B N     1 
ATOM   6741 C  CA    . GLY D 4  65  ? 58.072 139.199 34.764 1.00 23.83  ? 65   GLY B CA    1 
ATOM   6742 C  C     . GLY D 4  65  ? 57.032 138.133 35.047 1.00 22.95  ? 65   GLY B C     1 
ATOM   6743 O  O     . GLY D 4  65  ? 56.017 138.060 34.350 1.00 23.04  ? 65   GLY B O     1 
ATOM   6744 N  N     . THR D 4  66  ? 57.268 137.317 36.067 1.00 20.92  ? 66   THR B N     1 
ATOM   6745 C  CA    . THR D 4  66  ? 56.365 136.226 36.407 1.00 20.58  ? 66   THR B CA    1 
ATOM   6746 C  C     . THR D 4  66  ? 55.077 136.593 37.155 1.00 21.41  ? 66   THR B C     1 
ATOM   6747 O  O     . THR D 4  66  ? 53.985 136.252 36.710 1.00 22.84  ? 66   THR B O     1 
ATOM   6748 C  CB    . THR D 4  66  ? 57.115 135.165 37.226 1.00 19.72  ? 66   THR B CB    1 
ATOM   6749 O  OG1   . THR D 4  66  ? 58.351 134.863 36.576 1.00 20.47  ? 66   THR B OG1   1 
ATOM   6750 C  CG2   . THR D 4  66  ? 56.297 133.894 37.345 1.00 17.65  ? 66   THR B CG2   1 
ATOM   6751 N  N     . ALA D 4  67  ? 55.205 137.276 38.289 1.00 21.67  ? 67   ALA B N     1 
ATOM   6752 C  CA    . ALA D 4  67  ? 54.052 137.654 39.109 1.00 23.35  ? 67   ALA B CA    1 
ATOM   6753 C  C     . ALA D 4  67  ? 52.852 138.256 38.366 1.00 23.03  ? 67   ALA B C     1 
ATOM   6754 O  O     . ALA D 4  67  ? 51.714 137.869 38.613 1.00 22.19  ? 67   ALA B O     1 
ATOM   6755 C  CB    . ALA D 4  67  ? 54.499 138.600 40.223 1.00 24.06  ? 67   ALA B CB    1 
ATOM   6756 N  N     . PRO D 4  68  ? 53.089 139.215 37.457 1.00 24.11  ? 68   PRO B N     1 
ATOM   6757 C  CA    . PRO D 4  68  ? 51.994 139.839 36.706 1.00 24.09  ? 68   PRO B CA    1 
ATOM   6758 C  C     . PRO D 4  68  ? 51.066 138.829 36.038 1.00 26.51  ? 68   PRO B C     1 
ATOM   6759 O  O     . PRO D 4  68  ? 49.852 139.014 36.004 1.00 26.89  ? 68   PRO B O     1 
ATOM   6760 C  CB    . PRO D 4  68  ? 52.729 140.701 35.685 1.00 24.22  ? 68   PRO B CB    1 
ATOM   6761 C  CG    . PRO D 4  68  ? 53.960 141.110 36.426 1.00 24.71  ? 68   PRO B CG    1 
ATOM   6762 C  CD    . PRO D 4  68  ? 54.384 139.814 37.086 1.00 24.01  ? 68   PRO B CD    1 
ATOM   6763 N  N     . LYS D 4  69  ? 51.642 137.759 35.505 1.00 27.92  ? 69   LYS B N     1 
ATOM   6764 C  CA    . LYS D 4  69  ? 50.853 136.737 34.836 1.00 29.43  ? 69   LYS B CA    1 
ATOM   6765 C  C     . LYS D 4  69  ? 49.893 136.042 35.789 1.00 31.00  ? 69   LYS B C     1 
ATOM   6766 O  O     . LYS D 4  69  ? 48.954 135.377 35.355 1.00 32.34  ? 69   LYS B O     1 
ATOM   6767 C  CB    . LYS D 4  69  ? 51.774 135.695 34.201 1.00 29.90  ? 69   LYS B CB    1 
ATOM   6768 C  CG    . LYS D 4  69  ? 52.701 136.258 33.138 1.00 30.25  ? 69   LYS B CG    1 
ATOM   6769 C  CD    . LYS D 4  69  ? 53.762 135.247 32.742 1.00 30.42  ? 69   LYS B CD    1 
ATOM   6770 C  CE    . LYS D 4  69  ? 54.748 135.842 31.755 1.00 29.91  ? 69   LYS B CE    1 
ATOM   6771 N  NZ    . LYS D 4  69  ? 55.835 134.884 31.440 1.00 30.40  ? 69   LYS B NZ    1 
ATOM   6772 N  N     . TYR D 4  70  ? 50.125 136.185 37.088 1.00 31.88  ? 70   TYR B N     1 
ATOM   6773 C  CA    . TYR D 4  70  ? 49.262 135.543 38.073 1.00 31.24  ? 70   TYR B CA    1 
ATOM   6774 C  C     . TYR D 4  70  ? 48.408 136.530 38.862 1.00 31.45  ? 70   TYR B C     1 
ATOM   6775 O  O     . TYR D 4  70  ? 47.776 136.170 39.858 1.00 32.06  ? 70   TYR B O     1 
ATOM   6776 C  CB    . TYR D 4  70  ? 50.114 134.677 39.000 1.00 30.75  ? 70   TYR B CB    1 
ATOM   6777 C  CG    . TYR D 4  70  ? 50.688 133.485 38.270 1.00 29.66  ? 70   TYR B CG    1 
ATOM   6778 C  CD1   . TYR D 4  70  ? 49.892 132.382 37.975 1.00 28.68  ? 70   TYR B CD1   1 
ATOM   6779 C  CD2   . TYR D 4  70  ? 51.996 133.501 37.789 1.00 30.47  ? 70   TYR B CD2   1 
ATOM   6780 C  CE1   . TYR D 4  70  ? 50.375 131.328 37.214 1.00 28.33  ? 70   TYR B CE1   1 
ATOM   6781 C  CE2   . TYR D 4  70  ? 52.492 132.450 37.022 1.00 29.74  ? 70   TYR B CE2   1 
ATOM   6782 C  CZ    . TYR D 4  70  ? 51.672 131.370 36.738 1.00 30.08  ? 70   TYR B CZ    1 
ATOM   6783 O  OH    . TYR D 4  70  ? 52.137 130.344 35.957 1.00 30.17  ? 70   TYR B OH    1 
ATOM   6784 N  N     . GLY D 4  71  ? 48.382 137.774 38.397 1.00 30.64  ? 71   GLY B N     1 
ATOM   6785 C  CA    . GLY D 4  71  ? 47.580 138.796 39.043 1.00 30.88  ? 71   GLY B CA    1 
ATOM   6786 C  C     . GLY D 4  71  ? 47.873 139.026 40.510 1.00 30.32  ? 71   GLY B C     1 
ATOM   6787 O  O     . GLY D 4  71  ? 46.961 139.231 41.304 1.00 30.62  ? 71   GLY B O     1 
ATOM   6788 N  N     . ILE D 4  72  ? 49.149 138.993 40.871 1.00 30.79  ? 72   ILE B N     1 
ATOM   6789 C  CA    . ILE D 4  72  ? 49.558 139.221 42.249 1.00 29.80  ? 72   ILE B CA    1 
ATOM   6790 C  C     . ILE D 4  72  ? 49.118 140.612 42.701 1.00 29.55  ? 72   ILE B C     1 
ATOM   6791 O  O     . ILE D 4  72  ? 49.420 141.614 42.056 1.00 26.56  ? 72   ILE B O     1 
ATOM   6792 C  CB    . ILE D 4  72  ? 51.086 139.096 42.386 1.00 29.29  ? 72   ILE B CB    1 
ATOM   6793 C  CG1   . ILE D 4  72  ? 51.500 137.661 42.077 1.00 29.51  ? 72   ILE B CG1   1 
ATOM   6794 C  CG2   . ILE D 4  72  ? 51.538 139.528 43.770 1.00 28.70  ? 72   ILE B CG2   1 
ATOM   6795 C  CD1   . ILE D 4  72  ? 50.757 136.618 42.887 1.00 30.33  ? 72   ILE B CD1   1 
ATOM   6796 N  N     . ARG D 4  73  ? 48.405 140.668 43.816 1.00 30.44  ? 73   ARG B N     1 
ATOM   6797 C  CA    . ARG D 4  73  ? 47.932 141.941 44.324 1.00 32.09  ? 73   ARG B CA    1 
ATOM   6798 C  C     . ARG D 4  73  ? 48.377 142.129 45.772 1.00 29.60  ? 73   ARG B C     1 
ATOM   6799 O  O     . ARG D 4  73  ? 48.215 143.200 46.357 1.00 30.56  ? 73   ARG B O     1 
ATOM   6800 C  CB    . ARG D 4  73  ? 46.408 142.004 44.196 1.00 36.31  ? 73   ARG B CB    1 
ATOM   6801 C  CG    . ARG D 4  73  ? 45.860 143.399 43.911 1.00 45.39  ? 73   ARG B CG    1 
ATOM   6802 C  CD    . ARG D 4  73  ? 45.940 144.286 45.144 1.00 51.03  ? 73   ARG B CD    1 
ATOM   6803 N  NE    . ARG D 4  73  ? 45.258 143.663 46.279 1.00 57.07  ? 73   ARG B NE    1 
ATOM   6804 C  CZ    . ARG D 4  73  ? 45.265 144.145 47.518 1.00 59.09  ? 73   ARG B CZ    1 
ATOM   6805 N  NH1   . ARG D 4  73  ? 45.923 145.266 47.789 1.00 59.63  ? 73   ARG B NH1   1 
ATOM   6806 N  NH2   . ARG D 4  73  ? 44.616 143.506 48.485 1.00 60.58  ? 73   ARG B NH2   1 
ATOM   6807 N  N     . GLY D 4  74  ? 48.962 141.083 46.341 1.00 27.75  ? 74   GLY B N     1 
ATOM   6808 C  CA    . GLY D 4  74  ? 49.432 141.156 47.711 1.00 24.19  ? 74   GLY B CA    1 
ATOM   6809 C  C     . GLY D 4  74  ? 50.572 140.189 47.954 1.00 23.49  ? 74   GLY B C     1 
ATOM   6810 O  O     . GLY D 4  74  ? 50.680 139.172 47.278 1.00 23.21  ? 74   GLY B O     1 
ATOM   6811 N  N     . ILE D 4  75  ? 51.433 140.506 48.912 1.00 22.80  ? 75   ILE B N     1 
ATOM   6812 C  CA    . ILE D 4  75  ? 52.552 139.634 49.235 1.00 22.10  ? 75   ILE B CA    1 
ATOM   6813 C  C     . ILE D 4  75  ? 52.634 139.451 50.736 1.00 22.03  ? 75   ILE B C     1 
ATOM   6814 O  O     . ILE D 4  75  ? 52.277 140.346 51.490 1.00 23.47  ? 75   ILE B O     1 
ATOM   6815 C  CB    . ILE D 4  75  ? 53.895 140.208 48.722 1.00 20.97  ? 75   ILE B CB    1 
ATOM   6816 C  CG1   . ILE D 4  75  ? 54.058 141.657 49.175 1.00 21.04  ? 75   ILE B CG1   1 
ATOM   6817 C  CG2   . ILE D 4  75  ? 53.957 140.109 47.208 1.00 20.65  ? 75   ILE B CG2   1 
ATOM   6818 C  CD1   . ILE D 4  75  ? 55.368 142.298 48.709 1.00 22.58  ? 75   ILE B CD1   1 
ATOM   6819 N  N     . PRO D 4  76  ? 53.087 138.276 51.192 1.00 23.00  ? 76   PRO B N     1 
ATOM   6820 C  CA    . PRO D 4  76  ? 53.513 137.148 50.361 1.00 23.01  ? 76   PRO B CA    1 
ATOM   6821 C  C     . PRO D 4  76  ? 52.334 136.371 49.783 1.00 22.64  ? 76   PRO B C     1 
ATOM   6822 O  O     . PRO D 4  76  ? 51.341 136.138 50.468 1.00 23.23  ? 76   PRO B O     1 
ATOM   6823 C  CB    . PRO D 4  76  ? 54.314 136.300 51.337 1.00 23.15  ? 76   PRO B CB    1 
ATOM   6824 C  CG    . PRO D 4  76  ? 53.540 136.480 52.603 1.00 23.07  ? 76   PRO B CG    1 
ATOM   6825 C  CD    . PRO D 4  76  ? 53.327 137.980 52.616 1.00 23.02  ? 76   PRO B CD    1 
ATOM   6826 N  N     . THR D 4  77  ? 52.449 135.977 48.522 1.00 20.74  ? 77   THR B N     1 
ATOM   6827 C  CA    . THR D 4  77  ? 51.407 135.193 47.887 1.00 21.06  ? 77   THR B CA    1 
ATOM   6828 C  C     . THR D 4  77  ? 51.911 133.757 47.773 1.00 21.34  ? 77   THR B C     1 
ATOM   6829 O  O     . THR D 4  77  ? 53.037 133.527 47.335 1.00 22.15  ? 77   THR B O     1 
ATOM   6830 C  CB    . THR D 4  77  ? 51.077 135.740 46.490 1.00 20.97  ? 77   THR B CB    1 
ATOM   6831 O  OG1   . THR D 4  77  ? 50.337 136.955 46.629 1.00 21.99  ? 77   THR B OG1   1 
ATOM   6832 C  CG2   . THR D 4  77  ? 50.249 134.736 45.696 1.00 21.25  ? 77   THR B CG2   1 
ATOM   6833 N  N     . LEU D 4  78  ? 51.087 132.798 48.182 1.00 21.18  ? 78   LEU B N     1 
ATOM   6834 C  CA    . LEU D 4  78  ? 51.466 131.390 48.123 1.00 22.36  ? 78   LEU B CA    1 
ATOM   6835 C  C     . LEU D 4  78  ? 50.665 130.661 47.056 1.00 23.75  ? 78   LEU B C     1 
ATOM   6836 O  O     . LEU D 4  78  ? 49.476 130.407 47.222 1.00 23.38  ? 78   LEU B O     1 
ATOM   6837 C  CB    . LEU D 4  78  ? 51.238 130.723 49.481 1.00 22.14  ? 78   LEU B CB    1 
ATOM   6838 C  CG    . LEU D 4  78  ? 51.909 131.411 50.675 1.00 24.53  ? 78   LEU B CG    1 
ATOM   6839 C  CD1   . LEU D 4  78  ? 51.557 130.687 51.968 1.00 23.36  ? 78   LEU B CD1   1 
ATOM   6840 C  CD2   . LEU D 4  78  ? 53.416 131.433 50.467 1.00 24.01  ? 78   LEU B CD2   1 
ATOM   6841 N  N     . LEU D 4  79  ? 51.319 130.340 45.948 1.00 25.94  ? 79   LEU B N     1 
ATOM   6842 C  CA    . LEU D 4  79  ? 50.664 129.631 44.856 1.00 28.14  ? 79   LEU B CA    1 
ATOM   6843 C  C     . LEU D 4  79  ? 51.123 128.176 44.835 1.00 29.51  ? 79   LEU B C     1 
ATOM   6844 O  O     . LEU D 4  79  ? 52.314 127.895 44.689 1.00 30.57  ? 79   LEU B O     1 
ATOM   6845 C  CB    . LEU D 4  79  ? 50.997 130.299 43.522 1.00 27.26  ? 79   LEU B CB    1 
ATOM   6846 C  CG    . LEU D 4  79  ? 49.927 131.175 42.865 1.00 28.09  ? 79   LEU B CG    1 
ATOM   6847 C  CD1   . LEU D 4  79  ? 49.367 132.173 43.854 1.00 29.28  ? 79   LEU B CD1   1 
ATOM   6848 C  CD2   . LEU D 4  79  ? 50.537 131.887 41.667 1.00 27.46  ? 79   LEU B CD2   1 
ATOM   6849 N  N     . LEU D 4  80  ? 50.177 127.256 44.994 1.00 29.98  ? 80   LEU B N     1 
ATOM   6850 C  CA    . LEU D 4  80  ? 50.493 125.832 44.982 1.00 31.20  ? 80   LEU B CA    1 
ATOM   6851 C  C     . LEU D 4  80  ? 50.230 125.298 43.577 1.00 31.23  ? 80   LEU B C     1 
ATOM   6852 O  O     . LEU D 4  80  ? 49.077 125.212 43.150 1.00 30.94  ? 80   LEU B O     1 
ATOM   6853 C  CB    . LEU D 4  80  ? 49.618 125.088 45.995 1.00 31.71  ? 80   LEU B CB    1 
ATOM   6854 C  CG    . LEU D 4  80  ? 49.998 123.651 46.363 1.00 32.92  ? 80   LEU B CG    1 
ATOM   6855 C  CD1   . LEU D 4  80  ? 49.015 123.115 47.389 1.00 33.25  ? 80   LEU B CD1   1 
ATOM   6856 C  CD2   . LEU D 4  80  ? 49.992 122.773 45.135 1.00 34.38  ? 80   LEU B CD2   1 
ATOM   6857 N  N     . PHE D 4  81  ? 51.298 124.945 42.866 1.00 31.90  ? 81   PHE B N     1 
ATOM   6858 C  CA    . PHE D 4  81  ? 51.173 124.425 41.505 1.00 34.17  ? 81   PHE B CA    1 
ATOM   6859 C  C     . PHE D 4  81  ? 51.218 122.903 41.424 1.00 36.74  ? 81   PHE B C     1 
ATOM   6860 O  O     . PHE D 4  81  ? 51.895 122.235 42.213 1.00 36.45  ? 81   PHE B O     1 
ATOM   6861 C  CB    . PHE D 4  81  ? 52.284 124.959 40.598 1.00 31.33  ? 81   PHE B CB    1 
ATOM   6862 C  CG    . PHE D 4  81  ? 52.149 126.409 40.232 1.00 29.85  ? 81   PHE B CG    1 
ATOM   6863 C  CD1   . PHE D 4  81  ? 52.485 127.410 41.142 1.00 27.18  ? 81   PHE B CD1   1 
ATOM   6864 C  CD2   . PHE D 4  81  ? 51.740 126.774 38.948 1.00 27.17  ? 81   PHE B CD2   1 
ATOM   6865 C  CE1   . PHE D 4  81  ? 52.422 128.750 40.777 1.00 27.91  ? 81   PHE B CE1   1 
ATOM   6866 C  CE2   . PHE D 4  81  ? 51.672 128.112 38.574 1.00 26.15  ? 81   PHE B CE2   1 
ATOM   6867 C  CZ    . PHE D 4  81  ? 52.015 129.103 39.488 1.00 27.00  ? 81   PHE B CZ    1 
ATOM   6868 N  N     . LYS D 4  82  ? 50.499 122.372 40.442 1.00 38.50  ? 82   LYS B N     1 
ATOM   6869 C  CA    . LYS D 4  82  ? 50.452 120.943 40.199 1.00 41.13  ? 82   LYS B CA    1 
ATOM   6870 C  C     . LYS D 4  82  ? 50.143 120.747 38.720 1.00 41.95  ? 82   LYS B C     1 
ATOM   6871 O  O     . LYS D 4  82  ? 49.055 121.076 38.249 1.00 41.87  ? 82   LYS B O     1 
ATOM   6872 C  CB    . LYS D 4  82  ? 49.379 120.281 41.060 1.00 43.07  ? 82   LYS B CB    1 
ATOM   6873 C  CG    . LYS D 4  82  ? 49.534 118.771 41.141 1.00 49.51  ? 82   LYS B CG    1 
ATOM   6874 C  CD    . LYS D 4  82  ? 50.892 118.380 41.748 1.00 52.28  ? 82   LYS B CD    1 
ATOM   6875 C  CE    . LYS D 4  82  ? 51.091 116.862 41.793 1.00 53.37  ? 82   LYS B CE    1 
ATOM   6876 N  NZ    . LYS D 4  82  ? 51.163 116.258 40.430 1.00 53.84  ? 82   LYS B NZ    1 
ATOM   6877 N  N     . ASN D 4  83  ? 51.119 120.222 37.990 1.00 43.48  ? 83   ASN B N     1 
ATOM   6878 C  CA    . ASN D 4  83  ? 50.978 120.000 36.561 1.00 44.81  ? 83   ASN B CA    1 
ATOM   6879 C  C     . ASN D 4  83  ? 50.707 121.290 35.793 1.00 44.92  ? 83   ASN B C     1 
ATOM   6880 O  O     . ASN D 4  83  ? 49.691 121.423 35.109 1.00 44.79  ? 83   ASN B O     1 
ATOM   6881 C  CB    . ASN D 4  83  ? 49.875 118.974 36.278 1.00 46.98  ? 83   ASN B CB    1 
ATOM   6882 C  CG    . ASN D 4  83  ? 50.359 117.541 36.445 1.00 49.97  ? 83   ASN B CG    1 
ATOM   6883 O  OD1   . ASN D 4  83  ? 50.645 117.089 37.558 1.00 50.65  ? 83   ASN B OD1   1 
ATOM   6884 N  ND2   . ASN D 4  83  ? 50.466 116.822 35.331 1.00 51.65  ? 83   ASN B ND2   1 
ATOM   6885 N  N     . GLY D 4  84  ? 51.628 122.240 35.928 1.00 44.82  ? 84   GLY B N     1 
ATOM   6886 C  CA    . GLY D 4  84  ? 51.529 123.507 35.224 1.00 44.95  ? 84   GLY B CA    1 
ATOM   6887 C  C     . GLY D 4  84  ? 50.371 124.447 35.504 1.00 44.77  ? 84   GLY B C     1 
ATOM   6888 O  O     . GLY D 4  84  ? 50.165 125.402 34.752 1.00 43.82  ? 84   GLY B O     1 
ATOM   6889 N  N     . GLU D 4  85  ? 49.616 124.204 36.569 1.00 45.59  ? 85   GLU B N     1 
ATOM   6890 C  CA    . GLU D 4  85  ? 48.492 125.080 36.888 1.00 46.16  ? 85   GLU B CA    1 
ATOM   6891 C  C     . GLU D 4  85  ? 48.307 125.336 38.376 1.00 44.05  ? 85   GLU B C     1 
ATOM   6892 O  O     . GLU D 4  85  ? 48.662 124.506 39.218 1.00 43.57  ? 85   GLU B O     1 
ATOM   6893 C  CB    . GLU D 4  85  ? 47.206 124.512 36.299 1.00 48.84  ? 85   GLU B CB    1 
ATOM   6894 C  CG    . GLU D 4  85  ? 47.229 124.440 34.791 1.00 54.90  ? 85   GLU B CG    1 
ATOM   6895 C  CD    . GLU D 4  85  ? 45.969 123.838 34.229 1.00 58.86  ? 85   GLU B CD    1 
ATOM   6896 O  OE1   . GLU D 4  85  ? 45.613 122.717 34.657 1.00 61.36  ? 85   GLU B OE1   1 
ATOM   6897 O  OE2   . GLU D 4  85  ? 45.338 124.482 33.362 1.00 60.46  ? 85   GLU B OE2   1 
ATOM   6898 N  N     . VAL D 4  86  ? 47.752 126.500 38.691 1.00 41.70  ? 86   VAL B N     1 
ATOM   6899 C  CA    . VAL D 4  86  ? 47.510 126.878 40.075 1.00 40.02  ? 86   VAL B CA    1 
ATOM   6900 C  C     . VAL D 4  86  ? 46.398 126.017 40.661 1.00 39.21  ? 86   VAL B C     1 
ATOM   6901 O  O     . VAL D 4  86  ? 45.256 126.064 40.206 1.00 38.62  ? 86   VAL B O     1 
ATOM   6902 C  CB    . VAL D 4  86  ? 47.099 128.354 40.181 1.00 38.93  ? 86   VAL B CB    1 
ATOM   6903 C  CG1   . VAL D 4  86  ? 46.920 128.731 41.634 1.00 38.58  ? 86   VAL B CG1   1 
ATOM   6904 C  CG2   . VAL D 4  86  ? 48.143 129.233 39.522 1.00 38.01  ? 86   VAL B CG2   1 
ATOM   6905 N  N     . ALA D 4  87  ? 46.738 125.226 41.670 1.00 38.69  ? 87   ALA B N     1 
ATOM   6906 C  CA    . ALA D 4  87  ? 45.764 124.356 42.308 1.00 38.49  ? 87   ALA B CA    1 
ATOM   6907 C  C     . ALA D 4  87  ? 45.077 125.091 43.450 1.00 39.05  ? 87   ALA B C     1 
ATOM   6908 O  O     . ALA D 4  87  ? 43.881 124.916 43.678 1.00 40.03  ? 87   ALA B O     1 
ATOM   6909 C  CB    . ALA D 4  87  ? 46.452 123.101 42.829 1.00 38.57  ? 87   ALA B CB    1 
ATOM   6910 N  N     . ALA D 4  88  ? 45.840 125.915 44.164 1.00 38.37  ? 88   ALA B N     1 
ATOM   6911 C  CA    . ALA D 4  88  ? 45.313 126.678 45.293 1.00 36.72  ? 88   ALA B CA    1 
ATOM   6912 C  C     . ALA D 4  88  ? 46.198 127.881 45.567 1.00 35.78  ? 88   ALA B C     1 
ATOM   6913 O  O     . ALA D 4  88  ? 47.411 127.838 45.347 1.00 35.73  ? 88   ALA B O     1 
ATOM   6914 C  CB    . ALA D 4  88  ? 45.245 125.798 46.538 1.00 35.81  ? 88   ALA B CB    1 
ATOM   6915 N  N     . THR D 4  89  ? 45.591 128.955 46.053 1.00 34.22  ? 89   THR B N     1 
ATOM   6916 C  CA    . THR D 4  89  ? 46.343 130.160 46.355 1.00 34.08  ? 89   THR B CA    1 
ATOM   6917 C  C     . THR D 4  89  ? 45.905 130.764 47.683 1.00 32.84  ? 89   THR B C     1 
ATOM   6918 O  O     . THR D 4  89  ? 44.722 130.794 48.003 1.00 32.99  ? 89   THR B O     1 
ATOM   6919 C  CB    . THR D 4  89  ? 46.169 131.218 45.251 1.00 34.66  ? 89   THR B CB    1 
ATOM   6920 O  OG1   . THR D 4  89  ? 45.369 132.295 45.748 1.00 35.51  ? 89   THR B OG1   1 
ATOM   6921 C  CG2   . THR D 4  89  ? 45.486 130.614 44.027 1.00 35.41  ? 89   THR B CG2   1 
ATOM   6922 N  N     . LYS D 4  90  ? 46.875 131.249 48.449 1.00 32.58  ? 90   LYS B N     1 
ATOM   6923 C  CA    . LYS D 4  90  ? 46.607 131.857 49.745 1.00 32.36  ? 90   LYS B CA    1 
ATOM   6924 C  C     . LYS D 4  90  ? 47.546 133.057 49.921 1.00 30.54  ? 90   LYS B C     1 
ATOM   6925 O  O     . LYS D 4  90  ? 48.754 132.944 49.719 1.00 31.37  ? 90   LYS B O     1 
ATOM   6926 C  CB    . LYS D 4  90  ? 46.836 130.818 50.846 1.00 33.44  ? 90   LYS B CB    1 
ATOM   6927 C  CG    . LYS D 4  90  ? 46.164 131.133 52.164 1.00 36.58  ? 90   LYS B CG    1 
ATOM   6928 C  CD    . LYS D 4  90  ? 44.650 131.268 52.015 1.00 39.21  ? 90   LYS B CD    1 
ATOM   6929 C  CE    . LYS D 4  90  ? 43.970 129.953 51.652 1.00 40.10  ? 90   LYS B CE    1 
ATOM   6930 N  NZ    . LYS D 4  90  ? 42.482 130.113 51.617 1.00 40.49  ? 90   LYS B NZ    1 
ATOM   6931 N  N     . VAL D 4  91  ? 46.987 134.205 50.286 1.00 28.05  ? 91   VAL B N     1 
ATOM   6932 C  CA    . VAL D 4  91  ? 47.777 135.421 50.465 1.00 26.10  ? 91   VAL B CA    1 
ATOM   6933 C  C     . VAL D 4  91  ? 47.886 135.820 51.930 1.00 27.05  ? 91   VAL B C     1 
ATOM   6934 O  O     . VAL D 4  91  ? 46.875 136.047 52.587 1.00 28.47  ? 91   VAL B O     1 
ATOM   6935 C  CB    . VAL D 4  91  ? 47.149 136.617 49.704 1.00 24.61  ? 91   VAL B CB    1 
ATOM   6936 C  CG1   . VAL D 4  91  ? 47.990 137.870 49.920 1.00 22.30  ? 91   VAL B CG1   1 
ATOM   6937 C  CG2   . VAL D 4  91  ? 47.022 136.294 48.222 1.00 22.37  ? 91   VAL B CG2   1 
ATOM   6938 N  N     . GLY D 4  92  ? 49.111 135.912 52.437 1.00 26.89  ? 92   GLY B N     1 
ATOM   6939 C  CA    . GLY D 4  92  ? 49.294 136.302 53.822 1.00 27.57  ? 92   GLY B CA    1 
ATOM   6940 C  C     . GLY D 4  92  ? 50.339 135.520 54.596 1.00 28.69  ? 92   GLY B C     1 
ATOM   6941 O  O     . GLY D 4  92  ? 50.703 134.399 54.231 1.00 28.61  ? 92   GLY B O     1 
ATOM   6942 N  N     . ALA D 4  93  ? 50.819 136.123 55.679 1.00 28.68  ? 93   ALA B N     1 
ATOM   6943 C  CA    . ALA D 4  93  ? 51.820 135.501 56.532 1.00 29.46  ? 93   ALA B CA    1 
ATOM   6944 C  C     . ALA D 4  93  ? 51.169 134.452 57.416 1.00 30.60  ? 93   ALA B C     1 
ATOM   6945 O  O     . ALA D 4  93  ? 51.007 134.662 58.618 1.00 31.37  ? 93   ALA B O     1 
ATOM   6946 C  CB    . ALA D 4  93  ? 52.499 136.551 57.394 1.00 27.64  ? 93   ALA B CB    1 
ATOM   6947 N  N     . LEU D 4  94  ? 50.787 133.327 56.817 1.00 31.22  ? 94   LEU B N     1 
ATOM   6948 C  CA    . LEU D 4  94  ? 50.166 132.244 57.569 1.00 32.40  ? 94   LEU B CA    1 
ATOM   6949 C  C     . LEU D 4  94  ? 51.140 131.774 58.635 1.00 33.36  ? 94   LEU B C     1 
ATOM   6950 O  O     . LEU D 4  94  ? 52.336 132.071 58.579 1.00 35.31  ? 94   LEU B O     1 
ATOM   6951 C  CB    . LEU D 4  94  ? 49.831 131.062 56.656 1.00 30.42  ? 94   LEU B CB    1 
ATOM   6952 C  CG    . LEU D 4  94  ? 49.063 131.337 55.365 1.00 31.39  ? 94   LEU B CG    1 
ATOM   6953 C  CD1   . LEU D 4  94  ? 48.679 130.008 54.736 1.00 29.55  ? 94   LEU B CD1   1 
ATOM   6954 C  CD2   . LEU D 4  94  ? 47.825 132.177 55.646 1.00 30.73  ? 94   LEU B CD2   1 
ATOM   6955 N  N     . SER D 4  95  ? 50.624 131.046 59.613 1.00 33.57  ? 95   SER B N     1 
ATOM   6956 C  CA    . SER D 4  95  ? 51.463 130.526 60.676 1.00 34.92  ? 95   SER B CA    1 
ATOM   6957 C  C     . SER D 4  95  ? 51.841 129.105 60.287 1.00 35.93  ? 95   SER B C     1 
ATOM   6958 O  O     . SER D 4  95  ? 51.254 128.527 59.368 1.00 35.85  ? 95   SER B O     1 
ATOM   6959 C  CB    . SER D 4  95  ? 50.696 130.512 61.996 1.00 34.94  ? 95   SER B CB    1 
ATOM   6960 O  OG    . SER D 4  95  ? 49.574 129.647 61.908 1.00 34.79  ? 95   SER B OG    1 
ATOM   6961 N  N     . LYS D 4  96  ? 52.824 128.548 60.984 1.00 36.60  ? 96   LYS B N     1 
ATOM   6962 C  CA    . LYS D 4  96  ? 53.273 127.188 60.720 1.00 37.61  ? 96   LYS B CA    1 
ATOM   6963 C  C     . LYS D 4  96  ? 52.066 126.261 60.556 1.00 37.74  ? 96   LYS B C     1 
ATOM   6964 O  O     . LYS D 4  96  ? 51.896 125.633 59.512 1.00 37.33  ? 96   LYS B O     1 
ATOM   6965 C  CB    . LYS D 4  96  ? 54.162 126.715 61.877 1.00 37.91  ? 96   LYS B CB    1 
ATOM   6966 C  CG    . LYS D 4  96  ? 54.609 125.264 61.815 1.00 38.52  ? 96   LYS B CG    1 
ATOM   6967 C  CD    . LYS D 4  96  ? 55.647 125.016 60.737 1.00 39.53  ? 96   LYS B CD    1 
ATOM   6968 C  CE    . LYS D 4  96  ? 56.227 123.609 60.859 1.00 39.20  ? 96   LYS B CE    1 
ATOM   6969 N  NZ    . LYS D 4  96  ? 56.948 123.414 62.151 1.00 37.31  ? 96   LYS B NZ    1 
ATOM   6970 N  N     . GLY D 4  97  ? 51.221 126.206 61.585 1.00 38.98  ? 97   GLY B N     1 
ATOM   6971 C  CA    . GLY D 4  97  ? 50.043 125.351 61.556 1.00 40.23  ? 97   GLY B CA    1 
ATOM   6972 C  C     . GLY D 4  97  ? 49.058 125.604 60.426 1.00 41.68  ? 97   GLY B C     1 
ATOM   6973 O  O     . GLY D 4  97  ? 48.516 124.661 59.842 1.00 41.31  ? 97   GLY B O     1 
ATOM   6974 N  N     . GLN D 4  98  ? 48.814 126.872 60.113 1.00 43.10  ? 98   GLN B N     1 
ATOM   6975 C  CA    . GLN D 4  98  ? 47.886 127.217 59.039 1.00 44.01  ? 98   GLN B CA    1 
ATOM   6976 C  C     . GLN D 4  98  ? 48.407 126.735 57.683 1.00 43.22  ? 98   GLN B C     1 
ATOM   6977 O  O     . GLN D 4  98  ? 47.632 126.282 56.837 1.00 41.92  ? 98   GLN B O     1 
ATOM   6978 C  CB    . GLN D 4  98  ? 47.652 128.733 59.005 1.00 44.99  ? 98   GLN B CB    1 
ATOM   6979 C  CG    . GLN D 4  98  ? 47.024 129.289 60.281 1.00 45.88  ? 98   GLN B CG    1 
ATOM   6980 C  CD    . GLN D 4  98  ? 46.859 130.796 60.245 1.00 46.35  ? 98   GLN B CD    1 
ATOM   6981 O  OE1   . GLN D 4  98  ? 47.818 131.533 60.009 1.00 46.64  ? 98   GLN B OE1   1 
ATOM   6982 N  NE2   . GLN D 4  98  ? 45.641 131.263 60.490 1.00 45.81  ? 98   GLN B NE2   1 
ATOM   6983 N  N     . LEU D 4  99  ? 49.720 126.830 57.480 1.00 42.53  ? 99   LEU B N     1 
ATOM   6984 C  CA    . LEU D 4  99  ? 50.320 126.387 56.221 1.00 41.48  ? 99   LEU B CA    1 
ATOM   6985 C  C     . LEU D 4  99  ? 50.117 124.883 56.106 1.00 41.13  ? 99   LEU B C     1 
ATOM   6986 O  O     . LEU D 4  99  ? 49.801 124.365 55.035 1.00 38.84  ? 99   LEU B O     1 
ATOM   6987 C  CB    . LEU D 4  99  ? 51.817 126.705 56.194 1.00 40.48  ? 99   LEU B CB    1 
ATOM   6988 C  CG    . LEU D 4  99  ? 52.366 127.318 54.904 1.00 39.95  ? 99   LEU B CG    1 
ATOM   6989 C  CD1   . LEU D 4  99  ? 53.880 127.362 54.976 1.00 39.49  ? 99   LEU B CD1   1 
ATOM   6990 C  CD2   . LEU D 4  99  ? 51.922 126.507 53.705 1.00 39.78  ? 99   LEU B CD2   1 
ATOM   6991 N  N     . LYS D 4  100 ? 50.298 124.192 57.229 1.00 42.58  ? 100  LYS B N     1 
ATOM   6992 C  CA    . LYS D 4  100 ? 50.126 122.747 57.290 1.00 44.17  ? 100  LYS B CA    1 
ATOM   6993 C  C     . LYS D 4  100 ? 48.700 122.346 56.924 1.00 44.04  ? 100  LYS B C     1 
ATOM   6994 O  O     . LYS D 4  100 ? 48.495 121.495 56.060 1.00 43.73  ? 100  LYS B O     1 
ATOM   6995 C  CB    . LYS D 4  100 ? 50.486 122.239 58.688 1.00 46.11  ? 100  LYS B CB    1 
ATOM   6996 C  CG    . LYS D 4  100 ? 51.994 122.128 58.916 1.00 49.29  ? 100  LYS B CG    1 
ATOM   6997 C  CD    . LYS D 4  100 ? 52.391 122.120 60.395 1.00 53.57  ? 100  LYS B CD    1 
ATOM   6998 C  CE    . LYS D 4  100 ? 51.654 121.058 61.215 1.00 56.80  ? 100  LYS B CE    1 
ATOM   6999 N  NZ    . LYS D 4  100 ? 50.230 121.420 61.511 1.00 58.25  ? 100  LYS B NZ    1 
ATOM   7000 N  N     . GLU D 4  101 ? 47.714 122.957 57.574 1.00 44.88  ? 101  GLU B N     1 
ATOM   7001 C  CA    . GLU D 4  101 ? 46.323 122.643 57.263 1.00 44.89  ? 101  GLU B CA    1 
ATOM   7002 C  C     . GLU D 4  101 ? 46.122 122.813 55.766 1.00 43.54  ? 101  GLU B C     1 
ATOM   7003 O  O     . GLU D 4  101 ? 45.601 121.928 55.086 1.00 43.64  ? 101  GLU B O     1 
ATOM   7004 C  CB    . GLU D 4  101 ? 45.368 123.588 57.988 1.00 47.40  ? 101  GLU B CB    1 
ATOM   7005 C  CG    . GLU D 4  101 ? 45.301 123.428 59.490 1.00 51.52  ? 101  GLU B CG    1 
ATOM   7006 C  CD    . GLU D 4  101 ? 44.242 124.331 60.106 1.00 54.62  ? 101  GLU B CD    1 
ATOM   7007 O  OE1   . GLU D 4  101 ? 43.047 124.158 59.769 1.00 55.13  ? 101  GLU B OE1   1 
ATOM   7008 O  OE2   . GLU D 4  101 ? 44.608 125.215 60.918 1.00 55.12  ? 101  GLU B OE2   1 
ATOM   7009 N  N     . PHE D 4  102 ? 46.546 123.967 55.265 1.00 41.97  ? 102  PHE B N     1 
ATOM   7010 C  CA    . PHE D 4  102 ? 46.429 124.294 53.850 1.00 41.06  ? 102  PHE B CA    1 
ATOM   7011 C  C     . PHE D 4  102 ? 47.089 123.255 52.947 1.00 40.13  ? 102  PHE B C     1 
ATOM   7012 O  O     . PHE D 4  102 ? 46.475 122.757 52.003 1.00 39.91  ? 102  PHE B O     1 
ATOM   7013 C  CB    . PHE D 4  102 ? 47.055 125.663 53.583 1.00 39.93  ? 102  PHE B CB    1 
ATOM   7014 C  CG    . PHE D 4  102 ? 47.105 126.030 52.131 1.00 39.69  ? 102  PHE B CG    1 
ATOM   7015 C  CD1   . PHE D 4  102 ? 45.935 126.234 51.412 1.00 38.56  ? 102  PHE B CD1   1 
ATOM   7016 C  CD2   . PHE D 4  102 ? 48.322 126.175 51.481 1.00 38.71  ? 102  PHE B CD2   1 
ATOM   7017 C  CE1   . PHE D 4  102 ? 45.979 126.580 50.070 1.00 38.59  ? 102  PHE B CE1   1 
ATOM   7018 C  CE2   . PHE D 4  102 ? 48.373 126.520 50.141 1.00 38.25  ? 102  PHE B CE2   1 
ATOM   7019 C  CZ    . PHE D 4  102 ? 47.199 126.723 49.434 1.00 37.83  ? 102  PHE B CZ    1 
ATOM   7020 N  N     . LEU D 4  103 ? 48.346 122.937 53.233 1.00 39.42  ? 103  LEU B N     1 
ATOM   7021 C  CA    . LEU D 4  103 ? 49.075 121.965 52.433 1.00 39.79  ? 103  LEU B CA    1 
ATOM   7022 C  C     . LEU D 4  103 ? 48.453 120.572 52.494 1.00 41.08  ? 103  LEU B C     1 
ATOM   7023 O  O     . LEU D 4  103 ? 48.081 120.002 51.463 1.00 40.74  ? 103  LEU B O     1 
ATOM   7024 C  CB    . LEU D 4  103 ? 50.537 121.905 52.885 1.00 38.41  ? 103  LEU B CB    1 
ATOM   7025 C  CG    . LEU D 4  103 ? 51.410 123.095 52.481 1.00 36.77  ? 103  LEU B CG    1 
ATOM   7026 C  CD1   . LEU D 4  103 ? 52.808 122.937 53.052 1.00 36.46  ? 103  LEU B CD1   1 
ATOM   7027 C  CD2   . LEU D 4  103 ? 51.460 123.185 50.969 1.00 35.30  ? 103  LEU B CD2   1 
ATOM   7028 N  N     . ASP D 4  104 ? 48.337 120.030 53.702 1.00 42.06  ? 104  ASP B N     1 
ATOM   7029 C  CA    . ASP D 4  104 ? 47.770 118.702 53.881 1.00 43.62  ? 104  ASP B CA    1 
ATOM   7030 C  C     . ASP D 4  104 ? 46.421 118.572 53.195 1.00 43.69  ? 104  ASP B C     1 
ATOM   7031 O  O     . ASP D 4  104 ? 46.093 117.525 52.643 1.00 44.76  ? 104  ASP B O     1 
ATOM   7032 C  CB    . ASP D 4  104 ? 47.624 118.384 55.369 1.00 44.96  ? 104  ASP B CB    1 
ATOM   7033 C  CG    . ASP D 4  104 ? 48.956 118.384 56.096 1.00 47.65  ? 104  ASP B CG    1 
ATOM   7034 O  OD1   . ASP D 4  104 ? 49.900 117.719 55.617 1.00 49.46  ? 104  ASP B OD1   1 
ATOM   7035 O  OD2   . ASP D 4  104 ? 49.060 119.043 57.149 1.00 48.80  ? 104  ASP B OD2   1 
ATOM   7036 N  N     . ALA D 4  105 ? 45.646 119.647 53.216 1.00 43.49  ? 105  ALA B N     1 
ATOM   7037 C  CA    . ALA D 4  105 ? 44.327 119.637 52.610 1.00 42.56  ? 105  ALA B CA    1 
ATOM   7038 C  C     . ALA D 4  105 ? 44.355 119.638 51.091 1.00 43.06  ? 105  ALA B C     1 
ATOM   7039 O  O     . ALA D 4  105 ? 43.509 119.016 50.458 1.00 44.08  ? 105  ALA B O     1 
ATOM   7040 C  CB    . ALA D 4  105 ? 43.524 120.827 53.109 1.00 42.87  ? 105  ALA B CB    1 
ATOM   7041 N  N     . ASN D 4  106 ? 45.322 120.330 50.499 1.00 43.40  ? 106  ASN B N     1 
ATOM   7042 C  CA    . ASN D 4  106 ? 45.394 120.405 49.043 1.00 43.75  ? 106  ASN B CA    1 
ATOM   7043 C  C     . ASN D 4  106 ? 46.312 119.375 48.396 1.00 44.80  ? 106  ASN B C     1 
ATOM   7044 O  O     . ASN D 4  106 ? 46.408 119.299 47.170 1.00 44.38  ? 106  ASN B O     1 
ATOM   7045 C  CB    . ASN D 4  106 ? 45.792 121.820 48.628 1.00 41.85  ? 106  ASN B CB    1 
ATOM   7046 C  CG    . ASN D 4  106 ? 44.697 122.831 48.911 1.00 41.46  ? 106  ASN B CG    1 
ATOM   7047 O  OD1   . ASN D 4  106 ? 43.717 122.926 48.170 1.00 40.93  ? 106  ASN B OD1   1 
ATOM   7048 N  ND2   . ASN D 4  106 ? 44.847 123.578 49.999 1.00 39.22  ? 106  ASN B ND2   1 
ATOM   7049 N  N     . LEU D 4  107 ? 46.972 118.576 49.228 1.00 46.10  ? 107  LEU B N     1 
ATOM   7050 C  CA    . LEU D 4  107 ? 47.872 117.532 48.750 1.00 47.12  ? 107  LEU B CA    1 
ATOM   7051 C  C     . LEU D 4  107 ? 47.314 116.143 49.069 1.00 48.30  ? 107  LEU B C     1 
ATOM   7052 O  O     . LEU D 4  107 ? 46.197 116.068 49.633 1.00 48.83  ? 107  LEU B O     1 
ATOM   7053 C  CB    . LEU D 4  107 ? 49.253 117.695 49.389 1.00 46.92  ? 107  LEU B CB    1 
ATOM   7054 C  CG    . LEU D 4  107 ? 50.361 118.303 48.524 1.00 46.71  ? 107  LEU B CG    1 
ATOM   7055 C  CD1   . LEU D 4  107 ? 49.873 119.563 47.829 1.00 46.08  ? 107  LEU B CD1   1 
ATOM   7056 C  CD2   . LEU D 4  107 ? 51.560 118.597 49.404 1.00 46.84  ? 107  LEU B CD2   1 
HETATM 7057 MG MG    . MG  E 5  .   ? 55.368 181.301 37.544 1.00 34.38  ? 904  MG  T MG    1 
HETATM 7058 MG MG    . MG  F 5  .   ? 61.771 192.619 20.081 1.00 24.63  ? 901  MG  A MG    1 
HETATM 7059 MG MG    . MG  G 5  .   ? 59.364 190.003 20.645 1.00 24.35  ? 902  MG  A MG    1 
HETATM 7060 MG MG    . MG  H 5  .   ? 27.924 191.289 33.605 1.00 16.80  ? 903  MG  A MG    1 
HETATM 7061 S  S     . SO4 I 6  .   ? 33.259 195.023 15.380 1.00 59.03  ? 905  SO4 A S     1 
HETATM 7062 O  O1    . SO4 I 6  .   ? 33.659 193.633 15.077 1.00 59.36  ? 905  SO4 A O1    1 
HETATM 7063 O  O2    . SO4 I 6  .   ? 31.786 195.127 15.353 1.00 60.07  ? 905  SO4 A O2    1 
HETATM 7064 O  O3    . SO4 I 6  .   ? 33.835 195.938 14.375 1.00 60.78  ? 905  SO4 A O3    1 
HETATM 7065 O  O4    . SO4 I 6  .   ? 33.749 195.414 16.711 1.00 58.35  ? 905  SO4 A O4    1 
HETATM 7066 S  S     . SO4 J 6  .   ? 41.668 196.572 48.800 1.00 64.83  ? 906  SO4 A S     1 
HETATM 7067 O  O1    . SO4 J 6  .   ? 41.516 197.170 50.140 1.00 65.00  ? 906  SO4 A O1    1 
HETATM 7068 O  O2    . SO4 J 6  .   ? 43.021 196.849 48.284 1.00 65.38  ? 906  SO4 A O2    1 
HETATM 7069 O  O3    . SO4 J 6  .   ? 40.668 197.158 47.888 1.00 65.34  ? 906  SO4 A O3    1 
HETATM 7070 O  O4    . SO4 J 6  .   ? 41.471 195.113 48.879 1.00 65.39  ? 906  SO4 A O4    1 
HETATM 7071 P  PA    . D3T K 7  .   ? 62.490 190.146 22.330 1.00 21.37  ? 823  D3T A PA    1 
HETATM 7072 O  O1A   . D3T K 7  .   ? 62.840 188.716 22.119 1.00 19.01  ? 823  D3T A O1A   1 
HETATM 7073 O  O2A   . D3T K 7  .   ? 61.677 190.869 21.317 1.00 17.39  ? 823  D3T A O2A   1 
HETATM 7074 O  "O5'" . D3T K 7  .   ? 61.815 190.239 23.773 1.00 22.15  ? 823  D3T A "O5'" 1 
HETATM 7075 C  "C5'" . D3T K 7  .   ? 61.102 191.401 24.184 1.00 22.76  ? 823  D3T A "C5'" 1 
HETATM 7076 C  "C4'" . D3T K 7  .   ? 61.494 191.783 25.597 1.00 22.27  ? 823  D3T A "C4'" 1 
HETATM 7077 O  "O4'" . D3T K 7  .   ? 61.229 190.675 26.499 1.00 20.62  ? 823  D3T A "O4'" 1 
HETATM 7078 C  "C1'" . D3T K 7  .   ? 62.190 190.671 27.545 1.00 18.76  ? 823  D3T A "C1'" 1 
HETATM 7079 N  N1    . D3T K 7  .   ? 62.896 189.367 27.555 1.00 17.74  ? 823  D3T A N1    1 
HETATM 7080 C  C6    . D3T K 7  .   ? 63.020 188.603 26.410 1.00 17.58  ? 823  D3T A C6    1 
HETATM 7081 C  C2    . D3T K 7  .   ? 63.436 188.944 28.753 1.00 16.38  ? 823  D3T A C2    1 
HETATM 7082 O  O2    . D3T K 7  .   ? 63.357 189.586 29.785 1.00 16.45  ? 823  D3T A O2    1 
HETATM 7083 N  N3    . D3T K 7  .   ? 64.078 187.736 28.698 1.00 15.01  ? 823  D3T A N3    1 
HETATM 7084 C  C4    . D3T K 7  .   ? 64.241 186.921 27.598 1.00 16.87  ? 823  D3T A C4    1 
HETATM 7085 O  O4    . D3T K 7  .   ? 64.844 185.853 27.713 1.00 15.94  ? 823  D3T A O4    1 
HETATM 7086 C  C5    . D3T K 7  .   ? 63.661 187.422 26.370 1.00 17.85  ? 823  D3T A C5    1 
HETATM 7087 C  C5M   . D3T K 7  .   ? 63.804 186.614 25.117 1.00 15.67  ? 823  D3T A C5M   1 
HETATM 7088 C  "C2'" . D3T K 7  .   ? 63.129 191.853 27.309 1.00 19.83  ? 823  D3T A "C2'" 1 
HETATM 7089 C  "C3'" . D3T K 7  .   ? 62.968 192.081 25.809 1.00 21.65  ? 823  D3T A "C3'" 1 
HETATM 7090 O  O3A   . D3T K 7  .   ? 63.817 190.975 22.639 1.00 20.73  ? 823  D3T A O3A   1 
HETATM 7091 P  PB    . D3T K 7  .   ? 64.358 192.244 21.846 1.00 16.64  ? 823  D3T A PB    1 
HETATM 7092 O  O1B   . D3T K 7  .   ? 65.421 192.871 22.664 1.00 19.59  ? 823  D3T A O1B   1 
HETATM 7093 O  O2B   . D3T K 7  .   ? 63.208 193.061 21.384 1.00 18.74  ? 823  D3T A O2B   1 
HETATM 7094 O  O3B   . D3T K 7  .   ? 65.045 191.501 20.611 1.00 21.82  ? 823  D3T A O3B   1 
HETATM 7095 P  PG    . D3T K 7  .   ? 64.555 191.702 19.106 1.00 21.23  ? 823  D3T A PG    1 
HETATM 7096 O  O1G   . D3T K 7  .   ? 63.069 191.596 19.063 1.00 24.04  ? 823  D3T A O1G   1 
HETATM 7097 O  O2G   . D3T K 7  .   ? 65.215 192.905 18.551 1.00 20.01  ? 823  D3T A O2G   1 
HETATM 7098 O  O3G   . D3T K 7  .   ? 65.096 190.409 18.521 1.00 20.50  ? 823  D3T A O3G   1 
HETATM 7099 O  O1    . MES L 8  .   ? 13.580 198.219 11.203 1.00 37.20  ? 991  MES A O1    1 
HETATM 7100 C  C2    . MES L 8  .   ? 14.156 197.007 11.756 1.00 38.32  ? 991  MES A C2    1 
HETATM 7101 C  C3    . MES L 8  .   ? 13.665 196.770 13.195 1.00 38.19  ? 991  MES A C3    1 
HETATM 7102 N  N4    . MES L 8  .   ? 13.976 197.951 14.018 1.00 38.46  ? 991  MES A N4    1 
HETATM 7103 C  C5    . MES L 8  .   ? 13.416 199.189 13.448 1.00 37.10  ? 991  MES A C5    1 
HETATM 7104 C  C6    . MES L 8  .   ? 13.887 199.374 12.013 1.00 37.73  ? 991  MES A C6    1 
HETATM 7105 C  C7    . MES L 8  .   ? 13.510 197.757 15.399 1.00 37.65  ? 991  MES A C7    1 
HETATM 7106 C  C8    . MES L 8  .   ? 14.278 198.555 16.442 1.00 38.57  ? 991  MES A C8    1 
HETATM 7107 S  S     . MES L 8  .   ? 13.501 198.528 18.026 1.00 39.57  ? 991  MES A S     1 
HETATM 7108 O  O1S   . MES L 8  .   ? 12.922 199.866 18.184 1.00 43.05  ? 991  MES A O1S   1 
HETATM 7109 O  O2S   . MES L 8  .   ? 14.517 198.280 19.010 1.00 41.07  ? 991  MES A O2S   1 
HETATM 7110 O  O3S   . MES L 8  .   ? 12.458 197.500 18.024 1.00 41.19  ? 991  MES A O3S   1 
HETATM 7111 O  OH2   . 1PE M 9  .   ? 29.776 186.601 30.801 1.00 45.35  ? 992  1PE A OH2   1 
HETATM 7112 C  C12   . 1PE M 9  .   ? 28.379 186.378 31.147 1.00 42.18  ? 992  1PE A C12   1 
HETATM 7113 C  C22   . 1PE M 9  .   ? 27.671 185.566 30.022 1.00 40.01  ? 992  1PE A C22   1 
HETATM 7114 O  OH3   . 1PE M 9  .   ? 26.877 184.535 30.693 1.00 41.55  ? 992  1PE A OH3   1 
HETATM 7115 C  C13   . 1PE M 9  .   ? 25.975 182.367 30.466 1.00 41.23  ? 992  1PE A C13   1 
HETATM 7116 C  C23   . 1PE M 9  .   ? 26.142 183.686 29.722 1.00 39.39  ? 992  1PE A C23   1 
HETATM 7117 O  OH4   . 1PE M 9  .   ? 27.205 181.619 30.262 1.00 42.48  ? 992  1PE A OH4   1 
HETATM 7118 C  C14   . 1PE M 9  .   ? 28.455 179.579 30.713 1.00 48.35  ? 992  1PE A C14   1 
HETATM 7119 C  C24   . 1PE M 9  .   ? 27.154 180.296 30.948 1.00 44.60  ? 992  1PE A C24   1 
HETATM 7120 O  OH5   . 1PE M 9  .   ? 29.302 180.039 31.778 1.00 51.31  ? 992  1PE A OH5   1 
HETATM 7121 C  C15   . 1PE M 9  .   ? 31.457 179.935 32.783 1.00 52.19  ? 992  1PE A C15   1 
HETATM 7122 C  C25   . 1PE M 9  .   ? 30.590 179.432 31.660 1.00 52.42  ? 992  1PE A C25   1 
HETATM 7123 O  OH6   . 1PE M 9  .   ? 31.378 181.360 32.820 1.00 51.55  ? 992  1PE A OH6   1 
HETATM 7124 C  C16   . 1PE M 9  .   ? 32.379 183.483 32.944 1.00 51.04  ? 992  1PE A C16   1 
HETATM 7125 C  C26   . 1PE M 9  .   ? 32.425 182.153 32.270 1.00 50.51  ? 992  1PE A C26   1 
HETATM 7126 O  OH7   . 1PE M 9  .   ? 32.037 184.461 31.968 1.00 51.61  ? 992  1PE A OH7   1 
HETATM 7127 O  O     . HOH N 10 .   ? 51.687 174.346 41.840 1.00 23.92  ? 1069 HOH P O     1 
HETATM 7128 O  O     . HOH N 10 .   ? 46.743 171.697 38.742 1.00 25.18  ? 1092 HOH P O     1 
HETATM 7129 O  O     . HOH N 10 .   ? 57.287 171.033 31.791 1.00 31.08  ? 1118 HOH P O     1 
HETATM 7130 O  O     . HOH N 10 .   ? 62.569 180.052 25.618 1.00 28.57  ? 1160 HOH P O     1 
HETATM 7131 O  O     . HOH N 10 .   ? 64.223 170.700 23.151 1.00 27.07  ? 1187 HOH P O     1 
HETATM 7132 O  O     . HOH N 10 .   ? 57.285 177.427 38.589 1.00 38.14  ? 1206 HOH P O     1 
HETATM 7133 O  O     . HOH N 10 .   ? 62.315 173.121 22.987 1.00 26.88  ? 1243 HOH P O     1 
HETATM 7134 O  O     . HOH N 10 .   ? 61.882 181.010 21.438 1.00 26.84  ? 1253 HOH P O     1 
HETATM 7135 O  O     . HOH N 10 .   ? 52.655 175.844 39.471 1.00 24.25  ? 1258 HOH P O     1 
HETATM 7136 O  O     . HOH N 10 .   ? 61.951 182.963 25.365 1.00 30.24  ? 1260 HOH P O     1 
HETATM 7137 O  O     . HOH N 10 .   ? 56.235 166.641 41.523 1.00 21.74  ? 1279 HOH P O     1 
HETATM 7138 O  O     . HOH N 10 .   ? 62.552 166.221 40.553 1.00 31.39  ? 1289 HOH P O     1 
HETATM 7139 O  O     . HOH N 10 .   ? 59.960 171.186 25.221 1.00 36.98  ? 1329 HOH P O     1 
HETATM 7140 O  O     . HOH N 10 .   ? 63.876 182.216 28.601 1.00 27.19  ? 1349 HOH P O     1 
HETATM 7141 O  O     . HOH N 10 .   ? 59.241 173.545 42.454 1.00 30.58  ? 1372 HOH P O     1 
HETATM 7142 O  O     . HOH N 10 .   ? 63.161 175.562 35.694 1.00 43.88  ? 1376 HOH P O     1 
HETATM 7143 O  O     . HOH N 10 .   ? 55.216 174.444 44.450 1.00 32.38  ? 1421 HOH P O     1 
HETATM 7144 O  O     . HOH N 10 .   ? 62.862 181.057 31.750 1.00 40.99  ? 1430 HOH P O     1 
HETATM 7145 O  O     . HOH N 10 .   ? 62.151 179.791 29.036 1.00 30.31  ? 1433 HOH P O     1 
HETATM 7146 O  O     . HOH N 10 .   ? 55.580 177.943 42.631 1.00 44.84  ? 1490 HOH P O     1 
HETATM 7147 O  O     . HOH N 10 .   ? 57.889 175.181 47.505 1.00 42.71  ? 1507 HOH P O     1 
HETATM 7148 O  O     . HOH N 10 .   ? 54.636 177.833 39.788 1.00 52.58  ? 1511 HOH P O     1 
HETATM 7149 O  O     . HOH N 10 .   ? 59.664 175.571 39.830 1.00 33.58  ? 1513 HOH P O     1 
HETATM 7150 O  O     . HOH N 10 .   ? 65.556 180.038 26.236 1.00 28.15  ? 1542 HOH P O     1 
HETATM 7151 O  O     . HOH N 10 .   ? 48.200 175.282 43.186 1.00 42.41  ? 1547 HOH P O     1 
HETATM 7152 O  O     . HOH O 10 .   ? 64.531 181.469 35.450 1.00 20.90  ? 1005 HOH T O     1 
HETATM 7153 O  O     . HOH O 10 .   ? 46.961 186.752 34.051 1.00 14.49  ? 1010 HOH T O     1 
HETATM 7154 O  O     . HOH O 10 .   ? 60.792 182.155 35.325 1.00 25.38  ? 1024 HOH T O     1 
HETATM 7155 O  O     . HOH O 10 .   ? 51.852 179.337 37.630 1.00 30.24  ? 1070 HOH T O     1 
HETATM 7156 O  O     . HOH O 10 .   ? 55.291 188.465 30.356 1.00 20.06  ? 1073 HOH T O     1 
HETATM 7157 O  O     . HOH O 10 .   ? 53.228 183.818 28.766 1.00 13.02  ? 1084 HOH T O     1 
HETATM 7158 O  O     . HOH O 10 .   ? 55.766 185.889 37.195 1.00 26.04  ? 1086 HOH T O     1 
HETATM 7159 O  O     . HOH O 10 .   ? 48.363 184.460 37.448 1.00 33.99  ? 1144 HOH T O     1 
HETATM 7160 O  O     . HOH O 10 .   ? 45.474 183.462 33.383 1.00 32.29  ? 1146 HOH T O     1 
HETATM 7161 O  O     . HOH O 10 .   ? 53.338 172.600 30.141 1.00 26.51  ? 1188 HOH T O     1 
HETATM 7162 O  O     . HOH O 10 .   ? 45.187 174.510 32.730 1.00 26.08  ? 1193 HOH T O     1 
HETATM 7163 O  O     . HOH O 10 .   ? 73.142 182.179 40.170 1.00 27.36  ? 1200 HOH T O     1 
HETATM 7164 O  O     . HOH O 10 .   ? 45.872 180.434 33.803 1.00 38.47  ? 1202 HOH T O     1 
HETATM 7165 O  O     . HOH O 10 .   ? 53.708 181.525 36.275 1.00 26.32  ? 1221 HOH T O     1 
HETATM 7166 O  O     . HOH O 10 .   ? 55.599 179.177 36.795 1.00 26.01  ? 1222 HOH T O     1 
HETATM 7167 O  O     . HOH O 10 .   ? 49.990 189.147 38.286 1.00 22.18  ? 1236 HOH T O     1 
HETATM 7168 O  O     . HOH O 10 .   ? 58.590 180.185 35.472 1.00 25.98  ? 1246 HOH T O     1 
HETATM 7169 O  O     . HOH O 10 .   ? 55.162 183.539 39.043 1.00 49.51  ? 1257 HOH T O     1 
HETATM 7170 O  O     . HOH O 10 .   ? 48.816 174.132 27.008 1.00 38.18  ? 1268 HOH T O     1 
HETATM 7171 O  O     . HOH O 10 .   ? 52.583 186.218 39.085 1.00 31.01  ? 1270 HOH T O     1 
HETATM 7172 O  O     . HOH O 10 .   ? 47.816 166.445 32.654 1.00 27.53  ? 1291 HOH T O     1 
HETATM 7173 O  O     . HOH O 10 .   ? 49.482 180.702 36.333 1.00 30.00  ? 1300 HOH T O     1 
HETATM 7174 O  O     . HOH O 10 .   ? 45.578 162.082 38.530 1.00 40.59  ? 1338 HOH T O     1 
HETATM 7175 O  O     . HOH O 10 .   ? 52.063 184.046 36.971 1.00 30.31  ? 1352 HOH T O     1 
HETATM 7176 O  O     . HOH O 10 .   ? 52.160 182.991 40.423 1.00 37.47  ? 1362 HOH T O     1 
HETATM 7177 O  O     . HOH O 10 .   ? 54.337 164.412 42.532 1.00 36.35  ? 1379 HOH T O     1 
HETATM 7178 O  O     . HOH O 10 .   ? 59.600 182.578 38.872 1.00 39.66  ? 1387 HOH T O     1 
HETATM 7179 O  O     . HOH O 10 .   ? 74.285 183.359 43.427 1.00 37.07  ? 1388 HOH T O     1 
HETATM 7180 O  O     . HOH O 10 .   ? 74.721 188.415 47.259 1.00 39.34  ? 1406 HOH T O     1 
HETATM 7181 O  O     . HOH O 10 .   ? 57.404 163.190 42.325 1.00 40.92  ? 1416 HOH T O     1 
HETATM 7182 O  O     . HOH O 10 .   ? 49.030 182.308 39.528 1.00 35.17  ? 1442 HOH T O     1 
HETATM 7183 O  O     . HOH O 10 .   ? 61.068 185.027 39.933 1.00 33.41  ? 1443 HOH T O     1 
HETATM 7184 O  O     . HOH O 10 .   ? 43.928 157.760 43.628 1.00 48.12  ? 1456 HOH T O     1 
HETATM 7185 O  O     . HOH O 10 .   ? 56.516 163.899 37.397 1.00 41.47  ? 1461 HOH T O     1 
HETATM 7186 O  O     . HOH O 10 .   ? 56.946 182.324 36.595 1.00 16.46  ? 1487 HOH T O     1 
HETATM 7187 O  O     . HOH O 10 .   ? 56.956 180.805 39.205 1.00 28.59  ? 1488 HOH T O     1 
HETATM 7188 O  O     . HOH O 10 .   ? 53.941 180.809 39.244 1.00 26.40  ? 1489 HOH T O     1 
HETATM 7189 O  O     . HOH O 10 .   ? 58.212 186.521 39.130 1.00 20.47  ? 1510 HOH T O     1 
HETATM 7190 O  O     . HOH O 10 .   ? 63.839 179.252 36.954 1.00 36.89  ? 1512 HOH T O     1 
HETATM 7191 O  O     . HOH O 10 .   ? 53.373 155.408 40.347 1.00 31.03  ? 1517 HOH T O     1 
HETATM 7192 O  O     . HOH O 10 .   ? 65.938 181.963 30.905 1.00 34.61  ? 1540 HOH T O     1 
HETATM 7193 O  O     . HOH P 10 .   ? 37.397 190.730 -0.856 1.00 2.81   ? 1001 HOH A O     1 
HETATM 7194 O  O     . HOH P 10 .   ? 23.826 195.731 15.909 1.00 3.75   ? 1002 HOH A O     1 
HETATM 7195 O  O     . HOH P 10 .   ? 41.576 166.511 20.615 1.00 21.65  ? 1004 HOH A O     1 
HETATM 7196 O  O     . HOH P 10 .   ? 45.274 186.046 30.615 1.00 8.15   ? 1006 HOH A O     1 
HETATM 7197 O  O     . HOH P 10 .   ? 37.084 187.505 5.155  1.00 7.85   ? 1007 HOH A O     1 
HETATM 7198 O  O     . HOH P 10 .   ? 57.369 188.590 20.589 1.00 14.00  ? 1008 HOH A O     1 
HETATM 7199 O  O     . HOH P 10 .   ? 41.381 191.152 25.710 1.00 10.10  ? 1009 HOH A O     1 
HETATM 7200 O  O     . HOH P 10 .   ? 41.097 188.531 -2.408 1.00 6.77   ? 1011 HOH A O     1 
HETATM 7201 O  O     . HOH P 10 .   ? 72.119 206.193 26.784 1.00 6.45   ? 1012 HOH A O     1 
HETATM 7202 O  O     . HOH P 10 .   ? 11.492 197.672 24.302 1.00 12.97  ? 1013 HOH A O     1 
HETATM 7203 O  O     . HOH P 10 .   ? 36.570 202.824 26.607 1.00 6.02   ? 1014 HOH A O     1 
HETATM 7204 O  O     . HOH P 10 .   ? 39.779 193.444 26.263 1.00 10.01  ? 1015 HOH A O     1 
HETATM 7205 O  O     . HOH P 10 .   ? 44.108 186.896 34.251 1.00 9.08   ? 1016 HOH A O     1 
HETATM 7206 O  O     . HOH P 10 .   ? 51.989 192.321 43.087 1.00 22.44  ? 1017 HOH A O     1 
HETATM 7207 O  O     . HOH P 10 .   ? 52.480 187.925 30.772 1.00 9.36   ? 1018 HOH A O     1 
HETATM 7208 O  O     . HOH P 10 .   ? 43.576 197.514 29.142 1.00 12.22  ? 1020 HOH A O     1 
HETATM 7209 O  O     . HOH P 10 .   ? 43.037 186.715 18.191 1.00 9.39   ? 1022 HOH A O     1 
HETATM 7210 O  O     . HOH P 10 .   ? 67.597 197.369 18.718 1.00 16.76  ? 1023 HOH A O     1 
HETATM 7211 O  O     . HOH P 10 .   ? 43.492 202.131 18.286 1.00 11.74  ? 1025 HOH A O     1 
HETATM 7212 O  O     . HOH P 10 .   ? 28.335 195.362 33.924 1.00 17.49  ? 1026 HOH A O     1 
HETATM 7213 O  O     . HOH P 10 .   ? 35.279 190.595 11.433 1.00 12.87  ? 1027 HOH A O     1 
HETATM 7214 O  O     . HOH P 10 .   ? 47.918 208.801 25.290 1.00 20.94  ? 1028 HOH A O     1 
HETATM 7215 O  O     . HOH P 10 .   ? 58.383 171.353 12.730 1.00 20.30  ? 1029 HOH A O     1 
HETATM 7216 O  O     . HOH P 10 .   ? 75.125 192.548 37.383 1.00 29.57  ? 1030 HOH A O     1 
HETATM 7217 O  O     . HOH P 10 .   ? 66.766 207.647 34.715 1.00 25.70  ? 1031 HOH A O     1 
HETATM 7218 O  O     . HOH P 10 .   ? 50.013 174.622 8.492  1.00 14.15  ? 1032 HOH A O     1 
HETATM 7219 O  O     . HOH P 10 .   ? 46.414 188.701 44.541 1.00 14.94  ? 1034 HOH A O     1 
HETATM 7220 O  O     . HOH P 10 .   ? 52.487 206.027 48.551 1.00 43.96  ? 1035 HOH A O     1 
HETATM 7221 O  O     . HOH P 10 .   ? 63.616 167.087 26.987 1.00 16.46  ? 1036 HOH A O     1 
HETATM 7222 O  O     . HOH P 10 .   ? 27.811 198.004 20.968 1.00 5.53   ? 1037 HOH A O     1 
HETATM 7223 O  O     . HOH P 10 .   ? 49.213 200.062 37.917 1.00 16.26  ? 1038 HOH A O     1 
HETATM 7224 O  O     . HOH P 10 .   ? 69.047 206.597 19.933 1.00 18.47  ? 1039 HOH A O     1 
HETATM 7225 O  O     . HOH P 10 .   ? 43.501 208.292 47.197 1.00 25.52  ? 1040 HOH A O     1 
HETATM 7226 O  O     . HOH P 10 .   ? 41.367 191.574 42.543 1.00 15.43  ? 1041 HOH A O     1 
HETATM 7227 O  O     . HOH P 10 .   ? 13.276 200.298 21.059 1.00 20.89  ? 1042 HOH A O     1 
HETATM 7228 O  O     . HOH P 10 .   ? 57.459 197.793 10.829 1.00 19.50  ? 1043 HOH A O     1 
HETATM 7229 O  O     . HOH P 10 .   ? 70.429 197.387 17.682 1.00 17.47  ? 1045 HOH A O     1 
HETATM 7230 O  O     . HOH P 10 .   ? 35.540 186.126 41.389 1.00 24.44  ? 1046 HOH A O     1 
HETATM 7231 O  O     . HOH P 10 .   ? 51.121 185.767 29.129 1.00 10.39  ? 1047 HOH A O     1 
HETATM 7232 O  O     . HOH P 10 .   ? 32.487 198.502 29.420 1.00 9.01   ? 1048 HOH A O     1 
HETATM 7233 O  O     . HOH P 10 .   ? 57.346 203.761 7.927  1.00 20.79  ? 1049 HOH A O     1 
HETATM 7234 O  O     . HOH P 10 .   ? 48.199 201.940 41.468 1.00 22.64  ? 1050 HOH A O     1 
HETATM 7235 O  O     . HOH P 10 .   ? 34.946 190.839 22.800 1.00 16.78  ? 1051 HOH A O     1 
HETATM 7236 O  O     . HOH P 10 .   ? 59.144 202.463 33.098 1.00 11.80  ? 1052 HOH A O     1 
HETATM 7237 O  O     . HOH P 10 .   ? 50.962 191.114 24.852 1.00 16.57  ? 1053 HOH A O     1 
HETATM 7238 O  O     . HOH P 10 .   ? 34.946 211.202 41.087 1.00 18.32  ? 1054 HOH A O     1 
HETATM 7239 O  O     . HOH P 10 .   ? 77.014 204.131 28.441 1.00 18.15  ? 1055 HOH A O     1 
HETATM 7240 O  O     . HOH P 10 .   ? 34.436 203.228 18.736 1.00 23.72  ? 1056 HOH A O     1 
HETATM 7241 O  O     . HOH P 10 .   ? 43.892 197.570 33.231 1.00 20.07  ? 1057 HOH A O     1 
HETATM 7242 O  O     . HOH P 10 .   ? 26.145 179.697 35.554 1.00 15.23  ? 1058 HOH A O     1 
HETATM 7243 O  O     . HOH P 10 .   ? 59.369 193.435 37.710 1.00 13.85  ? 1059 HOH A O     1 
HETATM 7244 O  O     . HOH P 10 .   ? 40.238 200.060 18.602 1.00 17.47  ? 1061 HOH A O     1 
HETATM 7245 O  O     . HOH P 10 .   ? 67.390 195.890 40.390 1.00 18.11  ? 1062 HOH A O     1 
HETATM 7246 O  O     . HOH P 10 .   ? 74.354 150.680 34.954 1.00 25.65  ? 1063 HOH A O     1 
HETATM 7247 O  O     . HOH P 10 .   ? 17.609 206.721 22.127 1.00 13.86  ? 1065 HOH A O     1 
HETATM 7248 O  O     . HOH P 10 .   ? 47.967 187.938 36.489 1.00 25.79  ? 1066 HOH A O     1 
HETATM 7249 O  O     . HOH P 10 .   ? 26.871 191.130 31.724 1.00 12.47  ? 1067 HOH A O     1 
HETATM 7250 O  O     . HOH P 10 .   ? 53.773 151.910 23.008 1.00 28.82  ? 1068 HOH A O     1 
HETATM 7251 O  O     . HOH P 10 .   ? 60.881 208.721 31.299 1.00 15.46  ? 1071 HOH A O     1 
HETATM 7252 O  O     . HOH P 10 .   ? 16.504 206.772 35.661 1.00 19.96  ? 1072 HOH A O     1 
HETATM 7253 O  O     . HOH P 10 .   ? 35.962 190.851 38.556 1.00 12.74  ? 1074 HOH A O     1 
HETATM 7254 O  O     . HOH P 10 .   ? 68.021 152.197 24.828 1.00 33.65  ? 1075 HOH A O     1 
HETATM 7255 O  O     . HOH P 10 .   ? 35.215 200.544 17.628 1.00 23.01  ? 1076 HOH A O     1 
HETATM 7256 O  O     . HOH P 10 .   ? 37.991 184.749 23.366 1.00 30.45  ? 1077 HOH A O     1 
HETATM 7257 O  O     . HOH P 10 .   ? 44.756 176.448 4.954  1.00 28.63  ? 1078 HOH A O     1 
HETATM 7258 O  O     . HOH P 10 .   ? 15.517 206.366 26.069 1.00 20.34  ? 1079 HOH A O     1 
HETATM 7259 O  O     . HOH P 10 .   ? 66.331 198.547 43.997 1.00 15.70  ? 1080 HOH A O     1 
HETATM 7260 O  O     . HOH P 10 .   ? 61.905 207.421 19.419 1.00 28.88  ? 1081 HOH A O     1 
HETATM 7261 O  O     . HOH P 10 .   ? 54.978 185.289 26.947 1.00 13.83  ? 1082 HOH A O     1 
HETATM 7262 O  O     . HOH P 10 .   ? 44.286 191.047 36.522 1.00 28.42  ? 1083 HOH A O     1 
HETATM 7263 O  O     . HOH P 10 .   ? 79.891 210.484 31.179 1.00 38.15  ? 1085 HOH A O     1 
HETATM 7264 O  O     . HOH P 10 .   ? 25.185 186.836 37.481 1.00 33.20  ? 1087 HOH A O     1 
HETATM 7265 O  O     . HOH P 10 .   ? 65.940 193.514 38.028 1.00 28.09  ? 1088 HOH A O     1 
HETATM 7266 O  O     . HOH P 10 .   ? 50.698 157.786 21.807 1.00 22.13  ? 1089 HOH A O     1 
HETATM 7267 O  O     . HOH P 10 .   ? 39.259 205.450 26.143 1.00 27.69  ? 1090 HOH A O     1 
HETATM 7268 O  O     . HOH P 10 .   ? 38.120 188.185 40.742 1.00 25.35  ? 1091 HOH A O     1 
HETATM 7269 O  O     . HOH P 10 .   ? 49.968 198.323 35.717 1.00 17.83  ? 1094 HOH A O     1 
HETATM 7270 O  O     . HOH P 10 .   ? 13.669 194.771 39.422 1.00 23.60  ? 1095 HOH A O     1 
HETATM 7271 O  O     . HOH P 10 .   ? 37.706 199.813 11.226 1.00 25.26  ? 1096 HOH A O     1 
HETATM 7272 O  O     . HOH P 10 .   ? 8.959  190.206 29.703 1.00 29.45  ? 1097 HOH A O     1 
HETATM 7273 O  O     . HOH P 10 .   ? 43.489 202.392 45.375 1.00 20.12  ? 1098 HOH A O     1 
HETATM 7274 O  O     . HOH P 10 .   ? 37.162 174.372 12.676 1.00 35.03  ? 1100 HOH A O     1 
HETATM 7275 O  O     . HOH P 10 .   ? 60.734 206.422 36.895 1.00 27.94  ? 1101 HOH A O     1 
HETATM 7276 O  O     . HOH P 10 .   ? 46.812 206.430 45.399 1.00 22.56  ? 1102 HOH A O     1 
HETATM 7277 O  O     . HOH P 10 .   ? 44.967 196.569 -1.510 1.00 17.02  ? 1103 HOH A O     1 
HETATM 7278 O  O     . HOH P 10 .   ? 57.965 194.686 28.340 1.00 16.83  ? 1104 HOH A O     1 
HETATM 7279 O  O     . HOH P 10 .   ? 68.288 198.400 41.714 1.00 20.24  ? 1105 HOH A O     1 
HETATM 7280 O  O     . HOH P 10 .   ? 56.902 165.311 33.286 1.00 22.61  ? 1106 HOH A O     1 
HETATM 7281 O  O     . HOH P 10 .   ? 52.465 192.182 27.261 1.00 18.51  ? 1107 HOH A O     1 
HETATM 7282 O  O     . HOH P 10 .   ? 69.361 194.715 38.033 1.00 27.56  ? 1108 HOH A O     1 
HETATM 7283 O  O     . HOH P 10 .   ? 67.235 200.015 14.501 1.00 18.86  ? 1109 HOH A O     1 
HETATM 7284 O  O     . HOH P 10 .   ? 28.223 211.625 31.732 1.00 22.86  ? 1110 HOH A O     1 
HETATM 7285 O  O     . HOH P 10 .   ? 58.945 205.031 34.432 1.00 16.41  ? 1111 HOH A O     1 
HETATM 7286 O  O     . HOH P 10 .   ? 41.113 221.809 33.051 1.00 26.54  ? 1112 HOH A O     1 
HETATM 7287 O  O     . HOH P 10 .   ? 30.625 211.356 34.504 1.00 20.32  ? 1113 HOH A O     1 
HETATM 7288 O  O     . HOH P 10 .   ? 61.108 195.833 8.200  1.00 29.00  ? 1114 HOH A O     1 
HETATM 7289 O  O     . HOH P 10 .   ? 48.457 193.586 -3.186 1.00 32.57  ? 1116 HOH A O     1 
HETATM 7290 O  O     . HOH P 10 .   ? 38.822 180.500 5.984  1.00 22.31  ? 1117 HOH A O     1 
HETATM 7291 O  O     . HOH P 10 .   ? 30.476 198.996 20.102 1.00 21.41  ? 1120 HOH A O     1 
HETATM 7292 O  O     . HOH P 10 .   ? 45.987 183.894 24.413 1.00 18.36  ? 1121 HOH A O     1 
HETATM 7293 O  O     . HOH P 10 .   ? 39.174 193.851 28.982 1.00 16.00  ? 1122 HOH A O     1 
HETATM 7294 O  O     . HOH P 10 .   ? 61.479 173.213 13.842 1.00 32.51  ? 1123 HOH A O     1 
HETATM 7295 O  O     . HOH P 10 .   ? 56.974 166.966 29.410 1.00 24.81  ? 1124 HOH A O     1 
HETATM 7296 O  O     . HOH P 10 .   ? 54.300 211.964 19.184 1.00 21.57  ? 1125 HOH A O     1 
HETATM 7297 O  O     . HOH P 10 .   ? 14.307 203.548 29.620 1.00 27.43  ? 1126 HOH A O     1 
HETATM 7298 O  O     . HOH P 10 .   ? 46.313 185.953 21.908 1.00 19.48  ? 1127 HOH A O     1 
HETATM 7299 O  O     . HOH P 10 .   ? 61.440 164.233 17.938 1.00 19.17  ? 1128 HOH A O     1 
HETATM 7300 O  O     . HOH P 10 .   ? 52.028 172.957 10.206 1.00 20.26  ? 1129 HOH A O     1 
HETATM 7301 O  O     . HOH P 10 .   ? 48.446 142.035 62.169 1.00 38.12  ? 1130 HOH A O     1 
HETATM 7302 O  O     . HOH P 10 .   ? 29.181 191.363 18.574 1.00 22.59  ? 1131 HOH A O     1 
HETATM 7303 O  O     . HOH P 10 .   ? 73.657 213.504 31.816 1.00 24.33  ? 1132 HOH A O     1 
HETATM 7304 O  O     . HOH P 10 .   ? 32.828 218.119 38.462 1.00 24.68  ? 1133 HOH A O     1 
HETATM 7305 O  O     . HOH P 10 .   ? 22.216 203.439 14.164 1.00 36.72  ? 1134 HOH A O     1 
HETATM 7306 O  O     . HOH P 10 .   ? 42.260 163.790 21.771 1.00 30.04  ? 1135 HOH A O     1 
HETATM 7307 O  O     . HOH P 10 .   ? 21.325 213.320 42.134 1.00 41.36  ? 1137 HOH A O     1 
HETATM 7308 O  O     . HOH P 10 .   ? 26.695 206.908 18.003 1.00 31.44  ? 1138 HOH A O     1 
HETATM 7309 O  O     . HOH P 10 .   ? 67.711 144.407 26.506 1.00 42.18  ? 1139 HOH A O     1 
HETATM 7310 O  O     . HOH P 10 .   ? 23.164 210.219 32.857 1.00 16.04  ? 1140 HOH A O     1 
HETATM 7311 O  O     . HOH P 10 .   ? 61.489 191.510 30.781 1.00 13.39  ? 1142 HOH A O     1 
HETATM 7312 O  O     . HOH P 10 .   ? 45.828 207.537 20.982 1.00 36.75  ? 1143 HOH A O     1 
HETATM 7313 O  O     . HOH P 10 .   ? 26.421 190.215 34.651 1.00 16.89  ? 1145 HOH A O     1 
HETATM 7314 O  O     . HOH P 10 .   ? 49.087 181.287 0.845  1.00 28.59  ? 1147 HOH A O     1 
HETATM 7315 O  O     . HOH P 10 .   ? 71.534 183.353 15.635 1.00 23.77  ? 1148 HOH A O     1 
HETATM 7316 O  O     . HOH P 10 .   ? 35.340 187.363 13.804 1.00 22.95  ? 1149 HOH A O     1 
HETATM 7317 O  O     . HOH P 10 .   ? 28.481 201.137 49.325 1.00 33.97  ? 1150 HOH A O     1 
HETATM 7318 O  O     . HOH P 10 .   ? 61.352 205.142 10.434 1.00 16.71  ? 1151 HOH A O     1 
HETATM 7319 O  O     . HOH P 10 .   ? 13.643 206.484 36.383 1.00 28.34  ? 1152 HOH A O     1 
HETATM 7320 O  O     . HOH P 10 .   ? 37.739 168.958 24.010 1.00 24.58  ? 1153 HOH A O     1 
HETATM 7321 O  O     . HOH P 10 .   ? 36.622 190.299 3.078  1.00 22.66  ? 1154 HOH A O     1 
HETATM 7322 O  O     . HOH P 10 .   ? 47.920 175.049 24.146 1.00 24.18  ? 1155 HOH A O     1 
HETATM 7323 O  O     . HOH P 10 .   ? 39.412 209.747 48.418 1.00 35.98  ? 1156 HOH A O     1 
HETATM 7324 O  O     . HOH P 10 .   ? 73.908 165.284 35.640 1.00 27.34  ? 1157 HOH A O     1 
HETATM 7325 O  O     . HOH P 10 .   ? 58.474 195.627 53.770 1.00 33.50  ? 1158 HOH A O     1 
HETATM 7326 O  O     . HOH P 10 .   ? 55.329 172.241 23.508 1.00 26.50  ? 1159 HOH A O     1 
HETATM 7327 O  O     . HOH P 10 .   ? 38.724 185.998 29.586 1.00 36.21  ? 1161 HOH A O     1 
HETATM 7328 O  O     . HOH P 10 .   ? 20.147 188.075 44.993 1.00 39.53  ? 1162 HOH A O     1 
HETATM 7329 O  O     . HOH P 10 .   ? 19.372 207.151 29.039 1.00 22.99  ? 1163 HOH A O     1 
HETATM 7330 O  O     . HOH P 10 .   ? 38.606 194.770 48.733 1.00 22.93  ? 1164 HOH A O     1 
HETATM 7331 O  O     . HOH P 10 .   ? 34.171 196.247 22.840 1.00 24.00  ? 1165 HOH A O     1 
HETATM 7332 O  O     . HOH P 10 .   ? 28.750 211.178 22.606 1.00 16.50  ? 1166 HOH A O     1 
HETATM 7333 O  O     . HOH P 10 .   ? 67.852 195.023 14.493 1.00 24.29  ? 1167 HOH A O     1 
HETATM 7334 O  O     . HOH P 10 .   ? 19.095 200.047 12.704 1.00 29.04  ? 1169 HOH A O     1 
HETATM 7335 O  O     . HOH P 10 .   ? 67.718 209.432 31.635 1.00 14.19  ? 1170 HOH A O     1 
HETATM 7336 O  O     . HOH P 10 .   ? 52.864 152.020 52.718 1.00 37.14  ? 1171 HOH A O     1 
HETATM 7337 O  O     . HOH P 10 .   ? 38.701 190.649 42.639 1.00 19.02  ? 1172 HOH A O     1 
HETATM 7338 O  O     . HOH P 10 .   ? 40.045 169.726 16.679 1.00 29.57  ? 1173 HOH A O     1 
HETATM 7339 O  O     . HOH P 10 .   ? 56.681 182.442 1.953  1.00 38.75  ? 1174 HOH A O     1 
HETATM 7340 O  O     . HOH P 10 .   ? 29.965 215.589 26.928 1.00 23.86  ? 1175 HOH A O     1 
HETATM 7341 O  O     . HOH P 10 .   ? 45.675 213.635 35.600 1.00 33.90  ? 1176 HOH A O     1 
HETATM 7342 O  O     . HOH P 10 .   ? 30.261 209.243 20.905 1.00 21.19  ? 1177 HOH A O     1 
HETATM 7343 O  O     . HOH P 10 .   ? 55.214 177.891 5.990  1.00 18.55  ? 1178 HOH A O     1 
HETATM 7344 O  O     . HOH P 10 .   ? 59.581 206.585 39.887 1.00 24.65  ? 1179 HOH A O     1 
HETATM 7345 O  O     . HOH P 10 .   ? 18.681 198.475 44.746 1.00 45.12  ? 1180 HOH A O     1 
HETATM 7346 O  O     . HOH P 10 .   ? 53.904 182.721 20.971 1.00 29.37  ? 1181 HOH A O     1 
HETATM 7347 O  O     . HOH P 10 .   ? 86.857 177.829 35.316 1.00 42.33  ? 1182 HOH A O     1 
HETATM 7348 O  O     . HOH P 10 .   ? 62.574 148.835 39.425 1.00 31.25  ? 1183 HOH A O     1 
HETATM 7349 O  O     . HOH P 10 .   ? 38.134 194.587 41.563 1.00 18.30  ? 1184 HOH A O     1 
HETATM 7350 O  O     . HOH P 10 .   ? 24.824 193.848 10.445 1.00 38.97  ? 1185 HOH A O     1 
HETATM 7351 O  O     . HOH P 10 .   ? 49.230 210.986 39.773 1.00 21.79  ? 1186 HOH A O     1 
HETATM 7352 O  O     . HOH P 10 .   ? 24.920 181.017 46.401 1.00 41.73  ? 1189 HOH A O     1 
HETATM 7353 O  O     . HOH P 10 .   ? 17.197 204.065 32.501 1.00 24.38  ? 1190 HOH A O     1 
HETATM 7354 O  O     . HOH P 10 .   ? 55.302 164.693 30.757 1.00 24.73  ? 1191 HOH A O     1 
HETATM 7355 O  O     . HOH P 10 .   ? 48.184 163.897 27.845 1.00 29.98  ? 1192 HOH A O     1 
HETATM 7356 O  O     . HOH P 10 .   ? 14.072 203.712 26.589 1.00 34.56  ? 1194 HOH A O     1 
HETATM 7357 O  O     . HOH P 10 .   ? 65.872 167.862 51.977 1.00 32.95  ? 1195 HOH A O     1 
HETATM 7358 O  O     . HOH P 10 .   ? 36.645 193.539 52.198 1.00 21.51  ? 1197 HOH A O     1 
HETATM 7359 O  O     . HOH P 10 .   ? 26.403 200.796 45.309 1.00 18.94  ? 1201 HOH A O     1 
HETATM 7360 O  O     . HOH P 10 .   ? 33.776 187.963 25.703 1.00 24.62  ? 1203 HOH A O     1 
HETATM 7361 O  O     . HOH P 10 .   ? 38.702 199.907 14.120 1.00 25.59  ? 1204 HOH A O     1 
HETATM 7362 O  O     . HOH P 10 .   ? 81.561 172.675 25.663 1.00 42.32  ? 1205 HOH A O     1 
HETATM 7363 O  O     . HOH P 10 .   ? 73.545 147.501 27.542 1.00 39.70  ? 1207 HOH A O     1 
HETATM 7364 O  O     . HOH P 10 .   ? 53.939 194.396 26.028 1.00 32.69  ? 1208 HOH A O     1 
HETATM 7365 O  O     . HOH P 10 .   ? 39.554 211.073 43.065 1.00 23.86  ? 1209 HOH A O     1 
HETATM 7366 O  O     . HOH P 10 .   ? 34.606 181.965 -2.905 1.00 26.29  ? 1210 HOH A O     1 
HETATM 7367 O  O     . HOH P 10 .   ? 61.654 202.991 60.361 1.00 30.78  ? 1211 HOH A O     1 
HETATM 7368 O  O     . HOH P 10 .   ? 49.298 184.109 2.239  1.00 25.18  ? 1212 HOH A O     1 
HETATM 7369 O  O     . HOH P 10 .   ? 45.933 168.922 31.038 1.00 25.49  ? 1213 HOH A O     1 
HETATM 7370 O  O     . HOH P 10 .   ? 35.588 176.362 20.906 1.00 40.91  ? 1214 HOH A O     1 
HETATM 7371 O  O     . HOH P 10 .   ? 61.939 146.054 36.775 1.00 38.31  ? 1215 HOH A O     1 
HETATM 7372 O  O     . HOH P 10 .   ? 36.314 193.623 29.591 1.00 19.82  ? 1216 HOH A O     1 
HETATM 7373 O  O     . HOH P 10 .   ? 36.189 190.355 14.304 1.00 20.45  ? 1217 HOH A O     1 
HETATM 7374 O  O     . HOH P 10 .   ? 45.140 188.304 37.294 1.00 46.26  ? 1218 HOH A O     1 
HETATM 7375 O  O     . HOH P 10 .   ? 37.317 212.670 42.240 1.00 31.71  ? 1219 HOH A O     1 
HETATM 7376 O  O     . HOH P 10 .   ? 39.984 191.383 -1.939 1.00 28.63  ? 1220 HOH A O     1 
HETATM 7377 O  O     . HOH P 10 .   ? 10.728 199.887 22.530 1.00 35.60  ? 1223 HOH A O     1 
HETATM 7378 O  O     . HOH P 10 .   ? 38.284 192.158 39.866 1.00 20.25  ? 1224 HOH A O     1 
HETATM 7379 O  O     . HOH P 10 .   ? 33.486 216.706 28.195 1.00 40.08  ? 1225 HOH A O     1 
HETATM 7380 O  O     . HOH P 10 .   ? 47.559 209.786 22.585 1.00 29.88  ? 1226 HOH A O     1 
HETATM 7381 O  O     . HOH P 10 .   ? 11.902 195.486 22.518 1.00 22.18  ? 1227 HOH A O     1 
HETATM 7382 O  O     . HOH P 10 .   ? 56.373 185.041 19.664 1.00 27.47  ? 1228 HOH A O     1 
HETATM 7383 O  O     . HOH P 10 .   ? 56.810 194.712 25.586 1.00 30.13  ? 1229 HOH A O     1 
HETATM 7384 O  O     . HOH P 10 .   ? 45.945 195.094 -4.020 1.00 32.01  ? 1230 HOH A O     1 
HETATM 7385 O  O     . HOH P 10 .   ? 15.514 208.080 23.780 1.00 46.69  ? 1231 HOH A O     1 
HETATM 7386 O  O     . HOH P 10 .   ? 36.075 196.448 20.543 1.00 29.68  ? 1232 HOH A O     1 
HETATM 7387 O  O     . HOH P 10 .   ? 49.575 177.692 23.226 1.00 19.08  ? 1233 HOH A O     1 
HETATM 7388 O  O     . HOH P 10 .   ? 33.931 189.304 3.777  1.00 29.77  ? 1234 HOH A O     1 
HETATM 7389 O  O     . HOH P 10 .   ? 47.488 188.606 21.799 1.00 29.46  ? 1235 HOH A O     1 
HETATM 7390 O  O     . HOH P 10 .   ? 17.846 205.210 19.411 1.00 35.14  ? 1237 HOH A O     1 
HETATM 7391 O  O     . HOH P 10 .   ? 71.980 211.963 36.159 1.00 38.77  ? 1238 HOH A O     1 
HETATM 7392 O  O     . HOH P 10 .   ? 32.487 196.904 20.479 1.00 23.38  ? 1239 HOH A O     1 
HETATM 7393 O  O     . HOH P 10 .   ? 52.115 185.133 1.935  1.00 29.23  ? 1240 HOH A O     1 
HETATM 7394 O  O     . HOH P 10 .   ? 40.502 193.802 31.538 1.00 18.03  ? 1241 HOH A O     1 
HETATM 7395 O  O     . HOH P 10 .   ? 59.534 207.962 33.811 1.00 46.39  ? 1242 HOH A O     1 
HETATM 7396 O  O     . HOH P 10 .   ? 57.869 189.465 13.892 1.00 26.87  ? 1244 HOH A O     1 
HETATM 7397 O  O     . HOH P 10 .   ? 19.417 206.091 31.844 1.00 27.68  ? 1245 HOH A O     1 
HETATM 7398 O  O     . HOH P 10 .   ? 57.875 176.900 6.928  1.00 35.52  ? 1247 HOH A O     1 
HETATM 7399 O  O     . HOH P 10 .   ? 42.960 184.654 32.338 1.00 35.73  ? 1248 HOH A O     1 
HETATM 7400 O  O     . HOH P 10 .   ? 78.003 203.534 31.146 1.00 23.03  ? 1249 HOH A O     1 
HETATM 7401 O  O     . HOH P 10 .   ? 19.360 208.979 21.163 1.00 24.22  ? 1250 HOH A O     1 
HETATM 7402 O  O     . HOH P 10 .   ? 27.864 194.327 36.675 1.00 35.11  ? 1251 HOH A O     1 
HETATM 7403 O  O     . HOH P 10 .   ? 58.496 205.954 9.775  1.00 32.94  ? 1252 HOH A O     1 
HETATM 7404 O  O     . HOH P 10 .   ? 43.599 186.855 21.217 1.00 22.56  ? 1256 HOH A O     1 
HETATM 7405 O  O     . HOH P 10 .   ? 74.558 197.686 18.308 1.00 22.18  ? 1259 HOH A O     1 
HETATM 7406 O  O     . HOH P 10 .   ? 42.657 195.652 31.195 1.00 25.09  ? 1261 HOH A O     1 
HETATM 7407 O  O     . HOH P 10 .   ? 32.056 185.504 26.134 1.00 34.77  ? 1262 HOH A O     1 
HETATM 7408 O  O     . HOH P 10 .   ? 30.345 195.712 18.792 1.00 15.00  ? 1263 HOH A O     1 
HETATM 7409 O  O     . HOH P 10 .   ? 42.795 187.959 0.020  1.00 25.52  ? 1264 HOH A O     1 
HETATM 7410 O  O     . HOH P 10 .   ? 48.122 190.575 -3.672 1.00 30.62  ? 1265 HOH A O     1 
HETATM 7411 O  O     . HOH P 10 .   ? 39.082 181.832 -4.704 1.00 27.43  ? 1266 HOH A O     1 
HETATM 7412 O  O     . HOH P 10 .   ? 59.361 202.273 6.244  1.00 25.67  ? 1267 HOH A O     1 
HETATM 7413 O  O     . HOH P 10 .   ? 40.574 201.306 21.241 1.00 21.71  ? 1269 HOH A O     1 
HETATM 7414 O  O     . HOH P 10 .   ? 56.089 202.150 32.330 1.00 27.02  ? 1271 HOH A O     1 
HETATM 7415 O  O     . HOH P 10 .   ? 56.363 209.819 30.921 1.00 25.38  ? 1272 HOH A O     1 
HETATM 7416 O  O     . HOH P 10 .   ? 16.248 207.120 28.999 1.00 44.08  ? 1273 HOH A O     1 
HETATM 7417 O  O     . HOH P 10 .   ? 54.676 213.767 16.647 1.00 41.04  ? 1274 HOH A O     1 
HETATM 7418 O  O     . HOH P 10 .   ? 59.720 198.253 9.015  1.00 28.02  ? 1275 HOH A O     1 
HETATM 7419 O  O     . HOH P 10 .   ? 51.001 162.403 10.151 1.00 28.26  ? 1276 HOH A O     1 
HETATM 7420 O  O     . HOH P 10 .   ? 37.986 201.932 17.864 1.00 31.30  ? 1277 HOH A O     1 
HETATM 7421 O  O     . HOH P 10 .   ? 25.699 204.715 19.889 1.00 27.50  ? 1278 HOH A O     1 
HETATM 7422 O  O     . HOH P 10 .   ? 60.638 209.301 17.311 1.00 30.29  ? 1280 HOH A O     1 
HETATM 7423 O  O     . HOH P 10 .   ? 71.362 145.640 27.638 1.00 27.52  ? 1281 HOH A O     1 
HETATM 7424 O  O     . HOH P 10 .   ? 59.886 156.489 15.480 1.00 31.01  ? 1282 HOH A O     1 
HETATM 7425 O  O     . HOH P 10 .   ? 12.349 199.123 36.918 1.00 27.89  ? 1283 HOH A O     1 
HETATM 7426 O  O     . HOH P 10 .   ? 60.609 187.794 20.208 1.00 17.70  ? 1284 HOH A O     1 
HETATM 7427 O  O     . HOH P 10 .   ? 79.605 194.803 23.946 1.00 33.53  ? 1285 HOH A O     1 
HETATM 7428 O  O     . HOH P 10 .   ? 52.346 142.864 71.639 1.00 39.43  ? 1286 HOH A O     1 
HETATM 7429 O  O     . HOH P 10 .   ? 48.492 211.865 32.926 1.00 23.68  ? 1288 HOH A O     1 
HETATM 7430 O  O     . HOH P 10 .   ? 34.170 217.071 44.450 1.00 36.66  ? 1290 HOH A O     1 
HETATM 7431 O  O     . HOH P 10 .   ? 58.072 148.793 32.182 1.00 38.36  ? 1292 HOH A O     1 
HETATM 7432 O  O     . HOH P 10 .   ? 45.603 207.257 24.117 1.00 43.36  ? 1294 HOH A O     1 
HETATM 7433 O  O     . HOH P 10 .   ? 48.977 177.387 26.125 1.00 16.90  ? 1295 HOH A O     1 
HETATM 7434 O  O     . HOH P 10 .   ? 32.915 180.354 15.550 1.00 28.33  ? 1296 HOH A O     1 
HETATM 7435 O  O     . HOH P 10 .   ? 31.142 193.251 17.532 1.00 17.06  ? 1297 HOH A O     1 
HETATM 7436 O  O     . HOH P 10 .   ? 37.384 188.401 37.667 1.00 32.59  ? 1298 HOH A O     1 
HETATM 7437 O  O     . HOH P 10 .   ? 46.238 184.775 -1.585 1.00 27.78  ? 1299 HOH A O     1 
HETATM 7438 O  O     . HOH P 10 .   ? 35.425 181.499 1.335  1.00 36.19  ? 1301 HOH A O     1 
HETATM 7439 O  O     . HOH P 10 .   ? 33.758 194.425 51.767 1.00 31.99  ? 1304 HOH A O     1 
HETATM 7440 O  O     . HOH P 10 .   ? 32.505 214.996 25.755 1.00 48.68  ? 1306 HOH A O     1 
HETATM 7441 O  O     . HOH P 10 .   ? 39.058 211.768 45.902 1.00 46.56  ? 1307 HOH A O     1 
HETATM 7442 O  O     . HOH P 10 .   ? 38.549 179.940 20.036 1.00 25.25  ? 1308 HOH A O     1 
HETATM 7443 O  O     . HOH P 10 .   ? 72.260 156.725 43.951 1.00 27.67  ? 1309 HOH A O     1 
HETATM 7444 O  O     . HOH P 10 .   ? 32.281 202.440 47.305 1.00 28.78  ? 1312 HOH A O     1 
HETATM 7445 O  O     . HOH P 10 .   ? 72.544 165.809 39.650 1.00 34.28  ? 1314 HOH A O     1 
HETATM 7446 O  O     . HOH P 10 .   ? 42.948 172.910 8.332  1.00 35.37  ? 1316 HOH A O     1 
HETATM 7447 O  O     . HOH P 10 .   ? 55.262 206.844 49.622 1.00 47.26  ? 1317 HOH A O     1 
HETATM 7448 O  O     . HOH P 10 .   ? 51.881 153.396 68.522 1.00 32.86  ? 1320 HOH A O     1 
HETATM 7449 O  O     . HOH P 10 .   ? 77.601 153.539 27.310 1.00 41.99  ? 1322 HOH A O     1 
HETATM 7450 O  O     . HOH P 10 .   ? 37.076 193.211 55.137 1.00 33.07  ? 1324 HOH A O     1 
HETATM 7451 O  O     . HOH P 10 .   ? 73.320 162.783 51.843 1.00 32.43  ? 1326 HOH A O     1 
HETATM 7452 O  O     . HOH P 10 .   ? 38.797 167.767 20.654 1.00 48.89  ? 1328 HOH A O     1 
HETATM 7453 O  O     . HOH P 10 .   ? 49.401 179.844 43.803 1.00 43.28  ? 1331 HOH A O     1 
HETATM 7454 O  O     . HOH P 10 .   ? 73.523 206.333 41.041 1.00 35.02  ? 1332 HOH A O     1 
HETATM 7455 O  O     . HOH P 10 .   ? 75.932 211.148 23.171 1.00 36.07  ? 1333 HOH A O     1 
HETATM 7456 O  O     . HOH P 10 .   ? 15.671 198.278 39.144 1.00 28.45  ? 1334 HOH A O     1 
HETATM 7457 O  O     . HOH P 10 .   ? 70.236 179.406 27.613 1.00 31.36  ? 1335 HOH A O     1 
HETATM 7458 O  O     . HOH P 10 .   ? 58.368 211.765 44.766 1.00 37.01  ? 1336 HOH A O     1 
HETATM 7459 O  O     . HOH P 10 .   ? 39.062 209.641 23.651 1.00 40.43  ? 1337 HOH A O     1 
HETATM 7460 O  O     . HOH P 10 .   ? 54.244 154.986 64.551 1.00 28.39  ? 1339 HOH A O     1 
HETATM 7461 O  O     . HOH P 10 .   ? 15.708 193.493 43.376 1.00 28.58  ? 1340 HOH A O     1 
HETATM 7462 O  O     . HOH P 10 .   ? 61.001 208.863 12.765 1.00 44.15  ? 1342 HOH A O     1 
HETATM 7463 O  O     . HOH P 10 .   ? 46.909 203.349 43.965 1.00 28.30  ? 1343 HOH A O     1 
HETATM 7464 O  O     . HOH P 10 .   ? 13.176 208.336 28.062 1.00 38.48  ? 1344 HOH A O     1 
HETATM 7465 O  O     . HOH P 10 .   ? 83.276 201.025 35.839 1.00 30.85  ? 1345 HOH A O     1 
HETATM 7466 O  O     . HOH P 10 .   ? 15.381 203.120 41.958 1.00 25.42  ? 1347 HOH A O     1 
HETATM 7467 O  O     . HOH P 10 .   ? 19.178 197.096 10.611 1.00 48.71  ? 1348 HOH A O     1 
HETATM 7468 O  O     . HOH P 10 .   ? 11.101 203.718 33.402 1.00 43.58  ? 1350 HOH A O     1 
HETATM 7469 O  O     . HOH P 10 .   ? 30.114 186.186 37.098 1.00 38.83  ? 1351 HOH A O     1 
HETATM 7470 O  O     . HOH P 10 .   ? 51.563 199.085 -0.479 1.00 34.01  ? 1353 HOH A O     1 
HETATM 7471 O  O     . HOH P 10 .   ? 23.018 179.606 22.730 1.00 36.00  ? 1357 HOH A O     1 
HETATM 7472 O  O     . HOH P 10 .   ? 50.938 176.103 6.100  1.00 34.19  ? 1358 HOH A O     1 
HETATM 7473 O  O     . HOH P 10 .   ? 52.391 199.380 45.332 1.00 32.77  ? 1359 HOH A O     1 
HETATM 7474 O  O     . HOH P 10 .   ? 27.109 216.185 22.667 1.00 23.53  ? 1360 HOH A O     1 
HETATM 7475 O  O     . HOH P 10 .   ? 39.355 197.428 17.591 1.00 42.32  ? 1361 HOH A O     1 
HETATM 7476 O  O     . HOH P 10 .   ? 11.112 199.558 31.760 1.00 42.49  ? 1363 HOH A O     1 
HETATM 7477 O  O     . HOH P 10 .   ? 57.610 217.813 25.905 1.00 35.10  ? 1364 HOH A O     1 
HETATM 7478 O  O     . HOH P 10 .   ? 31.863 208.945 43.854 1.00 52.41  ? 1365 HOH A O     1 
HETATM 7479 O  O     . HOH P 10 .   ? 26.800 212.593 40.116 1.00 28.45  ? 1367 HOH A O     1 
HETATM 7480 O  O     . HOH P 10 .   ? 16.552 179.471 32.972 1.00 25.98  ? 1370 HOH A O     1 
HETATM 7481 O  O     . HOH P 10 .   ? 54.699 153.998 16.828 1.00 27.36  ? 1373 HOH A O     1 
HETATM 7482 O  O     . HOH P 10 .   ? 26.149 195.573 48.065 1.00 48.40  ? 1374 HOH A O     1 
HETATM 7483 O  O     . HOH P 10 .   ? 72.274 198.694 43.437 1.00 27.75  ? 1375 HOH A O     1 
HETATM 7484 O  O     . HOH P 10 .   ? 76.184 160.635 36.274 1.00 40.93  ? 1377 HOH A O     1 
HETATM 7485 O  O     . HOH P 10 .   ? 39.474 134.012 64.053 1.00 41.71  ? 1381 HOH A O     1 
HETATM 7486 O  O     . HOH P 10 .   ? 27.980 191.224 15.730 1.00 35.13  ? 1382 HOH A O     1 
HETATM 7487 O  O     . HOH P 10 .   ? 70.394 174.876 52.936 1.00 42.80  ? 1383 HOH A O     1 
HETATM 7488 O  O     . HOH P 10 .   ? 25.973 178.312 26.286 1.00 44.10  ? 1384 HOH A O     1 
HETATM 7489 O  O     . HOH P 10 .   ? 18.104 204.246 35.512 1.00 33.96  ? 1385 HOH A O     1 
HETATM 7490 O  O     . HOH P 10 .   ? 18.636 192.375 43.702 1.00 47.82  ? 1386 HOH A O     1 
HETATM 7491 O  O     . HOH P 10 .   ? 35.683 197.262 49.603 1.00 37.37  ? 1389 HOH A O     1 
HETATM 7492 O  O     . HOH P 10 .   ? 55.636 209.302 13.120 1.00 26.17  ? 1390 HOH A O     1 
HETATM 7493 O  O     . HOH P 10 .   ? 33.810 179.256 30.204 1.00 37.91  ? 1391 HOH A O     1 
HETATM 7494 O  O     . HOH P 10 .   ? 50.319 156.845 31.974 1.00 36.27  ? 1392 HOH A O     1 
HETATM 7495 O  O     . HOH P 10 .   ? 56.784 211.340 15.003 1.00 43.79  ? 1393 HOH A O     1 
HETATM 7496 O  O     . HOH P 10 .   ? 71.773 157.597 21.961 1.00 31.16  ? 1394 HOH A O     1 
HETATM 7497 O  O     . HOH P 10 .   ? 67.327 150.620 36.194 1.00 28.85  ? 1395 HOH A O     1 
HETATM 7498 O  O     . HOH P 10 .   ? 23.520 209.498 42.452 1.00 28.66  ? 1397 HOH A O     1 
HETATM 7499 O  O     . HOH P 10 .   ? 29.304 190.099 0.874  1.00 47.91  ? 1399 HOH A O     1 
HETATM 7500 O  O     . HOH P 10 .   ? 42.856 200.621 48.567 1.00 40.11  ? 1400 HOH A O     1 
HETATM 7501 O  O     . HOH P 10 .   ? 56.022 205.401 5.465  1.00 42.66  ? 1401 HOH A O     1 
HETATM 7502 O  O     . HOH P 10 .   ? 55.148 173.416 8.171  1.00 36.20  ? 1402 HOH A O     1 
HETATM 7503 O  O     . HOH P 10 .   ? 21.143 167.211 27.941 1.00 38.96  ? 1403 HOH A O     1 
HETATM 7504 O  O     . HOH P 10 .   ? 80.837 206.435 18.746 1.00 25.81  ? 1404 HOH A O     1 
HETATM 7505 O  O     . HOH P 10 .   ? 26.418 198.800 48.267 1.00 50.60  ? 1405 HOH A O     1 
HETATM 7506 O  O     . HOH P 10 .   ? 64.484 206.447 37.476 1.00 39.55  ? 1407 HOH A O     1 
HETATM 7507 O  O     . HOH P 10 .   ? 28.078 191.598 47.641 1.00 41.67  ? 1409 HOH A O     1 
HETATM 7508 O  O     . HOH P 10 .   ? 50.160 150.944 51.526 1.00 33.48  ? 1410 HOH A O     1 
HETATM 7509 O  O     . HOH P 10 .   ? 72.014 179.007 39.873 1.00 46.32  ? 1411 HOH A O     1 
HETATM 7510 O  O     . HOH P 10 .   ? 41.762 199.421 0.872  1.00 31.92  ? 1412 HOH A O     1 
HETATM 7511 O  O     . HOH P 10 .   ? 28.746 209.207 18.371 1.00 40.45  ? 1414 HOH A O     1 
HETATM 7512 O  O     . HOH P 10 .   ? 12.476 192.267 22.967 1.00 41.92  ? 1418 HOH A O     1 
HETATM 7513 O  O     . HOH P 10 .   ? 10.438 196.697 37.153 1.00 37.56  ? 1419 HOH A O     1 
HETATM 7514 O  O     . HOH P 10 .   ? 39.332 181.560 24.679 1.00 31.93  ? 1420 HOH A O     1 
HETATM 7515 O  O     . HOH P 10 .   ? 54.832 149.875 24.974 1.00 45.38  ? 1422 HOH A O     1 
HETATM 7516 O  O     . HOH P 10 .   ? 51.257 187.524 42.652 1.00 42.17  ? 1423 HOH A O     1 
HETATM 7517 O  O     . HOH P 10 .   ? 36.172 187.919 23.418 1.00 29.16  ? 1424 HOH A O     1 
HETATM 7518 O  O     . HOH P 10 .   ? 58.891 209.918 29.424 1.00 25.14  ? 1425 HOH A O     1 
HETATM 7519 O  O     . HOH P 10 .   ? 29.267 210.599 42.989 1.00 57.11  ? 1426 HOH A O     1 
HETATM 7520 O  O     . HOH P 10 .   ? 18.296 180.593 25.752 1.00 26.55  ? 1427 HOH A O     1 
HETATM 7521 O  O     . HOH P 10 .   ? 31.392 189.002 31.572 1.00 30.23  ? 1428 HOH A O     1 
HETATM 7522 O  O     . HOH P 10 .   ? 25.204 186.562 14.789 1.00 35.63  ? 1429 HOH A O     1 
HETATM 7523 O  O     . HOH P 10 .   ? 45.325 163.151 28.441 1.00 41.49  ? 1432 HOH A O     1 
HETATM 7524 O  O     . HOH P 10 .   ? 36.072 125.328 60.315 1.00 34.99  ? 1435 HOH A O     1 
HETATM 7525 O  O     . HOH P 10 .   ? 65.166 183.545 26.078 1.00 32.51  ? 1436 HOH A O     1 
HETATM 7526 O  O     . HOH P 10 .   ? 52.197 181.887 0.456  1.00 34.29  ? 1437 HOH A O     1 
HETATM 7527 O  O     . HOH P 10 .   ? 30.665 188.618 18.293 1.00 36.65  ? 1438 HOH A O     1 
HETATM 7528 O  O     . HOH P 10 .   ? 50.009 178.010 39.703 1.00 52.86  ? 1439 HOH A O     1 
HETATM 7529 O  O     . HOH P 10 .   ? 46.254 180.785 -3.999 1.00 37.62  ? 1440 HOH A O     1 
HETATM 7530 O  O     . HOH P 10 .   ? 41.884 203.731 20.270 1.00 23.21  ? 1441 HOH A O     1 
HETATM 7531 O  O     . HOH P 10 .   ? 80.021 200.436 9.399  1.00 38.43  ? 1444 HOH A O     1 
HETATM 7532 O  O     . HOH P 10 .   ? 34.394 188.176 28.950 1.00 37.72  ? 1446 HOH A O     1 
HETATM 7533 O  O     . HOH P 10 .   ? 10.852 206.289 28.311 1.00 39.89  ? 1447 HOH A O     1 
HETATM 7534 O  O     . HOH P 10 .   ? 72.419 190.619 23.554 1.00 31.52  ? 1448 HOH A O     1 
HETATM 7535 O  O     . HOH P 10 .   ? 44.805 163.793 14.939 1.00 34.83  ? 1449 HOH A O     1 
HETATM 7536 O  O     . HOH P 10 .   ? 70.770 194.562 11.155 1.00 40.02  ? 1450 HOH A O     1 
HETATM 7537 O  O     . HOH P 10 .   ? 59.129 193.729 51.328 1.00 38.47  ? 1451 HOH A O     1 
HETATM 7538 O  O     . HOH P 10 .   ? 44.583 199.416 -0.341 1.00 42.94  ? 1452 HOH A O     1 
HETATM 7539 O  O     . HOH P 10 .   ? 37.469 189.044 31.432 1.00 45.07  ? 1455 HOH A O     1 
HETATM 7540 O  O     . HOH P 10 .   ? 53.801 175.350 5.758  1.00 35.34  ? 1457 HOH A O     1 
HETATM 7541 O  O     . HOH P 10 .   ? 41.428 177.093 34.545 1.00 44.82  ? 1459 HOH A O     1 
HETATM 7542 O  O     . HOH P 10 .   ? 51.807 154.266 23.639 1.00 40.42  ? 1460 HOH A O     1 
HETATM 7543 O  O     . HOH P 10 .   ? 25.352 183.118 18.029 1.00 38.02  ? 1462 HOH A O     1 
HETATM 7544 O  O     . HOH P 10 .   ? 54.029 202.543 49.095 1.00 40.38  ? 1463 HOH A O     1 
HETATM 7545 O  O     . HOH P 10 .   ? 45.915 201.901 2.268  1.00 40.39  ? 1464 HOH A O     1 
HETATM 7546 O  O     . HOH P 10 .   ? 42.488 186.350 29.898 1.00 29.94  ? 1465 HOH A O     1 
HETATM 7547 O  O     . HOH P 10 .   ? 66.463 210.163 20.364 1.00 43.16  ? 1466 HOH A O     1 
HETATM 7548 O  O     . HOH P 10 .   ? 37.870 196.214 51.446 1.00 62.85  ? 1467 HOH A O     1 
HETATM 7549 O  O     . HOH P 10 .   ? 38.186 178.633 28.422 1.00 33.73  ? 1469 HOH A O     1 
HETATM 7550 O  O     . HOH P 10 .   ? 49.838 208.953 44.476 1.00 44.08  ? 1471 HOH A O     1 
HETATM 7551 O  O     . HOH P 10 .   ? 58.435 200.113 2.687  1.00 33.66  ? 1472 HOH A O     1 
HETATM 7552 O  O     . HOH P 10 .   ? 28.386 189.716 37.535 1.00 31.10  ? 1473 HOH A O     1 
HETATM 7553 O  O     . HOH P 10 .   ? 28.454 180.099 26.142 1.00 42.53  ? 1474 HOH A O     1 
HETATM 7554 O  O     . HOH P 10 .   ? 51.795 203.725 4.192  1.00 32.47  ? 1475 HOH A O     1 
HETATM 7555 O  O     . HOH P 10 .   ? 40.565 188.498 30.524 1.00 29.06  ? 1476 HOH A O     1 
HETATM 7556 O  O     . HOH P 10 .   ? 33.270 189.046 9.717  1.00 43.91  ? 1477 HOH A O     1 
HETATM 7557 O  O     . HOH P 10 .   ? 77.413 196.671 28.264 1.00 34.16  ? 1478 HOH A O     1 
HETATM 7558 O  O     . HOH P 10 .   ? 72.459 168.322 23.698 1.00 35.02  ? 1479 HOH A O     1 
HETATM 7559 O  O     . HOH P 10 .   ? 42.711 219.689 31.259 1.00 43.28  ? 1480 HOH A O     1 
HETATM 7560 O  O     . HOH P 10 .   ? 28.154 204.457 16.830 1.00 38.74  ? 1482 HOH A O     1 
HETATM 7561 O  O     . HOH P 10 .   ? 35.982 175.174 25.033 1.00 45.06  ? 1483 HOH A O     1 
HETATM 7562 O  O     . HOH P 10 .   ? 48.062 173.877 4.954  1.00 40.10  ? 1484 HOH A O     1 
HETATM 7563 O  O     . HOH P 10 .   ? 13.688 213.435 21.915 1.00 42.53  ? 1486 HOH A O     1 
HETATM 7564 O  O     . HOH P 10 .   ? 56.558 154.817 66.690 1.00 54.71  ? 1491 HOH A O     1 
HETATM 7565 O  O     . HOH P 10 .   ? 51.632 154.404 65.750 1.00 33.89  ? 1492 HOH A O     1 
HETATM 7566 O  O     . HOH P 10 .   ? 20.164 179.292 21.664 1.00 38.40  ? 1493 HOH A O     1 
HETATM 7567 O  O     . HOH P 10 .   ? 27.784 208.933 45.135 1.00 45.58  ? 1494 HOH A O     1 
HETATM 7568 O  O     . HOH P 10 .   ? 28.275 213.381 43.544 1.00 46.60  ? 1495 HOH A O     1 
HETATM 7569 O  O     . HOH P 10 .   ? 76.528 159.186 38.929 1.00 38.80  ? 1496 HOH A O     1 
HETATM 7570 O  O     . HOH P 10 .   ? 18.209 190.351 46.060 1.00 52.66  ? 1497 HOH A O     1 
HETATM 7571 O  O     . HOH P 10 .   ? 57.854 208.623 11.138 1.00 47.99  ? 1498 HOH A O     1 
HETATM 7572 O  O     . HOH P 10 .   ? 57.950 214.852 15.429 1.00 43.97  ? 1499 HOH A O     1 
HETATM 7573 O  O     . HOH P 10 .   ? 60.936 213.620 15.543 1.00 32.50  ? 1500 HOH A O     1 
HETATM 7574 O  O     . HOH P 10 .   ? 68.271 158.106 20.422 1.00 39.31  ? 1501 HOH A O     1 
HETATM 7575 O  O     . HOH P 10 .   ? 24.553 167.026 28.006 1.00 66.44  ? 1502 HOH A O     1 
HETATM 7576 O  O     . HOH P 10 .   ? 53.678 212.954 13.839 1.00 48.62  ? 1503 HOH A O     1 
HETATM 7577 O  O     . HOH P 10 .   ? 65.250 148.387 35.241 1.00 35.36  ? 1504 HOH A O     1 
HETATM 7578 O  O     . HOH P 10 .   ? 32.727 192.669 3.043  1.00 34.23  ? 1505 HOH A O     1 
HETATM 7579 O  O     . HOH P 10 .   ? 25.029 210.163 19.260 1.00 38.69  ? 1506 HOH A O     1 
HETATM 7580 O  O     . HOH P 10 .   ? 28.991 191.834 35.424 1.00 16.98  ? 1508 HOH A O     1 
HETATM 7581 O  O     . HOH P 10 .   ? 39.456 174.100 28.848 1.00 38.35  ? 1509 HOH A O     1 
HETATM 7582 O  O     . HOH P 10 .   ? 69.746 165.446 40.378 1.00 22.98  ? 1514 HOH A O     1 
HETATM 7583 O  O     . HOH P 10 .   ? 74.374 167.478 37.750 1.00 38.88  ? 1515 HOH A O     1 
HETATM 7584 O  O     . HOH P 10 .   ? 66.461 159.534 45.980 1.00 36.49  ? 1516 HOH A O     1 
HETATM 7585 O  O     . HOH P 10 .   ? 50.770 148.106 51.222 1.00 30.69  ? 1520 HOH A O     1 
HETATM 7586 O  O     . HOH P 10 .   ? 44.353 147.024 52.508 1.00 41.30  ? 1521 HOH A O     1 
HETATM 7587 O  O     . HOH P 10 .   ? 39.930 150.820 56.568 1.00 42.05  ? 1522 HOH A O     1 
HETATM 7588 O  O     . HOH P 10 .   ? 44.487 185.555 37.288 1.00 35.97  ? 1523 HOH A O     1 
HETATM 7589 O  O     . HOH P 10 .   ? 29.218 189.624 33.433 1.00 25.01  ? 1524 HOH A O     1 
HETATM 7590 O  O     . HOH P 10 .   ? 29.359 192.483 32.539 1.00 21.08  ? 1525 HOH A O     1 
HETATM 7591 O  O     . HOH P 10 .   ? 40.585 193.460 38.737 1.00 26.08  ? 1526 HOH A O     1 
HETATM 7592 O  O     . HOH P 10 .   ? 50.097 199.453 43.266 1.00 42.13  ? 1527 HOH A O     1 
HETATM 7593 O  O     . HOH P 10 .   ? 45.339 215.124 45.606 1.00 27.07  ? 1528 HOH A O     1 
HETATM 7594 O  O     . HOH P 10 .   ? 52.231 210.903 44.551 1.00 34.33  ? 1529 HOH A O     1 
HETATM 7595 O  O     . HOH P 10 .   ? 62.005 193.220 16.098 1.00 28.60  ? 1530 HOH A O     1 
HETATM 7596 O  O     . HOH P 10 .   ? 62.267 189.228 18.186 1.00 32.42  ? 1531 HOH A O     1 
HETATM 7597 O  O     . HOH P 10 .   ? 63.459 188.414 15.745 1.00 47.05  ? 1532 HOH A O     1 
HETATM 7598 O  O     . HOH P 10 .   ? 62.238 199.760 19.569 1.00 17.10  ? 1533 HOH A O     1 
HETATM 7599 O  O     . HOH P 10 .   ? 61.473 200.081 10.531 1.00 30.43  ? 1534 HOH A O     1 
HETATM 7600 O  O     . HOH P 10 .   ? 58.510 199.601 6.511  1.00 34.66  ? 1535 HOH A O     1 
HETATM 7601 O  O     . HOH P 10 .   ? 65.734 202.502 58.438 1.00 49.48  ? 1536 HOH A O     1 
HETATM 7602 O  O     . HOH P 10 .   ? 65.977 199.174 60.392 1.00 32.91  ? 1537 HOH A O     1 
HETATM 7603 O  O     . HOH P 10 .   ? 65.687 192.115 46.794 1.00 35.72  ? 1538 HOH A O     1 
HETATM 7604 O  O     . HOH P 10 .   ? 60.635 192.192 49.180 1.00 29.56  ? 1539 HOH A O     1 
HETATM 7605 O  O     . HOH P 10 .   ? 65.792 178.574 32.327 1.00 32.65  ? 1541 HOH A O     1 
HETATM 7606 O  O     . HOH P 10 .   ? 69.674 179.156 21.278 1.00 27.65  ? 1543 HOH A O     1 
HETATM 7607 O  O     . HOH P 10 .   ? 66.351 175.997 19.908 1.00 43.06  ? 1544 HOH A O     1 
HETATM 7608 O  O     . HOH P 10 .   ? 62.370 183.113 11.322 1.00 35.38  ? 1545 HOH A O     1 
HETATM 7609 O  O     . HOH P 10 .   ? 59.364 181.752 16.533 1.00 32.24  ? 1546 HOH A O     1 
HETATM 7610 O  O     . HOH P 10 .   ? 33.382 182.615 -0.225 1.00 46.54  ? 1548 HOH A O     1 
HETATM 7611 O  O     . HOH P 10 .   ? 40.310 180.214 9.459  1.00 31.95  ? 1549 HOH A O     1 
HETATM 7612 O  O     . HOH P 10 .   ? 33.689 191.259 16.013 1.00 29.74  ? 1550 HOH A O     1 
HETATM 7613 O  O     . HOH P 10 .   ? 30.468 197.838 16.939 1.00 30.80  ? 1551 HOH A O     1 
HETATM 7614 O  O     . HOH P 10 .   ? 34.359 197.578 18.320 1.00 34.14  ? 1552 HOH A O     1 
HETATM 7615 O  O     . HOH P 10 .   ? 37.209 197.547 15.180 1.00 38.68  ? 1553 HOH A O     1 
HETATM 7616 O  O     . HOH P 10 .   ? 34.360 186.433 16.788 1.00 27.23  ? 1554 HOH A O     1 
HETATM 7617 O  O     . HOH P 10 .   ? 32.883 186.332 19.320 1.00 34.90  ? 1555 HOH A O     1 
HETATM 7618 O  O     . HOH P 10 .   ? 20.322 201.730 17.206 1.00 28.52  ? 1556 HOH A O     1 
HETATM 7619 O  O     . HOH P 10 .   ? 41.047 203.319 15.820 1.00 36.30  ? 1557 HOH A O     1 
HETATM 7620 O  O     . HOH P 10 .   ? 28.793 214.183 21.415 1.00 31.88  ? 1558 HOH A O     1 
HETATM 7621 O  O     . HOH P 10 .   ? 23.263 208.003 20.352 1.00 41.49  ? 1559 HOH A O     1 
HETATM 7622 O  O     . HOH P 10 .   ? 17.418 207.992 33.145 1.00 25.75  ? 1560 HOH A O     1 
HETATM 7623 O  O     . HOH P 10 .   ? 18.340 211.425 22.924 1.00 42.53  ? 1561 HOH A O     1 
HETATM 7624 O  O     . HOH P 10 .   ? 8.670  195.242 23.432 1.00 30.46  ? 1562 HOH A O     1 
HETATM 7625 O  O     . HOH P 10 .   ? 10.338 200.986 29.040 1.00 46.41  ? 1563 HOH A O     1 
HETATM 7626 O  O     . HOH P 10 .   ? 33.105 171.916 21.604 1.00 39.52  ? 1564 HOH A O     1 
HETATM 7627 O  O     . HOH Q 10 .   ? 64.259 133.860 46.347 1.00 7.61   ? 1003 HOH B O     1 
HETATM 7628 O  O     . HOH Q 10 .   ? 58.051 134.677 32.933 1.00 23.81  ? 1033 HOH B O     1 
HETATM 7629 O  O     . HOH Q 10 .   ? 60.439 130.779 32.491 1.00 17.65  ? 1044 HOH B O     1 
HETATM 7630 O  O     . HOH Q 10 .   ? 47.889 138.071 45.329 1.00 21.21  ? 1093 HOH B O     1 
HETATM 7631 O  O     . HOH Q 10 .   ? 55.277 145.263 54.844 1.00 25.77  ? 1099 HOH B O     1 
HETATM 7632 O  O     . HOH Q 10 .   ? 57.342 138.703 39.121 1.00 26.15  ? 1115 HOH B O     1 
HETATM 7633 O  O     . HOH Q 10 .   ? 65.573 135.031 34.916 1.00 28.55  ? 1136 HOH B O     1 
HETATM 7634 O  O     . HOH Q 10 .   ? 50.087 128.799 34.465 1.00 33.06  ? 1168 HOH B O     1 
HETATM 7635 O  O     . HOH Q 10 .   ? 59.039 144.417 42.131 1.00 19.14  ? 1196 HOH B O     1 
HETATM 7636 O  O     . HOH Q 10 .   ? 59.611 149.815 46.725 1.00 18.80  ? 1198 HOH B O     1 
HETATM 7637 O  O     . HOH Q 10 .   ? 60.174 138.696 61.617 1.00 40.77  ? 1199 HOH B O     1 
HETATM 7638 O  O     . HOH Q 10 .   ? 61.623 122.211 48.617 1.00 32.56  ? 1293 HOH B O     1 
HETATM 7639 O  O     . HOH Q 10 .   ? 66.961 136.820 37.640 1.00 40.95  ? 1303 HOH B O     1 
HETATM 7640 O  O     . HOH Q 10 .   ? 41.545 124.457 46.867 1.00 31.41  ? 1311 HOH B O     1 
HETATM 7641 O  O     . HOH Q 10 .   ? 66.678 143.404 44.482 1.00 28.71  ? 1313 HOH B O     1 
HETATM 7642 O  O     . HOH Q 10 .   ? 45.474 136.142 54.782 1.00 31.79  ? 1315 HOH B O     1 
HETATM 7643 O  O     . HOH Q 10 .   ? 54.713 114.285 56.048 1.00 33.56  ? 1318 HOH B O     1 
HETATM 7644 O  O     . HOH Q 10 .   ? 62.476 136.705 61.414 1.00 39.89  ? 1323 HOH B O     1 
HETATM 7645 O  O     . HOH Q 10 .   ? 60.185 125.961 29.442 1.00 35.19  ? 1341 HOH B O     1 
HETATM 7646 O  O     . HOH Q 10 .   ? 60.148 135.144 51.971 1.00 39.10  ? 1346 HOH B O     1 
HETATM 7647 O  O     . HOH Q 10 .   ? 59.074 149.558 49.670 1.00 43.63  ? 1354 HOH B O     1 
HETATM 7648 O  O     . HOH Q 10 .   ? 47.693 129.296 64.111 1.00 49.22  ? 1355 HOH B O     1 
HETATM 7649 O  O     . HOH Q 10 .   ? 61.737 128.042 31.906 1.00 27.91  ? 1368 HOH B O     1 
HETATM 7650 O  O     . HOH Q 10 .   ? 53.729 119.834 38.503 1.00 40.42  ? 1369 HOH B O     1 
HETATM 7651 O  O     . HOH Q 10 .   ? 61.848 142.888 61.306 1.00 35.61  ? 1371 HOH B O     1 
HETATM 7652 O  O     . HOH Q 10 .   ? 67.746 133.208 41.708 1.00 39.80  ? 1378 HOH B O     1 
HETATM 7653 O  O     . HOH Q 10 .   ? 54.378 124.054 69.732 1.00 36.43  ? 1380 HOH B O     1 
HETATM 7654 O  O     . HOH Q 10 .   ? 46.240 136.082 43.647 1.00 51.42  ? 1445 HOH B O     1 
HETATM 7655 O  O     . HOH Q 10 .   ? 71.187 140.329 43.996 1.00 34.96  ? 1470 HOH B O     1 
HETATM 7656 O  O     . HOH Q 10 .   ? 42.436 125.752 49.585 1.00 50.21  ? 1481 HOH B O     1 
HETATM 7657 O  O     . HOH Q 10 .   ? 59.760 147.173 43.983 1.00 28.72  ? 1518 HOH B O     1 
HETATM 7658 O  O     . HOH Q 10 .   ? 62.813 147.373 42.388 1.00 34.77  ? 1519 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   801 ?   ?   ?   P . n 
A 1 2   DG  2   802 ?   ?   ?   P . n 
A 1 3   DA  3   803 ?   ?   ?   P . n 
A 1 4   DA  4   804 ?   ?   ?   P . n 
A 1 5   DA  5   805 ?   ?   ?   P . n 
A 1 6   DA  6   806 806 DA  ADE P . n 
A 1 7   DC  7   807 807 DC  CYT P . n 
A 1 8   DG  8   808 808 DG  GUA P . n 
A 1 9   DA  9   809 809 DA  ADE P . n 
A 1 10  DC  10  810 810 DC  CYT P . n 
A 1 11  DG  11  811 811 DG  GUA P . n 
A 1 12  DG  12  812 812 DG  GUA P . n 
A 1 13  DC  13  813 813 DC  CYT P . n 
A 1 14  DC  14  814 814 DC  CYT P . n 
A 1 15  DA  15  815 815 DA  ADE P . n 
A 1 16  DG  16  816 816 DG  GUA P . n 
A 1 17  DT  17  817 817 DT  THY P . n 
A 1 18  DG  18  818 818 DG  GUA P . n 
A 1 19  DC  19  819 819 DC  CYT P . n 
A 1 20  DC  20  820 820 DC  CYT P . n 
A 1 21  DA  21  821 821 DA  ADE P . n 
A 1 22  2DA 22  822 822 2DA 2DA P . n 
B 2 1   DC  1   851 ?   ?   ?   T . n 
B 2 2   DC  2   852 ?   ?   ?   T . n 
B 2 3   DC  3   853 853 DC  CYT T . n 
B 2 4   DA  4   854 854 DA  ADE T . n 
B 2 5   8OG 5   855 855 8OG 8OG T . n 
B 2 6   DT  6   856 856 DT  THY T . n 
B 2 7   DG  7   857 857 DG  GUA T . n 
B 2 8   DG  8   858 858 DG  GUA T . n 
B 2 9   DC  9   859 859 DC  CYT T . n 
B 2 10  DA  10  860 860 DA  ADE T . n 
B 2 11  DC  11  861 861 DC  CYT T . n 
B 2 12  DT  12  862 862 DT  THY T . n 
B 2 13  DG  13  863 863 DG  GUA T . n 
B 2 14  DG  14  864 864 DG  GUA T . n 
B 2 15  DC  15  865 865 DC  CYT T . n 
B 2 16  DC  16  866 866 DC  CYT T . n 
B 2 17  DG  17  867 867 DG  GUA T . n 
B 2 18  DT  18  868 868 DT  THY T . n 
B 2 19  DC  19  869 869 DC  CYT T . n 
B 2 20  DG  20  870 870 DG  GUA T . n 
B 2 21  DT  21  871 871 DT  THY T . n 
B 2 22  DT  22  872 872 DT  THY T . n 
B 2 23  DT  23  873 ?   ?   ?   T . n 
B 2 24  DT  24  874 ?   ?   ?   T . n 
B 2 25  DC  25  875 ?   ?   ?   T . n 
B 2 26  DG  26  876 ?   ?   ?   T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   SER 4   4   4   SER SER A . n 
C 3 5   ASP 5   5   5   ASP ASP A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   ALA 8   8   8   ALA ALA A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  GLU 13  13  13  GLU GLU A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  LYS 17  17  17  LYS LYS A . n 
C 3 18  PHE 18  18  18  PHE PHE A . n 
C 3 19  HIS 19  19  19  HIS HIS A . n 
C 3 20  CYS 20  20  20  CYS CYS A . n 
C 3 21  GLY 21  21  21  GLY GLY A . n 
C 3 22  VAL 22  22  22  VAL VAL A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  TYR 24  24  24  TYR TYR A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  TYR 26  26  26  TYR TYR A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ALA 29  29  29  ALA ALA A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  TYR 31  31  31  TYR TYR A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  SER 33  33  33  SER SER A . n 
C 3 34  TYR 34  34  34  TYR TYR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  PRO 36  36  36  PRO PRO A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  ASP 38  38  38  ASP ASP A . n 
C 3 39  PHE 39  39  39  PHE PHE A . n 
C 3 40  GLY 40  40  40  GLY GLY A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  LEU 43  43  43  LEU LEU A . n 
C 3 44  ASP 44  44  44  ASP ASP A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  LEU 46  46  46  LEU LEU A . n 
C 3 47  GLU 47  47  47  GLU GLU A . n 
C 3 48  ALA 48  48  48  ALA ALA A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  VAL 50  50  50  VAL VAL A . n 
C 3 51  ALA 51  51  51  ALA ALA A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  GLY 53  53  53  GLY GLY A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  ILE 56  56  56  ILE ILE A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  HIS 59  59  59  HIS HIS A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  GLY 61  61  61  GLY GLY A . n 
C 3 62  HIS 62  62  62  HIS HIS A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  TYR 64  64  64  TYR TYR A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  PRO 67  67  67  PRO PRO A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  THR 70  70  70  THR THR A . n 
C 3 71  LYS 71  71  71  LYS LYS A . n 
C 3 72  LEU 72  72  72  LEU LEU A . n 
C 3 73  ALA 73  73  73  ALA ALA A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  GLN 76  76  76  GLN GLN A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ASN 78  78  78  ASN ASN A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  GLU 80  80  80  GLU GLU A . n 
C 3 81  PHE 81  81  81  PHE PHE A . n 
C 3 82  HIS 82  82  82  HIS HIS A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  PRO 84  84  84  PRO PRO A . n 
C 3 85  ARG 85  85  85  ARG ARG A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  ASN 87  87  87  ASN ASN A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  ILE 89  89  89  ILE ILE A . n 
C 3 90  ASP 90  90  90  ASP ASP A . n 
C 3 91  THR 91  91  91  THR THR A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  VAL 93  93  93  VAL VAL A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  LEU 97  97  97  LEU LEU A . n 
C 3 98  ILE 98  98  98  ILE ILE A . n 
C 3 99  HIS 99  99  99  HIS HIS A . n 
C 3 100 SER 100 100 100 SER SER A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 LYS 103 103 103 LYS LYS A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 THR 105 105 105 THR THR A . n 
C 3 106 ASP 106 106 106 ASP ASP A . n 
C 3 107 MET 107 107 107 MET MET A . n 
C 3 108 GLY 108 108 108 GLY GLY A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 LEU 110 110 110 LEU LEU A . n 
C 3 111 ARG 111 111 111 ARG ARG A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 GLY 113 113 113 GLY GLY A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 PRO 116 116 116 PRO PRO A . n 
C 3 117 GLY 117 117 117 GLY GLY A . n 
C 3 118 ALA 118 124 124 ALA ALA A . n 
C 3 119 LEU 119 125 125 LEU LEU A . n 
C 3 120 GLU 120 126 126 GLU GLU A . n 
C 3 121 ALA 121 127 127 ALA ALA A . n 
C 3 122 TRP 122 128 128 TRP TRP A . n 
C 3 123 GLY 123 129 129 GLY GLY A . n 
C 3 124 TYR 124 130 130 TYR TYR A . n 
C 3 125 ARG 125 131 131 ARG ARG A . n 
C 3 126 LEU 126 132 132 LEU LEU A . n 
C 3 127 GLY 127 133 133 GLY GLY A . n 
C 3 128 GLU 128 134 134 GLU GLU A . n 
C 3 129 MET 129 135 135 MET MET A . n 
C 3 130 LYS 130 136 136 LYS LYS A . n 
C 3 131 GLY 131 137 137 GLY GLY A . n 
C 3 132 GLU 132 138 138 GLU GLU A . n 
C 3 133 TYR 133 139 139 TYR TYR A . n 
C 3 134 LYS 134 140 140 LYS LYS A . n 
C 3 135 ASP 135 141 141 ASP ASP A . n 
C 3 136 ASP 136 142 142 ASP ASP A . n 
C 3 137 PHE 137 143 143 PHE PHE A . n 
C 3 138 LYS 138 144 144 LYS LYS A . n 
C 3 139 ARG 139 145 145 ARG ARG A . n 
C 3 140 MET 140 146 146 MET MET A . n 
C 3 141 LEU 141 147 147 LEU LEU A . n 
C 3 142 GLU 142 148 148 GLU GLU A . n 
C 3 143 GLU 143 149 149 GLU GLU A . n 
C 3 144 GLN 144 150 150 GLN GLN A . n 
C 3 145 GLY 145 151 151 GLY GLY A . n 
C 3 146 GLU 146 152 152 GLU GLU A . n 
C 3 147 GLU 147 153 153 GLU GLU A . n 
C 3 148 TYR 148 154 154 TYR TYR A . n 
C 3 149 VAL 149 155 155 VAL VAL A . n 
C 3 150 ASP 150 156 156 ASP ASP A . n 
C 3 151 GLY 151 157 157 GLY GLY A . n 
C 3 152 MET 152 158 158 MET MET A . n 
C 3 153 GLU 153 159 159 GLU GLU A . n 
C 3 154 TRP 154 160 160 TRP TRP A . n 
C 3 155 TRP 155 161 161 TRP TRP A . n 
C 3 156 ASN 156 162 162 ASN ASN A . n 
C 3 157 PHE 157 163 163 PHE PHE A . n 
C 3 158 ASN 158 164 164 ASN ASN A . n 
C 3 159 GLU 159 165 165 GLU GLU A . n 
C 3 160 GLU 160 166 166 GLU GLU A . n 
C 3 161 MET 161 167 167 MET MET A . n 
C 3 162 MET 162 168 168 MET MET A . n 
C 3 163 ASP 163 169 169 ASP ASP A . n 
C 3 164 TYR 164 170 170 TYR TYR A . n 
C 3 165 ASN 165 171 171 ASN ASN A . n 
C 3 166 VAL 166 172 172 VAL VAL A . n 
C 3 167 GLN 167 173 173 GLN GLN A . n 
C 3 168 ASP 168 174 174 ASP ASP A . n 
C 3 169 VAL 169 175 175 VAL VAL A . n 
C 3 170 VAL 170 176 176 VAL VAL A . n 
C 3 171 VAL 171 177 177 VAL VAL A . n 
C 3 172 THR 172 178 178 THR THR A . n 
C 3 173 LYS 173 179 179 LYS LYS A . n 
C 3 174 ALA 174 180 180 ALA ALA A . n 
C 3 175 LEU 175 181 181 LEU LEU A . n 
C 3 176 LEU 176 182 182 LEU LEU A . n 
C 3 177 GLU 177 183 183 GLU GLU A . n 
C 3 178 LYS 178 184 184 LYS LYS A . n 
C 3 179 LEU 179 185 185 LEU LEU A . n 
C 3 180 LEU 180 186 186 LEU LEU A . n 
C 3 181 SER 181 187 187 SER SER A . n 
C 3 182 ASP 182 188 188 ASP ASP A . n 
C 3 183 LYS 183 189 189 LYS LYS A . n 
C 3 184 HIS 184 190 190 HIS HIS A . n 
C 3 185 TYR 185 191 191 TYR TYR A . n 
C 3 186 PHE 186 192 192 PHE PHE A . n 
C 3 187 PRO 187 193 193 PRO PRO A . n 
C 3 188 PRO 188 194 194 PRO PRO A . n 
C 3 189 GLU 189 195 195 GLU GLU A . n 
C 3 190 ILE 190 196 196 ILE ILE A . n 
C 3 191 ASP 191 197 197 ASP ASP A . n 
C 3 192 PHE 192 198 198 PHE PHE A . n 
C 3 193 THR 193 199 199 THR THR A . n 
C 3 194 ASP 194 200 200 ASP ASP A . n 
C 3 195 VAL 195 201 201 VAL VAL A . n 
C 3 196 GLY 196 202 202 GLY GLY A . n 
C 3 197 TYR 197 203 203 TYR TYR A . n 
C 3 198 THR 198 204 204 THR THR A . n 
C 3 199 THR 199 205 205 THR THR A . n 
C 3 200 PHE 200 206 206 PHE PHE A . n 
C 3 201 TRP 201 207 207 TRP TRP A . n 
C 3 202 SER 202 208 208 SER SER A . n 
C 3 203 GLU 203 209 209 GLU GLU A . n 
C 3 204 SER 204 210 210 SER SER A . n 
C 3 205 LEU 205 211 211 LEU LEU A . n 
C 3 206 GLU 206 212 212 GLU GLU A . n 
C 3 207 ALA 207 213 213 ALA ALA A . n 
C 3 208 VAL 208 214 214 VAL VAL A . n 
C 3 209 ASP 209 215 215 ASP ASP A . n 
C 3 210 ILE 210 216 216 ILE ILE A . n 
C 3 211 GLU 211 217 217 GLU GLU A . n 
C 3 212 HIS 212 218 218 HIS HIS A . n 
C 3 213 ARG 213 219 219 ARG ARG A . n 
C 3 214 ALA 214 220 220 ALA ALA A . n 
C 3 215 ALA 215 221 221 ALA ALA A . n 
C 3 216 TRP 216 222 222 TRP TRP A . n 
C 3 217 LEU 217 223 223 LEU LEU A . n 
C 3 218 LEU 218 224 224 LEU LEU A . n 
C 3 219 ALA 219 225 225 ALA ALA A . n 
C 3 220 LYS 220 226 226 LYS LYS A . n 
C 3 221 GLN 221 227 227 GLN GLN A . n 
C 3 222 GLU 222 228 228 GLU GLU A . n 
C 3 223 ARG 223 229 229 ARG ARG A . n 
C 3 224 ASN 224 230 230 ASN ASN A . n 
C 3 225 GLY 225 231 231 GLY GLY A . n 
C 3 226 PHE 226 232 232 PHE PHE A . n 
C 3 227 PRO 227 233 233 PRO PRO A . n 
C 3 228 PHE 228 234 234 PHE PHE A . n 
C 3 229 ASP 229 235 235 ASP ASP A . n 
C 3 230 THR 230 236 236 THR THR A . n 
C 3 231 LYS 231 237 237 LYS LYS A . n 
C 3 232 ALA 232 238 238 ALA ALA A . n 
C 3 233 ILE 233 239 239 ILE ILE A . n 
C 3 234 GLU 234 240 240 GLU GLU A . n 
C 3 235 GLU 235 241 241 GLU GLU A . n 
C 3 236 LEU 236 242 242 LEU LEU A . n 
C 3 237 TYR 237 243 243 TYR TYR A . n 
C 3 238 VAL 238 244 244 VAL VAL A . n 
C 3 239 GLU 239 245 245 GLU GLU A . n 
C 3 240 LEU 240 246 246 LEU LEU A . n 
C 3 241 ALA 241 247 247 ALA ALA A . n 
C 3 242 ALA 242 248 248 ALA ALA A . n 
C 3 243 ARG 243 249 249 ARG ARG A . n 
C 3 244 ARG 244 250 250 ARG ARG A . n 
C 3 245 SER 245 251 251 SER SER A . n 
C 3 246 GLU 246 252 252 GLU GLU A . n 
C 3 247 LEU 247 253 253 LEU LEU A . n 
C 3 248 LEU 248 254 254 LEU LEU A . n 
C 3 249 ARG 249 255 255 ARG ARG A . n 
C 3 250 LYS 250 256 256 LYS LYS A . n 
C 3 251 LEU 251 257 257 LEU LEU A . n 
C 3 252 THR 252 258 258 THR THR A . n 
C 3 253 GLU 253 259 259 GLU GLU A . n 
C 3 254 THR 254 260 260 THR THR A . n 
C 3 255 PHE 255 261 261 PHE PHE A . n 
C 3 256 GLY 256 262 262 GLY GLY A . n 
C 3 257 SER 257 263 263 SER SER A . n 
C 3 258 TRP 258 264 264 TRP TRP A . n 
C 3 259 TYR 259 265 265 TYR TYR A . n 
C 3 260 GLN 260 266 266 GLN GLN A . n 
C 3 261 PRO 261 267 267 PRO PRO A . n 
C 3 262 LYS 262 268 268 LYS LYS A . n 
C 3 263 GLY 263 269 269 GLY GLY A . n 
C 3 264 GLY 264 270 270 GLY GLY A . n 
C 3 265 THR 265 271 271 THR THR A . n 
C 3 266 GLU 266 272 272 GLU GLU A . n 
C 3 267 MET 267 273 273 MET MET A . n 
C 3 268 PHE 268 274 274 PHE PHE A . n 
C 3 269 CYS 269 275 275 CYS CYS A . n 
C 3 270 HIS 270 276 276 HIS HIS A . n 
C 3 271 PRO 271 277 277 PRO PRO A . n 
C 3 272 ARG 272 278 278 ARG ARG A . n 
C 3 273 THR 273 279 279 THR THR A . n 
C 3 274 GLY 274 280 280 GLY GLY A . n 
C 3 275 LYS 275 281 281 LYS LYS A . n 
C 3 276 PRO 276 282 282 PRO PRO A . n 
C 3 277 LEU 277 283 283 LEU LEU A . n 
C 3 278 PRO 278 284 284 PRO PRO A . n 
C 3 279 LYS 279 285 285 LYS LYS A . n 
C 3 280 TYR 280 286 286 TYR TYR A . n 
C 3 281 PRO 281 287 287 PRO PRO A . n 
C 3 282 ARG 282 288 288 ARG ARG A . n 
C 3 283 ILE 283 289 289 ILE ILE A . n 
C 3 284 LYS 284 290 290 LYS LYS A . n 
C 3 285 THR 285 291 291 THR THR A . n 
C 3 286 PRO 286 292 292 PRO PRO A . n 
C 3 287 LYS 287 293 293 LYS LYS A . n 
C 3 288 VAL 288 294 294 VAL VAL A . n 
C 3 289 GLY 289 295 295 GLY GLY A . n 
C 3 290 GLY 290 296 296 GLY GLY A . n 
C 3 291 ILE 291 297 297 ILE ILE A . n 
C 3 292 PHE 292 298 298 PHE PHE A . n 
C 3 293 LYS 293 299 299 LYS LYS A . n 
C 3 294 LYS 294 300 300 LYS LYS A . n 
C 3 295 PRO 295 301 301 PRO PRO A . n 
C 3 296 LYS 296 302 302 LYS LYS A . n 
C 3 297 ASN 297 303 303 ASN ASN A . n 
C 3 298 LYS 298 304 304 LYS LYS A . n 
C 3 299 ALA 299 305 305 ALA ALA A . n 
C 3 300 GLN 300 306 306 GLN GLN A . n 
C 3 301 ARG 301 307 307 ARG ARG A . n 
C 3 302 GLU 302 308 308 GLU GLU A . n 
C 3 303 GLY 303 309 309 GLY GLY A . n 
C 3 304 ARG 304 310 310 ARG ARG A . n 
C 3 305 GLU 305 311 311 GLU GLU A . n 
C 3 306 PRO 306 312 312 PRO PRO A . n 
C 3 307 CYS 307 313 313 CYS CYS A . n 
C 3 308 GLU 308 314 314 GLU GLU A . n 
C 3 309 LEU 309 315 315 LEU LEU A . n 
C 3 310 ASP 310 316 316 ASP ASP A . n 
C 3 311 THR 311 317 317 THR THR A . n 
C 3 312 ARG 312 318 318 ARG ARG A . n 
C 3 313 GLU 313 319 319 GLU GLU A . n 
C 3 314 TYR 314 320 320 TYR TYR A . n 
C 3 315 VAL 315 321 321 VAL VAL A . n 
C 3 316 ALA 316 322 322 ALA ALA A . n 
C 3 317 GLY 317 323 323 GLY GLY A . n 
C 3 318 ALA 318 324 324 ALA ALA A . n 
C 3 319 PRO 319 325 325 PRO PRO A . n 
C 3 320 TYR 320 326 326 TYR TYR A . n 
C 3 321 THR 321 327 327 THR THR A . n 
C 3 322 PRO 322 328 328 PRO PRO A . n 
C 3 323 VAL 323 329 329 VAL VAL A . n 
C 3 324 GLU 324 330 330 GLU GLU A . n 
C 3 325 HIS 325 331 331 HIS HIS A . n 
C 3 326 VAL 326 332 332 VAL VAL A . n 
C 3 327 VAL 327 333 333 VAL VAL A . n 
C 3 328 PHE 328 334 334 PHE PHE A . n 
C 3 329 ASN 329 335 335 ASN ASN A . n 
C 3 330 PRO 330 336 336 PRO PRO A . n 
C 3 331 SER 331 337 337 SER SER A . n 
C 3 332 SER 332 338 338 SER SER A . n 
C 3 333 ARG 333 339 339 ARG ARG A . n 
C 3 334 ASP 334 340 340 ASP ASP A . n 
C 3 335 HIS 335 341 341 HIS HIS A . n 
C 3 336 ILE 336 342 342 ILE ILE A . n 
C 3 337 GLN 337 343 343 GLN GLN A . n 
C 3 338 LYS 338 344 344 LYS LYS A . n 
C 3 339 LYS 339 345 345 LYS LYS A . n 
C 3 340 LEU 340 346 346 LEU LEU A . n 
C 3 341 GLN 341 347 347 GLN GLN A . n 
C 3 342 GLU 342 348 348 GLU GLU A . n 
C 3 343 ALA 343 349 349 ALA ALA A . n 
C 3 344 GLY 344 350 350 GLY GLY A . n 
C 3 345 TRP 345 351 351 TRP TRP A . n 
C 3 346 VAL 346 352 352 VAL VAL A . n 
C 3 347 PRO 347 353 353 PRO PRO A . n 
C 3 348 THR 348 354 354 THR THR A . n 
C 3 349 LYS 349 355 355 LYS LYS A . n 
C 3 350 TYR 350 356 356 TYR TYR A . n 
C 3 351 THR 351 357 357 THR THR A . n 
C 3 352 ASP 352 358 358 ASP ASP A . n 
C 3 353 LYS 353 359 359 LYS LYS A . n 
C 3 354 GLY 354 360 360 GLY GLY A . n 
C 3 355 ALA 355 361 361 ALA ALA A . n 
C 3 356 PRO 356 362 362 PRO PRO A . n 
C 3 357 VAL 357 363 363 VAL VAL A . n 
C 3 358 VAL 358 364 364 VAL VAL A . n 
C 3 359 ASP 359 365 365 ASP ASP A . n 
C 3 360 ASP 360 366 366 ASP ASP A . n 
C 3 361 GLU 361 367 367 GLU GLU A . n 
C 3 362 VAL 362 368 368 VAL VAL A . n 
C 3 363 LEU 363 369 369 LEU LEU A . n 
C 3 364 GLU 364 370 370 GLU GLU A . n 
C 3 365 GLY 365 371 371 GLY GLY A . n 
C 3 366 VAL 366 372 372 VAL VAL A . n 
C 3 367 ARG 367 373 373 ARG ARG A . n 
C 3 368 VAL 368 374 374 VAL VAL A . n 
C 3 369 ASP 369 375 375 ASP ASP A . n 
C 3 370 ASP 370 376 376 ASP ASP A . n 
C 3 371 PRO 371 377 377 PRO PRO A . n 
C 3 372 GLU 372 378 378 GLU GLU A . n 
C 3 373 LYS 373 379 379 LYS LYS A . n 
C 3 374 GLN 374 380 380 GLN GLN A . n 
C 3 375 ALA 375 381 381 ALA ALA A . n 
C 3 376 ALA 376 382 382 ALA ALA A . n 
C 3 377 ILE 377 383 383 ILE ILE A . n 
C 3 378 ASP 378 384 384 ASP ASP A . n 
C 3 379 LEU 379 385 385 LEU LEU A . n 
C 3 380 ILE 380 386 386 ILE ILE A . n 
C 3 381 LYS 381 387 387 LYS LYS A . n 
C 3 382 GLU 382 388 388 GLU GLU A . n 
C 3 383 TYR 383 389 389 TYR TYR A . n 
C 3 384 LEU 384 390 390 LEU LEU A . n 
C 3 385 MET 385 391 391 MET MET A . n 
C 3 386 ILE 386 392 392 ILE ILE A . n 
C 3 387 GLN 387 393 393 GLN GLN A . n 
C 3 388 LYS 388 394 394 LYS LYS A . n 
C 3 389 ARG 389 395 395 ARG ARG A . n 
C 3 390 ILE 390 396 396 ILE ILE A . n 
C 3 391 GLY 391 397 397 GLY GLY A . n 
C 3 392 GLN 392 398 398 GLN GLN A . n 
C 3 393 SER 393 399 399 SER SER A . n 
C 3 394 ALA 394 400 400 ALA ALA A . n 
C 3 395 GLU 395 401 401 GLU GLU A . n 
C 3 396 GLY 396 402 402 GLY GLY A . n 
C 3 397 ASP 397 403 403 ASP ASP A . n 
C 3 398 LYS 398 404 404 LYS LYS A . n 
C 3 399 ALA 399 405 405 ALA ALA A . n 
C 3 400 TRP 400 406 406 TRP TRP A . n 
C 3 401 LEU 401 407 407 LEU LEU A . n 
C 3 402 ARG 402 408 408 ARG ARG A . n 
C 3 403 TYR 403 409 409 TYR TYR A . n 
C 3 404 VAL 404 410 410 VAL VAL A . n 
C 3 405 ALA 405 411 411 ALA ALA A . n 
C 3 406 GLU 406 412 412 GLU GLU A . n 
C 3 407 ASP 407 413 413 ASP ASP A . n 
C 3 408 GLY 408 414 414 GLY GLY A . n 
C 3 409 LYS 409 415 415 LYS LYS A . n 
C 3 410 ILE 410 416 416 ILE ILE A . n 
C 3 411 HIS 411 417 417 HIS HIS A . n 
C 3 412 GLY 412 418 418 GLY GLY A . n 
C 3 413 SER 413 419 419 SER SER A . n 
C 3 414 VAL 414 420 420 VAL VAL A . n 
C 3 415 ASN 415 421 421 ASN ASN A . n 
C 3 416 PRO 416 422 422 PRO PRO A . n 
C 3 417 ASN 417 423 423 ASN ASN A . n 
C 3 418 GLY 418 424 424 GLY GLY A . n 
C 3 419 ALA 419 425 425 ALA ALA A . n 
C 3 420 VAL 420 426 426 VAL VAL A . n 
C 3 421 THR 421 427 427 THR THR A . n 
C 3 422 GLY 422 428 428 GLY GLY A . n 
C 3 423 ARG 423 429 429 ARG ARG A . n 
C 3 424 ALA 424 430 430 ALA ALA A . n 
C 3 425 THR 425 431 431 THR THR A . n 
C 3 426 HIS 426 432 432 HIS HIS A . n 
C 3 427 ALA 427 433 433 ALA ALA A . n 
C 3 428 PHE 428 434 434 PHE PHE A . n 
C 3 429 PRO 429 435 435 PRO PRO A . n 
C 3 430 ASN 430 436 436 ASN ASN A . n 
C 3 431 LEU 431 437 437 LEU LEU A . n 
C 3 432 ALA 432 438 438 ALA ALA A . n 
C 3 433 GLN 433 439 439 GLN GLN A . n 
C 3 434 ILE 434 440 440 ILE ILE A . n 
C 3 435 PRO 435 441 441 PRO PRO A . n 
C 3 436 GLY 436 442 442 GLY GLY A . n 
C 3 437 VAL 437 443 443 VAL VAL A . n 
C 3 438 ARG 438 444 444 ARG ARG A . n 
C 3 439 SER 439 445 445 SER SER A . n 
C 3 440 PRO 440 446 446 PRO PRO A . n 
C 3 441 TYR 441 447 447 TYR TYR A . n 
C 3 442 GLY 442 448 448 GLY GLY A . n 
C 3 443 GLU 443 449 449 GLU GLU A . n 
C 3 444 GLN 444 450 450 GLN GLN A . n 
C 3 445 CYS 445 451 451 CYS CYS A . n 
C 3 446 ARG 446 452 452 ARG ARG A . n 
C 3 447 ALA 447 453 453 ALA ALA A . n 
C 3 448 ALA 448 454 454 ALA ALA A . n 
C 3 449 PHE 449 455 455 PHE PHE A . n 
C 3 450 GLY 450 456 456 GLY GLY A . n 
C 3 451 ALA 451 457 457 ALA ALA A . n 
C 3 452 GLU 452 458 458 GLU GLU A . n 
C 3 453 HIS 453 459 459 HIS HIS A . n 
C 3 454 HIS 454 460 460 HIS HIS A . n 
C 3 455 LEU 455 461 461 LEU LEU A . n 
C 3 456 ASP 456 462 462 ASP ASP A . n 
C 3 457 GLY 457 463 463 GLY GLY A . n 
C 3 458 ILE 458 464 464 ILE ILE A . n 
C 3 459 THR 459 465 465 THR THR A . n 
C 3 460 GLY 460 466 466 GLY GLY A . n 
C 3 461 LYS 461 467 467 LYS LYS A . n 
C 3 462 PRO 462 468 468 PRO PRO A . n 
C 3 463 TRP 463 469 469 TRP TRP A . n 
C 3 464 VAL 464 470 470 VAL VAL A . n 
C 3 465 GLN 465 471 471 GLN GLN A . n 
C 3 466 ALA 466 472 472 ALA ALA A . n 
C 3 467 GLY 467 473 473 GLY GLY A . n 
C 3 468 ILE 468 474 474 ILE ILE A . n 
C 3 469 ASP 469 475 475 ASP ASP A . n 
C 3 470 ALA 470 476 476 ALA ALA A . n 
C 3 471 SER 471 477 477 SER SER A . n 
C 3 472 GLY 472 478 478 GLY GLY A . n 
C 3 473 LEU 473 479 479 LEU LEU A . n 
C 3 474 GLU 474 480 480 GLU GLU A . n 
C 3 475 LEU 475 481 481 LEU LEU A . n 
C 3 476 ARG 476 482 482 ARG ARG A . n 
C 3 477 CYS 477 483 483 CYS CYS A . n 
C 3 478 LEU 478 484 484 LEU LEU A . n 
C 3 479 ALA 479 485 485 ALA ALA A . n 
C 3 480 HIS 480 486 486 HIS HIS A . n 
C 3 481 PHE 481 487 487 PHE PHE A . n 
C 3 482 MET 482 488 488 MET MET A . n 
C 3 483 ALA 483 489 489 ALA ALA A . n 
C 3 484 ARG 484 490 490 ARG ARG A . n 
C 3 485 PHE 485 491 491 PHE PHE A . n 
C 3 486 ASP 486 492 492 ASP ASP A . n 
C 3 487 ASN 487 493 493 ASN ASN A . n 
C 3 488 GLY 488 494 494 GLY GLY A . n 
C 3 489 GLU 489 495 495 GLU GLU A . n 
C 3 490 TYR 490 496 496 TYR TYR A . n 
C 3 491 ALA 491 497 497 ALA ALA A . n 
C 3 492 HIS 492 498 498 HIS HIS A . n 
C 3 493 GLU 493 499 499 GLU GLU A . n 
C 3 494 ILE 494 500 500 ILE ILE A . n 
C 3 495 LEU 495 501 501 LEU LEU A . n 
C 3 496 ASN 496 502 502 ASN ASN A . n 
C 3 497 GLY 497 503 503 GLY GLY A . n 
C 3 498 ASP 498 504 504 ASP ASP A . n 
C 3 499 ILE 499 505 505 ILE ILE A . n 
C 3 500 HIS 500 506 506 HIS HIS A . n 
C 3 501 THR 501 507 507 THR THR A . n 
C 3 502 LYS 502 508 508 LYS LYS A . n 
C 3 503 ASN 503 509 509 ASN ASN A . n 
C 3 504 GLN 504 510 510 GLN GLN A . n 
C 3 505 ILE 505 511 511 ILE ILE A . n 
C 3 506 ALA 506 512 512 ALA ALA A . n 
C 3 507 ALA 507 513 513 ALA ALA A . n 
C 3 508 GLU 508 514 514 GLU GLU A . n 
C 3 509 LEU 509 515 515 LEU LEU A . n 
C 3 510 PRO 510 516 516 PRO PRO A . n 
C 3 511 THR 511 517 517 THR THR A . n 
C 3 512 ARG 512 518 518 ARG ARG A . n 
C 3 513 ASP 513 519 519 ASP ASP A . n 
C 3 514 ASN 514 520 520 ASN ASN A . n 
C 3 515 ALA 515 521 521 ALA ALA A . n 
C 3 516 LYS 516 522 522 LYS LYS A . n 
C 3 517 THR 517 523 523 THR THR A . n 
C 3 518 PHE 518 524 524 PHE PHE A . n 
C 3 519 ILE 519 525 525 ILE ILE A . n 
C 3 520 TYR 520 526 526 TYR TYR A . n 
C 3 521 GLY 521 527 527 GLY GLY A . n 
C 3 522 PHE 522 528 528 PHE PHE A . n 
C 3 523 LEU 523 529 529 LEU LEU A . n 
C 3 524 TYR 524 530 530 TYR TYR A . n 
C 3 525 GLY 525 531 531 GLY GLY A . n 
C 3 526 ALA 526 532 532 ALA ALA A . n 
C 3 527 GLY 527 533 533 GLY GLY A . n 
C 3 528 ASP 528 534 534 ASP ASP A . n 
C 3 529 GLU 529 535 535 GLU GLU A . n 
C 3 530 LYS 530 536 536 LYS LYS A . n 
C 3 531 ILE 531 537 537 ILE ILE A . n 
C 3 532 GLY 532 538 538 GLY GLY A . n 
C 3 533 GLN 533 539 539 GLN GLN A . n 
C 3 534 ILE 534 540 540 ILE ILE A . n 
C 3 535 VAL 535 541 541 VAL VAL A . n 
C 3 536 GLY 536 542 542 GLY GLY A . n 
C 3 537 ALA 537 543 543 ALA ALA A . n 
C 3 538 GLY 538 544 544 GLY GLY A . n 
C 3 539 LYS 539 545 545 LYS LYS A . n 
C 3 540 GLU 540 546 546 GLU GLU A . n 
C 3 541 ARG 541 547 547 ARG ARG A . n 
C 3 542 GLY 542 548 548 GLY GLY A . n 
C 3 543 LYS 543 549 549 LYS LYS A . n 
C 3 544 GLU 544 550 550 GLU GLU A . n 
C 3 545 LEU 545 551 551 LEU LEU A . n 
C 3 546 LYS 546 552 552 LYS LYS A . n 
C 3 547 LYS 547 553 553 LYS LYS A . n 
C 3 548 LYS 548 554 554 LYS LYS A . n 
C 3 549 PHE 549 555 555 PHE PHE A . n 
C 3 550 LEU 550 556 556 LEU LEU A . n 
C 3 551 GLU 551 557 557 GLU GLU A . n 
C 3 552 ASN 552 558 558 ASN ASN A . n 
C 3 553 THR 553 559 559 THR THR A . n 
C 3 554 PRO 554 560 560 PRO PRO A . n 
C 3 555 ALA 555 561 561 ALA ALA A . n 
C 3 556 ILE 556 562 562 ILE ILE A . n 
C 3 557 ALA 557 563 563 ALA ALA A . n 
C 3 558 ALA 558 564 564 ALA ALA A . n 
C 3 559 LEU 559 565 565 LEU LEU A . n 
C 3 560 ARG 560 566 566 ARG ARG A . n 
C 3 561 GLU 561 567 567 GLU GLU A . n 
C 3 562 SER 562 568 568 SER SER A . n 
C 3 563 ILE 563 569 569 ILE ILE A . n 
C 3 564 GLN 564 570 570 GLN GLN A . n 
C 3 565 GLN 565 571 571 GLN GLN A . n 
C 3 566 THR 566 572 572 THR THR A . n 
C 3 567 LEU 567 573 573 LEU LEU A . n 
C 3 568 VAL 568 574 574 VAL VAL A . n 
C 3 569 GLU 569 575 575 GLU GLU A . n 
C 3 570 SER 570 576 576 SER SER A . n 
C 3 571 SER 571 577 577 SER SER A . n 
C 3 572 GLN 572 578 ?   ?   ?   A . n 
C 3 573 TRP 573 579 ?   ?   ?   A . n 
C 3 574 VAL 574 580 ?   ?   ?   A . n 
C 3 575 ALA 575 581 ?   ?   ?   A . n 
C 3 576 GLY 576 582 ?   ?   ?   A . n 
C 3 577 GLU 577 583 ?   ?   ?   A . n 
C 3 578 GLN 578 584 584 GLN GLN A . n 
C 3 579 GLN 579 585 585 GLN GLN A . n 
C 3 580 VAL 580 586 586 VAL VAL A . n 
C 3 581 LYS 581 587 587 LYS LYS A . n 
C 3 582 TRP 582 588 588 TRP TRP A . n 
C 3 583 LYS 583 589 589 LYS LYS A . n 
C 3 584 ARG 584 590 590 ARG ARG A . n 
C 3 585 ARG 585 591 591 ARG ARG A . n 
C 3 586 TRP 586 592 592 TRP TRP A . n 
C 3 587 ILE 587 593 593 ILE ILE A . n 
C 3 588 LYS 588 594 594 LYS LYS A . n 
C 3 589 GLY 589 595 595 GLY GLY A . n 
C 3 590 LEU 590 596 596 LEU LEU A . n 
C 3 591 ASP 591 597 597 ASP ASP A . n 
C 3 592 GLY 592 598 598 GLY GLY A . n 
C 3 593 ARG 593 599 599 ARG ARG A . n 
C 3 594 LYS 594 600 600 LYS LYS A . n 
C 3 595 VAL 595 601 601 VAL VAL A . n 
C 3 596 HIS 596 602 602 HIS HIS A . n 
C 3 597 VAL 597 603 603 VAL VAL A . n 
C 3 598 ARG 598 604 604 ARG ARG A . n 
C 3 599 SER 599 605 605 SER SER A . n 
C 3 600 PRO 600 606 606 PRO PRO A . n 
C 3 601 HIS 601 607 607 HIS HIS A . n 
C 3 602 ALA 602 608 608 ALA ALA A . n 
C 3 603 ALA 603 609 609 ALA ALA A . n 
C 3 604 LEU 604 610 610 LEU LEU A . n 
C 3 605 ASN 605 611 611 ASN ASN A . n 
C 3 606 THR 606 612 612 THR THR A . n 
C 3 607 LEU 607 613 613 LEU LEU A . n 
C 3 608 LEU 608 614 614 LEU LEU A . n 
C 3 609 GLN 609 615 615 GLN GLN A . n 
C 3 610 SER 610 616 616 SER SER A . n 
C 3 611 ALA 611 617 617 ALA ALA A . n 
C 3 612 GLY 612 618 618 GLY GLY A . n 
C 3 613 ALA 613 619 619 ALA ALA A . n 
C 3 614 LEU 614 620 620 LEU LEU A . n 
C 3 615 ILE 615 621 621 ILE ILE A . n 
C 3 616 CYS 616 622 622 CYS CYS A . n 
C 3 617 LYS 617 623 623 LYS LYS A . n 
C 3 618 LEU 618 624 624 LEU LEU A . n 
C 3 619 TRP 619 625 625 TRP TRP A . n 
C 3 620 ILE 620 626 626 ILE ILE A . n 
C 3 621 ILE 621 627 627 ILE ILE A . n 
C 3 622 LYS 622 628 628 LYS LYS A . n 
C 3 623 THR 623 629 629 THR THR A . n 
C 3 624 GLU 624 630 630 GLU GLU A . n 
C 3 625 GLU 625 631 631 GLU GLU A . n 
C 3 626 MET 626 632 632 MET MET A . n 
C 3 627 LEU 627 633 633 LEU LEU A . n 
C 3 628 VAL 628 634 634 VAL VAL A . n 
C 3 629 GLU 629 635 635 GLU GLU A . n 
C 3 630 LYS 630 636 636 LYS LYS A . n 
C 3 631 GLY 631 637 637 GLY GLY A . n 
C 3 632 LEU 632 638 638 LEU LEU A . n 
C 3 633 LYS 633 639 639 LYS LYS A . n 
C 3 634 HIS 634 640 640 HIS HIS A . n 
C 3 635 GLY 635 641 641 GLY GLY A . n 
C 3 636 TRP 636 642 642 TRP TRP A . n 
C 3 637 ASP 637 643 643 ASP ASP A . n 
C 3 638 GLY 638 644 644 GLY GLY A . n 
C 3 639 ASP 639 645 645 ASP ASP A . n 
C 3 640 PHE 640 646 646 PHE PHE A . n 
C 3 641 ALA 641 647 647 ALA ALA A . n 
C 3 642 TYR 642 648 648 TYR TYR A . n 
C 3 643 MET 643 649 649 MET MET A . n 
C 3 644 ALA 644 650 650 ALA ALA A . n 
C 3 645 TRP 645 651 651 TRP TRP A . n 
C 3 646 VAL 646 652 652 VAL VAL A . n 
C 3 647 HIS 647 653 653 HIS HIS A . n 
C 3 648 ASP 648 654 654 ASP ASP A . n 
C 3 649 GLU 649 655 655 GLU GLU A . n 
C 3 650 ILE 650 656 656 ILE ILE A . n 
C 3 651 GLN 651 657 657 GLN GLN A . n 
C 3 652 VAL 652 658 658 VAL VAL A . n 
C 3 653 GLY 653 659 659 GLY GLY A . n 
C 3 654 CYS 654 660 660 CYS CYS A . n 
C 3 655 ARG 655 661 661 ARG ARG A . n 
C 3 656 THR 656 662 662 THR THR A . n 
C 3 657 GLU 657 663 663 GLU GLU A . n 
C 3 658 GLU 658 664 664 GLU GLU A . n 
C 3 659 ILE 659 665 665 ILE ILE A . n 
C 3 660 ALA 660 666 666 ALA ALA A . n 
C 3 661 GLN 661 667 667 GLN GLN A . n 
C 3 662 VAL 662 668 668 VAL VAL A . n 
C 3 663 VAL 663 669 669 VAL VAL A . n 
C 3 664 ILE 664 670 670 ILE ILE A . n 
C 3 665 GLU 665 671 671 GLU GLU A . n 
C 3 666 THR 666 672 672 THR THR A . n 
C 3 667 ALA 667 673 673 ALA ALA A . n 
C 3 668 GLN 668 674 674 GLN GLN A . n 
C 3 669 GLU 669 675 675 GLU GLU A . n 
C 3 670 ALA 670 676 676 ALA ALA A . n 
C 3 671 MET 671 677 677 MET MET A . n 
C 3 672 ARG 672 678 678 ARG ARG A . n 
C 3 673 TRP 673 679 679 TRP TRP A . n 
C 3 674 VAL 674 680 680 VAL VAL A . n 
C 3 675 GLY 675 681 681 GLY GLY A . n 
C 3 676 ASP 676 682 682 ASP ASP A . n 
C 3 677 HIS 677 683 683 HIS HIS A . n 
C 3 678 TRP 678 684 684 TRP TRP A . n 
C 3 679 ASN 679 685 685 ASN ASN A . n 
C 3 680 PHE 680 686 686 PHE PHE A . n 
C 3 681 ARG 681 687 687 ARG ARG A . n 
C 3 682 CYS 682 688 688 CYS CYS A . n 
C 3 683 LEU 683 689 689 LEU LEU A . n 
C 3 684 LEU 684 690 690 LEU LEU A . n 
C 3 685 ASP 685 691 691 ASP ASP A . n 
C 3 686 THR 686 692 692 THR THR A . n 
C 3 687 GLU 687 693 693 GLU GLU A . n 
C 3 688 GLY 688 694 694 GLY GLY A . n 
C 3 689 LYS 689 695 695 LYS LYS A . n 
C 3 690 MET 690 696 696 MET MET A . n 
C 3 691 GLY 691 697 697 GLY GLY A . n 
C 3 692 PRO 692 698 698 PRO PRO A . n 
C 3 693 ASN 693 699 699 ASN ASN A . n 
C 3 694 TRP 694 700 700 TRP TRP A . n 
C 3 695 ALA 695 701 701 ALA ALA A . n 
C 3 696 ILE 696 702 702 ILE ILE A . n 
C 3 697 CYS 697 703 703 CYS CYS A . n 
C 3 698 HIS 698 704 704 HIS HIS A . n 
D 4 1   SER 1   1   ?   ?   ?   B . n 
D 4 2   ASP 2   2   ?   ?   ?   B . n 
D 4 3   LYS 3   3   3   LYS LYS B . n 
D 4 4   ILE 4   4   4   ILE ILE B . n 
D 4 5   ILE 5   5   5   ILE ILE B . n 
D 4 6   HIS 6   6   6   HIS HIS B . n 
D 4 7   LEU 7   7   7   LEU LEU B . n 
D 4 8   THR 8   8   8   THR THR B . n 
D 4 9   ASP 9   9   9   ASP ASP B . n 
D 4 10  ASP 10  10  10  ASP ASP B . n 
D 4 11  SER 11  11  11  SER SER B . n 
D 4 12  PHE 12  12  12  PHE PHE B . n 
D 4 13  ASP 13  13  13  ASP ASP B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  LEU 17  17  17  LEU LEU B . n 
D 4 18  LYS 18  18  18  LYS LYS B . n 
D 4 19  ALA 19  19  19  ALA ALA B . n 
D 4 20  ASP 20  20  20  ASP ASP B . n 
D 4 21  GLY 21  21  21  GLY GLY B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  ILE 23  23  23  ILE ILE B . n 
D 4 24  LEU 24  24  24  LEU LEU B . n 
D 4 25  VAL 25  25  25  VAL VAL B . n 
D 4 26  ASP 26  26  26  ASP ASP B . n 
D 4 27  PHE 27  27  27  PHE PHE B . n 
D 4 28  TRP 28  28  28  TRP TRP B . n 
D 4 29  ALA 29  29  29  ALA ALA B . n 
D 4 30  GLU 30  30  30  GLU GLU B . n 
D 4 31  TRP 31  31  31  TRP TRP B . n 
D 4 32  CYS 32  32  32  CYS CYS B . n 
D 4 33  GLY 33  33  33  GLY GLY B . n 
D 4 34  PRO 34  34  34  PRO PRO B . n 
D 4 35  CYS 35  35  35  CYS CYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  MET 37  37  37  MET MET B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  ALA 39  39  39  ALA ALA B . n 
D 4 40  PRO 40  40  40  PRO PRO B . n 
D 4 41  ILE 41  41  41  ILE ILE B . n 
D 4 42  LEU 42  42  42  LEU LEU B . n 
D 4 43  ASP 43  43  43  ASP ASP B . n 
D 4 44  GLU 44  44  44  GLU GLU B . n 
D 4 45  ILE 45  45  45  ILE ILE B . n 
D 4 46  ALA 46  46  46  ALA ALA B . n 
D 4 47  ASP 47  47  47  ASP ASP B . n 
D 4 48  GLU 48  48  48  GLU GLU B . n 
D 4 49  TYR 49  49  49  TYR TYR B . n 
D 4 50  GLN 50  50  50  GLN GLN B . n 
D 4 51  GLY 51  51  51  GLY GLY B . n 
D 4 52  LYS 52  52  52  LYS LYS B . n 
D 4 53  LEU 53  53  53  LEU LEU B . n 
D 4 54  THR 54  54  54  THR THR B . n 
D 4 55  VAL 55  55  55  VAL VAL B . n 
D 4 56  ALA 56  56  56  ALA ALA B . n 
D 4 57  LYS 57  57  57  LYS LYS B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  ASN 59  59  59  ASN ASN B . n 
D 4 60  ILE 60  60  60  ILE ILE B . n 
D 4 61  ASP 61  61  61  ASP ASP B . n 
D 4 62  GLN 62  62  62  GLN GLN B . n 
D 4 63  ASN 63  63  63  ASN ASN B . n 
D 4 64  PRO 64  64  64  PRO PRO B . n 
D 4 65  GLY 65  65  65  GLY GLY B . n 
D 4 66  THR 66  66  66  THR THR B . n 
D 4 67  ALA 67  67  67  ALA ALA B . n 
D 4 68  PRO 68  68  68  PRO PRO B . n 
D 4 69  LYS 69  69  69  LYS LYS B . n 
D 4 70  TYR 70  70  70  TYR TYR B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ILE 72  72  72  ILE ILE B . n 
D 4 73  ARG 73  73  73  ARG ARG B . n 
D 4 74  GLY 74  74  74  GLY GLY B . n 
D 4 75  ILE 75  75  75  ILE ILE B . n 
D 4 76  PRO 76  76  76  PRO PRO B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  LEU 78  78  78  LEU LEU B . n 
D 4 79  LEU 79  79  79  LEU LEU B . n 
D 4 80  LEU 80  80  80  LEU LEU B . n 
D 4 81  PHE 81  81  81  PHE PHE B . n 
D 4 82  LYS 82  82  82  LYS LYS B . n 
D 4 83  ASN 83  83  83  ASN ASN B . n 
D 4 84  GLY 84  84  84  GLY GLY B . n 
D 4 85  GLU 85  85  85  GLU GLU B . n 
D 4 86  VAL 86  86  86  VAL VAL B . n 
D 4 87  ALA 87  87  87  ALA ALA B . n 
D 4 88  ALA 88  88  88  ALA ALA B . n 
D 4 89  THR 89  89  89  THR THR B . n 
D 4 90  LYS 90  90  90  LYS LYS B . n 
D 4 91  VAL 91  91  91  VAL VAL B . n 
D 4 92  GLY 92  92  92  GLY GLY B . n 
D 4 93  ALA 93  93  93  ALA ALA B . n 
D 4 94  LEU 94  94  94  LEU LEU B . n 
D 4 95  SER 95  95  95  SER SER B . n 
D 4 96  LYS 96  96  96  LYS LYS B . n 
D 4 97  GLY 97  97  97  GLY GLY B . n 
D 4 98  GLN 98  98  98  GLN GLN B . n 
D 4 99  LEU 99  99  99  LEU LEU B . n 
D 4 100 LYS 100 100 100 LYS LYS B . n 
D 4 101 GLU 101 101 101 GLU GLU B . n 
D 4 102 PHE 102 102 102 PHE PHE B . n 
D 4 103 LEU 103 103 103 LEU LEU B . n 
D 4 104 ASP 104 104 104 ASP ASP B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASN 106 106 106 ASN ASN B . n 
D 4 107 LEU 107 107 107 LEU LEU B . n 
D 4 108 ALA 108 108 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  MG  1   904  904  MG  MG2 T . 
F 5  MG  1   901  901  MG  MG2 A . 
G 5  MG  1   902  902  MG  MG2 A . 
H 5  MG  1   903  903  MG  MG2 A . 
I 6  SO4 1   905  905  SO4 SO4 A . 
J 6  SO4 1   906  906  SO4 SO4 A . 
K 7  D3T 1   823  823  D3T DT3 A . 
L 8  MES 1   991  991  MES MES A . 
M 9  1PE 1   992  992  1PE 1PE A . 
N 10 HOH 1   1069 1069 HOH HOH P . 
N 10 HOH 2   1092 1092 HOH HOH P . 
N 10 HOH 3   1118 1118 HOH HOH P . 
N 10 HOH 4   1160 1160 HOH HOH P . 
N 10 HOH 5   1187 1187 HOH HOH P . 
N 10 HOH 6   1206 1206 HOH HOH P . 
N 10 HOH 7   1243 1243 HOH HOH P . 
N 10 HOH 8   1253 1253 HOH HOH P . 
N 10 HOH 9   1258 1258 HOH HOH P . 
N 10 HOH 10  1260 1260 HOH HOH P . 
N 10 HOH 11  1279 1279 HOH HOH P . 
N 10 HOH 12  1289 1289 HOH HOH P . 
N 10 HOH 13  1329 1329 HOH HOH P . 
N 10 HOH 14  1349 1349 HOH HOH P . 
N 10 HOH 15  1372 1372 HOH HOH P . 
N 10 HOH 16  1376 1376 HOH HOH P . 
N 10 HOH 17  1421 1421 HOH HOH P . 
N 10 HOH 18  1430 1430 HOH HOH P . 
N 10 HOH 19  1433 1433 HOH HOH P . 
N 10 HOH 20  1490 1490 HOH HOH P . 
N 10 HOH 21  1507 1507 HOH HOH P . 
N 10 HOH 22  1511 1511 HOH HOH P . 
N 10 HOH 23  1513 1513 HOH HOH P . 
N 10 HOH 24  1542 1542 HOH HOH P . 
N 10 HOH 25  1547 1547 HOH HOH P . 
O 10 HOH 1   1005 1005 HOH HOH T . 
O 10 HOH 2   1010 1010 HOH HOH T . 
O 10 HOH 3   1024 1024 HOH HOH T . 
O 10 HOH 4   1070 1070 HOH HOH T . 
O 10 HOH 5   1073 1073 HOH HOH T . 
O 10 HOH 6   1084 1084 HOH HOH T . 
O 10 HOH 7   1086 1086 HOH HOH T . 
O 10 HOH 8   1144 1144 HOH HOH T . 
O 10 HOH 9   1146 1146 HOH HOH T . 
O 10 HOH 10  1188 1188 HOH HOH T . 
O 10 HOH 11  1193 1193 HOH HOH T . 
O 10 HOH 12  1200 1200 HOH HOH T . 
O 10 HOH 13  1202 1202 HOH HOH T . 
O 10 HOH 14  1221 1221 HOH HOH T . 
O 10 HOH 15  1222 1222 HOH HOH T . 
O 10 HOH 16  1236 1236 HOH HOH T . 
O 10 HOH 17  1246 1246 HOH HOH T . 
O 10 HOH 18  1257 1257 HOH HOH T . 
O 10 HOH 19  1268 1268 HOH HOH T . 
O 10 HOH 20  1270 1270 HOH HOH T . 
O 10 HOH 21  1291 1291 HOH HOH T . 
O 10 HOH 22  1300 1300 HOH HOH T . 
O 10 HOH 23  1338 1338 HOH HOH T . 
O 10 HOH 24  1352 1352 HOH HOH T . 
O 10 HOH 25  1362 1362 HOH HOH T . 
O 10 HOH 26  1379 1379 HOH HOH T . 
O 10 HOH 27  1387 1387 HOH HOH T . 
O 10 HOH 28  1388 1388 HOH HOH T . 
O 10 HOH 29  1406 1406 HOH HOH T . 
O 10 HOH 30  1416 1416 HOH HOH T . 
O 10 HOH 31  1442 1442 HOH HOH T . 
O 10 HOH 32  1443 1443 HOH HOH T . 
O 10 HOH 33  1456 1456 HOH HOH T . 
O 10 HOH 34  1461 1461 HOH HOH T . 
O 10 HOH 35  1487 1487 HOH HOH T . 
O 10 HOH 36  1488 1488 HOH HOH T . 
O 10 HOH 37  1489 1489 HOH HOH T . 
O 10 HOH 38  1510 1510 HOH HOH T . 
O 10 HOH 39  1512 1512 HOH HOH T . 
O 10 HOH 40  1517 1517 HOH HOH T . 
O 10 HOH 41  1540 1540 HOH HOH T . 
P 10 HOH 1   1001 1001 HOH HOH A . 
P 10 HOH 2   1002 1002 HOH HOH A . 
P 10 HOH 3   1004 1004 HOH HOH A . 
P 10 HOH 4   1006 1006 HOH HOH A . 
P 10 HOH 5   1007 1007 HOH HOH A . 
P 10 HOH 6   1008 1008 HOH HOH A . 
P 10 HOH 7   1009 1009 HOH HOH A . 
P 10 HOH 8   1011 1011 HOH HOH A . 
P 10 HOH 9   1012 1012 HOH HOH A . 
P 10 HOH 10  1013 1013 HOH HOH A . 
P 10 HOH 11  1014 1014 HOH HOH A . 
P 10 HOH 12  1015 1015 HOH HOH A . 
P 10 HOH 13  1016 1016 HOH HOH A . 
P 10 HOH 14  1017 1017 HOH HOH A . 
P 10 HOH 15  1018 1018 HOH HOH A . 
P 10 HOH 16  1020 1020 HOH HOH A . 
P 10 HOH 17  1022 1022 HOH HOH A . 
P 10 HOH 18  1023 1023 HOH HOH A . 
P 10 HOH 19  1025 1025 HOH HOH A . 
P 10 HOH 20  1026 1026 HOH HOH A . 
P 10 HOH 21  1027 1027 HOH HOH A . 
P 10 HOH 22  1028 1028 HOH HOH A . 
P 10 HOH 23  1029 1029 HOH HOH A . 
P 10 HOH 24  1030 1030 HOH HOH A . 
P 10 HOH 25  1031 1031 HOH HOH A . 
P 10 HOH 26  1032 1032 HOH HOH A . 
P 10 HOH 27  1034 1034 HOH HOH A . 
P 10 HOH 28  1035 1035 HOH HOH A . 
P 10 HOH 29  1036 1036 HOH HOH A . 
P 10 HOH 30  1037 1037 HOH HOH A . 
P 10 HOH 31  1038 1038 HOH HOH A . 
P 10 HOH 32  1039 1039 HOH HOH A . 
P 10 HOH 33  1040 1040 HOH HOH A . 
P 10 HOH 34  1041 1041 HOH HOH A . 
P 10 HOH 35  1042 1042 HOH HOH A . 
P 10 HOH 36  1043 1043 HOH HOH A . 
P 10 HOH 37  1045 1045 HOH HOH A . 
P 10 HOH 38  1046 1046 HOH HOH A . 
P 10 HOH 39  1047 1047 HOH HOH A . 
P 10 HOH 40  1048 1048 HOH HOH A . 
P 10 HOH 41  1049 1049 HOH HOH A . 
P 10 HOH 42  1050 1050 HOH HOH A . 
P 10 HOH 43  1051 1051 HOH HOH A . 
P 10 HOH 44  1052 1052 HOH HOH A . 
P 10 HOH 45  1053 1053 HOH HOH A . 
P 10 HOH 46  1054 1054 HOH HOH A . 
P 10 HOH 47  1055 1055 HOH HOH A . 
P 10 HOH 48  1056 1056 HOH HOH A . 
P 10 HOH 49  1057 1057 HOH HOH A . 
P 10 HOH 50  1058 1058 HOH HOH A . 
P 10 HOH 51  1059 1059 HOH HOH A . 
P 10 HOH 52  1061 1061 HOH HOH A . 
P 10 HOH 53  1062 1062 HOH HOH A . 
P 10 HOH 54  1063 1063 HOH HOH A . 
P 10 HOH 55  1065 1065 HOH HOH A . 
P 10 HOH 56  1066 1066 HOH HOH A . 
P 10 HOH 57  1067 1067 HOH HOH A . 
P 10 HOH 58  1068 1068 HOH HOH A . 
P 10 HOH 59  1071 1071 HOH HOH A . 
P 10 HOH 60  1072 1072 HOH HOH A . 
P 10 HOH 61  1074 1074 HOH HOH A . 
P 10 HOH 62  1075 1075 HOH HOH A . 
P 10 HOH 63  1076 1076 HOH HOH A . 
P 10 HOH 64  1077 1077 HOH HOH A . 
P 10 HOH 65  1078 1078 HOH HOH A . 
P 10 HOH 66  1079 1079 HOH HOH A . 
P 10 HOH 67  1080 1080 HOH HOH A . 
P 10 HOH 68  1081 1081 HOH HOH A . 
P 10 HOH 69  1082 1082 HOH HOH A . 
P 10 HOH 70  1083 1083 HOH HOH A . 
P 10 HOH 71  1085 1085 HOH HOH A . 
P 10 HOH 72  1087 1087 HOH HOH A . 
P 10 HOH 73  1088 1088 HOH HOH A . 
P 10 HOH 74  1089 1089 HOH HOH A . 
P 10 HOH 75  1090 1090 HOH HOH A . 
P 10 HOH 76  1091 1091 HOH HOH A . 
P 10 HOH 77  1094 1094 HOH HOH A . 
P 10 HOH 78  1095 1095 HOH HOH A . 
P 10 HOH 79  1096 1096 HOH HOH A . 
P 10 HOH 80  1097 1097 HOH HOH A . 
P 10 HOH 81  1098 1098 HOH HOH A . 
P 10 HOH 82  1100 1100 HOH HOH A . 
P 10 HOH 83  1101 1101 HOH HOH A . 
P 10 HOH 84  1102 1102 HOH HOH A . 
P 10 HOH 85  1103 1103 HOH HOH A . 
P 10 HOH 86  1104 1104 HOH HOH A . 
P 10 HOH 87  1105 1105 HOH HOH A . 
P 10 HOH 88  1106 1106 HOH HOH A . 
P 10 HOH 89  1107 1107 HOH HOH A . 
P 10 HOH 90  1108 1108 HOH HOH A . 
P 10 HOH 91  1109 1109 HOH HOH A . 
P 10 HOH 92  1110 1110 HOH HOH A . 
P 10 HOH 93  1111 1111 HOH HOH A . 
P 10 HOH 94  1112 1112 HOH HOH A . 
P 10 HOH 95  1113 1113 HOH HOH A . 
P 10 HOH 96  1114 1114 HOH HOH A . 
P 10 HOH 97  1116 1116 HOH HOH A . 
P 10 HOH 98  1117 1117 HOH HOH A . 
P 10 HOH 99  1120 1120 HOH HOH A . 
P 10 HOH 100 1121 1121 HOH HOH A . 
P 10 HOH 101 1122 1122 HOH HOH A . 
P 10 HOH 102 1123 1123 HOH HOH A . 
P 10 HOH 103 1124 1124 HOH HOH A . 
P 10 HOH 104 1125 1125 HOH HOH A . 
P 10 HOH 105 1126 1126 HOH HOH A . 
P 10 HOH 106 1127 1127 HOH HOH A . 
P 10 HOH 107 1128 1128 HOH HOH A . 
P 10 HOH 108 1129 1129 HOH HOH A . 
P 10 HOH 109 1130 1130 HOH HOH A . 
P 10 HOH 110 1131 1131 HOH HOH A . 
P 10 HOH 111 1132 1132 HOH HOH A . 
P 10 HOH 112 1133 1133 HOH HOH A . 
P 10 HOH 113 1134 1134 HOH HOH A . 
P 10 HOH 114 1135 1135 HOH HOH A . 
P 10 HOH 115 1137 1137 HOH HOH A . 
P 10 HOH 116 1138 1138 HOH HOH A . 
P 10 HOH 117 1139 1139 HOH HOH A . 
P 10 HOH 118 1140 1140 HOH HOH A . 
P 10 HOH 119 1142 1142 HOH HOH A . 
P 10 HOH 120 1143 1143 HOH HOH A . 
P 10 HOH 121 1145 1145 HOH HOH A . 
P 10 HOH 122 1147 1147 HOH HOH A . 
P 10 HOH 123 1148 1148 HOH HOH A . 
P 10 HOH 124 1149 1149 HOH HOH A . 
P 10 HOH 125 1150 1150 HOH HOH A . 
P 10 HOH 126 1151 1151 HOH HOH A . 
P 10 HOH 127 1152 1152 HOH HOH A . 
P 10 HOH 128 1153 1153 HOH HOH A . 
P 10 HOH 129 1154 1154 HOH HOH A . 
P 10 HOH 130 1155 1155 HOH HOH A . 
P 10 HOH 131 1156 1156 HOH HOH A . 
P 10 HOH 132 1157 1157 HOH HOH A . 
P 10 HOH 133 1158 1158 HOH HOH A . 
P 10 HOH 134 1159 1159 HOH HOH A . 
P 10 HOH 135 1161 1161 HOH HOH A . 
P 10 HOH 136 1162 1162 HOH HOH A . 
P 10 HOH 137 1163 1163 HOH HOH A . 
P 10 HOH 138 1164 1164 HOH HOH A . 
P 10 HOH 139 1165 1165 HOH HOH A . 
P 10 HOH 140 1166 1166 HOH HOH A . 
P 10 HOH 141 1167 1167 HOH HOH A . 
P 10 HOH 142 1169 1169 HOH HOH A . 
P 10 HOH 143 1170 1170 HOH HOH A . 
P 10 HOH 144 1171 1171 HOH HOH A . 
P 10 HOH 145 1172 1172 HOH HOH A . 
P 10 HOH 146 1173 1173 HOH HOH A . 
P 10 HOH 147 1174 1174 HOH HOH A . 
P 10 HOH 148 1175 1175 HOH HOH A . 
P 10 HOH 149 1176 1176 HOH HOH A . 
P 10 HOH 150 1177 1177 HOH HOH A . 
P 10 HOH 151 1178 1178 HOH HOH A . 
P 10 HOH 152 1179 1179 HOH HOH A . 
P 10 HOH 153 1180 1180 HOH HOH A . 
P 10 HOH 154 1181 1181 HOH HOH A . 
P 10 HOH 155 1182 1182 HOH HOH A . 
P 10 HOH 156 1183 1183 HOH HOH A . 
P 10 HOH 157 1184 1184 HOH HOH A . 
P 10 HOH 158 1185 1185 HOH HOH A . 
P 10 HOH 159 1186 1186 HOH HOH A . 
P 10 HOH 160 1189 1189 HOH HOH A . 
P 10 HOH 161 1190 1190 HOH HOH A . 
P 10 HOH 162 1191 1191 HOH HOH A . 
P 10 HOH 163 1192 1192 HOH HOH A . 
P 10 HOH 164 1194 1194 HOH HOH A . 
P 10 HOH 165 1195 1195 HOH HOH A . 
P 10 HOH 166 1197 1197 HOH HOH A . 
P 10 HOH 167 1201 1201 HOH HOH A . 
P 10 HOH 168 1203 1203 HOH HOH A . 
P 10 HOH 169 1204 1204 HOH HOH A . 
P 10 HOH 170 1205 1205 HOH HOH A . 
P 10 HOH 171 1207 1207 HOH HOH A . 
P 10 HOH 172 1208 1208 HOH HOH A . 
P 10 HOH 173 1209 1209 HOH HOH A . 
P 10 HOH 174 1210 1210 HOH HOH A . 
P 10 HOH 175 1211 1211 HOH HOH A . 
P 10 HOH 176 1212 1212 HOH HOH A . 
P 10 HOH 177 1213 1213 HOH HOH A . 
P 10 HOH 178 1214 1214 HOH HOH A . 
P 10 HOH 179 1215 1215 HOH HOH A . 
P 10 HOH 180 1216 1216 HOH HOH A . 
P 10 HOH 181 1217 1217 HOH HOH A . 
P 10 HOH 182 1218 1218 HOH HOH A . 
P 10 HOH 183 1219 1219 HOH HOH A . 
P 10 HOH 184 1220 1220 HOH HOH A . 
P 10 HOH 185 1223 1223 HOH HOH A . 
P 10 HOH 186 1224 1224 HOH HOH A . 
P 10 HOH 187 1225 1225 HOH HOH A . 
P 10 HOH 188 1226 1226 HOH HOH A . 
P 10 HOH 189 1227 1227 HOH HOH A . 
P 10 HOH 190 1228 1228 HOH HOH A . 
P 10 HOH 191 1229 1229 HOH HOH A . 
P 10 HOH 192 1230 1230 HOH HOH A . 
P 10 HOH 193 1231 1231 HOH HOH A . 
P 10 HOH 194 1232 1232 HOH HOH A . 
P 10 HOH 195 1233 1233 HOH HOH A . 
P 10 HOH 196 1234 1234 HOH HOH A . 
P 10 HOH 197 1235 1235 HOH HOH A . 
P 10 HOH 198 1237 1237 HOH HOH A . 
P 10 HOH 199 1238 1238 HOH HOH A . 
P 10 HOH 200 1239 1239 HOH HOH A . 
P 10 HOH 201 1240 1240 HOH HOH A . 
P 10 HOH 202 1241 1241 HOH HOH A . 
P 10 HOH 203 1242 1242 HOH HOH A . 
P 10 HOH 204 1244 1244 HOH HOH A . 
P 10 HOH 205 1245 1245 HOH HOH A . 
P 10 HOH 206 1247 1247 HOH HOH A . 
P 10 HOH 207 1248 1248 HOH HOH A . 
P 10 HOH 208 1249 1249 HOH HOH A . 
P 10 HOH 209 1250 1250 HOH HOH A . 
P 10 HOH 210 1251 1251 HOH HOH A . 
P 10 HOH 211 1252 1252 HOH HOH A . 
P 10 HOH 212 1256 1256 HOH HOH A . 
P 10 HOH 213 1259 1259 HOH HOH A . 
P 10 HOH 214 1261 1261 HOH HOH A . 
P 10 HOH 215 1262 1262 HOH HOH A . 
P 10 HOH 216 1263 1263 HOH HOH A . 
P 10 HOH 217 1264 1264 HOH HOH A . 
P 10 HOH 218 1265 1265 HOH HOH A . 
P 10 HOH 219 1266 1266 HOH HOH A . 
P 10 HOH 220 1267 1267 HOH HOH A . 
P 10 HOH 221 1269 1269 HOH HOH A . 
P 10 HOH 222 1271 1271 HOH HOH A . 
P 10 HOH 223 1272 1272 HOH HOH A . 
P 10 HOH 224 1273 1273 HOH HOH A . 
P 10 HOH 225 1274 1274 HOH HOH A . 
P 10 HOH 226 1275 1275 HOH HOH A . 
P 10 HOH 227 1276 1276 HOH HOH A . 
P 10 HOH 228 1277 1277 HOH HOH A . 
P 10 HOH 229 1278 1278 HOH HOH A . 
P 10 HOH 230 1280 1280 HOH HOH A . 
P 10 HOH 231 1281 1281 HOH HOH A . 
P 10 HOH 232 1282 1282 HOH HOH A . 
P 10 HOH 233 1283 1283 HOH HOH A . 
P 10 HOH 234 1284 1284 HOH HOH A . 
P 10 HOH 235 1285 1285 HOH HOH A . 
P 10 HOH 236 1286 1286 HOH HOH A . 
P 10 HOH 237 1288 1288 HOH HOH A . 
P 10 HOH 238 1290 1290 HOH HOH A . 
P 10 HOH 239 1292 1292 HOH HOH A . 
P 10 HOH 240 1294 1294 HOH HOH A . 
P 10 HOH 241 1295 1295 HOH HOH A . 
P 10 HOH 242 1296 1296 HOH HOH A . 
P 10 HOH 243 1297 1297 HOH HOH A . 
P 10 HOH 244 1298 1298 HOH HOH A . 
P 10 HOH 245 1299 1299 HOH HOH A . 
P 10 HOH 246 1301 1301 HOH HOH A . 
P 10 HOH 247 1304 1304 HOH HOH A . 
P 10 HOH 248 1306 1306 HOH HOH A . 
P 10 HOH 249 1307 1307 HOH HOH A . 
P 10 HOH 250 1308 1308 HOH HOH A . 
P 10 HOH 251 1309 1309 HOH HOH A . 
P 10 HOH 252 1312 1312 HOH HOH A . 
P 10 HOH 253 1314 1314 HOH HOH A . 
P 10 HOH 254 1316 1316 HOH HOH A . 
P 10 HOH 255 1317 1317 HOH HOH A . 
P 10 HOH 256 1320 1320 HOH HOH A . 
P 10 HOH 257 1322 1322 HOH HOH A . 
P 10 HOH 258 1324 1324 HOH HOH A . 
P 10 HOH 259 1326 1326 HOH HOH A . 
P 10 HOH 260 1328 1328 HOH HOH A . 
P 10 HOH 261 1331 1331 HOH HOH A . 
P 10 HOH 262 1332 1332 HOH HOH A . 
P 10 HOH 263 1333 1333 HOH HOH A . 
P 10 HOH 264 1334 1334 HOH HOH A . 
P 10 HOH 265 1335 1335 HOH HOH A . 
P 10 HOH 266 1336 1336 HOH HOH A . 
P 10 HOH 267 1337 1337 HOH HOH A . 
P 10 HOH 268 1339 1339 HOH HOH A . 
P 10 HOH 269 1340 1340 HOH HOH A . 
P 10 HOH 270 1342 1342 HOH HOH A . 
P 10 HOH 271 1343 1343 HOH HOH A . 
P 10 HOH 272 1344 1344 HOH HOH A . 
P 10 HOH 273 1345 1345 HOH HOH A . 
P 10 HOH 274 1347 1347 HOH HOH A . 
P 10 HOH 275 1348 1348 HOH HOH A . 
P 10 HOH 276 1350 1350 HOH HOH A . 
P 10 HOH 277 1351 1351 HOH HOH A . 
P 10 HOH 278 1353 1353 HOH HOH A . 
P 10 HOH 279 1357 1357 HOH HOH A . 
P 10 HOH 280 1358 1358 HOH HOH A . 
P 10 HOH 281 1359 1359 HOH HOH A . 
P 10 HOH 282 1360 1360 HOH HOH A . 
P 10 HOH 283 1361 1361 HOH HOH A . 
P 10 HOH 284 1363 1363 HOH HOH A . 
P 10 HOH 285 1364 1364 HOH HOH A . 
P 10 HOH 286 1365 1365 HOH HOH A . 
P 10 HOH 287 1367 1367 HOH HOH A . 
P 10 HOH 288 1370 1370 HOH HOH A . 
P 10 HOH 289 1373 1373 HOH HOH A . 
P 10 HOH 290 1374 1374 HOH HOH A . 
P 10 HOH 291 1375 1375 HOH HOH A . 
P 10 HOH 292 1377 1377 HOH HOH A . 
P 10 HOH 293 1381 1381 HOH HOH A . 
P 10 HOH 294 1382 1382 HOH HOH A . 
P 10 HOH 295 1383 1383 HOH HOH A . 
P 10 HOH 296 1384 1384 HOH HOH A . 
P 10 HOH 297 1385 1385 HOH HOH A . 
P 10 HOH 298 1386 1386 HOH HOH A . 
P 10 HOH 299 1389 1389 HOH HOH A . 
P 10 HOH 300 1390 1390 HOH HOH A . 
P 10 HOH 301 1391 1391 HOH HOH A . 
P 10 HOH 302 1392 1392 HOH HOH A . 
P 10 HOH 303 1393 1393 HOH HOH A . 
P 10 HOH 304 1394 1394 HOH HOH A . 
P 10 HOH 305 1395 1395 HOH HOH A . 
P 10 HOH 306 1397 1397 HOH HOH A . 
P 10 HOH 307 1399 1399 HOH HOH A . 
P 10 HOH 308 1400 1400 HOH HOH A . 
P 10 HOH 309 1401 1401 HOH HOH A . 
P 10 HOH 310 1402 1402 HOH HOH A . 
P 10 HOH 311 1403 1403 HOH HOH A . 
P 10 HOH 312 1404 1404 HOH HOH A . 
P 10 HOH 313 1405 1405 HOH HOH A . 
P 10 HOH 314 1407 1407 HOH HOH A . 
P 10 HOH 315 1409 1409 HOH HOH A . 
P 10 HOH 316 1410 1410 HOH HOH A . 
P 10 HOH 317 1411 1411 HOH HOH A . 
P 10 HOH 318 1412 1412 HOH HOH A . 
P 10 HOH 319 1414 1414 HOH HOH A . 
P 10 HOH 320 1418 1418 HOH HOH A . 
P 10 HOH 321 1419 1419 HOH HOH A . 
P 10 HOH 322 1420 1420 HOH HOH A . 
P 10 HOH 323 1422 1422 HOH HOH A . 
P 10 HOH 324 1423 1423 HOH HOH A . 
P 10 HOH 325 1424 1424 HOH HOH A . 
P 10 HOH 326 1425 1425 HOH HOH A . 
P 10 HOH 327 1426 1426 HOH HOH A . 
P 10 HOH 328 1427 1427 HOH HOH A . 
P 10 HOH 329 1428 1428 HOH HOH A . 
P 10 HOH 330 1429 1429 HOH HOH A . 
P 10 HOH 331 1432 1432 HOH HOH A . 
P 10 HOH 332 1435 1435 HOH HOH A . 
P 10 HOH 333 1436 1436 HOH HOH A . 
P 10 HOH 334 1437 1437 HOH HOH A . 
P 10 HOH 335 1438 1438 HOH HOH A . 
P 10 HOH 336 1439 1439 HOH HOH A . 
P 10 HOH 337 1440 1440 HOH HOH A . 
P 10 HOH 338 1441 1441 HOH HOH A . 
P 10 HOH 339 1444 1444 HOH HOH A . 
P 10 HOH 340 1446 1446 HOH HOH A . 
P 10 HOH 341 1447 1447 HOH HOH A . 
P 10 HOH 342 1448 1448 HOH HOH A . 
P 10 HOH 343 1449 1449 HOH HOH A . 
P 10 HOH 344 1450 1450 HOH HOH A . 
P 10 HOH 345 1451 1451 HOH HOH A . 
P 10 HOH 346 1452 1452 HOH HOH A . 
P 10 HOH 347 1455 1455 HOH HOH A . 
P 10 HOH 348 1457 1457 HOH HOH A . 
P 10 HOH 349 1459 1459 HOH HOH A . 
P 10 HOH 350 1460 1460 HOH HOH A . 
P 10 HOH 351 1462 1462 HOH HOH A . 
P 10 HOH 352 1463 1463 HOH HOH A . 
P 10 HOH 353 1464 1464 HOH HOH A . 
P 10 HOH 354 1465 1465 HOH HOH A . 
P 10 HOH 355 1466 1466 HOH HOH A . 
P 10 HOH 356 1467 1467 HOH HOH A . 
P 10 HOH 357 1469 1469 HOH HOH A . 
P 10 HOH 358 1471 1471 HOH HOH A . 
P 10 HOH 359 1472 1472 HOH HOH A . 
P 10 HOH 360 1473 1473 HOH HOH A . 
P 10 HOH 361 1474 1474 HOH HOH A . 
P 10 HOH 362 1475 1475 HOH HOH A . 
P 10 HOH 363 1476 1476 HOH HOH A . 
P 10 HOH 364 1477 1477 HOH HOH A . 
P 10 HOH 365 1478 1478 HOH HOH A . 
P 10 HOH 366 1479 1479 HOH HOH A . 
P 10 HOH 367 1480 1480 HOH HOH A . 
P 10 HOH 368 1482 1482 HOH HOH A . 
P 10 HOH 369 1483 1483 HOH HOH A . 
P 10 HOH 370 1484 1484 HOH HOH A . 
P 10 HOH 371 1486 1486 HOH HOH A . 
P 10 HOH 372 1491 1491 HOH HOH A . 
P 10 HOH 373 1492 1492 HOH HOH A . 
P 10 HOH 374 1493 1493 HOH HOH A . 
P 10 HOH 375 1494 1494 HOH HOH A . 
P 10 HOH 376 1495 1495 HOH HOH A . 
P 10 HOH 377 1496 1496 HOH HOH A . 
P 10 HOH 378 1497 1497 HOH HOH A . 
P 10 HOH 379 1498 1498 HOH HOH A . 
P 10 HOH 380 1499 1499 HOH HOH A . 
P 10 HOH 381 1500 1500 HOH HOH A . 
P 10 HOH 382 1501 1501 HOH HOH A . 
P 10 HOH 383 1502 1502 HOH HOH A . 
P 10 HOH 384 1503 1503 HOH HOH A . 
P 10 HOH 385 1504 1504 HOH HOH A . 
P 10 HOH 386 1505 1505 HOH HOH A . 
P 10 HOH 387 1506 1506 HOH HOH A . 
P 10 HOH 388 1508 1508 HOH HOH A . 
P 10 HOH 389 1509 1509 HOH HOH A . 
P 10 HOH 390 1514 1514 HOH HOH A . 
P 10 HOH 391 1515 1515 HOH HOH A . 
P 10 HOH 392 1516 1516 HOH HOH A . 
P 10 HOH 393 1520 1520 HOH HOH A . 
P 10 HOH 394 1521 1521 HOH HOH A . 
P 10 HOH 395 1522 1522 HOH HOH A . 
P 10 HOH 396 1523 1523 HOH HOH A . 
P 10 HOH 397 1524 1524 HOH HOH A . 
P 10 HOH 398 1525 1525 HOH HOH A . 
P 10 HOH 399 1526 1526 HOH HOH A . 
P 10 HOH 400 1527 1527 HOH HOH A . 
P 10 HOH 401 1528 1528 HOH HOH A . 
P 10 HOH 402 1529 1529 HOH HOH A . 
P 10 HOH 403 1530 1530 HOH HOH A . 
P 10 HOH 404 1531 1531 HOH HOH A . 
P 10 HOH 405 1532 1532 HOH HOH A . 
P 10 HOH 406 1533 1533 HOH HOH A . 
P 10 HOH 407 1534 1534 HOH HOH A . 
P 10 HOH 408 1535 1535 HOH HOH A . 
P 10 HOH 409 1536 1536 HOH HOH A . 
P 10 HOH 410 1537 1537 HOH HOH A . 
P 10 HOH 411 1538 1538 HOH HOH A . 
P 10 HOH 412 1539 1539 HOH HOH A . 
P 10 HOH 413 1541 1541 HOH HOH A . 
P 10 HOH 414 1543 1543 HOH HOH A . 
P 10 HOH 415 1544 1544 HOH HOH A . 
P 10 HOH 416 1545 1545 HOH HOH A . 
P 10 HOH 417 1546 1546 HOH HOH A . 
P 10 HOH 418 1548 1548 HOH HOH A . 
P 10 HOH 419 1549 1549 HOH HOH A . 
P 10 HOH 420 1550 1550 HOH HOH A . 
P 10 HOH 421 1551 1551 HOH HOH A . 
P 10 HOH 422 1552 1552 HOH HOH A . 
P 10 HOH 423 1553 1553 HOH HOH A . 
P 10 HOH 424 1554 1554 HOH HOH A . 
P 10 HOH 425 1555 1555 HOH HOH A . 
P 10 HOH 426 1556 1556 HOH HOH A . 
P 10 HOH 427 1557 1557 HOH HOH A . 
P 10 HOH 428 1558 1558 HOH HOH A . 
P 10 HOH 429 1559 1559 HOH HOH A . 
P 10 HOH 430 1560 1560 HOH HOH A . 
P 10 HOH 431 1561 1561 HOH HOH A . 
P 10 HOH 432 1562 1562 HOH HOH A . 
P 10 HOH 433 1563 1563 HOH HOH A . 
P 10 HOH 434 1564 1564 HOH HOH A . 
Q 10 HOH 1   1003 1003 HOH HOH B . 
Q 10 HOH 2   1033 1033 HOH HOH B . 
Q 10 HOH 3   1044 1044 HOH HOH B . 
Q 10 HOH 4   1093 1093 HOH HOH B . 
Q 10 HOH 5   1099 1099 HOH HOH B . 
Q 10 HOH 6   1115 1115 HOH HOH B . 
Q 10 HOH 7   1136 1136 HOH HOH B . 
Q 10 HOH 8   1168 1168 HOH HOH B . 
Q 10 HOH 9   1196 1196 HOH HOH B . 
Q 10 HOH 10  1198 1198 HOH HOH B . 
Q 10 HOH 11  1199 1199 HOH HOH B . 
Q 10 HOH 12  1293 1293 HOH HOH B . 
Q 10 HOH 13  1303 1303 HOH HOH B . 
Q 10 HOH 14  1311 1311 HOH HOH B . 
Q 10 HOH 15  1313 1313 HOH HOH B . 
Q 10 HOH 16  1315 1315 HOH HOH B . 
Q 10 HOH 17  1318 1318 HOH HOH B . 
Q 10 HOH 18  1323 1323 HOH HOH B . 
Q 10 HOH 19  1341 1341 HOH HOH B . 
Q 10 HOH 20  1346 1346 HOH HOH B . 
Q 10 HOH 21  1354 1354 HOH HOH B . 
Q 10 HOH 22  1355 1355 HOH HOH B . 
Q 10 HOH 23  1368 1368 HOH HOH B . 
Q 10 HOH 24  1369 1369 HOH HOH B . 
Q 10 HOH 25  1371 1371 HOH HOH B . 
Q 10 HOH 26  1378 1378 HOH HOH B . 
Q 10 HOH 27  1380 1380 HOH HOH B . 
Q 10 HOH 28  1445 1445 HOH HOH B . 
Q 10 HOH 29  1470 1470 HOH HOH B . 
Q 10 HOH 30  1481 1481 HOH HOH B . 
Q 10 HOH 31  1518 1518 HOH HOH B . 
Q 10 HOH 32  1519 1519 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A 2DA 22 P 2DA 822 ? DA "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" 
2 B 8OG 5  T 8OG 855 ? DG ?                                         
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2B ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O1G ? K D3T .   ? A D3T 823  ? 1_555 88.7  ? 
2  O2B ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 162.6 ? 
3  O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 87.4  ? 
4  O2B ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? C ALA 470 ? A ALA 476  ? 1_555 97.9  ? 
5  O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? C ALA 470 ? A ALA 476  ? 1_555 106.1 ? 
6  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? C ALA 470 ? A ALA 476  ? 1_555 67.0  ? 
7  O2B ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 102.9 ? 
8  O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 164.9 ? 
9  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 84.3  ? 
10 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 82.2  ? 
11 O2B ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 80.5  ? 
12 O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 84.3  ? 
13 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 115.9 ? 
14 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 169.5 ? 
15 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 88.0  ? 
16 O   ? P HOH .   ? A HOH 1008 ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 159.8 ? 
17 O   ? P HOH .   ? A HOH 1008 ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 99.4  ? 
18 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 88.0  ? 
19 O   ? P HOH .   ? A HOH 1008 ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 99.3  ? 
20 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 97.9  ? 
21 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 98.9  ? 
22 O   ? P HOH .   ? A HOH 1008 ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 O   ? P HOH .   ? A HOH 1284 ? 1_555 84.0  ? 
23 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 O   ? P HOH .   ? A HOH 1284 ? 1_555 84.1  ? 
24 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 O   ? P HOH .   ? A HOH 1284 ? 1_555 164.5 ? 
25 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? G MG . ? A MG 902 ? 1_555 O   ? P HOH .   ? A HOH 1284 ? 1_555 95.4  ? 
26 O   ? P HOH .   ? A HOH 1524 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1067 ? 1_555 99.7  ? 
27 O   ? P HOH .   ? A HOH 1524 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1525 ? 1_555 89.3  ? 
28 O   ? P HOH .   ? A HOH 1067 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1525 ? 1_555 86.2  ? 
29 O   ? P HOH .   ? A HOH 1524 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1508 ? 1_555 88.0  ? 
30 O   ? P HOH .   ? A HOH 1067 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1508 ? 1_555 169.7 ? 
31 O   ? P HOH .   ? A HOH 1525 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1508 ? 1_555 87.0  ? 
32 O   ? P HOH .   ? A HOH 1524 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1145 ? 1_555 94.3  ? 
33 O   ? P HOH .   ? A HOH 1067 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1145 ? 1_555 92.7  ? 
34 O   ? P HOH .   ? A HOH 1525 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1145 ? 1_555 176.3 ? 
35 O   ? P HOH .   ? A HOH 1508 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1145 ? 1_555 93.6  ? 
36 O   ? P HOH .   ? A HOH 1524 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 177.8 ? 
37 O   ? P HOH .   ? A HOH 1067 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 78.5  ? 
38 O   ? P HOH .   ? A HOH 1525 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 91.8  ? 
39 O   ? P HOH .   ? A HOH 1508 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 93.9  ? 
40 O   ? P HOH .   ? A HOH 1145 ? 1_555 MG ? H MG . ? A MG 903 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 84.5  ? 
41 O   ? O HOH .   ? T HOH 1488 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1487 ? 1_555 85.1  ? 
42 O   ? O HOH .   ? T HOH 1488 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1489 ? 1_555 81.4  ? 
43 O   ? O HOH .   ? T HOH 1487 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1489 ? 1_555 155.8 ? 
44 O   ? O HOH .   ? T HOH 1488 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1257 ? 1_555 80.5  ? 
45 O   ? O HOH .   ? T HOH 1487 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1257 ? 1_555 84.5  ? 
46 O   ? O HOH .   ? T HOH 1489 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1257 ? 1_555 73.5  ? 
47 O   ? O HOH .   ? T HOH 1488 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1222 ? 1_555 88.1  ? 
48 O   ? O HOH .   ? T HOH 1487 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1222 ? 1_555 103.3 ? 
49 O   ? O HOH .   ? T HOH 1489 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1222 ? 1_555 96.2  ? 
50 O   ? O HOH .   ? T HOH 1257 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1222 ? 1_555 165.6 ? 
51 O   ? O HOH .   ? T HOH 1488 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1221 ? 1_555 169.3 ? 
52 O   ? O HOH .   ? T HOH 1487 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1221 ? 1_555 105.5 ? 
53 O   ? O HOH .   ? T HOH 1489 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1221 ? 1_555 88.8  ? 
54 O   ? O HOH .   ? T HOH 1257 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1221 ? 1_555 100.8 ? 
55 O   ? O HOH .   ? T HOH 1222 ? 1_555 MG ? E MG . ? T MG 904 ? 1_555 O   ? O HOH .   ? T HOH 1221 ? 1_555 88.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-31 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 64  ? ? -110.36 -80.70 
2  1 ASP A 156 ? ? 18.44   -84.86 
3  1 ARG A 318 ? ? -16.55  -99.03 
4  1 GLU A 319 ? ? 154.23  -24.24 
5  1 ASP A 358 ? ? -67.98  0.24   
6  1 ALA A 400 ? ? -131.14 -43.25 
7  1 HIS A 417 ? ? -100.08 69.77  
8  1 VAL A 652 ? ? -114.65 79.64  
9  1 HIS A 653 ? ? 66.95   -90.18 
10 1 ASP B 47  ? ? -66.37  -73.11 
11 1 GLU B 48  ? ? -38.84  -36.34 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DA P 821 ? ? 0.060 'SIDE CHAIN' 
2 1 DG T 857 ? ? 0.073 'SIDE CHAIN' 
3 1 DC T 861 ? ? 0.061 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DT  868 ? OP1 ? B DT  18  OP1 
2  1 Y 1 A GLU 166 ? CD  ? C GLU 160 CD  
3  1 Y 1 A GLU 166 ? OE1 ? C GLU 160 OE1 
4  1 Y 1 A GLU 166 ? OE2 ? C GLU 160 OE2 
5  1 Y 1 A ARG 278 ? CG  ? C ARG 272 CG  
6  1 Y 1 A ARG 278 ? CD  ? C ARG 272 CD  
7  1 Y 1 A ARG 278 ? NE  ? C ARG 272 NE  
8  1 Y 1 A ARG 278 ? CZ  ? C ARG 272 CZ  
9  1 Y 1 A ARG 278 ? NH1 ? C ARG 272 NH1 
10 1 Y 1 A ARG 278 ? NH2 ? C ARG 272 NH2 
11 1 Y 1 A LYS 300 ? CG  ? C LYS 294 CG  
12 1 Y 1 A LYS 300 ? CD  ? C LYS 294 CD  
13 1 Y 1 A LYS 300 ? CE  ? C LYS 294 CE  
14 1 Y 1 A LYS 300 ? NZ  ? C LYS 294 NZ  
15 1 Y 1 A ARG 310 ? CG  ? C ARG 304 CG  
16 1 Y 1 A ARG 310 ? CD  ? C ARG 304 CD  
17 1 Y 1 A ARG 310 ? NE  ? C ARG 304 NE  
18 1 Y 1 A ARG 310 ? CZ  ? C ARG 304 CZ  
19 1 Y 1 A ARG 310 ? NH1 ? C ARG 304 NH1 
20 1 Y 1 A ARG 310 ? NH2 ? C ARG 304 NH2 
21 1 Y 1 A ARG 318 ? CG  ? C ARG 312 CG  
22 1 Y 1 A ARG 318 ? CD  ? C ARG 312 CD  
23 1 Y 1 A ARG 318 ? NE  ? C ARG 312 NE  
24 1 Y 1 A ARG 318 ? CZ  ? C ARG 312 CZ  
25 1 Y 1 A ARG 318 ? NH1 ? C ARG 312 NH1 
26 1 Y 1 A ARG 318 ? NH2 ? C ARG 312 NH2 
27 1 Y 1 A LYS 594 ? CE  ? C LYS 588 CE  
28 1 Y 1 A LYS 594 ? NZ  ? C LYS 588 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P DC  801 ? A DC  1   
2  1 Y 1 P DG  802 ? A DG  2   
3  1 Y 1 P DA  803 ? A DA  3   
4  1 Y 1 P DA  804 ? A DA  4   
5  1 Y 1 P DA  805 ? A DA  5   
6  1 Y 1 T DC  851 ? B DC  1   
7  1 Y 1 T DC  852 ? B DC  2   
8  1 Y 1 T DT  873 ? B DT  23  
9  1 Y 1 T DT  874 ? B DT  24  
10 1 Y 1 T DC  875 ? B DC  25  
11 1 Y 1 T DG  876 ? B DG  26  
12 1 Y 1 A GLN 578 ? C GLN 572 
13 1 Y 1 A TRP 579 ? C TRP 573 
14 1 Y 1 A VAL 580 ? C VAL 574 
15 1 Y 1 A ALA 581 ? C ALA 575 
16 1 Y 1 A GLY 582 ? C GLY 576 
17 1 Y 1 A GLU 583 ? C GLU 577 
18 1 Y 1 B SER 1   ? D SER 1   
19 1 Y 1 B ASP 2   ? D ASP 2   
20 1 Y 1 B ALA 108 ? D ALA 108 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1TK8 'double helix'         
1TK8 'b-form double helix'  
1TK8 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC  7  1_555 B DG  20 1_555 -0.004 0.154  -0.800 1.257   -7.538  -0.635  1  P_DC807:DG870_T   P 807 ? T 870 ? 19 1 
1 A DG  8  1_555 B DC  19 1_555 0.642  0.312  -0.245 -11.523 -4.524  7.493   2  P_DG808:DC869_T   P 808 ? T 869 ? ?  1 
1 A DA  9  1_555 B DT  18 1_555 0.280  0.189  0.303  -6.976  -7.981  -4.166  3  P_DA809:DT868_T   P 809 ? T 868 ? 20 1 
1 A DC  10 1_555 B DG  17 1_555 0.696  0.381  0.270  -5.596  0.107   1.453   4  P_DC810:DG867_T   P 810 ? T 867 ? ?  1 
1 A DG  11 1_555 B DC  16 1_555 -0.690 -0.225 0.073  -3.881  1.206   -4.303  5  P_DG811:DC866_T   P 811 ? T 866 ? 19 1 
1 A DG  12 1_555 B DC  15 1_555 -0.418 0.159  -0.152 1.321   -8.816  -0.294  6  P_DG812:DC865_T   P 812 ? T 865 ? 19 1 
1 A DC  13 1_555 B DG  14 1_555 0.107  0.004  0.062  -0.203  -6.955  1.977   7  P_DC813:DG864_T   P 813 ? T 864 ? 19 1 
1 A DC  14 1_555 B DG  13 1_555 0.022  -0.074 0.030  -7.190  -9.105  -0.449  8  P_DC814:DG863_T   P 814 ? T 863 ? 19 1 
1 A DA  15 1_555 B DT  12 1_555 -0.342 0.076  -0.032 -4.993  -9.355  -5.553  9  P_DA815:DT862_T   P 815 ? T 862 ? 20 1 
1 A DG  16 1_555 B DC  11 1_555 -0.271 -0.248 -0.335 -11.035 -13.282 2.765   10 P_DG816:DC861_T   P 816 ? T 861 ? 19 1 
1 A DT  17 1_555 B DA  10 1_555 -0.255 0.021  -0.196 -0.195  -5.746  1.465   11 P_DT817:DA860_T   P 817 ? T 860 ? 20 1 
1 A DG  18 1_555 B DC  9  1_555 -0.305 -0.169 -0.794 -5.499  1.842   0.450   12 P_DG818:DC859_T   P 818 ? T 859 ? 19 1 
1 A DC  19 1_555 B DG  8  1_555 0.453  -0.144 -0.317 4.402   5.258   -1.563  13 P_DC819:DG858_T   P 819 ? T 858 ? 19 1 
1 A DC  20 1_555 B DG  7  1_555 0.140  -0.321 -0.245 0.199   -10.975 3.464   14 P_DC820:DG857_T   P 820 ? T 857 ? 19 1 
1 A DA  21 1_555 B DT  6  1_555 0.126  -0.223 -0.064 -7.919  -7.577  3.167   15 P_DA821:DT856_T   P 821 ? T 856 ? 20 1 
1 A 2DA 22 1_555 B 8OG 5  1_555 0.307  4.511  0.381  -18.417 -3.030  -81.423 16 P_2DA822:8OG855_T P 822 ? T 855 ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 7  1_555 B DG 20 1_555 A DG  8  1_555 B DC  19 1_555 0.772  0.624  3.832 1.521   6.473  39.312 0.024  -0.924 3.909 9.538  
-2.241 39.848 1  PP_DC807DG808:DC869DG870_TT   P 807 ? T 870 ? P 808 ? T 869 ? 
1 A DG 8  1_555 B DC 19 1_555 A DA  9  1_555 B DT  18 1_555 -1.550 0.282  3.172 -10.187 0.023  37.186 0.425  1.045  3.463 0.036  
15.619 38.508 2  PP_DG808DA809:DT868DC869_TT   P 808 ? T 869 ? P 809 ? T 868 ? 
1 A DA 9  1_555 B DT 18 1_555 A DC  10 1_555 B DG  17 1_555 0.654  -0.730 3.342 2.228   -1.498 34.931 -0.980 -0.741 3.403 -2.491 
-3.704 35.031 3  PP_DA809DC810:DG867DT868_TT   P 809 ? T 868 ? P 810 ? T 867 ? 
1 A DC 10 1_555 B DG 17 1_555 A DG  11 1_555 B DC  16 1_555 -0.241 0.635  3.222 -0.627  2.836  32.193 0.642  0.323  3.268 5.101  
1.127  32.321 4  PP_DC810DG811:DC866DG867_TT   P 810 ? T 867 ? P 811 ? T 866 ? 
1 A DG 11 1_555 B DC 16 1_555 A DG  12 1_555 B DC  15 1_555 -0.114 -0.008 3.243 0.538   5.603  35.056 -0.826 0.265  3.201 9.228  
-0.887 35.491 5  PP_DG811DG812:DC865DC866_TT   P 811 ? T 866 ? P 812 ? T 865 ? 
1 A DG 12 1_555 B DC 15 1_555 A DC  13 1_555 B DG  14 1_555 -0.350 -0.936 3.293 -2.651  8.912  33.742 -2.871 0.191  2.976 15.002 
4.463  34.964 6  PP_DG812DC813:DG864DC865_TT   P 812 ? T 865 ? P 813 ? T 864 ? 
1 A DC 13 1_555 B DG 14 1_555 A DC  14 1_555 B DG  13 1_555 0.721  -0.360 3.328 2.428   7.842  33.395 -1.853 -0.835 3.207 13.396 
-4.148 34.362 7  PP_DC813DC814:DG863DG864_TT   P 813 ? T 864 ? P 814 ? T 863 ? 
1 A DC 14 1_555 B DG 13 1_555 A DA  15 1_555 B DT  12 1_555 -0.705 0.094  3.178 -1.667  10.037 30.424 -1.609 0.982  3.085 18.488 
3.071  32.042 8  PP_DC814DA815:DT862DG863_TT   P 814 ? T 863 ? P 815 ? T 862 ? 
1 A DA 15 1_555 B DT 12 1_555 A DG  16 1_555 B DC  11 1_555 0.342  -0.350 3.603 1.840   6.601  35.074 -1.615 -0.267 3.495 10.825 
-3.018 35.716 9  PP_DA815DG816:DC861DT862_TT   P 815 ? T 862 ? P 816 ? T 861 ? 
1 A DG 16 1_555 B DC 11 1_555 A DT  17 1_555 B DA  10 1_555 0.442  -0.346 3.036 -0.279  6.566  29.437 -1.893 -0.901 2.889 12.722 
0.541  30.145 10 PP_DG816DT817:DA860DC861_TT   P 816 ? T 861 ? P 817 ? T 860 ? 
1 A DT 17 1_555 B DA 10 1_555 A DG  18 1_555 B DC  9  1_555 0.923  0.060  3.576 5.508   7.687  33.716 -1.197 -0.606 3.604 12.939 
-9.272 34.980 11 PP_DT817DG818:DC859DA860_TT   P 817 ? T 860 ? P 818 ? T 859 ? 
1 A DG 18 1_555 B DC 9  1_555 A DC  19 1_555 B DG  8  1_555 -0.443 -0.247 3.174 -3.698  3.497  29.559 -1.179 0.113  3.156 6.791  
7.180  29.985 12 PP_DG818DC819:DG858DC859_TT   P 818 ? T 859 ? P 819 ? T 858 ? 
1 A DC 19 1_555 B DG 8  1_555 A DC  20 1_555 B DG  7  1_555 -0.320 -0.576 3.690 -8.028  6.420  38.312 -1.696 -0.586 3.546 9.574  
11.971 39.617 13 PP_DC819DC820:DG857DG858_TT   P 819 ? T 858 ? P 820 ? T 857 ? 
1 A DC 20 1_555 B DG 7  1_555 A DA  21 1_555 B DT  6  1_555 -0.411 -1.445 3.569 -0.981  15.227 23.983 -6.363 0.618  2.276 32.742 
2.109  28.365 14 PP_DC820DA821:DT856DG857_TT   P 820 ? T 857 ? P 821 ? T 856 ? 
1 A DA 21 1_555 B DT 6  1_555 A 2DA 22 1_555 B 8OG 5  1_555 0.812  -2.503 3.035 6.164   3.012  75.748 -2.115 -0.490 2.997 2.448  
-5.010 76.012 15 PP_DA8212DA822:8OG855DT856_TT P 821 ? T 856 ? P 822 ? T 855 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  'MAGNESIUM ION'                           MG  
6  'SULFATE ION'                             SO4 
7  "2',3'-DIDEOXY-THYMIDINE-5'-TRIPHOSPHATE" D3T 
8  '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'    MES 
9  'PENTAETHYLENE GLYCOL'                    1PE 
10 water                                     HOH 
#