data_1TKD
# 
_entry.id   1TKD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TKD         
NDB   PD0557       
RCSB  RCSB022715   
WWPDB D_1000022715 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1TK8 . unspecified 
PDB 1TK5 . unspecified 
PDB 1TK0 . unspecified 
PDB 1T8E . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TKD 
_pdbx_database_status.recvd_initial_deposition_date   2004-06-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brieba, L.G.'    1 
'Eichman, B.F.'   2 
'Kokoska, R.J.'   3 
'Doublie, S.'     4 
'Kunkel, T.A.'    5 
'Ellenberger, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the dual coding potential of 8-oxoguanosine by a high-fidelity DNA polymerase.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            23 
_citation.page_first                3452 
_citation.page_last                 3461 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15297882 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600354 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brieba, L.G.'    1 
primary 'Eichman, B.F.'   2 
primary 'Kokoska, R.J.'   3 
primary 'Doublie, S.'     4 
primary 'Kunkel, T.A.'    5 
primary 'Ellenberger, T.' 6 
# 
_cell.entry_id           1TKD 
_cell.length_a           105.514 
_cell.length_b           215.112 
_cell.length_c           52.035 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TKD 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn 
;DNA (5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*(DOC))-3')
;
6724.373  1   ?       ? ? ? 
2  polymer     syn 
;DNA (5'-D(*CP*CP*CP*AP*(8OG)P*TP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*TP*CP*G)-3')
;
7963.088  1   ?       ? ? ? 
3  polymer     man 'DNA polymerase'                                                                                   79089.789 1 
2.7.7.7 ? ? ? 
4  polymer     man 'Thioredoxin 1'                                                                                    11687.388 1 
?       ? ? ? 
5  non-polymer syn 'MAGNESIUM ION'                                                                                    24.305    3 
?       ? ? ? 
6  non-polymer syn 'SULFATE ION'                                                                                      96.063    3 
?       ? ? ? 
7  non-polymer syn "2',3'-DIDEOXY-THYMIDINE-5'-TRIPHOSPHATE"                                                          466.169   1 
?       ? ? ? 
8  non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                                             195.237   1 
?       ? ? ? 
9  non-polymer syn 'PENTAETHYLENE GLYCOL'                                                                             238.278   1 
?       ? ? ? 
10 water       nat water                                                                                              18.015    
716 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'T7 DNA polymerase' 
4 'TRX1, TRX'         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(DA)(DOC)
;
CGAAAACGACGGCCAGTGCCAC P ? 
2 polydeoxyribonucleotide no yes 
;(DC)(DC)(DC)(DA)(8OG)(DT)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DT)(DC)
(DG)(DT)(DT)(DT)(DT)(DC)(DG)
;
CCCAGTGGCACTGGCCGTCGTTTTCG T ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DC  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DA  n 
1 22  DOC n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   DA  n 
2 5   8OG n 
2 6   DT  n 
2 7   DG  n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DG  n 
2 14  DG  n 
2 15  DC  n 
2 16  DC  n 
2 17  DG  n 
2 18  DT  n 
2 19  DC  n 
2 20  DG  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DT  n 
2 25  DC  n 
2 26  DG  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? 'T7-like viruses' 5 ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 
Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? ? ? ? ? pGP5   ? ? 
4 1 sample ? ? ? ? Escherichia       
'TRXA, TSNC, FIPA, B3781, C4701, Z5291, ECS4714, STM3915, STMD1.75, STY3639, T3381, SF3854, S3905' ? ? ? ? ? ? 'Escherichia coli' 
562   ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? ? ? ? ? pTrx-3 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPT7  P00581 3 
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEW
WNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIE
ELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREY
VAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSA
EGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLE
LRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTP
AIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKH
GWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
1 ? 
2 UNP THIO_ECOLI P0AA25 4 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
1 ? 
3 PDB 1TKD       1TKD   1 ? ? ? 
4 PDB 1TKD       1TKD   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TKD A 1 ? 698 ? P00581 1   ? 704 ? 1   704 
2 2 1TKD B 1 ? 108 ? P0AA25 1   ? 108 ? 1   108 
3 3 1TKD P 1 ? 22  ? 1TKD   801 ? 822 ? 801 822 
4 4 1TKD T 1 ? 26  ? 1TKD   851 ? 876 ? 851 876 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1TKD ? A ? ? UNP P00581 LYS 118 DELETION ? 1 
1 1TKD ? A ? ? UNP P00581 ARG 119 DELETION ? 2 
1 1TKD ? A ? ? UNP P00581 PHE 120 DELETION ? 3 
1 1TKD ? A ? ? UNP P00581 GLY 121 DELETION ? 4 
1 1TKD ? A ? ? UNP P00581 SER 122 DELETION ? 5 
1 1TKD ? A ? ? UNP P00581 HIS 123 DELETION ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer               . 'PENTAETHYLENE GLYCOL'                      PEG400 'C10 H22 O6'        238.278 
8OG 'DNA linking'             n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
"8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 'C10 H14 N5 O8 P'   363.221 
ALA 'L-peptide linking'       y ALANINE                                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking'       y ARGININE                                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'       y ASPARAGINE                                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'       y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'       y CYSTEINE                                    ? 'C3 H7 N O2 S'      121.158 
D3T 'DNA OH 3 prime terminus' n "2',3'-DIDEOXY-THYMIDINE-5'-TRIPHOSPHATE"   ? 'C10 H17 N2 O13 P3' 466.169 
DA  'DNA linking'             y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'             y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'             y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ? 'C10 H14 N5 O7 P'   347.221 
DOC 'DNA linking'             n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"    ? 'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'             y "THYMIDINE-5'-MONOPHOSPHATE"                ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking'       y GLUTAMINE                                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'       y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'         y GLYCINE                                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'       y HISTIDINE                                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer               . WATER                                       ? 'H2 O'              18.015  
ILE 'L-peptide linking'       y ISOLEUCINE                                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'       y LEUCINE                                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'       y LYSINE                                      ? 'C6 H15 N2 O2 1'    147.195 
MES non-polymer               . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'      ? 'C6 H13 N O4 S'     195.237 
MET 'L-peptide linking'       y METHIONINE                                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer               . 'MAGNESIUM ION'                             ? 'Mg 2'              24.305  
PHE 'L-peptide linking'       y PHENYLALANINE                               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'       y PROLINE                                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'       y SERINE                                      ? 'C3 H7 N O3'        105.093 
SO4 non-polymer               . 'SULFATE ION'                               ? 'O4 S -2'           96.063  
THR 'L-peptide linking'       y THREONINE                                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'       y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'       y TYROSINE                                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'       y VALINE                                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1TKD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3 
_exptl_crystal.density_percent_sol   58.3 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG8000, Ammonium Sulfate, PEG400, Ethylene Glycol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-01-28 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X26C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X26C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     1TKD 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.49 
_reflns.number_obs                   40910 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.071 
_reflns.pdbx_netI_over_sigmaI        24.6 
_reflns.B_iso_Wilson_estimate        28.6 
_reflns.pdbx_redundancy              5.9 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.48 
_reflns_shell.d_res_low              2.57 
_reflns_shell.percent_possible_all   86 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.253 
_reflns_shell.meanI_over_sigI_obs    8.4 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      40910 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1TKD 
_refine.ls_number_reflns_obs                     40853 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1977204.66 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.91 
_refine.ls_d_res_high                            2.49 
_refine.ls_percent_reflns_obs                    95.9 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_all                          0.26185 
_refine.ls_R_factor_R_work                       0.202 
_refine.ls_R_factor_R_free                       0.265 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1957 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               31.1 
_refine.aniso_B[1][1]                            4.68 
_refine.aniso_B[2][2]                            -0.57 
_refine.aniso_B[3][3]                            -4.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.327916 
_refine.solvent_model_param_bsol                 43.7709 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1T7P' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1TKD 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.30 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6336 
_refine_hist.pdbx_number_atoms_nucleic_acid   716 
_refine_hist.pdbx_number_atoms_ligand         74 
_refine_hist.number_atoms_solvent             716 
_refine_hist.number_atoms_total               7842 
_refine_hist.d_res_high                       2.49 
_refine_hist.d_res_low                        47.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.88  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.25  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.05  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.00  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.94  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.49 
_refine_ls_shell.d_res_low                        2.64 
_refine_ls_shell.number_reflns_R_work             5310 
_refine_ls_shell.R_factor_R_work                  0.223 
_refine_ls_shell.percent_reflns_obs               79.3 
_refine_ls_shell.R_factor_R_free                  0.303 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             272 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP            'X-RAY DIFFRACTION' 
2 DNA-RNA-TT5.PARAM DNA-RNA-TT_4TD_NEW.TOP 'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP                'X-RAY DIFFRACTION' 
4 WATER.PARAM       WATER.TOP              'X-RAY DIFFRACTION' 
5 LIGAND.PAR        LIGAND.TOP             'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1TKD 
_struct.title                     'T7 DNA polymerase ternary complex with 8 oxo guanosine and dCMP at the elongation site' 
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)/THIOREDOXIN 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TKD 
_struct_keywords.pdbx_keywords   'TRANSFERASE/ELECTRON TRANSPORT/DNA' 
_struct_keywords.text            '8-oxoguanosine DNA polymerase, TRANSFERASE-ELECTRON TRANSPORT-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 5  ? 
H N N 6  ? 
I N N 6  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 9  ? 
N N N 10 ? 
O N N 10 ? 
P N N 10 ? 
Q N N 10 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 11  ? VAL C 15  ? LEU A 11  VAL A 15  5 ? 5  
HELX_P HELX_P2  2  ARG C 35  ? SER C 37  ? ARG A 35  SER A 37  5 ? 3  
HELX_P HELX_P3  3  ASP C 38  ? ARG C 52  ? ASP A 38  ARG A 52  1 ? 15 
HELX_P HELX_P4  4  TYR C 64  ? ASN C 78  ? TYR A 64  ASN A 78  1 ? 15 
HELX_P HELX_P5  5  PRO C 84  ? GLU C 86  ? PRO A 84  GLU A 86  5 ? 3  
HELX_P HELX_P6  6  THR C 91  ? HIS C 99  ? THR A 91  HIS A 99  1 ? 9  
HELX_P HELX_P7  7  ARG C 111 ? LEU C 115 ? ARG A 111 LEU A 115 5 ? 5  
HELX_P HELX_P8  8  GLU C 120 ? GLU C 143 ? GLU A 126 GLU A 149 1 ? 24 
HELX_P HELX_P9  9  GLY C 151 ? TRP C 155 ? GLY A 157 TRP A 161 5 ? 5  
HELX_P HELX_P10 10 ASN C 158 ? SER C 181 ? ASN A 164 SER A 187 1 ? 24 
HELX_P HELX_P11 11 GLY C 196 ? SER C 204 ? GLY A 202 SER A 210 1 ? 9  
HELX_P HELX_P12 12 LEU C 205 ? GLY C 225 ? LEU A 211 GLY A 231 1 ? 21 
HELX_P HELX_P13 13 ASP C 229 ? PHE C 255 ? ASP A 235 PHE A 261 1 ? 27 
HELX_P HELX_P14 14 SER C 332 ? GLU C 342 ? SER A 338 GLU A 348 1 ? 11 
HELX_P HELX_P15 15 ASP C 359 ? VAL C 366 ? ASP A 365 VAL A 372 1 ? 8  
HELX_P HELX_P16 16 ASP C 370 ? ALA C 394 ? ASP A 376 ALA A 400 1 ? 25 
HELX_P HELX_P17 17 ALA C 399 ? VAL C 404 ? ALA A 405 VAL A 410 1 ? 6  
HELX_P HELX_P18 18 TYR C 441 ? ALA C 448 ? TYR A 447 ALA A 454 1 ? 8  
HELX_P HELX_P19 19 GLY C 450 ? HIS C 454 ? GLY A 456 HIS A 460 5 ? 5  
HELX_P HELX_P20 20 GLY C 472 ? ASN C 487 ? GLY A 478 ASN A 493 1 ? 16 
HELX_P HELX_P21 21 GLY C 488 ? ILE C 494 ? GLY A 494 ILE A 500 1 ? 7  
HELX_P HELX_P22 22 ASP C 498 ? GLU C 508 ? ASP A 504 GLU A 514 1 ? 11 
HELX_P HELX_P23 23 THR C 511 ? TYR C 524 ? THR A 517 TYR A 530 1 ? 14 
HELX_P HELX_P24 24 GLY C 527 ? GLY C 536 ? GLY A 533 GLY A 542 1 ? 10 
HELX_P HELX_P25 25 GLY C 538 ? THR C 553 ? GLY A 544 THR A 559 1 ? 16 
HELX_P HELX_P26 26 PRO C 554 ? LEU C 567 ? PRO A 560 LEU A 573 1 ? 14 
HELX_P HELX_P27 27 ALA C 602 ? LYS C 630 ? ALA A 608 LYS A 636 1 ? 29 
HELX_P HELX_P28 28 THR C 656 ? TRP C 678 ? THR A 662 TRP A 684 1 ? 23 
HELX_P HELX_P29 29 THR D 8   ? VAL D 16  ? THR B 8   VAL B 16  1 ? 9  
HELX_P HELX_P30 30 CYS D 32  ? TYR D 49  ? CYS B 32  TYR B 49  1 ? 18 
HELX_P HELX_P31 31 GLY D 65  ? TYR D 70  ? GLY B 65  TYR B 70  1 ? 6  
HELX_P HELX_P32 32 SER D 95  ? LEU D 107 ? SER B 95  LEU B 107 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? K D3T .  O1G   ? ? ? 1_555 E MG  .   MG  ? ? A D3T 823 A MG  901  1_555 ? ? ? ? ? ? ?            1.899 ? 
metalc2  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 469 OD1 ? ? A MG  901 A ASP 475  1_555 ? ? ? ? ? ? ?            2.140 ? 
metalc3  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ALA 470 O   ? ? A MG  901 A ALA 476  1_555 ? ? ? ? ? ? ?            2.480 ? 
metalc4  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 648 OD2 ? ? A MG  901 A ASP 654  1_555 ? ? ? ? ? ? ?            2.107 ? 
metalc5  metalc ? ? E MG  .  MG    ? ? ? 1_555 F MG  .   MG  ? ? A MG  901 A MG  902  1_555 ? ? ? ? ? ? ?            2.958 ? 
metalc6  metalc ? ? E MG  .  MG    ? ? ? 1_555 K D3T .   O2A ? ? A MG  901 A D3T 823  1_555 ? ? ? ? ? ? ?            2.281 ? 
metalc7  metalc ? ? E MG  .  MG    ? ? ? 1_555 K D3T .   O2B ? ? A MG  901 A D3T 823  1_555 ? ? ? ? ? ? ?            2.094 ? 
metalc8  metalc ? ? F MG  .  MG    ? ? ? 1_555 K D3T .   O2A ? ? A MG  902 A D3T 823  1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc9  metalc ? ? F MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  902 A HOH 1372 1_555 ? ? ? ? ? ? ?            2.494 ? 
metalc10 metalc ? ? F MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  902 A HOH 1507 1_555 ? ? ? ? ? ? ?            2.677 ? 
metalc11 metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 469 OD2 ? ? A MG  902 A ASP 475  1_555 ? ? ? ? ? ? ?            1.950 ? 
metalc12 metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 648 OD1 ? ? A MG  902 A ASP 654  1_555 ? ? ? ? ? ? ?            2.500 ? 
metalc13 metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 648 OD2 ? ? A MG  902 A ASP 654  1_555 ? ? ? ? ? ? ?            3.082 ? 
metalc14 metalc ? ? G MG  .  MG    ? ? ? 1_555 C ASP 5   OD1 ? ? A MG  903 A ASP 5    1_555 ? ? ? ? ? ? ?            2.190 ? 
metalc15 metalc ? ? G MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1479 1_555 ? ? ? ? ? ? ?            2.228 ? 
metalc16 metalc ? ? G MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1093 1_555 ? ? ? ? ? ? ?            2.222 ? 
metalc17 metalc ? ? G MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1094 1_555 ? ? ? ? ? ? ?            2.208 ? 
metalc18 metalc ? ? G MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1480 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc19 metalc ? ? G MG  .  MG    ? ? ? 1_555 P HOH .   O   ? ? A MG  903 A HOH 1091 1_555 ? ? ? ? ? ? ?            2.226 ? 
covale1  covale ? ? A DA  21 "O3'" ? ? ? 1_555 A DOC 22  P   ? ? P DA  821 P DOC 822  1_555 ? ? ? ? ? ? ?            1.600 ? 
covale2  covale ? ? B DA  4  "O3'" ? ? ? 1_555 B 8OG 5   P   ? ? T DA  854 T 8OG 855  1_555 ? ? ? ? ? ? ?            1.613 ? 
covale3  covale ? ? B 8OG 5  "O3'" ? ? ? 1_555 B DT  6   P   ? ? T 8OG 855 T DT  856  1_555 ? ? ? ? ? ? ?            1.613 ? 
hydrog1  hydrog ? ? A DC  7  N3    ? ? ? 1_555 B DG  20  N1  ? ? P DC  807 T DG  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  7  N4    ? ? ? 1_555 B DG  20  O6  ? ? P DC  807 T DG  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  7  O2    ? ? ? 1_555 B DG  20  N2  ? ? P DC  807 T DG  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  8  N1    ? ? ? 1_555 B DC  19  N3  ? ? P DG  808 T DC  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  8  N2    ? ? ? 1_555 B DC  19  O2  ? ? P DG  808 T DC  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  8  O6    ? ? ? 1_555 B DC  19  N4  ? ? P DG  808 T DC  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA  9  N1    ? ? ? 1_555 B DT  18  N3  ? ? P DA  809 T DT  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  9  N6    ? ? ? 1_555 B DT  18  O4  ? ? P DA  809 T DT  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  10 O2    ? ? ? 1_555 B DG  17  N1  ? ? P DC  810 T DG  867  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog10 hydrog ? ? A DG  11 N1    ? ? ? 1_555 B DC  16  N3  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  11 N2    ? ? ? 1_555 B DC  16  O2  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  11 O6    ? ? ? 1_555 B DC  16  N4  ? ? P DG  811 T DC  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  12 N1    ? ? ? 1_555 B DC  15  N3  ? ? P DG  812 T DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG  12 N2    ? ? ? 1_555 B DC  15  O2  ? ? P DG  812 T DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  12 O6    ? ? ? 1_555 B DC  15  N4  ? ? P DG  812 T DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  13 N3    ? ? ? 1_555 B DG  14  N1  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  13 N4    ? ? ? 1_555 B DG  14  O6  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  13 O2    ? ? ? 1_555 B DG  14  N2  ? ? P DC  813 T DG  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  13  N1  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  13  O6  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  13  N2  ? ? P DC  814 T DG  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  12  N3  ? ? P DA  815 T DT  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  12  O4  ? ? P DA  815 T DT  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  11  N3  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  11  O2  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  11  N4  ? ? P DG  816 T DC  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  10  N1  ? ? P DT  817 T DA  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  10  N6  ? ? P DT  817 T DA  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  9   N3  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  9   O2  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  9   N4  ? ? P DG  818 T DC  859  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DC  19 N3    ? ? ? 1_555 B DG  8   N1  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DC  19 N4    ? ? ? 1_555 B DG  8   O6  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DC  19 O2    ? ? ? 1_555 B DG  8   N2  ? ? P DC  819 T DG  858  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DC  20 N3    ? ? ? 1_555 B DG  7   N1  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DC  20 N4    ? ? ? 1_555 B DG  7   O6  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DC  20 O2    ? ? ? 1_555 B DG  7   N2  ? ? P DC  820 T DG  857  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DA  21 N1    ? ? ? 1_555 B DT  6   N3  ? ? P DA  821 T DT  856  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A DA  21 N6    ? ? ? 1_555 B DT  6   O4  ? ? P DA  821 T DT  856  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A DOC 22 N3    ? ? ? 1_555 B 8OG 5   N1  ? ? P DOC 822 T 8OG 855  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A DOC 22 N4    ? ? ? 1_555 B 8OG 5   O6  ? ? P DOC 822 T 8OG 855  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A DOC 22 O2    ? ? ? 1_555 B 8OG 5   N2  ? ? P DOC 822 T 8OG 855  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 C . ? PHE 434 A PRO 429 C ? PRO 435 A 1 -1.67 
2 ILE 75  D . ? ILE 75  B PRO 76  D ? PRO 76  B 1 0.19  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 2 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 30  ? TYR C 34  ? GLU A 30  TYR A 34  
A 2 PHE C 18  ? ASP C 25  ? PHE A 18  ASP A 25  
A 3 ILE C 2   ? ALA C 8   ? ILE A 2   ALA A 8   
A 4 ILE C 56  ? PHE C 58  ? ILE A 56  PHE A 58  
A 5 CYS C 88  ? ASP C 90  ? CYS A 88  ASP A 90  
B 1 PHE C 226 ? PRO C 227 ? PHE A 232 PRO A 233 
B 2 LYS C 409 ? ILE C 410 ? LYS A 415 ILE A 416 
C 1 TRP C 258 ? PRO C 261 ? TRP A 264 PRO A 267 
C 2 THR C 321 ? VAL C 326 ? THR A 327 VAL A 332 
C 3 GLY D 74  ? ILE D 75  ? GLY B 74  ILE B 75  
D 1 SER C 413 ? ASN C 415 ? SER A 419 ASN A 421 
D 2 THR C 425 ? ALA C 427 ? THR A 431 ALA A 433 
E 1 PHE C 640 ? TRP C 645 ? PHE A 646 TRP A 651 
E 2 GLU C 649 ? CYS C 654 ? GLU A 655 CYS A 660 
E 3 VAL C 464 ? ALA C 470 ? VAL A 470 ALA A 476 
E 4 THR C 686 ? GLY C 691 ? THR A 692 GLY A 697 
F 1 VAL C 568 ? TRP C 573 ? VAL A 574 TRP A 579 
F 2 GLN C 578 ? TRP C 582 ? GLN A 584 TRP A 588 
G 1 TRP C 586 ? LYS C 588 ? TRP A 592 LYS A 594 
G 2 LYS C 594 ? HIS C 596 ? LYS A 600 HIS A 602 
H 1 ILE D 5   ? HIS D 6   ? ILE B 5   HIS B 6   
H 2 THR D 54  ? ASN D 59  ? THR B 54  ASN B 59  
H 3 ALA D 22  ? TRP D 28  ? ALA B 22  TRP B 28  
H 4 THR D 77  ? LYS D 82  ? THR B 77  LYS B 82  
H 5 GLU D 85  ? VAL D 91  ? GLU B 85  VAL B 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR C 34  ? O TYR A 34  N GLY C 21  ? N GLY A 21  
A 2 3 O HIS C 19  ? O HIS A 19  N GLU C 7   ? N GLU A 7   
A 3 4 N SER C 4   ? N SER A 4   O VAL C 57  ? O VAL A 57  
A 4 5 N PHE C 58  ? N PHE A 58  O ILE C 89  ? O ILE A 89  
B 1 2 N PHE C 226 ? N PHE A 232 O ILE C 410 ? O ILE A 416 
C 1 2 N TRP C 258 ? N TRP A 264 O VAL C 326 ? O VAL A 332 
C 2 3 N THR C 321 ? N THR A 327 O ILE D 75  ? O ILE B 75  
D 1 2 N ASN C 415 ? N ASN A 421 O THR C 425 ? O THR A 431 
E 1 2 N ALA C 641 ? N ALA A 647 O GLY C 653 ? O GLY A 659 
E 2 3 O CYS C 654 ? O CYS A 660 N VAL C 464 ? N VAL A 470 
E 3 4 N GLN C 465 ? N GLN A 471 O GLY C 691 ? O GLY A 697 
F 1 2 N SER C 570 ? N SER A 576 O LYS C 581 ? O LYS A 587 
G 1 2 N ILE C 587 ? N ILE A 593 O VAL C 595 ? O VAL A 601 
H 1 2 N ILE D 5   ? N ILE B 5   O VAL D 55  ? O VAL B 55  
H 2 3 O THR D 54  ? O THR B 54  N LEU D 24  ? N LEU B 24  
H 3 4 N VAL D 25  ? N VAL B 25  O LEU D 79  ? O LEU B 79  
H 4 5 N LEU D 80  ? N LEU B 80  O ALA D 87  ? O ALA B 87  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 901'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 902'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 903'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 904' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 905' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 906' 
AC7 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE D3T A 823' 
AC8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE MES A 991' 
AC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE 1PE A 992' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP C 469 ? ASP A 475  . ? 1_555 ? 
2  AC1 5  ALA C 470 ? ALA A 476  . ? 1_555 ? 
3  AC1 5  ASP C 648 ? ASP A 654  . ? 1_555 ? 
4  AC1 5  D3T K .   ? D3T A 823  . ? 1_555 ? 
5  AC1 5  MG  F .   ? MG  A 902  . ? 1_555 ? 
6  AC2 6  ASP C 469 ? ASP A 475  . ? 1_555 ? 
7  AC2 6  ASP C 648 ? ASP A 654  . ? 1_555 ? 
8  AC2 6  D3T K .   ? D3T A 823  . ? 1_555 ? 
9  AC2 6  MG  E .   ? MG  A 901  . ? 1_555 ? 
10 AC2 6  HOH P .   ? HOH A 1372 . ? 1_555 ? 
11 AC2 6  HOH P .   ? HOH A 1507 . ? 1_555 ? 
12 AC3 6  ASP C 5   ? ASP A 5    . ? 1_555 ? 
13 AC3 6  HOH P .   ? HOH A 1091 . ? 1_555 ? 
14 AC3 6  HOH P .   ? HOH A 1093 . ? 1_555 ? 
15 AC3 6  HOH P .   ? HOH A 1094 . ? 1_555 ? 
16 AC3 6  HOH P .   ? HOH A 1479 . ? 1_555 ? 
17 AC3 6  HOH P .   ? HOH A 1480 . ? 1_555 ? 
18 AC4 6  LYS C 220 ? LYS A 226  . ? 1_555 ? 
19 AC4 6  ARG C 223 ? ARG A 229  . ? 1_555 ? 
20 AC4 6  HOH P .   ? HOH A 1022 . ? 1_555 ? 
21 AC4 6  HOH P .   ? HOH A 1088 . ? 1_555 ? 
22 AC4 6  HOH P .   ? HOH A 1277 . ? 1_555 ? 
23 AC4 6  HOH P .   ? HOH A 1609 . ? 1_555 ? 
24 AC5 4  LYS C 178 ? LYS A 184  . ? 1_555 ? 
25 AC5 4  ARG C 655 ? ARG A 661  . ? 1_556 ? 
26 AC5 4  HOH P .   ? HOH A 1075 . ? 1_556 ? 
27 AC5 4  HOH P .   ? HOH A 1415 . ? 1_555 ? 
28 AC6 6  ASN C 156 ? ASN A 162  . ? 4_566 ? 
29 AC6 6  ARG C 249 ? ARG A 255  . ? 1_555 ? 
30 AC6 6  LYS C 250 ? LYS A 256  . ? 1_555 ? 
31 AC6 6  THR C 273 ? THR A 279  . ? 1_554 ? 
32 AC6 6  LYS C 275 ? LYS A 281  . ? 1_554 ? 
33 AC6 6  HOH P .   ? HOH A 1393 . ? 1_554 ? 
34 AC7 19 ARG C 423 ? ARG A 429  . ? 1_555 ? 
35 AC7 19 ASP C 469 ? ASP A 475  . ? 1_555 ? 
36 AC7 19 ALA C 470 ? ALA A 476  . ? 1_555 ? 
37 AC7 19 GLY C 472 ? GLY A 478  . ? 1_555 ? 
38 AC7 19 LEU C 473 ? LEU A 479  . ? 1_555 ? 
39 AC7 19 GLU C 474 ? GLU A 480  . ? 1_555 ? 
40 AC7 19 HIS C 500 ? HIS A 506  . ? 1_555 ? 
41 AC7 19 ARG C 512 ? ARG A 518  . ? 1_555 ? 
42 AC7 19 LYS C 516 ? LYS A 522  . ? 1_555 ? 
43 AC7 19 TYR C 520 ? TYR A 526  . ? 1_555 ? 
44 AC7 19 ASP C 648 ? ASP A 654  . ? 1_555 ? 
45 AC7 19 MG  E .   ? MG  A 901  . ? 1_555 ? 
46 AC7 19 MG  F .   ? MG  A 902  . ? 1_555 ? 
47 AC7 19 HOH P .   ? HOH A 1178 . ? 1_555 ? 
48 AC7 19 HOH P .   ? HOH A 1205 . ? 1_555 ? 
49 AC7 19 HOH P .   ? HOH A 1608 . ? 1_555 ? 
50 AC7 19 DOC A 22  ? DOC P 822  . ? 1_555 ? 
51 AC7 19 DA  B 4   ? DA  T 854  . ? 1_555 ? 
52 AC7 19 8OG B 5   ? 8OG T 855  . ? 1_555 ? 
53 AC8 10 LEU C 77  ? LEU A 77   . ? 1_555 ? 
54 AC8 10 ASN C 78  ? ASN A 78   . ? 1_555 ? 
55 AC8 10 ARG C 79  ? ARG A 79   . ? 1_555 ? 
56 AC8 10 HOH P .   ? HOH A 1188 . ? 1_555 ? 
57 AC8 10 HOH P .   ? HOH A 1341 . ? 1_555 ? 
58 AC8 10 ILE D 5   ? ILE B 5    . ? 4_466 ? 
59 AC8 10 HIS D 6   ? HIS B 6    . ? 4_466 ? 
60 AC8 10 SER D 11  ? SER B 11   . ? 4_466 ? 
61 AC8 10 THR D 14  ? THR B 14   . ? 4_466 ? 
62 AC8 10 ASP D 15  ? ASP B 15   . ? 4_466 ? 
63 AC9 7  ALA C 10  ? ALA A 10   . ? 1_555 ? 
64 AC9 7  TYR C 64  ? TYR A 64   . ? 1_555 ? 
65 AC9 7  MET C 107 ? MET A 107  . ? 1_555 ? 
66 AC9 7  LEU C 109 ? LEU A 109  . ? 1_555 ? 
67 AC9 7  LYS C 130 ? LYS A 136  . ? 1_555 ? 
68 AC9 7  TRP C 154 ? TRP A 160  . ? 1_555 ? 
69 AC9 7  HOH P .   ? HOH A 1405 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1TKD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TKD 
_atom_sites.fract_transf_matrix[1][1]   0.009477 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004649 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019218 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DC  A 1  7   ? 35.257 145.635 53.731 1.00 100.55 ? 807  DC  P P     1 
ATOM   2    O  OP1   . DC  A 1  7   ? 36.643 145.020 53.586 1.00 100.55 ? 807  DC  P OP1   1 
ATOM   3    O  OP2   . DC  A 1  7   ? 35.265 146.968 54.465 1.00 100.02 ? 807  DC  P OP2   1 
ATOM   4    O  "O5'" . DC  A 1  7   ? 34.739 145.947 52.216 1.00 100.51 ? 807  DC  P "O5'" 1 
ATOM   5    C  "C5'" . DC  A 1  7   ? 35.567 146.672 51.285 1.00 100.55 ? 807  DC  P "C5'" 1 
ATOM   6    C  "C4'" . DC  A 1  7   ? 35.085 146.444 49.871 1.00 100.54 ? 807  DC  P "C4'" 1 
ATOM   7    O  "O4'" . DC  A 1  7   ? 33.707 146.878 49.759 1.00 100.55 ? 807  DC  P "O4'" 1 
ATOM   8    C  "C3'" . DC  A 1  7   ? 35.827 147.218 48.793 1.00 100.55 ? 807  DC  P "C3'" 1 
ATOM   9    O  "O3'" . DC  A 1  7   ? 36.971 146.478 48.372 1.00 100.37 ? 807  DC  P "O3'" 1 
ATOM   10   C  "C2'" . DC  A 1  7   ? 34.792 147.307 47.676 1.00 100.55 ? 807  DC  P "C2'" 1 
ATOM   11   C  "C1'" . DC  A 1  7   ? 33.480 147.401 48.462 1.00 100.55 ? 807  DC  P "C1'" 1 
ATOM   12   N  N1    . DC  A 1  7   ? 32.914 148.763 48.583 1.00 100.55 ? 807  DC  P N1    1 
ATOM   13   C  C2    . DC  A 1  7   ? 32.310 149.352 47.456 1.00 100.55 ? 807  DC  P C2    1 
ATOM   14   O  O2    . DC  A 1  7   ? 32.299 148.732 46.376 1.00 100.34 ? 807  DC  P O2    1 
ATOM   15   N  N3    . DC  A 1  7   ? 31.756 150.581 47.573 1.00 100.43 ? 807  DC  P N3    1 
ATOM   16   C  C4    . DC  A 1  7   ? 31.794 151.223 48.742 1.00 100.30 ? 807  DC  P C4    1 
ATOM   17   N  N4    . DC  A 1  7   ? 31.222 152.427 48.812 1.00 100.52 ? 807  DC  P N4    1 
ATOM   18   C  C5    . DC  A 1  7   ? 32.417 150.660 49.894 1.00 100.41 ? 807  DC  P C5    1 
ATOM   19   C  C6    . DC  A 1  7   ? 32.959 149.442 49.771 1.00 100.40 ? 807  DC  P C6    1 
ATOM   20   P  P     . DG  A 1  8   ? 38.331 147.250 47.993 1.00 100.55 ? 808  DG  P P     1 
ATOM   21   O  OP1   . DG  A 1  8   ? 39.374 146.216 47.765 1.00 100.55 ? 808  DG  P OP1   1 
ATOM   22   O  OP2   . DG  A 1  8   ? 38.563 148.320 48.999 1.00 100.44 ? 808  DG  P OP2   1 
ATOM   23   O  "O5'" . DG  A 1  8   ? 38.015 147.948 46.597 1.00 100.55 ? 808  DG  P "O5'" 1 
ATOM   24   C  "C5'" . DG  A 1  8   ? 37.611 147.181 45.463 1.00 100.55 ? 808  DG  P "C5'" 1 
ATOM   25   C  "C4'" . DG  A 1  8   ? 37.242 148.100 44.321 1.00 100.55 ? 808  DG  P "C4'" 1 
ATOM   26   O  "O4'" . DG  A 1  8   ? 36.172 148.973 44.760 1.00 100.55 ? 808  DG  P "O4'" 1 
ATOM   27   C  "C3'" . DG  A 1  8   ? 38.369 149.024 43.854 1.00 100.42 ? 808  DG  P "C3'" 1 
ATOM   28   O  "O3'" . DG  A 1  8   ? 38.265 149.259 42.446 1.00 100.55 ? 808  DG  P "O3'" 1 
ATOM   29   C  "C2'" . DG  A 1  8   ? 38.093 150.314 44.601 1.00 100.43 ? 808  DG  P "C2'" 1 
ATOM   30   C  "C1'" . DG  A 1  8   ? 36.576 150.329 44.634 1.00 100.26 ? 808  DG  P "C1'" 1 
ATOM   31   N  N9    . DG  A 1  8   ? 35.991 151.084 45.738 1.00 99.69  ? 808  DG  P N9    1 
ATOM   32   C  C8    . DG  A 1  8   ? 36.373 151.076 47.061 1.00 99.82  ? 808  DG  P C8    1 
ATOM   33   N  N7    . DG  A 1  8   ? 35.664 151.884 47.803 1.00 99.09  ? 808  DG  P N7    1 
ATOM   34   C  C5    . DG  A 1  8   ? 34.758 152.454 46.919 1.00 98.83  ? 808  DG  P C5    1 
ATOM   35   C  C6    . DG  A 1  8   ? 33.737 153.413 47.140 1.00 98.48  ? 808  DG  P C6    1 
ATOM   36   O  O6    . DG  A 1  8   ? 33.423 153.976 48.195 1.00 97.97  ? 808  DG  P O6    1 
ATOM   37   N  N1    . DG  A 1  8   ? 33.050 153.706 45.965 1.00 98.16  ? 808  DG  P N1    1 
ATOM   38   C  C2    . DG  A 1  8   ? 33.313 153.151 44.736 1.00 98.05  ? 808  DG  P C2    1 
ATOM   39   N  N2    . DG  A 1  8   ? 32.541 153.555 43.721 1.00 97.76  ? 808  DG  P N2    1 
ATOM   40   N  N3    . DG  A 1  8   ? 34.265 152.264 44.517 1.00 98.05  ? 808  DG  P N3    1 
ATOM   41   C  C4    . DG  A 1  8   ? 34.943 151.963 45.643 1.00 98.90  ? 808  DG  P C4    1 
ATOM   42   P  P     . DA  A 1  9   ? 39.547 149.779 41.629 1.00 100.55 ? 809  DA  P P     1 
ATOM   43   O  OP1   . DA  A 1  9   ? 40.230 148.584 41.066 1.00 100.55 ? 809  DA  P OP1   1 
ATOM   44   O  OP2   . DA  A 1  9   ? 40.305 150.720 42.494 1.00 100.55 ? 809  DA  P OP2   1 
ATOM   45   O  "O5'" . DA  A 1  9   ? 38.925 150.614 40.423 1.00 100.45 ? 809  DA  P "O5'" 1 
ATOM   46   C  "C5'" . DA  A 1  9   ? 37.968 150.032 39.540 1.00 100.41 ? 809  DA  P "C5'" 1 
ATOM   47   C  "C4'" . DA  A 1  9   ? 37.129 151.114 38.900 1.00 100.55 ? 809  DA  P "C4'" 1 
ATOM   48   O  "O4'" . DA  A 1  9   ? 36.388 151.803 39.937 1.00 100.55 ? 809  DA  P "O4'" 1 
ATOM   49   C  "C3'" . DA  A 1  9   ? 37.928 152.192 38.166 1.00 100.27 ? 809  DA  P "C3'" 1 
ATOM   50   O  "O3'" . DA  A 1  9   ? 37.223 152.614 36.990 1.00 100.51 ? 809  DA  P "O3'" 1 
ATOM   51   C  "C2'" . DA  A 1  9   ? 38.034 153.309 39.190 1.00 100.09 ? 809  DA  P "C2'" 1 
ATOM   52   C  "C1'" . DA  A 1  9   ? 36.729 153.183 39.962 1.00 99.77  ? 809  DA  P "C1'" 1 
ATOM   53   N  N9    . DA  A 1  9   ? 36.820 153.599 41.364 1.00 99.48  ? 809  DA  P N9    1 
ATOM   54   C  C8    . DA  A 1  9   ? 37.679 153.130 42.331 1.00 99.16  ? 809  DA  P C8    1 
ATOM   55   N  N7    . DA  A 1  9   ? 37.530 153.709 43.498 1.00 98.82  ? 809  DA  P N7    1 
ATOM   56   C  C5    . DA  A 1  9   ? 36.501 154.618 43.290 1.00 98.67  ? 809  DA  P C5    1 
ATOM   57   C  C6    . DA  A 1  9   ? 35.870 155.544 44.142 1.00 98.34  ? 809  DA  P C6    1 
ATOM   58   N  N6    . DA  A 1  9   ? 36.196 155.713 45.426 1.00 97.95  ? 809  DA  P N6    1 
ATOM   59   N  N1    . DA  A 1  9   ? 34.879 156.302 43.623 1.00 98.21  ? 809  DA  P N1    1 
ATOM   60   C  C2    . DA  A 1  9   ? 34.552 156.134 42.335 1.00 98.61  ? 809  DA  P C2    1 
ATOM   61   N  N3    . DA  A 1  9   ? 35.070 155.299 41.435 1.00 98.95  ? 809  DA  P N3    1 
ATOM   62   C  C4    . DA  A 1  9   ? 36.053 154.560 41.981 1.00 99.11  ? 809  DA  P C4    1 
ATOM   63   P  P     . DC  A 1  10  ? 37.782 153.846 36.117 1.00 100.55 ? 810  DC  P P     1 
ATOM   64   O  OP1   . DC  A 1  10  ? 37.078 153.827 34.807 1.00 100.33 ? 810  DC  P OP1   1 
ATOM   65   O  OP2   . DC  A 1  10  ? 39.269 153.824 36.150 1.00 100.55 ? 810  DC  P OP2   1 
ATOM   66   O  "O5'" . DC  A 1  10  ? 37.284 155.125 36.926 1.00 99.73  ? 810  DC  P "O5'" 1 
ATOM   67   C  "C5'" . DC  A 1  10  ? 35.894 155.440 37.009 1.00 97.55  ? 810  DC  P "C5'" 1 
ATOM   68   C  "C4'" . DC  A 1  10  ? 35.706 156.857 37.498 1.00 96.00  ? 810  DC  P "C4'" 1 
ATOM   69   O  "O4'" . DC  A 1  10  ? 35.937 156.934 38.925 1.00 95.40  ? 810  DC  P "O4'" 1 
ATOM   70   C  "C3'" . DC  A 1  10  ? 36.647 157.877 36.856 1.00 95.65  ? 810  DC  P "C3'" 1 
ATOM   71   O  "O3'" . DC  A 1  10  ? 35.948 159.087 36.581 1.00 95.60  ? 810  DC  P "O3'" 1 
ATOM   72   C  "C2'" . DC  A 1  10  ? 37.692 158.119 37.928 1.00 95.16  ? 810  DC  P "C2'" 1 
ATOM   73   C  "C1'" . DC  A 1  10  ? 36.884 157.950 39.204 1.00 94.59  ? 810  DC  P "C1'" 1 
ATOM   74   N  N1    . DC  A 1  10  ? 37.653 157.542 40.397 1.00 94.01  ? 810  DC  P N1    1 
ATOM   75   C  C2    . DC  A 1  10  ? 37.342 158.128 41.637 1.00 93.55  ? 810  DC  P C2    1 
ATOM   76   O  O2    . DC  A 1  10  ? 36.424 158.966 41.701 1.00 92.23  ? 810  DC  P O2    1 
ATOM   77   N  N3    . DC  A 1  10  ? 38.050 157.765 42.734 1.00 93.41  ? 810  DC  P N3    1 
ATOM   78   C  C4    . DC  A 1  10  ? 39.028 156.859 42.630 1.00 93.73  ? 810  DC  P C4    1 
ATOM   79   N  N4    . DC  A 1  10  ? 39.701 156.534 43.737 1.00 93.79  ? 810  DC  P N4    1 
ATOM   80   C  C5    . DC  A 1  10  ? 39.360 156.247 41.385 1.00 93.30  ? 810  DC  P C5    1 
ATOM   81   C  C6    . DC  A 1  10  ? 38.655 156.612 40.307 1.00 93.54  ? 810  DC  P C6    1 
ATOM   82   P  P     . DG  A 1  11  ? 36.474 160.064 35.420 1.00 95.72  ? 811  DG  P P     1 
ATOM   83   O  OP1   . DG  A 1  11  ? 35.628 159.864 34.215 1.00 95.34  ? 811  DG  P OP1   1 
ATOM   84   O  OP2   . DG  A 1  11  ? 37.949 159.910 35.316 1.00 95.28  ? 811  DG  P OP2   1 
ATOM   85   O  "O5'" . DG  A 1  11  ? 36.176 161.511 36.008 1.00 95.06  ? 811  DG  P "O5'" 1 
ATOM   86   C  "C5'" . DG  A 1  11  ? 34.921 161.804 36.618 1.00 94.34  ? 811  DG  P "C5'" 1 
ATOM   87   C  "C4'" . DG  A 1  11  ? 35.101 162.811 37.729 1.00 93.50  ? 811  DG  P "C4'" 1 
ATOM   88   O  "O4'" . DG  A 1  11  ? 35.661 162.189 38.913 1.00 93.14  ? 811  DG  P "O4'" 1 
ATOM   89   C  "C3'" . DG  A 1  11  ? 36.032 163.970 37.374 1.00 93.43  ? 811  DG  P "C3'" 1 
ATOM   90   O  "O3'" . DG  A 1  11  ? 35.487 165.197 37.841 1.00 93.63  ? 811  DG  P "O3'" 1 
ATOM   91   C  "C2'" . DG  A 1  11  ? 37.302 163.655 38.142 1.00 93.08  ? 811  DG  P "C2'" 1 
ATOM   92   C  "C1'" . DG  A 1  11  ? 36.746 162.975 39.379 1.00 92.67  ? 811  DG  P "C1'" 1 
ATOM   93   N  N9    . DG  A 1  11  ? 37.685 162.106 40.086 1.00 92.28  ? 811  DG  P N9    1 
ATOM   94   C  C8    . DG  A 1  11  ? 38.500 161.137 39.545 1.00 92.04  ? 811  DG  P C8    1 
ATOM   95   N  N7    . DG  A 1  11  ? 39.254 160.547 40.434 1.00 91.83  ? 811  DG  P N7    1 
ATOM   96   C  C5    . DG  A 1  11  ? 38.912 161.155 41.636 1.00 91.34  ? 811  DG  P C5    1 
ATOM   97   C  C6    . DG  A 1  11  ? 39.401 160.932 42.954 1.00 90.67  ? 811  DG  P C6    1 
ATOM   98   O  O6    . DG  A 1  11  ? 40.266 160.133 43.333 1.00 90.09  ? 811  DG  P O6    1 
ATOM   99   N  N1    . DG  A 1  11  ? 38.775 161.763 43.877 1.00 90.30  ? 811  DG  P N1    1 
ATOM   100  C  C2    . DG  A 1  11  ? 37.809 162.691 43.578 1.00 90.88  ? 811  DG  P C2    1 
ATOM   101  N  N2    . DG  A 1  11  ? 37.327 163.396 44.612 1.00 90.95  ? 811  DG  P N2    1 
ATOM   102  N  N3    . DG  A 1  11  ? 37.348 162.912 42.356 1.00 90.94  ? 811  DG  P N3    1 
ATOM   103  C  C4    . DG  A 1  11  ? 37.939 162.113 41.441 1.00 91.53  ? 811  DG  P C4    1 
ATOM   104  P  P     . DG  A 1  12  ? 35.674 166.528 36.968 1.00 94.21  ? 812  DG  P P     1 
ATOM   105  O  OP1   . DG  A 1  12  ? 34.412 166.765 36.219 1.00 94.33  ? 812  DG  P OP1   1 
ATOM   106  O  OP2   . DG  A 1  12  ? 36.962 166.430 36.230 1.00 93.45  ? 812  DG  P OP2   1 
ATOM   107  O  "O5'" . DG  A 1  12  ? 35.826 167.660 38.071 1.00 92.88  ? 812  DG  P "O5'" 1 
ATOM   108  C  "C5'" . DG  A 1  12  ? 34.845 167.814 39.092 1.00 91.24  ? 812  DG  P "C5'" 1 
ATOM   109  C  "C4'" . DG  A 1  12  ? 35.481 168.380 40.339 1.00 89.62  ? 812  DG  P "C4'" 1 
ATOM   110  O  "O4'" . DG  A 1  12  ? 36.251 167.356 41.020 1.00 88.88  ? 812  DG  P "O4'" 1 
ATOM   111  C  "C3'" . DG  A 1  12  ? 36.444 169.538 40.077 1.00 88.45  ? 812  DG  P "C3'" 1 
ATOM   112  O  "O3'" . DG  A 1  12  ? 36.223 170.584 41.029 1.00 86.63  ? 812  DG  P "O3'" 1 
ATOM   113  C  "C2'" . DG  A 1  12  ? 37.818 168.901 40.220 1.00 87.93  ? 812  DG  P "C2'" 1 
ATOM   114  C  "C1'" . DG  A 1  12  ? 37.574 167.816 41.256 1.00 87.52  ? 812  DG  P "C1'" 1 
ATOM   115  N  N9    . DG  A 1  12  ? 38.473 166.666 41.170 1.00 86.15  ? 812  DG  P N9    1 
ATOM   116  C  C8    . DG  A 1  12  ? 38.850 165.988 40.034 1.00 85.64  ? 812  DG  P C8    1 
ATOM   117  N  N7    . DG  A 1  12  ? 39.667 164.999 40.273 1.00 84.79  ? 812  DG  P N7    1 
ATOM   118  C  C5    . DG  A 1  12  ? 39.844 165.020 41.650 1.00 84.15  ? 812  DG  P C5    1 
ATOM   119  C  C6    . DG  A 1  12  ? 40.627 164.182 42.489 1.00 83.44  ? 812  DG  P C6    1 
ATOM   120  O  O6    . DG  A 1  12  ? 41.341 163.225 42.172 1.00 83.37  ? 812  DG  P O6    1 
ATOM   121  N  N1    . DG  A 1  12  ? 40.522 164.555 43.823 1.00 82.95  ? 812  DG  P N1    1 
ATOM   122  C  C2    . DG  A 1  12  ? 39.764 165.598 44.295 1.00 83.89  ? 812  DG  P C2    1 
ATOM   123  N  N2    . DG  A 1  12  ? 39.795 165.797 45.621 1.00 83.43  ? 812  DG  P N2    1 
ATOM   124  N  N3    . DG  A 1  12  ? 39.029 166.387 43.525 1.00 84.34  ? 812  DG  P N3    1 
ATOM   125  C  C4    . DG  A 1  12  ? 39.115 166.043 42.221 1.00 84.68  ? 812  DG  P C4    1 
ATOM   126  P  P     . DC  A 1  13  ? 37.319 171.743 41.209 1.00 85.45  ? 813  DC  P P     1 
ATOM   127  O  OP1   . DC  A 1  13  ? 36.660 172.921 41.832 1.00 85.24  ? 813  DC  P OP1   1 
ATOM   128  O  OP2   . DC  A 1  13  ? 38.053 171.904 39.925 1.00 84.84  ? 813  DC  P OP2   1 
ATOM   129  O  "O5'" . DC  A 1  13  ? 38.307 171.104 42.274 1.00 82.73  ? 813  DC  P "O5'" 1 
ATOM   130  C  "C5'" . DC  A 1  13  ? 37.854 170.836 43.594 1.00 79.88  ? 813  DC  P "C5'" 1 
ATOM   131  C  "C4'" . DC  A 1  13  ? 39.016 170.877 44.554 1.00 78.20  ? 813  DC  P "C4'" 1 
ATOM   132  O  "O4'" . DC  A 1  13  ? 39.767 169.644 44.456 1.00 77.56  ? 813  DC  P "O4'" 1 
ATOM   133  C  "C3'" . DC  A 1  13  ? 40.004 172.012 44.284 1.00 77.75  ? 813  DC  P "C3'" 1 
ATOM   134  O  "O3'" . DC  A 1  13  ? 40.399 172.615 45.525 1.00 77.57  ? 813  DC  P "O3'" 1 
ATOM   135  C  "C2'" . DC  A 1  13  ? 41.150 171.315 43.568 1.00 76.85  ? 813  DC  P "C2'" 1 
ATOM   136  C  "C1'" . DC  A 1  13  ? 41.128 169.924 44.188 1.00 76.40  ? 813  DC  P "C1'" 1 
ATOM   137  N  N1    . DC  A 1  13  ? 41.667 168.823 43.359 1.00 75.12  ? 813  DC  P N1    1 
ATOM   138  C  C2    . DC  A 1  13  ? 42.528 167.881 43.956 1.00 74.09  ? 813  DC  P C2    1 
ATOM   139  O  O2    . DC  A 1  13  ? 42.805 167.992 45.160 1.00 73.02  ? 813  DC  P O2    1 
ATOM   140  N  N3    . DC  A 1  13  ? 43.031 166.875 43.203 1.00 73.14  ? 813  DC  P N3    1 
ATOM   141  C  C4    . DC  A 1  13  ? 42.710 166.782 41.911 1.00 73.52  ? 813  DC  P C4    1 
ATOM   142  N  N4    . DC  A 1  13  ? 43.234 165.774 41.206 1.00 72.23  ? 813  DC  P N4    1 
ATOM   143  C  C5    . DC  A 1  13  ? 41.837 167.718 41.281 1.00 74.10  ? 813  DC  P C5    1 
ATOM   144  C  C6    . DC  A 1  13  ? 41.342 168.712 42.034 1.00 74.65  ? 813  DC  P C6    1 
ATOM   145  P  P     . DC  A 1  14  ? 41.456 173.833 45.538 1.00 77.31  ? 814  DC  P P     1 
ATOM   146  O  OP1   . DC  A 1  14  ? 40.958 174.880 46.468 1.00 77.56  ? 814  DC  P OP1   1 
ATOM   147  O  OP2   . DC  A 1  14  ? 41.796 174.201 44.136 1.00 76.56  ? 814  DC  P OP2   1 
ATOM   148  O  "O5'" . DC  A 1  14  ? 42.736 173.154 46.192 1.00 73.91  ? 814  DC  P "O5'" 1 
ATOM   149  C  "C5'" . DC  A 1  14  ? 43.082 171.819 45.840 1.00 69.21  ? 814  DC  P "C5'" 1 
ATOM   150  C  "C4'" . DC  A 1  14  ? 44.395 171.426 46.465 1.00 65.76  ? 814  DC  P "C4'" 1 
ATOM   151  O  "O4'" . DC  A 1  14  ? 44.807 170.171 45.875 1.00 64.21  ? 814  DC  P "O4'" 1 
ATOM   152  C  "C3'" . DC  A 1  14  ? 45.522 172.407 46.173 1.00 63.99  ? 814  DC  P "C3'" 1 
ATOM   153  O  "O3'" . DC  A 1  14  ? 46.433 172.411 47.262 1.00 62.94  ? 814  DC  P "O3'" 1 
ATOM   154  C  "C2'" . DC  A 1  14  ? 46.178 171.839 44.933 1.00 63.58  ? 814  DC  P "C2'" 1 
ATOM   155  C  "C1'" . DC  A 1  14  ? 45.987 170.343 45.105 1.00 62.72  ? 814  DC  P "C1'" 1 
ATOM   156  N  N1    . DC  A 1  14  ? 45.808 169.613 43.837 1.00 60.93  ? 814  DC  P N1    1 
ATOM   157  C  C2    . DC  A 1  14  ? 46.548 168.452 43.623 1.00 59.64  ? 814  DC  P C2    1 
ATOM   158  O  O2    . DC  A 1  14  ? 47.319 168.061 44.510 1.00 58.87  ? 814  DC  P O2    1 
ATOM   159  N  N3    . DC  A 1  14  ? 46.405 167.784 42.457 1.00 60.22  ? 814  DC  P N3    1 
ATOM   160  C  C4    . DC  A 1  14  ? 45.562 168.235 41.527 1.00 59.98  ? 814  DC  P C4    1 
ATOM   161  N  N4    . DC  A 1  14  ? 45.455 167.544 40.391 1.00 60.38  ? 814  DC  P N4    1 
ATOM   162  C  C5    . DC  A 1  14  ? 44.790 169.414 41.722 1.00 60.86  ? 814  DC  P C5    1 
ATOM   163  C  C6    . DC  A 1  14  ? 44.940 170.064 42.880 1.00 60.38  ? 814  DC  P C6    1 
ATOM   164  P  P     . DA  A 1  15  ? 47.449 173.632 47.433 1.00 61.62  ? 815  DA  P P     1 
ATOM   165  O  OP1   . DA  A 1  15  ? 46.786 174.702 48.226 1.00 62.95  ? 815  DA  P OP1   1 
ATOM   166  O  OP2   . DA  A 1  15  ? 48.002 173.946 46.088 1.00 60.48  ? 815  DA  P OP2   1 
ATOM   167  O  "O5'" . DA  A 1  15  ? 48.605 173.001 48.316 1.00 58.83  ? 815  DA  P "O5'" 1 
ATOM   168  C  "C5'" . DA  A 1  15  ? 49.954 173.235 47.980 1.00 55.38  ? 815  DA  P "C5'" 1 
ATOM   169  C  "C4'" . DA  A 1  15  ? 50.692 171.927 47.843 1.00 51.73  ? 815  DA  P "C4'" 1 
ATOM   170  O  "O4'" . DA  A 1  15  ? 50.060 171.051 46.868 1.00 50.10  ? 815  DA  P "O4'" 1 
ATOM   171  C  "C3'" . DA  A 1  15  ? 52.119 172.139 47.359 1.00 49.66  ? 815  DA  P "C3'" 1 
ATOM   172  O  "O3'" . DA  A 1  15  ? 52.991 171.312 48.117 1.00 47.61  ? 815  DA  P "O3'" 1 
ATOM   173  C  "C2'" . DA  A 1  15  ? 52.063 171.750 45.891 1.00 48.03  ? 815  DA  P "C2'" 1 
ATOM   174  C  "C1'" . DA  A 1  15  ? 51.014 170.655 45.887 1.00 45.62  ? 815  DA  P "C1'" 1 
ATOM   175  N  N9    . DA  A 1  15  ? 50.317 170.480 44.608 1.00 42.32  ? 815  DA  P N9    1 
ATOM   176  C  C8    . DA  A 1  15  ? 49.342 171.285 44.078 1.00 41.90  ? 815  DA  P C8    1 
ATOM   177  N  N7    . DA  A 1  15  ? 48.885 170.874 42.921 1.00 40.05  ? 815  DA  P N7    1 
ATOM   178  C  C5    . DA  A 1  15  ? 49.609 169.720 42.664 1.00 38.55  ? 815  DA  P C5    1 
ATOM   179  C  C6    . DA  A 1  15  ? 49.591 168.810 41.586 1.00 37.66  ? 815  DA  P C6    1 
ATOM   180  N  N6    . DA  A 1  15  ? 48.775 168.918 40.536 1.00 35.25  ? 815  DA  P N6    1 
ATOM   181  N  N1    . DA  A 1  15  ? 50.447 167.769 41.629 1.00 37.41  ? 815  DA  P N1    1 
ATOM   182  C  C2    . DA  A 1  15  ? 51.256 167.652 42.687 1.00 38.21  ? 815  DA  P C2    1 
ATOM   183  N  N3    . DA  A 1  15  ? 51.362 168.434 43.763 1.00 39.69  ? 815  DA  P N3    1 
ATOM   184  C  C4    . DA  A 1  15  ? 50.501 169.466 43.690 1.00 39.93  ? 815  DA  P C4    1 
ATOM   185  P  P     . DG  A 1  16  ? 54.519 171.750 48.321 1.00 50.22  ? 816  DG  P P     1 
ATOM   186  O  OP1   . DG  A 1  16  ? 54.935 171.392 49.705 1.00 49.77  ? 816  DG  P OP1   1 
ATOM   187  O  OP2   . DG  A 1  16  ? 54.666 173.151 47.843 1.00 48.89  ? 816  DG  P OP2   1 
ATOM   188  O  "O5'" . DG  A 1  16  ? 55.284 170.798 47.304 1.00 48.52  ? 816  DG  P "O5'" 1 
ATOM   189  C  "C5'" . DG  A 1  16  ? 54.598 170.301 46.168 1.00 43.29  ? 816  DG  P "C5'" 1 
ATOM   190  C  "C4'" . DG  A 1  16  ? 55.433 169.287 45.434 1.00 38.67  ? 816  DG  P "C4'" 1 
ATOM   191  O  "O4'" . DG  A 1  16  ? 54.676 168.911 44.263 1.00 35.70  ? 816  DG  P "O4'" 1 
ATOM   192  C  "C3'" . DG  A 1  16  ? 56.754 169.840 44.912 1.00 37.02  ? 816  DG  P "C3'" 1 
ATOM   193  O  "O3'" . DG  A 1  16  ? 57.709 168.769 44.855 1.00 34.69  ? 816  DG  P "O3'" 1 
ATOM   194  C  "C2'" . DG  A 1  16  ? 56.368 170.392 43.550 1.00 34.82  ? 816  DG  P "C2'" 1 
ATOM   195  C  "C1'" . DG  A 1  16  ? 55.289 169.420 43.088 1.00 33.76  ? 816  DG  P "C1'" 1 
ATOM   196  N  N9    . DG  A 1  16  ? 54.235 169.993 42.253 1.00 30.87  ? 816  DG  P N9    1 
ATOM   197  C  C8    . DG  A 1  16  ? 53.538 171.158 42.469 1.00 31.40  ? 816  DG  P C8    1 
ATOM   198  N  N7    . DG  A 1  16  ? 52.649 171.405 41.543 1.00 29.40  ? 816  DG  P N7    1 
ATOM   199  C  C5    . DG  A 1  16  ? 52.769 170.342 40.660 1.00 28.30  ? 816  DG  P C5    1 
ATOM   200  C  C6    . DG  A 1  16  ? 52.072 170.065 39.455 1.00 27.58  ? 816  DG  P C6    1 
ATOM   201  O  O6    . DG  A 1  16  ? 51.193 170.738 38.897 1.00 25.33  ? 816  DG  P O6    1 
ATOM   202  N  N1    . DG  A 1  16  ? 52.499 168.870 38.884 1.00 27.98  ? 816  DG  P N1    1 
ATOM   203  C  C2    . DG  A 1  16  ? 53.481 168.055 39.397 1.00 28.81  ? 816  DG  P C2    1 
ATOM   204  N  N2    . DG  A 1  16  ? 53.757 166.939 38.703 1.00 29.31  ? 816  DG  P N2    1 
ATOM   205  N  N3    . DG  A 1  16  ? 54.146 168.311 40.508 1.00 29.30  ? 816  DG  P N3    1 
ATOM   206  C  C4    . DG  A 1  16  ? 53.741 169.459 41.086 1.00 29.88  ? 816  DG  P C4    1 
ATOM   207  P  P     . DT  A 1  17  ? 59.273 169.082 44.631 1.00 36.79  ? 817  DT  P P     1 
ATOM   208  O  OP1   . DT  A 1  17  ? 60.065 168.076 45.390 1.00 37.76  ? 817  DT  P OP1   1 
ATOM   209  O  OP2   . DT  A 1  17  ? 59.525 170.533 44.844 1.00 34.94  ? 817  DT  P OP2   1 
ATOM   210  O  "O5'" . DT  A 1  17  ? 59.489 168.760 43.091 1.00 36.10  ? 817  DT  P "O5'" 1 
ATOM   211  C  "C5'" . DT  A 1  17  ? 58.434 168.982 42.181 1.00 33.94  ? 817  DT  P "C5'" 1 
ATOM   212  C  "C4'" . DT  A 1  17  ? 58.807 168.519 40.800 1.00 31.07  ? 817  DT  P "C4'" 1 
ATOM   213  O  "O4'" . DT  A 1  17  ? 57.657 168.808 39.979 1.00 29.67  ? 817  DT  P "O4'" 1 
ATOM   214  C  "C3'" . DT  A 1  17  ? 59.980 169.270 40.173 1.00 30.43  ? 817  DT  P "C3'" 1 
ATOM   215  O  "O3'" . DT  A 1  17  ? 60.718 168.374 39.327 1.00 29.17  ? 817  DT  P "O3'" 1 
ATOM   216  C  "C2'" . DT  A 1  17  ? 59.304 170.403 39.418 1.00 29.07  ? 817  DT  P "C2'" 1 
ATOM   217  C  "C1'" . DT  A 1  17  ? 57.961 169.799 39.015 1.00 29.36  ? 817  DT  P "C1'" 1 
ATOM   218  N  N1    . DT  A 1  17  ? 56.805 170.728 38.952 1.00 27.43  ? 817  DT  P N1    1 
ATOM   219  C  C2    . DT  A 1  17  ? 55.914 170.571 37.915 1.00 27.66  ? 817  DT  P C2    1 
ATOM   220  O  O2    . DT  A 1  17  ? 56.029 169.709 37.064 1.00 27.53  ? 817  DT  P O2    1 
ATOM   221  N  N3    . DT  A 1  17  ? 54.873 171.467 37.912 1.00 29.08  ? 817  DT  P N3    1 
ATOM   222  C  C4    . DT  A 1  17  ? 54.638 172.482 38.821 1.00 28.83  ? 817  DT  P C4    1 
ATOM   223  O  O4    . DT  A 1  17  ? 53.665 173.218 38.677 1.00 27.48  ? 817  DT  P O4    1 
ATOM   224  C  C5    . DT  A 1  17  ? 55.606 172.584 39.891 1.00 29.04  ? 817  DT  P C5    1 
ATOM   225  C  C7    . DT  A 1  17  ? 55.433 173.646 40.934 1.00 26.42  ? 817  DT  P C7    1 
ATOM   226  C  C6    . DT  A 1  17  ? 56.625 171.713 39.901 1.00 29.02  ? 817  DT  P C6    1 
ATOM   227  P  P     . DG  A 1  18  ? 62.137 168.820 38.707 1.00 31.56  ? 818  DG  P P     1 
ATOM   228  O  OP1   . DG  A 1  18  ? 63.067 167.663 38.776 1.00 33.76  ? 818  DG  P OP1   1 
ATOM   229  O  OP2   . DG  A 1  18  ? 62.541 170.122 39.288 1.00 31.57  ? 818  DG  P OP2   1 
ATOM   230  O  "O5'" . DG  A 1  18  ? 61.804 169.056 37.172 1.00 30.62  ? 818  DG  P "O5'" 1 
ATOM   231  C  "C5'" . DG  A 1  18  ? 60.498 169.446 36.799 1.00 30.46  ? 818  DG  P "C5'" 1 
ATOM   232  C  "C4'" . DG  A 1  18  ? 60.346 169.443 35.302 1.00 29.13  ? 818  DG  P "C4'" 1 
ATOM   233  O  "O4'" . DG  A 1  18  ? 59.019 169.964 35.064 1.00 30.10  ? 818  DG  P "O4'" 1 
ATOM   234  C  "C3'" . DG  A 1  18  ? 61.312 170.383 34.585 1.00 28.63  ? 818  DG  P "C3'" 1 
ATOM   235  O  "O3'" . DG  A 1  18  ? 61.690 169.853 33.315 1.00 26.90  ? 818  DG  P "O3'" 1 
ATOM   236  C  "C2'" . DG  A 1  18  ? 60.536 171.681 34.456 1.00 28.46  ? 818  DG  P "C2'" 1 
ATOM   237  C  "C1'" . DG  A 1  18  ? 59.075 171.247 34.461 1.00 28.96  ? 818  DG  P "C1'" 1 
ATOM   238  N  N9    . DG  A 1  18  ? 58.209 172.139 35.230 1.00 26.35  ? 818  DG  P N9    1 
ATOM   239  C  C8    . DG  A 1  18  ? 58.487 172.725 36.443 1.00 26.81  ? 818  DG  P C8    1 
ATOM   240  N  N7    . DG  A 1  18  ? 57.535 173.511 36.862 1.00 26.95  ? 818  DG  P N7    1 
ATOM   241  C  C5    . DG  A 1  18  ? 56.566 173.433 35.872 1.00 24.92  ? 818  DG  P C5    1 
ATOM   242  C  C6    . DG  A 1  18  ? 55.309 174.074 35.770 1.00 23.58  ? 818  DG  P C6    1 
ATOM   243  O  O6    . DG  A 1  18  ? 54.792 174.876 36.548 1.00 23.00  ? 818  DG  P O6    1 
ATOM   244  N  N1    . DG  A 1  18  ? 54.637 173.702 34.613 1.00 23.28  ? 818  DG  P N1    1 
ATOM   245  C  C2    . DG  A 1  18  ? 55.114 172.830 33.668 1.00 25.68  ? 818  DG  P C2    1 
ATOM   246  N  N2    . DG  A 1  18  ? 54.313 172.588 32.619 1.00 25.23  ? 818  DG  P N2    1 
ATOM   247  N  N3    . DG  A 1  18  ? 56.291 172.234 33.746 1.00 26.06  ? 818  DG  P N3    1 
ATOM   248  C  C4    . DG  A 1  18  ? 56.960 172.579 34.867 1.00 25.50  ? 818  DG  P C4    1 
ATOM   249  P  P     . DC  A 1  19  ? 62.719 170.668 32.381 1.00 28.14  ? 819  DC  P P     1 
ATOM   250  O  OP1   . DC  A 1  19  ? 63.583 169.673 31.695 1.00 27.96  ? 819  DC  P OP1   1 
ATOM   251  O  OP2   . DC  A 1  19  ? 63.351 171.758 33.172 1.00 27.24  ? 819  DC  P OP2   1 
ATOM   252  O  "O5'" . DC  A 1  19  ? 61.759 171.338 31.300 1.00 26.95  ? 819  DC  P "O5'" 1 
ATOM   253  C  "C5'" . DC  A 1  19  ? 60.848 170.540 30.545 1.00 24.18  ? 819  DC  P "C5'" 1 
ATOM   254  C  "C4'" . DC  A 1  19  ? 59.960 171.416 29.695 1.00 25.96  ? 819  DC  P "C4'" 1 
ATOM   255  O  "O4'" . DC  A 1  19  ? 59.004 172.122 30.533 1.00 25.29  ? 819  DC  P "O4'" 1 
ATOM   256  C  "C3'" . DC  A 1  19  ? 60.711 172.488 28.896 1.00 26.76  ? 819  DC  P "C3'" 1 
ATOM   257  O  "O3'" . DC  A 1  19  ? 60.189 172.586 27.565 1.00 27.98  ? 819  DC  P "O3'" 1 
ATOM   258  C  "C2'" . DC  A 1  19  ? 60.424 173.768 29.663 1.00 25.72  ? 819  DC  P "C2'" 1 
ATOM   259  C  "C1'" . DC  A 1  19  ? 59.025 173.502 30.196 1.00 25.23  ? 819  DC  P "C1'" 1 
ATOM   260  N  N1    . DC  A 1  19  ? 58.633 174.292 31.383 1.00 22.45  ? 819  DC  P N1    1 
ATOM   261  C  C2    . DC  A 1  19  ? 57.350 174.863 31.420 1.00 19.53  ? 819  DC  P C2    1 
ATOM   262  O  O2    . DC  A 1  19  ? 56.568 174.651 30.486 1.00 19.59  ? 819  DC  P O2    1 
ATOM   263  N  N3    . DC  A 1  19  ? 56.999 175.629 32.469 1.00 18.67  ? 819  DC  P N3    1 
ATOM   264  C  C4    . DC  A 1  19  ? 57.863 175.834 33.462 1.00 20.83  ? 819  DC  P C4    1 
ATOM   265  N  N4    . DC  A 1  19  ? 57.481 176.623 34.466 1.00 21.86  ? 819  DC  P N4    1 
ATOM   266  C  C5    . DC  A 1  19  ? 59.159 175.243 33.469 1.00 21.20  ? 819  DC  P C5    1 
ATOM   267  C  C6    . DC  A 1  19  ? 59.500 174.486 32.421 1.00 21.21  ? 819  DC  P C6    1 
ATOM   268  P  P     . DC  A 1  20  ? 60.985 173.440 26.448 1.00 29.01  ? 820  DC  P P     1 
ATOM   269  O  OP1   . DC  A 1  20  ? 61.459 172.506 25.398 1.00 30.00  ? 820  DC  P OP1   1 
ATOM   270  O  OP2   . DC  A 1  20  ? 61.957 174.346 27.113 1.00 24.33  ? 820  DC  P OP2   1 
ATOM   271  O  "O5'" . DC  A 1  20  ? 59.860 174.371 25.822 1.00 25.34  ? 820  DC  P "O5'" 1 
ATOM   272  C  "C5'" . DC  A 1  20  ? 58.538 173.889 25.589 1.00 21.95  ? 820  DC  P "C5'" 1 
ATOM   273  C  "C4'" . DC  A 1  20  ? 57.625 175.044 25.251 1.00 23.26  ? 820  DC  P "C4'" 1 
ATOM   274  O  "O4'" . DC  A 1  20  ? 56.876 175.376 26.450 1.00 22.96  ? 820  DC  P "O4'" 1 
ATOM   275  C  "C3'" . DC  A 1  20  ? 58.406 176.306 24.882 1.00 22.89  ? 820  DC  P "C3'" 1 
ATOM   276  O  "O3'" . DC  A 1  20  ? 58.403 176.706 23.533 1.00 22.78  ? 820  DC  P "O3'" 1 
ATOM   277  C  "C2'" . DC  A 1  20  ? 57.794 177.424 25.695 1.00 24.35  ? 820  DC  P "C2'" 1 
ATOM   278  C  "C1'" . DC  A 1  20  ? 56.796 176.785 26.632 1.00 22.90  ? 820  DC  P "C1'" 1 
ATOM   279  N  N1    . DC  A 1  20  ? 57.266 177.121 27.986 1.00 21.18  ? 820  DC  P N1    1 
ATOM   280  C  C2    . DC  A 1  20  ? 56.558 178.070 28.732 1.00 20.41  ? 820  DC  P C2    1 
ATOM   281  O  O2    . DC  A 1  20  ? 55.483 178.495 28.292 1.00 17.25  ? 820  DC  P O2    1 
ATOM   282  N  N3    . DC  A 1  20  ? 57.067 178.493 29.915 1.00 19.98  ? 820  DC  P N3    1 
ATOM   283  C  C4    . DC  A 1  20  ? 58.220 177.986 30.365 1.00 21.12  ? 820  DC  P C4    1 
ATOM   284  N  N4    . DC  A 1  20  ? 58.706 178.449 31.512 1.00 20.03  ? 820  DC  P N4    1 
ATOM   285  C  C5    . DC  A 1  20  ? 58.930 176.981 29.651 1.00 22.02  ? 820  DC  P C5    1 
ATOM   286  C  C6    . DC  A 1  20  ? 58.417 176.572 28.484 1.00 21.57  ? 820  DC  P C6    1 
ATOM   287  P  P     . DA  A 1  21  ? 59.476 177.811 23.073 1.00 20.72  ? 821  DA  P P     1 
ATOM   288  O  OP1   . DA  A 1  21  ? 59.768 177.659 21.626 1.00 24.09  ? 821  DA  P OP1   1 
ATOM   289  O  OP2   . DA  A 1  21  ? 60.591 177.759 24.044 1.00 23.29  ? 821  DA  P OP2   1 
ATOM   290  O  "O5'" . DA  A 1  21  ? 58.683 179.170 23.332 1.00 22.01  ? 821  DA  P "O5'" 1 
ATOM   291  C  "C5'" . DA  A 1  21  ? 57.293 179.268 23.004 1.00 19.27  ? 821  DA  P "C5'" 1 
ATOM   292  C  "C4'" . DA  A 1  21  ? 56.767 180.648 23.318 1.00 18.45  ? 821  DA  P "C4'" 1 
ATOM   293  O  "O4'" . DA  A 1  21  ? 56.443 180.725 24.729 1.00 19.30  ? 821  DA  P "O4'" 1 
ATOM   294  C  "C3'" . DA  A 1  21  ? 57.798 181.738 23.037 1.00 19.41  ? 821  DA  P "C3'" 1 
ATOM   295  O  "O3'" . DA  A 1  21  ? 57.435 182.677 22.043 1.00 18.17  ? 821  DA  P "O3'" 1 
ATOM   296  C  "C2'" . DA  A 1  21  ? 57.997 182.462 24.351 1.00 20.69  ? 821  DA  P "C2'" 1 
ATOM   297  C  "C1'" . DA  A 1  21  ? 56.939 181.929 25.298 1.00 20.25  ? 821  DA  P "C1'" 1 
ATOM   298  N  N9    . DA  A 1  21  ? 57.618 181.604 26.554 1.00 19.48  ? 821  DA  P N9    1 
ATOM   299  C  C8    . DA  A 1  21  ? 58.523 180.594 26.781 1.00 19.13  ? 821  DA  P C8    1 
ATOM   300  N  N7    . DA  A 1  21  ? 59.074 180.637 27.969 1.00 19.57  ? 821  DA  P N7    1 
ATOM   301  C  C5    . DA  A 1  21  ? 58.473 181.729 28.576 1.00 17.57  ? 821  DA  P C5    1 
ATOM   302  C  C6    . DA  A 1  21  ? 58.634 182.313 29.847 1.00 18.65  ? 821  DA  P C6    1 
ATOM   303  N  N6    . DA  A 1  21  ? 59.507 181.878 30.758 1.00 16.00  ? 821  DA  P N6    1 
ATOM   304  N  N1    . DA  A 1  21  ? 57.863 183.382 30.150 1.00 17.70  ? 821  DA  P N1    1 
ATOM   305  C  C2    . DA  A 1  21  ? 57.006 183.835 29.226 1.00 18.45  ? 821  DA  P C2    1 
ATOM   306  N  N3    . DA  A 1  21  ? 56.775 183.380 27.993 1.00 18.12  ? 821  DA  P N3    1 
ATOM   307  C  C4    . DA  A 1  21  ? 57.550 182.314 27.728 1.00 18.13  ? 821  DA  P C4    1 
HETATM 308  N  N1    . DOC A 1  22  ? 59.084 185.941 26.380 1.00 15.18  ? 822  DOC P N1    1 
HETATM 309  C  C2    . DOC A 1  22  ? 59.432 186.194 27.713 1.00 16.92  ? 822  DOC P C2    1 
HETATM 310  N  N3    . DOC A 1  22  ? 60.311 185.376 28.333 1.00 15.48  ? 822  DOC P N3    1 
HETATM 311  C  C4    . DOC A 1  22  ? 60.849 184.351 27.671 1.00 16.74  ? 822  DOC P C4    1 
HETATM 312  C  C5    . DOC A 1  22  ? 60.535 184.087 26.307 1.00 15.21  ? 822  DOC P C5    1 
HETATM 313  C  C6    . DOC A 1  22  ? 59.657 184.900 25.707 1.00 15.63  ? 822  DOC P C6    1 
HETATM 314  O  O2    . DOC A 1  22  ? 58.928 187.169 28.292 1.00 17.77  ? 822  DOC P O2    1 
HETATM 315  N  N4    . DOC A 1  22  ? 61.698 183.561 28.325 1.00 16.14  ? 822  DOC P N4    1 
HETATM 316  C  "C1'" . DOC A 1  22  ? 58.084 186.812 25.735 1.00 14.64  ? 822  DOC P "C1'" 1 
HETATM 317  C  "C2'" . DOC A 1  22  ? 58.683 188.035 25.034 1.00 15.03  ? 822  DOC P "C2'" 1 
HETATM 318  C  "C3'" . DOC A 1  22  ? 58.735 187.572 23.581 1.00 14.67  ? 822  DOC P "C3'" 1 
HETATM 319  C  "C4'" . DOC A 1  22  ? 57.475 186.731 23.477 1.00 15.40  ? 822  DOC P "C4'" 1 
HETATM 320  O  "O4'" . DOC A 1  22  ? 57.378 186.061 24.763 1.00 16.19  ? 822  DOC P "O4'" 1 
HETATM 321  C  "C5'" . DOC A 1  22  ? 57.406 185.733 22.344 1.00 12.07  ? 822  DOC P "C5'" 1 
HETATM 322  O  "O5'" . DOC A 1  22  ? 58.559 184.894 22.326 1.00 14.27  ? 822  DOC P "O5'" 1 
HETATM 323  P  P     . DOC A 1  22  ? 58.586 183.590 21.408 1.00 14.41  ? 822  DOC P P     1 
HETATM 324  O  OP1   . DOC A 1  22  ? 58.163 183.951 20.031 1.00 16.24  ? 822  DOC P OP1   1 
HETATM 325  O  OP2   . DOC A 1  22  ? 59.874 182.879 21.617 1.00 13.08  ? 822  DOC P OP2   1 
ATOM   326  P  P     . DC  B 2  3   ? 73.024 187.989 42.397 1.00 66.50  ? 853  DC  T P     1 
ATOM   327  O  OP1   . DC  B 2  3   ? 73.844 188.065 43.675 1.00 66.26  ? 853  DC  T OP1   1 
ATOM   328  O  OP2   . DC  B 2  3   ? 72.488 189.349 41.962 1.00 64.05  ? 853  DC  T OP2   1 
ATOM   329  O  "O5'" . DC  B 2  3   ? 71.728 187.059 42.750 1.00 62.07  ? 853  DC  T "O5'" 1 
ATOM   330  C  "C5'" . DC  B 2  3   ? 71.704 185.640 42.447 1.00 56.90  ? 853  DC  T "C5'" 1 
ATOM   331  C  "C4'" . DC  B 2  3   ? 70.444 185.018 43.013 1.00 52.17  ? 853  DC  T "C4'" 1 
ATOM   332  O  "O4'" . DC  B 2  3   ? 70.212 185.625 44.300 1.00 50.76  ? 853  DC  T "O4'" 1 
ATOM   333  C  "C3'" . DC  B 2  3   ? 69.186 185.226 42.169 1.00 49.41  ? 853  DC  T "C3'" 1 
ATOM   334  O  "O3'" . DC  B 2  3   ? 68.838 183.986 41.532 1.00 45.62  ? 853  DC  T "O3'" 1 
ATOM   335  C  "C2'" . DC  B 2  3   ? 68.081 185.490 43.199 1.00 49.80  ? 853  DC  T "C2'" 1 
ATOM   336  C  "C1'" . DC  B 2  3   ? 68.847 185.921 44.452 1.00 48.78  ? 853  DC  T "C1'" 1 
ATOM   337  N  N1    . DC  B 2  3   ? 68.711 187.310 44.938 1.00 46.49  ? 853  DC  T N1    1 
ATOM   338  C  C2    . DC  B 2  3   ? 67.461 187.759 45.380 1.00 45.94  ? 853  DC  T C2    1 
ATOM   339  O  O2    . DC  B 2  3   ? 66.474 187.025 45.244 1.00 47.30  ? 853  DC  T O2    1 
ATOM   340  N  N3    . DC  B 2  3   ? 67.360 188.986 45.940 1.00 45.80  ? 853  DC  T N3    1 
ATOM   341  C  C4    . DC  B 2  3   ? 68.440 189.763 46.046 1.00 45.95  ? 853  DC  T C4    1 
ATOM   342  N  N4    . DC  B 2  3   ? 68.302 190.953 46.639 1.00 45.89  ? 853  DC  T N4    1 
ATOM   343  C  C5    . DC  B 2  3   ? 69.712 189.353 45.555 1.00 46.73  ? 853  DC  T C5    1 
ATOM   344  C  C6    . DC  B 2  3   ? 69.800 188.135 45.007 1.00 47.00  ? 853  DC  T C6    1 
ATOM   345  P  P     . DA  B 2  4   ? 69.583 183.497 40.190 1.00 42.41  ? 854  DA  T P     1 
ATOM   346  O  OP1   . DA  B 2  4   ? 68.996 182.175 39.858 1.00 43.08  ? 854  DA  T OP1   1 
ATOM   347  O  OP2   . DA  B 2  4   ? 71.053 183.626 40.349 1.00 43.00  ? 854  DA  T OP2   1 
ATOM   348  O  "O5'" . DA  B 2  4   ? 69.090 184.494 39.059 1.00 41.35  ? 854  DA  T "O5'" 1 
ATOM   349  C  "C5'" . DA  B 2  4   ? 67.706 184.674 38.826 1.00 36.73  ? 854  DA  T "C5'" 1 
ATOM   350  C  "C4'" . DA  B 2  4   ? 67.431 186.100 38.421 1.00 35.25  ? 854  DA  T "C4'" 1 
ATOM   351  O  "O4'" . DA  B 2  4   ? 67.814 186.253 37.030 1.00 31.84  ? 854  DA  T "O4'" 1 
ATOM   352  C  "C3'" . DA  B 2  4   ? 65.945 186.440 38.508 1.00 34.80  ? 854  DA  T "C3'" 1 
ATOM   353  O  "O3'" . DA  B 2  4   ? 65.696 187.668 39.190 1.00 32.29  ? 854  DA  T "O3'" 1 
ATOM   354  C  "C2'" . DA  B 2  4   ? 65.472 186.484 37.073 1.00 32.71  ? 854  DA  T "C2'" 1 
ATOM   355  C  "C1'" . DA  B 2  4   ? 66.717 186.700 36.245 1.00 31.12  ? 854  DA  T "C1'" 1 
ATOM   356  N  N9    . DA  B 2  4   ? 66.658 185.883 35.034 1.00 28.17  ? 854  DA  T N9    1 
ATOM   357  C  C8    . DA  B 2  4   ? 67.220 184.654 34.808 1.00 27.92  ? 854  DA  T C8    1 
ATOM   358  N  N7    . DA  B 2  4   ? 66.951 184.160 33.624 1.00 29.01  ? 854  DA  T N7    1 
ATOM   359  C  C5    . DA  B 2  4   ? 66.164 185.135 33.025 1.00 27.91  ? 854  DA  T C5    1 
ATOM   360  C  C6    . DA  B 2  4   ? 65.556 185.218 31.753 1.00 27.59  ? 854  DA  T C6    1 
ATOM   361  N  N6    . DA  B 2  4   ? 65.658 184.274 30.819 1.00 28.94  ? 854  DA  T N6    1 
ATOM   362  N  N1    . DA  B 2  4   ? 64.836 186.324 31.472 1.00 26.76  ? 854  DA  T N1    1 
ATOM   363  C  C2    . DA  B 2  4   ? 64.745 187.282 32.408 1.00 27.34  ? 854  DA  T C2    1 
ATOM   364  N  N3    . DA  B 2  4   ? 65.273 187.321 33.633 1.00 26.29  ? 854  DA  T N3    1 
ATOM   365  C  C4    . DA  B 2  4   ? 65.980 186.204 33.882 1.00 27.73  ? 854  DA  T C4    1 
HETATM 366  P  P     . 8OG B 2  5   ? 64.505 187.736 40.276 1.00 35.88  ? 855  8OG T P     1 
HETATM 367  O  OP1   . 8OG B 2  5   ? 64.976 188.643 41.361 1.00 35.57  ? 855  8OG T OP1   1 
HETATM 368  O  OP2   . 8OG B 2  5   ? 64.042 186.363 40.618 1.00 32.69  ? 855  8OG T OP2   1 
HETATM 369  O  "O5'" . 8OG B 2  5   ? 63.307 188.447 39.496 1.00 32.70  ? 855  8OG T "O5'" 1 
HETATM 370  C  "C5'" . 8OG B 2  5   ? 63.288 188.480 38.075 1.00 29.24  ? 855  8OG T "C5'" 1 
HETATM 371  C  "C4'" . 8OG B 2  5   ? 61.976 189.027 37.572 1.00 26.47  ? 855  8OG T "C4'" 1 
HETATM 372  O  "O4'" . 8OG B 2  5   ? 62.061 188.936 36.128 1.00 23.49  ? 855  8OG T "O4'" 1 
HETATM 373  C  "C3'" . 8OG B 2  5   ? 60.757 188.200 38.000 1.00 24.24  ? 855  8OG T "C3'" 1 
HETATM 374  O  "O3'" . 8OG B 2  5   ? 59.643 188.981 38.448 1.00 19.61  ? 855  8OG T "O3'" 1 
HETATM 375  C  "C2'" . 8OG B 2  5   ? 60.364 187.424 36.762 1.00 23.20  ? 855  8OG T "C2'" 1 
HETATM 376  C  "C1'" . 8OG B 2  5   ? 61.004 188.154 35.600 1.00 23.49  ? 855  8OG T "C1'" 1 
HETATM 377  N  N9    . 8OG B 2  5   ? 61.566 187.174 34.666 1.00 24.82  ? 855  8OG T N9    1 
HETATM 378  C  C8    . 8OG B 2  5   ? 62.414 186.110 34.951 1.00 23.75  ? 855  8OG T C8    1 
HETATM 379  N  N7    . 8OG B 2  5   ? 62.597 185.331 33.925 1.00 21.69  ? 855  8OG T N7    1 
HETATM 380  C  C5    . 8OG B 2  5   ? 61.874 185.920 32.903 1.00 22.81  ? 855  8OG T C5    1 
HETATM 381  C  C6    . 8OG B 2  5   ? 61.687 185.502 31.576 1.00 22.50  ? 855  8OG T C6    1 
HETATM 382  O  O6    . 8OG B 2  5   ? 62.139 184.495 31.027 1.00 23.00  ? 855  8OG T O6    1 
HETATM 383  N  N1    . 8OG B 2  5   ? 60.872 186.385 30.870 1.00 21.33  ? 855  8OG T N1    1 
HETATM 384  C  C2    . 8OG B 2  5   ? 60.308 187.526 31.392 1.00 20.67  ? 855  8OG T C2    1 
HETATM 385  N  N2    . 8OG B 2  5   ? 59.533 188.243 30.572 1.00 20.65  ? 855  8OG T N2    1 
HETATM 386  N  N3    . 8OG B 2  5   ? 60.484 187.928 32.636 1.00 20.52  ? 855  8OG T N3    1 
HETATM 387  C  C4    . 8OG B 2  5   ? 61.264 187.078 33.333 1.00 22.17  ? 855  8OG T C4    1 
HETATM 388  O  O8    . 8OG B 2  5   ? 62.883 185.930 36.063 1.00 24.99  ? 855  8OG T O8    1 
ATOM   389  P  P     . DT  B 2  6   ? 58.246 188.247 38.780 1.00 15.97  ? 856  DT  T P     1 
ATOM   390  O  OP1   . DT  B 2  6   ? 57.506 189.032 39.791 1.00 19.28  ? 856  DT  T OP1   1 
ATOM   391  O  OP2   . DT  B 2  6   ? 58.506 186.808 39.031 1.00 15.72  ? 856  DT  T OP2   1 
ATOM   392  O  "O5'" . DT  B 2  6   ? 57.461 188.336 37.396 1.00 17.88  ? 856  DT  T "O5'" 1 
ATOM   393  C  "C5'" . DT  B 2  6   ? 57.400 189.567 36.672 1.00 17.55  ? 856  DT  T "C5'" 1 
ATOM   394  C  "C4'" . DT  B 2  6   ? 56.419 189.465 35.525 1.00 19.11  ? 856  DT  T "C4'" 1 
ATOM   395  O  "O4'" . DT  B 2  6   ? 57.085 188.890 34.370 1.00 18.49  ? 856  DT  T "O4'" 1 
ATOM   396  C  "C3'" . DT  B 2  6   ? 55.234 188.561 35.846 1.00 19.30  ? 856  DT  T "C3'" 1 
ATOM   397  O  "O3'" . DT  B 2  6   ? 53.972 189.190 35.905 1.00 17.57  ? 856  DT  T "O3'" 1 
ATOM   398  C  "C2'" . DT  B 2  6   ? 55.216 187.505 34.764 1.00 20.61  ? 856  DT  T "C2'" 1 
ATOM   399  C  "C1'" . DT  B 2  6   ? 56.307 187.866 33.778 1.00 17.44  ? 856  DT  T "C1'" 1 
ATOM   400  N  N1    . DT  B 2  6   ? 57.154 186.664 33.625 1.00 18.44  ? 856  DT  T N1    1 
ATOM   401  C  C2    . DT  B 2  6   ? 57.090 185.942 32.450 1.00 17.28  ? 856  DT  T C2    1 
ATOM   402  O  O2    . DT  B 2  6   ? 56.459 186.301 31.467 1.00 14.81  ? 856  DT  T O2    1 
ATOM   403  N  N3    . DT  B 2  6   ? 57.799 184.766 32.470 1.00 15.86  ? 856  DT  T N3    1 
ATOM   404  C  C4    . DT  B 2  6   ? 58.554 184.260 33.506 1.00 15.12  ? 856  DT  T C4    1 
ATOM   405  O  O4    . DT  B 2  6   ? 59.104 183.170 33.381 1.00 16.78  ? 856  DT  T O4    1 
ATOM   406  C  C5    . DT  B 2  6   ? 58.618 185.091 34.686 1.00 16.18  ? 856  DT  T C5    1 
ATOM   407  C  C7    . DT  B 2  6   ? 59.420 184.632 35.866 1.00 15.17  ? 856  DT  T C7    1 
ATOM   408  C  C6    . DT  B 2  6   ? 57.939 186.241 34.677 1.00 16.11  ? 856  DT  T C6    1 
ATOM   409  P  P     . DG  B 2  7   ? 52.786 188.435 36.679 1.00 15.67  ? 857  DG  T P     1 
ATOM   410  O  OP1   . DG  B 2  7   ? 51.873 189.427 37.291 1.00 17.14  ? 857  DG  T OP1   1 
ATOM   411  O  OP2   . DG  B 2  7   ? 53.434 187.423 37.548 1.00 16.74  ? 857  DG  T OP2   1 
ATOM   412  O  "O5'" . DG  B 2  7   ? 52.039 187.650 35.511 1.00 17.35  ? 857  DG  T "O5'" 1 
ATOM   413  C  "C5'" . DG  B 2  7   ? 52.335 186.279 35.261 1.00 17.51  ? 857  DG  T "C5'" 1 
ATOM   414  C  "C4'" . DG  B 2  7   ? 51.721 185.831 33.957 1.00 18.51  ? 857  DG  T "C4'" 1 
ATOM   415  O  "O4'" . DG  B 2  7   ? 52.823 185.550 33.058 1.00 17.07  ? 857  DG  T "O4'" 1 
ATOM   416  C  "C3'" . DG  B 2  7   ? 50.932 184.531 34.107 1.00 17.00  ? 857  DG  T "C3'" 1 
ATOM   417  O  "O3'" . DG  B 2  7   ? 49.608 184.562 33.604 1.00 16.68  ? 857  DG  T "O3'" 1 
ATOM   418  C  "C2'" . DG  B 2  7   ? 51.713 183.489 33.343 1.00 19.04  ? 857  DG  T "C2'" 1 
ATOM   419  C  "C1'" . DG  B 2  7   ? 52.762 184.231 32.551 1.00 18.40  ? 857  DG  T "C1'" 1 
ATOM   420  N  N9    . DG  B 2  7   ? 54.022 183.558 32.843 1.00 19.79  ? 857  DG  T N9    1 
ATOM   421  C  C8    . DG  B 2  7   ? 54.779 183.639 33.990 1.00 19.50  ? 857  DG  T C8    1 
ATOM   422  N  N7    . DG  B 2  7   ? 55.746 182.760 34.027 1.00 18.37  ? 857  DG  T N7    1 
ATOM   423  C  C5    . DG  B 2  7   ? 55.641 182.090 32.816 1.00 19.63  ? 857  DG  T C5    1 
ATOM   424  C  C6    . DG  B 2  7   ? 56.384 181.002 32.298 1.00 19.47  ? 857  DG  T C6    1 
ATOM   425  O  O6    . DG  B 2  7   ? 57.293 180.366 32.836 1.00 19.86  ? 857  DG  T O6    1 
ATOM   426  N  N1    . DG  B 2  7   ? 55.956 180.656 31.022 1.00 19.18  ? 857  DG  T N1    1 
ATOM   427  C  C2    . DG  B 2  7   ? 54.930 181.267 30.340 1.00 18.05  ? 857  DG  T C2    1 
ATOM   428  N  N2    . DG  B 2  7   ? 54.674 180.826 29.112 1.00 17.98  ? 857  DG  T N2    1 
ATOM   429  N  N3    . DG  B 2  7   ? 54.212 182.250 30.826 1.00 19.13  ? 857  DG  T N3    1 
ATOM   430  C  C4    . DG  B 2  7   ? 54.616 182.611 32.057 1.00 19.26  ? 857  DG  T C4    1 
ATOM   431  P  P     . DG  B 2  8   ? 48.636 183.323 33.924 1.00 17.50  ? 858  DG  T P     1 
ATOM   432  O  OP1   . DG  B 2  8   ? 47.238 183.736 33.684 1.00 17.40  ? 858  DG  T OP1   1 
ATOM   433  O  OP2   . DG  B 2  8   ? 49.020 182.739 35.235 1.00 15.21  ? 858  DG  T OP2   1 
ATOM   434  O  "O5'" . DG  B 2  8   ? 49.023 182.247 32.820 1.00 16.58  ? 858  DG  T "O5'" 1 
ATOM   435  C  "C5'" . DG  B 2  8   ? 48.820 182.531 31.445 1.00 15.60  ? 858  DG  T "C5'" 1 
ATOM   436  C  "C4'" . DG  B 2  8   ? 48.757 181.251 30.650 1.00 15.88  ? 858  DG  T "C4'" 1 
ATOM   437  O  "O4'" . DG  B 2  8   ? 50.046 180.599 30.665 1.00 15.53  ? 858  DG  T "O4'" 1 
ATOM   438  C  "C3'" . DG  B 2  8   ? 47.742 180.216 31.126 1.00 14.38  ? 858  DG  T "C3'" 1 
ATOM   439  O  "O3'" . DG  B 2  8   ? 47.136 179.637 29.965 1.00 16.48  ? 858  DG  T "O3'" 1 
ATOM   440  C  "C2'" . DG  B 2  8   ? 48.589 179.228 31.913 1.00 16.20  ? 858  DG  T "C2'" 1 
ATOM   441  C  "C1'" . DG  B 2  8   ? 49.964 179.312 31.254 1.00 15.18  ? 858  DG  T "C1'" 1 
ATOM   442  N  N9    . DG  B 2  8   ? 51.088 179.200 32.181 1.00 15.49  ? 858  DG  T N9    1 
ATOM   443  C  C8    . DG  B 2  8   ? 51.242 179.888 33.361 1.00 15.90  ? 858  DG  T C8    1 
ATOM   444  N  N7    . DG  B 2  8   ? 52.358 179.611 33.975 1.00 15.33  ? 858  DG  T N7    1 
ATOM   445  C  C5    . DG  B 2  8   ? 52.980 178.677 33.158 1.00 14.09  ? 858  DG  T C5    1 
ATOM   446  C  C6    . DG  B 2  8   ? 54.231 178.011 33.310 1.00 15.35  ? 858  DG  T C6    1 
ATOM   447  O  O6    . DG  B 2  8   ? 55.051 178.106 34.232 1.00 13.36  ? 858  DG  T O6    1 
ATOM   448  N  N1    . DG  B 2  8   ? 54.486 177.157 32.245 1.00 13.56  ? 858  DG  T N1    1 
ATOM   449  C  C2    . DG  B 2  8   ? 53.646 176.955 31.182 1.00 16.17  ? 858  DG  T C2    1 
ATOM   450  N  N2    . DG  B 2  8   ? 54.068 176.070 30.269 1.00 16.61  ? 858  DG  T N2    1 
ATOM   451  N  N3    . DG  B 2  8   ? 52.476 177.568 31.028 1.00 15.25  ? 858  DG  T N3    1 
ATOM   452  C  C4    . DG  B 2  8   ? 52.211 178.410 32.047 1.00 14.14  ? 858  DG  T C4    1 
ATOM   453  P  P     . DC  B 2  9   ? 46.020 178.491 30.110 1.00 14.01  ? 859  DC  T P     1 
ATOM   454  O  OP1   . DC  B 2  9   ? 45.348 178.428 28.795 1.00 16.67  ? 859  DC  T OP1   1 
ATOM   455  O  OP2   . DC  B 2  9   ? 45.219 178.698 31.334 1.00 16.24  ? 859  DC  T OP2   1 
ATOM   456  O  "O5'" . DC  B 2  9   ? 46.884 177.171 30.291 1.00 18.29  ? 859  DC  T "O5'" 1 
ATOM   457  C  "C5'" . DC  B 2  9   ? 47.838 176.801 29.301 1.00 18.88  ? 859  DC  T "C5'" 1 
ATOM   458  C  "C4'" . DC  B 2  9   ? 48.508 175.500 29.671 1.00 20.45  ? 859  DC  T "C4'" 1 
ATOM   459  O  "O4'" . DC  B 2  9   ? 49.622 175.714 30.571 1.00 22.51  ? 859  DC  T "O4'" 1 
ATOM   460  C  "C3'" . DC  B 2  9   ? 47.606 174.455 30.333 1.00 20.26  ? 859  DC  T "C3'" 1 
ATOM   461  O  "O3'" . DC  B 2  9   ? 47.849 173.201 29.716 1.00 21.32  ? 859  DC  T "O3'" 1 
ATOM   462  C  "C2'" . DC  B 2  9   ? 48.104 174.415 31.769 1.00 19.33  ? 859  DC  T "C2'" 1 
ATOM   463  C  "C1'" . DC  B 2  9   ? 49.578 174.732 31.591 1.00 20.12  ? 859  DC  T "C1'" 1 
ATOM   464  N  N1    . DC  B 2  9   ? 50.310 175.250 32.767 1.00 20.02  ? 859  DC  T N1    1 
ATOM   465  C  C2    . DC  B 2  9   ? 51.633 174.828 32.970 1.00 19.74  ? 859  DC  T C2    1 
ATOM   466  O  O2    . DC  B 2  9   ? 52.150 174.045 32.159 1.00 23.86  ? 859  DC  T O2    1 
ATOM   467  N  N3    . DC  B 2  9   ? 52.316 175.283 34.037 1.00 18.07  ? 859  DC  T N3    1 
ATOM   468  C  C4    . DC  B 2  9   ? 51.738 176.128 34.889 1.00 18.91  ? 859  DC  T C4    1 
ATOM   469  N  N4    . DC  B 2  9   ? 52.458 176.544 35.932 1.00 18.25  ? 859  DC  T N4    1 
ATOM   470  C  C5    . DC  B 2  9   ? 50.398 176.582 34.710 1.00 18.85  ? 859  DC  T C5    1 
ATOM   471  C  C6    . DC  B 2  9   ? 49.727 176.122 33.647 1.00 20.24  ? 859  DC  T C6    1 
ATOM   472  P  P     . DA  B 2  10  ? 46.702 172.074 29.681 1.00 20.54  ? 860  DA  T P     1 
ATOM   473  O  OP1   . DA  B 2  10  ? 46.003 172.147 28.372 1.00 21.16  ? 860  DA  T OP1   1 
ATOM   474  O  OP2   . DA  B 2  10  ? 45.913 172.089 30.931 1.00 23.86  ? 860  DA  T OP2   1 
ATOM   475  O  "O5'" . DA  B 2  10  ? 47.602 170.770 29.672 1.00 24.60  ? 860  DA  T "O5'" 1 
ATOM   476  C  "C5'" . DA  B 2  10  ? 48.704 170.684 28.763 1.00 26.70  ? 860  DA  T "C5'" 1 
ATOM   477  C  "C4'" . DA  B 2  10  ? 49.730 169.707 29.277 1.00 29.48  ? 860  DA  T "C4'" 1 
ATOM   478  O  "O4'" . DA  B 2  10  ? 50.528 170.292 30.333 1.00 29.16  ? 860  DA  T "O4'" 1 
ATOM   479  C  "C3'" . DA  B 2  10  ? 49.100 168.447 29.852 1.00 31.25  ? 860  DA  T "C3'" 1 
ATOM   480  O  "O3'" . DA  B 2  10  ? 49.781 167.304 29.368 1.00 34.59  ? 860  DA  T "O3'" 1 
ATOM   481  C  "C2'" . DA  B 2  10  ? 49.238 168.612 31.355 1.00 29.58  ? 860  DA  T "C2'" 1 
ATOM   482  C  "C1'" . DA  B 2  10  ? 50.465 169.498 31.505 1.00 28.95  ? 860  DA  T "C1'" 1 
ATOM   483  N  N9    . DA  B 2  10  ? 50.408 170.410 32.651 1.00 28.62  ? 860  DA  T N9    1 
ATOM   484  C  C8    . DA  B 2  10  ? 49.408 171.300 32.972 1.00 28.71  ? 860  DA  T C8    1 
ATOM   485  N  N7    . DA  B 2  10  ? 49.649 171.999 34.055 1.00 29.07  ? 860  DA  T N7    1 
ATOM   486  C  C5    . DA  B 2  10  ? 50.888 171.539 34.480 1.00 27.96  ? 860  DA  T C5    1 
ATOM   487  C  C6    . DA  B 2  10  ? 51.704 171.888 35.574 1.00 26.55  ? 860  DA  T C6    1 
ATOM   488  N  N6    . DA  B 2  10  ? 51.386 172.827 36.465 1.00 26.02  ? 860  DA  T N6    1 
ATOM   489  N  N1    . DA  B 2  10  ? 52.874 171.232 35.719 1.00 26.80  ? 860  DA  T N1    1 
ATOM   490  C  C2    . DA  B 2  10  ? 53.198 170.295 34.818 1.00 28.05  ? 860  DA  T C2    1 
ATOM   491  N  N3    . DA  B 2  10  ? 52.522 169.884 33.745 1.00 25.62  ? 860  DA  T N3    1 
ATOM   492  C  C4    . DA  B 2  10  ? 51.363 170.553 33.630 1.00 28.19  ? 860  DA  T C4    1 
ATOM   493  P  P     . DC  B 2  11  ? 49.035 165.894 29.364 1.00 36.85  ? 861  DC  T P     1 
ATOM   494  O  OP1   . DC  B 2  11  ? 49.379 165.217 28.088 1.00 40.99  ? 861  DC  T OP1   1 
ATOM   495  O  OP2   . DC  B 2  11  ? 47.603 166.105 29.723 1.00 34.52  ? 861  DC  T OP2   1 
ATOM   496  O  "O5'" . DC  B 2  11  ? 49.772 165.139 30.556 1.00 37.35  ? 861  DC  T "O5'" 1 
ATOM   497  C  "C5'" . DC  B 2  11  ? 51.195 165.021 30.558 1.00 35.21  ? 861  DC  T "C5'" 1 
ATOM   498  C  "C4'" . DC  B 2  11  ? 51.689 164.578 31.914 1.00 33.41  ? 861  DC  T "C4'" 1 
ATOM   499  O  "O4'" . DC  B 2  11  ? 51.797 165.706 32.825 1.00 32.80  ? 861  DC  T "O4'" 1 
ATOM   500  C  "C3'" . DC  B 2  11  ? 50.792 163.542 32.595 1.00 31.78  ? 861  DC  T "C3'" 1 
ATOM   501  O  "O3'" . DC  B 2  11  ? 51.561 162.438 33.058 1.00 31.54  ? 861  DC  T "O3'" 1 
ATOM   502  C  "C2'" . DC  B 2  11  ? 50.194 164.299 33.767 1.00 32.90  ? 861  DC  T "C2'" 1 
ATOM   503  C  "C1'" . DC  B 2  11  ? 51.265 165.332 34.081 1.00 30.98  ? 861  DC  T "C1'" 1 
ATOM   504  N  N1    . DC  B 2  11  ? 50.777 166.545 34.779 1.00 27.37  ? 861  DC  T N1    1 
ATOM   505  C  C2    . DC  B 2  11  ? 51.572 167.114 35.783 1.00 27.21  ? 861  DC  T C2    1 
ATOM   506  O  O2    . DC  B 2  11  ? 52.682 166.631 36.021 1.00 28.39  ? 861  DC  T O2    1 
ATOM   507  N  N3    . DC  B 2  11  ? 51.110 168.183 36.470 1.00 26.71  ? 861  DC  T N3    1 
ATOM   508  C  C4    . DC  B 2  11  ? 49.914 168.693 36.183 1.00 26.01  ? 861  DC  T C4    1 
ATOM   509  N  N4    . DC  B 2  11  ? 49.494 169.741 36.901 1.00 25.20  ? 861  DC  T N4    1 
ATOM   510  C  C5    . DC  B 2  11  ? 49.093 168.152 35.152 1.00 25.46  ? 861  DC  T C5    1 
ATOM   511  C  C6    . DC  B 2  11  ? 49.560 167.092 34.478 1.00 25.47  ? 861  DC  T C6    1 
ATOM   512  P  P     . DT  B 2  12  ? 50.825 161.149 33.686 1.00 29.75  ? 862  DT  T P     1 
ATOM   513  O  OP1   . DT  B 2  12  ? 51.267 159.961 32.916 1.00 29.53  ? 862  DT  T OP1   1 
ATOM   514  O  OP2   . DT  B 2  12  ? 49.373 161.417 33.847 1.00 27.80  ? 862  DT  T OP2   1 
ATOM   515  O  "O5'" . DT  B 2  12  ? 51.492 161.073 35.124 1.00 27.91  ? 862  DT  T "O5'" 1 
ATOM   516  C  "C5'" . DT  B 2  12  ? 52.906 161.187 35.251 1.00 27.79  ? 862  DT  T "C5'" 1 
ATOM   517  C  "C4'" . DT  B 2  12  ? 53.299 161.295 36.703 1.00 28.68  ? 862  DT  T "C4'" 1 
ATOM   518  O  "O4'" . DT  B 2  12  ? 52.916 162.588 37.228 1.00 28.61  ? 862  DT  T "O4'" 1 
ATOM   519  C  "C3'" . DT  B 2  12  ? 52.656 160.244 37.604 1.00 28.01  ? 862  DT  T "C3'" 1 
ATOM   520  O  "O3'" . DT  B 2  12  ? 53.638 159.717 38.491 1.00 29.31  ? 862  DT  T "O3'" 1 
ATOM   521  C  "C2'" . DT  B 2  12  ? 51.562 161.007 38.331 1.00 27.92  ? 862  DT  T "C2'" 1 
ATOM   522  C  "C1'" . DT  B 2  12  ? 52.098 162.433 38.378 1.00 29.04  ? 862  DT  T "C1'" 1 
ATOM   523  N  N1    . DT  B 2  12  ? 51.067 163.504 38.351 1.00 29.20  ? 862  DT  T N1    1 
ATOM   524  C  C2    . DT  B 2  12  ? 51.133 164.496 39.313 1.00 29.81  ? 862  DT  T C2    1 
ATOM   525  O  O2    . DT  B 2  12  ? 51.986 164.531 40.189 1.00 30.54  ? 862  DT  T O2    1 
ATOM   526  N  N3    . DT  B 2  12  ? 50.155 165.455 39.213 1.00 28.78  ? 862  DT  T N3    1 
ATOM   527  C  C4    . DT  B 2  12  ? 49.141 165.523 38.277 1.00 29.08  ? 862  DT  T C4    1 
ATOM   528  O  O4    . DT  B 2  12  ? 48.338 166.454 38.310 1.00 29.62  ? 862  DT  T O4    1 
ATOM   529  C  C5    . DT  B 2  12  ? 49.123 164.451 37.309 1.00 28.56  ? 862  DT  T C5    1 
ATOM   530  C  C7    . DT  B 2  12  ? 48.050 164.433 36.267 1.00 26.58  ? 862  DT  T C7    1 
ATOM   531  C  C6    . DT  B 2  12  ? 50.076 163.511 37.390 1.00 28.90  ? 862  DT  T C6    1 
ATOM   532  P  P     . DG  B 2  13  ? 53.354 158.349 39.284 1.00 28.88  ? 863  DG  T P     1 
ATOM   533  O  OP1   . DG  B 2  13  ? 54.660 157.680 39.487 1.00 29.09  ? 863  DG  T OP1   1 
ATOM   534  O  OP2   . DG  B 2  13  ? 52.241 157.598 38.657 1.00 28.82  ? 863  DG  T OP2   1 
ATOM   535  O  "O5'" . DG  B 2  13  ? 52.835 158.887 40.684 1.00 31.18  ? 863  DG  T "O5'" 1 
ATOM   536  C  "C5'" . DG  B 2  13  ? 53.640 159.781 41.445 1.00 34.38  ? 863  DG  T "C5'" 1 
ATOM   537  C  "C4'" . DG  B 2  13  ? 52.861 160.318 42.621 1.00 36.52  ? 863  DG  T "C4'" 1 
ATOM   538  O  "O4'" . DG  B 2  13  ? 51.966 161.380 42.208 1.00 37.16  ? 863  DG  T "O4'" 1 
ATOM   539  C  "C3'" . DG  B 2  13  ? 52.002 159.291 43.359 1.00 38.10  ? 863  DG  T "C3'" 1 
ATOM   540  O  "O3'" . DG  B 2  13  ? 52.180 159.491 44.757 1.00 41.95  ? 863  DG  T "O3'" 1 
ATOM   541  C  "C2'" . DG  B 2  13  ? 50.584 159.646 42.934 1.00 35.81  ? 863  DG  T "C2'" 1 
ATOM   542  C  "C1'" . DG  B 2  13  ? 50.687 161.152 42.773 1.00 35.42  ? 863  DG  T "C1'" 1 
ATOM   543  N  N9    . DG  B 2  13  ? 49.692 161.812 41.928 1.00 33.36  ? 863  DG  T N9    1 
ATOM   544  C  C8    . DG  B 2  13  ? 49.133 161.354 40.758 1.00 32.66  ? 863  DG  T C8    1 
ATOM   545  N  N7    . DG  B 2  13  ? 48.275 162.191 40.238 1.00 31.66  ? 863  DG  T N7    1 
ATOM   546  C  C5    . DG  B 2  13  ? 48.266 163.269 41.117 1.00 31.96  ? 863  DG  T C5    1 
ATOM   547  C  C6    . DG  B 2  13  ? 47.521 164.493 41.087 1.00 30.88  ? 863  DG  T C6    1 
ATOM   548  O  O6    . DG  B 2  13  ? 46.700 164.884 40.246 1.00 27.88  ? 863  DG  T O6    1 
ATOM   549  N  N1    . DG  B 2  13  ? 47.813 165.292 42.186 1.00 30.41  ? 863  DG  T N1    1 
ATOM   550  C  C2    . DG  B 2  13  ? 48.697 164.968 43.188 1.00 32.15  ? 863  DG  T C2    1 
ATOM   551  N  N2    . DG  B 2  13  ? 48.830 165.866 44.175 1.00 32.11  ? 863  DG  T N2    1 
ATOM   552  N  N3    . DG  B 2  13  ? 49.397 163.846 43.224 1.00 31.72  ? 863  DG  T N3    1 
ATOM   553  C  C4    . DG  B 2  13  ? 49.132 163.048 42.167 1.00 32.93  ? 863  DG  T C4    1 
ATOM   554  P  P     . DG  B 2  14  ? 51.610 158.419 45.811 1.00 45.66  ? 864  DG  T P     1 
ATOM   555  O  OP1   . DG  B 2  14  ? 52.774 157.662 46.343 1.00 45.91  ? 864  DG  T OP1   1 
ATOM   556  O  OP2   . DG  B 2  14  ? 50.457 157.687 45.214 1.00 43.17  ? 864  DG  T OP2   1 
ATOM   557  O  "O5'" . DG  B 2  14  ? 51.041 159.362 46.957 1.00 47.65  ? 864  DG  T "O5'" 1 
ATOM   558  C  "C5'" . DG  B 2  14  ? 50.448 160.598 46.594 1.00 51.47  ? 864  DG  T "C5'" 1 
ATOM   559  C  "C4'" . DG  B 2  14  ? 50.009 161.370 47.812 1.00 53.77  ? 864  DG  T "C4'" 1 
ATOM   560  O  "O4'" . DG  B 2  14  ? 49.303 162.521 47.302 1.00 54.56  ? 864  DG  T "O4'" 1 
ATOM   561  C  "C3'" . DG  B 2  14  ? 49.005 160.630 48.690 1.00 56.00  ? 864  DG  T "C3'" 1 
ATOM   562  O  "O3'" . DG  B 2  14  ? 49.135 161.045 50.056 1.00 59.51  ? 864  DG  T "O3'" 1 
ATOM   563  C  "C2'" . DG  B 2  14  ? 47.660 160.997 48.085 1.00 54.85  ? 864  DG  T "C2'" 1 
ATOM   564  C  "C1'" . DG  B 2  14  ? 47.895 162.343 47.410 1.00 53.10  ? 864  DG  T "C1'" 1 
ATOM   565  N  N9    . DG  B 2  14  ? 47.343 162.393 46.059 1.00 50.39  ? 864  DG  T N9    1 
ATOM   566  C  C8    . DG  B 2  14  ? 47.562 161.492 45.043 1.00 49.89  ? 864  DG  T C8    1 
ATOM   567  N  N7    . DG  B 2  14  ? 46.897 161.770 43.958 1.00 48.64  ? 864  DG  T N7    1 
ATOM   568  C  C5    . DG  B 2  14  ? 46.203 162.929 44.269 1.00 49.48  ? 864  DG  T C5    1 
ATOM   569  C  C6    . DG  B 2  14  ? 45.301 163.691 43.491 1.00 50.57  ? 864  DG  T C6    1 
ATOM   570  O  O6    . DG  B 2  14  ? 44.911 163.482 42.334 1.00 51.96  ? 864  DG  T O6    1 
ATOM   571  N  N1    . DG  B 2  14  ? 44.830 164.796 44.193 1.00 50.66  ? 864  DG  T N1    1 
ATOM   572  C  C2    . DG  B 2  14  ? 45.178 165.120 45.482 1.00 50.77  ? 864  DG  T C2    1 
ATOM   573  N  N2    . DG  B 2  14  ? 44.619 166.227 45.985 1.00 50.68  ? 864  DG  T N2    1 
ATOM   574  N  N3    . DG  B 2  14  ? 46.011 164.411 46.221 1.00 49.77  ? 864  DG  T N3    1 
ATOM   575  C  C4    . DG  B 2  14  ? 46.481 163.336 45.558 1.00 49.92  ? 864  DG  T C4    1 
ATOM   576  P  P     . DC  B 2  15  ? 48.072 160.538 51.153 1.00 61.89  ? 865  DC  T P     1 
ATOM   577  O  OP1   . DC  B 2  15  ? 48.558 160.982 52.484 1.00 61.87  ? 865  DC  T OP1   1 
ATOM   578  O  OP2   . DC  B 2  15  ? 47.787 159.099 50.919 1.00 62.41  ? 865  DC  T OP2   1 
ATOM   579  O  "O5'" . DC  B 2  15  ? 46.761 161.360 50.788 1.00 61.69  ? 865  DC  T "O5'" 1 
ATOM   580  C  "C5'" . DC  B 2  15  ? 46.719 162.771 50.975 1.00 64.33  ? 865  DC  T "C5'" 1 
ATOM   581  C  "C4'" . DC  B 2  15  ? 45.297 163.268 50.877 1.00 66.36  ? 865  DC  T "C4'" 1 
ATOM   582  O  "O4'" . DC  B 2  15  ? 44.909 163.431 49.491 1.00 65.57  ? 865  DC  T "O4'" 1 
ATOM   583  C  "C3'" . DC  B 2  15  ? 44.264 162.333 51.508 1.00 68.49  ? 865  DC  T "C3'" 1 
ATOM   584  O  "O3'" . DC  B 2  15  ? 43.310 163.077 52.262 1.00 72.20  ? 865  DC  T "O3'" 1 
ATOM   585  C  "C2'" . DC  B 2  15  ? 43.594 161.683 50.311 1.00 67.24  ? 865  DC  T "C2'" 1 
ATOM   586  C  "C1'" . DC  B 2  15  ? 43.665 162.788 49.272 1.00 65.17  ? 865  DC  T "C1'" 1 
ATOM   587  N  N1    . DC  B 2  15  ? 43.615 162.338 47.866 1.00 62.94  ? 865  DC  T N1    1 
ATOM   588  C  C2    . DC  B 2  15  ? 42.746 162.995 46.973 1.00 61.86  ? 865  DC  T C2    1 
ATOM   589  O  O2    . DC  B 2  15  ? 42.069 163.957 47.379 1.00 61.61  ? 865  DC  T O2    1 
ATOM   590  N  N3    . DC  B 2  15  ? 42.670 162.567 45.692 1.00 60.77  ? 865  DC  T N3    1 
ATOM   591  C  C4    . DC  B 2  15  ? 43.419 161.537 45.286 1.00 60.67  ? 865  DC  T C4    1 
ATOM   592  N  N4    . DC  B 2  15  ? 43.304 161.142 44.016 1.00 59.63  ? 865  DC  T N4    1 
ATOM   593  C  C5    . DC  B 2  15  ? 44.320 160.864 46.165 1.00 60.51  ? 865  DC  T C5    1 
ATOM   594  C  C6    . DC  B 2  15  ? 44.387 161.294 47.431 1.00 61.68  ? 865  DC  T C6    1 
ATOM   595  P  P     . DC  B 2  16  ? 42.300 162.309 53.247 1.00 74.82  ? 866  DC  T P     1 
ATOM   596  O  OP1   . DC  B 2  16  ? 42.364 163.008 54.557 1.00 75.14  ? 866  DC  T OP1   1 
ATOM   597  O  OP2   . DC  B 2  16  ? 42.550 160.846 53.183 1.00 74.04  ? 866  DC  T OP2   1 
ATOM   598  O  "O5'" . DC  B 2  16  ? 40.880 162.597 52.592 1.00 75.83  ? 866  DC  T "O5'" 1 
ATOM   599  C  "C5'" . DC  B 2  16  ? 40.484 163.929 52.278 1.00 79.21  ? 866  DC  T "C5'" 1 
ATOM   600  C  "C4'" . DC  B 2  16  ? 39.264 163.911 51.390 1.00 81.54  ? 866  DC  T "C4'" 1 
ATOM   601  O  "O4'" . DC  B 2  16  ? 39.625 163.457 50.062 1.00 81.88  ? 866  DC  T "O4'" 1 
ATOM   602  C  "C3'" . DC  B 2  16  ? 38.172 162.962 51.885 1.00 83.40  ? 866  DC  T "C3'" 1 
ATOM   603  O  "O3'" . DC  B 2  16  ? 36.883 163.537 51.690 1.00 86.42  ? 866  DC  T "O3'" 1 
ATOM   604  C  "C2'" . DC  B 2  16  ? 38.335 161.742 50.999 1.00 82.86  ? 866  DC  T "C2'" 1 
ATOM   605  C  "C1'" . DC  B 2  16  ? 38.794 162.369 49.692 1.00 81.77  ? 866  DC  T "C1'" 1 
ATOM   606  N  N1    . DC  B 2  16  ? 39.556 161.480 48.791 1.00 80.55  ? 866  DC  T N1    1 
ATOM   607  C  C2    . DC  B 2  16  ? 39.293 161.532 47.412 1.00 79.57  ? 866  DC  T C2    1 
ATOM   608  O  O2    . DC  B 2  16  ? 38.458 162.349 46.985 1.00 79.12  ? 866  DC  T O2    1 
ATOM   609  N  N3    . DC  B 2  16  ? 39.955 160.692 46.581 1.00 79.31  ? 866  DC  T N3    1 
ATOM   610  C  C4    . DC  B 2  16  ? 40.849 159.832 47.074 1.00 78.95  ? 866  DC  T C4    1 
ATOM   611  N  N4    . DC  B 2  16  ? 41.463 159.010 46.217 1.00 77.89  ? 866  DC  T N4    1 
ATOM   612  C  C5    . DC  B 2  16  ? 41.151 159.772 48.466 1.00 79.08  ? 866  DC  T C5    1 
ATOM   613  C  C6    . DC  B 2  16  ? 40.490 160.606 49.280 1.00 80.08  ? 866  DC  T C6    1 
ATOM   614  P  P     . DG  B 2  17  ? 35.728 163.268 52.770 1.00 88.55  ? 867  DG  T P     1 
ATOM   615  O  OP1   . DG  B 2  17  ? 35.816 164.358 53.776 1.00 88.65  ? 867  DG  T OP1   1 
ATOM   616  O  OP2   . DG  B 2  17  ? 35.816 161.850 53.212 1.00 88.37  ? 867  DG  T OP2   1 
ATOM   617  O  "O5'" . DG  B 2  17  ? 34.387 163.447 51.933 1.00 88.71  ? 867  DG  T "O5'" 1 
ATOM   618  C  "C5'" . DG  B 2  17  ? 34.156 164.623 51.163 1.00 89.53  ? 867  DG  T "C5'" 1 
ATOM   619  C  "C4'" . DG  B 2  17  ? 33.482 164.266 49.860 1.00 90.56  ? 867  DG  T "C4'" 1 
ATOM   620  O  "O4'" . DG  B 2  17  ? 34.415 163.564 49.000 1.00 90.36  ? 867  DG  T "O4'" 1 
ATOM   621  C  "C3'" . DG  B 2  17  ? 32.268 163.346 50.009 1.00 91.74  ? 867  DG  T "C3'" 1 
ATOM   622  O  "O3'" . DG  B 2  17  ? 31.237 163.729 49.098 1.00 94.26  ? 867  DG  T "O3'" 1 
ATOM   623  C  "C2'" . DG  B 2  17  ? 32.811 161.985 49.615 1.00 90.94  ? 867  DG  T "C2'" 1 
ATOM   624  C  "C1'" . DG  B 2  17  ? 33.818 162.360 48.545 1.00 89.90  ? 867  DG  T "C1'" 1 
ATOM   625  N  N9    . DG  B 2  17  ? 34.871 161.373 48.315 1.00 88.05  ? 867  DG  T N9    1 
ATOM   626  C  C8    . DG  B 2  17  ? 35.673 160.772 49.256 1.00 87.42  ? 867  DG  T C8    1 
ATOM   627  N  N7    . DG  B 2  17  ? 36.500 159.901 48.743 1.00 87.30  ? 867  DG  T N7    1 
ATOM   628  C  C5    . DG  B 2  17  ? 36.234 159.934 47.380 1.00 86.94  ? 867  DG  T C5    1 
ATOM   629  C  C6    . DG  B 2  17  ? 36.813 159.198 46.309 1.00 86.47  ? 867  DG  T C6    1 
ATOM   630  O  O6    . DG  B 2  17  ? 37.704 158.339 46.355 1.00 86.42  ? 867  DG  T O6    1 
ATOM   631  N  N1    . DG  B 2  17  ? 36.247 159.545 45.087 1.00 85.80  ? 867  DG  T N1    1 
ATOM   632  C  C2    . DG  B 2  17  ? 35.253 160.476 44.912 1.00 85.78  ? 867  DG  T C2    1 
ATOM   633  N  N2    . DG  B 2  17  ? 34.841 160.670 43.651 1.00 85.01  ? 867  DG  T N2    1 
ATOM   634  N  N3    . DG  B 2  17  ? 34.704 161.165 45.898 1.00 85.98  ? 867  DG  T N3    1 
ATOM   635  C  C4    . DG  B 2  17  ? 35.238 160.845 47.098 1.00 86.99  ? 867  DG  T C4    1 
ATOM   636  P  P     . DT  B 2  18  ? 29.746 163.164 49.298 1.00 96.64  ? 868  DT  T P     1 
ATOM   637  O  OP1   . DT  B 2  18  ? 28.915 164.292 49.793 1.00 97.15  ? 868  DT  T OP1   1 
ATOM   638  O  OP2   . DT  B 2  18  ? 29.802 161.895 50.073 1.00 96.44  ? 868  DT  T OP2   1 
ATOM   639  O  "O5'" . DT  B 2  18  ? 29.275 162.813 47.819 1.00 97.13  ? 868  DT  T "O5'" 1 
ATOM   640  C  "C5'" . DT  B 2  18  ? 29.431 163.756 46.764 1.00 97.60  ? 868  DT  T "C5'" 1 
ATOM   641  C  "C4'" . DT  B 2  18  ? 29.487 163.044 45.433 1.00 98.12  ? 868  DT  T "C4'" 1 
ATOM   642  O  "O4'" . DT  B 2  18  ? 30.665 162.200 45.380 1.00 97.86  ? 868  DT  T "O4'" 1 
ATOM   643  C  "C3'" . DT  B 2  18  ? 28.297 162.128 45.139 1.00 98.12  ? 868  DT  T "C3'" 1 
ATOM   644  O  "O3'" . DT  B 2  18  ? 27.939 162.247 43.758 1.00 99.81  ? 868  DT  T "O3'" 1 
ATOM   645  C  "C2'" . DT  B 2  18  ? 28.840 160.740 45.430 1.00 97.81  ? 868  DT  T "C2'" 1 
ATOM   646  C  "C1'" . DT  B 2  18  ? 30.288 160.886 44.999 1.00 97.58  ? 868  DT  T "C1'" 1 
ATOM   647  N  N1    . DT  B 2  18  ? 31.249 159.930 45.600 1.00 97.26  ? 868  DT  T N1    1 
ATOM   648  C  C2    . DT  B 2  18  ? 32.065 159.211 44.745 1.00 96.92  ? 868  DT  T C2    1 
ATOM   649  O  O2    . DT  B 2  18  ? 32.027 159.318 43.527 1.00 96.63  ? 868  DT  T O2    1 
ATOM   650  N  N3    . DT  B 2  18  ? 32.934 158.352 45.372 1.00 96.68  ? 868  DT  T N3    1 
ATOM   651  C  C4    . DT  B 2  18  ? 33.067 158.137 46.730 1.00 96.64  ? 868  DT  T C4    1 
ATOM   652  O  O4    . DT  B 2  18  ? 33.900 157.331 47.142 1.00 96.49  ? 868  DT  T O4    1 
ATOM   653  C  C5    . DT  B 2  18  ? 32.176 158.914 47.568 1.00 96.66  ? 868  DT  T C5    1 
ATOM   654  C  C7    . DT  B 2  18  ? 32.237 158.738 49.054 1.00 96.28  ? 868  DT  T C7    1 
ATOM   655  C  C6    . DT  B 2  18  ? 31.327 159.762 46.969 1.00 97.03  ? 868  DT  T C6    1 
ATOM   656  P  P     . DC  B 2  19  ? 26.605 161.536 43.211 1.00 100.55 ? 869  DC  T P     1 
ATOM   657  O  OP1   . DC  B 2  19  ? 26.172 162.290 42.004 1.00 100.55 ? 869  DC  T OP1   1 
ATOM   658  O  OP2   . DC  B 2  19  ? 25.662 161.367 44.348 1.00 100.55 ? 869  DC  T OP2   1 
ATOM   659  O  "O5'" . DC  B 2  19  ? 27.105 160.092 42.751 1.00 100.55 ? 869  DC  T "O5'" 1 
ATOM   660  C  "C5'" . DC  B 2  19  ? 27.868 159.928 41.551 1.00 100.55 ? 869  DC  T "C5'" 1 
ATOM   661  C  "C4'" . DC  B 2  19  ? 28.121 158.463 41.275 1.00 100.55 ? 869  DC  T "C4'" 1 
ATOM   662  O  "O4'" . DC  B 2  19  ? 29.067 157.927 42.234 1.00 100.55 ? 869  DC  T "O4'" 1 
ATOM   663  C  "C3'" . DC  B 2  19  ? 26.886 157.559 41.346 1.00 100.55 ? 869  DC  T "C3'" 1 
ATOM   664  O  "O3'" . DC  B 2  19  ? 26.937 156.565 40.315 1.00 100.55 ? 869  DC  T "O3'" 1 
ATOM   665  C  "C2'" . DC  B 2  19  ? 27.028 156.885 42.698 1.00 100.55 ? 869  DC  T "C2'" 1 
ATOM   666  C  "C1'" . DC  B 2  19  ? 28.537 156.736 42.790 1.00 100.55 ? 869  DC  T "C1'" 1 
ATOM   667  N  N1    . DC  B 2  19  ? 29.120 156.543 44.135 1.00 100.55 ? 869  DC  T N1    1 
ATOM   668  C  C2    . DC  B 2  19  ? 30.348 155.869 44.237 1.00 100.35 ? 869  DC  T C2    1 
ATOM   669  O  O2    . DC  B 2  19  ? 30.917 155.492 43.196 1.00 99.63  ? 869  DC  T O2    1 
ATOM   670  N  N3    . DC  B 2  19  ? 30.884 155.650 45.462 1.00 100.05 ? 869  DC  T N3    1 
ATOM   671  C  C4    . DC  B 2  19  ? 30.250 156.081 46.556 1.00 99.91  ? 869  DC  T C4    1 
ATOM   672  N  N4    . DC  B 2  19  ? 30.812 155.834 47.742 1.00 99.24  ? 869  DC  T N4    1 
ATOM   673  C  C5    . DC  B 2  19  ? 29.010 156.783 46.482 1.00 100.03 ? 869  DC  T C5    1 
ATOM   674  C  C6    . DC  B 2  19  ? 28.487 156.992 45.264 1.00 100.48 ? 869  DC  T C6    1 
ATOM   675  P  P     . DG  B 2  20  ? 25.570 155.968 39.713 1.00 100.55 ? 870  DG  T P     1 
ATOM   676  O  OP1   . DG  B 2  20  ? 25.180 156.835 38.569 1.00 100.55 ? 870  DG  T OP1   1 
ATOM   677  O  OP2   . DG  B 2  20  ? 24.616 155.758 40.833 1.00 100.55 ? 870  DG  T OP2   1 
ATOM   678  O  "O5'" . DG  B 2  20  ? 25.984 154.539 39.139 1.00 100.55 ? 870  DG  T "O5'" 1 
ATOM   679  C  "C5'" . DG  B 2  20  ? 26.942 154.417 38.088 1.00 100.55 ? 870  DG  T "C5'" 1 
ATOM   680  C  "C4'" . DG  B 2  20  ? 27.843 153.227 38.331 1.00 100.55 ? 870  DG  T "C4'" 1 
ATOM   681  O  "O4'" . DG  B 2  20  ? 28.484 153.381 39.623 1.00 100.55 ? 870  DG  T "O4'" 1 
ATOM   682  C  "C3'" . DG  B 2  20  ? 27.156 151.858 38.369 1.00 100.38 ? 870  DG  T "C3'" 1 
ATOM   683  O  "O3'" . DG  B 2  20  ? 28.024 150.869 37.791 1.00 100.55 ? 870  DG  T "O3'" 1 
ATOM   684  C  "C2'" . DG  B 2  20  ? 26.990 151.596 39.853 1.00 100.07 ? 870  DG  T "C2'" 1 
ATOM   685  C  "C1'" . DG  B 2  20  ? 28.250 152.225 40.411 1.00 100.06 ? 870  DG  T "C1'" 1 
ATOM   686  N  N9    . DG  B 2  20  ? 28.155 152.634 41.808 1.00 100.11 ? 870  DG  T N9    1 
ATOM   687  C  C8    . DG  B 2  20  ? 27.248 153.503 42.370 1.00 99.77  ? 870  DG  T C8    1 
ATOM   688  N  N7    . DG  B 2  20  ? 27.406 153.645 43.659 1.00 99.67  ? 870  DG  T N7    1 
ATOM   689  C  C5    . DG  B 2  20  ? 28.484 152.826 43.965 1.00 99.73  ? 870  DG  T C5    1 
ATOM   690  C  C6    . DG  B 2  20  ? 29.117 152.562 45.210 1.00 99.12  ? 870  DG  T C6    1 
ATOM   691  O  O6    . DG  B 2  20  ? 28.839 153.012 46.329 1.00 98.42  ? 870  DG  T O6    1 
ATOM   692  N  N1    . DG  B 2  20  ? 30.176 151.670 45.066 1.00 99.13  ? 870  DG  T N1    1 
ATOM   693  C  C2    . DG  B 2  20  ? 30.576 151.101 43.879 1.00 99.72  ? 870  DG  T C2    1 
ATOM   694  N  N2    . DG  B 2  20  ? 31.624 150.265 43.944 1.00 99.98  ? 870  DG  T N2    1 
ATOM   695  N  N3    . DG  B 2  20  ? 29.993 151.335 42.715 1.00 99.79  ? 870  DG  T N3    1 
ATOM   696  C  C4    . DG  B 2  20  ? 28.962 152.201 42.832 1.00 100.15 ? 870  DG  T C4    1 
ATOM   697  P  P     . DT  B 2  21  ? 27.570 149.323 37.739 1.00 100.55 ? 871  DT  T P     1 
ATOM   698  O  OP1   . DT  B 2  21  ? 27.845 148.839 36.359 1.00 100.55 ? 871  DT  T OP1   1 
ATOM   699  O  OP2   . DT  B 2  21  ? 26.201 149.182 38.304 1.00 100.55 ? 871  DT  T OP2   1 
ATOM   700  O  "O5'" . DT  B 2  21  ? 28.583 148.591 38.731 1.00 100.55 ? 871  DT  T "O5'" 1 
ATOM   701  C  "C5'" . DT  B 2  21  ? 29.918 148.278 38.323 1.00 100.12 ? 871  DT  T "C5'" 1 
ATOM   702  C  "C4'" . DT  B 2  21  ? 30.477 147.150 39.163 1.00 100.02 ? 871  DT  T "C4'" 1 
ATOM   703  O  "O4'" . DT  B 2  21  ? 30.563 147.587 40.540 1.00 100.27 ? 871  DT  T "O4'" 1 
ATOM   704  C  "C3'" . DT  B 2  21  ? 29.653 145.859 39.176 1.00 99.86  ? 871  DT  T "C3'" 1 
ATOM   705  O  "O3'" . DT  B 2  21  ? 30.516 144.714 39.192 1.00 98.66  ? 871  DT  T "O3'" 1 
ATOM   706  C  "C2'" . DT  B 2  21  ? 28.879 145.946 40.479 1.00 99.99  ? 871  DT  T "C2'" 1 
ATOM   707  C  "C1'" . DT  B 2  21  ? 29.841 146.703 41.383 1.00 100.32 ? 871  DT  T "C1'" 1 
ATOM   708  N  N1    . DT  B 2  21  ? 29.202 147.513 42.446 1.00 100.55 ? 871  DT  T N1    1 
ATOM   709  C  C2    . DT  B 2  21  ? 29.705 147.416 43.730 1.00 100.55 ? 871  DT  T C2    1 
ATOM   710  O  O2    . DT  B 2  21  ? 30.650 146.699 44.032 1.00 100.55 ? 871  DT  T O2    1 
ATOM   711  N  N3    . DT  B 2  21  ? 29.055 148.197 44.657 1.00 100.55 ? 871  DT  T N3    1 
ATOM   712  C  C4    . DT  B 2  21  ? 27.982 149.043 44.437 1.00 100.22 ? 871  DT  T C4    1 
ATOM   713  O  O4    . DT  B 2  21  ? 27.505 149.681 45.376 1.00 99.92  ? 871  DT  T O4    1 
ATOM   714  C  C5    . DT  B 2  21  ? 27.507 149.095 43.069 1.00 99.91  ? 871  DT  T C5    1 
ATOM   715  C  C7    . DT  B 2  21  ? 26.346 149.976 42.732 1.00 99.44  ? 871  DT  T C7    1 
ATOM   716  C  C6    . DT  B 2  21  ? 28.134 148.341 42.157 1.00 100.13 ? 871  DT  T C6    1 
ATOM   717  N  N     . MET C 3  1   ? 25.789 209.760 33.533 1.00 14.64  ? 1    MET A N     1 
ATOM   718  C  CA    . MET C 3  1   ? 26.448 208.431 33.640 1.00 14.08  ? 1    MET A CA    1 
ATOM   719  C  C     . MET C 3  1   ? 25.468 207.363 34.095 1.00 13.63  ? 1    MET A C     1 
ATOM   720  O  O     . MET C 3  1   ? 24.682 207.587 35.015 1.00 12.83  ? 1    MET A O     1 
ATOM   721  C  CB    . MET C 3  1   ? 27.611 208.489 34.640 1.00 14.18  ? 1    MET A CB    1 
ATOM   722  C  CG    . MET C 3  1   ? 28.256 207.126 34.891 1.00 16.91  ? 1    MET A CG    1 
ATOM   723  S  SD    . MET C 3  1   ? 29.674 207.154 35.993 1.00 17.74  ? 1    MET A SD    1 
ATOM   724  C  CE    . MET C 3  1   ? 30.973 207.551 34.859 1.00 15.99  ? 1    MET A CE    1 
ATOM   725  N  N     . ILE C 3  2   ? 25.509 206.201 33.453 1.00 12.96  ? 2    ILE A N     1 
ATOM   726  C  CA    . ILE C 3  2   ? 24.629 205.108 33.853 1.00 13.70  ? 2    ILE A CA    1 
ATOM   727  C  C     . ILE C 3  2   ? 25.429 203.827 34.061 1.00 12.51  ? 2    ILE A C     1 
ATOM   728  O  O     . ILE C 3  2   ? 26.490 203.650 33.472 1.00 13.44  ? 2    ILE A O     1 
ATOM   729  C  CB    . ILE C 3  2   ? 23.533 204.847 32.813 1.00 12.21  ? 2    ILE A CB    1 
ATOM   730  C  CG1   . ILE C 3  2   ? 24.147 204.320 31.520 1.00 13.37  ? 2    ILE A CG1   1 
ATOM   731  C  CG2   . ILE C 3  2   ? 22.753 206.126 32.559 1.00 12.56  ? 2    ILE A CG2   1 
ATOM   732  C  CD1   . ILE C 3  2   ? 23.126 204.016 30.448 1.00 14.09  ? 2    ILE A CD1   1 
ATOM   733  N  N     . VAL C 3  3   ? 24.924 202.954 34.926 1.00 12.65  ? 3    VAL A N     1 
ATOM   734  C  CA    . VAL C 3  3   ? 25.573 201.679 35.213 1.00 11.81  ? 3    VAL A CA    1 
ATOM   735  C  C     . VAL C 3  3   ? 24.582 200.610 34.763 1.00 13.97  ? 3    VAL A C     1 
ATOM   736  O  O     . VAL C 3  3   ? 23.386 200.679 35.091 1.00 12.98  ? 3    VAL A O     1 
ATOM   737  C  CB    . VAL C 3  3   ? 25.876 201.521 36.722 1.00 9.04   ? 3    VAL A CB    1 
ATOM   738  C  CG1   . VAL C 3  3   ? 26.657 200.239 36.975 1.00 4.85   ? 3    VAL A CG1   1 
ATOM   739  C  CG2   . VAL C 3  3   ? 26.671 202.704 37.203 1.00 8.75   ? 3    VAL A CG2   1 
ATOM   740  N  N     . SER C 3  4   ? 25.074 199.633 34.004 1.00 12.58  ? 4    SER A N     1 
ATOM   741  C  CA    . SER C 3  4   ? 24.208 198.591 33.478 1.00 12.29  ? 4    SER A CA    1 
ATOM   742  C  C     . SER C 3  4   ? 24.853 197.209 33.443 1.00 12.85  ? 4    SER A C     1 
ATOM   743  O  O     . SER C 3  4   ? 26.040 197.048 33.735 1.00 8.98   ? 4    SER A O     1 
ATOM   744  C  CB    . SER C 3  4   ? 23.742 198.984 32.069 1.00 9.63   ? 4    SER A CB    1 
ATOM   745  O  OG    . SER C 3  4   ? 22.630 198.215 31.653 1.00 9.57   ? 4    SER A OG    1 
ATOM   746  N  N     . ASP C 3  5   ? 24.040 196.218 33.087 1.00 13.42  ? 5    ASP A N     1 
ATOM   747  C  CA    . ASP C 3  5   ? 24.470 194.831 33.004 1.00 15.51  ? 5    ASP A CA    1 
ATOM   748  C  C     . ASP C 3  5   ? 23.333 194.050 32.365 1.00 17.44  ? 5    ASP A C     1 
ATOM   749  O  O     . ASP C 3  5   ? 22.167 194.421 32.498 1.00 19.71  ? 5    ASP A O     1 
ATOM   750  C  CB    . ASP C 3  5   ? 24.742 194.281 34.404 1.00 16.04  ? 5    ASP A CB    1 
ATOM   751  C  CG    . ASP C 3  5   ? 25.166 192.824 34.386 1.00 18.59  ? 5    ASP A CG    1 
ATOM   752  O  OD1   . ASP C 3  5   ? 26.176 192.510 33.719 1.00 18.26  ? 5    ASP A OD1   1 
ATOM   753  O  OD2   . ASP C 3  5   ? 24.491 191.996 35.041 1.00 17.70  ? 5    ASP A OD2   1 
ATOM   754  N  N     . ILE C 3  6   ? 23.648 192.963 31.679 1.00 16.26  ? 6    ILE A N     1 
ATOM   755  C  CA    . ILE C 3  6   ? 22.582 192.197 31.061 1.00 17.31  ? 6    ILE A CA    1 
ATOM   756  C  C     . ILE C 3  6   ? 22.687 190.730 31.422 1.00 18.50  ? 6    ILE A C     1 
ATOM   757  O  O     . ILE C 3  6   ? 23.708 190.273 31.924 1.00 19.20  ? 6    ILE A O     1 
ATOM   758  C  CB    . ILE C 3  6   ? 22.626 192.296 29.530 1.00 15.82  ? 6    ILE A CB    1 
ATOM   759  C  CG1   . ILE C 3  6   ? 23.831 191.513 28.997 1.00 14.34  ? 6    ILE A CG1   1 
ATOM   760  C  CG2   . ILE C 3  6   ? 22.704 193.745 29.108 1.00 17.64  ? 6    ILE A CG2   1 
ATOM   761  C  CD1   . ILE C 3  6   ? 23.897 191.448 27.490 1.00 13.30  ? 6    ILE A CD1   1 
ATOM   762  N  N     . GLU C 3  7   ? 21.609 190.005 31.160 1.00 17.57  ? 7    GLU A N     1 
ATOM   763  C  CA    . GLU C 3  7   ? 21.563 188.580 31.396 1.00 17.44  ? 7    GLU A CA    1 
ATOM   764  C  C     . GLU C 3  7   ? 21.119 188.013 30.051 1.00 17.75  ? 7    GLU A C     1 
ATOM   765  O  O     . GLU C 3  7   ? 20.100 188.440 29.498 1.00 15.81  ? 7    GLU A O     1 
ATOM   766  C  CB    . GLU C 3  7   ? 20.541 188.241 32.485 1.00 20.07  ? 7    GLU A CB    1 
ATOM   767  C  CG    . GLU C 3  7   ? 20.841 188.845 33.863 1.00 23.06  ? 7    GLU A CG    1 
ATOM   768  C  CD    . GLU C 3  7   ? 22.075 188.257 34.549 1.00 24.60  ? 7    GLU A CD    1 
ATOM   769  O  OE1   . GLU C 3  7   ? 22.741 187.368 33.975 1.00 23.79  ? 7    GLU A OE1   1 
ATOM   770  O  OE2   . GLU C 3  7   ? 22.382 188.693 35.680 1.00 28.86  ? 7    GLU A OE2   1 
ATOM   771  N  N     . ALA C 3  8   ? 21.909 187.085 29.516 1.00 16.71  ? 8    ALA A N     1 
ATOM   772  C  CA    . ALA C 3  8   ? 21.616 186.454 28.237 1.00 16.24  ? 8    ALA A CA    1 
ATOM   773  C  C     . ALA C 3  8   ? 21.646 184.936 28.397 1.00 16.34  ? 8    ALA A C     1 
ATOM   774  O  O     . ALA C 3  8   ? 22.026 184.428 29.452 1.00 16.66  ? 8    ALA A O     1 
ATOM   775  C  CB    . ALA C 3  8   ? 22.624 186.905 27.188 1.00 14.29  ? 8    ALA A CB    1 
ATOM   776  N  N     . ASN C 3  9   ? 21.267 184.213 27.346 1.00 15.38  ? 9    ASN A N     1 
ATOM   777  C  CA    . ASN C 3  9   ? 21.206 182.755 27.412 1.00 16.54  ? 9    ASN A CA    1 
ATOM   778  C  C     . ASN C 3  9   ? 22.487 181.978 27.152 1.00 16.68  ? 9    ASN A C     1 
ATOM   779  O  O     . ASN C 3  9   ? 22.492 180.756 27.249 1.00 20.21  ? 9    ASN A O     1 
ATOM   780  C  CB    . ASN C 3  9   ? 20.115 182.243 26.471 1.00 17.55  ? 9    ASN A CB    1 
ATOM   781  C  CG    . ASN C 3  9   ? 20.465 182.430 25.006 1.00 19.45  ? 9    ASN A CG    1 
ATOM   782  O  OD1   . ASN C 3  9   ? 21.343 183.217 24.656 1.00 21.56  ? 9    ASN A OD1   1 
ATOM   783  N  ND2   . ASN C 3  9   ? 19.757 181.721 24.138 1.00 20.68  ? 9    ASN A ND2   1 
ATOM   784  N  N     . ALA C 3  10  ? 23.580 182.659 26.833 1.00 16.41  ? 10   ALA A N     1 
ATOM   785  C  CA    . ALA C 3  10  ? 24.820 181.939 26.571 1.00 14.92  ? 10   ALA A CA    1 
ATOM   786  C  C     . ALA C 3  10  ? 26.017 182.868 26.483 1.00 15.61  ? 10   ALA A C     1 
ATOM   787  O  O     . ALA C 3  10  ? 25.880 184.088 26.591 1.00 15.35  ? 10   ALA A O     1 
ATOM   788  C  CB    . ALA C 3  10  ? 24.686 181.137 25.268 1.00 11.52  ? 10   ALA A CB    1 
ATOM   789  N  N     . LEU C 3  11  ? 27.198 182.280 26.315 1.00 17.41  ? 11   LEU A N     1 
ATOM   790  C  CA    . LEU C 3  11  ? 28.414 183.068 26.165 1.00 18.74  ? 11   LEU A CA    1 
ATOM   791  C  C     . LEU C 3  11  ? 28.298 183.730 24.792 1.00 18.85  ? 11   LEU A C     1 
ATOM   792  O  O     . LEU C 3  11  ? 27.476 183.323 23.970 1.00 18.61  ? 11   LEU A O     1 
ATOM   793  C  CB    . LEU C 3  11  ? 29.659 182.172 26.233 1.00 18.65  ? 11   LEU A CB    1 
ATOM   794  C  CG    . LEU C 3  11  ? 29.892 181.448 27.566 1.00 19.44  ? 11   LEU A CG    1 
ATOM   795  C  CD1   . LEU C 3  11  ? 31.095 180.519 27.463 1.00 17.36  ? 11   LEU A CD1   1 
ATOM   796  C  CD2   . LEU C 3  11  ? 30.100 182.472 28.668 1.00 19.10  ? 11   LEU A CD2   1 
ATOM   797  N  N     . LEU C 3  12  ? 29.124 184.740 24.550 1.00 19.42  ? 12   LEU A N     1 
ATOM   798  C  CA    . LEU C 3  12  ? 29.083 185.492 23.305 1.00 18.84  ? 12   LEU A CA    1 
ATOM   799  C  C     . LEU C 3  12  ? 29.024 184.649 22.045 1.00 19.33  ? 12   LEU A C     1 
ATOM   800  O  O     . LEU C 3  12  ? 28.201 184.896 21.169 1.00 20.49  ? 12   LEU A O     1 
ATOM   801  C  CB    . LEU C 3  12  ? 30.277 186.451 23.233 1.00 17.95  ? 12   LEU A CB    1 
ATOM   802  C  CG    . LEU C 3  12  ? 30.312 187.394 22.024 1.00 18.02  ? 12   LEU A CG    1 
ATOM   803  C  CD1   . LEU C 3  12  ? 29.119 188.329 22.063 1.00 15.43  ? 12   LEU A CD1   1 
ATOM   804  C  CD2   . LEU C 3  12  ? 31.611 188.188 22.027 1.00 19.26  ? 12   LEU A CD2   1 
ATOM   805  N  N     . GLU C 3  13  ? 29.893 183.652 21.960 1.00 20.92  ? 13   GLU A N     1 
ATOM   806  C  CA    . GLU C 3  13  ? 29.963 182.780 20.792 1.00 23.29  ? 13   GLU A CA    1 
ATOM   807  C  C     . GLU C 3  13  ? 28.608 182.259 20.312 1.00 22.78  ? 13   GLU A C     1 
ATOM   808  O  O     . GLU C 3  13  ? 28.367 182.171 19.106 1.00 21.54  ? 13   GLU A O     1 
ATOM   809  C  CB    . GLU C 3  13  ? 30.875 181.583 21.077 1.00 26.99  ? 13   GLU A CB    1 
ATOM   810  C  CG    . GLU C 3  13  ? 32.175 181.932 21.790 1.00 36.70  ? 13   GLU A CG    1 
ATOM   811  C  CD    . GLU C 3  13  ? 31.973 182.320 23.255 1.00 39.35  ? 13   GLU A CD    1 
ATOM   812  O  OE1   . GLU C 3  13  ? 31.418 181.488 24.007 1.00 44.12  ? 13   GLU A OE1   1 
ATOM   813  O  OE2   . GLU C 3  13  ? 32.369 183.445 23.650 1.00 38.94  ? 13   GLU A OE2   1 
ATOM   814  N  N     . SER C 3  14  ? 27.722 181.913 21.239 1.00 20.11  ? 14   SER A N     1 
ATOM   815  C  CA    . SER C 3  14  ? 26.432 181.380 20.834 1.00 21.80  ? 14   SER A CA    1 
ATOM   816  C  C     . SER C 3  14  ? 25.207 181.999 21.483 1.00 22.23  ? 14   SER A C     1 
ATOM   817  O  O     . SER C 3  14  ? 24.135 181.392 21.493 1.00 23.13  ? 14   SER A O     1 
ATOM   818  C  CB    . SER C 3  14  ? 26.406 179.860 21.040 1.00 21.18  ? 14   SER A CB    1 
ATOM   819  O  OG    . SER C 3  14  ? 26.880 179.501 22.320 1.00 18.36  ? 14   SER A OG    1 
ATOM   820  N  N     . VAL C 3  15  ? 25.345 183.207 22.015 1.00 21.65  ? 15   VAL A N     1 
ATOM   821  C  CA    . VAL C 3  15  ? 24.199 183.849 22.640 1.00 20.28  ? 15   VAL A CA    1 
ATOM   822  C  C     . VAL C 3  15  ? 23.164 184.183 21.555 1.00 20.18  ? 15   VAL A C     1 
ATOM   823  O  O     . VAL C 3  15  ? 23.526 184.624 20.462 1.00 19.31  ? 15   VAL A O     1 
ATOM   824  C  CB    . VAL C 3  15  ? 24.631 185.135 23.401 1.00 19.37  ? 15   VAL A CB    1 
ATOM   825  C  CG1   . VAL C 3  15  ? 25.144 186.186 22.424 1.00 18.09  ? 15   VAL A CG1   1 
ATOM   826  C  CG2   . VAL C 3  15  ? 23.475 185.664 24.222 1.00 15.73  ? 15   VAL A CG2   1 
ATOM   827  N  N     . THR C 3  16  ? 21.886 183.944 21.846 1.00 19.12  ? 16   THR A N     1 
ATOM   828  C  CA    . THR C 3  16  ? 20.820 184.230 20.883 1.00 18.93  ? 16   THR A CA    1 
ATOM   829  C  C     . THR C 3  16  ? 19.610 184.887 21.526 1.00 19.77  ? 16   THR A C     1 
ATOM   830  O  O     . THR C 3  16  ? 18.652 185.233 20.831 1.00 19.05  ? 16   THR A O     1 
ATOM   831  C  CB    . THR C 3  16  ? 20.300 182.955 20.161 1.00 17.72  ? 16   THR A CB    1 
ATOM   832  O  OG1   . THR C 3  16  ? 19.640 182.104 21.105 1.00 18.60  ? 16   THR A OG1   1 
ATOM   833  C  CG2   . THR C 3  16  ? 21.436 182.200 19.507 1.00 15.67  ? 16   THR A CG2   1 
ATOM   834  N  N     . LYS C 3  17  ? 19.637 185.050 22.847 1.00 20.56  ? 17   LYS A N     1 
ATOM   835  C  CA    . LYS C 3  17  ? 18.508 185.669 23.526 1.00 20.36  ? 17   LYS A CA    1 
ATOM   836  C  C     . LYS C 3  17  ? 18.871 186.527 24.727 1.00 19.22  ? 17   LYS A C     1 
ATOM   837  O  O     . LYS C 3  17  ? 19.596 186.102 25.634 1.00 18.44  ? 17   LYS A O     1 
ATOM   838  C  CB    . LYS C 3  17  ? 17.505 184.602 23.981 1.00 23.67  ? 17   LYS A CB    1 
ATOM   839  C  CG    . LYS C 3  17  ? 17.050 183.640 22.901 1.00 28.17  ? 17   LYS A CG    1 
ATOM   840  C  CD    . LYS C 3  17  ? 16.076 182.608 23.464 1.00 33.86  ? 17   LYS A CD    1 
ATOM   841  C  CE    . LYS C 3  17  ? 14.668 183.179 23.630 1.00 37.70  ? 17   LYS A CE    1 
ATOM   842  N  NZ    . LYS C 3  17  ? 14.604 184.386 24.504 1.00 40.59  ? 17   LYS A NZ    1 
ATOM   843  N  N     . PHE C 3  18  ? 18.335 187.741 24.721 1.00 18.64  ? 18   PHE A N     1 
ATOM   844  C  CA    . PHE C 3  18  ? 18.519 188.707 25.798 1.00 15.89  ? 18   PHE A CA    1 
ATOM   845  C  C     . PHE C 3  18  ? 17.447 188.329 26.813 1.00 16.15  ? 18   PHE A C     1 
ATOM   846  O  O     . PHE C 3  18  ? 16.279 188.210 26.451 1.00 16.60  ? 18   PHE A O     1 
ATOM   847  C  CB    . PHE C 3  18  ? 18.260 190.113 25.247 1.00 13.21  ? 18   PHE A CB    1 
ATOM   848  C  CG    . PHE C 3  18  ? 18.132 191.184 26.295 1.00 10.80  ? 18   PHE A CG    1 
ATOM   849  C  CD1   . PHE C 3  18  ? 19.253 191.847 26.779 1.00 11.06  ? 18   PHE A CD1   1 
ATOM   850  C  CD2   . PHE C 3  18  ? 16.878 191.578 26.751 1.00 9.76   ? 18   PHE A CD2   1 
ATOM   851  C  CE1   . PHE C 3  18  ? 19.126 192.894 27.699 1.00 10.60  ? 18   PHE A CE1   1 
ATOM   852  C  CE2   . PHE C 3  18  ? 16.743 192.621 27.669 1.00 11.89  ? 18   PHE A CE2   1 
ATOM   853  C  CZ    . PHE C 3  18  ? 17.869 193.280 28.141 1.00 8.88   ? 18   PHE A CZ    1 
ATOM   854  N  N     . HIS C 3  19  ? 17.828 188.089 28.063 1.00 15.43  ? 19   HIS A N     1 
ATOM   855  C  CA    . HIS C 3  19  ? 16.821 187.750 29.064 1.00 16.65  ? 19   HIS A CA    1 
ATOM   856  C  C     . HIS C 3  19  ? 16.359 189.026 29.762 1.00 17.68  ? 19   HIS A C     1 
ATOM   857  O  O     . HIS C 3  19  ? 15.171 189.326 29.797 1.00 17.60  ? 19   HIS A O     1 
ATOM   858  C  CB    . HIS C 3  19  ? 17.366 186.744 30.082 1.00 15.97  ? 19   HIS A CB    1 
ATOM   859  C  CG    . HIS C 3  19  ? 17.517 185.357 29.537 1.00 16.37  ? 19   HIS A CG    1 
ATOM   860  N  ND1   . HIS C 3  19  ? 16.556 184.759 28.748 1.00 14.77  ? 19   HIS A ND1   1 
ATOM   861  C  CD2   . HIS C 3  19  ? 18.506 184.443 29.682 1.00 15.22  ? 19   HIS A CD2   1 
ATOM   862  C  CE1   . HIS C 3  19  ? 16.949 183.539 28.429 1.00 13.51  ? 19   HIS A CE1   1 
ATOM   863  N  NE2   . HIS C 3  19  ? 18.128 183.321 28.982 1.00 14.99  ? 19   HIS A NE2   1 
ATOM   864  N  N     . CYS C 3  20  ? 17.303 189.790 30.297 1.00 17.57  ? 20   CYS A N     1 
ATOM   865  C  CA    . CYS C 3  20  ? 16.952 191.029 30.965 1.00 18.28  ? 20   CYS A CA    1 
ATOM   866  C  C     . CYS C 3  20  ? 18.138 191.958 31.148 1.00 18.31  ? 20   CYS A C     1 
ATOM   867  O  O     . CYS C 3  20  ? 19.292 191.596 30.898 1.00 17.17  ? 20   CYS A O     1 
ATOM   868  C  CB    . CYS C 3  20  ? 16.329 190.736 32.329 1.00 16.80  ? 20   CYS A CB    1 
ATOM   869  S  SG    . CYS C 3  20  ? 17.413 189.819 33.421 1.00 18.36  ? 20   CYS A SG    1 
ATOM   870  N  N     . GLY C 3  21  ? 17.829 193.166 31.601 1.00 18.86  ? 21   GLY A N     1 
ATOM   871  C  CA    . GLY C 3  21  ? 18.851 194.158 31.837 1.00 18.45  ? 21   GLY A CA    1 
ATOM   872  C  C     . GLY C 3  21  ? 18.427 195.109 32.935 1.00 18.36  ? 21   GLY A C     1 
ATOM   873  O  O     . GLY C 3  21  ? 17.248 195.230 33.261 1.00 18.27  ? 21   GLY A O     1 
ATOM   874  N  N     . VAL C 3  22  ? 19.406 195.786 33.510 1.00 17.31  ? 22   VAL A N     1 
ATOM   875  C  CA    . VAL C 3  22  ? 19.156 196.737 34.570 1.00 15.46  ? 22   VAL A CA    1 
ATOM   876  C  C     . VAL C 3  22  ? 19.980 197.971 34.277 1.00 16.05  ? 22   VAL A C     1 
ATOM   877  O  O     . VAL C 3  22  ? 21.121 197.874 33.810 1.00 15.29  ? 22   VAL A O     1 
ATOM   878  C  CB    . VAL C 3  22  ? 19.596 196.185 35.939 1.00 12.64  ? 22   VAL A CB    1 
ATOM   879  C  CG1   . VAL C 3  22  ? 19.441 197.256 36.996 1.00 7.86   ? 22   VAL A CG1   1 
ATOM   880  C  CG2   . VAL C 3  22  ? 18.784 194.965 36.295 1.00 12.51  ? 22   VAL A CG2   1 
ATOM   881  N  N     . ILE C 3  23  ? 19.396 199.130 34.547 1.00 16.17  ? 23   ILE A N     1 
ATOM   882  C  CA    . ILE C 3  23  ? 20.099 200.383 34.350 1.00 15.38  ? 23   ILE A CA    1 
ATOM   883  C  C     . ILE C 3  23  ? 19.944 201.295 35.544 1.00 16.19  ? 23   ILE A C     1 
ATOM   884  O  O     . ILE C 3  23  ? 18.840 201.524 36.030 1.00 15.09  ? 23   ILE A O     1 
ATOM   885  C  CB    . ILE C 3  23  ? 19.602 201.152 33.135 1.00 13.77  ? 23   ILE A CB    1 
ATOM   886  C  CG1   . ILE C 3  23  ? 19.841 200.327 31.871 1.00 13.10  ? 23   ILE A CG1   1 
ATOM   887  C  CG2   . ILE C 3  23  ? 20.323 202.506 33.055 1.00 8.78   ? 23   ILE A CG2   1 
ATOM   888  C  CD1   . ILE C 3  23  ? 19.375 201.018 30.614 1.00 17.14  ? 23   ILE A CD1   1 
ATOM   889  N  N     . TYR C 3  24  ? 21.075 201.788 36.029 1.00 18.10  ? 24   TYR A N     1 
ATOM   890  C  CA    . TYR C 3  24  ? 21.072 202.720 37.130 1.00 17.89  ? 24   TYR A CA    1 
ATOM   891  C  C     . TYR C 3  24  ? 21.552 204.032 36.548 1.00 18.89  ? 24   TYR A C     1 
ATOM   892  O  O     . TYR C 3  24  ? 22.685 204.131 36.065 1.00 17.46  ? 24   TYR A O     1 
ATOM   893  C  CB    . TYR C 3  24  ? 22.026 202.296 38.231 1.00 19.75  ? 24   TYR A CB    1 
ATOM   894  C  CG    . TYR C 3  24  ? 22.122 203.353 39.295 1.00 24.02  ? 24   TYR A CG    1 
ATOM   895  C  CD1   . TYR C 3  24  ? 21.138 203.469 40.281 1.00 26.03  ? 24   TYR A CD1   1 
ATOM   896  C  CD2   . TYR C 3  24  ? 23.168 204.277 39.290 1.00 24.13  ? 24   TYR A CD2   1 
ATOM   897  C  CE1   . TYR C 3  24  ? 21.195 204.484 41.238 1.00 26.37  ? 24   TYR A CE1   1 
ATOM   898  C  CE2   . TYR C 3  24  ? 23.235 205.293 40.237 1.00 26.41  ? 24   TYR A CE2   1 
ATOM   899  C  CZ    . TYR C 3  24  ? 22.249 205.392 41.208 1.00 27.50  ? 24   TYR A CZ    1 
ATOM   900  O  OH    . TYR C 3  24  ? 22.321 206.398 42.144 1.00 29.38  ? 24   TYR A OH    1 
ATOM   901  N  N     . ASP C 3  25  ? 20.687 205.037 36.583 1.00 19.54  ? 25   ASP A N     1 
ATOM   902  C  CA    . ASP C 3  25  ? 21.032 206.346 36.058 1.00 19.08  ? 25   ASP A CA    1 
ATOM   903  C  C     . ASP C 3  25  ? 21.418 207.279 37.208 1.00 20.42  ? 25   ASP A C     1 
ATOM   904  O  O     . ASP C 3  25  ? 20.633 207.493 38.133 1.00 20.87  ? 25   ASP A O     1 
ATOM   905  C  CB    . ASP C 3  25  ? 19.842 206.924 35.295 1.00 18.90  ? 25   ASP A CB    1 
ATOM   906  C  CG    . ASP C 3  25  ? 20.225 208.111 34.430 1.00 20.60  ? 25   ASP A CG    1 
ATOM   907  O  OD1   . ASP C 3  25  ? 21.192 208.821 34.780 1.00 17.03  ? 25   ASP A OD1   1 
ATOM   908  O  OD2   . ASP C 3  25  ? 19.549 208.340 33.405 1.00 22.19  ? 25   ASP A OD2   1 
ATOM   909  N  N     . TYR C 3  26  ? 22.627 207.833 37.150 1.00 20.09  ? 26   TYR A N     1 
ATOM   910  C  CA    . TYR C 3  26  ? 23.093 208.754 38.181 1.00 20.27  ? 26   TYR A CA    1 
ATOM   911  C  C     . TYR C 3  26  ? 22.304 210.054 38.221 1.00 21.19  ? 26   TYR A C     1 
ATOM   912  O  O     . TYR C 3  26  ? 22.241 210.710 39.256 1.00 21.66  ? 26   TYR A O     1 
ATOM   913  C  CB    . TYR C 3  26  ? 24.567 209.087 37.972 1.00 18.41  ? 26   TYR A CB    1 
ATOM   914  C  CG    . TYR C 3  26  ? 25.508 208.155 38.688 1.00 17.37  ? 26   TYR A CG    1 
ATOM   915  C  CD1   . TYR C 3  26  ? 25.690 208.240 40.069 1.00 16.12  ? 26   TYR A CD1   1 
ATOM   916  C  CD2   . TYR C 3  26  ? 26.213 207.178 37.989 1.00 16.14  ? 26   TYR A CD2   1 
ATOM   917  C  CE1   . TYR C 3  26  ? 26.558 207.372 40.738 1.00 16.44  ? 26   TYR A CE1   1 
ATOM   918  C  CE2   . TYR C 3  26  ? 27.077 206.304 38.645 1.00 15.84  ? 26   TYR A CE2   1 
ATOM   919  C  CZ    . TYR C 3  26  ? 27.249 206.405 40.010 1.00 15.81  ? 26   TYR A CZ    1 
ATOM   920  O  OH    . TYR C 3  26  ? 28.118 205.550 40.640 1.00 15.23  ? 26   TYR A OH    1 
ATOM   921  N  N     . SER C 3  27  ? 21.708 210.434 37.099 1.00 23.13  ? 27   SER A N     1 
ATOM   922  C  CA    . SER C 3  27  ? 20.947 211.675 37.054 1.00 25.48  ? 27   SER A CA    1 
ATOM   923  C  C     . SER C 3  27  ? 19.619 211.553 37.799 1.00 26.14  ? 27   SER A C     1 
ATOM   924  O  O     . SER C 3  27  ? 19.139 212.535 38.368 1.00 27.47  ? 27   SER A O     1 
ATOM   925  C  CB    . SER C 3  27  ? 20.691 212.093 35.604 1.00 24.27  ? 27   SER A CB    1 
ATOM   926  O  OG    . SER C 3  27  ? 19.837 211.167 34.961 1.00 31.15  ? 27   SER A OG    1 
ATOM   927  N  N     . THR C 3  28  ? 19.034 210.354 37.797 1.00 24.64  ? 28   THR A N     1 
ATOM   928  C  CA    . THR C 3  28  ? 17.758 210.106 38.476 1.00 23.57  ? 28   THR A CA    1 
ATOM   929  C  C     . THR C 3  28  ? 17.955 209.358 39.790 1.00 25.69  ? 28   THR A C     1 
ATOM   930  O  O     . THR C 3  28  ? 17.049 209.300 40.623 1.00 26.77  ? 28   THR A O     1 
ATOM   931  C  CB    . THR C 3  28  ? 16.801 209.243 37.617 1.00 20.90  ? 28   THR A CB    1 
ATOM   932  O  OG1   . THR C 3  28  ? 17.402 207.966 37.372 1.00 20.48  ? 28   THR A OG1   1 
ATOM   933  C  CG2   . THR C 3  28  ? 16.497 209.916 36.297 1.00 19.87  ? 28   THR A CG2   1 
ATOM   934  N  N     . ALA C 3  29  ? 19.136 208.774 39.966 1.00 27.61  ? 29   ALA A N     1 
ATOM   935  C  CA    . ALA C 3  29  ? 19.445 208.009 41.170 1.00 28.23  ? 29   ALA A CA    1 
ATOM   936  C  C     . ALA C 3  29  ? 18.432 206.882 41.305 1.00 28.37  ? 29   ALA A C     1 
ATOM   937  O  O     . ALA C 3  29  ? 17.940 206.603 42.391 1.00 27.92  ? 29   ALA A O     1 
ATOM   938  C  CB    . ALA C 3  29  ? 19.389 208.905 42.393 1.00 27.59  ? 29   ALA A CB    1 
ATOM   939  N  N     . GLU C 3  30  ? 18.124 206.234 40.191 1.00 30.41  ? 30   GLU A N     1 
ATOM   940  C  CA    . GLU C 3  30  ? 17.157 205.146 40.195 1.00 31.02  ? 30   GLU A CA    1 
ATOM   941  C  C     . GLU C 3  30  ? 17.531 203.945 39.331 1.00 28.75  ? 30   GLU A C     1 
ATOM   942  O  O     . GLU C 3  30  ? 18.275 204.065 38.357 1.00 28.89  ? 30   GLU A O     1 
ATOM   943  C  CB    . GLU C 3  30  ? 15.798 205.679 39.752 1.00 33.98  ? 30   GLU A CB    1 
ATOM   944  C  CG    . GLU C 3  30  ? 14.863 205.972 40.900 1.00 41.63  ? 30   GLU A CG    1 
ATOM   945  C  CD    . GLU C 3  30  ? 13.567 206.578 40.430 1.00 47.10  ? 30   GLU A CD    1 
ATOM   946  O  OE1   . GLU C 3  30  ? 13.160 206.283 39.282 1.00 50.54  ? 30   GLU A OE1   1 
ATOM   947  O  OE2   . GLU C 3  30  ? 12.952 207.338 41.210 1.00 49.80  ? 30   GLU A OE2   1 
ATOM   948  N  N     . TYR C 3  31  ? 17.014 202.782 39.708 1.00 25.44  ? 31   TYR A N     1 
ATOM   949  C  CA    . TYR C 3  31  ? 17.254 201.566 38.951 1.00 23.14  ? 31   TYR A CA    1 
ATOM   950  C  C     . TYR C 3  31  ? 16.008 201.266 38.133 1.00 22.59  ? 31   TYR A C     1 
ATOM   951  O  O     . TYR C 3  31  ? 14.888 201.478 38.600 1.00 21.71  ? 31   TYR A O     1 
ATOM   952  C  CB    . TYR C 3  31  ? 17.518 200.379 39.875 1.00 20.89  ? 31   TYR A CB    1 
ATOM   953  C  CG    . TYR C 3  31  ? 18.768 200.486 40.715 1.00 19.78  ? 31   TYR A CG    1 
ATOM   954  C  CD1   . TYR C 3  31  ? 18.770 201.205 41.913 1.00 18.89  ? 31   TYR A CD1   1 
ATOM   955  C  CD2   . TYR C 3  31  ? 19.945 199.843 40.329 1.00 14.86  ? 31   TYR A CD2   1 
ATOM   956  C  CE1   . TYR C 3  31  ? 19.909 201.273 42.706 1.00 15.53  ? 31   TYR A CE1   1 
ATOM   957  C  CE2   . TYR C 3  31  ? 21.082 199.907 41.112 1.00 14.19  ? 31   TYR A CE2   1 
ATOM   958  C  CZ    . TYR C 3  31  ? 21.058 200.621 42.297 1.00 15.40  ? 31   TYR A CZ    1 
ATOM   959  O  OH    . TYR C 3  31  ? 22.187 200.682 43.078 1.00 20.18  ? 31   TYR A OH    1 
ATOM   960  N  N     . VAL C 3  32  ? 16.213 200.778 36.912 1.00 21.84  ? 32   VAL A N     1 
ATOM   961  C  CA    . VAL C 3  32  ? 15.120 200.409 36.019 1.00 18.66  ? 32   VAL A CA    1 
ATOM   962  C  C     . VAL C 3  32  ? 15.418 199.024 35.451 1.00 19.35  ? 32   VAL A C     1 
ATOM   963  O  O     . VAL C 3  32  ? 16.509 198.776 34.912 1.00 18.68  ? 32   VAL A O     1 
ATOM   964  C  CB    . VAL C 3  32  ? 14.970 201.409 34.848 1.00 19.65  ? 32   VAL A CB    1 
ATOM   965  C  CG1   . VAL C 3  32  ? 13.844 200.961 33.922 1.00 17.09  ? 32   VAL A CG1   1 
ATOM   966  C  CG2   . VAL C 3  32  ? 14.685 202.808 35.387 1.00 15.77  ? 32   VAL A CG2   1 
ATOM   967  N  N     . SER C 3  33  ? 14.453 198.118 35.586 1.00 18.25  ? 33   SER A N     1 
ATOM   968  C  CA    . SER C 3  33  ? 14.605 196.752 35.096 1.00 15.67  ? 33   SER A CA    1 
ATOM   969  C  C     . SER C 3  33  ? 13.941 196.578 33.750 1.00 15.01  ? 33   SER A C     1 
ATOM   970  O  O     . SER C 3  33  ? 12.867 197.113 33.511 1.00 15.12  ? 33   SER A O     1 
ATOM   971  C  CB    . SER C 3  33  ? 13.977 195.755 36.069 1.00 15.47  ? 33   SER A CB    1 
ATOM   972  O  OG    . SER C 3  33  ? 14.592 195.809 37.338 1.00 18.77  ? 33   SER A OG    1 
ATOM   973  N  N     . TYR C 3  34  ? 14.585 195.821 32.872 1.00 16.33  ? 34   TYR A N     1 
ATOM   974  C  CA    . TYR C 3  34  ? 14.035 195.540 31.560 1.00 15.98  ? 34   TYR A CA    1 
ATOM   975  C  C     . TYR C 3  34  ? 13.942 194.034 31.440 1.00 18.06  ? 34   TYR A C     1 
ATOM   976  O  O     . TYR C 3  34  ? 14.930 193.323 31.649 1.00 18.60  ? 34   TYR A O     1 
ATOM   977  C  CB    . TYR C 3  34  ? 14.929 196.093 30.458 1.00 14.33  ? 34   TYR A CB    1 
ATOM   978  C  CG    . TYR C 3  34  ? 15.128 197.580 30.564 1.00 17.68  ? 34   TYR A CG    1 
ATOM   979  C  CD1   . TYR C 3  34  ? 15.958 198.121 31.549 1.00 17.00  ? 34   TYR A CD1   1 
ATOM   980  C  CD2   . TYR C 3  34  ? 14.462 198.454 29.710 1.00 16.35  ? 34   TYR A CD2   1 
ATOM   981  C  CE1   . TYR C 3  34  ? 16.115 199.489 31.675 1.00 18.42  ? 34   TYR A CE1   1 
ATOM   982  C  CE2   . TYR C 3  34  ? 14.611 199.825 29.831 1.00 15.49  ? 34   TYR A CE2   1 
ATOM   983  C  CZ    . TYR C 3  34  ? 15.436 200.338 30.810 1.00 16.62  ? 34   TYR A CZ    1 
ATOM   984  O  OH    . TYR C 3  34  ? 15.593 201.699 30.928 1.00 17.85  ? 34   TYR A OH    1 
ATOM   985  N  N     . ARG C 3  35  ? 12.746 193.549 31.125 1.00 18.53  ? 35   ARG A N     1 
ATOM   986  C  CA    . ARG C 3  35  ? 12.527 192.122 30.976 1.00 20.11  ? 35   ARG A CA    1 
ATOM   987  C  C     . ARG C 3  35  ? 12.662 191.736 29.505 1.00 19.77  ? 35   ARG A C     1 
ATOM   988  O  O     . ARG C 3  35  ? 12.813 192.604 28.649 1.00 19.83  ? 35   ARG A O     1 
ATOM   989  C  CB    . ARG C 3  35  ? 11.165 191.762 31.565 1.00 20.61  ? 35   ARG A CB    1 
ATOM   990  C  CG    . ARG C 3  35  ? 11.183 191.923 33.078 1.00 23.74  ? 35   ARG A CG    1 
ATOM   991  C  CD    . ARG C 3  35  ? 9.872  191.596 33.755 1.00 24.33  ? 35   ARG A CD    1 
ATOM   992  N  NE    . ARG C 3  35  ? 10.068 191.495 35.198 1.00 27.52  ? 35   ARG A NE    1 
ATOM   993  C  CZ    . ARG C 3  35  ? 10.429 192.511 35.980 1.00 31.76  ? 35   ARG A CZ    1 
ATOM   994  N  NH1   . ARG C 3  35  ? 10.628 193.717 35.459 1.00 33.82  ? 35   ARG A NH1   1 
ATOM   995  N  NH2   . ARG C 3  35  ? 10.609 192.321 37.281 1.00 31.87  ? 35   ARG A NH2   1 
ATOM   996  N  N     . PRO C 3  36  ? 12.609 190.434 29.187 1.00 19.39  ? 36   PRO A N     1 
ATOM   997  C  CA    . PRO C 3  36  ? 12.756 190.067 27.773 1.00 20.11  ? 36   PRO A CA    1 
ATOM   998  C  C     . PRO C 3  36  ? 11.996 190.864 26.711 1.00 20.49  ? 36   PRO A C     1 
ATOM   999  O  O     . PRO C 3  36  ? 12.514 191.078 25.620 1.00 23.55  ? 36   PRO A O     1 
ATOM   1000 C  CB    . PRO C 3  36  ? 12.446 188.558 27.752 1.00 17.28  ? 36   PRO A CB    1 
ATOM   1001 C  CG    . PRO C 3  36  ? 11.787 188.277 29.066 1.00 19.61  ? 36   PRO A CG    1 
ATOM   1002 C  CD    . PRO C 3  36  ? 12.403 189.246 30.034 1.00 18.91  ? 36   PRO A CD    1 
ATOM   1003 N  N     . SER C 3  37  ? 10.789 191.324 27.001 1.00 20.09  ? 37   SER A N     1 
ATOM   1004 C  CA    . SER C 3  37  ? 10.068 192.084 25.987 1.00 18.80  ? 37   SER A CA    1 
ATOM   1005 C  C     . SER C 3  37  ? 10.422 193.570 26.023 1.00 18.25  ? 37   SER A C     1 
ATOM   1006 O  O     . SER C 3  37  ? 9.933  194.356 25.208 1.00 14.84  ? 37   SER A O     1 
ATOM   1007 C  CB    . SER C 3  37  ? 8.564  191.891 26.156 1.00 18.19  ? 37   SER A CB    1 
ATOM   1008 O  OG    . SER C 3  37  ? 8.183  192.128 27.496 1.00 24.10  ? 37   SER A OG    1 
ATOM   1009 N  N     . ASP C 3  38  ? 11.276 193.947 26.970 1.00 18.04  ? 38   ASP A N     1 
ATOM   1010 C  CA    . ASP C 3  38  ? 11.702 195.336 27.108 1.00 19.68  ? 38   ASP A CA    1 
ATOM   1011 C  C     . ASP C 3  38  ? 13.058 195.569 26.433 1.00 21.10  ? 38   ASP A C     1 
ATOM   1012 O  O     . ASP C 3  38  ? 13.652 196.639 26.576 1.00 22.37  ? 38   ASP A O     1 
ATOM   1013 C  CB    . ASP C 3  38  ? 11.817 195.722 28.589 1.00 19.80  ? 38   ASP A CB    1 
ATOM   1014 C  CG    . ASP C 3  38  ? 10.473 195.716 29.320 1.00 21.67  ? 38   ASP A CG    1 
ATOM   1015 O  OD1   . ASP C 3  38  ? 9.484  196.266 28.785 1.00 23.62  ? 38   ASP A OD1   1 
ATOM   1016 O  OD2   . ASP C 3  38  ? 10.413 195.173 30.449 1.00 20.55  ? 38   ASP A OD2   1 
ATOM   1017 N  N     . PHE C 3  39  ? 13.541 194.570 25.698 1.00 20.90  ? 39   PHE A N     1 
ATOM   1018 C  CA    . PHE C 3  39  ? 14.837 194.658 25.035 1.00 20.97  ? 39   PHE A CA    1 
ATOM   1019 C  C     . PHE C 3  39  ? 15.023 195.930 24.208 1.00 20.37  ? 39   PHE A C     1 
ATOM   1020 O  O     . PHE C 3  39  ? 16.029 196.621 24.344 1.00 20.64  ? 39   PHE A O     1 
ATOM   1021 C  CB    . PHE C 3  39  ? 15.058 193.412 24.165 1.00 21.10  ? 39   PHE A CB    1 
ATOM   1022 C  CG    . PHE C 3  39  ? 16.442 193.309 23.575 1.00 20.45  ? 39   PHE A CG    1 
ATOM   1023 C  CD1   . PHE C 3  39  ? 17.560 193.749 24.286 1.00 20.40  ? 39   PHE A CD1   1 
ATOM   1024 C  CD2   . PHE C 3  39  ? 16.634 192.739 22.319 1.00 19.84  ? 39   PHE A CD2   1 
ATOM   1025 C  CE1   . PHE C 3  39  ? 18.845 193.623 23.755 1.00 18.83  ? 39   PHE A CE1   1 
ATOM   1026 C  CE2   . PHE C 3  39  ? 17.915 192.608 21.778 1.00 18.94  ? 39   PHE A CE2   1 
ATOM   1027 C  CZ    . PHE C 3  39  ? 19.024 193.052 22.499 1.00 17.13  ? 39   PHE A CZ    1 
ATOM   1028 N  N     . GLY C 3  40  ? 14.060 196.246 23.355 1.00 20.13  ? 40   GLY A N     1 
ATOM   1029 C  CA    . GLY C 3  40  ? 14.183 197.450 22.551 1.00 19.36  ? 40   GLY A CA    1 
ATOM   1030 C  C     . GLY C 3  40  ? 14.305 198.695 23.413 1.00 19.44  ? 40   GLY A C     1 
ATOM   1031 O  O     . GLY C 3  40  ? 15.102 199.590 23.123 1.00 18.88  ? 40   GLY A O     1 
ATOM   1032 N  N     . ALA C 3  41  ? 13.509 198.752 24.478 1.00 17.65  ? 41   ALA A N     1 
ATOM   1033 C  CA    . ALA C 3  41  ? 13.523 199.891 25.386 1.00 17.22  ? 41   ALA A CA    1 
ATOM   1034 C  C     . ALA C 3  41  ? 14.876 199.980 26.074 1.00 16.80  ? 41   ALA A C     1 
ATOM   1035 O  O     . ALA C 3  41  ? 15.404 201.070 26.289 1.00 17.01  ? 41   ALA A O     1 
ATOM   1036 C  CB    . ALA C 3  41  ? 12.413 199.755 26.421 1.00 15.11  ? 41   ALA A CB    1 
ATOM   1037 N  N     . TYR C 3  42  ? 15.435 198.826 26.421 1.00 15.96  ? 42   TYR A N     1 
ATOM   1038 C  CA    . TYR C 3  42  ? 16.738 198.793 27.067 1.00 15.26  ? 42   TYR A CA    1 
ATOM   1039 C  C     . TYR C 3  42  ? 17.781 199.414 26.138 1.00 14.84  ? 42   TYR A C     1 
ATOM   1040 O  O     . TYR C 3  42  ? 18.556 200.277 26.547 1.00 15.26  ? 42   TYR A O     1 
ATOM   1041 C  CB    . TYR C 3  42  ? 17.138 197.355 27.390 1.00 14.79  ? 42   TYR A CB    1 
ATOM   1042 C  CG    . TYR C 3  42  ? 18.545 197.243 27.925 1.00 14.31  ? 42   TYR A CG    1 
ATOM   1043 C  CD1   . TYR C 3  42  ? 18.860 197.680 29.211 1.00 13.43  ? 42   TYR A CD1   1 
ATOM   1044 C  CD2   . TYR C 3  42  ? 19.572 196.743 27.130 1.00 13.08  ? 42   TYR A CD2   1 
ATOM   1045 C  CE1   . TYR C 3  42  ? 20.165 197.621 29.689 1.00 14.42  ? 42   TYR A CE1   1 
ATOM   1046 C  CE2   . TYR C 3  42  ? 20.879 196.682 27.599 1.00 14.12  ? 42   TYR A CE2   1 
ATOM   1047 C  CZ    . TYR C 3  42  ? 21.166 197.122 28.880 1.00 13.58  ? 42   TYR A CZ    1 
ATOM   1048 O  OH    . TYR C 3  42  ? 22.453 197.054 29.350 1.00 12.91  ? 42   TYR A OH    1 
ATOM   1049 N  N     . LEU C 3  43  ? 17.795 198.967 24.887 1.00 15.02  ? 43   LEU A N     1 
ATOM   1050 C  CA    . LEU C 3  43  ? 18.738 199.487 23.906 1.00 14.94  ? 43   LEU A CA    1 
ATOM   1051 C  C     . LEU C 3  43  ? 18.561 200.996 23.725 1.00 16.02  ? 43   LEU A C     1 
ATOM   1052 O  O     . LEU C 3  43  ? 19.546 201.741 23.648 1.00 16.59  ? 43   LEU A O     1 
ATOM   1053 C  CB    . LEU C 3  43  ? 18.549 198.778 22.564 1.00 13.84  ? 43   LEU A CB    1 
ATOM   1054 C  CG    . LEU C 3  43  ? 18.937 197.296 22.489 1.00 14.92  ? 43   LEU A CG    1 
ATOM   1055 C  CD1   . LEU C 3  43  ? 18.461 196.713 21.153 1.00 14.33  ? 43   LEU A CD1   1 
ATOM   1056 C  CD2   . LEU C 3  43  ? 20.450 197.140 22.649 1.00 9.77   ? 43   LEU A CD2   1 
ATOM   1057 N  N     . ASP C 3  44  ? 17.309 201.446 23.657 1.00 15.96  ? 44   ASP A N     1 
ATOM   1058 C  CA    . ASP C 3  44  ? 17.040 202.875 23.491 1.00 16.48  ? 44   ASP A CA    1 
ATOM   1059 C  C     . ASP C 3  44  ? 17.648 203.654 24.653 1.00 15.23  ? 44   ASP A C     1 
ATOM   1060 O  O     . ASP C 3  44  ? 18.230 204.722 24.462 1.00 15.83  ? 44   ASP A O     1 
ATOM   1061 C  CB    . ASP C 3  44  ? 15.529 203.163 23.423 1.00 16.60  ? 44   ASP A CB    1 
ATOM   1062 C  CG    . ASP C 3  44  ? 14.863 202.582 22.168 1.00 18.74  ? 44   ASP A CG    1 
ATOM   1063 O  OD1   . ASP C 3  44  ? 15.560 202.333 21.159 1.00 18.71  ? 44   ASP A OD1   1 
ATOM   1064 O  OD2   . ASP C 3  44  ? 13.629 202.388 22.189 1.00 18.84  ? 44   ASP A OD2   1 
ATOM   1065 N  N     . ALA C 3  45  ? 17.517 203.115 25.858 1.00 12.41  ? 45   ALA A N     1 
ATOM   1066 C  CA    . ALA C 3  45  ? 18.061 203.779 27.028 1.00 11.32  ? 45   ALA A CA    1 
ATOM   1067 C  C     . ALA C 3  45  ? 19.583 203.920 26.914 1.00 13.03  ? 45   ALA A C     1 
ATOM   1068 O  O     . ALA C 3  45  ? 20.153 204.919 27.350 1.00 13.52  ? 45   ALA A O     1 
ATOM   1069 C  CB    . ALA C 3  45  ? 17.693 203.005 28.267 1.00 7.42   ? 45   ALA A CB    1 
ATOM   1070 N  N     . LEU C 3  46  ? 20.250 202.930 26.329 1.00 12.10  ? 46   LEU A N     1 
ATOM   1071 C  CA    . LEU C 3  46  ? 21.697 203.026 26.185 1.00 11.92  ? 46   LEU A CA    1 
ATOM   1072 C  C     . LEU C 3  46  ? 22.058 204.080 25.142 1.00 13.22  ? 46   LEU A C     1 
ATOM   1073 O  O     . LEU C 3  46  ? 22.938 204.906 25.372 1.00 15.70  ? 46   LEU A O     1 
ATOM   1074 C  CB    . LEU C 3  46  ? 22.300 201.674 25.799 1.00 8.77   ? 46   LEU A CB    1 
ATOM   1075 C  CG    . LEU C 3  46  ? 22.132 200.533 26.806 1.00 8.47   ? 46   LEU A CG    1 
ATOM   1076 C  CD1   . LEU C 3  46  ? 23.004 199.389 26.357 1.00 8.28   ? 46   LEU A CD1   1 
ATOM   1077 C  CD2   . LEU C 3  46  ? 22.513 200.968 28.225 1.00 6.96   ? 46   LEU A CD2   1 
ATOM   1078 N  N     . GLU C 3  47  ? 21.377 204.069 24.001 1.00 13.90  ? 47   GLU A N     1 
ATOM   1079 C  CA    . GLU C 3  47  ? 21.661 205.059 22.966 1.00 15.79  ? 47   GLU A CA    1 
ATOM   1080 C  C     . GLU C 3  47  ? 21.331 206.487 23.408 1.00 15.95  ? 47   GLU A C     1 
ATOM   1081 O  O     . GLU C 3  47  ? 21.957 207.438 22.946 1.00 19.90  ? 47   GLU A O     1 
ATOM   1082 C  CB    . GLU C 3  47  ? 20.917 204.710 21.670 1.00 15.81  ? 47   GLU A CB    1 
ATOM   1083 C  CG    . GLU C 3  47  ? 21.385 203.384 21.066 1.00 18.66  ? 47   GLU A CG    1 
ATOM   1084 C  CD    . GLU C 3  47  ? 20.766 203.076 19.716 1.00 19.00  ? 47   GLU A CD    1 
ATOM   1085 O  OE1   . GLU C 3  47  ? 19.532 203.206 19.571 1.00 21.03  ? 47   GLU A OE1   1 
ATOM   1086 O  OE2   . GLU C 3  47  ? 21.518 202.690 18.803 1.00 18.85  ? 47   GLU A OE2   1 
ATOM   1087 N  N     . ALA C 3  48  ? 20.361 206.644 24.302 1.00 14.91  ? 48   ALA A N     1 
ATOM   1088 C  CA    . ALA C 3  48  ? 20.002 207.976 24.794 1.00 15.93  ? 48   ALA A CA    1 
ATOM   1089 C  C     . ALA C 3  48  ? 21.158 208.557 25.602 1.00 15.59  ? 48   ALA A C     1 
ATOM   1090 O  O     . ALA C 3  48  ? 21.403 209.765 25.575 1.00 15.82  ? 48   ALA A O     1 
ATOM   1091 C  CB    . ALA C 3  48  ? 18.740 207.907 25.669 1.00 12.20  ? 48   ALA A CB    1 
ATOM   1092 N  N     . GLU C 3  49  ? 21.864 207.690 26.323 1.00 15.40  ? 49   GLU A N     1 
ATOM   1093 C  CA    . GLU C 3  49  ? 22.993 208.124 27.129 1.00 15.66  ? 49   GLU A CA    1 
ATOM   1094 C  C     . GLU C 3  49  ? 24.133 208.534 26.194 1.00 16.43  ? 49   GLU A C     1 
ATOM   1095 O  O     . GLU C 3  49  ? 24.847 209.499 26.461 1.00 15.93  ? 49   GLU A O     1 
ATOM   1096 C  CB    . GLU C 3  49  ? 23.424 207.002 28.072 1.00 14.09  ? 49   GLU A CB    1 
ATOM   1097 C  CG    . GLU C 3  49  ? 24.567 207.357 29.015 1.00 17.55  ? 49   GLU A CG    1 
ATOM   1098 C  CD    . GLU C 3  49  ? 24.250 208.525 29.934 1.00 19.28  ? 49   GLU A CD    1 
ATOM   1099 O  OE1   . GLU C 3  49  ? 23.071 208.711 30.303 1.00 22.12  ? 49   GLU A OE1   1 
ATOM   1100 O  OE2   . GLU C 3  49  ? 25.188 209.252 30.310 1.00 21.20  ? 49   GLU A OE2   1 
ATOM   1101 N  N     . VAL C 3  50  ? 24.283 207.809 25.089 1.00 16.50  ? 50   VAL A N     1 
ATOM   1102 C  CA    . VAL C 3  50  ? 25.306 208.122 24.097 1.00 16.59  ? 50   VAL A CA    1 
ATOM   1103 C  C     . VAL C 3  50  ? 25.012 209.471 23.435 1.00 19.18  ? 50   VAL A C     1 
ATOM   1104 O  O     . VAL C 3  50  ? 25.895 210.331 23.316 1.00 16.87  ? 50   VAL A O     1 
ATOM   1105 C  CB    . VAL C 3  50  ? 25.359 207.060 22.969 1.00 17.02  ? 50   VAL A CB    1 
ATOM   1106 C  CG1   . VAL C 3  50  ? 26.230 207.567 21.823 1.00 14.31  ? 50   VAL A CG1   1 
ATOM   1107 C  CG2   . VAL C 3  50  ? 25.909 205.740 23.501 1.00 14.26  ? 50   VAL A CG2   1 
ATOM   1108 N  N     . ALA C 3  51  ? 23.769 209.649 22.995 1.00 19.38  ? 51   ALA A N     1 
ATOM   1109 C  CA    . ALA C 3  51  ? 23.375 210.886 22.318 1.00 21.51  ? 51   ALA A CA    1 
ATOM   1110 C  C     . ALA C 3  51  ? 23.512 212.103 23.234 1.00 22.78  ? 51   ALA A C     1 
ATOM   1111 O  O     . ALA C 3  51  ? 23.623 213.240 22.778 1.00 25.21  ? 51   ALA A O     1 
ATOM   1112 C  CB    . ALA C 3  51  ? 21.944 210.764 21.816 1.00 17.35  ? 51   ALA A CB    1 
ATOM   1113 N  N     . ARG C 3  52  ? 23.520 211.843 24.532 1.00 22.31  ? 52   ARG A N     1 
ATOM   1114 C  CA    . ARG C 3  52  ? 23.620 212.881 25.542 1.00 21.03  ? 52   ARG A CA    1 
ATOM   1115 C  C     . ARG C 3  52  ? 25.089 213.196 25.839 1.00 20.38  ? 52   ARG A C     1 
ATOM   1116 O  O     . ARG C 3  52  ? 25.391 214.077 26.637 1.00 20.30  ? 52   ARG A O     1 
ATOM   1117 C  CB    . ARG C 3  52  ? 22.926 212.368 26.798 1.00 24.75  ? 52   ARG A CB    1 
ATOM   1118 C  CG    . ARG C 3  52  ? 22.364 213.399 27.745 1.00 29.06  ? 52   ARG A CG    1 
ATOM   1119 C  CD    . ARG C 3  52  ? 21.639 212.667 28.864 1.00 30.96  ? 52   ARG A CD    1 
ATOM   1120 N  NE    . ARG C 3  52  ? 20.547 211.859 28.330 1.00 35.89  ? 52   ARG A NE    1 
ATOM   1121 C  CZ    . ARG C 3  52  ? 20.181 210.667 28.797 1.00 37.77  ? 52   ARG A CZ    1 
ATOM   1122 N  NH1   . ARG C 3  52  ? 20.820 210.112 29.822 1.00 37.38  ? 52   ARG A NH1   1 
ATOM   1123 N  NH2   . ARG C 3  52  ? 19.163 210.028 28.234 1.00 37.89  ? 52   ARG A NH2   1 
ATOM   1124 N  N     . GLY C 3  53  ? 25.997 212.469 25.191 1.00 18.89  ? 53   GLY A N     1 
ATOM   1125 C  CA    . GLY C 3  53  ? 27.419 212.672 25.417 1.00 14.58  ? 53   GLY A CA    1 
ATOM   1126 C  C     . GLY C 3  53  ? 27.829 212.064 26.750 1.00 13.63  ? 53   GLY A C     1 
ATOM   1127 O  O     . GLY C 3  53  ? 28.889 212.377 27.297 1.00 14.24  ? 53   GLY A O     1 
ATOM   1128 N  N     . GLY C 3  54  ? 26.977 211.190 27.274 1.00 10.65  ? 54   GLY A N     1 
ATOM   1129 C  CA    . GLY C 3  54  ? 27.246 210.558 28.547 1.00 9.01   ? 54   GLY A CA    1 
ATOM   1130 C  C     . GLY C 3  54  ? 28.106 209.304 28.493 1.00 12.15  ? 54   GLY A C     1 
ATOM   1131 O  O     . GLY C 3  54  ? 28.706 208.975 27.464 1.00 9.97   ? 54   GLY A O     1 
ATOM   1132 N  N     . LEU C 3  55  ? 28.138 208.595 29.619 1.00 12.03  ? 55   LEU A N     1 
ATOM   1133 C  CA    . LEU C 3  55  ? 28.920 207.383 29.774 1.00 11.28  ? 55   LEU A CA    1 
ATOM   1134 C  C     . LEU C 3  55  ? 28.086 206.204 30.260 1.00 12.96  ? 55   LEU A C     1 
ATOM   1135 O  O     . LEU C 3  55  ? 27.100 206.372 30.984 1.00 11.83  ? 55   LEU A O     1 
ATOM   1136 C  CB    . LEU C 3  55  ? 30.053 207.644 30.761 1.00 12.94  ? 55   LEU A CB    1 
ATOM   1137 C  CG    . LEU C 3  55  ? 31.136 208.607 30.275 1.00 14.48  ? 55   LEU A CG    1 
ATOM   1138 C  CD1   . LEU C 3  55  ? 31.761 209.345 31.457 1.00 14.96  ? 55   LEU A CD1   1 
ATOM   1139 C  CD2   . LEU C 3  55  ? 32.174 207.819 29.496 1.00 11.03  ? 55   LEU A CD2   1 
ATOM   1140 N  N     . ILE C 3  56  ? 28.498 205.008 29.849 1.00 13.18  ? 56   ILE A N     1 
ATOM   1141 C  CA    . ILE C 3  56  ? 27.823 203.776 30.230 1.00 13.81  ? 56   ILE A CA    1 
ATOM   1142 C  C     . ILE C 3  56  ? 28.845 202.867 30.908 1.00 14.88  ? 56   ILE A C     1 
ATOM   1143 O  O     . ILE C 3  56  ? 29.913 202.596 30.348 1.00 15.95  ? 56   ILE A O     1 
ATOM   1144 C  CB    . ILE C 3  56  ? 27.248 203.052 28.993 1.00 13.55  ? 56   ILE A CB    1 
ATOM   1145 C  CG1   . ILE C 3  56  ? 26.354 204.015 28.200 1.00 11.77  ? 56   ILE A CG1   1 
ATOM   1146 C  CG2   . ILE C 3  56  ? 26.471 201.810 29.434 1.00 10.06  ? 56   ILE A CG2   1 
ATOM   1147 C  CD1   . ILE C 3  56  ? 25.780 203.433 26.921 1.00 13.51  ? 56   ILE A CD1   1 
ATOM   1148 N  N     . VAL C 3  57  ? 28.520 202.396 32.109 1.00 12.34  ? 57   VAL A N     1 
ATOM   1149 C  CA    . VAL C 3  57  ? 29.430 201.533 32.846 1.00 11.15  ? 57   VAL A CA    1 
ATOM   1150 C  C     . VAL C 3  57  ? 28.959 200.087 32.939 1.00 13.42  ? 57   VAL A C     1 
ATOM   1151 O  O     . VAL C 3  57  ? 27.828 199.806 33.340 1.00 14.01  ? 57   VAL A O     1 
ATOM   1152 C  CB    . VAL C 3  57  ? 29.632 202.040 34.274 1.00 12.06  ? 57   VAL A CB    1 
ATOM   1153 C  CG1   . VAL C 3  57  ? 30.671 201.187 34.976 1.00 10.71  ? 57   VAL A CG1   1 
ATOM   1154 C  CG2   . VAL C 3  57  ? 30.041 203.505 34.259 1.00 11.66  ? 57   VAL A CG2   1 
ATOM   1155 N  N     . PHE C 3  58  ? 29.840 199.169 32.565 1.00 12.56  ? 58   PHE A N     1 
ATOM   1156 C  CA    . PHE C 3  58  ? 29.538 197.748 32.634 1.00 11.81  ? 58   PHE A CA    1 
ATOM   1157 C  C     . PHE C 3  58  ? 30.702 197.141 33.368 1.00 11.19  ? 58   PHE A C     1 
ATOM   1158 O  O     . PHE C 3  58  ? 31.751 197.765 33.486 1.00 12.61  ? 58   PHE A O     1 
ATOM   1159 C  CB    . PHE C 3  58  ? 29.512 197.107 31.244 1.00 12.02  ? 58   PHE A CB    1 
ATOM   1160 C  CG    . PHE C 3  58  ? 28.326 197.481 30.408 1.00 13.73  ? 58   PHE A CG    1 
ATOM   1161 C  CD1   . PHE C 3  58  ? 27.063 196.962 30.694 1.00 12.78  ? 58   PHE A CD1   1 
ATOM   1162 C  CD2   . PHE C 3  58  ? 28.484 198.294 29.286 1.00 12.30  ? 58   PHE A CD2   1 
ATOM   1163 C  CE1   . PHE C 3  58  ? 25.977 197.237 29.870 1.00 12.61  ? 58   PHE A CE1   1 
ATOM   1164 C  CE2   . PHE C 3  58  ? 27.405 198.578 28.452 1.00 12.15  ? 58   PHE A CE2   1 
ATOM   1165 C  CZ    . PHE C 3  58  ? 26.146 198.046 28.741 1.00 12.52  ? 58   PHE A CZ    1 
ATOM   1166 N  N     . HIS C 3  59  ? 30.516 195.928 33.873 1.00 11.96  ? 59   HIS A N     1 
ATOM   1167 C  CA    . HIS C 3  59  ? 31.605 195.214 34.510 1.00 10.85  ? 59   HIS A CA    1 
ATOM   1168 C  C     . HIS C 3  59  ? 31.848 194.080 33.513 1.00 11.97  ? 59   HIS A C     1 
ATOM   1169 O  O     . HIS C 3  59  ? 31.062 193.138 33.428 1.00 12.99  ? 59   HIS A O     1 
ATOM   1170 C  CB    . HIS C 3  59  ? 31.207 194.645 35.867 1.00 11.63  ? 59   HIS A CB    1 
ATOM   1171 C  CG    . HIS C 3  59  ? 32.311 193.881 36.526 1.00 13.23  ? 59   HIS A CG    1 
ATOM   1172 N  ND1   . HIS C 3  59  ? 33.372 194.500 37.153 1.00 13.37  ? 59   HIS A ND1   1 
ATOM   1173 C  CD2   . HIS C 3  59  ? 32.566 192.552 36.579 1.00 12.42  ? 59   HIS A CD2   1 
ATOM   1174 C  CE1   . HIS C 3  59  ? 34.232 193.583 37.563 1.00 13.19  ? 59   HIS A CE1   1 
ATOM   1175 N  NE2   . HIS C 3  59  ? 33.767 192.393 37.226 1.00 10.90  ? 59   HIS A NE2   1 
ATOM   1176 N  N     . ASN C 3  60  ? 32.915 194.213 32.731 1.00 11.97  ? 60   ASN A N     1 
ATOM   1177 C  CA    . ASN C 3  60  ? 33.297 193.243 31.706 1.00 11.46  ? 60   ASN A CA    1 
ATOM   1178 C  C     . ASN C 3  60  ? 32.468 193.417 30.441 1.00 10.83  ? 60   ASN A C     1 
ATOM   1179 O  O     . ASN C 3  60  ? 32.365 192.508 29.619 1.00 10.13  ? 60   ASN A O     1 
ATOM   1180 C  CB    . ASN C 3  60  ? 33.159 191.800 32.207 1.00 10.77  ? 60   ASN A CB    1 
ATOM   1181 C  CG    . ASN C 3  60  ? 33.830 190.809 31.278 1.00 10.44  ? 60   ASN A CG    1 
ATOM   1182 O  OD1   . ASN C 3  60  ? 34.958 191.030 30.854 1.00 12.65  ? 60   ASN A OD1   1 
ATOM   1183 N  ND2   . ASN C 3  60  ? 33.148 189.719 30.958 1.00 8.70   ? 60   ASN A ND2   1 
ATOM   1184 N  N     . GLY C 3  61  ? 31.889 194.599 30.287 1.00 11.70  ? 61   GLY A N     1 
ATOM   1185 C  CA    . GLY C 3  61  ? 31.075 194.876 29.118 1.00 10.87  ? 61   GLY A CA    1 
ATOM   1186 C  C     . GLY C 3  61  ? 31.880 194.934 27.837 1.00 11.70  ? 61   GLY A C     1 
ATOM   1187 O  O     . GLY C 3  61  ? 31.377 194.577 26.772 1.00 12.44  ? 61   GLY A O     1 
ATOM   1188 N  N     . HIS C 3  62  ? 33.126 195.390 27.921 1.00 12.02  ? 62   HIS A N     1 
ATOM   1189 C  CA    . HIS C 3  62  ? 33.958 195.472 26.722 1.00 13.26  ? 62   HIS A CA    1 
ATOM   1190 C  C     . HIS C 3  62  ? 34.040 194.123 26.011 1.00 12.86  ? 62   HIS A C     1 
ATOM   1191 O  O     . HIS C 3  62  ? 33.929 194.051 24.795 1.00 10.22  ? 62   HIS A O     1 
ATOM   1192 C  CB    . HIS C 3  62  ? 35.367 195.967 27.075 1.00 13.96  ? 62   HIS A CB    1 
ATOM   1193 C  CG    . HIS C 3  62  ? 35.485 197.458 27.132 1.00 12.18  ? 62   HIS A CG    1 
ATOM   1194 N  ND1   . HIS C 3  62  ? 34.571 198.254 27.788 1.00 15.08  ? 62   HIS A ND1   1 
ATOM   1195 C  CD2   . HIS C 3  62  ? 36.404 198.301 26.605 1.00 13.04  ? 62   HIS A CD2   1 
ATOM   1196 C  CE1   . HIS C 3  62  ? 34.917 199.522 27.661 1.00 12.34  ? 62   HIS A CE1   1 
ATOM   1197 N  NE2   . HIS C 3  62  ? 36.027 199.577 26.946 1.00 14.00  ? 62   HIS A NE2   1 
ATOM   1198 N  N     . LYS C 3  63  ? 34.208 193.047 26.772 1.00 14.27  ? 63   LYS A N     1 
ATOM   1199 C  CA    . LYS C 3  63  ? 34.309 191.728 26.161 1.00 15.30  ? 63   LYS A CA    1 
ATOM   1200 C  C     . LYS C 3  63  ? 32.972 191.032 25.985 1.00 14.91  ? 63   LYS A C     1 
ATOM   1201 O  O     . LYS C 3  63  ? 32.792 190.265 25.041 1.00 14.54  ? 63   LYS A O     1 
ATOM   1202 C  CB    . LYS C 3  63  ? 35.246 190.835 26.977 1.00 16.32  ? 63   LYS A CB    1 
ATOM   1203 C  CG    . LYS C 3  63  ? 36.706 191.230 26.867 1.00 18.86  ? 63   LYS A CG    1 
ATOM   1204 C  CD    . LYS C 3  63  ? 37.610 190.331 27.708 1.00 20.78  ? 63   LYS A CD    1 
ATOM   1205 C  CE    . LYS C 3  63  ? 37.598 188.889 27.239 1.00 20.19  ? 63   LYS A CE    1 
ATOM   1206 N  NZ    . LYS C 3  63  ? 38.756 188.128 27.797 1.00 18.53  ? 63   LYS A NZ    1 
ATOM   1207 N  N     . TYR C 3  64  ? 32.022 191.305 26.872 1.00 13.67  ? 64   TYR A N     1 
ATOM   1208 C  CA    . TYR C 3  64  ? 30.736 190.637 26.757 1.00 14.03  ? 64   TYR A CA    1 
ATOM   1209 C  C     . TYR C 3  64  ? 29.524 191.487 26.383 1.00 13.81  ? 64   TYR A C     1 
ATOM   1210 O  O     . TYR C 3  64  ? 29.097 191.487 25.226 1.00 15.66  ? 64   TYR A O     1 
ATOM   1211 C  CB    . TYR C 3  64  ? 30.425 189.871 28.043 1.00 14.45  ? 64   TYR A CB    1 
ATOM   1212 C  CG    . TYR C 3  64  ? 29.163 189.049 27.944 1.00 14.11  ? 64   TYR A CG    1 
ATOM   1213 C  CD1   . TYR C 3  64  ? 29.115 187.906 27.150 1.00 13.92  ? 64   TYR A CD1   1 
ATOM   1214 C  CD2   . TYR C 3  64  ? 28.003 189.442 28.607 1.00 14.95  ? 64   TYR A CD2   1 
ATOM   1215 C  CE1   . TYR C 3  64  ? 27.945 187.180 27.016 1.00 15.55  ? 64   TYR A CE1   1 
ATOM   1216 C  CE2   . TYR C 3  64  ? 26.825 188.721 28.482 1.00 15.08  ? 64   TYR A CE2   1 
ATOM   1217 C  CZ    . TYR C 3  64  ? 26.801 187.594 27.687 1.00 17.01  ? 64   TYR A CZ    1 
ATOM   1218 O  OH    . TYR C 3  64  ? 25.637 186.869 27.576 1.00 19.95  ? 64   TYR A OH    1 
ATOM   1219 N  N     . ASP C 3  65  ? 28.976 192.206 27.359 1.00 11.64  ? 65   ASP A N     1 
ATOM   1220 C  CA    . ASP C 3  65  ? 27.777 193.015 27.153 1.00 11.57  ? 65   ASP A CA    1 
ATOM   1221 C  C     . ASP C 3  65  ? 27.685 193.827 25.871 1.00 11.73  ? 65   ASP A C     1 
ATOM   1222 O  O     . ASP C 3  65  ? 26.711 193.700 25.135 1.00 12.38  ? 65   ASP A O     1 
ATOM   1223 C  CB    . ASP C 3  65  ? 27.560 193.947 28.344 1.00 12.92  ? 65   ASP A CB    1 
ATOM   1224 C  CG    . ASP C 3  65  ? 27.514 193.202 29.656 1.00 13.77  ? 65   ASP A CG    1 
ATOM   1225 O  OD1   . ASP C 3  65  ? 28.553 192.616 30.028 1.00 13.61  ? 65   ASP A OD1   1 
ATOM   1226 O  OD2   . ASP C 3  65  ? 26.448 193.199 30.307 1.00 12.92  ? 65   ASP A OD2   1 
ATOM   1227 N  N     . VAL C 3  66  ? 28.681 194.669 25.610 1.00 11.38  ? 66   VAL A N     1 
ATOM   1228 C  CA    . VAL C 3  66  ? 28.670 195.507 24.416 1.00 9.30   ? 66   VAL A CA    1 
ATOM   1229 C  C     . VAL C 3  66  ? 28.555 194.698 23.125 1.00 9.79   ? 66   VAL A C     1 
ATOM   1230 O  O     . VAL C 3  66  ? 27.628 194.908 22.349 1.00 11.41  ? 66   VAL A O     1 
ATOM   1231 C  CB    . VAL C 3  66  ? 29.919 196.420 24.376 1.00 9.00   ? 66   VAL A CB    1 
ATOM   1232 C  CG1   . VAL C 3  66  ? 29.932 197.271 23.108 1.00 1.55   ? 66   VAL A CG1   1 
ATOM   1233 C  CG2   . VAL C 3  66  ? 29.916 197.323 25.607 1.00 7.51   ? 66   VAL A CG2   1 
ATOM   1234 N  N     . PRO C 3  67  ? 29.484 193.758 22.881 1.00 10.65  ? 67   PRO A N     1 
ATOM   1235 C  CA    . PRO C 3  67  ? 29.408 192.956 21.652 1.00 10.29  ? 67   PRO A CA    1 
ATOM   1236 C  C     . PRO C 3  67  ? 28.135 192.098 21.633 1.00 11.94  ? 67   PRO A C     1 
ATOM   1237 O  O     . PRO C 3  67  ? 27.520 191.906 20.585 1.00 10.87  ? 67   PRO A O     1 
ATOM   1238 C  CB    . PRO C 3  67  ? 30.661 192.085 21.715 1.00 9.27   ? 67   PRO A CB    1 
ATOM   1239 C  CG    . PRO C 3  67  ? 31.576 192.830 22.662 1.00 12.91  ? 67   PRO A CG    1 
ATOM   1240 C  CD    . PRO C 3  67  ? 30.648 193.371 23.697 1.00 9.00   ? 67   PRO A CD    1 
ATOM   1241 N  N     . ALA C 3  68  ? 27.757 191.590 22.806 1.00 10.94  ? 68   ALA A N     1 
ATOM   1242 C  CA    . ALA C 3  68  ? 26.573 190.750 22.940 1.00 11.85  ? 68   ALA A CA    1 
ATOM   1243 C  C     . ALA C 3  68  ? 25.312 191.481 22.497 1.00 13.53  ? 68   ALA A C     1 
ATOM   1244 O  O     . ALA C 3  68  ? 24.459 190.920 21.800 1.00 15.23  ? 68   ALA A O     1 
ATOM   1245 C  CB    . ALA C 3  68  ? 26.420 190.287 24.384 1.00 8.67   ? 68   ALA A CB    1 
ATOM   1246 N  N     . LEU C 3  69  ? 25.192 192.734 22.910 1.00 14.02  ? 69   LEU A N     1 
ATOM   1247 C  CA    . LEU C 3  69  ? 24.034 193.532 22.559 1.00 14.53  ? 69   LEU A CA    1 
ATOM   1248 C  C     . LEU C 3  69  ? 24.011 193.768 21.055 1.00 14.95  ? 69   LEU A C     1 
ATOM   1249 O  O     . LEU C 3  69  ? 22.954 193.705 20.422 1.00 16.17  ? 69   LEU A O     1 
ATOM   1250 C  CB    . LEU C 3  69  ? 24.064 194.855 23.329 1.00 12.99  ? 69   LEU A CB    1 
ATOM   1251 C  CG    . LEU C 3  69  ? 23.835 194.639 24.830 1.00 12.43  ? 69   LEU A CG    1 
ATOM   1252 C  CD1   . LEU C 3  69  ? 24.223 195.875 25.611 1.00 11.26  ? 69   LEU A CD1   1 
ATOM   1253 C  CD2   . LEU C 3  69  ? 22.379 194.276 25.066 1.00 10.85  ? 69   LEU A CD2   1 
ATOM   1254 N  N     . THR C 3  70  ? 25.175 194.023 20.472 1.00 13.97  ? 70   THR A N     1 
ATOM   1255 C  CA    . THR C 3  70  ? 25.229 194.243 19.035 1.00 13.93  ? 70   THR A CA    1 
ATOM   1256 C  C     . THR C 3  70  ? 24.666 192.999 18.336 1.00 14.72  ? 70   THR A C     1 
ATOM   1257 O  O     . THR C 3  70  ? 23.831 193.089 17.434 1.00 12.85  ? 70   THR A O     1 
ATOM   1258 C  CB    . THR C 3  70  ? 26.681 194.489 18.574 1.00 13.34  ? 70   THR A CB    1 
ATOM   1259 O  OG1   . THR C 3  70  ? 27.134 195.739 19.103 1.00 13.07  ? 70   THR A OG1   1 
ATOM   1260 C  CG2   . THR C 3  70  ? 26.777 194.509 17.047 1.00 9.21   ? 70   THR A CG2   1 
ATOM   1261 N  N     . LYS C 3  71  ? 25.116 191.836 18.784 1.00 15.27  ? 71   LYS A N     1 
ATOM   1262 C  CA    . LYS C 3  71  ? 24.683 190.579 18.203 1.00 16.13  ? 71   LYS A CA    1 
ATOM   1263 C  C     . LYS C 3  71  ? 23.192 190.313 18.427 1.00 15.16  ? 71   LYS A C     1 
ATOM   1264 O  O     . LYS C 3  71  ? 22.456 190.043 17.481 1.00 14.16  ? 71   LYS A O     1 
ATOM   1265 C  CB    . LYS C 3  71  ? 25.530 189.444 18.779 1.00 17.11  ? 71   LYS A CB    1 
ATOM   1266 C  CG    . LYS C 3  71  ? 25.270 188.090 18.169 1.00 16.98  ? 71   LYS A CG    1 
ATOM   1267 C  CD    . LYS C 3  71  ? 26.258 187.075 18.688 1.00 18.71  ? 71   LYS A CD    1 
ATOM   1268 C  CE    . LYS C 3  71  ? 25.905 185.679 18.223 1.00 19.70  ? 71   LYS A CE    1 
ATOM   1269 N  NZ    . LYS C 3  71  ? 26.840 184.688 18.815 1.00 20.81  ? 71   LYS A NZ    1 
ATOM   1270 N  N     . LEU C 3  72  ? 22.747 190.409 19.674 1.00 16.03  ? 72   LEU A N     1 
ATOM   1271 C  CA    . LEU C 3  72  ? 21.347 190.164 19.995 1.00 16.16  ? 72   LEU A CA    1 
ATOM   1272 C  C     . LEU C 3  72  ? 20.413 191.146 19.305 1.00 16.90  ? 72   LEU A C     1 
ATOM   1273 O  O     . LEU C 3  72  ? 19.316 190.772 18.886 1.00 17.62  ? 72   LEU A O     1 
ATOM   1274 C  CB    . LEU C 3  72  ? 21.130 190.212 21.508 1.00 12.31  ? 72   LEU A CB    1 
ATOM   1275 C  CG    . LEU C 3  72  ? 21.902 189.124 22.263 1.00 14.55  ? 72   LEU A CG    1 
ATOM   1276 C  CD1   . LEU C 3  72  ? 21.782 189.350 23.774 1.00 9.51   ? 72   LEU A CD1   1 
ATOM   1277 C  CD2   . LEU C 3  72  ? 21.370 187.748 21.857 1.00 10.44  ? 72   LEU A CD2   1 
ATOM   1278 N  N     . ALA C 3  73  ? 20.850 192.395 19.181 1.00 17.50  ? 73   ALA A N     1 
ATOM   1279 C  CA    . ALA C 3  73  ? 20.042 193.421 18.539 1.00 18.52  ? 73   ALA A CA    1 
ATOM   1280 C  C     . ALA C 3  73  ? 19.764 193.039 17.090 1.00 20.67  ? 73   ALA A C     1 
ATOM   1281 O  O     . ALA C 3  73  ? 18.662 193.244 16.579 1.00 22.50  ? 73   ALA A O     1 
ATOM   1282 C  CB    . ALA C 3  73  ? 20.753 194.757 18.595 1.00 15.87  ? 73   ALA A CB    1 
ATOM   1283 N  N     . LYS C 3  74  ? 20.763 192.472 16.428 1.00 21.46  ? 74   LYS A N     1 
ATOM   1284 C  CA    . LYS C 3  74  ? 20.600 192.081 15.041 1.00 23.12  ? 74   LYS A CA    1 
ATOM   1285 C  C     . LYS C 3  74  ? 19.723 190.845 14.913 1.00 22.75  ? 74   LYS A C     1 
ATOM   1286 O  O     . LYS C 3  74  ? 18.854 190.788 14.048 1.00 22.81  ? 74   LYS A O     1 
ATOM   1287 C  CB    . LYS C 3  74  ? 21.964 191.827 14.400 1.00 25.07  ? 74   LYS A CB    1 
ATOM   1288 C  CG    . LYS C 3  74  ? 21.904 191.475 12.923 1.00 28.68  ? 74   LYS A CG    1 
ATOM   1289 C  CD    . LYS C 3  74  ? 21.178 192.545 12.118 1.00 32.70  ? 74   LYS A CD    1 
ATOM   1290 C  CE    . LYS C 3  74  ? 21.154 192.192 10.636 1.00 36.36  ? 74   LYS A CE    1 
ATOM   1291 N  NZ    . LYS C 3  74  ? 20.159 193.016 9.876  1.00 40.23  ? 74   LYS A NZ    1 
ATOM   1292 N  N     . LEU C 3  75  ? 19.944 189.858 15.774 1.00 21.44  ? 75   LEU A N     1 
ATOM   1293 C  CA    . LEU C 3  75  ? 19.159 188.632 15.724 1.00 23.06  ? 75   LEU A CA    1 
ATOM   1294 C  C     . LEU C 3  75  ? 17.700 188.794 16.153 1.00 21.72  ? 75   LEU A C     1 
ATOM   1295 O  O     . LEU C 3  75  ? 16.780 188.410 15.431 1.00 20.98  ? 75   LEU A O     1 
ATOM   1296 C  CB    . LEU C 3  75  ? 19.804 187.552 16.597 1.00 26.21  ? 75   LEU A CB    1 
ATOM   1297 C  CG    . LEU C 3  75  ? 21.139 186.968 16.135 1.00 29.24  ? 75   LEU A CG    1 
ATOM   1298 C  CD1   . LEU C 3  75  ? 21.729 186.118 17.247 1.00 29.63  ? 75   LEU A CD1   1 
ATOM   1299 C  CD2   . LEU C 3  75  ? 20.935 186.147 14.865 1.00 28.83  ? 75   LEU A CD2   1 
ATOM   1300 N  N     . GLN C 3  76  ? 17.487 189.370 17.327 1.00 20.43  ? 76   GLN A N     1 
ATOM   1301 C  CA    . GLN C 3  76  ? 16.137 189.514 17.843 1.00 20.77  ? 76   GLN A CA    1 
ATOM   1302 C  C     . GLN C 3  76  ? 15.287 190.637 17.288 1.00 21.54  ? 76   GLN A C     1 
ATOM   1303 O  O     . GLN C 3  76  ? 14.102 190.440 17.039 1.00 22.80  ? 76   GLN A O     1 
ATOM   1304 C  CB    . GLN C 3  76  ? 16.180 189.620 19.365 1.00 19.65  ? 76   GLN A CB    1 
ATOM   1305 C  CG    . GLN C 3  76  ? 16.742 188.379 20.037 1.00 18.75  ? 76   GLN A CG    1 
ATOM   1306 C  CD    . GLN C 3  76  ? 16.846 188.533 21.537 1.00 19.03  ? 76   GLN A CD    1 
ATOM   1307 O  OE1   . GLN C 3  76  ? 17.933 188.729 22.080 1.00 18.47  ? 76   GLN A OE1   1 
ATOM   1308 N  NE2   . GLN C 3  76  ? 15.709 188.460 22.215 1.00 16.49  ? 76   GLN A NE2   1 
ATOM   1309 N  N     . LEU C 3  77  ? 15.882 191.808 17.087 1.00 22.49  ? 77   LEU A N     1 
ATOM   1310 C  CA    . LEU C 3  77  ? 15.139 192.961 16.591 1.00 21.62  ? 77   LEU A CA    1 
ATOM   1311 C  C     . LEU C 3  77  ? 15.583 193.405 15.208 1.00 21.68  ? 77   LEU A C     1 
ATOM   1312 O  O     . LEU C 3  77  ? 15.064 194.384 14.673 1.00 21.14  ? 77   LEU A O     1 
ATOM   1313 C  CB    . LEU C 3  77  ? 15.307 194.137 17.559 1.00 21.94  ? 77   LEU A CB    1 
ATOM   1314 C  CG    . LEU C 3  77  ? 14.892 193.920 19.014 1.00 22.21  ? 77   LEU A CG    1 
ATOM   1315 C  CD1   . LEU C 3  77  ? 15.391 195.072 19.876 1.00 20.21  ? 77   LEU A CD1   1 
ATOM   1316 C  CD2   . LEU C 3  77  ? 13.381 193.795 19.094 1.00 21.92  ? 77   LEU A CD2   1 
ATOM   1317 N  N     . ASN C 3  78  ? 16.542 192.694 14.630 1.00 21.97  ? 78   ASN A N     1 
ATOM   1318 C  CA    . ASN C 3  78  ? 17.050 193.069 13.322 1.00 23.87  ? 78   ASN A CA    1 
ATOM   1319 C  C     . ASN C 3  78  ? 17.372 194.564 13.348 1.00 24.27  ? 78   ASN A C     1 
ATOM   1320 O  O     . ASN C 3  78  ? 16.956 195.322 12.471 1.00 24.72  ? 78   ASN A O     1 
ATOM   1321 C  CB    . ASN C 3  78  ? 16.009 192.767 12.245 1.00 26.57  ? 78   ASN A CB    1 
ATOM   1322 C  CG    . ASN C 3  78  ? 16.538 193.002 10.854 1.00 30.76  ? 78   ASN A CG    1 
ATOM   1323 O  OD1   . ASN C 3  78  ? 17.636 192.550 10.509 1.00 33.55  ? 78   ASN A OD1   1 
ATOM   1324 N  ND2   . ASN C 3  78  ? 15.764 193.707 10.039 1.00 32.41  ? 78   ASN A ND2   1 
ATOM   1325 N  N     . ARG C 3  79  ? 18.119 194.966 14.375 1.00 23.81  ? 79   ARG A N     1 
ATOM   1326 C  CA    . ARG C 3  79  ? 18.511 196.350 14.584 1.00 22.19  ? 79   ARG A CA    1 
ATOM   1327 C  C     . ARG C 3  79  ? 20.034 196.470 14.631 1.00 22.74  ? 79   ARG A C     1 
ATOM   1328 O  O     . ARG C 3  79  ? 20.727 195.557 15.095 1.00 22.82  ? 79   ARG A O     1 
ATOM   1329 C  CB    . ARG C 3  79  ? 17.932 196.870 15.917 1.00 23.11  ? 79   ARG A CB    1 
ATOM   1330 C  CG    . ARG C 3  79  ? 18.030 198.387 16.084 1.00 25.03  ? 79   ARG A CG    1 
ATOM   1331 C  CD    . ARG C 3  79  ? 18.239 198.879 17.524 1.00 21.89  ? 79   ARG A CD    1 
ATOM   1332 N  NE    . ARG C 3  79  ? 17.043 198.869 18.360 1.00 21.13  ? 79   ARG A NE    1 
ATOM   1333 C  CZ    . ARG C 3  79  ? 16.811 199.748 19.338 1.00 20.57  ? 79   ARG A CZ    1 
ATOM   1334 N  NH1   . ARG C 3  79  ? 17.688 200.713 19.587 1.00 15.56  ? 79   ARG A NH1   1 
ATOM   1335 N  NH2   . ARG C 3  79  ? 15.718 199.646 20.089 1.00 17.29  ? 79   ARG A NH2   1 
ATOM   1336 N  N     . GLU C 3  80  ? 20.551 197.590 14.136 1.00 21.98  ? 80   GLU A N     1 
ATOM   1337 C  CA    . GLU C 3  80  ? 21.986 197.851 14.167 1.00 21.11  ? 80   GLU A CA    1 
ATOM   1338 C  C     . GLU C 3  80  ? 22.239 198.582 15.483 1.00 19.65  ? 80   GLU A C     1 
ATOM   1339 O  O     . GLU C 3  80  ? 21.679 199.651 15.719 1.00 18.61  ? 80   GLU A O     1 
ATOM   1340 C  CB    . GLU C 3  80  ? 22.407 198.756 13.005 1.00 22.56  ? 80   GLU A CB    1 
ATOM   1341 C  CG    . GLU C 3  80  ? 22.316 198.133 11.626 1.00 25.34  ? 80   GLU A CG    1 
ATOM   1342 C  CD    . GLU C 3  80  ? 23.252 196.954 11.456 1.00 29.87  ? 80   GLU A CD    1 
ATOM   1343 O  OE1   . GLU C 3  80  ? 24.391 197.015 11.971 1.00 30.81  ? 80   GLU A OE1   1 
ATOM   1344 O  OE2   . GLU C 3  80  ? 22.856 195.968 10.797 1.00 30.61  ? 80   GLU A OE2   1 
ATOM   1345 N  N     . PHE C 3  81  ? 23.077 198.007 16.338 1.00 18.68  ? 81   PHE A N     1 
ATOM   1346 C  CA    . PHE C 3  81  ? 23.387 198.608 17.631 1.00 16.33  ? 81   PHE A CA    1 
ATOM   1347 C  C     . PHE C 3  81  ? 24.890 198.551 17.841 1.00 15.97  ? 81   PHE A C     1 
ATOM   1348 O  O     . PHE C 3  81  ? 25.473 197.471 17.854 1.00 18.46  ? 81   PHE A O     1 
ATOM   1349 C  CB    . PHE C 3  81  ? 22.685 197.830 18.738 1.00 14.64  ? 81   PHE A CB    1 
ATOM   1350 C  CG    . PHE C 3  81  ? 22.832 198.443 20.100 1.00 13.41  ? 81   PHE A CG    1 
ATOM   1351 C  CD1   . PHE C 3  81  ? 22.113 199.584 20.441 1.00 10.93  ? 81   PHE A CD1   1 
ATOM   1352 C  CD2   . PHE C 3  81  ? 23.667 197.864 21.047 1.00 10.93  ? 81   PHE A CD2   1 
ATOM   1353 C  CE1   . PHE C 3  81  ? 22.216 200.140 21.708 1.00 12.69  ? 81   PHE A CE1   1 
ATOM   1354 C  CE2   . PHE C 3  81  ? 23.784 198.411 22.323 1.00 14.30  ? 81   PHE A CE2   1 
ATOM   1355 C  CZ    . PHE C 3  81  ? 23.055 199.554 22.658 1.00 13.62  ? 81   PHE A CZ    1 
ATOM   1356 N  N     . HIS C 3  82  ? 25.518 199.710 18.008 1.00 14.87  ? 82   HIS A N     1 
ATOM   1357 C  CA    . HIS C 3  82  ? 26.967 199.773 18.193 1.00 14.70  ? 82   HIS A CA    1 
ATOM   1358 C  C     . HIS C 3  82  ? 27.376 200.891 19.153 1.00 14.37  ? 82   HIS A C     1 
ATOM   1359 O  O     . HIS C 3  82  ? 27.623 202.011 18.721 1.00 15.83  ? 82   HIS A O     1 
ATOM   1360 C  CB    . HIS C 3  82  ? 27.651 200.009 16.841 1.00 13.74  ? 82   HIS A CB    1 
ATOM   1361 C  CG    . HIS C 3  82  ? 27.213 199.064 15.765 1.00 17.23  ? 82   HIS A CG    1 
ATOM   1362 N  ND1   . HIS C 3  82  ? 27.723 197.788 15.635 1.00 18.82  ? 82   HIS A ND1   1 
ATOM   1363 C  CD2   . HIS C 3  82  ? 26.290 199.200 14.783 1.00 15.80  ? 82   HIS A CD2   1 
ATOM   1364 C  CE1   . HIS C 3  82  ? 27.134 197.181 14.621 1.00 16.03  ? 82   HIS A CE1   1 
ATOM   1365 N  NE2   . HIS C 3  82  ? 26.260 198.016 14.088 1.00 17.70  ? 82   HIS A NE2   1 
ATOM   1366 N  N     . LEU C 3  83  ? 27.440 200.604 20.449 1.00 14.02  ? 83   LEU A N     1 
ATOM   1367 C  CA    . LEU C 3  83  ? 27.849 201.633 21.402 1.00 13.21  ? 83   LEU A CA    1 
ATOM   1368 C  C     . LEU C 3  83  ? 29.258 202.074 21.040 1.00 11.83  ? 83   LEU A C     1 
ATOM   1369 O  O     . LEU C 3  83  ? 30.121 201.246 20.790 1.00 11.21  ? 83   LEU A O     1 
ATOM   1370 C  CB    . LEU C 3  83  ? 27.851 201.085 22.829 1.00 11.63  ? 83   LEU A CB    1 
ATOM   1371 C  CG    . LEU C 3  83  ? 26.492 200.652 23.354 1.00 12.73  ? 83   LEU A CG    1 
ATOM   1372 C  CD1   . LEU C 3  83  ? 26.663 200.118 24.764 1.00 11.87  ? 83   LEU A CD1   1 
ATOM   1373 C  CD2   . LEU C 3  83  ? 25.517 201.844 23.315 1.00 9.89   ? 83   LEU A CD2   1 
ATOM   1374 N  N     . PRO C 3  84  ? 29.508 203.386 20.999 1.00 11.92  ? 84   PRO A N     1 
ATOM   1375 C  CA    . PRO C 3  84  ? 30.856 203.840 20.653 1.00 13.31  ? 84   PRO A CA    1 
ATOM   1376 C  C     . PRO C 3  84  ? 31.829 203.542 21.789 1.00 14.01  ? 84   PRO A C     1 
ATOM   1377 O  O     . PRO C 3  84  ? 31.470 203.595 22.970 1.00 14.36  ? 84   PRO A O     1 
ATOM   1378 C  CB    . PRO C 3  84  ? 30.669 205.342 20.422 1.00 12.14  ? 84   PRO A CB    1 
ATOM   1379 C  CG    . PRO C 3  84  ? 29.216 205.458 20.053 1.00 13.17  ? 84   PRO A CG    1 
ATOM   1380 C  CD    . PRO C 3  84  ? 28.569 204.518 21.025 1.00 13.17  ? 84   PRO A CD    1 
ATOM   1381 N  N     . ARG C 3  85  ? 33.064 203.242 21.418 1.00 14.59  ? 85   ARG A N     1 
ATOM   1382 C  CA    . ARG C 3  85  ? 34.106 202.913 22.377 1.00 16.43  ? 85   ARG A CA    1 
ATOM   1383 C  C     . ARG C 3  85  ? 34.310 203.983 23.454 1.00 16.72  ? 85   ARG A C     1 
ATOM   1384 O  O     . ARG C 3  85  ? 34.464 203.662 24.638 1.00 15.74  ? 85   ARG A O     1 
ATOM   1385 C  CB    . ARG C 3  85  ? 35.415 202.684 21.626 1.00 18.24  ? 85   ARG A CB    1 
ATOM   1386 C  CG    . ARG C 3  85  ? 36.585 202.278 22.491 1.00 20.99  ? 85   ARG A CG    1 
ATOM   1387 C  CD    . ARG C 3  85  ? 37.773 203.155 22.178 1.00 23.56  ? 85   ARG A CD    1 
ATOM   1388 N  NE    . ARG C 3  85  ? 37.794 204.346 23.016 1.00 24.31  ? 85   ARG A NE    1 
ATOM   1389 C  CZ    . ARG C 3  85  ? 37.984 205.583 22.568 1.00 24.39  ? 85   ARG A CZ    1 
ATOM   1390 N  NH1   . ARG C 3  85  ? 38.166 205.808 21.270 1.00 19.18  ? 85   ARG A NH1   1 
ATOM   1391 N  NH2   . ARG C 3  85  ? 38.010 206.593 23.432 1.00 24.02  ? 85   ARG A NH2   1 
ATOM   1392 N  N     . GLU C 3  86  ? 34.296 205.249 23.042 1.00 16.47  ? 86   GLU A N     1 
ATOM   1393 C  CA    . GLU C 3  86  ? 34.512 206.360 23.966 1.00 16.87  ? 86   GLU A CA    1 
ATOM   1394 C  C     . GLU C 3  86  ? 33.398 206.585 24.971 1.00 14.98  ? 86   GLU A C     1 
ATOM   1395 O  O     . GLU C 3  86  ? 33.570 207.351 25.912 1.00 12.57  ? 86   GLU A O     1 
ATOM   1396 C  CB    . GLU C 3  86  ? 34.751 207.667 23.207 1.00 17.49  ? 86   GLU A CB    1 
ATOM   1397 C  CG    . GLU C 3  86  ? 33.603 208.087 22.320 1.00 21.34  ? 86   GLU A CG    1 
ATOM   1398 C  CD    . GLU C 3  86  ? 33.812 207.675 20.877 1.00 25.50  ? 86   GLU A CD    1 
ATOM   1399 O  OE1   . GLU C 3  86  ? 34.229 206.512 20.633 1.00 21.99  ? 86   GLU A OE1   1 
ATOM   1400 O  OE2   . GLU C 3  86  ? 33.550 208.522 19.992 1.00 28.38  ? 86   GLU A OE2   1 
ATOM   1401 N  N     . ASN C 3  87  ? 32.260 205.925 24.781 1.00 15.59  ? 87   ASN A N     1 
ATOM   1402 C  CA    . ASN C 3  87  ? 31.143 206.091 25.714 1.00 14.17  ? 87   ASN A CA    1 
ATOM   1403 C  C     . ASN C 3  87  ? 31.091 204.959 26.755 1.00 13.98  ? 87   ASN A C     1 
ATOM   1404 O  O     . ASN C 3  87  ? 30.246 204.969 27.664 1.00 12.39  ? 87   ASN A O     1 
ATOM   1405 C  CB    . ASN C 3  87  ? 29.810 206.133 24.947 1.00 11.87  ? 87   ASN A CB    1 
ATOM   1406 C  CG    . ASN C 3  87  ? 29.741 207.272 23.947 1.00 10.47  ? 87   ASN A CG    1 
ATOM   1407 O  OD1   . ASN C 3  87  ? 29.956 207.083 22.750 1.00 11.18  ? 87   ASN A OD1   1 
ATOM   1408 N  ND2   . ASN C 3  87  ? 29.448 208.464 24.436 1.00 10.88  ? 87   ASN A ND2   1 
ATOM   1409 N  N     . CYS C 3  88  ? 32.000 203.995 26.634 1.00 11.47  ? 88   CYS A N     1 
ATOM   1410 C  CA    . CYS C 3  88  ? 31.990 202.858 27.544 1.00 12.09  ? 88   CYS A CA    1 
ATOM   1411 C  C     . CYS C 3  88  ? 33.100 202.786 28.573 1.00 11.85  ? 88   CYS A C     1 
ATOM   1412 O  O     . CYS C 3  88  ? 34.248 203.154 28.316 1.00 13.41  ? 88   CYS A O     1 
ATOM   1413 C  CB    . CYS C 3  88  ? 31.976 201.558 26.740 1.00 11.99  ? 88   CYS A CB    1 
ATOM   1414 S  SG    . CYS C 3  88  ? 30.643 201.487 25.548 1.00 13.82  ? 88   CYS A SG    1 
ATOM   1415 N  N     . ILE C 3  89  ? 32.732 202.290 29.747 1.00 10.86  ? 89   ILE A N     1 
ATOM   1416 C  CA    . ILE C 3  89  ? 33.658 202.125 30.852 1.00 10.51  ? 89   ILE A CA    1 
ATOM   1417 C  C     . ILE C 3  89  ? 33.480 200.695 31.361 1.00 10.28  ? 89   ILE A C     1 
ATOM   1418 O  O     . ILE C 3  89  ? 32.362 200.188 31.449 1.00 10.66  ? 89   ILE A O     1 
ATOM   1419 C  CB    . ILE C 3  89  ? 33.354 203.150 31.979 1.00 10.89  ? 89   ILE A CB    1 
ATOM   1420 C  CG1   . ILE C 3  89  ? 33.649 204.562 31.475 1.00 11.44  ? 89   ILE A CG1   1 
ATOM   1421 C  CG2   . ILE C 3  89  ? 34.177 202.847 33.221 1.00 10.88  ? 89   ILE A CG2   1 
ATOM   1422 C  CD1   . ILE C 3  89  ? 33.297 205.666 32.468 1.00 12.76  ? 89   ILE A CD1   1 
ATOM   1423 N  N     . ASP C 3  90  ? 34.588 200.040 31.673 1.00 10.76  ? 90   ASP A N     1 
ATOM   1424 C  CA    . ASP C 3  90  ? 34.550 198.673 32.172 1.00 11.28  ? 90   ASP A CA    1 
ATOM   1425 C  C     . ASP C 3  90  ? 35.213 198.662 33.557 1.00 11.91  ? 90   ASP A C     1 
ATOM   1426 O  O     . ASP C 3  90  ? 36.415 198.947 33.679 1.00 11.22  ? 90   ASP A O     1 
ATOM   1427 C  CB    . ASP C 3  90  ? 35.306 197.749 31.202 1.00 10.74  ? 90   ASP A CB    1 
ATOM   1428 C  CG    . ASP C 3  90  ? 35.062 196.276 31.480 1.00 12.35  ? 90   ASP A CG    1 
ATOM   1429 O  OD1   . ASP C 3  90  ? 35.197 195.861 32.651 1.00 11.93  ? 90   ASP A OD1   1 
ATOM   1430 O  OD2   . ASP C 3  90  ? 34.743 195.534 30.521 1.00 12.76  ? 90   ASP A OD2   1 
ATOM   1431 N  N     . THR C 3  91  ? 34.436 198.357 34.599 1.00 11.60  ? 91   THR A N     1 
ATOM   1432 C  CA    . THR C 3  91  ? 34.988 198.327 35.952 1.00 11.03  ? 91   THR A CA    1 
ATOM   1433 C  C     . THR C 3  91  ? 36.019 197.227 36.124 1.00 11.63  ? 91   THR A C     1 
ATOM   1434 O  O     . THR C 3  91  ? 36.876 197.317 37.000 1.00 10.69  ? 91   THR A O     1 
ATOM   1435 C  CB    . THR C 3  91  ? 33.893 198.163 37.044 1.00 10.88  ? 91   THR A CB    1 
ATOM   1436 O  OG1   . THR C 3  91  ? 32.923 197.199 36.626 1.00 12.37  ? 91   THR A OG1   1 
ATOM   1437 C  CG2   . THR C 3  91  ? 33.213 199.506 37.333 1.00 9.03   ? 91   THR A CG2   1 
ATOM   1438 N  N     . LEU C 3  92  ? 35.943 196.190 35.288 1.00 12.89  ? 92   LEU A N     1 
ATOM   1439 C  CA    . LEU C 3  92  ? 36.907 195.094 35.366 1.00 11.99  ? 92   LEU A CA    1 
ATOM   1440 C  C     . LEU C 3  92  ? 38.237 195.587 34.820 1.00 12.49  ? 92   LEU A C     1 
ATOM   1441 O  O     . LEU C 3  92  ? 39.300 195.213 35.318 1.00 13.61  ? 92   LEU A O     1 
ATOM   1442 C  CB    . LEU C 3  92  ? 36.437 193.879 34.559 1.00 10.91  ? 92   LEU A CB    1 
ATOM   1443 C  CG    . LEU C 3  92  ? 37.350 192.642 34.579 1.00 11.75  ? 92   LEU A CG    1 
ATOM   1444 C  CD1   . LEU C 3  92  ? 37.638 192.217 36.008 1.00 11.57  ? 92   LEU A CD1   1 
ATOM   1445 C  CD2   . LEU C 3  92  ? 36.689 191.498 33.837 1.00 12.05  ? 92   LEU A CD2   1 
ATOM   1446 N  N     . VAL C 3  93  ? 38.171 196.416 33.783 1.00 11.72  ? 93   VAL A N     1 
ATOM   1447 C  CA    . VAL C 3  93  ? 39.373 196.981 33.184 1.00 11.00  ? 93   VAL A CA    1 
ATOM   1448 C  C     . VAL C 3  93  ? 39.983 197.959 34.189 1.00 11.37  ? 93   VAL A C     1 
ATOM   1449 O  O     . VAL C 3  93  ? 41.195 197.976 34.394 1.00 9.88   ? 93   VAL A O     1 
ATOM   1450 C  CB    . VAL C 3  93  ? 39.054 197.753 31.890 1.00 11.20  ? 93   VAL A CB    1 
ATOM   1451 C  CG1   . VAL C 3  93  ? 40.322 198.386 31.339 1.00 8.51   ? 93   VAL A CG1   1 
ATOM   1452 C  CG2   . VAL C 3  93  ? 38.439 196.820 30.870 1.00 13.06  ? 93   VAL A CG2   1 
ATOM   1453 N  N     . LEU C 3  94  ? 39.129 198.773 34.805 1.00 10.18  ? 94   LEU A N     1 
ATOM   1454 C  CA    . LEU C 3  94  ? 39.575 199.741 35.792 1.00 10.75  ? 94   LEU A CA    1 
ATOM   1455 C  C     . LEU C 3  94  ? 40.185 199.038 36.980 1.00 11.43  ? 94   LEU A C     1 
ATOM   1456 O  O     . LEU C 3  94  ? 41.233 199.439 37.489 1.00 13.49  ? 94   LEU A O     1 
ATOM   1457 C  CB    . LEU C 3  94  ? 38.409 200.585 36.296 1.00 9.61   ? 94   LEU A CB    1 
ATOM   1458 C  CG    . LEU C 3  94  ? 38.333 202.018 35.797 1.00 9.79   ? 94   LEU A CG    1 
ATOM   1459 C  CD1   . LEU C 3  94  ? 37.201 202.713 36.514 1.00 9.55   ? 94   LEU A CD1   1 
ATOM   1460 C  CD2   . LEU C 3  94  ? 39.656 202.728 36.051 1.00 11.82  ? 94   LEU A CD2   1 
ATOM   1461 N  N     . SER C 3  95  ? 39.510 197.991 37.426 1.00 10.49  ? 95   SER A N     1 
ATOM   1462 C  CA    . SER C 3  95  ? 39.961 197.240 38.583 1.00 12.32  ? 95   SER A CA    1 
ATOM   1463 C  C     . SER C 3  95  ? 41.285 196.515 38.333 1.00 12.92  ? 95   SER A C     1 
ATOM   1464 O  O     . SER C 3  95  ? 42.090 196.342 39.250 1.00 12.87  ? 95   SER A O     1 
ATOM   1465 C  CB    . SER C 3  95  ? 38.875 196.248 38.998 1.00 11.63  ? 95   SER A CB    1 
ATOM   1466 O  OG    . SER C 3  95  ? 39.211 195.625 40.216 1.00 20.34  ? 95   SER A OG    1 
ATOM   1467 N  N     . ARG C 3  96  ? 41.523 196.108 37.090 1.00 11.27  ? 96   ARG A N     1 
ATOM   1468 C  CA    . ARG C 3  96  ? 42.752 195.409 36.770 1.00 10.74  ? 96   ARG A CA    1 
ATOM   1469 C  C     . ARG C 3  96  ? 43.909 196.370 36.612 1.00 11.19  ? 96   ARG A C     1 
ATOM   1470 O  O     . ARG C 3  96  ? 45.073 195.956 36.593 1.00 10.75  ? 96   ARG A O     1 
ATOM   1471 C  CB    . ARG C 3  96  ? 42.584 194.570 35.504 1.00 11.41  ? 96   ARG A CB    1 
ATOM   1472 C  CG    . ARG C 3  96  ? 41.780 193.296 35.722 1.00 10.74  ? 96   ARG A CG    1 
ATOM   1473 C  CD    . ARG C 3  96  ? 41.476 192.595 34.407 1.00 11.78  ? 96   ARG A CD    1 
ATOM   1474 N  NE    . ARG C 3  96  ? 40.931 191.260 34.623 1.00 11.40  ? 96   ARG A NE    1 
ATOM   1475 C  CZ    . ARG C 3  96  ? 40.515 190.450 33.653 1.00 11.72  ? 96   ARG A CZ    1 
ATOM   1476 N  NH1   . ARG C 3  96  ? 40.572 190.837 32.384 1.00 9.07   ? 96   ARG A NH1   1 
ATOM   1477 N  NH2   . ARG C 3  96  ? 40.062 189.243 33.954 1.00 10.05  ? 96   ARG A NH2   1 
ATOM   1478 N  N     . LEU C 3  97  ? 43.594 197.655 36.497 1.00 10.78  ? 97   LEU A N     1 
ATOM   1479 C  CA    . LEU C 3  97  ? 44.631 198.671 36.369 1.00 9.99   ? 97   LEU A CA    1 
ATOM   1480 C  C     . LEU C 3  97  ? 44.994 199.195 37.745 1.00 12.25  ? 97   LEU A C     1 
ATOM   1481 O  O     . LEU C 3  97  ? 46.160 199.276 38.100 1.00 14.74  ? 97   LEU A O     1 
ATOM   1482 C  CB    . LEU C 3  97  ? 44.153 199.843 35.513 1.00 7.96   ? 97   LEU A CB    1 
ATOM   1483 C  CG    . LEU C 3  97  ? 44.964 201.137 35.721 1.00 6.57   ? 97   LEU A CG    1 
ATOM   1484 C  CD1   . LEU C 3  97  ? 46.431 200.911 35.321 1.00 1.90   ? 97   LEU A CD1   1 
ATOM   1485 C  CD2   . LEU C 3  97  ? 44.336 202.270 34.917 1.00 3.77   ? 97   LEU A CD2   1 
ATOM   1486 N  N     . ILE C 3  98  ? 43.978 199.557 38.516 1.00 14.60  ? 98   ILE A N     1 
ATOM   1487 C  CA    . ILE C 3  98  ? 44.181 200.090 39.851 1.00 15.82  ? 98   ILE A CA    1 
ATOM   1488 C  C     . ILE C 3  98  ? 44.666 199.029 40.846 1.00 18.91  ? 98   ILE A C     1 
ATOM   1489 O  O     . ILE C 3  98  ? 45.543 199.302 41.660 1.00 21.21  ? 98   ILE A O     1 
ATOM   1490 C  CB    . ILE C 3  98  ? 42.886 200.771 40.325 1.00 14.56  ? 98   ILE A CB    1 
ATOM   1491 C  CG1   . ILE C 3  98  ? 42.604 201.966 39.409 1.00 13.53  ? 98   ILE A CG1   1 
ATOM   1492 C  CG2   . ILE C 3  98  ? 43.004 201.223 41.767 1.00 10.88  ? 98   ILE A CG2   1 
ATOM   1493 C  CD1   . ILE C 3  98  ? 41.290 202.644 39.660 1.00 16.16  ? 98   ILE A CD1   1 
ATOM   1494 N  N     . HIS C 3  99  ? 44.115 197.822 40.775 1.00 20.59  ? 99   HIS A N     1 
ATOM   1495 C  CA    . HIS C 3  99  ? 44.530 196.733 41.664 1.00 21.29  ? 99   HIS A CA    1 
ATOM   1496 C  C     . HIS C 3  99  ? 45.333 195.716 40.853 1.00 22.64  ? 99   HIS A C     1 
ATOM   1497 O  O     . HIS C 3  99  ? 45.053 194.517 40.905 1.00 22.75  ? 99   HIS A O     1 
ATOM   1498 C  CB    . HIS C 3  99  ? 43.308 196.029 42.256 1.00 20.66  ? 99   HIS A CB    1 
ATOM   1499 C  CG    . HIS C 3  99  ? 42.407 196.930 43.038 1.00 23.67  ? 99   HIS A CG    1 
ATOM   1500 N  ND1   . HIS C 3  99  ? 42.788 197.514 44.226 1.00 24.04  ? 99   HIS A ND1   1 
ATOM   1501 C  CD2   . HIS C 3  99  ? 41.145 197.358 42.797 1.00 25.56  ? 99   HIS A CD2   1 
ATOM   1502 C  CE1   . HIS C 3  99  ? 41.801 198.264 44.683 1.00 24.98  ? 99   HIS A CE1   1 
ATOM   1503 N  NE2   . HIS C 3  99  ? 40.792 198.188 43.834 1.00 26.26  ? 99   HIS A NE2   1 
ATOM   1504 N  N     . SER C 3  100 ? 46.323 196.197 40.107 1.00 23.32  ? 100  SER A N     1 
ATOM   1505 C  CA    . SER C 3  100 ? 47.143 195.333 39.257 1.00 25.83  ? 100  SER A CA    1 
ATOM   1506 C  C     . SER C 3  100 ? 48.022 194.325 40.003 1.00 26.20  ? 100  SER A C     1 
ATOM   1507 O  O     . SER C 3  100 ? 48.519 193.365 39.414 1.00 24.91  ? 100  SER A O     1 
ATOM   1508 C  CB    . SER C 3  100 ? 48.017 196.192 38.330 1.00 26.31  ? 100  SER A CB    1 
ATOM   1509 O  OG    . SER C 3  100 ? 48.891 197.034 39.065 1.00 28.85  ? 100  SER A OG    1 
ATOM   1510 N  N     . ASN C 3  101 ? 48.222 194.550 41.294 1.00 27.02  ? 101  ASN A N     1 
ATOM   1511 C  CA    . ASN C 3  101 ? 49.034 193.645 42.094 1.00 28.29  ? 101  ASN A CA    1 
ATOM   1512 C  C     . ASN C 3  101 ? 48.195 192.431 42.490 1.00 28.76  ? 101  ASN A C     1 
ATOM   1513 O  O     . ASN C 3  101 ? 48.721 191.431 42.974 1.00 29.74  ? 101  ASN A O     1 
ATOM   1514 C  CB    . ASN C 3  101 ? 49.541 194.366 43.348 1.00 30.27  ? 101  ASN A CB    1 
ATOM   1515 C  CG    . ASN C 3  101 ? 48.406 194.875 44.236 1.00 31.88  ? 101  ASN A CG    1 
ATOM   1516 O  OD1   . ASN C 3  101 ? 47.430 195.448 43.754 1.00 31.82  ? 101  ASN A OD1   1 
ATOM   1517 N  ND2   . ASN C 3  101 ? 48.544 194.678 45.544 1.00 33.01  ? 101  ASN A ND2   1 
ATOM   1518 N  N     . LEU C 3  102 ? 46.888 192.523 42.270 1.00 27.65  ? 102  LEU A N     1 
ATOM   1519 C  CA    . LEU C 3  102 ? 45.982 191.439 42.616 1.00 27.74  ? 102  LEU A CA    1 
ATOM   1520 C  C     . LEU C 3  102 ? 45.558 190.590 41.426 1.00 28.28  ? 102  LEU A C     1 
ATOM   1521 O  O     . LEU C 3  102 ? 45.643 191.016 40.278 1.00 27.72  ? 102  LEU A O     1 
ATOM   1522 C  CB    . LEU C 3  102 ? 44.727 191.998 43.291 1.00 26.62  ? 102  LEU A CB    1 
ATOM   1523 C  CG    . LEU C 3  102 ? 44.922 192.769 44.597 1.00 25.92  ? 102  LEU A CG    1 
ATOM   1524 C  CD1   . LEU C 3  102 ? 43.558 193.178 45.134 1.00 24.88  ? 102  LEU A CD1   1 
ATOM   1525 C  CD2   . LEU C 3  102 ? 45.654 191.909 45.614 1.00 22.90  ? 102  LEU A CD2   1 
ATOM   1526 N  N     . LYS C 3  103 ? 45.092 189.381 41.718 1.00 28.04  ? 103  LYS A N     1 
ATOM   1527 C  CA    . LYS C 3  103 ? 44.621 188.465 40.689 1.00 26.47  ? 103  LYS A CA    1 
ATOM   1528 C  C     . LYS C 3  103 ? 43.101 188.501 40.742 1.00 26.92  ? 103  LYS A C     1 
ATOM   1529 O  O     . LYS C 3  103 ? 42.529 189.124 41.642 1.00 27.39  ? 103  LYS A O     1 
ATOM   1530 C  CB    . LYS C 3  103 ? 45.099 187.041 40.989 1.00 27.12  ? 103  LYS A CB    1 
ATOM   1531 C  CG    . LYS C 3  103 ? 46.602 186.833 40.890 1.00 27.27  ? 103  LYS A CG    1 
ATOM   1532 C  CD    . LYS C 3  103 ? 46.914 185.738 39.884 1.00 27.54  ? 103  LYS A CD    1 
ATOM   1533 C  CE    . LYS C 3  103 ? 48.405 185.462 39.774 1.00 28.55  ? 103  LYS A CE    1 
ATOM   1534 N  NZ    . LYS C 3  103 ? 49.134 186.553 39.091 1.00 25.03  ? 103  LYS A NZ    1 
ATOM   1535 N  N     . ASP C 3  104 ? 42.455 187.860 39.770 1.00 24.66  ? 104  ASP A N     1 
ATOM   1536 C  CA    . ASP C 3  104 ? 40.998 187.761 39.741 1.00 24.25  ? 104  ASP A CA    1 
ATOM   1537 C  C     . ASP C 3  104 ? 40.654 186.466 39.036 1.00 24.38  ? 104  ASP A C     1 
ATOM   1538 O  O     . ASP C 3  104 ? 41.504 185.872 38.379 1.00 23.93  ? 104  ASP A O     1 
ATOM   1539 C  CB    . ASP C 3  104 ? 40.327 188.970 39.048 1.00 24.96  ? 104  ASP A CB    1 
ATOM   1540 C  CG    . ASP C 3  104 ? 40.661 189.087 37.568 1.00 24.96  ? 104  ASP A CG    1 
ATOM   1541 O  OD1   . ASP C 3  104 ? 40.396 188.140 36.799 1.00 24.08  ? 104  ASP A OD1   1 
ATOM   1542 O  OD2   . ASP C 3  104 ? 41.177 190.151 37.169 1.00 26.06  ? 104  ASP A OD2   1 
ATOM   1543 N  N     . THR C 3  105 ? 39.411 186.025 39.182 1.00 24.82  ? 105  THR A N     1 
ATOM   1544 C  CA    . THR C 3  105 ? 38.966 184.766 38.595 1.00 25.92  ? 105  THR A CA    1 
ATOM   1545 C  C     . THR C 3  105 ? 38.614 184.854 37.120 1.00 25.92  ? 105  THR A C     1 
ATOM   1546 O  O     . THR C 3  105 ? 38.059 183.910 36.553 1.00 26.44  ? 105  THR A O     1 
ATOM   1547 C  CB    . THR C 3  105 ? 37.732 184.232 39.341 1.00 25.61  ? 105  THR A CB    1 
ATOM   1548 O  OG1   . THR C 3  105 ? 36.643 185.149 39.174 1.00 24.94  ? 105  THR A OG1   1 
ATOM   1549 C  CG2   . THR C 3  105 ? 38.034 184.085 40.821 1.00 25.35  ? 105  THR A CG2   1 
ATOM   1550 N  N     . ASP C 3  106 ? 38.937 185.985 36.505 1.00 25.73  ? 106  ASP A N     1 
ATOM   1551 C  CA    . ASP C 3  106 ? 38.636 186.200 35.099 1.00 25.91  ? 106  ASP A CA    1 
ATOM   1552 C  C     . ASP C 3  106 ? 37.155 185.928 34.856 1.00 24.85  ? 106  ASP A C     1 
ATOM   1553 O  O     . ASP C 3  106 ? 36.776 185.311 33.862 1.00 21.92  ? 106  ASP A O     1 
ATOM   1554 C  CB    . ASP C 3  106 ? 39.483 185.281 34.224 1.00 28.42  ? 106  ASP A CB    1 
ATOM   1555 C  CG    . ASP C 3  106 ? 39.415 185.658 32.767 1.00 31.31  ? 106  ASP A CG    1 
ATOM   1556 O  OD1   . ASP C 3  106 ? 38.854 186.736 32.465 1.00 33.13  ? 106  ASP A OD1   1 
ATOM   1557 O  OD2   . ASP C 3  106 ? 39.926 184.891 31.921 1.00 35.25  ? 106  ASP A OD2   1 
ATOM   1558 N  N     . MET C 3  107 ? 36.335 186.397 35.790 1.00 25.34  ? 107  MET A N     1 
ATOM   1559 C  CA    . MET C 3  107 ? 34.888 186.241 35.742 1.00 27.13  ? 107  MET A CA    1 
ATOM   1560 C  C     . MET C 3  107 ? 34.428 184.793 35.891 1.00 28.79  ? 107  MET A C     1 
ATOM   1561 O  O     . MET C 3  107 ? 33.605 184.309 35.112 1.00 30.22  ? 107  MET A O     1 
ATOM   1562 C  CB    . MET C 3  107 ? 34.326 186.850 34.448 1.00 26.64  ? 107  MET A CB    1 
ATOM   1563 C  CG    . MET C 3  107 ? 34.308 188.369 34.438 1.00 25.58  ? 107  MET A CG    1 
ATOM   1564 S  SD    . MET C 3  107 ? 33.279 189.025 35.780 1.00 29.97  ? 107  MET A SD    1 
ATOM   1565 C  CE    . MET C 3  107 ? 31.743 189.407 34.915 1.00 22.08  ? 107  MET A CE    1 
ATOM   1566 N  N     . GLY C 3  108 ? 34.969 184.098 36.886 1.00 28.54  ? 108  GLY A N     1 
ATOM   1567 C  CA    . GLY C 3  108 ? 34.559 182.724 37.122 1.00 28.74  ? 108  GLY A CA    1 
ATOM   1568 C  C     . GLY C 3  108 ? 35.154 181.636 36.243 1.00 30.23  ? 108  GLY A C     1 
ATOM   1569 O  O     . GLY C 3  108 ? 34.737 180.479 36.336 1.00 29.50  ? 108  GLY A O     1 
ATOM   1570 N  N     . LEU C 3  109 ? 36.110 181.977 35.385 1.00 29.00  ? 109  LEU A N     1 
ATOM   1571 C  CA    . LEU C 3  109 ? 36.722 180.955 34.545 1.00 28.95  ? 109  LEU A CA    1 
ATOM   1572 C  C     . LEU C 3  109 ? 37.804 180.230 35.329 1.00 27.92  ? 109  LEU A C     1 
ATOM   1573 O  O     . LEU C 3  109 ? 38.172 179.107 35.000 1.00 29.10  ? 109  LEU A O     1 
ATOM   1574 C  CB    . LEU C 3  109 ? 37.321 181.570 33.282 1.00 27.52  ? 109  LEU A CB    1 
ATOM   1575 C  CG    . LEU C 3  109 ? 36.266 182.028 32.278 1.00 29.87  ? 109  LEU A CG    1 
ATOM   1576 C  CD1   . LEU C 3  109 ? 36.935 182.584 31.026 1.00 28.38  ? 109  LEU A CD1   1 
ATOM   1577 C  CD2   . LEU C 3  109 ? 35.369 180.846 31.934 1.00 30.05  ? 109  LEU A CD2   1 
ATOM   1578 N  N     . LEU C 3  110 ? 38.306 180.882 36.369 1.00 28.21  ? 110  LEU A N     1 
ATOM   1579 C  CA    . LEU C 3  110 ? 39.346 180.308 37.211 1.00 30.40  ? 110  LEU A CA    1 
ATOM   1580 C  C     . LEU C 3  110 ? 38.803 180.161 38.627 1.00 32.53  ? 110  LEU A C     1 
ATOM   1581 O  O     . LEU C 3  110 ? 38.101 181.042 39.122 1.00 33.41  ? 110  LEU A O     1 
ATOM   1582 C  CB    . LEU C 3  110 ? 40.580 181.215 37.223 1.00 29.40  ? 110  LEU A CB    1 
ATOM   1583 C  CG    . LEU C 3  110 ? 41.177 181.604 35.864 1.00 29.11  ? 110  LEU A CG    1 
ATOM   1584 C  CD1   . LEU C 3  110 ? 42.285 182.623 36.060 1.00 29.19  ? 110  LEU A CD1   1 
ATOM   1585 C  CD2   . LEU C 3  110 ? 41.714 180.376 35.159 1.00 28.14  ? 110  LEU A CD2   1 
ATOM   1586 N  N     . ARG C 3  111 ? 39.113 179.038 39.268 1.00 35.22  ? 111  ARG A N     1 
ATOM   1587 C  CA    . ARG C 3  111 ? 38.658 178.791 40.631 1.00 37.63  ? 111  ARG A CA    1 
ATOM   1588 C  C     . ARG C 3  111 ? 39.420 179.723 41.563 1.00 37.00  ? 111  ARG A C     1 
ATOM   1589 O  O     . ARG C 3  111 ? 40.651 179.697 41.604 1.00 36.15  ? 111  ARG A O     1 
ATOM   1590 C  CB    . ARG C 3  111 ? 38.940 177.345 41.040 1.00 42.84  ? 111  ARG A CB    1 
ATOM   1591 C  CG    . ARG C 3  111 ? 38.406 176.293 40.093 1.00 48.77  ? 111  ARG A CG    1 
ATOM   1592 C  CD    . ARG C 3  111 ? 38.994 174.935 40.450 1.00 56.02  ? 111  ARG A CD    1 
ATOM   1593 N  NE    . ARG C 3  111 ? 40.443 175.012 40.647 1.00 62.56  ? 111  ARG A NE    1 
ATOM   1594 C  CZ    . ARG C 3  111 ? 41.235 173.963 40.866 1.00 65.55  ? 111  ARG A CZ    1 
ATOM   1595 N  NH1   . ARG C 3  111 ? 40.723 172.739 40.914 1.00 67.46  ? 111  ARG A NH1   1 
ATOM   1596 N  NH2   . ARG C 3  111 ? 42.541 174.137 41.045 1.00 66.45  ? 111  ARG A NH2   1 
ATOM   1597 N  N     . SER C 3  112 ? 38.684 180.541 42.310 1.00 36.92  ? 112  SER A N     1 
ATOM   1598 C  CA    . SER C 3  112 ? 39.290 181.487 43.238 1.00 37.15  ? 112  SER A CA    1 
ATOM   1599 C  C     . SER C 3  112 ? 40.311 180.848 44.183 1.00 36.58  ? 112  SER A C     1 
ATOM   1600 O  O     . SER C 3  112 ? 41.391 181.395 44.404 1.00 35.85  ? 112  SER A O     1 
ATOM   1601 C  CB    . SER C 3  112 ? 38.198 182.194 44.049 1.00 38.30  ? 112  SER A CB    1 
ATOM   1602 O  OG    . SER C 3  112 ? 37.295 181.271 44.637 1.00 40.36  ? 112  SER A OG    1 
ATOM   1603 N  N     . GLY C 3  113 ? 39.972 179.684 44.726 1.00 37.04  ? 113  GLY A N     1 
ATOM   1604 C  CA    . GLY C 3  113 ? 40.866 179.005 45.652 1.00 36.86  ? 113  GLY A CA    1 
ATOM   1605 C  C     . GLY C 3  113 ? 42.222 178.600 45.102 1.00 37.05  ? 113  GLY A C     1 
ATOM   1606 O  O     . GLY C 3  113 ? 43.128 178.263 45.863 1.00 37.64  ? 113  GLY A O     1 
ATOM   1607 N  N     . LYS C 3  114 ? 42.374 178.636 43.783 1.00 36.76  ? 114  LYS A N     1 
ATOM   1608 C  CA    . LYS C 3  114 ? 43.632 178.255 43.157 1.00 36.06  ? 114  LYS A CA    1 
ATOM   1609 C  C     . LYS C 3  114 ? 44.565 179.450 42.950 1.00 34.39  ? 114  LYS A C     1 
ATOM   1610 O  O     . LYS C 3  114 ? 45.754 179.281 42.694 1.00 34.75  ? 114  LYS A O     1 
ATOM   1611 C  CB    . LYS C 3  114 ? 43.343 177.575 41.816 1.00 40.22  ? 114  LYS A CB    1 
ATOM   1612 C  CG    . LYS C 3  114 ? 44.558 177.020 41.094 1.00 42.89  ? 114  LYS A CG    1 
ATOM   1613 C  CD    . LYS C 3  114 ? 44.137 176.334 39.800 1.00 45.04  ? 114  LYS A CD    1 
ATOM   1614 C  CE    . LYS C 3  114 ? 45.334 175.828 39.001 1.00 47.82  ? 114  LYS A CE    1 
ATOM   1615 N  NZ    . LYS C 3  114 ? 46.230 176.934 38.552 1.00 47.39  ? 114  LYS A NZ    1 
ATOM   1616 N  N     . LEU C 3  115 ? 44.028 180.658 43.078 1.00 32.29  ? 115  LEU A N     1 
ATOM   1617 C  CA    . LEU C 3  115 ? 44.814 181.877 42.885 1.00 29.55  ? 115  LEU A CA    1 
ATOM   1618 C  C     . LEU C 3  115 ? 45.555 182.322 44.146 1.00 28.34  ? 115  LEU A C     1 
ATOM   1619 O  O     . LEU C 3  115 ? 45.069 182.145 45.263 1.00 27.55  ? 115  LEU A O     1 
ATOM   1620 C  CB    . LEU C 3  115 ? 43.898 183.009 42.433 1.00 28.32  ? 115  LEU A CB    1 
ATOM   1621 C  CG    . LEU C 3  115 ? 43.067 182.755 41.178 1.00 28.41  ? 115  LEU A CG    1 
ATOM   1622 C  CD1   . LEU C 3  115 ? 41.962 183.793 41.079 1.00 27.55  ? 115  LEU A CD1   1 
ATOM   1623 C  CD2   . LEU C 3  115 ? 43.969 182.796 39.958 1.00 27.58  ? 115  LEU A CD2   1 
ATOM   1624 N  N     . PRO C 3  116 ? 46.749 182.909 43.977 1.00 26.56  ? 116  PRO A N     1 
ATOM   1625 C  CA    . PRO C 3  116 ? 47.548 183.385 45.114 1.00 25.25  ? 116  PRO A CA    1 
ATOM   1626 C  C     . PRO C 3  116 ? 47.097 184.775 45.557 1.00 24.62  ? 116  PRO A C     1 
ATOM   1627 O  O     . PRO C 3  116 ? 46.421 185.480 44.806 1.00 24.45  ? 116  PRO A O     1 
ATOM   1628 C  CB    . PRO C 3  116 ? 48.966 183.397 44.554 1.00 24.89  ? 116  PRO A CB    1 
ATOM   1629 C  CG    . PRO C 3  116 ? 48.744 183.766 43.115 1.00 24.93  ? 116  PRO A CG    1 
ATOM   1630 C  CD    . PRO C 3  116 ? 47.536 182.935 42.729 1.00 24.74  ? 116  PRO A CD    1 
ATOM   1631 N  N     . GLY C 3  117 ? 47.456 185.156 46.781 1.00 24.84  ? 117  GLY A N     1 
ATOM   1632 C  CA    . GLY C 3  117 ? 47.092 186.471 47.290 1.00 21.14  ? 117  GLY A CA    1 
ATOM   1633 C  C     . GLY C 3  117 ? 45.619 186.676 47.596 1.00 20.81  ? 117  GLY A C     1 
ATOM   1634 O  O     . GLY C 3  117 ? 44.862 185.718 47.753 1.00 21.50  ? 117  GLY A O     1 
ATOM   1635 N  N     . ALA C 3  118 ? 45.212 187.938 47.676 1.00 19.92  ? 124  ALA A N     1 
ATOM   1636 C  CA    . ALA C 3  118 ? 43.830 188.287 47.983 1.00 19.93  ? 124  ALA A CA    1 
ATOM   1637 C  C     . ALA C 3  118 ? 43.041 188.693 46.739 1.00 18.99  ? 124  ALA A C     1 
ATOM   1638 O  O     . ALA C 3  118 ? 43.605 188.857 45.659 1.00 18.22  ? 124  ALA A O     1 
ATOM   1639 C  CB    . ALA C 3  118 ? 43.801 189.420 49.009 1.00 20.09  ? 124  ALA A CB    1 
ATOM   1640 N  N     . LEU C 3  119 ? 41.734 188.858 46.901 1.00 16.48  ? 125  LEU A N     1 
ATOM   1641 C  CA    . LEU C 3  119 ? 40.887 189.255 45.787 1.00 18.80  ? 125  LEU A CA    1 
ATOM   1642 C  C     . LEU C 3  119 ? 39.976 190.400 46.217 1.00 19.40  ? 125  LEU A C     1 
ATOM   1643 O  O     . LEU C 3  119 ? 39.418 190.378 47.317 1.00 18.97  ? 125  LEU A O     1 
ATOM   1644 C  CB    . LEU C 3  119 ? 40.045 188.063 45.309 1.00 18.99  ? 125  LEU A CB    1 
ATOM   1645 C  CG    . LEU C 3  119 ? 40.786 186.749 45.017 1.00 18.71  ? 125  LEU A CG    1 
ATOM   1646 C  CD1   . LEU C 3  119 ? 39.778 185.652 44.733 1.00 18.95  ? 125  LEU A CD1   1 
ATOM   1647 C  CD2   . LEU C 3  119 ? 41.735 186.926 43.843 1.00 18.94  ? 125  LEU A CD2   1 
ATOM   1648 N  N     . GLU C 3  120 ? 39.840 191.406 45.355 1.00 19.19  ? 126  GLU A N     1 
ATOM   1649 C  CA    . GLU C 3  120 ? 38.984 192.555 45.648 1.00 18.34  ? 126  GLU A CA    1 
ATOM   1650 C  C     . GLU C 3  120 ? 37.571 192.008 45.870 1.00 17.21  ? 126  GLU A C     1 
ATOM   1651 O  O     . GLU C 3  120 ? 37.081 191.207 45.075 1.00 17.51  ? 126  GLU A O     1 
ATOM   1652 C  CB    . GLU C 3  120 ? 39.030 193.538 44.476 1.00 17.96  ? 126  GLU A CB    1 
ATOM   1653 C  CG    . GLU C 3  120 ? 38.566 194.950 44.810 1.00 20.11  ? 126  GLU A CG    1 
ATOM   1654 C  CD    . GLU C 3  120 ? 37.059 195.059 44.891 1.00 22.40  ? 126  GLU A CD    1 
ATOM   1655 O  OE1   . GLU C 3  120 ? 36.383 194.727 43.889 1.00 21.16  ? 126  GLU A OE1   1 
ATOM   1656 O  OE2   . GLU C 3  120 ? 36.551 195.475 45.952 1.00 23.08  ? 126  GLU A OE2   1 
ATOM   1657 N  N     . ALA C 3  121 ? 36.919 192.438 46.944 1.00 15.31  ? 127  ALA A N     1 
ATOM   1658 C  CA    . ALA C 3  121 ? 35.593 191.920 47.284 1.00 16.47  ? 127  ALA A CA    1 
ATOM   1659 C  C     . ALA C 3  121 ? 34.468 192.071 46.260 1.00 16.54  ? 127  ALA A C     1 
ATOM   1660 O  O     . ALA C 3  121 ? 33.855 191.071 45.869 1.00 17.54  ? 127  ALA A O     1 
ATOM   1661 C  CB    . ALA C 3  121 ? 35.144 192.489 48.628 1.00 14.38  ? 127  ALA A CB    1 
ATOM   1662 N  N     . TRP C 3  122 ? 34.180 193.303 45.843 1.00 15.98  ? 128  TRP A N     1 
ATOM   1663 C  CA    . TRP C 3  122 ? 33.113 193.554 44.878 1.00 14.94  ? 128  TRP A CA    1 
ATOM   1664 C  C     . TRP C 3  122 ? 33.343 192.769 43.596 1.00 15.01  ? 128  TRP A C     1 
ATOM   1665 O  O     . TRP C 3  122 ? 32.419 192.176 43.043 1.00 12.89  ? 128  TRP A O     1 
ATOM   1666 C  CB    . TRP C 3  122 ? 33.030 195.043 44.563 1.00 17.18  ? 128  TRP A CB    1 
ATOM   1667 C  CG    . TRP C 3  122 ? 32.717 195.888 45.768 1.00 21.11  ? 128  TRP A CG    1 
ATOM   1668 C  CD1   . TRP C 3  122 ? 33.459 196.925 46.257 1.00 20.25  ? 128  TRP A CD1   1 
ATOM   1669 C  CD2   . TRP C 3  122 ? 31.564 195.786 46.615 1.00 22.34  ? 128  TRP A CD2   1 
ATOM   1670 N  NE1   . TRP C 3  122 ? 32.840 197.477 47.353 1.00 22.54  ? 128  TRP A NE1   1 
ATOM   1671 C  CE2   . TRP C 3  122 ? 31.675 196.799 47.596 1.00 23.16  ? 128  TRP A CE2   1 
ATOM   1672 C  CE3   . TRP C 3  122 ? 30.447 194.938 46.641 1.00 24.81  ? 128  TRP A CE3   1 
ATOM   1673 C  CZ2   . TRP C 3  122 ? 30.709 196.990 48.593 1.00 23.80  ? 128  TRP A CZ2   1 
ATOM   1674 C  CZ3   . TRP C 3  122 ? 29.485 195.129 47.635 1.00 26.27  ? 128  TRP A CZ3   1 
ATOM   1675 C  CH2   . TRP C 3  122 ? 29.626 196.149 48.597 1.00 24.88  ? 128  TRP A CH2   1 
ATOM   1676 N  N     . GLY C 3  123 ? 34.587 192.763 43.132 1.00 15.98  ? 129  GLY A N     1 
ATOM   1677 C  CA    . GLY C 3  123 ? 34.917 192.034 41.925 1.00 15.87  ? 129  GLY A CA    1 
ATOM   1678 C  C     . GLY C 3  123 ? 34.713 190.548 42.124 1.00 17.14  ? 129  GLY A C     1 
ATOM   1679 O  O     . GLY C 3  123 ? 34.254 189.851 41.224 1.00 17.81  ? 129  GLY A O     1 
ATOM   1680 N  N     . TYR C 3  124 ? 35.057 190.054 43.307 1.00 17.04  ? 130  TYR A N     1 
ATOM   1681 C  CA    . TYR C 3  124 ? 34.891 188.640 43.587 1.00 18.70  ? 130  TYR A CA    1 
ATOM   1682 C  C     . TYR C 3  124 ? 33.414 188.298 43.442 1.00 18.90  ? 130  TYR A C     1 
ATOM   1683 O  O     . TYR C 3  124 ? 33.052 187.304 42.813 1.00 17.95  ? 130  TYR A O     1 
ATOM   1684 C  CB    . TYR C 3  124 ? 35.346 188.307 45.006 1.00 19.71  ? 130  TYR A CB    1 
ATOM   1685 C  CG    . TYR C 3  124 ? 35.138 186.851 45.339 1.00 20.66  ? 130  TYR A CG    1 
ATOM   1686 C  CD1   . TYR C 3  124 ? 36.029 185.881 44.888 1.00 20.90  ? 130  TYR A CD1   1 
ATOM   1687 C  CD2   . TYR C 3  124 ? 34.014 186.436 46.050 1.00 22.10  ? 130  TYR A CD2   1 
ATOM   1688 C  CE1   . TYR C 3  124 ? 35.808 184.533 45.135 1.00 22.57  ? 130  TYR A CE1   1 
ATOM   1689 C  CE2   . TYR C 3  124 ? 33.780 185.088 46.300 1.00 25.07  ? 130  TYR A CE2   1 
ATOM   1690 C  CZ    . TYR C 3  124 ? 34.681 184.143 45.839 1.00 24.70  ? 130  TYR A CZ    1 
ATOM   1691 O  OH    . TYR C 3  124 ? 34.451 182.809 46.084 1.00 27.22  ? 130  TYR A OH    1 
ATOM   1692 N  N     . ARG C 3  125 ? 32.575 189.137 44.041 1.00 19.14  ? 131  ARG A N     1 
ATOM   1693 C  CA    . ARG C 3  125 ? 31.131 188.967 43.994 1.00 21.29  ? 131  ARG A CA    1 
ATOM   1694 C  C     . ARG C 3  125 ? 30.622 188.850 42.567 1.00 21.84  ? 131  ARG A C     1 
ATOM   1695 O  O     . ARG C 3  125 ? 29.946 187.876 42.216 1.00 20.73  ? 131  ARG A O     1 
ATOM   1696 C  CB    . ARG C 3  125 ? 30.438 190.151 44.672 1.00 22.97  ? 131  ARG A CB    1 
ATOM   1697 C  CG    . ARG C 3  125 ? 30.312 190.014 46.164 1.00 29.86  ? 131  ARG A CG    1 
ATOM   1698 C  CD    . ARG C 3  125 ? 29.312 188.932 46.474 1.00 36.13  ? 131  ARG A CD    1 
ATOM   1699 N  NE    . ARG C 3  125 ? 29.565 188.315 47.764 1.00 41.61  ? 131  ARG A NE    1 
ATOM   1700 C  CZ    . ARG C 3  125 ? 29.233 187.065 48.050 1.00 44.66  ? 131  ARG A CZ    1 
ATOM   1701 N  NH1   . ARG C 3  125 ? 28.638 186.325 47.124 1.00 45.29  ? 131  ARG A NH1   1 
ATOM   1702 N  NH2   . ARG C 3  125 ? 29.505 186.553 49.245 1.00 45.79  ? 131  ARG A NH2   1 
ATOM   1703 N  N     . LEU C 3  126 ? 30.940 189.854 41.752 1.00 19.78  ? 132  LEU A N     1 
ATOM   1704 C  CA    . LEU C 3  126 ? 30.502 189.875 40.366 1.00 19.70  ? 132  LEU A CA    1 
ATOM   1705 C  C     . LEU C 3  126 ? 31.001 188.650 39.622 1.00 20.11  ? 132  LEU A C     1 
ATOM   1706 O  O     . LEU C 3  126 ? 30.267 188.049 38.839 1.00 19.74  ? 132  LEU A O     1 
ATOM   1707 C  CB    . LEU C 3  126 ? 30.998 191.144 39.671 1.00 16.40  ? 132  LEU A CB    1 
ATOM   1708 C  CG    . LEU C 3  126 ? 30.363 192.428 40.209 1.00 18.39  ? 132  LEU A CG    1 
ATOM   1709 C  CD1   . LEU C 3  126 ? 31.098 193.639 39.649 1.00 15.57  ? 132  LEU A CD1   1 
ATOM   1710 C  CD2   . LEU C 3  126 ? 28.873 192.457 39.850 1.00 13.75  ? 132  LEU A CD2   1 
ATOM   1711 N  N     . GLY C 3  127 ? 32.249 188.276 39.883 1.00 20.38  ? 133  GLY A N     1 
ATOM   1712 C  CA    . GLY C 3  127 ? 32.821 187.120 39.220 1.00 21.02  ? 133  GLY A CA    1 
ATOM   1713 C  C     . GLY C 3  127 ? 32.189 185.798 39.625 1.00 22.20  ? 133  GLY A C     1 
ATOM   1714 O  O     . GLY C 3  127 ? 32.352 184.804 38.921 1.00 23.17  ? 133  GLY A O     1 
ATOM   1715 N  N     . GLU C 3  128 ? 31.460 185.777 40.739 1.00 20.89  ? 134  GLU A N     1 
ATOM   1716 C  CA    . GLU C 3  128 ? 30.843 184.546 41.212 1.00 23.29  ? 134  GLU A CA    1 
ATOM   1717 C  C     . GLU C 3  128 ? 29.330 184.499 41.028 1.00 25.31  ? 134  GLU A C     1 
ATOM   1718 O  O     . GLU C 3  128 ? 28.694 183.503 41.376 1.00 27.24  ? 134  GLU A O     1 
ATOM   1719 C  CB    . GLU C 3  128 ? 31.159 184.332 42.700 1.00 24.08  ? 134  GLU A CB    1 
ATOM   1720 C  CG    . GLU C 3  128 ? 32.638 184.209 43.045 1.00 26.61  ? 134  GLU A CG    1 
ATOM   1721 C  CD    . GLU C 3  128 ? 33.288 182.977 42.438 1.00 28.57  ? 134  GLU A CD    1 
ATOM   1722 O  OE1   . GLU C 3  128 ? 32.766 181.863 42.668 1.00 31.86  ? 134  GLU A OE1   1 
ATOM   1723 O  OE2   . GLU C 3  128 ? 34.319 183.117 41.739 1.00 26.58  ? 134  GLU A OE2   1 
ATOM   1724 N  N     . MET C 3  129 ? 28.748 185.562 40.487 1.00 26.12  ? 135  MET A N     1 
ATOM   1725 C  CA    . MET C 3  129 ? 27.302 185.611 40.309 1.00 27.35  ? 135  MET A CA    1 
ATOM   1726 C  C     . MET C 3  129 ? 26.735 184.431 39.526 1.00 27.74  ? 135  MET A C     1 
ATOM   1727 O  O     . MET C 3  129 ? 25.742 183.836 39.939 1.00 27.62  ? 135  MET A O     1 
ATOM   1728 C  CB    . MET C 3  129 ? 26.889 186.932 39.645 1.00 29.04  ? 135  MET A CB    1 
ATOM   1729 C  CG    . MET C 3  129 ? 27.166 188.176 40.497 1.00 34.40  ? 135  MET A CG    1 
ATOM   1730 S  SD    . MET C 3  129 ? 26.064 188.429 41.938 1.00 37.53  ? 135  MET A SD    1 
ATOM   1731 C  CE    . MET C 3  129 ? 26.766 187.261 43.107 1.00 35.17  ? 135  MET A CE    1 
ATOM   1732 N  N     . LYS C 3  130 ? 27.354 184.079 38.404 1.00 28.31  ? 136  LYS A N     1 
ATOM   1733 C  CA    . LYS C 3  130 ? 26.849 182.957 37.616 1.00 27.95  ? 136  LYS A CA    1 
ATOM   1734 C  C     . LYS C 3  130 ? 26.853 181.676 38.434 1.00 26.42  ? 136  LYS A C     1 
ATOM   1735 O  O     . LYS C 3  130 ? 25.909 180.892 38.373 1.00 25.41  ? 136  LYS A O     1 
ATOM   1736 C  CB    . LYS C 3  130 ? 27.678 182.763 36.346 1.00 27.24  ? 136  LYS A CB    1 
ATOM   1737 C  CG    . LYS C 3  130 ? 27.535 183.903 35.371 1.00 29.19  ? 136  LYS A CG    1 
ATOM   1738 C  CD    . LYS C 3  130 ? 28.362 183.693 34.115 1.00 29.49  ? 136  LYS A CD    1 
ATOM   1739 C  CE    . LYS C 3  130 ? 27.922 182.470 33.343 1.00 27.30  ? 136  LYS A CE    1 
ATOM   1740 N  NZ    . LYS C 3  130 ? 28.631 182.438 32.044 1.00 26.70  ? 136  LYS A NZ    1 
ATOM   1741 N  N     . GLY C 3  131 ? 27.914 181.474 39.205 1.00 25.42  ? 137  GLY A N     1 
ATOM   1742 C  CA    . GLY C 3  131 ? 28.006 180.282 40.023 1.00 27.50  ? 137  GLY A CA    1 
ATOM   1743 C  C     . GLY C 3  131 ? 26.970 180.244 41.132 1.00 28.92  ? 137  GLY A C     1 
ATOM   1744 O  O     . GLY C 3  131 ? 26.354 179.211 41.384 1.00 29.78  ? 137  GLY A O     1 
ATOM   1745 N  N     . GLU C 3  132 ? 26.776 181.372 41.800 1.00 29.27  ? 138  GLU A N     1 
ATOM   1746 C  CA    . GLU C 3  132 ? 25.811 181.444 42.879 1.00 30.70  ? 138  GLU A CA    1 
ATOM   1747 C  C     . GLU C 3  132 ? 24.388 181.343 42.358 1.00 30.72  ? 138  GLU A C     1 
ATOM   1748 O  O     . GLU C 3  132 ? 23.518 180.773 43.019 1.00 30.10  ? 138  GLU A O     1 
ATOM   1749 C  CB    . GLU C 3  132 ? 26.009 182.742 43.657 1.00 33.16  ? 138  GLU A CB    1 
ATOM   1750 C  CG    . GLU C 3  132 ? 27.354 182.785 44.356 1.00 39.11  ? 138  GLU A CG    1 
ATOM   1751 C  CD    . GLU C 3  132 ? 27.677 184.140 44.942 1.00 43.80  ? 138  GLU A CD    1 
ATOM   1752 O  OE1   . GLU C 3  132 ? 28.783 184.281 45.513 1.00 47.25  ? 138  GLU A OE1   1 
ATOM   1753 O  OE2   . GLU C 3  132 ? 26.833 185.060 44.833 1.00 44.17  ? 138  GLU A OE2   1 
ATOM   1754 N  N     . TYR C 3  133 ? 24.153 181.892 41.169 1.00 29.85  ? 139  TYR A N     1 
ATOM   1755 C  CA    . TYR C 3  133 ? 22.827 181.845 40.571 1.00 28.83  ? 139  TYR A CA    1 
ATOM   1756 C  C     . TYR C 3  133 ? 22.488 180.396 40.268 1.00 29.20  ? 139  TYR A C     1 
ATOM   1757 O  O     . TYR C 3  133 ? 21.393 179.930 40.571 1.00 29.19  ? 139  TYR A O     1 
ATOM   1758 C  CB    . TYR C 3  133 ? 22.783 182.676 39.284 1.00 26.63  ? 139  TYR A CB    1 
ATOM   1759 C  CG    . TYR C 3  133 ? 21.567 182.407 38.430 1.00 23.81  ? 139  TYR A CG    1 
ATOM   1760 C  CD1   . TYR C 3  133 ? 20.278 182.607 38.929 1.00 22.61  ? 139  TYR A CD1   1 
ATOM   1761 C  CD2   . TYR C 3  133 ? 21.703 181.922 37.127 1.00 23.36  ? 139  TYR A CD2   1 
ATOM   1762 C  CE1   . TYR C 3  133 ? 19.147 182.325 38.148 1.00 22.66  ? 139  TYR A CE1   1 
ATOM   1763 C  CE2   . TYR C 3  133 ? 20.584 181.639 36.337 1.00 22.19  ? 139  TYR A CE2   1 
ATOM   1764 C  CZ    . TYR C 3  133 ? 19.309 181.839 36.853 1.00 22.82  ? 139  TYR A CZ    1 
ATOM   1765 O  OH    . TYR C 3  133 ? 18.205 181.545 36.083 1.00 21.65  ? 139  TYR A OH    1 
ATOM   1766 N  N     . LYS C 3  134 ? 23.440 179.687 39.672 1.00 29.47  ? 140  LYS A N     1 
ATOM   1767 C  CA    . LYS C 3  134 ? 23.244 178.287 39.339 1.00 30.49  ? 140  LYS A CA    1 
ATOM   1768 C  C     . LYS C 3  134 ? 22.965 177.478 40.611 1.00 32.35  ? 140  LYS A C     1 
ATOM   1769 O  O     . LYS C 3  134 ? 22.099 176.603 40.610 1.00 32.47  ? 140  LYS A O     1 
ATOM   1770 C  CB    . LYS C 3  134 ? 24.475 177.729 38.620 1.00 28.76  ? 140  LYS A CB    1 
ATOM   1771 C  CG    . LYS C 3  134 ? 24.362 176.256 38.290 1.00 28.84  ? 140  LYS A CG    1 
ATOM   1772 C  CD    . LYS C 3  134 ? 25.702 175.670 37.898 1.00 28.71  ? 140  LYS A CD    1 
ATOM   1773 C  CE    . LYS C 3  134 ? 25.645 174.147 37.898 1.00 28.17  ? 140  LYS A CE    1 
ATOM   1774 N  NZ    . LYS C 3  134 ? 26.926 173.529 37.464 1.00 28.74  ? 140  LYS A NZ    1 
ATOM   1775 N  N     . ASP C 3  135 ? 23.691 177.762 41.692 1.00 33.46  ? 141  ASP A N     1 
ATOM   1776 C  CA    . ASP C 3  135 ? 23.456 177.044 42.941 1.00 35.60  ? 141  ASP A CA    1 
ATOM   1777 C  C     . ASP C 3  135 ? 22.026 177.286 43.419 1.00 36.59  ? 141  ASP A C     1 
ATOM   1778 O  O     . ASP C 3  135 ? 21.315 176.347 43.765 1.00 36.27  ? 141  ASP A O     1 
ATOM   1779 C  CB    . ASP C 3  135 ? 24.435 177.482 44.030 1.00 36.99  ? 141  ASP A CB    1 
ATOM   1780 C  CG    . ASP C 3  135 ? 25.832 176.945 43.807 1.00 40.07  ? 141  ASP A CG    1 
ATOM   1781 O  OD1   . ASP C 3  135 ? 25.956 175.774 43.393 1.00 41.73  ? 141  ASP A OD1   1 
ATOM   1782 O  OD2   . ASP C 3  135 ? 26.811 177.686 44.058 1.00 42.26  ? 141  ASP A OD2   1 
ATOM   1783 N  N     . ASP C 3  136 ? 21.605 178.546 43.435 1.00 36.72  ? 142  ASP A N     1 
ATOM   1784 C  CA    . ASP C 3  136 ? 20.251 178.880 43.855 1.00 37.26  ? 142  ASP A CA    1 
ATOM   1785 C  C     . ASP C 3  136 ? 19.243 178.131 43.005 1.00 36.40  ? 142  ASP A C     1 
ATOM   1786 O  O     . ASP C 3  136 ? 18.360 177.453 43.522 1.00 36.31  ? 142  ASP A O     1 
ATOM   1787 C  CB    . ASP C 3  136 ? 19.998 180.380 43.714 1.00 40.80  ? 142  ASP A CB    1 
ATOM   1788 C  CG    . ASP C 3  136 ? 20.445 181.164 44.929 1.00 44.35  ? 142  ASP A CG    1 
ATOM   1789 O  OD1   . ASP C 3  136 ? 21.632 181.067 45.303 1.00 47.63  ? 142  ASP A OD1   1 
ATOM   1790 O  OD2   . ASP C 3  136 ? 19.608 181.885 45.512 1.00 48.65  ? 142  ASP A OD2   1 
ATOM   1791 N  N     . PHE C 3  137 ? 19.386 178.263 41.692 1.00 35.60  ? 143  PHE A N     1 
ATOM   1792 C  CA    . PHE C 3  137 ? 18.488 177.621 40.741 1.00 34.55  ? 143  PHE A CA    1 
ATOM   1793 C  C     . PHE C 3  137 ? 18.405 176.114 40.966 1.00 36.09  ? 143  PHE A C     1 
ATOM   1794 O  O     . PHE C 3  137 ? 17.320 175.543 40.954 1.00 34.89  ? 143  PHE A O     1 
ATOM   1795 C  CB    . PHE C 3  137 ? 18.966 177.896 39.316 1.00 29.86  ? 143  PHE A CB    1 
ATOM   1796 C  CG    . PHE C 3  137 ? 17.985 177.494 38.250 1.00 27.31  ? 143  PHE A CG    1 
ATOM   1797 C  CD1   . PHE C 3  137 ? 17.030 178.396 37.792 1.00 24.82  ? 143  PHE A CD1   1 
ATOM   1798 C  CD2   . PHE C 3  137 ? 18.032 176.221 37.684 1.00 25.03  ? 143  PHE A CD2   1 
ATOM   1799 C  CE1   . PHE C 3  137 ? 16.140 178.043 36.785 1.00 24.79  ? 143  PHE A CE1   1 
ATOM   1800 C  CE2   . PHE C 3  137 ? 17.143 175.855 36.672 1.00 25.02  ? 143  PHE A CE2   1 
ATOM   1801 C  CZ    . PHE C 3  137 ? 16.197 176.768 36.220 1.00 25.52  ? 143  PHE A CZ    1 
ATOM   1802 N  N     . LYS C 3  138 ? 19.557 175.482 41.170 1.00 39.67  ? 144  LYS A N     1 
ATOM   1803 C  CA    . LYS C 3  138 ? 19.622 174.041 41.377 1.00 43.81  ? 144  LYS A CA    1 
ATOM   1804 C  C     . LYS C 3  138 ? 18.897 173.518 42.606 1.00 47.57  ? 144  LYS A C     1 
ATOM   1805 O  O     . LYS C 3  138 ? 18.213 172.495 42.526 1.00 48.70  ? 144  LYS A O     1 
ATOM   1806 C  CB    . LYS C 3  138 ? 21.074 173.572 41.426 1.00 43.85  ? 144  LYS A CB    1 
ATOM   1807 C  CG    . LYS C 3  138 ? 21.728 173.474 40.067 1.00 45.69  ? 144  LYS A CG    1 
ATOM   1808 C  CD    . LYS C 3  138 ? 23.170 173.008 40.162 1.00 45.96  ? 144  LYS A CD    1 
ATOM   1809 C  CE    . LYS C 3  138 ? 23.271 171.619 40.745 1.00 45.48  ? 144  LYS A CE    1 
ATOM   1810 N  NZ    . LYS C 3  138 ? 24.683 171.154 40.712 1.00 48.47  ? 144  LYS A NZ    1 
ATOM   1811 N  N     . ARG C 3  139 ? 19.041 174.191 43.744 1.00 50.70  ? 145  ARG A N     1 
ATOM   1812 C  CA    . ARG C 3  139 ? 18.369 173.715 44.946 1.00 54.52  ? 145  ARG A CA    1 
ATOM   1813 C  C     . ARG C 3  139 ? 16.865 173.936 44.847 1.00 56.00  ? 145  ARG A C     1 
ATOM   1814 O  O     . ARG C 3  139 ? 16.082 173.076 45.251 1.00 56.52  ? 145  ARG A O     1 
ATOM   1815 C  CB    . ARG C 3  139 ? 18.920 174.392 46.203 1.00 55.80  ? 145  ARG A CB    1 
ATOM   1816 C  CG    . ARG C 3  139 ? 18.695 175.884 46.283 1.00 60.12  ? 145  ARG A CG    1 
ATOM   1817 C  CD    . ARG C 3  139 ? 18.876 176.370 47.712 1.00 62.41  ? 145  ARG A CD    1 
ATOM   1818 N  NE    . ARG C 3  139 ? 19.140 177.804 47.779 1.00 65.72  ? 145  ARG A NE    1 
ATOM   1819 C  CZ    . ARG C 3  139 ? 20.268 178.377 47.365 1.00 66.93  ? 145  ARG A CZ    1 
ATOM   1820 N  NH1   . ARG C 3  139 ? 21.245 177.638 46.852 1.00 66.41  ? 145  ARG A NH1   1 
ATOM   1821 N  NH2   . ARG C 3  139 ? 20.423 179.692 47.468 1.00 68.20  ? 145  ARG A NH2   1 
ATOM   1822 N  N     . MET C 3  140 ? 16.461 175.081 44.304 1.00 57.18  ? 146  MET A N     1 
ATOM   1823 C  CA    . MET C 3  140 ? 15.042 175.372 44.153 1.00 58.88  ? 146  MET A CA    1 
ATOM   1824 C  C     . MET C 3  140 ? 14.361 174.232 43.403 1.00 59.03  ? 146  MET A C     1 
ATOM   1825 O  O     . MET C 3  140 ? 13.278 173.790 43.785 1.00 58.54  ? 146  MET A O     1 
ATOM   1826 C  CB    . MET C 3  140 ? 14.830 176.690 43.401 1.00 59.72  ? 146  MET A CB    1 
ATOM   1827 C  CG    . MET C 3  140 ? 15.219 177.926 44.199 1.00 63.55  ? 146  MET A CG    1 
ATOM   1828 S  SD    . MET C 3  140 ? 14.689 179.490 43.437 1.00 67.66  ? 146  MET A SD    1 
ATOM   1829 C  CE    . MET C 3  140 ? 13.060 179.725 44.196 1.00 67.29  ? 146  MET A CE    1 
ATOM   1830 N  N     . LEU C 3  141 ? 15.004 173.754 42.341 1.00 59.69  ? 147  LEU A N     1 
ATOM   1831 C  CA    . LEU C 3  141 ? 14.453 172.659 41.550 1.00 60.49  ? 147  LEU A CA    1 
ATOM   1832 C  C     . LEU C 3  141 ? 14.296 171.408 42.399 1.00 61.35  ? 147  LEU A C     1 
ATOM   1833 O  O     . LEU C 3  141 ? 13.223 170.806 42.448 1.00 61.69  ? 147  LEU A O     1 
ATOM   1834 C  CB    . LEU C 3  141 ? 15.353 172.341 40.351 1.00 58.72  ? 147  LEU A CB    1 
ATOM   1835 C  CG    . LEU C 3  141 ? 15.326 173.301 39.162 1.00 58.29  ? 147  LEU A CG    1 
ATOM   1836 C  CD1   . LEU C 3  141 ? 16.133 172.711 38.011 1.00 57.17  ? 147  LEU A CD1   1 
ATOM   1837 C  CD2   . LEU C 3  141 ? 13.889 173.537 38.729 1.00 56.80  ? 147  LEU A CD2   1 
ATOM   1838 N  N     . GLU C 3  142 ? 15.377 171.020 43.065 1.00 62.17  ? 148  GLU A N     1 
ATOM   1839 C  CA    . GLU C 3  142 ? 15.367 169.838 43.910 1.00 63.14  ? 148  GLU A CA    1 
ATOM   1840 C  C     . GLU C 3  142 ? 14.389 169.975 45.071 1.00 63.52  ? 148  GLU A C     1 
ATOM   1841 O  O     . GLU C 3  142 ? 14.090 169.000 45.756 1.00 63.59  ? 148  GLU A O     1 
ATOM   1842 C  CB    . GLU C 3  142 ? 16.782 169.554 44.411 1.00 64.01  ? 148  GLU A CB    1 
ATOM   1843 C  CG    . GLU C 3  142 ? 17.695 169.053 43.300 1.00 64.99  ? 148  GLU A CG    1 
ATOM   1844 C  CD    . GLU C 3  142 ? 19.160 169.082 43.678 1.00 65.85  ? 148  GLU A CD    1 
ATOM   1845 O  OE1   . GLU C 3  142 ? 19.505 168.577 44.768 1.00 65.79  ? 148  GLU A OE1   1 
ATOM   1846 O  OE2   . GLU C 3  142 ? 19.966 169.605 42.877 1.00 66.12  ? 148  GLU A OE2   1 
ATOM   1847 N  N     . GLU C 3  143 ? 13.890 171.187 45.291 1.00 63.84  ? 149  GLU A N     1 
ATOM   1848 C  CA    . GLU C 3  143 ? 12.911 171.407 46.345 1.00 64.18  ? 149  GLU A CA    1 
ATOM   1849 C  C     . GLU C 3  143 ? 11.556 171.151 45.706 1.00 64.07  ? 149  GLU A C     1 
ATOM   1850 O  O     . GLU C 3  143 ? 10.547 171.000 46.395 1.00 65.00  ? 149  GLU A O     1 
ATOM   1851 C  CB    . GLU C 3  143 ? 12.956 172.846 46.864 1.00 64.96  ? 149  GLU A CB    1 
ATOM   1852 C  CG    . GLU C 3  143 ? 14.277 173.261 47.486 1.00 67.13  ? 149  GLU A CG    1 
ATOM   1853 C  CD    . GLU C 3  143 ? 14.165 174.547 48.290 1.00 67.95  ? 149  GLU A CD    1 
ATOM   1854 O  OE1   . GLU C 3  143 ? 13.585 175.532 47.780 1.00 67.65  ? 149  GLU A OE1   1 
ATOM   1855 O  OE2   . GLU C 3  143 ? 14.665 174.570 49.435 1.00 68.50  ? 149  GLU A OE2   1 
ATOM   1856 N  N     . GLN C 3  144 ? 11.551 171.102 44.376 1.00 63.06  ? 150  GLN A N     1 
ATOM   1857 C  CA    . GLN C 3  144 ? 10.332 170.872 43.611 1.00 62.66  ? 150  GLN A CA    1 
ATOM   1858 C  C     . GLN C 3  144 ? 10.289 169.482 42.988 1.00 62.27  ? 150  GLN A C     1 
ATOM   1859 O  O     . GLN C 3  144 ? 9.371  169.168 42.233 1.00 62.40  ? 150  GLN A O     1 
ATOM   1860 C  CB    . GLN C 3  144 ? 10.200 171.927 42.514 1.00 63.10  ? 150  GLN A CB    1 
ATOM   1861 C  CG    . GLN C 3  144 ? 10.192 173.346 43.042 1.00 64.75  ? 150  GLN A CG    1 
ATOM   1862 C  CD    . GLN C 3  144 ? 9.060  173.587 44.016 1.00 66.03  ? 150  GLN A CD    1 
ATOM   1863 O  OE1   . GLN C 3  144 ? 7.887  173.478 43.655 1.00 68.32  ? 150  GLN A OE1   1 
ATOM   1864 N  NE2   . GLN C 3  144 ? 9.402  173.909 45.259 1.00 64.52  ? 150  GLN A NE2   1 
ATOM   1865 N  N     . GLY C 3  145 ? 11.286 168.658 43.299 1.00 61.75  ? 151  GLY A N     1 
ATOM   1866 C  CA    . GLY C 3  145 ? 11.326 167.304 42.770 1.00 61.03  ? 151  GLY A CA    1 
ATOM   1867 C  C     . GLY C 3  145 ? 11.893 167.172 41.368 1.00 61.32  ? 151  GLY A C     1 
ATOM   1868 O  O     . GLY C 3  145 ? 12.383 166.107 40.987 1.00 61.96  ? 151  GLY A O     1 
ATOM   1869 N  N     . GLU C 3  146 ? 11.823 168.251 40.596 1.00 60.83  ? 152  GLU A N     1 
ATOM   1870 C  CA    . GLU C 3  146 ? 12.333 168.255 39.228 1.00 59.47  ? 152  GLU A CA    1 
ATOM   1871 C  C     . GLU C 3  146 ? 13.852 168.108 39.214 1.00 57.42  ? 152  GLU A C     1 
ATOM   1872 O  O     . GLU C 3  146 ? 14.533 168.559 40.133 1.00 57.24  ? 152  GLU A O     1 
ATOM   1873 C  CB    . GLU C 3  146 ? 11.926 169.556 38.541 1.00 60.98  ? 152  GLU A CB    1 
ATOM   1874 C  CG    . GLU C 3  146 ? 10.426 169.714 38.378 1.00 64.19  ? 152  GLU A CG    1 
ATOM   1875 C  CD    . GLU C 3  146 ? 10.002 171.166 38.264 1.00 66.67  ? 152  GLU A CD    1 
ATOM   1876 O  OE1   . GLU C 3  146 ? 10.087 171.889 39.280 1.00 68.03  ? 152  GLU A OE1   1 
ATOM   1877 O  OE2   . GLU C 3  146 ? 9.590  171.587 37.162 1.00 67.70  ? 152  GLU A OE2   1 
ATOM   1878 N  N     . GLU C 3  147 ? 14.382 167.470 38.176 1.00 55.41  ? 153  GLU A N     1 
ATOM   1879 C  CA    . GLU C 3  147 ? 15.824 167.284 38.068 1.00 53.71  ? 153  GLU A CA    1 
ATOM   1880 C  C     . GLU C 3  147 ? 16.515 168.494 37.446 1.00 51.69  ? 153  GLU A C     1 
ATOM   1881 O  O     . GLU C 3  147 ? 15.873 169.356 36.842 1.00 51.60  ? 153  GLU A O     1 
ATOM   1882 C  CB    . GLU C 3  147 ? 16.147 166.048 37.231 1.00 55.32  ? 153  GLU A CB    1 
ATOM   1883 C  CG    . GLU C 3  147 ? 15.829 164.730 37.898 1.00 58.67  ? 153  GLU A CG    1 
ATOM   1884 C  CD    . GLU C 3  147 ? 16.257 163.546 37.048 1.00 61.86  ? 153  GLU A CD    1 
ATOM   1885 O  OE1   . GLU C 3  147 ? 15.738 163.407 35.919 1.00 62.98  ? 153  GLU A OE1   1 
ATOM   1886 O  OE2   . GLU C 3  147 ? 17.114 162.759 37.506 1.00 63.28  ? 153  GLU A OE2   1 
ATOM   1887 N  N     . TYR C 3  148 ? 17.834 168.547 37.601 1.00 48.18  ? 154  TYR A N     1 
ATOM   1888 C  CA    . TYR C 3  148 ? 18.628 169.632 37.048 1.00 44.63  ? 154  TYR A CA    1 
ATOM   1889 C  C     . TYR C 3  148 ? 19.355 169.126 35.816 1.00 43.59  ? 154  TYR A C     1 
ATOM   1890 O  O     . TYR C 3  148 ? 19.830 167.995 35.799 1.00 43.50  ? 154  TYR A O     1 
ATOM   1891 C  CB    . TYR C 3  148 ? 19.660 170.124 38.058 1.00 41.15  ? 154  TYR A CB    1 
ATOM   1892 C  CG    . TYR C 3  148 ? 20.583 171.160 37.471 1.00 38.02  ? 154  TYR A CG    1 
ATOM   1893 C  CD1   . TYR C 3  148 ? 20.128 172.454 37.204 1.00 34.23  ? 154  TYR A CD1   1 
ATOM   1894 C  CD2   . TYR C 3  148 ? 21.899 170.836 37.127 1.00 36.05  ? 154  TYR A CD2   1 
ATOM   1895 C  CE1   . TYR C 3  148 ? 20.954 173.397 36.611 1.00 32.75  ? 154  TYR A CE1   1 
ATOM   1896 C  CE2   . TYR C 3  148 ? 22.734 171.774 36.529 1.00 34.25  ? 154  TYR A CE2   1 
ATOM   1897 C  CZ    . TYR C 3  148 ? 22.254 173.051 36.275 1.00 33.52  ? 154  TYR A CZ    1 
ATOM   1898 O  OH    . TYR C 3  148 ? 23.076 173.978 35.685 1.00 33.17  ? 154  TYR A OH    1 
ATOM   1899 N  N     . VAL C 3  149 ? 19.457 169.969 34.794 1.00 43.68  ? 155  VAL A N     1 
ATOM   1900 C  CA    . VAL C 3  149 ? 20.127 169.578 33.559 1.00 44.31  ? 155  VAL A CA    1 
ATOM   1901 C  C     . VAL C 3  149 ? 21.257 170.519 33.155 1.00 45.38  ? 155  VAL A C     1 
ATOM   1902 O  O     . VAL C 3  149 ? 21.176 171.731 33.363 1.00 44.74  ? 155  VAL A O     1 
ATOM   1903 C  CB    . VAL C 3  149 ? 19.120 169.489 32.386 1.00 43.55  ? 155  VAL A CB    1 
ATOM   1904 C  CG1   . VAL C 3  149 ? 19.844 169.145 31.092 1.00 42.41  ? 155  VAL A CG1   1 
ATOM   1905 C  CG2   . VAL C 3  149 ? 18.066 168.440 32.693 1.00 43.45  ? 155  VAL A CG2   1 
ATOM   1906 N  N     . ASP C 3  150 ? 22.303 169.932 32.575 1.00 46.86  ? 156  ASP A N     1 
ATOM   1907 C  CA    . ASP C 3  150 ? 23.482 170.650 32.094 1.00 47.90  ? 156  ASP A CA    1 
ATOM   1908 C  C     . ASP C 3  150 ? 23.576 172.063 32.641 1.00 46.49  ? 156  ASP A C     1 
ATOM   1909 O  O     . ASP C 3  150 ? 24.231 172.292 33.654 1.00 49.12  ? 156  ASP A O     1 
ATOM   1910 C  CB    . ASP C 3  150 ? 23.480 170.690 30.559 1.00 52.27  ? 156  ASP A CB    1 
ATOM   1911 C  CG    . ASP C 3  150 ? 23.575 169.299 29.933 1.00 55.55  ? 156  ASP A CG    1 
ATOM   1912 O  OD1   . ASP C 3  150 ? 22.735 168.430 30.266 1.00 58.03  ? 156  ASP A OD1   1 
ATOM   1913 O  OD2   . ASP C 3  150 ? 24.488 169.074 29.106 1.00 56.68  ? 156  ASP A OD2   1 
ATOM   1914 N  N     . GLY C 3  151 ? 22.920 173.008 31.972 1.00 42.89  ? 157  GLY A N     1 
ATOM   1915 C  CA    . GLY C 3  151 ? 22.956 174.388 32.427 1.00 38.74  ? 157  GLY A CA    1 
ATOM   1916 C  C     . GLY C 3  151 ? 21.657 175.118 32.146 1.00 35.89  ? 157  GLY A C     1 
ATOM   1917 O  O     . GLY C 3  151 ? 21.647 176.298 31.793 1.00 34.22  ? 157  GLY A O     1 
ATOM   1918 N  N     . MET C 3  152 ? 20.552 174.408 32.323 1.00 33.59  ? 158  MET A N     1 
ATOM   1919 C  CA    . MET C 3  152 ? 19.232 174.961 32.078 1.00 31.00  ? 158  MET A CA    1 
ATOM   1920 C  C     . MET C 3  152 ? 18.944 176.300 32.754 1.00 27.71  ? 158  MET A C     1 
ATOM   1921 O  O     . MET C 3  152 ? 17.996 176.989 32.373 1.00 29.13  ? 158  MET A O     1 
ATOM   1922 C  CB    . MET C 3  152 ? 18.165 173.936 32.479 1.00 31.32  ? 158  MET A CB    1 
ATOM   1923 C  CG    . MET C 3  152 ? 18.207 173.530 33.935 1.00 31.57  ? 158  MET A CG    1 
ATOM   1924 S  SD    . MET C 3  152 ? 16.949 172.299 34.311 1.00 35.40  ? 158  MET A SD    1 
ATOM   1925 C  CE    . MET C 3  152 ? 15.451 173.299 34.342 1.00 31.79  ? 158  MET A CE    1 
ATOM   1926 N  N     . GLU C 3  153 ? 19.744 176.683 33.744 1.00 25.26  ? 159  GLU A N     1 
ATOM   1927 C  CA    . GLU C 3  153 ? 19.497 177.953 34.436 1.00 23.92  ? 159  GLU A CA    1 
ATOM   1928 C  C     . GLU C 3  153 ? 19.602 179.156 33.498 1.00 22.66  ? 159  GLU A C     1 
ATOM   1929 O  O     . GLU C 3  153 ? 19.189 180.257 33.852 1.00 23.47  ? 159  GLU A O     1 
ATOM   1930 C  CB    . GLU C 3  153 ? 20.462 178.149 35.618 1.00 21.83  ? 159  GLU A CB    1 
ATOM   1931 C  CG    . GLU C 3  153 ? 21.920 178.343 35.237 1.00 20.12  ? 159  GLU A CG    1 
ATOM   1932 C  CD    . GLU C 3  153 ? 22.651 177.031 35.116 1.00 21.68  ? 159  GLU A CD    1 
ATOM   1933 O  OE1   . GLU C 3  153 ? 21.961 175.992 35.034 1.00 20.46  ? 159  GLU A OE1   1 
ATOM   1934 O  OE2   . GLU C 3  153 ? 23.906 177.036 35.099 1.00 19.99  ? 159  GLU A OE2   1 
ATOM   1935 N  N     . TRP C 3  154 ? 20.139 178.948 32.302 1.00 21.12  ? 160  TRP A N     1 
ATOM   1936 C  CA    . TRP C 3  154 ? 20.280 180.048 31.356 1.00 20.86  ? 160  TRP A CA    1 
ATOM   1937 C  C     . TRP C 3  154 ? 19.357 179.959 30.151 1.00 21.49  ? 160  TRP A C     1 
ATOM   1938 O  O     . TRP C 3  154 ? 19.304 180.883 29.337 1.00 22.12  ? 160  TRP A O     1 
ATOM   1939 C  CB    . TRP C 3  154 ? 21.732 180.147 30.878 1.00 18.74  ? 160  TRP A CB    1 
ATOM   1940 C  CG    . TRP C 3  154 ? 22.656 180.538 31.976 1.00 19.24  ? 160  TRP A CG    1 
ATOM   1941 C  CD1   . TRP C 3  154 ? 23.630 179.769 32.545 1.00 19.00  ? 160  TRP A CD1   1 
ATOM   1942 C  CD2   . TRP C 3  154 ? 22.647 181.775 32.694 1.00 17.33  ? 160  TRP A CD2   1 
ATOM   1943 N  NE1   . TRP C 3  154 ? 24.224 180.452 33.577 1.00 18.43  ? 160  TRP A NE1   1 
ATOM   1944 C  CE2   . TRP C 3  154 ? 23.638 181.686 33.691 1.00 17.35  ? 160  TRP A CE2   1 
ATOM   1945 C  CE3   . TRP C 3  154 ? 21.893 182.950 32.591 1.00 17.02  ? 160  TRP A CE3   1 
ATOM   1946 C  CZ2   . TRP C 3  154 ? 23.898 182.730 34.586 1.00 16.84  ? 160  TRP A CZ2   1 
ATOM   1947 C  CZ3   . TRP C 3  154 ? 22.151 183.990 33.481 1.00 17.74  ? 160  TRP A CZ3   1 
ATOM   1948 C  CH2   . TRP C 3  154 ? 23.147 183.871 34.465 1.00 17.04  ? 160  TRP A CH2   1 
ATOM   1949 N  N     . TRP C 3  155 ? 18.620 178.860 30.035 1.00 20.86  ? 161  TRP A N     1 
ATOM   1950 C  CA    . TRP C 3  155 ? 17.725 178.689 28.897 1.00 20.62  ? 161  TRP A CA    1 
ATOM   1951 C  C     . TRP C 3  155 ? 16.555 179.662 28.879 1.00 20.96  ? 161  TRP A C     1 
ATOM   1952 O  O     . TRP C 3  155 ? 16.190 180.169 27.827 1.00 20.31  ? 161  TRP A O     1 
ATOM   1953 C  CB    . TRP C 3  155 ? 17.184 177.261 28.847 1.00 21.22  ? 161  TRP A CB    1 
ATOM   1954 C  CG    . TRP C 3  155 ? 18.248 176.201 28.744 1.00 22.92  ? 161  TRP A CG    1 
ATOM   1955 C  CD1   . TRP C 3  155 ? 19.568 176.383 28.441 1.00 22.29  ? 161  TRP A CD1   1 
ATOM   1956 C  CD2   . TRP C 3  155 ? 18.068 174.791 28.914 1.00 22.15  ? 161  TRP A CD2   1 
ATOM   1957 N  NE1   . TRP C 3  155 ? 20.219 175.174 28.410 1.00 21.73  ? 161  TRP A NE1   1 
ATOM   1958 C  CE2   . TRP C 3  155 ? 19.323 174.180 28.697 1.00 22.05  ? 161  TRP A CE2   1 
ATOM   1959 C  CE3   . TRP C 3  155 ? 16.966 173.984 29.227 1.00 23.05  ? 161  TRP A CE3   1 
ATOM   1960 C  CZ2   . TRP C 3  155 ? 19.510 172.799 28.784 1.00 22.29  ? 161  TRP A CZ2   1 
ATOM   1961 C  CZ3   . TRP C 3  155 ? 17.150 172.607 29.313 1.00 22.51  ? 161  TRP A CZ3   1 
ATOM   1962 C  CH2   . TRP C 3  155 ? 18.416 172.031 29.093 1.00 24.23  ? 161  TRP A CH2   1 
ATOM   1963 N  N     . ASN C 3  156 ? 15.968 179.924 30.041 1.00 22.59  ? 162  ASN A N     1 
ATOM   1964 C  CA    . ASN C 3  156 ? 14.820 180.823 30.117 1.00 23.90  ? 162  ASN A CA    1 
ATOM   1965 C  C     . ASN C 3  156 ? 14.962 181.913 31.158 1.00 24.88  ? 162  ASN A C     1 
ATOM   1966 O  O     . ASN C 3  156 ? 15.699 181.772 32.134 1.00 26.81  ? 162  ASN A O     1 
ATOM   1967 C  CB    . ASN C 3  156 ? 13.547 180.031 30.416 1.00 22.79  ? 162  ASN A CB    1 
ATOM   1968 C  CG    . ASN C 3  156 ? 13.223 179.036 29.337 1.00 24.06  ? 162  ASN A CG    1 
ATOM   1969 O  OD1   . ASN C 3  156 ? 12.961 179.406 28.190 1.00 26.18  ? 162  ASN A OD1   1 
ATOM   1970 N  ND2   . ASN C 3  156 ? 13.244 177.760 29.691 1.00 24.63  ? 162  ASN A ND2   1 
ATOM   1971 N  N     . PHE C 3  157 ? 14.241 183.006 30.949 1.00 24.58  ? 163  PHE A N     1 
ATOM   1972 C  CA    . PHE C 3  157 ? 14.272 184.116 31.886 1.00 24.48  ? 163  PHE A CA    1 
ATOM   1973 C  C     . PHE C 3  157 ? 13.382 183.769 33.077 1.00 24.18  ? 163  PHE A C     1 
ATOM   1974 O  O     . PHE C 3  157 ? 12.397 183.053 32.931 1.00 23.84  ? 163  PHE A O     1 
ATOM   1975 C  CB    . PHE C 3  157 ? 13.751 185.387 31.214 1.00 23.08  ? 163  PHE A CB    1 
ATOM   1976 C  CG    . PHE C 3  157 ? 13.345 186.464 32.184 1.00 22.33  ? 163  PHE A CG    1 
ATOM   1977 C  CD1   . PHE C 3  157 ? 14.300 187.272 32.792 1.00 20.65  ? 163  PHE A CD1   1 
ATOM   1978 C  CD2   . PHE C 3  157 ? 12.004 186.651 32.511 1.00 21.33  ? 163  PHE A CD2   1 
ATOM   1979 C  CE1   . PHE C 3  157 ? 13.928 188.247 33.707 1.00 19.92  ? 163  PHE A CE1   1 
ATOM   1980 C  CE2   . PHE C 3  157 ? 11.621 187.624 33.426 1.00 19.52  ? 163  PHE A CE2   1 
ATOM   1981 C  CZ    . PHE C 3  157 ? 12.584 188.425 34.026 1.00 20.61  ? 163  PHE A CZ    1 
ATOM   1982 N  N     . ASN C 3  158 ? 13.749 184.268 34.252 1.00 24.59  ? 164  ASN A N     1 
ATOM   1983 C  CA    . ASN C 3  158 ? 12.975 184.053 35.466 1.00 24.50  ? 164  ASN A CA    1 
ATOM   1984 C  C     . ASN C 3  158 ? 13.306 185.189 36.429 1.00 26.00  ? 164  ASN A C     1 
ATOM   1985 O  O     . ASN C 3  158 ? 14.279 185.918 36.222 1.00 25.24  ? 164  ASN A O     1 
ATOM   1986 C  CB    . ASN C 3  158 ? 13.286 182.683 36.086 1.00 21.00  ? 164  ASN A CB    1 
ATOM   1987 C  CG    . ASN C 3  158 ? 14.733 182.530 36.492 1.00 21.24  ? 164  ASN A CG    1 
ATOM   1988 O  OD1   . ASN C 3  158 ? 15.213 183.212 37.397 1.00 20.66  ? 164  ASN A OD1   1 
ATOM   1989 N  ND2   . ASN C 3  158 ? 15.440 181.621 35.826 1.00 20.92  ? 164  ASN A ND2   1 
ATOM   1990 N  N     . GLU C 3  159 ? 12.498 185.348 37.471 1.00 27.53  ? 165  GLU A N     1 
ATOM   1991 C  CA    . GLU C 3  159 ? 12.714 186.428 38.424 1.00 28.00  ? 165  GLU A CA    1 
ATOM   1992 C  C     . GLU C 3  159 ? 13.961 186.341 39.296 1.00 28.23  ? 165  GLU A C     1 
ATOM   1993 O  O     . GLU C 3  159 ? 14.421 187.359 39.807 1.00 27.87  ? 165  GLU A O     1 
ATOM   1994 C  CB    . GLU C 3  159 ? 11.476 186.614 39.301 1.00 28.96  ? 165  GLU A CB    1 
ATOM   1995 C  CG    . GLU C 3  159 ? 10.373 187.419 38.619 1.00 30.06  ? 165  GLU A CG    1 
ATOM   1996 C  CD    . GLU C 3  159 ? 10.864 188.776 38.117 1.00 33.69  ? 165  GLU A CD    1 
ATOM   1997 O  OE1   . GLU C 3  159 ? 11.515 189.510 38.899 1.00 33.79  ? 165  GLU A OE1   1 
ATOM   1998 O  OE2   . GLU C 3  159 ? 10.596 189.114 36.942 1.00 34.55  ? 165  GLU A OE2   1 
ATOM   1999 N  N     . GLU C 3  160 ? 14.513 185.146 39.478 1.00 29.30  ? 166  GLU A N     1 
ATOM   2000 C  CA    . GLU C 3  160 ? 15.723 185.020 40.279 1.00 30.35  ? 166  GLU A CA    1 
ATOM   2001 C  C     . GLU C 3  160 ? 16.828 185.668 39.449 1.00 28.77  ? 166  GLU A C     1 
ATOM   2002 O  O     . GLU C 3  160 ? 17.694 186.369 39.973 1.00 27.88  ? 166  GLU A O     1 
ATOM   2003 C  CB    . GLU C 3  160 ? 16.082 183.554 40.527 1.00 35.07  ? 166  GLU A CB    1 
ATOM   2004 C  CG    . GLU C 3  160 ? 14.897 182.605 40.693 1.00 45.47  ? 166  GLU A CG    1 
ATOM   2005 C  CD    . GLU C 3  160 ? 13.945 182.994 41.817 1.00 49.96  ? 166  GLU A CD    1 
ATOM   2006 O  OE1   . GLU C 3  160 ? 13.190 183.979 41.657 1.00 52.94  ? 166  GLU A OE1   1 
ATOM   2007 O  OE2   . GLU C 3  160 ? 13.952 182.306 42.862 1.00 52.94  ? 166  GLU A OE2   1 
ATOM   2008 N  N     . MET C 3  161 ? 16.778 185.421 38.143 1.00 26.53  ? 167  MET A N     1 
ATOM   2009 C  CA    . MET C 3  161 ? 17.751 185.965 37.201 1.00 24.10  ? 167  MET A CA    1 
ATOM   2010 C  C     . MET C 3  161 ? 17.705 187.484 37.246 1.00 22.54  ? 167  MET A C     1 
ATOM   2011 O  O     . MET C 3  161 ? 18.742 188.150 37.238 1.00 22.51  ? 167  MET A O     1 
ATOM   2012 C  CB    . MET C 3  161 ? 17.436 185.479 35.782 1.00 23.00  ? 167  MET A CB    1 
ATOM   2013 C  CG    . MET C 3  161 ? 18.414 185.950 34.721 1.00 20.18  ? 167  MET A CG    1 
ATOM   2014 S  SD    . MET C 3  161 ? 17.993 185.295 33.092 1.00 21.79  ? 167  MET A SD    1 
ATOM   2015 C  CE    . MET C 3  161 ? 18.442 183.565 33.303 1.00 20.04  ? 167  MET A CE    1 
ATOM   2016 N  N     . MET C 3  162 ? 16.489 188.016 37.299 1.00 21.69  ? 168  MET A N     1 
ATOM   2017 C  CA    . MET C 3  162 ? 16.259 189.452 37.352 1.00 20.86  ? 168  MET A CA    1 
ATOM   2018 C  C     . MET C 3  162 ? 16.894 190.039 38.612 1.00 22.16  ? 168  MET A C     1 
ATOM   2019 O  O     . MET C 3  162 ? 17.618 191.035 38.545 1.00 21.77  ? 168  MET A O     1 
ATOM   2020 C  CB    . MET C 3  162 ? 14.757 189.726 37.348 1.00 19.41  ? 168  MET A CB    1 
ATOM   2021 C  CG    . MET C 3  162 ? 14.361 191.191 37.276 1.00 19.77  ? 168  MET A CG    1 
ATOM   2022 S  SD    . MET C 3  162 ? 14.356 191.837 35.590 1.00 21.36  ? 168  MET A SD    1 
ATOM   2023 C  CE    . MET C 3  162 ? 16.005 192.536 35.504 1.00 18.94  ? 168  MET A CE    1 
ATOM   2024 N  N     . ASP C 3  163 ? 16.632 189.415 39.759 1.00 22.82  ? 169  ASP A N     1 
ATOM   2025 C  CA    . ASP C 3  163 ? 17.178 189.898 41.025 1.00 24.38  ? 169  ASP A CA    1 
ATOM   2026 C  C     . ASP C 3  163 ? 18.700 189.936 40.993 1.00 23.78  ? 169  ASP A C     1 
ATOM   2027 O  O     . ASP C 3  163 ? 19.320 190.866 41.514 1.00 23.16  ? 169  ASP A O     1 
ATOM   2028 C  CB    . ASP C 3  163 ? 16.712 189.024 42.196 1.00 26.33  ? 169  ASP A CB    1 
ATOM   2029 C  CG    . ASP C 3  163 ? 15.233 189.190 42.498 1.00 28.95  ? 169  ASP A CG    1 
ATOM   2030 O  OD1   . ASP C 3  163 ? 14.677 190.267 42.192 1.00 31.44  ? 169  ASP A OD1   1 
ATOM   2031 O  OD2   . ASP C 3  163 ? 14.630 188.247 43.057 1.00 31.86  ? 169  ASP A OD2   1 
ATOM   2032 N  N     . TYR C 3  164 ? 19.295 188.921 40.381 1.00 22.03  ? 170  TYR A N     1 
ATOM   2033 C  CA    . TYR C 3  164 ? 20.739 188.856 40.274 1.00 22.33  ? 170  TYR A CA    1 
ATOM   2034 C  C     . TYR C 3  164 ? 21.224 189.961 39.353 1.00 21.35  ? 170  TYR A C     1 
ATOM   2035 O  O     . TYR C 3  164 ? 22.241 190.595 39.609 1.00 21.41  ? 170  TYR A O     1 
ATOM   2036 C  CB    . TYR C 3  164 ? 21.158 187.497 39.734 1.00 24.30  ? 170  TYR A CB    1 
ATOM   2037 C  CG    . TYR C 3  164 ? 21.497 186.505 40.813 1.00 25.76  ? 170  TYR A CG    1 
ATOM   2038 C  CD1   . TYR C 3  164 ? 22.718 186.571 41.485 1.00 26.87  ? 170  TYR A CD1   1 
ATOM   2039 C  CD2   . TYR C 3  164 ? 20.602 185.496 41.163 1.00 26.41  ? 170  TYR A CD2   1 
ATOM   2040 C  CE1   . TYR C 3  164 ? 23.044 185.653 42.476 1.00 27.00  ? 170  TYR A CE1   1 
ATOM   2041 C  CE2   . TYR C 3  164 ? 20.916 184.573 42.153 1.00 28.13  ? 170  TYR A CE2   1 
ATOM   2042 C  CZ    . TYR C 3  164 ? 22.138 184.655 42.804 1.00 28.36  ? 170  TYR A CZ    1 
ATOM   2043 O  OH    . TYR C 3  164 ? 22.458 183.723 43.764 1.00 30.47  ? 170  TYR A OH    1 
ATOM   2044 N  N     . ASN C 3  165 ? 20.489 190.186 38.273 1.00 21.77  ? 171  ASN A N     1 
ATOM   2045 C  CA    . ASN C 3  165 ? 20.844 191.232 37.330 1.00 21.64  ? 171  ASN A CA    1 
ATOM   2046 C  C     . ASN C 3  165 ? 20.910 192.550 38.121 1.00 21.40  ? 171  ASN A C     1 
ATOM   2047 O  O     . ASN C 3  165 ? 21.852 193.330 37.968 1.00 20.24  ? 171  ASN A O     1 
ATOM   2048 C  CB    . ASN C 3  165 ? 19.785 191.304 36.220 1.00 19.96  ? 171  ASN A CB    1 
ATOM   2049 C  CG    . ASN C 3  165 ? 20.226 192.143 35.033 1.00 20.17  ? 171  ASN A CG    1 
ATOM   2050 O  OD1   . ASN C 3  165 ? 19.426 192.444 34.151 1.00 22.98  ? 171  ASN A OD1   1 
ATOM   2051 N  ND2   . ASN C 3  165 ? 21.498 192.516 34.999 1.00 19.81  ? 171  ASN A ND2   1 
ATOM   2052 N  N     . VAL C 3  166 ? 19.916 192.775 38.980 1.00 21.84  ? 172  VAL A N     1 
ATOM   2053 C  CA    . VAL C 3  166 ? 19.853 193.978 39.810 1.00 22.28  ? 172  VAL A CA    1 
ATOM   2054 C  C     . VAL C 3  166 ? 21.032 194.044 40.780 1.00 22.95  ? 172  VAL A C     1 
ATOM   2055 O  O     . VAL C 3  166 ? 21.641 195.097 40.954 1.00 24.58  ? 172  VAL A O     1 
ATOM   2056 C  CB    . VAL C 3  166 ? 18.532 194.034 40.621 1.00 23.21  ? 172  VAL A CB    1 
ATOM   2057 C  CG1   . VAL C 3  166 ? 18.591 195.148 41.654 1.00 20.93  ? 172  VAL A CG1   1 
ATOM   2058 C  CG2   . VAL C 3  166 ? 17.355 194.259 39.683 1.00 21.57  ? 172  VAL A CG2   1 
ATOM   2059 N  N     . GLN C 3  167 ? 21.351 192.924 41.414 1.00 23.14  ? 173  GLN A N     1 
ATOM   2060 C  CA    . GLN C 3  167 ? 22.476 192.881 42.339 1.00 24.35  ? 173  GLN A CA    1 
ATOM   2061 C  C     . GLN C 3  167 ? 23.774 193.260 41.633 1.00 22.68  ? 173  GLN A C     1 
ATOM   2062 O  O     . GLN C 3  167 ? 24.591 193.989 42.186 1.00 22.44  ? 173  GLN A O     1 
ATOM   2063 C  CB    . GLN C 3  167 ? 22.630 191.482 42.942 1.00 27.74  ? 173  GLN A CB    1 
ATOM   2064 C  CG    . GLN C 3  167 ? 21.812 191.230 44.190 1.00 35.80  ? 173  GLN A CG    1 
ATOM   2065 C  CD    . GLN C 3  167 ? 22.217 192.128 45.354 1.00 41.33  ? 173  GLN A CD    1 
ATOM   2066 O  OE1   . GLN C 3  167 ? 21.885 193.322 45.389 1.00 40.32  ? 173  GLN A OE1   1 
ATOM   2067 N  NE2   . GLN C 3  167 ? 22.947 191.556 46.312 1.00 42.59  ? 173  GLN A NE2   1 
ATOM   2068 N  N     . ASP C 3  168 ? 23.975 192.753 40.420 1.00 21.23  ? 174  ASP A N     1 
ATOM   2069 C  CA    . ASP C 3  168 ? 25.189 193.075 39.679 1.00 21.76  ? 174  ASP A CA    1 
ATOM   2070 C  C     . ASP C 3  168 ? 25.375 194.586 39.555 1.00 20.27  ? 174  ASP A C     1 
ATOM   2071 O  O     . ASP C 3  168 ? 26.455 195.108 39.833 1.00 18.85  ? 174  ASP A O     1 
ATOM   2072 C  CB    . ASP C 3  168 ? 25.174 192.440 38.276 1.00 23.04  ? 174  ASP A CB    1 
ATOM   2073 C  CG    . ASP C 3  168 ? 25.464 190.939 38.303 1.00 26.19  ? 174  ASP A CG    1 
ATOM   2074 O  OD1   . ASP C 3  168 ? 26.054 190.454 39.295 1.00 26.49  ? 174  ASP A OD1   1 
ATOM   2075 O  OD2   . ASP C 3  168 ? 25.114 190.241 37.328 1.00 27.96  ? 174  ASP A OD2   1 
ATOM   2076 N  N     . VAL C 3  169 ? 24.321 195.291 39.156 1.00 18.06  ? 175  VAL A N     1 
ATOM   2077 C  CA    . VAL C 3  169 ? 24.426 196.738 38.995 1.00 18.51  ? 175  VAL A CA    1 
ATOM   2078 C  C     . VAL C 3  169 ? 24.723 197.471 40.305 1.00 17.06  ? 175  VAL A C     1 
ATOM   2079 O  O     . VAL C 3  169 ? 25.516 198.409 40.322 1.00 16.61  ? 175  VAL A O     1 
ATOM   2080 C  CB    . VAL C 3  169 ? 23.147 197.330 38.340 1.00 19.55  ? 175  VAL A CB    1 
ATOM   2081 C  CG1   . VAL C 3  169 ? 23.322 198.813 38.097 1.00 18.78  ? 175  VAL A CG1   1 
ATOM   2082 C  CG2   . VAL C 3  169 ? 22.877 196.640 37.017 1.00 19.77  ? 175  VAL A CG2   1 
ATOM   2083 N  N     . VAL C 3  170 ? 24.100 197.061 41.405 1.00 15.22  ? 176  VAL A N     1 
ATOM   2084 C  CA    . VAL C 3  170 ? 24.377 197.734 42.669 1.00 15.14  ? 176  VAL A CA    1 
ATOM   2085 C  C     . VAL C 3  170 ? 25.823 197.459 43.082 1.00 14.98  ? 176  VAL A C     1 
ATOM   2086 O  O     . VAL C 3  170 ? 26.512 198.354 43.568 1.00 14.59  ? 176  VAL A O     1 
ATOM   2087 C  CB    . VAL C 3  170 ? 23.383 197.311 43.802 1.00 15.21  ? 176  VAL A CB    1 
ATOM   2088 C  CG1   . VAL C 3  170 ? 22.555 196.142 43.362 1.00 17.98  ? 176  VAL A CG1   1 
ATOM   2089 C  CG2   . VAL C 3  170 ? 24.135 196.981 45.083 1.00 12.39  ? 176  VAL A CG2   1 
ATOM   2090 N  N     . VAL C 3  171 ? 26.293 196.232 42.874 1.00 13.97  ? 177  VAL A N     1 
ATOM   2091 C  CA    . VAL C 3  171 ? 27.670 195.907 43.222 1.00 14.17  ? 177  VAL A CA    1 
ATOM   2092 C  C     . VAL C 3  171 ? 28.623 196.622 42.259 1.00 14.55  ? 177  VAL A C     1 
ATOM   2093 O  O     . VAL C 3  171 ? 29.651 197.155 42.674 1.00 15.84  ? 177  VAL A O     1 
ATOM   2094 C  CB    . VAL C 3  171 ? 27.940 194.373 43.180 1.00 15.47  ? 177  VAL A CB    1 
ATOM   2095 C  CG1   . VAL C 3  171 ? 29.444 194.106 43.284 1.00 11.93  ? 177  VAL A CG1   1 
ATOM   2096 C  CG2   . VAL C 3  171 ? 27.201 193.672 44.334 1.00 10.73  ? 177  VAL A CG2   1 
ATOM   2097 N  N     . THR C 3  172 ? 28.280 196.648 40.976 1.00 13.73  ? 178  THR A N     1 
ATOM   2098 C  CA    . THR C 3  172 ? 29.124 197.317 39.995 1.00 12.77  ? 178  THR A CA    1 
ATOM   2099 C  C     . THR C 3  172 ? 29.198 198.815 40.279 1.00 14.55  ? 178  THR A C     1 
ATOM   2100 O  O     . THR C 3  172 ? 30.233 199.452 40.048 1.00 15.08  ? 178  THR A O     1 
ATOM   2101 C  CB    . THR C 3  172 ? 28.599 197.106 38.576 1.00 12.46  ? 178  THR A CB    1 
ATOM   2102 O  OG1   . THR C 3  172 ? 28.569 195.703 38.293 1.00 11.95  ? 178  THR A OG1   1 
ATOM   2103 C  CG2   . THR C 3  172 ? 29.506 197.803 37.560 1.00 11.16  ? 178  THR A CG2   1 
ATOM   2104 N  N     . LYS C 3  173 ? 28.101 199.373 40.784 1.00 14.58  ? 179  LYS A N     1 
ATOM   2105 C  CA    . LYS C 3  173 ? 28.052 200.789 41.112 1.00 15.37  ? 179  LYS A CA    1 
ATOM   2106 C  C     . LYS C 3  173 ? 28.973 201.069 42.289 1.00 16.27  ? 179  LYS A C     1 
ATOM   2107 O  O     . LYS C 3  173 ? 29.646 202.098 42.329 1.00 18.59  ? 179  LYS A O     1 
ATOM   2108 C  CB    . LYS C 3  173 ? 26.631 201.210 41.476 1.00 17.85  ? 179  LYS A CB    1 
ATOM   2109 C  CG    . LYS C 3  173 ? 26.525 202.654 41.936 1.00 19.17  ? 179  LYS A CG    1 
ATOM   2110 C  CD    . LYS C 3  173 ? 25.111 203.006 42.360 1.00 20.91  ? 179  LYS A CD    1 
ATOM   2111 C  CE    . LYS C 3  173 ? 25.027 204.468 42.801 1.00 23.06  ? 179  LYS A CE    1 
ATOM   2112 N  NZ    . LYS C 3  173 ? 25.819 204.763 44.028 1.00 20.33  ? 179  LYS A NZ    1 
ATOM   2113 N  N     . ALA C 3  174 ? 29.002 200.153 43.251 1.00 15.04  ? 180  ALA A N     1 
ATOM   2114 C  CA    . ALA C 3  174 ? 29.858 200.321 44.417 1.00 14.15  ? 180  ALA A CA    1 
ATOM   2115 C  C     . ALA C 3  174 ? 31.319 200.194 44.000 1.00 14.23  ? 180  ALA A C     1 
ATOM   2116 O  O     . ALA C 3  174 ? 32.160 200.997 44.411 1.00 15.82  ? 180  ALA A O     1 
ATOM   2117 C  CB    . ALA C 3  174 ? 29.518 199.274 45.474 1.00 14.08  ? 180  ALA A CB    1 
ATOM   2118 N  N     . LEU C 3  175 ? 31.614 199.182 43.187 1.00 13.03  ? 181  LEU A N     1 
ATOM   2119 C  CA    . LEU C 3  175 ? 32.969 198.950 42.698 1.00 13.47  ? 181  LEU A CA    1 
ATOM   2120 C  C     . LEU C 3  175 ? 33.461 200.214 41.983 1.00 14.92  ? 181  LEU A C     1 
ATOM   2121 O  O     . LEU C 3  175 ? 34.561 200.706 42.250 1.00 13.58  ? 181  LEU A O     1 
ATOM   2122 C  CB    . LEU C 3  175 ? 32.982 197.778 41.713 1.00 12.40  ? 181  LEU A CB    1 
ATOM   2123 C  CG    . LEU C 3  175 ? 34.222 196.870 41.640 1.00 14.85  ? 181  LEU A CG    1 
ATOM   2124 C  CD1   . LEU C 3  175 ? 34.325 196.325 40.230 1.00 11.07  ? 181  LEU A CD1   1 
ATOM   2125 C  CD2   . LEU C 3  175 ? 35.500 197.608 41.998 1.00 11.05  ? 181  LEU A CD2   1 
ATOM   2126 N  N     . LEU C 3  176 ? 32.635 200.728 41.073 1.00 15.56  ? 182  LEU A N     1 
ATOM   2127 C  CA    . LEU C 3  176 ? 32.959 201.929 40.315 1.00 17.27  ? 182  LEU A CA    1 
ATOM   2128 C  C     . LEU C 3  176 ? 33.372 203.074 41.231 1.00 20.59  ? 182  LEU A C     1 
ATOM   2129 O  O     . LEU C 3  176 ? 34.427 203.681 41.050 1.00 21.94  ? 182  LEU A O     1 
ATOM   2130 C  CB    . LEU C 3  176 ? 31.754 202.361 39.481 1.00 16.14  ? 182  LEU A CB    1 
ATOM   2131 C  CG    . LEU C 3  176 ? 31.837 203.736 38.807 1.00 15.86  ? 182  LEU A CG    1 
ATOM   2132 C  CD1   . LEU C 3  176 ? 32.963 203.760 37.777 1.00 14.88  ? 182  LEU A CD1   1 
ATOM   2133 C  CD2   . LEU C 3  176 ? 30.503 204.048 38.152 1.00 14.55  ? 182  LEU A CD2   1 
ATOM   2134 N  N     . GLU C 3  177 ? 32.527 203.373 42.212 1.00 22.84  ? 183  GLU A N     1 
ATOM   2135 C  CA    . GLU C 3  177 ? 32.808 204.451 43.153 1.00 24.26  ? 183  GLU A CA    1 
ATOM   2136 C  C     . GLU C 3  177 ? 34.059 204.185 43.994 1.00 23.35  ? 183  GLU A C     1 
ATOM   2137 O  O     . GLU C 3  177 ? 34.743 205.116 44.423 1.00 24.24  ? 183  GLU A O     1 
ATOM   2138 C  CB    . GLU C 3  177 ? 31.582 204.683 44.037 1.00 22.98  ? 183  GLU A CB    1 
ATOM   2139 C  CG    . GLU C 3  177 ? 30.499 205.463 43.303 1.00 27.00  ? 183  GLU A CG    1 
ATOM   2140 C  CD    . GLU C 3  177 ? 29.138 205.376 43.952 1.00 27.16  ? 183  GLU A CD    1 
ATOM   2141 O  OE1   . GLU C 3  177 ? 29.071 205.133 45.175 1.00 29.40  ? 183  GLU A OE1   1 
ATOM   2142 O  OE2   . GLU C 3  177 ? 28.135 205.567 43.235 1.00 27.77  ? 183  GLU A OE2   1 
ATOM   2143 N  N     . LYS C 3  178 ? 34.364 202.914 44.212 1.00 20.29  ? 184  LYS A N     1 
ATOM   2144 C  CA    . LYS C 3  178 ? 35.543 202.552 44.978 1.00 19.37  ? 184  LYS A CA    1 
ATOM   2145 C  C     . LYS C 3  178 ? 36.781 202.857 44.143 1.00 17.42  ? 184  LYS A C     1 
ATOM   2146 O  O     . LYS C 3  178 ? 37.782 203.347 44.647 1.00 18.28  ? 184  LYS A O     1 
ATOM   2147 C  CB    . LYS C 3  178 ? 35.497 201.065 45.329 1.00 19.93  ? 184  LYS A CB    1 
ATOM   2148 C  CG    . LYS C 3  178 ? 36.748 200.533 45.998 1.00 22.68  ? 184  LYS A CG    1 
ATOM   2149 C  CD    . LYS C 3  178 ? 36.586 199.049 46.351 1.00 25.45  ? 184  LYS A CD    1 
ATOM   2150 C  CE    . LYS C 3  178 ? 37.813 198.494 47.074 1.00 25.60  ? 184  LYS A CE    1 
ATOM   2151 N  NZ    . LYS C 3  178 ? 37.633 197.069 47.471 1.00 23.96  ? 184  LYS A NZ    1 
ATOM   2152 N  N     . LEU C 3  179 ? 36.699 202.564 42.853 1.00 16.50  ? 185  LEU A N     1 
ATOM   2153 C  CA    . LEU C 3  179 ? 37.805 202.802 41.940 1.00 14.72  ? 185  LEU A CA    1 
ATOM   2154 C  C     . LEU C 3  179 ? 37.982 204.306 41.682 1.00 12.81  ? 185  LEU A C     1 
ATOM   2155 O  O     . LEU C 3  179 ? 39.108 204.805 41.634 1.00 10.72  ? 185  LEU A O     1 
ATOM   2156 C  CB    . LEU C 3  179 ? 37.554 202.046 40.627 1.00 14.07  ? 185  LEU A CB    1 
ATOM   2157 C  CG    . LEU C 3  179 ? 37.445 200.518 40.765 1.00 14.94  ? 185  LEU A CG    1 
ATOM   2158 C  CD1   . LEU C 3  179 ? 36.920 199.906 39.475 1.00 10.78  ? 185  LEU A CD1   1 
ATOM   2159 C  CD2   . LEU C 3  179 ? 38.805 199.930 41.123 1.00 14.76  ? 185  LEU A CD2   1 
ATOM   2160 N  N     . LEU C 3  180 ? 36.871 205.021 41.537 1.00 10.72  ? 186  LEU A N     1 
ATOM   2161 C  CA    . LEU C 3  180 ? 36.912 206.460 41.291 1.00 14.19  ? 186  LEU A CA    1 
ATOM   2162 C  C     . LEU C 3  180 ? 37.484 207.256 42.471 1.00 16.68  ? 186  LEU A C     1 
ATOM   2163 O  O     . LEU C 3  180 ? 37.947 208.380 42.299 1.00 17.76  ? 186  LEU A O     1 
ATOM   2164 C  CB    . LEU C 3  180 ? 35.509 206.991 40.964 1.00 12.05  ? 186  LEU A CB    1 
ATOM   2165 C  CG    . LEU C 3  180 ? 34.843 206.491 39.676 1.00 12.53  ? 186  LEU A CG    1 
ATOM   2166 C  CD1   . LEU C 3  180 ? 33.470 207.103 39.540 1.00 6.71   ? 186  LEU A CD1   1 
ATOM   2167 C  CD2   . LEU C 3  180 ? 35.717 206.857 38.475 1.00 13.07  ? 186  LEU A CD2   1 
ATOM   2168 N  N     . SER C 3  181 ? 37.453 206.674 43.665 1.00 18.08  ? 187  SER A N     1 
ATOM   2169 C  CA    . SER C 3  181 ? 37.963 207.351 44.849 1.00 17.88  ? 187  SER A CA    1 
ATOM   2170 C  C     . SER C 3  181 ? 39.486 207.304 44.939 1.00 19.05  ? 187  SER A C     1 
ATOM   2171 O  O     . SER C 3  181 ? 40.079 207.897 45.841 1.00 20.41  ? 187  SER A O     1 
ATOM   2172 C  CB    . SER C 3  181 ? 37.361 206.740 46.119 1.00 15.42  ? 187  SER A CB    1 
ATOM   2173 O  OG    . SER C 3  181 ? 37.834 205.420 46.325 1.00 16.48  ? 187  SER A OG    1 
ATOM   2174 N  N     . ASP C 3  182 ? 40.128 206.596 44.020 1.00 18.59  ? 188  ASP A N     1 
ATOM   2175 C  CA    . ASP C 3  182 ? 41.579 206.532 44.057 1.00 18.96  ? 188  ASP A CA    1 
ATOM   2176 C  C     . ASP C 3  182 ? 42.112 207.839 43.470 1.00 19.25  ? 188  ASP A C     1 
ATOM   2177 O  O     . ASP C 3  182 ? 42.051 208.056 42.261 1.00 18.41  ? 188  ASP A O     1 
ATOM   2178 C  CB    . ASP C 3  182 ? 42.092 205.337 43.248 1.00 17.29  ? 188  ASP A CB    1 
ATOM   2179 C  CG    . ASP C 3  182 ? 43.577 205.110 43.435 1.00 19.32  ? 188  ASP A CG    1 
ATOM   2180 O  OD1   . ASP C 3  182 ? 44.337 206.097 43.337 1.00 19.91  ? 188  ASP A OD1   1 
ATOM   2181 O  OD2   . ASP C 3  182 ? 43.991 203.955 43.677 1.00 18.31  ? 188  ASP A OD2   1 
ATOM   2182 N  N     . LYS C 3  183 ? 42.631 208.707 44.334 1.00 20.76  ? 189  LYS A N     1 
ATOM   2183 C  CA    . LYS C 3  183 ? 43.155 210.001 43.907 1.00 22.45  ? 189  LYS A CA    1 
ATOM   2184 C  C     . LYS C 3  183 ? 44.265 209.909 42.871 1.00 20.42  ? 189  LYS A C     1 
ATOM   2185 O  O     . LYS C 3  183 ? 44.463 210.844 42.100 1.00 20.62  ? 189  LYS A O     1 
ATOM   2186 C  CB    . LYS C 3  183 ? 43.692 210.789 45.102 1.00 27.55  ? 189  LYS A CB    1 
ATOM   2187 C  CG    . LYS C 3  183 ? 42.719 210.997 46.251 1.00 34.13  ? 189  LYS A CG    1 
ATOM   2188 C  CD    . LYS C 3  183 ? 43.429 211.711 47.399 1.00 39.00  ? 189  LYS A CD    1 
ATOM   2189 C  CE    . LYS C 3  183 ? 44.728 210.983 47.781 1.00 42.76  ? 189  LYS A CE    1 
ATOM   2190 N  NZ    . LYS C 3  183 ? 45.647 211.808 48.621 1.00 44.32  ? 189  LYS A NZ    1 
ATOM   2191 N  N     . HIS C 3  184 ? 44.998 208.801 42.854 1.00 17.94  ? 190  HIS A N     1 
ATOM   2192 C  CA    . HIS C 3  184 ? 46.086 208.662 41.894 1.00 17.26  ? 190  HIS A CA    1 
ATOM   2193 C  C     . HIS C 3  184 ? 45.597 208.581 40.454 1.00 16.40  ? 190  HIS A C     1 
ATOM   2194 O  O     . HIS C 3  184 ? 46.263 209.058 39.538 1.00 17.91  ? 190  HIS A O     1 
ATOM   2195 C  CB    . HIS C 3  184 ? 46.932 207.427 42.191 1.00 17.74  ? 190  HIS A CB    1 
ATOM   2196 C  CG    . HIS C 3  184 ? 48.146 207.313 41.322 1.00 20.76  ? 190  HIS A CG    1 
ATOM   2197 N  ND1   . HIS C 3  184 ? 49.292 208.046 41.543 1.00 23.07  ? 190  HIS A ND1   1 
ATOM   2198 C  CD2   . HIS C 3  184 ? 48.385 206.568 40.216 1.00 22.38  ? 190  HIS A CD2   1 
ATOM   2199 C  CE1   . HIS C 3  184 ? 50.185 207.756 40.613 1.00 21.46  ? 190  HIS A CE1   1 
ATOM   2200 N  NE2   . HIS C 3  184 ? 49.660 206.862 39.795 1.00 20.32  ? 190  HIS A NE2   1 
ATOM   2201 N  N     . TYR C 3  185 ? 44.437 207.975 40.246 1.00 14.06  ? 191  TYR A N     1 
ATOM   2202 C  CA    . TYR C 3  185 ? 43.916 207.849 38.898 1.00 13.54  ? 191  TYR A CA    1 
ATOM   2203 C  C     . TYR C 3  185 ? 42.833 208.873 38.589 1.00 14.53  ? 191  TYR A C     1 
ATOM   2204 O  O     . TYR C 3  185 ? 42.670 209.278 37.439 1.00 12.11  ? 191  TYR A O     1 
ATOM   2205 C  CB    . TYR C 3  185 ? 43.391 206.431 38.670 1.00 11.00  ? 191  TYR A CB    1 
ATOM   2206 C  CG    . TYR C 3  185 ? 44.470 205.384 38.805 1.00 11.17  ? 191  TYR A CG    1 
ATOM   2207 C  CD1   . TYR C 3  185 ? 44.864 204.913 40.062 1.00 12.07  ? 191  TYR A CD1   1 
ATOM   2208 C  CD2   . TYR C 3  185 ? 45.146 204.905 37.683 1.00 12.37  ? 191  TYR A CD2   1 
ATOM   2209 C  CE1   . TYR C 3  185 ? 45.902 204.001 40.196 1.00 9.64   ? 191  TYR A CE1   1 
ATOM   2210 C  CE2   . TYR C 3  185 ? 46.191 203.992 37.809 1.00 10.54  ? 191  TYR A CE2   1 
ATOM   2211 C  CZ    . TYR C 3  185 ? 46.562 203.549 39.063 1.00 10.97  ? 191  TYR A CZ    1 
ATOM   2212 O  OH    . TYR C 3  185 ? 47.611 202.668 39.183 1.00 16.13  ? 191  TYR A OH    1 
ATOM   2213 N  N     . PHE C 3  186 ? 42.114 209.312 39.617 1.00 14.15  ? 192  PHE A N     1 
ATOM   2214 C  CA    . PHE C 3  186 ? 41.049 210.282 39.414 1.00 16.78  ? 192  PHE A CA    1 
ATOM   2215 C  C     . PHE C 3  186 ? 41.148 211.476 40.370 1.00 18.73  ? 192  PHE A C     1 
ATOM   2216 O  O     . PHE C 3  186 ? 41.005 211.325 41.585 1.00 17.33  ? 192  PHE A O     1 
ATOM   2217 C  CB    . PHE C 3  186 ? 39.697 209.582 39.572 1.00 14.20  ? 192  PHE A CB    1 
ATOM   2218 C  CG    . PHE C 3  186 ? 39.497 208.444 38.615 1.00 13.83  ? 192  PHE A CG    1 
ATOM   2219 C  CD1   . PHE C 3  186 ? 39.043 208.682 37.320 1.00 11.97  ? 192  PHE A CD1   1 
ATOM   2220 C  CD2   . PHE C 3  186 ? 39.789 207.135 38.995 1.00 12.46  ? 192  PHE A CD2   1 
ATOM   2221 C  CE1   . PHE C 3  186 ? 38.882 207.632 36.416 1.00 12.02  ? 192  PHE A CE1   1 
ATOM   2222 C  CE2   . PHE C 3  186 ? 39.634 206.077 38.101 1.00 11.42  ? 192  PHE A CE2   1 
ATOM   2223 C  CZ    . PHE C 3  186 ? 39.178 206.326 36.808 1.00 12.69  ? 192  PHE A CZ    1 
ATOM   2224 N  N     . PRO C 3  187 ? 41.404 212.678 39.823 1.00 20.62  ? 193  PRO A N     1 
ATOM   2225 C  CA    . PRO C 3  187 ? 41.526 213.919 40.599 1.00 22.89  ? 193  PRO A CA    1 
ATOM   2226 C  C     . PRO C 3  187 ? 40.297 214.167 41.466 1.00 24.99  ? 193  PRO A C     1 
ATOM   2227 O  O     . PRO C 3  187 ? 39.175 214.248 40.969 1.00 25.47  ? 193  PRO A O     1 
ATOM   2228 C  CB    . PRO C 3  187 ? 41.702 214.986 39.522 1.00 20.96  ? 193  PRO A CB    1 
ATOM   2229 C  CG    . PRO C 3  187 ? 42.448 214.257 38.464 1.00 22.71  ? 193  PRO A CG    1 
ATOM   2230 C  CD    . PRO C 3  187 ? 41.709 212.926 38.403 1.00 21.69  ? 193  PRO A CD    1 
ATOM   2231 N  N     . PRO C 3  188 ? 40.505 214.310 42.780 1.00 27.20  ? 194  PRO A N     1 
ATOM   2232 C  CA    . PRO C 3  188 ? 39.452 214.547 43.773 1.00 28.23  ? 194  PRO A CA    1 
ATOM   2233 C  C     . PRO C 3  188 ? 38.496 215.704 43.481 1.00 29.05  ? 194  PRO A C     1 
ATOM   2234 O  O     . PRO C 3  188 ? 37.323 215.623 43.833 1.00 29.70  ? 194  PRO A O     1 
ATOM   2235 C  CB    . PRO C 3  188 ? 40.238 214.783 45.062 1.00 28.95  ? 194  PRO A CB    1 
ATOM   2236 C  CG    . PRO C 3  188 ? 41.493 214.006 44.845 1.00 30.26  ? 194  PRO A CG    1 
ATOM   2237 C  CD    . PRO C 3  188 ? 41.833 214.333 43.416 1.00 27.28  ? 194  PRO A CD    1 
ATOM   2238 N  N     . GLU C 3  189 ? 38.985 216.767 42.842 1.00 29.79  ? 195  GLU A N     1 
ATOM   2239 C  CA    . GLU C 3  189 ? 38.142 217.939 42.564 1.00 31.87  ? 195  GLU A CA    1 
ATOM   2240 C  C     . GLU C 3  189 ? 37.041 217.704 41.537 1.00 30.67  ? 195  GLU A C     1 
ATOM   2241 O  O     . GLU C 3  189 ? 36.156 218.546 41.365 1.00 30.56  ? 195  GLU A O     1 
ATOM   2242 C  CB    . GLU C 3  189 ? 38.979 219.133 42.082 1.00 32.98  ? 195  GLU A CB    1 
ATOM   2243 C  CG    . GLU C 3  189 ? 40.403 219.162 42.566 1.00 38.32  ? 195  GLU A CG    1 
ATOM   2244 C  CD    . GLU C 3  189 ? 41.257 218.161 41.832 1.00 41.48  ? 195  GLU A CD    1 
ATOM   2245 O  OE1   . GLU C 3  189 ? 41.276 218.209 40.585 1.00 42.97  ? 195  GLU A OE1   1 
ATOM   2246 O  OE2   . GLU C 3  189 ? 41.908 217.331 42.499 1.00 45.21  ? 195  GLU A OE2   1 
ATOM   2247 N  N     . ILE C 3  190 ? 37.099 216.571 40.849 1.00 28.49  ? 196  ILE A N     1 
ATOM   2248 C  CA    . ILE C 3  190 ? 36.108 216.269 39.828 1.00 25.75  ? 196  ILE A CA    1 
ATOM   2249 C  C     . ILE C 3  190 ? 35.252 215.070 40.207 1.00 24.25  ? 196  ILE A C     1 
ATOM   2250 O  O     . ILE C 3  190 ? 35.777 214.046 40.641 1.00 24.49  ? 196  ILE A O     1 
ATOM   2251 C  CB    . ILE C 3  190 ? 36.802 215.966 38.487 1.00 25.74  ? 196  ILE A CB    1 
ATOM   2252 C  CG1   . ILE C 3  190 ? 37.697 217.141 38.095 1.00 25.69  ? 196  ILE A CG1   1 
ATOM   2253 C  CG2   . ILE C 3  190 ? 35.769 215.687 37.414 1.00 24.99  ? 196  ILE A CG2   1 
ATOM   2254 C  CD1   . ILE C 3  190 ? 38.508 216.901 36.845 1.00 27.57  ? 196  ILE A CD1   1 
ATOM   2255 N  N     . ASP C 3  191 ? 33.936 215.202 40.058 1.00 21.99  ? 197  ASP A N     1 
ATOM   2256 C  CA    . ASP C 3  191 ? 33.022 214.096 40.342 1.00 20.94  ? 197  ASP A CA    1 
ATOM   2257 C  C     . ASP C 3  191 ? 32.815 213.369 39.016 1.00 20.57  ? 197  ASP A C     1 
ATOM   2258 O  O     . ASP C 3  191 ? 31.950 213.740 38.218 1.00 20.80  ? 197  ASP A O     1 
ATOM   2259 C  CB    . ASP C 3  191 ? 31.689 214.624 40.880 1.00 22.15  ? 197  ASP A CB    1 
ATOM   2260 C  CG    . ASP C 3  191 ? 30.611 213.542 40.968 1.00 25.34  ? 197  ASP A CG    1 
ATOM   2261 O  OD1   . ASP C 3  191 ? 30.936 212.334 40.866 1.00 24.56  ? 197  ASP A OD1   1 
ATOM   2262 O  OD2   . ASP C 3  191 ? 29.429 213.913 41.149 1.00 26.50  ? 197  ASP A OD2   1 
ATOM   2263 N  N     . PHE C 3  192 ? 33.624 212.338 38.784 1.00 19.22  ? 198  PHE A N     1 
ATOM   2264 C  CA    . PHE C 3  192 ? 33.563 211.579 37.542 1.00 17.69  ? 198  PHE A CA    1 
ATOM   2265 C  C     . PHE C 3  192 ? 32.262 210.848 37.242 1.00 17.71  ? 198  PHE A C     1 
ATOM   2266 O  O     . PHE C 3  192 ? 32.141 210.228 36.195 1.00 17.61  ? 198  PHE A O     1 
ATOM   2267 C  CB    . PHE C 3  192 ? 34.730 210.596 37.471 1.00 17.00  ? 198  PHE A CB    1 
ATOM   2268 C  CG    . PHE C 3  192 ? 36.060 211.260 37.297 1.00 16.57  ? 198  PHE A CG    1 
ATOM   2269 C  CD1   . PHE C 3  192 ? 36.703 211.848 38.376 1.00 16.30  ? 198  PHE A CD1   1 
ATOM   2270 C  CD2   . PHE C 3  192 ? 36.654 211.332 36.041 1.00 17.59  ? 198  PHE A CD2   1 
ATOM   2271 C  CE1   . PHE C 3  192 ? 37.918 212.499 38.210 1.00 18.64  ? 198  PHE A CE1   1 
ATOM   2272 C  CE2   . PHE C 3  192 ? 37.869 211.983 35.861 1.00 18.84  ? 198  PHE A CE2   1 
ATOM   2273 C  CZ    . PHE C 3  192 ? 38.504 212.569 36.949 1.00 19.51  ? 198  PHE A CZ    1 
ATOM   2274 N  N     . THR C 3  193 ? 31.292 210.905 38.149 1.00 19.13  ? 199  THR A N     1 
ATOM   2275 C  CA    . THR C 3  193 ? 30.009 210.254 37.895 1.00 19.31  ? 199  THR A CA    1 
ATOM   2276 C  C     . THR C 3  193 ? 29.076 211.311 37.329 1.00 19.59  ? 199  THR A C     1 
ATOM   2277 O  O     . THR C 3  193 ? 27.911 211.037 37.031 1.00 20.32  ? 199  THR A O     1 
ATOM   2278 C  CB    . THR C 3  193 ? 29.363 209.707 39.182 1.00 19.99  ? 199  THR A CB    1 
ATOM   2279 O  OG1   . THR C 3  193 ? 29.135 210.789 40.095 1.00 22.62  ? 199  THR A OG1   1 
ATOM   2280 C  CG2   . THR C 3  193 ? 30.259 208.674 39.842 1.00 19.47  ? 199  THR A CG2   1 
ATOM   2281 N  N     . ASP C 3  194 ? 29.594 212.523 37.168 1.00 19.33  ? 200  ASP A N     1 
ATOM   2282 C  CA    . ASP C 3  194 ? 28.778 213.613 36.663 1.00 20.00  ? 200  ASP A CA    1 
ATOM   2283 C  C     . ASP C 3  194 ? 29.491 214.475 35.620 1.00 19.43  ? 200  ASP A C     1 
ATOM   2284 O  O     . ASP C 3  194 ? 29.453 215.704 35.686 1.00 20.26  ? 200  ASP A O     1 
ATOM   2285 C  CB    . ASP C 3  194 ? 28.317 214.469 37.846 1.00 22.80  ? 200  ASP A CB    1 
ATOM   2286 C  CG    . ASP C 3  194 ? 27.355 215.556 37.437 1.00 26.84  ? 200  ASP A CG    1 
ATOM   2287 O  OD1   . ASP C 3  194 ? 26.404 215.260 36.681 1.00 26.78  ? 200  ASP A OD1   1 
ATOM   2288 O  OD2   . ASP C 3  194 ? 27.546 216.710 37.879 1.00 31.56  ? 200  ASP A OD2   1 
ATOM   2289 N  N     . VAL C 3  195 ? 30.135 213.823 34.657 1.00 17.59  ? 201  VAL A N     1 
ATOM   2290 C  CA    . VAL C 3  195 ? 30.852 214.513 33.591 1.00 16.35  ? 201  VAL A CA    1 
ATOM   2291 C  C     . VAL C 3  195 ? 30.679 213.767 32.278 1.00 16.36  ? 201  VAL A C     1 
ATOM   2292 O  O     . VAL C 3  195 ? 30.440 212.559 32.272 1.00 16.99  ? 201  VAL A O     1 
ATOM   2293 C  CB    . VAL C 3  195 ? 32.368 214.593 33.880 1.00 15.59  ? 201  VAL A CB    1 
ATOM   2294 C  CG1   . VAL C 3  195 ? 32.630 215.451 35.110 1.00 13.91  ? 201  VAL A CG1   1 
ATOM   2295 C  CG2   . VAL C 3  195 ? 32.923 213.194 34.077 1.00 12.54  ? 201  VAL A CG2   1 
ATOM   2296 N  N     . GLY C 3  196 ? 30.808 214.487 31.169 1.00 14.82  ? 202  GLY A N     1 
ATOM   2297 C  CA    . GLY C 3  196 ? 30.672 213.867 29.864 1.00 14.72  ? 202  GLY A CA    1 
ATOM   2298 C  C     . GLY C 3  196 ? 31.854 212.957 29.606 1.00 16.51  ? 202  GLY A C     1 
ATOM   2299 O  O     . GLY C 3  196 ? 32.854 213.012 30.329 1.00 18.01  ? 202  GLY A O     1 
ATOM   2300 N  N     . TYR C 3  197 ? 31.765 212.135 28.569 1.00 15.67  ? 203  TYR A N     1 
ATOM   2301 C  CA    . TYR C 3  197 ? 32.842 211.203 28.288 1.00 16.08  ? 203  TYR A CA    1 
ATOM   2302 C  C     . TYR C 3  197 ? 34.171 211.892 27.982 1.00 17.59  ? 203  TYR A C     1 
ATOM   2303 O  O     . TYR C 3  197 ? 35.234 211.438 28.431 1.00 18.07  ? 203  TYR A O     1 
ATOM   2304 C  CB    . TYR C 3  197 ? 32.433 210.251 27.157 1.00 12.42  ? 203  TYR A CB    1 
ATOM   2305 C  CG    . TYR C 3  197 ? 32.528 210.809 25.764 1.00 10.22  ? 203  TYR A CG    1 
ATOM   2306 C  CD1   . TYR C 3  197 ? 33.729 210.757 25.056 1.00 9.31   ? 203  TYR A CD1   1 
ATOM   2307 C  CD2   . TYR C 3  197 ? 31.414 211.378 25.142 1.00 10.64  ? 203  TYR A CD2   1 
ATOM   2308 C  CE1   . TYR C 3  197 ? 33.820 211.249 23.765 1.00 8.83   ? 203  TYR A CE1   1 
ATOM   2309 C  CE2   . TYR C 3  197 ? 31.494 211.883 23.844 1.00 8.67   ? 203  TYR A CE2   1 
ATOM   2310 C  CZ    . TYR C 3  197 ? 32.699 211.812 23.165 1.00 11.06  ? 203  TYR A CZ    1 
ATOM   2311 O  OH    . TYR C 3  197 ? 32.790 212.294 21.879 1.00 15.03  ? 203  TYR A OH    1 
ATOM   2312 N  N     . THR C 3  198 ? 34.124 212.988 27.236 1.00 17.26  ? 204  THR A N     1 
ATOM   2313 C  CA    . THR C 3  198 ? 35.354 213.691 26.911 1.00 18.32  ? 204  THR A CA    1 
ATOM   2314 C  C     . THR C 3  198 ? 36.085 214.114 28.189 1.00 17.22  ? 204  THR A C     1 
ATOM   2315 O  O     . THR C 3  198 ? 37.299 213.961 28.305 1.00 18.27  ? 204  THR A O     1 
ATOM   2316 C  CB    . THR C 3  198 ? 35.078 214.925 26.039 1.00 21.53  ? 204  THR A CB    1 
ATOM   2317 O  OG1   . THR C 3  198 ? 34.312 214.538 24.888 1.00 22.49  ? 204  THR A OG1   1 
ATOM   2318 C  CG2   . THR C 3  198 ? 36.394 215.525 25.560 1.00 24.29  ? 204  THR A CG2   1 
ATOM   2319 N  N     . THR C 3  199 ? 35.344 214.629 29.161 1.00 15.99  ? 205  THR A N     1 
ATOM   2320 C  CA    . THR C 3  199 ? 35.954 215.044 30.419 1.00 15.50  ? 205  THR A CA    1 
ATOM   2321 C  C     . THR C 3  199 ? 36.515 213.823 31.147 1.00 15.93  ? 205  THR A C     1 
ATOM   2322 O  O     . THR C 3  199 ? 37.645 213.848 31.645 1.00 16.34  ? 205  THR A O     1 
ATOM   2323 C  CB    . THR C 3  199 ? 34.924 215.741 31.325 1.00 14.49  ? 205  THR A CB    1 
ATOM   2324 O  OG1   . THR C 3  199 ? 34.515 216.969 30.719 1.00 15.79  ? 205  THR A OG1   1 
ATOM   2325 C  CG2   . THR C 3  199 ? 35.504 216.018 32.688 1.00 11.44  ? 205  THR A CG2   1 
ATOM   2326 N  N     . PHE C 3  200 ? 35.729 212.751 31.188 1.00 12.97  ? 206  PHE A N     1 
ATOM   2327 C  CA    . PHE C 3  200 ? 36.152 211.530 31.862 1.00 13.61  ? 206  PHE A CA    1 
ATOM   2328 C  C     . PHE C 3  200 ? 37.528 211.048 31.406 1.00 14.35  ? 206  PHE A C     1 
ATOM   2329 O  O     . PHE C 3  200 ? 38.382 210.741 32.234 1.00 15.55  ? 206  PHE A O     1 
ATOM   2330 C  CB    . PHE C 3  200 ? 35.107 210.422 31.658 1.00 12.96  ? 206  PHE A CB    1 
ATOM   2331 C  CG    . PHE C 3  200 ? 35.362 209.190 32.473 1.00 10.68  ? 206  PHE A CG    1 
ATOM   2332 C  CD1   . PHE C 3  200 ? 36.142 208.152 31.968 1.00 11.78  ? 206  PHE A CD1   1 
ATOM   2333 C  CD2   . PHE C 3  200 ? 34.836 209.073 33.756 1.00 10.60  ? 206  PHE A CD2   1 
ATOM   2334 C  CE1   . PHE C 3  200 ? 36.392 207.013 32.734 1.00 11.95  ? 206  PHE A CE1   1 
ATOM   2335 C  CE2   . PHE C 3  200 ? 35.080 207.941 34.530 1.00 8.97   ? 206  PHE A CE2   1 
ATOM   2336 C  CZ    . PHE C 3  200 ? 35.857 206.908 34.022 1.00 9.66   ? 206  PHE A CZ    1 
ATOM   2337 N  N     . TRP C 3  201 ? 37.751 210.992 30.096 1.00 14.85  ? 207  TRP A N     1 
ATOM   2338 C  CA    . TRP C 3  201 ? 39.041 210.533 29.582 1.00 16.54  ? 207  TRP A CA    1 
ATOM   2339 C  C     . TRP C 3  201 ? 40.140 211.580 29.732 1.00 17.99  ? 207  TRP A C     1 
ATOM   2340 O  O     . TRP C 3  201 ? 41.258 211.257 30.118 1.00 18.01  ? 207  TRP A O     1 
ATOM   2341 C  CB    . TRP C 3  201 ? 38.932 210.133 28.100 1.00 15.53  ? 207  TRP A CB    1 
ATOM   2342 C  CG    . TRP C 3  201 ? 37.881 209.081 27.819 1.00 14.64  ? 207  TRP A CG    1 
ATOM   2343 C  CD1   . TRP C 3  201 ? 36.783 209.215 27.017 1.00 13.67  ? 207  TRP A CD1   1 
ATOM   2344 C  CD2   . TRP C 3  201 ? 37.814 207.760 28.371 1.00 12.55  ? 207  TRP A CD2   1 
ATOM   2345 N  NE1   . TRP C 3  201 ? 36.037 208.066 27.039 1.00 13.34  ? 207  TRP A NE1   1 
ATOM   2346 C  CE2   . TRP C 3  201 ? 36.644 207.155 27.862 1.00 14.57  ? 207  TRP A CE2   1 
ATOM   2347 C  CE3   . TRP C 3  201 ? 38.626 207.031 29.250 1.00 12.39  ? 207  TRP A CE3   1 
ATOM   2348 C  CZ2   . TRP C 3  201 ? 36.263 205.848 28.204 1.00 14.82  ? 207  TRP A CZ2   1 
ATOM   2349 C  CZ3   . TRP C 3  201 ? 38.251 205.734 29.590 1.00 13.99  ? 207  TRP A CZ3   1 
ATOM   2350 C  CH2   . TRP C 3  201 ? 37.076 205.156 29.067 1.00 14.78  ? 207  TRP A CH2   1 
ATOM   2351 N  N     . SER C 3  202 ? 39.822 212.837 29.444 1.00 19.59  ? 208  SER A N     1 
ATOM   2352 C  CA    . SER C 3  202 ? 40.831 213.892 29.525 1.00 21.86  ? 208  SER A CA    1 
ATOM   2353 C  C     . SER C 3  202 ? 41.287 214.267 30.939 1.00 21.99  ? 208  SER A C     1 
ATOM   2354 O  O     . SER C 3  202 ? 42.461 214.572 31.149 1.00 22.34  ? 208  SER A O     1 
ATOM   2355 C  CB    . SER C 3  202 ? 40.346 215.144 28.778 1.00 20.64  ? 208  SER A CB    1 
ATOM   2356 O  OG    . SER C 3  202 ? 39.147 215.650 29.334 1.00 27.27  ? 208  SER A OG    1 
ATOM   2357 N  N     . GLU C 3  203 ? 40.375 214.234 31.907 1.00 23.50  ? 209  GLU A N     1 
ATOM   2358 C  CA    . GLU C 3  203 ? 40.725 214.583 33.282 1.00 21.32  ? 209  GLU A CA    1 
ATOM   2359 C  C     . GLU C 3  203 ? 41.345 213.432 34.074 1.00 20.38  ? 209  GLU A C     1 
ATOM   2360 O  O     . GLU C 3  203 ? 42.010 213.661 35.082 1.00 21.77  ? 209  GLU A O     1 
ATOM   2361 C  CB    . GLU C 3  203 ? 39.498 215.098 34.030 1.00 23.66  ? 209  GLU A CB    1 
ATOM   2362 C  CG    . GLU C 3  203 ? 38.829 216.309 33.395 1.00 28.42  ? 209  GLU A CG    1 
ATOM   2363 C  CD    . GLU C 3  203 ? 39.752 217.511 33.280 1.00 31.60  ? 209  GLU A CD    1 
ATOM   2364 O  OE1   . GLU C 3  203 ? 40.407 217.857 34.285 1.00 33.91  ? 209  GLU A OE1   1 
ATOM   2365 O  OE2   . GLU C 3  203 ? 39.810 218.118 32.189 1.00 32.74  ? 209  GLU A OE2   1 
ATOM   2366 N  N     . SER C 3  204 ? 41.136 212.195 33.638 1.00 18.62  ? 210  SER A N     1 
ATOM   2367 C  CA    . SER C 3  204 ? 41.712 211.067 34.364 1.00 17.50  ? 210  SER A CA    1 
ATOM   2368 C  C     . SER C 3  204 ? 43.114 210.761 33.853 1.00 15.24  ? 210  SER A C     1 
ATOM   2369 O  O     . SER C 3  204 ? 43.489 211.173 32.757 1.00 16.15  ? 210  SER A O     1 
ATOM   2370 C  CB    . SER C 3  204 ? 40.822 209.824 34.238 1.00 17.58  ? 210  SER A CB    1 
ATOM   2371 O  OG    . SER C 3  204 ? 40.672 209.414 32.891 1.00 19.73  ? 210  SER A OG    1 
ATOM   2372 N  N     . LEU C 3  205 ? 43.884 210.047 34.661 1.00 13.78  ? 211  LEU A N     1 
ATOM   2373 C  CA    . LEU C 3  205 ? 45.258 209.680 34.318 1.00 14.67  ? 211  LEU A CA    1 
ATOM   2374 C  C     . LEU C 3  205 ? 45.270 208.987 32.955 1.00 15.14  ? 211  LEU A C     1 
ATOM   2375 O  O     . LEU C 3  205 ? 44.369 208.208 32.646 1.00 15.97  ? 211  LEU A O     1 
ATOM   2376 C  CB    . LEU C 3  205 ? 45.816 208.740 35.393 1.00 13.28  ? 211  LEU A CB    1 
ATOM   2377 C  CG    . LEU C 3  205 ? 47.330 208.576 35.539 1.00 14.76  ? 211  LEU A CG    1 
ATOM   2378 C  CD1   . LEU C 3  205 ? 47.931 209.864 36.057 1.00 7.59   ? 211  LEU A CD1   1 
ATOM   2379 C  CD2   . LEU C 3  205 ? 47.630 207.428 36.504 1.00 14.43  ? 211  LEU A CD2   1 
ATOM   2380 N  N     . GLU C 3  206 ? 46.282 209.276 32.141 1.00 14.72  ? 212  GLU A N     1 
ATOM   2381 C  CA    . GLU C 3  206 ? 46.386 208.678 30.812 1.00 13.26  ? 212  GLU A CA    1 
ATOM   2382 C  C     . GLU C 3  206 ? 46.102 207.172 30.835 1.00 12.67  ? 212  GLU A C     1 
ATOM   2383 O  O     . GLU C 3  206 ? 45.350 206.669 30.002 1.00 11.86  ? 212  GLU A O     1 
ATOM   2384 C  CB    . GLU C 3  206 ? 47.777 208.953 30.225 1.00 13.16  ? 212  GLU A CB    1 
ATOM   2385 C  CG    . GLU C 3  206 ? 48.092 208.232 28.920 1.00 13.83  ? 212  GLU A CG    1 
ATOM   2386 C  CD    . GLU C 3  206 ? 49.438 208.652 28.338 1.00 16.76  ? 212  GLU A CD    1 
ATOM   2387 O  OE1   . GLU C 3  206 ? 50.313 209.088 29.116 1.00 22.19  ? 212  GLU A OE1   1 
ATOM   2388 O  OE2   . GLU C 3  206 ? 49.637 208.539 27.110 1.00 17.69  ? 212  GLU A OE2   1 
ATOM   2389 N  N     . ALA C 3  207 ? 46.688 206.473 31.805 1.00 12.11  ? 213  ALA A N     1 
ATOM   2390 C  CA    . ALA C 3  207 ? 46.520 205.027 31.960 1.00 13.21  ? 213  ALA A CA    1 
ATOM   2391 C  C     . ALA C 3  207 ? 45.074 204.538 31.836 1.00 12.72  ? 213  ALA A C     1 
ATOM   2392 O  O     . ALA C 3  207 ? 44.825 203.451 31.307 1.00 12.07  ? 213  ALA A O     1 
ATOM   2393 C  CB    . ALA C 3  207 ? 47.098 204.574 33.301 1.00 11.80  ? 213  ALA A CB    1 
ATOM   2394 N  N     . VAL C 3  208 ? 44.127 205.332 32.322 1.00 11.43  ? 214  VAL A N     1 
ATOM   2395 C  CA    . VAL C 3  208 ? 42.728 204.947 32.253 1.00 12.47  ? 214  VAL A CA    1 
ATOM   2396 C  C     . VAL C 3  208 ? 42.242 204.893 30.821 1.00 13.70  ? 214  VAL A C     1 
ATOM   2397 O  O     . VAL C 3  208 ? 41.443 204.029 30.456 1.00 15.00  ? 214  VAL A O     1 
ATOM   2398 C  CB    . VAL C 3  208 ? 41.837 205.920 33.029 1.00 12.25  ? 214  VAL A CB    1 
ATOM   2399 C  CG1   . VAL C 3  208 ? 40.382 205.494 32.910 1.00 10.67  ? 214  VAL A CG1   1 
ATOM   2400 C  CG2   . VAL C 3  208 ? 42.265 205.954 34.493 1.00 12.74  ? 214  VAL A CG2   1 
ATOM   2401 N  N     . ASP C 3  209 ? 42.726 205.819 30.007 1.00 14.19  ? 215  ASP A N     1 
ATOM   2402 C  CA    . ASP C 3  209 ? 42.328 205.869 28.614 1.00 15.21  ? 215  ASP A CA    1 
ATOM   2403 C  C     . ASP C 3  209 ? 42.989 204.742 27.823 1.00 15.51  ? 215  ASP A C     1 
ATOM   2404 O  O     . ASP C 3  209 ? 42.357 204.108 26.976 1.00 16.84  ? 215  ASP A O     1 
ATOM   2405 C  CB    . ASP C 3  209 ? 42.696 207.234 28.030 1.00 16.76  ? 215  ASP A CB    1 
ATOM   2406 C  CG    . ASP C 3  209 ? 42.269 207.387 26.592 1.00 15.32  ? 215  ASP A CG    1 
ATOM   2407 O  OD1   . ASP C 3  209 ? 41.168 206.922 26.240 1.00 14.82  ? 215  ASP A OD1   1 
ATOM   2408 O  OD2   . ASP C 3  209 ? 43.030 207.989 25.814 1.00 18.39  ? 215  ASP A OD2   1 
ATOM   2409 N  N     . ILE C 3  210 ? 44.257 204.486 28.120 1.00 13.40  ? 216  ILE A N     1 
ATOM   2410 C  CA    . ILE C 3  210 ? 45.001 203.437 27.447 1.00 13.13  ? 216  ILE A CA    1 
ATOM   2411 C  C     . ILE C 3  210 ? 44.431 202.046 27.734 1.00 14.02  ? 216  ILE A C     1 
ATOM   2412 O  O     . ILE C 3  210 ? 44.278 201.225 26.814 1.00 12.04  ? 216  ILE A O     1 
ATOM   2413 C  CB    . ILE C 3  210 ? 46.486 203.480 27.858 1.00 14.65  ? 216  ILE A CB    1 
ATOM   2414 C  CG1   . ILE C 3  210 ? 47.137 204.732 27.270 1.00 13.06  ? 216  ILE A CG1   1 
ATOM   2415 C  CG2   . ILE C 3  210 ? 47.207 202.221 27.390 1.00 13.14  ? 216  ILE A CG2   1 
ATOM   2416 C  CD1   . ILE C 3  210 ? 48.572 204.904 27.670 1.00 18.53  ? 216  ILE A CD1   1 
ATOM   2417 N  N     . GLU C 3  211 ? 44.109 201.780 29.000 1.00 12.02  ? 217  GLU A N     1 
ATOM   2418 C  CA    . GLU C 3  211 ? 43.568 200.480 29.358 1.00 11.91  ? 217  GLU A CA    1 
ATOM   2419 C  C     . GLU C 3  211 ? 42.257 200.182 28.644 1.00 10.97  ? 217  GLU A C     1 
ATOM   2420 O  O     . GLU C 3  211 ? 42.090 199.092 28.101 1.00 12.29  ? 217  GLU A O     1 
ATOM   2421 C  CB    . GLU C 3  211 ? 43.402 200.358 30.877 1.00 12.35  ? 217  GLU A CB    1 
ATOM   2422 C  CG    . GLU C 3  211 ? 44.716 200.128 31.606 1.00 12.57  ? 217  GLU A CG    1 
ATOM   2423 C  CD    . GLU C 3  211 ? 45.519 198.971 31.027 1.00 12.55  ? 217  GLU A CD    1 
ATOM   2424 O  OE1   . GLU C 3  211 ? 44.962 197.859 30.901 1.00 12.30  ? 217  GLU A OE1   1 
ATOM   2425 O  OE2   . GLU C 3  211 ? 46.711 199.173 30.699 1.00 13.62  ? 217  GLU A OE2   1 
ATOM   2426 N  N     . HIS C 3  212 ? 41.336 201.142 28.624 1.00 9.58   ? 218  HIS A N     1 
ATOM   2427 C  CA    . HIS C 3  212 ? 40.060 200.939 27.940 1.00 9.01   ? 218  HIS A CA    1 
ATOM   2428 C  C     . HIS C 3  212 ? 40.222 200.788 26.428 1.00 8.35   ? 218  HIS A C     1 
ATOM   2429 O  O     . HIS C 3  212 ? 39.495 200.026 25.803 1.00 9.73   ? 218  HIS A O     1 
ATOM   2430 C  CB    . HIS C 3  212 ? 39.081 202.078 28.247 1.00 6.90   ? 218  HIS A CB    1 
ATOM   2431 C  CG    . HIS C 3  212 ? 38.499 202.014 29.624 1.00 6.63   ? 218  HIS A CG    1 
ATOM   2432 N  ND1   . HIS C 3  212 ? 39.159 202.496 30.735 1.00 7.40   ? 218  HIS A ND1   1 
ATOM   2433 C  CD2   . HIS C 3  212 ? 37.337 201.483 30.076 1.00 7.90   ? 218  HIS A CD2   1 
ATOM   2434 C  CE1   . HIS C 3  212 ? 38.426 202.264 31.811 1.00 8.17   ? 218  HIS A CE1   1 
ATOM   2435 N  NE2   . HIS C 3  212 ? 37.316 201.650 31.440 1.00 7.16   ? 218  HIS A NE2   1 
ATOM   2436 N  N     . ARG C 3  213 ? 41.162 201.500 25.823 1.00 9.58   ? 219  ARG A N     1 
ATOM   2437 C  CA    . ARG C 3  213 ? 41.335 201.336 24.383 1.00 11.76  ? 219  ARG A CA    1 
ATOM   2438 C  C     . ARG C 3  213 ? 41.959 199.963 24.123 1.00 13.60  ? 219  ARG A C     1 
ATOM   2439 O  O     . ARG C 3  213 ? 41.636 199.301 23.133 1.00 14.27  ? 219  ARG A O     1 
ATOM   2440 C  CB    . ARG C 3  213 ? 42.227 202.435 23.802 1.00 7.90   ? 219  ARG A CB    1 
ATOM   2441 C  CG    . ARG C 3  213 ? 41.546 203.786 23.612 1.00 9.75   ? 219  ARG A CG    1 
ATOM   2442 C  CD    . ARG C 3  213 ? 42.596 204.853 23.343 1.00 8.54   ? 219  ARG A CD    1 
ATOM   2443 N  NE    . ARG C 3  213 ? 42.047 206.192 23.185 1.00 13.71  ? 219  ARG A NE    1 
ATOM   2444 C  CZ    . ARG C 3  213 ? 41.556 206.685 22.047 1.00 17.85  ? 219  ARG A CZ    1 
ATOM   2445 N  NH1   . ARG C 3  213 ? 41.537 205.944 20.944 1.00 17.23  ? 219  ARG A NH1   1 
ATOM   2446 N  NH2   . ARG C 3  213 ? 41.093 207.932 22.007 1.00 13.49  ? 219  ARG A NH2   1 
ATOM   2447 N  N     . ALA C 3  214 ? 42.848 199.530 25.014 1.00 13.27  ? 220  ALA A N     1 
ATOM   2448 C  CA    . ALA C 3  214 ? 43.487 198.231 24.846 1.00 13.76  ? 220  ALA A CA    1 
ATOM   2449 C  C     . ALA C 3  214 ? 42.450 197.114 24.956 1.00 13.94  ? 220  ALA A C     1 
ATOM   2450 O  O     . ALA C 3  214 ? 42.412 196.200 24.121 1.00 14.80  ? 220  ALA A O     1 
ATOM   2451 C  CB    . ALA C 3  214 ? 44.580 198.038 25.893 1.00 13.47  ? 220  ALA A CB    1 
ATOM   2452 N  N     . ALA C 3  215 ? 41.599 197.197 25.977 1.00 13.59  ? 221  ALA A N     1 
ATOM   2453 C  CA    . ALA C 3  215 ? 40.569 196.178 26.191 1.00 12.34  ? 221  ALA A CA    1 
ATOM   2454 C  C     . ALA C 3  215 ? 39.579 196.115 25.033 1.00 12.28  ? 221  ALA A C     1 
ATOM   2455 O  O     . ALA C 3  215 ? 39.206 195.031 24.589 1.00 10.68  ? 221  ALA A O     1 
ATOM   2456 C  CB    . ALA C 3  215 ? 39.840 196.434 27.498 1.00 7.32   ? 221  ALA A CB    1 
ATOM   2457 N  N     . TRP C 3  216 ? 39.157 197.277 24.540 1.00 12.99  ? 222  TRP A N     1 
ATOM   2458 C  CA    . TRP C 3  216 ? 38.212 197.326 23.426 1.00 12.31  ? 222  TRP A CA    1 
ATOM   2459 C  C     . TRP C 3  216 ? 38.819 196.710 22.167 1.00 12.93  ? 222  TRP A C     1 
ATOM   2460 O  O     . TRP C 3  216 ? 38.161 195.957 21.453 1.00 13.92  ? 222  TRP A O     1 
ATOM   2461 C  CB    . TRP C 3  216 ? 37.801 198.771 23.160 1.00 10.96  ? 222  TRP A CB    1 
ATOM   2462 C  CG    . TRP C 3  216 ? 36.686 198.924 22.179 1.00 9.63   ? 222  TRP A CG    1 
ATOM   2463 C  CD1   . TRP C 3  216 ? 36.791 198.997 20.815 1.00 8.98   ? 222  TRP A CD1   1 
ATOM   2464 C  CD2   . TRP C 3  216 ? 35.296 199.084 22.484 1.00 6.54   ? 222  TRP A CD2   1 
ATOM   2465 N  NE1   . TRP C 3  216 ? 35.549 199.206 20.255 1.00 7.01   ? 222  TRP A NE1   1 
ATOM   2466 C  CE2   . TRP C 3  216 ? 34.616 199.264 21.256 1.00 7.50   ? 222  TRP A CE2   1 
ATOM   2467 C  CE3   . TRP C 3  216 ? 34.561 199.102 23.674 1.00 8.88   ? 222  TRP A CE3   1 
ATOM   2468 C  CZ2   . TRP C 3  216 ? 33.235 199.461 21.185 1.00 6.63   ? 222  TRP A CZ2   1 
ATOM   2469 C  CZ3   . TRP C 3  216 ? 33.178 199.302 23.609 1.00 10.69  ? 222  TRP A CZ3   1 
ATOM   2470 C  CH2   . TRP C 3  216 ? 32.533 199.480 22.368 1.00 10.46  ? 222  TRP A CH2   1 
ATOM   2471 N  N     . LEU C 3  217 ? 40.083 197.019 21.902 1.00 13.27  ? 223  LEU A N     1 
ATOM   2472 C  CA    . LEU C 3  217 ? 40.766 196.478 20.729 1.00 11.75  ? 223  LEU A CA    1 
ATOM   2473 C  C     . LEU C 3  217 ? 41.000 194.964 20.855 1.00 13.25  ? 223  LEU A C     1 
ATOM   2474 O  O     . LEU C 3  217 ? 40.761 194.193 19.914 1.00 11.43  ? 223  LEU A O     1 
ATOM   2475 C  CB    . LEU C 3  217 ? 42.104 197.192 20.540 1.00 10.19  ? 223  LEU A CB    1 
ATOM   2476 C  CG    . LEU C 3  217 ? 43.115 196.557 19.581 1.00 11.03  ? 223  LEU A CG    1 
ATOM   2477 C  CD1   . LEU C 3  217 ? 42.504 196.430 18.187 1.00 9.75   ? 223  LEU A CD1   1 
ATOM   2478 C  CD2   . LEU C 3  217 ? 44.382 197.418 19.540 1.00 8.18   ? 223  LEU A CD2   1 
ATOM   2479 N  N     . LEU C 3  218 ? 41.468 194.544 22.025 1.00 10.66  ? 224  LEU A N     1 
ATOM   2480 C  CA    . LEU C 3  218 ? 41.749 193.140 22.256 1.00 10.98  ? 224  LEU A CA    1 
ATOM   2481 C  C     . LEU C 3  218 ? 40.487 192.276 22.292 1.00 10.92  ? 224  LEU A C     1 
ATOM   2482 O  O     . LEU C 3  218 ? 40.529 191.098 21.942 1.00 11.95  ? 224  LEU A O     1 
ATOM   2483 C  CB    . LEU C 3  218 ? 42.588 192.992 23.533 1.00 10.14  ? 224  LEU A CB    1 
ATOM   2484 C  CG    . LEU C 3  218 ? 44.026 193.491 23.338 1.00 9.39   ? 224  LEU A CG    1 
ATOM   2485 C  CD1   . LEU C 3  218 ? 44.804 193.537 24.654 1.00 8.13   ? 224  LEU A CD1   1 
ATOM   2486 C  CD2   . LEU C 3  218 ? 44.705 192.564 22.349 1.00 7.03   ? 224  LEU A CD2   1 
ATOM   2487 N  N     . ALA C 3  219 ? 39.363 192.851 22.706 1.00 10.21  ? 225  ALA A N     1 
ATOM   2488 C  CA    . ALA C 3  219 ? 38.113 192.095 22.711 1.00 10.47  ? 225  ALA A CA    1 
ATOM   2489 C  C     . ALA C 3  219 ? 37.861 191.723 21.249 1.00 11.35  ? 225  ALA A C     1 
ATOM   2490 O  O     . ALA C 3  219 ? 37.568 190.571 20.921 1.00 12.36  ? 225  ALA A O     1 
ATOM   2491 C  CB    . ALA C 3  219 ? 36.976 192.962 23.245 1.00 8.67   ? 225  ALA A CB    1 
ATOM   2492 N  N     . LYS C 3  220 ? 38.002 192.720 20.379 1.00 10.66  ? 226  LYS A N     1 
ATOM   2493 C  CA    . LYS C 3  220 ? 37.831 192.554 18.940 1.00 12.17  ? 226  LYS A CA    1 
ATOM   2494 C  C     . LYS C 3  220 ? 38.748 191.459 18.375 1.00 13.16  ? 226  LYS A C     1 
ATOM   2495 O  O     . LYS C 3  220 ? 38.332 190.666 17.521 1.00 12.41  ? 226  LYS A O     1 
ATOM   2496 C  CB    . LYS C 3  220 ? 38.122 193.885 18.242 1.00 12.84  ? 226  LYS A CB    1 
ATOM   2497 C  CG    . LYS C 3  220 ? 38.240 193.812 16.734 1.00 10.30  ? 226  LYS A CG    1 
ATOM   2498 C  CD    . LYS C 3  220 ? 36.918 193.490 16.091 1.00 11.58  ? 226  LYS A CD    1 
ATOM   2499 C  CE    . LYS C 3  220 ? 36.994 193.767 14.611 1.00 13.55  ? 226  LYS A CE    1 
ATOM   2500 N  NZ    . LYS C 3  220 ? 35.672 193.666 13.981 1.00 17.46  ? 226  LYS A NZ    1 
ATOM   2501 N  N     . GLN C 3  221 ? 39.996 191.428 18.843 1.00 12.20  ? 227  GLN A N     1 
ATOM   2502 C  CA    . GLN C 3  221 ? 40.958 190.425 18.392 1.00 11.08  ? 227  GLN A CA    1 
ATOM   2503 C  C     . GLN C 3  221 ? 40.447 189.037 18.770 1.00 12.56  ? 227  GLN A C     1 
ATOM   2504 O  O     . GLN C 3  221 ? 40.562 188.090 17.993 1.00 13.35  ? 227  GLN A O     1 
ATOM   2505 C  CB    . GLN C 3  221 ? 42.325 190.663 19.038 1.00 10.69  ? 227  GLN A CB    1 
ATOM   2506 C  CG    . GLN C 3  221 ? 43.336 189.562 18.758 1.00 10.86  ? 227  GLN A CG    1 
ATOM   2507 C  CD    . GLN C 3  221 ? 44.665 189.779 19.469 1.00 11.65  ? 227  GLN A CD    1 
ATOM   2508 O  OE1   . GLN C 3  221 ? 45.402 190.707 19.160 1.00 8.85   ? 227  GLN A OE1   1 
ATOM   2509 N  NE2   . GLN C 3  221 ? 44.972 188.913 20.427 1.00 12.79  ? 227  GLN A NE2   1 
ATOM   2510 N  N     . GLU C 3  222 ? 39.892 188.919 19.971 1.00 12.11  ? 228  GLU A N     1 
ATOM   2511 C  CA    . GLU C 3  222 ? 39.356 187.645 20.422 1.00 13.13  ? 228  GLU A CA    1 
ATOM   2512 C  C     . GLU C 3  222 ? 38.232 187.217 19.489 1.00 14.09  ? 228  GLU A C     1 
ATOM   2513 O  O     . GLU C 3  222 ? 38.155 186.059 19.086 1.00 13.62  ? 228  GLU A O     1 
ATOM   2514 C  CB    . GLU C 3  222 ? 38.809 187.754 21.844 1.00 12.72  ? 228  GLU A CB    1 
ATOM   2515 C  CG    . GLU C 3  222 ? 39.867 187.868 22.908 1.00 15.04  ? 228  GLU A CG    1 
ATOM   2516 C  CD    . GLU C 3  222 ? 39.303 187.671 24.306 1.00 17.48  ? 228  GLU A CD    1 
ATOM   2517 O  OE1   . GLU C 3  222 ? 38.258 186.995 24.443 1.00 20.12  ? 228  GLU A OE1   1 
ATOM   2518 O  OE2   . GLU C 3  222 ? 39.912 188.168 25.269 1.00 17.62  ? 228  GLU A OE2   1 
ATOM   2519 N  N     . ARG C 3  223 ? 37.348 188.155 19.163 1.00 13.65  ? 229  ARG A N     1 
ATOM   2520 C  CA    . ARG C 3  223 ? 36.251 187.845 18.266 1.00 12.67  ? 229  ARG A CA    1 
ATOM   2521 C  C     . ARG C 3  223 ? 36.788 187.414 16.906 1.00 12.29  ? 229  ARG A C     1 
ATOM   2522 O  O     . ARG C 3  223 ? 36.242 186.500 16.289 1.00 13.43  ? 229  ARG A O     1 
ATOM   2523 C  CB    . ARG C 3  223 ? 35.325 189.049 18.108 1.00 13.16  ? 229  ARG A CB    1 
ATOM   2524 C  CG    . ARG C 3  223 ? 34.201 189.121 19.140 1.00 13.33  ? 229  ARG A CG    1 
ATOM   2525 C  CD    . ARG C 3  223 ? 33.451 190.443 19.027 1.00 11.12  ? 229  ARG A CD    1 
ATOM   2526 N  NE    . ARG C 3  223 ? 34.009 191.411 19.958 1.00 17.92  ? 229  ARG A NE    1 
ATOM   2527 C  CZ    . ARG C 3  223 ? 34.298 192.669 19.663 1.00 15.34  ? 229  ARG A CZ    1 
ATOM   2528 N  NH1   . ARG C 3  223 ? 34.087 193.135 18.448 1.00 11.54  ? 229  ARG A NH1   1 
ATOM   2529 N  NH2   . ARG C 3  223 ? 34.808 193.455 20.595 1.00 19.94  ? 229  ARG A NH2   1 
ATOM   2530 N  N     . ASN C 3  224 ? 37.858 188.061 16.444 1.00 10.60  ? 230  ASN A N     1 
ATOM   2531 C  CA    . ASN C 3  224 ? 38.442 187.714 15.153 1.00 8.96   ? 230  ASN A CA    1 
ATOM   2532 C  C     . ASN C 3  224 ? 38.942 186.272 15.190 1.00 9.21   ? 230  ASN A C     1 
ATOM   2533 O  O     . ASN C 3  224 ? 38.665 185.480 14.286 1.00 7.24   ? 230  ASN A O     1 
ATOM   2534 C  CB    . ASN C 3  224 ? 39.631 188.626 14.792 1.00 8.19   ? 230  ASN A CB    1 
ATOM   2535 C  CG    . ASN C 3  224 ? 39.246 190.107 14.616 1.00 10.27  ? 230  ASN A CG    1 
ATOM   2536 O  OD1   . ASN C 3  224 ? 38.120 190.451 14.254 1.00 3.87   ? 230  ASN A OD1   1 
ATOM   2537 N  ND2   . ASN C 3  224 ? 40.219 190.988 14.847 1.00 11.84  ? 230  ASN A ND2   1 
ATOM   2538 N  N     . GLY C 3  225 ? 39.682 185.934 16.244 1.00 8.74   ? 231  GLY A N     1 
ATOM   2539 C  CA    . GLY C 3  225 ? 40.231 184.596 16.356 1.00 7.41   ? 231  GLY A CA    1 
ATOM   2540 C  C     . GLY C 3  225 ? 41.464 184.449 15.473 1.00 9.40   ? 231  GLY A C     1 
ATOM   2541 O  O     . GLY C 3  225 ? 41.779 185.327 14.663 1.00 8.50   ? 231  GLY A O     1 
ATOM   2542 N  N     . PHE C 3  226 ? 42.172 183.340 15.627 1.00 9.16   ? 232  PHE A N     1 
ATOM   2543 C  CA    . PHE C 3  226 ? 43.372 183.088 14.839 1.00 10.91  ? 232  PHE A CA    1 
ATOM   2544 C  C     . PHE C 3  226 ? 43.108 181.887 13.928 1.00 11.64  ? 232  PHE A C     1 
ATOM   2545 O  O     . PHE C 3  226 ? 42.898 180.769 14.413 1.00 11.33  ? 232  PHE A O     1 
ATOM   2546 C  CB    . PHE C 3  226 ? 44.545 182.771 15.773 1.00 10.27  ? 232  PHE A CB    1 
ATOM   2547 C  CG    . PHE C 3  226 ? 45.895 183.089 15.197 1.00 11.45  ? 232  PHE A CG    1 
ATOM   2548 C  CD1   . PHE C 3  226 ? 46.202 182.772 13.877 1.00 11.72  ? 232  PHE A CD1   1 
ATOM   2549 C  CD2   . PHE C 3  226 ? 46.877 183.680 15.992 1.00 12.83  ? 232  PHE A CD2   1 
ATOM   2550 C  CE1   . PHE C 3  226 ? 47.465 183.036 13.355 1.00 10.73  ? 232  PHE A CE1   1 
ATOM   2551 C  CE2   . PHE C 3  226 ? 48.148 183.946 15.481 1.00 11.76  ? 232  PHE A CE2   1 
ATOM   2552 C  CZ    . PHE C 3  226 ? 48.441 183.624 14.160 1.00 12.46  ? 232  PHE A CZ    1 
ATOM   2553 N  N     . PRO C 3  227 ? 43.085 182.106 12.599 1.00 11.37  ? 233  PRO A N     1 
ATOM   2554 C  CA    . PRO C 3  227 ? 42.844 181.025 11.631 1.00 11.60  ? 233  PRO A CA    1 
ATOM   2555 C  C     . PRO C 3  227 ? 43.766 179.840 11.933 1.00 12.66  ? 233  PRO A C     1 
ATOM   2556 O  O     . PRO C 3  227 ? 44.993 179.969 11.935 1.00 11.98  ? 233  PRO A O     1 
ATOM   2557 C  CB    . PRO C 3  227 ? 43.142 181.699 10.295 1.00 11.21  ? 233  PRO A CB    1 
ATOM   2558 C  CG    . PRO C 3  227 ? 42.644 183.089 10.537 1.00 9.83   ? 233  PRO A CG    1 
ATOM   2559 C  CD    . PRO C 3  227 ? 43.192 183.406 11.914 1.00 10.19  ? 233  PRO A CD    1 
ATOM   2560 N  N     . PHE C 3  228 ? 43.161 178.683 12.169 1.00 12.81  ? 234  PHE A N     1 
ATOM   2561 C  CA    . PHE C 3  228 ? 43.904 177.493 12.559 1.00 12.48  ? 234  PHE A CA    1 
ATOM   2562 C  C     . PHE C 3  228 ? 43.738 176.311 11.600 1.00 14.34  ? 234  PHE A C     1 
ATOM   2563 O  O     . PHE C 3  228 ? 42.621 175.969 11.210 1.00 16.68  ? 234  PHE A O     1 
ATOM   2564 C  CB    . PHE C 3  228 ? 43.422 177.120 13.963 1.00 10.53  ? 234  PHE A CB    1 
ATOM   2565 C  CG    . PHE C 3  228 ? 44.073 175.912 14.549 1.00 8.02   ? 234  PHE A CG    1 
ATOM   2566 C  CD1   . PHE C 3  228 ? 45.364 175.980 15.058 1.00 8.42   ? 234  PHE A CD1   1 
ATOM   2567 C  CD2   . PHE C 3  228 ? 43.361 174.733 14.683 1.00 6.58   ? 234  PHE A CD2   1 
ATOM   2568 C  CE1   . PHE C 3  228 ? 45.937 174.894 15.703 1.00 8.31   ? 234  PHE A CE1   1 
ATOM   2569 C  CE2   . PHE C 3  228 ? 43.926 173.637 15.329 1.00 10.25  ? 234  PHE A CE2   1 
ATOM   2570 C  CZ    . PHE C 3  228 ? 45.216 173.719 15.842 1.00 9.29   ? 234  PHE A CZ    1 
ATOM   2571 N  N     . ASP C 3  229 ? 44.849 175.677 11.236 1.00 15.09  ? 235  ASP A N     1 
ATOM   2572 C  CA    . ASP C 3  229 ? 44.818 174.528 10.328 1.00 15.41  ? 235  ASP A CA    1 
ATOM   2573 C  C     . ASP C 3  229 ? 44.531 173.222 11.099 1.00 15.66  ? 235  ASP A C     1 
ATOM   2574 O  O     . ASP C 3  229 ? 45.441 172.443 11.393 1.00 15.19  ? 235  ASP A O     1 
ATOM   2575 C  CB    . ASP C 3  229 ? 46.158 174.407 9.591  1.00 16.87  ? 235  ASP A CB    1 
ATOM   2576 C  CG    . ASP C 3  229 ? 46.103 173.434 8.411  1.00 17.84  ? 235  ASP A CG    1 
ATOM   2577 O  OD1   . ASP C 3  229 ? 45.168 172.601 8.342  1.00 14.65  ? 235  ASP A OD1   1 
ATOM   2578 O  OD2   . ASP C 3  229 ? 47.011 173.503 7.552  1.00 17.10  ? 235  ASP A OD2   1 
ATOM   2579 N  N     . THR C 3  230 ? 43.264 172.990 11.417 1.00 15.44  ? 236  THR A N     1 
ATOM   2580 C  CA    . THR C 3  230 ? 42.858 171.795 12.144 1.00 16.38  ? 236  THR A CA    1 
ATOM   2581 C  C     . THR C 3  230 ? 43.406 170.511 11.528 1.00 17.51  ? 236  THR A C     1 
ATOM   2582 O  O     . THR C 3  230 ? 43.920 169.648 12.238 1.00 18.38  ? 236  THR A O     1 
ATOM   2583 C  CB    . THR C 3  230 ? 41.327 171.683 12.195 1.00 17.10  ? 236  THR A CB    1 
ATOM   2584 O  OG1   . THR C 3  230 ? 40.781 172.869 12.788 1.00 18.15  ? 236  THR A OG1   1 
ATOM   2585 C  CG2   . THR C 3  230 ? 40.908 170.474 13.005 1.00 14.89  ? 236  THR A CG2   1 
ATOM   2586 N  N     . LYS C 3  231 ? 43.299 170.385 10.209 1.00 18.40  ? 237  LYS A N     1 
ATOM   2587 C  CA    . LYS C 3  231 ? 43.769 169.186 9.519  1.00 19.74  ? 237  LYS A CA    1 
ATOM   2588 C  C     . LYS C 3  231 ? 45.248 168.901 9.725  1.00 17.44  ? 237  LYS A C     1 
ATOM   2589 O  O     . LYS C 3  231 ? 45.640 167.771 9.975  1.00 18.21  ? 237  LYS A O     1 
ATOM   2590 C  CB    . LYS C 3  231 ? 43.494 169.293 8.019  1.00 24.37  ? 237  LYS A CB    1 
ATOM   2591 C  CG    . LYS C 3  231 ? 42.766 168.095 7.444  1.00 31.29  ? 237  LYS A CG    1 
ATOM   2592 C  CD    . LYS C 3  231 ? 43.556 166.803 7.624  1.00 38.02  ? 237  LYS A CD    1 
ATOM   2593 C  CE    . LYS C 3  231 ? 42.715 165.578 7.257  1.00 41.21  ? 237  LYS A CE    1 
ATOM   2594 N  NZ    . LYS C 3  231 ? 41.525 165.431 8.160  1.00 43.98  ? 237  LYS A NZ    1 
ATOM   2595 N  N     . ALA C 3  232 ? 46.072 169.930 9.610  1.00 16.58  ? 238  ALA A N     1 
ATOM   2596 C  CA    . ALA C 3  232 ? 47.505 169.765 9.773  1.00 15.88  ? 238  ALA A CA    1 
ATOM   2597 C  C     . ALA C 3  232 ? 47.886 169.382 11.191 1.00 17.16  ? 238  ALA A C     1 
ATOM   2598 O  O     . ALA C 3  232 ? 48.863 168.661 11.396 1.00 18.67  ? 238  ALA A O     1 
ATOM   2599 C  CB    . ALA C 3  232 ? 48.228 171.037 9.369  1.00 14.06  ? 238  ALA A CB    1 
ATOM   2600 N  N     . ILE C 3  233 ? 47.127 169.851 12.175 1.00 17.17  ? 239  ILE A N     1 
ATOM   2601 C  CA    . ILE C 3  233 ? 47.463 169.522 13.553 1.00 19.19  ? 239  ILE A CA    1 
ATOM   2602 C  C     . ILE C 3  233 ? 47.004 168.122 13.926 1.00 21.31  ? 239  ILE A C     1 
ATOM   2603 O  O     . ILE C 3  233 ? 47.656 167.447 14.730 1.00 23.26  ? 239  ILE A O     1 
ATOM   2604 C  CB    . ILE C 3  233 ? 46.903 170.579 14.543 1.00 16.48  ? 239  ILE A CB    1 
ATOM   2605 C  CG1   . ILE C 3  233 ? 47.574 171.925 14.269 1.00 14.82  ? 239  ILE A CG1   1 
ATOM   2606 C  CG2   . ILE C 3  233 ? 47.210 170.183 15.977 1.00 11.90  ? 239  ILE A CG2   1 
ATOM   2607 C  CD1   . ILE C 3  233 ? 49.096 171.889 14.372 1.00 10.82  ? 239  ILE A CD1   1 
ATOM   2608 N  N     . GLU C 3  234 ? 45.900 167.672 13.336 1.00 21.54  ? 240  GLU A N     1 
ATOM   2609 C  CA    . GLU C 3  234 ? 45.422 166.325 13.616 1.00 23.13  ? 240  GLU A CA    1 
ATOM   2610 C  C     . GLU C 3  234 ? 46.404 165.325 13.021 1.00 21.70  ? 240  GLU A C     1 
ATOM   2611 O  O     . GLU C 3  234 ? 46.640 164.266 13.598 1.00 21.11  ? 240  GLU A O     1 
ATOM   2612 C  CB    . GLU C 3  234 ? 44.024 166.106 13.034 1.00 25.16  ? 240  GLU A CB    1 
ATOM   2613 C  CG    . GLU C 3  234 ? 42.999 167.040 13.630 1.00 30.49  ? 240  GLU A CG    1 
ATOM   2614 C  CD    . GLU C 3  234 ? 41.586 166.698 13.232 1.00 33.70  ? 240  GLU A CD    1 
ATOM   2615 O  OE1   . GLU C 3  234 ? 41.331 166.556 12.020 1.00 33.70  ? 240  GLU A OE1   1 
ATOM   2616 O  OE2   . GLU C 3  234 ? 40.728 166.582 14.138 1.00 37.66  ? 240  GLU A OE2   1 
ATOM   2617 N  N     . GLU C 3  235 ? 46.984 165.664 11.873 1.00 21.35  ? 241  GLU A N     1 
ATOM   2618 C  CA    . GLU C 3  235 ? 47.953 164.772 11.244 1.00 23.02  ? 241  GLU A CA    1 
ATOM   2619 C  C     . GLU C 3  235 ? 49.215 164.756 12.104 1.00 22.72  ? 241  GLU A C     1 
ATOM   2620 O  O     . GLU C 3  235 ? 49.864 163.719 12.243 1.00 23.78  ? 241  GLU A O     1 
ATOM   2621 C  CB    . GLU C 3  235 ? 48.290 165.234 9.824  1.00 24.00  ? 241  GLU A CB    1 
ATOM   2622 C  CG    . GLU C 3  235 ? 47.088 165.344 8.902  1.00 29.90  ? 241  GLU A CG    1 
ATOM   2623 C  CD    . GLU C 3  235 ? 47.469 165.781 7.494  1.00 33.73  ? 241  GLU A CD    1 
ATOM   2624 O  OE1   . GLU C 3  235 ? 48.317 166.693 7.361  1.00 36.27  ? 241  GLU A OE1   1 
ATOM   2625 O  OE2   . GLU C 3  235 ? 46.913 165.224 6.519  1.00 35.56  ? 241  GLU A OE2   1 
ATOM   2626 N  N     . LEU C 3  236 ? 49.557 165.906 12.683 1.00 20.79  ? 242  LEU A N     1 
ATOM   2627 C  CA    . LEU C 3  236 ? 50.727 166.001 13.552 1.00 19.85  ? 242  LEU A CA    1 
ATOM   2628 C  C     . LEU C 3  236 ? 50.481 165.176 14.814 1.00 19.66  ? 242  LEU A C     1 
ATOM   2629 O  O     . LEU C 3  236 ? 51.395 164.565 15.362 1.00 18.88  ? 242  LEU A O     1 
ATOM   2630 C  CB    . LEU C 3  236 ? 50.992 167.451 13.955 1.00 17.49  ? 242  LEU A CB    1 
ATOM   2631 C  CG    . LEU C 3  236 ? 52.051 167.621 15.051 1.00 17.31  ? 242  LEU A CG    1 
ATOM   2632 C  CD1   . LEU C 3  236 ? 53.421 167.273 14.493 1.00 18.19  ? 242  LEU A CD1   1 
ATOM   2633 C  CD2   . LEU C 3  236 ? 52.034 169.053 15.579 1.00 17.82  ? 242  LEU A CD2   1 
ATOM   2634 N  N     . TYR C 3  237 ? 49.235 165.174 15.274 1.00 18.52  ? 243  TYR A N     1 
ATOM   2635 C  CA    . TYR C 3  237 ? 48.864 164.428 16.464 1.00 19.32  ? 243  TYR A CA    1 
ATOM   2636 C  C     . TYR C 3  237 ? 49.059 162.935 16.218 1.00 19.54  ? 243  TYR A C     1 
ATOM   2637 O  O     . TYR C 3  237 ? 49.547 162.206 17.083 1.00 19.98  ? 243  TYR A O     1 
ATOM   2638 C  CB    . TYR C 3  237 ? 47.407 164.737 16.830 1.00 17.78  ? 243  TYR A CB    1 
ATOM   2639 C  CG    . TYR C 3  237 ? 46.876 163.949 18.001 1.00 17.87  ? 243  TYR A CG    1 
ATOM   2640 C  CD1   . TYR C 3  237 ? 47.698 163.617 19.078 1.00 17.22  ? 243  TYR A CD1   1 
ATOM   2641 C  CD2   . TYR C 3  237 ? 45.538 163.565 18.052 1.00 17.31  ? 243  TYR A CD2   1 
ATOM   2642 C  CE1   . TYR C 3  237 ? 47.200 162.923 20.173 1.00 17.86  ? 243  TYR A CE1   1 
ATOM   2643 C  CE2   . TYR C 3  237 ? 45.028 162.876 19.143 1.00 16.62  ? 243  TYR A CE2   1 
ATOM   2644 C  CZ    . TYR C 3  237 ? 45.864 162.556 20.201 1.00 18.10  ? 243  TYR A CZ    1 
ATOM   2645 O  OH    . TYR C 3  237 ? 45.359 161.878 21.291 1.00 19.98  ? 243  TYR A OH    1 
ATOM   2646 N  N     . VAL C 3  238 ? 48.679 162.489 15.027 1.00 21.24  ? 244  VAL A N     1 
ATOM   2647 C  CA    . VAL C 3  238 ? 48.818 161.089 14.643 1.00 21.95  ? 244  VAL A CA    1 
ATOM   2648 C  C     . VAL C 3  238 ? 50.293 160.697 14.650 1.00 22.76  ? 244  VAL A C     1 
ATOM   2649 O  O     . VAL C 3  238 ? 50.684 159.691 15.252 1.00 23.61  ? 244  VAL A O     1 
ATOM   2650 C  CB    . VAL C 3  238 ? 48.232 160.852 13.234 1.00 22.04  ? 244  VAL A CB    1 
ATOM   2651 C  CG1   . VAL C 3  238 ? 48.574 159.448 12.744 1.00 21.02  ? 244  VAL A CG1   1 
ATOM   2652 C  CG2   . VAL C 3  238 ? 46.721 161.056 13.269 1.00 20.16  ? 244  VAL A CG2   1 
ATOM   2653 N  N     . GLU C 3  239 ? 51.108 161.500 13.977 1.00 22.00  ? 245  GLU A N     1 
ATOM   2654 C  CA    . GLU C 3  239 ? 52.537 161.250 13.912 1.00 23.59  ? 245  GLU A CA    1 
ATOM   2655 C  C     . GLU C 3  239 ? 53.149 161.212 15.309 1.00 24.00  ? 245  GLU A C     1 
ATOM   2656 O  O     . GLU C 3  239 ? 53.927 160.310 15.626 1.00 24.94  ? 245  GLU A O     1 
ATOM   2657 C  CB    . GLU C 3  239 ? 53.218 162.326 13.061 1.00 24.30  ? 245  GLU A CB    1 
ATOM   2658 C  CG    . GLU C 3  239 ? 54.664 162.589 13.440 1.00 27.27  ? 245  GLU A CG    1 
ATOM   2659 C  CD    . GLU C 3  239 ? 55.347 163.588 12.523 1.00 31.13  ? 245  GLU A CD    1 
ATOM   2660 O  OE1   . GLU C 3  239 ? 54.663 164.491 11.985 1.00 33.54  ? 245  GLU A OE1   1 
ATOM   2661 O  OE2   . GLU C 3  239 ? 56.580 163.478 12.354 1.00 33.34  ? 245  GLU A OE2   1 
ATOM   2662 N  N     . LEU C 3  240 ? 52.795 162.187 16.142 1.00 23.33  ? 246  LEU A N     1 
ATOM   2663 C  CA    . LEU C 3  240 ? 53.313 162.248 17.510 1.00 23.28  ? 246  LEU A CA    1 
ATOM   2664 C  C     . LEU C 3  240 ? 52.842 161.053 18.332 1.00 22.73  ? 246  LEU A C     1 
ATOM   2665 O  O     . LEU C 3  240 ? 53.620 160.455 19.066 1.00 23.26  ? 246  LEU A O     1 
ATOM   2666 C  CB    . LEU C 3  240 ? 52.874 163.548 18.194 1.00 21.15  ? 246  LEU A CB    1 
ATOM   2667 C  CG    . LEU C 3  240 ? 53.384 164.830 17.528 1.00 20.49  ? 246  LEU A CG    1 
ATOM   2668 C  CD1   . LEU C 3  240 ? 52.752 166.037 18.175 1.00 20.45  ? 246  LEU A CD1   1 
ATOM   2669 C  CD2   . LEU C 3  240 ? 54.892 164.894 17.629 1.00 20.44  ? 246  LEU A CD2   1 
ATOM   2670 N  N     . ALA C 3  241 ? 51.566 160.704 18.207 1.00 23.05  ? 247  ALA A N     1 
ATOM   2671 C  CA    . ALA C 3  241 ? 51.022 159.572 18.950 1.00 23.15  ? 247  ALA A CA    1 
ATOM   2672 C  C     . ALA C 3  241 ? 51.750 158.273 18.591 1.00 22.85  ? 247  ALA A C     1 
ATOM   2673 O  O     . ALA C 3  241 ? 52.011 157.432 19.453 1.00 22.85  ? 247  ALA A O     1 
ATOM   2674 C  CB    . ALA C 3  241 ? 49.532 159.436 18.671 1.00 22.28  ? 247  ALA A CB    1 
ATOM   2675 N  N     . ALA C 3  242 ? 52.076 158.115 17.314 1.00 22.94  ? 248  ALA A N     1 
ATOM   2676 C  CA    . ALA C 3  242 ? 52.778 156.921 16.854 1.00 24.26  ? 248  ALA A CA    1 
ATOM   2677 C  C     . ALA C 3  242 ? 54.175 156.884 17.459 1.00 23.40  ? 248  ALA A C     1 
ATOM   2678 O  O     . ALA C 3  242 ? 54.636 155.843 17.936 1.00 23.56  ? 248  ALA A O     1 
ATOM   2679 C  CB    . ALA C 3  242 ? 52.873 156.915 15.331 1.00 22.74  ? 248  ALA A CB    1 
ATOM   2680 N  N     . ARG C 3  243 ? 54.845 158.028 17.438 1.00 22.33  ? 249  ARG A N     1 
ATOM   2681 C  CA    . ARG C 3  243 ? 56.185 158.110 17.982 1.00 22.84  ? 249  ARG A CA    1 
ATOM   2682 C  C     . ARG C 3  243 ? 56.165 157.853 19.479 1.00 22.63  ? 249  ARG A C     1 
ATOM   2683 O  O     . ARG C 3  243 ? 57.080 157.233 20.019 1.00 23.37  ? 249  ARG A O     1 
ATOM   2684 C  CB    . ARG C 3  243 ? 56.795 159.477 17.689 1.00 22.84  ? 249  ARG A CB    1 
ATOM   2685 C  CG    . ARG C 3  243 ? 58.243 159.601 18.120 1.00 25.24  ? 249  ARG A CG    1 
ATOM   2686 C  CD    . ARG C 3  243 ? 59.092 158.448 17.587 1.00 23.86  ? 249  ARG A CD    1 
ATOM   2687 N  NE    . ARG C 3  243 ? 60.487 158.591 17.996 1.00 23.10  ? 249  ARG A NE    1 
ATOM   2688 C  CZ    . ARG C 3  243 ? 61.413 157.650 17.854 1.00 22.76  ? 249  ARG A CZ    1 
ATOM   2689 N  NH1   . ARG C 3  243 ? 61.103 156.479 17.309 1.00 20.01  ? 249  ARG A NH1   1 
ATOM   2690 N  NH2   . ARG C 3  243 ? 62.651 157.880 18.266 1.00 20.82  ? 249  ARG A NH2   1 
ATOM   2691 N  N     . ARG C 3  244 ? 55.119 158.321 20.153 1.00 22.12  ? 250  ARG A N     1 
ATOM   2692 C  CA    . ARG C 3  244 ? 55.014 158.103 21.585 1.00 22.17  ? 250  ARG A CA    1 
ATOM   2693 C  C     . ARG C 3  244 ? 54.832 156.614 21.854 1.00 22.64  ? 250  ARG A C     1 
ATOM   2694 O  O     . ARG C 3  244 ? 55.476 156.067 22.745 1.00 23.83  ? 250  ARG A O     1 
ATOM   2695 C  CB    . ARG C 3  244 ? 53.842 158.887 22.185 1.00 20.22  ? 250  ARG A CB    1 
ATOM   2696 C  CG    . ARG C 3  244 ? 53.674 158.660 23.684 1.00 17.03  ? 250  ARG A CG    1 
ATOM   2697 C  CD    . ARG C 3  244 ? 52.562 159.512 24.269 1.00 19.25  ? 250  ARG A CD    1 
ATOM   2698 N  NE    . ARG C 3  244 ? 51.271 159.251 23.645 1.00 19.16  ? 250  ARG A NE    1 
ATOM   2699 C  CZ    . ARG C 3  244 ? 50.185 160.001 23.820 1.00 20.20  ? 250  ARG A CZ    1 
ATOM   2700 N  NH1   . ARG C 3  244 ? 50.226 161.070 24.607 1.00 19.19  ? 250  ARG A NH1   1 
ATOM   2701 N  NH2   . ARG C 3  244 ? 49.056 159.686 23.197 1.00 17.98  ? 250  ARG A NH2   1 
ATOM   2702 N  N     . SER C 3  245 ? 53.956 155.965 21.087 1.00 21.92  ? 251  SER A N     1 
ATOM   2703 C  CA    . SER C 3  245 ? 53.710 154.531 21.249 1.00 23.50  ? 251  SER A CA    1 
ATOM   2704 C  C     . SER C 3  245 ? 54.984 153.715 21.107 1.00 22.28  ? 251  SER A C     1 
ATOM   2705 O  O     . SER C 3  245 ? 55.254 152.826 21.914 1.00 22.36  ? 251  SER A O     1 
ATOM   2706 C  CB    . SER C 3  245 ? 52.703 154.021 20.215 1.00 24.29  ? 251  SER A CB    1 
ATOM   2707 O  OG    . SER C 3  245 ? 51.391 154.451 20.518 1.00 29.64  ? 251  SER A OG    1 
ATOM   2708 N  N     . GLU C 3  246 ? 55.759 154.014 20.073 1.00 20.86  ? 252  GLU A N     1 
ATOM   2709 C  CA    . GLU C 3  246 ? 56.996 153.291 19.825 1.00 22.44  ? 252  GLU A CA    1 
ATOM   2710 C  C     . GLU C 3  246 ? 57.976 153.499 20.970 1.00 22.39  ? 252  GLU A C     1 
ATOM   2711 O  O     . GLU C 3  246 ? 58.644 152.553 21.399 1.00 23.17  ? 252  GLU A O     1 
ATOM   2712 C  CB    . GLU C 3  246 ? 57.612 153.733 18.489 1.00 22.24  ? 252  GLU A CB    1 
ATOM   2713 C  CG    . GLU C 3  246 ? 58.920 153.038 18.088 1.00 25.45  ? 252  GLU A CG    1 
ATOM   2714 C  CD    . GLU C 3  246 ? 58.839 151.505 18.040 1.00 28.03  ? 252  GLU A CD    1 
ATOM   2715 O  OE1   . GLU C 3  246 ? 57.749 150.945 17.776 1.00 27.25  ? 252  GLU A OE1   1 
ATOM   2716 O  OE2   . GLU C 3  246 ? 59.889 150.859 18.248 1.00 27.97  ? 252  GLU A OE2   1 
ATOM   2717 N  N     . LEU C 3  247 ? 58.057 154.726 21.479 1.00 21.16  ? 253  LEU A N     1 
ATOM   2718 C  CA    . LEU C 3  247 ? 58.966 154.997 22.584 1.00 21.86  ? 253  LEU A CA    1 
ATOM   2719 C  C     . LEU C 3  247 ? 58.521 154.243 23.827 1.00 21.67  ? 253  LEU A C     1 
ATOM   2720 O  O     . LEU C 3  247 ? 59.345 153.679 24.552 1.00 22.03  ? 253  LEU A O     1 
ATOM   2721 C  CB    . LEU C 3  247 ? 59.030 156.489 22.878 1.00 21.07  ? 253  LEU A CB    1 
ATOM   2722 C  CG    . LEU C 3  247 ? 59.688 157.297 21.768 1.00 21.75  ? 253  LEU A CG    1 
ATOM   2723 C  CD1   . LEU C 3  247 ? 59.517 158.779 22.050 1.00 21.44  ? 253  LEU A CD1   1 
ATOM   2724 C  CD2   . LEU C 3  247 ? 61.155 156.918 21.667 1.00 23.48  ? 253  LEU A CD2   1 
ATOM   2725 N  N     . LEU C 3  248 ? 57.216 154.228 24.071 1.00 20.34  ? 254  LEU A N     1 
ATOM   2726 C  CA    . LEU C 3  248 ? 56.680 153.522 25.225 1.00 21.21  ? 254  LEU A CA    1 
ATOM   2727 C  C     . LEU C 3  248 ? 57.011 152.037 25.103 1.00 22.96  ? 254  LEU A C     1 
ATOM   2728 O  O     . LEU C 3  248 ? 57.453 151.407 26.064 1.00 22.16  ? 254  LEU A O     1 
ATOM   2729 C  CB    . LEU C 3  248 ? 55.166 153.708 25.305 1.00 18.89  ? 254  LEU A CB    1 
ATOM   2730 C  CG    . LEU C 3  248 ? 54.524 153.109 26.558 1.00 17.55  ? 254  LEU A CG    1 
ATOM   2731 C  CD1   . LEU C 3  248 ? 55.070 153.807 27.791 1.00 17.21  ? 254  LEU A CD1   1 
ATOM   2732 C  CD2   . LEU C 3  248 ? 53.014 153.255 26.489 1.00 12.87  ? 254  LEU A CD2   1 
ATOM   2733 N  N     . ARG C 3  249 ? 56.803 151.495 23.905 1.00 23.98  ? 255  ARG A N     1 
ATOM   2734 C  CA    . ARG C 3  249 ? 57.076 150.091 23.625 1.00 25.02  ? 255  ARG A CA    1 
ATOM   2735 C  C     . ARG C 3  249 ? 58.522 149.746 23.964 1.00 25.18  ? 255  ARG A C     1 
ATOM   2736 O  O     . ARG C 3  249 ? 58.787 148.797 24.699 1.00 25.24  ? 255  ARG A O     1 
ATOM   2737 C  CB    . ARG C 3  249 ? 56.815 149.785 22.142 1.00 25.36  ? 255  ARG A CB    1 
ATOM   2738 C  CG    . ARG C 3  249 ? 56.761 148.292 21.806 1.00 24.76  ? 255  ARG A CG    1 
ATOM   2739 C  CD    . ARG C 3  249 ? 56.710 148.045 20.301 1.00 26.76  ? 255  ARG A CD    1 
ATOM   2740 N  NE    . ARG C 3  249 ? 57.968 148.420 19.661 1.00 30.27  ? 255  ARG A NE    1 
ATOM   2741 C  CZ    . ARG C 3  249 ? 59.108 147.748 19.804 1.00 30.43  ? 255  ARG A CZ    1 
ATOM   2742 N  NH1   . ARG C 3  249 ? 59.145 146.657 20.557 1.00 31.05  ? 255  ARG A NH1   1 
ATOM   2743 N  NH2   . ARG C 3  249 ? 60.217 148.180 19.215 1.00 29.77  ? 255  ARG A NH2   1 
ATOM   2744 N  N     . LYS C 3  250 ? 59.456 150.514 23.417 1.00 26.12  ? 256  LYS A N     1 
ATOM   2745 C  CA    . LYS C 3  250 ? 60.865 150.271 23.670 1.00 26.78  ? 256  LYS A CA    1 
ATOM   2746 C  C     . LYS C 3  250 ? 61.217 150.475 25.133 1.00 27.28  ? 256  LYS A C     1 
ATOM   2747 O  O     . LYS C 3  250 ? 61.879 149.634 25.741 1.00 27.25  ? 256  LYS A O     1 
ATOM   2748 C  CB    . LYS C 3  250 ? 61.733 151.177 22.798 1.00 26.89  ? 256  LYS A CB    1 
ATOM   2749 C  CG    . LYS C 3  250 ? 61.795 150.741 21.341 1.00 31.76  ? 256  LYS A CG    1 
ATOM   2750 C  CD    . LYS C 3  250 ? 62.919 151.443 20.589 1.00 35.02  ? 256  LYS A CD    1 
ATOM   2751 C  CE    . LYS C 3  250 ? 63.132 150.832 19.209 1.00 37.19  ? 256  LYS A CE    1 
ATOM   2752 N  NZ    . LYS C 3  250 ? 63.482 149.383 19.283 1.00 39.11  ? 256  LYS A NZ    1 
ATOM   2753 N  N     . LEU C 3  251 ? 60.770 151.587 25.702 1.00 27.95  ? 257  LEU A N     1 
ATOM   2754 C  CA    . LEU C 3  251 ? 61.064 151.873 27.096 1.00 28.56  ? 257  LEU A CA    1 
ATOM   2755 C  C     . LEU C 3  251 ? 60.518 150.816 28.049 1.00 30.70  ? 257  LEU A C     1 
ATOM   2756 O  O     . LEU C 3  251 ? 61.197 150.439 29.008 1.00 29.84  ? 257  LEU A O     1 
ATOM   2757 C  CB    . LEU C 3  251 ? 60.530 153.254 27.489 1.00 27.47  ? 257  LEU A CB    1 
ATOM   2758 C  CG    . LEU C 3  251 ? 61.375 154.447 27.029 1.00 28.61  ? 257  LEU A CG    1 
ATOM   2759 C  CD1   . LEU C 3  251 ? 60.767 155.737 27.557 1.00 26.08  ? 257  LEU A CD1   1 
ATOM   2760 C  CD2   . LEU C 3  251 ? 62.811 154.296 27.528 1.00 26.07  ? 257  LEU A CD2   1 
ATOM   2761 N  N     . THR C 3  252 ? 59.300 150.340 27.794 1.00 31.90  ? 258  THR A N     1 
ATOM   2762 C  CA    . THR C 3  252 ? 58.711 149.333 28.665 1.00 34.85  ? 258  THR A CA    1 
ATOM   2763 C  C     . THR C 3  252 ? 59.394 147.988 28.494 1.00 35.78  ? 258  THR A C     1 
ATOM   2764 O  O     . THR C 3  252 ? 59.250 147.104 29.334 1.00 36.81  ? 258  THR A O     1 
ATOM   2765 C  CB    . THR C 3  252 ? 57.190 149.173 28.433 1.00 35.15  ? 258  THR A CB    1 
ATOM   2766 O  OG1   . THR C 3  252 ? 56.917 149.060 27.035 1.00 38.28  ? 258  THR A OG1   1 
ATOM   2767 C  CG2   . THR C 3  252 ? 56.442 150.365 29.000 1.00 35.53  ? 258  THR A CG2   1 
ATOM   2768 N  N     . GLU C 3  253 ? 60.148 147.836 27.412 1.00 36.92  ? 259  GLU A N     1 
ATOM   2769 C  CA    . GLU C 3  253 ? 60.865 146.589 27.170 1.00 37.81  ? 259  GLU A CA    1 
ATOM   2770 C  C     . GLU C 3  253 ? 62.160 146.662 27.963 1.00 36.07  ? 259  GLU A C     1 
ATOM   2771 O  O     . GLU C 3  253 ? 62.625 145.670 28.518 1.00 35.28  ? 259  GLU A O     1 
ATOM   2772 C  CB    . GLU C 3  253 ? 61.156 146.434 25.675 1.00 42.14  ? 259  GLU A CB    1 
ATOM   2773 C  CG    . GLU C 3  253 ? 61.898 145.162 25.280 1.00 50.45  ? 259  GLU A CG    1 
ATOM   2774 C  CD    . GLU C 3  253 ? 63.409 145.273 25.452 1.00 55.61  ? 259  GLU A CD    1 
ATOM   2775 O  OE1   . GLU C 3  253 ? 63.997 146.233 24.901 1.00 57.81  ? 259  GLU A OE1   1 
ATOM   2776 O  OE2   . GLU C 3  253 ? 64.008 144.399 26.125 1.00 57.93  ? 259  GLU A OE2   1 
ATOM   2777 N  N     . THR C 3  254 ? 62.722 147.863 28.026 1.00 34.21  ? 260  THR A N     1 
ATOM   2778 C  CA    . THR C 3  254 ? 63.964 148.106 28.746 1.00 31.09  ? 260  THR A CA    1 
ATOM   2779 C  C     . THR C 3  254 ? 63.739 148.142 30.250 1.00 30.36  ? 260  THR A C     1 
ATOM   2780 O  O     . THR C 3  254 ? 64.510 147.566 31.020 1.00 29.01  ? 260  THR A O     1 
ATOM   2781 C  CB    . THR C 3  254 ? 64.587 149.443 28.319 1.00 30.45  ? 260  THR A CB    1 
ATOM   2782 O  OG1   . THR C 3  254 ? 65.047 149.342 26.966 1.00 28.49  ? 260  THR A OG1   1 
ATOM   2783 C  CG2   . THR C 3  254 ? 65.745 149.814 29.236 1.00 28.50  ? 260  THR A CG2   1 
ATOM   2784 N  N     . PHE C 3  255 ? 62.681 148.831 30.659 1.00 27.85  ? 261  PHE A N     1 
ATOM   2785 C  CA    . PHE C 3  255 ? 62.352 148.960 32.068 1.00 27.26  ? 261  PHE A CA    1 
ATOM   2786 C  C     . PHE C 3  255 ? 61.096 148.158 32.386 1.00 28.57  ? 261  PHE A C     1 
ATOM   2787 O  O     . PHE C 3  255 ? 59.988 148.517 31.983 1.00 31.26  ? 261  PHE A O     1 
ATOM   2788 C  CB    . PHE C 3  255 ? 62.170 150.441 32.413 1.00 24.56  ? 261  PHE A CB    1 
ATOM   2789 C  CG    . PHE C 3  255 ? 63.411 151.267 32.190 1.00 22.99  ? 261  PHE A CG    1 
ATOM   2790 C  CD1   . PHE C 3  255 ? 64.565 151.032 32.935 1.00 22.34  ? 261  PHE A CD1   1 
ATOM   2791 C  CD2   . PHE C 3  255 ? 63.438 152.266 31.221 1.00 22.41  ? 261  PHE A CD2   1 
ATOM   2792 C  CE1   . PHE C 3  255 ? 65.729 151.781 32.714 1.00 22.00  ? 261  PHE A CE1   1 
ATOM   2793 C  CE2   . PHE C 3  255 ? 64.599 153.019 30.992 1.00 19.67  ? 261  PHE A CE2   1 
ATOM   2794 C  CZ    . PHE C 3  255 ? 65.743 152.775 31.739 1.00 19.72  ? 261  PHE A CZ    1 
ATOM   2795 N  N     . GLY C 3  256 ? 61.278 147.061 33.113 1.00 28.21  ? 262  GLY A N     1 
ATOM   2796 C  CA    . GLY C 3  256 ? 60.158 146.205 33.452 1.00 28.34  ? 262  GLY A CA    1 
ATOM   2797 C  C     . GLY C 3  256 ? 59.203 146.752 34.489 1.00 27.98  ? 262  GLY A C     1 
ATOM   2798 O  O     . GLY C 3  256 ? 59.522 147.691 35.213 1.00 29.99  ? 262  GLY A O     1 
ATOM   2799 N  N     . SER C 3  257 ? 58.022 146.151 34.557 1.00 27.67  ? 263  SER A N     1 
ATOM   2800 C  CA    . SER C 3  257 ? 56.998 146.548 35.507 1.00 26.81  ? 263  SER A CA    1 
ATOM   2801 C  C     . SER C 3  257 ? 57.351 145.999 36.884 1.00 26.84  ? 263  SER A C     1 
ATOM   2802 O  O     . SER C 3  257 ? 58.211 145.136 37.001 1.00 25.58  ? 263  SER A O     1 
ATOM   2803 C  CB    . SER C 3  257 ? 55.650 145.997 35.058 1.00 27.48  ? 263  SER A CB    1 
ATOM   2804 O  OG    . SER C 3  257 ? 55.724 144.593 34.881 1.00 31.34  ? 263  SER A OG    1 
ATOM   2805 N  N     . TRP C 3  258 ? 56.690 146.498 37.924 1.00 27.36  ? 264  TRP A N     1 
ATOM   2806 C  CA    . TRP C 3  258 ? 56.960 146.038 39.281 1.00 27.28  ? 264  TRP A CA    1 
ATOM   2807 C  C     . TRP C 3  258 ? 55.726 146.196 40.163 1.00 27.89  ? 264  TRP A C     1 
ATOM   2808 O  O     . TRP C 3  258 ? 54.734 146.793 39.746 1.00 29.16  ? 264  TRP A O     1 
ATOM   2809 C  CB    . TRP C 3  258 ? 58.132 146.829 39.873 1.00 27.41  ? 264  TRP A CB    1 
ATOM   2810 C  CG    . TRP C 3  258 ? 57.851 148.297 40.060 1.00 29.26  ? 264  TRP A CG    1 
ATOM   2811 C  CD1   . TRP C 3  258 ? 57.415 148.912 41.203 1.00 28.36  ? 264  TRP A CD1   1 
ATOM   2812 C  CD2   . TRP C 3  258 ? 57.954 149.328 39.067 1.00 28.21  ? 264  TRP A CD2   1 
ATOM   2813 N  NE1   . TRP C 3  258 ? 57.239 150.256 40.981 1.00 28.04  ? 264  TRP A NE1   1 
ATOM   2814 C  CE2   . TRP C 3  258 ? 57.562 150.539 39.680 1.00 27.69  ? 264  TRP A CE2   1 
ATOM   2815 C  CE3   . TRP C 3  258 ? 58.336 149.345 37.718 1.00 27.71  ? 264  TRP A CE3   1 
ATOM   2816 C  CZ2   . TRP C 3  258 ? 57.542 151.757 38.990 1.00 28.02  ? 264  TRP A CZ2   1 
ATOM   2817 C  CZ3   . TRP C 3  258 ? 58.315 150.558 37.030 1.00 26.60  ? 264  TRP A CZ3   1 
ATOM   2818 C  CH2   . TRP C 3  258 ? 57.920 151.746 37.669 1.00 26.67  ? 264  TRP A CH2   1 
ATOM   2819 N  N     . TYR C 3  259 ? 55.779 145.646 41.373 1.00 27.52  ? 265  TYR A N     1 
ATOM   2820 C  CA    . TYR C 3  259 ? 54.658 145.757 42.301 1.00 26.85  ? 265  TYR A CA    1 
ATOM   2821 C  C     . TYR C 3  259 ? 54.964 146.729 43.426 1.00 27.38  ? 265  TYR A C     1 
ATOM   2822 O  O     . TYR C 3  259 ? 56.092 146.815 43.907 1.00 26.02  ? 265  TYR A O     1 
ATOM   2823 C  CB    . TYR C 3  259 ? 54.300 144.405 42.916 1.00 25.35  ? 265  TYR A CB    1 
ATOM   2824 C  CG    . TYR C 3  259 ? 53.647 143.440 41.968 1.00 26.33  ? 265  TYR A CG    1 
ATOM   2825 C  CD1   . TYR C 3  259 ? 54.413 142.665 41.093 1.00 26.45  ? 265  TYR A CD1   1 
ATOM   2826 C  CD2   . TYR C 3  259 ? 52.260 143.291 41.945 1.00 24.54  ? 265  TYR A CD2   1 
ATOM   2827 C  CE1   . TYR C 3  259 ? 53.815 141.762 40.220 1.00 25.10  ? 265  TYR A CE1   1 
ATOM   2828 C  CE2   . TYR C 3  259 ? 51.651 142.396 41.078 1.00 25.74  ? 265  TYR A CE2   1 
ATOM   2829 C  CZ    . TYR C 3  259 ? 52.433 141.632 40.217 1.00 26.95  ? 265  TYR A CZ    1 
ATOM   2830 O  OH    . TYR C 3  259 ? 51.836 140.744 39.352 1.00 28.79  ? 265  TYR A OH    1 
ATOM   2831 N  N     . GLN C 3  260 ? 53.942 147.459 43.842 1.00 28.86  ? 266  GLN A N     1 
ATOM   2832 C  CA    . GLN C 3  260 ? 54.078 148.424 44.920 1.00 31.62  ? 266  GLN A CA    1 
ATOM   2833 C  C     . GLN C 3  260 ? 52.930 148.184 45.868 1.00 31.32  ? 266  GLN A C     1 
ATOM   2834 O  O     . GLN C 3  260 ? 51.853 147.756 45.453 1.00 31.85  ? 266  GLN A O     1 
ATOM   2835 C  CB    . GLN C 3  260 ? 53.983 149.867 44.399 1.00 32.56  ? 266  GLN A CB    1 
ATOM   2836 C  CG    . GLN C 3  260 ? 55.220 150.402 43.686 1.00 36.59  ? 266  GLN A CG    1 
ATOM   2837 C  CD    . GLN C 3  260 ? 55.043 151.843 43.209 1.00 38.53  ? 266  GLN A CD    1 
ATOM   2838 O  OE1   . GLN C 3  260 ? 55.976 152.458 42.679 1.00 36.27  ? 266  GLN A OE1   1 
ATOM   2839 N  NE2   . GLN C 3  260 ? 53.837 152.385 43.394 1.00 40.12  ? 266  GLN A NE2   1 
ATOM   2840 N  N     . PRO C 3  261 ? 53.147 148.435 47.162 1.00 32.16  ? 267  PRO A N     1 
ATOM   2841 C  CA    . PRO C 3  261 ? 52.063 148.232 48.123 1.00 32.24  ? 267  PRO A CA    1 
ATOM   2842 C  C     . PRO C 3  261 ? 51.027 149.326 47.885 1.00 32.93  ? 267  PRO A C     1 
ATOM   2843 O  O     . PRO C 3  261 ? 51.376 150.461 47.560 1.00 30.99  ? 267  PRO A O     1 
ATOM   2844 C  CB    . PRO C 3  261 ? 52.769 148.363 49.470 1.00 31.74  ? 267  PRO A CB    1 
ATOM   2845 C  CG    . PRO C 3  261 ? 53.895 149.314 49.168 1.00 31.87  ? 267  PRO A CG    1 
ATOM   2846 C  CD    . PRO C 3  261 ? 54.397 148.830 47.836 1.00 30.75  ? 267  PRO A CD    1 
ATOM   2847 N  N     . LYS C 3  262 ? 49.756 148.977 48.023 1.00 35.66  ? 268  LYS A N     1 
ATOM   2848 C  CA    . LYS C 3  262 ? 48.680 149.932 47.814 1.00 39.04  ? 268  LYS A CA    1 
ATOM   2849 C  C     . LYS C 3  262 ? 47.371 149.387 48.374 1.00 40.20  ? 268  LYS A C     1 
ATOM   2850 O  O     . LYS C 3  262 ? 46.961 148.277 48.043 1.00 41.22  ? 268  LYS A O     1 
ATOM   2851 C  CB    . LYS C 3  262 ? 48.526 150.224 46.315 1.00 41.02  ? 268  LYS A CB    1 
ATOM   2852 C  CG    . LYS C 3  262 ? 47.263 150.999 45.943 1.00 44.40  ? 268  LYS A CG    1 
ATOM   2853 C  CD    . LYS C 3  262 ? 47.253 152.406 46.540 1.00 47.93  ? 268  LYS A CD    1 
ATOM   2854 C  CE    . LYS C 3  262 ? 48.025 153.402 45.677 1.00 49.81  ? 268  LYS A CE    1 
ATOM   2855 N  NZ    . LYS C 3  262 ? 47.336 153.683 44.378 1.00 50.48  ? 268  LYS A NZ    1 
ATOM   2856 N  N     . GLY C 3  263 ? 46.721 150.165 49.233 1.00 41.52  ? 269  GLY A N     1 
ATOM   2857 C  CA    . GLY C 3  263 ? 45.460 149.722 49.798 1.00 42.49  ? 269  GLY A CA    1 
ATOM   2858 C  C     . GLY C 3  263 ? 45.552 149.266 51.238 1.00 43.31  ? 269  GLY A C     1 
ATOM   2859 O  O     . GLY C 3  263 ? 44.534 148.941 51.851 1.00 44.12  ? 269  GLY A O     1 
ATOM   2860 N  N     . GLY C 3  264 ? 46.767 149.243 51.779 1.00 43.65  ? 270  GLY A N     1 
ATOM   2861 C  CA    . GLY C 3  264 ? 46.959 148.824 53.157 1.00 44.13  ? 270  GLY A CA    1 
ATOM   2862 C  C     . GLY C 3  264 ? 46.338 149.800 54.135 1.00 43.71  ? 270  GLY A C     1 
ATOM   2863 O  O     . GLY C 3  264 ? 46.461 151.009 53.969 1.00 42.94  ? 270  GLY A O     1 
ATOM   2864 N  N     . THR C 3  265 ? 45.674 149.275 55.158 1.00 44.73  ? 271  THR A N     1 
ATOM   2865 C  CA    . THR C 3  265 ? 45.018 150.110 56.160 1.00 46.11  ? 271  THR A CA    1 
ATOM   2866 C  C     . THR C 3  265 ? 45.635 149.967 57.548 1.00 46.92  ? 271  THR A C     1 
ATOM   2867 O  O     . THR C 3  265 ? 45.886 150.961 58.230 1.00 47.25  ? 271  THR A O     1 
ATOM   2868 C  CB    . THR C 3  265 ? 43.525 149.765 56.261 1.00 46.48  ? 271  THR A CB    1 
ATOM   2869 O  OG1   . THR C 3  265 ? 43.378 148.357 56.488 1.00 47.78  ? 271  THR A OG1   1 
ATOM   2870 C  CG2   . THR C 3  265 ? 42.800 150.149 54.980 1.00 46.81  ? 271  THR A CG2   1 
ATOM   2871 N  N     . GLU C 3  266 ? 45.878 148.729 57.965 1.00 47.52  ? 272  GLU A N     1 
ATOM   2872 C  CA    . GLU C 3  266 ? 46.452 148.471 59.279 1.00 47.40  ? 272  GLU A CA    1 
ATOM   2873 C  C     . GLU C 3  266 ? 47.958 148.693 59.297 1.00 46.37  ? 272  GLU A C     1 
ATOM   2874 O  O     . GLU C 3  266 ? 48.612 148.725 58.258 1.00 45.97  ? 272  GLU A O     1 
ATOM   2875 C  CB    . GLU C 3  266 ? 46.164 147.035 59.707 1.00 48.48  ? 272  GLU A CB    1 
ATOM   2876 C  CG    . GLU C 3  266 ? 44.795 146.532 59.302 1.00 51.47  ? 272  GLU A CG    1 
ATOM   2877 C  CD    . GLU C 3  266 ? 44.608 145.057 59.601 1.00 52.86  ? 272  GLU A CD    1 
ATOM   2878 O  OE1   . GLU C 3  266 ? 43.670 144.456 59.032 1.00 54.73  ? 272  GLU A OE1   1 
ATOM   2879 O  OE2   . GLU C 3  266 ? 45.393 144.506 60.407 1.00 52.06  ? 272  GLU A OE2   1 
ATOM   2880 N  N     . MET C 3  267 ? 48.492 148.841 60.500 1.00 45.89  ? 273  MET A N     1 
ATOM   2881 C  CA    . MET C 3  267 ? 49.917 149.042 60.714 1.00 44.98  ? 273  MET A CA    1 
ATOM   2882 C  C     . MET C 3  267 ? 50.557 147.680 60.956 1.00 43.88  ? 273  MET A C     1 
ATOM   2883 O  O     . MET C 3  267 ? 50.000 146.853 61.679 1.00 43.20  ? 273  MET A O     1 
ATOM   2884 C  CB    . MET C 3  267 ? 50.123 149.923 61.945 1.00 46.69  ? 273  MET A CB    1 
ATOM   2885 C  CG    . MET C 3  267 ? 51.521 149.891 62.524 1.00 48.56  ? 273  MET A CG    1 
ATOM   2886 S  SD    . MET C 3  267 ? 52.693 150.763 61.483 1.00 54.70  ? 273  MET A SD    1 
ATOM   2887 C  CE    . MET C 3  267 ? 52.349 152.458 61.959 1.00 53.16  ? 273  MET A CE    1 
ATOM   2888 N  N     . PHE C 3  268 ? 51.716 147.439 60.353 1.00 42.24  ? 274  PHE A N     1 
ATOM   2889 C  CA    . PHE C 3  268 ? 52.399 146.171 60.563 1.00 41.72  ? 274  PHE A CA    1 
ATOM   2890 C  C     . PHE C 3  268 ? 53.199 146.264 61.858 1.00 41.82  ? 274  PHE A C     1 
ATOM   2891 O  O     . PHE C 3  268 ? 53.960 147.213 62.068 1.00 39.93  ? 274  PHE A O     1 
ATOM   2892 C  CB    . PHE C 3  268 ? 53.344 145.847 59.407 1.00 40.84  ? 274  PHE A CB    1 
ATOM   2893 C  CG    . PHE C 3  268 ? 54.057 144.533 59.566 1.00 39.09  ? 274  PHE A CG    1 
ATOM   2894 C  CD1   . PHE C 3  268 ? 53.378 143.331 59.387 1.00 38.76  ? 274  PHE A CD1   1 
ATOM   2895 C  CD2   . PHE C 3  268 ? 55.401 144.494 59.938 1.00 39.78  ? 274  PHE A CD2   1 
ATOM   2896 C  CE1   . PHE C 3  268 ? 54.025 142.103 59.577 1.00 38.13  ? 274  PHE A CE1   1 
ATOM   2897 C  CE2   . PHE C 3  268 ? 56.059 143.272 60.131 1.00 38.82  ? 274  PHE A CE2   1 
ATOM   2898 C  CZ    . PHE C 3  268 ? 55.367 142.076 59.951 1.00 37.34  ? 274  PHE A CZ    1 
ATOM   2899 N  N     . CYS C 3  269 ? 53.021 145.272 62.723 1.00 42.26  ? 275  CYS A N     1 
ATOM   2900 C  CA    . CYS C 3  269 ? 53.713 145.240 64.004 1.00 44.29  ? 275  CYS A CA    1 
ATOM   2901 C  C     . CYS C 3  269 ? 54.558 143.981 64.148 1.00 44.72  ? 275  CYS A C     1 
ATOM   2902 O  O     . CYS C 3  269 ? 54.218 142.931 63.601 1.00 44.75  ? 275  CYS A O     1 
ATOM   2903 C  CB    . CYS C 3  269 ? 52.694 145.293 65.147 1.00 44.37  ? 275  CYS A CB    1 
ATOM   2904 S  SG    . CYS C 3  269 ? 51.642 146.763 65.166 1.00 46.03  ? 275  CYS A SG    1 
ATOM   2905 N  N     . HIS C 3  270 ? 55.657 144.088 64.890 1.00 45.66  ? 276  HIS A N     1 
ATOM   2906 C  CA    . HIS C 3  270 ? 56.528 142.940 65.111 1.00 46.79  ? 276  HIS A CA    1 
ATOM   2907 C  C     . HIS C 3  270 ? 55.700 141.859 65.808 1.00 46.49  ? 276  HIS A C     1 
ATOM   2908 O  O     . HIS C 3  270 ? 55.084 142.114 66.840 1.00 44.78  ? 276  HIS A O     1 
ATOM   2909 C  CB    . HIS C 3  270 ? 57.713 143.327 65.995 1.00 48.01  ? 276  HIS A CB    1 
ATOM   2910 C  CG    . HIS C 3  270 ? 58.855 142.363 65.919 1.00 50.88  ? 276  HIS A CG    1 
ATOM   2911 N  ND1   . HIS C 3  270 ? 59.960 142.579 65.122 1.00 51.44  ? 276  HIS A ND1   1 
ATOM   2912 C  CD2   . HIS C 3  270 ? 59.042 141.154 66.501 1.00 51.24  ? 276  HIS A CD2   1 
ATOM   2913 C  CE1   . HIS C 3  270 ? 60.777 141.545 65.216 1.00 51.46  ? 276  HIS A CE1   1 
ATOM   2914 N  NE2   . HIS C 3  270 ? 60.243 140.666 66.046 1.00 51.85  ? 276  HIS A NE2   1 
ATOM   2915 N  N     . PRO C 3  271 ? 55.670 140.638 65.245 1.00 47.03  ? 277  PRO A N     1 
ATOM   2916 C  CA    . PRO C 3  271 ? 54.909 139.519 65.816 1.00 47.33  ? 277  PRO A CA    1 
ATOM   2917 C  C     . PRO C 3  271 ? 55.362 139.101 67.215 1.00 47.87  ? 277  PRO A C     1 
ATOM   2918 O  O     . PRO C 3  271 ? 54.592 138.510 67.970 1.00 47.27  ? 277  PRO A O     1 
ATOM   2919 C  CB    . PRO C 3  271 ? 55.117 138.405 64.793 1.00 46.19  ? 277  PRO A CB    1 
ATOM   2920 C  CG    . PRO C 3  271 ? 55.307 139.152 63.517 1.00 47.10  ? 277  PRO A CG    1 
ATOM   2921 C  CD    . PRO C 3  271 ? 56.233 140.262 63.939 1.00 46.92  ? 277  PRO A CD    1 
ATOM   2922 N  N     . ARG C 3  272 ? 56.611 139.402 67.550 1.00 48.12  ? 278  ARG A N     1 
ATOM   2923 C  CA    . ARG C 3  272 ? 57.151 139.051 68.857 1.00 48.62  ? 278  ARG A CA    1 
ATOM   2924 C  C     . ARG C 3  272 ? 57.013 140.240 69.806 1.00 48.71  ? 278  ARG A C     1 
ATOM   2925 O  O     . ARG C 3  272 ? 56.294 140.183 70.802 1.00 48.23  ? 278  ARG A O     1 
ATOM   2926 C  CB    . ARG C 3  272 ? 58.627 138.674 68.725 1.00 49.33  ? 278  ARG A CB    1 
ATOM   2927 C  CG    . ARG C 3  272 ? 59.238 138.041 69.964 1.00 51.53  ? 278  ARG A CG    1 
ATOM   2928 C  CD    . ARG C 3  272 ? 60.747 138.238 69.969 1.00 53.58  ? 278  ARG A CD    1 
ATOM   2929 N  NE    . ARG C 3  272 ? 61.329 138.021 68.647 1.00 54.59  ? 278  ARG A NE    1 
ATOM   2930 C  CZ    . ARG C 3  272 ? 62.132 138.888 68.036 1.00 54.71  ? 278  ARG A CZ    1 
ATOM   2931 N  NH1   . ARG C 3  272 ? 62.447 140.030 68.631 1.00 53.78  ? 278  ARG A NH1   1 
ATOM   2932 N  NH2   . ARG C 3  272 ? 62.614 138.615 66.829 1.00 53.93  ? 278  ARG A NH2   1 
ATOM   2933 N  N     . THR C 3  273 ? 57.704 141.323 69.472 1.00 49.34  ? 279  THR A N     1 
ATOM   2934 C  CA    . THR C 3  273 ? 57.693 142.537 70.270 1.00 49.56  ? 279  THR A CA    1 
ATOM   2935 C  C     . THR C 3  273 ? 56.372 143.302 70.230 1.00 50.09  ? 279  THR A C     1 
ATOM   2936 O  O     . THR C 3  273 ? 55.987 143.938 71.213 1.00 50.97  ? 279  THR A O     1 
ATOM   2937 C  CB    . THR C 3  273 ? 58.824 143.470 69.817 1.00 50.59  ? 279  THR A CB    1 
ATOM   2938 O  OG1   . THR C 3  273 ? 60.075 142.945 70.278 1.00 50.20  ? 279  THR A OG1   1 
ATOM   2939 C  CG2   . THR C 3  273 ? 58.622 144.876 70.352 1.00 51.58  ? 279  THR A CG2   1 
ATOM   2940 N  N     . GLY C 3  274 ? 55.678 143.241 69.099 1.00 49.73  ? 280  GLY A N     1 
ATOM   2941 C  CA    . GLY C 3  274 ? 54.418 143.953 68.982 1.00 47.94  ? 280  GLY A CA    1 
ATOM   2942 C  C     . GLY C 3  274 ? 54.672 145.403 68.627 1.00 47.84  ? 280  GLY A C     1 
ATOM   2943 O  O     . GLY C 3  274 ? 53.739 146.194 68.498 1.00 47.35  ? 280  GLY A O     1 
ATOM   2944 N  N     . LYS C 3  275 ? 55.946 145.752 68.474 1.00 47.61  ? 281  LYS A N     1 
ATOM   2945 C  CA    . LYS C 3  275 ? 56.328 147.112 68.124 1.00 47.51  ? 281  LYS A CA    1 
ATOM   2946 C  C     . LYS C 3  275 ? 55.810 147.487 66.743 1.00 47.80  ? 281  LYS A C     1 
ATOM   2947 O  O     . LYS C 3  275 ? 55.992 146.741 65.781 1.00 48.29  ? 281  LYS A O     1 
ATOM   2948 C  CB    . LYS C 3  275 ? 57.854 147.264 68.144 1.00 47.47  ? 281  LYS A CB    1 
ATOM   2949 C  CG    . LYS C 3  275 ? 58.350 148.573 67.524 1.00 48.77  ? 281  LYS A CG    1 
ATOM   2950 C  CD    . LYS C 3  275 ? 59.836 148.835 67.781 1.00 49.31  ? 281  LYS A CD    1 
ATOM   2951 C  CE    . LYS C 3  275 ? 60.739 147.866 67.029 1.00 50.30  ? 281  LYS A CE    1 
ATOM   2952 N  NZ    . LYS C 3  275 ? 62.194 148.148 67.245 1.00 50.01  ? 281  LYS A NZ    1 
ATOM   2953 N  N     . PRO C 3  276 ? 55.138 148.644 66.631 1.00 48.03  ? 282  PRO A N     1 
ATOM   2954 C  CA    . PRO C 3  276 ? 54.616 149.081 65.333 1.00 47.05  ? 282  PRO A CA    1 
ATOM   2955 C  C     . PRO C 3  276 ? 55.802 149.423 64.435 1.00 46.72  ? 282  PRO A C     1 
ATOM   2956 O  O     . PRO C 3  276 ? 56.786 150.003 64.903 1.00 46.57  ? 282  PRO A O     1 
ATOM   2957 C  CB    . PRO C 3  276 ? 53.790 150.313 65.693 1.00 47.76  ? 282  PRO A CB    1 
ATOM   2958 C  CG    . PRO C 3  276 ? 53.335 150.016 67.099 1.00 47.64  ? 282  PRO A CG    1 
ATOM   2959 C  CD    . PRO C 3  276 ? 54.599 149.480 67.718 1.00 47.84  ? 282  PRO A CD    1 
ATOM   2960 N  N     . LEU C 3  277 ? 55.716 149.057 63.158 1.00 45.77  ? 283  LEU A N     1 
ATOM   2961 C  CA    . LEU C 3  277 ? 56.795 149.325 62.208 1.00 46.25  ? 283  LEU A CA    1 
ATOM   2962 C  C     . LEU C 3  277 ? 56.315 150.213 61.057 1.00 47.16  ? 283  LEU A C     1 
ATOM   2963 O  O     . LEU C 3  277 ? 56.216 149.765 59.912 1.00 47.28  ? 283  LEU A O     1 
ATOM   2964 C  CB    . LEU C 3  277 ? 57.334 148.006 61.656 1.00 46.09  ? 283  LEU A CB    1 
ATOM   2965 C  CG    . LEU C 3  277 ? 57.934 147.045 62.683 1.00 44.54  ? 283  LEU A CG    1 
ATOM   2966 C  CD1   . LEU C 3  277 ? 58.063 145.656 62.083 1.00 43.20  ? 283  LEU A CD1   1 
ATOM   2967 C  CD2   . LEU C 3  277 ? 59.285 147.577 63.137 1.00 44.50  ? 283  LEU A CD2   1 
ATOM   2968 N  N     . PRO C 3  278 ? 56.029 151.494 61.349 1.00 47.15  ? 284  PRO A N     1 
ATOM   2969 C  CA    . PRO C 3  278 ? 55.552 152.481 60.374 1.00 46.95  ? 284  PRO A CA    1 
ATOM   2970 C  C     . PRO C 3  278 ? 56.266 152.460 59.028 1.00 46.48  ? 284  PRO A C     1 
ATOM   2971 O  O     . PRO C 3  278 ? 55.662 152.769 58.005 1.00 45.65  ? 284  PRO A O     1 
ATOM   2972 C  CB    . PRO C 3  278 ? 55.753 153.807 61.101 1.00 47.00  ? 284  PRO A CB    1 
ATOM   2973 C  CG    . PRO C 3  278 ? 55.529 153.433 62.523 1.00 48.25  ? 284  PRO A CG    1 
ATOM   2974 C  CD    . PRO C 3  278 ? 56.287 152.138 62.649 1.00 46.65  ? 284  PRO A CD    1 
ATOM   2975 N  N     . LYS C 3  279 ? 57.547 152.099 59.034 1.00 46.94  ? 285  LYS A N     1 
ATOM   2976 C  CA    . LYS C 3  279 ? 58.330 152.065 57.802 1.00 47.59  ? 285  LYS A CA    1 
ATOM   2977 C  C     . LYS C 3  279 ? 58.005 150.874 56.904 1.00 46.18  ? 285  LYS A C     1 
ATOM   2978 O  O     . LYS C 3  279 ? 58.299 150.893 55.711 1.00 46.02  ? 285  LYS A O     1 
ATOM   2979 C  CB    . LYS C 3  279 ? 59.827 152.095 58.127 1.00 50.37  ? 285  LYS A CB    1 
ATOM   2980 C  CG    . LYS C 3  279 ? 60.343 153.443 58.656 1.00 52.90  ? 285  LYS A CG    1 
ATOM   2981 C  CD    . LYS C 3  279 ? 60.344 154.540 57.581 1.00 55.06  ? 285  LYS A CD    1 
ATOM   2982 C  CE    . LYS C 3  279 ? 59.061 155.376 57.573 1.00 55.69  ? 285  LYS A CE    1 
ATOM   2983 N  NZ    . LYS C 3  279 ? 58.979 156.328 58.724 1.00 55.30  ? 285  LYS A NZ    1 
ATOM   2984 N  N     . TYR C 3  280 ? 57.408 149.835 57.475 1.00 45.15  ? 286  TYR A N     1 
ATOM   2985 C  CA    . TYR C 3  280 ? 57.017 148.669 56.689 1.00 43.51  ? 286  TYR A CA    1 
ATOM   2986 C  C     . TYR C 3  280 ? 55.687 149.002 56.024 1.00 42.32  ? 286  TYR A C     1 
ATOM   2987 O  O     . TYR C 3  280 ? 54.878 149.744 56.576 1.00 42.77  ? 286  TYR A O     1 
ATOM   2988 C  CB    . TYR C 3  280 ? 56.843 147.443 57.587 1.00 43.49  ? 286  TYR A CB    1 
ATOM   2989 C  CG    . TYR C 3  280 ? 57.987 146.459 57.528 1.00 45.21  ? 286  TYR A CG    1 
ATOM   2990 C  CD1   . TYR C 3  280 ? 58.100 145.554 56.475 1.00 46.00  ? 286  TYR A CD1   1 
ATOM   2991 C  CD2   . TYR C 3  280 ? 58.962 146.433 58.525 1.00 46.37  ? 286  TYR A CD2   1 
ATOM   2992 C  CE1   . TYR C 3  280 ? 59.154 144.642 56.418 1.00 46.32  ? 286  TYR A CE1   1 
ATOM   2993 C  CE2   . TYR C 3  280 ? 60.022 145.527 58.478 1.00 46.80  ? 286  TYR A CE2   1 
ATOM   2994 C  CZ    . TYR C 3  280 ? 60.111 144.633 57.423 1.00 46.35  ? 286  TYR A CZ    1 
ATOM   2995 O  OH    . TYR C 3  280 ? 61.149 143.733 57.386 1.00 45.22  ? 286  TYR A OH    1 
ATOM   2996 N  N     . PRO C 3  281 ? 55.446 148.465 54.824 1.00 41.49  ? 287  PRO A N     1 
ATOM   2997 C  CA    . PRO C 3  281 ? 54.194 148.729 54.112 1.00 41.03  ? 287  PRO A CA    1 
ATOM   2998 C  C     . PRO C 3  281 ? 52.970 148.398 54.959 1.00 41.24  ? 287  PRO A C     1 
ATOM   2999 O  O     . PRO C 3  281 ? 52.997 147.473 55.770 1.00 40.31  ? 287  PRO A O     1 
ATOM   3000 C  CB    . PRO C 3  281 ? 54.302 147.822 52.893 1.00 40.66  ? 287  PRO A CB    1 
ATOM   3001 C  CG    . PRO C 3  281 ? 55.772 147.814 52.628 1.00 40.86  ? 287  PRO A CG    1 
ATOM   3002 C  CD    . PRO C 3  281 ? 56.351 147.642 54.005 1.00 40.79  ? 287  PRO A CD    1 
ATOM   3003 N  N     . ARG C 3  282 ? 51.900 149.164 54.773 1.00 42.77  ? 288  ARG A N     1 
ATOM   3004 C  CA    . ARG C 3  282 ? 50.664 148.923 55.502 1.00 42.29  ? 288  ARG A CA    1 
ATOM   3005 C  C     . ARG C 3  282 ? 50.165 147.547 55.082 1.00 42.07  ? 288  ARG A C     1 
ATOM   3006 O  O     . ARG C 3  282 ? 50.423 147.105 53.963 1.00 41.75  ? 288  ARG A O     1 
ATOM   3007 C  CB    . ARG C 3  282 ? 49.630 149.989 55.152 1.00 43.49  ? 288  ARG A CB    1 
ATOM   3008 C  CG    . ARG C 3  282 ? 49.925 151.367 55.740 1.00 46.81  ? 288  ARG A CG    1 
ATOM   3009 C  CD    . ARG C 3  282 ? 49.704 151.394 57.253 1.00 48.12  ? 288  ARG A CD    1 
ATOM   3010 N  NE    . ARG C 3  282 ? 50.954 151.403 58.011 1.00 50.07  ? 288  ARG A NE    1 
ATOM   3011 C  CZ    . ARG C 3  282 ? 51.752 152.460 58.132 1.00 50.10  ? 288  ARG A CZ    1 
ATOM   3012 N  NH1   . ARG C 3  282 ? 51.434 153.604 57.546 1.00 50.80  ? 288  ARG A NH1   1 
ATOM   3013 N  NH2   . ARG C 3  282 ? 52.870 152.376 58.839 1.00 50.28  ? 288  ARG A NH2   1 
ATOM   3014 N  N     . ILE C 3  283 ? 49.462 146.861 55.971 1.00 41.69  ? 289  ILE A N     1 
ATOM   3015 C  CA    . ILE C 3  283 ? 48.975 145.534 55.641 1.00 42.72  ? 289  ILE A CA    1 
ATOM   3016 C  C     . ILE C 3  283 ? 47.471 145.438 55.778 1.00 43.47  ? 289  ILE A C     1 
ATOM   3017 O  O     . ILE C 3  283 ? 46.795 146.426 56.063 1.00 43.81  ? 289  ILE A O     1 
ATOM   3018 C  CB    . ILE C 3  283 ? 49.612 144.453 56.547 1.00 42.93  ? 289  ILE A CB    1 
ATOM   3019 C  CG1   . ILE C 3  283 ? 49.052 144.569 57.967 1.00 42.68  ? 289  ILE A CG1   1 
ATOM   3020 C  CG2   . ILE C 3  283 ? 51.126 144.617 56.566 1.00 42.05  ? 289  ILE A CG2   1 
ATOM   3021 C  CD1   . ILE C 3  283 ? 49.459 143.435 58.885 1.00 43.56  ? 289  ILE A CD1   1 
ATOM   3022 N  N     . LYS C 3  284 ? 46.960 144.229 55.582 1.00 44.40  ? 290  LYS A N     1 
ATOM   3023 C  CA    . LYS C 3  284 ? 45.536 143.966 55.678 1.00 45.80  ? 290  LYS A CA    1 
ATOM   3024 C  C     . LYS C 3  284 ? 45.366 142.611 56.359 1.00 46.90  ? 290  LYS A C     1 
ATOM   3025 O  O     . LYS C 3  284 ? 45.907 141.603 55.900 1.00 46.86  ? 290  LYS A O     1 
ATOM   3026 C  CB    . LYS C 3  284 ? 44.929 143.939 54.273 1.00 47.43  ? 290  LYS A CB    1 
ATOM   3027 C  CG    . LYS C 3  284 ? 43.459 144.338 54.181 1.00 48.46  ? 290  LYS A CG    1 
ATOM   3028 C  CD    . LYS C 3  284 ? 42.522 143.260 54.687 1.00 51.71  ? 290  LYS A CD    1 
ATOM   3029 C  CE    . LYS C 3  284 ? 41.069 143.647 54.435 1.00 52.46  ? 290  LYS A CE    1 
ATOM   3030 N  NZ    . LYS C 3  284 ? 40.124 142.571 54.843 1.00 52.58  ? 290  LYS A NZ    1 
ATOM   3031 N  N     . THR C 3  285 ? 44.638 142.597 57.469 1.00 47.79  ? 291  THR A N     1 
ATOM   3032 C  CA    . THR C 3  285 ? 44.391 141.362 58.200 1.00 48.88  ? 291  THR A CA    1 
ATOM   3033 C  C     . THR C 3  285 ? 42.925 140.992 58.030 1.00 49.98  ? 291  THR A C     1 
ATOM   3034 O  O     . THR C 3  285 ? 42.058 141.565 58.683 1.00 50.62  ? 291  THR A O     1 
ATOM   3035 C  CB    . THR C 3  285 ? 44.683 141.523 59.706 1.00 48.91  ? 291  THR A CB    1 
ATOM   3036 O  OG1   . THR C 3  285 ? 46.042 141.935 59.896 1.00 49.18  ? 291  THR A OG1   1 
ATOM   3037 C  CG2   . THR C 3  285 ? 44.458 140.203 60.433 1.00 50.49  ? 291  THR A CG2   1 
ATOM   3038 N  N     . PRO C 3  286 ? 42.626 140.035 57.138 1.00 51.32  ? 292  PRO A N     1 
ATOM   3039 C  CA    . PRO C 3  286 ? 41.233 139.638 56.932 1.00 52.70  ? 292  PRO A CA    1 
ATOM   3040 C  C     . PRO C 3  286 ? 40.629 139.104 58.224 1.00 54.44  ? 292  PRO A C     1 
ATOM   3041 O  O     . PRO C 3  286 ? 41.295 138.404 58.987 1.00 55.13  ? 292  PRO A O     1 
ATOM   3042 C  CB    . PRO C 3  286 ? 41.338 138.577 55.839 1.00 52.21  ? 292  PRO A CB    1 
ATOM   3043 C  CG    . PRO C 3  286 ? 42.670 137.962 56.102 1.00 51.71  ? 292  PRO A CG    1 
ATOM   3044 C  CD    . PRO C 3  286 ? 43.534 139.169 56.367 1.00 51.44  ? 292  PRO A CD    1 
ATOM   3045 N  N     . LYS C 3  287 ? 39.369 139.446 58.470 1.00 56.24  ? 293  LYS A N     1 
ATOM   3046 C  CA    . LYS C 3  287 ? 38.689 139.012 59.683 1.00 58.48  ? 293  LYS A CA    1 
ATOM   3047 C  C     . LYS C 3  287 ? 37.802 137.799 59.435 1.00 59.49  ? 293  LYS A C     1 
ATOM   3048 O  O     . LYS C 3  287 ? 37.284 137.201 60.379 1.00 60.42  ? 293  LYS A O     1 
ATOM   3049 C  CB    . LYS C 3  287 ? 37.849 140.162 60.253 1.00 57.86  ? 293  LYS A CB    1 
ATOM   3050 N  N     . VAL C 3  288 ? 37.635 137.432 58.168 1.00 60.41  ? 294  VAL A N     1 
ATOM   3051 C  CA    . VAL C 3  288 ? 36.802 136.287 57.814 1.00 61.53  ? 294  VAL A CA    1 
ATOM   3052 C  C     . VAL C 3  288 ? 37.550 135.308 56.913 1.00 61.91  ? 294  VAL A C     1 
ATOM   3053 O  O     . VAL C 3  288 ? 38.510 135.681 56.239 1.00 62.67  ? 294  VAL A O     1 
ATOM   3054 C  CB    . VAL C 3  288 ? 35.525 136.739 57.071 1.00 62.05  ? 294  VAL A CB    1 
ATOM   3055 C  CG1   . VAL C 3  288 ? 34.549 135.576 56.961 1.00 62.28  ? 294  VAL A CG1   1 
ATOM   3056 C  CG2   . VAL C 3  288 ? 34.890 137.917 57.792 1.00 63.18  ? 294  VAL A CG2   1 
ATOM   3057 N  N     . GLY C 3  289 ? 37.108 134.054 56.908 1.00 61.76  ? 295  GLY A N     1 
ATOM   3058 C  CA    . GLY C 3  289 ? 37.740 133.056 56.066 1.00 61.43  ? 295  GLY A CA    1 
ATOM   3059 C  C     . GLY C 3  289 ? 38.667 132.092 56.777 1.00 61.35  ? 295  GLY A C     1 
ATOM   3060 O  O     . GLY C 3  289 ? 39.444 132.482 57.648 1.00 61.82  ? 295  GLY A O     1 
ATOM   3061 N  N     . GLY C 3  290 ? 38.580 130.823 56.395 1.00 61.21  ? 296  GLY A N     1 
ATOM   3062 C  CA    . GLY C 3  290 ? 39.420 129.798 56.986 1.00 61.70  ? 296  GLY A CA    1 
ATOM   3063 C  C     . GLY C 3  290 ? 39.790 128.786 55.918 1.00 62.27  ? 296  GLY A C     1 
ATOM   3064 O  O     . GLY C 3  290 ? 39.503 129.003 54.738 1.00 62.69  ? 296  GLY A O     1 
ATOM   3065 N  N     . ILE C 3  291 ? 40.428 127.687 56.312 1.00 61.75  ? 297  ILE A N     1 
ATOM   3066 C  CA    . ILE C 3  291 ? 40.814 126.657 55.352 1.00 60.84  ? 297  ILE A CA    1 
ATOM   3067 C  C     . ILE C 3  291 ? 39.579 125.906 54.863 1.00 60.61  ? 297  ILE A C     1 
ATOM   3068 O  O     . ILE C 3  291 ? 39.456 125.603 53.677 1.00 59.73  ? 297  ILE A O     1 
ATOM   3069 C  CB    . ILE C 3  291 ? 41.808 125.651 55.973 1.00 60.46  ? 297  ILE A CB    1 
ATOM   3070 C  CG1   . ILE C 3  291 ? 43.141 126.345 56.255 1.00 59.66  ? 297  ILE A CG1   1 
ATOM   3071 C  CG2   . ILE C 3  291 ? 42.028 124.480 55.033 1.00 60.00  ? 297  ILE A CG2   1 
ATOM   3072 N  N     . PHE C 3  292 ? 38.667 125.607 55.782 1.00 61.31  ? 298  PHE A N     1 
ATOM   3073 C  CA    . PHE C 3  292 ? 37.440 124.900 55.431 1.00 61.85  ? 298  PHE A CA    1 
ATOM   3074 C  C     . PHE C 3  292 ? 36.234 125.793 55.656 1.00 62.65  ? 298  PHE A C     1 
ATOM   3075 O  O     . PHE C 3  292 ? 36.359 126.907 56.164 1.00 62.77  ? 298  PHE A O     1 
ATOM   3076 C  CB    . PHE C 3  292 ? 37.270 123.634 56.277 1.00 60.49  ? 298  PHE A CB    1 
ATOM   3077 C  CG    . PHE C 3  292 ? 38.416 122.672 56.175 1.00 60.27  ? 298  PHE A CG    1 
ATOM   3078 C  CD1   . PHE C 3  292 ? 39.530 122.808 56.998 1.00 60.03  ? 298  PHE A CD1   1 
ATOM   3079 C  CD2   . PHE C 3  292 ? 38.384 121.631 55.252 1.00 60.10  ? 298  PHE A CD2   1 
ATOM   3080 C  CE1   . PHE C 3  292 ? 40.597 121.920 56.906 1.00 60.63  ? 298  PHE A CE1   1 
ATOM   3081 C  CE2   . PHE C 3  292 ? 39.446 120.737 55.149 1.00 59.97  ? 298  PHE A CE2   1 
ATOM   3082 C  CZ    . PHE C 3  292 ? 40.555 120.881 55.977 1.00 60.71  ? 298  PHE A CZ    1 
ATOM   3083 N  N     . LYS C 3  293 ? 35.065 125.291 55.271 1.00 63.80  ? 299  LYS A N     1 
ATOM   3084 C  CA    . LYS C 3  293 ? 33.817 126.021 55.447 1.00 64.09  ? 299  LYS A CA    1 
ATOM   3085 C  C     . LYS C 3  293 ? 33.195 125.529 56.745 1.00 64.92  ? 299  LYS A C     1 
ATOM   3086 O  O     . LYS C 3  293 ? 33.731 124.630 57.397 1.00 64.67  ? 299  LYS A O     1 
ATOM   3087 C  CB    . LYS C 3  293 ? 32.849 125.733 54.296 1.00 63.97  ? 299  LYS A CB    1 
ATOM   3088 C  CG    . LYS C 3  293 ? 33.338 126.121 52.910 1.00 63.38  ? 299  LYS A CG    1 
ATOM   3089 C  CD    . LYS C 3  293 ? 32.224 125.918 51.891 1.00 63.80  ? 299  LYS A CD    1 
ATOM   3090 C  CE    . LYS C 3  293 ? 32.616 126.408 50.508 1.00 63.89  ? 299  LYS A CE    1 
ATOM   3091 N  NZ    . LYS C 3  293 ? 31.461 126.367 49.567 1.00 63.35  ? 299  LYS A NZ    1 
ATOM   3092 N  N     . LYS C 3  294 ? 32.067 126.118 57.122 1.00 66.04  ? 300  LYS A N     1 
ATOM   3093 C  CA    . LYS C 3  294 ? 31.379 125.701 58.334 1.00 67.15  ? 300  LYS A CA    1 
ATOM   3094 C  C     . LYS C 3  294 ? 30.704 124.361 58.041 1.00 67.61  ? 300  LYS A C     1 
ATOM   3095 O  O     . LYS C 3  294 ? 30.183 124.149 56.943 1.00 67.40  ? 300  LYS A O     1 
ATOM   3096 C  CB    . LYS C 3  294 ? 30.332 126.744 58.734 1.00 67.65  ? 300  LYS A CB    1 
ATOM   3097 N  N     . PRO C 3  295 ? 30.711 123.437 59.017 1.00 67.79  ? 301  PRO A N     1 
ATOM   3098 C  CA    . PRO C 3  295 ? 30.097 122.114 58.855 1.00 68.21  ? 301  PRO A CA    1 
ATOM   3099 C  C     . PRO C 3  295 ? 28.583 122.175 58.660 1.00 68.81  ? 301  PRO A C     1 
ATOM   3100 O  O     . PRO C 3  295 ? 27.881 122.846 59.411 1.00 68.87  ? 301  PRO A O     1 
ATOM   3101 C  CB    . PRO C 3  295 ? 30.493 121.398 60.142 1.00 67.50  ? 301  PRO A CB    1 
ATOM   3102 C  CG    . PRO C 3  295 ? 30.541 122.511 61.137 1.00 67.22  ? 301  PRO A CG    1 
ATOM   3103 C  CD    . PRO C 3  295 ? 31.262 123.594 60.375 1.00 67.16  ? 301  PRO A CD    1 
ATOM   3104 N  N     . LYS C 3  296 ? 28.086 121.466 57.651 1.00 70.51  ? 302  LYS A N     1 
ATOM   3105 C  CA    . LYS C 3  296 ? 26.657 121.459 57.359 1.00 72.54  ? 302  LYS A CA    1 
ATOM   3106 C  C     . LYS C 3  296 ? 25.928 120.171 57.752 1.00 74.04  ? 302  LYS A C     1 
ATOM   3107 O  O     . LYS C 3  296 ? 24.840 119.899 57.242 1.00 74.40  ? 302  LYS A O     1 
ATOM   3108 C  CB    . LYS C 3  296 ? 26.431 121.730 55.866 1.00 72.17  ? 302  LYS A CB    1 
ATOM   3109 N  N     . ASN C 3  297 ? 26.507 119.378 58.650 1.00 76.04  ? 303  ASN A N     1 
ATOM   3110 C  CA    . ASN C 3  297 ? 25.853 118.139 59.067 1.00 77.65  ? 303  ASN A CA    1 
ATOM   3111 C  C     . ASN C 3  297 ? 26.611 117.365 60.134 1.00 79.10  ? 303  ASN A C     1 
ATOM   3112 O  O     . ASN C 3  297 ? 27.692 117.765 60.576 1.00 78.86  ? 303  ASN A O     1 
ATOM   3113 C  CB    . ASN C 3  297 ? 25.624 117.211 57.867 1.00 77.85  ? 303  ASN A CB    1 
ATOM   3114 C  CG    . ASN C 3  297 ? 26.922 116.684 57.277 1.00 77.70  ? 303  ASN A CG    1 
ATOM   3115 O  OD1   . ASN C 3  297 ? 27.715 117.442 56.724 1.00 77.70  ? 303  ASN A OD1   1 
ATOM   3116 N  ND2   . ASN C 3  297 ? 27.140 115.379 57.391 1.00 77.83  ? 303  ASN A ND2   1 
ATOM   3117 N  N     . LYS C 3  298 ? 26.023 116.247 60.545 1.00 80.95  ? 304  LYS A N     1 
ATOM   3118 C  CA    . LYS C 3  298 ? 26.633 115.401 61.553 1.00 82.55  ? 304  LYS A CA    1 
ATOM   3119 C  C     . LYS C 3  298 ? 27.818 114.728 60.884 1.00 83.42  ? 304  LYS A C     1 
ATOM   3120 O  O     . LYS C 3  298 ? 27.725 114.279 59.735 1.00 83.47  ? 304  LYS A O     1 
ATOM   3121 C  CB    . LYS C 3  298 ? 25.632 114.361 62.057 1.00 82.84  ? 304  LYS A CB    1 
ATOM   3122 N  N     . ALA C 3  299 ? 28.924 114.647 61.613 1.00 83.90  ? 305  ALA A N     1 
ATOM   3123 C  CA    . ALA C 3  299 ? 30.146 114.094 61.063 1.00 84.46  ? 305  ALA A CA    1 
ATOM   3124 C  C     . ALA C 3  299 ? 30.515 115.147 60.025 1.00 84.74  ? 305  ALA A C     1 
ATOM   3125 O  O     . ALA C 3  299 ? 30.320 114.972 58.825 1.00 85.54  ? 305  ALA A O     1 
ATOM   3126 C  CB    . ALA C 3  299 ? 29.902 112.747 60.401 1.00 84.82  ? 305  ALA A CB    1 
ATOM   3127 N  N     . GLN C 3  300 ? 31.010 116.260 60.540 1.00 84.17  ? 306  GLN A N     1 
ATOM   3128 C  CA    . GLN C 3  300 ? 31.423 117.430 59.791 1.00 83.76  ? 306  GLN A CA    1 
ATOM   3129 C  C     . GLN C 3  300 ? 31.495 118.393 60.955 1.00 84.58  ? 306  GLN A C     1 
ATOM   3130 O  O     . GLN C 3  300 ? 32.526 119.009 61.237 1.00 84.40  ? 306  GLN A O     1 
ATOM   3131 C  CB    . GLN C 3  300 ? 30.340 117.879 58.802 1.00 81.96  ? 306  GLN A CB    1 
ATOM   3132 C  CG    . GLN C 3  300 ? 30.600 117.475 57.359 1.00 79.86  ? 306  GLN A CG    1 
ATOM   3133 C  CD    . GLN C 3  300 ? 30.245 118.576 56.374 1.00 78.63  ? 306  GLN A CD    1 
ATOM   3134 O  OE1   . GLN C 3  300 ? 30.026 118.315 55.193 1.00 77.42  ? 306  GLN A OE1   1 
ATOM   3135 N  NE2   . GLN C 3  300 ? 30.203 119.816 56.852 1.00 77.77  ? 306  GLN A NE2   1 
ATOM   3136 N  N     . ARG C 3  301 ? 30.374 118.471 61.659 1.00 85.59  ? 307  ARG A N     1 
ATOM   3137 C  CA    . ARG C 3  301 ? 30.270 119.324 62.825 1.00 86.55  ? 307  ARG A CA    1 
ATOM   3138 C  C     . ARG C 3  301 ? 30.791 118.516 64.006 1.00 87.18  ? 307  ARG A C     1 
ATOM   3139 O  O     . ARG C 3  301 ? 31.013 119.051 65.090 1.00 87.52  ? 307  ARG A O     1 
ATOM   3140 C  CB    . ARG C 3  301 ? 28.815 119.752 63.061 1.00 85.92  ? 307  ARG A CB    1 
ATOM   3141 C  CG    . ARG C 3  301 ? 28.653 120.847 64.112 1.00 85.45  ? 307  ARG A CG    1 
ATOM   3142 C  CD    . ARG C 3  301 ? 27.312 121.576 64.005 1.00 84.87  ? 307  ARG A CD    1 
ATOM   3143 N  NE    . ARG C 3  301 ? 26.165 120.712 64.283 1.00 85.00  ? 307  ARG A NE    1 
ATOM   3144 C  CZ    . ARG C 3  301 ? 25.611 119.879 63.406 1.00 84.91  ? 307  ARG A CZ    1 
ATOM   3145 N  NH1   . ARG C 3  301 ? 24.574 119.133 63.762 1.00 84.55  ? 307  ARG A NH1   1 
ATOM   3146 N  NH2   . ARG C 3  301 ? 26.081 119.799 62.169 1.00 85.62  ? 307  ARG A NH2   1 
ATOM   3147 N  N     . GLU C 3  302 ? 30.999 117.222 63.776 1.00 87.49  ? 308  GLU A N     1 
ATOM   3148 C  CA    . GLU C 3  302 ? 31.516 116.328 64.804 1.00 87.73  ? 308  GLU A CA    1 
ATOM   3149 C  C     . GLU C 3  302 ? 32.878 115.789 64.384 1.00 87.52  ? 308  GLU A C     1 
ATOM   3150 O  O     . GLU C 3  302 ? 33.362 114.798 64.931 1.00 87.23  ? 308  GLU A O     1 
ATOM   3151 C  CB    . GLU C 3  302 ? 30.556 115.163 65.033 1.00 88.64  ? 308  GLU A CB    1 
ATOM   3152 C  CG    . GLU C 3  302 ? 29.210 115.574 65.603 1.00 89.60  ? 308  GLU A CG    1 
ATOM   3153 C  CD    . GLU C 3  302 ? 28.290 114.388 65.844 1.00 90.42  ? 308  GLU A CD    1 
ATOM   3154 O  OE1   . GLU C 3  302 ? 27.118 114.615 66.213 1.00 90.63  ? 308  GLU A OE1   1 
ATOM   3155 O  OE2   . GLU C 3  302 ? 28.737 113.232 65.667 1.00 90.54  ? 308  GLU A OE2   1 
ATOM   3156 N  N     . GLY C 3  303 ? 33.489 116.448 63.405 1.00 87.16  ? 309  GLY A N     1 
ATOM   3157 C  CA    . GLY C 3  303 ? 34.791 116.027 62.927 1.00 86.42  ? 309  GLY A CA    1 
ATOM   3158 C  C     . GLY C 3  303 ? 34.864 114.560 62.549 1.00 85.83  ? 309  GLY A C     1 
ATOM   3159 O  O     . GLY C 3  303 ? 35.711 113.829 63.061 1.00 85.67  ? 309  GLY A O     1 
ATOM   3160 N  N     . ARG C 3  304 ? 33.978 114.121 61.660 1.00 85.32  ? 310  ARG A N     1 
ATOM   3161 C  CA    . ARG C 3  304 ? 33.981 112.731 61.215 1.00 84.65  ? 310  ARG A CA    1 
ATOM   3162 C  C     . ARG C 3  304 ? 34.125 112.659 59.695 1.00 84.06  ? 310  ARG A C     1 
ATOM   3163 O  O     . ARG C 3  304 ? 34.854 111.814 59.177 1.00 83.95  ? 310  ARG A O     1 
ATOM   3164 C  CB    . ARG C 3  304 ? 32.703 112.021 61.662 1.00 84.49  ? 310  ARG A CB    1 
ATOM   3165 N  N     . GLU C 3  305 ? 33.432 113.548 58.987 1.00 83.30  ? 311  GLU A N     1 
ATOM   3166 C  CA    . GLU C 3  305 ? 33.509 113.597 57.528 1.00 82.70  ? 311  GLU A CA    1 
ATOM   3167 C  C     . GLU C 3  305 ? 34.624 114.558 57.107 1.00 81.62  ? 311  GLU A C     1 
ATOM   3168 O  O     . GLU C 3  305 ? 35.399 115.022 57.945 1.00 81.99  ? 311  GLU A O     1 
ATOM   3169 C  CB    . GLU C 3  305 ? 32.177 114.056 56.931 1.00 83.00  ? 311  GLU A CB    1 
ATOM   3170 C  CG    . GLU C 3  305 ? 31.067 113.028 56.996 1.00 84.51  ? 311  GLU A CG    1 
ATOM   3171 C  CD    . GLU C 3  305 ? 29.854 113.449 56.189 1.00 85.25  ? 311  GLU A CD    1 
ATOM   3172 O  OE1   . GLU C 3  305 ? 28.772 112.851 56.380 1.00 85.78  ? 311  GLU A OE1   1 
ATOM   3173 O  OE2   . GLU C 3  305 ? 29.989 114.374 55.358 1.00 85.40  ? 311  GLU A OE2   1 
ATOM   3174 N  N     . PRO C 3  306 ? 34.726 114.871 55.802 1.00 80.04  ? 312  PRO A N     1 
ATOM   3175 C  CA    . PRO C 3  306 ? 35.791 115.787 55.390 1.00 78.30  ? 312  PRO A CA    1 
ATOM   3176 C  C     . PRO C 3  306 ? 35.587 117.234 55.833 1.00 76.44  ? 312  PRO A C     1 
ATOM   3177 O  O     . PRO C 3  306 ? 36.392 117.774 56.590 1.00 77.10  ? 312  PRO A O     1 
ATOM   3178 C  CB    . PRO C 3  306 ? 35.788 115.647 53.871 1.00 78.89  ? 312  PRO A CB    1 
ATOM   3179 C  CG    . PRO C 3  306 ? 34.340 115.405 53.571 1.00 79.54  ? 312  PRO A CG    1 
ATOM   3180 C  CD    . PRO C 3  306 ? 33.978 114.385 54.626 1.00 79.93  ? 312  PRO A CD    1 
ATOM   3181 N  N     . CYS C 3  307 ? 34.505 117.840 55.349 1.00 73.58  ? 313  CYS A N     1 
ATOM   3182 C  CA    . CYS C 3  307 ? 34.146 119.230 55.627 1.00 70.63  ? 313  CYS A CA    1 
ATOM   3183 C  C     . CYS C 3  307 ? 34.604 120.070 54.430 1.00 70.04  ? 313  CYS A C     1 
ATOM   3184 O  O     . CYS C 3  307 ? 35.795 120.156 54.127 1.00 69.35  ? 313  CYS A O     1 
ATOM   3185 C  CB    . CYS C 3  307 ? 34.800 119.734 56.920 1.00 69.12  ? 313  CYS A CB    1 
ATOM   3186 S  SG    . CYS C 3  307 ? 33.835 120.975 57.819 1.00 66.45  ? 313  CYS A SG    1 
ATOM   3187 N  N     . GLU C 3  308 ? 33.631 120.665 53.750 1.00 69.23  ? 314  GLU A N     1 
ATOM   3188 C  CA    . GLU C 3  308 ? 33.841 121.492 52.565 1.00 68.28  ? 314  GLU A CA    1 
ATOM   3189 C  C     . GLU C 3  308 ? 35.011 122.475 52.635 1.00 67.30  ? 314  GLU A C     1 
ATOM   3190 O  O     . GLU C 3  308 ? 35.186 123.180 53.629 1.00 66.66  ? 314  GLU A O     1 
ATOM   3191 C  CB    . GLU C 3  308 ? 32.552 122.255 52.277 1.00 69.45  ? 314  GLU A CB    1 
ATOM   3192 C  CG    . GLU C 3  308 ? 32.116 122.241 50.833 1.00 71.24  ? 314  GLU A CG    1 
ATOM   3193 C  CD    . GLU C 3  308 ? 30.632 122.511 50.695 1.00 72.50  ? 314  GLU A CD    1 
ATOM   3194 O  OE1   . GLU C 3  308 ? 29.832 121.691 51.198 1.00 72.01  ? 314  GLU A OE1   1 
ATOM   3195 O  OE2   . GLU C 3  308 ? 30.264 123.540 50.091 1.00 73.76  ? 314  GLU A OE2   1 
ATOM   3196 N  N     . LEU C 3  309 ? 35.803 122.520 51.565 1.00 65.81  ? 315  LEU A N     1 
ATOM   3197 C  CA    . LEU C 3  309 ? 36.949 123.424 51.484 1.00 64.64  ? 315  LEU A CA    1 
ATOM   3198 C  C     . LEU C 3  309 ? 36.499 124.844 51.189 1.00 64.00  ? 315  LEU A C     1 
ATOM   3199 O  O     . LEU C 3  309 ? 35.577 125.063 50.407 1.00 63.28  ? 315  LEU A O     1 
ATOM   3200 C  CB    . LEU C 3  309 ? 37.916 122.982 50.383 1.00 64.49  ? 315  LEU A CB    1 
ATOM   3201 C  CG    . LEU C 3  309 ? 39.005 121.968 50.731 1.00 64.86  ? 315  LEU A CG    1 
ATOM   3202 C  CD1   . LEU C 3  309 ? 39.784 121.609 49.475 1.00 64.43  ? 315  LEU A CD1   1 
ATOM   3203 C  CD2   . LEU C 3  309 ? 39.934 122.552 51.783 1.00 64.33  ? 315  LEU A CD2   1 
ATOM   3204 N  N     . ASP C 3  310 ? 37.163 125.810 51.812 1.00 63.44  ? 316  ASP A N     1 
ATOM   3205 C  CA    . ASP C 3  310 ? 36.828 127.209 51.602 1.00 63.29  ? 316  ASP A CA    1 
ATOM   3206 C  C     . ASP C 3  310 ? 37.621 127.747 50.415 1.00 63.45  ? 316  ASP A C     1 
ATOM   3207 O  O     . ASP C 3  310 ? 38.791 128.098 50.545 1.00 63.34  ? 316  ASP A O     1 
ATOM   3208 C  CB    . ASP C 3  310 ? 37.149 128.019 52.859 1.00 63.12  ? 316  ASP A CB    1 
ATOM   3209 C  CG    . ASP C 3  310 ? 36.678 129.454 52.761 1.00 63.80  ? 316  ASP A CG    1 
ATOM   3210 O  OD1   . ASP C 3  310 ? 36.944 130.236 53.701 1.00 63.92  ? 316  ASP A OD1   1 
ATOM   3211 O  OD2   . ASP C 3  310 ? 36.039 129.798 51.741 1.00 63.40  ? 316  ASP A OD2   1 
ATOM   3212 N  N     . THR C 3  311 ? 36.976 127.802 49.255 1.00 63.96  ? 317  THR A N     1 
ATOM   3213 C  CA    . THR C 3  311 ? 37.615 128.291 48.040 1.00 64.39  ? 317  THR A CA    1 
ATOM   3214 C  C     . THR C 3  311 ? 37.994 129.768 48.136 1.00 64.08  ? 317  THR A C     1 
ATOM   3215 O  O     . THR C 3  311 ? 38.782 130.257 47.329 1.00 63.79  ? 317  THR A O     1 
ATOM   3216 C  CB    . THR C 3  311 ? 36.694 128.055 46.804 1.00 65.91  ? 317  THR A CB    1 
ATOM   3217 O  OG1   . THR C 3  311 ? 36.902 126.726 46.309 1.00 66.78  ? 317  THR A OG1   1 
ATOM   3218 C  CG2   . THR C 3  311 ? 36.976 129.060 45.687 1.00 66.47  ? 317  THR A CG2   1 
ATOM   3219 N  N     . ARG C 3  312 ? 37.442 130.463 49.130 1.00 63.42  ? 318  ARG A N     1 
ATOM   3220 C  CA    . ARG C 3  312 ? 37.715 131.887 49.339 1.00 61.81  ? 318  ARG A CA    1 
ATOM   3221 C  C     . ARG C 3  312 ? 39.073 132.318 48.785 1.00 60.69  ? 318  ARG A C     1 
ATOM   3222 O  O     . ARG C 3  312 ? 39.210 132.518 47.578 1.00 62.09  ? 318  ARG A O     1 
ATOM   3223 C  CB    . ARG C 3  312 ? 37.633 132.229 50.830 1.00 62.19  ? 318  ARG A CB    1 
ATOM   3224 N  N     . GLU C 3  313 ? 40.066 132.465 49.660 1.00 58.37  ? 319  GLU A N     1 
ATOM   3225 C  CA    . GLU C 3  313 ? 41.412 132.873 49.252 1.00 55.72  ? 319  GLU A CA    1 
ATOM   3226 C  C     . GLU C 3  313 ? 42.167 133.499 50.418 1.00 53.72  ? 319  GLU A C     1 
ATOM   3227 O  O     . GLU C 3  313 ? 43.385 133.668 50.369 1.00 53.11  ? 319  GLU A O     1 
ATOM   3228 C  CB    . GLU C 3  313 ? 41.345 133.881 48.104 1.00 56.54  ? 319  GLU A CB    1 
ATOM   3229 C  CG    . GLU C 3  313 ? 42.636 134.012 47.329 1.00 58.72  ? 319  GLU A CG    1 
ATOM   3230 C  CD    . GLU C 3  313 ? 42.475 134.831 46.062 1.00 59.97  ? 319  GLU A CD    1 
ATOM   3231 O  OE1   . GLU C 3  313 ? 42.194 136.046 46.173 1.00 60.51  ? 319  GLU A OE1   1 
ATOM   3232 O  OE2   . GLU C 3  313 ? 42.626 134.254 44.960 1.00 58.78  ? 319  GLU A OE2   1 
ATOM   3233 N  N     . TYR C 3  314 ? 41.434 133.848 51.467 1.00 51.37  ? 320  TYR A N     1 
ATOM   3234 C  CA    . TYR C 3  314 ? 42.038 134.451 52.642 1.00 49.68  ? 320  TYR A CA    1 
ATOM   3235 C  C     . TYR C 3  314 ? 41.782 133.610 53.885 1.00 48.87  ? 320  TYR A C     1 
ATOM   3236 O  O     . TYR C 3  314 ? 40.959 132.694 53.878 1.00 48.14  ? 320  TYR A O     1 
ATOM   3237 C  CB    . TYR C 3  314 ? 41.480 135.857 52.854 1.00 49.60  ? 320  TYR A CB    1 
ATOM   3238 C  CG    . TYR C 3  314 ? 41.793 136.820 51.733 1.00 49.75  ? 320  TYR A CG    1 
ATOM   3239 C  CD1   . TYR C 3  314 ? 43.059 137.392 51.611 1.00 50.72  ? 320  TYR A CD1   1 
ATOM   3240 C  CD2   . TYR C 3  314 ? 40.827 137.152 50.787 1.00 48.95  ? 320  TYR A CD2   1 
ATOM   3241 C  CE1   . TYR C 3  314 ? 43.354 138.274 50.570 1.00 49.79  ? 320  TYR A CE1   1 
ATOM   3242 C  CE2   . TYR C 3  314 ? 41.110 138.029 49.746 1.00 49.57  ? 320  TYR A CE2   1 
ATOM   3243 C  CZ    . TYR C 3  314 ? 42.375 138.587 49.642 1.00 49.85  ? 320  TYR A CZ    1 
ATOM   3244 O  OH    . TYR C 3  314 ? 42.660 139.451 48.608 1.00 48.21  ? 320  TYR A OH    1 
ATOM   3245 N  N     . VAL C 3  315 ? 42.511 133.926 54.948 1.00 47.49  ? 321  VAL A N     1 
ATOM   3246 C  CA    . VAL C 3  315 ? 42.379 133.233 56.217 1.00 46.30  ? 321  VAL A CA    1 
ATOM   3247 C  C     . VAL C 3  315 ? 42.393 134.296 57.305 1.00 45.94  ? 321  VAL A C     1 
ATOM   3248 O  O     . VAL C 3  315 ? 43.263 135.166 57.319 1.00 45.54  ? 321  VAL A O     1 
ATOM   3249 C  CB    . VAL C 3  315 ? 43.544 132.253 56.447 1.00 45.94  ? 321  VAL A CB    1 
ATOM   3250 C  CG1   . VAL C 3  315 ? 43.396 131.573 57.798 1.00 45.62  ? 321  VAL A CG1   1 
ATOM   3251 C  CG2   . VAL C 3  315 ? 43.570 131.222 55.339 1.00 45.40  ? 321  VAL A CG2   1 
ATOM   3252 N  N     . ALA C 3  316 ? 41.417 134.231 58.204 1.00 45.88  ? 322  ALA A N     1 
ATOM   3253 C  CA    . ALA C 3  316 ? 41.308 135.193 59.292 1.00 45.37  ? 322  ALA A CA    1 
ATOM   3254 C  C     . ALA C 3  316 ? 42.570 135.212 60.148 1.00 45.13  ? 322  ALA A C     1 
ATOM   3255 O  O     . ALA C 3  316 ? 43.061 134.166 60.583 1.00 45.23  ? 322  ALA A O     1 
ATOM   3256 C  CB    . ALA C 3  316 ? 40.099 134.868 60.151 1.00 45.78  ? 322  ALA A CB    1 
ATOM   3257 N  N     . GLY C 3  317 ? 43.092 136.411 60.384 1.00 44.22  ? 323  GLY A N     1 
ATOM   3258 C  CA    . GLY C 3  317 ? 44.291 136.551 61.189 1.00 42.33  ? 323  GLY A CA    1 
ATOM   3259 C  C     . GLY C 3  317 ? 45.576 136.453 60.389 1.00 41.14  ? 323  GLY A C     1 
ATOM   3260 O  O     . GLY C 3  317 ? 46.645 136.813 60.887 1.00 41.11  ? 323  GLY A O     1 
ATOM   3261 N  N     . ALA C 3  318 ? 45.477 135.962 59.155 1.00 39.50  ? 324  ALA A N     1 
ATOM   3262 C  CA    . ALA C 3  318 ? 46.641 135.818 58.277 1.00 37.87  ? 324  ALA A CA    1 
ATOM   3263 C  C     . ALA C 3  318 ? 46.851 137.115 57.496 1.00 36.12  ? 324  ALA A C     1 
ATOM   3264 O  O     . ALA C 3  318 ? 46.233 137.336 56.458 1.00 35.15  ? 324  ALA A O     1 
ATOM   3265 C  CB    . ALA C 3  318 ? 46.426 134.653 57.320 1.00 37.90  ? 324  ALA A CB    1 
ATOM   3266 N  N     . PRO C 3  319 ? 47.745 137.984 57.986 1.00 34.67  ? 325  PRO A N     1 
ATOM   3267 C  CA    . PRO C 3  319 ? 48.036 139.266 57.347 1.00 34.29  ? 325  PRO A CA    1 
ATOM   3268 C  C     . PRO C 3  319 ? 48.789 139.163 56.037 1.00 33.61  ? 325  PRO A C     1 
ATOM   3269 O  O     . PRO C 3  319 ? 49.602 138.266 55.844 1.00 33.98  ? 325  PRO A O     1 
ATOM   3270 C  CB    . PRO C 3  319 ? 48.864 139.980 58.398 1.00 34.26  ? 325  PRO A CB    1 
ATOM   3271 C  CG    . PRO C 3  319 ? 49.700 138.856 58.929 1.00 33.84  ? 325  PRO A CG    1 
ATOM   3272 C  CD    . PRO C 3  319 ? 48.665 137.756 59.118 1.00 34.63  ? 325  PRO A CD    1 
ATOM   3273 N  N     . TYR C 3  320 ? 48.515 140.102 55.144 1.00 32.11  ? 326  TYR A N     1 
ATOM   3274 C  CA    . TYR C 3  320 ? 49.200 140.151 53.870 1.00 32.39  ? 326  TYR A CA    1 
ATOM   3275 C  C     . TYR C 3  320 ? 49.337 141.607 53.466 1.00 32.01  ? 326  TYR A C     1 
ATOM   3276 O  O     . TYR C 3  320 ? 48.693 142.482 54.046 1.00 33.40  ? 326  TYR A O     1 
ATOM   3277 C  CB    . TYR C 3  320 ? 48.420 139.402 52.796 1.00 33.15  ? 326  TYR A CB    1 
ATOM   3278 C  CG    . TYR C 3  320 ? 47.136 140.077 52.371 1.00 32.72  ? 326  TYR A CG    1 
ATOM   3279 C  CD1   . TYR C 3  320 ? 45.923 139.761 52.982 1.00 32.00  ? 326  TYR A CD1   1 
ATOM   3280 C  CD2   . TYR C 3  320 ? 47.132 141.018 51.338 1.00 32.43  ? 326  TYR A CD2   1 
ATOM   3281 C  CE1   . TYR C 3  320 ? 44.737 140.358 52.574 1.00 33.28  ? 326  TYR A CE1   1 
ATOM   3282 C  CE2   . TYR C 3  320 ? 45.953 141.622 50.921 1.00 33.51  ? 326  TYR A CE2   1 
ATOM   3283 C  CZ    . TYR C 3  320 ? 44.758 141.285 51.542 1.00 33.67  ? 326  TYR A CZ    1 
ATOM   3284 O  OH    . TYR C 3  320 ? 43.586 141.859 51.116 1.00 33.22  ? 326  TYR A OH    1 
ATOM   3285 N  N     . THR C 3  321 ? 50.172 141.865 52.470 1.00 29.93  ? 327  THR A N     1 
ATOM   3286 C  CA    . THR C 3  321 ? 50.367 143.220 51.996 1.00 28.56  ? 327  THR A CA    1 
ATOM   3287 C  C     . THR C 3  321 ? 49.729 143.429 50.632 1.00 28.93  ? 327  THR A C     1 
ATOM   3288 O  O     . THR C 3  321 ? 50.113 142.788 49.653 1.00 29.04  ? 327  THR A O     1 
ATOM   3289 C  CB    . THR C 3  321 ? 51.854 143.560 51.887 1.00 27.50  ? 327  THR A CB    1 
ATOM   3290 O  OG1   . THR C 3  321 ? 52.468 143.431 53.176 1.00 28.40  ? 327  THR A OG1   1 
ATOM   3291 C  CG2   . THR C 3  321 ? 52.031 144.975 51.386 1.00 24.77  ? 327  THR A CG2   1 
ATOM   3292 N  N     . PRO C 3  322 ? 48.723 144.315 50.558 1.00 29.15  ? 328  PRO A N     1 
ATOM   3293 C  CA    . PRO C 3  322 ? 48.025 144.623 49.305 1.00 28.74  ? 328  PRO A CA    1 
ATOM   3294 C  C     . PRO C 3  322 ? 48.977 145.364 48.366 1.00 27.51  ? 328  PRO A C     1 
ATOM   3295 O  O     . PRO C 3  322 ? 49.640 146.317 48.770 1.00 27.09  ? 328  PRO A O     1 
ATOM   3296 C  CB    . PRO C 3  322 ? 46.871 145.507 49.768 1.00 28.45  ? 328  PRO A CB    1 
ATOM   3297 C  CG    . PRO C 3  322 ? 46.592 144.991 51.138 1.00 29.42  ? 328  PRO A CG    1 
ATOM   3298 C  CD    . PRO C 3  322 ? 47.985 144.873 51.703 1.00 29.10  ? 328  PRO A CD    1 
ATOM   3299 N  N     . VAL C 3  323 ? 49.046 144.933 47.116 1.00 26.58  ? 329  VAL A N     1 
ATOM   3300 C  CA    . VAL C 3  323 ? 49.945 145.575 46.170 1.00 25.90  ? 329  VAL A CA    1 
ATOM   3301 C  C     . VAL C 3  323 ? 49.261 145.818 44.848 1.00 26.98  ? 329  VAL A C     1 
ATOM   3302 O  O     . VAL C 3  323 ? 48.183 145.284 44.584 1.00 27.60  ? 329  VAL A O     1 
ATOM   3303 C  CB    . VAL C 3  323 ? 51.195 144.702 45.895 1.00 23.97  ? 329  VAL A CB    1 
ATOM   3304 C  CG1   . VAL C 3  323 ? 52.021 144.547 47.156 1.00 23.70  ? 329  VAL A CG1   1 
ATOM   3305 C  CG2   . VAL C 3  323 ? 50.765 143.343 45.381 1.00 24.39  ? 329  VAL A CG2   1 
ATOM   3306 N  N     . GLU C 3  324 ? 49.897 146.636 44.021 1.00 28.25  ? 330  GLU A N     1 
ATOM   3307 C  CA    . GLU C 3  324 ? 49.378 146.931 42.698 1.00 30.37  ? 330  GLU A CA    1 
ATOM   3308 C  C     . GLU C 3  324 ? 50.507 146.686 41.710 1.00 30.04  ? 330  GLU A C     1 
ATOM   3309 O  O     . GLU C 3  324 ? 51.684 146.776 42.068 1.00 29.55  ? 330  GLU A O     1 
ATOM   3310 C  CB    . GLU C 3  324 ? 48.901 148.386 42.596 1.00 31.26  ? 330  GLU A CB    1 
ATOM   3311 C  CG    . GLU C 3  324 ? 49.965 149.433 42.868 1.00 35.71  ? 330  GLU A CG    1 
ATOM   3312 C  CD    . GLU C 3  324 ? 49.508 150.828 42.472 1.00 39.38  ? 330  GLU A CD    1 
ATOM   3313 O  OE1   . GLU C 3  324 ? 48.290 151.087 42.555 1.00 42.49  ? 330  GLU A OE1   1 
ATOM   3314 O  OE2   . GLU C 3  324 ? 50.359 151.663 42.092 1.00 41.31  ? 330  GLU A OE2   1 
ATOM   3315 N  N     . HIS C 3  325 ? 50.148 146.360 40.475 1.00 29.25  ? 331  HIS A N     1 
ATOM   3316 C  CA    . HIS C 3  325 ? 51.147 146.118 39.450 1.00 29.81  ? 331  HIS A CA    1 
ATOM   3317 C  C     . HIS C 3  325 ? 51.347 147.408 38.667 1.00 28.41  ? 331  HIS A C     1 
ATOM   3318 O  O     . HIS C 3  325 ? 50.424 147.884 38.010 1.00 28.42  ? 331  HIS A O     1 
ATOM   3319 C  CB    . HIS C 3  325 ? 50.681 145.012 38.501 1.00 31.63  ? 331  HIS A CB    1 
ATOM   3320 C  CG    . HIS C 3  325 ? 51.700 144.641 37.471 1.00 33.11  ? 331  HIS A CG    1 
ATOM   3321 N  ND1   . HIS C 3  325 ? 51.360 144.122 36.242 1.00 35.37  ? 331  HIS A ND1   1 
ATOM   3322 C  CD2   . HIS C 3  325 ? 53.052 144.709 37.490 1.00 35.38  ? 331  HIS A CD2   1 
ATOM   3323 C  CE1   . HIS C 3  325 ? 52.459 143.890 35.546 1.00 35.44  ? 331  HIS A CE1   1 
ATOM   3324 N  NE2   . HIS C 3  325 ? 53.499 144.236 36.280 1.00 34.74  ? 331  HIS A NE2   1 
ATOM   3325 N  N     . VAL C 3  326 ? 52.547 147.972 38.731 1.00 26.83  ? 332  VAL A N     1 
ATOM   3326 C  CA    . VAL C 3  326 ? 52.822 149.212 38.019 1.00 28.34  ? 332  VAL A CA    1 
ATOM   3327 C  C     . VAL C 3  326 ? 53.711 149.056 36.783 1.00 27.69  ? 332  VAL A C     1 
ATOM   3328 O  O     . VAL C 3  326 ? 54.736 148.369 36.813 1.00 27.59  ? 332  VAL A O     1 
ATOM   3329 C  CB    . VAL C 3  326 ? 53.437 150.276 38.975 1.00 29.52  ? 332  VAL A CB    1 
ATOM   3330 C  CG1   . VAL C 3  326 ? 54.358 149.611 39.975 1.00 31.28  ? 332  VAL A CG1   1 
ATOM   3331 C  CG2   . VAL C 3  326 ? 54.208 151.317 38.178 1.00 29.77  ? 332  VAL A CG2   1 
ATOM   3332 N  N     . VAL C 3  327 ? 53.295 149.701 35.697 1.00 25.63  ? 333  VAL A N     1 
ATOM   3333 C  CA    . VAL C 3  327 ? 54.024 149.679 34.429 1.00 24.45  ? 333  VAL A CA    1 
ATOM   3334 C  C     . VAL C 3  327 ? 54.846 150.967 34.307 1.00 23.27  ? 333  VAL A C     1 
ATOM   3335 O  O     . VAL C 3  327 ? 54.352 152.053 34.609 1.00 22.19  ? 333  VAL A O     1 
ATOM   3336 C  CB    . VAL C 3  327 ? 53.033 149.591 33.241 1.00 25.47  ? 333  VAL A CB    1 
ATOM   3337 C  CG1   . VAL C 3  327 ? 53.787 149.624 31.914 1.00 26.35  ? 333  VAL A CG1   1 
ATOM   3338 C  CG2   . VAL C 3  327 ? 52.207 148.322 33.359 1.00 24.72  ? 333  VAL A CG2   1 
ATOM   3339 N  N     . PHE C 3  328 ? 56.095 150.848 33.870 1.00 22.68  ? 334  PHE A N     1 
ATOM   3340 C  CA    . PHE C 3  328 ? 56.957 152.019 33.736 1.00 22.68  ? 334  PHE A CA    1 
ATOM   3341 C  C     . PHE C 3  328 ? 56.254 153.117 32.950 1.00 23.17  ? 334  PHE A C     1 
ATOM   3342 O  O     . PHE C 3  328 ? 55.692 152.863 31.889 1.00 24.01  ? 334  PHE A O     1 
ATOM   3343 C  CB    . PHE C 3  328 ? 58.261 151.644 33.034 1.00 21.20  ? 334  PHE A CB    1 
ATOM   3344 C  CG    . PHE C 3  328 ? 59.212 152.796 32.848 1.00 20.34  ? 334  PHE A CG    1 
ATOM   3345 C  CD1   . PHE C 3  328 ? 59.935 153.304 33.926 1.00 20.50  ? 334  PHE A CD1   1 
ATOM   3346 C  CD2   . PHE C 3  328 ? 59.402 153.359 31.585 1.00 19.69  ? 334  PHE A CD2   1 
ATOM   3347 C  CE1   . PHE C 3  328 ? 60.843 154.358 33.750 1.00 19.75  ? 334  PHE A CE1   1 
ATOM   3348 C  CE2   . PHE C 3  328 ? 60.305 154.411 31.392 1.00 18.40  ? 334  PHE A CE2   1 
ATOM   3349 C  CZ    . PHE C 3  328 ? 61.029 154.912 32.478 1.00 19.26  ? 334  PHE A CZ    1 
ATOM   3350 N  N     . ASN C 3  329 ? 56.281 154.332 33.489 1.00 22.65  ? 335  ASN A N     1 
ATOM   3351 C  CA    . ASN C 3  329 ? 55.655 155.484 32.848 1.00 20.67  ? 335  ASN A CA    1 
ATOM   3352 C  C     . ASN C 3  329 ? 56.732 156.537 32.598 1.00 19.34  ? 335  ASN A C     1 
ATOM   3353 O  O     . ASN C 3  329 ? 57.163 157.219 33.523 1.00 17.93  ? 335  ASN A O     1 
ATOM   3354 C  CB    . ASN C 3  329 ? 54.579 156.069 33.756 1.00 21.49  ? 335  ASN A CB    1 
ATOM   3355 C  CG    . ASN C 3  329 ? 53.814 157.201 33.096 1.00 23.22  ? 335  ASN A CG    1 
ATOM   3356 O  OD1   . ASN C 3  329 ? 54.331 157.883 32.210 1.00 22.41  ? 335  ASN A OD1   1 
ATOM   3357 N  ND2   . ASN C 3  329 ? 52.577 157.414 33.536 1.00 21.63  ? 335  ASN A ND2   1 
ATOM   3358 N  N     . PRO C 3  330 ? 57.173 156.687 31.340 1.00 17.71  ? 336  PRO A N     1 
ATOM   3359 C  CA    . PRO C 3  330 ? 58.208 157.659 30.985 1.00 17.76  ? 336  PRO A CA    1 
ATOM   3360 C  C     . PRO C 3  330 ? 57.874 159.076 31.434 1.00 18.54  ? 336  PRO A C     1 
ATOM   3361 O  O     . PRO C 3  330 ? 58.764 159.914 31.594 1.00 18.90  ? 336  PRO A O     1 
ATOM   3362 C  CB    . PRO C 3  330 ? 58.289 157.536 29.466 1.00 18.79  ? 336  PRO A CB    1 
ATOM   3363 C  CG    . PRO C 3  330 ? 57.839 156.146 29.207 1.00 17.49  ? 336  PRO A CG    1 
ATOM   3364 C  CD    . PRO C 3  330 ? 56.678 156.000 30.138 1.00 17.27  ? 336  PRO A CD    1 
ATOM   3365 N  N     . SER C 3  331 ? 56.588 159.344 31.629 1.00 18.44  ? 337  SER A N     1 
ATOM   3366 C  CA    . SER C 3  331 ? 56.144 160.660 32.068 1.00 18.97  ? 337  SER A CA    1 
ATOM   3367 C  C     . SER C 3  331 ? 56.291 160.863 33.577 1.00 20.54  ? 337  SER A C     1 
ATOM   3368 O  O     . SER C 3  331 ? 56.170 161.988 34.068 1.00 19.80  ? 337  SER A O     1 
ATOM   3369 C  CB    . SER C 3  331 ? 54.686 160.890 31.664 1.00 17.13  ? 337  SER A CB    1 
ATOM   3370 O  OG    . SER C 3  331 ? 54.606 161.406 30.349 1.00 18.44  ? 337  SER A OG    1 
ATOM   3371 N  N     . SER C 3  332 ? 56.557 159.780 34.303 1.00 20.44  ? 338  SER A N     1 
ATOM   3372 C  CA    . SER C 3  332 ? 56.704 159.844 35.753 1.00 22.50  ? 338  SER A CA    1 
ATOM   3373 C  C     . SER C 3  332 ? 58.144 160.043 36.187 1.00 24.16  ? 338  SER A C     1 
ATOM   3374 O  O     . SER C 3  332 ? 58.939 159.101 36.161 1.00 23.95  ? 338  SER A O     1 
ATOM   3375 C  CB    . SER C 3  332 ? 56.168 158.567 36.398 1.00 22.26  ? 338  SER A CB    1 
ATOM   3376 O  OG    . SER C 3  332 ? 56.364 158.592 37.802 1.00 22.57  ? 338  SER A OG    1 
ATOM   3377 N  N     . ARG C 3  333 ? 58.474 161.264 36.601 1.00 24.99  ? 339  ARG A N     1 
ATOM   3378 C  CA    . ARG C 3  333 ? 59.827 161.568 37.039 1.00 27.19  ? 339  ARG A CA    1 
ATOM   3379 C  C     . ARG C 3  333 ? 60.193 160.600 38.160 1.00 28.04  ? 339  ARG A C     1 
ATOM   3380 O  O     . ARG C 3  333 ? 61.370 160.275 38.367 1.00 26.99  ? 339  ARG A O     1 
ATOM   3381 C  CB    . ARG C 3  333 ? 59.915 163.011 37.547 1.00 29.78  ? 339  ARG A CB    1 
ATOM   3382 C  CG    . ARG C 3  333 ? 59.300 164.049 36.620 1.00 34.28  ? 339  ARG A CG    1 
ATOM   3383 C  CD    . ARG C 3  333 ? 60.125 164.330 35.367 1.00 40.41  ? 339  ARG A CD    1 
ATOM   3384 N  NE    . ARG C 3  333 ? 59.357 165.162 34.430 1.00 47.88  ? 339  ARG A NE    1 
ATOM   3385 C  CZ    . ARG C 3  333 ? 59.872 166.044 33.569 1.00 47.70  ? 339  ARG A CZ    1 
ATOM   3386 N  NH1   . ARG C 3  333 ? 61.186 166.243 33.498 1.00 46.35  ? 339  ARG A NH1   1 
ATOM   3387 N  NH2   . ARG C 3  333 ? 59.059 166.735 32.777 1.00 45.98  ? 339  ARG A NH2   1 
ATOM   3388 N  N     . ASP C 3  334 ? 59.176 160.135 38.879 1.00 28.47  ? 340  ASP A N     1 
ATOM   3389 C  CA    . ASP C 3  334 ? 59.393 159.212 39.980 1.00 28.72  ? 340  ASP A CA    1 
ATOM   3390 C  C     . ASP C 3  334 ? 59.870 157.868 39.443 1.00 27.03  ? 340  ASP A C     1 
ATOM   3391 O  O     . ASP C 3  334 ? 60.769 157.253 40.011 1.00 27.28  ? 340  ASP A O     1 
ATOM   3392 C  CB    . ASP C 3  334 ? 58.103 159.039 40.783 1.00 33.94  ? 340  ASP A CB    1 
ATOM   3393 C  CG    . ASP C 3  334 ? 58.357 158.534 42.191 1.00 37.69  ? 340  ASP A CG    1 
ATOM   3394 O  OD1   . ASP C 3  334 ? 59.239 159.102 42.872 1.00 40.56  ? 340  ASP A OD1   1 
ATOM   3395 O  OD2   . ASP C 3  334 ? 57.672 157.578 42.618 1.00 39.87  ? 340  ASP A OD2   1 
ATOM   3396 N  N     . HIS C 3  335 ? 59.268 157.421 38.344 1.00 25.42  ? 341  HIS A N     1 
ATOM   3397 C  CA    . HIS C 3  335 ? 59.645 156.155 37.720 1.00 22.37  ? 341  HIS A CA    1 
ATOM   3398 C  C     . HIS C 3  335 ? 61.026 156.270 37.082 1.00 22.97  ? 341  HIS A C     1 
ATOM   3399 O  O     . HIS C 3  335 ? 61.843 155.349 37.154 1.00 22.17  ? 341  HIS A O     1 
ATOM   3400 C  CB    . HIS C 3  335 ? 58.646 155.752 36.631 1.00 18.99  ? 341  HIS A CB    1 
ATOM   3401 C  CG    . HIS C 3  335 ? 57.338 155.242 37.149 1.00 17.56  ? 341  HIS A CG    1 
ATOM   3402 N  ND1   . HIS C 3  335 ? 56.404 154.643 36.331 1.00 19.01  ? 341  HIS A ND1   1 
ATOM   3403 C  CD2   . HIS C 3  335 ? 56.796 155.259 38.389 1.00 17.65  ? 341  HIS A CD2   1 
ATOM   3404 C  CE1   . HIS C 3  335 ? 55.343 154.313 37.046 1.00 16.59  ? 341  HIS A CE1   1 
ATOM   3405 N  NE2   . HIS C 3  335 ? 55.555 154.675 38.298 1.00 16.09  ? 341  HIS A NE2   1 
ATOM   3406 N  N     . ILE C 3  336 ? 61.281 157.401 36.442 1.00 22.78  ? 342  ILE A N     1 
ATOM   3407 C  CA    . ILE C 3  336 ? 62.563 157.599 35.797 1.00 23.85  ? 342  ILE A CA    1 
ATOM   3408 C  C     . ILE C 3  336 ? 63.657 157.519 36.847 1.00 25.90  ? 342  ILE A C     1 
ATOM   3409 O  O     . ILE C 3  336 ? 64.642 156.793 36.690 1.00 27.66  ? 342  ILE A O     1 
ATOM   3410 C  CB    . ILE C 3  336 ? 62.617 158.966 35.090 1.00 22.59  ? 342  ILE A CB    1 
ATOM   3411 C  CG1   . ILE C 3  336 ? 61.611 158.985 33.933 1.00 23.39  ? 342  ILE A CG1   1 
ATOM   3412 C  CG2   . ILE C 3  336 ? 64.026 159.242 34.597 1.00 21.60  ? 342  ILE A CG2   1 
ATOM   3413 C  CD1   . ILE C 3  336 ? 61.445 160.339 33.257 1.00 20.60  ? 342  ILE A CD1   1 
ATOM   3414 N  N     . GLN C 3  337 ? 63.468 158.261 37.928 1.00 27.06  ? 343  GLN A N     1 
ATOM   3415 C  CA    . GLN C 3  337 ? 64.434 158.295 39.014 1.00 27.25  ? 343  GLN A CA    1 
ATOM   3416 C  C     . GLN C 3  337 ? 64.677 156.912 39.616 1.00 27.84  ? 343  GLN A C     1 
ATOM   3417 O  O     . GLN C 3  337 ? 65.820 156.525 39.865 1.00 28.12  ? 343  GLN A O     1 
ATOM   3418 C  CB    . GLN C 3  337 ? 63.952 159.277 40.084 1.00 28.22  ? 343  GLN A CB    1 
ATOM   3419 C  CG    . GLN C 3  337 ? 64.587 159.070 41.421 1.00 30.99  ? 343  GLN A CG    1 
ATOM   3420 C  CD    . GLN C 3  337 ? 63.814 158.098 42.266 1.00 31.97  ? 343  GLN A CD    1 
ATOM   3421 O  OE1   . GLN C 3  337 ? 64.388 157.390 43.084 1.00 34.39  ? 343  GLN A OE1   1 
ATOM   3422 N  NE2   . GLN C 3  337 ? 62.496 158.067 42.084 1.00 33.13  ? 343  GLN A NE2   1 
ATOM   3423 N  N     . LYS C 3  338 ? 63.599 156.173 39.852 1.00 27.81  ? 344  LYS A N     1 
ATOM   3424 C  CA    . LYS C 3  338 ? 63.689 154.833 40.416 1.00 28.23  ? 344  LYS A CA    1 
ATOM   3425 C  C     . LYS C 3  338 ? 64.579 153.935 39.543 1.00 29.16  ? 344  LYS A C     1 
ATOM   3426 O  O     . LYS C 3  338 ? 65.627 153.455 39.981 1.00 29.79  ? 344  LYS A O     1 
ATOM   3427 C  CB    . LYS C 3  338 ? 62.285 154.243 40.519 1.00 29.07  ? 344  LYS A CB    1 
ATOM   3428 C  CG    . LYS C 3  338 ? 62.212 152.819 41.030 1.00 31.47  ? 344  LYS A CG    1 
ATOM   3429 C  CD    . LYS C 3  338 ? 60.770 152.323 40.971 1.00 32.50  ? 344  LYS A CD    1 
ATOM   3430 C  CE    . LYS C 3  338 ? 60.634 150.910 41.509 1.00 34.50  ? 344  LYS A CE    1 
ATOM   3431 N  NZ    . LYS C 3  338 ? 60.900 150.856 42.973 1.00 37.53  ? 344  LYS A NZ    1 
ATOM   3432 N  N     . LYS C 3  339 ? 64.162 153.731 38.298 1.00 28.46  ? 345  LYS A N     1 
ATOM   3433 C  CA    . LYS C 3  339 ? 64.902 152.892 37.367 1.00 27.89  ? 345  LYS A CA    1 
ATOM   3434 C  C     . LYS C 3  339 ? 66.359 153.307 37.143 1.00 28.02  ? 345  LYS A C     1 
ATOM   3435 O  O     . LYS C 3  339 ? 67.229 152.449 36.998 1.00 29.37  ? 345  LYS A O     1 
ATOM   3436 C  CB    . LYS C 3  339 ? 64.167 152.830 36.025 1.00 27.33  ? 345  LYS A CB    1 
ATOM   3437 C  CG    . LYS C 3  339 ? 62.815 152.119 36.077 1.00 27.47  ? 345  LYS A CG    1 
ATOM   3438 C  CD    . LYS C 3  339 ? 62.964 150.658 36.498 1.00 27.17  ? 345  LYS A CD    1 
ATOM   3439 C  CE    . LYS C 3  339 ? 61.630 149.920 36.440 1.00 28.38  ? 345  LYS A CE    1 
ATOM   3440 N  NZ    . LYS C 3  339 ? 61.785 148.437 36.622 1.00 28.52  ? 345  LYS A NZ    1 
ATOM   3441 N  N     . LEU C 3  340 ? 66.638 154.607 37.106 1.00 26.95  ? 346  LEU A N     1 
ATOM   3442 C  CA    . LEU C 3  340 ? 68.013 155.049 36.898 1.00 26.92  ? 346  LEU A CA    1 
ATOM   3443 C  C     . LEU C 3  340 ? 68.910 154.843 38.125 1.00 27.40  ? 346  LEU A C     1 
ATOM   3444 O  O     . LEU C 3  340 ? 70.096 154.553 37.985 1.00 27.16  ? 346  LEU A O     1 
ATOM   3445 C  CB    . LEU C 3  340 ? 68.049 156.511 36.447 1.00 26.21  ? 346  LEU A CB    1 
ATOM   3446 C  CG    . LEU C 3  340 ? 67.384 156.780 35.093 1.00 27.30  ? 346  LEU A CG    1 
ATOM   3447 C  CD1   . LEU C 3  340 ? 67.678 158.199 34.646 1.00 25.74  ? 346  LEU A CD1   1 
ATOM   3448 C  CD2   . LEU C 3  340 ? 67.897 155.793 34.064 1.00 24.59  ? 346  LEU A CD2   1 
ATOM   3449 N  N     . GLN C 3  341 ? 68.366 154.996 39.328 1.00 28.29  ? 347  GLN A N     1 
ATOM   3450 C  CA    . GLN C 3  341 ? 69.189 154.766 40.510 1.00 29.69  ? 347  GLN A CA    1 
ATOM   3451 C  C     . GLN C 3  341 ? 69.404 153.256 40.609 1.00 29.63  ? 347  GLN A C     1 
ATOM   3452 O  O     . GLN C 3  341 ? 70.441 152.795 41.090 1.00 29.06  ? 347  GLN A O     1 
ATOM   3453 C  CB    . GLN C 3  341 ? 68.524 155.304 41.787 1.00 28.60  ? 347  GLN A CB    1 
ATOM   3454 C  CG    . GLN C 3  341 ? 68.562 156.830 41.906 1.00 29.26  ? 347  GLN A CG    1 
ATOM   3455 C  CD    . GLN C 3  341 ? 68.297 157.340 43.324 1.00 28.83  ? 347  GLN A CD    1 
ATOM   3456 O  OE1   . GLN C 3  341 ? 69.153 157.247 44.207 1.00 25.83  ? 347  GLN A OE1   1 
ATOM   3457 N  NE2   . GLN C 3  341 ? 67.103 157.882 43.540 1.00 29.30  ? 347  GLN A NE2   1 
ATOM   3458 N  N     . GLU C 3  342 ? 68.425 152.489 40.135 1.00 29.47  ? 348  GLU A N     1 
ATOM   3459 C  CA    . GLU C 3  342 ? 68.542 151.039 40.153 1.00 28.50  ? 348  GLU A CA    1 
ATOM   3460 C  C     . GLU C 3  342 ? 69.516 150.621 39.075 1.00 28.86  ? 348  GLU A C     1 
ATOM   3461 O  O     . GLU C 3  342 ? 69.792 149.441 38.903 1.00 31.26  ? 348  GLU A O     1 
ATOM   3462 C  CB    . GLU C 3  342 ? 67.193 150.373 39.906 1.00 27.89  ? 348  GLU A CB    1 
ATOM   3463 C  CG    . GLU C 3  342 ? 66.231 150.491 41.071 1.00 27.72  ? 348  GLU A CG    1 
ATOM   3464 C  CD    . GLU C 3  342 ? 64.949 149.721 40.845 1.00 28.60  ? 348  GLU A CD    1 
ATOM   3465 O  OE1   . GLU C 3  342 ? 64.803 149.130 39.755 1.00 25.82  ? 348  GLU A OE1   1 
ATOM   3466 O  OE2   . GLU C 3  342 ? 64.086 149.707 41.754 1.00 30.31  ? 348  GLU A OE2   1 
ATOM   3467 N  N     . ALA C 3  343 ? 70.039 151.600 38.347 1.00 28.32  ? 349  ALA A N     1 
ATOM   3468 C  CA    . ALA C 3  343 ? 71.000 151.327 37.293 1.00 28.01  ? 349  ALA A CA    1 
ATOM   3469 C  C     . ALA C 3  343 ? 72.365 151.882 37.671 1.00 28.45  ? 349  ALA A C     1 
ATOM   3470 O  O     . ALA C 3  343 ? 73.301 151.849 36.871 1.00 29.48  ? 349  ALA A O     1 
ATOM   3471 C  CB    . ALA C 3  343 ? 70.530 151.939 35.975 1.00 29.67  ? 349  ALA A CB    1 
ATOM   3472 N  N     . GLY C 3  344 ? 72.472 152.409 38.887 1.00 29.21  ? 350  GLY A N     1 
ATOM   3473 C  CA    . GLY C 3  344 ? 73.743 152.940 39.345 1.00 29.61  ? 350  GLY A CA    1 
ATOM   3474 C  C     . GLY C 3  344 ? 73.877 154.450 39.342 1.00 31.03  ? 350  GLY A C     1 
ATOM   3475 O  O     . GLY C 3  344 ? 74.896 154.984 39.793 1.00 30.18  ? 350  GLY A O     1 
ATOM   3476 N  N     . TRP C 3  345 ? 72.867 155.150 38.835 1.00 31.33  ? 351  TRP A N     1 
ATOM   3477 C  CA    . TRP C 3  345 ? 72.923 156.605 38.804 1.00 30.59  ? 351  TRP A CA    1 
ATOM   3478 C  C     . TRP C 3  345 ? 72.871 157.146 40.222 1.00 31.24  ? 351  TRP A C     1 
ATOM   3479 O  O     . TRP C 3  345 ? 72.029 156.735 41.015 1.00 31.81  ? 351  TRP A O     1 
ATOM   3480 C  CB    . TRP C 3  345 ? 71.759 157.184 37.995 1.00 28.90  ? 351  TRP A CB    1 
ATOM   3481 C  CG    . TRP C 3  345 ? 71.629 158.690 38.126 1.00 28.54  ? 351  TRP A CG    1 
ATOM   3482 C  CD1   . TRP C 3  345 ? 72.617 159.623 37.935 1.00 27.03  ? 351  TRP A CD1   1 
ATOM   3483 C  CD2   . TRP C 3  345 ? 70.444 159.427 38.465 1.00 26.50  ? 351  TRP A CD2   1 
ATOM   3484 N  NE1   . TRP C 3  345 ? 72.118 160.888 38.136 1.00 26.64  ? 351  TRP A NE1   1 
ATOM   3485 C  CE2   . TRP C 3  345 ? 70.789 160.799 38.460 1.00 26.51  ? 351  TRP A CE2   1 
ATOM   3486 C  CE3   . TRP C 3  345 ? 69.125 159.063 38.771 1.00 26.02  ? 351  TRP A CE3   1 
ATOM   3487 C  CZ2   . TRP C 3  345 ? 69.861 161.808 38.747 1.00 25.39  ? 351  TRP A CZ2   1 
ATOM   3488 C  CZ3   . TRP C 3  345 ? 68.202 160.068 39.058 1.00 26.45  ? 351  TRP A CZ3   1 
ATOM   3489 C  CH2   . TRP C 3  345 ? 68.578 161.424 39.043 1.00 25.92  ? 351  TRP A CH2   1 
ATOM   3490 N  N     . VAL C 3  346 ? 73.783 158.061 40.535 1.00 33.07  ? 352  VAL A N     1 
ATOM   3491 C  CA    . VAL C 3  346 ? 73.831 158.671 41.858 1.00 35.13  ? 352  VAL A CA    1 
ATOM   3492 C  C     . VAL C 3  346 ? 73.442 160.140 41.735 1.00 36.01  ? 352  VAL A C     1 
ATOM   3493 O  O     . VAL C 3  346 ? 74.247 160.972 41.317 1.00 36.13  ? 352  VAL A O     1 
ATOM   3494 C  CB    . VAL C 3  346 ? 75.240 158.594 42.472 1.00 35.13  ? 352  VAL A CB    1 
ATOM   3495 C  CG1   . VAL C 3  346 ? 75.216 159.163 43.880 1.00 33.90  ? 352  VAL A CG1   1 
ATOM   3496 C  CG2   . VAL C 3  346 ? 75.727 157.159 42.485 1.00 35.05  ? 352  VAL A CG2   1 
ATOM   3497 N  N     . PRO C 3  347 ? 72.194 160.476 42.094 1.00 36.97  ? 353  PRO A N     1 
ATOM   3498 C  CA    . PRO C 3  347 ? 71.710 161.856 42.015 1.00 37.64  ? 353  PRO A CA    1 
ATOM   3499 C  C     . PRO C 3  347 ? 72.571 162.862 42.777 1.00 39.14  ? 353  PRO A C     1 
ATOM   3500 O  O     . PRO C 3  347 ? 72.944 162.639 43.928 1.00 39.47  ? 353  PRO A O     1 
ATOM   3501 C  CB    . PRO C 3  347 ? 70.297 161.751 42.575 1.00 36.45  ? 353  PRO A CB    1 
ATOM   3502 C  CG    . PRO C 3  347 ? 69.877 160.383 42.140 1.00 37.24  ? 353  PRO A CG    1 
ATOM   3503 C  CD    . PRO C 3  347 ? 71.102 159.563 42.475 1.00 36.81  ? 353  PRO A CD    1 
ATOM   3504 N  N     . THR C 3  348 ? 72.880 163.969 42.112 1.00 41.26  ? 354  THR A N     1 
ATOM   3505 C  CA    . THR C 3  348 ? 73.682 165.037 42.692 1.00 42.99  ? 354  THR A CA    1 
ATOM   3506 C  C     . THR C 3  348 ? 72.792 166.152 43.234 1.00 43.63  ? 354  THR A C     1 
ATOM   3507 O  O     . THR C 3  348 ? 73.000 166.629 44.347 1.00 44.10  ? 354  THR A O     1 
ATOM   3508 C  CB    . THR C 3  348 ? 74.653 165.629 41.644 1.00 44.04  ? 354  THR A CB    1 
ATOM   3509 O  OG1   . THR C 3  348 ? 75.764 164.741 41.472 1.00 45.80  ? 354  THR A OG1   1 
ATOM   3510 C  CG2   . THR C 3  348 ? 75.155 167.001 42.075 1.00 44.38  ? 354  THR A CG2   1 
ATOM   3511 N  N     . LYS C 3  349 ? 71.801 166.568 42.451 1.00 44.09  ? 355  LYS A N     1 
ATOM   3512 C  CA    . LYS C 3  349 ? 70.902 167.627 42.896 1.00 44.98  ? 355  LYS A CA    1 
ATOM   3513 C  C     . LYS C 3  349 ? 69.481 167.150 43.163 1.00 43.73  ? 355  LYS A C     1 
ATOM   3514 O  O     . LYS C 3  349 ? 68.914 166.375 42.398 1.00 42.90  ? 355  LYS A O     1 
ATOM   3515 C  CB    . LYS C 3  349 ? 70.907 168.780 41.888 1.00 47.32  ? 355  LYS A CB    1 
ATOM   3516 C  CG    . LYS C 3  349 ? 70.694 168.380 40.441 1.00 51.27  ? 355  LYS A CG    1 
ATOM   3517 C  CD    . LYS C 3  349 ? 71.418 169.348 39.491 1.00 54.70  ? 355  LYS A CD    1 
ATOM   3518 C  CE    . LYS C 3  349 ? 71.048 170.814 39.745 1.00 55.80  ? 355  LYS A CE    1 
ATOM   3519 N  NZ    . LYS C 3  349 ? 69.601 171.111 39.511 1.00 56.98  ? 355  LYS A NZ    1 
ATOM   3520 N  N     . TYR C 3  350 ? 68.920 167.618 44.273 1.00 44.14  ? 356  TYR A N     1 
ATOM   3521 C  CA    . TYR C 3  350 ? 67.569 167.246 44.679 1.00 45.40  ? 356  TYR A CA    1 
ATOM   3522 C  C     . TYR C 3  350 ? 66.699 168.491 44.810 1.00 46.69  ? 356  TYR A C     1 
ATOM   3523 O  O     . TYR C 3  350 ? 67.207 169.612 44.803 1.00 47.23  ? 356  TYR A O     1 
ATOM   3524 C  CB    . TYR C 3  350 ? 67.610 166.500 46.018 1.00 44.44  ? 356  TYR A CB    1 
ATOM   3525 C  CG    . TYR C 3  350 ? 68.440 165.233 45.991 1.00 42.99  ? 356  TYR A CG    1 
ATOM   3526 C  CD1   . TYR C 3  350 ? 69.816 165.283 45.768 1.00 42.37  ? 356  TYR A CD1   1 
ATOM   3527 C  CD2   . TYR C 3  350 ? 67.846 163.983 46.155 1.00 41.51  ? 356  TYR A CD2   1 
ATOM   3528 C  CE1   . TYR C 3  350 ? 70.578 164.124 45.705 1.00 41.91  ? 356  TYR A CE1   1 
ATOM   3529 C  CE2   . TYR C 3  350 ? 68.601 162.814 46.094 1.00 41.09  ? 356  TYR A CE2   1 
ATOM   3530 C  CZ    . TYR C 3  350 ? 69.966 162.893 45.867 1.00 42.36  ? 356  TYR A CZ    1 
ATOM   3531 O  OH    . TYR C 3  350 ? 70.723 161.744 45.790 1.00 44.75  ? 356  TYR A OH    1 
ATOM   3532 N  N     . THR C 3  351 ? 65.388 168.297 44.919 1.00 47.69  ? 357  THR A N     1 
ATOM   3533 C  CA    . THR C 3  351 ? 64.471 169.422 45.055 1.00 49.44  ? 357  THR A CA    1 
ATOM   3534 C  C     . THR C 3  351 ? 64.385 169.786 46.524 1.00 51.36  ? 357  THR A C     1 
ATOM   3535 O  O     . THR C 3  351 ? 64.753 168.988 47.385 1.00 51.83  ? 357  THR A O     1 
ATOM   3536 C  CB    . THR C 3  351 ? 63.046 169.077 44.572 1.00 48.91  ? 357  THR A CB    1 
ATOM   3537 O  OG1   . THR C 3  351 ? 62.499 168.044 45.399 1.00 47.05  ? 357  THR A OG1   1 
ATOM   3538 C  CG2   . THR C 3  351 ? 63.067 168.617 43.123 1.00 48.21  ? 357  THR A CG2   1 
ATOM   3539 N  N     . ASP C 3  352 ? 63.902 170.990 46.813 1.00 53.51  ? 358  ASP A N     1 
ATOM   3540 C  CA    . ASP C 3  352 ? 63.766 171.414 48.196 1.00 55.41  ? 358  ASP A CA    1 
ATOM   3541 C  C     . ASP C 3  352 ? 62.583 170.699 48.838 1.00 54.80  ? 358  ASP A C     1 
ATOM   3542 O  O     . ASP C 3  352 ? 61.760 171.309 49.518 1.00 55.47  ? 358  ASP A O     1 
ATOM   3543 C  CB    . ASP C 3  352 ? 63.618 172.944 48.293 1.00 58.81  ? 358  ASP A CB    1 
ATOM   3544 C  CG    . ASP C 3  352 ? 62.689 173.526 47.234 1.00 61.95  ? 358  ASP A CG    1 
ATOM   3545 O  OD1   . ASP C 3  352 ? 62.905 173.257 46.029 1.00 62.99  ? 358  ASP A OD1   1 
ATOM   3546 O  OD2   . ASP C 3  352 ? 61.751 174.267 47.610 1.00 62.41  ? 358  ASP A OD2   1 
ATOM   3547 N  N     . LYS C 3  353 ? 62.511 169.392 48.590 1.00 53.71  ? 359  LYS A N     1 
ATOM   3548 C  CA    . LYS C 3  353 ? 61.476 168.528 49.143 1.00 52.34  ? 359  LYS A CA    1 
ATOM   3549 C  C     . LYS C 3  353 ? 61.963 167.076 49.141 1.00 50.78  ? 359  LYS A C     1 
ATOM   3550 O  O     . LYS C 3  353 ? 61.181 166.140 49.319 1.00 50.98  ? 359  LYS A O     1 
ATOM   3551 C  CB    . LYS C 3  353 ? 60.168 168.639 48.353 1.00 53.42  ? 359  LYS A CB    1 
ATOM   3552 C  CG    . LYS C 3  353 ? 59.001 167.954 49.059 1.00 55.81  ? 359  LYS A CG    1 
ATOM   3553 C  CD    . LYS C 3  353 ? 57.753 167.858 48.199 1.00 58.77  ? 359  LYS A CD    1 
ATOM   3554 C  CE    . LYS C 3  353 ? 56.694 166.983 48.881 1.00 59.74  ? 359  LYS A CE    1 
ATOM   3555 N  NZ    . LYS C 3  353 ? 55.494 166.723 48.024 1.00 58.56  ? 359  LYS A NZ    1 
ATOM   3556 N  N     . GLY C 3  354 ? 63.262 166.894 48.922 1.00 48.45  ? 360  GLY A N     1 
ATOM   3557 C  CA    . GLY C 3  354 ? 63.834 165.559 48.941 1.00 45.49  ? 360  GLY A CA    1 
ATOM   3558 C  C     . GLY C 3  354 ? 63.933 164.809 47.627 1.00 43.26  ? 360  GLY A C     1 
ATOM   3559 O  O     . GLY C 3  354 ? 64.908 164.092 47.391 1.00 42.72  ? 360  GLY A O     1 
ATOM   3560 N  N     . ALA C 3  355 ? 62.928 164.956 46.772 1.00 40.50  ? 361  ALA A N     1 
ATOM   3561 C  CA    . ALA C 3  355 ? 62.931 164.263 45.492 1.00 37.51  ? 361  ALA A CA    1 
ATOM   3562 C  C     . ALA C 3  355 ? 64.099 164.707 44.625 1.00 35.37  ? 361  ALA A C     1 
ATOM   3563 O  O     . ALA C 3  355 ? 64.453 165.884 44.592 1.00 36.09  ? 361  ALA A O     1 
ATOM   3564 C  CB    . ALA C 3  355 ? 61.617 164.507 44.761 1.00 37.16  ? 361  ALA A CB    1 
ATOM   3565 N  N     . PRO C 3  356 ? 64.727 163.760 43.918 1.00 33.34  ? 362  PRO A N     1 
ATOM   3566 C  CA    . PRO C 3  356 ? 65.854 164.115 43.055 1.00 31.34  ? 362  PRO A CA    1 
ATOM   3567 C  C     . PRO C 3  356 ? 65.345 164.870 41.830 1.00 30.45  ? 362  PRO A C     1 
ATOM   3568 O  O     . PRO C 3  356 ? 64.260 164.581 41.324 1.00 29.00  ? 362  PRO A O     1 
ATOM   3569 C  CB    . PRO C 3  356 ? 66.445 162.760 42.696 1.00 31.26  ? 362  PRO A CB    1 
ATOM   3570 C  CG    . PRO C 3  356 ? 65.241 161.878 42.671 1.00 31.30  ? 362  PRO A CG    1 
ATOM   3571 C  CD    . PRO C 3  356 ? 64.484 162.306 43.900 1.00 31.99  ? 362  PRO A CD    1 
ATOM   3572 N  N     . VAL C 3  357 ? 66.125 165.838 41.361 1.00 29.42  ? 363  VAL A N     1 
ATOM   3573 C  CA    . VAL C 3  357 ? 65.733 166.623 40.198 1.00 28.82  ? 363  VAL A CA    1 
ATOM   3574 C  C     . VAL C 3  357 ? 65.845 165.815 38.911 1.00 29.29  ? 363  VAL A C     1 
ATOM   3575 O  O     . VAL C 3  357 ? 66.868 165.189 38.645 1.00 30.03  ? 363  VAL A O     1 
ATOM   3576 C  CB    . VAL C 3  357 ? 66.599 167.892 40.063 1.00 28.57  ? 363  VAL A CB    1 
ATOM   3577 C  CG1   . VAL C 3  357 ? 66.285 168.598 38.747 1.00 27.02  ? 363  VAL A CG1   1 
ATOM   3578 C  CG2   . VAL C 3  357 ? 66.335 168.828 41.236 1.00 25.24  ? 363  VAL A CG2   1 
ATOM   3579 N  N     . VAL C 3  358 ? 64.789 165.831 38.107 1.00 29.16  ? 364  VAL A N     1 
ATOM   3580 C  CA    . VAL C 3  358 ? 64.804 165.095 36.854 1.00 28.41  ? 364  VAL A CA    1 
ATOM   3581 C  C     . VAL C 3  358 ? 64.331 165.938 35.682 1.00 29.58  ? 364  VAL A C     1 
ATOM   3582 O  O     . VAL C 3  358 ? 63.244 165.730 35.138 1.00 27.15  ? 364  VAL A O     1 
ATOM   3583 C  CB    . VAL C 3  358 ? 63.946 163.829 36.939 1.00 27.97  ? 364  VAL A CB    1 
ATOM   3584 C  CG1   . VAL C 3  358 ? 64.022 163.062 35.625 1.00 26.15  ? 364  VAL A CG1   1 
ATOM   3585 C  CG2   . VAL C 3  358 ? 64.431 162.960 38.099 1.00 27.76  ? 364  VAL A CG2   1 
ATOM   3586 N  N     . ASP C 3  359 ? 65.159 166.910 35.315 1.00 29.78  ? 365  ASP A N     1 
ATOM   3587 C  CA    . ASP C 3  359 ? 64.871 167.778 34.188 1.00 31.05  ? 365  ASP A CA    1 
ATOM   3588 C  C     . ASP C 3  359 ? 65.786 167.345 33.048 1.00 32.59  ? 365  ASP A C     1 
ATOM   3589 O  O     . ASP C 3  359 ? 66.572 166.407 33.198 1.00 30.93  ? 365  ASP A O     1 
ATOM   3590 C  CB    . ASP C 3  359 ? 65.117 169.252 34.550 1.00 30.33  ? 365  ASP A CB    1 
ATOM   3591 C  CG    . ASP C 3  359 ? 66.488 169.497 35.169 1.00 29.47  ? 365  ASP A CG    1 
ATOM   3592 O  OD1   . ASP C 3  359 ? 67.485 168.908 34.697 1.00 26.58  ? 365  ASP A OD1   1 
ATOM   3593 O  OD2   . ASP C 3  359 ? 66.569 170.302 36.122 1.00 29.93  ? 365  ASP A OD2   1 
ATOM   3594 N  N     . ASP C 3  360 ? 65.688 168.022 31.911 1.00 34.75  ? 366  ASP A N     1 
ATOM   3595 C  CA    . ASP C 3  360 ? 66.509 167.672 30.759 1.00 36.00  ? 366  ASP A CA    1 
ATOM   3596 C  C     . ASP C 3  360 ? 67.996 167.850 31.052 1.00 35.52  ? 366  ASP A C     1 
ATOM   3597 O  O     . ASP C 3  360 ? 68.833 167.121 30.519 1.00 35.00  ? 366  ASP A O     1 
ATOM   3598 C  CB    . ASP C 3  360 ? 66.124 168.531 29.555 1.00 38.56  ? 366  ASP A CB    1 
ATOM   3599 C  CG    . ASP C 3  360 ? 66.316 167.800 28.240 1.00 42.13  ? 366  ASP A CG    1 
ATOM   3600 O  OD1   . ASP C 3  360 ? 65.480 166.921 27.928 1.00 43.91  ? 366  ASP A OD1   1 
ATOM   3601 O  OD2   . ASP C 3  360 ? 67.305 168.093 27.529 1.00 42.88  ? 366  ASP A OD2   1 
ATOM   3602 N  N     . GLU C 3  361 ? 68.314 168.821 31.902 1.00 35.34  ? 367  GLU A N     1 
ATOM   3603 C  CA    . GLU C 3  361 ? 69.698 169.108 32.261 1.00 35.71  ? 367  GLU A CA    1 
ATOM   3604 C  C     . GLU C 3  361 ? 70.373 167.907 32.915 1.00 34.51  ? 367  GLU A C     1 
ATOM   3605 O  O     . GLU C 3  361 ? 71.423 167.459 32.463 1.00 34.55  ? 367  GLU A O     1 
ATOM   3606 C  CB    . GLU C 3  361 ? 69.758 170.316 33.202 1.00 38.54  ? 367  GLU A CB    1 
ATOM   3607 C  CG    . GLU C 3  361 ? 71.160 170.848 33.455 1.00 43.30  ? 367  GLU A CG    1 
ATOM   3608 C  CD    . GLU C 3  361 ? 71.174 172.004 34.444 1.00 47.80  ? 367  GLU A CD    1 
ATOM   3609 O  OE1   . GLU C 3  361 ? 70.766 171.798 35.612 1.00 50.15  ? 367  GLU A OE1   1 
ATOM   3610 O  OE2   . GLU C 3  361 ? 71.592 173.118 34.056 1.00 48.87  ? 367  GLU A OE2   1 
ATOM   3611 N  N     . VAL C 3  362 ? 69.772 167.383 33.977 1.00 33.33  ? 368  VAL A N     1 
ATOM   3612 C  CA    . VAL C 3  362 ? 70.350 166.236 34.660 1.00 33.52  ? 368  VAL A CA    1 
ATOM   3613 C  C     . VAL C 3  362 ? 70.256 164.961 33.825 1.00 34.01  ? 368  VAL A C     1 
ATOM   3614 O  O     . VAL C 3  362 ? 71.181 164.148 33.825 1.00 34.31  ? 368  VAL A O     1 
ATOM   3615 C  CB    . VAL C 3  362 ? 69.701 166.017 36.059 1.00 31.65  ? 368  VAL A CB    1 
ATOM   3616 C  CG1   . VAL C 3  362 ? 68.315 166.601 36.085 1.00 32.44  ? 368  VAL A CG1   1 
ATOM   3617 C  CG2   . VAL C 3  362 ? 69.656 164.532 36.398 1.00 31.26  ? 368  VAL A CG2   1 
ATOM   3618 N  N     . LEU C 3  363 ? 69.152 164.781 33.110 1.00 33.80  ? 369  LEU A N     1 
ATOM   3619 C  CA    . LEU C 3  363 ? 69.009 163.591 32.281 1.00 33.31  ? 369  LEU A CA    1 
ATOM   3620 C  C     . LEU C 3  363 ? 70.174 163.537 31.301 1.00 34.22  ? 369  LEU A C     1 
ATOM   3621 O  O     . LEU C 3  363 ? 70.819 162.500 31.136 1.00 33.78  ? 369  LEU A O     1 
ATOM   3622 C  CB    . LEU C 3  363 ? 67.678 163.619 31.523 1.00 30.96  ? 369  LEU A CB    1 
ATOM   3623 C  CG    . LEU C 3  363 ? 66.443 163.295 32.372 1.00 29.76  ? 369  LEU A CG    1 
ATOM   3624 C  CD1   . LEU C 3  363 ? 65.171 163.582 31.586 1.00 26.57  ? 369  LEU A CD1   1 
ATOM   3625 C  CD2   . LEU C 3  363 ? 66.497 161.836 32.800 1.00 28.29  ? 369  LEU A CD2   1 
ATOM   3626 N  N     . GLU C 3  364 ? 70.454 164.669 30.670 1.00 34.96  ? 370  GLU A N     1 
ATOM   3627 C  CA    . GLU C 3  364 ? 71.541 164.750 29.710 1.00 37.48  ? 370  GLU A CA    1 
ATOM   3628 C  C     . GLU C 3  364 ? 72.881 164.384 30.348 1.00 37.37  ? 370  GLU A C     1 
ATOM   3629 O  O     . GLU C 3  364 ? 73.787 163.887 29.678 1.00 36.46  ? 370  GLU A O     1 
ATOM   3630 C  CB    . GLU C 3  364 ? 71.612 166.165 29.129 1.00 41.03  ? 370  GLU A CB    1 
ATOM   3631 C  CG    . GLU C 3  364 ? 72.622 166.322 28.010 1.00 47.06  ? 370  GLU A CG    1 
ATOM   3632 C  CD    . GLU C 3  364 ? 72.483 165.239 26.950 1.00 51.54  ? 370  GLU A CD    1 
ATOM   3633 O  OE1   . GLU C 3  364 ? 71.347 165.019 26.471 1.00 53.11  ? 370  GLU A OE1   1 
ATOM   3634 O  OE2   . GLU C 3  364 ? 73.510 164.612 26.595 1.00 53.04  ? 370  GLU A OE2   1 
ATOM   3635 N  N     . GLY C 3  365 ? 72.996 164.621 31.649 1.00 36.88  ? 371  GLY A N     1 
ATOM   3636 C  CA    . GLY C 3  365 ? 74.236 164.330 32.342 1.00 36.70  ? 371  GLY A CA    1 
ATOM   3637 C  C     . GLY C 3  365 ? 74.347 162.946 32.949 1.00 36.52  ? 371  GLY A C     1 
ATOM   3638 O  O     . GLY C 3  365 ? 75.448 162.477 33.231 1.00 36.82  ? 371  GLY A O     1 
ATOM   3639 N  N     . VAL C 3  366 ? 73.212 162.289 33.150 1.00 36.29  ? 372  VAL A N     1 
ATOM   3640 C  CA    . VAL C 3  366 ? 73.193 160.952 33.732 1.00 36.93  ? 372  VAL A CA    1 
ATOM   3641 C  C     . VAL C 3  366 ? 74.041 159.937 32.961 1.00 37.68  ? 372  VAL A C     1 
ATOM   3642 O  O     . VAL C 3  366 ? 74.079 159.947 31.727 1.00 37.67  ? 372  VAL A O     1 
ATOM   3643 C  CB    . VAL C 3  366 ? 71.744 160.423 33.831 1.00 36.43  ? 372  VAL A CB    1 
ATOM   3644 C  CG1   . VAL C 3  366 ? 71.741 158.957 34.236 1.00 35.94  ? 372  VAL A CG1   1 
ATOM   3645 C  CG2   . VAL C 3  366 ? 70.969 161.252 34.843 1.00 37.06  ? 372  VAL A CG2   1 
ATOM   3646 N  N     . ARG C 3  367 ? 74.721 159.067 33.705 1.00 38.30  ? 373  ARG A N     1 
ATOM   3647 C  CA    . ARG C 3  367 ? 75.563 158.018 33.128 1.00 38.62  ? 373  ARG A CA    1 
ATOM   3648 C  C     . ARG C 3  367 ? 75.358 156.705 33.883 1.00 37.77  ? 373  ARG A C     1 
ATOM   3649 O  O     . ARG C 3  367 ? 75.353 156.681 35.114 1.00 38.67  ? 373  ARG A O     1 
ATOM   3650 C  CB    . ARG C 3  367 ? 77.042 158.419 33.191 1.00 39.46  ? 373  ARG A CB    1 
ATOM   3651 C  CG    . ARG C 3  367 ? 77.427 159.579 32.281 1.00 40.18  ? 373  ARG A CG    1 
ATOM   3652 C  CD    . ARG C 3  367 ? 77.352 159.187 30.810 1.00 40.98  ? 373  ARG A CD    1 
ATOM   3653 N  NE    . ARG C 3  367 ? 77.625 160.315 29.918 1.00 42.06  ? 373  ARG A NE    1 
ATOM   3654 C  CZ    . ARG C 3  367 ? 76.881 161.418 29.845 1.00 41.17  ? 373  ARG A CZ    1 
ATOM   3655 N  NH1   . ARG C 3  367 ? 75.806 161.558 30.610 1.00 40.05  ? 373  ARG A NH1   1 
ATOM   3656 N  NH2   . ARG C 3  367 ? 77.211 162.386 29.004 1.00 40.48  ? 373  ARG A NH2   1 
ATOM   3657 N  N     . VAL C 3  368 ? 75.174 155.621 33.138 1.00 37.35  ? 374  VAL A N     1 
ATOM   3658 C  CA    . VAL C 3  368 ? 74.981 154.294 33.720 1.00 37.33  ? 374  VAL A CA    1 
ATOM   3659 C  C     . VAL C 3  368 ? 75.781 153.297 32.896 1.00 38.15  ? 374  VAL A C     1 
ATOM   3660 O  O     . VAL C 3  368 ? 76.007 153.511 31.704 1.00 38.80  ? 374  VAL A O     1 
ATOM   3661 C  CB    . VAL C 3  368 ? 73.498 153.870 33.713 1.00 37.14  ? 374  VAL A CB    1 
ATOM   3662 C  CG1   . VAL C 3  368 ? 72.703 154.752 34.659 1.00 36.15  ? 374  VAL A CG1   1 
ATOM   3663 C  CG2   . VAL C 3  368 ? 72.937 153.956 32.299 1.00 37.08  ? 374  VAL A CG2   1 
ATOM   3664 N  N     . ASP C 3  369 ? 76.200 152.203 33.521 1.00 38.82  ? 375  ASP A N     1 
ATOM   3665 C  CA    . ASP C 3  369 ? 77.004 151.214 32.820 1.00 38.41  ? 375  ASP A CA    1 
ATOM   3666 C  C     . ASP C 3  369 ? 76.297 150.409 31.740 1.00 36.65  ? 375  ASP A C     1 
ATOM   3667 O  O     . ASP C 3  369 ? 76.901 150.121 30.713 1.00 36.97  ? 375  ASP A O     1 
ATOM   3668 C  CB    . ASP C 3  369 ? 77.677 150.280 33.826 1.00 41.15  ? 375  ASP A CB    1 
ATOM   3669 C  CG    . ASP C 3  369 ? 78.643 151.020 34.735 1.00 44.99  ? 375  ASP A CG    1 
ATOM   3670 O  OD1   . ASP C 3  369 ? 79.380 151.897 34.226 1.00 46.04  ? 375  ASP A OD1   1 
ATOM   3671 O  OD2   . ASP C 3  369 ? 78.673 150.731 35.952 1.00 48.38  ? 375  ASP A OD2   1 
ATOM   3672 N  N     . ASP C 3  370 ? 75.036 150.043 31.953 1.00 34.80  ? 376  ASP A N     1 
ATOM   3673 C  CA    . ASP C 3  370 ? 74.308 149.280 30.940 1.00 34.32  ? 376  ASP A CA    1 
ATOM   3674 C  C     . ASP C 3  370 ? 74.058 150.166 29.733 1.00 32.63  ? 376  ASP A C     1 
ATOM   3675 O  O     . ASP C 3  370 ? 73.282 151.114 29.801 1.00 32.95  ? 376  ASP A O     1 
ATOM   3676 C  CB    . ASP C 3  370 ? 72.964 148.781 31.473 1.00 37.00  ? 376  ASP A CB    1 
ATOM   3677 C  CG    . ASP C 3  370 ? 72.153 148.060 30.407 1.00 39.76  ? 376  ASP A CG    1 
ATOM   3678 O  OD1   . ASP C 3  370 ? 72.642 147.048 29.869 1.00 43.14  ? 376  ASP A OD1   1 
ATOM   3679 O  OD2   . ASP C 3  370 ? 71.030 148.504 30.095 1.00 42.07  ? 376  ASP A OD2   1 
ATOM   3680 N  N     . PRO C 3  371 ? 74.704 149.858 28.601 1.00 31.43  ? 377  PRO A N     1 
ATOM   3681 C  CA    . PRO C 3  371 ? 74.515 150.675 27.402 1.00 29.67  ? 377  PRO A CA    1 
ATOM   3682 C  C     . PRO C 3  371 ? 73.084 150.807 26.912 1.00 28.21  ? 377  PRO A C     1 
ATOM   3683 O  O     . PRO C 3  371 ? 72.725 151.837 26.344 1.00 28.03  ? 377  PRO A O     1 
ATOM   3684 C  CB    . PRO C 3  371 ? 75.442 150.019 26.378 1.00 29.54  ? 377  PRO A CB    1 
ATOM   3685 C  CG    . PRO C 3  371 ? 75.537 148.606 26.848 1.00 31.84  ? 377  PRO A CG    1 
ATOM   3686 C  CD    . PRO C 3  371 ? 75.622 148.736 28.341 1.00 30.41  ? 377  PRO A CD    1 
ATOM   3687 N  N     . GLU C 3  372 ? 72.260 149.788 27.136 1.00 26.82  ? 378  GLU A N     1 
ATOM   3688 C  CA    . GLU C 3  372 ? 70.876 149.861 26.685 1.00 25.95  ? 378  GLU A CA    1 
ATOM   3689 C  C     . GLU C 3  372 ? 70.110 150.924 27.475 1.00 26.18  ? 378  GLU A C     1 
ATOM   3690 O  O     . GLU C 3  372 ? 69.355 151.711 26.903 1.00 25.36  ? 378  GLU A O     1 
ATOM   3691 C  CB    . GLU C 3  372 ? 70.166 148.511 26.831 1.00 25.93  ? 378  GLU A CB    1 
ATOM   3692 C  CG    . GLU C 3  372 ? 68.836 148.460 26.085 1.00 28.54  ? 378  GLU A CG    1 
ATOM   3693 C  CD    . GLU C 3  372 ? 68.005 147.231 26.403 1.00 29.85  ? 378  GLU A CD    1 
ATOM   3694 O  OE1   . GLU C 3  372 ? 68.548 146.109 26.373 1.00 30.58  ? 378  GLU A OE1   1 
ATOM   3695 O  OE2   . GLU C 3  372 ? 66.796 147.388 26.671 1.00 32.34  ? 378  GLU A OE2   1 
ATOM   3696 N  N     . LYS C 3  373 ? 70.303 150.938 28.791 1.00 25.94  ? 379  LYS A N     1 
ATOM   3697 C  CA    . LYS C 3  373 ? 69.634 151.912 29.643 1.00 26.08  ? 379  LYS A CA    1 
ATOM   3698 C  C     . LYS C 3  373 ? 70.206 153.307 29.406 1.00 25.41  ? 379  LYS A C     1 
ATOM   3699 O  O     . LYS C 3  373 ? 69.476 154.296 29.416 1.00 24.81  ? 379  LYS A O     1 
ATOM   3700 C  CB    . LYS C 3  373 ? 69.783 151.527 31.115 1.00 27.41  ? 379  LYS A CB    1 
ATOM   3701 C  CG    . LYS C 3  373 ? 69.083 150.231 31.470 1.00 27.47  ? 379  LYS A CG    1 
ATOM   3702 C  CD    . LYS C 3  373 ? 69.355 149.845 32.901 1.00 29.34  ? 379  LYS A CD    1 
ATOM   3703 C  CE    . LYS C 3  373 ? 68.903 148.424 33.180 1.00 29.41  ? 379  LYS A CE    1 
ATOM   3704 N  NZ    . LYS C 3  373 ? 67.479 148.240 32.821 1.00 31.21  ? 379  LYS A NZ    1 
ATOM   3705 N  N     . GLN C 3  374 ? 71.514 153.383 29.192 1.00 24.48  ? 380  GLN A N     1 
ATOM   3706 C  CA    . GLN C 3  374 ? 72.153 154.663 28.930 1.00 25.30  ? 380  GLN A CA    1 
ATOM   3707 C  C     . GLN C 3  374 ? 71.450 155.263 27.715 1.00 25.72  ? 380  GLN A C     1 
ATOM   3708 O  O     . GLN C 3  374 ? 71.138 156.452 27.680 1.00 25.42  ? 380  GLN A O     1 
ATOM   3709 C  CB    . GLN C 3  374 ? 73.640 154.462 28.626 1.00 25.40  ? 380  GLN A CB    1 
ATOM   3710 C  CG    . GLN C 3  374 ? 74.392 155.737 28.272 1.00 24.09  ? 380  GLN A CG    1 
ATOM   3711 C  CD    . GLN C 3  374 ? 74.467 156.709 29.430 1.00 27.69  ? 380  GLN A CD    1 
ATOM   3712 O  OE1   . GLN C 3  374 ? 75.111 156.438 30.446 1.00 28.91  ? 380  GLN A OE1   1 
ATOM   3713 N  NE2   . GLN C 3  374 ? 73.802 157.850 29.287 1.00 26.88  ? 380  GLN A NE2   1 
ATOM   3714 N  N     . ALA C 3  375 ? 71.189 154.417 26.724 1.00 25.47  ? 381  ALA A N     1 
ATOM   3715 C  CA    . ALA C 3  375 ? 70.525 154.847 25.505 1.00 23.90  ? 381  ALA A CA    1 
ATOM   3716 C  C     . ALA C 3  375 ? 69.060 155.189 25.773 1.00 23.92  ? 381  ALA A C     1 
ATOM   3717 O  O     . ALA C 3  375 ? 68.501 156.075 25.135 1.00 24.41  ? 381  ALA A O     1 
ATOM   3718 C  CB    . ALA C 3  375 ? 70.634 153.757 24.447 1.00 21.84  ? 381  ALA A CB    1 
ATOM   3719 N  N     . ALA C 3  376 ? 68.442 154.493 26.722 1.00 23.41  ? 382  ALA A N     1 
ATOM   3720 C  CA    . ALA C 3  376 ? 67.043 154.742 27.054 1.00 24.19  ? 382  ALA A CA    1 
ATOM   3721 C  C     . ALA C 3  376 ? 66.844 156.178 27.534 1.00 25.04  ? 382  ALA A C     1 
ATOM   3722 O  O     . ALA C 3  376 ? 65.748 156.737 27.431 1.00 24.31  ? 382  ALA A O     1 
ATOM   3723 C  CB    . ALA C 3  376 ? 66.577 153.766 28.127 1.00 22.60  ? 382  ALA A CB    1 
ATOM   3724 N  N     . ILE C 3  377 ? 67.908 156.777 28.054 1.00 25.32  ? 383  ILE A N     1 
ATOM   3725 C  CA    . ILE C 3  377 ? 67.819 158.143 28.548 1.00 26.57  ? 383  ILE A CA    1 
ATOM   3726 C  C     . ILE C 3  377 ? 67.398 159.102 27.443 1.00 26.16  ? 383  ILE A C     1 
ATOM   3727 O  O     . ILE C 3  377 ? 66.586 159.998 27.668 1.00 26.80  ? 383  ILE A O     1 
ATOM   3728 C  CB    . ILE C 3  377 ? 69.150 158.594 29.158 1.00 26.96  ? 383  ILE A CB    1 
ATOM   3729 C  CG1   . ILE C 3  377 ? 69.426 157.759 30.411 1.00 27.24  ? 383  ILE A CG1   1 
ATOM   3730 C  CG2   . ILE C 3  377 ? 69.102 160.083 29.485 1.00 26.26  ? 383  ILE A CG2   1 
ATOM   3731 C  CD1   . ILE C 3  377 ? 70.717 158.092 31.096 1.00 30.35  ? 383  ILE A CD1   1 
ATOM   3732 N  N     . ASP C 3  378 ? 67.941 158.913 26.248 1.00 25.28  ? 384  ASP A N     1 
ATOM   3733 C  CA    . ASP C 3  378 ? 67.565 159.771 25.141 1.00 25.45  ? 384  ASP A CA    1 
ATOM   3734 C  C     . ASP C 3  378 ? 66.106 159.520 24.788 1.00 24.67  ? 384  ASP A C     1 
ATOM   3735 O  O     . ASP C 3  378 ? 65.362 160.458 24.492 1.00 23.96  ? 384  ASP A O     1 
ATOM   3736 C  CB    . ASP C 3  378 ? 68.452 159.518 23.920 1.00 26.08  ? 384  ASP A CB    1 
ATOM   3737 C  CG    . ASP C 3  378 ? 69.839 160.109 24.082 1.00 29.77  ? 384  ASP A CG    1 
ATOM   3738 O  OD1   . ASP C 3  378 ? 69.941 161.247 24.595 1.00 29.59  ? 384  ASP A OD1   1 
ATOM   3739 O  OD2   . ASP C 3  378 ? 70.824 159.448 23.689 1.00 32.16  ? 384  ASP A OD2   1 
ATOM   3740 N  N     . LEU C 3  379 ? 65.688 158.257 24.835 1.00 23.24  ? 385  LEU A N     1 
ATOM   3741 C  CA    . LEU C 3  379 ? 64.303 157.936 24.517 1.00 22.10  ? 385  LEU A CA    1 
ATOM   3742 C  C     . LEU C 3  379 ? 63.375 158.645 25.496 1.00 21.18  ? 385  LEU A C     1 
ATOM   3743 O  O     . LEU C 3  379 ? 62.339 159.184 25.107 1.00 20.26  ? 385  LEU A O     1 
ATOM   3744 C  CB    . LEU C 3  379 ? 64.070 156.422 24.562 1.00 20.93  ? 385  LEU A CB    1 
ATOM   3745 C  CG    . LEU C 3  379 ? 64.947 155.568 23.629 1.00 22.29  ? 385  LEU A CG    1 
ATOM   3746 C  CD1   . LEU C 3  379 ? 64.383 154.152 23.576 1.00 19.15  ? 385  LEU A CD1   1 
ATOM   3747 C  CD2   . LEU C 3  379 ? 64.991 156.162 22.221 1.00 19.93  ? 385  LEU A CD2   1 
ATOM   3748 N  N     . ILE C 3  380 ? 63.764 158.658 26.766 1.00 20.31  ? 386  ILE A N     1 
ATOM   3749 C  CA    . ILE C 3  380 ? 62.972 159.312 27.793 1.00 20.25  ? 386  ILE A CA    1 
ATOM   3750 C  C     . ILE C 3  380 ? 62.874 160.812 27.528 1.00 20.83  ? 386  ILE A C     1 
ATOM   3751 O  O     . ILE C 3  380 ? 61.800 161.402 27.651 1.00 17.65  ? 386  ILE A O     1 
ATOM   3752 C  CB    . ILE C 3  380 ? 63.587 159.083 29.183 1.00 21.48  ? 386  ILE A CB    1 
ATOM   3753 C  CG1   . ILE C 3  380 ? 63.539 157.590 29.522 1.00 20.51  ? 386  ILE A CG1   1 
ATOM   3754 C  CG2   . ILE C 3  380 ? 62.851 159.915 30.225 1.00 18.12  ? 386  ILE A CG2   1 
ATOM   3755 C  CD1   . ILE C 3  380 ? 64.307 157.221 30.785 1.00 18.63  ? 386  ILE A CD1   1 
ATOM   3756 N  N     . LYS C 3  381 ? 63.993 161.430 27.162 1.00 21.65  ? 387  LYS A N     1 
ATOM   3757 C  CA    . LYS C 3  381 ? 63.984 162.860 26.883 1.00 24.03  ? 387  LYS A CA    1 
ATOM   3758 C  C     . LYS C 3  381 ? 63.033 163.153 25.727 1.00 24.50  ? 387  LYS A C     1 
ATOM   3759 O  O     . LYS C 3  381 ? 62.201 164.055 25.815 1.00 25.43  ? 387  LYS A O     1 
ATOM   3760 C  CB    . LYS C 3  381 ? 65.388 163.362 26.537 1.00 26.34  ? 387  LYS A CB    1 
ATOM   3761 C  CG    . LYS C 3  381 ? 66.408 163.164 27.641 1.00 30.19  ? 387  LYS A CG    1 
ATOM   3762 C  CD    . LYS C 3  381 ? 67.276 164.403 27.845 1.00 35.53  ? 387  LYS A CD    1 
ATOM   3763 C  CE    . LYS C 3  381 ? 68.108 164.744 26.620 1.00 37.07  ? 387  LYS A CE    1 
ATOM   3764 N  NZ    . LYS C 3  381 ? 69.123 163.697 26.341 1.00 40.38  ? 387  LYS A NZ    1 
ATOM   3765 N  N     . GLU C 3  382 ? 63.150 162.383 24.649 1.00 23.77  ? 388  GLU A N     1 
ATOM   3766 C  CA    . GLU C 3  382 ? 62.294 162.575 23.484 1.00 22.52  ? 388  GLU A CA    1 
ATOM   3767 C  C     . GLU C 3  382 ? 60.826 162.402 23.857 1.00 21.71  ? 388  GLU A C     1 
ATOM   3768 O  O     . GLU C 3  382 ? 59.971 163.175 23.433 1.00 21.80  ? 388  GLU A O     1 
ATOM   3769 C  CB    . GLU C 3  382 ? 62.660 161.578 22.379 1.00 22.48  ? 388  GLU A CB    1 
ATOM   3770 C  CG    . GLU C 3  382 ? 61.989 161.875 21.043 1.00 24.33  ? 388  GLU A CG    1 
ATOM   3771 C  CD    . GLU C 3  382 ? 62.295 160.836 19.978 1.00 27.53  ? 388  GLU A CD    1 
ATOM   3772 O  OE1   . GLU C 3  382 ? 63.378 160.218 20.045 1.00 31.14  ? 388  GLU A OE1   1 
ATOM   3773 O  OE2   . GLU C 3  382 ? 61.465 160.648 19.065 1.00 27.69  ? 388  GLU A OE2   1 
ATOM   3774 N  N     . TYR C 3  383 ? 60.546 161.380 24.655 1.00 20.86  ? 389  TYR A N     1 
ATOM   3775 C  CA    . TYR C 3  383 ? 59.185 161.076 25.086 1.00 20.58  ? 389  TYR A CA    1 
ATOM   3776 C  C     . TYR C 3  383 ? 58.568 162.244 25.852 1.00 21.26  ? 389  TYR A C     1 
ATOM   3777 O  O     . TYR C 3  383 ? 57.420 162.623 25.618 1.00 20.97  ? 389  TYR A O     1 
ATOM   3778 C  CB    . TYR C 3  383 ? 59.205 159.820 25.960 1.00 17.92  ? 389  TYR A CB    1 
ATOM   3779 C  CG    . TYR C 3  383 ? 57.847 159.334 26.407 1.00 18.53  ? 389  TYR A CG    1 
ATOM   3780 C  CD1   . TYR C 3  383 ? 57.160 159.964 27.451 1.00 20.08  ? 389  TYR A CD1   1 
ATOM   3781 C  CD2   . TYR C 3  383 ? 57.240 158.241 25.788 1.00 15.41  ? 389  TYR A CD2   1 
ATOM   3782 C  CE1   . TYR C 3  383 ? 55.904 159.514 27.864 1.00 18.15  ? 389  TYR A CE1   1 
ATOM   3783 C  CE2   . TYR C 3  383 ? 55.987 157.791 26.191 1.00 16.57  ? 389  TYR A CE2   1 
ATOM   3784 C  CZ    . TYR C 3  383 ? 55.327 158.431 27.225 1.00 17.79  ? 389  TYR A CZ    1 
ATOM   3785 O  OH    . TYR C 3  383 ? 54.077 158.005 27.606 1.00 22.36  ? 389  TYR A OH    1 
ATOM   3786 N  N     . LEU C 3  384 ? 59.339 162.806 26.775 1.00 21.68  ? 390  LEU A N     1 
ATOM   3787 C  CA    . LEU C 3  384 ? 58.866 163.923 27.571 1.00 21.90  ? 390  LEU A CA    1 
ATOM   3788 C  C     . LEU C 3  384 ? 58.503 165.090 26.667 1.00 22.64  ? 390  LEU A C     1 
ATOM   3789 O  O     . LEU C 3  384 ? 57.482 165.747 26.868 1.00 23.71  ? 390  LEU A O     1 
ATOM   3790 C  CB    . LEU C 3  384 ? 59.936 164.335 28.581 1.00 19.94  ? 390  LEU A CB    1 
ATOM   3791 C  CG    . LEU C 3  384 ? 60.094 163.317 29.715 1.00 20.94  ? 390  LEU A CG    1 
ATOM   3792 C  CD1   . LEU C 3  384 ? 61.321 163.634 30.547 1.00 17.20  ? 390  LEU A CD1   1 
ATOM   3793 C  CD2   . LEU C 3  384 ? 58.833 163.320 30.570 1.00 19.03  ? 390  LEU A CD2   1 
ATOM   3794 N  N     . MET C 3  385 ? 59.340 165.340 25.665 1.00 22.41  ? 391  MET A N     1 
ATOM   3795 C  CA    . MET C 3  385 ? 59.102 166.426 24.725 1.00 21.36  ? 391  MET A CA    1 
ATOM   3796 C  C     . MET C 3  385 ? 57.869 166.126 23.878 1.00 22.23  ? 391  MET A C     1 
ATOM   3797 O  O     . MET C 3  385 ? 57.019 167.000 23.685 1.00 22.06  ? 391  MET A O     1 
ATOM   3798 C  CB    . MET C 3  385 ? 60.327 166.628 23.831 1.00 20.56  ? 391  MET A CB    1 
ATOM   3799 C  CG    . MET C 3  385 ? 60.146 167.684 22.758 1.00 24.02  ? 391  MET A CG    1 
ATOM   3800 S  SD    . MET C 3  385 ? 60.028 166.947 21.113 1.00 28.49  ? 391  MET A SD    1 
ATOM   3801 C  CE    . MET C 3  385 ? 58.307 166.786 20.954 1.00 27.58  ? 391  MET A CE    1 
ATOM   3802 N  N     . ILE C 3  386 ? 57.767 164.894 23.381 1.00 20.17  ? 392  ILE A N     1 
ATOM   3803 C  CA    . ILE C 3  386 ? 56.619 164.501 22.575 1.00 20.46  ? 392  ILE A CA    1 
ATOM   3804 C  C     . ILE C 3  386 ? 55.329 164.766 23.365 1.00 21.25  ? 392  ILE A C     1 
ATOM   3805 O  O     . ILE C 3  386 ? 54.325 165.206 22.799 1.00 20.95  ? 392  ILE A O     1 
ATOM   3806 C  CB    . ILE C 3  386 ? 56.675 162.990 22.183 1.00 22.67  ? 392  ILE A CB    1 
ATOM   3807 C  CG1   . ILE C 3  386 ? 57.930 162.689 21.345 1.00 21.80  ? 392  ILE A CG1   1 
ATOM   3808 C  CG2   . ILE C 3  386 ? 55.424 162.607 21.393 1.00 21.25  ? 392  ILE A CG2   1 
ATOM   3809 C  CD1   . ILE C 3  386 ? 57.981 163.389 20.008 1.00 19.65  ? 392  ILE A CD1   1 
ATOM   3810 N  N     . GLN C 3  387 ? 55.359 164.508 24.671 1.00 20.71  ? 393  GLN A N     1 
ATOM   3811 C  CA    . GLN C 3  387 ? 54.178 164.727 25.506 1.00 21.75  ? 393  GLN A CA    1 
ATOM   3812 C  C     . GLN C 3  387 ? 53.774 166.185 25.590 1.00 20.89  ? 393  GLN A C     1 
ATOM   3813 O  O     . GLN C 3  387 ? 52.589 166.517 25.504 1.00 20.36  ? 393  GLN A O     1 
ATOM   3814 C  CB    . GLN C 3  387 ? 54.394 164.191 26.923 1.00 23.35  ? 393  GLN A CB    1 
ATOM   3815 C  CG    . GLN C 3  387 ? 53.906 162.765 27.114 1.00 26.53  ? 393  GLN A CG    1 
ATOM   3816 C  CD    . GLN C 3  387 ? 52.407 162.599 26.882 1.00 27.52  ? 393  GLN A CD    1 
ATOM   3817 O  OE1   . GLN C 3  387 ? 51.898 161.482 26.890 1.00 30.50  ? 393  GLN A OE1   1 
ATOM   3818 N  NE2   . GLN C 3  387 ? 51.695 163.708 26.688 1.00 26.41  ? 393  GLN A NE2   1 
ATOM   3819 N  N     . LYS C 3  388 ? 54.759 167.052 25.766 1.00 19.77  ? 394  LYS A N     1 
ATOM   3820 C  CA    . LYS C 3  388 ? 54.484 168.470 25.856 1.00 21.43  ? 394  LYS A CA    1 
ATOM   3821 C  C     . LYS C 3  388 ? 53.776 168.922 24.575 1.00 19.94  ? 394  LYS A C     1 
ATOM   3822 O  O     . LYS C 3  388 ? 52.809 169.678 24.621 1.00 21.71  ? 394  LYS A O     1 
ATOM   3823 C  CB    . LYS C 3  388 ? 55.796 169.237 26.065 1.00 25.11  ? 394  LYS A CB    1 
ATOM   3824 C  CG    . LYS C 3  388 ? 55.598 170.635 26.599 1.00 30.10  ? 394  LYS A CG    1 
ATOM   3825 C  CD    . LYS C 3  388 ? 56.896 171.219 27.117 1.00 34.18  ? 394  LYS A CD    1 
ATOM   3826 C  CE    . LYS C 3  388 ? 56.634 172.479 27.941 1.00 36.21  ? 394  LYS A CE    1 
ATOM   3827 N  NZ    . LYS C 3  388 ? 55.813 172.202 29.160 1.00 35.86  ? 394  LYS A NZ    1 
ATOM   3828 N  N     . ARG C 3  389 ? 54.241 168.431 23.431 1.00 19.23  ? 395  ARG A N     1 
ATOM   3829 C  CA    . ARG C 3  389 ? 53.637 168.791 22.150 1.00 18.17  ? 395  ARG A CA    1 
ATOM   3830 C  C     . ARG C 3  389 ? 52.237 168.229 22.014 1.00 17.66  ? 395  ARG A C     1 
ATOM   3831 O  O     . ARG C 3  389 ? 51.322 168.913 21.566 1.00 17.76  ? 395  ARG A O     1 
ATOM   3832 C  CB    . ARG C 3  389 ? 54.495 168.275 21.002 1.00 18.85  ? 395  ARG A CB    1 
ATOM   3833 C  CG    . ARG C 3  389 ? 55.870 168.880 20.967 1.00 16.43  ? 395  ARG A CG    1 
ATOM   3834 C  CD    . ARG C 3  389 ? 55.795 170.346 20.656 1.00 18.93  ? 395  ARG A CD    1 
ATOM   3835 N  NE    . ARG C 3  389 ? 57.130 170.916 20.577 1.00 22.85  ? 395  ARG A NE    1 
ATOM   3836 C  CZ    . ARG C 3  389 ? 57.926 171.098 21.623 1.00 20.95  ? 395  ARG A CZ    1 
ATOM   3837 N  NH1   . ARG C 3  389 ? 57.519 170.760 22.837 1.00 21.15  ? 395  ARG A NH1   1 
ATOM   3838 N  NH2   . ARG C 3  389 ? 59.134 171.611 21.447 1.00 23.13  ? 395  ARG A NH2   1 
ATOM   3839 N  N     . ILE C 3  390 ? 52.074 166.971 22.396 1.00 17.75  ? 396  ILE A N     1 
ATOM   3840 C  CA    . ILE C 3  390 ? 50.775 166.320 22.315 1.00 17.52  ? 396  ILE A CA    1 
ATOM   3841 C  C     . ILE C 3  390 ? 49.799 167.010 23.265 1.00 16.57  ? 396  ILE A C     1 
ATOM   3842 O  O     . ILE C 3  390 ? 48.665 167.318 22.892 1.00 16.04  ? 396  ILE A O     1 
ATOM   3843 C  CB    . ILE C 3  390 ? 50.901 164.810 22.665 1.00 18.22  ? 396  ILE A CB    1 
ATOM   3844 C  CG1   . ILE C 3  390 ? 51.718 164.106 21.574 1.00 18.79  ? 396  ILE A CG1   1 
ATOM   3845 C  CG2   . ILE C 3  390 ? 49.526 164.180 22.818 1.00 17.04  ? 396  ILE A CG2   1 
ATOM   3846 C  CD1   . ILE C 3  390 ? 51.859 162.611 21.754 1.00 18.41  ? 396  ILE A CD1   1 
ATOM   3847 N  N     . GLY C 3  391 ? 50.253 167.266 24.488 1.00 15.74  ? 397  GLY A N     1 
ATOM   3848 C  CA    . GLY C 3  391 ? 49.397 167.922 25.461 1.00 15.28  ? 397  GLY A CA    1 
ATOM   3849 C  C     . GLY C 3  391 ? 48.936 169.296 25.000 1.00 15.01  ? 397  GLY A C     1 
ATOM   3850 O  O     . GLY C 3  391 ? 47.756 169.625 25.071 1.00 13.41  ? 397  GLY A O     1 
ATOM   3851 N  N     . GLN C 3  392 ? 49.864 170.108 24.514 1.00 14.84  ? 398  GLN A N     1 
ATOM   3852 C  CA    . GLN C 3  392 ? 49.499 171.437 24.062 1.00 17.25  ? 398  GLN A CA    1 
ATOM   3853 C  C     . GLN C 3  392 ? 48.661 171.448 22.773 1.00 17.88  ? 398  GLN A C     1 
ATOM   3854 O  O     . GLN C 3  392 ? 47.797 172.308 22.593 1.00 18.55  ? 398  GLN A O     1 
ATOM   3855 C  CB    . GLN C 3  392 ? 50.767 172.275 23.874 1.00 16.23  ? 398  GLN A CB    1 
ATOM   3856 C  CG    . GLN C 3  392 ? 50.539 173.632 23.242 1.00 16.35  ? 398  GLN A CG    1 
ATOM   3857 C  CD    . GLN C 3  392 ? 51.778 174.504 23.315 1.00 19.70  ? 398  GLN A CD    1 
ATOM   3858 O  OE1   . GLN C 3  392 ? 52.905 173.998 23.296 1.00 20.93  ? 398  GLN A OE1   1 
ATOM   3859 N  NE2   . GLN C 3  392 ? 51.580 175.820 23.386 1.00 18.35  ? 398  GLN A NE2   1 
ATOM   3860 N  N     . SER C 3  393 ? 48.894 170.485 21.889 1.00 16.18  ? 399  SER A N     1 
ATOM   3861 C  CA    . SER C 3  393 ? 48.166 170.460 20.624 1.00 16.70  ? 399  SER A CA    1 
ATOM   3862 C  C     . SER C 3  393 ? 46.883 169.644 20.590 1.00 16.85  ? 399  SER A C     1 
ATOM   3863 O  O     . SER C 3  393 ? 45.910 170.049 19.952 1.00 17.92  ? 399  SER A O     1 
ATOM   3864 C  CB    . SER C 3  393 ? 49.081 169.964 19.492 1.00 14.97  ? 399  SER A CB    1 
ATOM   3865 O  OG    . SER C 3  393 ? 49.418 168.589 19.650 1.00 12.27  ? 399  SER A OG    1 
ATOM   3866 N  N     . ALA C 3  394 ? 46.859 168.506 21.273 1.00 16.14  ? 400  ALA A N     1 
ATOM   3867 C  CA    . ALA C 3  394 ? 45.671 167.677 21.191 1.00 17.83  ? 400  ALA A CA    1 
ATOM   3868 C  C     . ALA C 3  394 ? 45.027 167.140 22.461 1.00 17.80  ? 400  ALA A C     1 
ATOM   3869 O  O     . ALA C 3  394 ? 43.807 167.169 22.586 1.00 19.55  ? 400  ALA A O     1 
ATOM   3870 C  CB    . ALA C 3  394 ? 45.954 166.505 20.230 1.00 15.61  ? 400  ALA A CB    1 
ATOM   3871 N  N     . GLU C 3  395 ? 45.825 166.656 23.403 1.00 18.04  ? 401  GLU A N     1 
ATOM   3872 C  CA    . GLU C 3  395 ? 45.263 166.052 24.607 1.00 19.35  ? 401  GLU A CA    1 
ATOM   3873 C  C     . GLU C 3  395 ? 44.998 166.885 25.856 1.00 19.50  ? 401  GLU A C     1 
ATOM   3874 O  O     . GLU C 3  395 ? 44.129 166.529 26.647 1.00 20.08  ? 401  GLU A O     1 
ATOM   3875 C  CB    . GLU C 3  395 ? 46.108 164.835 24.989 1.00 18.55  ? 401  GLU A CB    1 
ATOM   3876 C  CG    . GLU C 3  395 ? 45.813 163.618 24.137 1.00 18.87  ? 401  GLU A CG    1 
ATOM   3877 C  CD    . GLU C 3  395 ? 46.848 162.524 24.269 1.00 18.99  ? 401  GLU A CD    1 
ATOM   3878 O  OE1   . GLU C 3  395 ? 47.534 162.448 25.313 1.00 19.50  ? 401  GLU A OE1   1 
ATOM   3879 O  OE2   . GLU C 3  395 ? 46.959 161.726 23.319 1.00 20.74  ? 401  GLU A OE2   1 
ATOM   3880 N  N     . GLY C 3  396 ? 45.730 167.977 26.043 1.00 20.81  ? 402  GLY A N     1 
ATOM   3881 C  CA    . GLY C 3  396 ? 45.536 168.790 27.236 1.00 20.23  ? 402  GLY A CA    1 
ATOM   3882 C  C     . GLY C 3  396 ? 44.139 169.359 27.356 1.00 21.07  ? 402  GLY A C     1 
ATOM   3883 O  O     . GLY C 3  396 ? 43.395 169.375 26.374 1.00 20.30  ? 402  GLY A O     1 
ATOM   3884 N  N     . ASP C 3  397 ? 43.767 169.813 28.553 1.00 21.64  ? 403  ASP A N     1 
ATOM   3885 C  CA    . ASP C 3  397 ? 42.441 170.398 28.744 1.00 22.82  ? 403  ASP A CA    1 
ATOM   3886 C  C     . ASP C 3  397 ? 42.338 171.641 27.874 1.00 21.97  ? 403  ASP A C     1 
ATOM   3887 O  O     . ASP C 3  397 ? 41.263 171.968 27.374 1.00 21.92  ? 403  ASP A O     1 
ATOM   3888 C  CB    . ASP C 3  397 ? 42.204 170.810 30.202 1.00 26.99  ? 403  ASP A CB    1 
ATOM   3889 C  CG    . ASP C 3  397 ? 42.161 169.627 31.157 1.00 32.52  ? 403  ASP A CG    1 
ATOM   3890 O  OD1   . ASP C 3  397 ? 41.444 168.637 30.881 1.00 34.26  ? 403  ASP A OD1   1 
ATOM   3891 O  OD2   . ASP C 3  397 ? 42.841 169.701 32.203 1.00 38.04  ? 403  ASP A OD2   1 
ATOM   3892 N  N     . LYS C 3  398 ? 43.465 172.323 27.698 1.00 20.09  ? 404  LYS A N     1 
ATOM   3893 C  CA    . LYS C 3  398 ? 43.512 173.541 26.902 1.00 20.19  ? 404  LYS A CA    1 
ATOM   3894 C  C     . LYS C 3  398 ? 44.110 173.305 25.519 1.00 18.27  ? 404  LYS A C     1 
ATOM   3895 O  O     . LYS C 3  398 ? 44.635 174.228 24.908 1.00 18.19  ? 404  LYS A O     1 
ATOM   3896 C  CB    . LYS C 3  398 ? 44.337 174.610 27.626 1.00 20.41  ? 404  LYS A CB    1 
ATOM   3897 C  CG    . LYS C 3  398 ? 43.992 174.796 29.091 1.00 23.72  ? 404  LYS A CG    1 
ATOM   3898 C  CD    . LYS C 3  398 ? 42.567 175.278 29.286 1.00 27.72  ? 404  LYS A CD    1 
ATOM   3899 C  CE    . LYS C 3  398 ? 42.257 175.461 30.768 1.00 30.51  ? 404  LYS A CE    1 
ATOM   3900 N  NZ    . LYS C 3  398 ? 43.255 176.355 31.432 1.00 32.94  ? 404  LYS A NZ    1 
ATOM   3901 N  N     . ALA C 3  399 ? 44.023 172.077 25.023 1.00 17.45  ? 405  ALA A N     1 
ATOM   3902 C  CA    . ALA C 3  399 ? 44.583 171.740 23.709 1.00 17.92  ? 405  ALA A CA    1 
ATOM   3903 C  C     . ALA C 3  399 ? 43.994 172.556 22.555 1.00 15.58  ? 405  ALA A C     1 
ATOM   3904 O  O     . ALA C 3  399 ? 42.808 172.879 22.553 1.00 15.51  ? 405  ALA A O     1 
ATOM   3905 C  CB    . ALA C 3  399 ? 44.396 170.248 23.437 1.00 17.23  ? 405  ALA A CB    1 
ATOM   3906 N  N     . TRP C 3  400 ? 44.827 172.877 21.569 1.00 15.08  ? 406  TRP A N     1 
ATOM   3907 C  CA    . TRP C 3  400 ? 44.371 173.650 20.411 1.00 13.96  ? 406  TRP A CA    1 
ATOM   3908 C  C     . TRP C 3  400 ? 43.179 172.974 19.755 1.00 14.96  ? 406  TRP A C     1 
ATOM   3909 O  O     . TRP C 3  400 ? 42.195 173.628 19.419 1.00 16.33  ? 406  TRP A O     1 
ATOM   3910 C  CB    . TRP C 3  400 ? 45.483 173.804 19.371 1.00 11.52  ? 406  TRP A CB    1 
ATOM   3911 C  CG    . TRP C 3  400 ? 46.751 174.391 19.912 1.00 10.22  ? 406  TRP A CG    1 
ATOM   3912 C  CD1   . TRP C 3  400 ? 46.870 175.296 20.931 1.00 9.63   ? 406  TRP A CD1   1 
ATOM   3913 C  CD2   . TRP C 3  400 ? 48.081 174.138 19.441 1.00 7.92   ? 406  TRP A CD2   1 
ATOM   3914 N  NE1   . TRP C 3  400 ? 48.192 175.619 21.123 1.00 9.23   ? 406  TRP A NE1   1 
ATOM   3915 C  CE2   . TRP C 3  400 ? 48.957 174.924 20.224 1.00 8.39   ? 406  TRP A CE2   1 
ATOM   3916 C  CE3   . TRP C 3  400 ? 48.615 173.325 18.430 1.00 6.82   ? 406  TRP A CE3   1 
ATOM   3917 C  CZ2   . TRP C 3  400 ? 50.343 174.923 20.030 1.00 9.00   ? 406  TRP A CZ2   1 
ATOM   3918 C  CZ3   . TRP C 3  400 ? 49.990 173.323 18.232 1.00 9.62   ? 406  TRP A CZ3   1 
ATOM   3919 C  CH2   . TRP C 3  400 ? 50.842 174.120 19.033 1.00 11.60  ? 406  TRP A CH2   1 
ATOM   3920 N  N     . LEU C 3  401 ? 43.266 171.661 19.577 1.00 15.27  ? 407  LEU A N     1 
ATOM   3921 C  CA    . LEU C 3  401 ? 42.183 170.915 18.955 1.00 15.13  ? 407  LEU A CA    1 
ATOM   3922 C  C     . LEU C 3  401 ? 40.876 170.979 19.737 1.00 16.38  ? 407  LEU A C     1 
ATOM   3923 O  O     . LEU C 3  401 ? 39.802 170.847 19.153 1.00 17.85  ? 407  LEU A O     1 
ATOM   3924 C  CB    . LEU C 3  401 ? 42.592 169.456 18.757 1.00 14.16  ? 407  LEU A CB    1 
ATOM   3925 C  CG    . LEU C 3  401 ? 43.640 169.232 17.668 1.00 14.95  ? 407  LEU A CG    1 
ATOM   3926 C  CD1   . LEU C 3  401 ? 44.045 167.770 17.640 1.00 12.82  ? 407  LEU A CD1   1 
ATOM   3927 C  CD2   . LEU C 3  401 ? 43.073 169.670 16.317 1.00 13.01  ? 407  LEU A CD2   1 
ATOM   3928 N  N     . ARG C 3  402 ? 40.952 171.172 21.051 1.00 16.61  ? 408  ARG A N     1 
ATOM   3929 C  CA    . ARG C 3  402 ? 39.727 171.247 21.844 1.00 19.22  ? 408  ARG A CA    1 
ATOM   3930 C  C     . ARG C 3  402 ? 39.131 172.640 21.788 1.00 19.37  ? 408  ARG A C     1 
ATOM   3931 O  O     . ARG C 3  402 ? 37.985 172.837 22.169 1.00 19.58  ? 408  ARG A O     1 
ATOM   3932 C  CB    . ARG C 3  402 ? 39.982 170.876 23.312 1.00 18.33  ? 408  ARG A CB    1 
ATOM   3933 C  CG    . ARG C 3  402 ? 40.408 169.442 23.529 1.00 21.54  ? 408  ARG A CG    1 
ATOM   3934 C  CD    . ARG C 3  402 ? 40.610 169.175 25.003 1.00 26.12  ? 408  ARG A CD    1 
ATOM   3935 N  NE    . ARG C 3  402 ? 41.261 167.893 25.269 1.00 29.62  ? 408  ARG A NE    1 
ATOM   3936 C  CZ    . ARG C 3  402 ? 40.756 166.705 24.943 1.00 32.61  ? 408  ARG A CZ    1 
ATOM   3937 N  NH1   . ARG C 3  402 ? 39.583 166.617 24.328 1.00 30.87  ? 408  ARG A NH1   1 
ATOM   3938 N  NH2   . ARG C 3  402 ? 41.422 165.597 25.247 1.00 34.28  ? 408  ARG A NH2   1 
ATOM   3939 N  N     . TYR C 3  403 ? 39.910 173.597 21.296 1.00 21.04  ? 409  TYR A N     1 
ATOM   3940 C  CA    . TYR C 3  403 ? 39.475 174.982 21.222 1.00 22.49  ? 409  TYR A CA    1 
ATOM   3941 C  C     . TYR C 3  403 ? 39.131 175.529 19.841 1.00 24.43  ? 409  TYR A C     1 
ATOM   3942 O  O     . TYR C 3  403 ? 38.628 176.647 19.730 1.00 25.44  ? 409  TYR A O     1 
ATOM   3943 C  CB    . TYR C 3  403 ? 40.529 175.875 21.879 1.00 23.17  ? 409  TYR A CB    1 
ATOM   3944 C  CG    . TYR C 3  403 ? 40.297 176.059 23.358 1.00 25.36  ? 409  TYR A CG    1 
ATOM   3945 C  CD1   . TYR C 3  403 ? 39.474 177.077 23.829 1.00 26.44  ? 409  TYR A CD1   1 
ATOM   3946 C  CD2   . TYR C 3  403 ? 40.839 175.177 24.282 1.00 27.25  ? 409  TYR A CD2   1 
ATOM   3947 C  CE1   . TYR C 3  403 ? 39.190 177.214 25.181 1.00 25.96  ? 409  TYR A CE1   1 
ATOM   3948 C  CE2   . TYR C 3  403 ? 40.560 175.303 25.644 1.00 29.95  ? 409  TYR A CE2   1 
ATOM   3949 C  CZ    . TYR C 3  403 ? 39.731 176.325 26.085 1.00 29.06  ? 409  TYR A CZ    1 
ATOM   3950 O  OH    . TYR C 3  403 ? 39.434 176.445 27.426 1.00 29.59  ? 409  TYR A OH    1 
ATOM   3951 N  N     . VAL C 3  404 ? 39.386 174.766 18.785 1.00 24.63  ? 410  VAL A N     1 
ATOM   3952 C  CA    . VAL C 3  404 ? 39.067 175.272 17.453 1.00 26.23  ? 410  VAL A CA    1 
ATOM   3953 C  C     . VAL C 3  404 ? 37.568 175.481 17.387 1.00 25.24  ? 410  VAL A C     1 
ATOM   3954 O  O     . VAL C 3  404 ? 36.808 174.589 17.744 1.00 25.98  ? 410  VAL A O     1 
ATOM   3955 C  CB    . VAL C 3  404 ? 39.443 174.281 16.328 1.00 28.43  ? 410  VAL A CB    1 
ATOM   3956 C  CG1   . VAL C 3  404 ? 39.784 175.060 15.068 1.00 28.79  ? 410  VAL A CG1   1 
ATOM   3957 C  CG2   . VAL C 3  404 ? 40.598 173.397 16.751 1.00 29.60  ? 410  VAL A CG2   1 
ATOM   3958 N  N     . ALA C 3  405 ? 37.141 176.656 16.939 1.00 24.61  ? 411  ALA A N     1 
ATOM   3959 C  CA    . ALA C 3  405 ? 35.715 176.943 16.833 1.00 23.92  ? 411  ALA A CA    1 
ATOM   3960 C  C     . ALA C 3  405 ? 35.208 176.546 15.441 1.00 25.21  ? 411  ALA A C     1 
ATOM   3961 O  O     . ALA C 3  405 ? 35.991 176.117 14.594 1.00 24.27  ? 411  ALA A O     1 
ATOM   3962 C  CB    . ALA C 3  405 ? 35.468 178.416 17.086 1.00 21.85  ? 411  ALA A CB    1 
ATOM   3963 N  N     . GLU C 3  406 ? 33.901 176.682 15.215 1.00 27.03  ? 412  GLU A N     1 
ATOM   3964 C  CA    . GLU C 3  406 ? 33.297 176.341 13.928 1.00 28.79  ? 412  GLU A CA    1 
ATOM   3965 C  C     . GLU C 3  406 ? 33.845 177.208 12.801 1.00 27.11  ? 412  GLU A C     1 
ATOM   3966 O  O     . GLU C 3  406 ? 34.009 176.737 11.676 1.00 27.36  ? 412  GLU A O     1 
ATOM   3967 C  CB    . GLU C 3  406 ? 31.774 176.492 13.984 1.00 33.32  ? 412  GLU A CB    1 
ATOM   3968 C  CG    . GLU C 3  406 ? 31.055 175.351 14.697 1.00 40.76  ? 412  GLU A CG    1 
ATOM   3969 C  CD    . GLU C 3  406 ? 31.140 174.027 13.942 1.00 46.06  ? 412  GLU A CD    1 
ATOM   3970 O  OE1   . GLU C 3  406 ? 30.631 173.953 12.797 1.00 49.33  ? 412  GLU A OE1   1 
ATOM   3971 O  OE2   . GLU C 3  406 ? 31.711 173.057 14.494 1.00 48.87  ? 412  GLU A OE2   1 
ATOM   3972 N  N     . ASP C 3  407 ? 34.136 178.470 13.105 1.00 24.56  ? 413  ASP A N     1 
ATOM   3973 C  CA    . ASP C 3  407 ? 34.667 179.382 12.100 1.00 21.41  ? 413  ASP A CA    1 
ATOM   3974 C  C     . ASP C 3  407 ? 36.106 179.050 11.761 1.00 20.64  ? 413  ASP A C     1 
ATOM   3975 O  O     . ASP C 3  407 ? 36.797 179.851 11.131 1.00 21.68  ? 413  ASP A O     1 
ATOM   3976 C  CB    . ASP C 3  407 ? 34.581 180.836 12.573 1.00 21.55  ? 413  ASP A CB    1 
ATOM   3977 C  CG    . ASP C 3  407 ? 35.295 181.068 13.891 1.00 22.82  ? 413  ASP A CG    1 
ATOM   3978 O  OD1   . ASP C 3  407 ? 36.288 180.365 14.179 1.00 23.23  ? 413  ASP A OD1   1 
ATOM   3979 O  OD2   . ASP C 3  407 ? 34.870 181.972 14.640 1.00 26.43  ? 413  ASP A OD2   1 
ATOM   3980 N  N     . GLY C 3  408 ? 36.562 177.879 12.200 1.00 19.07  ? 414  GLY A N     1 
ATOM   3981 C  CA    . GLY C 3  408 ? 37.922 177.447 11.910 1.00 17.68  ? 414  GLY A CA    1 
ATOM   3982 C  C     . GLY C 3  408 ? 39.025 178.306 12.502 1.00 18.12  ? 414  GLY A C     1 
ATOM   3983 O  O     . GLY C 3  408 ? 40.104 178.454 11.923 1.00 19.97  ? 414  GLY A O     1 
ATOM   3984 N  N     . LYS C 3  409 ? 38.771 178.870 13.672 1.00 17.31  ? 415  LYS A N     1 
ATOM   3985 C  CA    . LYS C 3  409 ? 39.762 179.715 14.310 1.00 16.56  ? 415  LYS A CA    1 
ATOM   3986 C  C     . LYS C 3  409 ? 39.761 179.485 15.795 1.00 14.12  ? 415  LYS A C     1 
ATOM   3987 O  O     . LYS C 3  409 ? 38.775 179.012 16.357 1.00 14.54  ? 415  LYS A O     1 
ATOM   3988 C  CB    . LYS C 3  409 ? 39.453 181.182 14.023 1.00 18.43  ? 415  LYS A CB    1 
ATOM   3989 C  CG    . LYS C 3  409 ? 39.393 181.491 12.545 1.00 21.18  ? 415  LYS A CG    1 
ATOM   3990 C  CD    . LYS C 3  409 ? 38.572 182.730 12.270 1.00 24.59  ? 415  LYS A CD    1 
ATOM   3991 C  CE    . LYS C 3  409 ? 38.421 182.955 10.777 1.00 26.99  ? 415  LYS A CE    1 
ATOM   3992 N  NZ    . LYS C 3  409 ? 37.412 184.010 10.523 1.00 31.07  ? 415  LYS A NZ    1 
ATOM   3993 N  N     . ILE C 3  410 ? 40.878 179.808 16.429 1.00 13.15  ? 416  ILE A N     1 
ATOM   3994 C  CA    . ILE C 3  410 ? 40.986 179.672 17.866 1.00 12.31  ? 416  ILE A CA    1 
ATOM   3995 C  C     . ILE C 3  410 ? 40.868 181.077 18.443 1.00 13.21  ? 416  ILE A C     1 
ATOM   3996 O  O     . ILE C 3  410 ? 41.656 181.968 18.116 1.00 12.96  ? 416  ILE A O     1 
ATOM   3997 C  CB    . ILE C 3  410 ? 42.324 179.039 18.269 1.00 10.76  ? 416  ILE A CB    1 
ATOM   3998 C  CG1   . ILE C 3  410 ? 42.375 177.594 17.771 1.00 11.03  ? 416  ILE A CG1   1 
ATOM   3999 C  CG2   . ILE C 3  410 ? 42.483 179.081 19.769 1.00 9.57   ? 416  ILE A CG2   1 
ATOM   4000 C  CD1   . ILE C 3  410 ? 43.699 176.889 18.027 1.00 7.92   ? 416  ILE A CD1   1 
ATOM   4001 N  N     . HIS C 3  411 ? 39.868 181.272 19.293 1.00 13.38  ? 417  HIS A N     1 
ATOM   4002 C  CA    . HIS C 3  411 ? 39.622 182.568 19.903 1.00 13.96  ? 417  HIS A CA    1 
ATOM   4003 C  C     . HIS C 3  411 ? 40.226 182.653 21.301 1.00 14.47  ? 417  HIS A C     1 
ATOM   4004 O  O     . HIS C 3  411 ? 39.514 182.698 22.306 1.00 13.22  ? 417  HIS A O     1 
ATOM   4005 C  CB    . HIS C 3  411 ? 38.118 182.817 19.932 1.00 12.39  ? 417  HIS A CB    1 
ATOM   4006 C  CG    . HIS C 3  411 ? 37.484 182.732 18.582 1.00 14.46  ? 417  HIS A CG    1 
ATOM   4007 N  ND1   . HIS C 3  411 ? 37.223 183.845 17.808 1.00 17.55  ? 417  HIS A ND1   1 
ATOM   4008 C  CD2   . HIS C 3  411 ? 37.120 181.663 17.835 1.00 14.74  ? 417  HIS A CD2   1 
ATOM   4009 C  CE1   . HIS C 3  411 ? 36.726 183.464 16.644 1.00 16.03  ? 417  HIS A CE1   1 
ATOM   4010 N  NE2   . HIS C 3  411 ? 36.655 182.146 16.634 1.00 17.22  ? 417  HIS A NE2   1 
ATOM   4011 N  N     . GLY C 3  412 ? 41.555 182.679 21.341 1.00 14.07  ? 418  GLY A N     1 
ATOM   4012 C  CA    . GLY C 3  412 ? 42.270 182.754 22.596 1.00 13.82  ? 418  GLY A CA    1 
ATOM   4013 C  C     . GLY C 3  412 ? 41.905 183.977 23.400 1.00 15.22  ? 418  GLY A C     1 
ATOM   4014 O  O     . GLY C 3  412 ? 41.692 185.068 22.856 1.00 14.23  ? 418  GLY A O     1 
ATOM   4015 N  N     . SER C 3  413 ? 41.849 183.796 24.712 1.00 14.21  ? 419  SER A N     1 
ATOM   4016 C  CA    . SER C 3  413 ? 41.492 184.878 25.609 1.00 12.55  ? 419  SER A CA    1 
ATOM   4017 C  C     . SER C 3  413 ? 42.692 185.706 26.059 1.00 11.41  ? 419  SER A C     1 
ATOM   4018 O  O     . SER C 3  413 ? 43.800 185.195 26.220 1.00 9.45   ? 419  SER A O     1 
ATOM   4019 C  CB    . SER C 3  413 ? 40.780 184.309 26.827 1.00 11.65  ? 419  SER A CB    1 
ATOM   4020 O  OG    . SER C 3  413 ? 40.302 185.357 27.646 1.00 17.90  ? 419  SER A OG    1 
ATOM   4021 N  N     . VAL C 3  414 ? 42.464 186.995 26.269 1.00 10.58  ? 420  VAL A N     1 
ATOM   4022 C  CA    . VAL C 3  414 ? 43.536 187.865 26.709 1.00 10.13  ? 420  VAL A CA    1 
ATOM   4023 C  C     . VAL C 3  414 ? 43.099 188.751 27.864 1.00 10.46  ? 420  VAL A C     1 
ATOM   4024 O  O     . VAL C 3  414 ? 42.014 189.329 27.840 1.00 10.78  ? 420  VAL A O     1 
ATOM   4025 C  CB    . VAL C 3  414 ? 44.039 188.786 25.555 1.00 11.70  ? 420  VAL A CB    1 
ATOM   4026 C  CG1   . VAL C 3  414 ? 45.154 189.687 26.060 1.00 6.85   ? 420  VAL A CG1   1 
ATOM   4027 C  CG2   . VAL C 3  414 ? 44.534 187.942 24.370 1.00 8.11   ? 420  VAL A CG2   1 
ATOM   4028 N  N     . ASN C 3  415 ? 43.934 188.816 28.896 1.00 10.54  ? 421  ASN A N     1 
ATOM   4029 C  CA    . ASN C 3  415 ? 43.681 189.685 30.040 1.00 11.42  ? 421  ASN A CA    1 
ATOM   4030 C  C     . ASN C 3  415 ? 44.660 190.817 29.741 1.00 10.15  ? 421  ASN A C     1 
ATOM   4031 O  O     . ASN C 3  415 ? 45.847 190.705 30.032 1.00 10.11  ? 421  ASN A O     1 
ATOM   4032 C  CB    . ASN C 3  415 ? 44.059 189.007 31.359 1.00 10.67  ? 421  ASN A CB    1 
ATOM   4033 C  CG    . ASN C 3  415 ? 43.783 189.895 32.566 1.00 13.97  ? 421  ASN A CG    1 
ATOM   4034 O  OD1   . ASN C 3  415 ? 43.902 191.126 32.489 1.00 13.67  ? 421  ASN A OD1   1 
ATOM   4035 N  ND2   . ASN C 3  415 ? 43.430 189.277 33.693 1.00 15.22  ? 421  ASN A ND2   1 
ATOM   4036 N  N     . PRO C 3  416 ? 44.167 191.911 29.144 1.00 10.91  ? 422  PRO A N     1 
ATOM   4037 C  CA    . PRO C 3  416 ? 44.943 193.097 28.759 1.00 12.96  ? 422  PRO A CA    1 
ATOM   4038 C  C     . PRO C 3  416 ? 45.960 193.607 29.764 1.00 13.81  ? 422  PRO A C     1 
ATOM   4039 O  O     . PRO C 3  416 ? 47.021 194.092 29.375 1.00 15.36  ? 422  PRO A O     1 
ATOM   4040 C  CB    . PRO C 3  416 ? 43.863 194.136 28.455 1.00 12.02  ? 422  PRO A CB    1 
ATOM   4041 C  CG    . PRO C 3  416 ? 42.730 193.293 27.960 1.00 11.99  ? 422  PRO A CG    1 
ATOM   4042 C  CD    . PRO C 3  416 ? 42.727 192.162 28.965 1.00 9.82   ? 422  PRO A CD    1 
ATOM   4043 N  N     . ASN C 3  417 ? 45.643 193.502 31.051 1.00 15.24  ? 423  ASN A N     1 
ATOM   4044 C  CA    . ASN C 3  417 ? 46.557 193.976 32.089 1.00 14.67  ? 423  ASN A CA    1 
ATOM   4045 C  C     . ASN C 3  417 ? 46.717 192.928 33.192 1.00 14.73  ? 423  ASN A C     1 
ATOM   4046 O  O     . ASN C 3  417 ? 46.747 193.256 34.377 1.00 14.12  ? 423  ASN A O     1 
ATOM   4047 C  CB    . ASN C 3  417 ? 46.033 195.294 32.675 1.00 13.20  ? 423  ASN A CB    1 
ATOM   4048 C  CG    . ASN C 3  417 ? 47.121 196.109 33.345 1.00 14.60  ? 423  ASN A CG    1 
ATOM   4049 O  OD1   . ASN C 3  417 ? 48.177 196.349 32.766 1.00 16.57  ? 423  ASN A OD1   1 
ATOM   4050 N  ND2   . ASN C 3  417 ? 46.866 196.544 34.564 1.00 13.84  ? 423  ASN A ND2   1 
ATOM   4051 N  N     . GLY C 3  418 ? 46.835 191.670 32.777 1.00 14.26  ? 424  GLY A N     1 
ATOM   4052 C  CA    . GLY C 3  418 ? 46.969 190.562 33.710 1.00 15.93  ? 424  GLY A CA    1 
ATOM   4053 C  C     . GLY C 3  418 ? 48.267 190.426 34.485 1.00 15.67  ? 424  GLY A C     1 
ATOM   4054 O  O     . GLY C 3  418 ? 48.271 189.818 35.548 1.00 17.70  ? 424  GLY A O     1 
ATOM   4055 N  N     . ALA C 3  419 ? 49.370 190.959 33.970 1.00 14.48  ? 425  ALA A N     1 
ATOM   4056 C  CA    . ALA C 3  419 ? 50.644 190.870 34.689 1.00 13.93  ? 425  ALA A CA    1 
ATOM   4057 C  C     . ALA C 3  419 ? 50.869 192.148 35.490 1.00 13.30  ? 425  ALA A C     1 
ATOM   4058 O  O     . ALA C 3  419 ? 50.455 193.229 35.063 1.00 14.41  ? 425  ALA A O     1 
ATOM   4059 C  CB    . ALA C 3  419 ? 51.787 190.662 33.713 1.00 13.10  ? 425  ALA A CB    1 
ATOM   4060 N  N     . VAL C 3  420 ? 51.524 192.030 36.641 1.00 12.68  ? 426  VAL A N     1 
ATOM   4061 C  CA    . VAL C 3  420 ? 51.785 193.191 37.492 1.00 15.19  ? 426  VAL A CA    1 
ATOM   4062 C  C     . VAL C 3  420 ? 52.462 194.363 36.779 1.00 13.73  ? 426  VAL A C     1 
ATOM   4063 O  O     . VAL C 3  420 ? 52.135 195.514 37.038 1.00 14.67  ? 426  VAL A O     1 
ATOM   4064 C  CB    . VAL C 3  420 ? 52.644 192.813 38.736 1.00 16.81  ? 426  VAL A CB    1 
ATOM   4065 C  CG1   . VAL C 3  420 ? 51.889 191.807 39.583 1.00 22.95  ? 426  VAL A CG1   1 
ATOM   4066 C  CG2   . VAL C 3  420 ? 53.997 192.240 38.311 1.00 15.58  ? 426  VAL A CG2   1 
ATOM   4067 N  N     . THR C 3  421 ? 53.391 194.065 35.876 1.00 13.04  ? 427  THR A N     1 
ATOM   4068 C  CA    . THR C 3  421 ? 54.116 195.092 35.143 1.00 11.56  ? 427  THR A CA    1 
ATOM   4069 C  C     . THR C 3  421 ? 53.293 195.841 34.102 1.00 12.18  ? 427  THR A C     1 
ATOM   4070 O  O     . THR C 3  421 ? 53.733 196.869 33.582 1.00 11.88  ? 427  THR A O     1 
ATOM   4071 C  CB    . THR C 3  421 ? 55.314 194.496 34.423 1.00 11.98  ? 427  THR A CB    1 
ATOM   4072 O  OG1   . THR C 3  421 ? 54.869 193.435 33.568 1.00 9.39   ? 427  THR A OG1   1 
ATOM   4073 C  CG2   . THR C 3  421 ? 56.332 193.972 35.433 1.00 13.28  ? 427  THR A CG2   1 
ATOM   4074 N  N     . GLY C 3  422 ? 52.110 195.334 33.785 1.00 10.92  ? 428  GLY A N     1 
ATOM   4075 C  CA    . GLY C 3  422 ? 51.299 196.003 32.788 1.00 10.47  ? 428  GLY A CA    1 
ATOM   4076 C  C     . GLY C 3  422 ? 51.232 195.200 31.503 1.00 12.36  ? 428  GLY A C     1 
ATOM   4077 O  O     . GLY C 3  422 ? 50.649 195.640 30.505 1.00 11.96  ? 428  GLY A O     1 
ATOM   4078 N  N     . ARG C 3  423 ? 51.856 194.026 31.518 1.00 11.63  ? 429  ARG A N     1 
ATOM   4079 C  CA    . ARG C 3  423 ? 51.825 193.139 30.365 1.00 12.75  ? 429  ARG A CA    1 
ATOM   4080 C  C     . ARG C 3  423 ? 50.466 192.467 30.380 1.00 13.01  ? 429  ARG A C     1 
ATOM   4081 O  O     . ARG C 3  423 ? 49.736 192.554 31.362 1.00 14.99  ? 429  ARG A O     1 
ATOM   4082 C  CB    . ARG C 3  423 ? 52.883 192.035 30.470 1.00 14.04  ? 429  ARG A CB    1 
ATOM   4083 C  CG    . ARG C 3  423 ? 54.229 192.338 29.851 1.00 14.17  ? 429  ARG A CG    1 
ATOM   4084 C  CD    . ARG C 3  423 ? 55.016 191.048 29.708 1.00 15.03  ? 429  ARG A CD    1 
ATOM   4085 N  NE    . ARG C 3  423 ? 56.296 191.241 29.033 1.00 17.43  ? 429  ARG A NE    1 
ATOM   4086 C  CZ    . ARG C 3  423 ? 57.109 190.247 28.690 1.00 16.28  ? 429  ARG A CZ    1 
ATOM   4087 N  NH1   . ARG C 3  423 ? 56.768 188.993 28.958 1.00 15.05  ? 429  ARG A NH1   1 
ATOM   4088 N  NH2   . ARG C 3  423 ? 58.263 190.505 28.092 1.00 12.89  ? 429  ARG A NH2   1 
ATOM   4089 N  N     . ALA C 3  424 ? 50.135 191.787 29.293 1.00 11.52  ? 430  ALA A N     1 
ATOM   4090 C  CA    . ALA C 3  424 ? 48.879 191.065 29.215 1.00 10.56  ? 430  ALA A CA    1 
ATOM   4091 C  C     . ALA C 3  424 ? 49.202 189.612 29.547 1.00 11.16  ? 430  ALA A C     1 
ATOM   4092 O  O     . ALA C 3  424 ? 50.371 189.220 29.563 1.00 9.07   ? 430  ALA A O     1 
ATOM   4093 C  CB    . ALA C 3  424 ? 48.304 191.153 27.795 1.00 10.11  ? 430  ALA A CB    1 
ATOM   4094 N  N     . THR C 3  425 ? 48.171 188.827 29.838 1.00 10.21  ? 431  THR A N     1 
ATOM   4095 C  CA    . THR C 3  425 ? 48.347 187.401 30.086 1.00 11.32  ? 431  THR A CA    1 
ATOM   4096 C  C     . THR C 3  425 ? 47.474 186.775 29.016 1.00 12.12  ? 431  THR A C     1 
ATOM   4097 O  O     . THR C 3  425 ? 46.556 187.417 28.517 1.00 13.53  ? 431  THR A O     1 
ATOM   4098 C  CB    . THR C 3  425 ? 47.871 186.968 31.496 1.00 12.86  ? 431  THR A CB    1 
ATOM   4099 O  OG1   . THR C 3  425 ? 46.484 187.295 31.679 1.00 9.99   ? 431  THR A OG1   1 
ATOM   4100 C  CG2   . THR C 3  425 ? 48.715 187.666 32.567 1.00 12.62  ? 431  THR A CG2   1 
ATOM   4101 N  N     . HIS C 3  426 ? 47.759 185.536 28.644 1.00 13.68  ? 432  HIS A N     1 
ATOM   4102 C  CA    . HIS C 3  426 ? 46.992 184.887 27.592 1.00 11.71  ? 432  HIS A CA    1 
ATOM   4103 C  C     . HIS C 3  426 ? 46.622 183.479 28.011 1.00 11.72  ? 432  HIS A C     1 
ATOM   4104 O  O     . HIS C 3  426 ? 47.423 182.780 28.615 1.00 12.86  ? 432  HIS A O     1 
ATOM   4105 C  CB    . HIS C 3  426 ? 47.822 184.855 26.310 1.00 11.83  ? 432  HIS A CB    1 
ATOM   4106 C  CG    . HIS C 3  426 ? 48.587 186.119 26.051 1.00 11.97  ? 432  HIS A CG    1 
ATOM   4107 N  ND1   . HIS C 3  426 ? 49.560 186.591 26.908 1.00 10.77  ? 432  HIS A ND1   1 
ATOM   4108 C  CD2   . HIS C 3  426 ? 48.523 187.010 25.033 1.00 11.90  ? 432  HIS A CD2   1 
ATOM   4109 C  CE1   . HIS C 3  426 ? 50.061 187.716 26.432 1.00 10.51  ? 432  HIS A CE1   1 
ATOM   4110 N  NE2   . HIS C 3  426 ? 49.449 187.994 25.294 1.00 13.25  ? 432  HIS A NE2   1 
ATOM   4111 N  N     . ALA C 3  427 ? 45.413 183.050 27.677 1.00 11.92  ? 433  ALA A N     1 
ATOM   4112 C  CA    . ALA C 3  427 ? 44.984 181.718 28.063 1.00 11.80  ? 433  ALA A CA    1 
ATOM   4113 C  C     . ALA C 3  427 ? 43.755 181.227 27.299 1.00 11.64  ? 433  ALA A C     1 
ATOM   4114 O  O     . ALA C 3  427 ? 43.122 181.979 26.562 1.00 11.64  ? 433  ALA A O     1 
ATOM   4115 C  CB    . ALA C 3  427 ? 44.705 181.702 29.563 1.00 9.93   ? 433  ALA A CB    1 
ATOM   4116 N  N     . PHE C 3  428 ? 43.434 179.951 27.489 1.00 11.92  ? 434  PHE A N     1 
ATOM   4117 C  CA    . PHE C 3  428 ? 42.276 179.322 26.863 1.00 13.46  ? 434  PHE A CA    1 
ATOM   4118 C  C     . PHE C 3  428 ? 42.220 179.369 25.331 1.00 12.52  ? 434  PHE A C     1 
ATOM   4119 O  O     . PHE C 3  428 ? 41.229 179.824 24.762 1.00 14.88  ? 434  PHE A O     1 
ATOM   4120 C  CB    . PHE C 3  428 ? 40.988 179.945 27.415 1.00 14.93  ? 434  PHE A CB    1 
ATOM   4121 C  CG    . PHE C 3  428 ? 40.981 180.106 28.904 1.00 16.33  ? 434  PHE A CG    1 
ATOM   4122 C  CD1   . PHE C 3  428 ? 41.193 179.017 29.737 1.00 19.88  ? 434  PHE A CD1   1 
ATOM   4123 C  CD2   . PHE C 3  428 ? 40.758 181.354 29.474 1.00 18.48  ? 434  PHE A CD2   1 
ATOM   4124 C  CE1   . PHE C 3  428 ? 41.184 179.166 31.122 1.00 20.17  ? 434  PHE A CE1   1 
ATOM   4125 C  CE2   . PHE C 3  428 ? 40.745 181.519 30.858 1.00 20.32  ? 434  PHE A CE2   1 
ATOM   4126 C  CZ    . PHE C 3  428 ? 40.960 180.421 31.686 1.00 19.25  ? 434  PHE A CZ    1 
ATOM   4127 N  N     . PRO C 3  429 ? 43.285 178.936 24.641 1.00 10.92  ? 435  PRO A N     1 
ATOM   4128 C  CA    . PRO C 3  429 ? 44.565 178.431 25.147 1.00 9.73   ? 435  PRO A CA    1 
ATOM   4129 C  C     . PRO C 3  429 ? 45.536 179.603 25.130 1.00 9.54   ? 435  PRO A C     1 
ATOM   4130 O  O     . PRO C 3  429 ? 45.234 180.641 24.557 1.00 8.13   ? 435  PRO A O     1 
ATOM   4131 C  CB    . PRO C 3  429 ? 44.932 177.367 24.121 1.00 8.97   ? 435  PRO A CB    1 
ATOM   4132 C  CG    . PRO C 3  429 ? 44.467 177.987 22.857 1.00 9.04   ? 435  PRO A CG    1 
ATOM   4133 C  CD    . PRO C 3  429 ? 43.125 178.606 23.214 1.00 8.75   ? 435  PRO A CD    1 
ATOM   4134 N  N     . ASN C 3  430 ? 46.696 179.452 25.752 1.00 11.67  ? 436  ASN A N     1 
ATOM   4135 C  CA    . ASN C 3  430 ? 47.670 180.535 25.768 1.00 12.85  ? 436  ASN A CA    1 
ATOM   4136 C  C     . ASN C 3  430 ? 48.352 180.669 24.407 1.00 12.97  ? 436  ASN A C     1 
ATOM   4137 O  O     . ASN C 3  430 ? 49.302 179.949 24.113 1.00 15.62  ? 436  ASN A O     1 
ATOM   4138 C  CB    . ASN C 3  430 ? 48.727 180.280 26.847 1.00 11.99  ? 436  ASN A CB    1 
ATOM   4139 C  CG    . ASN C 3  430 ? 49.791 181.371 26.893 1.00 14.54  ? 436  ASN A CG    1 
ATOM   4140 O  OD1   . ASN C 3  430 ? 49.767 182.319 26.097 1.00 12.87  ? 436  ASN A OD1   1 
ATOM   4141 N  ND2   . ASN C 3  430 ? 50.732 181.243 27.826 1.00 13.07  ? 436  ASN A ND2   1 
ATOM   4142 N  N     . LEU C 3  431 ? 47.881 181.595 23.581 1.00 12.40  ? 437  LEU A N     1 
ATOM   4143 C  CA    . LEU C 3  431 ? 48.486 181.788 22.267 1.00 13.65  ? 437  LEU A CA    1 
ATOM   4144 C  C     . LEU C 3  431 ? 49.847 182.472 22.348 1.00 13.86  ? 437  LEU A C     1 
ATOM   4145 O  O     . LEU C 3  431 ? 50.469 182.748 21.325 1.00 12.27  ? 437  LEU A O     1 
ATOM   4146 C  CB    . LEU C 3  431 ? 47.552 182.594 21.355 1.00 13.34  ? 437  LEU A CB    1 
ATOM   4147 C  CG    . LEU C 3  431 ? 46.267 181.852 20.964 1.00 15.69  ? 437  LEU A CG    1 
ATOM   4148 C  CD1   . LEU C 3  431 ? 45.493 182.662 19.927 1.00 17.07  ? 437  LEU A CD1   1 
ATOM   4149 C  CD2   . LEU C 3  431 ? 46.624 180.471 20.404 1.00 14.36  ? 437  LEU A CD2   1 
ATOM   4150 N  N     . ALA C 3  432 ? 50.312 182.740 23.566 1.00 14.66  ? 438  ALA A N     1 
ATOM   4151 C  CA    . ALA C 3  432 ? 51.608 183.377 23.751 1.00 15.53  ? 438  ALA A CA    1 
ATOM   4152 C  C     . ALA C 3  432 ? 52.683 182.378 24.194 1.00 15.94  ? 438  ALA A C     1 
ATOM   4153 O  O     . ALA C 3  432 ? 53.717 182.771 24.729 1.00 17.79  ? 438  ALA A O     1 
ATOM   4154 C  CB    . ALA C 3  432 ? 51.497 184.522 24.756 1.00 15.97  ? 438  ALA A CB    1 
ATOM   4155 N  N     . GLN C 3  433 ? 52.437 181.087 23.986 1.00 14.56  ? 439  GLN A N     1 
ATOM   4156 C  CA    . GLN C 3  433 ? 53.434 180.069 24.330 1.00 14.96  ? 439  GLN A CA    1 
ATOM   4157 C  C     . GLN C 3  433 ? 53.470 178.967 23.263 1.00 15.77  ? 439  GLN A C     1 
ATOM   4158 O  O     . GLN C 3  433 ? 53.713 177.794 23.571 1.00 13.53  ? 439  GLN A O     1 
ATOM   4159 C  CB    . GLN C 3  433 ? 53.170 179.463 25.722 1.00 12.38  ? 439  GLN A CB    1 
ATOM   4160 C  CG    . GLN C 3  433 ? 51.873 178.660 25.855 1.00 14.13  ? 439  GLN A CG    1 
ATOM   4161 C  CD    . GLN C 3  433 ? 51.640 178.131 27.273 1.00 13.99  ? 439  GLN A CD    1 
ATOM   4162 O  OE1   . GLN C 3  433 ? 50.556 177.643 27.598 1.00 10.07  ? 439  GLN A OE1   1 
ATOM   4163 N  NE2   . GLN C 3  433 ? 52.665 178.226 28.120 1.00 13.17  ? 439  GLN A NE2   1 
ATOM   4164 N  N     . ILE C 3  434 ? 53.213 179.347 22.008 1.00 14.47  ? 440  ILE A N     1 
ATOM   4165 C  CA    . ILE C 3  434 ? 53.252 178.387 20.905 1.00 13.29  ? 440  ILE A CA    1 
ATOM   4166 C  C     . ILE C 3  434 ? 54.714 178.043 20.694 1.00 13.97  ? 440  ILE A C     1 
ATOM   4167 O  O     . ILE C 3  434 ? 55.562 178.934 20.670 1.00 12.64  ? 440  ILE A O     1 
ATOM   4168 C  CB    . ILE C 3  434 ? 52.737 178.986 19.586 1.00 13.45  ? 440  ILE A CB    1 
ATOM   4169 C  CG1   . ILE C 3  434 ? 51.294 179.483 19.745 1.00 12.21  ? 440  ILE A CG1   1 
ATOM   4170 C  CG2   . ILE C 3  434 ? 52.853 177.940 18.475 1.00 12.30  ? 440  ILE A CG2   1 
ATOM   4171 C  CD1   . ILE C 3  434 ? 50.286 178.388 19.993 1.00 9.90   ? 440  ILE A CD1   1 
ATOM   4172 N  N     . PRO C 3  435 ? 55.038 176.748 20.542 1.00 16.50  ? 441  PRO A N     1 
ATOM   4173 C  CA    . PRO C 3  435 ? 56.449 176.393 20.335 1.00 16.65  ? 441  PRO A CA    1 
ATOM   4174 C  C     . PRO C 3  435 ? 57.060 177.197 19.185 1.00 17.59  ? 441  PRO A C     1 
ATOM   4175 O  O     . PRO C 3  435 ? 56.407 177.429 18.172 1.00 17.54  ? 441  PRO A O     1 
ATOM   4176 C  CB    . PRO C 3  435 ? 56.383 174.899 20.037 1.00 15.59  ? 441  PRO A CB    1 
ATOM   4177 C  CG    . PRO C 3  435 ? 55.224 174.449 20.889 1.00 14.73  ? 441  PRO A CG    1 
ATOM   4178 C  CD    . PRO C 3  435 ? 54.195 175.540 20.646 1.00 15.60  ? 441  PRO A CD    1 
ATOM   4179 N  N     . GLY C 3  436 ? 58.304 177.635 19.356 1.00 19.74  ? 442  GLY A N     1 
ATOM   4180 C  CA    . GLY C 3  436 ? 58.970 178.410 18.320 1.00 19.64  ? 442  GLY A CA    1 
ATOM   4181 C  C     . GLY C 3  436 ? 59.398 177.531 17.161 1.00 20.30  ? 442  GLY A C     1 
ATOM   4182 O  O     . GLY C 3  436 ? 59.630 176.345 17.353 1.00 19.05  ? 442  GLY A O     1 
ATOM   4183 N  N     . VAL C 3  437 ? 59.515 178.108 15.966 1.00 21.84  ? 443  VAL A N     1 
ATOM   4184 C  CA    . VAL C 3  437 ? 59.902 177.343 14.782 1.00 23.86  ? 443  VAL A CA    1 
ATOM   4185 C  C     . VAL C 3  437 ? 61.232 176.615 14.909 1.00 25.76  ? 443  VAL A C     1 
ATOM   4186 O  O     . VAL C 3  437 ? 61.462 175.623 14.220 1.00 29.34  ? 443  VAL A O     1 
ATOM   4187 C  CB    . VAL C 3  437 ? 59.982 178.231 13.508 1.00 23.49  ? 443  VAL A CB    1 
ATOM   4188 C  CG1   . VAL C 3  437 ? 58.658 178.914 13.259 1.00 22.60  ? 443  VAL A CG1   1 
ATOM   4189 C  CG2   . VAL C 3  437 ? 61.089 179.255 13.648 1.00 22.48  ? 443  VAL A CG2   1 
ATOM   4190 N  N     . ARG C 3  438 ? 62.113 177.091 15.780 1.00 27.83  ? 444  ARG A N     1 
ATOM   4191 C  CA    . ARG C 3  438 ? 63.410 176.442 15.924 1.00 30.35  ? 444  ARG A CA    1 
ATOM   4192 C  C     . ARG C 3  438 ? 63.419 175.281 16.900 1.00 30.49  ? 444  ARG A C     1 
ATOM   4193 O  O     . ARG C 3  438 ? 64.408 174.568 16.990 1.00 34.37  ? 444  ARG A O     1 
ATOM   4194 C  CB    . ARG C 3  438 ? 64.481 177.463 16.315 1.00 33.68  ? 444  ARG A CB    1 
ATOM   4195 C  CG    . ARG C 3  438 ? 64.762 178.480 15.215 1.00 37.06  ? 444  ARG A CG    1 
ATOM   4196 C  CD    . ARG C 3  438 ? 65.697 179.590 15.674 1.00 41.00  ? 444  ARG A CD    1 
ATOM   4197 N  NE    . ARG C 3  438 ? 65.436 180.821 14.932 1.00 44.86  ? 444  ARG A NE    1 
ATOM   4198 C  CZ    . ARG C 3  438 ? 64.392 181.616 15.150 1.00 46.69  ? 444  ARG A CZ    1 
ATOM   4199 N  NH1   . ARG C 3  438 ? 63.514 181.316 16.098 1.00 48.96  ? 444  ARG A NH1   1 
ATOM   4200 N  NH2   . ARG C 3  438 ? 64.209 182.696 14.405 1.00 48.67  ? 444  ARG A NH2   1 
ATOM   4201 N  N     . SER C 3  439 ? 62.331 175.082 17.635 1.00 29.11  ? 445  SER A N     1 
ATOM   4202 C  CA    . SER C 3  439 ? 62.270 173.960 18.571 1.00 26.97  ? 445  SER A CA    1 
ATOM   4203 C  C     . SER C 3  439 ? 61.634 172.783 17.835 1.00 24.99  ? 445  SER A C     1 
ATOM   4204 O  O     . SER C 3  439 ? 61.012 172.958 16.784 1.00 23.83  ? 445  SER A O     1 
ATOM   4205 C  CB    . SER C 3  439 ? 61.423 174.315 19.790 1.00 25.85  ? 445  SER A CB    1 
ATOM   4206 O  OG    . SER C 3  439 ? 60.071 174.458 19.411 1.00 27.18  ? 445  SER A OG    1 
ATOM   4207 N  N     . PRO C 3  440 ? 61.781 171.566 18.374 1.00 23.92  ? 446  PRO A N     1 
ATOM   4208 C  CA    . PRO C 3  440 ? 61.196 170.398 17.712 1.00 21.83  ? 446  PRO A CA    1 
ATOM   4209 C  C     . PRO C 3  440 ? 59.705 170.560 17.412 1.00 22.26  ? 446  PRO A C     1 
ATOM   4210 O  O     . PRO C 3  440 ? 58.930 170.987 18.274 1.00 20.27  ? 446  PRO A O     1 
ATOM   4211 C  CB    . PRO C 3  440 ? 61.485 169.270 18.699 1.00 21.37  ? 446  PRO A CB    1 
ATOM   4212 C  CG    . PRO C 3  440 ? 62.798 169.687 19.287 1.00 21.56  ? 446  PRO A CG    1 
ATOM   4213 C  CD    . PRO C 3  440 ? 62.567 171.161 19.555 1.00 22.89  ? 446  PRO A CD    1 
ATOM   4214 N  N     . TYR C 3  441 ? 59.324 170.219 16.180 1.00 21.96  ? 447  TYR A N     1 
ATOM   4215 C  CA    . TYR C 3  441 ? 57.938 170.303 15.724 1.00 21.63  ? 447  TYR A CA    1 
ATOM   4216 C  C     . TYR C 3  441 ? 57.418 171.729 15.687 1.00 22.20  ? 447  TYR A C     1 
ATOM   4217 O  O     . TYR C 3  441 ? 56.246 171.959 15.389 1.00 21.31  ? 447  TYR A O     1 
ATOM   4218 C  CB    . TYR C 3  441 ? 57.039 169.457 16.624 1.00 22.62  ? 447  TYR A CB    1 
ATOM   4219 C  CG    . TYR C 3  441 ? 57.384 167.992 16.584 1.00 24.82  ? 447  TYR A CG    1 
ATOM   4220 C  CD1   . TYR C 3  441 ? 57.042 167.204 15.480 1.00 23.37  ? 447  TYR A CD1   1 
ATOM   4221 C  CD2   . TYR C 3  441 ? 58.091 167.398 17.627 1.00 22.84  ? 447  TYR A CD2   1 
ATOM   4222 C  CE1   . TYR C 3  441 ? 57.398 165.864 15.417 1.00 21.42  ? 447  TYR A CE1   1 
ATOM   4223 C  CE2   . TYR C 3  441 ? 58.453 166.058 17.573 1.00 24.15  ? 447  TYR A CE2   1 
ATOM   4224 C  CZ    . TYR C 3  441 ? 58.104 165.297 16.466 1.00 23.94  ? 447  TYR A CZ    1 
ATOM   4225 O  OH    . TYR C 3  441 ? 58.470 163.969 16.414 1.00 26.31  ? 447  TYR A OH    1 
ATOM   4226 N  N     . GLY C 3  442 ? 58.296 172.681 15.988 1.00 22.80  ? 448  GLY A N     1 
ATOM   4227 C  CA    . GLY C 3  442 ? 57.909 174.078 15.996 1.00 24.80  ? 448  GLY A CA    1 
ATOM   4228 C  C     . GLY C 3  442 ? 57.338 174.597 14.689 1.00 27.56  ? 448  GLY A C     1 
ATOM   4229 O  O     . GLY C 3  442 ? 56.316 175.283 14.690 1.00 27.78  ? 448  GLY A O     1 
ATOM   4230 N  N     . GLU C 3  443 ? 57.978 174.276 13.568 1.00 27.99  ? 449  GLU A N     1 
ATOM   4231 C  CA    . GLU C 3  443 ? 57.487 174.757 12.285 1.00 29.83  ? 449  GLU A CA    1 
ATOM   4232 C  C     . GLU C 3  443 ? 56.072 174.306 11.985 1.00 27.01  ? 449  GLU A C     1 
ATOM   4233 O  O     . GLU C 3  443 ? 55.252 175.100 11.534 1.00 26.48  ? 449  GLU A O     1 
ATOM   4234 C  CB    . GLU C 3  443 ? 58.431 174.344 11.158 1.00 33.13  ? 449  GLU A CB    1 
ATOM   4235 C  CG    . GLU C 3  443 ? 59.710 175.156 11.171 1.00 42.21  ? 449  GLU A CG    1 
ATOM   4236 C  CD    . GLU C 3  443 ? 60.635 174.822 10.025 1.00 47.86  ? 449  GLU A CD    1 
ATOM   4237 O  OE1   . GLU C 3  443 ? 61.124 173.668 9.973  1.00 50.81  ? 449  GLU A OE1   1 
ATOM   4238 O  OE2   . GLU C 3  443 ? 60.869 175.715 9.177  1.00 50.01  ? 449  GLU A OE2   1 
ATOM   4239 N  N     . GLN C 3  444 ? 55.778 173.038 12.243 1.00 24.37  ? 450  GLN A N     1 
ATOM   4240 C  CA    . GLN C 3  444 ? 54.438 172.523 12.005 1.00 22.27  ? 450  GLN A CA    1 
ATOM   4241 C  C     . GLN C 3  444 ? 53.440 173.239 12.914 1.00 21.03  ? 450  GLN A C     1 
ATOM   4242 O  O     . GLN C 3  444 ? 52.375 173.664 12.469 1.00 19.29  ? 450  GLN A O     1 
ATOM   4243 C  CB    . GLN C 3  444 ? 54.408 171.013 12.259 1.00 23.89  ? 450  GLN A CB    1 
ATOM   4244 C  CG    . GLN C 3  444 ? 54.925 170.181 11.087 1.00 25.69  ? 450  GLN A CG    1 
ATOM   4245 C  CD    . GLN C 3  444 ? 55.366 168.790 11.507 1.00 28.24  ? 450  GLN A CD    1 
ATOM   4246 O  OE1   . GLN C 3  444 ? 56.405 168.630 12.151 1.00 30.55  ? 450  GLN A OE1   1 
ATOM   4247 N  NE2   . GLN C 3  444 ? 54.575 167.778 11.153 1.00 26.11  ? 450  GLN A NE2   1 
ATOM   4248 N  N     . CYS C 3  445 ? 53.793 173.385 14.186 1.00 19.17  ? 451  CYS A N     1 
ATOM   4249 C  CA    . CYS C 3  445 ? 52.916 174.056 15.136 1.00 19.25  ? 451  CYS A CA    1 
ATOM   4250 C  C     . CYS C 3  445 ? 52.631 175.493 14.717 1.00 18.92  ? 451  CYS A C     1 
ATOM   4251 O  O     . CYS C 3  445 ? 51.483 175.942 14.698 1.00 19.99  ? 451  CYS A O     1 
ATOM   4252 C  CB    . CYS C 3  445 ? 53.552 174.080 16.521 1.00 19.37  ? 451  CYS A CB    1 
ATOM   4253 S  SG    . CYS C 3  445 ? 53.655 172.495 17.328 1.00 22.90  ? 451  CYS A SG    1 
ATOM   4254 N  N     . ARG C 3  446 ? 53.701 176.204 14.396 1.00 16.62  ? 452  ARG A N     1 
ATOM   4255 C  CA    . ARG C 3  446 ? 53.643 177.594 14.012 1.00 15.43  ? 452  ARG A CA    1 
ATOM   4256 C  C     . ARG C 3  446 ? 52.877 177.837 12.713 1.00 17.16  ? 452  ARG A C     1 
ATOM   4257 O  O     . ARG C 3  446 ? 52.072 178.766 12.623 1.00 16.94  ? 452  ARG A O     1 
ATOM   4258 C  CB    . ARG C 3  446 ? 55.063 178.116 13.876 1.00 17.36  ? 452  ARG A CB    1 
ATOM   4259 C  CG    . ARG C 3  446 ? 55.277 179.476 14.458 1.00 21.58  ? 452  ARG A CG    1 
ATOM   4260 C  CD    . ARG C 3  446 ? 55.322 179.479 15.980 1.00 19.16  ? 452  ARG A CD    1 
ATOM   4261 N  NE    . ARG C 3  446 ? 55.309 180.868 16.417 1.00 20.87  ? 452  ARG A NE    1 
ATOM   4262 C  CZ    . ARG C 3  446 ? 55.619 181.309 17.627 1.00 17.19  ? 452  ARG A CZ    1 
ATOM   4263 N  NH1   . ARG C 3  446 ? 55.985 180.477 18.587 1.00 16.90  ? 452  ARG A NH1   1 
ATOM   4264 N  NH2   . ARG C 3  446 ? 55.572 182.608 17.857 1.00 17.63  ? 452  ARG A NH2   1 
ATOM   4265 N  N     . ALA C 3  447 ? 53.125 177.002 11.709 1.00 16.19  ? 453  ALA A N     1 
ATOM   4266 C  CA    . ALA C 3  447 ? 52.461 177.150 10.417 1.00 15.61  ? 453  ALA A CA    1 
ATOM   4267 C  C     . ALA C 3  447 ? 50.969 176.843 10.490 1.00 15.06  ? 453  ALA A C     1 
ATOM   4268 O  O     . ALA C 3  447 ? 50.205 177.236 9.608  1.00 13.90  ? 453  ALA A O     1 
ATOM   4269 C  CB    . ALA C 3  447 ? 53.128 176.249 9.375  1.00 15.72  ? 453  ALA A CB    1 
ATOM   4270 N  N     . ALA C 3  448 ? 50.548 176.137 11.532 1.00 12.71  ? 454  ALA A N     1 
ATOM   4271 C  CA    . ALA C 3  448 ? 49.135 175.821 11.662 1.00 13.30  ? 454  ALA A CA    1 
ATOM   4272 C  C     . ALA C 3  448 ? 48.330 177.077 12.011 1.00 12.77  ? 454  ALA A C     1 
ATOM   4273 O  O     . ALA C 3  448 ? 47.117 177.104 11.823 1.00 14.25  ? 454  ALA A O     1 
ATOM   4274 C  CB    . ALA C 3  448 ? 48.922 174.736 12.712 1.00 12.26  ? 454  ALA A CB    1 
ATOM   4275 N  N     . PHE C 3  449 ? 49.004 178.108 12.521 1.00 11.99  ? 455  PHE A N     1 
ATOM   4276 C  CA    . PHE C 3  449 ? 48.346 179.374 12.860 1.00 12.07  ? 455  PHE A CA    1 
ATOM   4277 C  C     . PHE C 3  449 ? 48.705 180.367 11.763 1.00 13.29  ? 455  PHE A C     1 
ATOM   4278 O  O     . PHE C 3  449 ? 49.865 180.748 11.626 1.00 13.71  ? 455  PHE A O     1 
ATOM   4279 C  CB    . PHE C 3  449 ? 48.842 179.934 14.201 1.00 10.61  ? 455  PHE A CB    1 
ATOM   4280 C  CG    . PHE C 3  449 ? 48.484 179.091 15.397 1.00 9.85   ? 455  PHE A CG    1 
ATOM   4281 C  CD1   . PHE C 3  449 ? 49.222 177.954 15.714 1.00 8.14   ? 455  PHE A CD1   1 
ATOM   4282 C  CD2   . PHE C 3  449 ? 47.407 179.439 16.204 1.00 6.45   ? 455  PHE A CD2   1 
ATOM   4283 C  CE1   . PHE C 3  449 ? 48.890 177.174 16.819 1.00 9.24   ? 455  PHE A CE1   1 
ATOM   4284 C  CE2   . PHE C 3  449 ? 47.065 178.672 17.307 1.00 7.53   ? 455  PHE A CE2   1 
ATOM   4285 C  CZ    . PHE C 3  449 ? 47.810 177.531 17.618 1.00 8.70   ? 455  PHE A CZ    1 
ATOM   4286 N  N     . GLY C 3  450 ? 47.729 180.792 10.973 1.00 14.38  ? 456  GLY A N     1 
ATOM   4287 C  CA    . GLY C 3  450 ? 48.059 181.722 9.912  1.00 15.52  ? 456  GLY A CA    1 
ATOM   4288 C  C     . GLY C 3  450 ? 46.899 182.247 9.106  1.00 14.89  ? 456  GLY A C     1 
ATOM   4289 O  O     . GLY C 3  450 ? 45.862 181.594 8.979  1.00 16.73  ? 456  GLY A O     1 
ATOM   4290 N  N     . ALA C 3  451 ? 47.091 183.438 8.552  1.00 14.20  ? 457  ALA A N     1 
ATOM   4291 C  CA    . ALA C 3  451 ? 46.074 184.087 7.741  1.00 14.88  ? 457  ALA A CA    1 
ATOM   4292 C  C     . ALA C 3  451 ? 45.697 183.227 6.539  1.00 15.47  ? 457  ALA A C     1 
ATOM   4293 O  O     . ALA C 3  451 ? 44.553 183.242 6.094  1.00 16.36  ? 457  ALA A O     1 
ATOM   4294 C  CB    . ALA C 3  451 ? 46.576 185.439 7.269  1.00 13.93  ? 457  ALA A CB    1 
ATOM   4295 N  N     . GLU C 3  452 ? 46.657 182.464 6.027  1.00 15.85  ? 458  GLU A N     1 
ATOM   4296 C  CA    . GLU C 3  452 ? 46.397 181.624 4.869  1.00 16.67  ? 458  GLU A CA    1 
ATOM   4297 C  C     . GLU C 3  452 ? 45.232 180.677 5.118  1.00 16.90  ? 458  GLU A C     1 
ATOM   4298 O  O     . GLU C 3  452 ? 44.484 180.361 4.195  1.00 15.69  ? 458  GLU A O     1 
ATOM   4299 C  CB    . GLU C 3  452 ? 47.646 180.818 4.488  1.00 16.06  ? 458  GLU A CB    1 
ATOM   4300 C  CG    . GLU C 3  452 ? 47.958 179.647 5.402  1.00 16.64  ? 458  GLU A CG    1 
ATOM   4301 C  CD    . GLU C 3  452 ? 49.155 178.844 4.916  1.00 19.21  ? 458  GLU A CD    1 
ATOM   4302 O  OE1   . GLU C 3  452 ? 49.257 178.616 3.688  1.00 20.52  ? 458  GLU A OE1   1 
ATOM   4303 O  OE2   . GLU C 3  452 ? 49.985 178.430 5.757  1.00 18.41  ? 458  GLU A OE2   1 
ATOM   4304 N  N     . HIS C 3  453 ? 45.069 180.239 6.365  1.00 16.22  ? 459  HIS A N     1 
ATOM   4305 C  CA    . HIS C 3  453 ? 43.995 179.310 6.697  1.00 15.96  ? 459  HIS A CA    1 
ATOM   4306 C  C     . HIS C 3  453 ? 42.614 179.956 6.731  1.00 16.43  ? 459  HIS A C     1 
ATOM   4307 O  O     . HIS C 3  453 ? 41.635 179.307 7.077  1.00 16.39  ? 459  HIS A O     1 
ATOM   4308 C  CB    . HIS C 3  453 ? 44.297 178.616 8.028  1.00 17.12  ? 459  HIS A CB    1 
ATOM   4309 C  CG    . HIS C 3  453 ? 45.659 177.999 8.077  1.00 19.93  ? 459  HIS A CG    1 
ATOM   4310 N  ND1   . HIS C 3  453 ? 46.070 177.032 7.184  1.00 21.53  ? 459  HIS A ND1   1 
ATOM   4311 C  CD2   . HIS C 3  453 ? 46.728 178.259 8.868  1.00 20.33  ? 459  HIS A CD2   1 
ATOM   4312 C  CE1   . HIS C 3  453 ? 47.335 176.728 7.418  1.00 21.83  ? 459  HIS A CE1   1 
ATOM   4313 N  NE2   . HIS C 3  453 ? 47.757 177.458 8.435  1.00 23.11  ? 459  HIS A NE2   1 
ATOM   4314 N  N     . HIS C 3  454 ? 42.537 181.237 6.382  1.00 16.27  ? 460  HIS A N     1 
ATOM   4315 C  CA    . HIS C 3  454 ? 41.251 181.922 6.335  1.00 15.21  ? 460  HIS A CA    1 
ATOM   4316 C  C     . HIS C 3  454 ? 40.976 182.304 4.882  1.00 15.81  ? 460  HIS A C     1 
ATOM   4317 O  O     . HIS C 3  454 ? 41.771 183.004 4.257  1.00 14.88  ? 460  HIS A O     1 
ATOM   4318 C  CB    . HIS C 3  454 ? 41.256 183.194 7.184  1.00 16.94  ? 460  HIS A CB    1 
ATOM   4319 C  CG    . HIS C 3  454 ? 40.045 184.053 6.976  1.00 17.20  ? 460  HIS A CG    1 
ATOM   4320 N  ND1   . HIS C 3  454 ? 38.815 183.756 7.525  1.00 17.57  ? 460  HIS A ND1   1 
ATOM   4321 C  CD2   . HIS C 3  454 ? 39.856 185.156 6.212  1.00 17.31  ? 460  HIS A CD2   1 
ATOM   4322 C  CE1   . HIS C 3  454 ? 37.922 184.636 7.108  1.00 14.78  ? 460  HIS A CE1   1 
ATOM   4323 N  NE2   . HIS C 3  454 ? 38.528 185.496 6.309  1.00 17.34  ? 460  HIS A NE2   1 
ATOM   4324 N  N     . LEU C 3  455 ? 39.858 181.833 4.344  1.00 14.50  ? 461  LEU A N     1 
ATOM   4325 C  CA    . LEU C 3  455 ? 39.503 182.149 2.975  1.00 15.68  ? 461  LEU A CA    1 
ATOM   4326 C  C     . LEU C 3  455 ? 38.537 183.325 3.019  1.00 16.94  ? 461  LEU A C     1 
ATOM   4327 O  O     . LEU C 3  455 ? 37.594 183.337 3.822  1.00 16.63  ? 461  LEU A O     1 
ATOM   4328 C  CB    . LEU C 3  455 ? 38.860 180.932 2.299  1.00 18.14  ? 461  LEU A CB    1 
ATOM   4329 C  CG    . LEU C 3  455 ? 39.693 179.637 2.337  1.00 17.32  ? 461  LEU A CG    1 
ATOM   4330 C  CD1   . LEU C 3  455 ? 38.875 178.487 1.773  1.00 16.94  ? 461  LEU A CD1   1 
ATOM   4331 C  CD2   . LEU C 3  455 ? 40.990 179.815 1.551  1.00 14.71  ? 461  LEU A CD2   1 
ATOM   4332 N  N     . ASP C 3  456 ? 38.781 184.321 2.170  1.00 15.17  ? 462  ASP A N     1 
ATOM   4333 C  CA    . ASP C 3  456 ? 37.944 185.507 2.149  1.00 14.59  ? 462  ASP A CA    1 
ATOM   4334 C  C     . ASP C 3  456 ? 36.474 185.181 1.955  1.00 15.39  ? 462  ASP A C     1 
ATOM   4335 O  O     . ASP C 3  456 ? 36.109 184.373 1.108  1.00 17.36  ? 462  ASP A O     1 
ATOM   4336 C  CB    . ASP C 3  456 ? 38.391 186.462 1.051  1.00 15.29  ? 462  ASP A CB    1 
ATOM   4337 C  CG    . ASP C 3  456 ? 37.648 187.767 1.103  1.00 15.56  ? 462  ASP A CG    1 
ATOM   4338 O  OD1   . ASP C 3  456 ? 37.998 188.605 1.960  1.00 15.03  ? 462  ASP A OD1   1 
ATOM   4339 O  OD2   . ASP C 3  456 ? 36.699 187.947 0.310  1.00 17.77  ? 462  ASP A OD2   1 
ATOM   4340 N  N     . GLY C 3  457 ? 35.629 185.845 2.732  1.00 15.47  ? 463  GLY A N     1 
ATOM   4341 C  CA    . GLY C 3  457 ? 34.206 185.601 2.651  1.00 14.73  ? 463  GLY A CA    1 
ATOM   4342 C  C     . GLY C 3  457 ? 33.606 185.788 1.278  1.00 16.59  ? 463  GLY A C     1 
ATOM   4343 O  O     . GLY C 3  457 ? 32.606 185.159 0.951  1.00 18.29  ? 463  GLY A O     1 
ATOM   4344 N  N     . ILE C 3  458 ? 34.217 186.637 0.463  1.00 17.77  ? 464  ILE A N     1 
ATOM   4345 C  CA    . ILE C 3  458 ? 33.681 186.909 -0.865 1.00 16.38  ? 464  ILE A CA    1 
ATOM   4346 C  C     . ILE C 3  458 ? 34.396 186.178 -2.009 1.00 17.09  ? 464  ILE A C     1 
ATOM   4347 O  O     . ILE C 3  458 ? 33.759 185.481 -2.802 1.00 18.69  ? 464  ILE A O     1 
ATOM   4348 C  CB    . ILE C 3  458 ? 33.672 188.448 -1.128 1.00 15.34  ? 464  ILE A CB    1 
ATOM   4349 C  CG1   . ILE C 3  458 ? 32.700 189.122 -0.148 1.00 13.49  ? 464  ILE A CG1   1 
ATOM   4350 C  CG2   . ILE C 3  458 ? 33.284 188.760 -2.576 1.00 11.24  ? 464  ILE A CG2   1 
ATOM   4351 C  CD1   . ILE C 3  458 ? 32.702 190.637 -0.201 1.00 15.69  ? 464  ILE A CD1   1 
ATOM   4352 N  N     . THR C 3  459 ? 35.715 186.312 -2.081 1.00 17.22  ? 465  THR A N     1 
ATOM   4353 C  CA    . THR C 3  459 ? 36.498 185.687 -3.140 1.00 17.18  ? 465  THR A CA    1 
ATOM   4354 C  C     . THR C 3  459 ? 36.996 184.280 -2.835 1.00 18.33  ? 465  THR A C     1 
ATOM   4355 O  O     . THR C 3  459 ? 37.450 183.580 -3.737 1.00 20.49  ? 465  THR A O     1 
ATOM   4356 C  CB    . THR C 3  459 ? 37.731 186.524 -3.469 1.00 19.05  ? 465  THR A CB    1 
ATOM   4357 O  OG1   . THR C 3  459 ? 38.646 186.464 -2.368 1.00 17.09  ? 465  THR A OG1   1 
ATOM   4358 C  CG2   . THR C 3  459 ? 37.344 187.969 -3.742 1.00 15.72  ? 465  THR A CG2   1 
ATOM   4359 N  N     . GLY C 3  460 ? 36.938 183.866 -1.575 1.00 17.60  ? 466  GLY A N     1 
ATOM   4360 C  CA    . GLY C 3  460 ? 37.420 182.541 -1.230 1.00 15.87  ? 466  GLY A CA    1 
ATOM   4361 C  C     . GLY C 3  460 ? 38.940 182.449 -1.320 1.00 18.56  ? 466  GLY A C     1 
ATOM   4362 O  O     . GLY C 3  460 ? 39.517 181.360 -1.222 1.00 20.08  ? 466  GLY A O     1 
ATOM   4363 N  N     . LYS C 3  461 ? 39.598 183.587 -1.513 1.00 17.41  ? 467  LYS A N     1 
ATOM   4364 C  CA    . LYS C 3  461 ? 41.050 183.601 -1.606 1.00 18.85  ? 467  LYS A CA    1 
ATOM   4365 C  C     . LYS C 3  461 ? 41.655 183.692 -0.210 1.00 19.47  ? 467  LYS A C     1 
ATOM   4366 O  O     . LYS C 3  461 ? 41.194 184.461 0.634  1.00 19.87  ? 467  LYS A O     1 
ATOM   4367 C  CB    . LYS C 3  461 ? 41.522 184.789 -2.450 1.00 19.60  ? 467  LYS A CB    1 
ATOM   4368 C  CG    . LYS C 3  461 ? 40.940 184.815 -3.862 1.00 22.70  ? 467  LYS A CG    1 
ATOM   4369 C  CD    . LYS C 3  461 ? 41.154 183.488 -4.590 1.00 21.59  ? 467  LYS A CD    1 
ATOM   4370 C  CE    . LYS C 3  461 ? 42.627 183.193 -4.786 1.00 22.31  ? 467  LYS A CE    1 
ATOM   4371 N  NZ    . LYS C 3  461 ? 42.849 181.799 -5.258 1.00 23.32  ? 467  LYS A NZ    1 
ATOM   4372 N  N     . PRO C 3  462 ? 42.691 182.894 0.057  1.00 17.93  ? 468  PRO A N     1 
ATOM   4373 C  CA    . PRO C 3  462 ? 43.324 182.932 1.379  1.00 17.08  ? 468  PRO A CA    1 
ATOM   4374 C  C     . PRO C 3  462 ? 43.891 184.298 1.728  1.00 17.18  ? 468  PRO A C     1 
ATOM   4375 O  O     . PRO C 3  462 ? 44.345 185.032 0.849  1.00 17.09  ? 468  PRO A O     1 
ATOM   4376 C  CB    . PRO C 3  462 ? 44.408 181.851 1.290  1.00 15.69  ? 468  PRO A CB    1 
ATOM   4377 C  CG    . PRO C 3  462 ? 44.628 181.662 -0.188 1.00 18.67  ? 468  PRO A CG    1 
ATOM   4378 C  CD    . PRO C 3  462 ? 43.256 181.828 -0.785 1.00 16.96  ? 468  PRO A CD    1 
ATOM   4379 N  N     . TRP C 3  463 ? 43.847 184.649 3.011  1.00 15.19  ? 469  TRP A N     1 
ATOM   4380 C  CA    . TRP C 3  463 ? 44.376 185.929 3.450  1.00 14.04  ? 469  TRP A CA    1 
ATOM   4381 C  C     . TRP C 3  463 ? 45.886 185.856 3.643  1.00 13.55  ? 469  TRP A C     1 
ATOM   4382 O  O     . TRP C 3  463 ? 46.472 184.776 3.607  1.00 13.74  ? 469  TRP A O     1 
ATOM   4383 C  CB    . TRP C 3  463 ? 43.688 186.366 4.742  1.00 14.33  ? 469  TRP A CB    1 
ATOM   4384 C  CG    . TRP C 3  463 ? 42.408 187.110 4.498  1.00 14.22  ? 469  TRP A CG    1 
ATOM   4385 C  CD1   . TRP C 3  463 ? 41.471 186.842 3.538  1.00 12.30  ? 469  TRP A CD1   1 
ATOM   4386 C  CD2   . TRP C 3  463 ? 41.901 188.218 5.254  1.00 12.27  ? 469  TRP A CD2   1 
ATOM   4387 N  NE1   . TRP C 3  463 ? 40.412 187.714 3.654  1.00 11.76  ? 469  TRP A NE1   1 
ATOM   4388 C  CE2   . TRP C 3  463 ? 40.651 188.566 4.700  1.00 12.19  ? 469  TRP A CE2   1 
ATOM   4389 C  CE3   . TRP C 3  463 ? 42.383 188.947 6.348  1.00 11.16  ? 469  TRP A CE3   1 
ATOM   4390 C  CZ2   . TRP C 3  463 ? 39.875 189.615 5.203  1.00 12.84  ? 469  TRP A CZ2   1 
ATOM   4391 C  CZ3   . TRP C 3  463 ? 41.614 189.991 6.849  1.00 10.32  ? 469  TRP A CZ3   1 
ATOM   4392 C  CH2   . TRP C 3  463 ? 40.373 190.315 6.276  1.00 11.44  ? 469  TRP A CH2   1 
ATOM   4393 N  N     . VAL C 3  464 ? 46.509 187.012 3.834  1.00 12.60  ? 470  VAL A N     1 
ATOM   4394 C  CA    . VAL C 3  464 ? 47.950 187.095 4.020  1.00 13.60  ? 470  VAL A CA    1 
ATOM   4395 C  C     . VAL C 3  464 ? 48.241 187.593 5.425  1.00 15.10  ? 470  VAL A C     1 
ATOM   4396 O  O     . VAL C 3  464 ? 47.433 188.304 6.028  1.00 15.72  ? 470  VAL A O     1 
ATOM   4397 C  CB    . VAL C 3  464 ? 48.596 188.055 2.992  1.00 14.87  ? 470  VAL A CB    1 
ATOM   4398 C  CG1   . VAL C 3  464 ? 50.091 188.175 3.250  1.00 16.36  ? 470  VAL A CG1   1 
ATOM   4399 C  CG2   . VAL C 3  464 ? 48.360 187.526 1.581  1.00 16.10  ? 470  VAL A CG2   1 
ATOM   4400 N  N     . GLN C 3  465 ? 49.411 187.238 5.936  1.00 14.56  ? 471  GLN A N     1 
ATOM   4401 C  CA    . GLN C 3  465 ? 49.775 187.606 7.289  1.00 13.64  ? 471  GLN A CA    1 
ATOM   4402 C  C     . GLN C 3  465 ? 50.889 188.637 7.402  1.00 12.96  ? 471  GLN A C     1 
ATOM   4403 O  O     . GLN C 3  465 ? 51.882 188.595 6.683  1.00 13.96  ? 471  GLN A O     1 
ATOM   4404 C  CB    . GLN C 3  465 ? 50.146 186.332 8.051  1.00 13.36  ? 471  GLN A CB    1 
ATOM   4405 C  CG    . GLN C 3  465 ? 50.177 186.482 9.555  1.00 12.32  ? 471  GLN A CG    1 
ATOM   4406 C  CD    . GLN C 3  465 ? 50.288 185.142 10.247 1.00 13.46  ? 471  GLN A CD    1 
ATOM   4407 O  OE1   . GLN C 3  465 ? 49.541 184.203 9.932  1.00 8.99   ? 471  GLN A OE1   1 
ATOM   4408 N  NE2   . GLN C 3  465 ? 51.212 185.042 11.203 1.00 8.95   ? 471  GLN A NE2   1 
ATOM   4409 N  N     . ALA C 3  466 ? 50.704 189.569 8.325  1.00 14.02  ? 472  ALA A N     1 
ATOM   4410 C  CA    . ALA C 3  466 ? 51.678 190.619 8.574  1.00 14.77  ? 472  ALA A CA    1 
ATOM   4411 C  C     . ALA C 3  466 ? 52.141 190.501 10.019 1.00 14.53  ? 472  ALA A C     1 
ATOM   4412 O  O     . ALA C 3  466 ? 51.367 190.753 10.942 1.00 15.76  ? 472  ALA A O     1 
ATOM   4413 C  CB    . ALA C 3  466 ? 51.044 191.992 8.330  1.00 13.29  ? 472  ALA A CB    1 
ATOM   4414 N  N     . GLY C 3  467 ? 53.391 190.090 10.210 1.00 14.99  ? 473  GLY A N     1 
ATOM   4415 C  CA    . GLY C 3  467 ? 53.935 189.954 11.550 1.00 15.18  ? 473  GLY A CA    1 
ATOM   4416 C  C     . GLY C 3  467 ? 54.883 191.097 11.857 1.00 17.65  ? 473  GLY A C     1 
ATOM   4417 O  O     . GLY C 3  467 ? 55.776 191.385 11.055 1.00 19.01  ? 473  GLY A O     1 
ATOM   4418 N  N     . ILE C 3  468 ? 54.692 191.756 13.000 1.00 16.40  ? 474  ILE A N     1 
ATOM   4419 C  CA    . ILE C 3  468 ? 55.550 192.874 13.398 1.00 16.21  ? 474  ILE A CA    1 
ATOM   4420 C  C     . ILE C 3  468 ? 55.993 192.723 14.847 1.00 17.97  ? 474  ILE A C     1 
ATOM   4421 O  O     . ILE C 3  468 ? 55.182 192.477 15.739 1.00 16.51  ? 474  ILE A O     1 
ATOM   4422 C  CB    . ILE C 3  468 ? 54.835 194.238 13.264 1.00 14.50  ? 474  ILE A CB    1 
ATOM   4423 C  CG1   . ILE C 3  468 ? 54.285 194.420 11.848 1.00 14.22  ? 474  ILE A CG1   1 
ATOM   4424 C  CG2   . ILE C 3  468 ? 55.808 195.357 13.576 1.00 13.06  ? 474  ILE A CG2   1 
ATOM   4425 C  CD1   . ILE C 3  468 ? 52.849 193.996 11.685 1.00 9.90   ? 474  ILE A CD1   1 
ATOM   4426 N  N     . ASP C 3  469 ? 57.285 192.904 15.079 1.00 20.56  ? 475  ASP A N     1 
ATOM   4427 C  CA    . ASP C 3  469 ? 57.841 192.751 16.413 1.00 23.23  ? 475  ASP A CA    1 
ATOM   4428 C  C     . ASP C 3  469 ? 58.756 193.924 16.758 1.00 23.26  ? 475  ASP A C     1 
ATOM   4429 O  O     . ASP C 3  469 ? 59.575 194.347 15.936 1.00 23.95  ? 475  ASP A O     1 
ATOM   4430 C  CB    . ASP C 3  469 ? 58.614 191.429 16.476 1.00 27.39  ? 475  ASP A CB    1 
ATOM   4431 C  CG    . ASP C 3  469 ? 59.176 191.141 17.849 1.00 33.86  ? 475  ASP A CG    1 
ATOM   4432 O  OD1   . ASP C 3  469 ? 59.983 191.958 18.343 1.00 39.80  ? 475  ASP A OD1   1 
ATOM   4433 O  OD2   . ASP C 3  469 ? 58.817 190.095 18.436 1.00 36.35  ? 475  ASP A OD2   1 
ATOM   4434 N  N     . ALA C 3  470 ? 58.607 194.449 17.973 1.00 20.22  ? 476  ALA A N     1 
ATOM   4435 C  CA    . ALA C 3  470 ? 59.428 195.568 18.424 1.00 20.25  ? 476  ALA A CA    1 
ATOM   4436 C  C     . ALA C 3  470 ? 60.874 195.098 18.577 1.00 19.48  ? 476  ALA A C     1 
ATOM   4437 O  O     . ALA C 3  470 ? 61.151 194.095 19.239 1.00 19.71  ? 476  ALA A O     1 
ATOM   4438 C  CB    . ALA C 3  470 ? 58.899 196.115 19.746 1.00 18.40  ? 476  ALA A CB    1 
ATOM   4439 N  N     . SER C 3  471 ? 61.791 195.836 17.963 1.00 18.48  ? 477  SER A N     1 
ATOM   4440 C  CA    . SER C 3  471 ? 63.209 195.491 17.988 1.00 18.55  ? 477  SER A CA    1 
ATOM   4441 C  C     . SER C 3  471 ? 63.911 195.721 19.326 1.00 16.85  ? 477  SER A C     1 
ATOM   4442 O  O     . SER C 3  471 ? 63.994 196.855 19.794 1.00 17.23  ? 477  SER A O     1 
ATOM   4443 C  CB    . SER C 3  471 ? 63.928 196.282 16.900 1.00 18.12  ? 477  SER A CB    1 
ATOM   4444 O  OG    . SER C 3  471 ? 63.203 196.217 15.687 1.00 20.16  ? 477  SER A OG    1 
ATOM   4445 N  N     . GLY C 3  472 ? 64.430 194.641 19.912 1.00 16.30  ? 478  GLY A N     1 
ATOM   4446 C  CA    . GLY C 3  472 ? 65.141 194.712 21.182 1.00 16.53  ? 478  GLY A CA    1 
ATOM   4447 C  C     . GLY C 3  472 ? 64.540 195.691 22.168 1.00 17.98  ? 478  GLY A C     1 
ATOM   4448 O  O     . GLY C 3  472 ? 65.241 196.460 22.823 1.00 18.89  ? 478  GLY A O     1 
ATOM   4449 N  N     . LEU C 3  473 ? 63.224 195.639 22.287 1.00 19.89  ? 479  LEU A N     1 
ATOM   4450 C  CA    . LEU C 3  473 ? 62.481 196.541 23.148 1.00 19.89  ? 479  LEU A CA    1 
ATOM   4451 C  C     . LEU C 3  473 ? 63.024 196.833 24.549 1.00 19.45  ? 479  LEU A C     1 
ATOM   4452 O  O     . LEU C 3  473 ? 63.365 197.979 24.843 1.00 18.83  ? 479  LEU A O     1 
ATOM   4453 C  CB    . LEU C 3  473 ? 61.037 196.053 23.253 1.00 21.44  ? 479  LEU A CB    1 
ATOM   4454 C  CG    . LEU C 3  473 ? 60.045 196.968 23.964 1.00 23.41  ? 479  LEU A CG    1 
ATOM   4455 C  CD1   . LEU C 3  473 ? 60.030 198.357 23.342 1.00 23.08  ? 479  LEU A CD1   1 
ATOM   4456 C  CD2   . LEU C 3  473 ? 58.684 196.334 23.870 1.00 25.66  ? 479  LEU A CD2   1 
ATOM   4457 N  N     . GLU C 3  474 ? 63.118 195.820 25.409 1.00 18.01  ? 480  GLU A N     1 
ATOM   4458 C  CA    . GLU C 3  474 ? 63.573 196.069 26.776 1.00 17.75  ? 480  GLU A CA    1 
ATOM   4459 C  C     . GLU C 3  474 ? 64.999 196.579 26.945 1.00 17.31  ? 480  GLU A C     1 
ATOM   4460 O  O     . GLU C 3  474 ? 65.319 197.209 27.958 1.00 16.50  ? 480  GLU A O     1 
ATOM   4461 C  CB    . GLU C 3  474 ? 63.278 194.855 27.671 1.00 15.44  ? 480  GLU A CB    1 
ATOM   4462 C  CG    . GLU C 3  474 ? 61.846 194.951 28.233 1.00 16.57  ? 480  GLU A CG    1 
ATOM   4463 C  CD    . GLU C 3  474 ? 61.335 193.683 28.905 1.00 16.87  ? 480  GLU A CD    1 
ATOM   4464 O  OE1   . GLU C 3  474 ? 62.023 193.141 29.798 1.00 19.04  ? 480  GLU A OE1   1 
ATOM   4465 O  OE2   . GLU C 3  474 ? 60.230 193.237 28.545 1.00 14.01  ? 480  GLU A OE2   1 
ATOM   4466 N  N     . LEU C 3  475 ? 65.849 196.338 25.955 1.00 17.03  ? 481  LEU A N     1 
ATOM   4467 C  CA    . LEU C 3  475 ? 67.201 196.862 26.023 1.00 16.14  ? 481  LEU A CA    1 
ATOM   4468 C  C     . LEU C 3  475 ? 67.137 198.350 25.654 1.00 17.43  ? 481  LEU A C     1 
ATOM   4469 O  O     . LEU C 3  475 ? 67.898 199.159 26.196 1.00 19.18  ? 481  LEU A O     1 
ATOM   4470 C  CB    . LEU C 3  475 ? 68.135 196.118 25.070 1.00 15.54  ? 481  LEU A CB    1 
ATOM   4471 C  CG    . LEU C 3  475 ? 68.573 194.734 25.547 1.00 15.08  ? 481  LEU A CG    1 
ATOM   4472 C  CD1   . LEU C 3  475 ? 69.629 194.177 24.616 1.00 14.44  ? 481  LEU A CD1   1 
ATOM   4473 C  CD2   . LEU C 3  475 ? 69.125 194.843 26.954 1.00 15.97  ? 481  LEU A CD2   1 
ATOM   4474 N  N     . ARG C 3  476 ? 66.226 198.717 24.748 1.00 15.42  ? 482  ARG A N     1 
ATOM   4475 C  CA    . ARG C 3  476 ? 66.089 200.120 24.358 1.00 15.30  ? 482  ARG A CA    1 
ATOM   4476 C  C     . ARG C 3  476 ? 65.475 200.888 25.518 1.00 16.46  ? 482  ARG A C     1 
ATOM   4477 O  O     . ARG C 3  476 ? 65.745 202.074 25.698 1.00 17.59  ? 482  ARG A O     1 
ATOM   4478 C  CB    . ARG C 3  476 ? 65.229 200.271 23.100 1.00 13.74  ? 482  ARG A CB    1 
ATOM   4479 C  CG    . ARG C 3  476 ? 65.827 199.558 21.891 1.00 16.23  ? 482  ARG A CG    1 
ATOM   4480 C  CD    . ARG C 3  476 ? 65.326 200.102 20.554 1.00 14.48  ? 482  ARG A CD    1 
ATOM   4481 N  NE    . ARG C 3  476 ? 65.817 199.290 19.440 1.00 13.59  ? 482  ARG A NE    1 
ATOM   4482 C  CZ    . ARG C 3  476 ? 65.827 199.680 18.168 1.00 13.97  ? 482  ARG A CZ    1 
ATOM   4483 N  NH1   . ARG C 3  476 ? 65.375 200.883 17.832 1.00 11.15  ? 482  ARG A NH1   1 
ATOM   4484 N  NH2   . ARG C 3  476 ? 66.279 198.860 17.230 1.00 12.41  ? 482  ARG A NH2   1 
ATOM   4485 N  N     . CYS C 3  477 ? 64.659 200.197 26.310 1.00 15.82  ? 483  CYS A N     1 
ATOM   4486 C  CA    . CYS C 3  477 ? 64.042 200.797 27.481 1.00 15.20  ? 483  CYS A CA    1 
ATOM   4487 C  C     . CYS C 3  477 ? 65.154 201.095 28.478 1.00 16.78  ? 483  CYS A C     1 
ATOM   4488 O  O     . CYS C 3  477 ? 65.163 202.148 29.128 1.00 15.99  ? 483  CYS A O     1 
ATOM   4489 C  CB    . CYS C 3  477 ? 63.036 199.838 28.111 1.00 15.43  ? 483  CYS A CB    1 
ATOM   4490 S  SG    . CYS C 3  477 ? 61.471 199.747 27.240 1.00 12.68  ? 483  CYS A SG    1 
ATOM   4491 N  N     . LEU C 3  478 ? 66.089 200.155 28.593 1.00 16.29  ? 484  LEU A N     1 
ATOM   4492 C  CA    . LEU C 3  478 ? 67.228 200.310 29.484 1.00 16.59  ? 484  LEU A CA    1 
ATOM   4493 C  C     . LEU C 3  478 ? 68.028 201.532 29.038 1.00 17.49  ? 484  LEU A C     1 
ATOM   4494 O  O     . LEU C 3  478 ? 68.385 202.388 29.851 1.00 16.06  ? 484  LEU A O     1 
ATOM   4495 C  CB    . LEU C 3  478 ? 68.116 199.067 29.424 1.00 18.40  ? 484  LEU A CB    1 
ATOM   4496 C  CG    . LEU C 3  478 ? 69.512 199.178 30.052 1.00 18.12  ? 484  LEU A CG    1 
ATOM   4497 C  CD1   . LEU C 3  478 ? 69.386 199.552 31.525 1.00 18.60  ? 484  LEU A CD1   1 
ATOM   4498 C  CD2   . LEU C 3  478 ? 70.258 197.866 29.891 1.00 13.44  ? 484  LEU A CD2   1 
ATOM   4499 N  N     . ALA C 3  479 ? 68.298 201.609 27.737 1.00 16.51  ? 485  ALA A N     1 
ATOM   4500 C  CA    . ALA C 3  479 ? 69.048 202.731 27.181 1.00 16.70  ? 485  ALA A CA    1 
ATOM   4501 C  C     . ALA C 3  479 ? 68.388 204.048 27.570 1.00 16.33  ? 485  ALA A C     1 
ATOM   4502 O  O     . ALA C 3  479 ? 69.067 204.997 27.949 1.00 18.01  ? 485  ALA A O     1 
ATOM   4503 C  CB    . ALA C 3  479 ? 69.124 202.614 25.657 1.00 15.07  ? 485  ALA A CB    1 
ATOM   4504 N  N     . HIS C 3  480 ? 67.060 204.092 27.477 1.00 14.77  ? 486  HIS A N     1 
ATOM   4505 C  CA    . HIS C 3  480 ? 66.290 205.291 27.805 1.00 13.72  ? 486  HIS A CA    1 
ATOM   4506 C  C     . HIS C 3  480 ? 66.479 205.716 29.259 1.00 14.11  ? 486  HIS A C     1 
ATOM   4507 O  O     . HIS C 3  480 ? 66.829 206.858 29.544 1.00 15.13  ? 486  HIS A O     1 
ATOM   4508 C  CB    . HIS C 3  480 ? 64.803 205.038 27.512 1.00 12.03  ? 486  HIS A CB    1 
ATOM   4509 C  CG    . HIS C 3  480 ? 63.869 205.975 28.213 1.00 11.45  ? 486  HIS A CG    1 
ATOM   4510 N  ND1   . HIS C 3  480 ? 63.615 207.254 27.766 1.00 11.90  ? 486  HIS A ND1   1 
ATOM   4511 C  CD2   . HIS C 3  480 ? 63.132 205.818 29.340 1.00 12.20  ? 486  HIS A CD2   1 
ATOM   4512 C  CE1   . HIS C 3  480 ? 62.763 207.844 28.587 1.00 9.39   ? 486  HIS A CE1   1 
ATOM   4513 N  NE2   . HIS C 3  480 ? 62.453 206.994 29.549 1.00 8.96   ? 486  HIS A NE2   1 
ATOM   4514 N  N     . PHE C 3  481 ? 66.255 204.788 30.178 1.00 15.61  ? 487  PHE A N     1 
ATOM   4515 C  CA    . PHE C 3  481 ? 66.380 205.087 31.592 1.00 15.49  ? 487  PHE A CA    1 
ATOM   4516 C  C     . PHE C 3  481 ? 67.803 205.349 32.070 1.00 16.61  ? 487  PHE A C     1 
ATOM   4517 O  O     . PHE C 3  481 ? 67.991 205.977 33.109 1.00 16.52  ? 487  PHE A O     1 
ATOM   4518 C  CB    . PHE C 3  481 ? 65.728 203.973 32.419 1.00 14.52  ? 487  PHE A CB    1 
ATOM   4519 C  CG    . PHE C 3  481 ? 64.224 204.007 32.391 1.00 13.13  ? 487  PHE A CG    1 
ATOM   4520 C  CD1   . PHE C 3  481 ? 63.531 205.049 33.006 1.00 11.64  ? 487  PHE A CD1   1 
ATOM   4521 C  CD2   . PHE C 3  481 ? 63.501 203.019 31.732 1.00 11.41  ? 487  PHE A CD2   1 
ATOM   4522 C  CE1   . PHE C 3  481 ? 62.141 205.105 32.964 1.00 11.07  ? 487  PHE A CE1   1 
ATOM   4523 C  CE2   . PHE C 3  481 ? 62.103 203.066 31.684 1.00 12.04  ? 487  PHE A CE2   1 
ATOM   4524 C  CZ    . PHE C 3  481 ? 61.423 204.111 32.301 1.00 11.33  ? 487  PHE A CZ    1 
ATOM   4525 N  N     . MET C 3  482 ? 68.815 204.881 31.346 1.00 17.99  ? 488  MET A N     1 
ATOM   4526 C  CA    . MET C 3  482 ? 70.162 205.171 31.813 1.00 20.35  ? 488  MET A CA    1 
ATOM   4527 C  C     . MET C 3  482 ? 70.833 206.308 31.063 1.00 19.10  ? 488  MET A C     1 
ATOM   4528 O  O     . MET C 3  482 ? 71.989 206.641 31.336 1.00 17.40  ? 488  MET A O     1 
ATOM   4529 C  CB    . MET C 3  482 ? 71.060 203.916 31.842 1.00 22.44  ? 488  MET A CB    1 
ATOM   4530 C  CG    . MET C 3  482 ? 71.218 203.117 30.582 1.00 23.50  ? 488  MET A CG    1 
ATOM   4531 S  SD    . MET C 3  482 ? 72.233 201.630 30.958 1.00 25.79  ? 488  MET A SD    1 
ATOM   4532 C  CE    . MET C 3  482 ? 73.350 201.649 29.588 1.00 23.66  ? 488  MET A CE    1 
ATOM   4533 N  N     . ALA C 3  483 ? 70.093 206.928 30.147 1.00 18.02  ? 489  ALA A N     1 
ATOM   4534 C  CA    . ALA C 3  483 ? 70.628 208.055 29.386 1.00 20.33  ? 489  ALA A CA    1 
ATOM   4535 C  C     . ALA C 3  483 ? 71.031 209.192 30.328 1.00 19.86  ? 489  ALA A C     1 
ATOM   4536 O  O     . ALA C 3  483 ? 71.949 209.953 30.040 1.00 21.19  ? 489  ALA A O     1 
ATOM   4537 C  CB    . ALA C 3  483 ? 69.592 208.556 28.374 1.00 20.47  ? 489  ALA A CB    1 
ATOM   4538 N  N     . ARG C 3  484 ? 70.351 209.309 31.460 1.00 19.82  ? 490  ARG A N     1 
ATOM   4539 C  CA    . ARG C 3  484 ? 70.688 210.368 32.402 1.00 22.09  ? 490  ARG A CA    1 
ATOM   4540 C  C     . ARG C 3  484 ? 72.010 210.065 33.097 1.00 21.57  ? 490  ARG A C     1 
ATOM   4541 O  O     . ARG C 3  484 ? 72.574 210.921 33.770 1.00 21.56  ? 490  ARG A O     1 
ATOM   4542 C  CB    . ARG C 3  484 ? 69.582 210.533 33.446 1.00 22.93  ? 490  ARG A CB    1 
ATOM   4543 C  CG    . ARG C 3  484 ? 69.666 209.572 34.602 1.00 26.50  ? 490  ARG A CG    1 
ATOM   4544 C  CD    . ARG C 3  484 ? 68.500 209.778 35.546 1.00 29.63  ? 490  ARG A CD    1 
ATOM   4545 N  NE    . ARG C 3  484 ? 68.836 209.373 36.907 1.00 34.36  ? 490  ARG A NE    1 
ATOM   4546 C  CZ    . ARG C 3  484 ? 67.948 209.233 37.886 1.00 36.52  ? 490  ARG A CZ    1 
ATOM   4547 N  NH1   . ARG C 3  484 ? 66.658 209.462 37.654 1.00 38.39  ? 490  ARG A NH1   1 
ATOM   4548 N  NH2   . ARG C 3  484 ? 68.351 208.875 39.098 1.00 36.91  ? 490  ARG A NH2   1 
ATOM   4549 N  N     . PHE C 3  485 ? 72.496 208.840 32.928 1.00 21.30  ? 491  PHE A N     1 
ATOM   4550 C  CA    . PHE C 3  485 ? 73.756 208.423 33.531 1.00 21.56  ? 491  PHE A CA    1 
ATOM   4551 C  C     . PHE C 3  485 ? 74.891 208.359 32.502 1.00 23.17  ? 491  PHE A C     1 
ATOM   4552 O  O     . PHE C 3  485 ? 76.053 208.607 32.838 1.00 25.47  ? 491  PHE A O     1 
ATOM   4553 C  CB    . PHE C 3  485 ? 73.605 207.050 34.186 1.00 17.87  ? 491  PHE A CB    1 
ATOM   4554 C  CG    . PHE C 3  485 ? 72.689 207.037 35.368 1.00 17.50  ? 491  PHE A CG    1 
ATOM   4555 C  CD1   . PHE C 3  485 ? 73.067 207.632 36.564 1.00 16.60  ? 491  PHE A CD1   1 
ATOM   4556 C  CD2   . PHE C 3  485 ? 71.448 206.417 35.293 1.00 16.11  ? 491  PHE A CD2   1 
ATOM   4557 C  CE1   . PHE C 3  485 ? 72.219 207.607 37.676 1.00 17.61  ? 491  PHE A CE1   1 
ATOM   4558 C  CE2   . PHE C 3  485 ? 70.596 206.388 36.394 1.00 15.36  ? 491  PHE A CE2   1 
ATOM   4559 C  CZ    . PHE C 3  485 ? 70.979 206.982 37.589 1.00 17.20  ? 491  PHE A CZ    1 
ATOM   4560 N  N     . ASP C 3  486 ? 74.563 208.032 31.255 1.00 21.62  ? 492  ASP A N     1 
ATOM   4561 C  CA    . ASP C 3  486 ? 75.587 207.919 30.219 1.00 22.05  ? 492  ASP A CA    1 
ATOM   4562 C  C     . ASP C 3  486 ? 75.340 208.826 29.020 1.00 21.81  ? 492  ASP A C     1 
ATOM   4563 O  O     . ASP C 3  486 ? 75.942 208.640 27.965 1.00 22.42  ? 492  ASP A O     1 
ATOM   4564 C  CB    . ASP C 3  486 ? 75.676 206.464 29.741 1.00 21.61  ? 492  ASP A CB    1 
ATOM   4565 C  CG    . ASP C 3  486 ? 74.535 206.084 28.807 1.00 21.46  ? 492  ASP A CG    1 
ATOM   4566 O  OD1   . ASP C 3  486 ? 73.449 206.700 28.892 1.00 22.13  ? 492  ASP A OD1   1 
ATOM   4567 O  OD2   . ASP C 3  486 ? 74.719 205.161 27.991 1.00 21.70  ? 492  ASP A OD2   1 
ATOM   4568 N  N     . ASN C 3  487 ? 74.448 209.798 29.184 1.00 22.23  ? 493  ASN A N     1 
ATOM   4569 C  CA    . ASN C 3  487 ? 74.112 210.734 28.114 1.00 22.75  ? 493  ASN A CA    1 
ATOM   4570 C  C     . ASN C 3  487 ? 73.703 210.065 26.808 1.00 23.47  ? 493  ASN A C     1 
ATOM   4571 O  O     . ASN C 3  487 ? 74.135 210.483 25.737 1.00 25.90  ? 493  ASN A O     1 
ATOM   4572 C  CB    . ASN C 3  487 ? 75.286 211.674 27.843 1.00 24.80  ? 493  ASN A CB    1 
ATOM   4573 C  CG    . ASN C 3  487 ? 75.591 212.568 29.021 1.00 26.17  ? 493  ASN A CG    1 
ATOM   4574 O  OD1   . ASN C 3  487 ? 74.736 213.332 29.470 1.00 27.23  ? 493  ASN A OD1   1 
ATOM   4575 N  ND2   . ASN C 3  487 ? 76.811 212.481 29.530 1.00 27.03  ? 493  ASN A ND2   1 
ATOM   4576 N  N     . GLY C 3  488 ? 72.881 209.024 26.893 1.00 23.23  ? 494  GLY A N     1 
ATOM   4577 C  CA    . GLY C 3  488 ? 72.417 208.351 25.693 1.00 21.59  ? 494  GLY A CA    1 
ATOM   4578 C  C     . GLY C 3  488 ? 73.473 207.571 24.945 1.00 23.35  ? 494  GLY A C     1 
ATOM   4579 O  O     . GLY C 3  488 ? 73.295 207.217 23.777 1.00 23.21  ? 494  GLY A O     1 
ATOM   4580 N  N     . GLU C 3  489 ? 74.578 207.290 25.618 1.00 23.58  ? 495  GLU A N     1 
ATOM   4581 C  CA    . GLU C 3  489 ? 75.659 206.540 25.001 1.00 25.23  ? 495  GLU A CA    1 
ATOM   4582 C  C     . GLU C 3  489 ? 75.155 205.178 24.516 1.00 25.24  ? 495  GLU A C     1 
ATOM   4583 O  O     . GLU C 3  489 ? 75.303 204.833 23.343 1.00 24.50  ? 495  GLU A O     1 
ATOM   4584 C  CB    . GLU C 3  489 ? 76.782 206.371 26.015 1.00 30.16  ? 495  GLU A CB    1 
ATOM   4585 C  CG    . GLU C 3  489 ? 78.030 205.704 25.503 1.00 36.04  ? 495  GLU A CG    1 
ATOM   4586 C  CD    . GLU C 3  489 ? 79.113 205.713 26.566 1.00 41.97  ? 495  GLU A CD    1 
ATOM   4587 O  OE1   . GLU C 3  489 ? 79.458 206.825 27.042 1.00 43.15  ? 495  GLU A OE1   1 
ATOM   4588 O  OE2   . GLU C 3  489 ? 79.603 204.619 26.928 1.00 41.85  ? 495  GLU A OE2   1 
ATOM   4589 N  N     . TYR C 3  490 ? 74.555 204.407 25.418 1.00 22.84  ? 496  TYR A N     1 
ATOM   4590 C  CA    . TYR C 3  490 ? 74.026 203.100 25.056 1.00 23.65  ? 496  TYR A CA    1 
ATOM   4591 C  C     . TYR C 3  490 ? 72.895 203.230 24.029 1.00 24.22  ? 496  TYR A C     1 
ATOM   4592 O  O     . TYR C 3  490 ? 72.743 202.389 23.143 1.00 23.81  ? 496  TYR A O     1 
ATOM   4593 C  CB    . TYR C 3  490 ? 73.516 202.375 26.307 1.00 24.51  ? 496  TYR A CB    1 
ATOM   4594 C  CG    . TYR C 3  490 ? 73.070 200.949 26.061 1.00 24.58  ? 496  TYR A CG    1 
ATOM   4595 C  CD1   . TYR C 3  490 ? 73.955 200.000 25.562 1.00 24.40  ? 496  TYR A CD1   1 
ATOM   4596 C  CD2   . TYR C 3  490 ? 71.755 200.553 26.318 1.00 25.26  ? 496  TYR A CD2   1 
ATOM   4597 C  CE1   . TYR C 3  490 ? 73.545 198.691 25.319 1.00 27.37  ? 496  TYR A CE1   1 
ATOM   4598 C  CE2   . TYR C 3  490 ? 71.333 199.246 26.082 1.00 25.39  ? 496  TYR A CE2   1 
ATOM   4599 C  CZ    . TYR C 3  490 ? 72.233 198.322 25.580 1.00 26.36  ? 496  TYR A CZ    1 
ATOM   4600 O  OH    . TYR C 3  490 ? 71.824 197.034 25.327 1.00 27.64  ? 496  TYR A OH    1 
ATOM   4601 N  N     . ALA C 3  491 ? 72.107 204.293 24.153 1.00 25.48  ? 497  ALA A N     1 
ATOM   4602 C  CA    . ALA C 3  491 ? 70.987 204.544 23.249 1.00 26.84  ? 497  ALA A CA    1 
ATOM   4603 C  C     . ALA C 3  491 ? 71.452 204.733 21.809 1.00 28.39  ? 497  ALA A C     1 
ATOM   4604 O  O     . ALA C 3  491 ? 70.681 204.535 20.866 1.00 27.87  ? 497  ALA A O     1 
ATOM   4605 C  CB    . ALA C 3  491 ? 70.211 205.774 23.709 1.00 24.66  ? 497  ALA A CB    1 
ATOM   4606 N  N     . HIS C 3  492 ? 72.712 205.122 21.643 1.00 29.30  ? 498  HIS A N     1 
ATOM   4607 C  CA    . HIS C 3  492 ? 73.272 205.331 20.317 1.00 29.94  ? 498  HIS A CA    1 
ATOM   4608 C  C     . HIS C 3  492 ? 73.973 204.073 19.827 1.00 29.96  ? 498  HIS A C     1 
ATOM   4609 O  O     . HIS C 3  492 ? 73.898 203.720 18.651 1.00 30.41  ? 498  HIS A O     1 
ATOM   4610 C  CB    . HIS C 3  492 ? 74.274 206.486 20.334 1.00 31.49  ? 498  HIS A CB    1 
ATOM   4611 C  CG    . HIS C 3  492 ? 74.946 206.705 19.016 1.00 33.70  ? 498  HIS A CG    1 
ATOM   4612 N  ND1   . HIS C 3  492 ? 74.344 207.388 17.982 1.00 34.23  ? 498  HIS A ND1   1 
ATOM   4613 C  CD2   . HIS C 3  492 ? 76.122 206.244 18.530 1.00 33.68  ? 498  HIS A CD2   1 
ATOM   4614 C  CE1   . HIS C 3  492 ? 75.118 207.333 16.913 1.00 34.71  ? 498  HIS A CE1   1 
ATOM   4615 N  NE2   . HIS C 3  492 ? 76.203 206.644 17.219 1.00 35.76  ? 498  HIS A NE2   1 
ATOM   4616 N  N     . GLU C 3  493 ? 74.657 203.397 20.737 1.00 31.40  ? 499  GLU A N     1 
ATOM   4617 C  CA    . GLU C 3  493 ? 75.383 202.180 20.400 1.00 33.23  ? 499  GLU A CA    1 
ATOM   4618 C  C     . GLU C 3  493 ? 74.452 201.032 20.016 1.00 33.47  ? 499  GLU A C     1 
ATOM   4619 O  O     . GLU C 3  493 ? 74.733 200.280 19.086 1.00 33.75  ? 499  GLU A O     1 
ATOM   4620 C  CB    . GLU C 3  493 ? 76.253 201.757 21.580 1.00 35.52  ? 499  GLU A CB    1 
ATOM   4621 C  CG    . GLU C 3  493 ? 77.304 200.722 21.236 1.00 42.50  ? 499  GLU A CG    1 
ATOM   4622 C  CD    . GLU C 3  493 ? 78.217 201.179 20.114 1.00 46.26  ? 499  GLU A CD    1 
ATOM   4623 O  OE1   . GLU C 3  493 ? 78.663 202.351 20.143 1.00 48.18  ? 499  GLU A OE1   1 
ATOM   4624 O  OE2   . GLU C 3  493 ? 78.491 200.360 19.208 1.00 48.99  ? 499  GLU A OE2   1 
ATOM   4625 N  N     . ILE C 3  494 ? 73.339 200.907 20.731 1.00 32.67  ? 500  ILE A N     1 
ATOM   4626 C  CA    . ILE C 3  494 ? 72.388 199.836 20.476 1.00 32.75  ? 500  ILE A CA    1 
ATOM   4627 C  C     . ILE C 3  494 ? 71.860 199.837 19.040 1.00 33.69  ? 500  ILE A C     1 
ATOM   4628 O  O     . ILE C 3  494 ? 71.408 198.809 18.543 1.00 34.14  ? 500  ILE A O     1 
ATOM   4629 C  CB    . ILE C 3  494 ? 71.208 199.924 21.466 1.00 33.17  ? 500  ILE A CB    1 
ATOM   4630 C  CG1   . ILE C 3  494 ? 70.510 198.571 21.585 1.00 32.66  ? 500  ILE A CG1   1 
ATOM   4631 C  CG2   . ILE C 3  494 ? 70.221 200.976 21.007 1.00 32.74  ? 500  ILE A CG2   1 
ATOM   4632 C  CD1   . ILE C 3  494 ? 69.551 198.494 22.758 1.00 32.62  ? 500  ILE A CD1   1 
ATOM   4633 N  N     . LEU C 3  495 ? 71.923 200.984 18.371 1.00 34.54  ? 501  LEU A N     1 
ATOM   4634 C  CA    . LEU C 3  495 ? 71.443 201.079 16.996 1.00 35.08  ? 501  LEU A CA    1 
ATOM   4635 C  C     . LEU C 3  495 ? 72.483 200.647 15.963 1.00 36.97  ? 501  LEU A C     1 
ATOM   4636 O  O     . LEU C 3  495 ? 72.165 200.484 14.784 1.00 37.65  ? 501  LEU A O     1 
ATOM   4637 C  CB    . LEU C 3  495 ? 70.990 202.505 16.680 1.00 34.33  ? 501  LEU A CB    1 
ATOM   4638 C  CG    . LEU C 3  495 ? 69.642 202.992 17.209 1.00 33.56  ? 501  LEU A CG    1 
ATOM   4639 C  CD1   . LEU C 3  495 ? 69.650 202.982 18.705 1.00 37.71  ? 501  LEU A CD1   1 
ATOM   4640 C  CD2   . LEU C 3  495 ? 69.375 204.396 16.712 1.00 32.42  ? 501  LEU A CD2   1 
ATOM   4641 N  N     . ASN C 3  496 ? 73.724 200.466 16.404 1.00 37.85  ? 502  ASN A N     1 
ATOM   4642 C  CA    . ASN C 3  496 ? 74.803 200.053 15.510 1.00 38.88  ? 502  ASN A CA    1 
ATOM   4643 C  C     . ASN C 3  496 ? 74.705 198.563 15.211 1.00 38.70  ? 502  ASN A C     1 
ATOM   4644 O  O     . ASN C 3  496 ? 75.414 197.748 15.806 1.00 39.45  ? 502  ASN A O     1 
ATOM   4645 C  CB    . ASN C 3  496 ? 76.159 200.372 16.149 1.00 41.65  ? 502  ASN A CB    1 
ATOM   4646 C  CG    . ASN C 3  496 ? 77.316 199.707 15.430 1.00 43.21  ? 502  ASN A CG    1 
ATOM   4647 O  OD1   . ASN C 3  496 ? 77.416 199.766 14.206 1.00 45.35  ? 502  ASN A OD1   1 
ATOM   4648 N  ND2   . ASN C 3  496 ? 78.203 199.076 16.191 1.00 44.02  ? 502  ASN A ND2   1 
ATOM   4649 N  N     . GLY C 3  497 ? 73.825 198.210 14.280 1.00 37.97  ? 503  GLY A N     1 
ATOM   4650 C  CA    . GLY C 3  497 ? 73.642 196.809 13.939 1.00 37.01  ? 503  GLY A CA    1 
ATOM   4651 C  C     . GLY C 3  497 ? 72.806 196.132 15.009 1.00 35.83  ? 503  GLY A C     1 
ATOM   4652 O  O     . GLY C 3  497 ? 72.569 196.714 16.066 1.00 37.08  ? 503  GLY A O     1 
ATOM   4653 N  N     . ASP C 3  498 ? 72.356 194.909 14.755 1.00 33.89  ? 504  ASP A N     1 
ATOM   4654 C  CA    . ASP C 3  498 ? 71.542 194.204 15.737 1.00 32.47  ? 504  ASP A CA    1 
ATOM   4655 C  C     . ASP C 3  498 ? 72.268 194.055 17.075 1.00 31.21  ? 504  ASP A C     1 
ATOM   4656 O  O     . ASP C 3  498 ? 73.380 193.536 17.138 1.00 31.86  ? 504  ASP A O     1 
ATOM   4657 C  CB    . ASP C 3  498 ? 71.154 192.828 15.224 1.00 31.83  ? 504  ASP A CB    1 
ATOM   4658 C  CG    . ASP C 3  498 ? 70.152 192.153 16.120 1.00 33.98  ? 504  ASP A CG    1 
ATOM   4659 O  OD1   . ASP C 3  498 ? 69.010 192.652 16.187 1.00 34.24  ? 504  ASP A OD1   1 
ATOM   4660 O  OD2   . ASP C 3  498 ? 70.505 191.141 16.766 1.00 35.06  ? 504  ASP A OD2   1 
ATOM   4661 N  N     . ILE C 3  499 ? 71.624 194.500 18.145 1.00 29.36  ? 505  ILE A N     1 
ATOM   4662 C  CA    . ILE C 3  499 ? 72.214 194.436 19.476 1.00 28.78  ? 505  ILE A CA    1 
ATOM   4663 C  C     . ILE C 3  499 ? 72.425 193.007 19.982 1.00 28.44  ? 505  ILE A C     1 
ATOM   4664 O  O     . ILE C 3  499 ? 73.428 192.716 20.630 1.00 28.07  ? 505  ILE A O     1 
ATOM   4665 C  CB    . ILE C 3  499 ? 71.346 195.228 20.498 1.00 26.38  ? 505  ILE A CB    1 
ATOM   4666 C  CG1   . ILE C 3  499 ? 72.001 195.214 21.882 1.00 25.27  ? 505  ILE A CG1   1 
ATOM   4667 C  CG2   . ILE C 3  499 ? 69.957 194.629 20.580 1.00 25.23  ? 505  ILE A CG2   1 
ATOM   4668 C  CD1   . ILE C 3  499 ? 73.304 195.958 21.954 1.00 22.48  ? 505  ILE A CD1   1 
ATOM   4669 N  N     . HIS C 3  500 ? 71.490 192.113 19.686 1.00 29.35  ? 506  HIS A N     1 
ATOM   4670 C  CA    . HIS C 3  500 ? 71.619 190.737 20.147 1.00 30.02  ? 506  HIS A CA    1 
ATOM   4671 C  C     . HIS C 3  500 ? 72.686 189.974 19.376 1.00 30.08  ? 506  HIS A C     1 
ATOM   4672 O  O     . HIS C 3  500 ? 73.372 189.128 19.943 1.00 31.59  ? 506  HIS A O     1 
ATOM   4673 C  CB    . HIS C 3  500 ? 70.269 190.014 20.063 1.00 27.80  ? 506  HIS A CB    1 
ATOM   4674 C  CG    . HIS C 3  500 ? 69.222 190.593 20.964 1.00 27.65  ? 506  HIS A CG    1 
ATOM   4675 N  ND1   . HIS C 3  500 ? 69.416 190.755 22.319 1.00 25.54  ? 506  HIS A ND1   1 
ATOM   4676 C  CD2   . HIS C 3  500 ? 67.980 191.067 20.704 1.00 27.10  ? 506  HIS A CD2   1 
ATOM   4677 C  CE1   . HIS C 3  500 ? 68.341 191.305 22.853 1.00 24.63  ? 506  HIS A CE1   1 
ATOM   4678 N  NE2   . HIS C 3  500 ? 67.455 191.504 21.896 1.00 23.52  ? 506  HIS A NE2   1 
ATOM   4679 N  N     . THR C 3  501 ? 72.831 190.267 18.087 1.00 30.78  ? 507  THR A N     1 
ATOM   4680 C  CA    . THR C 3  501 ? 73.850 189.594 17.283 1.00 30.38  ? 507  THR A CA    1 
ATOM   4681 C  C     . THR C 3  501 ? 75.213 190.080 17.748 1.00 31.29  ? 507  THR A C     1 
ATOM   4682 O  O     . THR C 3  501 ? 76.171 189.308 17.846 1.00 30.68  ? 507  THR A O     1 
ATOM   4683 C  CB    . THR C 3  501 ? 73.702 189.909 15.781 1.00 30.52  ? 507  THR A CB    1 
ATOM   4684 O  OG1   . THR C 3  501 ? 72.574 189.204 15.248 1.00 29.54  ? 507  THR A OG1   1 
ATOM   4685 C  CG2   . THR C 3  501 ? 74.955 189.503 15.027 1.00 27.38  ? 507  THR A CG2   1 
ATOM   4686 N  N     . LYS C 3  502 ? 75.293 191.372 18.041 1.00 31.65  ? 508  LYS A N     1 
ATOM   4687 C  CA    . LYS C 3  502 ? 76.538 191.949 18.501 1.00 33.27  ? 508  LYS A CA    1 
ATOM   4688 C  C     . LYS C 3  502 ? 76.934 191.257 19.796 1.00 33.56  ? 508  LYS A C     1 
ATOM   4689 O  O     . LYS C 3  502 ? 78.066 190.788 19.930 1.00 35.96  ? 508  LYS A O     1 
ATOM   4690 C  CB    . LYS C 3  502 ? 76.380 193.455 18.719 1.00 34.64  ? 508  LYS A CB    1 
ATOM   4691 C  CG    . LYS C 3  502 ? 77.704 194.182 18.895 1.00 37.20  ? 508  LYS A CG    1 
ATOM   4692 C  CD    . LYS C 3  502 ? 77.526 195.697 18.910 1.00 39.63  ? 508  LYS A CD    1 
ATOM   4693 C  CE    . LYS C 3  502 ? 76.694 196.154 20.097 1.00 40.51  ? 508  LYS A CE    1 
ATOM   4694 N  NZ    . LYS C 3  502 ? 76.523 197.636 20.115 1.00 43.02  ? 508  LYS A NZ    1 
ATOM   4695 N  N     . ASN C 3  503 ? 75.999 191.175 20.741 1.00 32.64  ? 509  ASN A N     1 
ATOM   4696 C  CA    . ASN C 3  503 ? 76.280 190.523 22.018 1.00 31.44  ? 509  ASN A CA    1 
ATOM   4697 C  C     . ASN C 3  503 ? 76.648 189.051 21.834 1.00 32.05  ? 509  ASN A C     1 
ATOM   4698 O  O     . ASN C 3  503 ? 77.602 188.560 22.441 1.00 30.94  ? 509  ASN A O     1 
ATOM   4699 C  CB    . ASN C 3  503 ? 75.081 190.632 22.967 1.00 30.28  ? 509  ASN A CB    1 
ATOM   4700 C  CG    . ASN C 3  503 ? 74.831 192.055 23.439 1.00 28.95  ? 509  ASN A CG    1 
ATOM   4701 O  OD1   . ASN C 3  503 ? 75.751 192.864 23.531 1.00 29.87  ? 509  ASN A OD1   1 
ATOM   4702 N  ND2   . ASN C 3  503 ? 73.584 192.358 23.761 1.00 28.31  ? 509  ASN A ND2   1 
ATOM   4703 N  N     . GLN C 3  504 ? 75.888 188.350 20.996 1.00 31.58  ? 510  GLN A N     1 
ATOM   4704 C  CA    . GLN C 3  504 ? 76.138 186.936 20.741 1.00 32.00  ? 510  GLN A CA    1 
ATOM   4705 C  C     . GLN C 3  504 ? 77.618 186.710 20.455 1.00 33.10  ? 510  GLN A C     1 
ATOM   4706 O  O     . GLN C 3  504 ? 78.262 185.847 21.058 1.00 31.93  ? 510  GLN A O     1 
ATOM   4707 C  CB    . GLN C 3  504 ? 75.324 186.462 19.537 1.00 31.52  ? 510  GLN A CB    1 
ATOM   4708 C  CG    . GLN C 3  504 ? 75.381 184.961 19.312 1.00 29.74  ? 510  GLN A CG    1 
ATOM   4709 C  CD    . GLN C 3  504 ? 74.873 184.550 17.947 1.00 30.56  ? 510  GLN A CD    1 
ATOM   4710 O  OE1   . GLN C 3  504 ? 74.141 185.293 17.289 1.00 30.88  ? 510  GLN A OE1   1 
ATOM   4711 N  NE2   . GLN C 3  504 ? 75.251 183.350 17.517 1.00 29.61  ? 510  GLN A NE2   1 
ATOM   4712 N  N     . ILE C 3  505 ? 78.142 187.499 19.522 1.00 33.68  ? 511  ILE A N     1 
ATOM   4713 C  CA    . ILE C 3  505 ? 79.536 187.416 19.116 1.00 34.11  ? 511  ILE A CA    1 
ATOM   4714 C  C     . ILE C 3  505 ? 80.465 187.737 20.279 1.00 35.25  ? 511  ILE A C     1 
ATOM   4715 O  O     . ILE C 3  505 ? 81.311 186.927 20.654 1.00 35.85  ? 511  ILE A O     1 
ATOM   4716 C  CB    . ILE C 3  505 ? 79.817 188.391 17.955 1.00 34.51  ? 511  ILE A CB    1 
ATOM   4717 C  CG1   . ILE C 3  505 ? 78.921 188.035 16.765 1.00 34.28  ? 511  ILE A CG1   1 
ATOM   4718 C  CG2   . ILE C 3  505 ? 81.284 188.336 17.566 1.00 34.47  ? 511  ILE A CG2   1 
ATOM   4719 C  CD1   . ILE C 3  505 ? 78.980 189.027 15.619 1.00 32.15  ? 511  ILE A CD1   1 
ATOM   4720 N  N     . ALA C 3  506 ? 80.300 188.920 20.856 1.00 35.51  ? 512  ALA A N     1 
ATOM   4721 C  CA    . ALA C 3  506 ? 81.133 189.337 21.973 1.00 36.08  ? 512  ALA A CA    1 
ATOM   4722 C  C     . ALA C 3  506 ? 81.131 188.309 23.101 1.00 37.61  ? 512  ALA A C     1 
ATOM   4723 O  O     . ALA C 3  506 ? 82.151 188.104 23.764 1.00 38.40  ? 512  ALA A O     1 
ATOM   4724 C  CB    . ALA C 3  506 ? 80.658 190.684 22.500 1.00 35.69  ? 512  ALA A CB    1 
ATOM   4725 N  N     . ALA C 3  507 ? 79.987 187.666 23.318 1.00 38.19  ? 513  ALA A N     1 
ATOM   4726 C  CA    . ALA C 3  507 ? 79.862 186.669 24.378 1.00 39.38  ? 513  ALA A CA    1 
ATOM   4727 C  C     . ALA C 3  507 ? 80.312 185.305 23.892 1.00 40.25  ? 513  ALA A C     1 
ATOM   4728 O  O     . ALA C 3  507 ? 80.533 184.397 24.689 1.00 40.81  ? 513  ALA A O     1 
ATOM   4729 C  CB    . ALA C 3  507 ? 78.422 186.594 24.863 1.00 39.55  ? 513  ALA A CB    1 
ATOM   4730 N  N     . GLU C 3  508 ? 80.444 185.168 22.579 1.00 41.08  ? 514  GLU A N     1 
ATOM   4731 C  CA    . GLU C 3  508 ? 80.863 183.909 21.989 1.00 42.79  ? 514  GLU A CA    1 
ATOM   4732 C  C     . GLU C 3  508 ? 79.781 182.867 22.232 1.00 42.19  ? 514  GLU A C     1 
ATOM   4733 O  O     . GLU C 3  508 ? 80.061 181.754 22.679 1.00 43.56  ? 514  GLU A O     1 
ATOM   4734 C  CB    . GLU C 3  508 ? 82.181 183.452 22.614 1.00 44.57  ? 514  GLU A CB    1 
ATOM   4735 C  CG    . GLU C 3  508 ? 83.236 184.538 22.637 1.00 47.69  ? 514  GLU A CG    1 
ATOM   4736 C  CD    . GLU C 3  508 ? 84.489 184.115 23.364 1.00 49.38  ? 514  GLU A CD    1 
ATOM   4737 O  OE1   . GLU C 3  508 ? 85.207 183.230 22.854 1.00 50.65  ? 514  GLU A OE1   1 
ATOM   4738 O  OE2   . GLU C 3  508 ? 84.754 184.663 24.453 1.00 51.63  ? 514  GLU A OE2   1 
ATOM   4739 N  N     . LEU C 3  509 ? 78.539 183.240 21.946 1.00 40.94  ? 515  LEU A N     1 
ATOM   4740 C  CA    . LEU C 3  509 ? 77.415 182.334 22.128 1.00 39.22  ? 515  LEU A CA    1 
ATOM   4741 C  C     . LEU C 3  509 ? 77.001 181.733 20.789 1.00 39.31  ? 515  LEU A C     1 
ATOM   4742 O  O     . LEU C 3  509 ? 77.090 182.383 19.744 1.00 39.05  ? 515  LEU A O     1 
ATOM   4743 C  CB    . LEU C 3  509 ? 76.236 183.074 22.771 1.00 37.74  ? 515  LEU A CB    1 
ATOM   4744 C  CG    . LEU C 3  509 ? 76.483 183.602 24.192 1.00 35.68  ? 515  LEU A CG    1 
ATOM   4745 C  CD1   . LEU C 3  509 ? 75.254 184.356 24.672 1.00 34.44  ? 515  LEU A CD1   1 
ATOM   4746 C  CD2   . LEU C 3  509 ? 76.805 182.446 25.133 1.00 32.58  ? 515  LEU A CD2   1 
ATOM   4747 N  N     . PRO C 3  510 ? 76.538 180.475 20.807 1.00 38.59  ? 516  PRO A N     1 
ATOM   4748 C  CA    . PRO C 3  510 ? 76.105 179.750 19.608 1.00 38.23  ? 516  PRO A CA    1 
ATOM   4749 C  C     . PRO C 3  510 ? 74.998 180.401 18.785 1.00 38.00  ? 516  PRO A C     1 
ATOM   4750 O  O     . PRO C 3  510 ? 75.132 180.554 17.572 1.00 38.67  ? 516  PRO A O     1 
ATOM   4751 C  CB    . PRO C 3  510 ? 75.686 178.390 20.162 1.00 38.62  ? 516  PRO A CB    1 
ATOM   4752 C  CG    . PRO C 3  510 ? 75.221 178.721 21.545 1.00 39.64  ? 516  PRO A CG    1 
ATOM   4753 C  CD    . PRO C 3  510 ? 76.290 179.673 22.016 1.00 38.77  ? 516  PRO A CD    1 
ATOM   4754 N  N     . THR C 3  511 ? 73.908 180.781 19.439 1.00 37.44  ? 517  THR A N     1 
ATOM   4755 C  CA    . THR C 3  511 ? 72.784 181.384 18.731 1.00 35.55  ? 517  THR A CA    1 
ATOM   4756 C  C     . THR C 3  511 ? 72.407 182.771 19.228 1.00 34.55  ? 517  THR A C     1 
ATOM   4757 O  O     . THR C 3  511 ? 72.797 183.181 20.319 1.00 33.77  ? 517  THR A O     1 
ATOM   4758 C  CB    . THR C 3  511 ? 71.539 180.495 18.842 1.00 35.25  ? 517  THR A CB    1 
ATOM   4759 O  OG1   . THR C 3  511 ? 71.261 180.244 20.225 1.00 34.09  ? 517  THR A OG1   1 
ATOM   4760 C  CG2   . THR C 3  511 ? 71.763 179.175 18.130 1.00 35.19  ? 517  THR A CG2   1 
ATOM   4761 N  N     . ARG C 3  512 ? 71.641 183.487 18.409 1.00 34.19  ? 518  ARG A N     1 
ATOM   4762 C  CA    . ARG C 3  512 ? 71.175 184.820 18.760 1.00 33.09  ? 518  ARG A CA    1 
ATOM   4763 C  C     . ARG C 3  512 ? 70.148 184.682 19.877 1.00 34.46  ? 518  ARG A C     1 
ATOM   4764 O  O     . ARG C 3  512 ? 69.970 185.594 20.689 1.00 34.84  ? 518  ARG A O     1 
ATOM   4765 C  CB    . ARG C 3  512 ? 70.535 185.498 17.549 1.00 30.35  ? 518  ARG A CB    1 
ATOM   4766 C  CG    . ARG C 3  512 ? 69.972 186.878 17.835 1.00 28.89  ? 518  ARG A CG    1 
ATOM   4767 C  CD    . ARG C 3  512 ? 69.594 187.579 16.542 1.00 28.15  ? 518  ARG A CD    1 
ATOM   4768 N  NE    . ARG C 3  512 ? 69.034 188.915 16.758 1.00 29.87  ? 518  ARG A NE    1 
ATOM   4769 C  CZ    . ARG C 3  512 ? 67.829 189.150 17.267 1.00 29.22  ? 518  ARG A CZ    1 
ATOM   4770 N  NH1   . ARG C 3  512 ? 67.044 188.139 17.616 1.00 30.43  ? 518  ARG A NH1   1 
ATOM   4771 N  NH2   . ARG C 3  512 ? 67.410 190.396 17.428 1.00 28.20  ? 518  ARG A NH2   1 
ATOM   4772 N  N     . ASP C 3  513 ? 69.471 183.536 19.911 1.00 33.50  ? 519  ASP A N     1 
ATOM   4773 C  CA    . ASP C 3  513 ? 68.475 183.286 20.940 1.00 33.92  ? 519  ASP A CA    1 
ATOM   4774 C  C     . ASP C 3  513 ? 69.181 183.185 22.281 1.00 32.57  ? 519  ASP A C     1 
ATOM   4775 O  O     . ASP C 3  513 ? 68.782 183.815 23.256 1.00 31.16  ? 519  ASP A O     1 
ATOM   4776 C  CB    . ASP C 3  513 ? 67.708 181.983 20.664 1.00 36.25  ? 519  ASP A CB    1 
ATOM   4777 C  CG    . ASP C 3  513 ? 66.584 182.154 19.644 1.00 37.90  ? 519  ASP A CG    1 
ATOM   4778 O  OD1   . ASP C 3  513 ? 65.908 183.206 19.652 1.00 39.20  ? 519  ASP A OD1   1 
ATOM   4779 O  OD2   . ASP C 3  513 ? 66.361 181.217 18.847 1.00 41.63  ? 519  ASP A OD2   1 
ATOM   4780 N  N     . ASN C 3  514 ? 70.240 182.390 22.319 1.00 32.94  ? 520  ASN A N     1 
ATOM   4781 C  CA    . ASN C 3  514 ? 71.003 182.204 23.541 1.00 33.71  ? 520  ASN A CA    1 
ATOM   4782 C  C     . ASN C 3  514 ? 71.481 183.557 24.062 1.00 33.11  ? 520  ASN A C     1 
ATOM   4783 O  O     . ASN C 3  514 ? 71.491 183.801 25.272 1.00 32.31  ? 520  ASN A O     1 
ATOM   4784 C  CB    . ASN C 3  514 ? 72.213 181.307 23.279 1.00 36.12  ? 520  ASN A CB    1 
ATOM   4785 C  CG    . ASN C 3  514 ? 72.896 180.863 24.562 1.00 38.88  ? 520  ASN A CG    1 
ATOM   4786 O  OD1   . ASN C 3  514 ? 74.125 180.792 24.638 1.00 40.26  ? 520  ASN A OD1   1 
ATOM   4787 N  ND2   . ASN C 3  514 ? 72.096 180.550 25.577 1.00 40.19  ? 520  ASN A ND2   1 
ATOM   4788 N  N     . ALA C 3  515 ? 71.877 184.432 23.141 1.00 32.01  ? 521  ALA A N     1 
ATOM   4789 C  CA    . ALA C 3  515 ? 72.364 185.758 23.509 1.00 31.92  ? 521  ALA A CA    1 
ATOM   4790 C  C     . ALA C 3  515 ? 71.270 186.534 24.220 1.00 31.07  ? 521  ALA A C     1 
ATOM   4791 O  O     . ALA C 3  515 ? 71.534 187.227 25.200 1.00 30.34  ? 521  ALA A O     1 
ATOM   4792 C  CB    . ALA C 3  515 ? 72.839 186.525 22.264 1.00 29.88  ? 521  ALA A CB    1 
ATOM   4793 N  N     . LYS C 3  516 ? 70.040 186.401 23.731 1.00 30.42  ? 522  LYS A N     1 
ATOM   4794 C  CA    . LYS C 3  516 ? 68.908 187.102 24.326 1.00 31.31  ? 522  LYS A CA    1 
ATOM   4795 C  C     . LYS C 3  516 ? 68.652 186.640 25.755 1.00 30.09  ? 522  LYS A C     1 
ATOM   4796 O  O     . LYS C 3  516 ? 68.591 187.459 26.678 1.00 30.33  ? 522  LYS A O     1 
ATOM   4797 C  CB    . LYS C 3  516 ? 67.653 186.893 23.475 1.00 32.11  ? 522  LYS A CB    1 
ATOM   4798 C  CG    . LYS C 3  516 ? 67.788 187.453 22.071 1.00 34.97  ? 522  LYS A CG    1 
ATOM   4799 C  CD    . LYS C 3  516 ? 66.661 187.000 21.161 1.00 36.25  ? 522  LYS A CD    1 
ATOM   4800 C  CE    . LYS C 3  516 ? 65.341 187.618 21.554 1.00 37.23  ? 522  LYS A CE    1 
ATOM   4801 N  NZ    . LYS C 3  516 ? 64.290 187.284 20.562 1.00 36.60  ? 522  LYS A NZ    1 
ATOM   4802 N  N     . THR C 3  517 ? 68.509 185.332 25.940 1.00 27.21  ? 523  THR A N     1 
ATOM   4803 C  CA    . THR C 3  517 ? 68.259 184.803 27.270 1.00 25.29  ? 523  THR A CA    1 
ATOM   4804 C  C     . THR C 3  517 ? 69.453 185.097 28.174 1.00 24.51  ? 523  THR A C     1 
ATOM   4805 O  O     . THR C 3  517 ? 69.331 185.104 29.400 1.00 23.29  ? 523  THR A O     1 
ATOM   4806 C  CB    . THR C 3  517 ? 67.942 183.278 27.237 1.00 25.50  ? 523  THR A CB    1 
ATOM   4807 O  OG1   . THR C 3  517 ? 68.725 182.599 28.224 1.00 28.09  ? 523  THR A OG1   1 
ATOM   4808 C  CG2   . THR C 3  517 ? 68.214 182.691 25.865 1.00 25.17  ? 523  THR A CG2   1 
ATOM   4809 N  N     . PHE C 3  518 ? 70.606 185.361 27.568 1.00 24.03  ? 524  PHE A N     1 
ATOM   4810 C  CA    . PHE C 3  518 ? 71.797 185.688 28.346 1.00 23.21  ? 524  PHE A CA    1 
ATOM   4811 C  C     . PHE C 3  518 ? 71.769 187.137 28.817 1.00 22.56  ? 524  PHE A C     1 
ATOM   4812 O  O     . PHE C 3  518 ? 71.912 187.425 30.001 1.00 22.11  ? 524  PHE A O     1 
ATOM   4813 C  CB    . PHE C 3  518 ? 73.069 185.510 27.521 1.00 23.03  ? 524  PHE A CB    1 
ATOM   4814 C  CG    . PHE C 3  518 ? 74.251 186.255 28.086 1.00 24.16  ? 524  PHE A CG    1 
ATOM   4815 C  CD1   . PHE C 3  518 ? 74.847 185.847 29.281 1.00 24.35  ? 524  PHE A CD1   1 
ATOM   4816 C  CD2   . PHE C 3  518 ? 74.737 187.398 27.453 1.00 25.08  ? 524  PHE A CD2   1 
ATOM   4817 C  CE1   . PHE C 3  518 ? 75.914 186.569 29.839 1.00 23.21  ? 524  PHE A CE1   1 
ATOM   4818 C  CE2   . PHE C 3  518 ? 75.802 188.130 28.002 1.00 25.60  ? 524  PHE A CE2   1 
ATOM   4819 C  CZ    . PHE C 3  518 ? 76.389 187.710 29.199 1.00 25.63  ? 524  PHE A CZ    1 
ATOM   4820 N  N     . ILE C 3  519 ? 71.606 188.048 27.866 1.00 22.08  ? 525  ILE A N     1 
ATOM   4821 C  CA    . ILE C 3  519 ? 71.609 189.464 28.179 1.00 22.49  ? 525  ILE A CA    1 
ATOM   4822 C  C     . ILE C 3  519 ? 70.490 189.848 29.129 1.00 22.84  ? 525  ILE A C     1 
ATOM   4823 O  O     . ILE C 3  519 ? 70.698 190.660 30.024 1.00 24.78  ? 525  ILE A O     1 
ATOM   4824 C  CB    . ILE C 3  519 ? 71.530 190.330 26.900 1.00 19.56  ? 525  ILE A CB    1 
ATOM   4825 C  CG1   . ILE C 3  519 ? 72.076 191.728 27.194 1.00 20.29  ? 525  ILE A CG1   1 
ATOM   4826 C  CG2   . ILE C 3  519 ? 70.108 190.405 26.399 1.00 18.12  ? 525  ILE A CG2   1 
ATOM   4827 C  CD1   . ILE C 3  519 ? 73.562 191.759 27.519 1.00 15.42  ? 525  ILE A CD1   1 
ATOM   4828 N  N     . TYR C 3  520 ? 69.310 189.265 28.963 1.00 22.20  ? 526  TYR A N     1 
ATOM   4829 C  CA    . TYR C 3  520 ? 68.226 189.610 29.862 1.00 24.11  ? 526  TYR A CA    1 
ATOM   4830 C  C     . TYR C 3  520 ? 68.412 188.989 31.237 1.00 25.18  ? 526  TYR A C     1 
ATOM   4831 O  O     . TYR C 3  520 ? 68.114 189.622 32.251 1.00 26.31  ? 526  TYR A O     1 
ATOM   4832 C  CB    . TYR C 3  520 ? 66.876 189.232 29.248 1.00 23.69  ? 526  TYR A CB    1 
ATOM   4833 C  CG    . TYR C 3  520 ? 66.490 190.197 28.145 1.00 23.62  ? 526  TYR A CG    1 
ATOM   4834 C  CD1   . TYR C 3  520 ? 66.471 191.573 28.383 1.00 23.05  ? 526  TYR A CD1   1 
ATOM   4835 C  CD2   . TYR C 3  520 ? 66.198 189.749 26.860 1.00 22.11  ? 526  TYR A CD2   1 
ATOM   4836 C  CE1   . TYR C 3  520 ? 66.178 192.485 27.369 1.00 20.91  ? 526  TYR A CE1   1 
ATOM   4837 C  CE2   . TYR C 3  520 ? 65.903 190.654 25.833 1.00 22.83  ? 526  TYR A CE2   1 
ATOM   4838 C  CZ    . TYR C 3  520 ? 65.896 192.022 26.099 1.00 22.57  ? 526  TYR A CZ    1 
ATOM   4839 O  OH    . TYR C 3  520 ? 65.602 192.926 25.102 1.00 21.38  ? 526  TYR A OH    1 
ATOM   4840 N  N     . GLY C 3  521 ? 68.923 187.764 31.281 1.00 25.42  ? 527  GLY A N     1 
ATOM   4841 C  CA    . GLY C 3  521 ? 69.152 187.132 32.566 1.00 25.04  ? 527  GLY A CA    1 
ATOM   4842 C  C     . GLY C 3  521 ? 70.197 187.951 33.302 1.00 24.96  ? 527  GLY A C     1 
ATOM   4843 O  O     . GLY C 3  521 ? 70.096 188.194 34.505 1.00 25.89  ? 527  GLY A O     1 
ATOM   4844 N  N     . PHE C 3  522 ? 71.207 188.386 32.558 1.00 23.71  ? 528  PHE A N     1 
ATOM   4845 C  CA    . PHE C 3  522 ? 72.286 189.196 33.099 1.00 23.08  ? 528  PHE A CA    1 
ATOM   4846 C  C     . PHE C 3  522 ? 71.746 190.533 33.597 1.00 23.21  ? 528  PHE A C     1 
ATOM   4847 O  O     . PHE C 3  522 ? 71.862 190.870 34.779 1.00 23.15  ? 528  PHE A O     1 
ATOM   4848 C  CB    . PHE C 3  522 ? 73.338 189.438 32.012 1.00 23.08  ? 528  PHE A CB    1 
ATOM   4849 C  CG    . PHE C 3  522 ? 74.136 190.690 32.209 1.00 22.62  ? 528  PHE A CG    1 
ATOM   4850 C  CD1   . PHE C 3  522 ? 75.006 190.813 33.286 1.00 23.96  ? 528  PHE A CD1   1 
ATOM   4851 C  CD2   . PHE C 3  522 ? 73.995 191.760 31.334 1.00 22.59  ? 528  PHE A CD2   1 
ATOM   4852 C  CE1   . PHE C 3  522 ? 75.729 191.987 33.493 1.00 23.12  ? 528  PHE A CE1   1 
ATOM   4853 C  CE2   . PHE C 3  522 ? 74.713 192.943 31.528 1.00 23.53  ? 528  PHE A CE2   1 
ATOM   4854 C  CZ    . PHE C 3  522 ? 75.583 193.057 32.612 1.00 22.70  ? 528  PHE A CZ    1 
ATOM   4855 N  N     . LEU C 3  523 ? 71.152 191.290 32.683 1.00 22.63  ? 529  LEU A N     1 
ATOM   4856 C  CA    . LEU C 3  523 ? 70.605 192.598 33.006 1.00 23.07  ? 529  LEU A CA    1 
ATOM   4857 C  C     . LEU C 3  523 ? 69.690 192.581 34.225 1.00 24.10  ? 529  LEU A C     1 
ATOM   4858 O  O     . LEU C 3  523 ? 69.700 193.525 35.015 1.00 24.46  ? 529  LEU A O     1 
ATOM   4859 C  CB    . LEU C 3  523 ? 69.840 193.157 31.803 1.00 21.21  ? 529  LEU A CB    1 
ATOM   4860 C  CG    . LEU C 3  523 ? 69.057 194.446 32.060 1.00 20.83  ? 529  LEU A CG    1 
ATOM   4861 C  CD1   . LEU C 3  523 ? 70.006 195.551 32.483 1.00 19.14  ? 529  LEU A CD1   1 
ATOM   4862 C  CD2   . LEU C 3  523 ? 68.308 194.842 30.805 1.00 20.88  ? 529  LEU A CD2   1 
ATOM   4863 N  N     . TYR C 3  524 ? 68.914 191.507 34.386 1.00 24.18  ? 530  TYR A N     1 
ATOM   4864 C  CA    . TYR C 3  524 ? 67.976 191.404 35.502 1.00 23.54  ? 530  TYR A CA    1 
ATOM   4865 C  C     . TYR C 3  524 ? 68.441 190.714 36.795 1.00 25.62  ? 530  TYR A C     1 
ATOM   4866 O  O     . TYR C 3  524 ? 67.611 190.365 37.639 1.00 24.89  ? 530  TYR A O     1 
ATOM   4867 C  CB    . TYR C 3  524 ? 66.658 190.778 35.016 1.00 21.57  ? 530  TYR A CB    1 
ATOM   4868 C  CG    . TYR C 3  524 ? 65.950 191.619 33.971 1.00 20.55  ? 530  TYR A CG    1 
ATOM   4869 C  CD1   . TYR C 3  524 ? 65.877 193.004 34.099 1.00 20.04  ? 530  TYR A CD1   1 
ATOM   4870 C  CD2   . TYR C 3  524 ? 65.378 191.037 32.843 1.00 19.68  ? 530  TYR A CD2   1 
ATOM   4871 C  CE1   . TYR C 3  524 ? 65.262 193.790 33.131 1.00 20.02  ? 530  TYR A CE1   1 
ATOM   4872 C  CE2   . TYR C 3  524 ? 64.758 191.816 31.862 1.00 19.63  ? 530  TYR A CE2   1 
ATOM   4873 C  CZ    . TYR C 3  524 ? 64.708 193.194 32.011 1.00 19.93  ? 530  TYR A CZ    1 
ATOM   4874 O  OH    . TYR C 3  524 ? 64.149 193.982 31.031 1.00 15.42  ? 530  TYR A OH    1 
ATOM   4875 N  N     . GLY C 3  525 ? 69.749 190.501 36.947 1.00 26.86  ? 531  GLY A N     1 
ATOM   4876 C  CA    . GLY C 3  525 ? 70.265 189.930 38.185 1.00 26.37  ? 531  GLY A CA    1 
ATOM   4877 C  C     . GLY C 3  525 ? 70.544 188.449 38.364 1.00 28.78  ? 531  GLY A C     1 
ATOM   4878 O  O     . GLY C 3  525 ? 70.569 187.970 39.498 1.00 27.98  ? 531  GLY A O     1 
ATOM   4879 N  N     . ALA C 3  526 ? 70.759 187.715 37.278 1.00 29.79  ? 532  ALA A N     1 
ATOM   4880 C  CA    . ALA C 3  526 ? 71.049 186.293 37.397 1.00 29.04  ? 532  ALA A CA    1 
ATOM   4881 C  C     . ALA C 3  526 ? 72.416 186.119 38.055 1.00 30.46  ? 532  ALA A C     1 
ATOM   4882 O  O     . ALA C 3  526 ? 73.323 186.926 37.851 1.00 30.05  ? 532  ALA A O     1 
ATOM   4883 C  CB    . ALA C 3  526 ? 71.031 185.631 36.028 1.00 26.81  ? 532  ALA A CB    1 
ATOM   4884 N  N     . GLY C 3  527 ? 72.554 185.068 38.856 1.00 32.21  ? 533  GLY A N     1 
ATOM   4885 C  CA    . GLY C 3  527 ? 73.811 184.813 39.537 1.00 33.64  ? 533  GLY A CA    1 
ATOM   4886 C  C     . GLY C 3  527 ? 74.861 184.264 38.597 1.00 34.85  ? 533  GLY A C     1 
ATOM   4887 O  O     . GLY C 3  527 ? 74.567 183.955 37.439 1.00 33.88  ? 533  GLY A O     1 
ATOM   4888 N  N     . ASP C 3  528 ? 76.089 184.139 39.090 1.00 36.81  ? 534  ASP A N     1 
ATOM   4889 C  CA    . ASP C 3  528 ? 77.180 183.627 38.267 1.00 38.10  ? 534  ASP A CA    1 
ATOM   4890 C  C     . ASP C 3  528 ? 76.848 182.245 37.716 1.00 38.15  ? 534  ASP A C     1 
ATOM   4891 O  O     . ASP C 3  528 ? 77.084 181.959 36.541 1.00 37.38  ? 534  ASP A O     1 
ATOM   4892 C  CB    . ASP C 3  528 ? 78.483 183.560 39.072 1.00 38.55  ? 534  ASP A CB    1 
ATOM   4893 C  CG    . ASP C 3  528 ? 78.954 184.925 39.536 1.00 41.38  ? 534  ASP A CG    1 
ATOM   4894 O  OD1   . ASP C 3  528 ? 78.890 185.886 38.741 1.00 42.38  ? 534  ASP A OD1   1 
ATOM   4895 O  OD2   . ASP C 3  528 ? 79.409 185.041 40.694 1.00 43.51  ? 534  ASP A OD2   1 
ATOM   4896 N  N     . GLU C 3  529 ? 76.295 181.390 38.567 1.00 39.08  ? 535  GLU A N     1 
ATOM   4897 C  CA    . GLU C 3  529 ? 75.949 180.044 38.141 1.00 41.42  ? 535  GLU A CA    1 
ATOM   4898 C  C     . GLU C 3  529 ? 74.770 180.089 37.180 1.00 40.80  ? 535  GLU A C     1 
ATOM   4899 O  O     . GLU C 3  529 ? 74.789 179.450 36.128 1.00 40.67  ? 535  GLU A O     1 
ATOM   4900 C  CB    . GLU C 3  529 ? 75.623 179.168 39.353 1.00 43.42  ? 535  GLU A CB    1 
ATOM   4901 C  CG    . GLU C 3  529 ? 75.366 177.713 39.000 1.00 49.50  ? 535  GLU A CG    1 
ATOM   4902 C  CD    . GLU C 3  529 ? 75.250 176.821 40.222 1.00 52.83  ? 535  GLU A CD    1 
ATOM   4903 O  OE1   . GLU C 3  529 ? 76.265 176.662 40.938 1.00 55.67  ? 535  GLU A OE1   1 
ATOM   4904 O  OE2   . GLU C 3  529 ? 74.148 176.283 40.465 1.00 53.25  ? 535  GLU A OE2   1 
ATOM   4905 N  N     . LYS C 3  530 ? 73.748 180.858 37.535 1.00 41.24  ? 536  LYS A N     1 
ATOM   4906 C  CA    . LYS C 3  530 ? 72.574 180.976 36.683 1.00 41.09  ? 536  LYS A CA    1 
ATOM   4907 C  C     . LYS C 3  530 ? 72.983 181.398 35.273 1.00 40.29  ? 536  LYS A C     1 
ATOM   4908 O  O     . LYS C 3  530 ? 72.419 180.925 34.288 1.00 40.60  ? 536  LYS A O     1 
ATOM   4909 C  CB    . LYS C 3  530 ? 71.584 181.989 37.266 1.00 41.97  ? 536  LYS A CB    1 
ATOM   4910 C  CG    . LYS C 3  530 ? 70.280 182.049 36.495 1.00 43.87  ? 536  LYS A CG    1 
ATOM   4911 C  CD    . LYS C 3  530 ? 69.644 180.669 36.434 1.00 45.60  ? 536  LYS A CD    1 
ATOM   4912 C  CE    . LYS C 3  530 ? 68.592 180.581 35.350 1.00 46.38  ? 536  LYS A CE    1 
ATOM   4913 N  NZ    . LYS C 3  530 ? 68.026 179.208 35.250 1.00 48.46  ? 536  LYS A NZ    1 
ATOM   4914 N  N     . ILE C 3  531 ? 73.965 182.288 35.179 1.00 39.26  ? 537  ILE A N     1 
ATOM   4915 C  CA    . ILE C 3  531 ? 74.442 182.740 33.879 1.00 40.02  ? 537  ILE A CA    1 
ATOM   4916 C  C     . ILE C 3  531 ? 75.171 181.597 33.190 1.00 41.45  ? 537  ILE A C     1 
ATOM   4917 O  O     . ILE C 3  531 ? 74.987 181.359 31.996 1.00 42.03  ? 537  ILE A O     1 
ATOM   4918 C  CB    . ILE C 3  531 ? 75.416 183.930 34.005 1.00 38.65  ? 537  ILE A CB    1 
ATOM   4919 C  CG1   . ILE C 3  531 ? 74.664 185.176 34.474 1.00 39.58  ? 537  ILE A CG1   1 
ATOM   4920 C  CG2   . ILE C 3  531 ? 76.084 184.198 32.668 1.00 36.68  ? 537  ILE A CG2   1 
ATOM   4921 C  CD1   . ILE C 3  531 ? 73.600 185.642 33.503 1.00 38.21  ? 537  ILE A CD1   1 
ATOM   4922 N  N     . GLY C 3  532 ? 76.000 180.891 33.954 1.00 42.84  ? 538  GLY A N     1 
ATOM   4923 C  CA    . GLY C 3  532 ? 76.752 179.779 33.403 1.00 42.99  ? 538  GLY A CA    1 
ATOM   4924 C  C     . GLY C 3  532 ? 75.839 178.746 32.777 1.00 43.05  ? 538  GLY A C     1 
ATOM   4925 O  O     . GLY C 3  532 ? 76.098 178.244 31.681 1.00 43.15  ? 538  GLY A O     1 
ATOM   4926 N  N     . GLN C 3  533 ? 74.755 178.437 33.476 1.00 42.64  ? 539  GLN A N     1 
ATOM   4927 C  CA    . GLN C 3  533 ? 73.799 177.461 32.989 1.00 42.42  ? 539  GLN A CA    1 
ATOM   4928 C  C     . GLN C 3  533 ? 73.208 177.915 31.668 1.00 41.61  ? 539  GLN A C     1 
ATOM   4929 O  O     . GLN C 3  533 ? 73.035 177.116 30.748 1.00 41.51  ? 539  GLN A O     1 
ATOM   4930 C  CB    . GLN C 3  533 ? 72.681 177.277 34.009 1.00 43.71  ? 539  GLN A CB    1 
ATOM   4931 C  CG    . GLN C 3  533 ? 71.598 176.329 33.555 1.00 47.47  ? 539  GLN A CG    1 
ATOM   4932 C  CD    . GLN C 3  533 ? 70.445 176.283 34.524 1.00 49.54  ? 539  GLN A CD    1 
ATOM   4933 O  OE1   . GLN C 3  533 ? 70.629 176.000 35.705 1.00 51.42  ? 539  GLN A OE1   1 
ATOM   4934 N  NE2   . GLN C 3  533 ? 69.245 176.563 34.032 1.00 51.99  ? 539  GLN A NE2   1 
ATOM   4935 N  N     . ILE C 3  534 ? 72.906 179.208 31.583 1.00 41.06  ? 540  ILE A N     1 
ATOM   4936 C  CA    . ILE C 3  534 ? 72.313 179.801 30.387 1.00 39.21  ? 540  ILE A CA    1 
ATOM   4937 C  C     . ILE C 3  534 ? 73.201 179.685 29.150 1.00 38.70  ? 540  ILE A C     1 
ATOM   4938 O  O     . ILE C 3  534 ? 72.708 179.459 28.045 1.00 35.46  ? 540  ILE A O     1 
ATOM   4939 C  CB    . ILE C 3  534 ? 71.980 181.301 30.626 1.00 38.93  ? 540  ILE A CB    1 
ATOM   4940 C  CG1   . ILE C 3  534 ? 70.864 181.424 31.663 1.00 37.20  ? 540  ILE A CG1   1 
ATOM   4941 C  CG2   . ILE C 3  534 ? 71.569 181.973 29.320 1.00 37.17  ? 540  ILE A CG2   1 
ATOM   4942 C  CD1   . ILE C 3  534 ? 70.457 182.850 31.943 1.00 37.97  ? 540  ILE A CD1   1 
ATOM   4943 N  N     . VAL C 3  535 ? 74.507 179.845 29.337 1.00 38.82  ? 541  VAL A N     1 
ATOM   4944 C  CA    . VAL C 3  535 ? 75.438 179.770 28.216 1.00 39.19  ? 541  VAL A CA    1 
ATOM   4945 C  C     . VAL C 3  535 ? 76.029 178.375 28.063 1.00 40.05  ? 541  VAL A C     1 
ATOM   4946 O  O     . VAL C 3  535 ? 76.642 178.060 27.048 1.00 38.95  ? 541  VAL A O     1 
ATOM   4947 C  CB    . VAL C 3  535 ? 76.574 180.796 28.377 1.00 38.54  ? 541  VAL A CB    1 
ATOM   4948 C  CG1   . VAL C 3  535 ? 75.984 182.198 28.442 1.00 37.54  ? 541  VAL A CG1   1 
ATOM   4949 C  CG2   . VAL C 3  535 ? 77.385 180.493 29.635 1.00 36.38  ? 541  VAL A CG2   1 
ATOM   4950 N  N     . GLY C 3  536 ? 75.837 177.540 29.078 1.00 42.29  ? 542  GLY A N     1 
ATOM   4951 C  CA    . GLY C 3  536 ? 76.342 176.181 29.018 1.00 43.83  ? 542  GLY A CA    1 
ATOM   4952 C  C     . GLY C 3  536 ? 77.711 175.975 29.638 1.00 45.01  ? 542  GLY A C     1 
ATOM   4953 O  O     . GLY C 3  536 ? 78.474 175.128 29.182 1.00 46.92  ? 542  GLY A O     1 
ATOM   4954 N  N     . ALA C 3  537 ? 78.025 176.745 30.673 1.00 45.07  ? 543  ALA A N     1 
ATOM   4955 C  CA    . ALA C 3  537 ? 79.304 176.631 31.357 1.00 44.81  ? 543  ALA A CA    1 
ATOM   4956 C  C     . ALA C 3  537 ? 79.037 176.610 32.852 1.00 45.72  ? 543  ALA A C     1 
ATOM   4957 O  O     . ALA C 3  537 ? 77.979 176.152 33.280 1.00 45.63  ? 543  ALA A O     1 
ATOM   4958 C  CB    . ALA C 3  537 ? 80.195 177.798 30.994 1.00 43.86  ? 543  ALA A CB    1 
ATOM   4959 N  N     . GLY C 3  538 ? 79.977 177.115 33.646 1.00 47.16  ? 544  GLY A N     1 
ATOM   4960 C  CA    . GLY C 3  538 ? 79.795 177.122 35.092 1.00 48.93  ? 544  GLY A CA    1 
ATOM   4961 C  C     . GLY C 3  538 ? 79.895 178.495 35.727 1.00 51.16  ? 544  GLY A C     1 
ATOM   4962 O  O     . GLY C 3  538 ? 80.105 179.494 35.034 1.00 51.17  ? 544  GLY A O     1 
ATOM   4963 N  N     . LYS C 3  539 ? 79.745 178.546 37.050 1.00 53.12  ? 545  LYS A N     1 
ATOM   4964 C  CA    . LYS C 3  539 ? 79.802 179.812 37.784 1.00 54.87  ? 545  LYS A CA    1 
ATOM   4965 C  C     . LYS C 3  539 ? 81.035 180.609 37.352 1.00 55.71  ? 545  LYS A C     1 
ATOM   4966 O  O     . LYS C 3  539 ? 81.041 181.836 37.436 1.00 55.99  ? 545  LYS A O     1 
ATOM   4967 C  CB    . LYS C 3  539 ? 79.849 179.552 39.294 1.00 55.55  ? 545  LYS A CB    1 
ATOM   4968 C  CG    . LYS C 3  539 ? 81.101 178.850 39.781 1.00 58.64  ? 545  LYS A CG    1 
ATOM   4969 C  CD    . LYS C 3  539 ? 81.089 178.694 41.299 1.00 61.22  ? 545  LYS A CD    1 
ATOM   4970 C  CE    . LYS C 3  539 ? 82.370 178.045 41.818 1.00 62.37  ? 545  LYS A CE    1 
ATOM   4971 N  NZ    . LYS C 3  539 ? 83.590 178.834 41.482 1.00 63.43  ? 545  LYS A NZ    1 
ATOM   4972 N  N     . GLU C 3  540 ? 82.055 179.897 36.872 1.00 55.97  ? 546  GLU A N     1 
ATOM   4973 C  CA    . GLU C 3  540 ? 83.261 180.556 36.439 1.00 56.96  ? 546  GLU A CA    1 
ATOM   4974 C  C     . GLU C 3  540 ? 83.043 181.408 35.216 1.00 55.16  ? 546  GLU A C     1 
ATOM   4975 O  O     . GLU C 3  540 ? 83.374 182.587 35.182 1.00 54.38  ? 546  GLU A O     1 
ATOM   4976 C  CB    . GLU C 3  540 ? 84.391 179.565 36.176 1.00 60.47  ? 546  GLU A CB    1 
ATOM   4977 C  CG    . GLU C 3  540 ? 85.422 179.461 37.282 1.00 65.08  ? 546  GLU A CG    1 
ATOM   4978 C  CD    . GLU C 3  540 ? 85.675 180.798 37.962 1.00 68.08  ? 546  GLU A CD    1 
ATOM   4979 O  OE1   . GLU C 3  540 ? 84.798 181.233 38.745 1.00 69.25  ? 546  GLU A OE1   1 
ATOM   4980 O  OE2   . GLU C 3  540 ? 86.741 181.401 37.719 1.00 70.40  ? 546  GLU A OE2   1 
ATOM   4981 N  N     . ARG C 3  541 ? 82.491 180.808 34.189 1.00 54.07  ? 547  ARG A N     1 
ATOM   4982 C  CA    . ARG C 3  541 ? 82.216 181.542 32.980 1.00 52.38  ? 547  ARG A CA    1 
ATOM   4983 C  C     . ARG C 3  541 ? 81.180 182.613 33.286 1.00 51.76  ? 547  ARG A C     1 
ATOM   4984 O  O     . ARG C 3  541 ? 81.179 183.679 32.677 1.00 50.07  ? 547  ARG A O     1 
ATOM   4985 C  CB    . ARG C 3  541 ? 81.684 180.584 31.911 1.00 50.90  ? 547  ARG A CB    1 
ATOM   4986 C  CG    . ARG C 3  541 ? 81.358 181.198 30.589 1.00 50.63  ? 547  ARG A CG    1 
ATOM   4987 C  CD    . ARG C 3  541 ? 82.569 181.845 29.975 1.00 50.51  ? 547  ARG A CD    1 
ATOM   4988 N  NE    . ARG C 3  541 ? 82.255 182.413 28.672 1.00 51.57  ? 547  ARG A NE    1 
ATOM   4989 C  CZ    . ARG C 3  541 ? 83.102 183.152 27.973 1.00 52.92  ? 547  ARG A CZ    1 
ATOM   4990 N  NH1   . ARG C 3  541 ? 84.309 183.404 28.459 1.00 52.95  ? 547  ARG A NH1   1 
ATOM   4991 N  NH2   . ARG C 3  541 ? 82.741 183.645 26.798 1.00 52.90  ? 547  ARG A NH2   1 
ATOM   4992 N  N     . GLY C 3  542 ? 80.290 182.323 34.230 1.00 51.53  ? 548  GLY A N     1 
ATOM   4993 C  CA    . GLY C 3  542 ? 79.261 183.285 34.594 1.00 50.73  ? 548  GLY A CA    1 
ATOM   4994 C  C     . GLY C 3  542 ? 79.852 184.623 34.998 1.00 50.20  ? 548  GLY A C     1 
ATOM   4995 O  O     . GLY C 3  542 ? 79.499 185.647 34.424 1.00 48.93  ? 548  GLY A O     1 
ATOM   4996 N  N     . LYS C 3  543 ? 80.752 184.615 35.982 1.00 50.86  ? 549  LYS A N     1 
ATOM   4997 C  CA    . LYS C 3  543 ? 81.400 185.845 36.448 1.00 51.03  ? 549  LYS A CA    1 
ATOM   4998 C  C     . LYS C 3  543 ? 82.113 186.622 35.340 1.00 50.51  ? 549  LYS A C     1 
ATOM   4999 O  O     . LYS C 3  543 ? 81.990 187.846 35.260 1.00 51.06  ? 549  LYS A O     1 
ATOM   5000 C  CB    . LYS C 3  543 ? 82.403 185.537 37.560 1.00 51.69  ? 549  LYS A CB    1 
ATOM   5001 C  CG    . LYS C 3  543 ? 81.781 185.537 38.933 1.00 54.29  ? 549  LYS A CG    1 
ATOM   5002 C  CD    . LYS C 3  543 ? 82.778 185.201 40.017 1.00 56.57  ? 549  LYS A CD    1 
ATOM   5003 C  CE    . LYS C 3  543 ? 83.865 186.247 40.113 1.00 57.70  ? 549  LYS A CE    1 
ATOM   5004 N  NZ    . LYS C 3  543 ? 84.856 185.882 41.164 1.00 61.97  ? 549  LYS A NZ    1 
ATOM   5005 N  N     . GLU C 3  544 ? 82.866 185.923 34.494 1.00 49.17  ? 550  GLU A N     1 
ATOM   5006 C  CA    . GLU C 3  544 ? 83.575 186.596 33.411 1.00 48.75  ? 550  GLU A CA    1 
ATOM   5007 C  C     . GLU C 3  544 ? 82.589 187.406 32.576 1.00 45.34  ? 550  GLU A C     1 
ATOM   5008 O  O     . GLU C 3  544 ? 82.752 188.610 32.386 1.00 44.69  ? 550  GLU A O     1 
ATOM   5009 C  CB    . GLU C 3  544 ? 84.280 185.585 32.500 1.00 52.46  ? 550  GLU A CB    1 
ATOM   5010 C  CG    . GLU C 3  544 ? 85.425 184.820 33.140 1.00 57.83  ? 550  GLU A CG    1 
ATOM   5011 C  CD    . GLU C 3  544 ? 86.089 183.853 32.167 1.00 61.35  ? 550  GLU A CD    1 
ATOM   5012 O  OE1   . GLU C 3  544 ? 86.517 184.305 31.082 1.00 63.27  ? 550  GLU A OE1   1 
ATOM   5013 O  OE2   . GLU C 3  544 ? 86.187 182.645 32.485 1.00 62.64  ? 550  GLU A OE2   1 
ATOM   5014 N  N     . LEU C 3  545 ? 81.562 186.726 32.084 1.00 41.25  ? 551  LEU A N     1 
ATOM   5015 C  CA    . LEU C 3  545 ? 80.543 187.350 31.258 1.00 38.98  ? 551  LEU A CA    1 
ATOM   5016 C  C     . LEU C 3  545 ? 79.837 188.523 31.940 1.00 37.46  ? 551  LEU A C     1 
ATOM   5017 O  O     . LEU C 3  545 ? 79.646 189.574 31.325 1.00 35.65  ? 551  LEU A O     1 
ATOM   5018 C  CB    . LEU C 3  545 ? 79.526 186.293 30.826 1.00 37.81  ? 551  LEU A CB    1 
ATOM   5019 C  CG    . LEU C 3  545 ? 79.491 185.885 29.348 1.00 37.86  ? 551  LEU A CG    1 
ATOM   5020 C  CD1   . LEU C 3  545 ? 80.832 186.119 28.669 1.00 36.41  ? 551  LEU A CD1   1 
ATOM   5021 C  CD2   . LEU C 3  545 ? 79.076 184.423 29.263 1.00 36.15  ? 551  LEU A CD2   1 
ATOM   5022 N  N     . LYS C 3  546 ? 79.461 188.351 33.206 1.00 35.99  ? 552  LYS A N     1 
ATOM   5023 C  CA    . LYS C 3  546 ? 78.774 189.411 33.933 1.00 35.75  ? 552  LYS A CA    1 
ATOM   5024 C  C     . LYS C 3  546 ? 79.645 190.652 34.097 1.00 35.53  ? 552  LYS A C     1 
ATOM   5025 O  O     . LYS C 3  546 ? 79.185 191.777 33.893 1.00 34.50  ? 552  LYS A O     1 
ATOM   5026 C  CB    . LYS C 3  546 ? 78.317 188.920 35.311 1.00 36.93  ? 552  LYS A CB    1 
ATOM   5027 C  CG    . LYS C 3  546 ? 77.426 187.683 35.269 1.00 38.46  ? 552  LYS A CG    1 
ATOM   5028 C  CD    . LYS C 3  546 ? 76.360 187.701 36.361 1.00 39.14  ? 552  LYS A CD    1 
ATOM   5029 C  CE    . LYS C 3  546 ? 76.942 187.978 37.743 1.00 39.61  ? 552  LYS A CE    1 
ATOM   5030 N  NZ    . LYS C 3  546 ? 75.914 187.825 38.817 1.00 38.78  ? 552  LYS A NZ    1 
ATOM   5031 N  N     . LYS C 3  547 ? 80.906 190.452 34.463 1.00 35.82  ? 553  LYS A N     1 
ATOM   5032 C  CA    . LYS C 3  547 ? 81.808 191.577 34.644 1.00 36.14  ? 553  LYS A CA    1 
ATOM   5033 C  C     . LYS C 3  547 ? 82.160 192.225 33.307 1.00 33.90  ? 553  LYS A C     1 
ATOM   5034 O  O     . LYS C 3  547 ? 82.365 193.433 33.237 1.00 32.51  ? 553  LYS A O     1 
ATOM   5035 C  CB    . LYS C 3  547 ? 83.084 191.133 35.366 1.00 39.40  ? 553  LYS A CB    1 
ATOM   5036 C  CG    . LYS C 3  547 ? 83.977 190.197 34.568 1.00 44.17  ? 553  LYS A CG    1 
ATOM   5037 C  CD    . LYS C 3  547 ? 85.288 189.894 35.306 1.00 47.09  ? 553  LYS A CD    1 
ATOM   5038 C  CE    . LYS C 3  547 ? 86.167 191.135 35.476 1.00 48.00  ? 553  LYS A CE    1 
ATOM   5039 N  NZ    . LYS C 3  547 ? 85.568 192.185 36.349 1.00 49.36  ? 553  LYS A NZ    1 
ATOM   5040 N  N     . LYS C 3  548 ? 82.219 191.422 32.250 1.00 31.88  ? 554  LYS A N     1 
ATOM   5041 C  CA    . LYS C 3  548 ? 82.545 191.939 30.927 1.00 32.77  ? 554  LYS A CA    1 
ATOM   5042 C  C     . LYS C 3  548 ? 81.446 192.857 30.379 1.00 32.20  ? 554  LYS A C     1 
ATOM   5043 O  O     . LYS C 3  548 ? 81.734 193.865 29.728 1.00 33.02  ? 554  LYS A O     1 
ATOM   5044 C  CB    . LYS C 3  548 ? 82.777 190.797 29.929 1.00 33.12  ? 554  LYS A CB    1 
ATOM   5045 C  CG    . LYS C 3  548 ? 83.337 191.304 28.606 1.00 36.02  ? 554  LYS A CG    1 
ATOM   5046 C  CD    . LYS C 3  548 ? 83.218 190.320 27.442 1.00 36.20  ? 554  LYS A CD    1 
ATOM   5047 C  CE    . LYS C 3  548 ? 83.799 190.959 26.176 1.00 37.73  ? 554  LYS A CE    1 
ATOM   5048 N  NZ    . LYS C 3  548 ? 83.629 190.145 24.941 1.00 39.46  ? 554  LYS A NZ    1 
ATOM   5049 N  N     . PHE C 3  549 ? 80.189 192.504 30.624 1.00 30.52  ? 555  PHE A N     1 
ATOM   5050 C  CA    . PHE C 3  549 ? 79.088 193.323 30.139 1.00 30.06  ? 555  PHE A CA    1 
ATOM   5051 C  C     . PHE C 3  549 ? 78.781 194.481 31.086 1.00 31.28  ? 555  PHE A C     1 
ATOM   5052 O  O     . PHE C 3  549 ? 78.290 195.525 30.658 1.00 29.72  ? 555  PHE A O     1 
ATOM   5053 C  CB    . PHE C 3  549 ? 77.842 192.460 29.899 1.00 26.90  ? 555  PHE A CB    1 
ATOM   5054 C  CG    . PHE C 3  549 ? 77.896 191.675 28.612 1.00 26.51  ? 555  PHE A CG    1 
ATOM   5055 C  CD1   . PHE C 3  549 ? 78.694 190.539 28.500 1.00 26.14  ? 555  PHE A CD1   1 
ATOM   5056 C  CD2   . PHE C 3  549 ? 77.192 192.107 27.489 1.00 25.48  ? 555  PHE A CD2   1 
ATOM   5057 C  CE1   . PHE C 3  549 ? 78.793 189.849 27.289 1.00 26.66  ? 555  PHE A CE1   1 
ATOM   5058 C  CE2   . PHE C 3  549 ? 77.283 191.425 26.272 1.00 24.79  ? 555  PHE A CE2   1 
ATOM   5059 C  CZ    . PHE C 3  549 ? 78.086 190.294 26.171 1.00 25.24  ? 555  PHE A CZ    1 
ATOM   5060 N  N     . LEU C 3  550 ? 79.086 194.304 32.367 1.00 33.33  ? 556  LEU A N     1 
ATOM   5061 C  CA    . LEU C 3  550 ? 78.853 195.360 33.338 1.00 36.28  ? 556  LEU A CA    1 
ATOM   5062 C  C     . LEU C 3  550 ? 79.947 196.412 33.188 1.00 37.82  ? 556  LEU A C     1 
ATOM   5063 O  O     . LEU C 3  550 ? 79.723 197.600 33.420 1.00 38.57  ? 556  LEU A O     1 
ATOM   5064 C  CB    . LEU C 3  550 ? 78.871 194.793 34.750 1.00 36.45  ? 556  LEU A CB    1 
ATOM   5065 C  CG    . LEU C 3  550 ? 78.506 195.806 35.831 1.00 38.04  ? 556  LEU A CG    1 
ATOM   5066 C  CD1   . LEU C 3  550 ? 77.122 196.381 35.554 1.00 39.10  ? 556  LEU A CD1   1 
ATOM   5067 C  CD2   . LEU C 3  550 ? 78.540 195.125 37.185 1.00 38.69  ? 556  LEU A CD2   1 
ATOM   5068 N  N     . GLU C 3  551 ? 81.132 195.955 32.793 1.00 39.68  ? 557  GLU A N     1 
ATOM   5069 C  CA    . GLU C 3  551 ? 82.289 196.823 32.585 1.00 40.54  ? 557  GLU A CA    1 
ATOM   5070 C  C     . GLU C 3  551 ? 81.969 197.703 31.387 1.00 38.96  ? 557  GLU A C     1 
ATOM   5071 O  O     . GLU C 3  551 ? 82.123 198.921 31.428 1.00 39.09  ? 557  GLU A O     1 
ATOM   5072 C  CB    . GLU C 3  551 ? 83.527 195.980 32.259 1.00 44.65  ? 557  GLU A CB    1 
ATOM   5073 C  CG    . GLU C 3  551 ? 84.833 196.422 32.915 1.00 49.39  ? 557  GLU A CG    1 
ATOM   5074 C  CD    . GLU C 3  551 ? 84.964 195.928 34.349 1.00 52.52  ? 557  GLU A CD    1 
ATOM   5075 O  OE1   . GLU C 3  551 ? 84.197 196.401 35.218 1.00 55.65  ? 557  GLU A OE1   1 
ATOM   5076 O  OE2   . GLU C 3  551 ? 85.828 195.059 34.607 1.00 52.35  ? 557  GLU A OE2   1 
ATOM   5077 N  N     . ASN C 3  552 ? 81.518 197.058 30.319 1.00 37.21  ? 558  ASN A N     1 
ATOM   5078 C  CA    . ASN C 3  552 ? 81.170 197.740 29.083 1.00 36.91  ? 558  ASN A CA    1 
ATOM   5079 C  C     . ASN C 3  552 ? 80.209 198.913 29.331 1.00 36.46  ? 558  ASN A C     1 
ATOM   5080 O  O     . ASN C 3  552 ? 80.418 200.011 28.811 1.00 36.22  ? 558  ASN A O     1 
ATOM   5081 C  CB    . ASN C 3  552 ? 80.570 196.723 28.108 1.00 38.12  ? 558  ASN A CB    1 
ATOM   5082 C  CG    . ASN C 3  552 ? 80.259 197.318 26.750 1.00 40.23  ? 558  ASN A CG    1 
ATOM   5083 O  OD1   . ASN C 3  552 ? 81.040 198.101 26.203 1.00 40.03  ? 558  ASN A OD1   1 
ATOM   5084 N  ND2   . ASN C 3  552 ? 79.118 196.931 26.186 1.00 41.20  ? 558  ASN A ND2   1 
ATOM   5085 N  N     . THR C 3  553 ? 79.165 198.689 30.127 1.00 34.52  ? 559  THR A N     1 
ATOM   5086 C  CA    . THR C 3  553 ? 78.220 199.760 30.438 1.00 33.97  ? 559  THR A CA    1 
ATOM   5087 C  C     . THR C 3  553 ? 77.921 199.823 31.938 1.00 32.70  ? 559  THR A C     1 
ATOM   5088 O  O     . THR C 3  553 ? 76.919 199.287 32.409 1.00 32.87  ? 559  THR A O     1 
ATOM   5089 C  CB    . THR C 3  553 ? 76.890 199.609 29.646 1.00 33.61  ? 559  THR A CB    1 
ATOM   5090 O  OG1   . THR C 3  553 ? 76.268 198.360 29.960 1.00 35.98  ? 559  THR A OG1   1 
ATOM   5091 C  CG2   . THR C 3  553 ? 77.156 199.671 28.157 1.00 33.95  ? 559  THR A CG2   1 
ATOM   5092 N  N     . PRO C 3  554 ? 78.794 200.497 32.707 1.00 31.99  ? 560  PRO A N     1 
ATOM   5093 C  CA    . PRO C 3  554 ? 78.659 200.651 34.159 1.00 30.10  ? 560  PRO A CA    1 
ATOM   5094 C  C     . PRO C 3  554 ? 77.415 201.421 34.609 1.00 29.29  ? 560  PRO A C     1 
ATOM   5095 O  O     . PRO C 3  554 ? 77.049 201.392 35.789 1.00 29.54  ? 560  PRO A O     1 
ATOM   5096 C  CB    . PRO C 3  554 ? 79.956 201.357 34.549 1.00 30.74  ? 560  PRO A CB    1 
ATOM   5097 C  CG    . PRO C 3  554 ? 80.251 202.195 33.347 1.00 31.41  ? 560  PRO A CG    1 
ATOM   5098 C  CD    . PRO C 3  554 ? 79.971 201.234 32.212 1.00 32.18  ? 560  PRO A CD    1 
ATOM   5099 N  N     . ALA C 3  555 ? 76.767 202.109 33.676 1.00 26.09  ? 561  ALA A N     1 
ATOM   5100 C  CA    . ALA C 3  555 ? 75.563 202.865 34.004 1.00 23.31  ? 561  ALA A CA    1 
ATOM   5101 C  C     . ALA C 3  555 ? 74.467 201.934 34.529 1.00 21.77  ? 561  ALA A C     1 
ATOM   5102 O  O     . ALA C 3  555 ? 73.538 202.384 35.203 1.00 20.62  ? 561  ALA A O     1 
ATOM   5103 C  CB    . ALA C 3  555 ? 75.066 203.616 32.781 1.00 24.81  ? 561  ALA A CB    1 
ATOM   5104 N  N     . ILE C 3  556 ? 74.565 200.644 34.213 1.00 16.98  ? 562  ILE A N     1 
ATOM   5105 C  CA    . ILE C 3  556 ? 73.566 199.702 34.697 1.00 17.18  ? 562  ILE A CA    1 
ATOM   5106 C  C     . ILE C 3  556 ? 73.592 199.735 36.223 1.00 17.39  ? 562  ILE A C     1 
ATOM   5107 O  O     . ILE C 3  556 ? 72.546 199.716 36.877 1.00 18.27  ? 562  ILE A O     1 
ATOM   5108 C  CB    . ILE C 3  556 ? 73.845 198.244 34.226 1.00 16.62  ? 562  ILE A CB    1 
ATOM   5109 C  CG1   . ILE C 3  556 ? 73.754 198.146 32.698 1.00 17.44  ? 562  ILE A CG1   1 
ATOM   5110 C  CG2   . ILE C 3  556 ? 72.845 197.296 34.868 1.00 12.93  ? 562  ILE A CG2   1 
ATOM   5111 C  CD1   . ILE C 3  556 ? 74.054 196.743 32.141 1.00 17.09  ? 562  ILE A CD1   1 
ATOM   5112 N  N     . ALA C 3  557 ? 74.793 199.791 36.789 1.00 17.72  ? 563  ALA A N     1 
ATOM   5113 C  CA    . ALA C 3  557 ? 74.934 199.838 38.240 1.00 18.96  ? 563  ALA A CA    1 
ATOM   5114 C  C     . ALA C 3  557 ? 74.273 201.106 38.765 1.00 18.88  ? 563  ALA A C     1 
ATOM   5115 O  O     . ALA C 3  557 ? 73.551 201.077 39.767 1.00 19.57  ? 563  ALA A O     1 
ATOM   5116 C  CB    . ALA C 3  557 ? 76.409 199.813 38.633 1.00 16.33  ? 563  ALA A CB    1 
ATOM   5117 N  N     . ALA C 3  558 ? 74.521 202.213 38.072 1.00 18.36  ? 564  ALA A N     1 
ATOM   5118 C  CA    . ALA C 3  558 ? 73.961 203.510 38.447 1.00 19.74  ? 564  ALA A CA    1 
ATOM   5119 C  C     . ALA C 3  558 ? 72.433 203.476 38.478 1.00 19.48  ? 564  ALA A C     1 
ATOM   5120 O  O     . ALA C 3  558 ? 71.809 203.957 39.429 1.00 18.50  ? 564  ALA A O     1 
ATOM   5121 C  CB    . ALA C 3  558 ? 74.442 204.585 37.472 1.00 20.27  ? 564  ALA A CB    1 
ATOM   5122 N  N     . LEU C 3  559 ? 71.835 202.904 37.437 1.00 18.72  ? 565  LEU A N     1 
ATOM   5123 C  CA    . LEU C 3  559 ? 70.385 202.817 37.359 1.00 18.50  ? 565  LEU A CA    1 
ATOM   5124 C  C     . LEU C 3  559 ? 69.871 201.957 38.502 1.00 19.93  ? 565  LEU A C     1 
ATOM   5125 O  O     . LEU C 3  559 ? 68.897 202.317 39.161 1.00 20.60  ? 565  LEU A O     1 
ATOM   5126 C  CB    . LEU C 3  559 ? 69.961 202.223 36.018 1.00 16.28  ? 565  LEU A CB    1 
ATOM   5127 C  CG    . LEU C 3  559 ? 68.470 202.231 35.676 1.00 15.72  ? 565  LEU A CG    1 
ATOM   5128 C  CD1   . LEU C 3  559 ? 67.878 203.621 35.895 1.00 8.02   ? 565  LEU A CD1   1 
ATOM   5129 C  CD2   . LEU C 3  559 ? 68.300 201.796 34.209 1.00 12.20  ? 565  LEU A CD2   1 
ATOM   5130 N  N     . ARG C 3  560 ? 70.545 200.836 38.750 1.00 20.64  ? 566  ARG A N     1 
ATOM   5131 C  CA    . ARG C 3  560 ? 70.153 199.923 39.825 1.00 22.40  ? 566  ARG A CA    1 
ATOM   5132 C  C     . ARG C 3  560 ? 70.200 200.593 41.197 1.00 22.17  ? 566  ARG A C     1 
ATOM   5133 O  O     . ARG C 3  560 ? 69.362 200.333 42.057 1.00 21.71  ? 566  ARG A O     1 
ATOM   5134 C  CB    . ARG C 3  560 ? 71.061 198.687 39.838 1.00 23.52  ? 566  ARG A CB    1 
ATOM   5135 C  CG    . ARG C 3  560 ? 70.792 197.670 38.747 1.00 23.59  ? 566  ARG A CG    1 
ATOM   5136 C  CD    . ARG C 3  560 ? 71.875 196.595 38.758 1.00 25.50  ? 566  ARG A CD    1 
ATOM   5137 N  NE    . ARG C 3  560 ? 71.588 195.492 37.846 1.00 24.72  ? 566  ARG A NE    1 
ATOM   5138 C  CZ    . ARG C 3  560 ? 72.494 194.607 37.438 1.00 24.31  ? 566  ARG A CZ    1 
ATOM   5139 N  NH1   . ARG C 3  560 ? 73.750 194.700 37.857 1.00 23.59  ? 566  ARG A NH1   1 
ATOM   5140 N  NH2   . ARG C 3  560 ? 72.144 193.624 36.618 1.00 22.79  ? 566  ARG A NH2   1 
ATOM   5141 N  N     . GLU C 3  561 ? 71.190 201.450 41.401 1.00 23.75  ? 567  GLU A N     1 
ATOM   5142 C  CA    . GLU C 3  561 ? 71.322 202.151 42.667 1.00 26.59  ? 567  GLU A CA    1 
ATOM   5143 C  C     . GLU C 3  561 ? 70.215 203.181 42.865 1.00 25.75  ? 567  GLU A C     1 
ATOM   5144 O  O     . GLU C 3  561 ? 69.596 203.232 43.923 1.00 26.55  ? 567  GLU A O     1 
ATOM   5145 C  CB    . GLU C 3  561 ? 72.676 202.853 42.748 1.00 32.03  ? 567  GLU A CB    1 
ATOM   5146 C  CG    . GLU C 3  561 ? 73.860 201.942 42.986 1.00 39.91  ? 567  GLU A CG    1 
ATOM   5147 C  CD    . GLU C 3  561 ? 75.181 202.685 42.859 1.00 45.95  ? 567  GLU A CD    1 
ATOM   5148 O  OE1   . GLU C 3  561 ? 75.308 203.789 43.446 1.00 47.66  ? 567  GLU A OE1   1 
ATOM   5149 O  OE2   . GLU C 3  561 ? 76.090 202.162 42.175 1.00 48.69  ? 567  GLU A OE2   1 
ATOM   5150 N  N     . SER C 3  562 ? 69.964 204.010 41.859 1.00 25.24  ? 568  SER A N     1 
ATOM   5151 C  CA    . SER C 3  562 ? 68.928 205.019 42.009 1.00 25.74  ? 568  SER A CA    1 
ATOM   5152 C  C     . SER C 3  562 ? 67.575 204.380 42.291 1.00 25.48  ? 568  SER A C     1 
ATOM   5153 O  O     . SER C 3  562 ? 66.807 204.888 43.106 1.00 26.28  ? 568  SER A O     1 
ATOM   5154 C  CB    . SER C 3  562 ? 68.850 205.914 40.770 1.00 25.89  ? 568  SER A CB    1 
ATOM   5155 O  OG    . SER C 3  562 ? 68.666 205.155 39.591 1.00 33.17  ? 568  SER A OG    1 
ATOM   5156 N  N     . ILE C 3  563 ? 67.279 203.264 41.631 1.00 25.16  ? 569  ILE A N     1 
ATOM   5157 C  CA    . ILE C 3  563 ? 66.007 202.594 41.866 1.00 24.34  ? 569  ILE A CA    1 
ATOM   5158 C  C     . ILE C 3  563 ? 65.966 202.175 43.336 1.00 25.33  ? 569  ILE A C     1 
ATOM   5159 O  O     . ILE C 3  563 ? 64.991 202.444 44.038 1.00 23.80  ? 569  ILE A O     1 
ATOM   5160 C  CB    . ILE C 3  563 ? 65.841 201.359 40.955 1.00 24.42  ? 569  ILE A CB    1 
ATOM   5161 C  CG1   . ILE C 3  563 ? 65.851 201.797 39.492 1.00 24.97  ? 569  ILE A CG1   1 
ATOM   5162 C  CG2   . ILE C 3  563 ? 64.524 200.657 41.245 1.00 21.50  ? 569  ILE A CG2   1 
ATOM   5163 C  CD1   . ILE C 3  563 ? 65.794 200.642 38.503 1.00 26.06  ? 569  ILE A CD1   1 
ATOM   5164 N  N     . GLN C 3  564 ? 67.033 201.528 43.797 1.00 26.06  ? 570  GLN A N     1 
ATOM   5165 C  CA    . GLN C 3  564 ? 67.127 201.100 45.192 1.00 29.92  ? 570  GLN A CA    1 
ATOM   5166 C  C     . GLN C 3  564 ? 66.912 202.289 46.125 1.00 30.94  ? 570  GLN A C     1 
ATOM   5167 O  O     . GLN C 3  564 ? 66.026 202.271 46.979 1.00 30.51  ? 570  GLN A O     1 
ATOM   5168 C  CB    . GLN C 3  564 ? 68.505 200.494 45.472 1.00 30.93  ? 570  GLN A CB    1 
ATOM   5169 C  CG    . GLN C 3  564 ? 68.575 198.978 45.374 1.00 33.95  ? 570  GLN A CG    1 
ATOM   5170 C  CD    . GLN C 3  564 ? 67.935 198.278 46.563 1.00 33.93  ? 570  GLN A CD    1 
ATOM   5171 O  OE1   . GLN C 3  564 ? 68.288 198.530 47.716 1.00 33.67  ? 570  GLN A OE1   1 
ATOM   5172 N  NE2   . GLN C 3  564 ? 66.995 197.385 46.284 1.00 34.39  ? 570  GLN A NE2   1 
ATOM   5173 N  N     . GLN C 3  565 ? 67.741 203.315 45.952 1.00 32.29  ? 571  GLN A N     1 
ATOM   5174 C  CA    . GLN C 3  565 ? 67.670 204.525 46.764 1.00 34.03  ? 571  GLN A CA    1 
ATOM   5175 C  C     . GLN C 3  565 ? 66.244 205.069 46.833 1.00 33.32  ? 571  GLN A C     1 
ATOM   5176 O  O     . GLN C 3  565 ? 65.792 205.522 47.884 1.00 33.37  ? 571  GLN A O     1 
ATOM   5177 C  CB    . GLN C 3  565 ? 68.611 205.594 46.187 1.00 35.73  ? 571  GLN A CB    1 
ATOM   5178 C  CG    . GLN C 3  565 ? 68.432 207.008 46.763 1.00 41.20  ? 571  GLN A CG    1 
ATOM   5179 C  CD    . GLN C 3  565 ? 68.872 207.140 48.220 1.00 44.43  ? 571  GLN A CD    1 
ATOM   5180 O  OE1   . GLN C 3  565 ? 68.763 208.216 48.820 1.00 44.18  ? 571  GLN A OE1   1 
ATOM   5181 N  NE2   . GLN C 3  565 ? 69.376 206.048 48.792 1.00 45.31  ? 571  GLN A NE2   1 
ATOM   5182 N  N     . THR C 3  566 ? 65.537 205.005 45.712 1.00 31.69  ? 572  THR A N     1 
ATOM   5183 C  CA    . THR C 3  566 ? 64.176 205.508 45.635 1.00 31.34  ? 572  THR A CA    1 
ATOM   5184 C  C     . THR C 3  566 ? 63.141 204.643 46.338 1.00 31.69  ? 572  THR A C     1 
ATOM   5185 O  O     . THR C 3  566 ? 62.238 205.160 46.999 1.00 32.03  ? 572  THR A O     1 
ATOM   5186 C  CB    . THR C 3  566 ? 63.737 205.662 44.172 1.00 31.71  ? 572  THR A CB    1 
ATOM   5187 O  OG1   . THR C 3  566 ? 64.591 206.607 43.517 1.00 33.49  ? 572  THR A OG1   1 
ATOM   5188 C  CG2   . THR C 3  566 ? 62.286 206.133 44.092 1.00 31.79  ? 572  THR A CG2   1 
ATOM   5189 N  N     . LEU C 3  567 ? 63.275 203.329 46.197 1.00 30.79  ? 573  LEU A N     1 
ATOM   5190 C  CA    . LEU C 3  567 ? 62.319 202.399 46.778 1.00 30.47  ? 573  LEU A CA    1 
ATOM   5191 C  C     . LEU C 3  567 ? 62.600 201.913 48.185 1.00 30.26  ? 573  LEU A C     1 
ATOM   5192 O  O     . LEU C 3  567 ? 61.723 201.948 49.036 1.00 30.95  ? 573  LEU A O     1 
ATOM   5193 C  CB    . LEU C 3  567 ? 62.173 201.176 45.866 1.00 29.48  ? 573  LEU A CB    1 
ATOM   5194 C  CG    . LEU C 3  567 ? 61.706 201.429 44.431 1.00 30.52  ? 573  LEU A CG    1 
ATOM   5195 C  CD1   . LEU C 3  567 ? 61.648 200.114 43.650 1.00 30.26  ? 573  LEU A CD1   1 
ATOM   5196 C  CD2   . LEU C 3  567 ? 60.341 202.098 44.466 1.00 29.44  ? 573  LEU A CD2   1 
ATOM   5197 N  N     . VAL C 3  568 ? 63.823 201.462 48.427 1.00 31.89  ? 574  VAL A N     1 
ATOM   5198 C  CA    . VAL C 3  568 ? 64.190 200.904 49.720 1.00 33.08  ? 574  VAL A CA    1 
ATOM   5199 C  C     . VAL C 3  568 ? 64.771 201.857 50.761 1.00 36.89  ? 574  VAL A C     1 
ATOM   5200 O  O     . VAL C 3  568 ? 65.539 202.765 50.439 1.00 36.82  ? 574  VAL A O     1 
ATOM   5201 C  CB    . VAL C 3  568 ? 65.185 199.743 49.520 1.00 32.17  ? 574  VAL A CB    1 
ATOM   5202 C  CG1   . VAL C 3  568 ? 65.470 199.055 50.844 1.00 29.82  ? 574  VAL A CG1   1 
ATOM   5203 C  CG2   . VAL C 3  568 ? 64.627 198.762 48.507 1.00 29.97  ? 574  VAL A CG2   1 
ATOM   5204 N  N     . GLU C 3  569 ? 64.390 201.633 52.017 1.00 40.62  ? 575  GLU A N     1 
ATOM   5205 C  CA    . GLU C 3  569 ? 64.894 202.423 53.135 1.00 44.75  ? 575  GLU A CA    1 
ATOM   5206 C  C     . GLU C 3  569 ? 65.905 201.538 53.867 1.00 45.62  ? 575  GLU A C     1 
ATOM   5207 O  O     . GLU C 3  569 ? 66.972 202.000 54.272 1.00 45.00  ? 575  GLU A O     1 
ATOM   5208 C  CB    . GLU C 3  569 ? 63.766 202.811 54.091 1.00 47.06  ? 575  GLU A CB    1 
ATOM   5209 C  CG    . GLU C 3  569 ? 64.203 203.805 55.157 1.00 52.03  ? 575  GLU A CG    1 
ATOM   5210 C  CD    . GLU C 3  569 ? 64.523 205.178 54.581 1.00 56.00  ? 575  GLU A CD    1 
ATOM   5211 O  OE1   . GLU C 3  569 ? 63.577 205.878 54.148 1.00 58.02  ? 575  GLU A OE1   1 
ATOM   5212 O  OE2   . GLU C 3  569 ? 65.717 205.558 54.557 1.00 57.19  ? 575  GLU A OE2   1 
ATOM   5213 N  N     . SER C 3  570 ? 65.549 200.263 54.018 1.00 46.27  ? 576  SER A N     1 
ATOM   5214 C  CA    . SER C 3  570 ? 66.398 199.268 54.667 1.00 49.51  ? 576  SER A CA    1 
ATOM   5215 C  C     . SER C 3  570 ? 65.778 197.885 54.479 1.00 51.26  ? 576  SER A C     1 
ATOM   5216 O  O     . SER C 3  570 ? 64.566 197.761 54.309 1.00 51.06  ? 576  SER A O     1 
ATOM   5217 C  CB    . SER C 3  570 ? 66.537 199.560 56.164 1.00 50.32  ? 576  SER A CB    1 
ATOM   5218 O  OG    . SER C 3  570 ? 65.344 199.240 56.862 1.00 51.34  ? 576  SER A OG    1 
ATOM   5219 N  N     . SER C 3  571 ? 66.609 196.848 54.514 1.00 53.87  ? 577  SER A N     1 
ATOM   5220 C  CA    . SER C 3  571 ? 66.124 195.482 54.343 1.00 56.96  ? 577  SER A CA    1 
ATOM   5221 C  C     . SER C 3  571 ? 67.019 194.472 55.053 1.00 59.79  ? 577  SER A C     1 
ATOM   5222 O  O     . SER C 3  571 ? 68.160 194.777 55.404 1.00 60.45  ? 577  SER A O     1 
ATOM   5223 C  CB    . SER C 3  571 ? 66.063 195.131 52.859 1.00 56.85  ? 577  SER A CB    1 
ATOM   5224 O  OG    . SER C 3  571 ? 67.353 195.200 52.279 1.00 57.40  ? 577  SER A OG    1 
ATOM   5225 N  N     . GLN C 3  572 ? 66.493 193.267 55.254 1.00 62.72  ? 578  GLN A N     1 
ATOM   5226 C  CA    . GLN C 3  572 ? 67.240 192.203 55.914 1.00 64.94  ? 578  GLN A CA    1 
ATOM   5227 C  C     . GLN C 3  572 ? 66.516 190.862 55.822 1.00 67.12  ? 578  GLN A C     1 
ATOM   5228 O  O     . GLN C 3  572 ? 65.284 190.804 55.785 1.00 66.43  ? 578  GLN A O     1 
ATOM   5229 C  CB    . GLN C 3  572 ? 67.481 192.559 57.385 1.00 64.99  ? 578  GLN A CB    1 
ATOM   5230 N  N     . TRP C 3  573 ? 67.300 189.788 55.774 1.00 69.54  ? 579  TRP A N     1 
ATOM   5231 C  CA    . TRP C 3  573 ? 66.776 188.429 55.696 1.00 71.23  ? 579  TRP A CA    1 
ATOM   5232 C  C     . TRP C 3  573 ? 66.515 187.897 57.104 1.00 72.44  ? 579  TRP A C     1 
ATOM   5233 O  O     . TRP C 3  573 ? 67.342 188.069 57.999 1.00 72.15  ? 579  TRP A O     1 
ATOM   5234 C  CB    . TRP C 3  573 ? 67.787 187.513 54.993 1.00 71.64  ? 579  TRP A CB    1 
ATOM   5235 C  CG    . TRP C 3  573 ? 67.854 187.670 53.495 1.00 72.27  ? 579  TRP A CG    1 
ATOM   5236 C  CD1   . TRP C 3  573 ? 67.050 187.064 52.568 1.00 72.91  ? 579  TRP A CD1   1 
ATOM   5237 C  CD2   . TRP C 3  573 ? 68.776 188.481 52.754 1.00 72.51  ? 579  TRP A CD2   1 
ATOM   5238 N  NE1   . TRP C 3  573 ? 67.416 187.445 51.297 1.00 72.30  ? 579  TRP A NE1   1 
ATOM   5239 C  CE2   . TRP C 3  573 ? 68.471 188.315 51.382 1.00 72.44  ? 579  TRP A CE2   1 
ATOM   5240 C  CE3   . TRP C 3  573 ? 69.829 189.334 53.114 1.00 72.32  ? 579  TRP A CE3   1 
ATOM   5241 C  CZ2   . TRP C 3  573 ? 69.184 188.970 50.369 1.00 72.48  ? 579  TRP A CZ2   1 
ATOM   5242 C  CZ3   . TRP C 3  573 ? 70.539 189.986 52.104 1.00 72.43  ? 579  TRP A CZ3   1 
ATOM   5243 C  CH2   . TRP C 3  573 ? 70.211 189.799 50.749 1.00 71.69  ? 579  TRP A CH2   1 
ATOM   5244 N  N     . VAL C 3  574 ? 65.362 187.260 57.296 1.00 74.33  ? 580  VAL A N     1 
ATOM   5245 C  CA    . VAL C 3  574 ? 65.008 186.687 58.592 1.00 76.23  ? 580  VAL A CA    1 
ATOM   5246 C  C     . VAL C 3  574 ? 65.411 185.216 58.609 1.00 77.13  ? 580  VAL A C     1 
ATOM   5247 O  O     . VAL C 3  574 ? 66.256 184.792 59.401 1.00 77.35  ? 580  VAL A O     1 
ATOM   5248 C  CB    . VAL C 3  574 ? 63.489 186.790 58.861 1.00 76.79  ? 580  VAL A CB    1 
ATOM   5249 C  CG1   . VAL C 3  574 ? 63.099 185.912 60.048 1.00 77.13  ? 580  VAL A CG1   1 
ATOM   5250 C  CG2   . VAL C 3  574 ? 63.117 188.231 59.147 1.00 77.85  ? 580  VAL A CG2   1 
ATOM   5251 N  N     . ALA C 3  575 ? 64.796 184.444 57.724 1.00 77.48  ? 581  ALA A N     1 
ATOM   5252 C  CA    . ALA C 3  575 ? 65.085 183.023 57.616 1.00 77.72  ? 581  ALA A CA    1 
ATOM   5253 C  C     . ALA C 3  575 ? 65.133 182.664 56.137 1.00 77.51  ? 581  ALA A C     1 
ATOM   5254 O  O     . ALA C 3  575 ? 66.204 182.642 55.527 1.00 77.33  ? 581  ALA A O     1 
ATOM   5255 C  CB    . ALA C 3  575 ? 64.007 182.215 58.327 1.00 77.63  ? 581  ALA A CB    1 
ATOM   5256 N  N     . GLY C 3  576 ? 63.965 182.394 55.565 1.00 77.17  ? 582  GLY A N     1 
ATOM   5257 C  CA    . GLY C 3  576 ? 63.889 182.051 54.159 1.00 75.74  ? 582  GLY A CA    1 
ATOM   5258 C  C     . GLY C 3  576 ? 63.281 183.191 53.367 1.00 74.99  ? 582  GLY A C     1 
ATOM   5259 O  O     . GLY C 3  576 ? 62.595 182.971 52.368 1.00 75.41  ? 582  GLY A O     1 
ATOM   5260 N  N     . GLU C 3  577 ? 63.531 184.415 53.821 1.00 73.49  ? 583  GLU A N     1 
ATOM   5261 C  CA    . GLU C 3  577 ? 63.003 185.599 53.155 1.00 71.73  ? 583  GLU A CA    1 
ATOM   5262 C  C     . GLU C 3  577 ? 63.708 186.878 53.607 1.00 69.90  ? 583  GLU A C     1 
ATOM   5263 O  O     . GLU C 3  577 ? 64.352 186.913 54.658 1.00 69.39  ? 583  GLU A O     1 
ATOM   5264 C  CB    . GLU C 3  577 ? 61.497 185.719 53.419 1.00 71.89  ? 583  GLU A CB    1 
ATOM   5265 N  N     . GLN C 3  578 ? 63.576 187.926 52.799 1.00 67.28  ? 584  GLN A N     1 
ATOM   5266 C  CA    . GLN C 3  578 ? 64.182 189.222 53.087 1.00 63.93  ? 584  GLN A CA    1 
ATOM   5267 C  C     . GLN C 3  578 ? 63.092 190.243 53.412 1.00 60.64  ? 584  GLN A C     1 
ATOM   5268 O  O     . GLN C 3  578 ? 62.346 190.663 52.528 1.00 60.56  ? 584  GLN A O     1 
ATOM   5269 C  CB    . GLN C 3  578 ? 64.989 189.689 51.871 1.00 64.47  ? 584  GLN A CB    1 
ATOM   5270 C  CG    . GLN C 3  578 ? 65.520 191.108 51.962 1.00 65.80  ? 584  GLN A CG    1 
ATOM   5271 C  CD    . GLN C 3  578 ? 66.215 191.543 50.685 1.00 66.64  ? 584  GLN A CD    1 
ATOM   5272 O  OE1   . GLN C 3  578 ? 65.674 191.388 49.591 1.00 66.95  ? 584  GLN A OE1   1 
ATOM   5273 N  NE2   . GLN C 3  578 ? 67.415 192.095 50.818 1.00 66.43  ? 584  GLN A NE2   1 
ATOM   5274 N  N     . GLN C 3  579 ? 62.991 190.630 54.681 1.00 56.80  ? 585  GLN A N     1 
ATOM   5275 C  CA    . GLN C 3  579 ? 61.986 191.611 55.091 1.00 52.48  ? 585  GLN A CA    1 
ATOM   5276 C  C     . GLN C 3  579 ? 62.503 192.998 54.709 1.00 48.75  ? 585  GLN A C     1 
ATOM   5277 O  O     . GLN C 3  579 ? 63.613 193.379 55.085 1.00 47.26  ? 585  GLN A O     1 
ATOM   5278 C  CB    . GLN C 3  579 ? 61.743 191.546 56.605 1.00 52.75  ? 585  GLN A CB    1 
ATOM   5279 C  CG    . GLN C 3  579 ? 61.500 190.149 57.172 1.00 52.51  ? 585  GLN A CG    1 
ATOM   5280 C  CD    . GLN C 3  579 ? 60.306 189.432 56.557 1.00 54.69  ? 585  GLN A CD    1 
ATOM   5281 O  OE1   . GLN C 3  579 ? 59.173 189.929 56.582 1.00 51.66  ? 585  GLN A OE1   1 
ATOM   5282 N  NE2   . GLN C 3  579 ? 60.556 188.243 56.012 1.00 55.23  ? 585  GLN A NE2   1 
ATOM   5283 N  N     . VAL C 3  580 ? 61.691 193.750 53.971 1.00 45.15  ? 586  VAL A N     1 
ATOM   5284 C  CA    . VAL C 3  580 ? 62.079 195.084 53.505 1.00 41.38  ? 586  VAL A CA    1 
ATOM   5285 C  C     . VAL C 3  580 ? 61.239 196.234 54.058 1.00 38.05  ? 586  VAL A C     1 
ATOM   5286 O  O     . VAL C 3  580 ? 60.034 196.094 54.243 1.00 38.43  ? 586  VAL A O     1 
ATOM   5287 C  CB    . VAL C 3  580 ? 62.001 195.159 51.946 1.00 40.96  ? 586  VAL A CB    1 
ATOM   5288 C  CG1   . VAL C 3  580 ? 62.309 196.569 51.466 1.00 39.04  ? 586  VAL A CG1   1 
ATOM   5289 C  CG2   . VAL C 3  580 ? 62.966 194.158 51.319 1.00 40.46  ? 586  VAL A CG2   1 
ATOM   5290 N  N     . LYS C 3  581 ? 61.891 197.364 54.320 1.00 34.37  ? 587  LYS A N     1 
ATOM   5291 C  CA    . LYS C 3  581 ? 61.209 198.575 54.778 1.00 33.27  ? 587  LYS A CA    1 
ATOM   5292 C  C     . LYS C 3  581 ? 61.200 199.507 53.566 1.00 30.97  ? 587  LYS A C     1 
ATOM   5293 O  O     . LYS C 3  581 ? 62.248 199.978 53.131 1.00 30.72  ? 587  LYS A O     1 
ATOM   5294 C  CB    . LYS C 3  581 ? 61.965 199.249 55.924 1.00 35.27  ? 587  LYS A CB    1 
ATOM   5295 C  CG    . LYS C 3  581 ? 61.840 198.558 57.268 1.00 36.90  ? 587  LYS A CG    1 
ATOM   5296 C  CD    . LYS C 3  581 ? 62.429 199.425 58.365 1.00 37.74  ? 587  LYS A CD    1 
ATOM   5297 C  CE    . LYS C 3  581 ? 62.417 198.709 59.699 1.00 39.01  ? 587  LYS A CE    1 
ATOM   5298 N  NZ    . LYS C 3  581 ? 63.155 199.485 60.723 1.00 40.64  ? 587  LYS A NZ    1 
ATOM   5299 N  N     . TRP C 3  582 ? 60.018 199.776 53.026 1.00 28.41  ? 588  TRP A N     1 
ATOM   5300 C  CA    . TRP C 3  582 ? 59.906 200.609 51.833 1.00 26.82  ? 588  TRP A CA    1 
ATOM   5301 C  C     . TRP C 3  582 ? 59.638 202.099 52.019 1.00 25.82  ? 588  TRP A C     1 
ATOM   5302 O  O     . TRP C 3  582 ? 58.971 202.522 52.966 1.00 25.45  ? 588  TRP A O     1 
ATOM   5303 C  CB    . TRP C 3  582 ? 58.806 200.057 50.910 1.00 23.94  ? 588  TRP A CB    1 
ATOM   5304 C  CG    . TRP C 3  582 ? 58.929 198.605 50.587 1.00 21.87  ? 588  TRP A CG    1 
ATOM   5305 C  CD1   . TRP C 3  582 ? 58.597 197.557 51.393 1.00 20.24  ? 588  TRP A CD1   1 
ATOM   5306 C  CD2   . TRP C 3  582 ? 59.452 198.035 49.379 1.00 20.54  ? 588  TRP A CD2   1 
ATOM   5307 N  NE1   . TRP C 3  582 ? 58.881 196.368 50.765 1.00 20.04  ? 588  TRP A NE1   1 
ATOM   5308 C  CE2   . TRP C 3  582 ? 59.410 196.631 49.529 1.00 19.80  ? 588  TRP A CE2   1 
ATOM   5309 C  CE3   . TRP C 3  582 ? 59.956 198.575 48.188 1.00 18.72  ? 588  TRP A CE3   1 
ATOM   5310 C  CZ2   . TRP C 3  582 ? 59.854 195.754 48.531 1.00 19.04  ? 588  TRP A CZ2   1 
ATOM   5311 C  CZ3   . TRP C 3  582 ? 60.398 197.705 47.193 1.00 19.69  ? 588  TRP A CZ3   1 
ATOM   5312 C  CH2   . TRP C 3  582 ? 60.345 196.307 47.374 1.00 19.59  ? 588  TRP A CH2   1 
ATOM   5313 N  N     . LYS C 3  583 ? 60.171 202.885 51.091 1.00 25.02  ? 589  LYS A N     1 
ATOM   5314 C  CA    . LYS C 3  583 ? 59.937 204.317 51.076 1.00 26.51  ? 589  LYS A CA    1 
ATOM   5315 C  C     . LYS C 3  583 ? 58.661 204.414 50.252 1.00 26.91  ? 589  LYS A C     1 
ATOM   5316 O  O     . LYS C 3  583 ? 57.717 205.114 50.608 1.00 27.37  ? 589  LYS A O     1 
ATOM   5317 C  CB    . LYS C 3  583 ? 61.072 205.057 50.362 1.00 27.44  ? 589  LYS A CB    1 
ATOM   5318 C  CG    . LYS C 3  583 ? 62.408 205.010 51.083 1.00 30.62  ? 589  LYS A CG    1 
ATOM   5319 C  CD    . LYS C 3  583 ? 63.439 205.886 50.385 1.00 31.60  ? 589  LYS A CD    1 
ATOM   5320 C  CE    . LYS C 3  583 ? 64.784 205.821 51.097 1.00 34.27  ? 589  LYS A CE    1 
ATOM   5321 N  NZ    . LYS C 3  583 ? 65.802 206.709 50.457 1.00 36.24  ? 589  LYS A NZ    1 
ATOM   5322 N  N     . ARG C 3  584 ? 58.654 203.677 49.146 1.00 28.12  ? 590  ARG A N     1 
ATOM   5323 C  CA    . ARG C 3  584 ? 57.520 203.603 48.231 1.00 28.94  ? 590  ARG A CA    1 
ATOM   5324 C  C     . ARG C 3  584 ? 57.632 202.210 47.617 1.00 29.11  ? 590  ARG A C     1 
ATOM   5325 O  O     . ARG C 3  584 ? 58.726 201.790 47.236 1.00 28.76  ? 590  ARG A O     1 
ATOM   5326 C  CB    . ARG C 3  584 ? 57.638 204.656 47.125 1.00 31.11  ? 590  ARG A CB    1 
ATOM   5327 C  CG    . ARG C 3  584 ? 56.323 204.944 46.384 1.00 35.17  ? 590  ARG A CG    1 
ATOM   5328 C  CD    . ARG C 3  584 ? 56.566 205.531 45.004 1.00 37.45  ? 590  ARG A CD    1 
ATOM   5329 N  NE    . ARG C 3  584 ? 57.622 206.537 45.016 1.00 42.43  ? 590  ARG A NE    1 
ATOM   5330 C  CZ    . ARG C 3  584 ? 58.467 206.747 44.010 1.00 44.98  ? 590  ARG A CZ    1 
ATOM   5331 N  NH1   . ARG C 3  584 ? 58.381 206.019 42.902 1.00 46.69  ? 590  ARG A NH1   1 
ATOM   5332 N  NH2   . ARG C 3  584 ? 59.411 207.674 44.113 1.00 47.10  ? 590  ARG A NH2   1 
ATOM   5333 N  N     . ARG C 3  585 ? 56.523 201.485 47.518 1.00 28.00  ? 591  ARG A N     1 
ATOM   5334 C  CA    . ARG C 3  585 ? 56.598 200.151 46.947 1.00 26.36  ? 591  ARG A CA    1 
ATOM   5335 C  C     . ARG C 3  585 ? 56.026 200.038 45.533 1.00 24.95  ? 591  ARG A C     1 
ATOM   5336 O  O     . ARG C 3  585 ? 55.554 198.978 45.130 1.00 23.99  ? 591  ARG A O     1 
ATOM   5337 C  CB    . ARG C 3  585 ? 55.933 199.128 47.878 1.00 26.19  ? 591  ARG A CB    1 
ATOM   5338 C  CG    . ARG C 3  585 ? 56.296 197.694 47.518 1.00 27.44  ? 591  ARG A CG    1 
ATOM   5339 C  CD    . ARG C 3  585 ? 55.923 196.699 48.596 1.00 29.70  ? 591  ARG A CD    1 
ATOM   5340 N  NE    . ARG C 3  585 ? 56.127 195.335 48.121 1.00 30.28  ? 591  ARG A NE    1 
ATOM   5341 C  CZ    . ARG C 3  585 ? 55.987 194.245 48.867 1.00 32.58  ? 591  ARG A CZ    1 
ATOM   5342 N  NH1   . ARG C 3  585 ? 55.638 194.350 50.144 1.00 34.77  ? 591  ARG A NH1   1 
ATOM   5343 N  NH2   . ARG C 3  585 ? 56.202 193.046 48.335 1.00 32.74  ? 591  ARG A NH2   1 
ATOM   5344 N  N     . TRP C 3  586 ? 56.077 201.136 44.781 1.00 23.97  ? 592  TRP A N     1 
ATOM   5345 C  CA    . TRP C 3  586 ? 55.592 201.139 43.404 1.00 23.45  ? 592  TRP A CA    1 
ATOM   5346 C  C     . TRP C 3  586 ? 56.355 202.120 42.520 1.00 23.90  ? 592  TRP A C     1 
ATOM   5347 O  O     . TRP C 3  586 ? 56.871 203.127 42.992 1.00 21.85  ? 592  TRP A O     1 
ATOM   5348 C  CB    . TRP C 3  586 ? 54.090 201.463 43.337 1.00 21.72  ? 592  TRP A CB    1 
ATOM   5349 C  CG    . TRP C 3  586 ? 53.701 202.750 43.990 1.00 21.42  ? 592  TRP A CG    1 
ATOM   5350 C  CD1   . TRP C 3  586 ? 53.246 202.916 45.262 1.00 20.48  ? 592  TRP A CD1   1 
ATOM   5351 C  CD2   . TRP C 3  586 ? 53.733 204.057 43.403 1.00 20.63  ? 592  TRP A CD2   1 
ATOM   5352 N  NE1   . TRP C 3  586 ? 52.988 204.244 45.505 1.00 19.72  ? 592  TRP A NE1   1 
ATOM   5353 C  CE2   . TRP C 3  586 ? 53.278 204.965 44.380 1.00 19.70  ? 592  TRP A CE2   1 
ATOM   5354 C  CE3   . TRP C 3  586 ? 54.101 204.546 42.145 1.00 21.48  ? 592  TRP A CE3   1 
ATOM   5355 C  CZ2   . TRP C 3  586 ? 53.179 206.336 44.142 1.00 22.96  ? 592  TRP A CZ2   1 
ATOM   5356 C  CZ3   . TRP C 3  586 ? 54.003 205.911 41.904 1.00 24.21  ? 592  TRP A CZ3   1 
ATOM   5357 C  CH2   . TRP C 3  586 ? 53.545 206.793 42.900 1.00 23.30  ? 592  TRP A CH2   1 
ATOM   5358 N  N     . ILE C 3  587 ? 56.416 201.790 41.231 1.00 24.68  ? 593  ILE A N     1 
ATOM   5359 C  CA    . ILE C 3  587 ? 57.082 202.587 40.212 1.00 24.13  ? 593  ILE A CA    1 
ATOM   5360 C  C     . ILE C 3  587 ? 56.012 203.337 39.425 1.00 24.39  ? 593  ILE A C     1 
ATOM   5361 O  O     . ILE C 3  587 ? 54.921 202.815 39.218 1.00 24.71  ? 593  ILE A O     1 
ATOM   5362 C  CB    . ILE C 3  587 ? 57.847 201.679 39.225 1.00 26.34  ? 593  ILE A CB    1 
ATOM   5363 C  CG1   . ILE C 3  587 ? 59.115 201.146 39.879 1.00 26.25  ? 593  ILE A CG1   1 
ATOM   5364 C  CG2   . ILE C 3  587 ? 58.165 202.434 37.946 1.00 26.83  ? 593  ILE A CG2   1 
ATOM   5365 C  CD1   . ILE C 3  587 ? 60.077 202.231 40.276 1.00 30.06  ? 593  ILE A CD1   1 
ATOM   5366 N  N     . LYS C 3  588 ? 56.316 204.556 38.992 1.00 23.67  ? 594  LYS A N     1 
ATOM   5367 C  CA    . LYS C 3  588 ? 55.362 205.326 38.204 1.00 22.87  ? 594  LYS A CA    1 
ATOM   5368 C  C     . LYS C 3  588 ? 55.558 204.919 36.757 1.00 21.72  ? 594  LYS A C     1 
ATOM   5369 O  O     . LYS C 3  588 ? 56.591 205.220 36.161 1.00 22.20  ? 594  LYS A O     1 
ATOM   5370 C  CB    . LYS C 3  588 ? 55.613 206.827 38.345 1.00 23.49  ? 594  LYS A CB    1 
ATOM   5371 C  CG    . LYS C 3  588 ? 54.684 207.682 37.498 1.00 26.67  ? 594  LYS A CG    1 
ATOM   5372 C  CD    . LYS C 3  588 ? 54.920 209.161 37.729 1.00 32.21  ? 594  LYS A CD    1 
ATOM   5373 C  CE    . LYS C 3  588 ? 54.560 209.550 39.161 1.00 37.69  ? 594  LYS A CE    1 
ATOM   5374 N  NZ    . LYS C 3  588 ? 54.933 210.964 39.483 1.00 40.95  ? 594  LYS A NZ    1 
ATOM   5375 N  N     . GLY C 3  589 ? 54.572 204.231 36.194 1.00 19.69  ? 595  GLY A N     1 
ATOM   5376 C  CA    . GLY C 3  589 ? 54.678 203.789 34.814 1.00 16.74  ? 595  GLY A CA    1 
ATOM   5377 C  C     . GLY C 3  589 ? 54.697 204.935 33.822 1.00 15.01  ? 595  GLY A C     1 
ATOM   5378 O  O     . GLY C 3  589 ? 54.409 206.076 34.181 1.00 14.67  ? 595  GLY A O     1 
ATOM   5379 N  N     . LEU C 3  590 ? 55.022 204.625 32.570 1.00 13.67  ? 596  LEU A N     1 
ATOM   5380 C  CA    . LEU C 3  590 ? 55.084 205.631 31.518 1.00 14.82  ? 596  LEU A CA    1 
ATOM   5381 C  C     . LEU C 3  590 ? 53.797 206.423 31.351 1.00 15.03  ? 596  LEU A C     1 
ATOM   5382 O  O     . LEU C 3  590 ? 53.835 207.584 30.946 1.00 15.58  ? 596  LEU A O     1 
ATOM   5383 C  CB    . LEU C 3  590 ? 55.443 204.994 30.168 1.00 13.68  ? 596  LEU A CB    1 
ATOM   5384 C  CG    . LEU C 3  590 ? 56.851 204.424 29.982 1.00 14.52  ? 596  LEU A CG    1 
ATOM   5385 C  CD1   . LEU C 3  590 ? 56.978 203.871 28.572 1.00 13.03  ? 596  LEU A CD1   1 
ATOM   5386 C  CD2   . LEU C 3  590 ? 57.892 205.506 30.226 1.00 12.76  ? 596  LEU A CD2   1 
ATOM   5387 N  N     . ASP C 3  591 ? 52.657 205.808 31.640 1.00 13.56  ? 597  ASP A N     1 
ATOM   5388 C  CA    . ASP C 3  591 ? 51.389 206.512 31.486 1.00 14.07  ? 597  ASP A CA    1 
ATOM   5389 C  C     . ASP C 3  591 ? 50.856 207.007 32.820 1.00 14.30  ? 597  ASP A C     1 
ATOM   5390 O  O     . ASP C 3  591 ? 49.679 207.357 32.943 1.00 14.90  ? 597  ASP A O     1 
ATOM   5391 C  CB    . ASP C 3  591 ? 50.362 205.615 30.811 1.00 15.27  ? 597  ASP A CB    1 
ATOM   5392 C  CG    . ASP C 3  591 ? 50.131 204.332 31.569 1.00 17.70  ? 597  ASP A CG    1 
ATOM   5393 O  OD1   . ASP C 3  591 ? 50.723 204.178 32.654 1.00 16.84  ? 597  ASP A OD1   1 
ATOM   5394 O  OD2   . ASP C 3  591 ? 49.359 203.481 31.081 1.00 18.68  ? 597  ASP A OD2   1 
ATOM   5395 N  N     . GLY C 3  592 ? 51.734 207.027 33.819 1.00 13.45  ? 598  GLY A N     1 
ATOM   5396 C  CA    . GLY C 3  592 ? 51.358 207.520 35.130 1.00 13.91  ? 598  GLY A CA    1 
ATOM   5397 C  C     . GLY C 3  592 ? 50.872 206.543 36.186 1.00 13.56  ? 598  GLY A C     1 
ATOM   5398 O  O     . GLY C 3  592 ? 50.837 206.893 37.365 1.00 13.61  ? 598  GLY A O     1 
ATOM   5399 N  N     . ARG C 3  593 ? 50.506 205.329 35.795 1.00 12.83  ? 599  ARG A N     1 
ATOM   5400 C  CA    . ARG C 3  593 ? 50.001 204.362 36.769 1.00 13.98  ? 599  ARG A CA    1 
ATOM   5401 C  C     . ARG C 3  593 ? 51.050 203.890 37.765 1.00 12.93  ? 599  ARG A C     1 
ATOM   5402 O  O     . ARG C 3  593 ? 52.258 204.021 37.552 1.00 12.57  ? 599  ARG A O     1 
ATOM   5403 C  CB    . ARG C 3  593 ? 49.430 203.127 36.061 1.00 14.01  ? 599  ARG A CB    1 
ATOM   5404 C  CG    . ARG C 3  593 ? 50.504 202.158 35.561 1.00 13.81  ? 599  ARG A CG    1 
ATOM   5405 C  CD    . ARG C 3  593 ? 50.280 201.827 34.100 1.00 15.73  ? 599  ARG A CD    1 
ATOM   5406 N  NE    . ARG C 3  593 ? 49.896 200.436 33.924 1.00 17.05  ? 599  ARG A NE    1 
ATOM   5407 C  CZ    . ARG C 3  593 ? 49.056 200.006 32.994 1.00 15.51  ? 599  ARG A CZ    1 
ATOM   5408 N  NH1   . ARG C 3  593 ? 48.500 200.857 32.141 1.00 12.24  ? 599  ARG A NH1   1 
ATOM   5409 N  NH2   . ARG C 3  593 ? 48.762 198.718 32.934 1.00 17.07  ? 599  ARG A NH2   1 
ATOM   5410 N  N     . LYS C 3  594 ? 50.564 203.328 38.860 1.00 13.73  ? 600  LYS A N     1 
ATOM   5411 C  CA    . LYS C 3  594 ? 51.442 202.777 39.876 1.00 13.43  ? 600  LYS A CA    1 
ATOM   5412 C  C     . LYS C 3  594 ? 51.766 201.356 39.443 1.00 11.99  ? 600  LYS A C     1 
ATOM   5413 O  O     . LYS C 3  594 ? 50.876 200.597 39.091 1.00 13.13  ? 600  LYS A O     1 
ATOM   5414 C  CB    . LYS C 3  594 ? 50.738 202.715 41.231 1.00 13.63  ? 600  LYS A CB    1 
ATOM   5415 C  CG    . LYS C 3  594 ? 50.373 204.042 41.860 1.00 15.76  ? 600  LYS A CG    1 
ATOM   5416 C  CD    . LYS C 3  594 ? 49.720 203.742 43.193 1.00 19.98  ? 600  LYS A CD    1 
ATOM   5417 C  CE    . LYS C 3  594 ? 49.336 204.978 43.967 1.00 23.50  ? 600  LYS A CE    1 
ATOM   5418 N  NZ    . LYS C 3  594 ? 48.774 204.576 45.297 1.00 24.89  ? 600  LYS A NZ    1 
ATOM   5419 N  N     . VAL C 3  595 ? 53.040 201.002 39.450 1.00 12.63  ? 601  VAL A N     1 
ATOM   5420 C  CA    . VAL C 3  595 ? 53.436 199.655 39.098 1.00 12.59  ? 601  VAL A CA    1 
ATOM   5421 C  C     . VAL C 3  595 ? 54.061 199.041 40.348 1.00 12.68  ? 601  VAL A C     1 
ATOM   5422 O  O     . VAL C 3  595 ? 55.170 199.398 40.743 1.00 14.86  ? 601  VAL A O     1 
ATOM   5423 C  CB    . VAL C 3  595 ? 54.450 199.642 37.943 1.00 13.93  ? 601  VAL A CB    1 
ATOM   5424 C  CG1   . VAL C 3  595 ? 54.721 198.193 37.504 1.00 10.52  ? 601  VAL A CG1   1 
ATOM   5425 C  CG2   . VAL C 3  595 ? 53.916 200.465 36.780 1.00 10.63  ? 601  VAL A CG2   1 
ATOM   5426 N  N     . HIS C 3  596 ? 53.316 198.140 40.977 1.00 13.50  ? 602  HIS A N     1 
ATOM   5427 C  CA    . HIS C 3  596 ? 53.739 197.460 42.197 1.00 14.00  ? 602  HIS A CA    1 
ATOM   5428 C  C     . HIS C 3  596 ? 55.060 196.712 42.034 1.00 14.81  ? 602  HIS A C     1 
ATOM   5429 O  O     . HIS C 3  596 ? 55.248 195.967 41.067 1.00 12.70  ? 602  HIS A O     1 
ATOM   5430 C  CB    . HIS C 3  596 ? 52.658 196.465 42.631 1.00 15.81  ? 602  HIS A CB    1 
ATOM   5431 C  CG    . HIS C 3  596 ? 52.997 195.706 43.879 1.00 19.53  ? 602  HIS A CG    1 
ATOM   5432 N  ND1   . HIS C 3  596 ? 52.898 196.258 45.138 1.00 16.98  ? 602  HIS A ND1   1 
ATOM   5433 C  CD2   . HIS C 3  596 ? 53.448 194.442 44.059 1.00 20.17  ? 602  HIS A CD2   1 
ATOM   5434 C  CE1   . HIS C 3  596 ? 53.274 195.368 46.038 1.00 19.53  ? 602  HIS A CE1   1 
ATOM   5435 N  NE2   . HIS C 3  596 ? 53.613 194.258 45.410 1.00 19.83  ? 602  HIS A NE2   1 
ATOM   5436 N  N     . VAL C 3  597 ? 55.970 196.919 42.983 1.00 13.29  ? 603  VAL A N     1 
ATOM   5437 C  CA    . VAL C 3  597 ? 57.267 196.251 42.966 1.00 13.55  ? 603  VAL A CA    1 
ATOM   5438 C  C     . VAL C 3  597 ? 57.250 195.111 43.972 1.00 14.43  ? 603  VAL A C     1 
ATOM   5439 O  O     . VAL C 3  597 ? 57.005 195.324 45.158 1.00 13.91  ? 603  VAL A O     1 
ATOM   5440 C  CB    . VAL C 3  597 ? 58.411 197.201 43.360 1.00 13.11  ? 603  VAL A CB    1 
ATOM   5441 C  CG1   . VAL C 3  597 ? 59.730 196.447 43.343 1.00 9.92   ? 603  VAL A CG1   1 
ATOM   5442 C  CG2   . VAL C 3  597 ? 58.453 198.384 42.412 1.00 14.34  ? 603  VAL A CG2   1 
ATOM   5443 N  N     . ARG C 3  598 ? 57.501 193.899 43.498 1.00 15.91  ? 604  ARG A N     1 
ATOM   5444 C  CA    . ARG C 3  598 ? 57.501 192.744 44.380 1.00 17.52  ? 604  ARG A CA    1 
ATOM   5445 C  C     . ARG C 3  598 ? 58.754 192.637 45.246 1.00 18.14  ? 604  ARG A C     1 
ATOM   5446 O  O     . ARG C 3  598 ? 58.660 192.280 46.413 1.00 20.37  ? 604  ARG A O     1 
ATOM   5447 C  CB    . ARG C 3  598 ? 57.304 191.466 43.566 1.00 16.40  ? 604  ARG A CB    1 
ATOM   5448 C  CG    . ARG C 3  598 ? 55.876 191.299 43.082 1.00 19.90  ? 604  ARG A CG    1 
ATOM   5449 C  CD    . ARG C 3  598 ? 55.720 190.149 42.098 1.00 17.99  ? 604  ARG A CD    1 
ATOM   5450 N  NE    . ARG C 3  598 ? 54.327 190.011 41.675 1.00 18.69  ? 604  ARG A NE    1 
ATOM   5451 C  CZ    . ARG C 3  598 ? 53.925 189.298 40.627 1.00 18.07  ? 604  ARG A CZ    1 
ATOM   5452 N  NH1   . ARG C 3  598 ? 54.805 188.650 39.877 1.00 14.82  ? 604  ARG A NH1   1 
ATOM   5453 N  NH2   . ARG C 3  598 ? 52.640 189.231 40.329 1.00 18.03  ? 604  ARG A NH2   1 
ATOM   5454 N  N     . SER C 3  599 ? 59.922 192.942 44.690 1.00 17.36  ? 605  SER A N     1 
ATOM   5455 C  CA    . SER C 3  599 ? 61.151 192.866 45.469 1.00 19.15  ? 605  SER A CA    1 
ATOM   5456 C  C     . SER C 3  599 ? 62.198 193.882 45.020 1.00 19.21  ? 605  SER A C     1 
ATOM   5457 O  O     . SER C 3  599 ? 62.259 194.272 43.850 1.00 20.42  ? 605  SER A O     1 
ATOM   5458 C  CB    . SER C 3  599 ? 61.746 191.459 45.392 1.00 20.52  ? 605  SER A CB    1 
ATOM   5459 O  OG    . SER C 3  599 ? 62.220 191.183 44.086 1.00 24.15  ? 605  SER A OG    1 
ATOM   5460 N  N     . PRO C 3  600 ? 63.044 194.327 45.955 1.00 17.26  ? 606  PRO A N     1 
ATOM   5461 C  CA    . PRO C 3  600 ? 64.058 195.301 45.556 1.00 16.87  ? 606  PRO A CA    1 
ATOM   5462 C  C     . PRO C 3  600 ? 64.899 194.747 44.410 1.00 17.15  ? 606  PRO A C     1 
ATOM   5463 O  O     . PRO C 3  600 ? 65.352 195.488 43.538 1.00 15.04  ? 606  PRO A O     1 
ATOM   5464 C  CB    . PRO C 3  600 ? 64.872 195.494 46.837 1.00 16.11  ? 606  PRO A CB    1 
ATOM   5465 C  CG    . PRO C 3  600 ? 63.863 195.236 47.921 1.00 15.35  ? 606  PRO A CG    1 
ATOM   5466 C  CD    . PRO C 3  600 ? 63.121 194.034 47.396 1.00 14.63  ? 606  PRO A CD    1 
ATOM   5467 N  N     . HIS C 3  601 ? 65.090 193.434 44.405 1.00 17.90  ? 607  HIS A N     1 
ATOM   5468 C  CA    . HIS C 3  601 ? 65.908 192.813 43.374 1.00 20.56  ? 607  HIS A CA    1 
ATOM   5469 C  C     . HIS C 3  601 ? 65.279 192.827 41.987 1.00 20.82  ? 607  HIS A C     1 
ATOM   5470 O  O     . HIS C 3  601 ? 65.955 193.109 41.002 1.00 21.47  ? 607  HIS A O     1 
ATOM   5471 C  CB    . HIS C 3  601 ? 66.273 191.377 43.772 1.00 22.85  ? 607  HIS A CB    1 
ATOM   5472 C  CG    . HIS C 3  601 ? 67.308 190.755 42.886 1.00 25.87  ? 607  HIS A CG    1 
ATOM   5473 N  ND1   . HIS C 3  601 ? 66.986 189.984 41.789 1.00 25.80  ? 607  HIS A ND1   1 
ATOM   5474 C  CD2   . HIS C 3  601 ? 68.660 190.841 42.900 1.00 26.14  ? 607  HIS A CD2   1 
ATOM   5475 C  CE1   . HIS C 3  601 ? 68.093 189.625 41.165 1.00 26.48  ? 607  HIS A CE1   1 
ATOM   5476 N  NE2   . HIS C 3  601 ? 69.124 190.132 41.818 1.00 27.45  ? 607  HIS A NE2   1 
ATOM   5477 N  N     . ALA C 3  602 ? 63.987 192.532 41.904 1.00 21.40  ? 608  ALA A N     1 
ATOM   5478 C  CA    . ALA C 3  602 ? 63.302 192.512 40.615 1.00 20.64  ? 608  ALA A CA    1 
ATOM   5479 C  C     . ALA C 3  602 ? 62.901 193.908 40.125 1.00 19.78  ? 608  ALA A C     1 
ATOM   5480 O  O     . ALA C 3  602 ? 62.345 194.051 39.035 1.00 19.48  ? 608  ALA A O     1 
ATOM   5481 C  CB    . ALA C 3  602 ? 62.073 191.625 40.706 1.00 21.74  ? 608  ALA A CB    1 
ATOM   5482 N  N     . ALA C 3  603 ? 63.195 194.926 40.930 1.00 18.42  ? 609  ALA A N     1 
ATOM   5483 C  CA    . ALA C 3  603 ? 62.853 196.309 40.603 1.00 18.19  ? 609  ALA A CA    1 
ATOM   5484 C  C     . ALA C 3  603 ? 63.206 196.752 39.181 1.00 18.01  ? 609  ALA A C     1 
ATOM   5485 O  O     . ALA C 3  603 ? 62.344 197.251 38.444 1.00 17.76  ? 609  ALA A O     1 
ATOM   5486 C  CB    . ALA C 3  603 ? 63.500 197.250 41.605 1.00 16.96  ? 609  ALA A CB    1 
ATOM   5487 N  N     . LEU C 3  604 ? 64.468 196.595 38.796 1.00 15.55  ? 610  LEU A N     1 
ATOM   5488 C  CA    . LEU C 3  604 ? 64.877 196.993 37.456 1.00 16.37  ? 610  LEU A CA    1 
ATOM   5489 C  C     . LEU C 3  604 ? 64.022 196.282 36.406 1.00 16.34  ? 610  LEU A C     1 
ATOM   5490 O  O     . LEU C 3  604 ? 63.651 196.879 35.392 1.00 16.46  ? 610  LEU A O     1 
ATOM   5491 C  CB    . LEU C 3  604 ? 66.357 196.683 37.226 1.00 15.14  ? 610  LEU A CB    1 
ATOM   5492 C  CG    . LEU C 3  604 ? 66.891 196.991 35.818 1.00 17.50  ? 610  LEU A CG    1 
ATOM   5493 C  CD1   . LEU C 3  604 ? 66.657 198.458 35.484 1.00 14.91  ? 610  LEU A CD1   1 
ATOM   5494 C  CD2   . LEU C 3  604 ? 68.383 196.662 35.743 1.00 15.98  ? 610  LEU A CD2   1 
ATOM   5495 N  N     . ASN C 3  605 ? 63.700 195.015 36.652 1.00 13.53  ? 611  ASN A N     1 
ATOM   5496 C  CA    . ASN C 3  605 ? 62.878 194.270 35.707 1.00 15.29  ? 611  ASN A CA    1 
ATOM   5497 C  C     . ASN C 3  605 ? 61.465 194.844 35.679 1.00 15.17  ? 611  ASN A C     1 
ATOM   5498 O  O     . ASN C 3  605 ? 60.811 194.867 34.636 1.00 17.06  ? 611  ASN A O     1 
ATOM   5499 C  CB    . ASN C 3  605 ? 62.850 192.778 36.067 1.00 14.47  ? 611  ASN A CB    1 
ATOM   5500 C  CG    . ASN C 3  605 ? 61.893 191.981 35.194 1.00 14.63  ? 611  ASN A CG    1 
ATOM   5501 O  OD1   . ASN C 3  605 ? 60.722 191.819 35.531 1.00 12.49  ? 611  ASN A OD1   1 
ATOM   5502 N  ND2   . ASN C 3  605 ? 62.385 191.495 34.057 1.00 12.75  ? 611  ASN A ND2   1 
ATOM   5503 N  N     . THR C 3  606 ? 60.994 195.321 36.823 1.00 15.08  ? 612  THR A N     1 
ATOM   5504 C  CA    . THR C 3  606 ? 59.668 195.914 36.874 1.00 13.91  ? 612  THR A CA    1 
ATOM   5505 C  C     . THR C 3  606 ? 59.661 197.181 36.035 1.00 12.34  ? 612  THR A C     1 
ATOM   5506 O  O     . THR C 3  606 ? 58.769 197.388 35.216 1.00 14.67  ? 612  THR A O     1 
ATOM   5507 C  CB    . THR C 3  606 ? 59.271 196.251 38.309 1.00 13.94  ? 612  THR A CB    1 
ATOM   5508 O  OG1   . THR C 3  606 ? 59.208 195.041 39.069 1.00 15.99  ? 612  THR A OG1   1 
ATOM   5509 C  CG2   . THR C 3  606 ? 57.916 196.929 38.345 1.00 10.89  ? 612  THR A CG2   1 
ATOM   5510 N  N     . LEU C 3  607 ? 60.671 198.019 36.228 1.00 11.18  ? 613  LEU A N     1 
ATOM   5511 C  CA    . LEU C 3  607 ? 60.778 199.264 35.486 1.00 11.72  ? 613  LEU A CA    1 
ATOM   5512 C  C     . LEU C 3  607 ? 60.840 199.053 33.970 1.00 14.44  ? 613  LEU A C     1 
ATOM   5513 O  O     . LEU C 3  607 ? 60.069 199.651 33.220 1.00 15.25  ? 613  LEU A O     1 
ATOM   5514 C  CB    . LEU C 3  607 ? 62.021 200.020 35.931 1.00 12.29  ? 613  LEU A CB    1 
ATOM   5515 C  CG    . LEU C 3  607 ? 62.332 201.339 35.218 1.00 14.19  ? 613  LEU A CG    1 
ATOM   5516 C  CD1   . LEU C 3  607 ? 61.329 202.403 35.641 1.00 12.78  ? 613  LEU A CD1   1 
ATOM   5517 C  CD2   . LEU C 3  607 ? 63.745 201.774 35.565 1.00 13.19  ? 613  LEU A CD2   1 
ATOM   5518 N  N     . LEU C 3  608 ? 61.751 198.198 33.516 1.00 15.23  ? 614  LEU A N     1 
ATOM   5519 C  CA    . LEU C 3  608 ? 61.906 197.962 32.085 1.00 15.26  ? 614  LEU A CA    1 
ATOM   5520 C  C     . LEU C 3  608 ? 60.792 197.139 31.443 1.00 15.60  ? 614  LEU A C     1 
ATOM   5521 O  O     . LEU C 3  608 ? 60.344 197.456 30.340 1.00 16.11  ? 614  LEU A O     1 
ATOM   5522 C  CB    . LEU C 3  608 ? 63.268 197.315 31.802 1.00 14.49  ? 614  LEU A CB    1 
ATOM   5523 C  CG    . LEU C 3  608 ? 64.494 198.053 32.368 1.00 13.16  ? 614  LEU A CG    1 
ATOM   5524 C  CD1   . LEU C 3  608 ? 65.779 197.406 31.851 1.00 11.69  ? 614  LEU A CD1   1 
ATOM   5525 C  CD2   . LEU C 3  608 ? 64.453 199.525 31.969 1.00 13.31  ? 614  LEU A CD2   1 
ATOM   5526 N  N     . GLN C 3  609 ? 60.330 196.091 32.117 1.00 15.34  ? 615  GLN A N     1 
ATOM   5527 C  CA    . GLN C 3  609 ? 59.269 195.281 31.533 1.00 13.26  ? 615  GLN A CA    1 
ATOM   5528 C  C     . GLN C 3  609 ? 57.994 196.107 31.424 1.00 13.49  ? 615  GLN A C     1 
ATOM   5529 O  O     . GLN C 3  609 ? 57.277 196.022 30.431 1.00 15.52  ? 615  GLN A O     1 
ATOM   5530 C  CB    . GLN C 3  609 ? 58.995 194.026 32.366 1.00 12.18  ? 615  GLN A CB    1 
ATOM   5531 C  CG    . GLN C 3  609 ? 58.285 192.927 31.574 1.00 11.97  ? 615  GLN A CG    1 
ATOM   5532 C  CD    . GLN C 3  609 ? 57.792 191.790 32.446 1.00 12.14  ? 615  GLN A CD    1 
ATOM   5533 O  OE1   . GLN C 3  609 ? 56.720 191.872 33.046 1.00 11.87  ? 615  GLN A OE1   1 
ATOM   5534 N  NE2   . GLN C 3  609 ? 58.580 190.721 32.529 1.00 10.35  ? 615  GLN A NE2   1 
ATOM   5535 N  N     . SER C 3  610 ? 57.713 196.915 32.442 1.00 12.99  ? 616  SER A N     1 
ATOM   5536 C  CA    . SER C 3  610 ? 56.515 197.748 32.423 1.00 12.35  ? 616  SER A CA    1 
ATOM   5537 C  C     . SER C 3  610 ? 56.581 198.733 31.262 1.00 12.47  ? 616  SER A C     1 
ATOM   5538 O  O     . SER C 3  610 ? 55.629 198.861 30.491 1.00 13.02  ? 616  SER A O     1 
ATOM   5539 C  CB    . SER C 3  610 ? 56.371 198.510 33.743 1.00 11.87  ? 616  SER A CB    1 
ATOM   5540 O  OG    . SER C 3  610 ? 55.187 199.293 33.745 1.00 9.41   ? 616  SER A OG    1 
ATOM   5541 N  N     . ALA C 3  611 ? 57.708 199.428 31.139 1.00 11.90  ? 617  ALA A N     1 
ATOM   5542 C  CA    . ALA C 3  611 ? 57.890 200.396 30.064 1.00 12.04  ? 617  ALA A CA    1 
ATOM   5543 C  C     . ALA C 3  611 ? 57.672 199.731 28.706 1.00 12.66  ? 617  ALA A C     1 
ATOM   5544 O  O     . ALA C 3  611 ? 56.969 200.267 27.846 1.00 12.34  ? 617  ALA A O     1 
ATOM   5545 C  CB    . ALA C 3  611 ? 59.288 201.004 30.136 1.00 12.83  ? 617  ALA A CB    1 
ATOM   5546 N  N     . GLY C 3  612 ? 58.270 198.560 28.513 1.00 12.24  ? 618  GLY A N     1 
ATOM   5547 C  CA    . GLY C 3  612 ? 58.101 197.867 27.249 1.00 11.04  ? 618  GLY A CA    1 
ATOM   5548 C  C     . GLY C 3  612 ? 56.658 197.449 27.053 1.00 11.67  ? 618  GLY A C     1 
ATOM   5549 O  O     . GLY C 3  612 ? 56.126 197.470 25.942 1.00 14.31  ? 618  GLY A O     1 
ATOM   5550 N  N     . ALA C 3  613 ? 56.010 197.077 28.146 1.00 10.53  ? 619  ALA A N     1 
ATOM   5551 C  CA    . ALA C 3  613 ? 54.627 196.645 28.081 1.00 10.20  ? 619  ALA A CA    1 
ATOM   5552 C  C     . ALA C 3  613 ? 53.699 197.794 27.709 1.00 11.10  ? 619  ALA A C     1 
ATOM   5553 O  O     . ALA C 3  613 ? 52.833 197.633 26.851 1.00 13.44  ? 619  ALA A O     1 
ATOM   5554 C  CB    . ALA C 3  613 ? 54.212 196.039 29.408 1.00 8.50   ? 619  ALA A CB    1 
ATOM   5555 N  N     . LEU C 3  614 ? 53.881 198.953 28.342 1.00 11.03  ? 620  LEU A N     1 
ATOM   5556 C  CA    . LEU C 3  614 ? 53.031 200.102 28.053 1.00 10.05  ? 620  LEU A CA    1 
ATOM   5557 C  C     . LEU C 3  614 ? 53.308 200.677 26.670 1.00 11.11  ? 620  LEU A C     1 
ATOM   5558 O  O     . LEU C 3  614 ? 52.403 201.179 26.000 1.00 8.48   ? 620  LEU A O     1 
ATOM   5559 C  CB    . LEU C 3  614 ? 53.204 201.181 29.124 1.00 11.22  ? 620  LEU A CB    1 
ATOM   5560 C  CG    . LEU C 3  614 ? 52.892 200.725 30.554 1.00 10.89  ? 620  LEU A CG    1 
ATOM   5561 C  CD1   . LEU C 3  614 ? 52.669 201.935 31.433 1.00 9.77   ? 620  LEU A CD1   1 
ATOM   5562 C  CD2   . LEU C 3  614 ? 51.651 199.835 30.561 1.00 9.62   ? 620  LEU A CD2   1 
ATOM   5563 N  N     . ILE C 3  615 ? 54.562 200.597 26.237 1.00 12.58  ? 621  ILE A N     1 
ATOM   5564 C  CA    . ILE C 3  615 ? 54.919 201.084 24.916 1.00 11.06  ? 621  ILE A CA    1 
ATOM   5565 C  C     . ILE C 3  615 ? 54.182 200.234 23.893 1.00 10.99  ? 621  ILE A C     1 
ATOM   5566 O  O     . ILE C 3  615 ? 53.523 200.756 22.992 1.00 11.39  ? 621  ILE A O     1 
ATOM   5567 C  CB    . ILE C 3  615 ? 56.447 200.982 24.676 1.00 11.68  ? 621  ILE A CB    1 
ATOM   5568 C  CG1   . ILE C 3  615 ? 57.127 202.256 25.188 1.00 8.76   ? 621  ILE A CG1   1 
ATOM   5569 C  CG2   . ILE C 3  615 ? 56.753 200.737 23.189 1.00 9.32   ? 621  ILE A CG2   1 
ATOM   5570 C  CD1   . ILE C 3  615 ? 58.635 202.191 25.149 1.00 7.38   ? 621  ILE A CD1   1 
ATOM   5571 N  N     . CYS C 3  616 ? 54.281 198.919 24.039 1.00 9.98   ? 622  CYS A N     1 
ATOM   5572 C  CA    . CYS C 3  616 ? 53.620 198.016 23.100 1.00 11.88  ? 622  CYS A CA    1 
ATOM   5573 C  C     . CYS C 3  616 ? 52.108 198.137 23.130 1.00 12.29  ? 622  CYS A C     1 
ATOM   5574 O  O     . CYS C 3  616 ? 51.442 197.992 22.100 1.00 9.46   ? 622  CYS A O     1 
ATOM   5575 C  CB    . CYS C 3  616 ? 54.010 196.571 23.392 1.00 13.76  ? 622  CYS A CB    1 
ATOM   5576 S  SG    . CYS C 3  616 ? 55.718 196.233 23.015 1.00 16.14  ? 622  CYS A SG    1 
ATOM   5577 N  N     . LYS C 3  617 ? 51.567 198.395 24.318 1.00 10.64  ? 623  LYS A N     1 
ATOM   5578 C  CA    . LYS C 3  617 ? 50.137 198.524 24.453 1.00 12.33  ? 623  LYS A CA    1 
ATOM   5579 C  C     . LYS C 3  617 ? 49.672 199.747 23.650 1.00 14.88  ? 623  LYS A C     1 
ATOM   5580 O  O     . LYS C 3  617 ? 48.751 199.657 22.827 1.00 14.70  ? 623  LYS A O     1 
ATOM   5581 C  CB    . LYS C 3  617 ? 49.772 198.638 25.932 1.00 12.94  ? 623  LYS A CB    1 
ATOM   5582 C  CG    . LYS C 3  617 ? 48.294 198.406 26.213 1.00 14.84  ? 623  LYS A CG    1 
ATOM   5583 C  CD    . LYS C 3  617 ? 47.996 198.247 27.700 1.00 12.88  ? 623  LYS A CD    1 
ATOM   5584 C  CE    . LYS C 3  617 ? 48.500 196.930 28.240 1.00 12.33  ? 623  LYS A CE    1 
ATOM   5585 N  NZ    . LYS C 3  617 ? 48.255 196.796 29.713 1.00 13.15  ? 623  LYS A NZ    1 
ATOM   5586 N  N     . LEU C 3  618 ? 50.321 200.885 23.872 1.00 14.66  ? 624  LEU A N     1 
ATOM   5587 C  CA    . LEU C 3  618 ? 49.966 202.102 23.155 1.00 14.93  ? 624  LEU A CA    1 
ATOM   5588 C  C     . LEU C 3  618 ? 50.229 201.864 21.670 1.00 15.63  ? 624  LEU A C     1 
ATOM   5589 O  O     . LEU C 3  618 ? 49.530 202.387 20.799 1.00 17.38  ? 624  LEU A O     1 
ATOM   5590 C  CB    . LEU C 3  618 ? 50.825 203.274 23.634 1.00 12.67  ? 624  LEU A CB    1 
ATOM   5591 C  CG    . LEU C 3  618 ? 50.126 204.614 23.847 1.00 15.04  ? 624  LEU A CG    1 
ATOM   5592 C  CD1   . LEU C 3  618 ? 51.192 205.698 23.906 1.00 14.62  ? 624  LEU A CD1   1 
ATOM   5593 C  CD2   . LEU C 3  618 ? 49.124 204.899 22.736 1.00 9.68   ? 624  LEU A CD2   1 
ATOM   5594 N  N     . TRP C 3  619 ? 51.248 201.059 21.398 1.00 14.71  ? 625  TRP A N     1 
ATOM   5595 C  CA    . TRP C 3  619 ? 51.644 200.728 20.037 1.00 13.65  ? 625  TRP A CA    1 
ATOM   5596 C  C     . TRP C 3  619 ? 50.559 200.036 19.212 1.00 13.31  ? 625  TRP A C     1 
ATOM   5597 O  O     . TRP C 3  619 ? 50.267 200.450 18.077 1.00 12.71  ? 625  TRP A O     1 
ATOM   5598 C  CB    . TRP C 3  619 ? 52.897 199.855 20.075 1.00 12.13  ? 625  TRP A CB    1 
ATOM   5599 C  CG    . TRP C 3  619 ? 53.289 199.299 18.748 1.00 14.12  ? 625  TRP A CG    1 
ATOM   5600 C  CD1   . TRP C 3  619 ? 53.429 199.989 17.576 1.00 12.07  ? 625  TRP A CD1   1 
ATOM   5601 C  CD2   . TRP C 3  619 ? 53.655 197.944 18.463 1.00 11.86  ? 625  TRP A CD2   1 
ATOM   5602 N  NE1   . TRP C 3  619 ? 53.864 199.146 16.582 1.00 10.93  ? 625  TRP A NE1   1 
ATOM   5603 C  CE2   . TRP C 3  619 ? 54.014 197.887 17.097 1.00 12.42  ? 625  TRP A CE2   1 
ATOM   5604 C  CE3   . TRP C 3  619 ? 53.721 196.773 19.231 1.00 12.15  ? 625  TRP A CE3   1 
ATOM   5605 C  CZ2   . TRP C 3  619 ? 54.435 196.699 16.477 1.00 13.17  ? 625  TRP A CZ2   1 
ATOM   5606 C  CZ3   . TRP C 3  619 ? 54.140 195.584 18.613 1.00 12.07  ? 625  TRP A CZ3   1 
ATOM   5607 C  CH2   . TRP C 3  619 ? 54.493 195.563 17.248 1.00 11.33  ? 625  TRP A CH2   1 
ATOM   5608 N  N     . ILE C 3  620 ? 49.963 198.986 19.768 1.00 11.75  ? 626  ILE A N     1 
ATOM   5609 C  CA    . ILE C 3  620 ? 48.938 198.264 19.030 1.00 11.02  ? 626  ILE A CA    1 
ATOM   5610 C  C     . ILE C 3  620 ? 47.706 199.134 18.874 1.00 12.55  ? 626  ILE A C     1 
ATOM   5611 O  O     . ILE C 3  620 ? 46.965 199.011 17.900 1.00 14.82  ? 626  ILE A O     1 
ATOM   5612 C  CB    . ILE C 3  620 ? 48.555 196.944 19.728 1.00 11.54  ? 626  ILE A CB    1 
ATOM   5613 C  CG1   . ILE C 3  620 ? 47.864 197.238 21.059 1.00 11.02  ? 626  ILE A CG1   1 
ATOM   5614 C  CG2   . ILE C 3  620 ? 49.806 196.074 19.931 1.00 4.58   ? 626  ILE A CG2   1 
ATOM   5615 C  CD1   . ILE C 3  620 ? 47.431 195.995 21.793 1.00 13.28  ? 626  ILE A CD1   1 
ATOM   5616 N  N     . ILE C 3  621 ? 47.498 200.030 19.829 1.00 11.88  ? 627  ILE A N     1 
ATOM   5617 C  CA    . ILE C 3  621 ? 46.352 200.923 19.793 1.00 11.83  ? 627  ILE A CA    1 
ATOM   5618 C  C     . ILE C 3  621 ? 46.505 201.955 18.680 1.00 13.45  ? 627  ILE A C     1 
ATOM   5619 O  O     . ILE C 3  621 ? 45.607 202.133 17.861 1.00 11.91  ? 627  ILE A O     1 
ATOM   5620 C  CB    . ILE C 3  621 ? 46.189 201.665 21.134 1.00 13.51  ? 627  ILE A CB    1 
ATOM   5621 C  CG1   . ILE C 3  621 ? 45.828 200.665 22.236 1.00 13.01  ? 627  ILE A CG1   1 
ATOM   5622 C  CG2   . ILE C 3  621 ? 45.137 202.757 21.006 1.00 9.46   ? 627  ILE A CG2   1 
ATOM   5623 C  CD1   . ILE C 3  621 ? 45.674 201.297 23.602 1.00 13.95  ? 627  ILE A CD1   1 
ATOM   5624 N  N     . LYS C 3  622 ? 47.649 202.634 18.662 1.00 13.81  ? 628  LYS A N     1 
ATOM   5625 C  CA    . LYS C 3  622 ? 47.910 203.652 17.657 1.00 14.38  ? 628  LYS A CA    1 
ATOM   5626 C  C     . LYS C 3  622 ? 47.968 203.028 16.273 1.00 14.27  ? 628  LYS A C     1 
ATOM   5627 O  O     . LYS C 3  622 ? 47.497 203.621 15.303 1.00 13.47  ? 628  LYS A O     1 
ATOM   5628 C  CB    . LYS C 3  622 ? 49.229 204.371 17.955 1.00 16.93  ? 628  LYS A CB    1 
ATOM   5629 C  CG    . LYS C 3  622 ? 49.548 205.529 17.014 1.00 19.37  ? 628  LYS A CG    1 
ATOM   5630 C  CD    . LYS C 3  622 ? 48.587 206.704 17.192 1.00 21.99  ? 628  LYS A CD    1 
ATOM   5631 C  CE    . LYS C 3  622 ? 48.910 207.799 16.181 1.00 25.57  ? 628  LYS A CE    1 
ATOM   5632 N  NZ    . LYS C 3  622 ? 47.931 208.933 16.159 1.00 27.12  ? 628  LYS A NZ    1 
ATOM   5633 N  N     . THR C 3  623 ? 48.548 201.832 16.183 1.00 13.90  ? 629  THR A N     1 
ATOM   5634 C  CA    . THR C 3  623 ? 48.651 201.143 14.904 1.00 13.37  ? 629  THR A CA    1 
ATOM   5635 C  C     . THR C 3  623 ? 47.269 200.929 14.311 1.00 14.60  ? 629  THR A C     1 
ATOM   5636 O  O     . THR C 3  623 ? 47.026 201.289 13.160 1.00 16.50  ? 629  THR A O     1 
ATOM   5637 C  CB    . THR C 3  623 ? 49.363 199.768 15.032 1.00 13.54  ? 629  THR A CB    1 
ATOM   5638 O  OG1   . THR C 3  623 ? 50.741 199.969 15.364 1.00 15.30  ? 629  THR A OG1   1 
ATOM   5639 C  CG2   . THR C 3  623 ? 49.295 199.001 13.723 1.00 11.28  ? 629  THR A CG2   1 
ATOM   5640 N  N     . GLU C 3  624 ? 46.346 200.366 15.081 1.00 15.61  ? 630  GLU A N     1 
ATOM   5641 C  CA    . GLU C 3  624 ? 45.022 200.144 14.519 1.00 18.08  ? 630  GLU A CA    1 
ATOM   5642 C  C     . GLU C 3  624 ? 44.344 201.461 14.184 1.00 18.73  ? 630  GLU A C     1 
ATOM   5643 O  O     . GLU C 3  624 ? 43.612 201.554 13.202 1.00 19.52  ? 630  GLU A O     1 
ATOM   5644 C  CB    . GLU C 3  624 ? 44.111 199.354 15.461 1.00 15.88  ? 630  GLU A CB    1 
ATOM   5645 C  CG    . GLU C 3  624 ? 42.776 199.041 14.789 1.00 17.54  ? 630  GLU A CG    1 
ATOM   5646 C  CD    . GLU C 3  624 ? 41.592 199.153 15.723 1.00 18.12  ? 630  GLU A CD    1 
ATOM   5647 O  OE1   . GLU C 3  624 ? 41.642 199.977 16.659 1.00 18.68  ? 630  GLU A OE1   1 
ATOM   5648 O  OE2   . GLU C 3  624 ? 40.600 198.428 15.511 1.00 18.65  ? 630  GLU A OE2   1 
ATOM   5649 N  N     . GLU C 3  625 ? 44.592 202.480 14.995 1.00 19.82  ? 631  GLU A N     1 
ATOM   5650 C  CA    . GLU C 3  625 ? 43.975 203.774 14.764 1.00 22.15  ? 631  GLU A CA    1 
ATOM   5651 C  C     . GLU C 3  625 ? 44.493 204.397 13.477 1.00 20.89  ? 631  GLU A C     1 
ATOM   5652 O  O     . GLU C 3  625 ? 43.726 204.972 12.708 1.00 19.88  ? 631  GLU A O     1 
ATOM   5653 C  CB    . GLU C 3  625 ? 44.227 204.706 15.952 1.00 23.81  ? 631  GLU A CB    1 
ATOM   5654 C  CG    . GLU C 3  625 ? 43.448 206.010 15.892 1.00 30.60  ? 631  GLU A CG    1 
ATOM   5655 C  CD    . GLU C 3  625 ? 43.319 206.670 17.260 1.00 37.40  ? 631  GLU A CD    1 
ATOM   5656 O  OE1   . GLU C 3  625 ? 44.366 206.968 17.889 1.00 38.27  ? 631  GLU A OE1   1 
ATOM   5657 O  OE2   . GLU C 3  625 ? 42.167 206.884 17.709 1.00 39.44  ? 631  GLU A OE2   1 
ATOM   5658 N  N     . MET C 3  626 ? 45.794 204.284 13.239 1.00 20.41  ? 632  MET A N     1 
ATOM   5659 C  CA    . MET C 3  626 ? 46.365 204.841 12.027 1.00 20.01  ? 632  MET A CA    1 
ATOM   5660 C  C     . MET C 3  626 ? 45.836 204.094 10.798 1.00 20.62  ? 632  MET A C     1 
ATOM   5661 O  O     . MET C 3  626 ? 45.650 204.693 9.743  1.00 21.61  ? 632  MET A O     1 
ATOM   5662 C  CB    . MET C 3  626 ? 47.891 204.785 12.082 1.00 20.23  ? 632  MET A CB    1 
ATOM   5663 C  CG    . MET C 3  626 ? 48.505 205.824 13.004 1.00 18.53  ? 632  MET A CG    1 
ATOM   5664 S  SD    . MET C 3  626 ? 50.307 205.667 13.132 1.00 20.03  ? 632  MET A SD    1 
ATOM   5665 C  CE    . MET C 3  626 ? 50.834 206.529 11.655 1.00 21.17  ? 632  MET A CE    1 
ATOM   5666 N  N     . LEU C 3  627 ? 45.586 202.793 10.930 1.00 18.19  ? 633  LEU A N     1 
ATOM   5667 C  CA    . LEU C 3  627 ? 45.049 202.028 9.809  1.00 18.52  ? 633  LEU A CA    1 
ATOM   5668 C  C     . LEU C 3  627 ? 43.611 202.461 9.526  1.00 18.95  ? 633  LEU A C     1 
ATOM   5669 O  O     . LEU C 3  627 ? 43.229 202.666 8.376  1.00 18.62  ? 633  LEU A O     1 
ATOM   5670 C  CB    . LEU C 3  627 ? 45.079 200.523 10.102 1.00 16.82  ? 633  LEU A CB    1 
ATOM   5671 C  CG    . LEU C 3  627 ? 46.469 199.906 10.206 1.00 16.53  ? 633  LEU A CG    1 
ATOM   5672 C  CD1   . LEU C 3  627 ? 46.367 198.446 10.605 1.00 15.50  ? 633  LEU A CD1   1 
ATOM   5673 C  CD2   . LEU C 3  627 ? 47.177 200.062 8.872  1.00 18.16  ? 633  LEU A CD2   1 
ATOM   5674 N  N     . VAL C 3  628 ? 42.812 202.595 10.578 1.00 19.45  ? 634  VAL A N     1 
ATOM   5675 C  CA    . VAL C 3  628 ? 41.427 203.008 10.407 1.00 20.98  ? 634  VAL A CA    1 
ATOM   5676 C  C     . VAL C 3  628 ? 41.329 204.390 9.765  1.00 22.15  ? 634  VAL A C     1 
ATOM   5677 O  O     . VAL C 3  628 ? 40.449 204.626 8.939  1.00 21.77  ? 634  VAL A O     1 
ATOM   5678 C  CB    . VAL C 3  628 ? 40.671 203.021 11.751 1.00 20.43  ? 634  VAL A CB    1 
ATOM   5679 C  CG1   . VAL C 3  628 ? 39.327 203.706 11.582 1.00 19.65  ? 634  VAL A CG1   1 
ATOM   5680 C  CG2   . VAL C 3  628 ? 40.462 201.598 12.241 1.00 16.14  ? 634  VAL A CG2   1 
ATOM   5681 N  N     . GLU C 3  629 ? 42.229 205.300 10.131 1.00 24.62  ? 635  GLU A N     1 
ATOM   5682 C  CA    . GLU C 3  629 ? 42.190 206.639 9.555  1.00 28.62  ? 635  GLU A CA    1 
ATOM   5683 C  C     . GLU C 3  629 ? 42.612 206.595 8.098  1.00 28.09  ? 635  GLU A C     1 
ATOM   5684 O  O     . GLU C 3  629 ? 42.343 207.522 7.343  1.00 30.20  ? 635  GLU A O     1 
ATOM   5685 C  CB    . GLU C 3  629 ? 43.079 207.613 10.342 1.00 32.69  ? 635  GLU A CB    1 
ATOM   5686 C  CG    . GLU C 3  629 ? 44.550 207.246 10.391 1.00 40.94  ? 635  GLU A CG    1 
ATOM   5687 C  CD    . GLU C 3  629 ? 45.360 208.175 11.290 1.00 44.98  ? 635  GLU A CD    1 
ATOM   5688 O  OE1   . GLU C 3  629 ? 44.907 208.463 12.426 1.00 45.04  ? 635  GLU A OE1   1 
ATOM   5689 O  OE2   . GLU C 3  629 ? 46.456 208.605 10.864 1.00 46.34  ? 635  GLU A OE2   1 
ATOM   5690 N  N     . LYS C 3  630 ? 43.267 205.508 7.704  1.00 27.89  ? 636  LYS A N     1 
ATOM   5691 C  CA    . LYS C 3  630 ? 43.699 205.336 6.324  1.00 26.85  ? 636  LYS A CA    1 
ATOM   5692 C  C     . LYS C 3  630 ? 42.592 204.672 5.510  1.00 26.35  ? 636  LYS A C     1 
ATOM   5693 O  O     . LYS C 3  630 ? 42.803 204.291 4.361  1.00 25.83  ? 636  LYS A O     1 
ATOM   5694 C  CB    . LYS C 3  630 ? 44.974 204.485 6.253  1.00 27.29  ? 636  LYS A CB    1 
ATOM   5695 C  CG    . LYS C 3  630 ? 46.208 205.171 6.823  1.00 28.02  ? 636  LYS A CG    1 
ATOM   5696 C  CD    . LYS C 3  630 ? 47.463 204.329 6.641  1.00 26.57  ? 636  LYS A CD    1 
ATOM   5697 C  CE    . LYS C 3  630 ? 48.690 205.068 7.164  1.00 24.78  ? 636  LYS A CE    1 
ATOM   5698 N  NZ    . LYS C 3  630 ? 49.943 204.268 7.016  1.00 24.66  ? 636  LYS A NZ    1 
ATOM   5699 N  N     . GLY C 3  631 ? 41.416 204.524 6.116  1.00 25.12  ? 637  GLY A N     1 
ATOM   5700 C  CA    . GLY C 3  631 ? 40.296 203.917 5.417  1.00 23.28  ? 637  GLY A CA    1 
ATOM   5701 C  C     . GLY C 3  631 ? 40.185 202.405 5.521  1.00 23.42  ? 637  GLY A C     1 
ATOM   5702 O  O     . GLY C 3  631 ? 39.213 201.823 5.061  1.00 24.02  ? 637  GLY A O     1 
ATOM   5703 N  N     . LEU C 3  632 ? 41.176 201.757 6.117  1.00 22.72  ? 638  LEU A N     1 
ATOM   5704 C  CA    . LEU C 3  632 ? 41.134 200.307 6.264  1.00 21.23  ? 638  LEU A CA    1 
ATOM   5705 C  C     . LEU C 3  632 ? 40.102 199.912 7.312  1.00 21.40  ? 638  LEU A C     1 
ATOM   5706 O  O     . LEU C 3  632 ? 39.949 200.594 8.320  1.00 21.85  ? 638  LEU A O     1 
ATOM   5707 C  CB    . LEU C 3  632 ? 42.515 199.789 6.668  1.00 22.71  ? 638  LEU A CB    1 
ATOM   5708 C  CG    . LEU C 3  632 ? 43.532 199.515 5.553  1.00 23.45  ? 638  LEU A CG    1 
ATOM   5709 C  CD1   . LEU C 3  632 ? 43.328 200.446 4.387  1.00 24.46  ? 638  LEU A CD1   1 
ATOM   5710 C  CD2   . LEU C 3  632 ? 44.925 199.643 6.121  1.00 23.30  ? 638  LEU A CD2   1 
ATOM   5711 N  N     . LYS C 3  633 ? 39.386 198.820 7.067  1.00 21.51  ? 639  LYS A N     1 
ATOM   5712 C  CA    . LYS C 3  633 ? 38.377 198.345 8.009  1.00 23.09  ? 639  LYS A CA    1 
ATOM   5713 C  C     . LYS C 3  633 ? 38.869 197.103 8.762  1.00 22.37  ? 639  LYS A C     1 
ATOM   5714 O  O     . LYS C 3  633 ? 39.412 196.168 8.169  1.00 23.31  ? 639  LYS A O     1 
ATOM   5715 C  CB    . LYS C 3  633 ? 37.074 198.018 7.279  1.00 25.59  ? 639  LYS A CB    1 
ATOM   5716 C  CG    . LYS C 3  633 ? 35.982 197.504 8.202  1.00 30.06  ? 639  LYS A CG    1 
ATOM   5717 C  CD    . LYS C 3  633 ? 34.762 197.032 7.420  1.00 35.09  ? 639  LYS A CD    1 
ATOM   5718 C  CE    . LYS C 3  633 ? 33.628 196.612 8.357  1.00 37.23  ? 639  LYS A CE    1 
ATOM   5719 N  NZ    . LYS C 3  633 ? 33.138 197.744 9.208  1.00 38.44  ? 639  LYS A NZ    1 
ATOM   5720 N  N     . HIS C 3  634 ? 38.652 197.094 10.070 1.00 20.78  ? 640  HIS A N     1 
ATOM   5721 C  CA    . HIS C 3  634 ? 39.095 195.996 10.920 1.00 17.35  ? 640  HIS A CA    1 
ATOM   5722 C  C     . HIS C 3  634 ? 38.059 194.882 11.014 1.00 15.94  ? 640  HIS A C     1 
ATOM   5723 O  O     . HIS C 3  634 ? 37.031 195.046 11.659 1.00 15.87  ? 640  HIS A O     1 
ATOM   5724 C  CB    . HIS C 3  634 ? 39.414 196.547 12.311 1.00 16.22  ? 640  HIS A CB    1 
ATOM   5725 C  CG    . HIS C 3  634 ? 40.114 195.573 13.204 1.00 17.57  ? 640  HIS A CG    1 
ATOM   5726 N  ND1   . HIS C 3  634 ? 40.716 195.950 14.384 1.00 15.51  ? 640  HIS A ND1   1 
ATOM   5727 C  CD2   . HIS C 3  634 ? 40.332 194.242 13.077 1.00 17.22  ? 640  HIS A CD2   1 
ATOM   5728 C  CE1   . HIS C 3  634 ? 41.281 194.894 14.943 1.00 17.49  ? 640  HIS A CE1   1 
ATOM   5729 N  NE2   . HIS C 3  634 ? 41.064 193.845 14.170 1.00 16.39  ? 640  HIS A NE2   1 
ATOM   5730 N  N     . GLY C 3  635 ? 38.338 193.754 10.364 1.00 14.39  ? 641  GLY A N     1 
ATOM   5731 C  CA    . GLY C 3  635 ? 37.424 192.620 10.384 1.00 14.38  ? 641  GLY A CA    1 
ATOM   5732 C  C     . GLY C 3  635 ? 37.586 191.671 9.201  1.00 15.80  ? 641  GLY A C     1 
ATOM   5733 O  O     . GLY C 3  635 ? 38.229 192.007 8.209  1.00 15.34  ? 641  GLY A O     1 
ATOM   5734 N  N     . TRP C 3  636 ? 37.004 190.478 9.291  1.00 15.75  ? 642  TRP A N     1 
ATOM   5735 C  CA    . TRP C 3  636 ? 37.117 189.525 8.190  1.00 14.55  ? 642  TRP A CA    1 
ATOM   5736 C  C     . TRP C 3  636 ? 36.252 189.988 7.021  1.00 14.48  ? 642  TRP A C     1 
ATOM   5737 O  O     . TRP C 3  636 ? 36.413 189.533 5.898  1.00 14.98  ? 642  TRP A O     1 
ATOM   5738 C  CB    . TRP C 3  636 ? 36.701 188.119 8.639  1.00 11.51  ? 642  TRP A CB    1 
ATOM   5739 C  CG    . TRP C 3  636 ? 37.540 187.554 9.754  1.00 10.77  ? 642  TRP A CG    1 
ATOM   5740 C  CD1   . TRP C 3  636 ? 37.105 187.185 10.991 1.00 10.65  ? 642  TRP A CD1   1 
ATOM   5741 C  CD2   . TRP C 3  636 ? 38.954 187.279 9.729  1.00 9.93   ? 642  TRP A CD2   1 
ATOM   5742 N  NE1   . TRP C 3  636 ? 38.151 186.698 11.739 1.00 9.03   ? 642  TRP A NE1   1 
ATOM   5743 C  CE2   . TRP C 3  636 ? 39.296 186.742 10.994 1.00 8.73   ? 642  TRP A CE2   1 
ATOM   5744 C  CE3   . TRP C 3  636 ? 39.962 187.436 8.766  1.00 8.88   ? 642  TRP A CE3   1 
ATOM   5745 C  CZ2   . TRP C 3  636 ? 40.604 186.357 11.322 1.00 8.00   ? 642  TRP A CZ2   1 
ATOM   5746 C  CZ3   . TRP C 3  636 ? 41.267 187.054 9.091  1.00 10.26  ? 642  TRP A CZ3   1 
ATOM   5747 C  CH2   . TRP C 3  636 ? 41.574 186.520 10.362 1.00 9.14   ? 642  TRP A CH2   1 
ATOM   5748 N  N     . ASP C 3  637 ? 35.332 190.901 7.298  1.00 14.91  ? 643  ASP A N     1 
ATOM   5749 C  CA    . ASP C 3  637 ? 34.466 191.453 6.263  1.00 15.84  ? 643  ASP A CA    1 
ATOM   5750 C  C     . ASP C 3  637 ? 35.070 192.807 5.882  1.00 16.72  ? 643  ASP A C     1 
ATOM   5751 O  O     . ASP C 3  637 ? 34.390 193.687 5.351  1.00 17.39  ? 643  ASP A O     1 
ATOM   5752 C  CB    . ASP C 3  637 ? 33.045 191.641 6.806  1.00 16.20  ? 643  ASP A CB    1 
ATOM   5753 C  CG    . ASP C 3  637 ? 32.995 192.586 8.001  1.00 22.06  ? 643  ASP A CG    1 
ATOM   5754 O  OD1   . ASP C 3  637 ? 34.043 192.765 8.669  1.00 21.60  ? 643  ASP A OD1   1 
ATOM   5755 O  OD2   . ASP C 3  637 ? 31.905 193.138 8.281  1.00 23.82  ? 643  ASP A OD2   1 
ATOM   5756 N  N     . GLY C 3  638 ? 36.360 192.962 6.164  1.00 15.49  ? 644  GLY A N     1 
ATOM   5757 C  CA    . GLY C 3  638 ? 37.034 194.208 5.864  1.00 15.19  ? 644  GLY A CA    1 
ATOM   5758 C  C     . GLY C 3  638 ? 38.379 194.024 5.193  1.00 13.80  ? 644  GLY A C     1 
ATOM   5759 O  O     . GLY C 3  638 ? 38.492 193.271 4.232  1.00 13.88  ? 644  GLY A O     1 
ATOM   5760 N  N     . ASP C 3  639 ? 39.403 194.686 5.727  1.00 14.08  ? 645  ASP A N     1 
ATOM   5761 C  CA    . ASP C 3  639 ? 40.745 194.636 5.160  1.00 14.11  ? 645  ASP A CA    1 
ATOM   5762 C  C     . ASP C 3  639 ? 41.806 193.963 6.018  1.00 14.32  ? 645  ASP A C     1 
ATOM   5763 O  O     . ASP C 3  639 ? 42.708 193.305 5.491  1.00 15.01  ? 645  ASP A O     1 
ATOM   5764 C  CB    . ASP C 3  639 ? 41.180 196.056 4.824  1.00 14.75  ? 645  ASP A CB    1 
ATOM   5765 C  CG    . ASP C 3  639 ? 40.127 196.792 4.031  1.00 16.77  ? 645  ASP A CG    1 
ATOM   5766 O  OD1   . ASP C 3  639 ? 39.839 196.362 2.887  1.00 18.35  ? 645  ASP A OD1   1 
ATOM   5767 O  OD2   . ASP C 3  639 ? 39.568 197.780 4.559  1.00 16.38  ? 645  ASP A OD2   1 
ATOM   5768 N  N     . PHE C 3  640 ? 41.717 194.130 7.334  1.00 13.36  ? 646  PHE A N     1 
ATOM   5769 C  CA    . PHE C 3  640 ? 42.689 193.514 8.226  1.00 11.94  ? 646  PHE A CA    1 
ATOM   5770 C  C     . PHE C 3  640 ? 42.030 193.017 9.508  1.00 12.27  ? 646  PHE A C     1 
ATOM   5771 O  O     . PHE C 3  640 ? 40.939 193.460 9.871  1.00 11.39  ? 646  PHE A O     1 
ATOM   5772 C  CB    . PHE C 3  640 ? 43.803 194.509 8.578  1.00 11.41  ? 646  PHE A CB    1 
ATOM   5773 C  CG    . PHE C 3  640 ? 43.357 195.618 9.489  1.00 11.54  ? 646  PHE A CG    1 
ATOM   5774 C  CD1   . PHE C 3  640 ? 42.747 196.760 8.978  1.00 11.13  ? 646  PHE A CD1   1 
ATOM   5775 C  CD2   . PHE C 3  640 ? 43.517 195.503 10.867 1.00 10.34  ? 646  PHE A CD2   1 
ATOM   5776 C  CE1   . PHE C 3  640 ? 42.302 197.772 9.827  1.00 13.27  ? 646  PHE A CE1   1 
ATOM   5777 C  CE2   . PHE C 3  640 ? 43.076 196.506 11.728 1.00 11.95  ? 646  PHE A CE2   1 
ATOM   5778 C  CZ    . PHE C 3  640 ? 42.468 197.642 11.209 1.00 13.54  ? 646  PHE A CZ    1 
ATOM   5779 N  N     . ALA C 3  641 ? 42.702 192.097 10.194 1.00 11.55  ? 647  ALA A N     1 
ATOM   5780 C  CA    . ALA C 3  641 ? 42.178 191.557 11.440 1.00 9.99   ? 647  ALA A CA    1 
ATOM   5781 C  C     . ALA C 3  641 ? 43.283 191.159 12.415 1.00 11.07  ? 647  ALA A C     1 
ATOM   5782 O  O     . ALA C 3  641 ? 44.149 190.343 12.092 1.00 11.61  ? 647  ALA A O     1 
ATOM   5783 C  CB    . ALA C 3  641 ? 41.285 190.353 11.155 1.00 10.70  ? 647  ALA A CB    1 
ATOM   5784 N  N     . TYR C 3  642 ? 43.263 191.761 13.600 1.00 11.04  ? 648  TYR A N     1 
ATOM   5785 C  CA    . TYR C 3  642 ? 44.228 191.424 14.629 1.00 11.13  ? 648  TYR A CA    1 
ATOM   5786 C  C     . TYR C 3  642 ? 43.952 189.954 14.956 1.00 12.48  ? 648  TYR A C     1 
ATOM   5787 O  O     . TYR C 3  642 ? 42.796 189.560 15.141 1.00 10.55  ? 648  TYR A O     1 
ATOM   5788 C  CB    . TYR C 3  642 ? 43.998 192.284 15.877 1.00 10.45  ? 648  TYR A CB    1 
ATOM   5789 C  CG    . TYR C 3  642 ? 44.775 193.585 15.891 1.00 12.69  ? 648  TYR A CG    1 
ATOM   5790 C  CD1   . TYR C 3  642 ? 44.734 194.460 14.805 1.00 11.82  ? 648  TYR A CD1   1 
ATOM   5791 C  CD2   . TYR C 3  642 ? 45.553 193.940 16.990 1.00 12.79  ? 648  TYR A CD2   1 
ATOM   5792 C  CE1   . TYR C 3  642 ? 45.448 195.649 14.817 1.00 10.68  ? 648  TYR A CE1   1 
ATOM   5793 C  CE2   . TYR C 3  642 ? 46.272 195.128 17.010 1.00 12.48  ? 648  TYR A CE2   1 
ATOM   5794 C  CZ    . TYR C 3  642 ? 46.216 195.976 15.924 1.00 12.92  ? 648  TYR A CZ    1 
ATOM   5795 O  OH    . TYR C 3  642 ? 46.931 197.151 15.948 1.00 14.29  ? 648  TYR A OH    1 
ATOM   5796 N  N     . MET C 3  643 ? 45.002 189.140 14.997 1.00 11.83  ? 649  MET A N     1 
ATOM   5797 C  CA    . MET C 3  643 ? 44.837 187.726 15.301 1.00 11.48  ? 649  MET A CA    1 
ATOM   5798 C  C     . MET C 3  643 ? 45.518 187.409 16.628 1.00 11.73  ? 649  MET A C     1 
ATOM   5799 O  O     . MET C 3  643 ? 45.028 186.595 17.410 1.00 9.34   ? 649  MET A O     1 
ATOM   5800 C  CB    . MET C 3  643 ? 45.425 186.860 14.175 1.00 9.01   ? 649  MET A CB    1 
ATOM   5801 C  CG    . MET C 3  643 ? 44.878 187.205 12.793 1.00 9.07   ? 649  MET A CG    1 
ATOM   5802 S  SD    . MET C 3  643 ? 45.423 186.096 11.478 1.00 12.02  ? 649  MET A SD    1 
ATOM   5803 C  CE    . MET C 3  643 ? 47.189 186.504 11.362 1.00 2.57   ? 649  MET A CE    1 
ATOM   5804 N  N     . ALA C 3  644 ? 46.644 188.065 16.888 1.00 10.95  ? 650  ALA A N     1 
ATOM   5805 C  CA    . ALA C 3  644 ? 47.340 187.825 18.135 1.00 10.49  ? 650  ALA A CA    1 
ATOM   5806 C  C     . ALA C 3  644 ? 48.282 188.950 18.544 1.00 9.35   ? 650  ALA A C     1 
ATOM   5807 O  O     . ALA C 3  644 ? 48.892 189.611 17.706 1.00 8.57   ? 650  ALA A O     1 
ATOM   5808 C  CB    . ALA C 3  644 ? 48.115 186.520 18.042 1.00 9.48   ? 650  ALA A CB    1 
ATOM   5809 N  N     . TRP C 3  645 ? 48.383 189.152 19.848 1.00 8.40   ? 651  TRP A N     1 
ATOM   5810 C  CA    . TRP C 3  645 ? 49.283 190.137 20.411 1.00 10.07  ? 651  TRP A CA    1 
ATOM   5811 C  C     . TRP C 3  645 ? 50.115 189.378 21.431 1.00 8.98   ? 651  TRP A C     1 
ATOM   5812 O  O     . TRP C 3  645 ? 49.598 188.937 22.446 1.00 10.27  ? 651  TRP A O     1 
ATOM   5813 C  CB    . TRP C 3  645 ? 48.517 191.275 21.096 1.00 9.39   ? 651  TRP A CB    1 
ATOM   5814 C  CG    . TRP C 3  645 ? 49.449 192.238 21.787 1.00 10.21  ? 651  TRP A CG    1 
ATOM   5815 C  CD1   . TRP C 3  645 ? 50.677 192.640 21.349 1.00 9.84   ? 651  TRP A CD1   1 
ATOM   5816 C  CD2   . TRP C 3  645 ? 49.234 192.904 23.037 1.00 11.34  ? 651  TRP A CD2   1 
ATOM   5817 N  NE1   . TRP C 3  645 ? 51.243 193.510 22.246 1.00 9.56   ? 651  TRP A NE1   1 
ATOM   5818 C  CE2   . TRP C 3  645 ? 50.380 193.690 23.293 1.00 12.12  ? 651  TRP A CE2   1 
ATOM   5819 C  CE3   . TRP C 3  645 ? 48.189 192.909 23.967 1.00 10.35  ? 651  TRP A CE3   1 
ATOM   5820 C  CZ2   . TRP C 3  645 ? 50.509 194.478 24.442 1.00 13.05  ? 651  TRP A CZ2   1 
ATOM   5821 C  CZ3   . TRP C 3  645 ? 48.317 193.693 25.111 1.00 12.89  ? 651  TRP A CZ3   1 
ATOM   5822 C  CH2   . TRP C 3  645 ? 49.471 194.464 25.337 1.00 13.38  ? 651  TRP A CH2   1 
ATOM   5823 N  N     . VAL C 3  646 ? 51.400 189.211 21.155 1.00 11.14  ? 652  VAL A N     1 
ATOM   5824 C  CA    . VAL C 3  646 ? 52.280 188.482 22.066 1.00 12.02  ? 652  VAL A CA    1 
ATOM   5825 C  C     . VAL C 3  646 ? 53.410 189.362 22.613 1.00 13.49  ? 652  VAL A C     1 
ATOM   5826 O  O     . VAL C 3  646 ? 54.552 189.296 22.153 1.00 15.53  ? 652  VAL A O     1 
ATOM   5827 C  CB    . VAL C 3  646 ? 52.868 187.230 21.359 1.00 11.70  ? 652  VAL A CB    1 
ATOM   5828 C  CG1   . VAL C 3  646 ? 53.875 186.541 22.252 1.00 8.83   ? 652  VAL A CG1   1 
ATOM   5829 C  CG2   . VAL C 3  646 ? 51.730 186.259 21.001 1.00 8.48   ? 652  VAL A CG2   1 
ATOM   5830 N  N     . HIS C 3  647 ? 53.061 190.193 23.593 1.00 12.79  ? 653  HIS A N     1 
ATOM   5831 C  CA    . HIS C 3  647 ? 53.986 191.108 24.261 1.00 13.33  ? 653  HIS A CA    1 
ATOM   5832 C  C     . HIS C 3  647 ? 54.536 192.234 23.391 1.00 14.81  ? 653  HIS A C     1 
ATOM   5833 O  O     . HIS C 3  647 ? 54.101 193.374 23.515 1.00 16.84  ? 653  HIS A O     1 
ATOM   5834 C  CB    . HIS C 3  647 ? 55.128 190.313 24.898 1.00 13.25  ? 653  HIS A CB    1 
ATOM   5835 C  CG    . HIS C 3  647 ? 54.651 189.236 25.816 1.00 13.05  ? 653  HIS A CG    1 
ATOM   5836 N  ND1   . HIS C 3  647 ? 53.843 189.494 26.904 1.00 12.61  ? 653  HIS A ND1   1 
ATOM   5837 C  CD2   . HIS C 3  647 ? 54.796 187.892 25.764 1.00 11.61  ? 653  HIS A CD2   1 
ATOM   5838 C  CE1   . HIS C 3  647 ? 53.507 188.353 27.477 1.00 13.64  ? 653  HIS A CE1   1 
ATOM   5839 N  NE2   . HIS C 3  647 ? 54.071 187.366 26.805 1.00 10.01  ? 653  HIS A NE2   1 
ATOM   5840 N  N     . ASP C 3  648 ? 55.487 191.937 22.516 1.00 15.02  ? 654  ASP A N     1 
ATOM   5841 C  CA    . ASP C 3  648 ? 56.036 192.984 21.672 1.00 16.06  ? 654  ASP A CA    1 
ATOM   5842 C  C     . ASP C 3  648 ? 55.885 192.658 20.195 1.00 15.64  ? 654  ASP A C     1 
ATOM   5843 O  O     . ASP C 3  648 ? 56.609 193.196 19.358 1.00 15.65  ? 654  ASP A O     1 
ATOM   5844 C  CB    . ASP C 3  648 ? 57.509 193.220 22.016 1.00 18.58  ? 654  ASP A CB    1 
ATOM   5845 C  CG    . ASP C 3  648 ? 58.398 192.071 21.589 1.00 23.42  ? 654  ASP A CG    1 
ATOM   5846 O  OD1   . ASP C 3  648 ? 57.928 190.909 21.603 1.00 22.15  ? 654  ASP A OD1   1 
ATOM   5847 O  OD2   . ASP C 3  648 ? 59.572 192.336 21.249 1.00 24.90  ? 654  ASP A OD2   1 
ATOM   5848 N  N     . GLU C 3  649 ? 54.949 191.769 19.877 1.00 14.81  ? 655  GLU A N     1 
ATOM   5849 C  CA    . GLU C 3  649 ? 54.709 191.402 18.493 1.00 15.66  ? 655  GLU A CA    1 
ATOM   5850 C  C     . GLU C 3  649 ? 53.221 191.226 18.209 1.00 13.91  ? 655  GLU A C     1 
ATOM   5851 O  O     . GLU C 3  649 ? 52.453 190.792 19.067 1.00 12.48  ? 655  GLU A O     1 
ATOM   5852 C  CB    . GLU C 3  649 ? 55.436 190.099 18.124 1.00 16.91  ? 655  GLU A CB    1 
ATOM   5853 C  CG    . GLU C 3  649 ? 54.638 188.858 18.451 1.00 22.41  ? 655  GLU A CG    1 
ATOM   5854 C  CD    . GLU C 3  649 ? 55.244 187.576 17.908 1.00 22.82  ? 655  GLU A CD    1 
ATOM   5855 O  OE1   . GLU C 3  649 ? 55.227 187.359 16.680 1.00 22.05  ? 655  GLU A OE1   1 
ATOM   5856 O  OE2   . GLU C 3  649 ? 55.736 186.779 18.722 1.00 24.64  ? 655  GLU A OE2   1 
ATOM   5857 N  N     . ILE C 3  650 ? 52.812 191.595 17.005 1.00 11.97  ? 656  ILE A N     1 
ATOM   5858 C  CA    . ILE C 3  650 ? 51.430 191.409 16.617 1.00 12.52  ? 656  ILE A CA    1 
ATOM   5859 C  C     . ILE C 3  650 ? 51.430 190.634 15.320 1.00 11.84  ? 656  ILE A C     1 
ATOM   5860 O  O     . ILE C 3  650 ? 52.371 190.714 14.525 1.00 10.96  ? 656  ILE A O     1 
ATOM   5861 C  CB    . ILE C 3  650 ? 50.675 192.743 16.409 1.00 12.97  ? 656  ILE A CB    1 
ATOM   5862 C  CG1   . ILE C 3  650 ? 51.520 193.706 15.578 1.00 11.72  ? 656  ILE A CG1   1 
ATOM   5863 C  CG2   . ILE C 3  650 ? 50.273 193.333 17.763 1.00 11.82  ? 656  ILE A CG2   1 
ATOM   5864 C  CD1   . ILE C 3  650 ? 50.821 195.035 15.288 1.00 11.40  ? 656  ILE A CD1   1 
ATOM   5865 N  N     . GLN C 3  651 ? 50.388 189.843 15.134 1.00 11.27  ? 657  GLN A N     1 
ATOM   5866 C  CA    . GLN C 3  651 ? 50.236 189.069 13.915 1.00 11.53  ? 657  GLN A CA    1 
ATOM   5867 C  C     . GLN C 3  651 ? 48.887 189.530 13.404 1.00 11.40  ? 657  GLN A C     1 
ATOM   5868 O  O     . GLN C 3  651 ? 47.881 189.406 14.104 1.00 9.31   ? 657  GLN A O     1 
ATOM   5869 C  CB    . GLN C 3  651 ? 50.235 187.573 14.225 1.00 10.88  ? 657  GLN A CB    1 
ATOM   5870 C  CG    . GLN C 3  651 ? 51.590 187.041 14.700 1.00 12.67  ? 657  GLN A CG    1 
ATOM   5871 C  CD    . GLN C 3  651 ? 52.682 187.232 13.660 1.00 12.77  ? 657  GLN A CD    1 
ATOM   5872 O  OE1   . GLN C 3  651 ? 52.421 187.187 12.467 1.00 14.60  ? 657  GLN A OE1   1 
ATOM   5873 N  NE2   . GLN C 3  651 ? 53.908 187.428 14.111 1.00 14.45  ? 657  GLN A NE2   1 
ATOM   5874 N  N     . VAL C 3  652 ? 48.878 190.086 12.196 1.00 12.58  ? 658  VAL A N     1 
ATOM   5875 C  CA    . VAL C 3  652 ? 47.652 190.606 11.609 1.00 13.61  ? 658  VAL A CA    1 
ATOM   5876 C  C     . VAL C 3  652 ? 47.278 189.966 10.279 1.00 14.36  ? 658  VAL A C     1 
ATOM   5877 O  O     . VAL C 3  652 ? 48.106 189.849 9.375  1.00 15.14  ? 658  VAL A O     1 
ATOM   5878 C  CB    . VAL C 3  652 ? 47.761 192.149 11.404 1.00 13.34  ? 658  VAL A CB    1 
ATOM   5879 C  CG1   . VAL C 3  652 ? 46.443 192.715 10.905 1.00 11.31  ? 658  VAL A CG1   1 
ATOM   5880 C  CG2   . VAL C 3  652 ? 48.170 192.821 12.718 1.00 11.15  ? 658  VAL A CG2   1 
ATOM   5881 N  N     . GLY C 3  653 ? 46.022 189.550 10.165 1.00 14.82  ? 659  GLY A N     1 
ATOM   5882 C  CA    . GLY C 3  653 ? 45.558 188.965 8.921  1.00 12.56  ? 659  GLY A CA    1 
ATOM   5883 C  C     . GLY C 3  653 ? 45.197 190.100 7.982  1.00 13.42  ? 659  GLY A C     1 
ATOM   5884 O  O     . GLY C 3  653 ? 44.577 191.088 8.398  1.00 11.65  ? 659  GLY A O     1 
ATOM   5885 N  N     . CYS C 3  654 ? 45.586 189.974 6.717  1.00 13.76  ? 660  CYS A N     1 
ATOM   5886 C  CA    . CYS C 3  654 ? 45.299 191.010 5.724  1.00 14.99  ? 660  CYS A CA    1 
ATOM   5887 C  C     . CYS C 3  654 ? 44.662 190.391 4.490  1.00 16.17  ? 660  CYS A C     1 
ATOM   5888 O  O     . CYS C 3  654 ? 45.037 189.293 4.065  1.00 16.91  ? 660  CYS A O     1 
ATOM   5889 C  CB    . CYS C 3  654 ? 46.586 191.734 5.328  1.00 14.67  ? 660  CYS A CB    1 
ATOM   5890 S  SG    . CYS C 3  654 ? 47.530 192.378 6.722  1.00 16.43  ? 660  CYS A SG    1 
ATOM   5891 N  N     . ARG C 3  655 ? 43.701 191.097 3.910  1.00 14.38  ? 661  ARG A N     1 
ATOM   5892 C  CA    . ARG C 3  655 ? 43.017 190.588 2.736  1.00 13.15  ? 661  ARG A CA    1 
ATOM   5893 C  C     . ARG C 3  655 ? 43.932 190.545 1.511  1.00 13.33  ? 661  ARG A C     1 
ATOM   5894 O  O     . ARG C 3  655 ? 43.746 189.709 0.629  1.00 13.22  ? 661  ARG A O     1 
ATOM   5895 C  CB    . ARG C 3  655 ? 41.772 191.436 2.457  1.00 11.83  ? 661  ARG A CB    1 
ATOM   5896 C  CG    . ARG C 3  655 ? 40.921 190.957 1.291  1.00 11.87  ? 661  ARG A CG    1 
ATOM   5897 C  CD    . ARG C 3  655 ? 39.546 191.638 1.288  1.00 12.75  ? 661  ARG A CD    1 
ATOM   5898 N  NE    . ARG C 3  655 ? 39.668 193.090 1.323  1.00 11.48  ? 661  ARG A NE    1 
ATOM   5899 C  CZ    . ARG C 3  655 ? 40.186 193.820 0.342  1.00 12.54  ? 661  ARG A CZ    1 
ATOM   5900 N  NH1   . ARG C 3  655 ? 40.621 193.241 -0.773 1.00 10.41  ? 661  ARG A NH1   1 
ATOM   5901 N  NH2   . ARG C 3  655 ? 40.319 195.128 0.502  1.00 12.01  ? 661  ARG A NH2   1 
ATOM   5902 N  N     . THR C 3  656 ? 44.924 191.432 1.458  1.00 12.68  ? 662  THR A N     1 
ATOM   5903 C  CA    . THR C 3  656 ? 45.842 191.471 0.316  1.00 13.32  ? 662  THR A CA    1 
ATOM   5904 C  C     . THR C 3  656 ? 47.288 191.749 0.720  1.00 14.53  ? 662  THR A C     1 
ATOM   5905 O  O     . THR C 3  656 ? 47.561 192.222 1.824  1.00 14.73  ? 662  THR A O     1 
ATOM   5906 C  CB    . THR C 3  656 ? 45.448 192.563 -0.694 1.00 12.70  ? 662  THR A CB    1 
ATOM   5907 O  OG1   . THR C 3  656 ? 45.787 193.853 -0.159 1.00 11.49  ? 662  THR A OG1   1 
ATOM   5908 C  CG2   . THR C 3  656 ? 43.964 192.510 -0.979 1.00 11.34  ? 662  THR A CG2   1 
ATOM   5909 N  N     . GLU C 3  657 ? 48.216 191.464 -0.186 1.00 16.15  ? 663  GLU A N     1 
ATOM   5910 C  CA    . GLU C 3  657 ? 49.621 191.701 0.090  1.00 18.97  ? 663  GLU A CA    1 
ATOM   5911 C  C     . GLU C 3  657 ? 49.842 193.193 0.266  1.00 18.25  ? 663  GLU A C     1 
ATOM   5912 O  O     . GLU C 3  657 ? 50.621 193.619 1.112  1.00 19.91  ? 663  GLU A O     1 
ATOM   5913 C  CB    . GLU C 3  657 ? 50.496 191.188 -1.054 1.00 20.46  ? 663  GLU A CB    1 
ATOM   5914 C  CG    . GLU C 3  657 ? 50.363 189.706 -1.324 1.00 25.66  ? 663  GLU A CG    1 
ATOM   5915 C  CD    . GLU C 3  657 ? 51.703 189.037 -1.589 1.00 29.23  ? 663  GLU A CD    1 
ATOM   5916 O  OE1   . GLU C 3  657 ? 52.555 189.646 -2.281 1.00 29.86  ? 663  GLU A OE1   1 
ATOM   5917 O  OE2   . GLU C 3  657 ? 51.896 187.896 -1.110 1.00 31.04  ? 663  GLU A OE2   1 
ATOM   5918 N  N     . GLU C 3  658 ? 49.153 193.984 -0.543 1.00 18.08  ? 664  GLU A N     1 
ATOM   5919 C  CA    . GLU C 3  658 ? 49.278 195.427 -0.472 1.00 19.09  ? 664  GLU A CA    1 
ATOM   5920 C  C     . GLU C 3  658 ? 48.914 195.926 0.928  1.00 17.15  ? 664  GLU A C     1 
ATOM   5921 O  O     . GLU C 3  658 ? 49.627 196.739 1.511  1.00 17.41  ? 664  GLU A O     1 
ATOM   5922 C  CB    . GLU C 3  658 ? 48.366 196.079 -1.513 1.00 22.85  ? 664  GLU A CB    1 
ATOM   5923 C  CG    . GLU C 3  658 ? 48.602 197.564 -1.692 1.00 32.04  ? 664  GLU A CG    1 
ATOM   5924 C  CD    . GLU C 3  658 ? 47.732 198.170 -2.784 1.00 38.13  ? 664  GLU A CD    1 
ATOM   5925 O  OE1   . GLU C 3  658 ? 47.640 197.565 -3.879 1.00 41.39  ? 664  GLU A OE1   1 
ATOM   5926 O  OE2   . GLU C 3  658 ? 47.153 199.256 -2.551 1.00 39.96  ? 664  GLU A OE2   1 
ATOM   5927 N  N     . ILE C 3  659 ? 47.797 195.443 1.462  1.00 15.28  ? 665  ILE A N     1 
ATOM   5928 C  CA    . ILE C 3  659 ? 47.363 195.846 2.789  1.00 15.50  ? 665  ILE A CA    1 
ATOM   5929 C  C     . ILE C 3  659 ? 48.395 195.394 3.826  1.00 15.50  ? 665  ILE A C     1 
ATOM   5930 O  O     . ILE C 3  659 ? 48.735 196.142 4.738  1.00 15.56  ? 665  ILE A O     1 
ATOM   5931 C  CB    . ILE C 3  659 ? 45.957 195.268 3.111  1.00 15.13  ? 665  ILE A CB    1 
ATOM   5932 C  CG1   . ILE C 3  659 ? 44.918 195.943 2.207  1.00 15.55  ? 665  ILE A CG1   1 
ATOM   5933 C  CG2   . ILE C 3  659 ? 45.589 195.527 4.564  1.00 12.85  ? 665  ILE A CG2   1 
ATOM   5934 C  CD1   . ILE C 3  659 ? 43.532 195.336 2.272  1.00 13.58  ? 665  ILE A CD1   1 
ATOM   5935 N  N     . ALA C 3  660 ? 48.906 194.179 3.675  1.00 14.92  ? 666  ALA A N     1 
ATOM   5936 C  CA    . ALA C 3  660 ? 49.908 193.681 4.598  1.00 16.62  ? 666  ALA A CA    1 
ATOM   5937 C  C     . ALA C 3  660 ? 51.108 194.628 4.593  1.00 17.45  ? 666  ALA A C     1 
ATOM   5938 O  O     . ALA C 3  660 ? 51.670 194.934 5.644  1.00 18.84  ? 666  ALA A O     1 
ATOM   5939 C  CB    . ALA C 3  660 ? 50.342 192.280 4.198  1.00 14.88  ? 666  ALA A CB    1 
ATOM   5940 N  N     . GLN C 3  661 ? 51.496 195.093 3.409  1.00 18.00  ? 667  GLN A N     1 
ATOM   5941 C  CA    . GLN C 3  661 ? 52.627 196.002 3.298  1.00 19.45  ? 667  GLN A CA    1 
ATOM   5942 C  C     . GLN C 3  661 ? 52.288 197.291 4.050  1.00 17.04  ? 667  GLN A C     1 
ATOM   5943 O  O     . GLN C 3  661 ? 53.149 197.881 4.693  1.00 16.94  ? 667  GLN A O     1 
ATOM   5944 C  CB    . GLN C 3  661 ? 52.954 196.313 1.821  1.00 23.43  ? 667  GLN A CB    1 
ATOM   5945 C  CG    . GLN C 3  661 ? 54.308 197.032 1.620  1.00 31.79  ? 667  GLN A CG    1 
ATOM   5946 C  CD    . GLN C 3  661 ? 54.504 197.645 0.220  1.00 36.47  ? 667  GLN A CD    1 
ATOM   5947 O  OE1   . GLN C 3  661 ? 54.634 196.932 -0.784 1.00 37.70  ? 667  GLN A OE1   1 
ATOM   5948 N  NE2   . GLN C 3  661 ? 54.532 198.975 0.159  1.00 34.91  ? 667  GLN A NE2   1 
ATOM   5949 N  N     . VAL C 3  662 ? 51.032 197.722 3.985  1.00 14.48  ? 668  VAL A N     1 
ATOM   5950 C  CA    . VAL C 3  662 ? 50.638 198.938 4.686  1.00 13.09  ? 668  VAL A CA    1 
ATOM   5951 C  C     . VAL C 3  662 ? 50.551 198.715 6.198  1.00 13.68  ? 668  VAL A C     1 
ATOM   5952 O  O     . VAL C 3  662 ? 50.877 199.606 6.981  1.00 14.16  ? 668  VAL A O     1 
ATOM   5953 C  CB    . VAL C 3  662 ? 49.293 199.491 4.159  1.00 13.30  ? 668  VAL A CB    1 
ATOM   5954 C  CG1   . VAL C 3  662 ? 48.840 200.652 5.031  1.00 9.61   ? 668  VAL A CG1   1 
ATOM   5955 C  CG2   . VAL C 3  662 ? 49.452 199.963 2.706  1.00 9.50   ? 668  VAL A CG2   1 
ATOM   5956 N  N     . VAL C 3  663 ? 50.123 197.527 6.609  1.00 11.90  ? 669  VAL A N     1 
ATOM   5957 C  CA    . VAL C 3  663 ? 50.039 197.224 8.029  1.00 14.23  ? 669  VAL A CA    1 
ATOM   5958 C  C     . VAL C 3  663 ? 51.444 197.300 8.625  1.00 15.31  ? 669  VAL A C     1 
ATOM   5959 O  O     . VAL C 3  663 ? 51.667 197.894 9.686  1.00 15.50  ? 669  VAL A O     1 
ATOM   5960 C  CB    . VAL C 3  663 ? 49.463 195.810 8.271  1.00 13.50  ? 669  VAL A CB    1 
ATOM   5961 C  CG1   . VAL C 3  663 ? 49.626 195.417 9.738  1.00 10.63  ? 669  VAL A CG1   1 
ATOM   5962 C  CG2   . VAL C 3  663 ? 47.999 195.781 7.879  1.00 12.65  ? 669  VAL A CG2   1 
ATOM   5963 N  N     . ILE C 3  664 ? 52.393 196.696 7.923  1.00 16.30  ? 670  ILE A N     1 
ATOM   5964 C  CA    . ILE C 3  664 ? 53.781 196.688 8.359  1.00 16.86  ? 670  ILE A CA    1 
ATOM   5965 C  C     . ILE C 3  664 ? 54.378 198.100 8.427  1.00 16.45  ? 670  ILE A C     1 
ATOM   5966 O  O     . ILE C 3  664 ? 55.035 198.451 9.405  1.00 17.90  ? 670  ILE A O     1 
ATOM   5967 C  CB    . ILE C 3  664 ? 54.614 195.779 7.426  1.00 15.28  ? 670  ILE A CB    1 
ATOM   5968 C  CG1   . ILE C 3  664 ? 54.247 194.316 7.718  1.00 13.99  ? 670  ILE A CG1   1 
ATOM   5969 C  CG2   . ILE C 3  664 ? 56.097 196.075 7.575  1.00 11.45  ? 670  ILE A CG2   1 
ATOM   5970 C  CD1   . ILE C 3  664 ? 54.892 193.292 6.803  1.00 13.91  ? 670  ILE A CD1   1 
ATOM   5971 N  N     . GLU C 3  665 ? 54.137 198.914 7.408  1.00 14.41  ? 671  GLU A N     1 
ATOM   5972 C  CA    . GLU C 3  665 ? 54.664 200.272 7.407  1.00 16.06  ? 671  GLU A CA    1 
ATOM   5973 C  C     . GLU C 3  665 ? 53.991 201.123 8.485  1.00 16.66  ? 671  GLU A C     1 
ATOM   5974 O  O     . GLU C 3  665 ? 54.637 201.940 9.153  1.00 16.48  ? 671  GLU A O     1 
ATOM   5975 C  CB    . GLU C 3  665 ? 54.443 200.927 6.045  1.00 16.85  ? 671  GLU A CB    1 
ATOM   5976 C  CG    . GLU C 3  665 ? 55.017 200.141 4.870  1.00 22.31  ? 671  GLU A CG    1 
ATOM   5977 C  CD    . GLU C 3  665 ? 54.699 200.790 3.533  1.00 25.29  ? 671  GLU A CD    1 
ATOM   5978 O  OE1   . GLU C 3  665 ? 53.554 201.262 3.363  1.00 28.37  ? 671  GLU A OE1   1 
ATOM   5979 O  OE2   . GLU C 3  665 ? 55.584 200.821 2.649  1.00 28.68  ? 671  GLU A OE2   1 
ATOM   5980 N  N     . THR C 3  666 ? 52.688 200.935 8.647  1.00 14.92  ? 672  THR A N     1 
ATOM   5981 C  CA    . THR C 3  666 ? 51.938 201.696 9.628  1.00 14.59  ? 672  THR A CA    1 
ATOM   5982 C  C     . THR C 3  666 ? 52.376 201.350 11.044 1.00 15.71  ? 672  THR A C     1 
ATOM   5983 O  O     . THR C 3  666 ? 52.442 202.224 11.915 1.00 14.59  ? 672  THR A O     1 
ATOM   5984 C  CB    . THR C 3  666 ? 50.438 201.444 9.463  1.00 14.81  ? 672  THR A CB    1 
ATOM   5985 O  OG1   . THR C 3  666 ? 50.043 201.855 8.152  1.00 15.35  ? 672  THR A OG1   1 
ATOM   5986 C  CG2   . THR C 3  666 ? 49.637 202.226 10.492 1.00 13.63  ? 672  THR A CG2   1 
ATOM   5987 N  N     . ALA C 3  667 ? 52.680 200.076 11.269 1.00 15.78  ? 673  ALA A N     1 
ATOM   5988 C  CA    . ALA C 3  667 ? 53.128 199.627 12.580 1.00 17.30  ? 673  ALA A CA    1 
ATOM   5989 C  C     . ALA C 3  667 ? 54.414 200.375 12.973 1.00 17.05  ? 673  ALA A C     1 
ATOM   5990 O  O     . ALA C 3  667 ? 54.567 200.805 14.118 1.00 15.84  ? 673  ALA A O     1 
ATOM   5991 C  CB    . ALA C 3  667 ? 53.366 198.116 12.559 1.00 17.12  ? 673  ALA A CB    1 
ATOM   5992 N  N     . GLN C 3  668 ? 55.327 200.528 12.013 1.00 16.45  ? 674  GLN A N     1 
ATOM   5993 C  CA    . GLN C 3  668 ? 56.587 201.236 12.238 1.00 16.49  ? 674  GLN A CA    1 
ATOM   5994 C  C     . GLN C 3  668 ? 56.317 202.718 12.525 1.00 17.67  ? 674  GLN A C     1 
ATOM   5995 O  O     . GLN C 3  668 ? 56.957 203.322 13.393 1.00 18.80  ? 674  GLN A O     1 
ATOM   5996 C  CB    . GLN C 3  668 ? 57.493 201.082 11.012 1.00 16.66  ? 674  GLN A CB    1 
ATOM   5997 C  CG    . GLN C 3  668 ? 58.786 201.872 11.054 1.00 17.48  ? 674  GLN A CG    1 
ATOM   5998 C  CD    . GLN C 3  668 ? 59.695 201.482 12.206 1.00 18.00  ? 674  GLN A CD    1 
ATOM   5999 O  OE1   . GLN C 3  668 ? 59.485 200.467 12.869 1.00 17.80  ? 674  GLN A OE1   1 
ATOM   6000 N  NE2   . GLN C 3  668 ? 60.725 202.285 12.439 1.00 18.66  ? 674  GLN A NE2   1 
ATOM   6001 N  N     . GLU C 3  669 ? 55.370 203.310 11.802 1.00 18.01  ? 675  GLU A N     1 
ATOM   6002 C  CA    . GLU C 3  669 ? 55.026 204.712 12.034 1.00 19.21  ? 675  GLU A CA    1 
ATOM   6003 C  C     . GLU C 3  669 ? 54.479 204.873 13.452 1.00 17.17  ? 675  GLU A C     1 
ATOM   6004 O  O     . GLU C 3  669 ? 54.869 205.786 14.180 1.00 18.14  ? 675  GLU A O     1 
ATOM   6005 C  CB    . GLU C 3  669 ? 53.987 205.181 11.015 1.00 23.12  ? 675  GLU A CB    1 
ATOM   6006 C  CG    . GLU C 3  669 ? 54.557 205.381 9.613  1.00 29.60  ? 675  GLU A CG    1 
ATOM   6007 C  CD    . GLU C 3  669 ? 53.490 205.718 8.582  1.00 32.70  ? 675  GLU A CD    1 
ATOM   6008 O  OE1   . GLU C 3  669 ? 52.653 206.601 8.864  1.00 34.25  ? 675  GLU A OE1   1 
ATOM   6009 O  OE2   . GLU C 3  669 ? 53.497 205.108 7.489  1.00 36.42  ? 675  GLU A OE2   1 
ATOM   6010 N  N     . ALA C 3  670 ? 53.588 203.968 13.842 1.00 13.13  ? 676  ALA A N     1 
ATOM   6011 C  CA    . ALA C 3  670 ? 52.993 204.002 15.167 1.00 11.98  ? 676  ALA A CA    1 
ATOM   6012 C  C     . ALA C 3  670 ? 54.038 203.868 16.290 1.00 13.19  ? 676  ALA A C     1 
ATOM   6013 O  O     . ALA C 3  670 ? 53.941 204.544 17.320 1.00 12.11  ? 676  ALA A O     1 
ATOM   6014 C  CB    . ALA C 3  670 ? 51.956 202.895 15.289 1.00 11.39  ? 676  ALA A CB    1 
ATOM   6015 N  N     . MET C 3  671 ? 55.025 202.994 16.106 1.00 11.43  ? 677  MET A N     1 
ATOM   6016 C  CA    . MET C 3  671 ? 56.047 202.810 17.127 1.00 12.32  ? 677  MET A CA    1 
ATOM   6017 C  C     . MET C 3  671 ? 56.841 204.106 17.323 1.00 15.28  ? 677  MET A C     1 
ATOM   6018 O  O     . MET C 3  671 ? 57.100 204.522 18.456 1.00 14.13  ? 677  MET A O     1 
ATOM   6019 C  CB    . MET C 3  671 ? 56.989 201.663 16.741 1.00 12.44  ? 677  MET A CB    1 
ATOM   6020 C  CG    . MET C 3  671 ? 58.083 201.357 17.776 1.00 13.48  ? 677  MET A CG    1 
ATOM   6021 S  SD    . MET C 3  671 ? 57.438 201.029 19.437 1.00 16.10  ? 677  MET A SD    1 
ATOM   6022 C  CE    . MET C 3  671 ? 56.810 199.336 19.238 1.00 13.08  ? 677  MET A CE    1 
ATOM   6023 N  N     . ARG C 3  672 ? 57.214 204.750 16.218 1.00 15.34  ? 678  ARG A N     1 
ATOM   6024 C  CA    . ARG C 3  672 ? 57.967 205.992 16.296 1.00 15.61  ? 678  ARG A CA    1 
ATOM   6025 C  C     . ARG C 3  672 ? 57.091 207.062 16.925 1.00 14.47  ? 678  ARG A C     1 
ATOM   6026 O  O     . ARG C 3  672 ? 57.582 207.927 17.657 1.00 14.27  ? 678  ARG A O     1 
ATOM   6027 C  CB    . ARG C 3  672 ? 58.441 206.424 14.903 1.00 16.18  ? 678  ARG A CB    1 
ATOM   6028 C  CG    . ARG C 3  672 ? 59.368 205.409 14.247 1.00 19.73  ? 678  ARG A CG    1 
ATOM   6029 C  CD    . ARG C 3  672 ? 60.756 205.412 14.868 1.00 21.86  ? 678  ARG A CD    1 
ATOM   6030 N  NE    . ARG C 3  672 ? 61.673 206.201 14.046 1.00 30.09  ? 678  ARG A NE    1 
ATOM   6031 C  CZ    . ARG C 3  672 ? 62.642 205.694 13.288 1.00 27.92  ? 678  ARG A CZ    1 
ATOM   6032 N  NH1   . ARG C 3  672 ? 62.852 204.390 13.240 1.00 28.63  ? 678  ARG A NH1   1 
ATOM   6033 N  NH2   . ARG C 3  672 ? 63.387 206.496 12.551 1.00 31.49  ? 678  ARG A NH2   1 
ATOM   6034 N  N     . TRP C 3  673 ? 55.791 206.999 16.659 1.00 12.57  ? 679  TRP A N     1 
ATOM   6035 C  CA    . TRP C 3  673 ? 54.875 207.972 17.247 1.00 12.37  ? 679  TRP A CA    1 
ATOM   6036 C  C     . TRP C 3  673 ? 54.862 207.761 18.775 1.00 13.93  ? 679  TRP A C     1 
ATOM   6037 O  O     . TRP C 3  673 ? 54.918 208.720 19.549 1.00 14.50  ? 679  TRP A O     1 
ATOM   6038 C  CB    . TRP C 3  673 ? 53.471 207.791 16.669 1.00 11.76  ? 679  TRP A CB    1 
ATOM   6039 C  CG    . TRP C 3  673 ? 52.466 208.758 17.217 1.00 12.96  ? 679  TRP A CG    1 
ATOM   6040 C  CD1   . TRP C 3  673 ? 52.104 209.957 16.682 1.00 11.19  ? 679  TRP A CD1   1 
ATOM   6041 C  CD2   . TRP C 3  673 ? 51.704 208.611 18.421 1.00 13.76  ? 679  TRP A CD2   1 
ATOM   6042 N  NE1   . TRP C 3  673 ? 51.165 210.568 17.472 1.00 11.82  ? 679  TRP A NE1   1 
ATOM   6043 C  CE2   . TRP C 3  673 ? 50.902 209.765 18.550 1.00 14.05  ? 679  TRP A CE2   1 
ATOM   6044 C  CE3   . TRP C 3  673 ? 51.622 207.613 19.405 1.00 13.70  ? 679  TRP A CE3   1 
ATOM   6045 C  CZ2   . TRP C 3  673 ? 50.024 209.953 19.628 1.00 11.73  ? 679  TRP A CZ2   1 
ATOM   6046 C  CZ3   . TRP C 3  673 ? 50.751 207.799 20.474 1.00 12.23  ? 679  TRP A CZ3   1 
ATOM   6047 C  CH2   . TRP C 3  673 ? 49.964 208.964 20.575 1.00 12.98  ? 679  TRP A CH2   1 
ATOM   6048 N  N     . VAL C 3  674 ? 54.798 206.504 19.206 1.00 13.03  ? 680  VAL A N     1 
ATOM   6049 C  CA    . VAL C 3  674 ? 54.801 206.201 20.635 1.00 15.32  ? 680  VAL A CA    1 
ATOM   6050 C  C     . VAL C 3  674 ? 56.082 206.743 21.284 1.00 16.06  ? 680  VAL A C     1 
ATOM   6051 O  O     . VAL C 3  674 ? 56.035 207.411 22.319 1.00 17.10  ? 680  VAL A O     1 
ATOM   6052 C  CB    . VAL C 3  674 ? 54.702 204.674 20.889 1.00 14.67  ? 680  VAL A CB    1 
ATOM   6053 C  CG1   . VAL C 3  674 ? 54.830 204.377 22.376 1.00 16.86  ? 680  VAL A CG1   1 
ATOM   6054 C  CG2   . VAL C 3  674 ? 53.379 204.146 20.375 1.00 12.36  ? 680  VAL A CG2   1 
ATOM   6055 N  N     . GLY C 3  675 ? 57.223 206.461 20.662 1.00 16.33  ? 681  GLY A N     1 
ATOM   6056 C  CA    . GLY C 3  675 ? 58.491 206.930 21.189 1.00 15.93  ? 681  GLY A CA    1 
ATOM   6057 C  C     . GLY C 3  675 ? 58.512 208.437 21.359 1.00 17.17  ? 681  GLY A C     1 
ATOM   6058 O  O     . GLY C 3  675 ? 58.989 208.957 22.369 1.00 16.00  ? 681  GLY A O     1 
ATOM   6059 N  N     . ASP C 3  676 ? 58.003 209.148 20.364 1.00 17.15  ? 682  ASP A N     1 
ATOM   6060 C  CA    . ASP C 3  676 ? 57.963 210.598 20.446 1.00 18.23  ? 682  ASP A CA    1 
ATOM   6061 C  C     . ASP C 3  676 ? 56.962 211.036 21.511 1.00 17.87  ? 682  ASP A C     1 
ATOM   6062 O  O     . ASP C 3  676 ? 57.202 211.997 22.231 1.00 17.89  ? 682  ASP A O     1 
ATOM   6063 C  CB    . ASP C 3  676 ? 57.546 211.205 19.106 1.00 20.78  ? 682  ASP A CB    1 
ATOM   6064 C  CG    . ASP C 3  676 ? 57.282 212.693 19.208 1.00 24.55  ? 682  ASP A CG    1 
ATOM   6065 O  OD1   . ASP C 3  676 ? 58.239 213.482 19.057 1.00 27.56  ? 682  ASP A OD1   1 
ATOM   6066 O  OD2   . ASP C 3  676 ? 56.118 213.076 19.464 1.00 24.15  ? 682  ASP A OD2   1 
ATOM   6067 N  N     . HIS C 3  677 ? 55.839 210.323 21.589 1.00 16.55  ? 683  HIS A N     1 
ATOM   6068 C  CA    . HIS C 3  677 ? 54.771 210.623 22.535 1.00 15.13  ? 683  HIS A CA    1 
ATOM   6069 C  C     . HIS C 3  677 ? 55.222 210.690 23.991 1.00 16.18  ? 683  HIS A C     1 
ATOM   6070 O  O     . HIS C 3  677 ? 54.736 211.521 24.762 1.00 16.81  ? 683  HIS A O     1 
ATOM   6071 C  CB    . HIS C 3  677 ? 53.662 209.572 22.413 1.00 15.09  ? 683  HIS A CB    1 
ATOM   6072 C  CG    . HIS C 3  677 ? 52.575 209.712 23.437 1.00 12.28  ? 683  HIS A CG    1 
ATOM   6073 N  ND1   . HIS C 3  677 ? 51.597 210.680 23.361 1.00 10.80  ? 683  HIS A ND1   1 
ATOM   6074 C  CD2   . HIS C 3  677 ? 52.309 208.997 24.557 1.00 11.66  ? 683  HIS A CD2   1 
ATOM   6075 C  CE1   . HIS C 3  677 ? 50.774 210.554 24.388 1.00 11.41  ? 683  HIS A CE1   1 
ATOM   6076 N  NE2   . HIS C 3  677 ? 51.184 209.539 25.128 1.00 9.93   ? 683  HIS A NE2   1 
ATOM   6077 N  N     . TRP C 3  678 ? 56.133 209.802 24.374 1.00 16.21  ? 684  TRP A N     1 
ATOM   6078 C  CA    . TRP C 3  678 ? 56.612 209.780 25.747 1.00 15.06  ? 684  TRP A CA    1 
ATOM   6079 C  C     . TRP C 3  678 ? 58.045 210.265 25.898 1.00 15.47  ? 684  TRP A C     1 
ATOM   6080 O  O     . TRP C 3  678 ? 58.731 209.909 26.855 1.00 14.38  ? 684  TRP A O     1 
ATOM   6081 C  CB    . TRP C 3  678 ? 56.460 208.374 26.346 1.00 11.23  ? 684  TRP A CB    1 
ATOM   6082 C  CG    . TRP C 3  678 ? 55.047 208.059 26.774 1.00 10.76  ? 684  TRP A CG    1 
ATOM   6083 C  CD1   . TRP C 3  678 ? 54.150 208.926 27.319 1.00 11.72  ? 684  TRP A CD1   1 
ATOM   6084 C  CD2   . TRP C 3  678 ? 54.397 206.780 26.747 1.00 12.45  ? 684  TRP A CD2   1 
ATOM   6085 N  NE1   . TRP C 3  678 ? 52.983 208.274 27.636 1.00 12.30  ? 684  TRP A NE1   1 
ATOM   6086 C  CE2   . TRP C 3  678 ? 53.108 206.955 27.297 1.00 11.76  ? 684  TRP A CE2   1 
ATOM   6087 C  CE3   . TRP C 3  678 ? 54.779 205.502 26.315 1.00 11.13  ? 684  TRP A CE3   1 
ATOM   6088 C  CZ2   . TRP C 3  678 ? 52.199 205.902 27.430 1.00 13.19  ? 684  TRP A CZ2   1 
ATOM   6089 C  CZ3   . TRP C 3  678 ? 53.879 204.457 26.448 1.00 12.87  ? 684  TRP A CZ3   1 
ATOM   6090 C  CH2   . TRP C 3  678 ? 52.602 204.663 27.002 1.00 13.21  ? 684  TRP A CH2   1 
ATOM   6091 N  N     . ASN C 3  679 ? 58.489 211.082 24.947 1.00 15.42  ? 685  ASN A N     1 
ATOM   6092 C  CA    . ASN C 3  679 ? 59.835 211.643 24.978 1.00 16.73  ? 685  ASN A CA    1 
ATOM   6093 C  C     . ASN C 3  679 ? 60.878 210.588 25.289 1.00 16.75  ? 685  ASN A C     1 
ATOM   6094 O  O     . ASN C 3  679 ? 61.738 210.794 26.146 1.00 17.65  ? 685  ASN A O     1 
ATOM   6095 C  CB    . ASN C 3  679 ? 59.914 212.743 26.035 1.00 16.75  ? 685  ASN A CB    1 
ATOM   6096 C  CG    . ASN C 3  679 ? 58.831 213.788 25.864 1.00 21.21  ? 685  ASN A CG    1 
ATOM   6097 O  OD1   . ASN C 3  679 ? 58.698 214.392 24.801 1.00 23.05  ? 685  ASN A OD1   1 
ATOM   6098 N  ND2   . ASN C 3  679 ? 58.048 214.007 26.916 1.00 24.50  ? 685  ASN A ND2   1 
ATOM   6099 N  N     . PHE C 3  680 ? 60.816 209.461 24.594 1.00 16.42  ? 686  PHE A N     1 
ATOM   6100 C  CA    . PHE C 3  680 ? 61.772 208.402 24.860 1.00 17.35  ? 686  PHE A CA    1 
ATOM   6101 C  C     . PHE C 3  680 ? 63.176 208.769 24.413 1.00 18.14  ? 686  PHE A C     1 
ATOM   6102 O  O     . PHE C 3  680 ? 63.373 209.332 23.339 1.00 20.11  ? 686  PHE A O     1 
ATOM   6103 C  CB    . PHE C 3  680 ? 61.322 207.098 24.206 1.00 15.29  ? 686  PHE A CB    1 
ATOM   6104 C  CG    . PHE C 3  680 ? 61.393 205.922 25.126 1.00 13.15  ? 686  PHE A CG    1 
ATOM   6105 C  CD1   . PHE C 3  680 ? 60.744 205.958 26.354 1.00 10.81  ? 686  PHE A CD1   1 
ATOM   6106 C  CD2   . PHE C 3  680 ? 62.086 204.774 24.764 1.00 13.37  ? 686  PHE A CD2   1 
ATOM   6107 C  CE1   . PHE C 3  680 ? 60.778 204.872 27.209 1.00 11.24  ? 686  PHE A CE1   1 
ATOM   6108 C  CE2   . PHE C 3  680 ? 62.129 203.675 25.614 1.00 12.73  ? 686  PHE A CE2   1 
ATOM   6109 C  CZ    . PHE C 3  680 ? 61.471 203.725 26.842 1.00 13.01  ? 686  PHE A CZ    1 
ATOM   6110 N  N     . ARG C 3  681 ? 64.153 208.441 25.251 1.00 19.01  ? 687  ARG A N     1 
ATOM   6111 C  CA    . ARG C 3  681 ? 65.546 208.762 24.976 1.00 18.81  ? 687  ARG A CA    1 
ATOM   6112 C  C     . ARG C 3  681 ? 66.252 207.761 24.079 1.00 18.86  ? 687  ARG A C     1 
ATOM   6113 O  O     . ARG C 3  681 ? 67.452 207.868 23.837 1.00 19.75  ? 687  ARG A O     1 
ATOM   6114 C  CB    . ARG C 3  681 ? 66.294 208.922 26.291 1.00 19.76  ? 687  ARG A CB    1 
ATOM   6115 C  CG    . ARG C 3  681 ? 65.824 210.138 27.078 1.00 20.69  ? 687  ARG A CG    1 
ATOM   6116 C  CD    . ARG C 3  681 ? 66.798 211.276 26.915 1.00 20.21  ? 687  ARG A CD    1 
ATOM   6117 N  NE    . ARG C 3  681 ? 67.547 211.498 28.144 1.00 20.30  ? 687  ARG A NE    1 
ATOM   6118 C  CZ    . ARG C 3  681 ? 68.799 211.935 28.189 1.00 20.78  ? 687  ARG A CZ    1 
ATOM   6119 N  NH1   . ARG C 3  681 ? 69.459 212.196 27.070 1.00 20.41  ? 687  ARG A NH1   1 
ATOM   6120 N  NH2   . ARG C 3  681 ? 69.390 212.114 29.359 1.00 21.23  ? 687  ARG A NH2   1 
ATOM   6121 N  N     . CYS C 3  682 ? 65.505 206.783 23.586 1.00 18.44  ? 688  CYS A N     1 
ATOM   6122 C  CA    . CYS C 3  682 ? 66.069 205.798 22.679 1.00 17.18  ? 688  CYS A CA    1 
ATOM   6123 C  C     . CYS C 3  682 ? 65.094 205.644 21.524 1.00 16.52  ? 688  CYS A C     1 
ATOM   6124 O  O     . CYS C 3  682 ? 63.891 205.506 21.734 1.00 17.02  ? 688  CYS A O     1 
ATOM   6125 C  CB    . CYS C 3  682 ? 66.271 204.450 23.376 1.00 14.33  ? 688  CYS A CB    1 
ATOM   6126 S  SG    . CYS C 3  682 ? 67.167 203.231 22.349 1.00 16.74  ? 688  CYS A SG    1 
ATOM   6127 N  N     . LEU C 3  683 ? 65.610 205.705 20.304 1.00 16.77  ? 689  LEU A N     1 
ATOM   6128 C  CA    . LEU C 3  683 ? 64.768 205.558 19.126 1.00 16.58  ? 689  LEU A CA    1 
ATOM   6129 C  C     . LEU C 3  683 ? 64.127 204.169 19.180 1.00 16.45  ? 689  LEU A C     1 
ATOM   6130 O  O     . LEU C 3  683 ? 64.780 203.189 19.544 1.00 15.91  ? 689  LEU A O     1 
ATOM   6131 C  CB    . LEU C 3  683 ? 65.613 205.708 17.859 1.00 15.47  ? 689  LEU A CB    1 
ATOM   6132 C  CG    . LEU C 3  683 ? 64.848 205.864 16.541 1.00 19.58  ? 689  LEU A CG    1 
ATOM   6133 C  CD1   . LEU C 3  683 ? 64.157 207.236 16.480 1.00 14.75  ? 689  LEU A CD1   1 
ATOM   6134 C  CD2   . LEU C 3  683 ? 65.821 205.706 15.385 1.00 17.77  ? 689  LEU A CD2   1 
ATOM   6135 N  N     . LEU C 3  684 ? 62.846 204.089 18.834 1.00 16.09  ? 690  LEU A N     1 
ATOM   6136 C  CA    . LEU C 3  684 ? 62.133 202.818 18.858 1.00 16.91  ? 690  LEU A CA    1 
ATOM   6137 C  C     . LEU C 3  684 ? 61.900 202.315 17.450 1.00 16.79  ? 690  LEU A C     1 
ATOM   6138 O  O     . LEU C 3  684 ? 61.615 203.097 16.550 1.00 17.93  ? 690  LEU A O     1 
ATOM   6139 C  CB    . LEU C 3  684 ? 60.788 202.971 19.568 1.00 17.25  ? 690  LEU A CB    1 
ATOM   6140 C  CG    . LEU C 3  684 ? 60.814 203.407 21.032 1.00 16.34  ? 690  LEU A CG    1 
ATOM   6141 C  CD1   . LEU C 3  684 ? 59.391 203.484 21.560 1.00 16.28  ? 690  LEU A CD1   1 
ATOM   6142 C  CD2   . LEU C 3  684 ? 61.631 202.422 21.839 1.00 14.48  ? 690  LEU A CD2   1 
ATOM   6143 N  N     . ASP C 3  685 ? 62.015 201.006 17.265 1.00 16.36  ? 691  ASP A N     1 
ATOM   6144 C  CA    . ASP C 3  685 ? 61.818 200.404 15.954 1.00 17.34  ? 691  ASP A CA    1 
ATOM   6145 C  C     . ASP C 3  685 ? 61.069 199.084 15.972 1.00 17.78  ? 691  ASP A C     1 
ATOM   6146 O  O     . ASP C 3  685 ? 60.938 198.430 17.009 1.00 18.11  ? 691  ASP A O     1 
ATOM   6147 C  CB    . ASP C 3  685 ? 63.166 200.170 15.272 1.00 17.72  ? 691  ASP A CB    1 
ATOM   6148 C  CG    . ASP C 3  685 ? 63.810 201.444 14.840 1.00 16.31  ? 691  ASP A CG    1 
ATOM   6149 O  OD1   . ASP C 3  685 ? 63.132 202.210 14.135 1.00 17.64  ? 691  ASP A OD1   1 
ATOM   6150 O  OD2   . ASP C 3  685 ? 64.979 201.679 15.201 1.00 15.92  ? 691  ASP A OD2   1 
ATOM   6151 N  N     . THR C 3  686 ? 60.600 198.690 14.796 1.00 17.29  ? 692  THR A N     1 
ATOM   6152 C  CA    . THR C 3  686 ? 59.889 197.437 14.639 1.00 17.72  ? 692  THR A CA    1 
ATOM   6153 C  C     . THR C 3  686 ? 60.444 196.742 13.405 1.00 19.83  ? 692  THR A C     1 
ATOM   6154 O  O     . THR C 3  686 ? 61.061 197.371 12.549 1.00 20.29  ? 692  THR A O     1 
ATOM   6155 C  CB    . THR C 3  686 ? 58.386 197.664 14.419 1.00 16.45  ? 692  THR A CB    1 
ATOM   6156 O  OG1   . THR C 3  686 ? 58.197 198.423 13.219 1.00 15.20  ? 692  THR A OG1   1 
ATOM   6157 C  CG2   . THR C 3  686 ? 57.770 198.411 15.595 1.00 15.17  ? 692  THR A CG2   1 
ATOM   6158 N  N     . GLU C 3  687 ? 60.234 195.436 13.328 1.00 23.12  ? 693  GLU A N     1 
ATOM   6159 C  CA    . GLU C 3  687 ? 60.672 194.650 12.186 1.00 24.37  ? 693  GLU A CA    1 
ATOM   6160 C  C     . GLU C 3  687 ? 59.421 193.881 11.752 1.00 22.96  ? 693  GLU A C     1 
ATOM   6161 O  O     . GLU C 3  687 ? 58.770 193.221 12.567 1.00 19.30  ? 693  GLU A O     1 
ATOM   6162 C  CB    . GLU C 3  687 ? 61.792 193.677 12.586 1.00 28.28  ? 693  GLU A CB    1 
ATOM   6163 C  CG    . GLU C 3  687 ? 62.760 193.344 11.441 1.00 36.27  ? 693  GLU A CG    1 
ATOM   6164 C  CD    . GLU C 3  687 ? 63.570 192.070 11.679 1.00 40.05  ? 693  GLU A CD    1 
ATOM   6165 O  OE1   . GLU C 3  687 ? 62.993 190.964 11.587 1.00 40.48  ? 693  GLU A OE1   1 
ATOM   6166 O  OE2   . GLU C 3  687 ? 64.786 192.176 11.957 1.00 42.83  ? 693  GLU A OE2   1 
ATOM   6167 N  N     . GLY C 3  688 ? 59.078 193.986 10.473 1.00 22.94  ? 694  GLY A N     1 
ATOM   6168 C  CA    . GLY C 3  688 ? 57.898 193.310 9.972  1.00 21.54  ? 694  GLY A CA    1 
ATOM   6169 C  C     . GLY C 3  688 ? 58.184 192.279 8.902  1.00 21.03  ? 694  GLY A C     1 
ATOM   6170 O  O     . GLY C 3  688 ? 59.177 192.364 8.182  1.00 21.46  ? 694  GLY A O     1 
ATOM   6171 N  N     . LYS C 3  689 ? 57.298 191.297 8.803  1.00 20.50  ? 695  LYS A N     1 
ATOM   6172 C  CA    . LYS C 3  689 ? 57.431 190.232 7.821  1.00 19.90  ? 695  LYS A CA    1 
ATOM   6173 C  C     . LYS C 3  689 ? 56.076 189.869 7.241  1.00 18.74  ? 695  LYS A C     1 
ATOM   6174 O  O     . LYS C 3  689 ? 55.089 189.741 7.965  1.00 18.69  ? 695  LYS A O     1 
ATOM   6175 C  CB    . LYS C 3  689 ? 58.030 188.986 8.464  1.00 20.69  ? 695  LYS A CB    1 
ATOM   6176 C  CG    . LYS C 3  689 ? 59.415 189.168 9.016  1.00 23.36  ? 695  LYS A CG    1 
ATOM   6177 C  CD    . LYS C 3  689 ? 59.792 187.964 9.856  1.00 27.38  ? 695  LYS A CD    1 
ATOM   6178 C  CE    . LYS C 3  689 ? 61.161 188.122 10.481 1.00 29.65  ? 695  LYS A CE    1 
ATOM   6179 N  NZ    . LYS C 3  689 ? 61.401 187.026 11.460 1.00 32.43  ? 695  LYS A NZ    1 
ATOM   6180 N  N     . MET C 3  690 ? 56.032 189.704 5.930  1.00 18.26  ? 696  MET A N     1 
ATOM   6181 C  CA    . MET C 3  690 ? 54.798 189.320 5.267  1.00 19.63  ? 696  MET A CA    1 
ATOM   6182 C  C     . MET C 3  690 ? 54.915 187.827 4.977  1.00 19.62  ? 696  MET A C     1 
ATOM   6183 O  O     . MET C 3  690 ? 56.007 187.338 4.681  1.00 21.71  ? 696  MET A O     1 
ATOM   6184 C  CB    . MET C 3  690 ? 54.634 190.105 3.966  1.00 19.11  ? 696  MET A CB    1 
ATOM   6185 C  CG    . MET C 3  690 ? 53.321 189.863 3.262  1.00 21.45  ? 696  MET A CG    1 
ATOM   6186 S  SD    . MET C 3  690 ? 53.203 190.827 1.746  1.00 25.56  ? 696  MET A SD    1 
ATOM   6187 C  CE    . MET C 3  690 ? 53.169 192.465 2.430  1.00 26.10  ? 696  MET A CE    1 
ATOM   6188 N  N     . GLY C 3  691 ? 53.808 187.099 5.065  1.00 18.61  ? 697  GLY A N     1 
ATOM   6189 C  CA    . GLY C 3  691 ? 53.862 185.672 4.807  1.00 16.72  ? 697  GLY A CA    1 
ATOM   6190 C  C     . GLY C 3  691 ? 52.513 185.016 4.989  1.00 16.24  ? 697  GLY A C     1 
ATOM   6191 O  O     . GLY C 3  691 ? 51.556 185.679 5.372  1.00 15.13  ? 697  GLY A O     1 
ATOM   6192 N  N     . PRO C 3  692 ? 52.407 183.703 4.736  1.00 16.77  ? 698  PRO A N     1 
ATOM   6193 C  CA    . PRO C 3  692 ? 51.139 182.981 4.878  1.00 16.61  ? 698  PRO A CA    1 
ATOM   6194 C  C     . PRO C 3  692 ? 50.725 182.633 6.300  1.00 15.41  ? 698  PRO A C     1 
ATOM   6195 O  O     . PRO C 3  692 ? 49.542 182.669 6.623  1.00 16.97  ? 698  PRO A O     1 
ATOM   6196 C  CB    . PRO C 3  692 ? 51.369 181.727 4.043  1.00 17.24  ? 698  PRO A CB    1 
ATOM   6197 C  CG    . PRO C 3  692 ? 52.817 181.438 4.312  1.00 16.13  ? 698  PRO A CG    1 
ATOM   6198 C  CD    . PRO C 3  692 ? 53.448 182.820 4.174  1.00 17.67  ? 698  PRO A CD    1 
ATOM   6199 N  N     . ASN C 3  693 ? 51.694 182.297 7.144  1.00 13.72  ? 699  ASN A N     1 
ATOM   6200 C  CA    . ASN C 3  693 ? 51.395 181.897 8.513  1.00 14.61  ? 699  ASN A CA    1 
ATOM   6201 C  C     . ASN C 3  693 ? 52.413 182.394 9.545  1.00 15.39  ? 699  ASN A C     1 
ATOM   6202 O  O     . ASN C 3  693 ? 53.329 183.160 9.220  1.00 14.99  ? 699  ASN A O     1 
ATOM   6203 C  CB    . ASN C 3  693 ? 51.326 180.375 8.573  1.00 15.18  ? 699  ASN A CB    1 
ATOM   6204 C  CG    . ASN C 3  693 ? 52.625 179.732 8.140  1.00 15.30  ? 699  ASN A CG    1 
ATOM   6205 O  OD1   . ASN C 3  693 ? 53.674 179.972 8.742  1.00 15.43  ? 699  ASN A OD1   1 
ATOM   6206 N  ND2   . ASN C 3  693 ? 52.570 178.924 7.086  1.00 13.59  ? 699  ASN A ND2   1 
ATOM   6207 N  N     . TRP C 3  694 ? 52.260 181.924 10.783 1.00 13.12  ? 700  TRP A N     1 
ATOM   6208 C  CA    . TRP C 3  694 ? 53.140 182.326 11.872 1.00 15.02  ? 700  TRP A CA    1 
ATOM   6209 C  C     . TRP C 3  694 ? 54.555 181.772 11.760 1.00 17.22  ? 700  TRP A C     1 
ATOM   6210 O  O     . TRP C 3  694 ? 55.497 182.385 12.258 1.00 19.26  ? 700  TRP A O     1 
ATOM   6211 C  CB    . TRP C 3  694 ? 52.551 181.904 13.219 1.00 14.50  ? 700  TRP A CB    1 
ATOM   6212 C  CG    . TRP C 3  694 ? 52.896 182.838 14.361 1.00 12.89  ? 700  TRP A CG    1 
ATOM   6213 C  CD1   . TRP C 3  694 ? 53.837 183.826 14.358 1.00 11.22  ? 700  TRP A CD1   1 
ATOM   6214 C  CD2   . TRP C 3  694 ? 52.247 182.907 15.641 1.00 11.28  ? 700  TRP A CD2   1 
ATOM   6215 N  NE1   . TRP C 3  694 ? 53.807 184.509 15.546 1.00 11.69  ? 700  TRP A NE1   1 
ATOM   6216 C  CE2   . TRP C 3  694 ? 52.841 183.969 16.352 1.00 10.63  ? 700  TRP A CE2   1 
ATOM   6217 C  CE3   . TRP C 3  694 ? 51.216 182.175 16.250 1.00 8.54   ? 700  TRP A CE3   1 
ATOM   6218 C  CZ2   . TRP C 3  694 ? 52.437 184.327 17.646 1.00 11.55  ? 700  TRP A CZ2   1 
ATOM   6219 C  CZ3   . TRP C 3  694 ? 50.814 182.526 17.528 1.00 8.54   ? 700  TRP A CZ3   1 
ATOM   6220 C  CH2   . TRP C 3  694 ? 51.424 183.598 18.215 1.00 10.46  ? 700  TRP A CH2   1 
ATOM   6221 N  N     . ALA C 3  695 ? 54.713 180.620 11.119 1.00 17.48  ? 701  ALA A N     1 
ATOM   6222 C  CA    . ALA C 3  695 ? 56.042 180.026 10.973 1.00 20.07  ? 701  ALA A CA    1 
ATOM   6223 C  C     . ALA C 3  695 ? 56.947 180.916 10.136 1.00 20.97  ? 701  ALA A C     1 
ATOM   6224 O  O     . ALA C 3  695 ? 58.142 181.029 10.401 1.00 22.12  ? 701  ALA A O     1 
ATOM   6225 C  CB    . ALA C 3  695 ? 55.945 178.644 10.334 1.00 19.33  ? 701  ALA A CB    1 
ATOM   6226 N  N     . ILE C 3  696 ? 56.373 181.550 9.122  1.00 21.64  ? 702  ILE A N     1 
ATOM   6227 C  CA    . ILE C 3  696 ? 57.146 182.423 8.256  1.00 20.73  ? 702  ILE A CA    1 
ATOM   6228 C  C     . ILE C 3  696 ? 57.172 183.866 8.747  1.00 22.23  ? 702  ILE A C     1 
ATOM   6229 O  O     . ILE C 3  696 ? 58.133 184.584 8.497  1.00 23.00  ? 702  ILE A O     1 
ATOM   6230 C  CB    . ILE C 3  696 ? 56.588 182.365 6.825  1.00 22.96  ? 702  ILE A CB    1 
ATOM   6231 C  CG1   . ILE C 3  696 ? 56.717 180.930 6.306  1.00 24.12  ? 702  ILE A CG1   1 
ATOM   6232 C  CG2   . ILE C 3  696 ? 57.315 183.359 5.919  1.00 19.43  ? 702  ILE A CG2   1 
ATOM   6233 C  CD1   . ILE C 3  696 ? 56.057 180.698 4.979  1.00 27.62  ? 702  ILE A CD1   1 
ATOM   6234 N  N     . CYS C 3  697 ? 56.142 184.284 9.477  1.00 22.95  ? 703  CYS A N     1 
ATOM   6235 C  CA    . CYS C 3  697 ? 56.071 185.662 9.951  1.00 24.24  ? 703  CYS A CA    1 
ATOM   6236 C  C     . CYS C 3  697 ? 56.670 186.007 11.318 1.00 26.52  ? 703  CYS A C     1 
ATOM   6237 O  O     . CYS C 3  697 ? 56.344 187.044 11.888 1.00 26.23  ? 703  CYS A O     1 
ATOM   6238 C  CB    . CYS C 3  697 ? 54.617 186.146 9.902  1.00 22.23  ? 703  CYS A CB    1 
ATOM   6239 S  SG    . CYS C 3  697 ? 53.957 186.313 8.220  1.00 21.10  ? 703  CYS A SG    1 
ATOM   6240 N  N     . HIS C 3  698 ? 57.548 185.166 11.852 1.00 29.80  ? 704  HIS A N     1 
ATOM   6241 C  CA    . HIS C 3  698 ? 58.154 185.478 13.148 1.00 32.49  ? 704  HIS A CA    1 
ATOM   6242 C  C     . HIS C 3  698 ? 59.539 184.886 13.261 1.00 33.67  ? 704  HIS A C     1 
ATOM   6243 O  O     . HIS C 3  698 ? 60.436 185.614 13.739 1.00 33.83  ? 704  HIS A O     1 
ATOM   6244 C  CB    . HIS C 3  698 ? 57.291 184.970 14.310 1.00 33.17  ? 704  HIS A CB    1 
ATOM   6245 C  CG    . HIS C 3  698 ? 57.809 185.361 15.663 1.00 33.75  ? 704  HIS A CG    1 
ATOM   6246 N  ND1   . HIS C 3  698 ? 57.887 186.673 16.082 1.00 36.08  ? 704  HIS A ND1   1 
ATOM   6247 C  CD2   . HIS C 3  698 ? 58.273 184.612 16.693 1.00 34.63  ? 704  HIS A CD2   1 
ATOM   6248 C  CE1   . HIS C 3  698 ? 58.376 186.715 17.310 1.00 34.57  ? 704  HIS A CE1   1 
ATOM   6249 N  NE2   . HIS C 3  698 ? 58.618 185.478 17.704 1.00 33.25  ? 704  HIS A NE2   1 
ATOM   6250 O  OXT   . HIS C 3  698 ? 59.693 183.701 12.884 1.00 36.88  ? 704  HIS A OXT   1 
ATOM   6251 N  N     . LYS D 4  3   ? 66.081 122.930 51.093 1.00 40.07  ? 3    LYS B N     1 
ATOM   6252 C  CA    . LYS D 4  3   ? 65.321 121.969 50.243 1.00 39.16  ? 3    LYS B CA    1 
ATOM   6253 C  C     . LYS D 4  3   ? 64.298 122.696 49.371 1.00 37.84  ? 3    LYS B C     1 
ATOM   6254 O  O     . LYS D 4  3   ? 63.604 122.078 48.564 1.00 37.58  ? 3    LYS B O     1 
ATOM   6255 C  CB    . LYS D 4  3   ? 64.609 120.930 51.120 1.00 41.04  ? 3    LYS B CB    1 
ATOM   6256 C  CG    . LYS D 4  3   ? 63.993 119.788 50.321 1.00 45.93  ? 3    LYS B CG    1 
ATOM   6257 C  CD    . LYS D 4  3   ? 63.271 118.756 51.186 1.00 50.57  ? 3    LYS B CD    1 
ATOM   6258 C  CE    . LYS D 4  3   ? 64.218 117.975 52.096 1.00 52.64  ? 3    LYS B CE    1 
ATOM   6259 N  NZ    . LYS D 4  3   ? 64.627 118.742 53.307 1.00 55.33  ? 3    LYS B NZ    1 
ATOM   6260 N  N     . ILE D 4  4   ? 64.208 124.012 49.539 1.00 36.40  ? 4    ILE B N     1 
ATOM   6261 C  CA    . ILE D 4  4   ? 63.279 124.825 48.755 1.00 35.23  ? 4    ILE B CA    1 
ATOM   6262 C  C     . ILE D 4  4   ? 63.890 125.184 47.396 1.00 32.94  ? 4    ILE B C     1 
ATOM   6263 O  O     . ILE D 4  4   ? 65.107 125.325 47.266 1.00 32.49  ? 4    ILE B O     1 
ATOM   6264 C  CB    . ILE D 4  4   ? 62.919 126.139 49.499 1.00 36.05  ? 4    ILE B CB    1 
ATOM   6265 C  CG1   . ILE D 4  4   ? 62.046 125.827 50.714 1.00 37.17  ? 4    ILE B CG1   1 
ATOM   6266 C  CG2   . ILE D 4  4   ? 62.204 127.102 48.562 1.00 34.92  ? 4    ILE B CG2   1 
ATOM   6267 C  CD1   . ILE D 4  4   ? 61.761 127.036 51.580 1.00 38.93  ? 4    ILE B CD1   1 
ATOM   6268 N  N     . ILE D 4  5   ? 63.042 125.337 46.388 1.00 29.35  ? 5    ILE B N     1 
ATOM   6269 C  CA    . ILE D 4  5   ? 63.517 125.678 45.061 1.00 27.58  ? 5    ILE B CA    1 
ATOM   6270 C  C     . ILE D 4  5   ? 63.386 127.172 44.794 1.00 27.09  ? 5    ILE B C     1 
ATOM   6271 O  O     . ILE D 4  5   ? 62.297 127.743 44.897 1.00 25.94  ? 5    ILE B O     1 
ATOM   6272 C  CB    . ILE D 4  5   ? 62.742 124.886 43.997 1.00 27.48  ? 5    ILE B CB    1 
ATOM   6273 C  CG1   . ILE D 4  5   ? 63.102 123.405 44.117 1.00 29.24  ? 5    ILE B CG1   1 
ATOM   6274 C  CG2   . ILE D 4  5   ? 63.063 125.408 42.604 1.00 27.87  ? 5    ILE B CG2   1 
ATOM   6275 C  CD1   . ILE D 4  5   ? 62.312 122.498 43.199 1.00 34.39  ? 5    ILE B CD1   1 
ATOM   6276 N  N     . HIS D 4  6   ? 64.505 127.803 44.461 1.00 25.98  ? 6    HIS B N     1 
ATOM   6277 C  CA    . HIS D 4  6   ? 64.519 129.229 44.164 1.00 25.37  ? 6    HIS B CA    1 
ATOM   6278 C  C     . HIS D 4  6   ? 64.282 129.427 42.663 1.00 24.49  ? 6    HIS B C     1 
ATOM   6279 O  O     . HIS D 4  6   ? 65.154 129.170 41.837 1.00 25.56  ? 6    HIS B O     1 
ATOM   6280 C  CB    . HIS D 4  6   ? 65.852 129.819 44.616 1.00 27.23  ? 6    HIS B CB    1 
ATOM   6281 C  CG    . HIS D 4  6   ? 66.118 129.630 46.079 1.00 32.43  ? 6    HIS B CG    1 
ATOM   6282 N  ND1   . HIS D 4  6   ? 65.396 130.280 47.060 1.00 34.06  ? 6    HIS B ND1   1 
ATOM   6283 C  CD2   . HIS D 4  6   ? 66.982 128.813 46.731 1.00 34.21  ? 6    HIS B CD2   1 
ATOM   6284 C  CE1   . HIS D 4  6   ? 65.801 129.870 48.249 1.00 33.50  ? 6    HIS B CE1   1 
ATOM   6285 N  NE2   . HIS D 4  6   ? 66.762 128.979 48.078 1.00 35.19  ? 6    HIS B NE2   1 
ATOM   6286 N  N     . LEU D 4  7   ? 63.085 129.883 42.318 1.00 22.14  ? 7    LEU B N     1 
ATOM   6287 C  CA    . LEU D 4  7   ? 62.706 130.075 40.925 1.00 21.57  ? 7    LEU B CA    1 
ATOM   6288 C  C     . LEU D 4  7   ? 63.147 131.392 40.303 1.00 21.77  ? 7    LEU B C     1 
ATOM   6289 O  O     . LEU D 4  7   ? 63.523 132.334 41.004 1.00 23.12  ? 7    LEU B O     1 
ATOM   6290 C  CB    . LEU D 4  7   ? 61.188 129.995 40.796 1.00 21.73  ? 7    LEU B CB    1 
ATOM   6291 C  CG    . LEU D 4  7   ? 60.473 128.844 41.494 1.00 21.98  ? 7    LEU B CG    1 
ATOM   6292 C  CD1   . LEU D 4  7   ? 58.981 129.149 41.543 1.00 21.16  ? 7    LEU B CD1   1 
ATOM   6293 C  CD2   . LEU D 4  7   ? 60.755 127.541 40.759 1.00 19.66  ? 7    LEU B CD2   1 
ATOM   6294 N  N     . THR D 4  8   ? 63.086 131.436 38.973 1.00 19.11  ? 8    THR B N     1 
ATOM   6295 C  CA    . THR D 4  8   ? 63.395 132.637 38.200 1.00 18.71  ? 8    THR B CA    1 
ATOM   6296 C  C     . THR D 4  8   ? 62.310 132.656 37.145 1.00 18.59  ? 8    THR B C     1 
ATOM   6297 O  O     . THR D 4  8   ? 61.653 131.637 36.922 1.00 18.62  ? 8    THR B O     1 
ATOM   6298 C  CB    . THR D 4  8   ? 64.747 132.572 37.458 1.00 17.59  ? 8    THR B CB    1 
ATOM   6299 O  OG1   . THR D 4  8   ? 64.672 131.596 36.406 1.00 17.96  ? 8    THR B OG1   1 
ATOM   6300 C  CG2   . THR D 4  8   ? 65.872 132.241 38.424 1.00 15.34  ? 8    THR B CG2   1 
ATOM   6301 N  N     . ASP D 4  9   ? 62.115 133.797 36.498 1.00 19.31  ? 9    ASP B N     1 
ATOM   6302 C  CA    . ASP D 4  9   ? 61.099 133.881 35.466 1.00 21.39  ? 9    ASP B CA    1 
ATOM   6303 C  C     . ASP D 4  9   ? 61.348 132.845 34.376 1.00 22.65  ? 9    ASP B C     1 
ATOM   6304 O  O     . ASP D 4  9   ? 60.422 132.164 33.942 1.00 24.16  ? 9    ASP B O     1 
ATOM   6305 C  CB    . ASP D 4  9   ? 61.072 135.276 34.826 1.00 23.06  ? 9    ASP B CB    1 
ATOM   6306 C  CG    . ASP D 4  9   ? 60.303 136.292 35.655 1.00 25.09  ? 9    ASP B CG    1 
ATOM   6307 O  OD1   . ASP D 4  9   ? 59.305 135.911 36.313 1.00 25.48  ? 9    ASP B OD1   1 
ATOM   6308 O  OD2   . ASP D 4  9   ? 60.686 137.479 35.632 1.00 25.48  ? 9    ASP B OD2   1 
ATOM   6309 N  N     . ASP D 4  10  ? 62.599 132.719 33.945 1.00 22.53  ? 10   ASP B N     1 
ATOM   6310 C  CA    . ASP D 4  10  ? 62.937 131.792 32.876 1.00 23.36  ? 10   ASP B CA    1 
ATOM   6311 C  C     . ASP D 4  10  ? 62.896 130.319 33.239 1.00 24.54  ? 10   ASP B C     1 
ATOM   6312 O  O     . ASP D 4  10  ? 62.836 129.476 32.353 1.00 25.71  ? 10   ASP B O     1 
ATOM   6313 C  CB    . ASP D 4  10  ? 64.313 132.126 32.294 1.00 24.25  ? 10   ASP B CB    1 
ATOM   6314 C  CG    . ASP D 4  10  ? 64.341 133.480 31.614 1.00 25.83  ? 10   ASP B CG    1 
ATOM   6315 O  OD1   . ASP D 4  10  ? 63.277 133.923 31.139 1.00 27.75  ? 10   ASP B OD1   1 
ATOM   6316 O  OD2   . ASP D 4  10  ? 65.422 134.098 31.542 1.00 27.50  ? 10   ASP B OD2   1 
ATOM   6317 N  N     . SER D 4  11  ? 62.925 129.997 34.526 1.00 24.53  ? 11   SER B N     1 
ATOM   6318 C  CA    . SER D 4  11  ? 62.897 128.595 34.929 1.00 24.38  ? 11   SER B CA    1 
ATOM   6319 C  C     . SER D 4  11  ? 61.545 128.189 35.491 1.00 24.81  ? 11   SER B C     1 
ATOM   6320 O  O     . SER D 4  11  ? 61.328 127.023 35.817 1.00 23.55  ? 11   SER B O     1 
ATOM   6321 C  CB    . SER D 4  11  ? 63.955 128.323 35.989 1.00 23.89  ? 11   SER B CB    1 
ATOM   6322 O  OG    . SER D 4  11  ? 63.460 128.652 37.272 1.00 27.28  ? 11   SER B OG    1 
ATOM   6323 N  N     . PHE D 4  12  ? 60.638 129.153 35.600 1.00 25.13  ? 12   PHE B N     1 
ATOM   6324 C  CA    . PHE D 4  12  ? 59.321 128.889 36.153 1.00 26.74  ? 12   PHE B CA    1 
ATOM   6325 C  C     . PHE D 4  12  ? 58.490 127.893 35.348 1.00 27.81  ? 12   PHE B C     1 
ATOM   6326 O  O     . PHE D 4  12  ? 57.840 127.016 35.918 1.00 27.99  ? 12   PHE B O     1 
ATOM   6327 C  CB    . PHE D 4  12  ? 58.562 130.202 36.314 1.00 25.64  ? 12   PHE B CB    1 
ATOM   6328 C  CG    . PHE D 4  12  ? 57.288 130.072 37.092 1.00 25.82  ? 12   PHE B CG    1 
ATOM   6329 C  CD1   . PHE D 4  12  ? 56.121 129.632 36.479 1.00 23.47  ? 12   PHE B CD1   1 
ATOM   6330 C  CD2   . PHE D 4  12  ? 57.251 130.403 38.443 1.00 26.81  ? 12   PHE B CD2   1 
ATOM   6331 C  CE1   . PHE D 4  12  ? 54.938 129.529 37.198 1.00 24.57  ? 12   PHE B CE1   1 
ATOM   6332 C  CE2   . PHE D 4  12  ? 56.069 130.301 39.171 1.00 24.98  ? 12   PHE B CE2   1 
ATOM   6333 C  CZ    . PHE D 4  12  ? 54.912 129.864 38.546 1.00 23.91  ? 12   PHE B CZ    1 
ATOM   6334 N  N     . ASP D 4  13  ? 58.511 128.025 34.028 1.00 29.50  ? 13   ASP B N     1 
ATOM   6335 C  CA    . ASP D 4  13  ? 57.751 127.129 33.169 1.00 31.91  ? 13   ASP B CA    1 
ATOM   6336 C  C     . ASP D 4  13  ? 58.116 125.662 33.392 1.00 32.18  ? 13   ASP B C     1 
ATOM   6337 O  O     . ASP D 4  13  ? 57.241 124.836 33.652 1.00 32.96  ? 13   ASP B O     1 
ATOM   6338 C  CB    . ASP D 4  13  ? 57.970 127.513 31.702 1.00 36.45  ? 13   ASP B CB    1 
ATOM   6339 C  CG    . ASP D 4  13  ? 57.202 126.622 30.731 1.00 41.90  ? 13   ASP B CG    1 
ATOM   6340 O  OD1   . ASP D 4  13  ? 57.624 125.466 30.503 1.00 44.62  ? 13   ASP B OD1   1 
ATOM   6341 O  OD2   . ASP D 4  13  ? 56.173 127.083 30.190 1.00 44.49  ? 13   ASP B OD2   1 
ATOM   6342 N  N     . THR D 4  14  ? 59.399 125.330 33.313 1.00 31.28  ? 14   THR B N     1 
ATOM   6343 C  CA    . THR D 4  14  ? 59.790 123.940 33.484 1.00 31.78  ? 14   THR B CA    1 
ATOM   6344 C  C     . THR D 4  14  ? 59.789 123.447 34.929 1.00 32.68  ? 14   THR B C     1 
ATOM   6345 O  O     . THR D 4  14  ? 59.429 122.299 35.183 1.00 35.76  ? 14   THR B O     1 
ATOM   6346 C  CB    . THR D 4  14  ? 61.179 123.649 32.857 1.00 31.24  ? 14   THR B CB    1 
ATOM   6347 O  OG1   . THR D 4  14  ? 62.210 124.177 33.698 1.00 34.88  ? 14   THR B OG1   1 
ATOM   6348 C  CG2   . THR D 4  14  ? 61.281 124.284 31.479 1.00 28.20  ? 14   THR B CG2   1 
ATOM   6349 N  N     . ASP D 4  15  ? 60.175 124.293 35.879 1.00 31.20  ? 15   ASP B N     1 
ATOM   6350 C  CA    . ASP D 4  15  ? 60.200 123.860 37.275 1.00 31.93  ? 15   ASP B CA    1 
ATOM   6351 C  C     . ASP D 4  15  ? 58.835 123.746 37.924 1.00 32.29  ? 15   ASP B C     1 
ATOM   6352 O  O     . ASP D 4  15  ? 58.662 122.997 38.886 1.00 32.03  ? 15   ASP B O     1 
ATOM   6353 C  CB    . ASP D 4  15  ? 61.038 124.802 38.128 1.00 32.69  ? 15   ASP B CB    1 
ATOM   6354 C  CG    . ASP D 4  15  ? 62.500 124.688 37.843 1.00 33.41  ? 15   ASP B CG    1 
ATOM   6355 O  OD1   . ASP D 4  15  ? 62.994 123.548 37.719 1.00 36.49  ? 15   ASP B OD1   1 
ATOM   6356 O  OD2   . ASP D 4  15  ? 63.154 125.739 37.755 1.00 34.16  ? 15   ASP B OD2   1 
ATOM   6357 N  N     . VAL D 4  16  ? 57.869 124.497 37.409 1.00 32.19  ? 16   VAL B N     1 
ATOM   6358 C  CA    . VAL D 4  16  ? 56.532 124.483 37.972 1.00 31.39  ? 16   VAL B CA    1 
ATOM   6359 C  C     . VAL D 4  16  ? 55.480 123.895 37.037 1.00 31.51  ? 16   VAL B C     1 
ATOM   6360 O  O     . VAL D 4  16  ? 54.950 122.816 37.290 1.00 32.65  ? 16   VAL B O     1 
ATOM   6361 C  CB    . VAL D 4  16  ? 56.100 125.915 38.378 1.00 31.11  ? 16   VAL B CB    1 
ATOM   6362 C  CG1   . VAL D 4  16  ? 54.679 125.898 38.927 1.00 30.03  ? 16   VAL B CG1   1 
ATOM   6363 C  CG2   . VAL D 4  16  ? 57.068 126.473 39.415 1.00 28.55  ? 16   VAL B CG2   1 
ATOM   6364 N  N     . LEU D 4  17  ? 55.187 124.605 35.955 1.00 30.89  ? 17   LEU B N     1 
ATOM   6365 C  CA    . LEU D 4  17  ? 54.174 124.170 35.007 1.00 31.08  ? 17   LEU B CA    1 
ATOM   6366 C  C     . LEU D 4  17  ? 54.390 122.785 34.413 1.00 33.96  ? 17   LEU B C     1 
ATOM   6367 O  O     . LEU D 4  17  ? 53.442 122.167 33.922 1.00 33.93  ? 17   LEU B O     1 
ATOM   6368 C  CB    . LEU D 4  17  ? 54.036 125.203 33.885 1.00 26.04  ? 17   LEU B CB    1 
ATOM   6369 C  CG    . LEU D 4  17  ? 53.610 126.583 34.385 1.00 24.88  ? 17   LEU B CG    1 
ATOM   6370 C  CD1   . LEU D 4  17  ? 53.316 127.485 33.208 1.00 22.31  ? 17   LEU B CD1   1 
ATOM   6371 C  CD2   . LEU D 4  17  ? 52.375 126.448 35.268 1.00 23.42  ? 17   LEU B CD2   1 
ATOM   6372 N  N     . LYS D 4  18  ? 55.627 122.294 34.455 1.00 36.93  ? 18   LYS B N     1 
ATOM   6373 C  CA    . LYS D 4  18  ? 55.928 120.974 33.910 1.00 38.76  ? 18   LYS B CA    1 
ATOM   6374 C  C     . LYS D 4  18  ? 56.615 120.090 34.938 1.00 39.81  ? 18   LYS B C     1 
ATOM   6375 O  O     . LYS D 4  18  ? 57.267 119.105 34.594 1.00 40.37  ? 18   LYS B O     1 
ATOM   6376 C  CB    . LYS D 4  18  ? 56.794 121.106 32.655 1.00 39.67  ? 18   LYS B CB    1 
ATOM   6377 C  CG    . LYS D 4  18  ? 56.096 121.846 31.519 1.00 42.36  ? 18   LYS B CG    1 
ATOM   6378 C  CD    . LYS D 4  18  ? 56.907 121.816 30.230 1.00 44.34  ? 18   LYS B CD    1 
ATOM   6379 C  CE    . LYS D 4  18  ? 58.248 122.523 30.389 1.00 45.97  ? 18   LYS B CE    1 
ATOM   6380 N  NZ    . LYS D 4  18  ? 59.088 122.430 29.158 1.00 46.56  ? 18   LYS B NZ    1 
ATOM   6381 N  N     . ALA D 4  19  ? 56.442 120.442 36.206 1.00 41.33  ? 19   ALA B N     1 
ATOM   6382 C  CA    . ALA D 4  19  ? 57.039 119.701 37.306 1.00 43.82  ? 19   ALA B CA    1 
ATOM   6383 C  C     . ALA D 4  19  ? 56.396 118.339 37.548 1.00 46.87  ? 19   ALA B C     1 
ATOM   6384 O  O     . ALA D 4  19  ? 57.036 117.442 38.099 1.00 46.93  ? 19   ALA B O     1 
ATOM   6385 C  CB    . ALA D 4  19  ? 56.968 120.526 38.572 1.00 43.47  ? 19   ALA B CB    1 
ATOM   6386 N  N     . ASP D 4  20  ? 55.139 118.179 37.142 1.00 49.81  ? 20   ASP B N     1 
ATOM   6387 C  CA    . ASP D 4  20  ? 54.438 116.913 37.355 1.00 53.99  ? 20   ASP B CA    1 
ATOM   6388 C  C     . ASP D 4  20  ? 54.560 116.508 38.824 1.00 53.80  ? 20   ASP B C     1 
ATOM   6389 O  O     . ASP D 4  20  ? 55.475 115.784 39.220 1.00 54.25  ? 20   ASP B O     1 
ATOM   6390 C  CB    . ASP D 4  20  ? 55.010 115.820 36.444 1.00 57.81  ? 20   ASP B CB    1 
ATOM   6391 C  CG    . ASP D 4  20  ? 54.438 115.878 35.031 1.00 61.06  ? 20   ASP B CG    1 
ATOM   6392 O  OD1   . ASP D 4  20  ? 54.378 116.987 34.452 1.00 62.60  ? 20   ASP B OD1   1 
ATOM   6393 O  OD2   . ASP D 4  20  ? 54.054 114.811 34.499 1.00 62.61  ? 20   ASP B OD2   1 
ATOM   6394 N  N     . GLY D 4  21  ? 53.613 116.994 39.618 1.00 53.51  ? 21   GLY B N     1 
ATOM   6395 C  CA    . GLY D 4  21  ? 53.591 116.739 41.046 1.00 50.20  ? 21   GLY B CA    1 
ATOM   6396 C  C     . GLY D 4  21  ? 53.111 118.028 41.684 1.00 48.54  ? 21   GLY B C     1 
ATOM   6397 O  O     . GLY D 4  21  ? 52.990 119.046 40.999 1.00 48.99  ? 21   GLY B O     1 
ATOM   6398 N  N     . ALA D 4  22  ? 52.827 118.003 42.981 1.00 45.99  ? 22   ALA B N     1 
ATOM   6399 C  CA    . ALA D 4  22  ? 52.358 119.200 43.668 1.00 42.25  ? 22   ALA B CA    1 
ATOM   6400 C  C     . ALA D 4  22  ? 53.513 120.146 43.973 1.00 40.29  ? 22   ALA B C     1 
ATOM   6401 O  O     . ALA D 4  22  ? 54.506 119.752 44.590 1.00 40.63  ? 22   ALA B O     1 
ATOM   6402 C  CB    . ALA D 4  22  ? 51.643 118.817 44.958 1.00 40.50  ? 22   ALA B CB    1 
ATOM   6403 N  N     . ILE D 4  23  ? 53.384 121.392 43.532 1.00 38.10  ? 23   ILE B N     1 
ATOM   6404 C  CA    . ILE D 4  23  ? 54.413 122.401 43.779 1.00 35.83  ? 23   ILE B CA    1 
ATOM   6405 C  C     . ILE D 4  23  ? 53.754 123.609 44.440 1.00 34.24  ? 23   ILE B C     1 
ATOM   6406 O  O     . ILE D 4  23  ? 52.802 124.176 43.897 1.00 35.06  ? 23   ILE B O     1 
ATOM   6407 C  CB    . ILE D 4  23  ? 55.068 122.897 42.468 1.00 35.84  ? 23   ILE B CB    1 
ATOM   6408 C  CG1   . ILE D 4  23  ? 55.415 121.719 41.559 1.00 36.11  ? 23   ILE B CG1   1 
ATOM   6409 C  CG2   . ILE D 4  23  ? 56.333 123.686 42.793 1.00 33.59  ? 23   ILE B CG2   1 
ATOM   6410 C  CD1   . ILE D 4  23  ? 56.523 120.845 42.086 1.00 39.22  ? 23   ILE B CD1   1 
ATOM   6411 N  N     . LEU D 4  24  ? 54.247 124.000 45.608 1.00 31.37  ? 24   LEU B N     1 
ATOM   6412 C  CA    . LEU D 4  24  ? 53.690 125.159 46.293 1.00 29.29  ? 24   LEU B CA    1 
ATOM   6413 C  C     . LEU D 4  24  ? 54.599 126.358 46.034 1.00 28.92  ? 24   LEU B C     1 
ATOM   6414 O  O     . LEU D 4  24  ? 55.746 126.390 46.487 1.00 27.47  ? 24   LEU B O     1 
ATOM   6415 C  CB    . LEU D 4  24  ? 53.588 124.903 47.798 1.00 28.13  ? 24   LEU B CB    1 
ATOM   6416 C  CG    . LEU D 4  24  ? 52.972 126.028 48.640 1.00 28.71  ? 24   LEU B CG    1 
ATOM   6417 C  CD1   . LEU D 4  24  ? 51.500 126.195 48.281 1.00 26.01  ? 24   LEU B CD1   1 
ATOM   6418 C  CD2   . LEU D 4  24  ? 53.125 125.711 50.124 1.00 26.87  ? 24   LEU B CD2   1 
ATOM   6419 N  N     . VAL D 4  25  ? 54.085 127.338 45.297 1.00 27.49  ? 25   VAL B N     1 
ATOM   6420 C  CA    . VAL D 4  25  ? 54.860 128.528 44.975 1.00 26.50  ? 25   VAL B CA    1 
ATOM   6421 C  C     . VAL D 4  25  ? 54.503 129.711 45.864 1.00 26.14  ? 25   VAL B C     1 
ATOM   6422 O  O     . VAL D 4  25  ? 53.331 130.050 46.033 1.00 26.01  ? 25   VAL B O     1 
ATOM   6423 C  CB    . VAL D 4  25  ? 54.653 128.951 43.508 1.00 25.97  ? 25   VAL B CB    1 
ATOM   6424 C  CG1   . VAL D 4  25  ? 55.398 130.249 43.234 1.00 24.50  ? 25   VAL B CG1   1 
ATOM   6425 C  CG2   . VAL D 4  25  ? 55.142 127.859 42.581 1.00 27.09  ? 25   VAL B CG2   1 
ATOM   6426 N  N     . ASP D 4  26  ? 55.529 130.341 46.422 1.00 23.31  ? 26   ASP B N     1 
ATOM   6427 C  CA    . ASP D 4  26  ? 55.340 131.488 47.282 1.00 21.75  ? 26   ASP B CA    1 
ATOM   6428 C  C     . ASP D 4  26  ? 55.895 132.734 46.610 1.00 22.75  ? 26   ASP B C     1 
ATOM   6429 O  O     . ASP D 4  26  ? 57.102 132.857 46.420 1.00 23.39  ? 26   ASP B O     1 
ATOM   6430 C  CB    . ASP D 4  26  ? 56.036 131.242 48.624 1.00 23.29  ? 26   ASP B CB    1 
ATOM   6431 C  CG    . ASP D 4  26  ? 56.333 132.523 49.380 1.00 22.29  ? 26   ASP B CG    1 
ATOM   6432 O  OD1   . ASP D 4  26  ? 55.483 133.439 49.383 1.00 23.55  ? 26   ASP B OD1   1 
ATOM   6433 O  OD2   . ASP D 4  26  ? 57.418 132.606 49.986 1.00 21.23  ? 26   ASP B OD2   1 
ATOM   6434 N  N     . PHE D 4  27  ? 55.003 133.637 46.210 1.00 22.67  ? 27   PHE B N     1 
ATOM   6435 C  CA    . PHE D 4  27  ? 55.417 134.883 45.582 1.00 22.37  ? 27   PHE B CA    1 
ATOM   6436 C  C     . PHE D 4  27  ? 55.640 135.855 46.717 1.00 22.95  ? 27   PHE B C     1 
ATOM   6437 O  O     . PHE D 4  27  ? 54.698 136.193 47.438 1.00 24.56  ? 27   PHE B O     1 
ATOM   6438 C  CB    . PHE D 4  27  ? 54.332 135.429 44.658 1.00 21.62  ? 27   PHE B CB    1 
ATOM   6439 C  CG    . PHE D 4  27  ? 54.047 134.555 43.483 1.00 20.33  ? 27   PHE B CG    1 
ATOM   6440 C  CD1   . PHE D 4  27  ? 53.241 133.434 43.618 1.00 19.88  ? 27   PHE B CD1   1 
ATOM   6441 C  CD2   . PHE D 4  27  ? 54.594 134.849 42.239 1.00 18.52  ? 27   PHE B CD2   1 
ATOM   6442 C  CE1   . PHE D 4  27  ? 52.978 132.608 42.528 1.00 22.22  ? 27   PHE B CE1   1 
ATOM   6443 C  CE2   . PHE D 4  27  ? 54.343 134.034 41.139 1.00 22.00  ? 27   PHE B CE2   1 
ATOM   6444 C  CZ    . PHE D 4  27  ? 53.529 132.906 41.283 1.00 22.59  ? 27   PHE B CZ    1 
ATOM   6445 N  N     . TRP D 4  28  ? 56.881 136.304 46.870 1.00 21.79  ? 28   TRP B N     1 
ATOM   6446 C  CA    . TRP D 4  28  ? 57.233 137.212 47.948 1.00 20.18  ? 28   TRP B CA    1 
ATOM   6447 C  C     . TRP D 4  28  ? 58.085 138.396 47.513 1.00 21.21  ? 28   TRP B C     1 
ATOM   6448 O  O     . TRP D 4  28  ? 58.484 138.521 46.353 1.00 20.86  ? 28   TRP B O     1 
ATOM   6449 C  CB    . TRP D 4  28  ? 57.996 136.450 49.020 1.00 18.25  ? 28   TRP B CB    1 
ATOM   6450 C  CG    . TRP D 4  28  ? 59.338 135.977 48.549 1.00 16.68  ? 28   TRP B CG    1 
ATOM   6451 C  CD1   . TRP D 4  28  ? 59.588 134.979 47.652 1.00 15.42  ? 28   TRP B CD1   1 
ATOM   6452 C  CD2   . TRP D 4  28  ? 60.615 136.488 48.947 1.00 14.77  ? 28   TRP B CD2   1 
ATOM   6453 N  NE1   . TRP D 4  28  ? 60.943 134.833 47.469 1.00 14.16  ? 28   TRP B NE1   1 
ATOM   6454 C  CE2   . TRP D 4  28  ? 61.597 135.747 48.253 1.00 13.82  ? 28   TRP B CE2   1 
ATOM   6455 C  CE3   . TRP D 4  28  ? 61.025 137.500 49.827 1.00 14.85  ? 28   TRP B CE3   1 
ATOM   6456 C  CZ2   . TRP D 4  28  ? 62.973 135.987 48.409 1.00 13.92  ? 28   TRP B CZ2   1 
ATOM   6457 C  CZ3   . TRP D 4  28  ? 62.394 137.738 49.984 1.00 13.47  ? 28   TRP B CZ3   1 
ATOM   6458 C  CH2   . TRP D 4  28  ? 63.350 136.980 49.276 1.00 12.71  ? 28   TRP B CH2   1 
ATOM   6459 N  N     . ALA D 4  29  ? 58.369 139.260 48.476 1.00 20.89  ? 29   ALA B N     1 
ATOM   6460 C  CA    . ALA D 4  29  ? 59.185 140.435 48.240 1.00 22.84  ? 29   ALA B CA    1 
ATOM   6461 C  C     . ALA D 4  29  ? 59.893 140.708 49.552 1.00 24.86  ? 29   ALA B C     1 
ATOM   6462 O  O     . ALA D 4  29  ? 59.318 140.506 50.624 1.00 25.77  ? 29   ALA B O     1 
ATOM   6463 C  CB    . ALA D 4  29  ? 58.312 141.619 47.850 1.00 24.01  ? 29   ALA B CB    1 
ATOM   6464 N  N     . GLU D 4  30  ? 61.136 141.165 49.465 1.00 27.30  ? 30   GLU B N     1 
ATOM   6465 C  CA    . GLU D 4  30  ? 61.937 141.442 50.649 1.00 29.84  ? 30   GLU B CA    1 
ATOM   6466 C  C     . GLU D 4  30  ? 61.342 142.523 51.555 1.00 30.02  ? 30   GLU B C     1 
ATOM   6467 O  O     . GLU D 4  30  ? 61.622 142.552 52.752 1.00 30.53  ? 30   GLU B O     1 
ATOM   6468 C  CB    . GLU D 4  30  ? 63.348 141.853 50.225 1.00 32.45  ? 30   GLU B CB    1 
ATOM   6469 C  CG    . GLU D 4  30  ? 64.354 141.864 51.360 1.00 39.42  ? 30   GLU B CG    1 
ATOM   6470 C  CD    . GLU D 4  30  ? 64.642 140.467 51.894 1.00 42.88  ? 30   GLU B CD    1 
ATOM   6471 O  OE1   . GLU D 4  30  ? 65.053 139.600 51.093 1.00 45.66  ? 30   GLU B OE1   1 
ATOM   6472 O  OE2   . GLU D 4  30  ? 64.465 140.235 53.109 1.00 45.06  ? 30   GLU B OE2   1 
ATOM   6473 N  N     . TRP D 4  31  ? 60.512 143.396 50.987 1.00 28.71  ? 31   TRP B N     1 
ATOM   6474 C  CA    . TRP D 4  31  ? 59.913 144.498 51.741 1.00 27.75  ? 31   TRP B CA    1 
ATOM   6475 C  C     . TRP D 4  31  ? 58.524 144.268 52.323 1.00 28.41  ? 31   TRP B C     1 
ATOM   6476 O  O     . TRP D 4  31  ? 57.848 145.223 52.692 1.00 29.28  ? 31   TRP B O     1 
ATOM   6477 C  CB    . TRP D 4  31  ? 59.873 145.765 50.873 1.00 27.14  ? 31   TRP B CB    1 
ATOM   6478 C  CG    . TRP D 4  31  ? 59.458 145.516 49.443 1.00 25.88  ? 31   TRP B CG    1 
ATOM   6479 C  CD1   . TRP D 4  31  ? 60.285 145.339 48.363 1.00 26.57  ? 31   TRP B CD1   1 
ATOM   6480 C  CD2   . TRP D 4  31  ? 58.123 145.361 48.949 1.00 24.74  ? 31   TRP B CD2   1 
ATOM   6481 N  NE1   . TRP D 4  31  ? 59.546 145.082 47.231 1.00 24.80  ? 31   TRP B NE1   1 
ATOM   6482 C  CE2   . TRP D 4  31  ? 58.217 145.088 47.560 1.00 24.72  ? 31   TRP B CE2   1 
ATOM   6483 C  CE3   . TRP D 4  31  ? 56.857 145.422 49.541 1.00 22.97  ? 31   TRP B CE3   1 
ATOM   6484 C  CZ2   . TRP D 4  31  ? 57.096 144.878 46.760 1.00 23.53  ? 31   TRP B CZ2   1 
ATOM   6485 C  CZ3   . TRP D 4  31  ? 55.739 145.212 48.746 1.00 25.52  ? 31   TRP B CZ3   1 
ATOM   6486 C  CH2   . TRP D 4  31  ? 55.866 144.942 47.367 1.00 25.94  ? 31   TRP B CH2   1 
ATOM   6487 N  N     . CYS D 4  32  ? 58.097 143.016 52.421 1.00 29.43  ? 32   CYS B N     1 
ATOM   6488 C  CA    . CYS D 4  32  ? 56.772 142.709 52.955 1.00 28.42  ? 32   CYS B CA    1 
ATOM   6489 C  C     . CYS D 4  32  ? 56.838 142.057 54.333 1.00 28.21  ? 32   CYS B C     1 
ATOM   6490 O  O     . CYS D 4  32  ? 57.475 141.022 54.507 1.00 28.12  ? 32   CYS B O     1 
ATOM   6491 C  CB    . CYS D 4  32  ? 56.033 141.797 51.975 1.00 28.25  ? 32   CYS B CB    1 
ATOM   6492 S  SG    . CYS D 4  32  ? 54.501 141.075 52.593 1.00 27.78  ? 32   CYS B SG    1 
ATOM   6493 N  N     . GLY D 4  33  ? 56.178 142.673 55.310 1.00 29.24  ? 33   GLY B N     1 
ATOM   6494 C  CA    . GLY D 4  33  ? 56.168 142.137 56.663 1.00 27.97  ? 33   GLY B CA    1 
ATOM   6495 C  C     . GLY D 4  33  ? 55.698 140.695 56.682 1.00 27.31  ? 33   GLY B C     1 
ATOM   6496 O  O     . GLY D 4  33  ? 56.437 139.811 57.103 1.00 26.74  ? 33   GLY B O     1 
ATOM   6497 N  N     . PRO D 4  34  ? 54.461 140.425 56.239 1.00 28.08  ? 34   PRO B N     1 
ATOM   6498 C  CA    . PRO D 4  34  ? 53.913 139.066 56.209 1.00 29.13  ? 34   PRO B CA    1 
ATOM   6499 C  C     . PRO D 4  34  ? 54.809 138.048 55.480 1.00 29.91  ? 34   PRO B C     1 
ATOM   6500 O  O     . PRO D 4  34  ? 54.867 136.876 55.865 1.00 30.22  ? 34   PRO B O     1 
ATOM   6501 C  CB    . PRO D 4  34  ? 52.567 139.264 55.520 1.00 28.08  ? 34   PRO B CB    1 
ATOM   6502 C  CG    . PRO D 4  34  ? 52.154 140.610 56.033 1.00 27.56  ? 34   PRO B CG    1 
ATOM   6503 C  CD    . PRO D 4  34  ? 53.421 141.414 55.902 1.00 27.15  ? 34   PRO B CD    1 
ATOM   6504 N  N     . CYS D 4  35  ? 55.505 138.490 54.434 1.00 29.54  ? 35   CYS B N     1 
ATOM   6505 C  CA    . CYS D 4  35  ? 56.391 137.594 53.691 1.00 29.34  ? 35   CYS B CA    1 
ATOM   6506 C  C     . CYS D 4  35  ? 57.542 137.111 54.569 1.00 29.52  ? 35   CYS B C     1 
ATOM   6507 O  O     . CYS D 4  35  ? 57.929 135.947 54.510 1.00 29.97  ? 35   CYS B O     1 
ATOM   6508 C  CB    . CYS D 4  35  ? 56.950 138.290 52.441 1.00 28.01  ? 35   CYS B CB    1 
ATOM   6509 S  SG    . CYS D 4  35  ? 55.777 138.424 51.068 1.00 23.80  ? 35   CYS B SG    1 
ATOM   6510 N  N     . LYS D 4  36  ? 58.088 138.005 55.383 1.00 30.04  ? 36   LYS B N     1 
ATOM   6511 C  CA    . LYS D 4  36  ? 59.181 137.634 56.267 1.00 32.28  ? 36   LYS B CA    1 
ATOM   6512 C  C     . LYS D 4  36  ? 58.684 136.688 57.362 1.00 32.95  ? 36   LYS B C     1 
ATOM   6513 O  O     . LYS D 4  36  ? 59.444 135.878 57.888 1.00 35.39  ? 36   LYS B O     1 
ATOM   6514 C  CB    . LYS D 4  36  ? 59.795 138.883 56.899 1.00 33.54  ? 36   LYS B CB    1 
ATOM   6515 C  CG    . LYS D 4  36  ? 60.954 138.601 57.843 1.00 37.63  ? 36   LYS B CG    1 
ATOM   6516 C  CD    . LYS D 4  36  ? 61.392 139.874 58.577 1.00 40.94  ? 36   LYS B CD    1 
ATOM   6517 C  CE    . LYS D 4  36  ? 62.444 139.583 59.638 1.00 41.01  ? 36   LYS B CE    1 
ATOM   6518 N  NZ    . LYS D 4  36  ? 62.694 140.765 60.511 1.00 46.01  ? 36   LYS B NZ    1 
ATOM   6519 N  N     . MET D 4  37  ? 57.403 136.783 57.696 1.00 31.69  ? 37   MET B N     1 
ATOM   6520 C  CA    . MET D 4  37  ? 56.829 135.932 58.730 1.00 31.43  ? 37   MET B CA    1 
ATOM   6521 C  C     . MET D 4  37  ? 56.722 134.482 58.287 1.00 31.56  ? 37   MET B C     1 
ATOM   6522 O  O     . MET D 4  37  ? 57.189 133.575 58.977 1.00 31.67  ? 37   MET B O     1 
ATOM   6523 C  CB    . MET D 4  37  ? 55.427 136.410 59.109 1.00 32.20  ? 37   MET B CB    1 
ATOM   6524 C  CG    . MET D 4  37  ? 55.354 137.747 59.819 1.00 32.09  ? 37   MET B CG    1 
ATOM   6525 S  SD    . MET D 4  37  ? 53.625 138.171 60.129 1.00 32.18  ? 37   MET B SD    1 
ATOM   6526 C  CE    . MET D 4  37  ? 53.175 136.910 61.310 1.00 28.48  ? 37   MET B CE    1 
ATOM   6527 N  N     . ILE D 4  38  ? 56.093 134.275 57.132 1.00 30.61  ? 38   ILE B N     1 
ATOM   6528 C  CA    . ILE D 4  38  ? 55.870 132.940 56.585 1.00 29.74  ? 38   ILE B CA    1 
ATOM   6529 C  C     . ILE D 4  38  ? 57.117 132.234 56.047 1.00 29.06  ? 38   ILE B C     1 
ATOM   6530 O  O     . ILE D 4  38  ? 57.094 131.026 55.817 1.00 27.39  ? 38   ILE B O     1 
ATOM   6531 C  CB    . ILE D 4  38  ? 54.805 132.992 55.456 1.00 29.92  ? 38   ILE B CB    1 
ATOM   6532 C  CG1   . ILE D 4  38  ? 54.116 131.636 55.326 1.00 28.97  ? 38   ILE B CG1   1 
ATOM   6533 C  CG2   . ILE D 4  38  ? 55.459 133.371 54.125 1.00 26.17  ? 38   ILE B CG2   1 
ATOM   6534 C  CD1   . ILE D 4  38  ? 52.894 131.678 54.441 1.00 31.37  ? 38   ILE B CD1   1 
ATOM   6535 N  N     . ALA D 4  39  ? 58.197 132.985 55.846 1.00 28.88  ? 39   ALA B N     1 
ATOM   6536 C  CA    . ALA D 4  39  ? 59.437 132.416 55.321 1.00 29.18  ? 39   ALA B CA    1 
ATOM   6537 C  C     . ALA D 4  39  ? 59.939 131.240 56.155 1.00 29.05  ? 39   ALA B C     1 
ATOM   6538 O  O     . ALA D 4  39  ? 60.250 130.185 55.613 1.00 28.03  ? 39   ALA B O     1 
ATOM   6539 C  CB    . ALA D 4  39  ? 60.522 133.496 55.222 1.00 27.84  ? 39   ALA B CB    1 
ATOM   6540 N  N     . PRO D 4  40  ? 60.034 131.407 57.483 1.00 29.82  ? 40   PRO B N     1 
ATOM   6541 C  CA    . PRO D 4  40  ? 60.511 130.296 58.311 1.00 30.25  ? 40   PRO B CA    1 
ATOM   6542 C  C     . PRO D 4  40  ? 59.546 129.114 58.304 1.00 30.49  ? 40   PRO B C     1 
ATOM   6543 O  O     . PRO D 4  40  ? 59.969 127.968 58.407 1.00 32.75  ? 40   PRO B O     1 
ATOM   6544 C  CB    . PRO D 4  40  ? 60.645 130.933 59.690 1.00 29.15  ? 40   PRO B CB    1 
ATOM   6545 C  CG    . PRO D 4  40  ? 61.010 132.336 59.361 1.00 29.45  ? 40   PRO B CG    1 
ATOM   6546 C  CD    . PRO D 4  40  ? 60.013 132.650 58.269 1.00 29.68  ? 40   PRO B CD    1 
ATOM   6547 N  N     . ILE D 4  41  ? 58.253 129.398 58.185 1.00 29.80  ? 41   ILE B N     1 
ATOM   6548 C  CA    . ILE D 4  41  ? 57.244 128.348 58.152 1.00 30.69  ? 41   ILE B CA    1 
ATOM   6549 C  C     . ILE D 4  41  ? 57.479 127.473 56.926 1.00 31.67  ? 41   ILE B C     1 
ATOM   6550 O  O     . ILE D 4  41  ? 57.390 126.248 56.992 1.00 31.89  ? 41   ILE B O     1 
ATOM   6551 C  CB    . ILE D 4  41  ? 55.820 128.925 58.029 1.00 31.99  ? 41   ILE B CB    1 
ATOM   6552 C  CG1   . ILE D 4  41  ? 55.613 130.066 59.031 1.00 32.74  ? 41   ILE B CG1   1 
ATOM   6553 C  CG2   . ILE D 4  41  ? 54.796 127.812 58.220 1.00 30.20  ? 41   ILE B CG2   1 
ATOM   6554 C  CD1   . ILE D 4  41  ? 55.751 129.664 60.475 1.00 34.58  ? 41   ILE B CD1   1 
ATOM   6555 N  N     . LEU D 4  42  ? 57.773 128.118 55.803 1.00 32.48  ? 42   LEU B N     1 
ATOM   6556 C  CA    . LEU D 4  42  ? 58.011 127.416 54.551 1.00 33.27  ? 42   LEU B CA    1 
ATOM   6557 C  C     . LEU D 4  42  ? 59.224 126.493 54.615 1.00 33.72  ? 42   LEU B C     1 
ATOM   6558 O  O     . LEU D 4  42  ? 59.195 125.400 54.054 1.00 33.75  ? 42   LEU B O     1 
ATOM   6559 C  CB    . LEU D 4  42  ? 58.181 128.425 53.412 1.00 33.17  ? 42   LEU B CB    1 
ATOM   6560 C  CG    . LEU D 4  42  ? 56.934 129.251 53.102 1.00 33.33  ? 42   LEU B CG    1 
ATOM   6561 C  CD1   . LEU D 4  42  ? 57.265 130.330 52.086 1.00 33.28  ? 42   LEU B CD1   1 
ATOM   6562 C  CD2   . LEU D 4  42  ? 55.832 128.332 52.581 1.00 33.01  ? 42   LEU B CD2   1 
ATOM   6563 N  N     . ASP D 4  43  ? 60.284 126.931 55.295 1.00 33.73  ? 43   ASP B N     1 
ATOM   6564 C  CA    . ASP D 4  43  ? 61.494 126.123 55.426 1.00 36.12  ? 43   ASP B CA    1 
ATOM   6565 C  C     . ASP D 4  43  ? 61.192 124.799 56.103 1.00 37.50  ? 43   ASP B C     1 
ATOM   6566 O  O     . ASP D 4  43  ? 61.698 123.755 55.710 1.00 37.27  ? 43   ASP B O     1 
ATOM   6567 C  CB    . ASP D 4  43  ? 62.559 126.862 56.236 1.00 35.41  ? 43   ASP B CB    1 
ATOM   6568 C  CG    . ASP D 4  43  ? 63.116 128.058 55.501 1.00 35.24  ? 43   ASP B CG    1 
ATOM   6569 O  OD1   . ASP D 4  43  ? 63.278 127.963 54.268 1.00 34.85  ? 43   ASP B OD1   1 
ATOM   6570 O  OD2   . ASP D 4  43  ? 63.404 129.085 56.149 1.00 34.82  ? 43   ASP B OD2   1 
ATOM   6571 N  N     . GLU D 4  44  ? 60.359 124.849 57.130 1.00 40.84  ? 44   GLU B N     1 
ATOM   6572 C  CA    . GLU D 4  44  ? 59.991 123.644 57.853 1.00 43.16  ? 44   GLU B CA    1 
ATOM   6573 C  C     . GLU D 4  44  ? 59.027 122.796 57.034 1.00 42.93  ? 44   GLU B C     1 
ATOM   6574 O  O     . GLU D 4  44  ? 59.150 121.572 57.000 1.00 43.46  ? 44   GLU B O     1 
ATOM   6575 C  CB    . GLU D 4  44  ? 59.380 124.020 59.206 1.00 45.93  ? 44   GLU B CB    1 
ATOM   6576 C  CG    . GLU D 4  44  ? 60.415 124.524 60.207 1.00 49.65  ? 44   GLU B CG    1 
ATOM   6577 C  CD    . GLU D 4  44  ? 59.794 125.070 61.479 1.00 53.35  ? 44   GLU B CD    1 
ATOM   6578 O  OE1   . GLU D 4  44  ? 58.829 124.455 61.990 1.00 55.20  ? 44   GLU B OE1   1 
ATOM   6579 O  OE2   . GLU D 4  44  ? 60.283 126.112 61.973 1.00 54.17  ? 44   GLU B OE2   1 
ATOM   6580 N  N     . ILE D 4  45  ? 58.078 123.444 56.363 1.00 41.85  ? 45   ILE B N     1 
ATOM   6581 C  CA    . ILE D 4  45  ? 57.118 122.720 55.541 1.00 41.33  ? 45   ILE B CA    1 
ATOM   6582 C  C     . ILE D 4  45  ? 57.839 121.964 54.440 1.00 41.87  ? 45   ILE B C     1 
ATOM   6583 O  O     . ILE D 4  45  ? 57.483 120.834 54.123 1.00 42.07  ? 45   ILE B O     1 
ATOM   6584 C  CB    . ILE D 4  45  ? 56.092 123.666 54.889 1.00 40.68  ? 45   ILE B CB    1 
ATOM   6585 C  CG1   . ILE D 4  45  ? 55.215 124.306 55.967 1.00 40.39  ? 45   ILE B CG1   1 
ATOM   6586 C  CG2   . ILE D 4  45  ? 55.234 122.899 53.895 1.00 37.65  ? 45   ILE B CG2   1 
ATOM   6587 C  CD1   . ILE D 4  45  ? 54.429 123.311 56.791 1.00 39.02  ? 45   ILE B CD1   1 
ATOM   6588 N  N     . ALA D 4  46  ? 58.858 122.591 53.862 1.00 43.92  ? 46   ALA B N     1 
ATOM   6589 C  CA    . ALA D 4  46  ? 59.627 121.963 52.793 1.00 45.89  ? 46   ALA B CA    1 
ATOM   6590 C  C     . ALA D 4  46  ? 60.122 120.589 53.233 1.00 46.61  ? 46   ALA B C     1 
ATOM   6591 O  O     . ALA D 4  46  ? 60.020 119.619 52.481 1.00 46.51  ? 46   ALA B O     1 
ATOM   6592 C  CB    . ALA D 4  46  ? 60.807 122.845 52.398 1.00 44.79  ? 46   ALA B CB    1 
ATOM   6593 N  N     . ASP D 4  47  ? 60.652 120.513 54.451 1.00 47.77  ? 47   ASP B N     1 
ATOM   6594 C  CA    . ASP D 4  47  ? 61.156 119.255 54.994 1.00 50.21  ? 47   ASP B CA    1 
ATOM   6595 C  C     . ASP D 4  47  ? 60.034 118.244 55.189 1.00 50.63  ? 47   ASP B C     1 
ATOM   6596 O  O     . ASP D 4  47  ? 59.928 117.272 54.444 1.00 50.82  ? 47   ASP B O     1 
ATOM   6597 C  CB    . ASP D 4  47  ? 61.857 119.497 56.331 1.00 51.04  ? 47   ASP B CB    1 
ATOM   6598 C  CG    . ASP D 4  47  ? 63.086 120.367 56.191 1.00 53.84  ? 47   ASP B CG    1 
ATOM   6599 O  OD1   . ASP D 4  47  ? 62.986 121.426 55.536 1.00 55.08  ? 47   ASP B OD1   1 
ATOM   6600 O  OD2   . ASP D 4  47  ? 64.150 119.997 56.737 1.00 54.61  ? 47   ASP B OD2   1 
ATOM   6601 N  N     . GLU D 4  48  ? 59.201 118.480 56.195 1.00 51.03  ? 48   GLU B N     1 
ATOM   6602 C  CA    . GLU D 4  48  ? 58.086 117.595 56.496 1.00 52.67  ? 48   GLU B CA    1 
ATOM   6603 C  C     . GLU D 4  48  ? 57.408 116.995 55.264 1.00 52.56  ? 48   GLU B C     1 
ATOM   6604 O  O     . GLU D 4  48  ? 57.272 115.776 55.151 1.00 54.26  ? 48   GLU B O     1 
ATOM   6605 C  CB    . GLU D 4  48  ? 57.042 118.340 57.331 1.00 54.42  ? 48   GLU B CB    1 
ATOM   6606 C  CG    . GLU D 4  48  ? 57.477 118.612 58.760 1.00 57.12  ? 48   GLU B CG    1 
ATOM   6607 C  CD    . GLU D 4  48  ? 56.462 119.434 59.536 1.00 59.13  ? 48   GLU B CD    1 
ATOM   6608 O  OE1   . GLU D 4  48  ? 55.255 119.100 59.490 1.00 58.17  ? 48   GLU B OE1   1 
ATOM   6609 O  OE2   . GLU D 4  48  ? 56.878 120.412 60.197 1.00 60.18  ? 48   GLU B OE2   1 
ATOM   6610 N  N     . TYR D 4  49  ? 56.991 117.846 54.337 1.00 50.91  ? 49   TYR B N     1 
ATOM   6611 C  CA    . TYR D 4  49  ? 56.304 117.373 53.146 1.00 50.59  ? 49   TYR B CA    1 
ATOM   6612 C  C     . TYR D 4  49  ? 57.212 116.876 52.028 1.00 50.57  ? 49   TYR B C     1 
ATOM   6613 O  O     . TYR D 4  49  ? 56.755 116.626 50.907 1.00 50.20  ? 49   TYR B O     1 
ATOM   6614 C  CB    . TYR D 4  49  ? 55.367 118.469 52.628 1.00 49.86  ? 49   TYR B CB    1 
ATOM   6615 C  CG    . TYR D 4  49  ? 54.178 118.704 53.535 1.00 48.82  ? 49   TYR B CG    1 
ATOM   6616 C  CD1   . TYR D 4  49  ? 54.352 119.135 54.852 1.00 48.04  ? 49   TYR B CD1   1 
ATOM   6617 C  CD2   . TYR D 4  49  ? 52.882 118.447 53.092 1.00 48.50  ? 49   TYR B CD2   1 
ATOM   6618 C  CE1   . TYR D 4  49  ? 53.261 119.297 55.704 1.00 49.03  ? 49   TYR B CE1   1 
ATOM   6619 C  CE2   . TYR D 4  49  ? 51.788 118.607 53.931 1.00 48.65  ? 49   TYR B CE2   1 
ATOM   6620 C  CZ    . TYR D 4  49  ? 51.981 119.029 55.234 1.00 49.64  ? 49   TYR B CZ    1 
ATOM   6621 O  OH    . TYR D 4  49  ? 50.892 119.168 56.063 1.00 50.09  ? 49   TYR B OH    1 
ATOM   6622 N  N     . GLN D 4  50  ? 58.494 116.718 52.335 1.00 50.31  ? 50   GLN B N     1 
ATOM   6623 C  CA    . GLN D 4  50  ? 59.450 116.237 51.347 1.00 51.31  ? 50   GLN B CA    1 
ATOM   6624 C  C     . GLN D 4  50  ? 58.997 114.883 50.832 1.00 50.81  ? 50   GLN B C     1 
ATOM   6625 O  O     . GLN D 4  50  ? 58.864 113.934 51.600 1.00 51.44  ? 50   GLN B O     1 
ATOM   6626 C  CB    . GLN D 4  50  ? 60.838 116.089 51.965 1.00 52.70  ? 50   GLN B CB    1 
ATOM   6627 C  CG    . GLN D 4  50  ? 61.858 115.484 51.015 1.00 56.01  ? 50   GLN B CG    1 
ATOM   6628 C  CD    . GLN D 4  50  ? 63.108 114.995 51.722 1.00 58.06  ? 50   GLN B CD    1 
ATOM   6629 O  OE1   . GLN D 4  50  ? 64.001 114.419 51.096 1.00 59.92  ? 50   GLN B OE1   1 
ATOM   6630 N  NE2   . GLN D 4  50  ? 63.179 115.220 53.033 1.00 57.61  ? 50   GLN B NE2   1 
ATOM   6631 N  N     . GLY D 4  51  ? 58.764 114.788 49.531 1.00 49.77  ? 51   GLY B N     1 
ATOM   6632 C  CA    . GLY D 4  51  ? 58.329 113.523 48.977 1.00 49.72  ? 51   GLY B CA    1 
ATOM   6633 C  C     . GLY D 4  51  ? 56.975 113.643 48.323 1.00 49.62  ? 51   GLY B C     1 
ATOM   6634 O  O     . GLY D 4  51  ? 56.765 113.125 47.227 1.00 50.13  ? 51   GLY B O     1 
ATOM   6635 N  N     . LYS D 4  52  ? 56.047 114.320 48.991 1.00 49.16  ? 52   LYS B N     1 
ATOM   6636 C  CA    . LYS D 4  52  ? 54.717 114.505 48.427 1.00 48.59  ? 52   LYS B CA    1 
ATOM   6637 C  C     . LYS D 4  52  ? 54.460 115.963 48.046 1.00 47.40  ? 52   LYS B C     1 
ATOM   6638 O  O     . LYS D 4  52  ? 53.378 116.300 47.558 1.00 47.08  ? 52   LYS B O     1 
ATOM   6639 C  CB    . LYS D 4  52  ? 53.640 114.006 49.399 1.00 49.92  ? 52   LYS B CB    1 
ATOM   6640 C  CG    . LYS D 4  52  ? 53.720 114.566 50.809 1.00 51.60  ? 52   LYS B CG    1 
ATOM   6641 C  CD    . LYS D 4  52  ? 52.566 114.028 51.655 1.00 53.27  ? 52   LYS B CD    1 
ATOM   6642 C  CE    . LYS D 4  52  ? 52.627 114.529 53.095 1.00 54.68  ? 52   LYS B CE    1 
ATOM   6643 N  NZ    . LYS D 4  52  ? 51.439 114.098 53.894 1.00 54.58  ? 52   LYS B NZ    1 
ATOM   6644 N  N     . LEU D 4  53  ? 55.460 116.820 48.254 1.00 44.69  ? 53   LEU B N     1 
ATOM   6645 C  CA    . LEU D 4  53  ? 55.334 118.237 47.918 1.00 42.12  ? 53   LEU B CA    1 
ATOM   6646 C  C     . LEU D 4  53  ? 56.664 118.968 47.755 1.00 40.65  ? 53   LEU B C     1 
ATOM   6647 O  O     . LEU D 4  53  ? 57.606 118.766 48.529 1.00 40.22  ? 53   LEU B O     1 
ATOM   6648 C  CB    . LEU D 4  53  ? 54.517 118.976 48.981 1.00 41.99  ? 53   LEU B CB    1 
ATOM   6649 C  CG    . LEU D 4  53  ? 54.321 120.465 48.680 1.00 41.21  ? 53   LEU B CG    1 
ATOM   6650 C  CD1   . LEU D 4  53  ? 53.285 120.611 47.579 1.00 40.82  ? 53   LEU B CD1   1 
ATOM   6651 C  CD2   . LEU D 4  53  ? 53.876 121.208 49.920 1.00 41.64  ? 53   LEU B CD2   1 
ATOM   6652 N  N     . THR D 4  54  ? 56.723 119.834 46.749 1.00 38.51  ? 54   THR B N     1 
ATOM   6653 C  CA    . THR D 4  54  ? 57.911 120.634 46.489 1.00 36.32  ? 54   THR B CA    1 
ATOM   6654 C  C     . THR D 4  54  ? 57.576 122.092 46.795 1.00 34.09  ? 54   THR B C     1 
ATOM   6655 O  O     . THR D 4  54  ? 56.558 122.608 46.336 1.00 33.50  ? 54   THR B O     1 
ATOM   6656 C  CB    . THR D 4  54  ? 58.351 120.547 45.013 1.00 37.43  ? 54   THR B CB    1 
ATOM   6657 O  OG1   . THR D 4  54  ? 58.732 119.203 44.698 1.00 38.84  ? 54   THR B OG1   1 
ATOM   6658 C  CG2   . THR D 4  54  ? 59.528 121.474 44.759 1.00 37.19  ? 54   THR B CG2   1 
ATOM   6659 N  N     . VAL D 4  55  ? 58.429 122.749 47.574 1.00 32.10  ? 55   VAL B N     1 
ATOM   6660 C  CA    . VAL D 4  55  ? 58.222 124.149 47.918 1.00 29.11  ? 55   VAL B CA    1 
ATOM   6661 C  C     . VAL D 4  55  ? 59.186 125.030 47.122 1.00 28.43  ? 55   VAL B C     1 
ATOM   6662 O  O     . VAL D 4  55  ? 60.406 124.873 47.204 1.00 27.55  ? 55   VAL B O     1 
ATOM   6663 C  CB    . VAL D 4  55  ? 58.430 124.394 49.436 1.00 29.45  ? 55   VAL B CB    1 
ATOM   6664 C  CG1   . VAL D 4  55  ? 58.468 125.893 49.736 1.00 27.54  ? 55   VAL B CG1   1 
ATOM   6665 C  CG2   . VAL D 4  55  ? 57.304 123.740 50.223 1.00 27.39  ? 55   VAL B CG2   1 
ATOM   6666 N  N     . ALA D 4  56  ? 58.626 125.949 46.341 1.00 26.32  ? 56   ALA B N     1 
ATOM   6667 C  CA    . ALA D 4  56  ? 59.426 126.860 45.539 1.00 24.94  ? 56   ALA B CA    1 
ATOM   6668 C  C     . ALA D 4  56  ? 59.060 128.307 45.848 1.00 24.78  ? 56   ALA B C     1 
ATOM   6669 O  O     . ALA D 4  56  ? 57.921 128.607 46.207 1.00 25.28  ? 56   ALA B O     1 
ATOM   6670 C  CB    . ALA D 4  56  ? 59.217 126.578 44.065 1.00 24.03  ? 56   ALA B CB    1 
ATOM   6671 N  N     . LYS D 4  57  ? 60.031 129.202 45.703 1.00 23.05  ? 57   LYS B N     1 
ATOM   6672 C  CA    . LYS D 4  57  ? 59.802 130.611 45.964 1.00 22.55  ? 57   LYS B CA    1 
ATOM   6673 C  C     . LYS D 4  57  ? 60.193 131.449 44.756 1.00 23.33  ? 57   LYS B C     1 
ATOM   6674 O  O     . LYS D 4  57  ? 61.181 131.162 44.073 1.00 23.50  ? 57   LYS B O     1 
ATOM   6675 C  CB    . LYS D 4  57  ? 60.602 131.065 47.190 1.00 21.38  ? 57   LYS B CB    1 
ATOM   6676 C  CG    . LYS D 4  57  ? 60.460 130.145 48.391 1.00 23.29  ? 57   LYS B CG    1 
ATOM   6677 C  CD    . LYS D 4  57  ? 60.512 130.904 49.714 1.00 25.16  ? 57   LYS B CD    1 
ATOM   6678 C  CE    . LYS D 4  57  ? 61.837 131.596 49.955 1.00 25.31  ? 57   LYS B CE    1 
ATOM   6679 N  NZ    . LYS D 4  57  ? 61.773 132.449 51.179 1.00 24.33  ? 57   LYS B NZ    1 
ATOM   6680 N  N     . LEU D 4  58  ? 59.402 132.483 44.489 1.00 23.10  ? 58   LEU B N     1 
ATOM   6681 C  CA    . LEU D 4  58  ? 59.665 133.382 43.374 1.00 21.31  ? 58   LEU B CA    1 
ATOM   6682 C  C     . LEU D 4  58  ? 59.593 134.822 43.869 1.00 21.37  ? 58   LEU B C     1 
ATOM   6683 O  O     . LEU D 4  58  ? 58.514 135.325 44.209 1.00 19.60  ? 58   LEU B O     1 
ATOM   6684 C  CB    . LEU D 4  58  ? 58.639 133.174 42.259 1.00 21.65  ? 58   LEU B CB    1 
ATOM   6685 C  CG    . LEU D 4  58  ? 58.887 134.053 41.031 1.00 23.71  ? 58   LEU B CG    1 
ATOM   6686 C  CD1   . LEU D 4  58  ? 60.186 133.621 40.347 1.00 23.81  ? 58   LEU B CD1   1 
ATOM   6687 C  CD2   . LEU D 4  58  ? 57.724 133.933 40.070 1.00 24.17  ? 58   LEU B CD2   1 
ATOM   6688 N  N     . ASN D 4  59  ? 60.750 135.474 43.924 1.00 20.17  ? 59   ASN B N     1 
ATOM   6689 C  CA    . ASN D 4  59  ? 60.823 136.859 44.367 1.00 20.33  ? 59   ASN B CA    1 
ATOM   6690 C  C     . ASN D 4  59  ? 60.329 137.767 43.241 1.00 19.19  ? 59   ASN B C     1 
ATOM   6691 O  O     . ASN D 4  59  ? 60.991 137.913 42.214 1.00 19.69  ? 59   ASN B O     1 
ATOM   6692 C  CB    . ASN D 4  59  ? 62.259 137.203 44.745 1.00 21.66  ? 59   ASN B CB    1 
ATOM   6693 C  CG    . ASN D 4  59  ? 62.411 138.632 45.188 1.00 22.71  ? 59   ASN B CG    1 
ATOM   6694 O  OD1   . ASN D 4  59  ? 62.128 139.560 44.429 1.00 24.56  ? 59   ASN B OD1   1 
ATOM   6695 N  ND2   . ASN D 4  59  ? 62.860 138.825 46.422 1.00 23.60  ? 59   ASN B ND2   1 
ATOM   6696 N  N     . ILE D 4  60  ? 59.166 138.380 43.444 1.00 19.68  ? 60   ILE B N     1 
ATOM   6697 C  CA    . ILE D 4  60  ? 58.562 139.228 42.429 1.00 18.85  ? 60   ILE B CA    1 
ATOM   6698 C  C     . ILE D 4  60  ? 59.357 140.453 42.006 1.00 20.62  ? 60   ILE B C     1 
ATOM   6699 O  O     . ILE D 4  60  ? 59.065 141.041 40.970 1.00 20.77  ? 60   ILE B O     1 
ATOM   6700 C  CB    . ILE D 4  60  ? 57.146 139.659 42.837 1.00 18.57  ? 60   ILE B CB    1 
ATOM   6701 C  CG1   . ILE D 4  60  ? 57.190 140.570 44.058 1.00 18.47  ? 60   ILE B CG1   1 
ATOM   6702 C  CG2   . ILE D 4  60  ? 56.310 138.429 43.139 1.00 18.20  ? 60   ILE B CG2   1 
ATOM   6703 C  CD1   . ILE D 4  60  ? 55.829 141.130 44.411 1.00 19.90  ? 60   ILE B CD1   1 
ATOM   6704 N  N     . ASP D 4  61  ? 60.359 140.838 42.790 1.00 22.44  ? 61   ASP B N     1 
ATOM   6705 C  CA    . ASP D 4  61  ? 61.197 141.982 42.425 1.00 24.33  ? 61   ASP B CA    1 
ATOM   6706 C  C     . ASP D 4  61  ? 62.250 141.550 41.413 1.00 25.18  ? 61   ASP B C     1 
ATOM   6707 O  O     . ASP D 4  61  ? 62.466 142.221 40.407 1.00 25.87  ? 61   ASP B O     1 
ATOM   6708 C  CB    . ASP D 4  61  ? 61.921 142.565 43.644 1.00 25.39  ? 61   ASP B CB    1 
ATOM   6709 C  CG    . ASP D 4  61  ? 60.998 143.329 44.566 1.00 27.24  ? 61   ASP B CG    1 
ATOM   6710 O  OD1   . ASP D 4  61  ? 60.087 144.006 44.053 1.00 26.98  ? 61   ASP B OD1   1 
ATOM   6711 O  OD2   . ASP D 4  61  ? 61.197 143.264 45.800 1.00 29.37  ? 61   ASP B OD2   1 
ATOM   6712 N  N     . GLN D 4  62  ? 62.906 140.427 41.690 1.00 25.54  ? 62   GLN B N     1 
ATOM   6713 C  CA    . GLN D 4  62  ? 63.950 139.917 40.814 1.00 26.76  ? 62   GLN B CA    1 
ATOM   6714 C  C     . GLN D 4  62  ? 63.336 139.250 39.582 1.00 26.37  ? 62   GLN B C     1 
ATOM   6715 O  O     . GLN D 4  62  ? 63.960 139.182 38.530 1.00 25.77  ? 62   GLN B O     1 
ATOM   6716 C  CB    . GLN D 4  62  ? 64.824 138.922 41.584 1.00 30.30  ? 62   GLN B CB    1 
ATOM   6717 C  CG    . GLN D 4  62  ? 65.114 139.356 43.019 1.00 35.64  ? 62   GLN B CG    1 
ATOM   6718 C  CD    . GLN D 4  62  ? 65.878 138.312 43.832 1.00 38.49  ? 62   GLN B CD    1 
ATOM   6719 O  OE1   . GLN D 4  62  ? 65.521 137.131 43.857 1.00 40.37  ? 62   GLN B OE1   1 
ATOM   6720 N  NE2   . GLN D 4  62  ? 66.926 138.754 44.516 1.00 39.88  ? 62   GLN B NE2   1 
ATOM   6721 N  N     . ASN D 4  63  ? 62.104 138.769 39.716 1.00 26.39  ? 63   ASN B N     1 
ATOM   6722 C  CA    . ASN D 4  63  ? 61.410 138.113 38.611 1.00 27.12  ? 63   ASN B CA    1 
ATOM   6723 C  C     . ASN D 4  63  ? 60.033 138.740 38.487 1.00 28.53  ? 63   ASN B C     1 
ATOM   6724 O  O     . ASN D 4  63  ? 59.059 138.243 39.051 1.00 28.86  ? 63   ASN B O     1 
ATOM   6725 C  CB    . ASN D 4  63  ? 61.296 136.629 38.902 1.00 25.42  ? 63   ASN B CB    1 
ATOM   6726 C  CG    . ASN D 4  63  ? 62.637 136.001 39.117 1.00 27.18  ? 63   ASN B CG    1 
ATOM   6727 O  OD1   . ASN D 4  63  ? 63.379 135.762 38.164 1.00 28.53  ? 63   ASN B OD1   1 
ATOM   6728 N  ND2   . ASN D 4  63  ? 62.980 135.756 40.375 1.00 28.76  ? 63   ASN B ND2   1 
ATOM   6729 N  N     . PRO D 4  64  ? 59.939 139.844 37.732 1.00 28.66  ? 64   PRO B N     1 
ATOM   6730 C  CA    . PRO D 4  64  ? 58.706 140.601 37.503 1.00 28.74  ? 64   PRO B CA    1 
ATOM   6731 C  C     . PRO D 4  64  ? 57.769 140.115 36.407 1.00 27.82  ? 64   PRO B C     1 
ATOM   6732 O  O     . PRO D 4  64  ? 56.737 140.734 36.168 1.00 28.80  ? 64   PRO B O     1 
ATOM   6733 C  CB    . PRO D 4  64  ? 59.235 141.995 37.202 1.00 29.52  ? 64   PRO B CB    1 
ATOM   6734 C  CG    . PRO D 4  64  ? 60.440 141.681 36.352 1.00 28.56  ? 64   PRO B CG    1 
ATOM   6735 C  CD    . PRO D 4  64  ? 61.090 140.515 37.092 1.00 29.14  ? 64   PRO B CD    1 
ATOM   6736 N  N     . GLY D 4  65  ? 58.104 139.015 35.751 1.00 27.25  ? 65   GLY B N     1 
ATOM   6737 C  CA    . GLY D 4  65  ? 57.259 138.549 34.667 1.00 27.62  ? 65   GLY B CA    1 
ATOM   6738 C  C     . GLY D 4  65  ? 56.196 137.500 34.937 1.00 27.30  ? 65   GLY B C     1 
ATOM   6739 O  O     . GLY D 4  65  ? 55.197 137.444 34.217 1.00 27.90  ? 65   GLY B O     1 
ATOM   6740 N  N     . THR D 4  66  ? 56.392 136.681 35.966 1.00 25.55  ? 66   THR B N     1 
ATOM   6741 C  CA    . THR D 4  66  ? 55.453 135.608 36.286 1.00 24.36  ? 66   THR B CA    1 
ATOM   6742 C  C     . THR D 4  66  ? 54.172 136.008 37.028 1.00 24.43  ? 66   THR B C     1 
ATOM   6743 O  O     . THR D 4  66  ? 53.074 135.702 36.575 1.00 23.71  ? 66   THR B O     1 
ATOM   6744 C  CB    . THR D 4  66  ? 56.159 134.511 37.106 1.00 22.85  ? 66   THR B CB    1 
ATOM   6745 O  OG1   . THR D 4  66  ? 57.392 134.174 36.470 1.00 21.05  ? 66   THR B OG1   1 
ATOM   6746 C  CG2   . THR D 4  66  ? 55.289 133.267 37.207 1.00 19.40  ? 66   THR B CG2   1 
ATOM   6747 N  N     . ALA D 4  67  ? 54.317 136.676 38.169 1.00 24.99  ? 67   ALA B N     1 
ATOM   6748 C  CA    . ALA D 4  67  ? 53.172 137.086 38.983 1.00 26.27  ? 67   ALA B CA    1 
ATOM   6749 C  C     . ALA D 4  67  ? 52.002 137.672 38.200 1.00 26.00  ? 67   ALA B C     1 
ATOM   6750 O  O     . ALA D 4  67  ? 50.860 137.226 38.351 1.00 25.66  ? 67   ALA B O     1 
ATOM   6751 C  CB    . ALA D 4  67  ? 53.619 138.074 40.060 1.00 27.70  ? 67   ALA B CB    1 
ATOM   6752 N  N     . PRO D 4  68  ? 52.266 138.679 37.354 1.00 26.14  ? 68   PRO B N     1 
ATOM   6753 C  CA    . PRO D 4  68  ? 51.202 139.304 36.563 1.00 26.55  ? 68   PRO B CA    1 
ATOM   6754 C  C     . PRO D 4  68  ? 50.294 138.283 35.882 1.00 29.39  ? 68   PRO B C     1 
ATOM   6755 O  O     . PRO D 4  68  ? 49.071 138.427 35.882 1.00 29.46  ? 68   PRO B O     1 
ATOM   6756 C  CB    . PRO D 4  68  ? 51.974 140.151 35.563 1.00 26.79  ? 68   PRO B CB    1 
ATOM   6757 C  CG    . PRO D 4  68  ? 53.181 140.561 36.350 1.00 26.27  ? 68   PRO B CG    1 
ATOM   6758 C  CD    . PRO D 4  68  ? 53.576 139.272 37.031 1.00 25.95  ? 68   PRO B CD    1 
ATOM   6759 N  N     . LYS D 4  69  ? 50.890 137.246 35.306 1.00 31.20  ? 69   LYS B N     1 
ATOM   6760 C  CA    . LYS D 4  69  ? 50.106 136.226 34.630 1.00 33.17  ? 69   LYS B CA    1 
ATOM   6761 C  C     . LYS D 4  69  ? 49.090 135.583 35.568 1.00 34.91  ? 69   LYS B C     1 
ATOM   6762 O  O     . LYS D 4  69  ? 48.080 135.042 35.121 1.00 36.78  ? 69   LYS B O     1 
ATOM   6763 C  CB    . LYS D 4  69  ? 51.017 135.139 34.058 1.00 34.13  ? 69   LYS B CB    1 
ATOM   6764 C  CG    . LYS D 4  69  ? 51.964 135.601 32.956 1.00 36.36  ? 69   LYS B CG    1 
ATOM   6765 C  CD    . LYS D 4  69  ? 52.664 134.399 32.320 1.00 37.17  ? 69   LYS B CD    1 
ATOM   6766 C  CE    . LYS D 4  69  ? 53.672 134.812 31.259 1.00 36.97  ? 69   LYS B CE    1 
ATOM   6767 N  NZ    . LYS D 4  69  ? 54.808 135.573 31.835 1.00 38.83  ? 69   LYS B NZ    1 
ATOM   6768 N  N     . TYR D 4  70  ? 49.355 135.643 36.870 1.00 35.37  ? 70   TYR B N     1 
ATOM   6769 C  CA    . TYR D 4  70  ? 48.459 135.036 37.853 1.00 34.67  ? 70   TYR B CA    1 
ATOM   6770 C  C     . TYR D 4  70  ? 47.643 136.039 38.664 1.00 33.75  ? 70   TYR B C     1 
ATOM   6771 O  O     . TYR D 4  70  ? 47.074 135.694 39.696 1.00 32.42  ? 70   TYR B O     1 
ATOM   6772 C  CB    . TYR D 4  70  ? 49.264 134.124 38.784 1.00 33.61  ? 70   TYR B CB    1 
ATOM   6773 C  CG    . TYR D 4  70  ? 49.861 132.943 38.059 1.00 33.36  ? 70   TYR B CG    1 
ATOM   6774 C  CD1   . TYR D 4  70  ? 49.066 131.860 37.687 1.00 32.51  ? 70   TYR B CD1   1 
ATOM   6775 C  CD2   . TYR D 4  70  ? 51.201 132.942 37.668 1.00 33.09  ? 70   TYR B CD2   1 
ATOM   6776 C  CE1   . TYR D 4  70  ? 49.585 130.809 36.939 1.00 31.43  ? 70   TYR B CE1   1 
ATOM   6777 C  CE2   . TYR D 4  70  ? 51.729 131.893 36.916 1.00 32.48  ? 70   TYR B CE2   1 
ATOM   6778 C  CZ    . TYR D 4  70  ? 50.912 130.835 36.554 1.00 31.96  ? 70   TYR B CZ    1 
ATOM   6779 O  OH    . TYR D 4  70  ? 51.407 129.817 35.780 1.00 32.15  ? 70   TYR B OH    1 
ATOM   6780 N  N     . GLY D 4  71  ? 47.596 137.278 38.186 1.00 33.85  ? 71   GLY B N     1 
ATOM   6781 C  CA    . GLY D 4  71  ? 46.826 138.314 38.854 1.00 34.66  ? 71   GLY B CA    1 
ATOM   6782 C  C     . GLY D 4  71  ? 47.140 138.569 40.318 1.00 34.67  ? 71   GLY B C     1 
ATOM   6783 O  O     . GLY D 4  71  ? 46.243 138.867 41.107 1.00 32.85  ? 71   GLY B O     1 
ATOM   6784 N  N     . ILE D 4  72  ? 48.411 138.447 40.683 1.00 35.66  ? 72   ILE B N     1 
ATOM   6785 C  CA    . ILE D 4  72  ? 48.840 138.693 42.052 1.00 35.93  ? 72   ILE B CA    1 
ATOM   6786 C  C     . ILE D 4  72  ? 48.321 140.060 42.496 1.00 36.74  ? 72   ILE B C     1 
ATOM   6787 O  O     . ILE D 4  72  ? 48.554 141.067 41.834 1.00 35.14  ? 72   ILE B O     1 
ATOM   6788 C  CB    . ILE D 4  72  ? 50.378 138.663 42.145 1.00 35.63  ? 72   ILE B CB    1 
ATOM   6789 C  CG1   . ILE D 4  72  ? 50.866 137.242 41.864 1.00 36.14  ? 72   ILE B CG1   1 
ATOM   6790 C  CG2   . ILE D 4  72  ? 50.851 139.159 43.503 1.00 33.30  ? 72   ILE B CG2   1 
ATOM   6791 C  CD1   . ILE D 4  72  ? 50.255 136.193 42.765 1.00 34.96  ? 72   ILE B CD1   1 
ATOM   6792 N  N     . ARG D 4  73  ? 47.615 140.089 43.619 1.00 37.38  ? 73   ARG B N     1 
ATOM   6793 C  CA    . ARG D 4  73  ? 47.056 141.332 44.117 1.00 38.88  ? 73   ARG B CA    1 
ATOM   6794 C  C     . ARG D 4  73  ? 47.561 141.633 45.531 1.00 36.67  ? 73   ARG B C     1 
ATOM   6795 O  O     . ARG D 4  73  ? 47.447 142.758 46.021 1.00 37.73  ? 73   ARG B O     1 
ATOM   6796 C  CB    . ARG D 4  73  ? 45.530 141.234 44.081 1.00 44.07  ? 73   ARG B CB    1 
ATOM   6797 C  CG    . ARG D 4  73  ? 44.794 142.565 44.085 1.00 52.40  ? 73   ARG B CG    1 
ATOM   6798 C  CD    . ARG D 4  73  ? 44.814 143.209 45.461 1.00 58.49  ? 73   ARG B CD    1 
ATOM   6799 N  NE    . ARG D 4  73  ? 44.392 142.261 46.489 1.00 62.80  ? 73   ARG B NE    1 
ATOM   6800 C  CZ    . ARG D 4  73  ? 44.245 142.565 47.773 1.00 65.28  ? 73   ARG B CZ    1 
ATOM   6801 N  NH1   . ARG D 4  73  ? 44.484 143.802 48.197 1.00 66.27  ? 73   ARG B NH1   1 
ATOM   6802 N  NH2   . ARG D 4  73  ? 43.858 141.631 48.633 1.00 65.91  ? 73   ARG B NH2   1 
ATOM   6803 N  N     . GLY D 4  74  ? 48.137 140.622 46.171 1.00 33.70  ? 74   GLY B N     1 
ATOM   6804 C  CA    . GLY D 4  74  ? 48.664 140.787 47.513 1.00 29.67  ? 74   GLY B CA    1 
ATOM   6805 C  C     . GLY D 4  74  ? 49.717 139.735 47.795 1.00 28.70  ? 74   GLY B C     1 
ATOM   6806 O  O     . GLY D 4  74  ? 49.714 138.674 47.175 1.00 28.15  ? 74   GLY B O     1 
ATOM   6807 N  N     . ILE D 4  75  ? 50.628 140.024 48.718 1.00 27.22  ? 75   ILE B N     1 
ATOM   6808 C  CA    . ILE D 4  75  ? 51.680 139.079 49.072 1.00 25.46  ? 75   ILE B CA    1 
ATOM   6809 C  C     . ILE D 4  75  ? 51.793 138.936 50.579 1.00 25.78  ? 75   ILE B C     1 
ATOM   6810 O  O     . ILE D 4  75  ? 51.455 139.852 51.322 1.00 27.52  ? 75   ILE B O     1 
ATOM   6811 C  CB    . ILE D 4  75  ? 53.055 139.516 48.517 1.00 24.21  ? 75   ILE B CB    1 
ATOM   6812 C  CG1   . ILE D 4  75  ? 53.332 140.975 48.879 1.00 22.45  ? 75   ILE B CG1   1 
ATOM   6813 C  CG2   . ILE D 4  75  ? 53.099 139.289 47.014 1.00 23.41  ? 75   ILE B CG2   1 
ATOM   6814 C  CD1   . ILE D 4  75  ? 54.692 141.478 48.407 1.00 23.78  ? 75   ILE B CD1   1 
ATOM   6815 N  N     . PRO D 4  76  ? 52.290 137.783 51.053 1.00 25.66  ? 76   PRO B N     1 
ATOM   6816 C  CA    . PRO D 4  76  ? 52.741 136.642 50.253 1.00 25.09  ? 76   PRO B CA    1 
ATOM   6817 C  C     . PRO D 4  76  ? 51.600 135.867 49.609 1.00 25.06  ? 76   PRO B C     1 
ATOM   6818 O  O     . PRO D 4  76  ? 50.564 135.651 50.231 1.00 26.11  ? 76   PRO B O     1 
ATOM   6819 C  CB    . PRO D 4  76  ? 53.477 135.793 51.279 1.00 25.91  ? 76   PRO B CB    1 
ATOM   6820 C  CG    . PRO D 4  76  ? 52.625 135.983 52.493 1.00 25.01  ? 76   PRO B CG    1 
ATOM   6821 C  CD    . PRO D 4  76  ? 52.414 137.483 52.491 1.00 24.60  ? 76   PRO B CD    1 
ATOM   6822 N  N     . THR D 4  77  ? 51.791 135.444 48.366 1.00 24.28  ? 77   THR B N     1 
ATOM   6823 C  CA    . THR D 4  77  ? 50.775 134.659 47.680 1.00 25.20  ? 77   THR B CA    1 
ATOM   6824 C  C     . THR D 4  77  ? 51.237 133.202 47.554 1.00 26.02  ? 77   THR B C     1 
ATOM   6825 O  O     . THR D 4  77  ? 52.316 132.931 47.032 1.00 25.61  ? 77   THR B O     1 
ATOM   6826 C  CB    . THR D 4  77  ? 50.477 135.225 46.282 1.00 25.20  ? 77   THR B CB    1 
ATOM   6827 O  OG1   . THR D 4  77  ? 49.735 136.441 46.417 1.00 27.29  ? 77   THR B OG1   1 
ATOM   6828 C  CG2   . THR D 4  77  ? 49.659 134.241 45.466 1.00 26.07  ? 77   THR B CG2   1 
ATOM   6829 N  N     . LEU D 4  78  ? 50.414 132.274 48.040 1.00 26.98  ? 78   LEU B N     1 
ATOM   6830 C  CA    . LEU D 4  78  ? 50.729 130.850 47.998 1.00 27.38  ? 78   LEU B CA    1 
ATOM   6831 C  C     . LEU D 4  78  ? 49.888 130.129 46.952 1.00 29.10  ? 78   LEU B C     1 
ATOM   6832 O  O     . LEU D 4  78  ? 48.687 129.949 47.130 1.00 30.05  ? 78   LEU B O     1 
ATOM   6833 C  CB    . LEU D 4  78  ? 50.473 130.220 49.367 1.00 27.56  ? 78   LEU B CB    1 
ATOM   6834 C  CG    . LEU D 4  78  ? 51.123 130.942 50.548 1.00 28.67  ? 78   LEU B CG    1 
ATOM   6835 C  CD1   . LEU D 4  78  ? 50.693 130.300 51.858 1.00 25.89  ? 78   LEU B CD1   1 
ATOM   6836 C  CD2   . LEU D 4  78  ? 52.640 130.897 50.393 1.00 27.84  ? 78   LEU B CD2   1 
ATOM   6837 N  N     . LEU D 4  79  ? 50.525 129.719 45.862 1.00 30.47  ? 79   LEU B N     1 
ATOM   6838 C  CA    . LEU D 4  79  ? 49.846 129.006 44.783 1.00 31.03  ? 79   LEU B CA    1 
ATOM   6839 C  C     . LEU D 4  79  ? 50.253 127.534 44.769 1.00 32.48  ? 79   LEU B C     1 
ATOM   6840 O  O     . LEU D 4  79  ? 51.442 127.214 44.761 1.00 33.49  ? 79   LEU B O     1 
ATOM   6841 C  CB    . LEU D 4  79  ? 50.199 129.640 43.438 1.00 28.71  ? 79   LEU B CB    1 
ATOM   6842 C  CG    . LEU D 4  79  ? 49.240 130.655 42.829 1.00 30.23  ? 79   LEU B CG    1 
ATOM   6843 C  CD1   . LEU D 4  79  ? 48.850 131.681 43.860 1.00 30.97  ? 79   LEU B CD1   1 
ATOM   6844 C  CD2   . LEU D 4  79  ? 49.893 131.314 41.617 1.00 29.00  ? 79   LEU B CD2   1 
ATOM   6845 N  N     . LEU D 4  80  ? 49.270 126.640 44.765 1.00 34.31  ? 80   LEU B N     1 
ATOM   6846 C  CA    . LEU D 4  80  ? 49.553 125.207 44.742 1.00 37.69  ? 80   LEU B CA    1 
ATOM   6847 C  C     . LEU D 4  80  ? 49.333 124.678 43.331 1.00 38.68  ? 80   LEU B C     1 
ATOM   6848 O  O     . LEU D 4  80  ? 48.195 124.568 42.882 1.00 40.15  ? 80   LEU B O     1 
ATOM   6849 C  CB    . LEU D 4  80  ? 48.625 124.464 45.706 1.00 38.24  ? 80   LEU B CB    1 
ATOM   6850 C  CG    . LEU D 4  80  ? 49.163 123.187 46.360 1.00 39.13  ? 80   LEU B CG    1 
ATOM   6851 C  CD1   . LEU D 4  80  ? 48.019 122.481 47.055 1.00 40.41  ? 80   LEU B CD1   1 
ATOM   6852 C  CD2   . LEU D 4  80  ? 49.790 122.273 45.328 1.00 40.56  ? 80   LEU B CD2   1 
ATOM   6853 N  N     . PHE D 4  81  ? 50.416 124.350 42.634 1.00 40.52  ? 81   PHE B N     1 
ATOM   6854 C  CA    . PHE D 4  81  ? 50.313 123.837 41.267 1.00 42.19  ? 81   PHE B CA    1 
ATOM   6855 C  C     . PHE D 4  81  ? 50.347 122.309 41.181 1.00 44.13  ? 81   PHE B C     1 
ATOM   6856 O  O     . PHE D 4  81  ? 51.060 121.638 41.937 1.00 43.95  ? 81   PHE B O     1 
ATOM   6857 C  CB    . PHE D 4  81  ? 51.439 124.391 40.387 1.00 40.26  ? 81   PHE B CB    1 
ATOM   6858 C  CG    . PHE D 4  81  ? 51.299 125.849 40.043 1.00 39.48  ? 81   PHE B CG    1 
ATOM   6859 C  CD1   . PHE D 4  81  ? 51.560 126.836 40.991 1.00 38.99  ? 81   PHE B CD1   1 
ATOM   6860 C  CD2   . PHE D 4  81  ? 50.939 126.236 38.754 1.00 38.36  ? 81   PHE B CD2   1 
ATOM   6861 C  CE1   . PHE D 4  81  ? 51.470 128.188 40.656 1.00 39.12  ? 81   PHE B CE1   1 
ATOM   6862 C  CE2   . PHE D 4  81  ? 50.845 127.583 38.410 1.00 38.15  ? 81   PHE B CE2   1 
ATOM   6863 C  CZ    . PHE D 4  81  ? 51.112 128.560 39.363 1.00 39.11  ? 81   PHE B CZ    1 
ATOM   6864 N  N     . LYS D 4  82  ? 49.570 121.776 40.242 1.00 45.31  ? 82   LYS B N     1 
ATOM   6865 C  CA    . LYS D 4  82  ? 49.494 120.341 39.992 1.00 45.93  ? 82   LYS B CA    1 
ATOM   6866 C  C     . LYS D 4  82  ? 49.295 120.171 38.495 1.00 46.67  ? 82   LYS B C     1 
ATOM   6867 O  O     . LYS D 4  82  ? 48.253 120.536 37.950 1.00 46.40  ? 82   LYS B O     1 
ATOM   6868 C  CB    . LYS D 4  82  ? 48.326 119.719 40.760 1.00 46.14  ? 82   LYS B CB    1 
ATOM   6869 C  CG    . LYS D 4  82  ? 48.535 119.732 42.269 1.00 48.16  ? 82   LYS B CG    1 
ATOM   6870 C  CD    . LYS D 4  82  ? 47.257 119.443 43.058 1.00 49.22  ? 82   LYS B CD    1 
ATOM   6871 C  CE    . LYS D 4  82  ? 46.934 117.960 43.119 1.00 49.40  ? 82   LYS B CE    1 
ATOM   6872 N  NZ    . LYS D 4  82  ? 45.793 117.694 44.041 1.00 49.87  ? 82   LYS B NZ    1 
ATOM   6873 N  N     . ASN D 4  83  ? 50.312 119.631 37.835 1.00 48.27  ? 83   ASN B N     1 
ATOM   6874 C  CA    . ASN D 4  83  ? 50.274 119.426 36.395 1.00 50.36  ? 83   ASN B CA    1 
ATOM   6875 C  C     . ASN D 4  83  ? 49.966 120.721 35.652 1.00 50.75  ? 83   ASN B C     1 
ATOM   6876 O  O     . ASN D 4  83  ? 48.958 120.824 34.951 1.00 50.48  ? 83   ASN B O     1 
ATOM   6877 C  CB    . ASN D 4  83  ? 49.244 118.352 36.022 1.00 52.63  ? 83   ASN B CB    1 
ATOM   6878 C  CG    . ASN D 4  83  ? 49.710 116.945 36.377 1.00 55.84  ? 83   ASN B CG    1 
ATOM   6879 O  OD1   . ASN D 4  83  ? 49.768 116.571 37.551 1.00 57.46  ? 83   ASN B OD1   1 
ATOM   6880 N  ND2   . ASN D 4  83  ? 50.056 116.162 35.358 1.00 57.24  ? 83   ASN B ND2   1 
ATOM   6881 N  N     . GLY D 4  84  ? 50.843 121.708 35.827 1.00 50.69  ? 84   GLY B N     1 
ATOM   6882 C  CA    . GLY D 4  84  ? 50.691 122.989 35.159 1.00 50.99  ? 84   GLY B CA    1 
ATOM   6883 C  C     . GLY D 4  84  ? 49.417 123.766 35.430 1.00 51.30  ? 84   GLY B C     1 
ATOM   6884 O  O     . GLY D 4  84  ? 49.194 124.822 34.835 1.00 50.64  ? 84   GLY B O     1 
ATOM   6885 N  N     . GLU D 4  85  ? 48.580 123.255 36.325 1.00 51.88  ? 85   GLU B N     1 
ATOM   6886 C  CA    . GLU D 4  85  ? 47.329 123.923 36.657 1.00 53.18  ? 85   GLU B CA    1 
ATOM   6887 C  C     . GLU D 4  85  ? 47.353 124.428 38.095 1.00 51.47  ? 85   GLU B C     1 
ATOM   6888 O  O     . GLU D 4  85  ? 47.902 123.769 38.984 1.00 50.66  ? 85   GLU B O     1 
ATOM   6889 C  CB    . GLU D 4  85  ? 46.158 122.953 36.505 1.00 57.25  ? 85   GLU B CB    1 
ATOM   6890 C  CG    . GLU D 4  85  ? 46.034 122.299 35.144 1.00 62.58  ? 85   GLU B CG    1 
ATOM   6891 C  CD    . GLU D 4  85  ? 45.025 121.159 35.150 1.00 66.58  ? 85   GLU B CD    1 
ATOM   6892 O  OE1   . GLU D 4  85  ? 45.267 120.152 35.857 1.00 67.77  ? 85   GLU B OE1   1 
ATOM   6893 O  OE2   . GLU D 4  85  ? 43.989 121.271 34.454 1.00 68.88  ? 85   GLU B OE2   1 
ATOM   6894 N  N     . VAL D 4  86  ? 46.769 125.599 38.324 1.00 49.36  ? 86   VAL B N     1 
ATOM   6895 C  CA    . VAL D 4  86  ? 46.702 126.136 39.676 1.00 48.36  ? 86   VAL B CA    1 
ATOM   6896 C  C     . VAL D 4  86  ? 45.606 125.331 40.364 1.00 47.43  ? 86   VAL B C     1 
ATOM   6897 O  O     . VAL D 4  86  ? 44.442 125.400 39.972 1.00 47.60  ? 86   VAL B O     1 
ATOM   6898 C  CB    . VAL D 4  86  ? 46.308 127.628 39.686 1.00 48.75  ? 86   VAL B CB    1 
ATOM   6899 C  CG1   . VAL D 4  86  ? 46.132 128.108 41.120 1.00 47.67  ? 86   VAL B CG1   1 
ATOM   6900 C  CG2   . VAL D 4  86  ? 47.372 128.452 38.984 1.00 48.33  ? 86   VAL B CG2   1 
ATOM   6901 N  N     . ALA D 4  87  ? 45.980 124.558 41.377 1.00 46.44  ? 87   ALA B N     1 
ATOM   6902 C  CA    . ALA D 4  87  ? 45.017 123.731 42.089 1.00 46.27  ? 87   ALA B CA    1 
ATOM   6903 C  C     . ALA D 4  87  ? 44.309 124.504 43.188 1.00 46.80  ? 87   ALA B C     1 
ATOM   6904 O  O     . ALA D 4  87  ? 43.099 124.367 43.371 1.00 46.59  ? 87   ALA B O     1 
ATOM   6905 C  CB    . ALA D 4  87  ? 45.712 122.513 42.678 1.00 46.09  ? 87   ALA B CB    1 
ATOM   6906 N  N     . ALA D 4  88  ? 45.065 125.317 43.919 1.00 46.33  ? 88   ALA B N     1 
ATOM   6907 C  CA    . ALA D 4  88  ? 44.501 126.102 45.009 1.00 45.76  ? 88   ALA B CA    1 
ATOM   6908 C  C     . ALA D 4  88  ? 45.322 127.357 45.256 1.00 45.59  ? 88   ALA B C     1 
ATOM   6909 O  O     . ALA D 4  88  ? 46.538 127.365 45.067 1.00 47.35  ? 88   ALA B O     1 
ATOM   6910 C  CB    . ALA D 4  88  ? 44.447 125.264 46.279 1.00 45.30  ? 88   ALA B CB    1 
ATOM   6911 N  N     . THR D 4  89  ? 44.653 128.417 45.685 1.00 43.55  ? 89   THR B N     1 
ATOM   6912 C  CA    . THR D 4  89  ? 45.336 129.665 45.963 1.00 41.93  ? 89   THR B CA    1 
ATOM   6913 C  C     . THR D 4  89  ? 44.957 130.188 47.343 1.00 40.34  ? 89   THR B C     1 
ATOM   6914 O  O     . THR D 4  89  ? 43.824 130.023 47.792 1.00 41.15  ? 89   THR B O     1 
ATOM   6915 C  CB    . THR D 4  89  ? 45.012 130.721 44.890 1.00 42.08  ? 89   THR B CB    1 
ATOM   6916 O  OG1   . THR D 4  89  ? 45.421 132.013 45.354 1.00 42.78  ? 89   THR B OG1   1 
ATOM   6917 C  CG2   . THR D 4  89  ? 43.527 130.732 44.579 1.00 44.65  ? 89   THR B CG2   1 
ATOM   6918 N  N     . LYS D 4  90  ? 45.918 130.809 48.017 1.00 38.44  ? 90   LYS B N     1 
ATOM   6919 C  CA    . LYS D 4  90  ? 45.690 131.351 49.349 1.00 37.71  ? 90   LYS B CA    1 
ATOM   6920 C  C     . LYS D 4  90  ? 46.660 132.512 49.585 1.00 35.56  ? 90   LYS B C     1 
ATOM   6921 O  O     . LYS D 4  90  ? 47.864 132.379 49.363 1.00 35.78  ? 90   LYS B O     1 
ATOM   6922 C  CB    . LYS D 4  90  ? 45.904 130.250 50.390 1.00 38.87  ? 90   LYS B CB    1 
ATOM   6923 C  CG    . LYS D 4  90  ? 45.298 130.539 51.741 1.00 41.35  ? 90   LYS B CG    1 
ATOM   6924 C  CD    . LYS D 4  90  ? 43.788 130.741 51.650 1.00 43.97  ? 90   LYS B CD    1 
ATOM   6925 C  CE    . LYS D 4  90  ? 43.049 129.472 51.238 1.00 44.38  ? 90   LYS B CE    1 
ATOM   6926 N  NZ    . LYS D 4  90  ? 41.566 129.689 51.225 1.00 42.88  ? 90   LYS B NZ    1 
ATOM   6927 N  N     . VAL D 4  91  ? 46.132 133.650 50.025 1.00 32.11  ? 91   VAL B N     1 
ATOM   6928 C  CA    . VAL D 4  91  ? 46.956 134.833 50.265 1.00 29.21  ? 91   VAL B CA    1 
ATOM   6929 C  C     . VAL D 4  91  ? 46.992 135.202 51.743 1.00 29.43  ? 91   VAL B C     1 
ATOM   6930 O  O     . VAL D 4  91  ? 45.956 135.259 52.403 1.00 29.57  ? 91   VAL B O     1 
ATOM   6931 C  CB    . VAL D 4  91  ? 46.427 136.056 49.461 1.00 27.87  ? 91   VAL B CB    1 
ATOM   6932 C  CG1   . VAL D 4  91  ? 47.315 137.269 49.704 1.00 26.51  ? 91   VAL B CG1   1 
ATOM   6933 C  CG2   . VAL D 4  91  ? 46.372 135.725 47.979 1.00 23.54  ? 91   VAL B CG2   1 
ATOM   6934 N  N     . GLY D 4  92  ? 48.190 135.459 52.255 1.00 29.39  ? 92   GLY B N     1 
ATOM   6935 C  CA    . GLY D 4  92  ? 48.332 135.821 53.653 1.00 30.52  ? 92   GLY B CA    1 
ATOM   6936 C  C     . GLY D 4  92  ? 49.364 134.979 54.385 1.00 31.79  ? 92   GLY B C     1 
ATOM   6937 O  O     . GLY D 4  92  ? 49.648 133.843 53.994 1.00 31.50  ? 92   GLY B O     1 
ATOM   6938 N  N     . ALA D 4  93  ? 49.923 135.537 55.454 1.00 31.10  ? 93   ALA B N     1 
ATOM   6939 C  CA    . ALA D 4  93  ? 50.931 134.843 56.244 1.00 31.52  ? 93   ALA B CA    1 
ATOM   6940 C  C     . ALA D 4  93  ? 50.290 133.823 57.163 1.00 31.80  ? 93   ALA B C     1 
ATOM   6941 O  O     . ALA D 4  93  ? 50.194 134.050 58.369 1.00 32.06  ? 93   ALA B O     1 
ATOM   6942 C  CB    . ALA D 4  93  ? 51.736 135.844 57.070 1.00 30.40  ? 93   ALA B CB    1 
ATOM   6943 N  N     . LEU D 4  94  ? 49.853 132.702 56.597 1.00 32.01  ? 94   LEU B N     1 
ATOM   6944 C  CA    . LEU D 4  94  ? 49.226 131.657 57.398 1.00 33.00  ? 94   LEU B CA    1 
ATOM   6945 C  C     . LEU D 4  94  ? 50.224 131.163 58.436 1.00 33.97  ? 94   LEU B C     1 
ATOM   6946 O  O     . LEU D 4  94  ? 51.410 131.476 58.368 1.00 36.39  ? 94   LEU B O     1 
ATOM   6947 C  CB    . LEU D 4  94  ? 48.791 130.480 56.521 1.00 30.84  ? 94   LEU B CB    1 
ATOM   6948 C  CG    . LEU D 4  94  ? 48.091 130.785 55.197 1.00 30.99  ? 94   LEU B CG    1 
ATOM   6949 C  CD1   . LEU D 4  94  ? 47.460 129.502 54.683 1.00 30.82  ? 94   LEU B CD1   1 
ATOM   6950 C  CD2   . LEU D 4  94  ? 47.032 131.857 55.377 1.00 29.55  ? 94   LEU B CD2   1 
ATOM   6951 N  N     . SER D 4  95  ? 49.741 130.395 59.400 1.00 34.65  ? 95   SER B N     1 
ATOM   6952 C  CA    . SER D 4  95  ? 50.607 129.863 60.435 1.00 35.27  ? 95   SER B CA    1 
ATOM   6953 C  C     . SER D 4  95  ? 50.985 128.439 60.065 1.00 36.96  ? 95   SER B C     1 
ATOM   6954 O  O     . SER D 4  95  ? 50.387 127.841 59.164 1.00 35.48  ? 95   SER B O     1 
ATOM   6955 C  CB    . SER D 4  95  ? 49.896 129.881 61.792 1.00 34.59  ? 95   SER B CB    1 
ATOM   6956 O  OG    . SER D 4  95  ? 48.658 129.190 61.736 1.00 32.86  ? 95   SER B OG    1 
ATOM   6957 N  N     . LYS D 4  96  ? 51.985 127.909 60.761 1.00 38.27  ? 96   LYS B N     1 
ATOM   6958 C  CA    . LYS D 4  96  ? 52.458 126.550 60.530 1.00 40.68  ? 96   LYS B CA    1 
ATOM   6959 C  C     . LYS D 4  96  ? 51.262 125.607 60.437 1.00 41.75  ? 96   LYS B C     1 
ATOM   6960 O  O     . LYS D 4  96  ? 51.130 124.852 59.473 1.00 42.12  ? 96   LYS B O     1 
ATOM   6961 C  CB    . LYS D 4  96  ? 53.381 126.127 61.682 1.00 41.14  ? 96   LYS B CB    1 
ATOM   6962 C  CG    . LYS D 4  96  ? 54.028 124.759 61.534 1.00 41.07  ? 96   LYS B CG    1 
ATOM   6963 C  CD    . LYS D 4  96  ? 55.194 124.775 60.564 1.00 42.01  ? 96   LYS B CD    1 
ATOM   6964 C  CE    . LYS D 4  96  ? 55.884 123.409 60.499 1.00 42.90  ? 96   LYS B CE    1 
ATOM   6965 N  NZ    . LYS D 4  96  ? 56.546 123.017 61.778 1.00 40.20  ? 96   LYS B NZ    1 
ATOM   6966 N  N     . GLY D 4  97  ? 50.384 125.670 61.437 1.00 43.44  ? 97   GLY B N     1 
ATOM   6967 C  CA    . GLY D 4  97  ? 49.208 124.816 61.460 1.00 44.56  ? 97   GLY B CA    1 
ATOM   6968 C  C     . GLY D 4  97  ? 48.276 125.036 60.284 1.00 45.76  ? 97   GLY B C     1 
ATOM   6969 O  O     . GLY D 4  97  ? 47.897 124.089 59.596 1.00 46.44  ? 97   GLY B O     1 
ATOM   6970 N  N     . GLN D 4  98  ? 47.910 126.292 60.051 1.00 46.71  ? 98   GLN B N     1 
ATOM   6971 C  CA    . GLN D 4  98  ? 47.019 126.654 58.951 1.00 47.15  ? 98   GLN B CA    1 
ATOM   6972 C  C     . GLN D 4  98  ? 47.558 126.228 57.583 1.00 47.40  ? 98   GLN B C     1 
ATOM   6973 O  O     . GLN D 4  98  ? 46.791 125.852 56.695 1.00 46.70  ? 98   GLN B O     1 
ATOM   6974 C  CB    . GLN D 4  98  ? 46.787 128.164 58.949 1.00 47.82  ? 98   GLN B CB    1 
ATOM   6975 C  CG    . GLN D 4  98  ? 46.206 128.707 60.239 1.00 47.56  ? 98   GLN B CG    1 
ATOM   6976 C  CD    . GLN D 4  98  ? 46.036 130.205 60.196 1.00 48.30  ? 98   GLN B CD    1 
ATOM   6977 O  OE1   . GLN D 4  98  ? 47.008 130.946 60.043 1.00 48.61  ? 98   GLN B OE1   1 
ATOM   6978 N  NE2   . GLN D 4  98  ? 44.797 130.665 60.324 1.00 47.09  ? 98   GLN B NE2   1 
ATOM   6979 N  N     . LEU D 4  99  ? 48.874 126.307 57.408 1.00 47.80  ? 99   LEU B N     1 
ATOM   6980 C  CA    . LEU D 4  99  ? 49.484 125.918 56.141 1.00 47.74  ? 99   LEU B CA    1 
ATOM   6981 C  C     . LEU D 4  99  ? 49.298 124.417 55.995 1.00 48.64  ? 99   LEU B C     1 
ATOM   6982 O  O     . LEU D 4  99  ? 48.750 123.944 54.998 1.00 47.84  ? 99   LEU B O     1 
ATOM   6983 C  CB    . LEU D 4  99  ? 50.974 126.257 56.128 1.00 45.85  ? 99   LEU B CB    1 
ATOM   6984 C  CG    . LEU D 4  99  ? 51.548 126.715 54.785 1.00 44.11  ? 99   LEU B CG    1 
ATOM   6985 C  CD1   . LEU D 4  99  ? 53.043 126.907 54.916 1.00 44.43  ? 99   LEU B CD1   1 
ATOM   6986 C  CD2   . LEU D 4  99  ? 51.245 125.702 53.713 1.00 45.14  ? 99   LEU B CD2   1 
ATOM   6987 N  N     . LYS D 4  100 ? 49.755 123.677 57.001 1.00 50.40  ? 100  LYS B N     1 
ATOM   6988 C  CA    . LYS D 4  100 ? 49.625 122.224 57.013 1.00 52.25  ? 100  LYS B CA    1 
ATOM   6989 C  C     . LYS D 4  100 ? 48.185 121.844 56.703 1.00 52.45  ? 100  LYS B C     1 
ATOM   6990 O  O     . LYS D 4  100 ? 47.923 120.949 55.897 1.00 52.74  ? 100  LYS B O     1 
ATOM   6991 C  CB    . LYS D 4  100 ? 50.015 121.671 58.384 1.00 53.34  ? 100  LYS B CB    1 
ATOM   6992 C  CG    . LYS D 4  100 ? 51.512 121.532 58.596 1.00 55.88  ? 100  LYS B CG    1 
ATOM   6993 C  CD    . LYS D 4  100 ? 51.879 121.344 60.065 1.00 59.50  ? 100  LYS B CD    1 
ATOM   6994 C  CE    . LYS D 4  100 ? 51.067 120.240 60.737 1.00 62.24  ? 100  LYS B CE    1 
ATOM   6995 N  NZ    . LYS D 4  100 ? 49.656 120.654 61.012 1.00 63.34  ? 100  LYS B NZ    1 
ATOM   6996 N  N     . GLU D 4  101 ? 47.251 122.537 57.343 1.00 52.42  ? 101  GLU B N     1 
ATOM   6997 C  CA    . GLU D 4  101 ? 45.839 122.269 57.130 1.00 52.80  ? 101  GLU B CA    1 
ATOM   6998 C  C     . GLU D 4  101 ? 45.514 122.462 55.653 1.00 51.72  ? 101  GLU B C     1 
ATOM   6999 O  O     . GLU D 4  101 ? 44.901 121.599 55.022 1.00 51.76  ? 101  GLU B O     1 
ATOM   7000 C  CB    . GLU D 4  101 ? 44.989 123.214 57.979 1.00 54.99  ? 101  GLU B CB    1 
ATOM   7001 C  CG    . GLU D 4  101 ? 43.768 122.556 58.600 1.00 58.75  ? 101  GLU B CG    1 
ATOM   7002 C  CD    . GLU D 4  101 ? 42.869 123.549 59.314 1.00 61.57  ? 101  GLU B CD    1 
ATOM   7003 O  OE1   . GLU D 4  101 ? 42.113 124.272 58.629 1.00 61.69  ? 101  GLU B OE1   1 
ATOM   7004 O  OE2   . GLU D 4  101 ? 42.927 123.611 60.560 1.00 63.61  ? 101  GLU B OE2   1 
ATOM   7005 N  N     . PHE D 4  102 ? 45.942 123.596 55.106 1.00 50.63  ? 102  PHE B N     1 
ATOM   7006 C  CA    . PHE D 4  102 ? 45.703 123.916 53.704 1.00 49.03  ? 102  PHE B CA    1 
ATOM   7007 C  C     . PHE D 4  102 ? 46.328 122.882 52.775 1.00 48.57  ? 102  PHE B C     1 
ATOM   7008 O  O     . PHE D 4  102 ? 45.709 122.456 51.799 1.00 48.40  ? 102  PHE B O     1 
ATOM   7009 C  CB    . PHE D 4  102 ? 46.268 125.299 53.377 1.00 47.76  ? 102  PHE B CB    1 
ATOM   7010 C  CG    . PHE D 4  102 ? 46.255 125.629 51.909 1.00 46.61  ? 102  PHE B CG    1 
ATOM   7011 C  CD1   . PHE D 4  102 ? 45.056 125.768 51.222 1.00 45.71  ? 102  PHE B CD1   1 
ATOM   7012 C  CD2   . PHE D 4  102 ? 47.444 125.798 51.213 1.00 45.49  ? 102  PHE B CD2   1 
ATOM   7013 C  CE1   . PHE D 4  102 ? 45.043 126.070 49.865 1.00 45.11  ? 102  PHE B CE1   1 
ATOM   7014 C  CE2   . PHE D 4  102 ? 47.438 126.101 49.859 1.00 44.88  ? 102  PHE B CE2   1 
ATOM   7015 C  CZ    . PHE D 4  102 ? 46.236 126.237 49.184 1.00 44.61  ? 102  PHE B CZ    1 
ATOM   7016 N  N     . LEU D 4  103 ? 47.558 122.486 53.079 1.00 47.99  ? 103  LEU B N     1 
ATOM   7017 C  CA    . LEU D 4  103 ? 48.257 121.505 52.262 1.00 48.25  ? 103  LEU B CA    1 
ATOM   7018 C  C     . LEU D 4  103 ? 47.591 120.128 52.294 1.00 49.46  ? 103  LEU B C     1 
ATOM   7019 O  O     . LEU D 4  103 ? 47.226 119.583 51.249 1.00 49.31  ? 103  LEU B O     1 
ATOM   7020 C  CB    . LEU D 4  103 ? 49.720 121.390 52.710 1.00 46.58  ? 103  LEU B CB    1 
ATOM   7021 C  CG    . LEU D 4  103 ? 50.650 122.553 52.339 1.00 45.47  ? 103  LEU B CG    1 
ATOM   7022 C  CD1   . LEU D 4  103 ? 52.022 122.341 52.944 1.00 44.26  ? 103  LEU B CD1   1 
ATOM   7023 C  CD2   . LEU D 4  103 ? 50.755 122.660 50.827 1.00 45.00  ? 103  LEU B CD2   1 
ATOM   7024 N  N     . ASP D 4  104 ? 47.426 119.574 53.493 1.00 49.44  ? 104  ASP B N     1 
ATOM   7025 C  CA    . ASP D 4  104 ? 46.820 118.257 53.641 1.00 50.49  ? 104  ASP B CA    1 
ATOM   7026 C  C     . ASP D 4  104 ? 45.446 118.163 52.987 1.00 50.60  ? 104  ASP B C     1 
ATOM   7027 O  O     . ASP D 4  104 ? 45.037 117.098 52.533 1.00 51.92  ? 104  ASP B O     1 
ATOM   7028 C  CB    . ASP D 4  104 ? 46.709 117.887 55.122 1.00 51.67  ? 104  ASP B CB    1 
ATOM   7029 C  CG    . ASP D 4  104 ? 48.061 117.838 55.816 1.00 54.16  ? 104  ASP B CG    1 
ATOM   7030 O  OD1   . ASP D 4  104 ? 48.990 117.198 55.275 1.00 55.44  ? 104  ASP B OD1   1 
ATOM   7031 O  OD2   . ASP D 4  104 ? 48.195 118.433 56.907 1.00 54.70  ? 104  ASP B OD2   1 
ATOM   7032 N  N     . ALA D 4  105 ? 44.741 119.284 52.927 1.00 50.52  ? 105  ALA B N     1 
ATOM   7033 C  CA    . ALA D 4  105 ? 43.407 119.308 52.345 1.00 49.99  ? 105  ALA B CA    1 
ATOM   7034 C  C     . ALA D 4  105 ? 43.415 119.330 50.826 1.00 50.43  ? 105  ALA B C     1 
ATOM   7035 O  O     . ALA D 4  105 ? 42.417 118.986 50.194 1.00 51.09  ? 105  ALA B O     1 
ATOM   7036 C  CB    . ALA D 4  105 ? 42.633 120.509 52.876 1.00 49.78  ? 105  ALA B CB    1 
ATOM   7037 N  N     . ASN D 4  106 ? 44.535 119.731 50.234 1.00 50.64  ? 106  ASN B N     1 
ATOM   7038 C  CA    . ASN D 4  106 ? 44.622 119.803 48.777 1.00 50.35  ? 106  ASN B CA    1 
ATOM   7039 C  C     . ASN D 4  106 ? 45.546 118.763 48.157 1.00 50.65  ? 106  ASN B C     1 
ATOM   7040 O  O     . ASN D 4  106 ? 45.584 118.602 46.936 1.00 49.54  ? 106  ASN B O     1 
ATOM   7041 C  CB    . ASN D 4  106 ? 45.054 121.208 48.358 1.00 48.85  ? 106  ASN B CB    1 
ATOM   7042 C  CG    . ASN D 4  106 ? 43.949 122.230 48.535 1.00 47.66  ? 106  ASN B CG    1 
ATOM   7043 O  OD1   . ASN D 4  106 ? 42.995 122.272 47.753 1.00 46.45  ? 106  ASN B OD1   1 
ATOM   7044 N  ND2   . ASN D 4  106 ? 44.064 123.051 49.573 1.00 45.91  ? 106  ASN B ND2   1 
ATOM   7045 N  N     . LEU D 4  107 ? 46.288 118.059 49.003 1.00 51.99  ? 107  LEU B N     1 
ATOM   7046 C  CA    . LEU D 4  107 ? 47.202 117.025 48.541 1.00 54.37  ? 107  LEU B CA    1 
ATOM   7047 C  C     . LEU D 4  107 ? 46.532 115.653 48.591 1.00 56.31  ? 107  LEU B C     1 
ATOM   7048 O  O     . LEU D 4  107 ? 45.316 115.606 48.886 1.00 57.39  ? 107  LEU B O     1 
ATOM   7049 C  CB    . LEU D 4  107 ? 48.468 117.021 49.399 1.00 53.62  ? 107  LEU B CB    1 
ATOM   7050 C  CG    . LEU D 4  107 ? 49.664 117.803 48.852 1.00 53.75  ? 107  LEU B CG    1 
ATOM   7051 C  CD1   . LEU D 4  107 ? 49.242 119.199 48.431 1.00 55.01  ? 107  LEU B CD1   1 
ATOM   7052 C  CD2   . LEU D 4  107 ? 50.745 117.861 49.916 1.00 54.22  ? 107  LEU B CD2   1 
HETATM 7053 MG MG    . MG  E 5  .   ? 61.224 191.761 20.075 1.00 24.26  ? 901  MG  A MG    1 
HETATM 7054 MG MG    . MG  F 5  .   ? 59.382 189.449 20.187 1.00 37.46  ? 902  MG  A MG    1 
HETATM 7055 MG MG    . MG  G 5  .   ? 27.492 190.772 33.513 1.00 18.61  ? 903  MG  A MG    1 
HETATM 7056 S  S     . SO4 H 6  .   ? 32.603 194.598 15.288 1.00 54.84  ? 904  SO4 A S     1 
HETATM 7057 O  O1    . SO4 H 6  .   ? 32.987 193.265 14.790 1.00 53.60  ? 904  SO4 A O1    1 
HETATM 7058 O  O2    . SO4 H 6  .   ? 31.148 194.785 15.107 1.00 55.27  ? 904  SO4 A O2    1 
HETATM 7059 O  O3    . SO4 H 6  .   ? 33.320 195.643 14.537 1.00 55.08  ? 904  SO4 A O3    1 
HETATM 7060 O  O4    . SO4 H 6  .   ? 32.942 194.712 16.714 1.00 54.38  ? 904  SO4 A O4    1 
HETATM 7061 S  S     . SO4 I 6  .   ? 41.343 196.199 48.908 1.00 58.40  ? 905  SO4 A S     1 
HETATM 7062 O  O1    . SO4 I 6  .   ? 41.082 196.304 50.352 1.00 58.56  ? 905  SO4 A O1    1 
HETATM 7063 O  O2    . SO4 I 6  .   ? 42.768 196.473 48.650 1.00 59.72  ? 905  SO4 A O2    1 
HETATM 7064 O  O3    . SO4 I 6  .   ? 40.505 197.183 48.199 1.00 59.15  ? 905  SO4 A O3    1 
HETATM 7065 O  O4    . SO4 I 6  .   ? 41.026 194.843 48.430 1.00 58.67  ? 905  SO4 A O4    1 
HETATM 7066 S  S     . SO4 J 6  .   ? 63.293 145.907 18.906 1.00 88.83  ? 906  SO4 A S     1 
HETATM 7067 O  O1    . SO4 J 6  .   ? 62.467 146.392 20.028 1.00 88.69  ? 906  SO4 A O1    1 
HETATM 7068 O  O2    . SO4 J 6  .   ? 64.722 146.028 19.252 1.00 88.09  ? 906  SO4 A O2    1 
HETATM 7069 O  O3    . SO4 J 6  .   ? 63.010 146.716 17.703 1.00 87.94  ? 906  SO4 A O3    1 
HETATM 7070 O  O4    . SO4 J 6  .   ? 62.973 144.491 18.645 1.00 88.26  ? 906  SO4 A O4    1 
HETATM 7071 P  PA    . D3T K 7  .   ? 62.046 189.309 22.518 1.00 27.66  ? 823  D3T A PA    1 
HETATM 7072 O  O1A   . D3T K 7  .   ? 62.352 187.866 22.353 1.00 24.22  ? 823  D3T A O1A   1 
HETATM 7073 O  O2A   . D3T K 7  .   ? 61.181 190.003 21.528 1.00 24.58  ? 823  D3T A O2A   1 
HETATM 7074 O  "O5'" . D3T K 7  .   ? 61.452 189.487 23.987 1.00 29.24  ? 823  D3T A "O5'" 1 
HETATM 7075 C  "C5'" . D3T K 7  .   ? 60.737 190.660 24.362 1.00 28.73  ? 823  D3T A "C5'" 1 
HETATM 7076 C  "C4'" . D3T K 7  .   ? 61.100 191.069 25.777 1.00 27.48  ? 823  D3T A "C4'" 1 
HETATM 7077 O  "O4'" . D3T K 7  .   ? 60.825 189.971 26.687 1.00 26.83  ? 823  D3T A "O4'" 1 
HETATM 7078 C  "C1'" . D3T K 7  .   ? 61.767 189.985 27.749 1.00 25.52  ? 823  D3T A "C1'" 1 
HETATM 7079 N  N1    . D3T K 7  .   ? 62.480 188.686 27.788 1.00 25.08  ? 823  D3T A N1    1 
HETATM 7080 C  C6    . D3T K 7  .   ? 62.624 187.916 26.651 1.00 24.81  ? 823  D3T A C6    1 
HETATM 7081 C  C2    . D3T K 7  .   ? 63.003 188.275 28.998 1.00 24.19  ? 823  D3T A C2    1 
HETATM 7082 O  O2    . D3T K 7  .   ? 62.909 188.923 30.028 1.00 23.33  ? 823  D3T A O2    1 
HETATM 7083 N  N3    . D3T K 7  .   ? 63.649 187.071 28.960 1.00 24.26  ? 823  D3T A N3    1 
HETATM 7084 C  C4    . D3T K 7  .   ? 63.833 186.253 27.867 1.00 26.58  ? 823  D3T A C4    1 
HETATM 7085 O  O4    . D3T K 7  .   ? 64.442 185.191 27.996 1.00 26.91  ? 823  D3T A O4    1 
HETATM 7086 C  C5    . D3T K 7  .   ? 63.269 186.743 26.627 1.00 26.52  ? 823  D3T A C5    1 
HETATM 7087 C  C5M   . D3T K 7  .   ? 63.431 185.926 25.383 1.00 26.13  ? 823  D3T A C5M   1 
HETATM 7088 C  "C2'" . D3T K 7  .   ? 62.703 191.171 27.518 1.00 24.62  ? 823  D3T A "C2'" 1 
HETATM 7089 C  "C3'" . D3T K 7  .   ? 62.568 191.380 26.015 1.00 26.32  ? 823  D3T A "C3'" 1 
HETATM 7090 O  O3A   . D3T K 7  .   ? 63.413 190.113 22.686 1.00 27.65  ? 823  D3T A O3A   1 
HETATM 7091 P  PB    . D3T K 7  .   ? 63.864 191.433 21.916 1.00 27.21  ? 823  D3T A PB    1 
HETATM 7092 O  O1B   . D3T K 7  .   ? 64.947 192.087 22.689 1.00 27.91  ? 823  D3T A O1B   1 
HETATM 7093 O  O2B   . D3T K 7  .   ? 62.672 192.222 21.515 1.00 28.74  ? 823  D3T A O2B   1 
HETATM 7094 O  O3B   . D3T K 7  .   ? 64.501 190.701 20.648 1.00 29.22  ? 823  D3T A O3B   1 
HETATM 7095 P  PG    . D3T K 7  .   ? 64.101 190.949 19.121 1.00 30.35  ? 823  D3T A PG    1 
HETATM 7096 O  O1G   . D3T K 7  .   ? 62.620 191.028 19.016 1.00 30.49  ? 823  D3T A O1G   1 
HETATM 7097 O  O2G   . D3T K 7  .   ? 64.934 192.054 18.573 1.00 27.76  ? 823  D3T A O2G   1 
HETATM 7098 O  O3G   . D3T K 7  .   ? 64.529 189.596 18.578 1.00 27.12  ? 823  D3T A O3G   1 
HETATM 7099 O  O1    . MES L 8  .   ? 13.131 197.639 11.078 1.00 44.18  ? 991  MES A O1    1 
HETATM 7100 C  C2    . MES L 8  .   ? 13.677 196.439 11.680 1.00 44.50  ? 991  MES A C2    1 
HETATM 7101 C  C3    . MES L 8  .   ? 13.196 196.279 13.132 1.00 44.61  ? 991  MES A C3    1 
HETATM 7102 N  N4    . MES L 8  .   ? 13.540 197.487 13.902 1.00 43.35  ? 991  MES A N4    1 
HETATM 7103 C  C5    . MES L 8  .   ? 12.984 198.703 13.282 1.00 43.62  ? 991  MES A C5    1 
HETATM 7104 C  C6    . MES L 8  .   ? 13.457 198.821 11.839 1.00 44.41  ? 991  MES A C6    1 
HETATM 7105 C  C7    . MES L 8  .   ? 13.085 197.346 15.297 1.00 42.13  ? 991  MES A C7    1 
HETATM 7106 C  C8    . MES L 8  .   ? 13.601 198.417 16.256 1.00 40.89  ? 991  MES A C8    1 
HETATM 7107 S  S     . MES L 8  .   ? 13.016 198.200 17.910 1.00 39.38  ? 991  MES A S     1 
HETATM 7108 O  O1S   . MES L 8  .   ? 12.392 199.475 18.254 1.00 40.95  ? 991  MES A O1S   1 
HETATM 7109 O  O2S   . MES L 8  .   ? 14.157 197.923 18.738 1.00 39.22  ? 991  MES A O2S   1 
HETATM 7110 O  O3S   . MES L 8  .   ? 12.037 197.120 17.918 1.00 40.34  ? 991  MES A O3S   1 
HETATM 7111 O  OH2   . 1PE M 9  .   ? 29.382 186.062 30.430 1.00 40.77  ? 992  1PE A OH2   1 
HETATM 7112 C  C12   . 1PE M 9  .   ? 28.062 185.688 30.914 1.00 39.71  ? 992  1PE A C12   1 
HETATM 7113 C  C22   . 1PE M 9  .   ? 27.299 184.834 29.853 1.00 37.85  ? 992  1PE A C22   1 
HETATM 7114 O  OH3   . 1PE M 9  .   ? 26.397 183.960 30.611 1.00 40.18  ? 992  1PE A OH3   1 
HETATM 7115 C  C13   . 1PE M 9  .   ? 25.555 181.753 30.491 1.00 39.64  ? 992  1PE A C13   1 
HETATM 7116 C  C23   . 1PE M 9  .   ? 25.587 183.074 29.729 1.00 39.39  ? 992  1PE A C23   1 
HETATM 7117 O  OH4   . 1PE M 9  .   ? 26.835 181.111 30.257 1.00 41.71  ? 992  1PE A OH4   1 
HETATM 7118 C  C14   . 1PE M 9  .   ? 28.283 179.207 30.670 1.00 47.01  ? 992  1PE A C14   1 
HETATM 7119 C  C24   . 1PE M 9  .   ? 26.929 179.797 30.951 1.00 43.79  ? 992  1PE A C24   1 
HETATM 7120 O  OH5   . 1PE M 9  .   ? 29.134 179.771 31.679 1.00 50.31  ? 992  1PE A OH5   1 
HETATM 7121 C  C15   . 1PE M 9  .   ? 31.349 179.882 32.562 1.00 51.00  ? 992  1PE A C15   1 
HETATM 7122 C  C25   . 1PE M 9  .   ? 30.467 179.284 31.499 1.00 50.66  ? 992  1PE A C25   1 
HETATM 7123 O  OH6   . 1PE M 9  .   ? 31.064 181.280 32.677 1.00 50.95  ? 992  1PE A OH6   1 
HETATM 7124 C  C16   . 1PE M 9  .   ? 31.662 183.545 32.851 1.00 48.70  ? 992  1PE A C16   1 
HETATM 7125 C  C26   . 1PE M 9  .   ? 31.996 182.246 32.200 1.00 49.04  ? 992  1PE A C26   1 
HETATM 7126 O  OH7   . 1PE M 9  .   ? 31.622 184.557 31.856 1.00 47.88  ? 992  1PE A OH7   1 
HETATM 7127 O  O     . HOH N 10 .   ? 46.029 171.380 38.447 1.00 31.42  ? 1050 HOH P O     1 
HETATM 7128 O  O     . HOH N 10 .   ? 47.284 171.927 41.123 1.00 48.33  ? 1164 HOH P O     1 
HETATM 7129 O  O     . HOH N 10 .   ? 50.850 174.010 41.676 1.00 30.87  ? 1165 HOH P O     1 
HETATM 7130 O  O     . HOH N 10 .   ? 52.381 175.480 39.446 1.00 26.97  ? 1166 HOH P O     1 
HETATM 7131 O  O     . HOH N 10 .   ? 56.045 176.670 38.327 1.00 37.03  ? 1174 HOH P O     1 
HETATM 7132 O  O     . HOH N 10 .   ? 53.890 177.950 40.397 1.00 45.97  ? 1179 HOH P O     1 
HETATM 7133 O  O     . HOH N 10 .   ? 56.426 170.372 31.427 1.00 44.81  ? 1301 HOH P O     1 
HETATM 7134 O  O     . HOH N 10 .   ? 60.297 182.647 18.412 1.00 40.14  ? 1343 HOH P O     1 
HETATM 7135 O  O     . HOH N 10 .   ? 59.286 177.226 36.537 1.00 37.15  ? 1344 HOH P O     1 
HETATM 7136 O  O     . HOH N 10 .   ? 59.610 170.619 25.169 1.00 34.61  ? 1349 HOH P O     1 
HETATM 7137 O  O     . HOH N 10 .   ? 55.622 166.164 41.508 1.00 25.54  ? 1431 HOH P O     1 
HETATM 7138 O  O     . HOH N 10 .   ? 49.435 173.059 39.072 1.00 71.43  ? 1433 HOH P O     1 
HETATM 7139 O  O     . HOH N 10 .   ? 59.729 167.849 29.228 1.00 45.02  ? 1439 HOH P O     1 
HETATM 7140 O  O     . HOH N 10 .   ? 62.597 167.420 30.758 1.00 30.70  ? 1579 HOH P O     1 
HETATM 7141 O  O     . HOH N 10 .   ? 58.664 172.752 42.442 1.00 37.85  ? 1616 HOH P O     1 
HETATM 7142 O  O     . HOH N 10 .   ? 58.868 175.166 39.881 1.00 41.22  ? 1617 HOH P O     1 
HETATM 7143 O  O     . HOH N 10 .   ? 65.006 173.929 30.083 1.00 53.54  ? 1620 HOH P O     1 
HETATM 7144 O  O     . HOH N 10 .   ? 62.608 177.373 20.230 1.00 37.69  ? 1623 HOH P O     1 
HETATM 7145 O  O     . HOH N 10 .   ? 61.206 180.026 21.245 1.00 32.01  ? 1723 HOH P O     1 
HETATM 7146 O  O     . HOH N 10 .   ? 63.586 170.218 22.942 1.00 40.06  ? 1726 HOH P O     1 
HETATM 7147 O  O     . HOH N 10 .   ? 53.880 174.851 26.410 1.00 38.88  ? 1737 HOH P O     1 
HETATM 7148 O  O     . HOH O 10 .   ? 52.659 183.105 28.676 1.00 13.14  ? 1053 HOH T O     1 
HETATM 7149 O  O     . HOH O 10 .   ? 46.254 186.205 34.273 1.00 11.28  ? 1111 HOH T O     1 
HETATM 7150 O  O     . HOH O 10 .   ? 49.618 188.858 38.191 1.00 18.21  ? 1144 HOH T O     1 
HETATM 7151 O  O     . HOH O 10 .   ? 46.903 178.119 35.065 1.00 52.57  ? 1170 HOH T O     1 
HETATM 7152 O  O     . HOH O 10 .   ? 51.110 178.605 37.784 1.00 32.14  ? 1171 HOH T O     1 
HETATM 7153 O  O     . HOH O 10 .   ? 53.758 182.333 39.529 1.00 34.46  ? 1172 HOH T O     1 
HETATM 7154 O  O     . HOH O 10 .   ? 51.809 183.330 37.417 1.00 36.30  ? 1173 HOH T O     1 
HETATM 7155 O  O     . HOH O 10 .   ? 58.304 179.991 35.532 1.00 30.30  ? 1175 HOH T O     1 
HETATM 7156 O  O     . HOH O 10 .   ? 60.694 181.612 34.911 1.00 32.33  ? 1176 HOH T O     1 
HETATM 7157 O  O     . HOH O 10 .   ? 63.561 182.579 34.623 1.00 23.59  ? 1177 HOH T O     1 
HETATM 7158 O  O     . HOH O 10 .   ? 52.971 154.946 40.150 1.00 39.07  ? 1180 HOH T O     1 
HETATM 7159 O  O     . HOH O 10 .   ? 46.075 159.998 41.802 1.00 46.11  ? 1181 HOH T O     1 
HETATM 7160 O  O     . HOH O 10 .   ? 43.074 169.149 37.598 1.00 46.91  ? 1182 HOH T O     1 
HETATM 7161 O  O     . HOH O 10 .   ? 45.569 166.286 34.550 1.00 34.56  ? 1183 HOH T O     1 
HETATM 7162 O  O     . HOH O 10 .   ? 47.002 162.718 32.831 1.00 25.51  ? 1185 HOH T O     1 
HETATM 7163 O  O     . HOH O 10 .   ? 57.877 191.567 39.951 1.00 32.21  ? 1218 HOH T O     1 
HETATM 7164 O  O     . HOH O 10 .   ? 48.891 180.099 36.316 1.00 38.59  ? 1226 HOH T O     1 
HETATM 7165 O  O     . HOH O 10 .   ? 44.724 182.803 33.532 1.00 38.66  ? 1260 HOH T O     1 
HETATM 7166 O  O     . HOH O 10 .   ? 32.671 139.856 44.632 1.00 39.21  ? 1274 HOH T O     1 
HETATM 7167 O  O     . HOH O 10 .   ? 55.633 179.049 36.637 1.00 40.20  ? 1289 HOH T O     1 
HETATM 7168 O  O     . HOH O 10 .   ? 44.616 179.745 33.598 1.00 28.66  ? 1292 HOH T O     1 
HETATM 7169 O  O     . HOH O 10 .   ? 51.516 155.429 42.991 1.00 44.01  ? 1305 HOH T O     1 
HETATM 7170 O  O     . HOH O 10 .   ? 44.488 173.870 32.547 1.00 41.61  ? 1335 HOH T O     1 
HETATM 7171 O  O     . HOH O 10 .   ? 47.438 165.716 32.332 1.00 49.83  ? 1342 HOH T O     1 
HETATM 7172 O  O     . HOH O 10 .   ? 53.225 180.722 36.407 1.00 37.17  ? 1384 HOH T O     1 
HETATM 7173 O  O     . HOH O 10 .   ? 51.915 156.332 36.322 1.00 26.53  ? 1388 HOH T O     1 
HETATM 7174 O  O     . HOH O 10 .   ? 54.168 168.122 31.770 1.00 39.17  ? 1399 HOH T O     1 
HETATM 7175 O  O     . HOH O 10 .   ? 63.644 181.670 31.624 1.00 44.12  ? 1418 HOH T O     1 
HETATM 7176 O  O     . HOH O 10 .   ? 64.570 188.569 46.513 1.00 41.01  ? 1432 HOH T O     1 
HETATM 7177 O  O     . HOH O 10 .   ? 46.022 167.553 37.306 1.00 38.33  ? 1452 HOH T O     1 
HETATM 7178 O  O     . HOH O 10 .   ? 54.704 185.128 36.874 1.00 43.30  ? 1461 HOH T O     1 
HETATM 7179 O  O     . HOH O 10 .   ? 56.254 181.942 36.771 1.00 36.62  ? 1463 HOH T O     1 
HETATM 7180 O  O     . HOH O 10 .   ? 55.006 165.554 35.728 1.00 33.27  ? 1477 HOH T O     1 
HETATM 7181 O  O     . HOH O 10 .   ? 50.638 187.029 42.413 1.00 48.39  ? 1505 HOH T O     1 
HETATM 7182 O  O     . HOH O 10 .   ? 77.775 187.808 43.951 1.00 64.91  ? 1512 HOH T O     1 
HETATM 7183 O  O     . HOH O 10 .   ? 52.855 171.694 29.881 1.00 30.99  ? 1537 HOH T O     1 
HETATM 7184 O  O     . HOH O 10 .   ? 52.012 185.868 39.463 1.00 32.61  ? 1603 HOH T O     1 
HETATM 7185 O  O     . HOH O 10 .   ? 56.862 184.751 39.004 1.00 38.97  ? 1604 HOH T O     1 
HETATM 7186 O  O     . HOH O 10 .   ? 53.583 163.920 42.217 1.00 35.03  ? 1606 HOH T O     1 
HETATM 7187 O  O     . HOH O 10 .   ? 45.164 162.616 55.446 1.00 37.32  ? 1607 HOH T O     1 
HETATM 7188 O  O     . HOH O 10 .   ? 48.281 158.340 33.343 1.00 39.31  ? 1653 HOH T O     1 
HETATM 7189 O  O     . HOH O 10 .   ? 50.342 173.071 27.043 1.00 29.47  ? 1736 HOH T O     1 
HETATM 7190 O  O     . HOH P 10 .   ? 43.164 186.352 21.131 1.00 11.94  ? 1001 HOH A O     1 
HETATM 7191 O  O     . HOH P 10 .   ? 63.802 139.909 64.900 1.00 19.01  ? 1002 HOH A O     1 
HETATM 7192 O  O     . HOH P 10 .   ? 42.554 186.051 18.087 1.00 10.43  ? 1003 HOH A O     1 
HETATM 7193 O  O     . HOH P 10 .   ? 36.039 202.256 26.351 1.00 7.20   ? 1004 HOH A O     1 
HETATM 7194 O  O     . HOH P 10 .   ? 40.979 190.550 25.594 1.00 4.94   ? 1005 HOH A O     1 
HETATM 7195 O  O     . HOH P 10 .   ? 48.762 199.493 37.765 1.00 12.42  ? 1006 HOH A O     1 
HETATM 7196 O  O     . HOH P 10 .   ? 44.764 185.531 30.586 1.00 11.17  ? 1007 HOH A O     1 
HETATM 7197 O  O     . HOH P 10 .   ? 54.426 184.617 26.819 1.00 12.84  ? 1008 HOH A O     1 
HETATM 7198 O  O     . HOH P 10 .   ? 53.066 182.349 20.865 1.00 11.16  ? 1009 HOH A O     1 
HETATM 7199 O  O     . HOH P 10 .   ? 40.980 165.998 20.389 1.00 20.94  ? 1010 HOH A O     1 
HETATM 7200 O  O     . HOH P 10 .   ? 43.082 201.611 18.265 1.00 10.58  ? 1011 HOH A O     1 
HETATM 7201 O  O     . HOH P 10 .   ? 23.448 195.355 15.908 1.00 13.18  ? 1012 HOH A O     1 
HETATM 7202 O  O     . HOH P 10 .   ? 36.885 190.255 -0.855 1.00 9.63   ? 1013 HOH A O     1 
HETATM 7203 O  O     . HOH P 10 .   ? 38.521 193.286 28.909 1.00 10.64  ? 1014 HOH A O     1 
HETATM 7204 O  O     . HOH P 10 .   ? 66.452 207.395 34.733 1.00 14.80  ? 1015 HOH A O     1 
HETATM 7205 O  O     . HOH P 10 .   ? 27.391 197.597 20.974 1.00 14.10  ? 1016 HOH A O     1 
HETATM 7206 O  O     . HOH P 10 .   ? 24.864 186.248 37.391 1.00 19.97  ? 1017 HOH A O     1 
HETATM 7207 O  O     . HOH P 10 .   ? 49.507 174.107 8.390  1.00 15.42  ? 1018 HOH A O     1 
HETATM 7208 O  O     . HOH P 10 .   ? 37.527 187.759 40.820 1.00 16.09  ? 1019 HOH A O     1 
HETATM 7209 O  O     . HOH P 10 .   ? 40.710 191.224 42.654 1.00 20.60  ? 1020 HOH A O     1 
HETATM 7210 O  O     . HOH P 10 .   ? 33.451 191.013 15.987 1.00 29.42  ? 1022 HOH A O     1 
HETATM 7211 O  O     . HOH P 10 .   ? 43.532 186.350 34.131 1.00 17.19  ? 1023 HOH A O     1 
HETATM 7212 O  O     . HOH P 10 .   ? 43.004 207.735 47.101 1.00 28.20  ? 1024 HOH A O     1 
HETATM 7213 O  O     . HOH P 10 .   ? 17.273 205.934 21.838 1.00 26.42  ? 1025 HOH A O     1 
HETATM 7214 O  O     . HOH P 10 .   ? 51.917 187.302 30.728 1.00 6.76   ? 1026 HOH A O     1 
HETATM 7215 O  O     . HOH P 10 .   ? 46.279 206.016 45.375 1.00 21.94  ? 1027 HOH A O     1 
HETATM 7216 O  O     . HOH P 10 .   ? 37.733 194.190 41.579 1.00 26.17  ? 1029 HOH A O     1 
HETATM 7217 O  O     . HOH P 10 .   ? 27.757 194.958 33.734 1.00 14.53  ? 1030 HOH A O     1 
HETATM 7218 O  O     . HOH P 10 .   ? 40.539 188.039 -2.446 1.00 10.53  ? 1031 HOH A O     1 
HETATM 7219 O  O     . HOH P 10 .   ? 67.158 196.740 18.905 1.00 13.48  ? 1032 HOH A O     1 
HETATM 7220 O  O     . HOH P 10 .   ? 34.540 211.014 41.001 1.00 19.05  ? 1033 HOH A O     1 
HETATM 7221 O  O     . HOH P 10 .   ? 45.413 213.380 35.303 1.00 30.37  ? 1034 HOH A O     1 
HETATM 7222 O  O     . HOH P 10 .   ? 11.022 197.217 24.642 1.00 26.06  ? 1035 HOH A O     1 
HETATM 7223 O  O     . HOH P 10 .   ? 34.277 181.621 49.187 1.00 25.68  ? 1036 HOH A O     1 
HETATM 7224 O  O     . HOH P 10 .   ? 51.728 191.597 42.770 1.00 21.20  ? 1037 HOH A O     1 
HETATM 7225 O  O     . HOH P 10 .   ? 47.638 187.286 36.585 1.00 22.78  ? 1038 HOH A O     1 
HETATM 7226 O  O     . HOH P 10 .   ? 36.637 187.043 4.980  1.00 16.58  ? 1039 HOH A O     1 
HETATM 7227 O  O     . HOH P 10 .   ? 34.639 190.019 11.428 1.00 17.81  ? 1040 HOH A O     1 
HETATM 7228 O  O     . HOH P 10 .   ? 66.622 143.968 26.550 1.00 40.87  ? 1041 HOH A O     1 
HETATM 7229 O  O     . HOH P 10 .   ? 50.436 190.569 24.807 1.00 14.58  ? 1043 HOH A O     1 
HETATM 7230 O  O     . HOH P 10 .   ? 52.386 205.428 48.618 1.00 33.21  ? 1044 HOH A O     1 
HETATM 7231 O  O     . HOH P 10 .   ? 53.424 193.753 26.330 1.00 21.24  ? 1045 HOH A O     1 
HETATM 7232 O  O     . HOH P 10 .   ? 45.801 185.359 22.043 1.00 12.32  ? 1046 HOH A O     1 
HETATM 7233 O  O     . HOH P 10 .   ? 39.376 192.843 26.286 1.00 11.95  ? 1047 HOH A O     1 
HETATM 7234 O  O     . HOH P 10 .   ? 60.478 195.338 8.343  1.00 22.91  ? 1048 HOH A O     1 
HETATM 7235 O  O     . HOH P 10 .   ? 57.069 197.161 10.724 1.00 22.84  ? 1049 HOH A O     1 
HETATM 7236 O  O     . HOH P 10 .   ? 49.469 197.846 35.556 1.00 21.64  ? 1052 HOH A O     1 
HETATM 7237 O  O     . HOH P 10 .   ? 50.466 185.113 29.024 1.00 10.76  ? 1054 HOH A O     1 
HETATM 7238 O  O     . HOH P 10 .   ? 55.611 184.371 19.533 1.00 10.82  ? 1055 HOH A O     1 
HETATM 7239 O  O     . HOH P 10 .   ? 41.275 203.197 20.150 1.00 30.94  ? 1056 HOH A O     1 
HETATM 7240 O  O     . HOH P 10 .   ? 40.195 200.749 21.244 1.00 15.06  ? 1057 HOH A O     1 
HETATM 7241 O  O     . HOH P 10 .   ? 40.010 199.483 18.557 1.00 26.58  ? 1058 HOH A O     1 
HETATM 7242 O  O     . HOH P 10 .   ? 38.267 203.780 19.253 1.00 37.64  ? 1059 HOH A O     1 
HETATM 7243 O  O     . HOH P 10 .   ? 37.688 201.183 18.019 1.00 32.57  ? 1060 HOH A O     1 
HETATM 7244 O  O     . HOH P 10 .   ? 38.073 201.959 15.163 1.00 50.93  ? 1061 HOH A O     1 
HETATM 7245 O  O     . HOH P 10 .   ? 38.300 199.146 14.221 1.00 24.40  ? 1062 HOH A O     1 
HETATM 7246 O  O     . HOH P 10 .   ? 37.222 198.988 11.487 1.00 31.41  ? 1063 HOH A O     1 
HETATM 7247 O  O     . HOH P 10 .   ? 36.641 196.917 15.359 1.00 38.89  ? 1064 HOH A O     1 
HETATM 7248 O  O     . HOH P 10 .   ? 34.031 202.788 18.635 1.00 25.42  ? 1065 HOH A O     1 
HETATM 7249 O  O     . HOH P 10 .   ? 24.910 194.210 13.470 1.00 26.50  ? 1066 HOH A O     1 
HETATM 7250 O  O     . HOH P 10 .   ? 24.692 193.445 10.429 1.00 43.57  ? 1067 HOH A O     1 
HETATM 7251 O  O     . HOH P 10 .   ? 20.449 195.659 9.790  1.00 44.02  ? 1068 HOH A O     1 
HETATM 7252 O  O     . HOH P 10 .   ? 18.763 199.616 12.772 1.00 31.11  ? 1069 HOH A O     1 
HETATM 7253 O  O     . HOH P 10 .   ? 20.093 201.134 17.304 1.00 38.00  ? 1070 HOH A O     1 
HETATM 7254 O  O     . HOH P 10 .   ? 22.127 202.783 13.831 1.00 41.23  ? 1071 HOH A O     1 
HETATM 7255 O  O     . HOH P 10 .   ? 39.552 190.923 -1.935 1.00 25.53  ? 1072 HOH A O     1 
HETATM 7256 O  O     . HOH P 10 .   ? 35.901 193.145 -0.016 1.00 29.49  ? 1073 HOH A O     1 
HETATM 7257 O  O     . HOH P 10 .   ? 35.043 196.822 -2.255 1.00 39.95  ? 1074 HOH A O     1 
HETATM 7258 O  O     . HOH P 10 .   ? 38.186 194.529 -3.027 1.00 18.87  ? 1075 HOH A O     1 
HETATM 7259 O  O     . HOH P 10 .   ? 36.059 189.754 3.077  1.00 19.09  ? 1076 HOH A O     1 
HETATM 7260 O  O     . HOH P 10 .   ? 64.588 209.078 32.940 1.00 19.29  ? 1077 HOH A O     1 
HETATM 7261 O  O     . HOH P 10 .   ? 64.281 205.923 37.441 1.00 25.08  ? 1078 HOH A O     1 
HETATM 7262 O  O     . HOH P 10 .   ? 58.914 207.334 33.563 1.00 24.43  ? 1079 HOH A O     1 
HETATM 7263 O  O     . HOH P 10 .   ? 58.781 204.412 34.714 1.00 22.82  ? 1080 HOH A O     1 
HETATM 7264 O  O     . HOH P 10 .   ? 58.579 201.847 33.127 1.00 19.49  ? 1081 HOH A O     1 
HETATM 7265 O  O     . HOH P 10 .   ? 55.748 201.643 32.227 1.00 21.36  ? 1082 HOH A O     1 
HETATM 7266 O  O     . HOH P 10 .   ? 60.318 205.903 36.940 1.00 22.92  ? 1083 HOH A O     1 
HETATM 7267 O  O     . HOH P 10 .   ? 59.092 205.883 39.811 1.00 34.05  ? 1084 HOH A O     1 
HETATM 7268 O  O     . HOH P 10 .   ? 30.078 198.733 19.946 1.00 18.13  ? 1085 HOH A O     1 
HETATM 7269 O  O     . HOH P 10 .   ? 29.933 195.274 18.756 1.00 13.38  ? 1086 HOH A O     1 
HETATM 7270 O  O     . HOH P 10 .   ? 31.985 196.608 20.397 1.00 17.54  ? 1087 HOH A O     1 
HETATM 7271 O  O     . HOH P 10 .   ? 33.728 197.213 17.991 1.00 36.36  ? 1088 HOH A O     1 
HETATM 7272 O  O     . HOH P 10 .   ? 28.836 191.028 18.466 1.00 19.11  ? 1089 HOH A O     1 
HETATM 7273 O  O     . HOH P 10 .   ? 28.313 189.270 37.598 1.00 22.28  ? 1090 HOH A O     1 
HETATM 7274 O  O     . HOH P 10 .   ? 28.420 191.329 35.458 1.00 15.48  ? 1091 HOH A O     1 
HETATM 7275 O  O     . HOH P 10 .   ? 27.497 193.952 36.495 1.00 24.35  ? 1092 HOH A O     1 
HETATM 7276 O  O     . HOH P 10 .   ? 28.886 192.211 32.552 1.00 14.96  ? 1093 HOH A O     1 
HETATM 7277 O  O     . HOH P 10 .   ? 26.459 190.803 31.562 1.00 14.75  ? 1094 HOH A O     1 
HETATM 7278 O  O     . HOH P 10 .   ? 25.989 187.022 33.094 1.00 59.33  ? 1095 HOH A O     1 
HETATM 7279 O  O     . HOH P 10 .   ? 30.568 189.006 31.609 1.00 21.40  ? 1096 HOH A O     1 
HETATM 7280 O  O     . HOH P 10 .   ? 35.624 193.024 29.377 1.00 17.82  ? 1097 HOH A O     1 
HETATM 7281 O  O     . HOH P 10 .   ? 34.383 190.502 22.668 1.00 15.02  ? 1098 HOH A O     1 
HETATM 7282 O  O     . HOH P 10 .   ? 33.391 187.365 25.658 1.00 25.62  ? 1099 HOH A O     1 
HETATM 7283 O  O     . HOH P 10 .   ? 31.671 185.060 26.162 1.00 20.80  ? 1100 HOH A O     1 
HETATM 7284 O  O     . HOH P 10 .   ? 37.303 184.174 23.119 1.00 29.22  ? 1101 HOH A O     1 
HETATM 7285 O  O     . HOH P 10 .   ? 35.724 189.751 14.187 1.00 26.98  ? 1102 HOH A O     1 
HETATM 7286 O  O     . HOH P 10 .   ? 34.793 186.910 13.622 1.00 20.30  ? 1103 HOH A O     1 
HETATM 7287 O  O     . HOH P 10 .   ? 33.648 185.901 16.529 1.00 32.04  ? 1104 HOH A O     1 
HETATM 7288 O  O     . HOH P 10 .   ? 50.557 175.615 6.110  1.00 29.99  ? 1105 HOH A O     1 
HETATM 7289 O  O     . HOH P 10 .   ? 51.300 172.692 10.240 1.00 23.35  ? 1106 HOH A O     1 
HETATM 7290 O  O     . HOH P 10 .   ? 35.343 185.750 41.344 1.00 23.39  ? 1107 HOH A O     1 
HETATM 7291 O  O     . HOH P 10 .   ? 35.374 190.463 38.532 1.00 11.82  ? 1108 HOH A O     1 
HETATM 7292 O  O     . HOH P 10 .   ? 40.341 192.478 38.579 1.00 19.67  ? 1109 HOH A O     1 
HETATM 7293 O  O     . HOH P 10 .   ? 37.694 191.717 39.833 1.00 21.93  ? 1110 HOH A O     1 
HETATM 7294 O  O     . HOH P 10 .   ? 42.523 184.241 32.172 1.00 27.78  ? 1112 HOH A O     1 
HETATM 7295 O  O     . HOH P 10 .   ? 43.920 185.341 37.204 1.00 24.92  ? 1113 HOH A O     1 
HETATM 7296 O  O     . HOH P 10 .   ? 43.738 190.404 36.500 1.00 14.33  ? 1114 HOH A O     1 
HETATM 7297 O  O     . HOH P 10 .   ? 54.720 188.114 30.371 1.00 25.04  ? 1115 HOH A O     1 
HETATM 7298 O  O     . HOH P 10 .   ? 12.598 178.577 37.111 1.00 36.37  ? 1116 HOH A O     1 
HETATM 7299 O  O     . HOH P 10 .   ? 32.221 198.124 29.432 1.00 14.74  ? 1117 HOH A O     1 
HETATM 7300 O  O     . HOH P 10 .   ? 69.806 196.666 17.572 1.00 19.21  ? 1118 HOH A O     1 
HETATM 7301 O  O     . HOH P 10 .   ? 62.066 198.908 19.489 1.00 15.20  ? 1119 HOH A O     1 
HETATM 7302 O  O     . HOH P 10 .   ? 66.805 199.357 14.405 1.00 30.86  ? 1120 HOH A O     1 
HETATM 7303 O  O     . HOH P 10 .   ? 33.462 216.167 44.203 1.00 21.84  ? 1121 HOH A O     1 
HETATM 7304 O  O     . HOH P 10 .   ? 32.529 217.885 38.402 1.00 23.54  ? 1122 HOH A O     1 
HETATM 7305 O  O     . HOH P 10 .   ? 45.168 212.678 39.380 1.00 38.17  ? 1123 HOH A O     1 
HETATM 7306 O  O     . HOH P 10 .   ? 11.382 194.769 22.702 1.00 25.02  ? 1124 HOH A O     1 
HETATM 7307 O  O     . HOH P 10 .   ? 10.515 199.212 22.594 1.00 25.08  ? 1125 HOH A O     1 
HETATM 7308 O  O     . HOH P 10 .   ? 13.775 203.461 26.486 1.00 22.81  ? 1126 HOH A O     1 
HETATM 7309 O  O     . HOH P 10 .   ? 15.416 205.936 26.402 1.00 28.15  ? 1127 HOH A O     1 
HETATM 7310 O  O     . HOH P 10 .   ? 18.902 205.631 31.764 1.00 18.80  ? 1128 HOH A O     1 
HETATM 7311 O  O     . HOH P 10 .   ? 16.593 203.565 32.483 1.00 24.30  ? 1129 HOH A O     1 
HETATM 7312 O  O     . HOH P 10 .   ? 13.092 205.928 36.427 1.00 20.14  ? 1130 HOH A O     1 
HETATM 7313 O  O     . HOH P 10 .   ? 16.008 206.365 35.642 1.00 18.33  ? 1131 HOH A O     1 
HETATM 7314 O  O     . HOH P 10 .   ? 12.699 203.582 38.569 1.00 33.43  ? 1132 HOH A O     1 
HETATM 7315 O  O     . HOH P 10 .   ? 15.263 202.219 42.166 1.00 32.61  ? 1133 HOH A O     1 
HETATM 7316 O  O     . HOH P 10 .   ? 9.977  196.393 37.102 1.00 42.03  ? 1134 HOH A O     1 
HETATM 7317 O  O     . HOH P 10 .   ? 13.387 194.348 39.588 1.00 32.01  ? 1135 HOH A O     1 
HETATM 7318 O  O     . HOH P 10 .   ? 11.781 198.939 36.716 1.00 31.84  ? 1136 HOH A O     1 
HETATM 7319 O  O     . HOH P 10 .   ? 42.771 209.018 30.658 1.00 19.66  ? 1137 HOH A O     1 
HETATM 7320 O  O     . HOH P 10 .   ? 39.108 205.197 26.363 1.00 23.77  ? 1138 HOH A O     1 
HETATM 7321 O  O     . HOH P 10 .   ? 39.156 208.879 24.160 1.00 32.08  ? 1139 HOH A O     1 
HETATM 7322 O  O     . HOH P 10 .   ? 47.548 208.318 25.010 1.00 25.70  ? 1140 HOH A O     1 
HETATM 7323 O  O     . HOH P 10 .   ? 45.321 207.186 21.436 1.00 33.97  ? 1141 HOH A O     1 
HETATM 7324 O  O     . HOH P 10 .   ? 56.720 194.263 39.486 1.00 23.54  ? 1142 HOH A O     1 
HETATM 7325 O  O     . HOH P 10 .   ? 59.555 192.797 37.738 1.00 22.88  ? 1143 HOH A O     1 
HETATM 7326 O  O     . HOH P 10 .   ? 53.868 202.193 49.202 1.00 40.68  ? 1145 HOH A O     1 
HETATM 7327 O  O     . HOH P 10 .   ? 51.871 191.541 27.358 1.00 15.50  ? 1146 HOH A O     1 
HETATM 7328 O  O     . HOH P 10 .   ? 56.448 193.917 26.069 1.00 29.54  ? 1147 HOH A O     1 
HETATM 7329 O  O     . HOH P 10 .   ? 45.307 183.500 24.481 1.00 14.99  ? 1148 HOH A O     1 
HETATM 7330 O  O     . HOH P 10 .   ? 40.068 193.095 31.523 1.00 17.90  ? 1149 HOH A O     1 
HETATM 7331 O  O     . HOH P 10 .   ? 42.205 194.998 31.231 1.00 16.42  ? 1150 HOH A O     1 
HETATM 7332 O  O     . HOH P 10 .   ? 42.911 197.038 29.225 1.00 12.46  ? 1151 HOH A O     1 
HETATM 7333 O  O     . HOH P 10 .   ? 43.275 197.099 33.057 1.00 16.23  ? 1152 HOH A O     1 
HETATM 7334 O  O     . HOH P 10 .   ? 61.980 192.593 7.760  1.00 44.98  ? 1153 HOH A O     1 
HETATM 7335 O  O     . HOH P 10 .   ? 60.844 199.481 10.440 1.00 31.31  ? 1154 HOH A O     1 
HETATM 7336 O  O     . HOH P 10 .   ? 61.775 202.371 8.446  1.00 43.06  ? 1155 HOH A O     1 
HETATM 7337 O  O     . HOH P 10 .   ? 61.090 204.635 10.432 1.00 29.55  ? 1156 HOH A O     1 
HETATM 7338 O  O     . HOH P 10 .   ? 58.156 205.442 10.001 1.00 31.64  ? 1157 HOH A O     1 
HETATM 7339 O  O     . HOH P 10 .   ? 57.543 208.225 11.146 1.00 45.25  ? 1158 HOH A O     1 
HETATM 7340 O  O     . HOH P 10 .   ? 61.303 209.918 14.808 1.00 50.58  ? 1159 HOH A O     1 
HETATM 7341 O  O     . HOH P 10 .   ? 60.266 208.597 17.379 1.00 26.51  ? 1160 HOH A O     1 
HETATM 7342 O  O     . HOH P 10 .   ? 61.459 206.431 18.824 1.00 18.87  ? 1161 HOH A O     1 
HETATM 7343 O  O     . HOH P 10 .   ? 66.079 209.542 20.238 1.00 30.51  ? 1162 HOH A O     1 
HETATM 7344 O  O     . HOH P 10 .   ? 68.659 206.288 19.907 1.00 25.92  ? 1163 HOH A O     1 
HETATM 7345 O  O     . HOH P 10 .   ? 40.897 173.409 35.772 1.00 57.90  ? 1167 HOH A O     1 
HETATM 7346 O  O     . HOH P 10 .   ? 40.077 176.140 34.181 1.00 38.53  ? 1168 HOH A O     1 
HETATM 7347 O  O     . HOH P 10 .   ? 41.197 177.016 37.501 1.00 48.37  ? 1169 HOH A O     1 
HETATM 7348 O  O     . HOH P 10 .   ? 64.913 182.552 26.755 1.00 38.83  ? 1178 HOH A O     1 
HETATM 7349 O  O     . HOH P 10 .   ? 45.120 168.390 30.843 1.00 17.97  ? 1184 HOH A O     1 
HETATM 7350 O  O     . HOH P 10 .   ? 41.781 163.464 21.732 1.00 29.15  ? 1186 HOH A O     1 
HETATM 7351 O  O     . HOH P 10 .   ? 47.148 187.863 21.907 1.00 18.11  ? 1187 HOH A O     1 
HETATM 7352 O  O     . HOH P 10 .   ? 12.708 200.229 20.927 1.00 37.07  ? 1188 HOH A O     1 
HETATM 7353 O  O     . HOH P 10 .   ? 22.907 209.727 32.878 1.00 11.12  ? 1189 HOH A O     1 
HETATM 7354 O  O     . HOH P 10 .   ? 57.689 194.120 28.581 1.00 24.72  ? 1190 HOH A O     1 
HETATM 7355 O  O     . HOH P 10 .   ? 38.120 190.225 42.394 1.00 19.87  ? 1191 HOH A O     1 
HETATM 7356 O  O     . HOH P 10 .   ? 63.147 166.479 26.690 1.00 23.19  ? 1193 HOH A O     1 
HETATM 7357 O  O     . HOH P 10 .   ? 71.687 205.494 26.819 1.00 8.04   ? 1194 HOH A O     1 
HETATM 7358 O  O     . HOH P 10 .   ? 28.425 210.749 22.730 1.00 15.55  ? 1195 HOH A O     1 
HETATM 7359 O  O     . HOH P 10 .   ? 47.603 193.142 -3.424 1.00 29.36  ? 1196 HOH A O     1 
HETATM 7360 O  O     . HOH P 10 .   ? 61.025 145.266 36.644 1.00 28.23  ? 1197 HOH A O     1 
HETATM 7361 O  O     . HOH P 10 .   ? 60.328 208.303 12.496 1.00 48.65  ? 1198 HOH A O     1 
HETATM 7362 O  O     . HOH P 10 .   ? 73.239 164.838 35.613 1.00 20.85  ? 1199 HOH A O     1 
HETATM 7363 O  O     . HOH P 10 .   ? 50.267 157.173 21.845 1.00 22.58  ? 1200 HOH A O     1 
HETATM 7364 O  O     . HOH P 10 .   ? 48.955 177.193 23.255 1.00 17.49  ? 1201 HOH A O     1 
HETATM 7365 O  O     . HOH P 10 .   ? 38.055 179.280 19.906 1.00 20.34  ? 1202 HOH A O     1 
HETATM 7366 O  O     . HOH P 10 .   ? 44.914 187.969 37.506 1.00 43.80  ? 1204 HOH A O     1 
HETATM 7367 O  O     . HOH P 10 .   ? 61.299 191.011 31.271 1.00 15.12  ? 1205 HOH A O     1 
HETATM 7368 O  O     . HOH P 10 .   ? 25.583 179.250 35.519 1.00 12.77  ? 1206 HOH A O     1 
HETATM 7369 O  O     . HOH P 10 .   ? 54.798 171.735 23.523 1.00 18.62  ? 1207 HOH A O     1 
HETATM 7370 O  O     . HOH P 10 .   ? 38.085 167.137 20.389 1.00 49.02  ? 1208 HOH A O     1 
HETATM 7371 O  O     . HOH P 10 .   ? 54.913 164.089 30.756 1.00 20.47  ? 1209 HOH A O     1 
HETATM 7372 O  O     . HOH P 10 .   ? 67.891 198.229 41.752 1.00 20.77  ? 1210 HOH A O     1 
HETATM 7373 O  O     . HOH P 10 .   ? 56.491 164.779 33.188 1.00 23.19  ? 1211 HOH A O     1 
HETATM 7374 O  O     . HOH P 10 .   ? 59.130 197.795 8.827  1.00 32.69  ? 1212 HOH A O     1 
HETATM 7375 O  O     . HOH P 10 .   ? 51.922 151.532 52.565 1.00 39.76  ? 1213 HOH A O     1 
HETATM 7376 O  O     . HOH P 10 .   ? 30.064 208.993 20.848 1.00 25.79  ? 1215 HOH A O     1 
HETATM 7377 O  O     . HOH P 10 .   ? 53.820 211.465 19.143 1.00 23.76  ? 1216 HOH A O     1 
HETATM 7378 O  O     . HOH P 10 .   ? 55.931 209.190 30.692 1.00 21.26  ? 1217 HOH A O     1 
HETATM 7379 O  O     . HOH P 10 .   ? 24.335 115.099 65.513 1.00 44.17  ? 1219 HOH A O     1 
HETATM 7380 O  O     . HOH P 10 .   ? 17.929 198.221 44.519 1.00 34.87  ? 1220 HOH A O     1 
HETATM 7381 O  O     . HOH P 10 .   ? 44.533 146.929 53.461 1.00 44.24  ? 1222 HOH A O     1 
HETATM 7382 O  O     . HOH P 10 .   ? 48.493 183.570 2.126  1.00 26.03  ? 1223 HOH A O     1 
HETATM 7383 O  O     . HOH P 10 .   ? 38.095 180.185 6.006  1.00 31.07  ? 1224 HOH A O     1 
HETATM 7384 O  O     . HOH P 10 .   ? 17.944 197.304 10.315 1.00 46.26  ? 1227 HOH A O     1 
HETATM 7385 O  O     . HOH P 10 .   ? 17.671 203.873 35.413 1.00 32.85  ? 1229 HOH A O     1 
HETATM 7386 O  O     . HOH P 10 .   ? 35.109 175.853 20.927 1.00 38.61  ? 1230 HOH A O     1 
HETATM 7387 O  O     . HOH P 10 .   ? 45.711 180.786 -3.846 1.00 40.16  ? 1231 HOH A O     1 
HETATM 7388 O  O     . HOH P 10 .   ? 60.487 207.958 31.121 1.00 22.10  ? 1232 HOH A O     1 
HETATM 7389 O  O     . HOH P 10 .   ? 66.964 195.733 40.458 1.00 18.00  ? 1233 HOH A O     1 
HETATM 7390 O  O     . HOH P 10 .   ? 76.452 203.319 28.421 1.00 22.76  ? 1234 HOH A O     1 
HETATM 7391 O  O     . HOH P 10 .   ? 57.357 188.769 14.127 1.00 26.16  ? 1236 HOH A O     1 
HETATM 7392 O  O     . HOH P 10 .   ? 31.726 188.705 15.849 1.00 32.80  ? 1239 HOH A O     1 
HETATM 7393 O  O     . HOH P 10 .   ? 13.704 203.113 29.568 1.00 31.06  ? 1240 HOH A O     1 
HETATM 7394 O  O     . HOH P 10 .   ? 18.938 206.635 28.938 1.00 24.31  ? 1241 HOH A O     1 
HETATM 7395 O  O     . HOH P 10 .   ? 53.227 151.199 22.625 1.00 26.05  ? 1242 HOH A O     1 
HETATM 7396 O  O     . HOH P 10 .   ? 43.313 199.801 48.057 1.00 42.76  ? 1243 HOH A O     1 
HETATM 7397 O  O     . HOH P 10 .   ? 44.190 142.856 63.854 1.00 39.22  ? 1244 HOH A O     1 
HETATM 7398 O  O     . HOH P 10 .   ? 10.541 199.378 30.395 1.00 33.59  ? 1245 HOH A O     1 
HETATM 7399 O  O     . HOH P 10 .   ? 57.977 170.930 12.705 1.00 31.32  ? 1246 HOH A O     1 
HETATM 7400 O  O     . HOH P 10 .   ? 34.952 200.134 17.381 1.00 26.60  ? 1247 HOH A O     1 
HETATM 7401 O  O     . HOH P 10 .   ? 14.385 185.802 26.930 1.00 23.92  ? 1248 HOH A O     1 
HETATM 7402 O  O     . HOH P 10 .   ? 39.122 210.602 43.533 1.00 34.44  ? 1249 HOH A O     1 
HETATM 7403 O  O     . HOH P 10 .   ? 45.705 187.977 44.436 1.00 22.73  ? 1250 HOH A O     1 
HETATM 7404 O  O     . HOH P 10 .   ? 56.500 182.040 2.151  1.00 33.52  ? 1251 HOH A O     1 
HETATM 7405 O  O     . HOH P 10 .   ? 71.612 165.206 39.523 1.00 30.91  ? 1253 HOH A O     1 
HETATM 7406 O  O     . HOH P 10 .   ? 35.047 185.541 21.127 1.00 28.45  ? 1254 HOH A O     1 
HETATM 7407 O  O     . HOH P 10 .   ? 67.394 151.847 24.708 1.00 35.52  ? 1255 HOH A O     1 
HETATM 7408 O  O     . HOH P 10 .   ? 48.376 176.799 26.167 1.00 23.91  ? 1256 HOH A O     1 
HETATM 7409 O  O     . HOH P 10 .   ? 51.512 184.406 1.917  1.00 31.10  ? 1257 HOH A O     1 
HETATM 7410 O  O     . HOH P 10 .   ? 67.214 208.777 31.532 1.00 23.73  ? 1258 HOH A O     1 
HETATM 7411 O  O     . HOH P 10 .   ? 79.148 194.488 23.289 1.00 34.10  ? 1261 HOH A O     1 
HETATM 7412 O  O     . HOH P 10 .   ? 62.135 148.422 39.269 1.00 25.33  ? 1262 HOH A O     1 
HETATM 7413 O  O     . HOH P 10 .   ? 56.366 209.700 41.590 1.00 28.91  ? 1263 HOH A O     1 
HETATM 7414 O  O     . HOH P 10 .   ? 38.560 197.091 17.846 1.00 51.89  ? 1264 HOH A O     1 
HETATM 7415 O  O     . HOH P 10 .   ? 61.941 165.760 40.469 1.00 27.41  ? 1265 HOH A O     1 
HETATM 7416 O  O     . HOH P 10 .   ? 15.262 207.184 23.665 1.00 47.00  ? 1266 HOH A O     1 
HETATM 7417 O  O     . HOH P 10 .   ? 36.356 192.725 2.980  1.00 40.30  ? 1267 HOH A O     1 
HETATM 7418 O  O     . HOH P 10 .   ? 69.045 194.321 38.290 1.00 36.71  ? 1268 HOH A O     1 
HETATM 7419 O  O     . HOH P 10 .   ? 58.461 209.366 29.369 1.00 22.76  ? 1269 HOH A O     1 
HETATM 7420 O  O     . HOH P 10 .   ? 18.655 208.508 21.732 1.00 40.91  ? 1270 HOH A O     1 
HETATM 7421 O  O     . HOH P 10 .   ? 37.452 195.806 -0.322 1.00 82.15  ? 1271 HOH A O     1 
HETATM 7422 O  O     . HOH P 10 .   ? 49.615 185.381 -1.177 1.00 36.77  ? 1272 HOH A O     1 
HETATM 7423 O  O     . HOH P 10 .   ? 38.964 180.957 24.630 1.00 30.01  ? 1275 HOH A O     1 
HETATM 7424 O  O     . HOH P 10 .   ? 57.777 143.146 33.141 1.00 37.56  ? 1276 HOH A O     1 
HETATM 7425 O  O     . HOH P 10 .   ? 30.897 192.786 17.339 1.00 33.31  ? 1277 HOH A O     1 
HETATM 7426 O  O     . HOH P 10 .   ? 26.552 198.705 48.597 1.00 52.47  ? 1278 HOH A O     1 
HETATM 7427 O  O     . HOH P 10 .   ? 73.867 197.046 18.586 1.00 27.38  ? 1279 HOH A O     1 
HETATM 7428 O  O     . HOH P 10 .   ? 48.191 211.672 32.689 1.00 34.48  ? 1280 HOH A O     1 
HETATM 7429 O  O     . HOH P 10 .   ? 65.228 167.642 51.729 1.00 32.99  ? 1281 HOH A O     1 
HETATM 7430 O  O     . HOH P 10 .   ? 59.018 201.838 6.839  1.00 36.07  ? 1282 HOH A O     1 
HETATM 7431 O  O     . HOH P 10 .   ? 25.616 200.154 45.301 1.00 22.20  ? 1283 HOH A O     1 
HETATM 7432 O  O     . HOH P 10 .   ? 68.764 164.555 40.291 1.00 29.40  ? 1284 HOH A O     1 
HETATM 7433 O  O     . HOH P 10 .   ? 38.290 199.556 3.120  1.00 39.69  ? 1286 HOH A O     1 
HETATM 7434 O  O     . HOH P 10 .   ? 49.273 141.172 39.027 1.00 32.88  ? 1287 HOH A O     1 
HETATM 7435 O  O     . HOH P 10 .   ? 62.250 208.094 21.086 1.00 31.29  ? 1290 HOH A O     1 
HETATM 7436 O  O     . HOH P 10 .   ? 53.691 153.608 16.728 1.00 43.47  ? 1293 HOH A O     1 
HETATM 7437 O  O     . HOH P 10 .   ? 31.561 202.020 46.979 1.00 36.82  ? 1294 HOH A O     1 
HETATM 7438 O  O     . HOH P 10 .   ? 65.697 193.375 38.150 1.00 25.50  ? 1295 HOH A O     1 
HETATM 7439 O  O     . HOH P 10 .   ? 9.364  169.961 34.933 1.00 35.23  ? 1296 HOH A O     1 
HETATM 7440 O  O     . HOH P 10 .   ? 42.779 201.974 45.098 1.00 22.20  ? 1298 HOH A O     1 
HETATM 7441 O  O     . HOH P 10 .   ? 30.127 210.982 34.528 1.00 27.73  ? 1299 HOH A O     1 
HETATM 7442 O  O     . HOH P 10 .   ? 50.084 204.125 3.816  1.00 38.90  ? 1300 HOH A O     1 
HETATM 7443 O  O     . HOH P 10 .   ? 19.624 188.234 44.927 1.00 37.06  ? 1302 HOH A O     1 
HETATM 7444 O  O     . HOH P 10 .   ? 56.691 203.385 8.091  1.00 39.11  ? 1303 HOH A O     1 
HETATM 7445 O  O     . HOH P 10 .   ? 73.004 206.005 41.098 1.00 47.18  ? 1304 HOH A O     1 
HETATM 7446 O  O     . HOH P 10 .   ? 33.817 187.667 28.808 1.00 27.56  ? 1306 HOH A O     1 
HETATM 7447 O  O     . HOH P 10 .   ? 52.288 140.725 63.742 1.00 48.51  ? 1307 HOH A O     1 
HETATM 7448 O  O     . HOH P 10 .   ? 37.220 212.227 41.976 1.00 33.42  ? 1308 HOH A O     1 
HETATM 7449 O  O     . HOH P 10 .   ? 79.239 209.837 31.287 1.00 40.02  ? 1309 HOH A O     1 
HETATM 7450 O  O     . HOH P 10 .   ? 62.179 179.475 17.725 1.00 30.90  ? 1310 HOH A O     1 
HETATM 7451 O  O     . HOH P 10 .   ? 51.300 212.604 21.213 1.00 39.95  ? 1311 HOH A O     1 
HETATM 7452 O  O     . HOH P 10 .   ? 50.173 206.787 46.653 1.00 39.68  ? 1315 HOH A O     1 
HETATM 7453 O  O     . HOH P 10 .   ? 30.915 214.727 26.475 1.00 29.86  ? 1316 HOH A O     1 
HETATM 7454 O  O     . HOH P 10 .   ? 43.748 205.086 19.569 1.00 44.79  ? 1317 HOH A O     1 
HETATM 7455 O  O     . HOH P 10 .   ? 33.294 188.885 3.669  1.00 28.59  ? 1319 HOH A O     1 
HETATM 7456 O  O     . HOH P 10 .   ? 51.793 199.004 44.882 1.00 37.82  ? 1320 HOH A O     1 
HETATM 7457 O  O     . HOH P 10 .   ? 49.869 155.838 32.162 1.00 40.36  ? 1321 HOH A O     1 
HETATM 7458 O  O     . HOH P 10 .   ? 47.713 201.212 41.354 1.00 34.26  ? 1323 HOH A O     1 
HETATM 7459 O  O     . HOH P 10 .   ? 47.574 190.780 38.563 1.00 45.83  ? 1324 HOH A O     1 
HETATM 7460 O  O     . HOH P 10 .   ? 62.742 143.796 34.491 1.00 50.74  ? 1325 HOH A O     1 
HETATM 7461 O  O     . HOH P 10 .   ? 48.845 210.380 39.723 1.00 20.69  ? 1326 HOH A O     1 
HETATM 7462 O  O     . HOH P 10 .   ? 47.264 174.474 24.204 1.00 27.28  ? 1327 HOH A O     1 
HETATM 7463 O  O     . HOH P 10 .   ? 24.815 182.801 17.927 1.00 30.00  ? 1328 HOH A O     1 
HETATM 7464 O  O     . HOH P 10 .   ? 50.594 193.704 47.447 1.00 36.69  ? 1329 HOH A O     1 
HETATM 7465 O  O     . HOH P 10 .   ? 56.615 166.334 29.371 1.00 39.04  ? 1330 HOH A O     1 
HETATM 7466 O  O     . HOH P 10 .   ? 8.424  190.043 29.392 1.00 38.02  ? 1331 HOH A O     1 
HETATM 7467 O  O     . HOH P 10 .   ? 75.923 159.400 37.430 1.00 31.33  ? 1332 HOH A O     1 
HETATM 7468 O  O     . HOH P 10 .   ? 56.512 156.111 14.845 1.00 27.65  ? 1333 HOH A O     1 
HETATM 7469 O  O     . HOH P 10 .   ? 35.937 174.699 24.655 1.00 35.19  ? 1336 HOH A O     1 
HETATM 7470 O  O     . HOH P 10 .   ? 42.097 187.492 0.026  1.00 24.12  ? 1337 HOH A O     1 
HETATM 7471 O  O     . HOH P 10 .   ? 60.587 163.301 17.898 1.00 20.14  ? 1338 HOH A O     1 
HETATM 7472 O  O     . HOH P 10 .   ? 30.111 197.534 16.802 1.00 31.19  ? 1340 HOH A O     1 
HETATM 7473 O  O     . HOH P 10 .   ? 10.965 196.513 20.296 1.00 32.84  ? 1341 HOH A O     1 
HETATM 7474 O  O     . HOH P 10 .   ? 49.284 208.986 44.333 1.00 39.45  ? 1345 HOH A O     1 
HETATM 7475 O  O     . HOH P 10 .   ? 77.610 203.207 31.205 1.00 29.80  ? 1346 HOH A O     1 
HETATM 7476 O  O     . HOH P 10 .   ? 23.310 216.702 26.940 1.00 26.21  ? 1347 HOH A O     1 
HETATM 7477 O  O     . HOH P 10 .   ? 53.137 148.945 19.870 1.00 40.86  ? 1348 HOH A O     1 
HETATM 7478 O  O     . HOH P 10 .   ? 36.304 201.592 10.428 1.00 33.28  ? 1350 HOH A O     1 
HETATM 7479 O  O     . HOH P 10 .   ? 34.977 184.036 12.881 1.00 51.21  ? 1351 HOH A O     1 
HETATM 7480 O  O     . HOH P 10 .   ? 29.492 185.831 37.421 1.00 33.19  ? 1352 HOH A O     1 
HETATM 7481 O  O     . HOH P 10 .   ? 32.233 185.958 19.285 1.00 39.56  ? 1353 HOH A O     1 
HETATM 7482 O  O     . HOH P 10 .   ? 58.768 180.922 16.318 1.00 31.64  ? 1356 HOH A O     1 
HETATM 7483 O  O     . HOH P 10 .   ? 54.948 151.140 18.486 1.00 28.88  ? 1357 HOH A O     1 
HETATM 7484 O  O     . HOH P 10 .   ? 16.754 207.488 33.011 1.00 29.42  ? 1358 HOH A O     1 
HETATM 7485 O  O     . HOH P 10 .   ? 41.409 193.810 41.044 1.00 49.52  ? 1359 HOH A O     1 
HETATM 7486 O  O     . HOH P 10 .   ? 16.122 185.011 18.245 1.00 38.46  ? 1360 HOH A O     1 
HETATM 7487 O  O     . HOH P 10 .   ? 15.467 179.171 33.226 1.00 53.00  ? 1361 HOH A O     1 
HETATM 7488 O  O     . HOH P 10 .   ? 72.204 189.839 23.546 1.00 34.62  ? 1362 HOH A O     1 
HETATM 7489 O  O     . HOH P 10 .   ? 29.750 119.403 67.743 1.00 36.20  ? 1363 HOH A O     1 
HETATM 7490 O  O     . HOH P 10 .   ? 53.334 189.213 44.377 1.00 39.49  ? 1364 HOH A O     1 
HETATM 7491 O  O     . HOH P 10 .   ? 49.416 198.330 42.396 1.00 44.69  ? 1365 HOH A O     1 
HETATM 7492 O  O     . HOH P 10 .   ? 51.238 213.448 45.557 1.00 57.10  ? 1366 HOH A O     1 
HETATM 7493 O  O     . HOH P 10 .   ? 67.440 205.190 12.289 1.00 39.59  ? 1367 HOH A O     1 
HETATM 7494 O  O     . HOH P 10 .   ? 33.677 195.853 22.761 1.00 23.39  ? 1368 HOH A O     1 
HETATM 7495 O  O     . HOH P 10 .   ? 44.252 163.108 14.788 1.00 34.26  ? 1369 HOH A O     1 
HETATM 7496 O  O     . HOH P 10 .   ? 57.175 144.644 74.016 1.00 27.86  ? 1370 HOH A O     1 
HETATM 7497 O  O     . HOH P 10 .   ? 55.041 177.564 6.176  1.00 26.63  ? 1371 HOH A O     1 
HETATM 7498 O  O     . HOH P 10 .   ? 60.093 187.058 20.195 1.00 20.25  ? 1372 HOH A O     1 
HETATM 7499 O  O     . HOH P 10 .   ? 74.732 197.493 40.732 1.00 48.42  ? 1375 HOH A O     1 
HETATM 7500 O  O     . HOH P 10 .   ? 24.072 201.911 18.109 1.00 26.81  ? 1376 HOH A O     1 
HETATM 7501 O  O     . HOH P 10 .   ? 34.661 181.394 1.153  1.00 33.90  ? 1377 HOH A O     1 
HETATM 7502 O  O     . HOH P 10 .   ? 44.943 213.627 50.676 1.00 38.42  ? 1378 HOH A O     1 
HETATM 7503 O  O     . HOH P 10 .   ? 43.666 192.509 38.808 1.00 33.15  ? 1379 HOH A O     1 
HETATM 7504 O  O     . HOH P 10 .   ? 19.267 210.672 45.799 1.00 42.31  ? 1380 HOH A O     1 
HETATM 7505 O  O     . HOH P 10 .   ? 45.987 160.482 17.507 1.00 35.58  ? 1382 HOH A O     1 
HETATM 7506 O  O     . HOH P 10 .   ? 37.437 168.345 23.874 1.00 40.47  ? 1383 HOH A O     1 
HETATM 7507 O  O     . HOH P 10 .   ? 35.349 172.881 -1.218 1.00 39.67  ? 1385 HOH A O     1 
HETATM 7508 O  O     . HOH P 10 .   ? 10.420 203.286 33.550 1.00 40.58  ? 1387 HOH A O     1 
HETATM 7509 O  O     . HOH P 10 .   ? 76.868 152.510 28.667 1.00 40.44  ? 1389 HOH A O     1 
HETATM 7510 O  O     . HOH P 10 .   ? 51.178 147.420 68.850 1.00 32.89  ? 1390 HOH A O     1 
HETATM 7511 O  O     . HOH P 10 .   ? 52.622 200.907 0.914  1.00 29.21  ? 1391 HOH A O     1 
HETATM 7512 O  O     . HOH P 10 .   ? 61.315 144.525 68.129 1.00 38.66  ? 1393 HOH A O     1 
HETATM 7513 O  O     . HOH P 10 .   ? 35.282 124.725 59.837 1.00 45.87  ? 1394 HOH A O     1 
HETATM 7514 O  O     . HOH P 10 .   ? 66.710 149.983 36.032 1.00 34.81  ? 1395 HOH A O     1 
HETATM 7515 O  O     . HOH P 10 .   ? 45.088 209.458 26.594 1.00 38.91  ? 1396 HOH A O     1 
HETATM 7516 O  O     . HOH P 10 .   ? 45.521 184.424 -1.665 1.00 24.86  ? 1397 HOH A O     1 
HETATM 7517 O  O     . HOH P 10 .   ? 53.972 191.862 46.502 1.00 40.88  ? 1398 HOH A O     1 
HETATM 7518 O  O     . HOH P 10 .   ? 26.931 202.794 45.779 1.00 34.88  ? 1400 HOH A O     1 
HETATM 7519 O  O     . HOH P 10 .   ? 35.648 195.938 20.419 1.00 34.43  ? 1402 HOH A O     1 
HETATM 7520 O  O     . HOH P 10 .   ? 34.063 186.217 6.221  1.00 41.23  ? 1403 HOH A O     1 
HETATM 7521 O  O     . HOH P 10 .   ? 57.934 199.354 54.548 1.00 27.36  ? 1404 HOH A O     1 
HETATM 7522 O  O     . HOH P 10 .   ? 31.921 185.452 29.170 1.00 51.43  ? 1405 HOH A O     1 
HETATM 7523 O  O     . HOH P 10 .   ? 20.190 214.757 21.407 1.00 48.87  ? 1407 HOH A O     1 
HETATM 7524 O  O     . HOH P 10 .   ? 46.412 202.685 43.786 1.00 21.67  ? 1408 HOH A O     1 
HETATM 7525 O  O     . HOH P 10 .   ? 49.080 155.730 18.443 1.00 33.97  ? 1410 HOH A O     1 
HETATM 7526 O  O     . HOH P 10 .   ? 15.286 197.424 41.897 1.00 33.26  ? 1411 HOH A O     1 
HETATM 7527 O  O     . HOH P 10 .   ? 22.135 179.468 16.573 1.00 41.54  ? 1412 HOH A O     1 
HETATM 7528 O  O     . HOH P 10 .   ? 56.289 196.122 3.696  1.00 38.84  ? 1413 HOH A O     1 
HETATM 7529 O  O     . HOH P 10 .   ? 22.985 207.642 20.334 1.00 36.82  ? 1414 HOH A O     1 
HETATM 7530 O  O     . HOH P 10 .   ? 44.663 196.133 50.793 1.00 24.56  ? 1415 HOH A O     1 
HETATM 7531 O  O     . HOH P 10 .   ? 61.083 172.619 13.873 1.00 35.78  ? 1416 HOH A O     1 
HETATM 7532 O  O     . HOH P 10 .   ? 70.703 145.201 27.604 1.00 40.65  ? 1417 HOH A O     1 
HETATM 7533 O  O     . HOH P 10 .   ? 60.324 205.528 54.323 1.00 40.87  ? 1419 HOH A O     1 
HETATM 7534 O  O     . HOH P 10 .   ? 24.848 204.177 19.884 1.00 34.87  ? 1421 HOH A O     1 
HETATM 7535 O  O     . HOH P 10 .   ? 57.343 166.272 11.678 1.00 33.75  ? 1422 HOH A O     1 
HETATM 7536 O  O     . HOH P 10 .   ? 18.047 191.741 43.764 1.00 45.75  ? 1423 HOH A O     1 
HETATM 7537 O  O     . HOH P 10 .   ? 61.054 187.932 15.241 1.00 33.14  ? 1424 HOH A O     1 
HETATM 7538 O  O     . HOH P 10 .   ? 42.855 177.323 34.518 1.00 39.12  ? 1425 HOH A O     1 
HETATM 7539 O  O     . HOH P 10 .   ? 81.463 175.074 47.633 1.00 43.70  ? 1426 HOH A O     1 
HETATM 7540 O  O     . HOH P 10 .   ? 56.463 162.464 42.208 1.00 49.43  ? 1427 HOH A O     1 
HETATM 7541 O  O     . HOH P 10 .   ? 80.401 205.439 19.094 1.00 39.50  ? 1428 HOH A O     1 
HETATM 7542 O  O     . HOH P 10 .   ? 36.748 188.121 37.674 1.00 26.61  ? 1429 HOH A O     1 
HETATM 7543 O  O     . HOH P 10 .   ? 34.853 177.914 8.088  1.00 43.51  ? 1430 HOH A O     1 
HETATM 7544 O  O     . HOH P 10 .   ? 73.614 189.465 36.579 1.00 29.06  ? 1435 HOH A O     1 
HETATM 7545 O  O     . HOH P 10 .   ? 27.797 211.104 31.852 1.00 38.64  ? 1436 HOH A O     1 
HETATM 7546 O  O     . HOH P 10 .   ? 40.151 174.728 10.011 1.00 45.46  ? 1438 HOH A O     1 
HETATM 7547 O  O     . HOH P 10 .   ? 46.203 144.980 42.666 1.00 56.37  ? 1441 HOH A O     1 
HETATM 7548 O  O     . HOH P 10 .   ? 43.002 167.034 32.983 1.00 42.02  ? 1442 HOH A O     1 
HETATM 7549 O  O     . HOH P 10 .   ? 22.107 178.699 22.626 1.00 37.72  ? 1443 HOH A O     1 
HETATM 7550 O  O     . HOH P 10 .   ? 53.335 153.488 30.830 1.00 41.05  ? 1444 HOH A O     1 
HETATM 7551 O  O     . HOH P 10 .   ? 47.351 189.887 48.513 1.00 34.17  ? 1445 HOH A O     1 
HETATM 7552 O  O     . HOH P 10 .   ? 60.820 211.142 18.922 1.00 35.44  ? 1446 HOH A O     1 
HETATM 7553 O  O     . HOH P 10 .   ? 62.625 212.698 27.922 1.00 32.94  ? 1448 HOH A O     1 
HETATM 7554 O  O     . HOH P 10 .   ? 47.609 156.484 41.787 1.00 65.09  ? 1449 HOH A O     1 
HETATM 7555 O  O     . HOH P 10 .   ? 25.461 211.758 35.475 1.00 36.15  ? 1450 HOH A O     1 
HETATM 7556 O  O     . HOH P 10 .   ? 38.226 202.862 8.318  1.00 35.84  ? 1451 HOH A O     1 
HETATM 7557 O  O     . HOH P 10 .   ? 38.907 134.209 64.708 1.00 38.39  ? 1453 HOH A O     1 
HETATM 7558 O  O     . HOH P 10 .   ? 66.130 142.106 12.805 1.00 46.46  ? 1454 HOH A O     1 
HETATM 7559 O  O     . HOH P 10 .   ? 78.522 204.552 36.908 1.00 49.11  ? 1455 HOH A O     1 
HETATM 7560 O  O     . HOH P 10 .   ? 25.924 195.326 48.005 1.00 35.69  ? 1456 HOH A O     1 
HETATM 7561 O  O     . HOH P 10 .   ? 53.375 153.978 64.705 1.00 29.20  ? 1458 HOH A O     1 
HETATM 7562 O  O     . HOH P 10 .   ? 14.959 169.750 30.709 1.00 41.14  ? 1459 HOH A O     1 
HETATM 7563 O  O     . HOH P 10 .   ? 58.124 210.844 15.096 1.00 70.92  ? 1460 HOH A O     1 
HETATM 7564 O  O     . HOH P 10 .   ? 30.484 181.196 5.852  1.00 43.65  ? 1464 HOH A O     1 
HETATM 7565 O  O     . HOH P 10 .   ? 28.014 213.785 21.459 1.00 47.41  ? 1465 HOH A O     1 
HETATM 7566 O  O     . HOH P 10 .   ? 14.244 196.031 8.283  1.00 30.25  ? 1467 HOH A O     1 
HETATM 7567 O  O     . HOH P 10 .   ? 31.638 171.228 9.938  1.00 50.02  ? 1468 HOH A O     1 
HETATM 7568 O  O     . HOH P 10 .   ? 64.251 147.489 35.011 1.00 41.41  ? 1469 HOH A O     1 
HETATM 7569 O  O     . HOH P 10 .   ? 13.733 213.152 21.701 1.00 46.99  ? 1470 HOH A O     1 
HETATM 7570 O  O     . HOH P 10 .   ? 56.007 146.621 24.839 1.00 39.18  ? 1471 HOH A O     1 
HETATM 7571 O  O     . HOH P 10 .   ? 51.908 181.519 0.568  1.00 32.23  ? 1473 HOH A O     1 
HETATM 7572 O  O     . HOH P 10 .   ? 26.172 212.710 19.354 1.00 41.10  ? 1474 HOH A O     1 
HETATM 7573 O  O     . HOH P 10 .   ? 45.665 171.329 5.756  1.00 45.12  ? 1475 HOH A O     1 
HETATM 7574 O  O     . HOH P 10 .   ? 55.344 186.593 0.400  1.00 40.89  ? 1476 HOH A O     1 
HETATM 7575 O  O     . HOH P 10 .   ? 30.139 188.232 18.285 1.00 44.16  ? 1478 HOH A O     1 
HETATM 7576 O  O     . HOH P 10 .   ? 25.882 189.752 34.667 1.00 20.00  ? 1479 HOH A O     1 
HETATM 7577 O  O     . HOH P 10 .   ? 28.566 188.796 33.632 1.00 39.19  ? 1480 HOH A O     1 
HETATM 7578 O  O     . HOH P 10 .   ? 60.390 141.934 27.852 1.00 45.29  ? 1482 HOH A O     1 
HETATM 7579 O  O     . HOH P 10 .   ? 6.885  194.445 27.661 1.00 43.59  ? 1485 HOH A O     1 
HETATM 7580 O  O     . HOH P 10 .   ? 7.740  193.528 31.471 1.00 45.74  ? 1486 HOH A O     1 
HETATM 7581 O  O     . HOH P 10 .   ? 59.519 155.756 15.318 1.00 31.59  ? 1487 HOH A O     1 
HETATM 7582 O  O     . HOH P 10 .   ? 45.400 187.515 0.295  1.00 49.31  ? 1488 HOH A O     1 
HETATM 7583 O  O     . HOH P 10 .   ? 77.673 201.684 25.835 1.00 52.41  ? 1489 HOH A O     1 
HETATM 7584 O  O     . HOH P 10 .   ? 23.369 216.959 22.872 1.00 55.70  ? 1490 HOH A O     1 
HETATM 7585 O  O     . HOH P 10 .   ? 26.837 216.123 22.963 1.00 45.50  ? 1491 HOH A O     1 
HETATM 7586 O  O     . HOH P 10 .   ? 71.683 208.723 21.940 1.00 47.04  ? 1492 HOH A O     1 
HETATM 7587 O  O     . HOH P 10 .   ? 76.901 210.457 24.114 1.00 39.99  ? 1493 HOH A O     1 
HETATM 7588 O  O     . HOH P 10 .   ? 82.786 207.668 31.164 1.00 55.30  ? 1494 HOH A O     1 
HETATM 7589 O  O     . HOH P 10 .   ? 85.058 211.368 29.270 1.00 40.66  ? 1495 HOH A O     1 
HETATM 7590 O  O     . HOH P 10 .   ? 90.185 204.670 28.378 1.00 59.36  ? 1496 HOH A O     1 
HETATM 7591 O  O     . HOH P 10 .   ? 86.062 205.779 20.881 1.00 52.18  ? 1497 HOH A O     1 
HETATM 7592 O  O     . HOH P 10 .   ? 87.261 204.256 26.453 1.00 48.86  ? 1498 HOH A O     1 
HETATM 7593 O  O     . HOH P 10 .   ? 84.472 200.532 28.761 1.00 46.96  ? 1499 HOH A O     1 
HETATM 7594 O  O     . HOH P 10 .   ? 85.754 197.799 25.347 1.00 57.45  ? 1500 HOH A O     1 
HETATM 7595 O  O     . HOH P 10 .   ? 86.182 193.891 25.662 1.00 58.01  ? 1501 HOH A O     1 
HETATM 7596 O  O     . HOH P 10 .   ? 86.714 191.013 29.386 1.00 63.00  ? 1502 HOH A O     1 
HETATM 7597 O  O     . HOH P 10 .   ? 34.054 200.147 14.272 1.00 52.34  ? 1503 HOH A O     1 
HETATM 7598 O  O     . HOH P 10 .   ? 34.712 196.781 11.428 1.00 56.38  ? 1504 HOH A O     1 
HETATM 7599 O  O     . HOH P 10 .   ? 55.315 141.391 74.588 1.00 67.76  ? 1506 HOH A O     1 
HETATM 7600 O  O     . HOH P 10 .   ? 57.067 188.132 20.457 1.00 20.46  ? 1507 HOH A O     1 
HETATM 7601 O  O     . HOH P 10 .   ? 39.183 209.390 48.246 1.00 37.83  ? 1508 HOH A O     1 
HETATM 7602 O  O     . HOH P 10 .   ? 65.873 198.035 43.959 1.00 19.72  ? 1509 HOH A O     1 
HETATM 7603 O  O     . HOH P 10 .   ? 72.961 194.146 47.234 1.00 41.28  ? 1510 HOH A O     1 
HETATM 7604 O  O     . HOH P 10 .   ? 80.527 188.438 42.767 1.00 44.11  ? 1511 HOH A O     1 
HETATM 7605 O  O     . HOH P 10 .   ? 76.232 185.044 41.819 1.00 41.83  ? 1513 HOH A O     1 
HETATM 7606 O  O     . HOH P 10 .   ? 74.089 183.356 43.876 1.00 38.22  ? 1514 HOH A O     1 
HETATM 7607 O  O     . HOH P 10 .   ? 43.005 160.765 16.925 1.00 41.02  ? 1519 HOH A O     1 
HETATM 7608 O  O     . HOH P 10 .   ? 38.247 175.169 -0.567 1.00 37.94  ? 1520 HOH A O     1 
HETATM 7609 O  O     . HOH P 10 .   ? 39.089 177.709 -2.419 1.00 59.37  ? 1521 HOH A O     1 
HETATM 7610 O  O     . HOH P 10 .   ? 41.768 179.957 -3.179 1.00 31.53  ? 1522 HOH A O     1 
HETATM 7611 O  O     . HOH P 10 .   ? 4.969  200.738 34.142 1.00 62.37  ? 1523 HOH A O     1 
HETATM 7612 O  O     . HOH P 10 .   ? 2.270  198.289 34.768 1.00 37.72  ? 1524 HOH A O     1 
HETATM 7613 O  O     . HOH P 10 .   ? 7.833  199.322 38.267 1.00 55.91  ? 1525 HOH A O     1 
HETATM 7614 O  O     . HOH P 10 .   ? 48.336 144.857 67.498 1.00 53.34  ? 1526 HOH A O     1 
HETATM 7615 O  O     . HOH P 10 .   ? 34.616 122.091 62.796 1.00 40.27  ? 1527 HOH A O     1 
HETATM 7616 O  O     . HOH P 10 .   ? 35.928 119.423 64.248 1.00 39.77  ? 1528 HOH A O     1 
HETATM 7617 O  O     . HOH P 10 .   ? 49.452 213.212 18.382 1.00 48.74  ? 1529 HOH A O     1 
HETATM 7618 O  O     . HOH P 10 .   ? 60.710 213.002 15.240 1.00 43.23  ? 1535 HOH A O     1 
HETATM 7619 O  O     . HOH P 10 .   ? 42.070 215.092 12.992 1.00 46.77  ? 1536 HOH A O     1 
HETATM 7620 O  O     . HOH P 10 .   ? 14.015 175.989 52.121 1.00 40.18  ? 1539 HOH A O     1 
HETATM 7621 O  O     . HOH P 10 .   ? 58.405 135.848 67.020 1.00 38.65  ? 1542 HOH A O     1 
HETATM 7622 O  O     . HOH P 10 .   ? 7.320  193.157 36.945 1.00 40.27  ? 1543 HOH A O     1 
HETATM 7623 O  O     . HOH P 10 .   ? 47.656 138.747 63.005 1.00 55.63  ? 1544 HOH A O     1 
HETATM 7624 O  O     . HOH P 10 .   ? 46.433 136.923 68.500 1.00 61.70  ? 1545 HOH A O     1 
HETATM 7625 O  O     . HOH P 10 .   ? 47.747 135.208 65.174 1.00 59.62  ? 1546 HOH A O     1 
HETATM 7626 O  O     . HOH P 10 .   ? 41.136 138.171 62.648 1.00 58.70  ? 1547 HOH A O     1 
HETATM 7627 O  O     . HOH P 10 .   ? 48.267 141.615 61.799 1.00 47.82  ? 1548 HOH A O     1 
HETATM 7628 O  O     . HOH P 10 .   ? 58.690 197.565 56.865 1.00 30.07  ? 1549 HOH A O     1 
HETATM 7629 O  O     . HOH P 10 .   ? 57.471 199.252 58.917 1.00 37.90  ? 1550 HOH A O     1 
HETATM 7630 O  O     . HOH P 10 .   ? 58.033 202.148 56.046 1.00 37.00  ? 1551 HOH A O     1 
HETATM 7631 O  O     . HOH P 10 .   ? 62.326 203.709 57.549 1.00 55.42  ? 1552 HOH A O     1 
HETATM 7632 O  O     . HOH P 10 .   ? 59.749 205.638 57.665 1.00 54.71  ? 1553 HOH A O     1 
HETATM 7633 O  O     . HOH P 10 .   ? 55.783 204.426 56.591 1.00 55.73  ? 1554 HOH A O     1 
HETATM 7634 O  O     . HOH P 10 .   ? 65.286 201.916 58.116 1.00 50.36  ? 1555 HOH A O     1 
HETATM 7635 O  O     . HOH P 10 .   ? 70.201 199.830 54.550 1.00 44.44  ? 1556 HOH A O     1 
HETATM 7636 O  O     . HOH P 10 .   ? 71.131 195.685 51.364 1.00 52.69  ? 1557 HOH A O     1 
HETATM 7637 O  O     . HOH P 10 .   ? 69.166 200.100 50.603 1.00 45.04  ? 1558 HOH A O     1 
HETATM 7638 O  O     . HOH P 10 .   ? 71.974 198.179 43.555 1.00 40.27  ? 1559 HOH A O     1 
HETATM 7639 O  O     . HOH P 10 .   ? 19.261 217.384 19.869 1.00 54.27  ? 1560 HOH A O     1 
HETATM 7640 O  O     . HOH P 10 .   ? 17.380 210.853 22.868 1.00 48.05  ? 1561 HOH A O     1 
HETATM 7641 O  O     . HOH P 10 .   ? 18.309 213.351 27.332 1.00 40.11  ? 1562 HOH A O     1 
HETATM 7642 O  O     . HOH P 10 .   ? 15.630 210.296 32.017 1.00 32.77  ? 1563 HOH A O     1 
HETATM 7643 O  O     . HOH P 10 .   ? 14.241 212.161 34.436 1.00 39.39  ? 1564 HOH A O     1 
HETATM 7644 O  O     . HOH P 10 .   ? 49.206 157.383 15.523 1.00 37.02  ? 1565 HOH A O     1 
HETATM 7645 O  O     . HOH P 10 .   ? 47.053 153.207 16.138 1.00 42.61  ? 1566 HOH A O     1 
HETATM 7646 O  O     . HOH P 10 .   ? 15.423 193.307 42.928 1.00 39.52  ? 1567 HOH A O     1 
HETATM 7647 O  O     . HOH P 10 .   ? 14.726 191.354 45.977 1.00 49.20  ? 1568 HOH A O     1 
HETATM 7648 O  O     . HOH P 10 .   ? 18.286 197.274 49.757 1.00 42.01  ? 1569 HOH A O     1 
HETATM 7649 O  O     . HOH P 10 .   ? 81.989 200.500 17.054 1.00 53.19  ? 1570 HOH A O     1 
HETATM 7650 O  O     . HOH P 10 .   ? 87.654 199.265 14.485 1.00 54.97  ? 1571 HOH A O     1 
HETATM 7651 O  O     . HOH P 10 .   ? 80.263 201.210 12.323 1.00 59.64  ? 1572 HOH A O     1 
HETATM 7652 O  O     . HOH P 10 .   ? 78.118 203.293 14.474 1.00 50.83  ? 1573 HOH A O     1 
HETATM 7653 O  O     . HOH P 10 .   ? 83.407 198.144 9.075  1.00 51.26  ? 1574 HOH A O     1 
HETATM 7654 O  O     . HOH P 10 .   ? 79.470 199.457 9.877  1.00 49.68  ? 1575 HOH A O     1 
HETATM 7655 O  O     . HOH P 10 .   ? 56.218 163.174 37.404 1.00 29.13  ? 1576 HOH A O     1 
HETATM 7656 O  O     . HOH P 10 .   ? 65.388 191.530 46.871 1.00 32.99  ? 1577 HOH A O     1 
HETATM 7657 O  O     . HOH P 10 .   ? 42.077 172.498 8.598  1.00 43.07  ? 1578 HOH A O     1 
HETATM 7658 O  O     . HOH P 10 .   ? 64.867 213.036 20.896 1.00 58.75  ? 1580 HOH A O     1 
HETATM 7659 O  O     . HOH P 10 .   ? 63.404 214.075 24.968 1.00 57.13  ? 1581 HOH A O     1 
HETATM 7660 O  O     . HOH P 10 .   ? 45.986 154.483 38.917 1.00 50.64  ? 1582 HOH A O     1 
HETATM 7661 O  O     . HOH P 10 .   ? 46.325 149.055 33.686 1.00 41.23  ? 1583 HOH A O     1 
HETATM 7662 O  O     . HOH P 10 .   ? 49.251 143.267 28.893 1.00 53.94  ? 1584 HOH A O     1 
HETATM 7663 O  O     . HOH P 10 .   ? 52.378 142.241 25.048 1.00 56.55  ? 1585 HOH A O     1 
HETATM 7664 O  O     . HOH P 10 .   ? 48.249 146.390 24.733 1.00 65.54  ? 1586 HOH A O     1 
HETATM 7665 O  O     . HOH P 10 .   ? 52.626 146.870 29.321 1.00 39.73  ? 1587 HOH A O     1 
HETATM 7666 O  O     . HOH P 10 .   ? 63.205 211.282 30.830 1.00 36.79  ? 1588 HOH A O     1 
HETATM 7667 O  O     . HOH P 10 .   ? 44.276 155.774 43.513 1.00 55.20  ? 1589 HOH A O     1 
HETATM 7668 O  O     . HOH P 10 .   ? 77.586 206.105 34.378 1.00 44.70  ? 1590 HOH A O     1 
HETATM 7669 O  O     . HOH P 10 .   ? 77.812 171.196 30.794 1.00 36.90  ? 1591 HOH A O     1 
HETATM 7670 O  O     . HOH P 10 .   ? 79.144 167.581 29.986 1.00 54.04  ? 1592 HOH A O     1 
HETATM 7671 O  O     . HOH P 10 .   ? 44.173 211.132 28.949 1.00 54.40  ? 1593 HOH A O     1 
HETATM 7672 O  O     . HOH P 10 .   ? 51.915 210.558 43.511 1.00 44.22  ? 1594 HOH A O     1 
HETATM 7673 O  O     . HOH P 10 .   ? 17.648 204.920 18.945 1.00 39.31  ? 1595 HOH A O     1 
HETATM 7674 O  O     . HOH P 10 .   ? 37.109 171.575 18.901 1.00 36.61  ? 1596 HOH A O     1 
HETATM 7675 O  O     . HOH P 10 .   ? 17.846 180.242 25.621 1.00 25.14  ? 1597 HOH A O     1 
HETATM 7676 O  O     . HOH P 10 .   ? 74.384 153.271 24.906 1.00 24.57  ? 1598 HOH A O     1 
HETATM 7677 O  O     . HOH P 10 .   ? 63.880 144.916 31.888 1.00 45.23  ? 1599 HOH A O     1 
HETATM 7678 O  O     . HOH P 10 .   ? 31.136 183.857 36.038 1.00 53.27  ? 1600 HOH A O     1 
HETATM 7679 O  O     . HOH P 10 .   ? 45.931 192.563 36.714 1.00 43.93  ? 1601 HOH A O     1 
HETATM 7680 O  O     . HOH P 10 .   ? 48.463 188.864 44.773 1.00 40.83  ? 1602 HOH A O     1 
HETATM 7681 O  O     . HOH P 10 .   ? 56.204 161.033 39.430 1.00 52.88  ? 1605 HOH A O     1 
HETATM 7682 O  O     . HOH P 10 .   ? 61.921 188.427 18.102 1.00 39.05  ? 1608 HOH A O     1 
HETATM 7683 O  O     . HOH P 10 .   ? 31.880 195.589 11.793 1.00 43.70  ? 1609 HOH A O     1 
HETATM 7684 O  O     . HOH P 10 .   ? 27.708 190.903 15.613 1.00 34.38  ? 1610 HOH A O     1 
HETATM 7685 O  O     . HOH P 10 .   ? 25.026 185.887 14.911 1.00 38.88  ? 1611 HOH A O     1 
HETATM 7686 O  O     . HOH P 10 .   ? 24.108 179.993 18.889 1.00 48.98  ? 1612 HOH A O     1 
HETATM 7687 O  O     . HOH P 10 .   ? 73.256 146.645 27.339 1.00 56.64  ? 1613 HOH A O     1 
HETATM 7688 O  O     . HOH P 10 .   ? 25.223 178.062 26.452 1.00 42.93  ? 1614 HOH A O     1 
HETATM 7689 O  O     . HOH P 10 .   ? 26.608 175.743 30.343 1.00 36.62  ? 1615 HOH A O     1 
HETATM 7690 O  O     . HOH P 10 .   ? 65.001 171.403 38.147 1.00 34.67  ? 1618 HOH A O     1 
HETATM 7691 O  O     . HOH P 10 .   ? 65.732 178.302 32.138 1.00 47.27  ? 1619 HOH A O     1 
HETATM 7692 O  O     . HOH P 10 .   ? 63.686 170.205 27.851 1.00 50.13  ? 1621 HOH A O     1 
HETATM 7693 O  O     . HOH P 10 .   ? 66.405 171.024 32.429 1.00 48.63  ? 1622 HOH A O     1 
HETATM 7694 O  O     . HOH P 10 .   ? 64.832 171.981 17.088 1.00 41.38  ? 1624 HOH A O     1 
HETATM 7695 O  O     . HOH P 10 .   ? 63.891 168.836 15.677 1.00 50.33  ? 1625 HOH A O     1 
HETATM 7696 O  O     . HOH P 10 .   ? 63.030 165.298 17.325 1.00 49.77  ? 1626 HOH A O     1 
HETATM 7697 O  O     . HOH P 10 .   ? 61.589 166.583 14.902 1.00 38.73  ? 1627 HOH A O     1 
HETATM 7698 O  O     . HOH P 10 .   ? 61.168 163.188 12.241 1.00 41.12  ? 1628 HOH A O     1 
HETATM 7699 O  O     . HOH P 10 .   ? 13.876 163.190 39.693 1.00 52.41  ? 1629 HOH A O     1 
HETATM 7700 O  O     . HOH P 10 .   ? 21.026 166.564 27.831 1.00 31.42  ? 1630 HOH A O     1 
HETATM 7701 O  O     . HOH P 10 .   ? 18.431 165.746 29.704 1.00 36.43  ? 1631 HOH A O     1 
HETATM 7702 O  O     . HOH P 10 .   ? 16.707 164.575 33.590 1.00 46.67  ? 1632 HOH A O     1 
HETATM 7703 O  O     . HOH P 10 .   ? 14.766 165.098 31.313 1.00 34.83  ? 1633 HOH A O     1 
HETATM 7704 O  O     . HOH P 10 .   ? 11.367 166.582 47.677 1.00 51.12  ? 1634 HOH A O     1 
HETATM 7705 O  O     . HOH P 10 .   ? 58.513 156.526 52.812 1.00 45.37  ? 1635 HOH A O     1 
HETATM 7706 O  O     . HOH P 10 .   ? 55.128 152.307 50.581 1.00 56.49  ? 1637 HOH A O     1 
HETATM 7707 O  O     . HOH P 10 .   ? 49.803 148.129 51.342 1.00 40.70  ? 1638 HOH A O     1 
HETATM 7708 O  O     . HOH P 10 .   ? 49.887 144.804 31.574 1.00 46.92  ? 1639 HOH A O     1 
HETATM 7709 O  O     . HOH P 10 .   ? 50.590 152.660 23.619 1.00 49.77  ? 1649 HOH A O     1 
HETATM 7710 O  O     . HOH P 10 .   ? 54.414 150.028 25.202 1.00 62.89  ? 1650 HOH A O     1 
HETATM 7711 O  O     . HOH P 10 .   ? 52.991 149.596 27.952 1.00 52.74  ? 1651 HOH A O     1 
HETATM 7712 O  O     . HOH P 10 .   ? 51.395 151.461 29.603 1.00 45.70  ? 1652 HOH A O     1 
HETATM 7713 O  O     . HOH P 10 .   ? 48.876 158.146 30.241 1.00 42.51  ? 1654 HOH A O     1 
HETATM 7714 O  O     . HOH P 10 .   ? 46.699 159.258 26.707 1.00 31.84  ? 1655 HOH A O     1 
HETATM 7715 O  O     . HOH P 10 .   ? 42.693 162.931 26.303 1.00 47.02  ? 1656 HOH A O     1 
HETATM 7716 O  O     . HOH P 10 .   ? 45.166 162.883 28.268 1.00 44.89  ? 1657 HOH A O     1 
HETATM 7717 O  O     . HOH P 10 .   ? 38.766 173.462 28.997 1.00 50.54  ? 1658 HOH A O     1 
HETATM 7718 O  O     . HOH P 10 .   ? 37.884 178.453 28.350 1.00 40.75  ? 1659 HOH A O     1 
HETATM 7719 O  O     . HOH P 10 .   ? 32.951 178.344 20.492 1.00 49.72  ? 1660 HOH A O     1 
HETATM 7720 O  O     . HOH P 10 .   ? 26.837 178.706 18.078 1.00 45.28  ? 1661 HOH A O     1 
HETATM 7721 O  O     . HOH P 10 .   ? 32.577 179.936 15.782 1.00 33.59  ? 1662 HOH A O     1 
HETATM 7722 O  O     . HOH P 10 .   ? 24.404 180.872 8.214  1.00 40.96  ? 1663 HOH A O     1 
HETATM 7723 O  O     . HOH P 10 .   ? 33.084 187.763 10.254 1.00 47.79  ? 1664 HOH A O     1 
HETATM 7724 O  O     . HOH P 10 .   ? 30.487 189.502 9.371  1.00 40.21  ? 1665 HOH A O     1 
HETATM 7725 O  O     . HOH P 10 .   ? 39.935 180.084 9.435  1.00 32.20  ? 1666 HOH A O     1 
HETATM 7726 O  O     . HOH P 10 .   ? 44.366 176.057 4.953  1.00 33.61  ? 1667 HOH A O     1 
HETATM 7727 O  O     . HOH P 10 .   ? 35.735 178.346 4.378  1.00 41.08  ? 1668 HOH A O     1 
HETATM 7728 O  O     . HOH P 10 .   ? 35.251 182.453 4.775  1.00 42.43  ? 1669 HOH A O     1 
HETATM 7729 O  O     . HOH P 10 .   ? 27.595 187.366 -0.283 1.00 43.48  ? 1670 HOH A O     1 
HETATM 7730 O  O     . HOH P 10 .   ? 29.257 189.466 1.500  1.00 42.36  ? 1671 HOH A O     1 
HETATM 7731 O  O     . HOH P 10 .   ? 31.575 191.454 3.066  1.00 44.59  ? 1672 HOH A O     1 
HETATM 7732 O  O     . HOH P 10 .   ? 31.021 192.645 -2.500 1.00 45.22  ? 1673 HOH A O     1 
HETATM 7733 O  O     . HOH P 10 .   ? 31.888 196.101 4.395  1.00 44.68  ? 1674 HOH A O     1 
HETATM 7734 O  O     . HOH P 10 .   ? 32.575 203.069 4.499  1.00 51.40  ? 1675 HOH A O     1 
HETATM 7735 O  O     . HOH P 10 .   ? 35.315 213.326 43.976 1.00 40.94  ? 1676 HOH A O     1 
HETATM 7736 O  O     . HOH P 10 .   ? 34.172 208.059 44.607 1.00 41.02  ? 1677 HOH A O     1 
HETATM 7737 O  O     . HOH P 10 .   ? 31.235 208.463 43.524 1.00 45.94  ? 1678 HOH A O     1 
HETATM 7738 O  O     . HOH P 10 .   ? 32.147 207.041 47.497 1.00 48.15  ? 1679 HOH A O     1 
HETATM 7739 O  O     . HOH P 10 .   ? 39.396 201.123 48.031 1.00 45.80  ? 1680 HOH A O     1 
HETATM 7740 O  O     . HOH P 10 .   ? 43.447 198.806 51.770 1.00 38.95  ? 1681 HOH A O     1 
HETATM 7741 O  O     . HOH P 10 .   ? 44.242 206.141 51.431 1.00 41.08  ? 1682 HOH A O     1 
HETATM 7742 O  O     . HOH P 10 .   ? 67.145 194.861 49.239 1.00 34.96  ? 1683 HOH A O     1 
HETATM 7743 O  O     . HOH P 10 .   ? 72.856 199.679 46.099 1.00 40.26  ? 1684 HOH A O     1 
HETATM 7744 O  O     . HOH P 10 .   ? 68.746 197.493 52.550 1.00 54.99  ? 1685 HOH A O     1 
HETATM 7745 O  O     . HOH P 10 .   ? 69.050 199.185 59.296 1.00 37.47  ? 1686 HOH A O     1 
HETATM 7746 O  O     . HOH P 10 .   ? 75.827 195.575 60.038 1.00 58.46  ? 1687 HOH A O     1 
HETATM 7747 O  O     . HOH P 10 .   ? 28.642 129.450 51.775 1.00 42.69  ? 1688 HOH A O     1 
HETATM 7748 O  O     . HOH P 10 .   ? 88.778 184.968 32.425 1.00 41.94  ? 1689 HOH A O     1 
HETATM 7749 O  O     . HOH P 10 .   ? 81.069 193.269 25.350 1.00 44.47  ? 1690 HOH A O     1 
HETATM 7750 O  O     . HOH P 10 .   ? 83.731 186.727 25.539 1.00 29.34  ? 1691 HOH A O     1 
HETATM 7751 O  O     . HOH P 10 .   ? 89.040 186.773 20.304 1.00 39.37  ? 1692 HOH A O     1 
HETATM 7752 O  O     . HOH P 10 .   ? 71.254 182.572 15.512 1.00 39.73  ? 1693 HOH A O     1 
HETATM 7753 O  O     . HOH P 10 .   ? 72.577 190.966 11.299 1.00 44.88  ? 1694 HOH A O     1 
HETATM 7754 O  O     . HOH P 10 .   ? 80.779 198.107 13.286 1.00 58.56  ? 1695 HOH A O     1 
HETATM 7755 O  O     . HOH P 10 .   ? 79.693 191.811 10.388 1.00 53.16  ? 1696 HOH A O     1 
HETATM 7756 O  O     . HOH P 10 .   ? 85.725 202.423 16.567 1.00 54.03  ? 1697 HOH A O     1 
HETATM 7757 O  O     . HOH P 10 .   ? 83.815 203.092 12.568 1.00 55.63  ? 1698 HOH A O     1 
HETATM 7758 O  O     . HOH P 10 .   ? 83.261 208.956 16.183 1.00 49.56  ? 1699 HOH A O     1 
HETATM 7759 O  O     . HOH P 10 .   ? 78.594 209.025 17.425 1.00 54.43  ? 1700 HOH A O     1 
HETATM 7760 O  O     . HOH P 10 .   ? 72.535 212.408 24.294 1.00 41.52  ? 1701 HOH A O     1 
HETATM 7761 O  O     . HOH P 10 .   ? 34.662 214.089 20.413 1.00 43.28  ? 1702 HOH A O     1 
HETATM 7762 O  O     . HOH P 10 .   ? 28.165 208.483 18.403 1.00 37.64  ? 1703 HOH A O     1 
HETATM 7763 O  O     . HOH P 10 .   ? 24.744 209.772 19.335 1.00 44.67  ? 1704 HOH A O     1 
HETATM 7764 O  O     . HOH P 10 .   ? 20.231 208.182 19.090 1.00 51.10  ? 1705 HOH A O     1 
HETATM 7765 O  O     . HOH P 10 .   ? 19.404 211.618 24.991 1.00 34.18  ? 1706 HOH A O     1 
HETATM 7766 O  O     . HOH P 10 .   ? 16.322 208.722 18.538 1.00 51.15  ? 1707 HOH A O     1 
HETATM 7767 O  O     . HOH P 10 .   ? 35.844 116.335 47.169 1.00 54.57  ? 1719 HOH A O     1 
HETATM 7768 O  O     . HOH P 10 .   ? 41.028 126.834 51.594 1.00 56.99  ? 1720 HOH A O     1 
HETATM 7769 O  O     . HOH P 10 .   ? 33.383 129.354 50.234 1.00 61.65  ? 1721 HOH A O     1 
HETATM 7770 O  O     . HOH P 10 .   ? 68.428 182.072 16.948 1.00 44.83  ? 1724 HOH A O     1 
HETATM 7771 O  O     . HOH P 10 .   ? 69.508 178.590 21.290 1.00 29.14  ? 1725 HOH A O     1 
HETATM 7772 O  O     . HOH P 10 .   ? 51.689 178.161 2.473  1.00 35.30  ? 1727 HOH A O     1 
HETATM 7773 O  O     . HOH P 10 .   ? 51.184 198.382 -0.346 1.00 39.74  ? 1728 HOH A O     1 
HETATM 7774 O  O     . HOH P 10 .   ? 60.624 169.342 13.909 1.00 39.84  ? 1729 HOH A O     1 
HETATM 7775 O  O     . HOH P 10 .   ? 37.483 173.103 12.507 1.00 41.68  ? 1730 HOH A O     1 
HETATM 7776 O  O     . HOH P 10 .   ? 37.665 170.407 15.032 1.00 42.34  ? 1731 HOH A O     1 
HETATM 7777 O  O     . HOH P 10 .   ? 35.561 187.532 23.609 1.00 29.23  ? 1732 HOH A O     1 
HETATM 7778 O  O     . HOH P 10 .   ? 16.896 189.161 11.925 1.00 39.45  ? 1733 HOH A O     1 
HETATM 7779 O  O     . HOH P 10 .   ? 14.052 189.937 10.277 1.00 37.63  ? 1734 HOH A O     1 
HETATM 7780 O  O     . HOH P 10 .   ? 19.701 188.761 11.147 1.00 33.23  ? 1735 HOH A O     1 
HETATM 7781 O  O     . HOH P 10 .   ? 79.690 157.176 48.861 1.00 36.74  ? 1738 HOH A O     1 
HETATM 7782 O  O     . HOH P 10 .   ? 85.155 158.913 27.216 1.00 35.54  ? 1739 HOH A O     1 
HETATM 7783 O  O     . HOH P 10 .   ? 80.088 175.516 37.742 1.00 42.30  ? 1740 HOH A O     1 
HETATM 7784 O  O     . HOH P 10 .   ? 83.618 177.017 38.117 1.00 37.95  ? 1741 HOH A O     1 
HETATM 7785 O  O     . HOH P 10 .   ? 76.581 198.131 23.010 1.00 27.67  ? 1742 HOH A O     1 
HETATM 7786 O  O     . HOH P 10 .   ? 74.028 195.266 25.427 1.00 28.25  ? 1743 HOH A O     1 
HETATM 7787 O  O     . HOH Q 10 .   ? 59.692 130.243 32.431 1.00 20.56  ? 1042 HOH B O     1 
HETATM 7788 O  O     . HOH Q 10 .   ? 63.405 133.285 46.160 1.00 14.01  ? 1051 HOH B O     1 
HETATM 7789 O  O     . HOH Q 10 .   ? 47.042 137.706 45.219 1.00 25.38  ? 1214 HOH B O     1 
HETATM 7790 O  O     . HOH Q 10 .   ? 60.916 134.952 51.944 1.00 22.84  ? 1221 HOH B O     1 
HETATM 7791 O  O     . HOH Q 10 .   ? 44.759 135.713 54.727 1.00 26.92  ? 1225 HOH B O     1 
HETATM 7792 O  O     . HOH Q 10 .   ? 56.544 137.959 38.810 1.00 38.54  ? 1235 HOH B O     1 
HETATM 7793 O  O     . HOH Q 10 .   ? 49.259 128.131 34.830 1.00 36.21  ? 1237 HOH B O     1 
HETATM 7794 O  O     . HOH Q 10 .   ? 58.448 149.072 46.712 1.00 30.05  ? 1238 HOH B O     1 
HETATM 7795 O  O     . HOH Q 10 .   ? 61.560 145.053 39.735 1.00 32.17  ? 1285 HOH B O     1 
HETATM 7796 O  O     . HOH Q 10 .   ? 46.045 131.506 34.009 1.00 45.11  ? 1288 HOH B O     1 
HETATM 7797 O  O     . HOH Q 10 .   ? 54.413 144.607 54.716 1.00 29.58  ? 1291 HOH B O     1 
HETATM 7798 O  O     . HOH Q 10 .   ? 58.019 143.689 41.906 1.00 44.23  ? 1312 HOH B O     1 
HETATM 7799 O  O     . HOH Q 10 .   ? 63.010 133.861 43.182 1.00 22.20  ? 1314 HOH B O     1 
HETATM 7800 O  O     . HOH Q 10 .   ? 62.463 133.811 27.798 1.00 47.79  ? 1334 HOH B O     1 
HETATM 7801 O  O     . HOH Q 10 .   ? 41.642 124.744 49.300 1.00 43.66  ? 1339 HOH B O     1 
HETATM 7802 O  O     . HOH Q 10 .   ? 60.646 121.641 48.597 1.00 30.67  ? 1373 HOH B O     1 
HETATM 7803 O  O     . HOH Q 10 .   ? 47.982 114.549 53.062 1.00 43.97  ? 1381 HOH B O     1 
HETATM 7804 O  O     . HOH Q 10 .   ? 54.480 114.158 56.297 1.00 34.67  ? 1386 HOH B O     1 
HETATM 7805 O  O     . HOH Q 10 .   ? 63.026 145.556 54.569 1.00 44.44  ? 1401 HOH B O     1 
HETATM 7806 O  O     . HOH Q 10 .   ? 64.580 142.711 37.697 1.00 47.68  ? 1406 HOH B O     1 
HETATM 7807 O  O     . HOH Q 10 .   ? 63.524 148.039 49.714 1.00 46.20  ? 1409 HOH B O     1 
HETATM 7808 O  O     . HOH Q 10 .   ? 54.145 139.250 32.311 1.00 35.96  ? 1420 HOH B O     1 
HETATM 7809 O  O     . HOH Q 10 .   ? 46.910 118.980 65.573 1.00 35.86  ? 1437 HOH B O     1 
HETATM 7810 O  O     . HOH Q 10 .   ? 65.921 142.879 44.259 1.00 37.62  ? 1472 HOH B O     1 
HETATM 7811 O  O     . HOH Q 10 .   ? 58.761 139.853 31.803 1.00 45.98  ? 1481 HOH B O     1 
HETATM 7812 O  O     . HOH Q 10 .   ? 64.887 134.716 35.013 1.00 29.09  ? 1483 HOH B O     1 
HETATM 7813 O  O     . HOH Q 10 .   ? 57.382 134.938 32.352 1.00 27.76  ? 1484 HOH B O     1 
HETATM 7814 O  O     . HOH Q 10 .   ? 65.077 116.363 55.412 1.00 52.79  ? 1515 HOH B O     1 
HETATM 7815 O  O     . HOH Q 10 .   ? 63.937 113.419 59.115 1.00 54.29  ? 1516 HOH B O     1 
HETATM 7816 O  O     . HOH Q 10 .   ? 63.302 112.245 55.971 1.00 48.00  ? 1517 HOH B O     1 
HETATM 7817 O  O     . HOH Q 10 .   ? 58.950 110.796 52.685 1.00 44.38  ? 1518 HOH B O     1 
HETATM 7818 O  O     . HOH Q 10 .   ? 60.252 147.184 54.795 1.00 54.31  ? 1538 HOH B O     1 
HETATM 7819 O  O     . HOH Q 10 .   ? 59.706 136.934 61.902 1.00 66.96  ? 1540 HOH B O     1 
HETATM 7820 O  O     . HOH Q 10 .   ? 62.259 136.215 60.238 1.00 44.72  ? 1541 HOH B O     1 
HETATM 7821 O  O     . HOH Q 10 .   ? 58.718 149.101 49.691 1.00 39.20  ? 1636 HOH B O     1 
HETATM 7822 O  O     . HOH Q 10 .   ? 53.028 135.629 27.627 1.00 44.94  ? 1640 HOH B O     1 
HETATM 7823 O  O     . HOH Q 10 .   ? 52.257 132.667 28.901 1.00 56.97  ? 1641 HOH B O     1 
HETATM 7824 O  O     . HOH Q 10 .   ? 48.777 135.172 26.484 1.00 47.87  ? 1642 HOH B O     1 
HETATM 7825 O  O     . HOH Q 10 .   ? 57.468 134.194 26.381 1.00 48.13  ? 1643 HOH B O     1 
HETATM 7826 O  O     . HOH Q 10 .   ? 47.970 126.735 29.260 1.00 51.25  ? 1644 HOH B O     1 
HETATM 7827 O  O     . HOH Q 10 .   ? 46.245 122.616 30.786 1.00 47.39  ? 1645 HOH B O     1 
HETATM 7828 O  O     . HOH Q 10 .   ? 48.017 121.505 23.244 1.00 45.03  ? 1646 HOH B O     1 
HETATM 7829 O  O     . HOH Q 10 .   ? 46.059 127.252 19.790 1.00 57.49  ? 1647 HOH B O     1 
HETATM 7830 O  O     . HOH Q 10 .   ? 44.037 126.927 23.863 1.00 45.47  ? 1648 HOH B O     1 
HETATM 7831 O  O     . HOH Q 10 .   ? 60.591 119.790 36.379 1.00 57.45  ? 1708 HOH B O     1 
HETATM 7832 O  O     . HOH Q 10 .   ? 60.355 115.500 34.249 1.00 34.81  ? 1709 HOH B O     1 
HETATM 7833 O  O     . HOH Q 10 .   ? 44.561 113.266 32.233 1.00 50.02  ? 1710 HOH B O     1 
HETATM 7834 O  O     . HOH Q 10 .   ? 41.338 114.225 33.420 1.00 66.48  ? 1711 HOH B O     1 
HETATM 7835 O  O     . HOH Q 10 .   ? 41.132 113.799 37.683 1.00 51.39  ? 1712 HOH B O     1 
HETATM 7836 O  O     . HOH Q 10 .   ? 36.198 114.247 31.778 1.00 45.51  ? 1713 HOH B O     1 
HETATM 7837 O  O     . HOH Q 10 .   ? 39.986 110.389 41.850 1.00 46.80  ? 1714 HOH B O     1 
HETATM 7838 O  O     . HOH Q 10 .   ? 52.236 110.536 27.992 1.00 39.22  ? 1715 HOH B O     1 
HETATM 7839 O  O     . HOH Q 10 .   ? 51.918 111.835 36.231 1.00 50.20  ? 1716 HOH B O     1 
HETATM 7840 O  O     . HOH Q 10 .   ? 43.868 118.815 41.618 1.00 62.61  ? 1717 HOH B O     1 
HETATM 7841 O  O     . HOH Q 10 .   ? 41.554 117.250 43.284 1.00 47.17  ? 1718 HOH B O     1 
HETATM 7842 O  O     . HOH Q 10 .   ? 61.050 127.611 31.904 1.00 36.90  ? 1722 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   801 ?   ?   ?   P . n 
A 1 2   DG  2   802 ?   ?   ?   P . n 
A 1 3   DA  3   803 ?   ?   ?   P . n 
A 1 4   DA  4   804 ?   ?   ?   P . n 
A 1 5   DA  5   805 ?   ?   ?   P . n 
A 1 6   DA  6   806 ?   ?   ?   P . n 
A 1 7   DC  7   807 807 DC  CYT P . n 
A 1 8   DG  8   808 808 DG  GUA P . n 
A 1 9   DA  9   809 809 DA  ADE P . n 
A 1 10  DC  10  810 810 DC  CYT P . n 
A 1 11  DG  11  811 811 DG  GUA P . n 
A 1 12  DG  12  812 812 DG  GUA P . n 
A 1 13  DC  13  813 813 DC  CYT P . n 
A 1 14  DC  14  814 814 DC  CYT P . n 
A 1 15  DA  15  815 815 DA  ADE P . n 
A 1 16  DG  16  816 816 DG  GUA P . n 
A 1 17  DT  17  817 817 DT  THY P . n 
A 1 18  DG  18  818 818 DG  GUA P . n 
A 1 19  DC  19  819 819 DC  CYT P . n 
A 1 20  DC  20  820 820 DC  CYT P . n 
A 1 21  DA  21  821 821 DA  ADE P . n 
A 1 22  DOC 22  822 822 DOC 2DC P . n 
B 2 1   DC  1   851 ?   ?   ?   T . n 
B 2 2   DC  2   852 ?   ?   ?   T . n 
B 2 3   DC  3   853 853 DC  CYT T . n 
B 2 4   DA  4   854 854 DA  ADE T . n 
B 2 5   8OG 5   855 855 8OG 8OG T . n 
B 2 6   DT  6   856 856 DT  THY T . n 
B 2 7   DG  7   857 857 DG  GUA T . n 
B 2 8   DG  8   858 858 DG  GUA T . n 
B 2 9   DC  9   859 859 DC  CYT T . n 
B 2 10  DA  10  860 860 DA  ADE T . n 
B 2 11  DC  11  861 861 DC  CYT T . n 
B 2 12  DT  12  862 862 DT  THY T . n 
B 2 13  DG  13  863 863 DG  GUA T . n 
B 2 14  DG  14  864 864 DG  GUA T . n 
B 2 15  DC  15  865 865 DC  CYT T . n 
B 2 16  DC  16  866 866 DC  CYT T . n 
B 2 17  DG  17  867 867 DG  GUA T . n 
B 2 18  DT  18  868 868 DT  THY T . n 
B 2 19  DC  19  869 869 DC  CYT T . n 
B 2 20  DG  20  870 870 DG  GUA T . n 
B 2 21  DT  21  871 871 DT  THY T . n 
B 2 22  DT  22  872 ?   ?   ?   T . n 
B 2 23  DT  23  873 ?   ?   ?   T . n 
B 2 24  DT  24  874 ?   ?   ?   T . n 
B 2 25  DC  25  875 ?   ?   ?   T . n 
B 2 26  DG  26  876 ?   ?   ?   T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   SER 4   4   4   SER SER A . n 
C 3 5   ASP 5   5   5   ASP ASP A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   ALA 8   8   8   ALA ALA A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  GLU 13  13  13  GLU GLU A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  LYS 17  17  17  LYS LYS A . n 
C 3 18  PHE 18  18  18  PHE PHE A . n 
C 3 19  HIS 19  19  19  HIS HIS A . n 
C 3 20  CYS 20  20  20  CYS CYS A . n 
C 3 21  GLY 21  21  21  GLY GLY A . n 
C 3 22  VAL 22  22  22  VAL VAL A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  TYR 24  24  24  TYR TYR A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  TYR 26  26  26  TYR TYR A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ALA 29  29  29  ALA ALA A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  TYR 31  31  31  TYR TYR A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  SER 33  33  33  SER SER A . n 
C 3 34  TYR 34  34  34  TYR TYR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  PRO 36  36  36  PRO PRO A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  ASP 38  38  38  ASP ASP A . n 
C 3 39  PHE 39  39  39  PHE PHE A . n 
C 3 40  GLY 40  40  40  GLY GLY A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  LEU 43  43  43  LEU LEU A . n 
C 3 44  ASP 44  44  44  ASP ASP A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  LEU 46  46  46  LEU LEU A . n 
C 3 47  GLU 47  47  47  GLU GLU A . n 
C 3 48  ALA 48  48  48  ALA ALA A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  VAL 50  50  50  VAL VAL A . n 
C 3 51  ALA 51  51  51  ALA ALA A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  GLY 53  53  53  GLY GLY A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  ILE 56  56  56  ILE ILE A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  HIS 59  59  59  HIS HIS A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  GLY 61  61  61  GLY GLY A . n 
C 3 62  HIS 62  62  62  HIS HIS A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  TYR 64  64  64  TYR TYR A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  PRO 67  67  67  PRO PRO A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  THR 70  70  70  THR THR A . n 
C 3 71  LYS 71  71  71  LYS LYS A . n 
C 3 72  LEU 72  72  72  LEU LEU A . n 
C 3 73  ALA 73  73  73  ALA ALA A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  GLN 76  76  76  GLN GLN A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ASN 78  78  78  ASN ASN A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  GLU 80  80  80  GLU GLU A . n 
C 3 81  PHE 81  81  81  PHE PHE A . n 
C 3 82  HIS 82  82  82  HIS HIS A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  PRO 84  84  84  PRO PRO A . n 
C 3 85  ARG 85  85  85  ARG ARG A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  ASN 87  87  87  ASN ASN A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  ILE 89  89  89  ILE ILE A . n 
C 3 90  ASP 90  90  90  ASP ASP A . n 
C 3 91  THR 91  91  91  THR THR A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  VAL 93  93  93  VAL VAL A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  LEU 97  97  97  LEU LEU A . n 
C 3 98  ILE 98  98  98  ILE ILE A . n 
C 3 99  HIS 99  99  99  HIS HIS A . n 
C 3 100 SER 100 100 100 SER SER A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 LYS 103 103 103 LYS LYS A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 THR 105 105 105 THR THR A . n 
C 3 106 ASP 106 106 106 ASP ASP A . n 
C 3 107 MET 107 107 107 MET MET A . n 
C 3 108 GLY 108 108 108 GLY GLY A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 LEU 110 110 110 LEU LEU A . n 
C 3 111 ARG 111 111 111 ARG ARG A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 GLY 113 113 113 GLY GLY A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 PRO 116 116 116 PRO PRO A . n 
C 3 117 GLY 117 117 117 GLY GLY A . n 
C 3 118 ALA 118 124 124 ALA ALA A . n 
C 3 119 LEU 119 125 125 LEU LEU A . n 
C 3 120 GLU 120 126 126 GLU GLU A . n 
C 3 121 ALA 121 127 127 ALA ALA A . n 
C 3 122 TRP 122 128 128 TRP TRP A . n 
C 3 123 GLY 123 129 129 GLY GLY A . n 
C 3 124 TYR 124 130 130 TYR TYR A . n 
C 3 125 ARG 125 131 131 ARG ARG A . n 
C 3 126 LEU 126 132 132 LEU LEU A . n 
C 3 127 GLY 127 133 133 GLY GLY A . n 
C 3 128 GLU 128 134 134 GLU GLU A . n 
C 3 129 MET 129 135 135 MET MET A . n 
C 3 130 LYS 130 136 136 LYS LYS A . n 
C 3 131 GLY 131 137 137 GLY GLY A . n 
C 3 132 GLU 132 138 138 GLU GLU A . n 
C 3 133 TYR 133 139 139 TYR TYR A . n 
C 3 134 LYS 134 140 140 LYS LYS A . n 
C 3 135 ASP 135 141 141 ASP ASP A . n 
C 3 136 ASP 136 142 142 ASP ASP A . n 
C 3 137 PHE 137 143 143 PHE PHE A . n 
C 3 138 LYS 138 144 144 LYS LYS A . n 
C 3 139 ARG 139 145 145 ARG ARG A . n 
C 3 140 MET 140 146 146 MET MET A . n 
C 3 141 LEU 141 147 147 LEU LEU A . n 
C 3 142 GLU 142 148 148 GLU GLU A . n 
C 3 143 GLU 143 149 149 GLU GLU A . n 
C 3 144 GLN 144 150 150 GLN GLN A . n 
C 3 145 GLY 145 151 151 GLY GLY A . n 
C 3 146 GLU 146 152 152 GLU GLU A . n 
C 3 147 GLU 147 153 153 GLU GLU A . n 
C 3 148 TYR 148 154 154 TYR TYR A . n 
C 3 149 VAL 149 155 155 VAL VAL A . n 
C 3 150 ASP 150 156 156 ASP ASP A . n 
C 3 151 GLY 151 157 157 GLY GLY A . n 
C 3 152 MET 152 158 158 MET MET A . n 
C 3 153 GLU 153 159 159 GLU GLU A . n 
C 3 154 TRP 154 160 160 TRP TRP A . n 
C 3 155 TRP 155 161 161 TRP TRP A . n 
C 3 156 ASN 156 162 162 ASN ASN A . n 
C 3 157 PHE 157 163 163 PHE PHE A . n 
C 3 158 ASN 158 164 164 ASN ASN A . n 
C 3 159 GLU 159 165 165 GLU GLU A . n 
C 3 160 GLU 160 166 166 GLU GLU A . n 
C 3 161 MET 161 167 167 MET MET A . n 
C 3 162 MET 162 168 168 MET MET A . n 
C 3 163 ASP 163 169 169 ASP ASP A . n 
C 3 164 TYR 164 170 170 TYR TYR A . n 
C 3 165 ASN 165 171 171 ASN ASN A . n 
C 3 166 VAL 166 172 172 VAL VAL A . n 
C 3 167 GLN 167 173 173 GLN GLN A . n 
C 3 168 ASP 168 174 174 ASP ASP A . n 
C 3 169 VAL 169 175 175 VAL VAL A . n 
C 3 170 VAL 170 176 176 VAL VAL A . n 
C 3 171 VAL 171 177 177 VAL VAL A . n 
C 3 172 THR 172 178 178 THR THR A . n 
C 3 173 LYS 173 179 179 LYS LYS A . n 
C 3 174 ALA 174 180 180 ALA ALA A . n 
C 3 175 LEU 175 181 181 LEU LEU A . n 
C 3 176 LEU 176 182 182 LEU LEU A . n 
C 3 177 GLU 177 183 183 GLU GLU A . n 
C 3 178 LYS 178 184 184 LYS LYS A . n 
C 3 179 LEU 179 185 185 LEU LEU A . n 
C 3 180 LEU 180 186 186 LEU LEU A . n 
C 3 181 SER 181 187 187 SER SER A . n 
C 3 182 ASP 182 188 188 ASP ASP A . n 
C 3 183 LYS 183 189 189 LYS LYS A . n 
C 3 184 HIS 184 190 190 HIS HIS A . n 
C 3 185 TYR 185 191 191 TYR TYR A . n 
C 3 186 PHE 186 192 192 PHE PHE A . n 
C 3 187 PRO 187 193 193 PRO PRO A . n 
C 3 188 PRO 188 194 194 PRO PRO A . n 
C 3 189 GLU 189 195 195 GLU GLU A . n 
C 3 190 ILE 190 196 196 ILE ILE A . n 
C 3 191 ASP 191 197 197 ASP ASP A . n 
C 3 192 PHE 192 198 198 PHE PHE A . n 
C 3 193 THR 193 199 199 THR THR A . n 
C 3 194 ASP 194 200 200 ASP ASP A . n 
C 3 195 VAL 195 201 201 VAL VAL A . n 
C 3 196 GLY 196 202 202 GLY GLY A . n 
C 3 197 TYR 197 203 203 TYR TYR A . n 
C 3 198 THR 198 204 204 THR THR A . n 
C 3 199 THR 199 205 205 THR THR A . n 
C 3 200 PHE 200 206 206 PHE PHE A . n 
C 3 201 TRP 201 207 207 TRP TRP A . n 
C 3 202 SER 202 208 208 SER SER A . n 
C 3 203 GLU 203 209 209 GLU GLU A . n 
C 3 204 SER 204 210 210 SER SER A . n 
C 3 205 LEU 205 211 211 LEU LEU A . n 
C 3 206 GLU 206 212 212 GLU GLU A . n 
C 3 207 ALA 207 213 213 ALA ALA A . n 
C 3 208 VAL 208 214 214 VAL VAL A . n 
C 3 209 ASP 209 215 215 ASP ASP A . n 
C 3 210 ILE 210 216 216 ILE ILE A . n 
C 3 211 GLU 211 217 217 GLU GLU A . n 
C 3 212 HIS 212 218 218 HIS HIS A . n 
C 3 213 ARG 213 219 219 ARG ARG A . n 
C 3 214 ALA 214 220 220 ALA ALA A . n 
C 3 215 ALA 215 221 221 ALA ALA A . n 
C 3 216 TRP 216 222 222 TRP TRP A . n 
C 3 217 LEU 217 223 223 LEU LEU A . n 
C 3 218 LEU 218 224 224 LEU LEU A . n 
C 3 219 ALA 219 225 225 ALA ALA A . n 
C 3 220 LYS 220 226 226 LYS LYS A . n 
C 3 221 GLN 221 227 227 GLN GLN A . n 
C 3 222 GLU 222 228 228 GLU GLU A . n 
C 3 223 ARG 223 229 229 ARG ARG A . n 
C 3 224 ASN 224 230 230 ASN ASN A . n 
C 3 225 GLY 225 231 231 GLY GLY A . n 
C 3 226 PHE 226 232 232 PHE PHE A . n 
C 3 227 PRO 227 233 233 PRO PRO A . n 
C 3 228 PHE 228 234 234 PHE PHE A . n 
C 3 229 ASP 229 235 235 ASP ASP A . n 
C 3 230 THR 230 236 236 THR THR A . n 
C 3 231 LYS 231 237 237 LYS LYS A . n 
C 3 232 ALA 232 238 238 ALA ALA A . n 
C 3 233 ILE 233 239 239 ILE ILE A . n 
C 3 234 GLU 234 240 240 GLU GLU A . n 
C 3 235 GLU 235 241 241 GLU GLU A . n 
C 3 236 LEU 236 242 242 LEU LEU A . n 
C 3 237 TYR 237 243 243 TYR TYR A . n 
C 3 238 VAL 238 244 244 VAL VAL A . n 
C 3 239 GLU 239 245 245 GLU GLU A . n 
C 3 240 LEU 240 246 246 LEU LEU A . n 
C 3 241 ALA 241 247 247 ALA ALA A . n 
C 3 242 ALA 242 248 248 ALA ALA A . n 
C 3 243 ARG 243 249 249 ARG ARG A . n 
C 3 244 ARG 244 250 250 ARG ARG A . n 
C 3 245 SER 245 251 251 SER SER A . n 
C 3 246 GLU 246 252 252 GLU GLU A . n 
C 3 247 LEU 247 253 253 LEU LEU A . n 
C 3 248 LEU 248 254 254 LEU LEU A . n 
C 3 249 ARG 249 255 255 ARG ARG A . n 
C 3 250 LYS 250 256 256 LYS LYS A . n 
C 3 251 LEU 251 257 257 LEU LEU A . n 
C 3 252 THR 252 258 258 THR THR A . n 
C 3 253 GLU 253 259 259 GLU GLU A . n 
C 3 254 THR 254 260 260 THR THR A . n 
C 3 255 PHE 255 261 261 PHE PHE A . n 
C 3 256 GLY 256 262 262 GLY GLY A . n 
C 3 257 SER 257 263 263 SER SER A . n 
C 3 258 TRP 258 264 264 TRP TRP A . n 
C 3 259 TYR 259 265 265 TYR TYR A . n 
C 3 260 GLN 260 266 266 GLN GLN A . n 
C 3 261 PRO 261 267 267 PRO PRO A . n 
C 3 262 LYS 262 268 268 LYS LYS A . n 
C 3 263 GLY 263 269 269 GLY GLY A . n 
C 3 264 GLY 264 270 270 GLY GLY A . n 
C 3 265 THR 265 271 271 THR THR A . n 
C 3 266 GLU 266 272 272 GLU GLU A . n 
C 3 267 MET 267 273 273 MET MET A . n 
C 3 268 PHE 268 274 274 PHE PHE A . n 
C 3 269 CYS 269 275 275 CYS CYS A . n 
C 3 270 HIS 270 276 276 HIS HIS A . n 
C 3 271 PRO 271 277 277 PRO PRO A . n 
C 3 272 ARG 272 278 278 ARG ARG A . n 
C 3 273 THR 273 279 279 THR THR A . n 
C 3 274 GLY 274 280 280 GLY GLY A . n 
C 3 275 LYS 275 281 281 LYS LYS A . n 
C 3 276 PRO 276 282 282 PRO PRO A . n 
C 3 277 LEU 277 283 283 LEU LEU A . n 
C 3 278 PRO 278 284 284 PRO PRO A . n 
C 3 279 LYS 279 285 285 LYS LYS A . n 
C 3 280 TYR 280 286 286 TYR TYR A . n 
C 3 281 PRO 281 287 287 PRO PRO A . n 
C 3 282 ARG 282 288 288 ARG ARG A . n 
C 3 283 ILE 283 289 289 ILE ILE A . n 
C 3 284 LYS 284 290 290 LYS LYS A . n 
C 3 285 THR 285 291 291 THR THR A . n 
C 3 286 PRO 286 292 292 PRO PRO A . n 
C 3 287 LYS 287 293 293 LYS LYS A . n 
C 3 288 VAL 288 294 294 VAL VAL A . n 
C 3 289 GLY 289 295 295 GLY GLY A . n 
C 3 290 GLY 290 296 296 GLY GLY A . n 
C 3 291 ILE 291 297 297 ILE ILE A . n 
C 3 292 PHE 292 298 298 PHE PHE A . n 
C 3 293 LYS 293 299 299 LYS LYS A . n 
C 3 294 LYS 294 300 300 LYS LYS A . n 
C 3 295 PRO 295 301 301 PRO PRO A . n 
C 3 296 LYS 296 302 302 LYS LYS A . n 
C 3 297 ASN 297 303 303 ASN ASN A . n 
C 3 298 LYS 298 304 304 LYS LYS A . n 
C 3 299 ALA 299 305 305 ALA ALA A . n 
C 3 300 GLN 300 306 306 GLN GLN A . n 
C 3 301 ARG 301 307 307 ARG ARG A . n 
C 3 302 GLU 302 308 308 GLU GLU A . n 
C 3 303 GLY 303 309 309 GLY GLY A . n 
C 3 304 ARG 304 310 310 ARG ARG A . n 
C 3 305 GLU 305 311 311 GLU GLU A . n 
C 3 306 PRO 306 312 312 PRO PRO A . n 
C 3 307 CYS 307 313 313 CYS CYS A . n 
C 3 308 GLU 308 314 314 GLU GLU A . n 
C 3 309 LEU 309 315 315 LEU LEU A . n 
C 3 310 ASP 310 316 316 ASP ASP A . n 
C 3 311 THR 311 317 317 THR THR A . n 
C 3 312 ARG 312 318 318 ARG ARG A . n 
C 3 313 GLU 313 319 319 GLU GLU A . n 
C 3 314 TYR 314 320 320 TYR TYR A . n 
C 3 315 VAL 315 321 321 VAL VAL A . n 
C 3 316 ALA 316 322 322 ALA ALA A . n 
C 3 317 GLY 317 323 323 GLY GLY A . n 
C 3 318 ALA 318 324 324 ALA ALA A . n 
C 3 319 PRO 319 325 325 PRO PRO A . n 
C 3 320 TYR 320 326 326 TYR TYR A . n 
C 3 321 THR 321 327 327 THR THR A . n 
C 3 322 PRO 322 328 328 PRO PRO A . n 
C 3 323 VAL 323 329 329 VAL VAL A . n 
C 3 324 GLU 324 330 330 GLU GLU A . n 
C 3 325 HIS 325 331 331 HIS HIS A . n 
C 3 326 VAL 326 332 332 VAL VAL A . n 
C 3 327 VAL 327 333 333 VAL VAL A . n 
C 3 328 PHE 328 334 334 PHE PHE A . n 
C 3 329 ASN 329 335 335 ASN ASN A . n 
C 3 330 PRO 330 336 336 PRO PRO A . n 
C 3 331 SER 331 337 337 SER SER A . n 
C 3 332 SER 332 338 338 SER SER A . n 
C 3 333 ARG 333 339 339 ARG ARG A . n 
C 3 334 ASP 334 340 340 ASP ASP A . n 
C 3 335 HIS 335 341 341 HIS HIS A . n 
C 3 336 ILE 336 342 342 ILE ILE A . n 
C 3 337 GLN 337 343 343 GLN GLN A . n 
C 3 338 LYS 338 344 344 LYS LYS A . n 
C 3 339 LYS 339 345 345 LYS LYS A . n 
C 3 340 LEU 340 346 346 LEU LEU A . n 
C 3 341 GLN 341 347 347 GLN GLN A . n 
C 3 342 GLU 342 348 348 GLU GLU A . n 
C 3 343 ALA 343 349 349 ALA ALA A . n 
C 3 344 GLY 344 350 350 GLY GLY A . n 
C 3 345 TRP 345 351 351 TRP TRP A . n 
C 3 346 VAL 346 352 352 VAL VAL A . n 
C 3 347 PRO 347 353 353 PRO PRO A . n 
C 3 348 THR 348 354 354 THR THR A . n 
C 3 349 LYS 349 355 355 LYS LYS A . n 
C 3 350 TYR 350 356 356 TYR TYR A . n 
C 3 351 THR 351 357 357 THR THR A . n 
C 3 352 ASP 352 358 358 ASP ASP A . n 
C 3 353 LYS 353 359 359 LYS LYS A . n 
C 3 354 GLY 354 360 360 GLY GLY A . n 
C 3 355 ALA 355 361 361 ALA ALA A . n 
C 3 356 PRO 356 362 362 PRO PRO A . n 
C 3 357 VAL 357 363 363 VAL VAL A . n 
C 3 358 VAL 358 364 364 VAL VAL A . n 
C 3 359 ASP 359 365 365 ASP ASP A . n 
C 3 360 ASP 360 366 366 ASP ASP A . n 
C 3 361 GLU 361 367 367 GLU GLU A . n 
C 3 362 VAL 362 368 368 VAL VAL A . n 
C 3 363 LEU 363 369 369 LEU LEU A . n 
C 3 364 GLU 364 370 370 GLU GLU A . n 
C 3 365 GLY 365 371 371 GLY GLY A . n 
C 3 366 VAL 366 372 372 VAL VAL A . n 
C 3 367 ARG 367 373 373 ARG ARG A . n 
C 3 368 VAL 368 374 374 VAL VAL A . n 
C 3 369 ASP 369 375 375 ASP ASP A . n 
C 3 370 ASP 370 376 376 ASP ASP A . n 
C 3 371 PRO 371 377 377 PRO PRO A . n 
C 3 372 GLU 372 378 378 GLU GLU A . n 
C 3 373 LYS 373 379 379 LYS LYS A . n 
C 3 374 GLN 374 380 380 GLN GLN A . n 
C 3 375 ALA 375 381 381 ALA ALA A . n 
C 3 376 ALA 376 382 382 ALA ALA A . n 
C 3 377 ILE 377 383 383 ILE ILE A . n 
C 3 378 ASP 378 384 384 ASP ASP A . n 
C 3 379 LEU 379 385 385 LEU LEU A . n 
C 3 380 ILE 380 386 386 ILE ILE A . n 
C 3 381 LYS 381 387 387 LYS LYS A . n 
C 3 382 GLU 382 388 388 GLU GLU A . n 
C 3 383 TYR 383 389 389 TYR TYR A . n 
C 3 384 LEU 384 390 390 LEU LEU A . n 
C 3 385 MET 385 391 391 MET MET A . n 
C 3 386 ILE 386 392 392 ILE ILE A . n 
C 3 387 GLN 387 393 393 GLN GLN A . n 
C 3 388 LYS 388 394 394 LYS LYS A . n 
C 3 389 ARG 389 395 395 ARG ARG A . n 
C 3 390 ILE 390 396 396 ILE ILE A . n 
C 3 391 GLY 391 397 397 GLY GLY A . n 
C 3 392 GLN 392 398 398 GLN GLN A . n 
C 3 393 SER 393 399 399 SER SER A . n 
C 3 394 ALA 394 400 400 ALA ALA A . n 
C 3 395 GLU 395 401 401 GLU GLU A . n 
C 3 396 GLY 396 402 402 GLY GLY A . n 
C 3 397 ASP 397 403 403 ASP ASP A . n 
C 3 398 LYS 398 404 404 LYS LYS A . n 
C 3 399 ALA 399 405 405 ALA ALA A . n 
C 3 400 TRP 400 406 406 TRP TRP A . n 
C 3 401 LEU 401 407 407 LEU LEU A . n 
C 3 402 ARG 402 408 408 ARG ARG A . n 
C 3 403 TYR 403 409 409 TYR TYR A . n 
C 3 404 VAL 404 410 410 VAL VAL A . n 
C 3 405 ALA 405 411 411 ALA ALA A . n 
C 3 406 GLU 406 412 412 GLU GLU A . n 
C 3 407 ASP 407 413 413 ASP ASP A . n 
C 3 408 GLY 408 414 414 GLY GLY A . n 
C 3 409 LYS 409 415 415 LYS LYS A . n 
C 3 410 ILE 410 416 416 ILE ILE A . n 
C 3 411 HIS 411 417 417 HIS HIS A . n 
C 3 412 GLY 412 418 418 GLY GLY A . n 
C 3 413 SER 413 419 419 SER SER A . n 
C 3 414 VAL 414 420 420 VAL VAL A . n 
C 3 415 ASN 415 421 421 ASN ASN A . n 
C 3 416 PRO 416 422 422 PRO PRO A . n 
C 3 417 ASN 417 423 423 ASN ASN A . n 
C 3 418 GLY 418 424 424 GLY GLY A . n 
C 3 419 ALA 419 425 425 ALA ALA A . n 
C 3 420 VAL 420 426 426 VAL VAL A . n 
C 3 421 THR 421 427 427 THR THR A . n 
C 3 422 GLY 422 428 428 GLY GLY A . n 
C 3 423 ARG 423 429 429 ARG ARG A . n 
C 3 424 ALA 424 430 430 ALA ALA A . n 
C 3 425 THR 425 431 431 THR THR A . n 
C 3 426 HIS 426 432 432 HIS HIS A . n 
C 3 427 ALA 427 433 433 ALA ALA A . n 
C 3 428 PHE 428 434 434 PHE PHE A . n 
C 3 429 PRO 429 435 435 PRO PRO A . n 
C 3 430 ASN 430 436 436 ASN ASN A . n 
C 3 431 LEU 431 437 437 LEU LEU A . n 
C 3 432 ALA 432 438 438 ALA ALA A . n 
C 3 433 GLN 433 439 439 GLN GLN A . n 
C 3 434 ILE 434 440 440 ILE ILE A . n 
C 3 435 PRO 435 441 441 PRO PRO A . n 
C 3 436 GLY 436 442 442 GLY GLY A . n 
C 3 437 VAL 437 443 443 VAL VAL A . n 
C 3 438 ARG 438 444 444 ARG ARG A . n 
C 3 439 SER 439 445 445 SER SER A . n 
C 3 440 PRO 440 446 446 PRO PRO A . n 
C 3 441 TYR 441 447 447 TYR TYR A . n 
C 3 442 GLY 442 448 448 GLY GLY A . n 
C 3 443 GLU 443 449 449 GLU GLU A . n 
C 3 444 GLN 444 450 450 GLN GLN A . n 
C 3 445 CYS 445 451 451 CYS CYS A . n 
C 3 446 ARG 446 452 452 ARG ARG A . n 
C 3 447 ALA 447 453 453 ALA ALA A . n 
C 3 448 ALA 448 454 454 ALA ALA A . n 
C 3 449 PHE 449 455 455 PHE PHE A . n 
C 3 450 GLY 450 456 456 GLY GLY A . n 
C 3 451 ALA 451 457 457 ALA ALA A . n 
C 3 452 GLU 452 458 458 GLU GLU A . n 
C 3 453 HIS 453 459 459 HIS HIS A . n 
C 3 454 HIS 454 460 460 HIS HIS A . n 
C 3 455 LEU 455 461 461 LEU LEU A . n 
C 3 456 ASP 456 462 462 ASP ASP A . n 
C 3 457 GLY 457 463 463 GLY GLY A . n 
C 3 458 ILE 458 464 464 ILE ILE A . n 
C 3 459 THR 459 465 465 THR THR A . n 
C 3 460 GLY 460 466 466 GLY GLY A . n 
C 3 461 LYS 461 467 467 LYS LYS A . n 
C 3 462 PRO 462 468 468 PRO PRO A . n 
C 3 463 TRP 463 469 469 TRP TRP A . n 
C 3 464 VAL 464 470 470 VAL VAL A . n 
C 3 465 GLN 465 471 471 GLN GLN A . n 
C 3 466 ALA 466 472 472 ALA ALA A . n 
C 3 467 GLY 467 473 473 GLY GLY A . n 
C 3 468 ILE 468 474 474 ILE ILE A . n 
C 3 469 ASP 469 475 475 ASP ASP A . n 
C 3 470 ALA 470 476 476 ALA ALA A . n 
C 3 471 SER 471 477 477 SER SER A . n 
C 3 472 GLY 472 478 478 GLY GLY A . n 
C 3 473 LEU 473 479 479 LEU LEU A . n 
C 3 474 GLU 474 480 480 GLU GLU A . n 
C 3 475 LEU 475 481 481 LEU LEU A . n 
C 3 476 ARG 476 482 482 ARG ARG A . n 
C 3 477 CYS 477 483 483 CYS CYS A . n 
C 3 478 LEU 478 484 484 LEU LEU A . n 
C 3 479 ALA 479 485 485 ALA ALA A . n 
C 3 480 HIS 480 486 486 HIS HIS A . n 
C 3 481 PHE 481 487 487 PHE PHE A . n 
C 3 482 MET 482 488 488 MET MET A . n 
C 3 483 ALA 483 489 489 ALA ALA A . n 
C 3 484 ARG 484 490 490 ARG ARG A . n 
C 3 485 PHE 485 491 491 PHE PHE A . n 
C 3 486 ASP 486 492 492 ASP ASP A . n 
C 3 487 ASN 487 493 493 ASN ASN A . n 
C 3 488 GLY 488 494 494 GLY GLY A . n 
C 3 489 GLU 489 495 495 GLU GLU A . n 
C 3 490 TYR 490 496 496 TYR TYR A . n 
C 3 491 ALA 491 497 497 ALA ALA A . n 
C 3 492 HIS 492 498 498 HIS HIS A . n 
C 3 493 GLU 493 499 499 GLU GLU A . n 
C 3 494 ILE 494 500 500 ILE ILE A . n 
C 3 495 LEU 495 501 501 LEU LEU A . n 
C 3 496 ASN 496 502 502 ASN ASN A . n 
C 3 497 GLY 497 503 503 GLY GLY A . n 
C 3 498 ASP 498 504 504 ASP ASP A . n 
C 3 499 ILE 499 505 505 ILE ILE A . n 
C 3 500 HIS 500 506 506 HIS HIS A . n 
C 3 501 THR 501 507 507 THR THR A . n 
C 3 502 LYS 502 508 508 LYS LYS A . n 
C 3 503 ASN 503 509 509 ASN ASN A . n 
C 3 504 GLN 504 510 510 GLN GLN A . n 
C 3 505 ILE 505 511 511 ILE ILE A . n 
C 3 506 ALA 506 512 512 ALA ALA A . n 
C 3 507 ALA 507 513 513 ALA ALA A . n 
C 3 508 GLU 508 514 514 GLU GLU A . n 
C 3 509 LEU 509 515 515 LEU LEU A . n 
C 3 510 PRO 510 516 516 PRO PRO A . n 
C 3 511 THR 511 517 517 THR THR A . n 
C 3 512 ARG 512 518 518 ARG ARG A . n 
C 3 513 ASP 513 519 519 ASP ASP A . n 
C 3 514 ASN 514 520 520 ASN ASN A . n 
C 3 515 ALA 515 521 521 ALA ALA A . n 
C 3 516 LYS 516 522 522 LYS LYS A . n 
C 3 517 THR 517 523 523 THR THR A . n 
C 3 518 PHE 518 524 524 PHE PHE A . n 
C 3 519 ILE 519 525 525 ILE ILE A . n 
C 3 520 TYR 520 526 526 TYR TYR A . n 
C 3 521 GLY 521 527 527 GLY GLY A . n 
C 3 522 PHE 522 528 528 PHE PHE A . n 
C 3 523 LEU 523 529 529 LEU LEU A . n 
C 3 524 TYR 524 530 530 TYR TYR A . n 
C 3 525 GLY 525 531 531 GLY GLY A . n 
C 3 526 ALA 526 532 532 ALA ALA A . n 
C 3 527 GLY 527 533 533 GLY GLY A . n 
C 3 528 ASP 528 534 534 ASP ASP A . n 
C 3 529 GLU 529 535 535 GLU GLU A . n 
C 3 530 LYS 530 536 536 LYS LYS A . n 
C 3 531 ILE 531 537 537 ILE ILE A . n 
C 3 532 GLY 532 538 538 GLY GLY A . n 
C 3 533 GLN 533 539 539 GLN GLN A . n 
C 3 534 ILE 534 540 540 ILE ILE A . n 
C 3 535 VAL 535 541 541 VAL VAL A . n 
C 3 536 GLY 536 542 542 GLY GLY A . n 
C 3 537 ALA 537 543 543 ALA ALA A . n 
C 3 538 GLY 538 544 544 GLY GLY A . n 
C 3 539 LYS 539 545 545 LYS LYS A . n 
C 3 540 GLU 540 546 546 GLU GLU A . n 
C 3 541 ARG 541 547 547 ARG ARG A . n 
C 3 542 GLY 542 548 548 GLY GLY A . n 
C 3 543 LYS 543 549 549 LYS LYS A . n 
C 3 544 GLU 544 550 550 GLU GLU A . n 
C 3 545 LEU 545 551 551 LEU LEU A . n 
C 3 546 LYS 546 552 552 LYS LYS A . n 
C 3 547 LYS 547 553 553 LYS LYS A . n 
C 3 548 LYS 548 554 554 LYS LYS A . n 
C 3 549 PHE 549 555 555 PHE PHE A . n 
C 3 550 LEU 550 556 556 LEU LEU A . n 
C 3 551 GLU 551 557 557 GLU GLU A . n 
C 3 552 ASN 552 558 558 ASN ASN A . n 
C 3 553 THR 553 559 559 THR THR A . n 
C 3 554 PRO 554 560 560 PRO PRO A . n 
C 3 555 ALA 555 561 561 ALA ALA A . n 
C 3 556 ILE 556 562 562 ILE ILE A . n 
C 3 557 ALA 557 563 563 ALA ALA A . n 
C 3 558 ALA 558 564 564 ALA ALA A . n 
C 3 559 LEU 559 565 565 LEU LEU A . n 
C 3 560 ARG 560 566 566 ARG ARG A . n 
C 3 561 GLU 561 567 567 GLU GLU A . n 
C 3 562 SER 562 568 568 SER SER A . n 
C 3 563 ILE 563 569 569 ILE ILE A . n 
C 3 564 GLN 564 570 570 GLN GLN A . n 
C 3 565 GLN 565 571 571 GLN GLN A . n 
C 3 566 THR 566 572 572 THR THR A . n 
C 3 567 LEU 567 573 573 LEU LEU A . n 
C 3 568 VAL 568 574 574 VAL VAL A . n 
C 3 569 GLU 569 575 575 GLU GLU A . n 
C 3 570 SER 570 576 576 SER SER A . n 
C 3 571 SER 571 577 577 SER SER A . n 
C 3 572 GLN 572 578 578 GLN GLN A . n 
C 3 573 TRP 573 579 579 TRP TRP A . n 
C 3 574 VAL 574 580 580 VAL VAL A . n 
C 3 575 ALA 575 581 581 ALA ALA A . n 
C 3 576 GLY 576 582 582 GLY GLY A . n 
C 3 577 GLU 577 583 583 GLU GLU A . n 
C 3 578 GLN 578 584 584 GLN GLN A . n 
C 3 579 GLN 579 585 585 GLN GLN A . n 
C 3 580 VAL 580 586 586 VAL VAL A . n 
C 3 581 LYS 581 587 587 LYS LYS A . n 
C 3 582 TRP 582 588 588 TRP TRP A . n 
C 3 583 LYS 583 589 589 LYS LYS A . n 
C 3 584 ARG 584 590 590 ARG ARG A . n 
C 3 585 ARG 585 591 591 ARG ARG A . n 
C 3 586 TRP 586 592 592 TRP TRP A . n 
C 3 587 ILE 587 593 593 ILE ILE A . n 
C 3 588 LYS 588 594 594 LYS LYS A . n 
C 3 589 GLY 589 595 595 GLY GLY A . n 
C 3 590 LEU 590 596 596 LEU LEU A . n 
C 3 591 ASP 591 597 597 ASP ASP A . n 
C 3 592 GLY 592 598 598 GLY GLY A . n 
C 3 593 ARG 593 599 599 ARG ARG A . n 
C 3 594 LYS 594 600 600 LYS LYS A . n 
C 3 595 VAL 595 601 601 VAL VAL A . n 
C 3 596 HIS 596 602 602 HIS HIS A . n 
C 3 597 VAL 597 603 603 VAL VAL A . n 
C 3 598 ARG 598 604 604 ARG ARG A . n 
C 3 599 SER 599 605 605 SER SER A . n 
C 3 600 PRO 600 606 606 PRO PRO A . n 
C 3 601 HIS 601 607 607 HIS HIS A . n 
C 3 602 ALA 602 608 608 ALA ALA A . n 
C 3 603 ALA 603 609 609 ALA ALA A . n 
C 3 604 LEU 604 610 610 LEU LEU A . n 
C 3 605 ASN 605 611 611 ASN ASN A . n 
C 3 606 THR 606 612 612 THR THR A . n 
C 3 607 LEU 607 613 613 LEU LEU A . n 
C 3 608 LEU 608 614 614 LEU LEU A . n 
C 3 609 GLN 609 615 615 GLN GLN A . n 
C 3 610 SER 610 616 616 SER SER A . n 
C 3 611 ALA 611 617 617 ALA ALA A . n 
C 3 612 GLY 612 618 618 GLY GLY A . n 
C 3 613 ALA 613 619 619 ALA ALA A . n 
C 3 614 LEU 614 620 620 LEU LEU A . n 
C 3 615 ILE 615 621 621 ILE ILE A . n 
C 3 616 CYS 616 622 622 CYS CYS A . n 
C 3 617 LYS 617 623 623 LYS LYS A . n 
C 3 618 LEU 618 624 624 LEU LEU A . n 
C 3 619 TRP 619 625 625 TRP TRP A . n 
C 3 620 ILE 620 626 626 ILE ILE A . n 
C 3 621 ILE 621 627 627 ILE ILE A . n 
C 3 622 LYS 622 628 628 LYS LYS A . n 
C 3 623 THR 623 629 629 THR THR A . n 
C 3 624 GLU 624 630 630 GLU GLU A . n 
C 3 625 GLU 625 631 631 GLU GLU A . n 
C 3 626 MET 626 632 632 MET MET A . n 
C 3 627 LEU 627 633 633 LEU LEU A . n 
C 3 628 VAL 628 634 634 VAL VAL A . n 
C 3 629 GLU 629 635 635 GLU GLU A . n 
C 3 630 LYS 630 636 636 LYS LYS A . n 
C 3 631 GLY 631 637 637 GLY GLY A . n 
C 3 632 LEU 632 638 638 LEU LEU A . n 
C 3 633 LYS 633 639 639 LYS LYS A . n 
C 3 634 HIS 634 640 640 HIS HIS A . n 
C 3 635 GLY 635 641 641 GLY GLY A . n 
C 3 636 TRP 636 642 642 TRP TRP A . n 
C 3 637 ASP 637 643 643 ASP ASP A . n 
C 3 638 GLY 638 644 644 GLY GLY A . n 
C 3 639 ASP 639 645 645 ASP ASP A . n 
C 3 640 PHE 640 646 646 PHE PHE A . n 
C 3 641 ALA 641 647 647 ALA ALA A . n 
C 3 642 TYR 642 648 648 TYR TYR A . n 
C 3 643 MET 643 649 649 MET MET A . n 
C 3 644 ALA 644 650 650 ALA ALA A . n 
C 3 645 TRP 645 651 651 TRP TRP A . n 
C 3 646 VAL 646 652 652 VAL VAL A . n 
C 3 647 HIS 647 653 653 HIS HIS A . n 
C 3 648 ASP 648 654 654 ASP ASP A . n 
C 3 649 GLU 649 655 655 GLU GLU A . n 
C 3 650 ILE 650 656 656 ILE ILE A . n 
C 3 651 GLN 651 657 657 GLN GLN A . n 
C 3 652 VAL 652 658 658 VAL VAL A . n 
C 3 653 GLY 653 659 659 GLY GLY A . n 
C 3 654 CYS 654 660 660 CYS CYS A . n 
C 3 655 ARG 655 661 661 ARG ARG A . n 
C 3 656 THR 656 662 662 THR THR A . n 
C 3 657 GLU 657 663 663 GLU GLU A . n 
C 3 658 GLU 658 664 664 GLU GLU A . n 
C 3 659 ILE 659 665 665 ILE ILE A . n 
C 3 660 ALA 660 666 666 ALA ALA A . n 
C 3 661 GLN 661 667 667 GLN GLN A . n 
C 3 662 VAL 662 668 668 VAL VAL A . n 
C 3 663 VAL 663 669 669 VAL VAL A . n 
C 3 664 ILE 664 670 670 ILE ILE A . n 
C 3 665 GLU 665 671 671 GLU GLU A . n 
C 3 666 THR 666 672 672 THR THR A . n 
C 3 667 ALA 667 673 673 ALA ALA A . n 
C 3 668 GLN 668 674 674 GLN GLN A . n 
C 3 669 GLU 669 675 675 GLU GLU A . n 
C 3 670 ALA 670 676 676 ALA ALA A . n 
C 3 671 MET 671 677 677 MET MET A . n 
C 3 672 ARG 672 678 678 ARG ARG A . n 
C 3 673 TRP 673 679 679 TRP TRP A . n 
C 3 674 VAL 674 680 680 VAL VAL A . n 
C 3 675 GLY 675 681 681 GLY GLY A . n 
C 3 676 ASP 676 682 682 ASP ASP A . n 
C 3 677 HIS 677 683 683 HIS HIS A . n 
C 3 678 TRP 678 684 684 TRP TRP A . n 
C 3 679 ASN 679 685 685 ASN ASN A . n 
C 3 680 PHE 680 686 686 PHE PHE A . n 
C 3 681 ARG 681 687 687 ARG ARG A . n 
C 3 682 CYS 682 688 688 CYS CYS A . n 
C 3 683 LEU 683 689 689 LEU LEU A . n 
C 3 684 LEU 684 690 690 LEU LEU A . n 
C 3 685 ASP 685 691 691 ASP ASP A . n 
C 3 686 THR 686 692 692 THR THR A . n 
C 3 687 GLU 687 693 693 GLU GLU A . n 
C 3 688 GLY 688 694 694 GLY GLY A . n 
C 3 689 LYS 689 695 695 LYS LYS A . n 
C 3 690 MET 690 696 696 MET MET A . n 
C 3 691 GLY 691 697 697 GLY GLY A . n 
C 3 692 PRO 692 698 698 PRO PRO A . n 
C 3 693 ASN 693 699 699 ASN ASN A . n 
C 3 694 TRP 694 700 700 TRP TRP A . n 
C 3 695 ALA 695 701 701 ALA ALA A . n 
C 3 696 ILE 696 702 702 ILE ILE A . n 
C 3 697 CYS 697 703 703 CYS CYS A . n 
C 3 698 HIS 698 704 704 HIS HIS A . n 
D 4 1   SER 1   1   ?   ?   ?   B . n 
D 4 2   ASP 2   2   ?   ?   ?   B . n 
D 4 3   LYS 3   3   3   LYS LYS B . n 
D 4 4   ILE 4   4   4   ILE ILE B . n 
D 4 5   ILE 5   5   5   ILE ILE B . n 
D 4 6   HIS 6   6   6   HIS HIS B . n 
D 4 7   LEU 7   7   7   LEU LEU B . n 
D 4 8   THR 8   8   8   THR THR B . n 
D 4 9   ASP 9   9   9   ASP ASP B . n 
D 4 10  ASP 10  10  10  ASP ASP B . n 
D 4 11  SER 11  11  11  SER SER B . n 
D 4 12  PHE 12  12  12  PHE PHE B . n 
D 4 13  ASP 13  13  13  ASP ASP B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  LEU 17  17  17  LEU LEU B . n 
D 4 18  LYS 18  18  18  LYS LYS B . n 
D 4 19  ALA 19  19  19  ALA ALA B . n 
D 4 20  ASP 20  20  20  ASP ASP B . n 
D 4 21  GLY 21  21  21  GLY GLY B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  ILE 23  23  23  ILE ILE B . n 
D 4 24  LEU 24  24  24  LEU LEU B . n 
D 4 25  VAL 25  25  25  VAL VAL B . n 
D 4 26  ASP 26  26  26  ASP ASP B . n 
D 4 27  PHE 27  27  27  PHE PHE B . n 
D 4 28  TRP 28  28  28  TRP TRP B . n 
D 4 29  ALA 29  29  29  ALA ALA B . n 
D 4 30  GLU 30  30  30  GLU GLU B . n 
D 4 31  TRP 31  31  31  TRP TRP B . n 
D 4 32  CYS 32  32  32  CYS CYS B . n 
D 4 33  GLY 33  33  33  GLY GLY B . n 
D 4 34  PRO 34  34  34  PRO PRO B . n 
D 4 35  CYS 35  35  35  CYS CYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  MET 37  37  37  MET MET B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  ALA 39  39  39  ALA ALA B . n 
D 4 40  PRO 40  40  40  PRO PRO B . n 
D 4 41  ILE 41  41  41  ILE ILE B . n 
D 4 42  LEU 42  42  42  LEU LEU B . n 
D 4 43  ASP 43  43  43  ASP ASP B . n 
D 4 44  GLU 44  44  44  GLU GLU B . n 
D 4 45  ILE 45  45  45  ILE ILE B . n 
D 4 46  ALA 46  46  46  ALA ALA B . n 
D 4 47  ASP 47  47  47  ASP ASP B . n 
D 4 48  GLU 48  48  48  GLU GLU B . n 
D 4 49  TYR 49  49  49  TYR TYR B . n 
D 4 50  GLN 50  50  50  GLN GLN B . n 
D 4 51  GLY 51  51  51  GLY GLY B . n 
D 4 52  LYS 52  52  52  LYS LYS B . n 
D 4 53  LEU 53  53  53  LEU LEU B . n 
D 4 54  THR 54  54  54  THR THR B . n 
D 4 55  VAL 55  55  55  VAL VAL B . n 
D 4 56  ALA 56  56  56  ALA ALA B . n 
D 4 57  LYS 57  57  57  LYS LYS B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  ASN 59  59  59  ASN ASN B . n 
D 4 60  ILE 60  60  60  ILE ILE B . n 
D 4 61  ASP 61  61  61  ASP ASP B . n 
D 4 62  GLN 62  62  62  GLN GLN B . n 
D 4 63  ASN 63  63  63  ASN ASN B . n 
D 4 64  PRO 64  64  64  PRO PRO B . n 
D 4 65  GLY 65  65  65  GLY GLY B . n 
D 4 66  THR 66  66  66  THR THR B . n 
D 4 67  ALA 67  67  67  ALA ALA B . n 
D 4 68  PRO 68  68  68  PRO PRO B . n 
D 4 69  LYS 69  69  69  LYS LYS B . n 
D 4 70  TYR 70  70  70  TYR TYR B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ILE 72  72  72  ILE ILE B . n 
D 4 73  ARG 73  73  73  ARG ARG B . n 
D 4 74  GLY 74  74  74  GLY GLY B . n 
D 4 75  ILE 75  75  75  ILE ILE B . n 
D 4 76  PRO 76  76  76  PRO PRO B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  LEU 78  78  78  LEU LEU B . n 
D 4 79  LEU 79  79  79  LEU LEU B . n 
D 4 80  LEU 80  80  80  LEU LEU B . n 
D 4 81  PHE 81  81  81  PHE PHE B . n 
D 4 82  LYS 82  82  82  LYS LYS B . n 
D 4 83  ASN 83  83  83  ASN ASN B . n 
D 4 84  GLY 84  84  84  GLY GLY B . n 
D 4 85  GLU 85  85  85  GLU GLU B . n 
D 4 86  VAL 86  86  86  VAL VAL B . n 
D 4 87  ALA 87  87  87  ALA ALA B . n 
D 4 88  ALA 88  88  88  ALA ALA B . n 
D 4 89  THR 89  89  89  THR THR B . n 
D 4 90  LYS 90  90  90  LYS LYS B . n 
D 4 91  VAL 91  91  91  VAL VAL B . n 
D 4 92  GLY 92  92  92  GLY GLY B . n 
D 4 93  ALA 93  93  93  ALA ALA B . n 
D 4 94  LEU 94  94  94  LEU LEU B . n 
D 4 95  SER 95  95  95  SER SER B . n 
D 4 96  LYS 96  96  96  LYS LYS B . n 
D 4 97  GLY 97  97  97  GLY GLY B . n 
D 4 98  GLN 98  98  98  GLN GLN B . n 
D 4 99  LEU 99  99  99  LEU LEU B . n 
D 4 100 LYS 100 100 100 LYS LYS B . n 
D 4 101 GLU 101 101 101 GLU GLU B . n 
D 4 102 PHE 102 102 102 PHE PHE B . n 
D 4 103 LEU 103 103 103 LEU LEU B . n 
D 4 104 ASP 104 104 104 ASP ASP B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASN 106 106 106 ASN ASN B . n 
D 4 107 LEU 107 107 107 LEU LEU B . n 
D 4 108 ALA 108 108 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  MG  1   901  901  MG  MG2 A . 
F 5  MG  1   902  902  MG  MG2 A . 
G 5  MG  1   903  903  MG  MG2 A . 
H 6  SO4 1   904  904  SO4 SO4 A . 
I 6  SO4 1   905  905  SO4 SO4 A . 
J 6  SO4 1   906  906  SO4 SO4 A . 
K 7  D3T 1   823  823  D3T DT3 A . 
L 8  MES 1   991  991  MES MES A . 
M 9  1PE 1   992  992  1PE 1PE A . 
N 10 HOH 1   1050 1050 HOH HOH P . 
N 10 HOH 2   1164 1164 HOH HOH P . 
N 10 HOH 3   1165 1165 HOH HOH P . 
N 10 HOH 4   1166 1166 HOH HOH P . 
N 10 HOH 5   1174 1174 HOH HOH P . 
N 10 HOH 6   1179 1179 HOH HOH P . 
N 10 HOH 7   1301 1301 HOH HOH P . 
N 10 HOH 8   1343 1343 HOH HOH P . 
N 10 HOH 9   1344 1344 HOH HOH P . 
N 10 HOH 10  1349 1349 HOH HOH P . 
N 10 HOH 11  1431 1431 HOH HOH P . 
N 10 HOH 12  1433 1433 HOH HOH P . 
N 10 HOH 13  1439 1439 HOH HOH P . 
N 10 HOH 14  1579 1579 HOH HOH P . 
N 10 HOH 15  1616 1616 HOH HOH P . 
N 10 HOH 16  1617 1617 HOH HOH P . 
N 10 HOH 17  1620 1620 HOH HOH P . 
N 10 HOH 18  1623 1623 HOH HOH P . 
N 10 HOH 19  1723 1723 HOH HOH P . 
N 10 HOH 20  1726 1726 HOH HOH P . 
N 10 HOH 21  1737 1737 HOH HOH P . 
O 10 HOH 1   1053 1053 HOH HOH T . 
O 10 HOH 2   1111 1111 HOH HOH T . 
O 10 HOH 3   1144 1144 HOH HOH T . 
O 10 HOH 4   1170 1170 HOH HOH T . 
O 10 HOH 5   1171 1171 HOH HOH T . 
O 10 HOH 6   1172 1172 HOH HOH T . 
O 10 HOH 7   1173 1173 HOH HOH T . 
O 10 HOH 8   1175 1175 HOH HOH T . 
O 10 HOH 9   1176 1176 HOH HOH T . 
O 10 HOH 10  1177 1177 HOH HOH T . 
O 10 HOH 11  1180 1180 HOH HOH T . 
O 10 HOH 12  1181 1181 HOH HOH T . 
O 10 HOH 13  1182 1182 HOH HOH T . 
O 10 HOH 14  1183 1183 HOH HOH T . 
O 10 HOH 15  1185 1185 HOH HOH T . 
O 10 HOH 16  1218 1218 HOH HOH T . 
O 10 HOH 17  1226 1226 HOH HOH T . 
O 10 HOH 18  1260 1260 HOH HOH T . 
O 10 HOH 19  1274 1274 HOH HOH T . 
O 10 HOH 20  1289 1289 HOH HOH T . 
O 10 HOH 21  1292 1292 HOH HOH T . 
O 10 HOH 22  1305 1305 HOH HOH T . 
O 10 HOH 23  1335 1335 HOH HOH T . 
O 10 HOH 24  1342 1342 HOH HOH T . 
O 10 HOH 25  1384 1384 HOH HOH T . 
O 10 HOH 26  1388 1388 HOH HOH T . 
O 10 HOH 27  1399 1399 HOH HOH T . 
O 10 HOH 28  1418 1418 HOH HOH T . 
O 10 HOH 29  1432 1432 HOH HOH T . 
O 10 HOH 30  1452 1452 HOH HOH T . 
O 10 HOH 31  1461 1461 HOH HOH T . 
O 10 HOH 32  1463 1463 HOH HOH T . 
O 10 HOH 33  1477 1477 HOH HOH T . 
O 10 HOH 34  1505 1505 HOH HOH T . 
O 10 HOH 35  1512 1512 HOH HOH T . 
O 10 HOH 36  1537 1537 HOH HOH T . 
O 10 HOH 37  1603 1603 HOH HOH T . 
O 10 HOH 38  1604 1604 HOH HOH T . 
O 10 HOH 39  1606 1606 HOH HOH T . 
O 10 HOH 40  1607 1607 HOH HOH T . 
O 10 HOH 41  1653 1653 HOH HOH T . 
O 10 HOH 42  1736 1736 HOH HOH T . 
P 10 HOH 1   1001 1001 HOH HOH A . 
P 10 HOH 2   1002 1002 HOH HOH A . 
P 10 HOH 3   1003 1003 HOH HOH A . 
P 10 HOH 4   1004 1004 HOH HOH A . 
P 10 HOH 5   1005 1005 HOH HOH A . 
P 10 HOH 6   1006 1006 HOH HOH A . 
P 10 HOH 7   1007 1007 HOH HOH A . 
P 10 HOH 8   1008 1008 HOH HOH A . 
P 10 HOH 9   1009 1009 HOH HOH A . 
P 10 HOH 10  1010 1010 HOH HOH A . 
P 10 HOH 11  1011 1011 HOH HOH A . 
P 10 HOH 12  1012 1012 HOH HOH A . 
P 10 HOH 13  1013 1013 HOH HOH A . 
P 10 HOH 14  1014 1014 HOH HOH A . 
P 10 HOH 15  1015 1015 HOH HOH A . 
P 10 HOH 16  1016 1016 HOH HOH A . 
P 10 HOH 17  1017 1017 HOH HOH A . 
P 10 HOH 18  1018 1018 HOH HOH A . 
P 10 HOH 19  1019 1019 HOH HOH A . 
P 10 HOH 20  1020 1020 HOH HOH A . 
P 10 HOH 21  1022 1022 HOH HOH A . 
P 10 HOH 22  1023 1023 HOH HOH A . 
P 10 HOH 23  1024 1024 HOH HOH A . 
P 10 HOH 24  1025 1025 HOH HOH A . 
P 10 HOH 25  1026 1026 HOH HOH A . 
P 10 HOH 26  1027 1027 HOH HOH A . 
P 10 HOH 27  1029 1029 HOH HOH A . 
P 10 HOH 28  1030 1030 HOH HOH A . 
P 10 HOH 29  1031 1031 HOH HOH A . 
P 10 HOH 30  1032 1032 HOH HOH A . 
P 10 HOH 31  1033 1033 HOH HOH A . 
P 10 HOH 32  1034 1034 HOH HOH A . 
P 10 HOH 33  1035 1035 HOH HOH A . 
P 10 HOH 34  1036 1036 HOH HOH A . 
P 10 HOH 35  1037 1037 HOH HOH A . 
P 10 HOH 36  1038 1038 HOH HOH A . 
P 10 HOH 37  1039 1039 HOH HOH A . 
P 10 HOH 38  1040 1040 HOH HOH A . 
P 10 HOH 39  1041 1041 HOH HOH A . 
P 10 HOH 40  1043 1043 HOH HOH A . 
P 10 HOH 41  1044 1044 HOH HOH A . 
P 10 HOH 42  1045 1045 HOH HOH A . 
P 10 HOH 43  1046 1046 HOH HOH A . 
P 10 HOH 44  1047 1047 HOH HOH A . 
P 10 HOH 45  1048 1048 HOH HOH A . 
P 10 HOH 46  1049 1049 HOH HOH A . 
P 10 HOH 47  1052 1052 HOH HOH A . 
P 10 HOH 48  1054 1054 HOH HOH A . 
P 10 HOH 49  1055 1055 HOH HOH A . 
P 10 HOH 50  1056 1056 HOH HOH A . 
P 10 HOH 51  1057 1057 HOH HOH A . 
P 10 HOH 52  1058 1058 HOH HOH A . 
P 10 HOH 53  1059 1059 HOH HOH A . 
P 10 HOH 54  1060 1060 HOH HOH A . 
P 10 HOH 55  1061 1061 HOH HOH A . 
P 10 HOH 56  1062 1062 HOH HOH A . 
P 10 HOH 57  1063 1063 HOH HOH A . 
P 10 HOH 58  1064 1064 HOH HOH A . 
P 10 HOH 59  1065 1065 HOH HOH A . 
P 10 HOH 60  1066 1066 HOH HOH A . 
P 10 HOH 61  1067 1067 HOH HOH A . 
P 10 HOH 62  1068 1068 HOH HOH A . 
P 10 HOH 63  1069 1069 HOH HOH A . 
P 10 HOH 64  1070 1070 HOH HOH A . 
P 10 HOH 65  1071 1071 HOH HOH A . 
P 10 HOH 66  1072 1072 HOH HOH A . 
P 10 HOH 67  1073 1073 HOH HOH A . 
P 10 HOH 68  1074 1074 HOH HOH A . 
P 10 HOH 69  1075 1075 HOH HOH A . 
P 10 HOH 70  1076 1076 HOH HOH A . 
P 10 HOH 71  1077 1077 HOH HOH A . 
P 10 HOH 72  1078 1078 HOH HOH A . 
P 10 HOH 73  1079 1079 HOH HOH A . 
P 10 HOH 74  1080 1080 HOH HOH A . 
P 10 HOH 75  1081 1081 HOH HOH A . 
P 10 HOH 76  1082 1082 HOH HOH A . 
P 10 HOH 77  1083 1083 HOH HOH A . 
P 10 HOH 78  1084 1084 HOH HOH A . 
P 10 HOH 79  1085 1085 HOH HOH A . 
P 10 HOH 80  1086 1086 HOH HOH A . 
P 10 HOH 81  1087 1087 HOH HOH A . 
P 10 HOH 82  1088 1088 HOH HOH A . 
P 10 HOH 83  1089 1089 HOH HOH A . 
P 10 HOH 84  1090 1090 HOH HOH A . 
P 10 HOH 85  1091 1091 HOH HOH A . 
P 10 HOH 86  1092 1092 HOH HOH A . 
P 10 HOH 87  1093 1093 HOH HOH A . 
P 10 HOH 88  1094 1094 HOH HOH A . 
P 10 HOH 89  1095 1095 HOH HOH A . 
P 10 HOH 90  1096 1096 HOH HOH A . 
P 10 HOH 91  1097 1097 HOH HOH A . 
P 10 HOH 92  1098 1098 HOH HOH A . 
P 10 HOH 93  1099 1099 HOH HOH A . 
P 10 HOH 94  1100 1100 HOH HOH A . 
P 10 HOH 95  1101 1101 HOH HOH A . 
P 10 HOH 96  1102 1102 HOH HOH A . 
P 10 HOH 97  1103 1103 HOH HOH A . 
P 10 HOH 98  1104 1104 HOH HOH A . 
P 10 HOH 99  1105 1105 HOH HOH A . 
P 10 HOH 100 1106 1106 HOH HOH A . 
P 10 HOH 101 1107 1107 HOH HOH A . 
P 10 HOH 102 1108 1108 HOH HOH A . 
P 10 HOH 103 1109 1109 HOH HOH A . 
P 10 HOH 104 1110 1110 HOH HOH A . 
P 10 HOH 105 1112 1112 HOH HOH A . 
P 10 HOH 106 1113 1113 HOH HOH A . 
P 10 HOH 107 1114 1114 HOH HOH A . 
P 10 HOH 108 1115 1115 HOH HOH A . 
P 10 HOH 109 1116 1116 HOH HOH A . 
P 10 HOH 110 1117 1117 HOH HOH A . 
P 10 HOH 111 1118 1118 HOH HOH A . 
P 10 HOH 112 1119 1119 HOH HOH A . 
P 10 HOH 113 1120 1120 HOH HOH A . 
P 10 HOH 114 1121 1121 HOH HOH A . 
P 10 HOH 115 1122 1122 HOH HOH A . 
P 10 HOH 116 1123 1123 HOH HOH A . 
P 10 HOH 117 1124 1124 HOH HOH A . 
P 10 HOH 118 1125 1125 HOH HOH A . 
P 10 HOH 119 1126 1126 HOH HOH A . 
P 10 HOH 120 1127 1127 HOH HOH A . 
P 10 HOH 121 1128 1128 HOH HOH A . 
P 10 HOH 122 1129 1129 HOH HOH A . 
P 10 HOH 123 1130 1130 HOH HOH A . 
P 10 HOH 124 1131 1131 HOH HOH A . 
P 10 HOH 125 1132 1132 HOH HOH A . 
P 10 HOH 126 1133 1133 HOH HOH A . 
P 10 HOH 127 1134 1134 HOH HOH A . 
P 10 HOH 128 1135 1135 HOH HOH A . 
P 10 HOH 129 1136 1136 HOH HOH A . 
P 10 HOH 130 1137 1137 HOH HOH A . 
P 10 HOH 131 1138 1138 HOH HOH A . 
P 10 HOH 132 1139 1139 HOH HOH A . 
P 10 HOH 133 1140 1140 HOH HOH A . 
P 10 HOH 134 1141 1141 HOH HOH A . 
P 10 HOH 135 1142 1142 HOH HOH A . 
P 10 HOH 136 1143 1143 HOH HOH A . 
P 10 HOH 137 1145 1145 HOH HOH A . 
P 10 HOH 138 1146 1146 HOH HOH A . 
P 10 HOH 139 1147 1147 HOH HOH A . 
P 10 HOH 140 1148 1148 HOH HOH A . 
P 10 HOH 141 1149 1149 HOH HOH A . 
P 10 HOH 142 1150 1150 HOH HOH A . 
P 10 HOH 143 1151 1151 HOH HOH A . 
P 10 HOH 144 1152 1152 HOH HOH A . 
P 10 HOH 145 1153 1153 HOH HOH A . 
P 10 HOH 146 1154 1154 HOH HOH A . 
P 10 HOH 147 1155 1155 HOH HOH A . 
P 10 HOH 148 1156 1156 HOH HOH A . 
P 10 HOH 149 1157 1157 HOH HOH A . 
P 10 HOH 150 1158 1158 HOH HOH A . 
P 10 HOH 151 1159 1159 HOH HOH A . 
P 10 HOH 152 1160 1160 HOH HOH A . 
P 10 HOH 153 1161 1161 HOH HOH A . 
P 10 HOH 154 1162 1162 HOH HOH A . 
P 10 HOH 155 1163 1163 HOH HOH A . 
P 10 HOH 156 1167 1167 HOH HOH A . 
P 10 HOH 157 1168 1168 HOH HOH A . 
P 10 HOH 158 1169 1169 HOH HOH A . 
P 10 HOH 159 1178 1178 HOH HOH A . 
P 10 HOH 160 1184 1184 HOH HOH A . 
P 10 HOH 161 1186 1186 HOH HOH A . 
P 10 HOH 162 1187 1187 HOH HOH A . 
P 10 HOH 163 1188 1188 HOH HOH A . 
P 10 HOH 164 1189 1189 HOH HOH A . 
P 10 HOH 165 1190 1190 HOH HOH A . 
P 10 HOH 166 1191 1191 HOH HOH A . 
P 10 HOH 167 1193 1193 HOH HOH A . 
P 10 HOH 168 1194 1194 HOH HOH A . 
P 10 HOH 169 1195 1195 HOH HOH A . 
P 10 HOH 170 1196 1196 HOH HOH A . 
P 10 HOH 171 1197 1197 HOH HOH A . 
P 10 HOH 172 1198 1198 HOH HOH A . 
P 10 HOH 173 1199 1199 HOH HOH A . 
P 10 HOH 174 1200 1200 HOH HOH A . 
P 10 HOH 175 1201 1201 HOH HOH A . 
P 10 HOH 176 1202 1202 HOH HOH A . 
P 10 HOH 177 1204 1204 HOH HOH A . 
P 10 HOH 178 1205 1205 HOH HOH A . 
P 10 HOH 179 1206 1206 HOH HOH A . 
P 10 HOH 180 1207 1207 HOH HOH A . 
P 10 HOH 181 1208 1208 HOH HOH A . 
P 10 HOH 182 1209 1209 HOH HOH A . 
P 10 HOH 183 1210 1210 HOH HOH A . 
P 10 HOH 184 1211 1211 HOH HOH A . 
P 10 HOH 185 1212 1212 HOH HOH A . 
P 10 HOH 186 1213 1213 HOH HOH A . 
P 10 HOH 187 1215 1215 HOH HOH A . 
P 10 HOH 188 1216 1216 HOH HOH A . 
P 10 HOH 189 1217 1217 HOH HOH A . 
P 10 HOH 190 1219 1219 HOH HOH A . 
P 10 HOH 191 1220 1220 HOH HOH A . 
P 10 HOH 192 1222 1222 HOH HOH A . 
P 10 HOH 193 1223 1223 HOH HOH A . 
P 10 HOH 194 1224 1224 HOH HOH A . 
P 10 HOH 195 1227 1227 HOH HOH A . 
P 10 HOH 196 1229 1229 HOH HOH A . 
P 10 HOH 197 1230 1230 HOH HOH A . 
P 10 HOH 198 1231 1231 HOH HOH A . 
P 10 HOH 199 1232 1232 HOH HOH A . 
P 10 HOH 200 1233 1233 HOH HOH A . 
P 10 HOH 201 1234 1234 HOH HOH A . 
P 10 HOH 202 1236 1236 HOH HOH A . 
P 10 HOH 203 1239 1239 HOH HOH A . 
P 10 HOH 204 1240 1240 HOH HOH A . 
P 10 HOH 205 1241 1241 HOH HOH A . 
P 10 HOH 206 1242 1242 HOH HOH A . 
P 10 HOH 207 1243 1243 HOH HOH A . 
P 10 HOH 208 1244 1244 HOH HOH A . 
P 10 HOH 209 1245 1245 HOH HOH A . 
P 10 HOH 210 1246 1246 HOH HOH A . 
P 10 HOH 211 1247 1247 HOH HOH A . 
P 10 HOH 212 1248 1248 HOH HOH A . 
P 10 HOH 213 1249 1249 HOH HOH A . 
P 10 HOH 214 1250 1250 HOH HOH A . 
P 10 HOH 215 1251 1251 HOH HOH A . 
P 10 HOH 216 1253 1253 HOH HOH A . 
P 10 HOH 217 1254 1254 HOH HOH A . 
P 10 HOH 218 1255 1255 HOH HOH A . 
P 10 HOH 219 1256 1256 HOH HOH A . 
P 10 HOH 220 1257 1257 HOH HOH A . 
P 10 HOH 221 1258 1258 HOH HOH A . 
P 10 HOH 222 1261 1261 HOH HOH A . 
P 10 HOH 223 1262 1262 HOH HOH A . 
P 10 HOH 224 1263 1263 HOH HOH A . 
P 10 HOH 225 1264 1264 HOH HOH A . 
P 10 HOH 226 1265 1265 HOH HOH A . 
P 10 HOH 227 1266 1266 HOH HOH A . 
P 10 HOH 228 1267 1267 HOH HOH A . 
P 10 HOH 229 1268 1268 HOH HOH A . 
P 10 HOH 230 1269 1269 HOH HOH A . 
P 10 HOH 231 1270 1270 HOH HOH A . 
P 10 HOH 232 1271 1271 HOH HOH A . 
P 10 HOH 233 1272 1272 HOH HOH A . 
P 10 HOH 234 1275 1275 HOH HOH A . 
P 10 HOH 235 1276 1276 HOH HOH A . 
P 10 HOH 236 1277 1277 HOH HOH A . 
P 10 HOH 237 1278 1278 HOH HOH A . 
P 10 HOH 238 1279 1279 HOH HOH A . 
P 10 HOH 239 1280 1280 HOH HOH A . 
P 10 HOH 240 1281 1281 HOH HOH A . 
P 10 HOH 241 1282 1282 HOH HOH A . 
P 10 HOH 242 1283 1283 HOH HOH A . 
P 10 HOH 243 1284 1284 HOH HOH A . 
P 10 HOH 244 1286 1286 HOH HOH A . 
P 10 HOH 245 1287 1287 HOH HOH A . 
P 10 HOH 246 1290 1290 HOH HOH A . 
P 10 HOH 247 1293 1293 HOH HOH A . 
P 10 HOH 248 1294 1294 HOH HOH A . 
P 10 HOH 249 1295 1295 HOH HOH A . 
P 10 HOH 250 1296 1296 HOH HOH A . 
P 10 HOH 251 1298 1298 HOH HOH A . 
P 10 HOH 252 1299 1299 HOH HOH A . 
P 10 HOH 253 1300 1300 HOH HOH A . 
P 10 HOH 254 1302 1302 HOH HOH A . 
P 10 HOH 255 1303 1303 HOH HOH A . 
P 10 HOH 256 1304 1304 HOH HOH A . 
P 10 HOH 257 1306 1306 HOH HOH A . 
P 10 HOH 258 1307 1307 HOH HOH A . 
P 10 HOH 259 1308 1308 HOH HOH A . 
P 10 HOH 260 1309 1309 HOH HOH A . 
P 10 HOH 261 1310 1310 HOH HOH A . 
P 10 HOH 262 1311 1311 HOH HOH A . 
P 10 HOH 263 1315 1315 HOH HOH A . 
P 10 HOH 264 1316 1316 HOH HOH A . 
P 10 HOH 265 1317 1317 HOH HOH A . 
P 10 HOH 266 1319 1319 HOH HOH A . 
P 10 HOH 267 1320 1320 HOH HOH A . 
P 10 HOH 268 1321 1321 HOH HOH A . 
P 10 HOH 269 1323 1323 HOH HOH A . 
P 10 HOH 270 1324 1324 HOH HOH A . 
P 10 HOH 271 1325 1325 HOH HOH A . 
P 10 HOH 272 1326 1326 HOH HOH A . 
P 10 HOH 273 1327 1327 HOH HOH A . 
P 10 HOH 274 1328 1328 HOH HOH A . 
P 10 HOH 275 1329 1329 HOH HOH A . 
P 10 HOH 276 1330 1330 HOH HOH A . 
P 10 HOH 277 1331 1331 HOH HOH A . 
P 10 HOH 278 1332 1332 HOH HOH A . 
P 10 HOH 279 1333 1333 HOH HOH A . 
P 10 HOH 280 1336 1336 HOH HOH A . 
P 10 HOH 281 1337 1337 HOH HOH A . 
P 10 HOH 282 1338 1338 HOH HOH A . 
P 10 HOH 283 1340 1340 HOH HOH A . 
P 10 HOH 284 1341 1341 HOH HOH A . 
P 10 HOH 285 1345 1345 HOH HOH A . 
P 10 HOH 286 1346 1346 HOH HOH A . 
P 10 HOH 287 1347 1347 HOH HOH A . 
P 10 HOH 288 1348 1348 HOH HOH A . 
P 10 HOH 289 1350 1350 HOH HOH A . 
P 10 HOH 290 1351 1351 HOH HOH A . 
P 10 HOH 291 1352 1352 HOH HOH A . 
P 10 HOH 292 1353 1353 HOH HOH A . 
P 10 HOH 293 1356 1356 HOH HOH A . 
P 10 HOH 294 1357 1357 HOH HOH A . 
P 10 HOH 295 1358 1358 HOH HOH A . 
P 10 HOH 296 1359 1359 HOH HOH A . 
P 10 HOH 297 1360 1360 HOH HOH A . 
P 10 HOH 298 1361 1361 HOH HOH A . 
P 10 HOH 299 1362 1362 HOH HOH A . 
P 10 HOH 300 1363 1363 HOH HOH A . 
P 10 HOH 301 1364 1364 HOH HOH A . 
P 10 HOH 302 1365 1365 HOH HOH A . 
P 10 HOH 303 1366 1366 HOH HOH A . 
P 10 HOH 304 1367 1367 HOH HOH A . 
P 10 HOH 305 1368 1368 HOH HOH A . 
P 10 HOH 306 1369 1369 HOH HOH A . 
P 10 HOH 307 1370 1370 HOH HOH A . 
P 10 HOH 308 1371 1371 HOH HOH A . 
P 10 HOH 309 1372 1372 HOH HOH A . 
P 10 HOH 310 1375 1375 HOH HOH A . 
P 10 HOH 311 1376 1376 HOH HOH A . 
P 10 HOH 312 1377 1377 HOH HOH A . 
P 10 HOH 313 1378 1378 HOH HOH A . 
P 10 HOH 314 1379 1379 HOH HOH A . 
P 10 HOH 315 1380 1380 HOH HOH A . 
P 10 HOH 316 1382 1382 HOH HOH A . 
P 10 HOH 317 1383 1383 HOH HOH A . 
P 10 HOH 318 1385 1385 HOH HOH A . 
P 10 HOH 319 1387 1387 HOH HOH A . 
P 10 HOH 320 1389 1389 HOH HOH A . 
P 10 HOH 321 1390 1390 HOH HOH A . 
P 10 HOH 322 1391 1391 HOH HOH A . 
P 10 HOH 323 1393 1393 HOH HOH A . 
P 10 HOH 324 1394 1394 HOH HOH A . 
P 10 HOH 325 1395 1395 HOH HOH A . 
P 10 HOH 326 1396 1396 HOH HOH A . 
P 10 HOH 327 1397 1397 HOH HOH A . 
P 10 HOH 328 1398 1398 HOH HOH A . 
P 10 HOH 329 1400 1400 HOH HOH A . 
P 10 HOH 330 1402 1402 HOH HOH A . 
P 10 HOH 331 1403 1403 HOH HOH A . 
P 10 HOH 332 1404 1404 HOH HOH A . 
P 10 HOH 333 1405 1405 HOH HOH A . 
P 10 HOH 334 1407 1407 HOH HOH A . 
P 10 HOH 335 1408 1408 HOH HOH A . 
P 10 HOH 336 1410 1410 HOH HOH A . 
P 10 HOH 337 1411 1411 HOH HOH A . 
P 10 HOH 338 1412 1412 HOH HOH A . 
P 10 HOH 339 1413 1413 HOH HOH A . 
P 10 HOH 340 1414 1414 HOH HOH A . 
P 10 HOH 341 1415 1415 HOH HOH A . 
P 10 HOH 342 1416 1416 HOH HOH A . 
P 10 HOH 343 1417 1417 HOH HOH A . 
P 10 HOH 344 1419 1419 HOH HOH A . 
P 10 HOH 345 1421 1421 HOH HOH A . 
P 10 HOH 346 1422 1422 HOH HOH A . 
P 10 HOH 347 1423 1423 HOH HOH A . 
P 10 HOH 348 1424 1424 HOH HOH A . 
P 10 HOH 349 1425 1425 HOH HOH A . 
P 10 HOH 350 1426 1426 HOH HOH A . 
P 10 HOH 351 1427 1427 HOH HOH A . 
P 10 HOH 352 1428 1428 HOH HOH A . 
P 10 HOH 353 1429 1429 HOH HOH A . 
P 10 HOH 354 1430 1430 HOH HOH A . 
P 10 HOH 355 1435 1435 HOH HOH A . 
P 10 HOH 356 1436 1436 HOH HOH A . 
P 10 HOH 357 1438 1438 HOH HOH A . 
P 10 HOH 358 1441 1441 HOH HOH A . 
P 10 HOH 359 1442 1442 HOH HOH A . 
P 10 HOH 360 1443 1443 HOH HOH A . 
P 10 HOH 361 1444 1444 HOH HOH A . 
P 10 HOH 362 1445 1445 HOH HOH A . 
P 10 HOH 363 1446 1446 HOH HOH A . 
P 10 HOH 364 1448 1448 HOH HOH A . 
P 10 HOH 365 1449 1449 HOH HOH A . 
P 10 HOH 366 1450 1450 HOH HOH A . 
P 10 HOH 367 1451 1451 HOH HOH A . 
P 10 HOH 368 1453 1453 HOH HOH A . 
P 10 HOH 369 1454 1454 HOH HOH A . 
P 10 HOH 370 1455 1455 HOH HOH A . 
P 10 HOH 371 1456 1456 HOH HOH A . 
P 10 HOH 372 1458 1458 HOH HOH A . 
P 10 HOH 373 1459 1459 HOH HOH A . 
P 10 HOH 374 1460 1460 HOH HOH A . 
P 10 HOH 375 1464 1464 HOH HOH A . 
P 10 HOH 376 1465 1465 HOH HOH A . 
P 10 HOH 377 1467 1467 HOH HOH A . 
P 10 HOH 378 1468 1468 HOH HOH A . 
P 10 HOH 379 1469 1469 HOH HOH A . 
P 10 HOH 380 1470 1470 HOH HOH A . 
P 10 HOH 381 1471 1471 HOH HOH A . 
P 10 HOH 382 1473 1473 HOH HOH A . 
P 10 HOH 383 1474 1474 HOH HOH A . 
P 10 HOH 384 1475 1475 HOH HOH A . 
P 10 HOH 385 1476 1476 HOH HOH A . 
P 10 HOH 386 1478 1478 HOH HOH A . 
P 10 HOH 387 1479 1479 HOH HOH A . 
P 10 HOH 388 1480 1480 HOH HOH A . 
P 10 HOH 389 1482 1482 HOH HOH A . 
P 10 HOH 390 1485 1485 HOH HOH A . 
P 10 HOH 391 1486 1486 HOH HOH A . 
P 10 HOH 392 1487 1487 HOH HOH A . 
P 10 HOH 393 1488 1488 HOH HOH A . 
P 10 HOH 394 1489 1489 HOH HOH A . 
P 10 HOH 395 1490 1490 HOH HOH A . 
P 10 HOH 396 1491 1491 HOH HOH A . 
P 10 HOH 397 1492 1492 HOH HOH A . 
P 10 HOH 398 1493 1493 HOH HOH A . 
P 10 HOH 399 1494 1494 HOH HOH A . 
P 10 HOH 400 1495 1495 HOH HOH A . 
P 10 HOH 401 1496 1496 HOH HOH A . 
P 10 HOH 402 1497 1497 HOH HOH A . 
P 10 HOH 403 1498 1498 HOH HOH A . 
P 10 HOH 404 1499 1499 HOH HOH A . 
P 10 HOH 405 1500 1500 HOH HOH A . 
P 10 HOH 406 1501 1501 HOH HOH A . 
P 10 HOH 407 1502 1502 HOH HOH A . 
P 10 HOH 408 1503 1503 HOH HOH A . 
P 10 HOH 409 1504 1504 HOH HOH A . 
P 10 HOH 410 1506 1506 HOH HOH A . 
P 10 HOH 411 1507 1507 HOH HOH A . 
P 10 HOH 412 1508 1508 HOH HOH A . 
P 10 HOH 413 1509 1509 HOH HOH A . 
P 10 HOH 414 1510 1510 HOH HOH A . 
P 10 HOH 415 1511 1511 HOH HOH A . 
P 10 HOH 416 1513 1513 HOH HOH A . 
P 10 HOH 417 1514 1514 HOH HOH A . 
P 10 HOH 418 1519 1519 HOH HOH A . 
P 10 HOH 419 1520 1520 HOH HOH A . 
P 10 HOH 420 1521 1521 HOH HOH A . 
P 10 HOH 421 1522 1522 HOH HOH A . 
P 10 HOH 422 1523 1523 HOH HOH A . 
P 10 HOH 423 1524 1524 HOH HOH A . 
P 10 HOH 424 1525 1525 HOH HOH A . 
P 10 HOH 425 1526 1526 HOH HOH A . 
P 10 HOH 426 1527 1527 HOH HOH A . 
P 10 HOH 427 1528 1528 HOH HOH A . 
P 10 HOH 428 1529 1529 HOH HOH A . 
P 10 HOH 429 1535 1535 HOH HOH A . 
P 10 HOH 430 1536 1536 HOH HOH A . 
P 10 HOH 431 1539 1539 HOH HOH A . 
P 10 HOH 432 1542 1542 HOH HOH A . 
P 10 HOH 433 1543 1543 HOH HOH A . 
P 10 HOH 434 1544 1544 HOH HOH A . 
P 10 HOH 435 1545 1545 HOH HOH A . 
P 10 HOH 436 1546 1546 HOH HOH A . 
P 10 HOH 437 1547 1547 HOH HOH A . 
P 10 HOH 438 1548 1548 HOH HOH A . 
P 10 HOH 439 1549 1549 HOH HOH A . 
P 10 HOH 440 1550 1550 HOH HOH A . 
P 10 HOH 441 1551 1551 HOH HOH A . 
P 10 HOH 442 1552 1552 HOH HOH A . 
P 10 HOH 443 1553 1553 HOH HOH A . 
P 10 HOH 444 1554 1554 HOH HOH A . 
P 10 HOH 445 1555 1555 HOH HOH A . 
P 10 HOH 446 1556 1556 HOH HOH A . 
P 10 HOH 447 1557 1557 HOH HOH A . 
P 10 HOH 448 1558 1558 HOH HOH A . 
P 10 HOH 449 1559 1559 HOH HOH A . 
P 10 HOH 450 1560 1560 HOH HOH A . 
P 10 HOH 451 1561 1561 HOH HOH A . 
P 10 HOH 452 1562 1562 HOH HOH A . 
P 10 HOH 453 1563 1563 HOH HOH A . 
P 10 HOH 454 1564 1564 HOH HOH A . 
P 10 HOH 455 1565 1565 HOH HOH A . 
P 10 HOH 456 1566 1566 HOH HOH A . 
P 10 HOH 457 1567 1567 HOH HOH A . 
P 10 HOH 458 1568 1568 HOH HOH A . 
P 10 HOH 459 1569 1569 HOH HOH A . 
P 10 HOH 460 1570 1570 HOH HOH A . 
P 10 HOH 461 1571 1571 HOH HOH A . 
P 10 HOH 462 1572 1572 HOH HOH A . 
P 10 HOH 463 1573 1573 HOH HOH A . 
P 10 HOH 464 1574 1574 HOH HOH A . 
P 10 HOH 465 1575 1575 HOH HOH A . 
P 10 HOH 466 1576 1576 HOH HOH A . 
P 10 HOH 467 1577 1577 HOH HOH A . 
P 10 HOH 468 1578 1578 HOH HOH A . 
P 10 HOH 469 1580 1580 HOH HOH A . 
P 10 HOH 470 1581 1581 HOH HOH A . 
P 10 HOH 471 1582 1582 HOH HOH A . 
P 10 HOH 472 1583 1583 HOH HOH A . 
P 10 HOH 473 1584 1584 HOH HOH A . 
P 10 HOH 474 1585 1585 HOH HOH A . 
P 10 HOH 475 1586 1586 HOH HOH A . 
P 10 HOH 476 1587 1587 HOH HOH A . 
P 10 HOH 477 1588 1588 HOH HOH A . 
P 10 HOH 478 1589 1589 HOH HOH A . 
P 10 HOH 479 1590 1590 HOH HOH A . 
P 10 HOH 480 1591 1591 HOH HOH A . 
P 10 HOH 481 1592 1592 HOH HOH A . 
P 10 HOH 482 1593 1593 HOH HOH A . 
P 10 HOH 483 1594 1594 HOH HOH A . 
P 10 HOH 484 1595 1595 HOH HOH A . 
P 10 HOH 485 1596 1596 HOH HOH A . 
P 10 HOH 486 1597 1597 HOH HOH A . 
P 10 HOH 487 1598 1598 HOH HOH A . 
P 10 HOH 488 1599 1599 HOH HOH A . 
P 10 HOH 489 1600 1600 HOH HOH A . 
P 10 HOH 490 1601 1601 HOH HOH A . 
P 10 HOH 491 1602 1602 HOH HOH A . 
P 10 HOH 492 1605 1605 HOH HOH A . 
P 10 HOH 493 1608 1608 HOH HOH A . 
P 10 HOH 494 1609 1609 HOH HOH A . 
P 10 HOH 495 1610 1610 HOH HOH A . 
P 10 HOH 496 1611 1611 HOH HOH A . 
P 10 HOH 497 1612 1612 HOH HOH A . 
P 10 HOH 498 1613 1613 HOH HOH A . 
P 10 HOH 499 1614 1614 HOH HOH A . 
P 10 HOH 500 1615 1615 HOH HOH A . 
P 10 HOH 501 1618 1618 HOH HOH A . 
P 10 HOH 502 1619 1619 HOH HOH A . 
P 10 HOH 503 1621 1621 HOH HOH A . 
P 10 HOH 504 1622 1622 HOH HOH A . 
P 10 HOH 505 1624 1624 HOH HOH A . 
P 10 HOH 506 1625 1625 HOH HOH A . 
P 10 HOH 507 1626 1626 HOH HOH A . 
P 10 HOH 508 1627 1627 HOH HOH A . 
P 10 HOH 509 1628 1628 HOH HOH A . 
P 10 HOH 510 1629 1629 HOH HOH A . 
P 10 HOH 511 1630 1630 HOH HOH A . 
P 10 HOH 512 1631 1631 HOH HOH A . 
P 10 HOH 513 1632 1632 HOH HOH A . 
P 10 HOH 514 1633 1633 HOH HOH A . 
P 10 HOH 515 1634 1634 HOH HOH A . 
P 10 HOH 516 1635 1635 HOH HOH A . 
P 10 HOH 517 1637 1637 HOH HOH A . 
P 10 HOH 518 1638 1638 HOH HOH A . 
P 10 HOH 519 1639 1639 HOH HOH A . 
P 10 HOH 520 1649 1649 HOH HOH A . 
P 10 HOH 521 1650 1650 HOH HOH A . 
P 10 HOH 522 1651 1651 HOH HOH A . 
P 10 HOH 523 1652 1652 HOH HOH A . 
P 10 HOH 524 1654 1654 HOH HOH A . 
P 10 HOH 525 1655 1655 HOH HOH A . 
P 10 HOH 526 1656 1656 HOH HOH A . 
P 10 HOH 527 1657 1657 HOH HOH A . 
P 10 HOH 528 1658 1658 HOH HOH A . 
P 10 HOH 529 1659 1659 HOH HOH A . 
P 10 HOH 530 1660 1660 HOH HOH A . 
P 10 HOH 531 1661 1661 HOH HOH A . 
P 10 HOH 532 1662 1662 HOH HOH A . 
P 10 HOH 533 1663 1663 HOH HOH A . 
P 10 HOH 534 1664 1664 HOH HOH A . 
P 10 HOH 535 1665 1665 HOH HOH A . 
P 10 HOH 536 1666 1666 HOH HOH A . 
P 10 HOH 537 1667 1667 HOH HOH A . 
P 10 HOH 538 1668 1668 HOH HOH A . 
P 10 HOH 539 1669 1669 HOH HOH A . 
P 10 HOH 540 1670 1670 HOH HOH A . 
P 10 HOH 541 1671 1671 HOH HOH A . 
P 10 HOH 542 1672 1672 HOH HOH A . 
P 10 HOH 543 1673 1673 HOH HOH A . 
P 10 HOH 544 1674 1674 HOH HOH A . 
P 10 HOH 545 1675 1675 HOH HOH A . 
P 10 HOH 546 1676 1676 HOH HOH A . 
P 10 HOH 547 1677 1677 HOH HOH A . 
P 10 HOH 548 1678 1678 HOH HOH A . 
P 10 HOH 549 1679 1679 HOH HOH A . 
P 10 HOH 550 1680 1680 HOH HOH A . 
P 10 HOH 551 1681 1681 HOH HOH A . 
P 10 HOH 552 1682 1682 HOH HOH A . 
P 10 HOH 553 1683 1683 HOH HOH A . 
P 10 HOH 554 1684 1684 HOH HOH A . 
P 10 HOH 555 1685 1685 HOH HOH A . 
P 10 HOH 556 1686 1686 HOH HOH A . 
P 10 HOH 557 1687 1687 HOH HOH A . 
P 10 HOH 558 1688 1688 HOH HOH A . 
P 10 HOH 559 1689 1689 HOH HOH A . 
P 10 HOH 560 1690 1690 HOH HOH A . 
P 10 HOH 561 1691 1691 HOH HOH A . 
P 10 HOH 562 1692 1692 HOH HOH A . 
P 10 HOH 563 1693 1693 HOH HOH A . 
P 10 HOH 564 1694 1694 HOH HOH A . 
P 10 HOH 565 1695 1695 HOH HOH A . 
P 10 HOH 566 1696 1696 HOH HOH A . 
P 10 HOH 567 1697 1697 HOH HOH A . 
P 10 HOH 568 1698 1698 HOH HOH A . 
P 10 HOH 569 1699 1699 HOH HOH A . 
P 10 HOH 570 1700 1700 HOH HOH A . 
P 10 HOH 571 1701 1701 HOH HOH A . 
P 10 HOH 572 1702 1702 HOH HOH A . 
P 10 HOH 573 1703 1703 HOH HOH A . 
P 10 HOH 574 1704 1704 HOH HOH A . 
P 10 HOH 575 1705 1705 HOH HOH A . 
P 10 HOH 576 1706 1706 HOH HOH A . 
P 10 HOH 577 1707 1707 HOH HOH A . 
P 10 HOH 578 1719 1719 HOH HOH A . 
P 10 HOH 579 1720 1720 HOH HOH A . 
P 10 HOH 580 1721 1721 HOH HOH A . 
P 10 HOH 581 1724 1724 HOH HOH A . 
P 10 HOH 582 1725 1725 HOH HOH A . 
P 10 HOH 583 1727 1727 HOH HOH A . 
P 10 HOH 584 1728 1728 HOH HOH A . 
P 10 HOH 585 1729 1729 HOH HOH A . 
P 10 HOH 586 1730 1730 HOH HOH A . 
P 10 HOH 587 1731 1731 HOH HOH A . 
P 10 HOH 588 1732 1732 HOH HOH A . 
P 10 HOH 589 1733 1733 HOH HOH A . 
P 10 HOH 590 1734 1734 HOH HOH A . 
P 10 HOH 591 1735 1735 HOH HOH A . 
P 10 HOH 592 1738 1738 HOH HOH A . 
P 10 HOH 593 1739 1739 HOH HOH A . 
P 10 HOH 594 1740 1740 HOH HOH A . 
P 10 HOH 595 1741 1741 HOH HOH A . 
P 10 HOH 596 1742 1742 HOH HOH A . 
P 10 HOH 597 1743 1743 HOH HOH A . 
Q 10 HOH 1   1042 1042 HOH HOH B . 
Q 10 HOH 2   1051 1051 HOH HOH B . 
Q 10 HOH 3   1214 1214 HOH HOH B . 
Q 10 HOH 4   1221 1221 HOH HOH B . 
Q 10 HOH 5   1225 1225 HOH HOH B . 
Q 10 HOH 6   1235 1235 HOH HOH B . 
Q 10 HOH 7   1237 1237 HOH HOH B . 
Q 10 HOH 8   1238 1238 HOH HOH B . 
Q 10 HOH 9   1285 1285 HOH HOH B . 
Q 10 HOH 10  1288 1288 HOH HOH B . 
Q 10 HOH 11  1291 1291 HOH HOH B . 
Q 10 HOH 12  1312 1312 HOH HOH B . 
Q 10 HOH 13  1314 1314 HOH HOH B . 
Q 10 HOH 14  1334 1334 HOH HOH B . 
Q 10 HOH 15  1339 1339 HOH HOH B . 
Q 10 HOH 16  1373 1373 HOH HOH B . 
Q 10 HOH 17  1381 1381 HOH HOH B . 
Q 10 HOH 18  1386 1386 HOH HOH B . 
Q 10 HOH 19  1401 1401 HOH HOH B . 
Q 10 HOH 20  1406 1406 HOH HOH B . 
Q 10 HOH 21  1409 1409 HOH HOH B . 
Q 10 HOH 22  1420 1420 HOH HOH B . 
Q 10 HOH 23  1437 1437 HOH HOH B . 
Q 10 HOH 24  1472 1472 HOH HOH B . 
Q 10 HOH 25  1481 1481 HOH HOH B . 
Q 10 HOH 26  1483 1483 HOH HOH B . 
Q 10 HOH 27  1484 1484 HOH HOH B . 
Q 10 HOH 28  1515 1515 HOH HOH B . 
Q 10 HOH 29  1516 1516 HOH HOH B . 
Q 10 HOH 30  1517 1517 HOH HOH B . 
Q 10 HOH 31  1518 1518 HOH HOH B . 
Q 10 HOH 32  1538 1538 HOH HOH B . 
Q 10 HOH 33  1540 1540 HOH HOH B . 
Q 10 HOH 34  1541 1541 HOH HOH B . 
Q 10 HOH 35  1636 1636 HOH HOH B . 
Q 10 HOH 36  1640 1640 HOH HOH B . 
Q 10 HOH 37  1641 1641 HOH HOH B . 
Q 10 HOH 38  1642 1642 HOH HOH B . 
Q 10 HOH 39  1643 1643 HOH HOH B . 
Q 10 HOH 40  1644 1644 HOH HOH B . 
Q 10 HOH 41  1645 1645 HOH HOH B . 
Q 10 HOH 42  1646 1646 HOH HOH B . 
Q 10 HOH 43  1647 1647 HOH HOH B . 
Q 10 HOH 44  1648 1648 HOH HOH B . 
Q 10 HOH 45  1708 1708 HOH HOH B . 
Q 10 HOH 46  1709 1709 HOH HOH B . 
Q 10 HOH 47  1710 1710 HOH HOH B . 
Q 10 HOH 48  1711 1711 HOH HOH B . 
Q 10 HOH 49  1712 1712 HOH HOH B . 
Q 10 HOH 50  1713 1713 HOH HOH B . 
Q 10 HOH 51  1714 1714 HOH HOH B . 
Q 10 HOH 52  1715 1715 HOH HOH B . 
Q 10 HOH 53  1716 1716 HOH HOH B . 
Q 10 HOH 54  1717 1717 HOH HOH B . 
Q 10 HOH 55  1718 1718 HOH HOH B . 
Q 10 HOH 56  1722 1722 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A DOC 22 P DOC 822 ? DC "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
2 B 8OG 5  T 8OG 855 ? DG ?                                        
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 90.6  ? 
2  O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O   ? C ALA 470 ? A ALA 476  ? 1_555 101.4 ? 
3  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O   ? C ALA 470 ? A ALA 476  ? 1_555 67.9  ? 
4  O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 172.9 ? 
5  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 88.3  ? 
6  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 84.7  ? 
7  O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 MG  ? F MG  .   ? A MG  902  ? 1_555 100.2 ? 
8  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 MG  ? F MG  .   ? A MG  902  ? 1_555 75.0  ? 
9  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 MG  ? F MG  .   ? A MG  902  ? 1_555 136.9 ? 
10 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 MG  ? F MG  .   ? A MG  902  ? 1_555 72.8  ? 
11 O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 94.1  ? 
12 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 125.1 ? 
13 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 159.9 ? 
14 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 80.8  ? 
15 MG  ? F MG  .   ? A MG  902  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2A ? K D3T .   ? A D3T 823  ? 1_555 50.3  ? 
16 O1G ? K D3T .   ? A D3T 823  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2B ? K D3T .   ? A D3T 823  ? 1_555 87.7  ? 
17 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2B ? K D3T .   ? A D3T 823  ? 1_555 159.7 ? 
18 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2B ? K D3T .   ? A D3T 823  ? 1_555 92.6  ? 
19 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2B ? K D3T .   ? A D3T 823  ? 1_555 95.7  ? 
20 MG  ? F MG  .   ? A MG  902  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2B ? K D3T .   ? A D3T 823  ? 1_555 125.2 ? 
21 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? E MG . ? A MG 901 ? 1_555 O2B ? K D3T .   ? A D3T 823  ? 1_555 75.2  ? 
22 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 O   ? P HOH .   ? A HOH 1372 ? 1_555 90.3  ? 
23 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 O   ? P HOH .   ? A HOH 1507 ? 1_555 137.1 ? 
24 O   ? P HOH .   ? A HOH 1372 ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 O   ? P HOH .   ? A HOH 1507 ? 1_555 77.0  ? 
25 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 131.8 ? 
26 O   ? P HOH .   ? A HOH 1372 ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 113.8 ? 
27 O   ? P HOH .   ? A HOH 1507 ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 90.2  ? 
28 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 89.1  ? 
29 O   ? P HOH .   ? A HOH 1372 ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 136.4 ? 
30 O   ? P HOH .   ? A HOH 1507 ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 74.2  ? 
31 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 98.4  ? 
32 O2A ? K D3T .   ? A D3T 823  ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 61.8  ? 
33 O   ? P HOH .   ? A HOH 1372 ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 151.5 ? 
34 O   ? P HOH .   ? A HOH 1507 ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 118.6 ? 
35 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 91.0  ? 
36 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 902 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 45.1  ? 
37 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1479 ? 1_555 83.1  ? 
38 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1093 ? 1_555 84.5  ? 
39 O   ? P HOH .   ? A HOH 1479 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1093 ? 1_555 166.9 ? 
40 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1094 ? 1_555 77.9  ? 
41 O   ? P HOH .   ? A HOH 1479 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1094 ? 1_555 97.2  ? 
42 O   ? P HOH .   ? A HOH 1093 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1094 ? 1_555 84.4  ? 
43 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1480 ? 1_555 168.0 ? 
44 O   ? P HOH .   ? A HOH 1479 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1480 ? 1_555 85.2  ? 
45 O   ? P HOH .   ? A HOH 1093 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1480 ? 1_555 107.0 ? 
46 O   ? P HOH .   ? A HOH 1094 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1480 ? 1_555 106.4 ? 
47 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1091 ? 1_555 88.3  ? 
48 O   ? P HOH .   ? A HOH 1479 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1091 ? 1_555 87.9  ? 
49 O   ? P HOH .   ? A HOH 1093 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1091 ? 1_555 87.4  ? 
50 O   ? P HOH .   ? A HOH 1094 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1091 ? 1_555 164.5 ? 
51 O   ? P HOH .   ? A HOH 1480 ? 1_555 MG ? G MG . ? A MG 903 ? 1_555 O   ? P HOH .   ? A HOH 1091 ? 1_555 88.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-31 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 64  ? ? -112.22 -79.02  
2  1 HIS A 99  ? ? -107.79 50.18   
3  1 ASP A 156 ? ? 15.41   -85.96  
4  1 ARG A 278 ? ? -95.23  -63.84  
5  1 LEU A 283 ? ? -119.56 69.59   
6  1 ALA A 305 ? ? 67.76   74.83   
7  1 GLN A 306 ? ? 165.15  -54.95  
8  1 CYS A 313 ? ? 98.91   116.19  
9  1 ARG A 318 ? ? -26.00  -101.48 
10 1 GLU A 319 ? ? 157.00  -14.70  
11 1 ASP A 358 ? ? -74.18  45.19   
12 1 LYS A 359 ? ? -157.80 13.25   
13 1 ALA A 400 ? ? -131.18 -43.16  
14 1 GLN A 439 ? ? -140.58 32.80   
15 1 ALA A 543 ? ? -133.36 -149.79 
16 1 GLN A 578 ? ? -170.64 148.54  
17 1 VAL A 580 ? ? -94.55  -62.70  
18 1 ALA A 581 ? ? -138.81 -84.66  
19 1 VAL A 652 ? ? -118.00 78.07   
20 1 HIS A 653 ? ? 66.82   -76.25  
21 1 ASP B 20  ? ? 51.33   88.18   
22 1 ASP B 47  ? ? -65.27  -72.64  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DA P 821 ? ? 0.051 'SIDE CHAIN' 
2 1 DG T 857 ? ? 0.079 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 293 ? CG  ? C LYS 287 CG  
2  1 Y 1 A LYS 293 ? CD  ? C LYS 287 CD  
3  1 Y 1 A LYS 293 ? CE  ? C LYS 287 CE  
4  1 Y 1 A LYS 293 ? NZ  ? C LYS 287 NZ  
5  1 Y 1 A ILE 297 ? CD1 ? C ILE 291 CD1 
6  1 Y 1 A LYS 300 ? CG  ? C LYS 294 CG  
7  1 Y 1 A LYS 300 ? CD  ? C LYS 294 CD  
8  1 Y 1 A LYS 300 ? CE  ? C LYS 294 CE  
9  1 Y 1 A LYS 300 ? NZ  ? C LYS 294 NZ  
10 1 Y 1 A LYS 302 ? CG  ? C LYS 296 CG  
11 1 Y 1 A LYS 302 ? CD  ? C LYS 296 CD  
12 1 Y 1 A LYS 302 ? CE  ? C LYS 296 CE  
13 1 Y 1 A LYS 302 ? NZ  ? C LYS 296 NZ  
14 1 Y 1 A LYS 304 ? CG  ? C LYS 298 CG  
15 1 Y 1 A LYS 304 ? CD  ? C LYS 298 CD  
16 1 Y 1 A LYS 304 ? CE  ? C LYS 298 CE  
17 1 Y 1 A LYS 304 ? NZ  ? C LYS 298 NZ  
18 1 Y 1 A ARG 310 ? CG  ? C ARG 304 CG  
19 1 Y 1 A ARG 310 ? CD  ? C ARG 304 CD  
20 1 Y 1 A ARG 310 ? NE  ? C ARG 304 NE  
21 1 Y 1 A ARG 310 ? CZ  ? C ARG 304 CZ  
22 1 Y 1 A ARG 310 ? NH1 ? C ARG 304 NH1 
23 1 Y 1 A ARG 310 ? NH2 ? C ARG 304 NH2 
24 1 Y 1 A ARG 318 ? CG  ? C ARG 312 CG  
25 1 Y 1 A ARG 318 ? CD  ? C ARG 312 CD  
26 1 Y 1 A ARG 318 ? NE  ? C ARG 312 NE  
27 1 Y 1 A ARG 318 ? CZ  ? C ARG 312 CZ  
28 1 Y 1 A ARG 318 ? NH1 ? C ARG 312 NH1 
29 1 Y 1 A ARG 318 ? NH2 ? C ARG 312 NH2 
30 1 Y 1 A GLN 578 ? CG  ? C GLN 572 CG  
31 1 Y 1 A GLN 578 ? CD  ? C GLN 572 CD  
32 1 Y 1 A GLN 578 ? OE1 ? C GLN 572 OE1 
33 1 Y 1 A GLN 578 ? NE2 ? C GLN 572 NE2 
34 1 Y 1 A GLU 583 ? CG  ? C GLU 577 CG  
35 1 Y 1 A GLU 583 ? CD  ? C GLU 577 CD  
36 1 Y 1 A GLU 583 ? OE1 ? C GLU 577 OE1 
37 1 Y 1 A GLU 583 ? OE2 ? C GLU 577 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P DC  801 ? A DC  1   
2  1 Y 1 P DG  802 ? A DG  2   
3  1 Y 1 P DA  803 ? A DA  3   
4  1 Y 1 P DA  804 ? A DA  4   
5  1 Y 1 P DA  805 ? A DA  5   
6  1 Y 1 P DA  806 ? A DA  6   
7  1 Y 1 T DC  851 ? B DC  1   
8  1 Y 1 T DC  852 ? B DC  2   
9  1 Y 1 T DT  872 ? B DT  22  
10 1 Y 1 T DT  873 ? B DT  23  
11 1 Y 1 T DT  874 ? B DT  24  
12 1 Y 1 T DC  875 ? B DC  25  
13 1 Y 1 T DG  876 ? B DG  26  
14 1 Y 1 B SER 1   ? D SER 1   
15 1 Y 1 B ASP 2   ? D ASP 2   
16 1 Y 1 B ALA 108 ? D ALA 108 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1TKD 'double helix'        
1TKD 'a-form double helix' 
1TKD 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC  7  1_555 B DG  20 1_555 0.115  0.220  0.428  -12.166 -22.380 5.324  1  P_DC807:DG870_T   P 807 ? T 870 ? 19 1 
1 A DG  8  1_555 B DC  19 1_555 0.213  0.037  -0.452 -10.413 -9.041  8.038  2  P_DG808:DC869_T   P 808 ? T 869 ? 19 1 
1 A DA  9  1_555 B DT  18 1_555 0.241  0.361  0.012  -9.013  -15.456 -4.240 3  P_DA809:DT868_T   P 809 ? T 868 ? 20 1 
1 A DC  10 1_555 B DG  17 1_555 1.247  0.224  0.351  -2.937  -3.091  7.389  4  P_DC810:DG867_T   P 810 ? T 867 ? ?  1 
1 A DG  11 1_555 B DC  16 1_555 -1.171 -0.141 0.235  -1.414  -0.336  4.753  5  P_DG811:DC866_T   P 811 ? T 866 ? 19 1 
1 A DG  12 1_555 B DC  15 1_555 -0.643 0.338  0.116  8.077   -3.364  -1.978 6  P_DG812:DC865_T   P 812 ? T 865 ? 19 1 
1 A DC  13 1_555 B DG  14 1_555 -0.234 -0.035 0.081  1.503   -5.792  3.062  7  P_DC813:DG864_T   P 813 ? T 864 ? 19 1 
1 A DC  14 1_555 B DG  13 1_555 0.137  -0.118 0.225  -7.112  -5.641  1.742  8  P_DC814:DG863_T   P 814 ? T 863 ? 19 1 
1 A DA  15 1_555 B DT  12 1_555 -0.271 0.332  0.141  -4.610  -8.648  -2.788 9  P_DA815:DT862_T   P 815 ? T 862 ? 20 1 
1 A DG  16 1_555 B DC  11 1_555 -0.243 -0.186 -0.290 -10.265 -15.142 -1.449 10 P_DG816:DC861_T   P 816 ? T 861 ? 19 1 
1 A DT  17 1_555 B DA  10 1_555 -0.159 0.066  0.043  -3.328  -5.459  3.463  11 P_DT817:DA860_T   P 817 ? T 860 ? 20 1 
1 A DG  18 1_555 B DC  9  1_555 -0.308 -0.244 -0.745 -5.799  2.169   1.364  12 P_DG818:DC859_T   P 818 ? T 859 ? 19 1 
1 A DC  19 1_555 B DG  8  1_555 0.187  -0.108 -0.365 6.836   0.808   -2.243 13 P_DC819:DG858_T   P 819 ? T 858 ? 19 1 
1 A DC  20 1_555 B DG  7  1_555 0.130  -0.360 -0.338 2.660   -7.920  1.720  14 P_DC820:DG857_T   P 820 ? T 857 ? 19 1 
1 A DA  21 1_555 B DT  6  1_555 0.142  -0.218 0.285  4.860   -7.101  2.953  15 P_DA821:DT856_T   P 821 ? T 856 ? 20 1 
1 A DOC 22 1_555 B 8OG 5  1_555 0.521  -0.315 -0.226 -2.365  -4.551  2.300  16 P_DOC822:8OG855_T P 822 ? T 855 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 7  1_555 B DG 20 1_555 A DG  8  1_555 B DC  19 1_555 0.864  0.437  3.263 11.940 12.128 36.549 -0.832 0.186  3.353 18.177 
-17.896 40.194 1  PP_DC807DG808:DC869DG870_TT   P 807 ? T 870 ? P 808 ? T 869 ? 
1 A DG 8  1_555 B DC 19 1_555 A DA  9  1_555 B DT  18 1_555 -1.629 0.405  3.271 -7.919 2.649  38.088 0.269  1.431  3.546 4.001  
11.959  38.960 2  PP_DG808DA809:DT868DC869_TT   P 808 ? T 869 ? P 809 ? T 868 ? 
1 A DA 9  1_555 B DT 18 1_555 A DC  10 1_555 B DG  17 1_555 1.137  -0.233 3.157 -1.379 -2.127 38.684 -0.101 -1.875 3.124 -3.207 
2.078   38.764 3  PP_DA809DC810:DG867DT868_TT   P 809 ? T 868 ? P 810 ? T 867 ? 
1 A DC 10 1_555 B DG 17 1_555 A DG  11 1_555 B DC  16 1_555 0.041  0.162  3.128 0.480  3.211  26.634 -0.445 0.031  3.125 6.938  
-1.038  26.828 4  PP_DC810DG811:DC866DG867_TT   P 810 ? T 867 ? P 811 ? T 866 ? 
1 A DG 11 1_555 B DC 16 1_555 A DG  12 1_555 B DC  15 1_555 -0.876 0.402  3.072 -1.161 4.995  37.166 0.004  1.219  3.123 7.791  
1.811   37.506 5  PP_DG811DG812:DC865DC866_TT   P 811 ? T 866 ? P 812 ? T 865 ? 
1 A DG 12 1_555 B DC 15 1_555 A DC  13 1_555 B DG  14 1_555 0.065  -0.887 3.378 -0.356 7.337  30.854 -2.978 -0.184 3.090 13.551 
0.658   31.696 6  PP_DG812DC813:DG864DC865_TT   P 812 ? T 865 ? P 813 ? T 864 ? 
1 A DC 13 1_555 B DG 14 1_555 A DC  14 1_555 B DG  13 1_555 0.703  -0.878 3.294 1.429  10.794 35.884 -2.749 -0.912 2.942 17.042 
-2.256  37.447 7  PP_DC813DC814:DG863DG864_TT   P 813 ? T 864 ? P 814 ? T 863 ? 
1 A DC 14 1_555 B DG 13 1_555 A DA  15 1_555 B DT  12 1_555 -0.840 0.252  3.157 -2.038 7.259  31.701 -0.794 1.148  3.182 13.058 
3.666   32.563 8  PP_DC814DA815:DT862DG863_TT   P 814 ? T 863 ? P 815 ? T 862 ? 
1 A DA 15 1_555 B DT 12 1_555 A DG  16 1_555 B DC  11 1_555 0.218  -0.478 3.620 2.879  5.249  35.836 -1.573 0.092  3.523 8.458  
-4.638  36.316 9  PP_DA815DG816:DC861DT862_TT   P 815 ? T 862 ? P 816 ? T 861 ? 
1 A DG 16 1_555 B DC 11 1_555 A DT  17 1_555 B DA  10 1_555 0.666  -0.275 3.129 -1.336 7.201  28.792 -1.965 -1.565 2.942 14.194 
2.632   29.690 10 PP_DG816DT817:DA860DC861_TT   P 816 ? T 861 ? P 817 ? T 860 ? 
1 A DT 17 1_555 B DA 10 1_555 A DG  18 1_555 B DC  9  1_555 0.681  -0.011 3.421 5.444  7.863  33.635 -1.283 -0.259 3.399 13.259 
-9.180  34.930 11 PP_DT817DG818:DC859DA860_TT   P 817 ? T 860 ? P 818 ? T 859 ? 
1 A DG 18 1_555 B DC 9  1_555 A DC  19 1_555 B DG  8  1_555 -0.499 -0.274 3.152 -1.597 2.057  27.316 -1.067 0.672  3.147 4.343  
3.372   27.437 12 PP_DG818DC819:DG858DC859_TT   P 818 ? T 859 ? P 819 ? T 858 ? 
1 A DC 19 1_555 B DG 8  1_555 A DC  20 1_555 B DG  7  1_555 -0.104 -0.578 3.706 -8.555 6.942  38.579 -1.736 -0.949 3.499 10.255 
12.638  40.063 13 PP_DC819DC820:DG857DG858_TT   P 819 ? T 858 ? P 820 ? T 857 ? 
1 A DC 20 1_555 B DG 7  1_555 A DA  21 1_555 B DT  6  1_555 -0.434 -1.395 3.240 -4.734 13.423 25.216 -5.485 -0.079 2.267 28.074 
9.902   28.899 14 PP_DC820DA821:DT856DG857_TT   P 820 ? T 857 ? P 821 ? T 856 ? 
1 A DA 21 1_555 B DT 6  1_555 A DOC 22 1_555 B 8OG 5  1_555 0.052  -0.793 3.751 4.865  0.841  35.836 -1.413 0.702  3.707 1.359  
-7.861  36.163 15 PP_DA821DOC822:8OG855DT856_TT P 821 ? T 856 ? P 822 ? T 855 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  'MAGNESIUM ION'                           MG  
6  'SULFATE ION'                             SO4 
7  "2',3'-DIDEOXY-THYMIDINE-5'-TRIPHOSPHATE" D3T 
8  '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'    MES 
9  'PENTAETHYLENE GLYCOL'                    1PE 
10 water                                     HOH 
#