data_1TMZ
# 
_entry.id   1TMZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TMZ         
WWPDB D_1000176740 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TMZ 
_pdbx_database_status.recvd_initial_deposition_date   1998-04-20 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Greenfield, N.J.'          1 
'Montelione, G.T.'          2 
'Hitchcock-Degregori, S.E.' 3 
'Farid, R.S.'               4 
# 
_citation.id                        primary 
_citation.title                     
;The structure of the N-terminus of striated muscle alpha-tropomyosin in a chimeric peptide: nuclear magnetic resonance structure and circular dichroism studies.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            37 
_citation.page_first                7834 
_citation.page_last                 7843 
_citation.year                      1998 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9601044 
_citation.pdbx_database_id_DOI      10.1021/bi973167m 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Greenfield, N.J.'          1 
primary 'Montelione, G.T.'          2 
primary 'Farid, R.S.'               3 
primary 'Hitchcock-DeGregori, S.E.' 4 
# 
_cell.entry_id           1TMZ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TMZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           TMZIP 
_entity.formula_weight             3852.657 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    
'SYNTHETIC CHIMERIC PEPTIDE OF THE N-TERMINUS OF RAT ALPHA-TROPOMYOSIN AND THE C-TERMINUS OF THE YEAST TRANSCRIPTION FACTOR GCN4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MDAIKKKMQMLKLDNYHLENEVARLKKLVGER 
_entity_poly.pdbx_seq_one_letter_code_can   MDAIKKKMQMLKLDNYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  ALA n 
1 4  ILE n 
1 5  LYS n 
1 6  LYS n 
1 7  LYS n 
1 8  MET n 
1 9  GLN n 
1 10 MET n 
1 11 LEU n 
1 12 LYS n 
1 13 LEU n 
1 14 ASP n 
1 15 ASN n 
1 16 TYR n 
1 17 HIS n 
1 18 LEU n 
1 19 GLU n 
1 20 ASN n 
1 21 GLU n 
1 22 VAL n 
1 23 ALA n 
1 24 ARG n 
1 25 LEU n 
1 26 LYS n 
1 27 LYS n 
1 28 LEU n 
1 29 VAL n 
1 30 GLY n 
1 31 GLU n 
1 32 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;black rat, baker's yeast
;
_entity_src_gen.gene_src_genus                     'Rattus, Saccharomyces' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   , 
_entity_src_gen.gene_src_strain                    , 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus rattus, Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10117,4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDA
KTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTT
SFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR
RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TMZ A 1 ? 32 ? P03069 250 ? 281 ? 1 32 
2 1 1TMZ B 1 ? 32 ? P03069 250 ? 281 ? 1 32 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1TMZ ASP A 2  ? UNP P03069 LYS 251 CONFLICT 2  1  
1 1TMZ ALA A 3  ? UNP P03069 GLN 252 CONFLICT 3  2  
1 1TMZ ILE A 4  ? UNP P03069 LEU 253 CONFLICT 4  3  
1 1TMZ LYS A 5  ? UNP P03069 GLU 254 CONFLICT 5  4  
1 1TMZ LYS A 6  ? UNP P03069 ASP 255 CONFLICT 6  5  
1 1TMZ MET A 8  ? UNP P03069 VAL 257 CONFLICT 8  6  
1 1TMZ GLN A 9  ? UNP P03069 GLU 258 CONFLICT 9  7  
1 1TMZ MET A 10 ? UNP P03069 GLU 259 CONFLICT 10 8  
1 1TMZ LYS A 12 ? UNP P03069 LEU 261 CONFLICT 12 9  
1 1TMZ LEU A 13 ? UNP P03069 SER 262 CONFLICT 13 10 
1 1TMZ ASP A 14 ? UNP P03069 LYS 263 CONFLICT 14 11 
2 1TMZ ASP B 2  ? UNP P03069 LYS 251 CONFLICT 2  12 
2 1TMZ ALA B 3  ? UNP P03069 GLN 252 CONFLICT 3  13 
2 1TMZ ILE B 4  ? UNP P03069 LEU 253 CONFLICT 4  14 
2 1TMZ LYS B 5  ? UNP P03069 GLU 254 CONFLICT 5  15 
2 1TMZ LYS B 6  ? UNP P03069 ASP 255 CONFLICT 6  16 
2 1TMZ MET B 8  ? UNP P03069 VAL 257 CONFLICT 8  17 
2 1TMZ GLN B 9  ? UNP P03069 GLU 258 CONFLICT 9  18 
2 1TMZ MET B 10 ? UNP P03069 GLU 259 CONFLICT 10 19 
2 1TMZ LYS B 12 ? UNP P03069 LEU 261 CONFLICT 12 20 
2 1TMZ LEU B 13 ? UNP P03069 SER 262 CONFLICT 13 21 
2 1TMZ ASP B 14 ? UNP P03069 LYS 263 CONFLICT 14 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY    1 
2 1 2QF-COSY 1 
3 1 TOCSY    1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         288 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'UNITY 500' 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    500 
# 
_pdbx_nmr_refine.entry_id           1TMZ 
_pdbx_nmr_refine.method             'CONSTRAINED MINIMIZATION' 
_pdbx_nmr_refine.details            'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1TMZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number   200 
_pdbx_nmr_ensemble.conformers_submitted_total_number    15 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LOWEST VALUE OF TARGET FUNCTION' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           DIANA         ?    GUNTERT,WUTHRICH 1 
'structure solution' 'VARIAN VNMR' VNMR ?                2 
'structure solution' DIANA         ?    ?                3 
# 
_exptl.entry_id          1TMZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1TMZ 
_struct.title                     'TMZIP: A CHIMERIC PEPTIDE MODEL OF THE N-TERMINUS OF ALPHA TROPOMYOSIN, NMR, 15 STRUCTURES' 
_struct.pdbx_descriptor           TMZIP 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TMZ 
_struct_keywords.pdbx_keywords   TROPOMYOSIN 
_struct_keywords.text            
;TROPOMYOSIN, ACTIN-BINDING, THIN-FILAMENT-REGULATION, MUSCLE, ALPHA-HELIX COILED-COIL DIMER, GCN4, CHIMERIC-PEPTIDE-MODEL, DIMERIC TW0-CHAINED COILED-COIL
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 4 ? LYS A 26 ? ILE A 4 LYS A 26 1 ? 23 
HELX_P HELX_P2 2 ILE B 4 ? LEU B 25 ? ILE B 4 LEU B 25 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1TMZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TMZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? 8.125   -11.073 17.143  1.00 0.00 ? 1  MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? 8.895   -11.073 15.911  1.00 0.00 ? 1  MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? 8.310   -12.109 14.949  1.00 0.00 ? 1  MET A C    1  
ATOM 4     O O    . MET A 1 1  ? 8.228   -11.818 13.747  1.00 0.00 ? 1  MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? 10.359  -11.412 16.198  1.00 0.00 ? 1  MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? 11.295  -10.621 15.282  1.00 0.00 ? 1  MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? 12.812  -11.571 14.972  1.00 0.00 ? 1  MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? 13.102  -12.253 16.631  1.00 0.00 ? 1  MET A CE   1  
ATOM 9     H H    . MET A 1 1  ? 8.635   -11.073 18.026  1.00 0.00 ? 1  MET A H    1  
ATOM 10    H HA   . MET A 1 1  ? 8.830   -10.086 15.452  1.00 0.00 ? 1  MET A HA   1  
ATOM 11    H HB2  . MET A 1 1  ? 10.583  -11.164 17.235  1.00 0.00 ? 1  MET A HB2  1  
ATOM 12    H HB3  . MET A 1 1  ? 10.510  -12.481 16.049  1.00 0.00 ? 1  MET A HB3  1  
ATOM 13    H HG2  . MET A 1 1  ? 10.796  -10.429 14.332  1.00 0.00 ? 1  MET A HG2  1  
ATOM 14    H HG3  . MET A 1 1  ? 11.542  -9.669  15.752  1.00 0.00 ? 1  MET A HG3  1  
ATOM 15    H HE1  . MET A 1 1  ? 12.249  -12.858 16.939  1.00 0.00 ? 1  MET A HE1  1  
ATOM 16    H HE2  . MET A 1 1  ? 14.003  -12.865 16.611  1.00 0.00 ? 1  MET A HE2  1  
ATOM 17    H HE3  . MET A 1 1  ? 13.239  -11.443 17.348  1.00 0.00 ? 1  MET A HE3  1  
ATOM 18    N N    . ASP A 1 2  ? 7.920   -13.278 15.488  1.00 0.00 ? 2  ASP A N    1  
ATOM 19    C CA   . ASP A 1 2  ? 7.349   -14.345 14.683  1.00 0.00 ? 2  ASP A CA   1  
ATOM 20    C C    . ASP A 1 2  ? 6.182   -13.790 13.863  1.00 0.00 ? 2  ASP A C    1  
ATOM 21    O O    . ASP A 1 2  ? 5.994   -14.241 12.724  1.00 0.00 ? 2  ASP A O    1  
ATOM 22    C CB   . ASP A 1 2  ? 6.812   -15.474 15.565  1.00 0.00 ? 2  ASP A CB   1  
ATOM 23    C CG   . ASP A 1 2  ? 7.591   -15.707 16.861  1.00 0.00 ? 2  ASP A CG   1  
ATOM 24    O OD1  . ASP A 1 2  ? 7.634   -14.840 17.746  1.00 0.00 ? 2  ASP A OD1  1  
ATOM 25    O OD2  . ASP A 1 2  ? 8.181   -16.852 16.944  1.00 0.00 ? 2  ASP A OD2  1  
ATOM 26    H H    . ASP A 1 2  ? 8.022   -13.437 16.490  1.00 0.00 ? 2  ASP A H    1  
ATOM 27    H HA   . ASP A 1 2  ? 8.112   -14.723 14.002  1.00 0.00 ? 2  ASP A HA   1  
ATOM 28    H HB2  . ASP A 1 2  ? 5.781   -15.221 15.811  1.00 0.00 ? 2  ASP A HB2  1  
ATOM 29    H HB3  . ASP A 1 2  ? 6.821   -16.379 14.958  1.00 0.00 ? 2  ASP A HB3  1  
ATOM 30    N N    . ALA A 1 3  ? 5.433   -12.838 14.449  1.00 0.00 ? 3  ALA A N    1  
ATOM 31    C CA   . ALA A 1 3  ? 4.297   -12.230 13.778  1.00 0.00 ? 3  ALA A CA   1  
ATOM 32    C C    . ALA A 1 3  ? 4.768   -11.000 13.000  1.00 0.00 ? 3  ALA A C    1  
ATOM 33    O O    . ALA A 1 3  ? 4.007   -10.509 12.154  1.00 0.00 ? 3  ALA A O    1  
ATOM 34    C CB   . ALA A 1 3  ? 3.296   -11.723 14.818  1.00 0.00 ? 3  ALA A CB   1  
ATOM 35    H H    . ALA A 1 3  ? 5.657   -12.523 15.393  1.00 0.00 ? 3  ALA A H    1  
ATOM 36    H HA   . ALA A 1 3  ? 3.828   -12.929 13.086  1.00 0.00 ? 3  ALA A HA   1  
ATOM 37    H HB1  . ALA A 1 3  ? 2.964   -12.562 15.430  1.00 0.00 ? 3  ALA A HB1  1  
ATOM 38    H HB2  . ALA A 1 3  ? 3.771   -10.981 15.460  1.00 0.00 ? 3  ALA A HB2  1  
ATOM 39    H HB3  . ALA A 1 3  ? 2.441   -11.266 14.319  1.00 0.00 ? 3  ALA A HB3  1  
ATOM 40    N N    . ILE A 1 4  ? 5.995   -10.533 13.297  1.00 0.00 ? 4  ILE A N    1  
ATOM 41    C CA   . ILE A 1 4  ? 6.559   -9.372  12.630  1.00 0.00 ? 4  ILE A CA   1  
ATOM 42    C C    . ILE A 1 4  ? 7.043   -9.775  11.236  1.00 0.00 ? 4  ILE A C    1  
ATOM 43    O O    . ILE A 1 4  ? 6.747   -9.049  10.276  1.00 0.00 ? 4  ILE A O    1  
ATOM 44    C CB   . ILE A 1 4  ? 7.644   -8.731  13.497  1.00 0.00 ? 4  ILE A CB   1  
ATOM 45    C CG1  . ILE A 1 4  ? 7.059   -8.210  14.812  1.00 0.00 ? 4  ILE A CG1  1  
ATOM 46    C CG2  . ILE A 1 4  ? 8.387   -7.638  12.727  1.00 0.00 ? 4  ILE A CG2  1  
ATOM 47    C CD1  . ILE A 1 4  ? 7.526   -6.779  15.090  1.00 0.00 ? 4  ILE A CD1  1  
ATOM 48    H H    . ILE A 1 4  ? 6.558   -10.997 14.009  1.00 0.00 ? 4  ILE A H    1  
ATOM 49    H HA   . ILE A 1 4  ? 5.749   -8.649  12.529  1.00 0.00 ? 4  ILE A HA   1  
ATOM 50    H HB   . ILE A 1 4  ? 8.346   -9.536  13.716  1.00 0.00 ? 4  ILE A HB   1  
ATOM 51    H HG12 . ILE A 1 4  ? 5.971   -8.221  14.744  1.00 0.00 ? 4  ILE A HG12 1  
ATOM 52    H HG13 . ILE A 1 4  ? 7.371   -8.867  15.623  1.00 0.00 ? 4  ILE A HG13 1  
ATOM 53    H HG21 . ILE A 1 4  ? 7.686   -6.865  12.409  1.00 0.00 ? 4  ILE A HG21 1  
ATOM 54    H HG22 . ILE A 1 4  ? 9.150   -7.204  13.373  1.00 0.00 ? 4  ILE A HG22 1  
ATOM 55    H HG23 . ILE A 1 4  ? 8.868   -8.064  11.847  1.00 0.00 ? 4  ILE A HG23 1  
ATOM 56    H HD11 . ILE A 1 4  ? 7.214   -6.122  14.279  1.00 0.00 ? 4  ILE A HD11 1  
ATOM 57    H HD12 . ILE A 1 4  ? 7.092   -6.441  16.031  1.00 0.00 ? 4  ILE A HD12 1  
ATOM 58    H HD13 . ILE A 1 4  ? 8.613   -6.752  15.171  1.00 0.00 ? 4  ILE A HD13 1  
ATOM 59    N N    . LYS A 1 5  ? 7.767   -10.906 11.154  1.00 0.00 ? 5  LYS A N    1  
ATOM 60    C CA   . LYS A 1 5  ? 8.287   -11.397 9.889   1.00 0.00 ? 5  LYS A CA   1  
ATOM 61    C C    . LYS A 1 5  ? 7.137   -11.534 8.889   1.00 0.00 ? 5  LYS A C    1  
ATOM 62    O O    . LYS A 1 5  ? 7.362   -11.291 7.695   1.00 0.00 ? 5  LYS A O    1  
ATOM 63    C CB   . LYS A 1 5  ? 9.075   -12.691 10.100  1.00 0.00 ? 5  LYS A CB   1  
ATOM 64    C CG   . LYS A 1 5  ? 8.609   -13.417 11.363  1.00 0.00 ? 5  LYS A CG   1  
ATOM 65    C CD   . LYS A 1 5  ? 8.770   -14.932 11.216  1.00 0.00 ? 5  LYS A CD   1  
ATOM 66    C CE   . LYS A 1 5  ? 10.124  -15.395 11.755  1.00 0.00 ? 5  LYS A CE   1  
ATOM 67    N NZ   . LYS A 1 5  ? 10.472  -16.717 11.209  1.00 0.00 ? 5  LYS A NZ   1  
ATOM 68    H H    . LYS A 1 5  ? 7.967   -11.446 11.996  1.00 0.00 ? 5  LYS A H    1  
ATOM 69    H HA   . LYS A 1 5  ? 8.984   -10.642 9.527   1.00 0.00 ? 5  LYS A HA   1  
ATOM 70    H HB2  . LYS A 1 5  ? 8.923   -13.342 9.240   1.00 0.00 ? 5  LYS A HB2  1  
ATOM 71    H HB3  . LYS A 1 5  ? 10.135  -12.450 10.180  1.00 0.00 ? 5  LYS A HB3  1  
ATOM 72    H HG2  . LYS A 1 5  ? 9.208   -13.078 12.208  1.00 0.00 ? 5  LYS A HG2  1  
ATOM 73    H HG3  . LYS A 1 5  ? 7.564   -13.171 11.548  1.00 0.00 ? 5  LYS A HG3  1  
ATOM 74    H HD2  . LYS A 1 5  ? 7.977   -15.428 11.776  1.00 0.00 ? 5  LYS A HD2  1  
ATOM 75    H HD3  . LYS A 1 5  ? 8.679   -15.196 10.162  1.00 0.00 ? 5  LYS A HD3  1  
ATOM 76    H HE2  . LYS A 1 5  ? 10.891  -14.677 11.463  1.00 0.00 ? 5  LYS A HE2  1  
ATOM 77    H HE3  . LYS A 1 5  ? 10.080  -15.442 12.843  1.00 0.00 ? 5  LYS A HE3  1  
ATOM 78    H HZ1  . LYS A 1 5  ? 10.514  -16.673 10.191  1.00 0.00 ? 5  LYS A HZ1  1  
ATOM 79    H HZ2  . LYS A 1 5  ? 11.377  -17.003 11.582  1.00 0.00 ? 5  LYS A HZ2  1  
ATOM 80    H HZ3  . LYS A 1 5  ? 9.768   -17.402 11.483  1.00 0.00 ? 5  LYS A HZ3  1  
ATOM 81    N N    . LYS A 1 6  ? 5.947   -11.915 9.388   1.00 0.00 ? 6  LYS A N    1  
ATOM 82    C CA   . LYS A 1 6  ? 4.776   -12.082 8.544   1.00 0.00 ? 6  LYS A CA   1  
ATOM 83    C C    . LYS A 1 6  ? 4.069   -10.734 8.388   1.00 0.00 ? 6  LYS A C    1  
ATOM 84    O O    . LYS A 1 6  ? 3.468   -10.502 7.329   1.00 0.00 ? 6  LYS A O    1  
ATOM 85    C CB   . LYS A 1 6  ? 3.874   -13.189 9.093   1.00 0.00 ? 6  LYS A CB   1  
ATOM 86    C CG   . LYS A 1 6  ? 4.701   -14.293 9.754   1.00 0.00 ? 6  LYS A CG   1  
ATOM 87    C CD   . LYS A 1 6  ? 4.053   -15.663 9.546   1.00 0.00 ? 6  LYS A CD   1  
ATOM 88    C CE   . LYS A 1 6  ? 3.879   -15.967 8.057   1.00 0.00 ? 6  LYS A CE   1  
ATOM 89    N NZ   . LYS A 1 6  ? 4.985   -15.385 7.279   1.00 0.00 ? 6  LYS A NZ   1  
ATOM 90    H H    . LYS A 1 6  ? 5.847   -12.095 10.387  1.00 0.00 ? 6  LYS A H    1  
ATOM 91    H HA   . LYS A 1 6  ? 5.141   -12.406 7.570   1.00 0.00 ? 6  LYS A HA   1  
ATOM 92    H HB2  . LYS A 1 6  ? 3.198   -12.761 9.832   1.00 0.00 ? 6  LYS A HB2  1  
ATOM 93    H HB3  . LYS A 1 6  ? 3.287   -13.605 8.274   1.00 0.00 ? 6  LYS A HB3  1  
ATOM 94    H HG2  . LYS A 1 6  ? 5.698   -14.301 9.313   1.00 0.00 ? 6  LYS A HG2  1  
ATOM 95    H HG3  . LYS A 1 6  ? 4.787   -14.080 10.820  1.00 0.00 ? 6  LYS A HG3  1  
ATOM 96    H HD2  . LYS A 1 6  ? 4.690   -16.427 9.992   1.00 0.00 ? 6  LYS A HD2  1  
ATOM 97    H HD3  . LYS A 1 6  ? 3.084   -15.675 10.044  1.00 0.00 ? 6  LYS A HD3  1  
ATOM 98    H HE2  . LYS A 1 6  ? 3.871   -17.047 7.910   1.00 0.00 ? 6  LYS A HE2  1  
ATOM 99    H HE3  . LYS A 1 6  ? 2.928   -15.556 7.717   1.00 0.00 ? 6  LYS A HE3  1  
ATOM 100   H HZ1  . LYS A 1 6  ? 5.874   -15.770 7.598   1.00 0.00 ? 6  LYS A HZ1  1  
ATOM 101   H HZ2  . LYS A 1 6  ? 4.846   -15.600 6.292   1.00 0.00 ? 6  LYS A HZ2  1  
ATOM 102   H HZ3  . LYS A 1 6  ? 4.999   -14.372 7.399   1.00 0.00 ? 6  LYS A HZ3  1  
ATOM 103   N N    . LYS A 1 7  ? 4.153   -9.885  9.428   1.00 0.00 ? 7  LYS A N    1  
ATOM 104   C CA   . LYS A 1 7  ? 3.525   -8.575  9.406   1.00 0.00 ? 7  LYS A CA   1  
ATOM 105   C C    . LYS A 1 7  ? 3.957   -7.829  8.142   1.00 0.00 ? 7  LYS A C    1  
ATOM 106   O O    . LYS A 1 7  ? 3.080   -7.320  7.429   1.00 0.00 ? 7  LYS A O    1  
ATOM 107   C CB   . LYS A 1 7  ? 3.824   -7.816  10.700  1.00 0.00 ? 7  LYS A CB   1  
ATOM 108   C CG   . LYS A 1 7  ? 3.147   -6.444  10.700  1.00 0.00 ? 7  LYS A CG   1  
ATOM 109   C CD   . LYS A 1 7  ? 1.662   -6.565  10.352  1.00 0.00 ? 7  LYS A CD   1  
ATOM 110   C CE   . LYS A 1 7  ? 0.824   -5.593  11.185  1.00 0.00 ? 7  LYS A CE   1  
ATOM 111   N NZ   . LYS A 1 7  ? 1.014   -4.212  10.713  1.00 0.00 ? 7  LYS A NZ   1  
ATOM 112   H H    . LYS A 1 7  ? 4.669   -10.155 10.266  1.00 0.00 ? 7  LYS A H    1  
ATOM 113   H HA   . LYS A 1 7  ? 2.450   -8.748  9.366   1.00 0.00 ? 7  LYS A HA   1  
ATOM 114   H HB2  . LYS A 1 7  ? 3.450   -8.395  11.544  1.00 0.00 ? 7  LYS A HB2  1  
ATOM 115   H HB3  . LYS A 1 7  ? 4.903   -7.698  10.800  1.00 0.00 ? 7  LYS A HB3  1  
ATOM 116   H HG2  . LYS A 1 7  ? 3.245   -6.000  11.691  1.00 0.00 ? 7  LYS A HG2  1  
ATOM 117   H HG3  . LYS A 1 7  ? 3.648   -5.803  9.973   1.00 0.00 ? 7  LYS A HG3  1  
ATOM 118   H HD2  . LYS A 1 7  ? 1.526   -6.335  9.296   1.00 0.00 ? 7  LYS A HD2  1  
ATOM 119   H HD3  . LYS A 1 7  ? 1.338   -7.589  10.538  1.00 0.00 ? 7  LYS A HD3  1  
ATOM 120   H HE2  . LYS A 1 7  ? -0.230  -5.858  11.092  1.00 0.00 ? 7  LYS A HE2  1  
ATOM 121   H HE3  . LYS A 1 7  ? 1.118   -5.672  12.232  1.00 0.00 ? 7  LYS A HE3  1  
ATOM 122   H HZ1  . LYS A 1 7  ? 0.738   -4.138  9.734   1.00 0.00 ? 7  LYS A HZ1  1  
ATOM 123   H HZ2  . LYS A 1 7  ? 0.446   -3.585  11.282  1.00 0.00 ? 7  LYS A HZ2  1  
ATOM 124   H HZ3  . LYS A 1 7  ? 1.995   -3.946  10.803  1.00 0.00 ? 7  LYS A HZ3  1  
ATOM 125   N N    . MET A 1 8  ? 5.278   -7.779  7.894   1.00 0.00 ? 8  MET A N    1  
ATOM 126   C CA   . MET A 1 8  ? 5.818   -7.102  6.727   1.00 0.00 ? 8  MET A CA   1  
ATOM 127   C C    . MET A 1 8  ? 5.415   -7.868  5.466   1.00 0.00 ? 8  MET A C    1  
ATOM 128   O O    . MET A 1 8  ? 5.325   -7.243  4.399   1.00 0.00 ? 8  MET A O    1  
ATOM 129   C CB   . MET A 1 8  ? 7.343   -7.025  6.813   1.00 0.00 ? 8  MET A CB   1  
ATOM 130   C CG   . MET A 1 8  ? 7.972   -8.410  6.645   1.00 0.00 ? 8  MET A CG   1  
ATOM 131   S SD   . MET A 1 8  ? 8.503   -8.646  4.923   1.00 0.00 ? 8  MET A SD   1  
ATOM 132   C CE   . MET A 1 8  ? 10.296  -8.426  5.113   1.00 0.00 ? 8  MET A CE   1  
ATOM 133   H H    . MET A 1 8  ? 5.935   -8.226  8.534   1.00 0.00 ? 8  MET A H    1  
ATOM 134   H HA   . MET A 1 8  ? 5.402   -6.095  6.679   1.00 0.00 ? 8  MET A HA   1  
ATOM 135   H HB2  . MET A 1 8  ? 7.710   -6.370  6.023   1.00 0.00 ? 8  MET A HB2  1  
ATOM 136   H HB3  . MET A 1 8  ? 7.622   -6.606  7.780   1.00 0.00 ? 8  MET A HB3  1  
ATOM 137   H HG2  . MET A 1 8  ? 8.840   -8.496  7.299   1.00 0.00 ? 8  MET A HG2  1  
ATOM 138   H HG3  . MET A 1 8  ? 7.244   -9.174  6.918   1.00 0.00 ? 8  MET A HG3  1  
ATOM 139   H HE1  . MET A 1 8  ? 10.690  -9.166  5.810   1.00 0.00 ? 8  MET A HE1  1  
ATOM 140   H HE2  . MET A 1 8  ? 10.773  -8.541  4.140   1.00 0.00 ? 8  MET A HE2  1  
ATOM 141   H HE3  . MET A 1 8  ? 10.510  -7.428  5.497   1.00 0.00 ? 8  MET A HE3  1  
ATOM 142   N N    . GLN A 1 9  ? 5.186   -9.186  5.609   1.00 0.00 ? 9  GLN A N    1  
ATOM 143   C CA   . GLN A 1 9  ? 4.797   -10.026 4.489   1.00 0.00 ? 9  GLN A CA   1  
ATOM 144   C C    . GLN A 1 9  ? 3.338   -9.743  4.127   1.00 0.00 ? 9  GLN A C    1  
ATOM 145   O O    . GLN A 1 9  ? 2.965   -9.966  2.966   1.00 0.00 ? 9  GLN A O    1  
ATOM 146   C CB   . GLN A 1 9  ? 5.007   -11.509 4.801   1.00 0.00 ? 9  GLN A CB   1  
ATOM 147   C CG   . GLN A 1 9  ? 6.477   -11.901 4.639   1.00 0.00 ? 9  GLN A CG   1  
ATOM 148   C CD   . GLN A 1 9  ? 6.613   -13.384 4.289   1.00 0.00 ? 9  GLN A CD   1  
ATOM 149   O OE1  . GLN A 1 9  ? 6.139   -13.854 3.267   1.00 0.00 ? 9  GLN A OE1  1  
ATOM 150   N NE2  . GLN A 1 9  ? 7.287   -14.094 5.190   1.00 0.00 ? 9  GLN A NE2  1  
ATOM 151   H H    . GLN A 1 9  ? 5.283   -9.624  6.525   1.00 0.00 ? 9  GLN A H    1  
ATOM 152   H HA   . GLN A 1 9  ? 5.432   -9.748  3.648   1.00 0.00 ? 9  GLN A HA   1  
ATOM 153   H HB2  . GLN A 1 9  ? 4.699   -11.702 5.828   1.00 0.00 ? 9  GLN A HB2  1  
ATOM 154   H HB3  . GLN A 1 9  ? 4.388   -12.103 4.128   1.00 0.00 ? 9  GLN A HB3  1  
ATOM 155   H HG2  . GLN A 1 9  ? 6.916   -11.306 3.839   1.00 0.00 ? 9  GLN A HG2  1  
ATOM 156   H HG3  . GLN A 1 9  ? 7.003   -11.689 5.570   1.00 0.00 ? 9  GLN A HG3  1  
ATOM 157   H HE21 . GLN A 1 9  ? 7.658   -13.638 6.024   1.00 0.00 ? 9  GLN A HE21 1  
ATOM 158   H HE22 . GLN A 1 9  ? 7.432   -15.093 5.048   1.00 0.00 ? 9  GLN A HE22 1  
ATOM 159   N N    . MET A 1 10 ? 2.555   -9.265  5.111   1.00 0.00 ? 10 MET A N    1  
ATOM 160   C CA   . MET A 1 10 ? 1.152   -8.956  4.896   1.00 0.00 ? 10 MET A CA   1  
ATOM 161   C C    . MET A 1 10 ? 1.025   -7.531  4.353   1.00 0.00 ? 10 MET A C    1  
ATOM 162   O O    . MET A 1 10 ? 0.156   -7.300  3.500   1.00 0.00 ? 10 MET A O    1  
ATOM 163   C CB   . MET A 1 10 ? 0.373   -9.074  6.208   1.00 0.00 ? 10 MET A CB   1  
ATOM 164   C CG   . MET A 1 10 ? 0.777   -10.336 6.973   1.00 0.00 ? 10 MET A CG   1  
ATOM 165   S SD   . MET A 1 10 ? -0.696  -11.332 7.349   1.00 0.00 ? 10 MET A SD   1  
ATOM 166   C CE   . MET A 1 10 ? 0.070   -12.970 7.533   1.00 0.00 ? 10 MET A CE   1  
ATOM 167   H H    . MET A 1 10 ? 2.943   -9.110  6.041   1.00 0.00 ? 10 MET A H    1  
ATOM 168   H HA   . MET A 1 10 ? 0.744   -9.652  4.163   1.00 0.00 ? 10 MET A HA   1  
ATOM 169   H HB2  . MET A 1 10 ? 0.587   -8.201  6.826   1.00 0.00 ? 10 MET A HB2  1  
ATOM 170   H HB3  . MET A 1 10 ? -0.693  -9.099  5.985   1.00 0.00 ? 10 MET A HB3  1  
ATOM 171   H HG2  . MET A 1 10 ? 1.459   -10.927 6.363   1.00 0.00 ? 10 MET A HG2  1  
ATOM 172   H HG3  . MET A 1 10 ? 1.281   -10.054 7.897   1.00 0.00 ? 10 MET A HG3  1  
ATOM 173   H HE1  . MET A 1 10 ? 0.811   -12.946 8.331   1.00 0.00 ? 10 MET A HE1  1  
ATOM 174   H HE2  . MET A 1 10 ? -0.705  -13.699 7.767   1.00 0.00 ? 10 MET A HE2  1  
ATOM 175   H HE3  . MET A 1 10 ? 0.559   -13.258 6.603   1.00 0.00 ? 10 MET A HE3  1  
ATOM 176   N N    . LEU A 1 11 ? 1.880   -6.619  4.850   1.00 0.00 ? 11 LEU A N    1  
ATOM 177   C CA   . LEU A 1 11 ? 1.864   -5.232  4.418   1.00 0.00 ? 11 LEU A CA   1  
ATOM 178   C C    . LEU A 1 11 ? 2.536   -5.121  3.048   1.00 0.00 ? 11 LEU A C    1  
ATOM 179   O O    . LEU A 1 11 ? 2.184   -4.205  2.291   1.00 0.00 ? 11 LEU A O    1  
ATOM 180   C CB   . LEU A 1 11 ? 2.489   -4.331  5.485   1.00 0.00 ? 11 LEU A CB   1  
ATOM 181   C CG   . LEU A 1 11 ? 1.814   -4.350  6.858   1.00 0.00 ? 11 LEU A CG   1  
ATOM 182   C CD1  . LEU A 1 11 ? 2.284   -3.173  7.716   1.00 0.00 ? 11 LEU A CD1  1  
ATOM 183   C CD2  . LEU A 1 11 ? 0.291   -4.386  6.720   1.00 0.00 ? 11 LEU A CD2  1  
ATOM 184   H H    . LEU A 1 11 ? 2.567   -6.894  5.552   1.00 0.00 ? 11 LEU A H    1  
ATOM 185   H HA   . LEU A 1 11 ? 0.815   -4.950  4.323   1.00 0.00 ? 11 LEU A HA   1  
ATOM 186   H HB2  . LEU A 1 11 ? 3.524   -4.656  5.593   1.00 0.00 ? 11 LEU A HB2  1  
ATOM 187   H HB3  . LEU A 1 11 ? 2.475   -3.320  5.078   1.00 0.00 ? 11 LEU A HB3  1  
ATOM 188   H HG   . LEU A 1 11 ? 2.150   -5.274  7.327   1.00 0.00 ? 11 LEU A HG   1  
ATOM 189   H HD11 . LEU A 1 11 ? 2.048   -2.233  7.218   1.00 0.00 ? 11 LEU A HD11 1  
ATOM 190   H HD12 . LEU A 1 11 ? 1.785   -3.218  8.684   1.00 0.00 ? 11 LEU A HD12 1  
ATOM 191   H HD13 . LEU A 1 11 ? 3.362   -3.232  7.869   1.00 0.00 ? 11 LEU A HD13 1  
ATOM 192   H HD21 . LEU A 1 11 ? -0.011  -5.275  6.166   1.00 0.00 ? 11 LEU A HD21 1  
ATOM 193   H HD22 . LEU A 1 11 ? -0.155  -4.399  7.715   1.00 0.00 ? 11 LEU A HD22 1  
ATOM 194   H HD23 . LEU A 1 11 ? -0.055  -3.501  6.187   1.00 0.00 ? 11 LEU A HD23 1  
ATOM 195   N N    . LYS A 1 12 ? 3.474   -6.041  2.762   1.00 0.00 ? 12 LYS A N    1  
ATOM 196   C CA   . LYS A 1 12 ? 4.187   -6.046  1.496   1.00 0.00 ? 12 LYS A CA   1  
ATOM 197   C C    . LYS A 1 12 ? 3.292   -6.653  0.414   1.00 0.00 ? 12 LYS A C    1  
ATOM 198   O O    . LYS A 1 12 ? 3.411   -6.241  -0.750  1.00 0.00 ? 12 LYS A O    1  
ATOM 199   C CB   . LYS A 1 12 ? 5.537   -6.750  1.643   1.00 0.00 ? 12 LYS A CB   1  
ATOM 200   C CG   . LYS A 1 12 ? 5.352   -8.257  1.828   1.00 0.00 ? 12 LYS A CG   1  
ATOM 201   C CD   . LYS A 1 12 ? 5.060   -8.942  0.490   1.00 0.00 ? 12 LYS A CD   1  
ATOM 202   C CE   . LYS A 1 12 ? 6.004   -10.123 0.261   1.00 0.00 ? 12 LYS A CE   1  
ATOM 203   N NZ   . LYS A 1 12 ? 5.489   -10.995 -0.807  1.00 0.00 ? 12 LYS A NZ   1  
ATOM 204   H H    . LYS A 1 12 ? 3.704   -6.764  3.443   1.00 0.00 ? 12 LYS A H    1  
ATOM 205   H HA   . LYS A 1 12 ? 4.385   -5.003  1.248   1.00 0.00 ? 12 LYS A HA   1  
ATOM 206   H HB2  . LYS A 1 12 ? 6.129   -6.572  0.745   1.00 0.00 ? 12 LYS A HB2  1  
ATOM 207   H HB3  . LYS A 1 12 ? 6.062   -6.332  2.502   1.00 0.00 ? 12 LYS A HB3  1  
ATOM 208   H HG2  . LYS A 1 12 ? 6.265   -8.677  2.249   1.00 0.00 ? 12 LYS A HG2  1  
ATOM 209   H HG3  . LYS A 1 12 ? 4.529   -8.430  2.521   1.00 0.00 ? 12 LYS A HG3  1  
ATOM 210   H HD2  . LYS A 1 12 ? 4.032   -9.305  0.496   1.00 0.00 ? 12 LYS A HD2  1  
ATOM 211   H HD3  . LYS A 1 12 ? 5.174   -8.213  -0.312  1.00 0.00 ? 12 LYS A HD3  1  
ATOM 212   H HE2  . LYS A 1 12 ? 6.985   -9.746  -0.031  1.00 0.00 ? 12 LYS A HE2  1  
ATOM 213   H HE3  . LYS A 1 12 ? 6.103   -10.688 1.188   1.00 0.00 ? 12 LYS A HE3  1  
ATOM 214   H HZ1  . LYS A 1 12 ? 5.397   -10.467 -1.674  1.00 0.00 ? 12 LYS A HZ1  1  
ATOM 215   H HZ2  . LYS A 1 12 ? 6.135   -11.774 -0.941  1.00 0.00 ? 12 LYS A HZ2  1  
ATOM 216   H HZ3  . LYS A 1 12 ? 4.575   -11.364 -0.544  1.00 0.00 ? 12 LYS A HZ3  1  
ATOM 217   N N    . LEU A 1 13 ? 2.427   -7.603  0.811   1.00 0.00 ? 13 LEU A N    1  
ATOM 218   C CA   . LEU A 1 13 ? 1.522   -8.258  -0.119  1.00 0.00 ? 13 LEU A CA   1  
ATOM 219   C C    . LEU A 1 13 ? 0.387   -7.299  -0.480  1.00 0.00 ? 13 LEU A C    1  
ATOM 220   O O    . LEU A 1 13 ? -0.017  -7.278  -1.652  1.00 0.00 ? 13 LEU A O    1  
ATOM 221   C CB   . LEU A 1 13 ? 1.040   -9.593  0.453   1.00 0.00 ? 13 LEU A CB   1  
ATOM 222   C CG   . LEU A 1 13 ? 0.564   -10.628 -0.568  1.00 0.00 ? 13 LEU A CG   1  
ATOM 223   C CD1  . LEU A 1 13 ? -0.415  -11.616 0.069   1.00 0.00 ? 13 LEU A CD1  1  
ATOM 224   C CD2  . LEU A 1 13 ? -0.030  -9.947  -1.802  1.00 0.00 ? 13 LEU A CD2  1  
ATOM 225   H H    . LEU A 1 13 ? 2.393   -7.885  1.791   1.00 0.00 ? 13 LEU A H    1  
ATOM 226   H HA   . LEU A 1 13 ? 2.103   -8.475  -1.015  1.00 0.00 ? 13 LEU A HA   1  
ATOM 227   H HB2  . LEU A 1 13 ? 1.878   -10.007 1.015   1.00 0.00 ? 13 LEU A HB2  1  
ATOM 228   H HB3  . LEU A 1 13 ? 0.233   -9.355  1.146   1.00 0.00 ? 13 LEU A HB3  1  
ATOM 229   H HG   . LEU A 1 13 ? 1.462   -11.172 -0.861  1.00 0.00 ? 13 LEU A HG   1  
ATOM 230   H HD11 . LEU A 1 13 ? -1.280  -11.082 0.460   1.00 0.00 ? 13 LEU A HD11 1  
ATOM 231   H HD12 . LEU A 1 13 ? -0.732  -12.337 -0.685  1.00 0.00 ? 13 LEU A HD12 1  
ATOM 232   H HD13 . LEU A 1 13 ? 0.073   -12.149 0.885   1.00 0.00 ? 13 LEU A HD13 1  
ATOM 233   H HD21 . LEU A 1 13 ? 0.718   -9.307  -2.270  1.00 0.00 ? 13 LEU A HD21 1  
ATOM 234   H HD22 . LEU A 1 13 ? -0.358  -10.712 -2.506  1.00 0.00 ? 13 LEU A HD22 1  
ATOM 235   H HD23 . LEU A 1 13 ? -0.888  -9.339  -1.514  1.00 0.00 ? 13 LEU A HD23 1  
ATOM 236   N N    . ASP A 1 14 ? -0.097  -6.536  0.516   1.00 0.00 ? 14 ASP A N    1  
ATOM 237   C CA   . ASP A 1 14 ? -1.175  -5.584  0.304   1.00 0.00 ? 14 ASP A CA   1  
ATOM 238   C C    . ASP A 1 14 ? -0.657  -4.412  -0.531  1.00 0.00 ? 14 ASP A C    1  
ATOM 239   O O    . ASP A 1 14 ? -1.446  -3.839  -1.297  1.00 0.00 ? 14 ASP A O    1  
ATOM 240   C CB   . ASP A 1 14 ? -1.688  -5.028  1.633   1.00 0.00 ? 14 ASP A CB   1  
ATOM 241   C CG   . ASP A 1 14 ? -3.208  -4.893  1.734   1.00 0.00 ? 14 ASP A CG   1  
ATOM 242   O OD1  . ASP A 1 14 ? -3.956  -5.823  1.397   1.00 0.00 ? 14 ASP A OD1  1  
ATOM 243   O OD2  . ASP A 1 14 ? -3.626  -3.759  2.186   1.00 0.00 ? 14 ASP A OD2  1  
ATOM 244   H H    . ASP A 1 14 ? 0.293   -6.616  1.455   1.00 0.00 ? 14 ASP A H    1  
ATOM 245   H HA   . ASP A 1 14 ? -1.981  -6.078  -0.239  1.00 0.00 ? 14 ASP A HA   1  
ATOM 246   H HB2  . ASP A 1 14 ? -1.339  -5.702  2.415   1.00 0.00 ? 14 ASP A HB2  1  
ATOM 247   H HB3  . ASP A 1 14 ? -1.218  -4.053  1.769   1.00 0.00 ? 14 ASP A HB3  1  
ATOM 248   N N    . ASN A 1 15 ? 0.638   -4.083  -0.371  1.00 0.00 ? 15 ASN A N    1  
ATOM 249   C CA   . ASN A 1 15 ? 1.252   -2.990  -1.105  1.00 0.00 ? 15 ASN A CA   1  
ATOM 250   C C    . ASN A 1 15 ? 1.207   -3.299  -2.603  1.00 0.00 ? 15 ASN A C    1  
ATOM 251   O O    . ASN A 1 15 ? 0.778   -2.426  -3.372  1.00 0.00 ? 15 ASN A O    1  
ATOM 252   C CB   . ASN A 1 15 ? 2.717   -2.811  -0.702  1.00 0.00 ? 15 ASN A CB   1  
ATOM 253   C CG   . ASN A 1 15 ? 3.201   -1.393  -1.013  1.00 0.00 ? 15 ASN A CG   1  
ATOM 254   O OD1  . ASN A 1 15 ? 3.647   -1.087  -2.106  1.00 0.00 ? 15 ASN A OD1  1  
ATOM 255   N ND2  . ASN A 1 15 ? 3.089   -0.547  0.008   1.00 0.00 ? 15 ASN A ND2  1  
ATOM 256   H H    . ASN A 1 15 ? 1.220   -4.608  0.282   1.00 0.00 ? 15 ASN A H    1  
ATOM 257   H HA   . ASN A 1 15 ? 0.690   -2.076  -0.914  1.00 0.00 ? 15 ASN A HA   1  
ATOM 258   H HB2  . ASN A 1 15 ? 2.815   -2.993  0.368   1.00 0.00 ? 15 ASN A HB2  1  
ATOM 259   H HB3  . ASN A 1 15 ? 3.323   -3.537  -1.243  1.00 0.00 ? 15 ASN A HB3  1  
ATOM 260   H HD21 . ASN A 1 15 ? 2.707   -0.869  0.897   1.00 0.00 ? 15 ASN A HD21 1  
ATOM 261   H HD22 . ASN A 1 15 ? 3.385   0.423   -0.099  1.00 0.00 ? 15 ASN A HD22 1  
ATOM 262   N N    . TYR A 1 16 ? 1.644   -4.513  -2.981  1.00 0.00 ? 16 TYR A N    1  
ATOM 263   C CA   . TYR A 1 16 ? 1.632   -4.867  -4.390  1.00 0.00 ? 16 TYR A CA   1  
ATOM 264   C C    . TYR A 1 16 ? 0.187   -4.887  -4.894  1.00 0.00 ? 16 TYR A C    1  
ATOM 265   O O    . TYR A 1 16 ? -0.030  -4.508  -6.054  1.00 0.00 ? 16 TYR A O    1  
ATOM 266   C CB   . TYR A 1 16 ? 2.332   -6.222  -4.602  1.00 0.00 ? 16 TYR A CB   1  
ATOM 267   C CG   . TYR A 1 16 ? 3.613   -6.403  -3.800  1.00 0.00 ? 16 TYR A CG   1  
ATOM 268   C CD1  . TYR A 1 16 ? 4.367   -5.273  -3.406  1.00 0.00 ? 16 TYR A CD1  1  
ATOM 269   C CD2  . TYR A 1 16 ? 4.054   -7.697  -3.439  1.00 0.00 ? 16 TYR A CD2  1  
ATOM 270   C CE1  . TYR A 1 16 ? 5.553   -5.436  -2.660  1.00 0.00 ? 16 TYR A CE1  1  
ATOM 271   C CE2  . TYR A 1 16 ? 5.241   -7.859  -2.692  1.00 0.00 ? 16 TYR A CE2  1  
ATOM 272   C CZ   . TYR A 1 16 ? 5.992   -6.729  -2.303  1.00 0.00 ? 16 TYR A CZ   1  
ATOM 273   O OH   . TYR A 1 16 ? 7.142   -6.882  -1.581  1.00 0.00 ? 16 TYR A OH   1  
ATOM 274   H H    . TYR A 1 16 ? 1.982   -5.179  -2.301  1.00 0.00 ? 16 TYR A H    1  
ATOM 275   H HA   . TYR A 1 16 ? 2.172   -4.094  -4.939  1.00 0.00 ? 16 TYR A HA   1  
ATOM 276   H HB2  . TYR A 1 16 ? 1.634   -7.026  -4.360  1.00 0.00 ? 16 TYR A HB2  1  
ATOM 277   H HB3  . TYR A 1 16 ? 2.584   -6.326  -5.659  1.00 0.00 ? 16 TYR A HB3  1  
ATOM 278   H HD1  . TYR A 1 16 ? 4.037   -4.280  -3.675  1.00 0.00 ? 16 TYR A HD1  1  
ATOM 279   H HD2  . TYR A 1 16 ? 3.485   -8.568  -3.731  1.00 0.00 ? 16 TYR A HD2  1  
ATOM 280   H HE1  . TYR A 1 16 ? 6.123   -4.566  -2.364  1.00 0.00 ? 16 TYR A HE1  1  
ATOM 281   H HE2  . TYR A 1 16 ? 5.571   -8.852  -2.421  1.00 0.00 ? 16 TYR A HE2  1  
ATOM 282   H HH   . TYR A 1 16 ? 7.901   -7.126  -2.116  1.00 0.00 ? 16 TYR A HH   1  
ATOM 283   N N    . HIS A 1 17 ? -0.752  -5.326  -4.037  1.00 0.00 ? 17 HIS A N    1  
ATOM 284   C CA   . HIS A 1 17 ? -2.155  -5.400  -4.405  1.00 0.00 ? 17 HIS A CA   1  
ATOM 285   C C    . HIS A 1 17 ? -2.721  -3.983  -4.528  1.00 0.00 ? 17 HIS A C    1  
ATOM 286   O O    . HIS A 1 17 ? -3.591  -3.769  -5.385  1.00 0.00 ? 17 HIS A O    1  
ATOM 287   C CB   . HIS A 1 17 ? -2.936  -6.266  -3.414  1.00 0.00 ? 17 HIS A CB   1  
ATOM 288   C CG   . HIS A 1 17 ? -4.182  -5.607  -2.872  1.00 0.00 ? 17 HIS A CG   1  
ATOM 289   N ND1  . HIS A 1 17 ? -5.402  -5.660  -3.523  1.00 0.00 ? 17 HIS A ND1  1  
ATOM 290   C CD2  . HIS A 1 17 ? -4.384  -4.881  -1.735  1.00 0.00 ? 17 HIS A CD2  1  
ATOM 291   C CE1  . HIS A 1 17 ? -6.291  -4.992  -2.801  1.00 0.00 ? 17 HIS A CE1  1  
ATOM 292   N NE2  . HIS A 1 17 ? -5.657  -4.510  -1.693  1.00 0.00 ? 17 HIS A NE2  1  
ATOM 293   H H    . HIS A 1 17 ? -0.487  -5.619  -3.096  1.00 0.00 ? 17 HIS A H    1  
ATOM 294   H HA   . HIS A 1 17 ? -2.195  -5.884  -5.381  1.00 0.00 ? 17 HIS A HA   1  
ATOM 295   H HB2  . HIS A 1 17 ? -3.217  -7.182  -3.933  1.00 0.00 ? 17 HIS A HB2  1  
ATOM 296   H HB3  . HIS A 1 17 ? -2.260  -6.513  -2.596  1.00 0.00 ? 17 HIS A HB3  1  
ATOM 297   H HD1  . HIS A 1 17 ? -5.684  -6.101  -4.398  1.00 0.00 ? 17 HIS A HD1  1  
ATOM 298   H HD2  . HIS A 1 17 ? -3.712  -4.595  -0.939  1.00 0.00 ? 17 HIS A HD2  1  
ATOM 299   H HE1  . HIS A 1 17 ? -7.313  -4.915  -3.140  1.00 0.00 ? 17 HIS A HE1  1  
ATOM 300   N N    . LEU A 1 18 ? -2.225  -3.061  -3.685  1.00 0.00 ? 18 LEU A N    1  
ATOM 301   C CA   . LEU A 1 18 ? -2.678  -1.681  -3.700  1.00 0.00 ? 18 LEU A CA   1  
ATOM 302   C C    . LEU A 1 18 ? -2.051  -0.956  -4.893  1.00 0.00 ? 18 LEU A C    1  
ATOM 303   O O    . LEU A 1 18 ? -2.784  -0.263  -5.614  1.00 0.00 ? 18 LEU A O    1  
ATOM 304   C CB   . LEU A 1 18 ? -2.395  -1.009  -2.355  1.00 0.00 ? 18 LEU A CB   1  
ATOM 305   C CG   . LEU A 1 18 ? -3.268  -1.461  -1.182  1.00 0.00 ? 18 LEU A CG   1  
ATOM 306   C CD1  . LEU A 1 18 ? -2.651  -1.043  0.154   1.00 0.00 ? 18 LEU A CD1  1  
ATOM 307   C CD2  . LEU A 1 18 ? -4.702  -0.950  -1.337  1.00 0.00 ? 18 LEU A CD2  1  
ATOM 308   H H    . LEU A 1 18 ? -1.509  -3.322  -3.007  1.00 0.00 ? 18 LEU A H    1  
ATOM 309   H HA   . LEU A 1 18 ? -3.760  -1.711  -3.832  1.00 0.00 ? 18 LEU A HA   1  
ATOM 310   H HB2  . LEU A 1 18 ? -1.351  -1.217  -2.120  1.00 0.00 ? 18 LEU A HB2  1  
ATOM 311   H HB3  . LEU A 1 18 ? -2.516  0.062   -2.516  1.00 0.00 ? 18 LEU A HB3  1  
ATOM 312   H HG   . LEU A 1 18 ? -3.272  -2.550  -1.234  1.00 0.00 ? 18 LEU A HG   1  
ATOM 313   H HD11 . LEU A 1 18 ? -2.544  0.041   0.191   1.00 0.00 ? 18 LEU A HD11 1  
ATOM 314   H HD12 . LEU A 1 18 ? -3.298  -1.380  0.964   1.00 0.00 ? 18 LEU A HD12 1  
ATOM 315   H HD13 . LEU A 1 18 ? -1.669  -1.501  0.269   1.00 0.00 ? 18 LEU A HD13 1  
ATOM 316   H HD21 . LEU A 1 18 ? -5.133  -1.326  -2.264  1.00 0.00 ? 18 LEU A HD21 1  
ATOM 317   H HD22 . LEU A 1 18 ? -5.293  -1.290  -0.487  1.00 0.00 ? 18 LEU A HD22 1  
ATOM 318   H HD23 . LEU A 1 18 ? -4.707  0.140   -1.360  1.00 0.00 ? 18 LEU A HD23 1  
ATOM 319   N N    . GLU A 1 19 ? -0.729  -1.126  -5.074  1.00 0.00 ? 19 GLU A N    1  
ATOM 320   C CA   . GLU A 1 19 ? -0.015  -0.493  -6.169  1.00 0.00 ? 19 GLU A CA   1  
ATOM 321   C C    . GLU A 1 19 ? -0.551  -1.026  -7.499  1.00 0.00 ? 19 GLU A C    1  
ATOM 322   O O    . GLU A 1 19 ? -0.612  -0.250  -8.464  1.00 0.00 ? 19 GLU A O    1  
ATOM 323   C CB   . GLU A 1 19 ? 1.495   -0.716  -6.058  1.00 0.00 ? 19 GLU A CB   1  
ATOM 324   C CG   . GLU A 1 19 ? 2.256   0.605   -6.192  1.00 0.00 ? 19 GLU A CG   1  
ATOM 325   C CD   . GLU A 1 19 ? 1.884   1.568   -5.063  1.00 0.00 ? 19 GLU A CD   1  
ATOM 326   O OE1  . GLU A 1 19 ? 1.073   1.219   -4.192  1.00 0.00 ? 19 GLU A OE1  1  
ATOM 327   O OE2  . GLU A 1 19 ? 2.471   2.716   -5.110  1.00 0.00 ? 19 GLU A OE2  1  
ATOM 328   H H    . GLU A 1 19 ? -0.198  -1.715  -4.432  1.00 0.00 ? 19 GLU A H    1  
ATOM 329   H HA   . GLU A 1 19 ? -0.220  0.576   -6.106  1.00 0.00 ? 19 GLU A HA   1  
ATOM 330   H HB2  . GLU A 1 19 ? 1.717   -1.157  -5.087  1.00 0.00 ? 19 GLU A HB2  1  
ATOM 331   H HB3  . GLU A 1 19 ? 1.809   -1.406  -6.841  1.00 0.00 ? 19 GLU A HB3  1  
ATOM 332   H HG2  . GLU A 1 19 ? 3.326   0.403   -6.148  1.00 0.00 ? 19 GLU A HG2  1  
ATOM 333   H HG3  . GLU A 1 19 ? 2.019   1.053   -7.156  1.00 0.00 ? 19 GLU A HG3  1  
ATOM 334   N N    . ASN A 1 20 ? -0.924  -2.318  -7.524  1.00 0.00 ? 20 ASN A N    1  
ATOM 335   C CA   . ASN A 1 20 ? -1.450  -2.946  -8.724  1.00 0.00 ? 20 ASN A CA   1  
ATOM 336   C C    . ASN A 1 20 ? -2.808  -2.329  -9.063  1.00 0.00 ? 20 ASN A C    1  
ATOM 337   O O    . ASN A 1 20 ? -3.164  -2.302  -10.250 1.00 0.00 ? 20 ASN A O    1  
ATOM 338   C CB   . ASN A 1 20 ? -1.651  -4.448  -8.517  1.00 0.00 ? 20 ASN A CB   1  
ATOM 339   C CG   . ASN A 1 20 ? -0.426  -5.235  -8.987  1.00 0.00 ? 20 ASN A CG   1  
ATOM 340   O OD1  . ASN A 1 20 ? 0.336   -4.801  -9.835  1.00 0.00 ? 20 ASN A OD1  1  
ATOM 341   N ND2  . ASN A 1 20 ? -0.278  -6.414  -8.389  1.00 0.00 ? 20 ASN A ND2  1  
ATOM 342   H H    . ASN A 1 20 ? -0.841  -2.889  -6.682  1.00 0.00 ? 20 ASN A H    1  
ATOM 343   H HA   . ASN A 1 20 ? -0.761  -2.764  -9.549  1.00 0.00 ? 20 ASN A HA   1  
ATOM 344   H HB2  . ASN A 1 20 ? -1.812  -4.641  -7.457  1.00 0.00 ? 20 ASN A HB2  1  
ATOM 345   H HB3  . ASN A 1 20 ? -2.533  -4.766  -9.074  1.00 0.00 ? 20 ASN A HB3  1  
ATOM 346   H HD21 . ASN A 1 20 ? -0.953  -6.717  -7.686  1.00 0.00 ? 20 ASN A HD21 1  
ATOM 347   H HD22 . ASN A 1 20 ? 0.509   -7.015  -8.633  1.00 0.00 ? 20 ASN A HD22 1  
ATOM 348   N N    . GLU A 1 21 ? -3.528  -1.853  -8.031  1.00 0.00 ? 21 GLU A N    1  
ATOM 349   C CA   . GLU A 1 21 ? -4.833  -1.243  -8.219  1.00 0.00 ? 21 GLU A CA   1  
ATOM 350   C C    . GLU A 1 21 ? -4.657  0.247   -8.517  1.00 0.00 ? 21 GLU A C    1  
ATOM 351   O O    . GLU A 1 21 ? -5.435  0.784   -9.319  1.00 0.00 ? 21 GLU A O    1  
ATOM 352   C CB   . GLU A 1 21 ? -5.734  -1.456  -7.001  1.00 0.00 ? 21 GLU A CB   1  
ATOM 353   C CG   . GLU A 1 21 ? -7.209  -1.485  -7.407  1.00 0.00 ? 21 GLU A CG   1  
ATOM 354   C CD   . GLU A 1 21 ? -7.662  -2.912  -7.725  1.00 0.00 ? 21 GLU A CD   1  
ATOM 355   O OE1  . GLU A 1 21 ? -6.846  -3.741  -8.153  1.00 0.00 ? 21 GLU A OE1  1  
ATOM 356   O OE2  . GLU A 1 21 ? -8.912  -3.147  -7.510  1.00 0.00 ? 21 GLU A OE2  1  
ATOM 357   H H    . GLU A 1 21 ? -3.161  -1.915  -7.082  1.00 0.00 ? 21 GLU A H    1  
ATOM 358   H HA   . GLU A 1 21 ? -5.288  -1.727  -9.084  1.00 0.00 ? 21 GLU A HA   1  
ATOM 359   H HB2  . GLU A 1 21 ? -5.476  -2.406  -6.532  1.00 0.00 ? 21 GLU A HB2  1  
ATOM 360   H HB3  . GLU A 1 21 ? -5.560  -0.650  -6.288  1.00 0.00 ? 21 GLU A HB3  1  
ATOM 361   H HG2  . GLU A 1 21 ? -7.810  -1.096  -6.585  1.00 0.00 ? 21 GLU A HG2  1  
ATOM 362   H HG3  . GLU A 1 21 ? -7.347  -0.848  -8.281  1.00 0.00 ? 21 GLU A HG3  1  
ATOM 363   N N    . VAL A 1 22 ? -3.655  0.875   -7.877  1.00 0.00 ? 22 VAL A N    1  
ATOM 364   C CA   . VAL A 1 22 ? -3.382  2.289   -8.072  1.00 0.00 ? 22 VAL A CA   1  
ATOM 365   C C    . VAL A 1 22 ? -2.676  2.486   -9.415  1.00 0.00 ? 22 VAL A C    1  
ATOM 366   O O    . VAL A 1 22 ? -2.819  3.568   -10.003 1.00 0.00 ? 22 VAL A O    1  
ATOM 367   C CB   . VAL A 1 22 ? -2.581  2.835   -6.889  1.00 0.00 ? 22 VAL A CB   1  
ATOM 368   C CG1  . VAL A 1 22 ? -2.067  4.247   -7.181  1.00 0.00 ? 22 VAL A CG1  1  
ATOM 369   C CG2  . VAL A 1 22 ? -3.412  2.809   -5.605  1.00 0.00 ? 22 VAL A CG2  1  
ATOM 370   H H    . VAL A 1 22 ? -3.059  0.357   -7.231  1.00 0.00 ? 22 VAL A H    1  
ATOM 371   H HA   . VAL A 1 22 ? -4.341  2.806   -8.096  1.00 0.00 ? 22 VAL A HA   1  
ATOM 372   H HB   . VAL A 1 22 ? -1.729  2.165   -6.774  1.00 0.00 ? 22 VAL A HB   1  
ATOM 373   H HG11 . VAL A 1 22 ? -2.906  4.914   -7.378  1.00 0.00 ? 22 VAL A HG11 1  
ATOM 374   H HG12 . VAL A 1 22 ? -1.502  4.604   -6.319  1.00 0.00 ? 22 VAL A HG12 1  
ATOM 375   H HG13 . VAL A 1 22 ? -1.413  4.232   -8.052  1.00 0.00 ? 22 VAL A HG13 1  
ATOM 376   H HG21 . VAL A 1 22 ? -3.718  1.787   -5.382  1.00 0.00 ? 22 VAL A HG21 1  
ATOM 377   H HG22 . VAL A 1 22 ? -2.811  3.204   -4.786  1.00 0.00 ? 22 VAL A HG22 1  
ATOM 378   H HG23 . VAL A 1 22 ? -4.301  3.428   -5.724  1.00 0.00 ? 22 VAL A HG23 1  
ATOM 379   N N    . ALA A 1 23 ? -1.940  1.455   -9.866  1.00 0.00 ? 23 ALA A N    1  
ATOM 380   C CA   . ALA A 1 23 ? -1.221  1.516   -11.127 1.00 0.00 ? 23 ALA A CA   1  
ATOM 381   C C    . ALA A 1 23 ? -2.224  1.591   -12.279 1.00 0.00 ? 23 ALA A C    1  
ATOM 382   O O    . ALA A 1 23 ? -1.902  2.210   -13.303 1.00 0.00 ? 23 ALA A O    1  
ATOM 383   C CB   . ALA A 1 23 ? -0.429  0.222   -11.331 1.00 0.00 ? 23 ALA A CB   1  
ATOM 384   H H    . ALA A 1 23 ? -1.875  0.597   -9.319  1.00 0.00 ? 23 ALA A H    1  
ATOM 385   H HA   . ALA A 1 23 ? -0.568  2.388   -11.167 1.00 0.00 ? 23 ALA A HA   1  
ATOM 386   H HB1  . ALA A 1 23 ? 0.272   0.101   -10.505 1.00 0.00 ? 23 ALA A HB1  1  
ATOM 387   H HB2  . ALA A 1 23 ? -1.109  -0.630  -11.348 1.00 0.00 ? 23 ALA A HB2  1  
ATOM 388   H HB3  . ALA A 1 23 ? 0.112   0.262   -12.276 1.00 0.00 ? 23 ALA A HB3  1  
ATOM 389   N N    . ARG A 1 24 ? -3.402  0.969   -12.093 1.00 0.00 ? 24 ARG A N    1  
ATOM 390   C CA   . ARG A 1 24 ? -4.441  0.966   -13.110 1.00 0.00 ? 24 ARG A CA   1  
ATOM 391   C C    . ARG A 1 24 ? -5.241  2.266   -13.019 1.00 0.00 ? 24 ARG A C    1  
ATOM 392   O O    . ARG A 1 24 ? -5.545  2.846   -14.072 1.00 0.00 ? 24 ARG A O    1  
ATOM 393   C CB   . ARG A 1 24 ? -5.390  -0.222  -12.942 1.00 0.00 ? 24 ARG A CB   1  
ATOM 394   C CG   . ARG A 1 24 ? -4.789  -1.278  -12.012 1.00 0.00 ? 24 ARG A CG   1  
ATOM 395   C CD   . ARG A 1 24 ? -5.623  -2.561  -12.027 1.00 0.00 ? 24 ARG A CD   1  
ATOM 396   N NE   . ARG A 1 24 ? -4.743  -3.735  -12.221 1.00 0.00 ? 24 ARG A NE   1  
ATOM 397   C CZ   . ARG A 1 24 ? -4.320  -4.173  -13.425 1.00 0.00 ? 24 ARG A CZ   1  
ATOM 398   N NH1  . ARG A 1 24 ? -4.709  -3.519  -14.528 1.00 0.00 ? 24 ARG A NH1  1  
ATOM 399   N NH2  . ARG A 1 24 ? -3.522  -5.246  -13.517 1.00 0.00 ? 24 ARG A NH2  1  
ATOM 400   H H    . ARG A 1 24 ? -3.588  0.480   -11.217 1.00 0.00 ? 24 ARG A H    1  
ATOM 401   H HA   . ARG A 1 24 ? -3.954  0.915   -14.084 1.00 0.00 ? 24 ARG A HA   1  
ATOM 402   H HB2  . ARG A 1 24 ? -6.329  0.133   -12.515 1.00 0.00 ? 24 ARG A HB2  1  
ATOM 403   H HB3  . ARG A 1 24 ? -5.588  -0.658  -13.921 1.00 0.00 ? 24 ARG A HB3  1  
ATOM 404   H HG2  . ARG A 1 24 ? -3.777  -1.509  -12.347 1.00 0.00 ? 24 ARG A HG2  1  
ATOM 405   H HG3  . ARG A 1 24 ? -4.745  -0.875  -11.001 1.00 0.00 ? 24 ARG A HG3  1  
ATOM 406   H HD2  . ARG A 1 24 ? -6.148  -2.664  -11.077 1.00 0.00 ? 24 ARG A HD2  1  
ATOM 407   H HD3  . ARG A 1 24 ? -6.355  -2.508  -12.833 1.00 0.00 ? 24 ARG A HD3  1  
ATOM 408   H HE   . ARG A 1 24 ? -4.455  -4.221  -11.371 1.00 0.00 ? 24 ARG A HE   1  
ATOM 409   H HH11 . ARG A 1 24 ? -5.316  -2.703  -14.450 1.00 0.00 ? 24 ARG A HH11 1  
ATOM 410   H HH12 . ARG A 1 24 ? -4.398  -3.838  -15.446 1.00 0.00 ? 24 ARG A HH12 1  
ATOM 411   H HH21 . ARG A 1 24 ? -3.230  -5.738  -12.673 1.00 0.00 ? 24 ARG A HH21 1  
ATOM 412   H HH22 . ARG A 1 24 ? -3.207  -5.571  -14.431 1.00 0.00 ? 24 ARG A HH22 1  
ATOM 413   N N    . LEU A 1 25 ? -5.561  2.692   -11.784 1.00 0.00 ? 25 LEU A N    1  
ATOM 414   C CA   . LEU A 1 25 ? -6.318  3.912   -11.562 1.00 0.00 ? 25 LEU A CA   1  
ATOM 415   C C    . LEU A 1 25 ? -5.466  5.117   -11.968 1.00 0.00 ? 25 LEU A C    1  
ATOM 416   O O    . LEU A 1 25 ? -6.007  6.035   -12.601 1.00 0.00 ? 25 LEU A O    1  
ATOM 417   C CB   . LEU A 1 25 ? -6.822  3.974   -10.118 1.00 0.00 ? 25 LEU A CB   1  
ATOM 418   C CG   . LEU A 1 25 ? -7.910  2.966   -9.744  1.00 0.00 ? 25 LEU A CG   1  
ATOM 419   C CD1  . LEU A 1 25 ? -8.322  3.123   -8.279  1.00 0.00 ? 25 LEU A CD1  1  
ATOM 420   C CD2  . LEU A 1 25 ? -9.106  3.073   -10.691 1.00 0.00 ? 25 LEU A CD2  1  
ATOM 421   H H    . LEU A 1 25 ? -5.270  2.154   -10.968 1.00 0.00 ? 25 LEU A H    1  
ATOM 422   H HA   . LEU A 1 25 ? -7.190  3.858   -12.213 1.00 0.00 ? 25 LEU A HA   1  
ATOM 423   H HB2  . LEU A 1 25 ? -5.953  3.812   -9.482  1.00 0.00 ? 25 LEU A HB2  1  
ATOM 424   H HB3  . LEU A 1 25 ? -7.189  4.990   -9.966  1.00 0.00 ? 25 LEU A HB3  1  
ATOM 425   H HG   . LEU A 1 25 ? -7.445  1.987   -9.868  1.00 0.00 ? 25 LEU A HG   1  
ATOM 426   H HD11 . LEU A 1 25 ? -8.700  4.130   -8.105  1.00 0.00 ? 25 LEU A HD11 1  
ATOM 427   H HD12 . LEU A 1 25 ? -9.096  2.391   -8.048  1.00 0.00 ? 25 LEU A HD12 1  
ATOM 428   H HD13 . LEU A 1 25 ? -7.464  2.949   -7.630  1.00 0.00 ? 25 LEU A HD13 1  
ATOM 429   H HD21 . LEU A 1 25 ? -8.787  2.884   -11.716 1.00 0.00 ? 25 LEU A HD21 1  
ATOM 430   H HD22 . LEU A 1 25 ? -9.859  2.342   -10.396 1.00 0.00 ? 25 LEU A HD22 1  
ATOM 431   H HD23 . LEU A 1 25 ? -9.539  4.071   -10.632 1.00 0.00 ? 25 LEU A HD23 1  
ATOM 432   N N    . LYS A 1 26 ? -4.172  5.090   -11.602 1.00 0.00 ? 26 LYS A N    1  
ATOM 433   C CA   . LYS A 1 26 ? -3.258  6.172   -11.926 1.00 0.00 ? 26 LYS A CA   1  
ATOM 434   C C    . LYS A 1 26 ? -3.161  6.314   -13.446 1.00 0.00 ? 26 LYS A C    1  
ATOM 435   O O    . LYS A 1 26 ? -2.952  7.440   -13.921 1.00 0.00 ? 26 LYS A O    1  
ATOM 436   C CB   . LYS A 1 26 ? -1.907  5.956   -11.240 1.00 0.00 ? 26 LYS A CB   1  
ATOM 437   C CG   . LYS A 1 26 ? -1.955  6.408   -9.779  1.00 0.00 ? 26 LYS A CG   1  
ATOM 438   C CD   . LYS A 1 26 ? -0.578  6.879   -9.306  1.00 0.00 ? 26 LYS A CD   1  
ATOM 439   C CE   . LYS A 1 26 ? -0.179  8.185   -9.995  1.00 0.00 ? 26 LYS A CE   1  
ATOM 440   N NZ   . LYS A 1 26 ? 1.076   8.704   -9.428  1.00 0.00 ? 26 LYS A NZ   1  
ATOM 441   H H    . LYS A 1 26 ? -3.806  4.294   -11.080 1.00 0.00 ? 26 LYS A H    1  
ATOM 442   H HA   . LYS A 1 26 ? -3.695  7.081   -11.512 1.00 0.00 ? 26 LYS A HA   1  
ATOM 443   H HB2  . LYS A 1 26 ? -1.659  4.895   -11.276 1.00 0.00 ? 26 LYS A HB2  1  
ATOM 444   H HB3  . LYS A 1 26 ? -1.144  6.518   -11.778 1.00 0.00 ? 26 LYS A HB3  1  
ATOM 445   H HG2  . LYS A 1 26 ? -2.663  7.231   -9.687  1.00 0.00 ? 26 LYS A HG2  1  
ATOM 446   H HG3  . LYS A 1 26 ? -2.295  5.576   -9.163  1.00 0.00 ? 26 LYS A HG3  1  
ATOM 447   H HD2  . LYS A 1 26 ? -0.611  7.042   -8.229  1.00 0.00 ? 26 LYS A HD2  1  
ATOM 448   H HD3  . LYS A 1 26 ? 0.155   6.103   -9.525  1.00 0.00 ? 26 LYS A HD3  1  
ATOM 449   H HE2  . LYS A 1 26 ? -0.037  7.999   -11.060 1.00 0.00 ? 26 LYS A HE2  1  
ATOM 450   H HE3  . LYS A 1 26 ? -0.976  8.917   -9.866  1.00 0.00 ? 26 LYS A HE3  1  
ATOM 451   H HZ1  . LYS A 1 26 ? 1.822   8.020   -9.549  1.00 0.00 ? 26 LYS A HZ1  1  
ATOM 452   H HZ2  . LYS A 1 26 ? 1.321   9.573   -9.902  1.00 0.00 ? 26 LYS A HZ2  1  
ATOM 453   H HZ3  . LYS A 1 26 ? 0.956   8.892   -8.432  1.00 0.00 ? 26 LYS A HZ3  1  
ATOM 454   N N    . LYS A 1 27 ? -3.311  5.189   -14.166 1.00 0.00 ? 27 LYS A N    1  
ATOM 455   C CA   . LYS A 1 27 ? -3.240  5.188   -15.618 1.00 0.00 ? 27 LYS A CA   1  
ATOM 456   C C    . LYS A 1 27 ? -4.469  5.902   -16.184 1.00 0.00 ? 27 LYS A C    1  
ATOM 457   O O    . LYS A 1 27 ? -4.491  6.167   -17.395 1.00 0.00 ? 27 LYS A O    1  
ATOM 458   C CB   . LYS A 1 27 ? -3.060  3.763   -16.145 1.00 0.00 ? 27 LYS A CB   1  
ATOM 459   C CG   . LYS A 1 27 ? -2.049  3.727   -17.293 1.00 0.00 ? 27 LYS A CG   1  
ATOM 460   C CD   . LYS A 1 27 ? -1.379  2.355   -17.391 1.00 0.00 ? 27 LYS A CD   1  
ATOM 461   C CE   . LYS A 1 27 ? -2.332  1.246   -16.941 1.00 0.00 ? 27 LYS A CE   1  
ATOM 462   N NZ   . LYS A 1 27 ? -1.926  -0.046  -17.517 1.00 0.00 ? 27 LYS A NZ   1  
ATOM 463   H H    . LYS A 1 27 ? -3.481  4.300   -13.695 1.00 0.00 ? 27 LYS A H    1  
ATOM 464   H HA   . LYS A 1 27 ? -2.347  5.753   -15.884 1.00 0.00 ? 27 LYS A HA   1  
ATOM 465   H HB2  . LYS A 1 27 ? -2.699  3.129   -15.335 1.00 0.00 ? 27 LYS A HB2  1  
ATOM 466   H HB3  . LYS A 1 27 ? -4.024  3.388   -16.487 1.00 0.00 ? 27 LYS A HB3  1  
ATOM 467   H HG2  . LYS A 1 27 ? -2.569  3.936   -18.228 1.00 0.00 ? 27 LYS A HG2  1  
ATOM 468   H HG3  . LYS A 1 27 ? -1.297  4.498   -17.126 1.00 0.00 ? 27 LYS A HG3  1  
ATOM 469   H HD2  . LYS A 1 27 ? -1.089  2.176   -18.426 1.00 0.00 ? 27 LYS A HD2  1  
ATOM 470   H HD3  . LYS A 1 27 ? -0.485  2.353   -16.767 1.00 0.00 ? 27 LYS A HD3  1  
ATOM 471   H HE2  . LYS A 1 27 ? -2.309  1.173   -15.854 1.00 0.00 ? 27 LYS A HE2  1  
ATOM 472   H HE3  . LYS A 1 27 ? -3.344  1.494   -17.259 1.00 0.00 ? 27 LYS A HE3  1  
ATOM 473   H HZ1  . LYS A 1 27 ? -0.979  -0.278  -17.220 1.00 0.00 ? 27 LYS A HZ1  1  
ATOM 474   H HZ2  . LYS A 1 27 ? -2.575  -0.768  -17.204 1.00 0.00 ? 27 LYS A HZ2  1  
ATOM 475   H HZ3  . LYS A 1 27 ? -1.952  0.003   -18.536 1.00 0.00 ? 27 LYS A HZ3  1  
ATOM 476   N N    . LEU A 1 28 ? -5.451  6.195   -15.313 1.00 0.00 ? 28 LEU A N    1  
ATOM 477   C CA   . LEU A 1 28 ? -6.669  6.872   -15.724 1.00 0.00 ? 28 LEU A CA   1  
ATOM 478   C C    . LEU A 1 28 ? -6.692  8.280   -15.126 1.00 0.00 ? 28 LEU A C    1  
ATOM 479   O O    . LEU A 1 28 ? -7.226  9.189   -15.778 1.00 0.00 ? 28 LEU A O    1  
ATOM 480   C CB   . LEU A 1 28 ? -7.896  6.031   -15.365 1.00 0.00 ? 28 LEU A CB   1  
ATOM 481   C CG   . LEU A 1 28 ? -8.918  5.824   -16.485 1.00 0.00 ? 28 LEU A CG   1  
ATOM 482   C CD1  . LEU A 1 28 ? -8.505  4.666   -17.396 1.00 0.00 ? 28 LEU A CD1  1  
ATOM 483   C CD2  . LEU A 1 28 ? -10.324 5.631   -15.914 1.00 0.00 ? 28 LEU A CD2  1  
ATOM 484   H H    . LEU A 1 28 ? -5.352  5.941   -14.330 1.00 0.00 ? 28 LEU A H    1  
ATOM 485   H HA   . LEU A 1 28 ? -6.629  6.948   -16.810 1.00 0.00 ? 28 LEU A HA   1  
ATOM 486   H HB2  . LEU A 1 28 ? -7.520  5.060   -15.043 1.00 0.00 ? 28 LEU A HB2  1  
ATOM 487   H HB3  . LEU A 1 28 ? -8.369  6.527   -14.517 1.00 0.00 ? 28 LEU A HB3  1  
ATOM 488   H HG   . LEU A 1 28 ? -8.894  6.746   -17.066 1.00 0.00 ? 28 LEU A HG   1  
ATOM 489   H HD11 . LEU A 1 28 ? -8.425  3.747   -16.816 1.00 0.00 ? 28 LEU A HD11 1  
ATOM 490   H HD12 . LEU A 1 28 ? -9.254  4.547   -18.180 1.00 0.00 ? 28 LEU A HD12 1  
ATOM 491   H HD13 . LEU A 1 28 ? -7.541  4.881   -17.856 1.00 0.00 ? 28 LEU A HD13 1  
ATOM 492   H HD21 . LEU A 1 28 ? -10.612 6.506   -15.331 1.00 0.00 ? 28 LEU A HD21 1  
ATOM 493   H HD22 . LEU A 1 28 ? -11.024 5.487   -16.737 1.00 0.00 ? 28 LEU A HD22 1  
ATOM 494   H HD23 . LEU A 1 28 ? -10.347 4.752   -15.271 1.00 0.00 ? 28 LEU A HD23 1  
ATOM 495   N N    . VAL A 1 29 ? -6.121  8.430   -13.917 1.00 0.00 ? 29 VAL A N    1  
ATOM 496   C CA   . VAL A 1 29 ? -6.077  9.715   -13.241 1.00 0.00 ? 29 VAL A CA   1  
ATOM 497   C C    . VAL A 1 29 ? -4.652  10.269  -13.300 1.00 0.00 ? 29 VAL A C    1  
ATOM 498   O O    . VAL A 1 29 ? -4.457  11.331  -13.910 1.00 0.00 ? 29 VAL A O    1  
ATOM 499   C CB   . VAL A 1 29 ? -6.604  9.573   -11.811 1.00 0.00 ? 29 VAL A CB   1  
ATOM 500   C CG1  . VAL A 1 29 ? -6.882  10.943  -11.191 1.00 0.00 ? 29 VAL A CG1  1  
ATOM 501   C CG2  . VAL A 1 29 ? -7.853  8.690   -11.773 1.00 0.00 ? 29 VAL A CG2  1  
ATOM 502   H H    . VAL A 1 29 ? -5.703  7.627   -13.447 1.00 0.00 ? 29 VAL A H    1  
ATOM 503   H HA   . VAL A 1 29 ? -6.743  10.390  -13.778 1.00 0.00 ? 29 VAL A HA   1  
ATOM 504   H HB   . VAL A 1 29 ? -5.807  9.084   -11.250 1.00 0.00 ? 29 VAL A HB   1  
ATOM 505   H HG11 . VAL A 1 29 ? -7.620  11.479  -11.787 1.00 0.00 ? 29 VAL A HG11 1  
ATOM 506   H HG12 . VAL A 1 29 ? -7.255  10.804  -10.176 1.00 0.00 ? 29 VAL A HG12 1  
ATOM 507   H HG13 . VAL A 1 29 ? -5.963  11.528  -11.154 1.00 0.00 ? 29 VAL A HG13 1  
ATOM 508   H HG21 . VAL A 1 29 ? -7.620  7.699   -12.164 1.00 0.00 ? 29 VAL A HG21 1  
ATOM 509   H HG22 . VAL A 1 29 ? -8.199  8.610   -10.742 1.00 0.00 ? 29 VAL A HG22 1  
ATOM 510   H HG23 . VAL A 1 29 ? -8.641  9.134   -12.380 1.00 0.00 ? 29 VAL A HG23 1  
ATOM 511   N N    . GLY A 1 30 ? -3.701  9.551   -12.677 1.00 0.00 ? 30 GLY A N    1  
ATOM 512   C CA   . GLY A 1 30 ? -2.309  9.968   -12.660 1.00 0.00 ? 30 GLY A CA   1  
ATOM 513   C C    . GLY A 1 30 ? -1.750  9.924   -14.083 1.00 0.00 ? 30 GLY A C    1  
ATOM 514   O O    . GLY A 1 30 ? -0.528  10.064  -14.242 1.00 0.00 ? 30 GLY A O    1  
ATOM 515   H H    . GLY A 1 30 ? -3.947  8.685   -12.197 1.00 0.00 ? 30 GLY A H    1  
ATOM 516   H HA2  . GLY A 1 30 ? -2.234  10.987  -12.280 1.00 0.00 ? 30 GLY A HA2  1  
ATOM 517   H HA3  . GLY A 1 30 ? -1.733  9.306   -12.013 1.00 0.00 ? 30 GLY A HA3  1  
ATOM 518   N N    . GLU A 1 31 ? -2.639  9.732   -15.074 1.00 0.00 ? 31 GLU A N    1  
ATOM 519   C CA   . GLU A 1 31 ? -2.237  9.671   -16.469 1.00 0.00 ? 31 GLU A CA   1  
ATOM 520   C C    . GLU A 1 31 ? -1.209  10.769  -16.747 1.00 0.00 ? 31 GLU A C    1  
ATOM 521   O O    . GLU A 1 31 ? -1.546  11.950  -16.578 1.00 0.00 ? 31 GLU A O    1  
ATOM 522   C CB   . GLU A 1 31 ? -3.440  9.795   -17.406 1.00 0.00 ? 31 GLU A CB   1  
ATOM 523   C CG   . GLU A 1 31 ? -4.589  10.543  -16.728 1.00 0.00 ? 31 GLU A CG   1  
ATOM 524   C CD   . GLU A 1 31 ? -5.600  11.047  -17.759 1.00 0.00 ? 31 GLU A CD   1  
ATOM 525   O OE1  . GLU A 1 31 ? -5.086  11.484  -18.859 1.00 0.00 ? 31 GLU A OE1  1  
ATOM 526   O OE2  . GLU A 1 31 ? -6.814  11.015  -17.505 1.00 0.00 ? 31 GLU A OE2  1  
ATOM 527   H H    . GLU A 1 31 ? -3.630  9.625   -14.856 1.00 0.00 ? 31 GLU A H    1  
ATOM 528   H HA   . GLU A 1 31 ? -1.768  8.699   -16.621 1.00 0.00 ? 31 GLU A HA   1  
ATOM 529   H HB2  . GLU A 1 31 ? -3.137  10.343  -18.299 1.00 0.00 ? 31 GLU A HB2  1  
ATOM 530   H HB3  . GLU A 1 31 ? -3.766  8.797   -17.697 1.00 0.00 ? 31 GLU A HB3  1  
ATOM 531   H HG2  . GLU A 1 31 ? -5.093  9.866   -16.038 1.00 0.00 ? 31 GLU A HG2  1  
ATOM 532   H HG3  . GLU A 1 31 ? -4.181  11.383  -16.166 1.00 0.00 ? 31 GLU A HG3  1  
ATOM 533   N N    . ARG A 1 32 ? 0.005   10.365  -17.163 1.00 0.00 ? 32 ARG A N    1  
ATOM 534   C CA   . ARG A 1 32 ? 1.070   11.309  -17.461 1.00 0.00 ? 32 ARG A CA   1  
ATOM 535   C C    . ARG A 1 32 ? 0.499   12.476  -18.269 1.00 0.00 ? 32 ARG A C    1  
ATOM 536   O O    . ARG A 1 32 ? 0.027   12.288  -19.388 1.00 0.00 ? 32 ARG A O    1  
ATOM 537   C CB   . ARG A 1 32 ? 2.199   10.651  -18.256 1.00 0.00 ? 32 ARG A CB   1  
ATOM 538   C CG   . ARG A 1 32 ? 2.317   9.164   -17.915 1.00 0.00 ? 32 ARG A CG   1  
ATOM 539   C CD   . ARG A 1 32 ? 1.626   8.302   -18.974 1.00 0.00 ? 32 ARG A CD   1  
ATOM 540   N NE   . ARG A 1 32 ? 0.425   8.998   -19.489 1.00 0.00 ? 32 ARG A NE   1  
ATOM 541   C CZ   . ARG A 1 32 ? -0.763  8.396   -19.709 1.00 0.00 ? 32 ARG A CZ   1  
ATOM 542   N NH1  . ARG A 1 32 ? -0.884  7.086   -19.453 1.00 0.00 ? 32 ARG A NH1  1  
ATOM 543   N NH2  . ARG A 1 32 ? -1.804  9.097   -20.177 1.00 0.00 ? 32 ARG A NH2  1  
ATOM 544   H H    . ARG A 1 32 ? 0.201   9.371   -17.277 1.00 0.00 ? 32 ARG A H    1  
ATOM 545   H HA   . ARG A 1 32 ? 1.456   11.687  -16.515 1.00 0.00 ? 32 ARG A HA   1  
ATOM 546   H HB2  . ARG A 1 32 ? 1.990   10.755  -19.321 1.00 0.00 ? 32 ARG A HB2  1  
ATOM 547   H HB3  . ARG A 1 32 ? 3.136   11.160  -18.028 1.00 0.00 ? 32 ARG A HB3  1  
ATOM 548   H HG2  . ARG A 1 32 ? 3.371   8.893   -17.870 1.00 0.00 ? 32 ARG A HG2  1  
ATOM 549   H HG3  . ARG A 1 32 ? 1.863   8.989   -16.939 1.00 0.00 ? 32 ARG A HG3  1  
ATOM 550   H HD2  . ARG A 1 32 ? 2.313   8.122   -19.800 1.00 0.00 ? 32 ARG A HD2  1  
ATOM 551   H HD3  . ARG A 1 32 ? 1.341   7.346   -18.534 1.00 0.00 ? 32 ARG A HD3  1  
ATOM 552   H HE   . ARG A 1 32 ? 0.535   9.994   -19.678 1.00 0.00 ? 32 ARG A HE   1  
ATOM 553   H HH11 . ARG A 1 32 ? -0.087  6.560   -19.097 1.00 0.00 ? 32 ARG A HH11 1  
ATOM 554   H HH12 . ARG A 1 32 ? -1.775  6.616   -19.614 1.00 0.00 ? 32 ARG A HH12 1  
ATOM 555   H HH21 . ARG A 1 32 ? -1.703  10.093  -20.370 1.00 0.00 ? 32 ARG A HH21 1  
ATOM 556   H HH22 . ARG A 1 32 ? -2.698  8.634   -20.341 1.00 0.00 ? 32 ARG A HH22 1  
ATOM 557   N N    . MET B 1 1  ? 16.413  -6.766  12.654  1.00 0.00 ? 1  MET B N    1  
ATOM 558   C CA   . MET B 1 1  ? 15.159  -6.558  13.359  1.00 0.00 ? 1  MET B CA   1  
ATOM 559   C C    . MET B 1 1  ? 14.935  -5.059  13.561  1.00 0.00 ? 1  MET B C    1  
ATOM 560   O O    . MET B 1 1  ? 13.792  -4.606  13.401  1.00 0.00 ? 1  MET B O    1  
ATOM 561   C CB   . MET B 1 1  ? 15.191  -7.258  14.720  1.00 0.00 ? 1  MET B CB   1  
ATOM 562   C CG   . MET B 1 1  ? 13.816  -7.823  15.078  1.00 0.00 ? 1  MET B CG   1  
ATOM 563   S SD   . MET B 1 1  ? 13.529  -7.674  16.866  1.00 0.00 ? 1  MET B SD   1  
ATOM 564   C CE   . MET B 1 1  ? 14.739  -8.882  17.481  1.00 0.00 ? 1  MET B CE   1  
ATOM 565   H H    . MET B 1 1  ? 17.044  -7.488  13.002  1.00 0.00 ? 1  MET B H    1  
ATOM 566   H HA   . MET B 1 1  ? 14.344  -6.961  12.758  1.00 0.00 ? 1  MET B HA   1  
ATOM 567   H HB2  . MET B 1 1  ? 15.912  -8.075  14.681  1.00 0.00 ? 1  MET B HB2  1  
ATOM 568   H HB3  . MET B 1 1  ? 15.508  -6.542  15.478  1.00 0.00 ? 1  MET B HB3  1  
ATOM 569   H HG2  . MET B 1 1  ? 13.044  -7.265  14.547  1.00 0.00 ? 1  MET B HG2  1  
ATOM 570   H HG3  . MET B 1 1  ? 13.765  -8.870  14.779  1.00 0.00 ? 1  MET B HG3  1  
ATOM 571   H HE1  . MET B 1 1  ? 15.742  -8.598  17.163  1.00 0.00 ? 1  MET B HE1  1  
ATOM 572   H HE2  . MET B 1 1  ? 14.689  -8.911  18.570  1.00 0.00 ? 1  MET B HE2  1  
ATOM 573   H HE3  . MET B 1 1  ? 14.509  -9.872  17.089  1.00 0.00 ? 1  MET B HE3  1  
ATOM 574   N N    . ASP B 1 2  ? 16.012  -4.329  13.903  1.00 0.00 ? 2  ASP B N    1  
ATOM 575   C CA   . ASP B 1 2  ? 15.933  -2.895  14.124  1.00 0.00 ? 2  ASP B CA   1  
ATOM 576   C C    . ASP B 1 2  ? 15.274  -2.233  12.912  1.00 0.00 ? 2  ASP B C    1  
ATOM 577   O O    . ASP B 1 2  ? 14.541  -1.251  13.102  1.00 0.00 ? 2  ASP B O    1  
ATOM 578   C CB   . ASP B 1 2  ? 17.326  -2.287  14.296  1.00 0.00 ? 2  ASP B CB   1  
ATOM 579   C CG   . ASP B 1 2  ? 18.350  -3.198  14.975  1.00 0.00 ? 2  ASP B CG   1  
ATOM 580   O OD1  . ASP B 1 2  ? 18.754  -4.193  14.259  1.00 0.00 ? 2  ASP B OD1  1  
ATOM 581   O OD2  . ASP B 1 2  ? 18.743  -2.970  16.129  1.00 0.00 ? 2  ASP B OD2  1  
ATOM 582   H H    . ASP B 1 2  ? 16.920  -4.781  14.015  1.00 0.00 ? 2  ASP B H    1  
ATOM 583   H HA   . ASP B 1 2  ? 15.322  -2.706  15.007  1.00 0.00 ? 2  ASP B HA   1  
ATOM 584   H HB2  . ASP B 1 2  ? 17.685  -2.029  13.300  1.00 0.00 ? 2  ASP B HB2  1  
ATOM 585   H HB3  . ASP B 1 2  ? 17.200  -1.372  14.876  1.00 0.00 ? 2  ASP B HB3  1  
ATOM 586   N N    . ALA B 1 3  ? 15.544  -2.772  11.710  1.00 0.00 ? 3  ALA B N    1  
ATOM 587   C CA   . ALA B 1 3  ? 14.982  -2.237  10.481  1.00 0.00 ? 3  ALA B CA   1  
ATOM 588   C C    . ALA B 1 3  ? 13.651  -2.933  10.189  1.00 0.00 ? 3  ALA B C    1  
ATOM 589   O O    . ALA B 1 3  ? 12.888  -2.421  9.357   1.00 0.00 ? 3  ALA B O    1  
ATOM 590   C CB   . ALA B 1 3  ? 15.905  -2.566  9.306   1.00 0.00 ? 3  ALA B CB   1  
ATOM 591   H H    . ALA B 1 3  ? 16.161  -3.582  11.641  1.00 0.00 ? 3  ALA B H    1  
ATOM 592   H HA   . ALA B 1 3  ? 14.811  -1.164  10.561  1.00 0.00 ? 3  ALA B HA   1  
ATOM 593   H HB1  . ALA B 1 3  ? 16.886  -2.127  9.492   1.00 0.00 ? 3  ALA B HB1  1  
ATOM 594   H HB2  . ALA B 1 3  ? 16.013  -3.646  9.209   1.00 0.00 ? 3  ALA B HB2  1  
ATOM 595   H HB3  . ALA B 1 3  ? 15.488  -2.167  8.382   1.00 0.00 ? 3  ALA B HB3  1  
ATOM 596   N N    . ILE B 1 4  ? 13.403  -4.068  10.868  1.00 0.00 ? 4  ILE B N    1  
ATOM 597   C CA   . ILE B 1 4  ? 12.176  -4.823  10.682  1.00 0.00 ? 4  ILE B CA   1  
ATOM 598   C C    . ILE B 1 4  ? 11.030  -4.113  11.405  1.00 0.00 ? 4  ILE B C    1  
ATOM 599   O O    . ILE B 1 4  ? 9.954   -3.970  10.806  1.00 0.00 ? 4  ILE B O    1  
ATOM 600   C CB   . ILE B 1 4  ? 12.371  -6.277  11.118  1.00 0.00 ? 4  ILE B CB   1  
ATOM 601   C CG1  . ILE B 1 4  ? 13.439  -6.966  10.266  1.00 0.00 ? 4  ILE B CG1  1  
ATOM 602   C CG2  . ILE B 1 4  ? 11.044  -7.038  11.099  1.00 0.00 ? 4  ILE B CG2  1  
ATOM 603   C CD1  . ILE B 1 4  ? 12.967  -8.347  9.807   1.00 0.00 ? 4  ILE B CD1  1  
ATOM 604   H H    . ILE B 1 4  ? 14.087  -4.422  11.537  1.00 0.00 ? 4  ILE B H    1  
ATOM 605   H HA   . ILE B 1 4  ? 11.973  -4.825  9.611   1.00 0.00 ? 4  ILE B HA   1  
ATOM 606   H HB   . ILE B 1 4  ? 12.721  -6.220  12.149  1.00 0.00 ? 4  ILE B HB   1  
ATOM 607   H HG12 . ILE B 1 4  ? 13.644  -6.351  9.390   1.00 0.00 ? 4  ILE B HG12 1  
ATOM 608   H HG13 . ILE B 1 4  ? 14.352  -7.062  10.854  1.00 0.00 ? 4  ILE B HG13 1  
ATOM 609   H HG21 . ILE B 1 4  ? 10.621  -7.024  10.094  1.00 0.00 ? 4  ILE B HG21 1  
ATOM 610   H HG22 . ILE B 1 4  ? 11.220  -8.066  11.414  1.00 0.00 ? 4  ILE B HG22 1  
ATOM 611   H HG23 . ILE B 1 4  ? 10.338  -6.572  11.787  1.00 0.00 ? 4  ILE B HG23 1  
ATOM 612   H HD11 . ILE B 1 4  ? 12.054  -8.251  9.219   1.00 0.00 ? 4  ILE B HD11 1  
ATOM 613   H HD12 . ILE B 1 4  ? 13.750  -8.808  9.204   1.00 0.00 ? 4  ILE B HD12 1  
ATOM 614   H HD13 . ILE B 1 4  ? 12.767  -8.979  10.672  1.00 0.00 ? 4  ILE B HD13 1  
ATOM 615   N N    . LYS B 1 5  ? 11.279  -3.688  12.657  1.00 0.00 ? 5  LYS B N    1  
ATOM 616   C CA   . LYS B 1 5  ? 10.275  -3.001  13.450  1.00 0.00 ? 5  LYS B CA   1  
ATOM 617   C C    . LYS B 1 5  ? 9.762   -1.786  12.674  1.00 0.00 ? 5  LYS B C    1  
ATOM 618   O O    . LYS B 1 5  ? 8.570   -1.468  12.798  1.00 0.00 ? 5  LYS B O    1  
ATOM 619   C CB   . LYS B 1 5  ? 10.829  -2.657  14.834  1.00 0.00 ? 5  LYS B CB   1  
ATOM 620   C CG   . LYS B 1 5  ? 12.353  -2.529  14.799  1.00 0.00 ? 5  LYS B CG   1  
ATOM 621   C CD   . LYS B 1 5  ? 12.842  -1.508  15.828  1.00 0.00 ? 5  LYS B CD   1  
ATOM 622   C CE   . LYS B 1 5  ? 13.139  -2.182  17.169  1.00 0.00 ? 5  LYS B CE   1  
ATOM 623   N NZ   . LYS B 1 5  ? 12.571  -1.398  18.278  1.00 0.00 ? 5  LYS B NZ   1  
ATOM 624   H H    . LYS B 1 5  ? 12.195  -3.847  13.076  1.00 0.00 ? 5  LYS B H    1  
ATOM 625   H HA   . LYS B 1 5  ? 9.455   -3.705  13.589  1.00 0.00 ? 5  LYS B HA   1  
ATOM 626   H HB2  . LYS B 1 5  ? 10.401  -1.710  15.162  1.00 0.00 ? 5  LYS B HB2  1  
ATOM 627   H HB3  . LYS B 1 5  ? 10.538  -3.439  15.536  1.00 0.00 ? 5  LYS B HB3  1  
ATOM 628   H HG2  . LYS B 1 5  ? 12.795  -3.499  15.023  1.00 0.00 ? 5  LYS B HG2  1  
ATOM 629   H HG3  . LYS B 1 5  ? 12.658  -2.223  13.798  1.00 0.00 ? 5  LYS B HG3  1  
ATOM 630   H HD2  . LYS B 1 5  ? 13.753  -1.039  15.457  1.00 0.00 ? 5  LYS B HD2  1  
ATOM 631   H HD3  . LYS B 1 5  ? 12.077  -0.743  15.959  1.00 0.00 ? 5  LYS B HD3  1  
ATOM 632   H HE2  . LYS B 1 5  ? 12.697  -3.178  17.176  1.00 0.00 ? 5  LYS B HE2  1  
ATOM 633   H HE3  . LYS B 1 5  ? 14.219  -2.272  17.293  1.00 0.00 ? 5  LYS B HE3  1  
ATOM 634   H HZ1  . LYS B 1 5  ? 11.561  -1.314  18.162  1.00 0.00 ? 5  LYS B HZ1  1  
ATOM 635   H HZ2  . LYS B 1 5  ? 12.782  -1.866  19.159  1.00 0.00 ? 5  LYS B HZ2  1  
ATOM 636   H HZ3  . LYS B 1 5  ? 12.982  -0.465  18.291  1.00 0.00 ? 5  LYS B HZ3  1  
ATOM 637   N N    . LYS B 1 6  ? 10.656  -1.142  11.903  1.00 0.00 ? 6  LYS B N    1  
ATOM 638   C CA   . LYS B 1 6  ? 10.296  0.025   11.117  1.00 0.00 ? 6  LYS B CA   1  
ATOM 639   C C    . LYS B 1 6  ? 9.788   -0.425  9.746   1.00 0.00 ? 6  LYS B C    1  
ATOM 640   O O    . LYS B 1 6  ? 8.973   0.297   9.153   1.00 0.00 ? 6  LYS B O    1  
ATOM 641   C CB   . LYS B 1 6  ? 11.468  1.006   11.046  1.00 0.00 ? 6  LYS B CB   1  
ATOM 642   C CG   . LYS B 1 6  ? 12.342  0.907   12.298  1.00 0.00 ? 6  LYS B CG   1  
ATOM 643   C CD   . LYS B 1 6  ? 12.966  2.262   12.640  1.00 0.00 ? 6  LYS B CD   1  
ATOM 644   C CE   . LYS B 1 6  ? 13.634  2.884   11.412  1.00 0.00 ? 6  LYS B CE   1  
ATOM 645   N NZ   . LYS B 1 6  ? 15.089  2.663   11.450  1.00 0.00 ? 6  LYS B NZ   1  
ATOM 646   H H    . LYS B 1 6  ? 11.621  -1.471  11.858  1.00 0.00 ? 6  LYS B H    1  
ATOM 647   H HA   . LYS B 1 6  ? 9.485   0.520   11.651  1.00 0.00 ? 6  LYS B HA   1  
ATOM 648   H HB2  . LYS B 1 6  ? 12.074  0.771   10.171  1.00 0.00 ? 6  LYS B HB2  1  
ATOM 649   H HB3  . LYS B 1 6  ? 11.077  2.018   10.946  1.00 0.00 ? 6  LYS B HB3  1  
ATOM 650   H HG2  . LYS B 1 6  ? 11.726  0.579   13.135  1.00 0.00 ? 6  LYS B HG2  1  
ATOM 651   H HG3  . LYS B 1 6  ? 13.127  0.171   12.124  1.00 0.00 ? 6  LYS B HG3  1  
ATOM 652   H HD2  . LYS B 1 6  ? 12.183  2.932   12.995  1.00 0.00 ? 6  LYS B HD2  1  
ATOM 653   H HD3  . LYS B 1 6  ? 13.701  2.123   13.433  1.00 0.00 ? 6  LYS B HD3  1  
ATOM 654   H HE2  . LYS B 1 6  ? 13.229  2.423   10.511  1.00 0.00 ? 6  LYS B HE2  1  
ATOM 655   H HE3  . LYS B 1 6  ? 13.421  3.952   11.391  1.00 0.00 ? 6  LYS B HE3  1  
ATOM 656   H HZ1  . LYS B 1 6  ? 15.289  1.663   11.470  1.00 0.00 ? 6  LYS B HZ1  1  
ATOM 657   H HZ2  . LYS B 1 6  ? 15.511  3.085   10.623  1.00 0.00 ? 6  LYS B HZ2  1  
ATOM 658   H HZ3  . LYS B 1 6  ? 15.486  3.097   12.283  1.00 0.00 ? 6  LYS B HZ3  1  
ATOM 659   N N    . LYS B 1 7  ? 10.271  -1.590  9.278   1.00 0.00 ? 7  LYS B N    1  
ATOM 660   C CA   . LYS B 1 7  ? 9.868   -2.129  7.990   1.00 0.00 ? 7  LYS B CA   1  
ATOM 661   C C    . LYS B 1 7  ? 8.344   -2.250  7.946   1.00 0.00 ? 7  LYS B C    1  
ATOM 662   O O    . LYS B 1 7  ? 7.741   -1.771  6.974   1.00 0.00 ? 7  LYS B O    1  
ATOM 663   C CB   . LYS B 1 7  ? 10.598  -3.443  7.707   1.00 0.00 ? 7  LYS B CB   1  
ATOM 664   C CG   . LYS B 1 7  ? 10.116  -4.067  6.396   1.00 0.00 ? 7  LYS B CG   1  
ATOM 665   C CD   . LYS B 1 7  ? 10.179  -3.053  5.251   1.00 0.00 ? 7  LYS B CD   1  
ATOM 666   C CE   . LYS B 1 7  ? 10.578  -3.732  3.939   1.00 0.00 ? 7  LYS B CE   1  
ATOM 667   N NZ   . LYS B 1 7  ? 9.617   -4.793  3.595   1.00 0.00 ? 7  LYS B NZ   1  
ATOM 668   H H    . LYS B 1 7  ? 10.940  -2.124  9.832   1.00 0.00 ? 7  LYS B H    1  
ATOM 669   H HA   . LYS B 1 7  ? 10.188  -1.406  7.239   1.00 0.00 ? 7  LYS B HA   1  
ATOM 670   H HB2  . LYS B 1 7  ? 11.667  -3.246  7.634   1.00 0.00 ? 7  LYS B HB2  1  
ATOM 671   H HB3  . LYS B 1 7  ? 10.420  -4.131  8.533   1.00 0.00 ? 7  LYS B HB3  1  
ATOM 672   H HG2  . LYS B 1 7  ? 10.754  -4.917  6.152   1.00 0.00 ? 7  LYS B HG2  1  
ATOM 673   H HG3  . LYS B 1 7  ? 9.092   -4.417  6.526   1.00 0.00 ? 7  LYS B HG3  1  
ATOM 674   H HD2  . LYS B 1 7  ? 9.197   -2.595  5.129   1.00 0.00 ? 7  LYS B HD2  1  
ATOM 675   H HD3  . LYS B 1 7  ? 10.903  -2.279  5.504   1.00 0.00 ? 7  LYS B HD3  1  
ATOM 676   H HE2  . LYS B 1 7  ? 10.588  -2.990  3.140   1.00 0.00 ? 7  LYS B HE2  1  
ATOM 677   H HE3  . LYS B 1 7  ? 11.577  -4.155  4.044   1.00 0.00 ? 7  LYS B HE3  1  
ATOM 678   H HZ1  . LYS B 1 7  ? 8.682   -4.398  3.497   1.00 0.00 ? 7  LYS B HZ1  1  
ATOM 679   H HZ2  . LYS B 1 7  ? 9.904   -5.230  2.719   1.00 0.00 ? 7  LYS B HZ2  1  
ATOM 680   H HZ3  . LYS B 1 7  ? 9.603   -5.501  4.330   1.00 0.00 ? 7  LYS B HZ3  1  
ATOM 681   N N    . MET B 1 8  ? 7.760   -2.877  8.983   1.00 0.00 ? 8  MET B N    1  
ATOM 682   C CA   . MET B 1 8  ? 6.320   -3.058  9.062   1.00 0.00 ? 8  MET B CA   1  
ATOM 683   C C    . MET B 1 8  ? 5.645   -1.692  9.193   1.00 0.00 ? 8  MET B C    1  
ATOM 684   O O    . MET B 1 8  ? 4.474   -1.572  8.805   1.00 0.00 ? 8  MET B O    1  
ATOM 685   C CB   . MET B 1 8  ? 5.958   -3.926  10.269  1.00 0.00 ? 8  MET B CB   1  
ATOM 686   C CG   . MET B 1 8  ? 6.555   -3.352  11.555  1.00 0.00 ? 8  MET B CG   1  
ATOM 687   S SD   . MET B 1 8  ? 5.949   -4.285  12.992  1.00 0.00 ? 8  MET B SD   1  
ATOM 688   C CE   . MET B 1 8  ? 5.913   -2.960  14.235  1.00 0.00 ? 8  MET B CE   1  
ATOM 689   H H    . MET B 1 8  ? 8.331   -3.243  9.745   1.00 0.00 ? 8  MET B H    1  
ATOM 690   H HA   . MET B 1 8  ? 5.973   -3.539  8.147   1.00 0.00 ? 8  MET B HA   1  
ATOM 691   H HB2  . MET B 1 8  ? 4.873   -3.960  10.367  1.00 0.00 ? 8  MET B HB2  1  
ATOM 692   H HB3  . MET B 1 8  ? 6.331   -4.936  10.103  1.00 0.00 ? 8  MET B HB3  1  
ATOM 693   H HG2  . MET B 1 8  ? 7.642   -3.428  11.515  1.00 0.00 ? 8  MET B HG2  1  
ATOM 694   H HG3  . MET B 1 8  ? 6.276   -2.303  11.648  1.00 0.00 ? 8  MET B HG3  1  
ATOM 695   H HE1  . MET B 1 8  ? 5.250   -2.160  13.907  1.00 0.00 ? 8  MET B HE1  1  
ATOM 696   H HE2  . MET B 1 8  ? 5.561   -3.371  15.181  1.00 0.00 ? 8  MET B HE2  1  
ATOM 697   H HE3  . MET B 1 8  ? 6.915   -2.555  14.376  1.00 0.00 ? 8  MET B HE3  1  
ATOM 698   N N    . GLN B 1 9  ? 6.384   -0.704  9.730   1.00 0.00 ? 9  GLN B N    1  
ATOM 699   C CA   . GLN B 1 9  ? 5.860   0.639   9.910   1.00 0.00 ? 9  GLN B CA   1  
ATOM 700   C C    . GLN B 1 9  ? 5.943   1.396   8.583   1.00 0.00 ? 9  GLN B C    1  
ATOM 701   O O    . GLN B 1 9  ? 5.206   2.380   8.419   1.00 0.00 ? 9  GLN B O    1  
ATOM 702   C CB   . GLN B 1 9  ? 6.605   1.389   11.016  1.00 0.00 ? 9  GLN B CB   1  
ATOM 703   C CG   . GLN B 1 9  ? 6.278   0.805   12.392  1.00 0.00 ? 9  GLN B CG   1  
ATOM 704   C CD   . GLN B 1 9  ? 6.678   1.772   13.508  1.00 0.00 ? 9  GLN B CD   1  
ATOM 705   O OE1  . GLN B 1 9  ? 5.957   2.694   13.853  1.00 0.00 ? 9  GLN B OE1  1  
ATOM 706   N NE2  . GLN B 1 9  ? 7.863   1.512   14.050  1.00 0.00 ? 9  GLN B NE2  1  
ATOM 707   H H    . GLN B 1 9  ? 7.343   -0.888  10.025  1.00 0.00 ? 9  GLN B H    1  
ATOM 708   H HA   . GLN B 1 9  ? 4.814   0.536   10.196  1.00 0.00 ? 9  GLN B HA   1  
ATOM 709   H HB2  . GLN B 1 9  ? 7.678   1.305   10.841  1.00 0.00 ? 9  GLN B HB2  1  
ATOM 710   H HB3  . GLN B 1 9  ? 6.322   2.441   10.982  1.00 0.00 ? 9  GLN B HB3  1  
ATOM 711   H HG2  . GLN B 1 9  ? 5.205   0.619   12.451  1.00 0.00 ? 9  GLN B HG2  1  
ATOM 712   H HG3  . GLN B 1 9  ? 6.809   -0.139  12.510  1.00 0.00 ? 9  GLN B HG3  1  
ATOM 713   H HE21 . GLN B 1 9  ? 8.416   0.724   13.713  1.00 0.00 ? 9  GLN B HE21 1  
ATOM 714   H HE22 . GLN B 1 9  ? 8.220   2.100   14.803  1.00 0.00 ? 9  GLN B HE22 1  
ATOM 715   N N    . MET B 1 10 ? 6.822   0.930   7.678   1.00 0.00 ? 10 MET B N    1  
ATOM 716   C CA   . MET B 1 10 ? 6.996   1.559   6.380   1.00 0.00 ? 10 MET B CA   1  
ATOM 717   C C    . MET B 1 10 ? 5.875   1.104   5.443   1.00 0.00 ? 10 MET B C    1  
ATOM 718   O O    . MET B 1 10 ? 5.340   1.948   4.710   1.00 0.00 ? 10 MET B O    1  
ATOM 719   C CB   . MET B 1 10 ? 8.351   1.176   5.780   1.00 0.00 ? 10 MET B CB   1  
ATOM 720   C CG   . MET B 1 10 ? 9.489   1.488   6.753   1.00 0.00 ? 10 MET B CG   1  
ATOM 721   S SD   . MET B 1 10 ? 10.695  2.595   5.965   1.00 0.00 ? 10 MET B SD   1  
ATOM 722   C CE   . MET B 1 10 ? 11.255  3.536   7.415   1.00 0.00 ? 10 MET B CE   1  
ATOM 723   H H    . MET B 1 10 ? 7.391   0.112   7.894   1.00 0.00 ? 10 MET B H    1  
ATOM 724   H HA   . MET B 1 10 ? 6.940   2.641   6.500   1.00 0.00 ? 10 MET B HA   1  
ATOM 725   H HB2  . MET B 1 10 ? 8.352   0.108   5.562   1.00 0.00 ? 10 MET B HB2  1  
ATOM 726   H HB3  . MET B 1 10 ? 8.494   1.728   4.851   1.00 0.00 ? 10 MET B HB3  1  
ATOM 727   H HG2  . MET B 1 10 ? 9.085   1.977   7.639   1.00 0.00 ? 10 MET B HG2  1  
ATOM 728   H HG3  . MET B 1 10 ? 9.976   0.560   7.051   1.00 0.00 ? 10 MET B HG3  1  
ATOM 729   H HE1  . MET B 1 10 ? 11.683  2.859   8.154   1.00 0.00 ? 10 MET B HE1  1  
ATOM 730   H HE2  . MET B 1 10 ? 12.003  4.263   7.099   1.00 0.00 ? 10 MET B HE2  1  
ATOM 731   H HE3  . MET B 1 10 ? 10.413  4.064   7.862   1.00 0.00 ? 10 MET B HE3  1  
ATOM 732   N N    . LEU B 1 11 ? 5.549   -0.200  5.484   1.00 0.00 ? 11 LEU B N    1  
ATOM 733   C CA   . LEU B 1 11 ? 4.503   -0.759  4.644   1.00 0.00 ? 11 LEU B CA   1  
ATOM 734   C C    . LEU B 1 11 ? 3.137   -0.405  5.236   1.00 0.00 ? 11 LEU B C    1  
ATOM 735   O O    . LEU B 1 11 ? 2.160   -0.354  4.475   1.00 0.00 ? 11 LEU B O    1  
ATOM 736   C CB   . LEU B 1 11 ? 4.718   -2.261  4.449   1.00 0.00 ? 11 LEU B CB   1  
ATOM 737   C CG   . LEU B 1 11 ? 6.027   -2.669  3.770   1.00 0.00 ? 11 LEU B CG   1  
ATOM 738   C CD1  . LEU B 1 11 ? 6.120   -4.189  3.626   1.00 0.00 ? 11 LEU B CD1  1  
ATOM 739   C CD2  . LEU B 1 11 ? 6.195   -1.954  2.428   1.00 0.00 ? 11 LEU B CD2  1  
ATOM 740   H H    . LEU B 1 11 ? 6.042   -0.830  6.117   1.00 0.00 ? 11 LEU B H    1  
ATOM 741   H HA   . LEU B 1 11 ? 4.601   -0.282  3.669   1.00 0.00 ? 11 LEU B HA   1  
ATOM 742   H HB2  . LEU B 1 11 ? 4.677   -2.709  5.441   1.00 0.00 ? 11 LEU B HB2  1  
ATOM 743   H HB3  . LEU B 1 11 ? 3.869   -2.617  3.864   1.00 0.00 ? 11 LEU B HB3  1  
ATOM 744   H HG   . LEU B 1 11 ? 6.813   -2.338  4.449   1.00 0.00 ? 11 LEU B HG   1  
ATOM 745   H HD11 . LEU B 1 11 ? 5.284   -4.558  3.031   1.00 0.00 ? 11 LEU B HD11 1  
ATOM 746   H HD12 . LEU B 1 11 ? 7.062   -4.443  3.141   1.00 0.00 ? 11 LEU B HD12 1  
ATOM 747   H HD13 . LEU B 1 11 ? 6.089   -4.658  4.609   1.00 0.00 ? 11 LEU B HD13 1  
ATOM 748   H HD21 . LEU B 1 11 ? 6.196   -0.875  2.579   1.00 0.00 ? 11 LEU B HD21 1  
ATOM 749   H HD22 . LEU B 1 11 ? 7.135   -2.267  1.975   1.00 0.00 ? 11 LEU B HD22 1  
ATOM 750   H HD23 . LEU B 1 11 ? 5.374   -2.218  1.761   1.00 0.00 ? 11 LEU B HD23 1  
ATOM 751   N N    . LYS B 1 12 ? 3.097   -0.172  6.561   1.00 0.00 ? 12 LYS B N    1  
ATOM 752   C CA   . LYS B 1 12 ? 1.862   0.172   7.245   1.00 0.00 ? 12 LYS B CA   1  
ATOM 753   C C    . LYS B 1 12 ? 1.509   1.631   6.947   1.00 0.00 ? 12 LYS B C    1  
ATOM 754   O O    . LYS B 1 12 ? 0.312   1.944   6.870   1.00 0.00 ? 12 LYS B O    1  
ATOM 755   C CB   . LYS B 1 12 ? 1.971   -0.141  8.738   1.00 0.00 ? 12 LYS B CB   1  
ATOM 756   C CG   . LYS B 1 12 ? 1.061   0.775   9.559   1.00 0.00 ? 12 LYS B CG   1  
ATOM 757   C CD   . LYS B 1 12 ? 1.754   2.104   9.866   1.00 0.00 ? 12 LYS B CD   1  
ATOM 758   C CE   . LYS B 1 12 ? 1.961   2.279   11.371  1.00 0.00 ? 12 LYS B CE   1  
ATOM 759   N NZ   . LYS B 1 12 ? 0.858   3.058   11.957  1.00 0.00 ? 12 LYS B NZ   1  
ATOM 760   H H    . LYS B 1 12 ? 3.950   -0.236  7.116   1.00 0.00 ? 12 LYS B H    1  
ATOM 761   H HA   . LYS B 1 12 ? 1.087   -0.472  6.829   1.00 0.00 ? 12 LYS B HA   1  
ATOM 762   H HB2  . LYS B 1 12 ? 1.676   -1.177  8.905   1.00 0.00 ? 12 LYS B HB2  1  
ATOM 763   H HB3  . LYS B 1 12 ? 3.007   -0.013  9.051   1.00 0.00 ? 12 LYS B HB3  1  
ATOM 764   H HG2  . LYS B 1 12 ? 0.152   0.972   8.990   1.00 0.00 ? 12 LYS B HG2  1  
ATOM 765   H HG3  . LYS B 1 12 ? 0.797   0.270   10.488  1.00 0.00 ? 12 LYS B HG3  1  
ATOM 766   H HD2  . LYS B 1 12 ? 2.724   2.121   9.370   1.00 0.00 ? 12 LYS B HD2  1  
ATOM 767   H HD3  . LYS B 1 12 ? 1.143   2.919   9.478   1.00 0.00 ? 12 LYS B HD3  1  
ATOM 768   H HE2  . LYS B 1 12 ? 1.994   1.298   11.845  1.00 0.00 ? 12 LYS B HE2  1  
ATOM 769   H HE3  . LYS B 1 12 ? 2.909   2.789   11.546  1.00 0.00 ? 12 LYS B HE3  1  
ATOM 770   H HZ1  . LYS B 1 12 ? -0.029  2.581   11.794  1.00 0.00 ? 12 LYS B HZ1  1  
ATOM 771   H HZ2  . LYS B 1 12 ? 1.019   3.160   12.959  1.00 0.00 ? 12 LYS B HZ2  1  
ATOM 772   H HZ3  . LYS B 1 12 ? 0.820   3.983   11.530  1.00 0.00 ? 12 LYS B HZ3  1  
ATOM 773   N N    . LEU B 1 13 ? 2.540   2.480   6.787   1.00 0.00 ? 13 LEU B N    1  
ATOM 774   C CA   . LEU B 1 13 ? 2.340   3.890   6.500   1.00 0.00 ? 13 LEU B CA   1  
ATOM 775   C C    . LEU B 1 13 ? 1.929   4.055   5.035   1.00 0.00 ? 13 LEU B C    1  
ATOM 776   O O    . LEU B 1 13 ? 0.979   4.806   4.770   1.00 0.00 ? 13 LEU B O    1  
ATOM 777   C CB   . LEU B 1 13 ? 3.582   4.697   6.885   1.00 0.00 ? 13 LEU B CB   1  
ATOM 778   C CG   . LEU B 1 13 ? 3.382   6.207   7.029   1.00 0.00 ? 13 LEU B CG   1  
ATOM 779   C CD1  . LEU B 1 13 ? 4.677   6.962   6.724   1.00 0.00 ? 13 LEU B CD1  1  
ATOM 780   C CD2  . LEU B 1 13 ? 2.218   6.691   6.163   1.00 0.00 ? 13 LEU B CD2  1  
ATOM 781   H H    . LEU B 1 13 ? 3.498   2.139   6.866   1.00 0.00 ? 13 LEU B H    1  
ATOM 782   H HA   . LEU B 1 13 ? 1.521   4.222   7.138   1.00 0.00 ? 13 LEU B HA   1  
ATOM 783   H HB2  . LEU B 1 13 ? 3.929   4.292   7.836   1.00 0.00 ? 13 LEU B HB2  1  
ATOM 784   H HB3  . LEU B 1 13 ? 4.329   4.492   6.118   1.00 0.00 ? 13 LEU B HB3  1  
ATOM 785   H HG   . LEU B 1 13 ? 3.132   6.362   8.079   1.00 0.00 ? 13 LEU B HG   1  
ATOM 786   H HD11 . LEU B 1 13 ? 5.004   6.744   5.707   1.00 0.00 ? 13 LEU B HD11 1  
ATOM 787   H HD12 . LEU B 1 13 ? 4.499   8.032   6.836   1.00 0.00 ? 13 LEU B HD12 1  
ATOM 788   H HD13 . LEU B 1 13 ? 5.458   6.658   7.420   1.00 0.00 ? 13 LEU B HD13 1  
ATOM 789   H HD21 . LEU B 1 13 ? 1.299   6.184   6.457   1.00 0.00 ? 13 LEU B HD21 1  
ATOM 790   H HD22 . LEU B 1 13 ? 2.106   7.768   6.290   1.00 0.00 ? 13 LEU B HD22 1  
ATOM 791   H HD23 . LEU B 1 13 ? 2.421   6.477   5.114   1.00 0.00 ? 13 LEU B HD23 1  
ATOM 792   N N    . ASP B 1 14 ? 2.640   3.361   4.129   1.00 0.00 ? 14 ASP B N    1  
ATOM 793   C CA   . ASP B 1 14 ? 2.351   3.431   2.706   1.00 0.00 ? 14 ASP B CA   1  
ATOM 794   C C    . ASP B 1 14 ? 0.928   2.929   2.454   1.00 0.00 ? 14 ASP B C    1  
ATOM 795   O O    . ASP B 1 14 ? 0.271   3.453   1.543   1.00 0.00 ? 14 ASP B O    1  
ATOM 796   C CB   . ASP B 1 14 ? 3.312   2.549   1.905   1.00 0.00 ? 14 ASP B CB   1  
ATOM 797   C CG   . ASP B 1 14 ? 3.807   3.159   0.593   1.00 0.00 ? 14 ASP B CG   1  
ATOM 798   O OD1  . ASP B 1 14 ? 4.492   4.245   0.720   1.00 0.00 ? 14 ASP B OD1  1  
ATOM 799   O OD2  . ASP B 1 14 ? 3.551   2.624   -0.497  1.00 0.00 ? 14 ASP B OD2  1  
ATOM 800   H H    . ASP B 1 14 ? 3.410   2.764   4.432   1.00 0.00 ? 14 ASP B H    1  
ATOM 801   H HA   . ASP B 1 14 ? 2.425   4.468   2.380   1.00 0.00 ? 14 ASP B HA   1  
ATOM 802   H HB2  . ASP B 1 14 ? 4.169   2.348   2.549   1.00 0.00 ? 14 ASP B HB2  1  
ATOM 803   H HB3  . ASP B 1 14 ? 2.790   1.613   1.707   1.00 0.00 ? 14 ASP B HB3  1  
ATOM 804   N N    . ASN B 1 15 ? 0.488   1.941   3.253   1.00 0.00 ? 15 ASN B N    1  
ATOM 805   C CA   . ASN B 1 15 ? -0.845  1.377   3.118   1.00 0.00 ? 15 ASN B CA   1  
ATOM 806   C C    . ASN B 1 15 ? -1.885  2.479   3.330   1.00 0.00 ? 15 ASN B C    1  
ATOM 807   O O    . ASN B 1 15 ? -2.792  2.603   2.494   1.00 0.00 ? 15 ASN B O    1  
ATOM 808   C CB   . ASN B 1 15 ? -1.090  0.287   4.163   1.00 0.00 ? 15 ASN B CB   1  
ATOM 809   C CG   . ASN B 1 15 ? -2.043  -0.783  3.626   1.00 0.00 ? 15 ASN B CG   1  
ATOM 810   O OD1  . ASN B 1 15 ? -3.251  -0.710  3.782   1.00 0.00 ? 15 ASN B OD1  1  
ATOM 811   N ND2  . ASN B 1 15 ? -1.434  -1.778  2.987   1.00 0.00 ? 15 ASN B ND2  1  
ATOM 812   H H    . ASN B 1 15 ? 1.095   1.565   3.982   1.00 0.00 ? 15 ASN B H    1  
ATOM 813   H HA   . ASN B 1 15 ? -0.957  0.972   2.112   1.00 0.00 ? 15 ASN B HA   1  
ATOM 814   H HB2  . ASN B 1 15 ? -0.139  -0.180  4.418   1.00 0.00 ? 15 ASN B HB2  1  
ATOM 815   H HB3  . ASN B 1 15 ? -1.512  0.745   5.058   1.00 0.00 ? 15 ASN B HB3  1  
ATOM 816   H HD21 . ASN B 1 15 ? -0.418  -1.777  2.893   1.00 0.00 ? 15 ASN B HD21 1  
ATOM 817   H HD22 . ASN B 1 15 ? -1.982  -2.541  2.592   1.00 0.00 ? 15 ASN B HD22 1  
ATOM 818   N N    . TYR B 1 16 ? -1.735  3.245   4.425   1.00 0.00 ? 16 TYR B N    1  
ATOM 819   C CA   . TYR B 1 16 ? -2.693  4.306   4.686   1.00 0.00 ? 16 TYR B CA   1  
ATOM 820   C C    . TYR B 1 16 ? -2.671  5.304   3.526   1.00 0.00 ? 16 TYR B C    1  
ATOM 821   O O    . TYR B 1 16 ? -3.751  5.780   3.148   1.00 0.00 ? 16 TYR B O    1  
ATOM 822   C CB   . TYR B 1 16 ? -2.376  4.985   6.032   1.00 0.00 ? 16 TYR B CB   1  
ATOM 823   C CG   . TYR B 1 16 ? -2.192  4.022   7.197   1.00 0.00 ? 16 TYR B CG   1  
ATOM 824   C CD1  . TYR B 1 16 ? -2.828  2.760   7.178   1.00 0.00 ? 16 TYR B CD1  1  
ATOM 825   C CD2  . TYR B 1 16 ? -1.382  4.380   8.299   1.00 0.00 ? 16 TYR B CD2  1  
ATOM 826   C CE1  . TYR B 1 16 ? -2.658  1.863   8.254   1.00 0.00 ? 16 TYR B CE1  1  
ATOM 827   C CE2  . TYR B 1 16 ? -1.211  3.483   9.375   1.00 0.00 ? 16 TYR B CE2  1  
ATOM 828   C CZ   . TYR B 1 16 ? -1.850  2.223   9.354   1.00 0.00 ? 16 TYR B CZ   1  
ATOM 829   O OH   . TYR B 1 16 ? -1.689  1.352   10.394  1.00 0.00 ? 16 TYR B OH   1  
ATOM 830   H H    . TYR B 1 16 ? -0.972  3.091   5.068   1.00 0.00 ? 16 TYR B H    1  
ATOM 831   H HA   . TYR B 1 16 ? -3.689  3.863   4.734   1.00 0.00 ? 16 TYR B HA   1  
ATOM 832   H HB2  . TYR B 1 16 ? -1.479  5.598   5.920   1.00 0.00 ? 16 TYR B HB2  1  
ATOM 833   H HB3  . TYR B 1 16 ? -3.195  5.662   6.286   1.00 0.00 ? 16 TYR B HB3  1  
ATOM 834   H HD1  . TYR B 1 16 ? -3.447  2.476   6.339   1.00 0.00 ? 16 TYR B HD1  1  
ATOM 835   H HD2  . TYR B 1 16 ? -0.888  5.341   8.323   1.00 0.00 ? 16 TYR B HD2  1  
ATOM 836   H HE1  . TYR B 1 16 ? -3.149  0.900   8.231   1.00 0.00 ? 16 TYR B HE1  1  
ATOM 837   H HE2  . TYR B 1 16 ? -0.591  3.764   10.214  1.00 0.00 ? 16 TYR B HE2  1  
ATOM 838   H HH   . TYR B 1 16 ? -2.262  0.584   10.343  1.00 0.00 ? 16 TYR B HH   1  
ATOM 839   N N    . HIS B 1 17 ? -1.469  5.602   3.000   1.00 0.00 ? 17 HIS B N    1  
ATOM 840   C CA   . HIS B 1 17 ? -1.322  6.542   1.902   1.00 0.00 ? 17 HIS B CA   1  
ATOM 841   C C    . HIS B 1 17 ? -1.967  5.957   0.645   1.00 0.00 ? 17 HIS B C    1  
ATOM 842   O O    . HIS B 1 17 ? -2.619  6.714   -0.090  1.00 0.00 ? 17 HIS B O    1  
ATOM 843   C CB   . HIS B 1 17 ? 0.148   6.916   1.696   1.00 0.00 ? 17 HIS B CB   1  
ATOM 844   C CG   . HIS B 1 17 ? 0.606   6.831   0.259   1.00 0.00 ? 17 HIS B CG   1  
ATOM 845   N ND1  . HIS B 1 17 ? 0.544   7.905   -0.612  1.00 0.00 ? 17 HIS B ND1  1  
ATOM 846   C CD2  . HIS B 1 17 ? 1.136   5.792   -0.448  1.00 0.00 ? 17 HIS B CD2  1  
ATOM 847   C CE1  . HIS B 1 17 ? 1.016   7.517   -1.788  1.00 0.00 ? 17 HIS B CE1  1  
ATOM 848   N NE2  . HIS B 1 17 ? 1.382   6.207   -1.684  1.00 0.00 ? 17 HIS B NE2  1  
ATOM 849   H H    . HIS B 1 17 ? -0.627  5.163   3.371   1.00 0.00 ? 17 HIS B H    1  
ATOM 850   H HA   . HIS B 1 17 ? -1.861  7.443   2.192   1.00 0.00 ? 17 HIS B HA   1  
ATOM 851   H HB2  . HIS B 1 17 ? 0.278   7.938   2.050   1.00 0.00 ? 17 HIS B HB2  1  
ATOM 852   H HB3  . HIS B 1 17 ? 0.744   6.246   2.316   1.00 0.00 ? 17 HIS B HB3  1  
ATOM 853   H HD1  . HIS B 1 17 ? 0.216   8.862   -0.485  1.00 0.00 ? 17 HIS B HD1  1  
ATOM 854   H HD2  . HIS B 1 17 ? 1.361   4.774   -0.165  1.00 0.00 ? 17 HIS B HD2  1  
ATOM 855   H HE1  . HIS B 1 17 ? 1.053   8.214   -2.611  1.00 0.00 ? 17 HIS B HE1  1  
ATOM 856   N N    . LEU B 1 18 ? -1.778  4.643   0.426   1.00 0.00 ? 18 LEU B N    1  
ATOM 857   C CA   . LEU B 1 18 ? -2.338  3.967   -0.732  1.00 0.00 ? 18 LEU B CA   1  
ATOM 858   C C    . LEU B 1 18 ? -3.863  3.952   -0.620  1.00 0.00 ? 18 LEU B C    1  
ATOM 859   O O    . LEU B 1 18 ? -4.532  4.105   -1.652  1.00 0.00 ? 18 LEU B O    1  
ATOM 860   C CB   . LEU B 1 18 ? -1.719  2.577   -0.891  1.00 0.00 ? 18 LEU B CB   1  
ATOM 861   C CG   . LEU B 1 18 ? -0.263  2.540   -1.358  1.00 0.00 ? 18 LEU B CG   1  
ATOM 862   C CD1  . LEU B 1 18 ? 0.288   1.113   -1.324  1.00 0.00 ? 18 LEU B CD1  1  
ATOM 863   C CD2  . LEU B 1 18 ? -0.114  3.178   -2.741  1.00 0.00 ? 18 LEU B CD2  1  
ATOM 864   H H    . LEU B 1 18 ? -1.226  4.091   1.083   1.00 0.00 ? 18 LEU B H    1  
ATOM 865   H HA   . LEU B 1 18 ? -2.052  4.557   -1.603  1.00 0.00 ? 18 LEU B HA   1  
ATOM 866   H HB2  . LEU B 1 18 ? -1.792  2.094   0.084   1.00 0.00 ? 18 LEU B HB2  1  
ATOM 867   H HB3  . LEU B 1 18 ? -2.351  2.041   -1.600  1.00 0.00 ? 18 LEU B HB3  1  
ATOM 868   H HG   . LEU B 1 18 ? 0.285   3.139   -0.630  1.00 0.00 ? 18 LEU B HG   1  
ATOM 869   H HD11 . LEU B 1 18 ? -0.307  0.469   -1.971  1.00 0.00 ? 18 LEU B HD11 1  
ATOM 870   H HD12 . LEU B 1 18 ? 1.324   1.124   -1.662  1.00 0.00 ? 18 LEU B HD12 1  
ATOM 871   H HD13 . LEU B 1 18 ? 0.251   0.725   -0.306  1.00 0.00 ? 18 LEU B HD13 1  
ATOM 872   H HD21 . LEU B 1 18 ? -0.449  4.215   -2.710  1.00 0.00 ? 18 LEU B HD21 1  
ATOM 873   H HD22 . LEU B 1 18 ? 0.933   3.134   -3.041  1.00 0.00 ? 18 LEU B HD22 1  
ATOM 874   H HD23 . LEU B 1 18 ? -0.715  2.633   -3.468  1.00 0.00 ? 18 LEU B HD23 1  
ATOM 875   N N    . GLU B 1 19 ? -4.375  3.771   0.611   1.00 0.00 ? 19 GLU B N    1  
ATOM 876   C CA   . GLU B 1 19 ? -5.808  3.737   0.852   1.00 0.00 ? 19 GLU B CA   1  
ATOM 877   C C    . GLU B 1 19 ? -6.399  5.122   0.580   1.00 0.00 ? 19 GLU B C    1  
ATOM 878   O O    . GLU B 1 19 ? -7.388  5.205   -0.163  1.00 0.00 ? 19 GLU B O    1  
ATOM 879   C CB   . GLU B 1 19 ? -6.127  3.275   2.275   1.00 0.00 ? 19 GLU B CB   1  
ATOM 880   C CG   . GLU B 1 19 ? -7.450  2.508   2.318   1.00 0.00 ? 19 GLU B CG   1  
ATOM 881   C CD   . GLU B 1 19 ? -7.271  1.077   1.808   1.00 0.00 ? 19 GLU B CD   1  
ATOM 882   O OE1  . GLU B 1 19 ? -6.216  0.472   2.237   1.00 0.00 ? 19 GLU B OE1  1  
ATOM 883   O OE2  . GLU B 1 19 ? -8.109  0.584   1.038   1.00 0.00 ? 19 GLU B OE2  1  
ATOM 884   H H    . GLU B 1 19 ? -3.752  3.653   1.410   1.00 0.00 ? 19 GLU B H    1  
ATOM 885   H HA   . GLU B 1 19 ? -6.232  3.025   0.145   1.00 0.00 ? 19 GLU B HA   1  
ATOM 886   H HB2  . GLU B 1 19 ? -5.327  2.622   2.623   1.00 0.00 ? 19 GLU B HB2  1  
ATOM 887   H HB3  . GLU B 1 19 ? -6.182  4.147   2.926   1.00 0.00 ? 19 GLU B HB3  1  
ATOM 888   H HG2  . GLU B 1 19 ? -7.807  2.475   3.348   1.00 0.00 ? 19 GLU B HG2  1  
ATOM 889   H HG3  . GLU B 1 19 ? -8.183  3.032   1.705   1.00 0.00 ? 19 GLU B HG3  1  
ATOM 890   N N    . ASN B 1 20 ? -5.793  6.164   1.176   1.00 0.00 ? 20 ASN B N    1  
ATOM 891   C CA   . ASN B 1 20 ? -6.256  7.529   0.999   1.00 0.00 ? 20 ASN B CA   1  
ATOM 892   C C    . ASN B 1 20 ? -6.126  7.920   -0.475  1.00 0.00 ? 20 ASN B C    1  
ATOM 893   O O    . ASN B 1 20 ? -6.960  8.703   -0.953  1.00 0.00 ? 20 ASN B O    1  
ATOM 894   C CB   . ASN B 1 20 ? -5.417  8.508   1.824   1.00 0.00 ? 20 ASN B CB   1  
ATOM 895   C CG   . ASN B 1 20 ? -5.228  7.997   3.254   1.00 0.00 ? 20 ASN B CG   1  
ATOM 896   O OD1  . ASN B 1 20 ? -6.041  7.263   3.790   1.00 0.00 ? 20 ASN B OD1  1  
ATOM 897   N ND2  . ASN B 1 20 ? -4.114  8.427   3.838   1.00 0.00 ? 20 ASN B ND2  1  
ATOM 898   H H    . ASN B 1 20 ? -4.981  6.008   1.774   1.00 0.00 ? 20 ASN B H    1  
ATOM 899   H HA   . ASN B 1 20 ? -7.305  7.588   1.290   1.00 0.00 ? 20 ASN B HA   1  
ATOM 900   H HB2  . ASN B 1 20 ? -4.440  8.619   1.354   1.00 0.00 ? 20 ASN B HB2  1  
ATOM 901   H HB3  . ASN B 1 20 ? -5.916  9.477   1.838   1.00 0.00 ? 20 ASN B HB3  1  
ATOM 902   H HD21 . ASN B 1 20 ? -3.476  9.041   3.332   1.00 0.00 ? 20 ASN B HD21 1  
ATOM 903   H HD22 . ASN B 1 20 ? -3.897  8.142   4.793   1.00 0.00 ? 20 ASN B HD22 1  
ATOM 904   N N    . GLU B 1 21 ? -5.099  7.378   -1.153  1.00 0.00 ? 21 GLU B N    1  
ATOM 905   C CA   . GLU B 1 21 ? -4.864  7.668   -2.557  1.00 0.00 ? 21 GLU B CA   1  
ATOM 906   C C    . GLU B 1 21 ? -5.838  6.853   -3.412  1.00 0.00 ? 21 GLU B C    1  
ATOM 907   O O    . GLU B 1 21 ? -6.207  7.325   -4.497  1.00 0.00 ? 21 GLU B O    1  
ATOM 908   C CB   . GLU B 1 21 ? -3.415  7.384   -2.956  1.00 0.00 ? 21 GLU B CB   1  
ATOM 909   C CG   . GLU B 1 21 ? -3.109  7.941   -4.347  1.00 0.00 ? 21 GLU B CG   1  
ATOM 910   C CD   . GLU B 1 21 ? -1.805  7.360   -4.896  1.00 0.00 ? 21 GLU B CD   1  
ATOM 911   O OE1  . GLU B 1 21 ? -1.120  6.664   -4.053  1.00 0.00 ? 21 GLU B OE1  1  
ATOM 912   O OE2  . GLU B 1 21 ? -1.477  7.574   -6.073  1.00 0.00 ? 21 GLU B OE2  1  
ATOM 913   H H    . GLU B 1 21 ? -4.456  6.741   -0.682  1.00 0.00 ? 21 GLU B H    1  
ATOM 914   H HA   . GLU B 1 21 ? -5.069  8.729   -2.701  1.00 0.00 ? 21 GLU B HA   1  
ATOM 915   H HB2  . GLU B 1 21 ? -2.750  7.853   -2.231  1.00 0.00 ? 21 GLU B HB2  1  
ATOM 916   H HB3  . GLU B 1 21 ? -3.250  6.306   -2.942  1.00 0.00 ? 21 GLU B HB3  1  
ATOM 917   H HG2  . GLU B 1 21 ? -3.925  7.680   -5.020  1.00 0.00 ? 21 GLU B HG2  1  
ATOM 918   H HG3  . GLU B 1 21 ? -3.034  9.027   -4.284  1.00 0.00 ? 21 GLU B HG3  1  
ATOM 919   N N    . VAL B 1 22 ? -6.227  5.666   -2.914  1.00 0.00 ? 22 VAL B N    1  
ATOM 920   C CA   . VAL B 1 22 ? -7.148  4.797   -3.627  1.00 0.00 ? 22 VAL B CA   1  
ATOM 921   C C    . VAL B 1 22 ? -8.574  5.323   -3.457  1.00 0.00 ? 22 VAL B C    1  
ATOM 922   O O    . VAL B 1 22 ? -9.356  5.227   -4.414  1.00 0.00 ? 22 VAL B O    1  
ATOM 923   C CB   . VAL B 1 22 ? -6.982  3.353   -3.147  1.00 0.00 ? 22 VAL B CB   1  
ATOM 924   C CG1  . VAL B 1 22 ? -8.309  2.595   -3.223  1.00 0.00 ? 22 VAL B CG1  1  
ATOM 925   C CG2  . VAL B 1 22 ? -5.893  2.632   -3.943  1.00 0.00 ? 22 VAL B CG2  1  
ATOM 926   H H    . VAL B 1 22 ? -5.874  5.351   -2.010  1.00 0.00 ? 22 VAL B H    1  
ATOM 927   H HA   . VAL B 1 22 ? -6.880  4.832   -4.683  1.00 0.00 ? 22 VAL B HA   1  
ATOM 928   H HB   . VAL B 1 22 ? -6.672  3.422   -2.105  1.00 0.00 ? 22 VAL B HB   1  
ATOM 929   H HG11 . VAL B 1 22 ? -8.674  2.586   -4.250  1.00 0.00 ? 22 VAL B HG11 1  
ATOM 930   H HG12 . VAL B 1 22 ? -8.155  1.573   -2.875  1.00 0.00 ? 22 VAL B HG12 1  
ATOM 931   H HG13 . VAL B 1 22 ? -9.050  3.078   -2.587  1.00 0.00 ? 22 VAL B HG13 1  
ATOM 932   H HG21 . VAL B 1 22 ? -4.942  3.153   -3.829  1.00 0.00 ? 22 VAL B HG21 1  
ATOM 933   H HG22 . VAL B 1 22 ? -5.802  1.610   -3.576  1.00 0.00 ? 22 VAL B HG22 1  
ATOM 934   H HG23 . VAL B 1 22 ? -6.159  2.607   -5.000  1.00 0.00 ? 22 VAL B HG23 1  
ATOM 935   N N    . ALA B 1 23 ? -8.879  5.861   -2.262  1.00 0.00 ? 23 ALA B N    1  
ATOM 936   C CA   . ALA B 1 23 ? -10.199 6.396   -1.973  1.00 0.00 ? 23 ALA B CA   1  
ATOM 937   C C    . ALA B 1 23 ? -10.423 7.662   -2.802  1.00 0.00 ? 23 ALA B C    1  
ATOM 938   O O    . ALA B 1 23 ? -11.588 8.030   -3.014  1.00 0.00 ? 23 ALA B O    1  
ATOM 939   C CB   . ALA B 1 23 ? -10.270 6.826   -0.507  1.00 0.00 ? 23 ALA B CB   1  
ATOM 940   H H    . ALA B 1 23 ? -8.174  5.901   -1.526  1.00 0.00 ? 23 ALA B H    1  
ATOM 941   H HA   . ALA B 1 23 ? -10.979 5.673   -2.212  1.00 0.00 ? 23 ALA B HA   1  
ATOM 942   H HB1  . ALA B 1 23 ? -10.070 5.961   0.126   1.00 0.00 ? 23 ALA B HB1  1  
ATOM 943   H HB2  . ALA B 1 23 ? -9.521  7.592   -0.307  1.00 0.00 ? 23 ALA B HB2  1  
ATOM 944   H HB3  . ALA B 1 23 ? -11.258 7.228   -0.285  1.00 0.00 ? 23 ALA B HB3  1  
ATOM 945   N N    . ARG B 1 24 ? -9.322  8.294   -3.248  1.00 0.00 ? 24 ARG B N    1  
ATOM 946   C CA   . ARG B 1 24 ? -9.399  9.506   -4.045  1.00 0.00 ? 24 ARG B CA   1  
ATOM 947   C C    . ARG B 1 24 ? -9.442  9.133   -5.529  1.00 0.00 ? 24 ARG B C    1  
ATOM 948   O O    . ARG B 1 24 ? -10.067 9.872   -6.304  1.00 0.00 ? 24 ARG B O    1  
ATOM 949   C CB   . ARG B 1 24 ? -8.202  10.424  -3.792  1.00 0.00 ? 24 ARG B CB   1  
ATOM 950   C CG   . ARG B 1 24 ? -8.498  11.412  -2.662  1.00 0.00 ? 24 ARG B CG   1  
ATOM 951   C CD   . ARG B 1 24 ? -9.309  10.745  -1.549  1.00 0.00 ? 24 ARG B CD   1  
ATOM 952   N NE   . ARG B 1 24 ? -9.389  11.642  -0.374  1.00 0.00 ? 24 ARG B NE   1  
ATOM 953   C CZ   . ARG B 1 24 ? -10.226 11.451  0.668   1.00 0.00 ? 24 ARG B CZ   1  
ATOM 954   N NH1  . ARG B 1 24 ? -11.043 10.389  0.659   1.00 0.00 ? 24 ARG B NH1  1  
ATOM 955   N NH2  . ARG B 1 24 ? -10.238 12.310  1.697   1.00 0.00 ? 24 ARG B NH2  1  
ATOM 956   H H    . ARG B 1 24 ? -8.398  7.923   -3.028  1.00 0.00 ? 24 ARG B H    1  
ATOM 957   H HA   . ARG B 1 24 ? -10.323 10.021  -3.782  1.00 0.00 ? 24 ARG B HA   1  
ATOM 958   H HB2  . ARG B 1 24 ? -7.341  9.815   -3.514  1.00 0.00 ? 24 ARG B HB2  1  
ATOM 959   H HB3  . ARG B 1 24 ? -7.972  10.966  -4.709  1.00 0.00 ? 24 ARG B HB3  1  
ATOM 960   H HG2  . ARG B 1 24 ? -7.555  11.770  -2.248  1.00 0.00 ? 24 ARG B HG2  1  
ATOM 961   H HG3  . ARG B 1 24 ? -9.051  12.259  -3.069  1.00 0.00 ? 24 ARG B HG3  1  
ATOM 962   H HD2  . ARG B 1 24 ? -10.317 10.539  -1.908  1.00 0.00 ? 24 ARG B HD2  1  
ATOM 963   H HD3  . ARG B 1 24 ? -8.834  9.805   -1.267  1.00 0.00 ? 24 ARG B HD3  1  
ATOM 964   H HE   . ARG B 1 24 ? -8.760  12.445  -0.383  1.00 0.00 ? 24 ARG B HE   1  
ATOM 965   H HH11 . ARG B 1 24 ? -11.027 9.740   -0.128  1.00 0.00 ? 24 ARG B HH11 1  
ATOM 966   H HH12 . ARG B 1 24 ? -11.682 10.230  1.438   1.00 0.00 ? 24 ARG B HH12 1  
ATOM 967   H HH21 . ARG B 1 24 ? -9.613  13.115  1.696   1.00 0.00 ? 24 ARG B HH21 1  
ATOM 968   H HH22 . ARG B 1 24 ? -10.873 12.158  2.480   1.00 0.00 ? 24 ARG B HH22 1  
ATOM 969   N N    . LEU B 1 25 ? -8.788  8.014   -5.888  1.00 0.00 ? 25 LEU B N    1  
ATOM 970   C CA   . LEU B 1 25 ? -8.753  7.551   -7.265  1.00 0.00 ? 25 LEU B CA   1  
ATOM 971   C C    . LEU B 1 25 ? -10.066 6.838   -7.592  1.00 0.00 ? 25 LEU B C    1  
ATOM 972   O O    . LEU B 1 25 ? -10.580 7.028   -8.705  1.00 0.00 ? 25 LEU B O    1  
ATOM 973   C CB   . LEU B 1 25 ? -7.510  6.694   -7.510  1.00 0.00 ? 25 LEU B CB   1  
ATOM 974   C CG   . LEU B 1 25 ? -6.193  7.455   -7.683  1.00 0.00 ? 25 LEU B CG   1  
ATOM 975   C CD1  . LEU B 1 25 ? -5.008  6.490   -7.756  1.00 0.00 ? 25 LEU B CD1  1  
ATOM 976   C CD2  . LEU B 1 25 ? -6.252  8.384   -8.896  1.00 0.00 ? 25 LEU B CD2  1  
ATOM 977   H H    . LEU B 1 25 ? -8.298  7.462   -5.184  1.00 0.00 ? 25 LEU B H    1  
ATOM 978   H HA   . LEU B 1 25 ? -8.668  8.441   -7.888  1.00 0.00 ? 25 LEU B HA   1  
ATOM 979   H HB2  . LEU B 1 25 ? -7.423  6.025   -6.654  1.00 0.00 ? 25 LEU B HB2  1  
ATOM 980   H HB3  . LEU B 1 25 ? -7.717  6.103   -8.402  1.00 0.00 ? 25 LEU B HB3  1  
ATOM 981   H HG   . LEU B 1 25 ? -6.093  8.057   -6.779  1.00 0.00 ? 25 LEU B HG   1  
ATOM 982   H HD11 . LEU B 1 25 ? -5.135  5.809   -8.597  1.00 0.00 ? 25 LEU B HD11 1  
ATOM 983   H HD12 . LEU B 1 25 ? -4.090  7.065   -7.878  1.00 0.00 ? 25 LEU B HD12 1  
ATOM 984   H HD13 . LEU B 1 25 ? -4.944  5.910   -6.836  1.00 0.00 ? 25 LEU B HD13 1  
ATOM 985   H HD21 . LEU B 1 25 ? -7.063  9.103   -8.775  1.00 0.00 ? 25 LEU B HD21 1  
ATOM 986   H HD22 . LEU B 1 25 ? -5.301  8.909   -8.988  1.00 0.00 ? 25 LEU B HD22 1  
ATOM 987   H HD23 . LEU B 1 25 ? -6.426  7.803   -9.802  1.00 0.00 ? 25 LEU B HD23 1  
ATOM 988   N N    . LYS B 1 26 ? -10.575 6.043   -6.634  1.00 0.00 ? 26 LYS B N    1  
ATOM 989   C CA   . LYS B 1 26 ? -11.816 5.310   -6.820  1.00 0.00 ? 26 LYS B CA   1  
ATOM 990   C C    . LYS B 1 26 ? -12.978 6.299   -6.920  1.00 0.00 ? 26 LYS B C    1  
ATOM 991   O O    . LYS B 1 26 ? -13.995 5.954   -7.539  1.00 0.00 ? 26 LYS B O    1  
ATOM 992   C CB   . LYS B 1 26 ? -11.991 4.265   -5.716  1.00 0.00 ? 26 LYS B CB   1  
ATOM 993   C CG   . LYS B 1 26 ? -11.099 3.047   -5.967  1.00 0.00 ? 26 LYS B CG   1  
ATOM 994   C CD   . LYS B 1 26 ? -11.918 1.867   -6.495  1.00 0.00 ? 26 LYS B CD   1  
ATOM 995   C CE   . LYS B 1 26 ? -12.028 1.917   -8.020  1.00 0.00 ? 26 LYS B CE   1  
ATOM 996   N NZ   . LYS B 1 26 ? -13.067 0.987   -8.492  1.00 0.00 ? 26 LYS B NZ   1  
ATOM 997   H H    . LYS B 1 26 ? -10.088 5.941   -5.744  1.00 0.00 ? 26 LYS B H    1  
ATOM 998   H HA   . LYS B 1 26 ? -11.721 4.777   -7.766  1.00 0.00 ? 26 LYS B HA   1  
ATOM 999   H HB2  . LYS B 1 26 ? -11.721 4.712   -4.760  1.00 0.00 ? 26 LYS B HB2  1  
ATOM 1000  H HB3  . LYS B 1 26 ? -13.037 3.959   -5.682  1.00 0.00 ? 26 LYS B HB3  1  
ATOM 1001  H HG2  . LYS B 1 26 ? -10.340 3.311   -6.703  1.00 0.00 ? 26 LYS B HG2  1  
ATOM 1002  H HG3  . LYS B 1 26 ? -10.608 2.771   -5.034  1.00 0.00 ? 26 LYS B HG3  1  
ATOM 1003  H HD2  . LYS B 1 26 ? -11.427 0.938   -6.205  1.00 0.00 ? 26 LYS B HD2  1  
ATOM 1004  H HD3  . LYS B 1 26 ? -12.912 1.899   -6.049  1.00 0.00 ? 26 LYS B HD3  1  
ATOM 1005  H HE2  . LYS B 1 26 ? -12.292 2.929   -8.328  1.00 0.00 ? 26 LYS B HE2  1  
ATOM 1006  H HE3  . LYS B 1 26 ? -11.066 1.652   -8.458  1.00 0.00 ? 26 LYS B HE3  1  
ATOM 1007  H HZ1  . LYS B 1 26 ? -13.968 1.235   -8.083  1.00 0.00 ? 26 LYS B HZ1  1  
ATOM 1008  H HZ2  . LYS B 1 26 ? -13.122 1.038   -9.509  1.00 0.00 ? 26 LYS B HZ2  1  
ATOM 1009  H HZ3  . LYS B 1 26 ? -12.830 0.033   -8.220  1.00 0.00 ? 26 LYS B HZ3  1  
ATOM 1010  N N    . LYS B 1 27 ? -12.808 7.491   -6.320  1.00 0.00 ? 27 LYS B N    1  
ATOM 1011  C CA   . LYS B 1 27 ? -13.836 8.518   -6.342  1.00 0.00 ? 27 LYS B CA   1  
ATOM 1012  C C    . LYS B 1 27 ? -13.761 9.280   -7.667  1.00 0.00 ? 27 LYS B C    1  
ATOM 1013  O O    . LYS B 1 27 ? -14.706 10.022  -7.974  1.00 0.00 ? 27 LYS B O    1  
ATOM 1014  C CB   . LYS B 1 27 ? -13.721 9.417   -5.109  1.00 0.00 ? 27 LYS B CB   1  
ATOM 1015  C CG   . LYS B 1 27 ? -15.102 9.735   -4.533  1.00 0.00 ? 27 LYS B CG   1  
ATOM 1016  C CD   . LYS B 1 27 ? -15.001 10.148  -3.063  1.00 0.00 ? 27 LYS B CD   1  
ATOM 1017  C CE   . LYS B 1 27 ? -14.277 9.080   -2.242  1.00 0.00 ? 27 LYS B CE   1  
ATOM 1018  N NZ   . LYS B 1 27 ? -14.979 8.843   -0.970  1.00 0.00 ? 27 LYS B NZ   1  
ATOM 1019  H H    . LYS B 1 27 ? -11.937 7.696   -5.831  1.00 0.00 ? 27 LYS B H    1  
ATOM 1020  H HA   . LYS B 1 27 ? -14.792 7.999   -6.284  1.00 0.00 ? 27 LYS B HA   1  
ATOM 1021  H HB2  . LYS B 1 27 ? -13.130 8.904   -4.351  1.00 0.00 ? 27 LYS B HB2  1  
ATOM 1022  H HB3  . LYS B 1 27 ? -13.214 10.340  -5.390  1.00 0.00 ? 27 LYS B HB3  1  
ATOM 1023  H HG2  . LYS B 1 27 ? -15.543 10.553  -5.102  1.00 0.00 ? 27 LYS B HG2  1  
ATOM 1024  H HG3  . LYS B 1 27 ? -15.737 8.854   -4.628  1.00 0.00 ? 27 LYS B HG3  1  
ATOM 1025  H HD2  . LYS B 1 27 ? -14.446 11.084  -2.996  1.00 0.00 ? 27 LYS B HD2  1  
ATOM 1026  H HD3  . LYS B 1 27 ? -16.006 10.302  -2.669  1.00 0.00 ? 27 LYS B HD3  1  
ATOM 1027  H HE2  . LYS B 1 27 ? -14.248 8.150   -2.809  1.00 0.00 ? 27 LYS B HE2  1  
ATOM 1028  H HE3  . LYS B 1 27 ? -13.256 9.408   -2.047  1.00 0.00 ? 27 LYS B HE3  1  
ATOM 1029  H HZ1  . LYS B 1 27 ? -15.934 8.536   -1.152  1.00 0.00 ? 27 LYS B HZ1  1  
ATOM 1030  H HZ2  . LYS B 1 27 ? -14.478 8.129   -0.441  1.00 0.00 ? 27 LYS B HZ2  1  
ATOM 1031  H HZ3  . LYS B 1 27 ? -15.006 9.703   -0.422  1.00 0.00 ? 27 LYS B HZ3  1  
ATOM 1032  N N    . LEU B 1 28 ? -12.660 9.084   -8.413  1.00 0.00 ? 28 LEU B N    1  
ATOM 1033  C CA   . LEU B 1 28 ? -12.468 9.748   -9.692  1.00 0.00 ? 28 LEU B CA   1  
ATOM 1034  C C    . LEU B 1 28 ? -12.767 8.762   -10.823 1.00 0.00 ? 28 LEU B C    1  
ATOM 1035  O O    . LEU B 1 28 ? -13.308 9.193   -11.852 1.00 0.00 ? 28 LEU B O    1  
ATOM 1036  C CB   . LEU B 1 28 ? -11.071 10.367  -9.769  1.00 0.00 ? 28 LEU B CB   1  
ATOM 1037  C CG   . LEU B 1 28 ? -11.008 11.826  -10.227 1.00 0.00 ? 28 LEU B CG   1  
ATOM 1038  C CD1  . LEU B 1 28 ? -11.237 12.779  -9.052  1.00 0.00 ? 28 LEU B CD1  1  
ATOM 1039  C CD2  . LEU B 1 28 ? -9.694  12.117  -10.953 1.00 0.00 ? 28 LEU B CD2  1  
ATOM 1040  H H    . LEU B 1 28 ? -11.927 8.454   -8.086  1.00 0.00 ? 28 LEU B H    1  
ATOM 1041  H HA   . LEU B 1 28 ? -13.191 10.562  -9.729  1.00 0.00 ? 28 LEU B HA   1  
ATOM 1042  H HB2  . LEU B 1 28 ? -10.644 10.290  -8.769  1.00 0.00 ? 28 LEU B HB2  1  
ATOM 1043  H HB3  . LEU B 1 28 ? -10.495 9.739   -10.450 1.00 0.00 ? 28 LEU B HB3  1  
ATOM 1044  H HG   . LEU B 1 28 ? -11.834 11.939  -10.929 1.00 0.00 ? 28 LEU B HG   1  
ATOM 1045  H HD11 . LEU B 1 28 ? -10.478 12.616  -8.287  1.00 0.00 ? 28 LEU B HD11 1  
ATOM 1046  H HD12 . LEU B 1 28 ? -11.186 13.806  -9.413  1.00 0.00 ? 28 LEU B HD12 1  
ATOM 1047  H HD13 . LEU B 1 28 ? -12.222 12.604  -8.618  1.00 0.00 ? 28 LEU B HD13 1  
ATOM 1048  H HD21 . LEU B 1 28 ? -9.599  11.469  -11.825 1.00 0.00 ? 28 LEU B HD21 1  
ATOM 1049  H HD22 . LEU B 1 28 ? -9.684  13.162  -11.264 1.00 0.00 ? 28 LEU B HD22 1  
ATOM 1050  H HD23 . LEU B 1 28 ? -8.852  11.937  -10.285 1.00 0.00 ? 28 LEU B HD23 1  
ATOM 1051  N N    . VAL B 1 29 ? -12.416 7.481   -10.614 1.00 0.00 ? 29 VAL B N    1  
ATOM 1052  C CA   . VAL B 1 29 ? -12.645 6.447   -11.609 1.00 0.00 ? 29 VAL B CA   1  
ATOM 1053  C C    . VAL B 1 29 ? -13.801 5.555   -11.154 1.00 0.00 ? 29 VAL B C    1  
ATOM 1054  O O    . VAL B 1 29 ? -14.832 5.527   -11.842 1.00 0.00 ? 29 VAL B O    1  
ATOM 1055  C CB   . VAL B 1 29 ? -11.353 5.669   -11.863 1.00 0.00 ? 29 VAL B CB   1  
ATOM 1056  C CG1  . VAL B 1 29 ? -11.457 4.834   -13.141 1.00 0.00 ? 29 VAL B CG1  1  
ATOM 1057  C CG2  . VAL B 1 29 ? -10.148 6.610   -11.920 1.00 0.00 ? 29 VAL B CG2  1  
ATOM 1058  H H    . VAL B 1 29 ? -11.973 7.210   -9.736  1.00 0.00 ? 29 VAL B H    1  
ATOM 1059  H HA   . VAL B 1 29 ? -12.925 6.945   -12.538 1.00 0.00 ? 29 VAL B HA   1  
ATOM 1060  H HB   . VAL B 1 29 ? -11.239 4.999   -11.011 1.00 0.00 ? 29 VAL B HB   1  
ATOM 1061  H HG11 . VAL B 1 29 ? -11.652 5.484   -13.995 1.00 0.00 ? 29 VAL B HG11 1  
ATOM 1062  H HG12 . VAL B 1 29 ? -10.522 4.295   -13.290 1.00 0.00 ? 29 VAL B HG12 1  
ATOM 1063  H HG13 . VAL B 1 29 ? -12.271 4.115   -13.050 1.00 0.00 ? 29 VAL B HG13 1  
ATOM 1064  H HG21 . VAL B 1 29 ? -10.055 7.152   -10.979 1.00 0.00 ? 29 VAL B HG21 1  
ATOM 1065  H HG22 . VAL B 1 29 ? -9.247  6.023   -12.101 1.00 0.00 ? 29 VAL B HG22 1  
ATOM 1066  H HG23 . VAL B 1 29 ? -10.274 7.327   -12.731 1.00 0.00 ? 29 VAL B HG23 1  
ATOM 1067  N N    . GLY B 1 30 ? -13.611 4.854   -10.022 1.00 0.00 ? 30 GLY B N    1  
ATOM 1068  C CA   . GLY B 1 30 ? -14.630 3.970   -9.483  1.00 0.00 ? 30 GLY B CA   1  
ATOM 1069  C C    . GLY B 1 30 ? -15.886 4.783   -9.160  1.00 0.00 ? 30 GLY B C    1  
ATOM 1070  O O    . GLY B 1 30 ? -16.875 4.187   -8.710  1.00 0.00 ? 30 GLY B O    1  
ATOM 1071  H H    . GLY B 1 30 ? -12.730 4.934   -9.514  1.00 0.00 ? 30 GLY B H    1  
ATOM 1072  H HA2  . GLY B 1 30 ? -14.882 3.205   -10.217 1.00 0.00 ? 30 GLY B HA2  1  
ATOM 1073  H HA3  . GLY B 1 30 ? -14.259 3.486   -8.579  1.00 0.00 ? 30 GLY B HA3  1  
ATOM 1074  N N    . GLU B 1 31 ? -15.822 6.107   -9.393  1.00 0.00 ? 31 GLU B N    1  
ATOM 1075  C CA   . GLU B 1 31 ? -16.946 6.990   -9.129  1.00 0.00 ? 31 GLU B CA   1  
ATOM 1076  C C    . GLU B 1 31 ? -18.237 6.320   -9.602  1.00 0.00 ? 31 GLU B C    1  
ATOM 1077  O O    . GLU B 1 31 ? -18.217 5.685   -10.667 1.00 0.00 ? 31 GLU B O    1  
ATOM 1078  C CB   . GLU B 1 31 ? -16.758 8.353   -9.798  1.00 0.00 ? 31 GLU B CB   1  
ATOM 1079  C CG   . GLU B 1 31 ? -17.340 8.353   -11.214 1.00 0.00 ? 31 GLU B CG   1  
ATOM 1080  C CD   . GLU B 1 31 ? -18.849 8.604   -11.186 1.00 0.00 ? 31 GLU B CD   1  
ATOM 1081  O OE1  . GLU B 1 31 ? -19.256 9.374   -10.235 1.00 0.00 ? 31 GLU B OE1  1  
ATOM 1082  O OE2  . GLU B 1 31 ? -19.580 8.080   -12.039 1.00 0.00 ? 31 GLU B OE2  1  
ATOM 1083  H H    . GLU B 1 31 ? -14.967 6.518   -9.766  1.00 0.00 ? 31 GLU B H    1  
ATOM 1084  H HA   . GLU B 1 31 ? -16.993 7.129   -8.049  1.00 0.00 ? 31 GLU B HA   1  
ATOM 1085  H HB2  . GLU B 1 31 ? -17.268 9.111   -9.205  1.00 0.00 ? 31 GLU B HB2  1  
ATOM 1086  H HB3  . GLU B 1 31 ? -15.694 8.585   -9.834  1.00 0.00 ? 31 GLU B HB3  1  
ATOM 1087  H HG2  . GLU B 1 31 ? -16.860 9.142   -11.793 1.00 0.00 ? 31 GLU B HG2  1  
ATOM 1088  H HG3  . GLU B 1 31 ? -17.132 7.391   -11.682 1.00 0.00 ? 31 GLU B HG3  1  
ATOM 1089  N N    . ARG B 1 32 ? -19.317 6.470   -8.815  1.00 0.00 ? 32 ARG B N    1  
ATOM 1090  C CA   . ARG B 1 32 ? -20.604 5.884   -9.151  1.00 0.00 ? 32 ARG B CA   1  
ATOM 1091  C C    . ARG B 1 32 ? -21.009 6.328   -10.559 1.00 0.00 ? 32 ARG B C    1  
ATOM 1092  O O    . ARG B 1 32 ? -21.637 7.372   -10.725 1.00 0.00 ? 32 ARG B O    1  
ATOM 1093  C CB   . ARG B 1 32 ? -21.691 6.303   -8.159  1.00 0.00 ? 32 ARG B CB   1  
ATOM 1094  C CG   . ARG B 1 32 ? -21.087 6.636   -6.793  1.00 0.00 ? 32 ARG B CG   1  
ATOM 1095  C CD   . ARG B 1 32 ? -20.262 5.463   -6.258  1.00 0.00 ? 32 ARG B CD   1  
ATOM 1096  N NE   . ARG B 1 32 ? -20.847 4.183   -6.714  1.00 0.00 ? 32 ARG B NE   1  
ATOM 1097  C CZ   . ARG B 1 32 ? -21.779 3.489   -6.026  1.00 0.00 ? 32 ARG B CZ   1  
ATOM 1098  N NH1  . ARG B 1 32 ? -22.216 3.973   -4.855  1.00 0.00 ? 32 ARG B NH1  1  
ATOM 1099  N NH2  . ARG B 1 32 ? -22.260 2.335   -6.507  1.00 0.00 ? 32 ARG B NH2  1  
ATOM 1100  H H    . ARG B 1 32 ? -19.248 7.010   -7.952  1.00 0.00 ? 32 ARG B H    1  
ATOM 1101  H HA   . ARG B 1 32 ? -20.490 4.800   -9.140  1.00 0.00 ? 32 ARG B HA   1  
ATOM 1102  H HB2  . ARG B 1 32 ? -22.202 7.184   -8.546  1.00 0.00 ? 32 ARG B HB2  1  
ATOM 1103  H HB3  . ARG B 1 32 ? -22.410 5.490   -8.060  1.00 0.00 ? 32 ARG B HB3  1  
ATOM 1104  H HG2  . ARG B 1 32 ? -20.441 7.507   -6.895  1.00 0.00 ? 32 ARG B HG2  1  
ATOM 1105  H HG3  . ARG B 1 32 ? -21.894 6.870   -6.099  1.00 0.00 ? 32 ARG B HG3  1  
ATOM 1106  H HD2  . ARG B 1 32 ? -19.241 5.539   -6.630  1.00 0.00 ? 32 ARG B HD2  1  
ATOM 1107  H HD3  . ARG B 1 32 ? -20.247 5.498   -5.169  1.00 0.00 ? 32 ARG B HD3  1  
ATOM 1108  H HE   . ARG B 1 32 ? -20.504 3.829   -7.606  1.00 0.00 ? 32 ARG B HE   1  
ATOM 1109  H HH11 . ARG B 1 32 ? -21.845 4.852   -4.496  1.00 0.00 ? 32 ARG B HH11 1  
ATOM 1110  H HH12 . ARG B 1 32 ? -22.920 3.461   -4.323  1.00 0.00 ? 32 ARG B HH12 1  
ATOM 1111  H HH21 . ARG B 1 32 ? -21.923 1.974   -7.399  1.00 0.00 ? 32 ARG B HH21 1  
ATOM 1112  H HH22 . ARG B 1 32 ? -22.965 1.817   -5.981  1.00 0.00 ? 32 ARG B HH22 1  
ATOM 1113  N N    . MET A 1 1  ? 8.686   -10.871 17.051  1.00 0.00 ? 1  MET A N    2  
ATOM 1114  C CA   . MET A 1 1  ? 9.230   -10.811 15.705  1.00 0.00 ? 1  MET A CA   2  
ATOM 1115  C C    . MET A 1 1  ? 8.552   -11.875 14.838  1.00 0.00 ? 1  MET A C    2  
ATOM 1116  O O    . MET A 1 1  ? 8.271   -11.588 13.665  1.00 0.00 ? 1  MET A O    2  
ATOM 1117  C CB   . MET A 1 1  ? 10.740  -11.059 15.729  1.00 0.00 ? 1  MET A CB   2  
ATOM 1118  C CG   . MET A 1 1  ? 11.444  -10.261 14.631  1.00 0.00 ? 1  MET A CG   2  
ATOM 1119  S SD   . MET A 1 1  ? 12.939  -11.138 14.086  1.00 0.00 ? 1  MET A SD   2  
ATOM 1120  C CE   . MET A 1 1  ? 12.181  -12.521 13.184  1.00 0.00 ? 1  MET A CE   2  
ATOM 1121  H H    . MET A 1 1  ? 9.339   -10.834 17.833  1.00 0.00 ? 1  MET A H    2  
ATOM 1122  H HA   . MET A 1 1  ? 9.025   -9.827  15.284  1.00 0.00 ? 1  MET A HA   2  
ATOM 1123  H HB2  . MET A 1 1  ? 11.133  -10.752 16.699  1.00 0.00 ? 1  MET A HB2  2  
ATOM 1124  H HB3  . MET A 1 1  ? 10.925  -12.124 15.592  1.00 0.00 ? 1  MET A HB3  2  
ATOM 1125  H HG2  . MET A 1 1  ? 10.771  -10.143 13.781  1.00 0.00 ? 1  MET A HG2  2  
ATOM 1126  H HG3  . MET A 1 1  ? 11.710  -9.275  15.013  1.00 0.00 ? 1  MET A HG3  2  
ATOM 1127  H HE1  . MET A 1 1  ? 11.563  -12.142 12.371  1.00 0.00 ? 1  MET A HE1  2  
ATOM 1128  H HE2  . MET A 1 1  ? 12.971  -13.159 12.784  1.00 0.00 ? 1  MET A HE2  2  
ATOM 1129  H HE3  . MET A 1 1  ? 11.559  -13.109 13.859  1.00 0.00 ? 1  MET A HE3  2  
ATOM 1130  N N    . ASP A 1 2  ? 8.306   -13.061 15.423  1.00 0.00 ? 2  ASP A N    2  
ATOM 1131  C CA   . ASP A 1 2  ? 7.668   -14.153 14.709  1.00 0.00 ? 2  ASP A CA   2  
ATOM 1132  C C    . ASP A 1 2  ? 6.410   -13.634 14.010  1.00 0.00 ? 2  ASP A C    2  
ATOM 1133  O O    . ASP A 1 2  ? 6.107   -14.113 12.908  1.00 0.00 ? 2  ASP A O    2  
ATOM 1134  C CB   . ASP A 1 2  ? 7.250   -15.269 15.669  1.00 0.00 ? 2  ASP A CB   2  
ATOM 1135  C CG   . ASP A 1 2  ? 8.170   -15.462 16.875  1.00 0.00 ? 2  ASP A CG   2  
ATOM 1136  O OD1  . ASP A 1 2  ? 9.183   -16.234 16.672  1.00 0.00 ? 2  ASP A OD1  2  
ATOM 1137  O OD2  . ASP A 1 2  ? 7.932   -14.902 17.956  1.00 0.00 ? 2  ASP A OD2  2  
ATOM 1138  H H    . ASP A 1 2  ? 8.570   -13.214 16.396  1.00 0.00 ? 2  ASP A H    2  
ATOM 1139  H HA   . ASP A 1 2  ? 8.359   -14.537 13.957  1.00 0.00 ? 2  ASP A HA   2  
ATOM 1140  H HB2  . ASP A 1 2  ? 6.248   -15.026 16.021  1.00 0.00 ? 2  ASP A HB2  2  
ATOM 1141  H HB3  . ASP A 1 2  ? 7.206   -16.189 15.083  1.00 0.00 ? 2  ASP A HB3  2  
ATOM 1142  N N    . ALA A 1 3  ? 5.713   -12.682 14.655  1.00 0.00 ? 3  ALA A N    2  
ATOM 1143  C CA   . ALA A 1 3  ? 4.499   -12.105 14.100  1.00 0.00 ? 3  ALA A CA   2  
ATOM 1144  C C    . ALA A 1 3  ? 4.860   -10.867 13.277  1.00 0.00 ? 3  ALA A C    2  
ATOM 1145  O O    . ALA A 1 3  ? 4.012   -10.413 12.493  1.00 0.00 ? 3  ALA A O    2  
ATOM 1146  C CB   . ALA A 1 3  ? 3.595   -11.619 15.234  1.00 0.00 ? 3  ALA A CB   2  
ATOM 1147  H H    . ALA A 1 3  ? 6.032   -12.343 15.562  1.00 0.00 ? 3  ALA A H    2  
ATOM 1148  H HA   . ALA A 1 3  ? 3.982   -12.820 13.459  1.00 0.00 ? 3  ALA A HA   2  
ATOM 1149  H HB1  . ALA A 1 3  ? 3.348   -12.463 15.877  1.00 0.00 ? 3  ALA A HB1  2  
ATOM 1150  H HB2  . ALA A 1 3  ? 4.112   -10.863 15.823  1.00 0.00 ? 3  ALA A HB2  2  
ATOM 1151  H HB3  . ALA A 1 3  ? 2.683   -11.186 14.822  1.00 0.00 ? 3  ALA A HB3  2  
ATOM 1152  N N    . ILE A 1 4  ? 6.088   -10.354 13.465  1.00 0.00 ? 4  ILE A N    2  
ATOM 1153  C CA   . ILE A 1 4  ? 6.552   -9.180  12.746  1.00 0.00 ? 4  ILE A CA   2  
ATOM 1154  C C    . ILE A 1 4  ? 6.975   -9.588  11.334  1.00 0.00 ? 4  ILE A C    2  
ATOM 1155  O O    . ILE A 1 4  ? 6.606   -8.886  10.381  1.00 0.00 ? 4  ILE A O    2  
ATOM 1156  C CB   . ILE A 1 4  ? 7.651   -8.467  13.535  1.00 0.00 ? 4  ILE A CB   2  
ATOM 1157  C CG1  . ILE A 1 4  ? 7.143   -8.033  14.912  1.00 0.00 ? 4  ILE A CG1  2  
ATOM 1158  C CG2  . ILE A 1 4  ? 8.224   -7.293  12.739  1.00 0.00 ? 4  ILE A CG2  2  
ATOM 1159  C CD1  . ILE A 1 4  ? 7.572   -6.598  15.227  1.00 0.00 ? 4  ILE A CD1  2  
ATOM 1160  H H    . ILE A 1 4  ? 6.726   -10.790 14.132  1.00 0.00 ? 4  ILE A H    2  
ATOM 1161  H HA   . ILE A 1 4  ? 5.701   -8.502  12.679  1.00 0.00 ? 4  ILE A HA   2  
ATOM 1162  H HB   . ILE A 1 4  ? 8.436   -9.211  13.665  1.00 0.00 ? 4  ILE A HB   2  
ATOM 1163  H HG12 . ILE A 1 4  ? 6.055   -8.088  14.921  1.00 0.00 ? 4  ILE A HG12 2  
ATOM 1164  H HG13 . ILE A 1 4  ? 7.539   -8.714  15.666  1.00 0.00 ? 4  ILE A HG13 2  
ATOM 1165  H HG21 . ILE A 1 4  ? 7.434   -6.578  12.510  1.00 0.00 ? 4  ILE A HG21 2  
ATOM 1166  H HG22 . ILE A 1 4  ? 9.002   -6.809  13.331  1.00 0.00 ? 4  ILE A HG22 2  
ATOM 1167  H HG23 . ILE A 1 4  ? 8.659   -7.653  11.807  1.00 0.00 ? 4  ILE A HG23 2  
ATOM 1168  H HD11 . ILE A 1 4  ? 7.176   -5.918  14.474  1.00 0.00 ? 4  ILE A HD11 2  
ATOM 1169  H HD12 . ILE A 1 4  ? 7.195   -6.323  16.212  1.00 0.00 ? 4  ILE A HD12 2  
ATOM 1170  H HD13 . ILE A 1 4  ? 8.660   -6.528  15.232  1.00 0.00 ? 4  ILE A HD13 2  
ATOM 1171  N N    . LYS A 1 5  ? 7.730   -10.696 11.227  1.00 0.00 ? 5  LYS A N    2  
ATOM 1172  C CA   . LYS A 1 5  ? 8.197   -11.190 9.943   1.00 0.00 ? 5  LYS A CA   2  
ATOM 1173  C C    . LYS A 1 5  ? 7.005   -11.350 8.998   1.00 0.00 ? 5  LYS A C    2  
ATOM 1174  O O    . LYS A 1 5  ? 7.166   -11.096 7.795   1.00 0.00 ? 5  LYS A O    2  
ATOM 1175  C CB   . LYS A 1 5  ? 9.013   -12.470 10.125  1.00 0.00 ? 5  LYS A CB   2  
ATOM 1176  C CG   . LYS A 1 5  ? 8.616   -13.194 11.413  1.00 0.00 ? 5  LYS A CG   2  
ATOM 1177  C CD   . LYS A 1 5  ? 8.752   -14.710 11.255  1.00 0.00 ? 5  LYS A CD   2  
ATOM 1178  C CE   . LYS A 1 5  ? 10.142  -15.185 11.682  1.00 0.00 ? 5  LYS A CE   2  
ATOM 1179  N NZ   . LYS A 1 5  ? 10.497  -16.433 10.987  1.00 0.00 ? 5  LYS A NZ   2  
ATOM 1180  H H    . LYS A 1 5  ? 7.990   -11.218 12.064  1.00 0.00 ? 5  LYS A H    2  
ATOM 1181  H HA   . LYS A 1 5  ? 8.866   -10.427 9.544   1.00 0.00 ? 5  LYS A HA   2  
ATOM 1182  H HB2  . LYS A 1 5  ? 8.831   -13.130 9.277   1.00 0.00 ? 5  LYS A HB2  2  
ATOM 1183  H HB3  . LYS A 1 5  ? 10.072  -12.214 10.155  1.00 0.00 ? 5  LYS A HB3  2  
ATOM 1184  H HG2  . LYS A 1 5  ? 9.268   -12.863 12.221  1.00 0.00 ? 5  LYS A HG2  2  
ATOM 1185  H HG3  . LYS A 1 5  ? 7.586   -12.938 11.661  1.00 0.00 ? 5  LYS A HG3  2  
ATOM 1186  H HD2  . LYS A 1 5  ? 8.002   -15.200 11.877  1.00 0.00 ? 5  LYS A HD2  2  
ATOM 1187  H HD3  . LYS A 1 5  ? 8.574   -14.974 10.212  1.00 0.00 ? 5  LYS A HD3  2  
ATOM 1188  H HE2  . LYS A 1 5  ? 10.875  -14.418 11.432  1.00 0.00 ? 5  LYS A HE2  2  
ATOM 1189  H HE3  . LYS A 1 5  ? 10.149  -15.345 12.760  1.00 0.00 ? 5  LYS A HE3  2  
ATOM 1190  H HZ1  . LYS A 1 5  ? 10.491  -16.282 9.978   1.00 0.00 ? 5  LYS A HZ1  2  
ATOM 1191  H HZ2  . LYS A 1 5  ? 11.426  -16.728 11.289  1.00 0.00 ? 5  LYS A HZ2  2  
ATOM 1192  H HZ3  . LYS A 1 5  ? 9.825   -17.164 11.219  1.00 0.00 ? 5  LYS A HZ3  2  
ATOM 1193  N N    . LYS A 1 6  ? 5.849   -11.761 9.550   1.00 0.00 ? 6  LYS A N    2  
ATOM 1194  C CA   . LYS A 1 6  ? 4.643   -11.952 8.763   1.00 0.00 ? 6  LYS A CA   2  
ATOM 1195  C C    . LYS A 1 6  ? 3.889   -10.625 8.662   1.00 0.00 ? 6  LYS A C    2  
ATOM 1196  O O    . LYS A 1 6  ? 3.243   -10.391 7.630   1.00 0.00 ? 6  LYS A O    2  
ATOM 1197  C CB   . LYS A 1 6  ? 3.803   -13.095 9.337   1.00 0.00 ? 6  LYS A CB   2  
ATOM 1198  C CG   . LYS A 1 6  ? 4.695   -14.177 9.947   1.00 0.00 ? 6  LYS A CG   2  
ATOM 1199  C CD   . LYS A 1 6  ? 3.885   -15.431 10.284  1.00 0.00 ? 6  LYS A CD   2  
ATOM 1200  C CE   . LYS A 1 6  ? 4.232   -16.579 9.333   1.00 0.00 ? 6  LYS A CE   2  
ATOM 1201  N NZ   . LYS A 1 6  ? 5.450   -17.272 9.786   1.00 0.00 ? 6  LYS A NZ   2  
ATOM 1202  H H    . LYS A 1 6  ? 5.802   -11.948 10.552  1.00 0.00 ? 6  LYS A H    2  
ATOM 1203  H HA   . LYS A 1 6  ? 4.970   -12.251 7.767   1.00 0.00 ? 6  LYS A HA   2  
ATOM 1204  H HB2  . LYS A 1 6  ? 3.148   -12.697 10.111  1.00 0.00 ? 6  LYS A HB2  2  
ATOM 1205  H HB3  . LYS A 1 6  ? 3.195   -13.521 8.539   1.00 0.00 ? 6  LYS A HB3  2  
ATOM 1206  H HG2  . LYS A 1 6  ? 5.475   -14.440 9.232   1.00 0.00 ? 6  LYS A HG2  2  
ATOM 1207  H HG3  . LYS A 1 6  ? 5.162   -13.783 10.851  1.00 0.00 ? 6  LYS A HG3  2  
ATOM 1208  H HD2  . LYS A 1 6  ? 4.111   -15.735 11.306  1.00 0.00 ? 6  LYS A HD2  2  
ATOM 1209  H HD3  . LYS A 1 6  ? 2.823   -15.196 10.209  1.00 0.00 ? 6  LYS A HD3  2  
ATOM 1210  H HE2  . LYS A 1 6  ? 3.407   -17.290 9.313   1.00 0.00 ? 6  LYS A HE2  2  
ATOM 1211  H HE3  . LYS A 1 6  ? 4.383   -16.180 8.330   1.00 0.00 ? 6  LYS A HE3  2  
ATOM 1212  H HZ1  . LYS A 1 6  ? 5.310   -17.644 10.725  1.00 0.00 ? 6  LYS A HZ1  2  
ATOM 1213  H HZ2  . LYS A 1 6  ? 5.661   -18.030 9.138   1.00 0.00 ? 6  LYS A HZ2  2  
ATOM 1214  H HZ3  . LYS A 1 6  ? 6.235   -16.620 9.801   1.00 0.00 ? 6  LYS A HZ3  2  
ATOM 1215  N N    . LYS A 1 7  ? 3.985   -9.796  9.717   1.00 0.00 ? 7  LYS A N    2  
ATOM 1216  C CA   . LYS A 1 7  ? 3.316   -8.507  9.747   1.00 0.00 ? 7  LYS A CA   2  
ATOM 1217  C C    . LYS A 1 7  ? 3.651   -7.733  8.469   1.00 0.00 ? 7  LYS A C    2  
ATOM 1218  O O    . LYS A 1 7  ? 2.732   -7.153  7.874   1.00 0.00 ? 7  LYS A O    2  
ATOM 1219  C CB   . LYS A 1 7  ? 3.663   -7.752  11.032  1.00 0.00 ? 7  LYS A CB   2  
ATOM 1220  C CG   . LYS A 1 7  ? 2.978   -6.384  11.067  1.00 0.00 ? 7  LYS A CG   2  
ATOM 1221  C CD   . LYS A 1 7  ? 1.495   -6.505  10.713  1.00 0.00 ? 7  LYS A CD   2  
ATOM 1222  C CE   . LYS A 1 7  ? 0.740   -5.221  11.065  1.00 0.00 ? 7  LYS A CE   2  
ATOM 1223  N NZ   . LYS A 1 7  ? -0.287  -4.933  10.052  1.00 0.00 ? 7  LYS A NZ   2  
ATOM 1224  H H    . LYS A 1 7  ? 4.540   -10.066 10.529  1.00 0.00 ? 7  LYS A H    2  
ATOM 1225  H HA   . LYS A 1 7  ? 2.246   -8.714  9.767   1.00 0.00 ? 7  LYS A HA   2  
ATOM 1226  H HB2  . LYS A 1 7  ? 3.331   -8.338  11.888  1.00 0.00 ? 7  LYS A HB2  2  
ATOM 1227  H HB3  . LYS A 1 7  ? 4.745   -7.628  11.086  1.00 0.00 ? 7  LYS A HB3  2  
ATOM 1228  H HG2  . LYS A 1 7  ? 3.071   -5.968  12.070  1.00 0.00 ? 7  LYS A HG2  2  
ATOM 1229  H HG3  . LYS A 1 7  ? 3.477   -5.721  10.360  1.00 0.00 ? 7  LYS A HG3  2  
ATOM 1230  H HD2  . LYS A 1 7  ? 1.401   -6.689  9.643   1.00 0.00 ? 7  LYS A HD2  2  
ATOM 1231  H HD3  . LYS A 1 7  ? 1.069   -7.348  11.256  1.00 0.00 ? 7  LYS A HD3  2  
ATOM 1232  H HE2  . LYS A 1 7  ? 0.259   -5.344  12.036  1.00 0.00 ? 7  LYS A HE2  2  
ATOM 1233  H HE3  . LYS A 1 7  ? 1.448   -4.395  11.123  1.00 0.00 ? 7  LYS A HE3  2  
ATOM 1234  H HZ1  . LYS A 1 7  ? -0.949  -5.706  9.998   1.00 0.00 ? 7  LYS A HZ1  2  
ATOM 1235  H HZ2  . LYS A 1 7  ? -0.775  -4.074  10.309  1.00 0.00 ? 7  LYS A HZ2  2  
ATOM 1236  H HZ3  . LYS A 1 7  ? 0.150   -4.805  9.140   1.00 0.00 ? 7  LYS A HZ3  2  
ATOM 1237  N N    . MET A 1 8  ? 4.939   -7.742  8.081   1.00 0.00 ? 8  MET A N    2  
ATOM 1238  C CA   . MET A 1 8  ? 5.387   -7.047  6.887   1.00 0.00 ? 8  MET A CA   2  
ATOM 1239  C C    . MET A 1 8  ? 4.962   -7.840  5.650   1.00 0.00 ? 8  MET A C    2  
ATOM 1240  O O    . MET A 1 8  ? 4.874   -7.243  4.567   1.00 0.00 ? 8  MET A O    2  
ATOM 1241  C CB   . MET A 1 8  ? 6.910   -6.894  6.899   1.00 0.00 ? 8  MET A CB   2  
ATOM 1242  C CG   . MET A 1 8  ? 7.595   -8.258  7.010   1.00 0.00 ? 8  MET A CG   2  
ATOM 1243  S SD   . MET A 1 8  ? 9.400   -8.049  6.990   1.00 0.00 ? 8  MET A SD   2  
ATOM 1244  C CE   . MET A 1 8  ? 9.889   -9.611  6.201   1.00 0.00 ? 8  MET A CE   2  
ATOM 1245  H H    . MET A 1 8  ? 5.634   -8.248  8.631   1.00 0.00 ? 8  MET A H    2  
ATOM 1246  H HA   . MET A 1 8  ? 4.919   -6.062  6.854   1.00 0.00 ? 8  MET A HA   2  
ATOM 1247  H HB2  . MET A 1 8  ? 7.224   -6.413  5.973   1.00 0.00 ? 8  MET A HB2  2  
ATOM 1248  H HB3  . MET A 1 8  ? 7.195   -6.265  7.741   1.00 0.00 ? 8  MET A HB3  2  
ATOM 1249  H HG2  . MET A 1 8  ? 7.303   -8.735  7.944   1.00 0.00 ? 8  MET A HG2  2  
ATOM 1250  H HG3  . MET A 1 8  ? 7.284   -8.889  6.177   1.00 0.00 ? 8  MET A HG3  2  
ATOM 1251  H HE1  . MET A 1 8  ? 9.436   -9.687  5.213   1.00 0.00 ? 8  MET A HE1  2  
ATOM 1252  H HE2  . MET A 1 8  ? 10.976  -9.640  6.115   1.00 0.00 ? 8  MET A HE2  2  
ATOM 1253  H HE3  . MET A 1 8  ? 9.560   -10.453 6.809   1.00 0.00 ? 8  MET A HE3  2  
ATOM 1254  N N    . GLN A 1 9  ? 4.712   -9.150  5.832   1.00 0.00 ? 9  GLN A N    2  
ATOM 1255  C CA   . GLN A 1 9  ? 4.302   -10.014 4.738   1.00 0.00 ? 9  GLN A CA   2  
ATOM 1256  C C    . GLN A 1 9  ? 2.852   -9.701  4.363   1.00 0.00 ? 9  GLN A C    2  
ATOM 1257  O O    . GLN A 1 9  ? 2.499   -9.864  3.186   1.00 0.00 ? 9  GLN A O    2  
ATOM 1258  C CB   . GLN A 1 9  ? 4.469   -11.492 5.096   1.00 0.00 ? 9  GLN A CB   2  
ATOM 1259  C CG   . GLN A 1 9  ? 5.925   -11.933 4.936   1.00 0.00 ? 9  GLN A CG   2  
ATOM 1260  C CD   . GLN A 1 9  ? 6.014   -13.432 4.640   1.00 0.00 ? 9  GLN A CD   2  
ATOM 1261  O OE1  . GLN A 1 9  ? 5.460   -13.934 3.676   1.00 0.00 ? 9  GLN A OE1  2  
ATOM 1262  N NE2  . GLN A 1 9  ? 6.742   -14.115 5.519   1.00 0.00 ? 9  GLN A NE2  2  
ATOM 1263  H H    . GLN A 1 9  ? 4.810   -9.564  6.758   1.00 0.00 ? 9  GLN A H    2  
ATOM 1264  H HA   . GLN A 1 9  ? 4.946   -9.780  3.890   1.00 0.00 ? 9  GLN A HA   2  
ATOM 1265  H HB2  . GLN A 1 9  ? 4.165   -11.641 6.132   1.00 0.00 ? 9  GLN A HB2  2  
ATOM 1266  H HB3  . GLN A 1 9  ? 3.827   -12.088 4.448   1.00 0.00 ? 9  GLN A HB3  2  
ATOM 1267  H HG2  . GLN A 1 9  ? 6.374   -11.381 4.111   1.00 0.00 ? 9  GLN A HG2  2  
ATOM 1268  H HG3  . GLN A 1 9  ? 6.467   -11.703 5.854   1.00 0.00 ? 9  GLN A HG3  2  
ATOM 1269  H HE21 . GLN A 1 9  ? 7.179   -13.632 6.304   1.00 0.00 ? 9  GLN A HE21 2  
ATOM 1270  H HE22 . GLN A 1 9  ? 6.861   -15.122 5.409   1.00 0.00 ? 9  GLN A HE22 2  
ATOM 1271  N N    . MET A 1 10 ? 2.054   -9.267  5.355   1.00 0.00 ? 10 MET A N    2  
ATOM 1272  C CA   . MET A 1 10 ? 0.657   -8.936  5.131   1.00 0.00 ? 10 MET A CA   2  
ATOM 1273  C C    . MET A 1 10 ? 0.562   -7.549  4.494   1.00 0.00 ? 10 MET A C    2  
ATOM 1274  O O    . MET A 1 10 ? -0.309  -7.353  3.635   1.00 0.00 ? 10 MET A O    2  
ATOM 1275  C CB   . MET A 1 10 ? -0.111  -8.944  6.454   1.00 0.00 ? 10 MET A CB   2  
ATOM 1276  C CG   . MET A 1 10 ? 0.710   -9.608  7.561   1.00 0.00 ? 10 MET A CG   2  
ATOM 1277  S SD   . MET A 1 10 ? -0.284  -9.744  9.076   1.00 0.00 ? 10 MET A SD   2  
ATOM 1278  C CE   . MET A 1 10 ? -1.954  -9.688  8.364   1.00 0.00 ? 10 MET A CE   2  
ATOM 1279  H H    . MET A 1 10 ? 2.426   -9.161  6.299   1.00 0.00 ? 10 MET A H    2  
ATOM 1280  H HA   . MET A 1 10 ? 0.225   -9.669  4.450   1.00 0.00 ? 10 MET A HA   2  
ATOM 1281  H HB2  . MET A 1 10 ? -0.330  -7.917  6.742   1.00 0.00 ? 10 MET A HB2  2  
ATOM 1282  H HB3  . MET A 1 10 ? -1.049  -9.482  6.314   1.00 0.00 ? 10 MET A HB3  2  
ATOM 1283  H HG2  . MET A 1 10 ? 1.009   -10.607 7.242   1.00 0.00 ? 10 MET A HG2  2  
ATOM 1284  H HG3  . MET A 1 10 ? 1.604   -9.015  7.754   1.00 0.00 ? 10 MET A HG3  2  
ATOM 1285  H HE1  . MET A 1 10 ? -2.088  -10.513 7.665   1.00 0.00 ? 10 MET A HE1  2  
ATOM 1286  H HE2  . MET A 1 10 ? -2.685  -9.761  9.169   1.00 0.00 ? 10 MET A HE2  2  
ATOM 1287  H HE3  . MET A 1 10 ? -2.102  -8.746  7.834   1.00 0.00 ? 10 MET A HE3  2  
ATOM 1288  N N    . LEU A 1 11 ? 1.445   -6.628  4.921   1.00 0.00 ? 11 LEU A N    2  
ATOM 1289  C CA   . LEU A 1 11 ? 1.460   -5.273  4.396   1.00 0.00 ? 11 LEU A CA   2  
ATOM 1290  C C    . LEU A 1 11 ? 2.139   -5.270  3.024   1.00 0.00 ? 11 LEU A C    2  
ATOM 1291  O O    . LEU A 1 11 ? 1.828   -4.383  2.215   1.00 0.00 ? 11 LEU A O    2  
ATOM 1292  C CB   . LEU A 1 11 ? 2.103   -4.315  5.401   1.00 0.00 ? 11 LEU A CB   2  
ATOM 1293  C CG   . LEU A 1 11 ? 1.428   -4.231  6.772   1.00 0.00 ? 11 LEU A CG   2  
ATOM 1294  C CD1  . LEU A 1 11 ? 2.403   -3.713  7.831   1.00 0.00 ? 11 LEU A CD1  2  
ATOM 1295  C CD2  . LEU A 1 11 ? 0.154   -3.387  6.704   1.00 0.00 ? 11 LEU A CD2  2  
ATOM 1296  H H    . LEU A 1 11 ? 2.132   -6.873  5.634   1.00 0.00 ? 11 LEU A H    2  
ATOM 1297  H HA   . LEU A 1 11 ? 0.418   -4.976  4.277   1.00 0.00 ? 11 LEU A HA   2  
ATOM 1298  H HB2  . LEU A 1 11 ? 3.131   -4.652  5.532   1.00 0.00 ? 11 LEU A HB2  2  
ATOM 1299  H HB3  . LEU A 1 11 ? 2.108   -3.333  4.928   1.00 0.00 ? 11 LEU A HB3  2  
ATOM 1300  H HG   . LEU A 1 11 ? 1.161   -5.258  7.021   1.00 0.00 ? 11 LEU A HG   2  
ATOM 1301  H HD11 . LEU A 1 11 ? 2.762   -2.723  7.553   1.00 0.00 ? 11 LEU A HD11 2  
ATOM 1302  H HD12 . LEU A 1 11 ? 1.890   -3.665  8.792   1.00 0.00 ? 11 LEU A HD12 2  
ATOM 1303  H HD13 . LEU A 1 11 ? 3.253   -4.390  7.916   1.00 0.00 ? 11 LEU A HD13 2  
ATOM 1304  H HD21 . LEU A 1 11 ? -0.546  -3.826  5.992   1.00 0.00 ? 11 LEU A HD21 2  
ATOM 1305  H HD22 . LEU A 1 11 ? -0.299  -3.348  7.695   1.00 0.00 ? 11 LEU A HD22 2  
ATOM 1306  H HD23 . LEU A 1 11 ? 0.395   -2.374  6.385   1.00 0.00 ? 11 LEU A HD23 2  
ATOM 1307  N N    . LYS A 1 12 ? 3.035   -6.246  2.793   1.00 0.00 ? 12 LYS A N    2  
ATOM 1308  C CA   . LYS A 1 12 ? 3.748   -6.353  1.533   1.00 0.00 ? 12 LYS A CA   2  
ATOM 1309  C C    . LYS A 1 12 ? 2.800   -6.893  0.459   1.00 0.00 ? 12 LYS A C    2  
ATOM 1310  O O    . LYS A 1 12 ? 2.919   -6.472  -0.700  1.00 0.00 ? 12 LYS A O    2  
ATOM 1311  C CB   . LYS A 1 12 ? 5.020   -7.186  1.705   1.00 0.00 ? 12 LYS A CB   2  
ATOM 1312  C CG   . LYS A 1 12 ? 6.198   -6.307  2.127   1.00 0.00 ? 12 LYS A CG   2  
ATOM 1313  C CD   . LYS A 1 12 ? 7.526   -6.911  1.664   1.00 0.00 ? 12 LYS A CD   2  
ATOM 1314  C CE   . LYS A 1 12 ? 8.146   -7.778  2.762   1.00 0.00 ? 12 LYS A CE   2  
ATOM 1315  N NZ   . LYS A 1 12 ? 8.466   -6.962  3.944   1.00 0.00 ? 12 LYS A NZ   2  
ATOM 1316  H H    . LYS A 1 12 ? 3.232   -6.938  3.515   1.00 0.00 ? 12 LYS A H    2  
ATOM 1317  H HA   . LYS A 1 12 ? 4.052   -5.342  1.261   1.00 0.00 ? 12 LYS A HA   2  
ATOM 1318  H HB2  . LYS A 1 12 ? 4.847   -7.940  2.473   1.00 0.00 ? 12 LYS A HB2  2  
ATOM 1319  H HB3  . LYS A 1 12 ? 5.247   -7.686  0.762   1.00 0.00 ? 12 LYS A HB3  2  
ATOM 1320  H HG2  . LYS A 1 12 ? 6.083   -5.321  1.678   1.00 0.00 ? 12 LYS A HG2  2  
ATOM 1321  H HG3  . LYS A 1 12 ? 6.194   -6.206  3.212   1.00 0.00 ? 12 LYS A HG3  2  
ATOM 1322  H HD2  . LYS A 1 12 ? 7.347   -7.529  0.784   1.00 0.00 ? 12 LYS A HD2  2  
ATOM 1323  H HD3  . LYS A 1 12 ? 8.209   -6.105  1.399   1.00 0.00 ? 12 LYS A HD3  2  
ATOM 1324  H HE2  . LYS A 1 12 ? 7.437   -8.555  3.049   1.00 0.00 ? 12 LYS A HE2  2  
ATOM 1325  H HE3  . LYS A 1 12 ? 9.051   -8.249  2.379   1.00 0.00 ? 12 LYS A HE3  2  
ATOM 1326  H HZ1  . LYS A 1 12 ? 7.618   -6.522  4.303   1.00 0.00 ? 12 LYS A HZ1  2  
ATOM 1327  H HZ2  . LYS A 1 12 ? 8.877   -7.561  4.661   1.00 0.00 ? 12 LYS A HZ2  2  
ATOM 1328  H HZ3  . LYS A 1 12 ? 9.137   -6.235  3.694   1.00 0.00 ? 12 LYS A HZ3  2  
ATOM 1329  N N    . LEU A 1 13 ? 1.893   -7.801  0.860   1.00 0.00 ? 13 LEU A N    2  
ATOM 1330  C CA   . LEU A 1 13 ? 0.934   -8.391  -0.060  1.00 0.00 ? 13 LEU A CA   2  
ATOM 1331  C C    . LEU A 1 13 ? -0.124  -7.348  -0.425  1.00 0.00 ? 13 LEU A C    2  
ATOM 1332  O O    . LEU A 1 13 ? -0.514  -7.290  -1.600  1.00 0.00 ? 13 LEU A O    2  
ATOM 1333  C CB   . LEU A 1 13 ? 0.353   -9.680  0.525   1.00 0.00 ? 13 LEU A CB   2  
ATOM 1334  C CG   . LEU A 1 13 ? -0.200  -10.686 -0.487  1.00 0.00 ? 13 LEU A CG   2  
ATOM 1335  C CD1  . LEU A 1 13 ? -1.246  -11.595 0.161   1.00 0.00 ? 13 LEU A CD1  2  
ATOM 1336  C CD2  . LEU A 1 13 ? -0.747  -9.973  -1.725  1.00 0.00 ? 13 LEU A CD2  2  
ATOM 1337  H H    . LEU A 1 13 ? 1.862   -8.095  1.837   1.00 0.00 ? 13 LEU A H    2  
ATOM 1338  H HA   . LEU A 1 13 ? 1.493   -8.658  -0.957  1.00 0.00 ? 13 LEU A HA   2  
ATOM 1339  H HB2  . LEU A 1 13 ? 1.157   -10.151 1.091   1.00 0.00 ? 13 LEU A HB2  2  
ATOM 1340  H HB3  . LEU A 1 13 ? -0.434  -9.374  1.215   1.00 0.00 ? 13 LEU A HB3  2  
ATOM 1341  H HG   . LEU A 1 13 ? 0.655   -11.296 -0.777  1.00 0.00 ? 13 LEU A HG   2  
ATOM 1342  H HD11 . LEU A 1 13 ? -2.069  -10.996 0.550   1.00 0.00 ? 13 LEU A HD11 2  
ATOM 1343  H HD12 . LEU A 1 13 ? -1.617  -12.296 -0.586  1.00 0.00 ? 13 LEU A HD12 2  
ATOM 1344  H HD13 . LEU A 1 13 ? -0.796  -12.155 0.980   1.00 0.00 ? 13 LEU A HD13 2  
ATOM 1345  H HD21 . LEU A 1 13 ? 0.044   -9.393  -2.200  1.00 0.00 ? 13 LEU A HD21 2  
ATOM 1346  H HD22 . LEU A 1 13 ? -1.131  -10.718 -2.422  1.00 0.00 ? 13 LEU A HD22 2  
ATOM 1347  H HD23 . LEU A 1 13 ? -1.558  -9.302  -1.439  1.00 0.00 ? 13 LEU A HD23 2  
ATOM 1348  N N    . ASP A 1 14 ? -0.562  -6.560  0.573   1.00 0.00 ? 14 ASP A N    2  
ATOM 1349  C CA   . ASP A 1 14 ? -1.565  -5.531  0.359   1.00 0.00 ? 14 ASP A CA   2  
ATOM 1350  C C    . ASP A 1 14 ? -0.961  -4.402  -0.478  1.00 0.00 ? 14 ASP A C    2  
ATOM 1351  O O    . ASP A 1 14 ? -1.705  -3.774  -1.246  1.00 0.00 ? 14 ASP A O    2  
ATOM 1352  C CB   . ASP A 1 14 ? -2.035  -4.936  1.686   1.00 0.00 ? 14 ASP A CB   2  
ATOM 1353  C CG   . ASP A 1 14 ? -3.540  -4.675  1.782   1.00 0.00 ? 14 ASP A CG   2  
ATOM 1354  O OD1  . ASP A 1 14 ? -4.285  -5.717  1.627   1.00 0.00 ? 14 ASP A OD1  2  
ATOM 1355  O OD2  . ASP A 1 14 ? -3.979  -3.534  1.994   1.00 0.00 ? 14 ASP A OD2  2  
ATOM 1356  H H    . ASP A 1 14 ? -0.188  -6.675  1.516   1.00 0.00 ? 14 ASP A H    2  
ATOM 1357  H HA   . ASP A 1 14 ? -2.406  -5.965  -0.183  1.00 0.00 ? 14 ASP A HA   2  
ATOM 1358  H HB2  . ASP A 1 14 ? -1.747  -5.637  2.470   1.00 0.00 ? 14 ASP A HB2  2  
ATOM 1359  H HB3  . ASP A 1 14 ? -1.488  -4.003  1.826   1.00 0.00 ? 14 ASP A HB3  2  
ATOM 1360  N N    . ASN A 1 15 ? 0.354   -4.171  -0.317  1.00 0.00 ? 15 ASN A N    2  
ATOM 1361  C CA   . ASN A 1 15 ? 1.048   -3.128  -1.054  1.00 0.00 ? 15 ASN A CA   2  
ATOM 1362  C C    . ASN A 1 15 ? 1.013   -3.454  -2.548  1.00 0.00 ? 15 ASN A C    2  
ATOM 1363  O O    . ASN A 1 15 ? 0.658   -2.565  -3.337  1.00 0.00 ? 15 ASN A O    2  
ATOM 1364  C CB   . ASN A 1 15 ? 2.514   -3.033  -0.625  1.00 0.00 ? 15 ASN A CB   2  
ATOM 1365  C CG   . ASN A 1 15 ? 3.090   -1.652  -0.942  1.00 0.00 ? 15 ASN A CG   2  
ATOM 1366  O OD1  . ASN A 1 15 ? 3.585   -1.392  -2.026  1.00 0.00 ? 15 ASN A OD1  2  
ATOM 1367  N ND2  . ASN A 1 15 ? 2.999   -0.784  0.061   1.00 0.00 ? 15 ASN A ND2  2  
ATOM 1368  H H    . ASN A 1 15 ? 0.895   -4.736  0.337   1.00 0.00 ? 15 ASN A H    2  
ATOM 1369  H HA   . ASN A 1 15 ? 0.541   -2.178  -0.886  1.00 0.00 ? 15 ASN A HA   2  
ATOM 1370  H HB2  . ASN A 1 15 ? 2.581   -3.208  0.449   1.00 0.00 ? 15 ASN A HB2  2  
ATOM 1371  H HB3  . ASN A 1 15 ? 3.085   -3.802  -1.145  1.00 0.00 ? 15 ASN A HB3  2  
ATOM 1372  H HD21 . ASN A 1 15 ? 2.572   -1.068  0.943   1.00 0.00 ? 15 ASN A HD21 2  
ATOM 1373  H HD22 . ASN A 1 15 ? 3.355   0.165   -0.051  1.00 0.00 ? 15 ASN A HD22 2  
ATOM 1374  N N    . TYR A 1 16 ? 1.374   -4.700  -2.901  1.00 0.00 ? 16 TYR A N    2  
ATOM 1375  C CA   . TYR A 1 16 ? 1.366   -5.072  -4.306  1.00 0.00 ? 16 TYR A CA   2  
ATOM 1376  C C    . TYR A 1 16 ? -0.058  -4.957  -4.851  1.00 0.00 ? 16 TYR A C    2  
ATOM 1377  O O    . TYR A 1 16 ? -0.205  -4.581  -6.024  1.00 0.00 ? 16 TYR A O    2  
ATOM 1378  C CB   . TYR A 1 16 ? 1.934   -6.492  -4.481  1.00 0.00 ? 16 TYR A CB   2  
ATOM 1379  C CG   . TYR A 1 16 ? 3.170   -6.786  -3.642  1.00 0.00 ? 16 TYR A CG   2  
ATOM 1380  C CD1  . TYR A 1 16 ? 4.119   -5.767  -3.400  1.00 0.00 ? 16 TYR A CD1  2  
ATOM 1381  C CD2  . TYR A 1 16 ? 3.374   -8.073  -3.094  1.00 0.00 ? 16 TYR A CD2  2  
ATOM 1382  C CE1  . TYR A 1 16 ? 5.265   -6.034  -2.621  1.00 0.00 ? 16 TYR A CE1  2  
ATOM 1383  C CE2  . TYR A 1 16 ? 4.519   -8.340  -2.315  1.00 0.00 ? 16 TYR A CE2  2  
ATOM 1384  C CZ   . TYR A 1 16 ? 5.467   -7.320  -2.077  1.00 0.00 ? 16 TYR A CZ   2  
ATOM 1385  O OH   . TYR A 1 16 ? 6.578   -7.575  -1.325  1.00 0.00 ? 16 TYR A OH   2  
ATOM 1386  H H    . TYR A 1 16 ? 1.654   -5.377  -2.206  1.00 0.00 ? 16 TYR A H    2  
ATOM 1387  H HA   . TYR A 1 16 ? 1.995   -4.365  -4.849  1.00 0.00 ? 16 TYR A HA   2  
ATOM 1388  H HB2  . TYR A 1 16 ? 1.153   -7.220  -4.247  1.00 0.00 ? 16 TYR A HB2  2  
ATOM 1389  H HB3  . TYR A 1 16 ? 2.202   -6.638  -5.529  1.00 0.00 ? 16 TYR A HB3  2  
ATOM 1390  H HD1  . TYR A 1 16 ? 3.972   -4.778  -3.812  1.00 0.00 ? 16 TYR A HD1  2  
ATOM 1391  H HD2  . TYR A 1 16 ? 2.654   -8.860  -3.270  1.00 0.00 ? 16 TYR A HD2  2  
ATOM 1392  H HE1  . TYR A 1 16 ? 5.986   -5.247  -2.443  1.00 0.00 ? 16 TYR A HE1  2  
ATOM 1393  H HE2  . TYR A 1 16 ? 4.668   -9.328  -1.900  1.00 0.00 ? 16 TYR A HE2  2  
ATOM 1394  H HH   . TYR A 1 16 ? 7.187   -6.835  -1.279  1.00 0.00 ? 16 TYR A HH   2  
ATOM 1395  N N    . HIS A 1 17 ? -1.060  -5.281  -4.014  1.00 0.00 ? 17 HIS A N    2  
ATOM 1396  C CA   . HIS A 1 17 ? -2.454  -5.222  -4.422  1.00 0.00 ? 17 HIS A CA   2  
ATOM 1397  C C    . HIS A 1 17 ? -2.884  -3.758  -4.536  1.00 0.00 ? 17 HIS A C    2  
ATOM 1398  O O    . HIS A 1 17 ? -3.700  -3.451  -5.417  1.00 0.00 ? 17 HIS A O    2  
ATOM 1399  C CB   . HIS A 1 17 ? -3.338  -6.028  -3.468  1.00 0.00 ? 17 HIS A CB   2  
ATOM 1400  C CG   . HIS A 1 17 ? -4.540  -5.269  -2.957  1.00 0.00 ? 17 HIS A CG   2  
ATOM 1401  N ND1  . HIS A 1 17 ? -5.721  -5.165  -3.672  1.00 0.00 ? 17 HIS A ND1  2  
ATOM 1402  C CD2  . HIS A 1 17 ? -4.731  -4.581  -1.795  1.00 0.00 ? 17 HIS A CD2  2  
ATOM 1403  C CE1  . HIS A 1 17 ? -6.576  -4.443  -2.964  1.00 0.00 ? 17 HIS A CE1  2  
ATOM 1404  N NE2  . HIS A 1 17 ? -5.961  -4.083  -1.801  1.00 0.00 ? 17 HIS A NE2  2  
ATOM 1405  H H    . HIS A 1 17 ? -0.852  -5.581  -3.062  1.00 0.00 ? 17 HIS A H    2  
ATOM 1406  H HA   . HIS A 1 17 ? -2.509  -5.686  -5.407  1.00 0.00 ? 17 HIS A HA   2  
ATOM 1407  H HB2  . HIS A 1 17 ? -3.679  -6.911  -4.008  1.00 0.00 ? 17 HIS A HB2  2  
ATOM 1408  H HB3  . HIS A 1 17 ? -2.714  -6.341  -2.632  1.00 0.00 ? 17 HIS A HB3  2  
ATOM 1409  H HD1  . HIS A 1 17 ? -5.995  -5.532  -4.583  1.00 0.00 ? 17 HIS A HD1  2  
ATOM 1410  H HD2  . HIS A 1 17 ? -4.080  -4.405  -0.951  1.00 0.00 ? 17 HIS A HD2  2  
ATOM 1411  H HE1  . HIS A 1 17 ? -7.565  -4.244  -3.350  1.00 0.00 ? 17 HIS A HE1  2  
ATOM 1412  N N    . LEU A 1 18 ? -2.338  -2.899  -3.657  1.00 0.00 ? 18 LEU A N    2  
ATOM 1413  C CA   . LEU A 1 18 ? -2.664  -1.483  -3.660  1.00 0.00 ? 18 LEU A CA   2  
ATOM 1414  C C    . LEU A 1 18 ? -1.925  -0.797  -4.810  1.00 0.00 ? 18 LEU A C    2  
ATOM 1415  O O    . LEU A 1 18 ? -2.549  0.009   -5.515  1.00 0.00 ? 18 LEU A O    2  
ATOM 1416  C CB   . LEU A 1 18 ? -2.378  -0.865  -2.290  1.00 0.00 ? 18 LEU A CB   2  
ATOM 1417  C CG   . LEU A 1 18 ? -3.330  -1.266  -1.162  1.00 0.00 ? 18 LEU A CG   2  
ATOM 1418  C CD1  . LEU A 1 18 ? -2.696  -1.013  0.207   1.00 0.00 ? 18 LEU A CD1  2  
ATOM 1419  C CD2  . LEU A 1 18 ? -4.680  -0.562  -1.307  1.00 0.00 ? 18 LEU A CD2  2  
ATOM 1420  H H    . LEU A 1 18 ? -1.672  -3.236  -2.962  1.00 0.00 ? 18 LEU A H    2  
ATOM 1421  H HA   . LEU A 1 18 ? -3.737  -1.413  -3.836  1.00 0.00 ? 18 LEU A HA   2  
ATOM 1422  H HB2  . LEU A 1 18 ? -1.364  -1.164  -2.022  1.00 0.00 ? 18 LEU A HB2  2  
ATOM 1423  H HB3  . LEU A 1 18 ? -2.404  0.216   -2.431  1.00 0.00 ? 18 LEU A HB3  2  
ATOM 1424  H HG   . LEU A 1 18 ? -3.476  -2.340  -1.281  1.00 0.00 ? 18 LEU A HG   2  
ATOM 1425  H HD11 . LEU A 1 18 ? -2.448  0.043   0.313   1.00 0.00 ? 18 LEU A HD11 2  
ATOM 1426  H HD12 . LEU A 1 18 ? -3.399  -1.309  0.985   1.00 0.00 ? 18 LEU A HD12 2  
ATOM 1427  H HD13 . LEU A 1 18 ? -1.785  -1.602  0.309   1.00 0.00 ? 18 LEU A HD13 2  
ATOM 1428  H HD21 . LEU A 1 18 ? -5.135  -0.824  -2.262  1.00 0.00 ? 18 LEU A HD21 2  
ATOM 1429  H HD22 . LEU A 1 18 ? -5.332  -0.870  -0.489  1.00 0.00 ? 18 LEU A HD22 2  
ATOM 1430  H HD23 . LEU A 1 18 ? -4.543  0.518   -1.263  1.00 0.00 ? 18 LEU A HD23 2  
ATOM 1431  N N    . GLU A 1 19 ? -0.630  -1.124  -4.975  1.00 0.00 ? 19 GLU A N    2  
ATOM 1432  C CA   . GLU A 1 19 ? 0.183   -0.543  -6.030  1.00 0.00 ? 19 GLU A CA   2  
ATOM 1433  C C    . GLU A 1 19 ? -0.375  -0.966  -7.390  1.00 0.00 ? 19 GLU A C    2  
ATOM 1434  O O    . GLU A 1 19 ? -0.340  -0.149  -8.322  1.00 0.00 ? 19 GLU A O    2  
ATOM 1435  C CB   . GLU A 1 19 ? 1.653   -0.942  -5.892  1.00 0.00 ? 19 GLU A CB   2  
ATOM 1436  C CG   . GLU A 1 19 ? 2.570   0.272   -6.053  1.00 0.00 ? 19 GLU A CG   2  
ATOM 1437  C CD   . GLU A 1 19 ? 2.539   1.153   -4.803  1.00 0.00 ? 19 GLU A CD   2  
ATOM 1438  O OE1  . GLU A 1 19 ? 2.419   0.636   -3.683  1.00 0.00 ? 19 GLU A OE1  2  
ATOM 1439  O OE2  . GLU A 1 19 ? 2.646   2.419   -5.027  1.00 0.00 ? 19 GLU A OE2  2  
ATOM 1440  H H    . GLU A 1 19 ? -0.191  -1.798  -4.349  1.00 0.00 ? 19 GLU A H    2  
ATOM 1441  H HA   . GLU A 1 19 ? 0.100   0.540   -5.934  1.00 0.00 ? 19 GLU A HA   2  
ATOM 1442  H HB2  . GLU A 1 19 ? 1.811   -1.376  -4.903  1.00 0.00 ? 19 GLU A HB2  2  
ATOM 1443  H HB3  . GLU A 1 19 ? 1.888   -1.690  -6.648  1.00 0.00 ? 19 GLU A HB3  2  
ATOM 1444  H HG2  . GLU A 1 19 ? 3.590   -0.075  -6.219  1.00 0.00 ? 19 GLU A HG2  2  
ATOM 1445  H HG3  . GLU A 1 19 ? 2.246   0.845   -6.922  1.00 0.00 ? 19 GLU A HG3  2  
ATOM 1446  N N    . ASN A 1 20 ? -0.870  -2.214  -7.476  1.00 0.00 ? 20 ASN A N    2  
ATOM 1447  C CA   . ASN A 1 20 ? -1.428  -2.738  -8.711  1.00 0.00 ? 20 ASN A CA   2  
ATOM 1448  C C    . ASN A 1 20 ? -2.730  -1.999  -9.030  1.00 0.00 ? 20 ASN A C    2  
ATOM 1449  O O    . ASN A 1 20 ? -3.070  -1.889  -10.217 1.00 0.00 ? 20 ASN A O    2  
ATOM 1450  C CB   . ASN A 1 20 ? -1.749  -4.228  -8.582  1.00 0.00 ? 20 ASN A CB   2  
ATOM 1451  C CG   . ASN A 1 20 ? -0.568  -5.085  -9.042  1.00 0.00 ? 20 ASN A CG   2  
ATOM 1452  O OD1  . ASN A 1 20 ? 0.279   -4.659  -9.809  1.00 0.00 ? 20 ASN A OD1  2  
ATOM 1453  N ND2  . ASN A 1 20 ? -0.560  -6.313  -8.532  1.00 0.00 ? 20 ASN A ND2  2  
ATOM 1454  H H    . ASN A 1 20 ? -0.859  -2.824  -6.658  1.00 0.00 ? 20 ASN A H    2  
ATOM 1455  H HA   . ASN A 1 20 ? -0.718  -2.570  -9.520  1.00 0.00 ? 20 ASN A HA   2  
ATOM 1456  H HB2  . ASN A 1 20 ? -1.967  -4.455  -7.538  1.00 0.00 ? 20 ASN A HB2  2  
ATOM 1457  H HB3  . ASN A 1 20 ? -2.630  -4.454  -9.184  1.00 0.00 ? 20 ASN A HB3  2  
ATOM 1458  H HD21 . ASN A 1 20 ? -1.301  -6.606  -7.895  1.00 0.00 ? 20 ASN A HD21 2  
ATOM 1459  H HD22 . ASN A 1 20 ? 0.187   -6.963  -8.778  1.00 0.00 ? 20 ASN A HD22 2  
ATOM 1460  N N    . GLU A 1 21 ? -3.422  -1.518  -7.981  1.00 0.00 ? 21 GLU A N    2  
ATOM 1461  C CA   . GLU A 1 21 ? -4.672  -0.798  -8.149  1.00 0.00 ? 21 GLU A CA   2  
ATOM 1462  C C    . GLU A 1 21 ? -4.375  0.676   -8.434  1.00 0.00 ? 21 GLU A C    2  
ATOM 1463  O O    . GLU A 1 21 ? -5.082  1.271   -9.260  1.00 0.00 ? 21 GLU A O    2  
ATOM 1464  C CB   . GLU A 1 21 ? -5.576  -0.948  -6.923  1.00 0.00 ? 21 GLU A CB   2  
ATOM 1465  C CG   . GLU A 1 21 ? -7.040  -1.106  -7.336  1.00 0.00 ? 21 GLU A CG   2  
ATOM 1466  C CD   . GLU A 1 21 ? -7.936  -1.317  -6.114  1.00 0.00 ? 21 GLU A CD   2  
ATOM 1467  O OE1  . GLU A 1 21 ? -7.450  -1.745  -5.056  1.00 0.00 ? 21 GLU A OE1  2  
ATOM 1468  O OE2  . GLU A 1 21 ? -9.178  -1.018  -6.289  1.00 0.00 ? 21 GLU A OE2  2  
ATOM 1469  H H    . GLU A 1 21 ? -3.071  -1.653  -7.033  1.00 0.00 ? 21 GLU A H    2  
ATOM 1470  H HA   . GLU A 1 21 ? -5.175  -1.232  -9.014  1.00 0.00 ? 21 GLU A HA   2  
ATOM 1471  H HB2  . GLU A 1 21 ? -5.267  -1.829  -6.362  1.00 0.00 ? 21 GLU A HB2  2  
ATOM 1472  H HB3  . GLU A 1 21 ? -5.462  -0.067  -6.290  1.00 0.00 ? 21 GLU A HB3  2  
ATOM 1473  H HG2  . GLU A 1 21 ? -7.360  -0.206  -7.860  1.00 0.00 ? 21 GLU A HG2  2  
ATOM 1474  H HG3  . GLU A 1 21 ? -7.126  -1.959  -8.011  1.00 0.00 ? 21 GLU A HG3  2  
ATOM 1475  N N    . VAL A 1 22 ? -3.350  1.224   -7.757  1.00 0.00 ? 22 VAL A N    2  
ATOM 1476  C CA   . VAL A 1 22 ? -2.964  2.613   -7.937  1.00 0.00 ? 22 VAL A CA   2  
ATOM 1477  C C    . VAL A 1 22 ? -2.193  2.758   -9.251  1.00 0.00 ? 22 VAL A C    2  
ATOM 1478  O O    . VAL A 1 22 ? -2.410  3.755   -9.955  1.00 0.00 ? 22 VAL A O    2  
ATOM 1479  C CB   . VAL A 1 22 ? -2.171  3.098   -6.722  1.00 0.00 ? 22 VAL A CB   2  
ATOM 1480  C CG1  . VAL A 1 22 ? -1.487  4.436   -7.011  1.00 0.00 ? 22 VAL A CG1  2  
ATOM 1481  C CG2  . VAL A 1 22 ? -3.067  3.196   -5.486  1.00 0.00 ? 22 VAL A CG2  2  
ATOM 1482  H H    . VAL A 1 22 ? -2.817  0.662   -7.094  1.00 0.00 ? 22 VAL A H    2  
ATOM 1483  H HA   . VAL A 1 22 ? -3.880  3.201   -7.996  1.00 0.00 ? 22 VAL A HA   2  
ATOM 1484  H HB   . VAL A 1 22 ? -1.408  2.340   -6.545  1.00 0.00 ? 22 VAL A HB   2  
ATOM 1485  H HG11 . VAL A 1 22 ? -2.234  5.187   -7.269  1.00 0.00 ? 22 VAL A HG11 2  
ATOM 1486  H HG12 . VAL A 1 22 ? -0.933  4.750   -6.127  1.00 0.00 ? 22 VAL A HG12 2  
ATOM 1487  H HG13 . VAL A 1 22 ? -0.793  4.325   -7.845  1.00 0.00 ? 22 VAL A HG13 2  
ATOM 1488  H HG21 . VAL A 1 22 ? -3.498  2.221   -5.260  1.00 0.00 ? 22 VAL A HG21 2  
ATOM 1489  H HG22 . VAL A 1 22 ? -2.471  3.544   -4.643  1.00 0.00 ? 22 VAL A HG22 2  
ATOM 1490  H HG23 . VAL A 1 22 ? -3.874  3.908   -5.668  1.00 0.00 ? 22 VAL A HG23 2  
ATOM 1491  N N    . ALA A 1 23 ? -1.322  1.778   -9.549  1.00 0.00 ? 23 ALA A N    2  
ATOM 1492  C CA   . ALA A 1 23 ? -0.528  1.797   -10.766 1.00 0.00 ? 23 ALA A CA   2  
ATOM 1493  C C    . ALA A 1 23 ? -1.453  1.647   -11.976 1.00 0.00 ? 23 ALA A C    2  
ATOM 1494  O O    . ALA A 1 23 ? -1.040  2.018   -13.084 1.00 0.00 ? 23 ALA A O    2  
ATOM 1495  C CB   . ALA A 1 23 ? 0.408   0.587   -10.790 1.00 0.00 ? 23 ALA A CB   2  
ATOM 1496  H H    . ALA A 1 23 ? -1.203  0.990   -8.912  1.00 0.00 ? 23 ALA A H    2  
ATOM 1497  H HA   . ALA A 1 23 ? 0.029   2.728   -10.859 1.00 0.00 ? 23 ALA A HA   2  
ATOM 1498  H HB1  . ALA A 1 23 ? 1.059   0.626   -9.917  1.00 0.00 ? 23 ALA A HB1  2  
ATOM 1499  H HB2  . ALA A 1 23 ? -0.175  -0.334  -10.757 1.00 0.00 ? 23 ALA A HB2  2  
ATOM 1500  H HB3  . ALA A 1 23 ? 1.005   0.596   -11.700 1.00 0.00 ? 23 ALA A HB3  2  
ATOM 1501  N N    . ARG A 1 24 ? -2.666  1.115   -11.743 1.00 0.00 ? 24 ARG A N    2  
ATOM 1502  C CA   . ARG A 1 24 ? -3.638  0.919   -12.806 1.00 0.00 ? 24 ARG A CA   2  
ATOM 1503  C C    . ARG A 1 24 ? -4.546  2.147   -12.893 1.00 0.00 ? 24 ARG A C    2  
ATOM 1504  O O    . ARG A 1 24 ? -5.041  2.439   -13.992 1.00 0.00 ? 24 ARG A O    2  
ATOM 1505  C CB   . ARG A 1 24 ? -4.495  -0.325  -12.565 1.00 0.00 ? 24 ARG A CB   2  
ATOM 1506  C CG   . ARG A 1 24 ? -3.842  -1.567  -13.173 1.00 0.00 ? 24 ARG A CG   2  
ATOM 1507  C CD   . ARG A 1 24 ? -4.600  -2.836  -12.776 1.00 0.00 ? 24 ARG A CD   2  
ATOM 1508  N NE   . ARG A 1 24 ? -5.016  -3.577  -13.987 1.00 0.00 ? 24 ARG A NE   2  
ATOM 1509  C CZ   . ARG A 1 24 ? -4.244  -4.484  -14.623 1.00 0.00 ? 24 ARG A CZ   2  
ATOM 1510  N NH1  . ARG A 1 24 ? -3.020  -4.744  -14.143 1.00 0.00 ? 24 ARG A NH1  2  
ATOM 1511  N NH2  . ARG A 1 24 ? -4.694  -5.113  -15.717 1.00 0.00 ? 24 ARG A NH2  2  
ATOM 1512  H H    . ARG A 1 24 ? -2.928  0.834   -10.798 1.00 0.00 ? 24 ARG A H    2  
ATOM 1513  H HA   . ARG A 1 24 ? -3.091  0.816   -13.743 1.00 0.00 ? 24 ARG A HA   2  
ATOM 1514  H HB2  . ARG A 1 24 ? -4.608  -0.474  -11.490 1.00 0.00 ? 24 ARG A HB2  2  
ATOM 1515  H HB3  . ARG A 1 24 ? -5.478  -0.168  -13.007 1.00 0.00 ? 24 ARG A HB3  2  
ATOM 1516  H HG2  . ARG A 1 24 ? -3.848  -1.475  -14.259 1.00 0.00 ? 24 ARG A HG2  2  
ATOM 1517  H HG3  . ARG A 1 24 ? -2.809  -1.628  -12.829 1.00 0.00 ? 24 ARG A HG3  2  
ATOM 1518  H HD2  . ARG A 1 24 ? -3.951  -3.474  -12.175 1.00 0.00 ? 24 ARG A HD2  2  
ATOM 1519  H HD3  . ARG A 1 24 ? -5.476  -2.566  -12.186 1.00 0.00 ? 24 ARG A HD3  2  
ATOM 1520  H HE   . ARG A 1 24 ? -5.950  -3.367  -14.339 1.00 0.00 ? 24 ARG A HE   2  
ATOM 1521  H HH11 . ARG A 1 24 ? -2.685  -4.260  -13.311 1.00 0.00 ? 24 ARG A HH11 2  
ATOM 1522  H HH12 . ARG A 1 24 ? -2.423  -5.426  -14.612 1.00 0.00 ? 24 ARG A HH12 2  
ATOM 1523  H HH21 . ARG A 1 24 ? -5.627  -4.909  -16.075 1.00 0.00 ? 24 ARG A HH21 2  
ATOM 1524  H HH22 . ARG A 1 24 ? -4.104  -5.797  -16.190 1.00 0.00 ? 24 ARG A HH22 2  
ATOM 1525  N N    . LEU A 1 25 ? -4.746  2.831   -11.752 1.00 0.00 ? 25 LEU A N    2  
ATOM 1526  C CA   . LEU A 1 25 ? -5.587  4.014   -11.700 1.00 0.00 ? 25 LEU A CA   2  
ATOM 1527  C C    . LEU A 1 25 ? -4.766  5.237   -12.114 1.00 0.00 ? 25 LEU A C    2  
ATOM 1528  O O    . LEU A 1 25 ? -5.327  6.134   -12.759 1.00 0.00 ? 25 LEU A O    2  
ATOM 1529  C CB   . LEU A 1 25 ? -6.238  4.149   -10.322 1.00 0.00 ? 25 LEU A CB   2  
ATOM 1530  C CG   . LEU A 1 25 ? -7.375  3.170   -10.019 1.00 0.00 ? 25 LEU A CG   2  
ATOM 1531  C CD1  . LEU A 1 25 ? -7.786  3.248   -8.547  1.00 0.00 ? 25 LEU A CD1  2  
ATOM 1532  C CD2  . LEU A 1 25 ? -8.559  3.398   -10.959 1.00 0.00 ? 25 LEU A CD2  2  
ATOM 1533  H H    . LEU A 1 25 ? -4.300  2.522   -10.888 1.00 0.00 ? 25 LEU A H    2  
ATOM 1534  H HA   . LEU A 1 25 ? -6.384  3.860   -12.427 1.00 0.00 ? 25 LEU A HA   2  
ATOM 1535  H HB2  . LEU A 1 25 ? -5.442  4.007   -9.590  1.00 0.00 ? 25 LEU A HB2  2  
ATOM 1536  H HB3  . LEU A 1 25 ? -6.602  5.174   -10.255 1.00 0.00 ? 25 LEU A HB3  2  
ATOM 1537  H HG   . LEU A 1 25 ? -6.956  2.182   -10.208 1.00 0.00 ? 25 LEU A HG   2  
ATOM 1538  H HD11 . LEU A 1 25 ? -8.117  4.259   -8.306  1.00 0.00 ? 25 LEU A HD11 2  
ATOM 1539  H HD12 . LEU A 1 25 ? -8.595  2.540   -8.368  1.00 0.00 ? 25 LEU A HD12 2  
ATOM 1540  H HD13 . LEU A 1 25 ? -6.941  2.990   -7.910  1.00 0.00 ? 25 LEU A HD13 2  
ATOM 1541  H HD21 . LEU A 1 25 ? -8.245  3.263   -11.993 1.00 0.00 ? 25 LEU A HD21 2  
ATOM 1542  H HD22 . LEU A 1 25 ? -9.348  2.686   -10.714 1.00 0.00 ? 25 LEU A HD22 2  
ATOM 1543  H HD23 . LEU A 1 25 ? -8.944  4.410   -10.833 1.00 0.00 ? 25 LEU A HD23 2  
ATOM 1544  N N    . LYS A 1 26 ? -3.474  5.249   -11.741 1.00 0.00 ? 26 LYS A N    2  
ATOM 1545  C CA   . LYS A 1 26 ? -2.587  6.351   -12.071 1.00 0.00 ? 26 LYS A CA   2  
ATOM 1546  C C    . LYS A 1 26 ? -2.538  6.524   -13.590 1.00 0.00 ? 26 LYS A C    2  
ATOM 1547  O O    . LYS A 1 26 ? -2.255  7.641   -14.049 1.00 0.00 ? 26 LYS A O    2  
ATOM 1548  C CB   . LYS A 1 26 ? -1.212  6.143   -11.432 1.00 0.00 ? 26 LYS A CB   2  
ATOM 1549  C CG   . LYS A 1 26 ? -1.022  7.068   -10.228 1.00 0.00 ? 26 LYS A CG   2  
ATOM 1550  C CD   . LYS A 1 26 ? -2.287  7.117   -9.369  1.00 0.00 ? 26 LYS A CD   2  
ATOM 1551  C CE   . LYS A 1 26 ? -3.088  8.392   -9.643  1.00 0.00 ? 26 LYS A CE   2  
ATOM 1552  N NZ   . LYS A 1 26 ? -3.057  9.281   -8.469  1.00 0.00 ? 26 LYS A NZ   2  
ATOM 1553  H H    . LYS A 1 26 ? -3.088  4.467   -11.209 1.00 0.00 ? 26 LYS A H    2  
ATOM 1554  H HA   . LYS A 1 26 ? -3.025  7.244   -11.626 1.00 0.00 ? 26 LYS A HA   2  
ATOM 1555  H HB2  . LYS A 1 26 ? -1.128  5.109   -11.101 1.00 0.00 ? 26 LYS A HB2  2  
ATOM 1556  H HB3  . LYS A 1 26 ? -0.442  6.340   -12.177 1.00 0.00 ? 26 LYS A HB3  2  
ATOM 1557  H HG2  . LYS A 1 26 ? -0.196  6.696   -9.622  1.00 0.00 ? 26 LYS A HG2  2  
ATOM 1558  H HG3  . LYS A 1 26 ? -0.777  8.068   -10.585 1.00 0.00 ? 26 LYS A HG3  2  
ATOM 1559  H HD2  . LYS A 1 26 ? -2.907  6.251   -9.603  1.00 0.00 ? 26 LYS A HD2  2  
ATOM 1560  H HD3  . LYS A 1 26 ? -2.002  7.076   -8.317  1.00 0.00 ? 26 LYS A HD3  2  
ATOM 1561  H HE2  . LYS A 1 26 ? -2.650  8.913   -10.494 1.00 0.00 ? 26 LYS A HE2  2  
ATOM 1562  H HE3  . LYS A 1 26 ? -4.116  8.125   -9.879  1.00 0.00 ? 26 LYS A HE3  2  
ATOM 1563  H HZ1  . LYS A 1 26 ? -2.094  9.531   -8.248  1.00 0.00 ? 26 LYS A HZ1  2  
ATOM 1564  H HZ2  . LYS A 1 26 ? -3.596  10.122  -8.677  1.00 0.00 ? 26 LYS A HZ2  2  
ATOM 1565  H HZ3  . LYS A 1 26 ? -3.472  8.810   -7.666  1.00 0.00 ? 26 LYS A HZ3  2  
ATOM 1566  N N    . LYS A 1 27 ? -2.811  5.434   -14.330 1.00 0.00 ? 27 LYS A N    2  
ATOM 1567  C CA   . LYS A 1 27 ? -2.798  5.465   -15.782 1.00 0.00 ? 27 LYS A CA   2  
ATOM 1568  C C    . LYS A 1 27 ? -4.103  6.085   -16.286 1.00 0.00 ? 27 LYS A C    2  
ATOM 1569  O O    . LYS A 1 27 ? -4.164  6.449   -17.469 1.00 0.00 ? 27 LYS A O    2  
ATOM 1570  C CB   . LYS A 1 27 ? -2.523  4.069   -16.346 1.00 0.00 ? 27 LYS A CB   2  
ATOM 1571  C CG   . LYS A 1 27 ? -1.561  4.138   -17.533 1.00 0.00 ? 27 LYS A CG   2  
ATOM 1572  C CD   . LYS A 1 27 ? -2.125  3.385   -18.740 1.00 0.00 ? 27 LYS A CD   2  
ATOM 1573  C CE   . LYS A 1 27 ? -1.722  1.910   -18.702 1.00 0.00 ? 27 LYS A CE   2  
ATOM 1574  N NZ   . LYS A 1 27 ? -1.319  1.451   -20.043 1.00 0.00 ? 27 LYS A NZ   2  
ATOM 1575  H H    . LYS A 1 27 ? -3.035  4.550   -13.871 1.00 0.00 ? 27 LYS A H    2  
ATOM 1576  H HA   . LYS A 1 27 ? -1.966  6.106   -16.070 1.00 0.00 ? 27 LYS A HA   2  
ATOM 1577  H HB2  . LYS A 1 27 ? -2.078  3.453   -15.564 1.00 0.00 ? 27 LYS A HB2  2  
ATOM 1578  H HB3  . LYS A 1 27 ? -3.466  3.621   -16.657 1.00 0.00 ? 27 LYS A HB3  2  
ATOM 1579  H HG2  . LYS A 1 27 ? -1.409  5.182   -17.805 1.00 0.00 ? 27 LYS A HG2  2  
ATOM 1580  H HG3  . LYS A 1 27 ? -0.605  3.704   -17.239 1.00 0.00 ? 27 LYS A HG3  2  
ATOM 1581  H HD2  . LYS A 1 27 ? -3.213  3.457   -18.725 1.00 0.00 ? 27 LYS A HD2  2  
ATOM 1582  H HD3  . LYS A 1 27 ? -1.751  3.850   -19.653 1.00 0.00 ? 27 LYS A HD3  2  
ATOM 1583  H HE2  . LYS A 1 27 ? -0.884  1.783   -18.018 1.00 0.00 ? 27 LYS A HE2  2  
ATOM 1584  H HE3  . LYS A 1 27 ? -2.565  1.317   -18.346 1.00 0.00 ? 27 LYS A HE3  2  
ATOM 1585  H HZ1  . LYS A 1 27 ? -0.531  2.005   -20.377 1.00 0.00 ? 27 LYS A HZ1  2  
ATOM 1586  H HZ2  . LYS A 1 27 ? -1.056  0.467   -19.991 1.00 0.00 ? 27 LYS A HZ2  2  
ATOM 1587  H HZ3  . LYS A 1 27 ? -2.097  1.554   -20.694 1.00 0.00 ? 27 LYS A HZ3  2  
ATOM 1588  N N    . LEU A 1 28 ? -5.103  6.193   -15.393 1.00 0.00 ? 28 LEU A N    2  
ATOM 1589  C CA   . LEU A 1 28 ? -6.391  6.763   -15.746 1.00 0.00 ? 28 LEU A CA   2  
ATOM 1590  C C    . LEU A 1 28 ? -6.508  8.162   -15.138 1.00 0.00 ? 28 LEU A C    2  
ATOM 1591  O O    . LEU A 1 28 ? -7.116  9.035   -15.777 1.00 0.00 ? 28 LEU A O    2  
ATOM 1592  C CB   . LEU A 1 28 ? -7.525  5.820   -15.339 1.00 0.00 ? 28 LEU A CB   2  
ATOM 1593  C CG   . LEU A 1 28 ? -8.568  5.519   -16.416 1.00 0.00 ? 28 LEU A CG   2  
ATOM 1594  C CD1  . LEU A 1 28 ? -8.125  4.348   -17.297 1.00 0.00 ? 28 LEU A CD1  2  
ATOM 1595  C CD2  . LEU A 1 28 ? -9.946  5.279   -15.796 1.00 0.00 ? 28 LEU A CD2  2  
ATOM 1596  H H    . LEU A 1 28 ? -4.968  5.867   -14.435 1.00 0.00 ? 28 LEU A H    2  
ATOM 1597  H HA   . LEU A 1 28 ? -6.406  6.846   -16.832 1.00 0.00 ? 28 LEU A HA   2  
ATOM 1598  H HB2  . LEU A 1 28 ? -7.053  4.887   -15.031 1.00 0.00 ? 28 LEU A HB2  2  
ATOM 1599  H HB3  . LEU A 1 28 ? -8.007  6.276   -14.473 1.00 0.00 ? 28 LEU A HB3  2  
ATOM 1600  H HG   . LEU A 1 28 ? -8.608  6.418   -17.032 1.00 0.00 ? 28 LEU A HG   2  
ATOM 1601  H HD11 . LEU A 1 28 ? -7.982  3.458   -16.686 1.00 0.00 ? 28 LEU A HD11 2  
ATOM 1602  H HD12 . LEU A 1 28 ? -8.888  4.163   -18.051 1.00 0.00 ? 28 LEU A HD12 2  
ATOM 1603  H HD13 . LEU A 1 28 ? -7.187  4.593   -17.795 1.00 0.00 ? 28 LEU A HD13 2  
ATOM 1604  H HD21 . LEU A 1 28 ? -10.260 6.161   -15.237 1.00 0.00 ? 28 LEU A HD21 2  
ATOM 1605  H HD22 . LEU A 1 28 ? -10.662 5.069   -16.590 1.00 0.00 ? 28 LEU A HD22 2  
ATOM 1606  H HD23 . LEU A 1 28 ? -9.905  4.425   -15.119 1.00 0.00 ? 28 LEU A HD23 2  
ATOM 1607  N N    . VAL A 1 29 ? -5.934  8.346   -13.936 1.00 0.00 ? 29 VAL A N    2  
ATOM 1608  C CA   . VAL A 1 29 ? -5.973  9.628   -13.251 1.00 0.00 ? 29 VAL A CA   2  
ATOM 1609  C C    . VAL A 1 29 ? -4.581  10.261  -13.284 1.00 0.00 ? 29 VAL A C    2  
ATOM 1610  O O    . VAL A 1 29 ? -4.443  11.356  -13.851 1.00 0.00 ? 29 VAL A O    2  
ATOM 1611  C CB   . VAL A 1 29 ? -6.514  9.447   -11.832 1.00 0.00 ? 29 VAL A CB   2  
ATOM 1612  C CG1  . VAL A 1 29 ? -6.874  10.796  -11.206 1.00 0.00 ? 29 VAL A CG1  2  
ATOM 1613  C CG2  . VAL A 1 29 ? -7.715  8.498   -11.820 1.00 0.00 ? 29 VAL A CG2  2  
ATOM 1614  H H    . VAL A 1 29 ? -5.452  7.574   -13.477 1.00 0.00 ? 29 VAL A H    2  
ATOM 1615  H HA   . VAL A 1 29 ? -6.667  10.268  -13.796 1.00 0.00 ? 29 VAL A HA   2  
ATOM 1616  H HB   . VAL A 1 29 ? -5.702  8.997   -11.262 1.00 0.00 ? 29 VAL A HB   2  
ATOM 1617  H HG11 . VAL A 1 29 ? -7.630  11.296  -11.812 1.00 0.00 ? 29 VAL A HG11 2  
ATOM 1618  H HG12 . VAL A 1 29 ? -7.255  10.629  -10.199 1.00 0.00 ? 29 VAL A HG12 2  
ATOM 1619  H HG13 . VAL A 1 29 ? -5.988  11.428  -11.151 1.00 0.00 ? 29 VAL A HG13 2  
ATOM 1620  H HG21 . VAL A 1 29 ? -7.423  7.525   -12.213 1.00 0.00 ? 29 VAL A HG21 2  
ATOM 1621  H HG22 . VAL A 1 29 ? -8.073  8.393   -10.796 1.00 0.00 ? 29 VAL A HG22 2  
ATOM 1622  H HG23 . VAL A 1 29 ? -8.515  8.906   -12.436 1.00 0.00 ? 29 VAL A HG23 2  
ATOM 1623  N N    . GLY A 1 30 ? -3.591  9.574   -12.686 1.00 0.00 ? 30 GLY A N    2  
ATOM 1624  C CA   . GLY A 1 30 ? -2.225  10.066  -12.647 1.00 0.00 ? 30 GLY A CA   2  
ATOM 1625  C C    . GLY A 1 30 ? -1.730  10.295  -14.077 1.00 0.00 ? 30 GLY A C    2  
ATOM 1626  O O    . GLY A 1 30 ? -0.594  10.765  -14.238 1.00 0.00 ? 30 GLY A O    2  
ATOM 1627  H H    . GLY A 1 30 ? -3.791  8.678   -12.241 1.00 0.00 ? 30 GLY A H    2  
ATOM 1628  H HA2  . GLY A 1 30 ? -2.188  11.010  -12.102 1.00 0.00 ? 30 GLY A HA2  2  
ATOM 1629  H HA3  . GLY A 1 30 ? -1.586  9.340   -12.144 1.00 0.00 ? 30 GLY A HA3  2  
ATOM 1630  N N    . GLU A 1 31 ? -2.577  9.966   -15.068 1.00 0.00 ? 31 GLU A N    2  
ATOM 1631  C CA   . GLU A 1 31 ? -2.227  10.135  -16.468 1.00 0.00 ? 31 GLU A CA   2  
ATOM 1632  C C    . GLU A 1 31 ? -1.547  11.492  -16.659 1.00 0.00 ? 31 GLU A C    2  
ATOM 1633  O O    . GLU A 1 31 ? -1.755  12.379  -15.817 1.00 0.00 ? 31 GLU A O    2  
ATOM 1634  C CB   . GLU A 1 31 ? -3.453  10.003  -17.374 1.00 0.00 ? 31 GLU A CB   2  
ATOM 1635  C CG   . GLU A 1 31 ? -4.100  11.368  -17.623 1.00 0.00 ? 31 GLU A CG   2  
ATOM 1636  C CD   . GLU A 1 31 ? -5.483  11.211  -18.257 1.00 0.00 ? 31 GLU A CD   2  
ATOM 1637  O OE1  . GLU A 1 31 ? -5.582  10.260  -19.124 1.00 0.00 ? 31 GLU A OE1  2  
ATOM 1638  O OE2  . GLU A 1 31 ? -6.406  11.970  -17.926 1.00 0.00 ? 31 GLU A OE2  2  
ATOM 1639  H H    . GLU A 1 31 ? -3.496  9.584   -14.847 1.00 0.00 ? 31 GLU A H    2  
ATOM 1640  H HA   . GLU A 1 31 ? -1.518  9.345   -16.716 1.00 0.00 ? 31 GLU A HA   2  
ATOM 1641  H HB2  . GLU A 1 31 ? -3.144  9.577   -18.327 1.00 0.00 ? 31 GLU A HB2  2  
ATOM 1642  H HB3  . GLU A 1 31 ? -4.171  9.333   -16.901 1.00 0.00 ? 31 GLU A HB3  2  
ATOM 1643  H HG2  . GLU A 1 31 ? -4.202  11.890  -16.672 1.00 0.00 ? 31 GLU A HG2  2  
ATOM 1644  H HG3  . GLU A 1 31 ? -3.453  11.950  -18.281 1.00 0.00 ? 31 GLU A HG3  2  
ATOM 1645  N N    . ARG A 1 32 ? -0.764  11.626  -17.743 1.00 0.00 ? 32 ARG A N    2  
ATOM 1646  C CA   . ARG A 1 32 ? -0.063  12.864  -18.038 1.00 0.00 ? 32 ARG A CA   2  
ATOM 1647  C C    . ARG A 1 32 ? -0.598  13.450  -19.347 1.00 0.00 ? 32 ARG A C    2  
ATOM 1648  O O    . ARG A 1 32 ? -1.803  13.646  -19.494 1.00 0.00 ? 32 ARG A O    2  
ATOM 1649  C CB   . ARG A 1 32 ? 1.446   12.642  -18.168 1.00 0.00 ? 32 ARG A CB   2  
ATOM 1650  C CG   . ARG A 1 32 ? 1.757   11.184  -18.513 1.00 0.00 ? 32 ARG A CG   2  
ATOM 1651  C CD   . ARG A 1 32 ? 3.153   10.790  -18.025 1.00 0.00 ? 32 ARG A CD   2  
ATOM 1652  N NE   . ARG A 1 32 ? 4.058   11.959  -18.085 1.00 0.00 ? 32 ARG A NE   2  
ATOM 1653  C CZ   . ARG A 1 32 ? 5.384   11.878  -18.321 1.00 0.00 ? 32 ARG A CZ   2  
ATOM 1654  N NH1  . ARG A 1 32 ? 5.937   10.672  -18.516 1.00 0.00 ? 32 ARG A NH1  2  
ATOM 1655  N NH2  . ARG A 1 32 ? 6.138   12.985  -18.361 1.00 0.00 ? 32 ARG A NH2  2  
ATOM 1656  H H    . ARG A 1 32 ? -0.646  10.845  -18.388 1.00 0.00 ? 32 ARG A H    2  
ATOM 1657  H HA   . ARG A 1 32 ? -0.264  13.565  -17.228 1.00 0.00 ? 32 ARG A HA   2  
ATOM 1658  H HB2  . ARG A 1 32 ? 1.832   13.283  -18.960 1.00 0.00 ? 32 ARG A HB2  2  
ATOM 1659  H HB3  . ARG A 1 32 ? 1.926   12.911  -17.226 1.00 0.00 ? 32 ARG A HB3  2  
ATOM 1660  H HG2  . ARG A 1 32 ? 1.018   10.541  -18.034 1.00 0.00 ? 32 ARG A HG2  2  
ATOM 1661  H HG3  . ARG A 1 32 ? 1.691   11.055  -19.593 1.00 0.00 ? 32 ARG A HG3  2  
ATOM 1662  H HD2  . ARG A 1 32 ? 3.091   10.442  -16.994 1.00 0.00 ? 32 ARG A HD2  2  
ATOM 1663  H HD3  . ARG A 1 32 ? 3.542   9.986   -18.649 1.00 0.00 ? 32 ARG A HD3  2  
ATOM 1664  H HE   . ARG A 1 32 ? 3.622   12.869  -17.935 1.00 0.00 ? 32 ARG A HE   2  
ATOM 1665  H HH11 . ARG A 1 32 ? 5.357   9.834   -18.484 1.00 0.00 ? 32 ARG A HH11 2  
ATOM 1666  H HH12 . ARG A 1 32 ? 6.938   10.593  -18.695 1.00 0.00 ? 32 ARG A HH12 2  
ATOM 1667  H HH21 . ARG A 1 32 ? 5.710   13.898  -18.212 1.00 0.00 ? 32 ARG A HH21 2  
ATOM 1668  H HH22 . ARG A 1 32 ? 7.140   12.914  -18.539 1.00 0.00 ? 32 ARG A HH22 2  
ATOM 1669  N N    . MET B 1 1  ? 16.469  -6.864  11.565  1.00 0.00 ? 1  MET B N    2  
ATOM 1670  C CA   . MET B 1 1  ? 15.395  -6.664  12.523  1.00 0.00 ? 1  MET B CA   2  
ATOM 1671  C C    . MET B 1 1  ? 15.202  -5.165  12.759  1.00 0.00 ? 1  MET B C    2  
ATOM 1672  O O    . MET B 1 1  ? 14.046  -4.714  12.770  1.00 0.00 ? 1  MET B O    2  
ATOM 1673  C CB   . MET B 1 1  ? 15.729  -7.352  13.848  1.00 0.00 ? 1  MET B CB   2  
ATOM 1674  C CG   . MET B 1 1  ? 14.479  -7.980  14.469  1.00 0.00 ? 1  MET B CG   2  
ATOM 1675  S SD   . MET B 1 1  ? 14.605  -7.951  16.282  1.00 0.00 ? 1  MET B SD   2  
ATOM 1676  C CE   . MET B 1 1  ? 14.114  -9.659  16.660  1.00 0.00 ? 1  MET B CE   2  
ATOM 1677  H H    . MET B 1 1  ? 17.203  -7.533  11.801  1.00 0.00 ? 1  MET B H    2  
ATOM 1678  H HA   . MET B 1 1  ? 14.474  -7.081  12.115  1.00 0.00 ? 1  MET B HA   2  
ATOM 1679  H HB2  . MET B 1 1  ? 16.466  -8.132  13.666  1.00 0.00 ? 1  MET B HB2  2  
ATOM 1680  H HB3  . MET B 1 1  ? 16.153  -6.616  14.531  1.00 0.00 ? 1  MET B HB3  2  
ATOM 1681  H HG2  . MET B 1 1  ? 13.599  -7.415  14.165  1.00 0.00 ? 1  MET B HG2  2  
ATOM 1682  H HG3  . MET B 1 1  ? 14.380  -9.009  14.120  1.00 0.00 ? 1  MET B HG3  2  
ATOM 1683  H HE1  . MET B 1 1  ? 14.796  -10.358 16.174  1.00 0.00 ? 1  MET B HE1  2  
ATOM 1684  H HE2  . MET B 1 1  ? 14.139  -9.805  17.739  1.00 0.00 ? 1  MET B HE2  2  
ATOM 1685  H HE3  . MET B 1 1  ? 13.101  -9.844  16.300  1.00 0.00 ? 1  MET B HE3  2  
ATOM 1686  N N    . ASP B 1 2  ? 16.316  -4.435  12.941  1.00 0.00 ? 2  ASP B N    2  
ATOM 1687  C CA   . ASP B 1 2  ? 16.269  -3.001  13.174  1.00 0.00 ? 2  ASP B CA   2  
ATOM 1688  C C    . ASP B 1 2  ? 15.470  -2.333  12.054  1.00 0.00 ? 2  ASP B C    2  
ATOM 1689  O O    . ASP B 1 2  ? 14.767  -1.352  12.336  1.00 0.00 ? 2  ASP B O    2  
ATOM 1690  C CB   . ASP B 1 2  ? 17.674  -2.397  13.178  1.00 0.00 ? 2  ASP B CB   2  
ATOM 1691  C CG   . ASP B 1 2  ? 18.771  -3.315  13.722  1.00 0.00 ? 2  ASP B CG   2  
ATOM 1692  O OD1  . ASP B 1 2  ? 18.807  -3.623  14.923  1.00 0.00 ? 2  ASP B OD1  2  
ATOM 1693  O OD2  . ASP B 1 2  ? 19.626  -3.723  12.846  1.00 0.00 ? 2  ASP B OD2  2  
ATOM 1694  H H    . ASP B 1 2  ? 17.231  -4.886  12.917  1.00 0.00 ? 2  ASP B H    2  
ATOM 1695  H HA   . ASP B 1 2  ? 15.771  -2.813  14.126  1.00 0.00 ? 2  ASP B HA   2  
ATOM 1696  H HB2  . ASP B 1 2  ? 17.910  -2.136  12.146  1.00 0.00 ? 2  ASP B HB2  2  
ATOM 1697  H HB3  . ASP B 1 2  ? 17.624  -1.485  13.772  1.00 0.00 ? 2  ASP B HB3  2  
ATOM 1698  N N    . ALA B 1 3  ? 15.591  -2.867  10.826  1.00 0.00 ? 3  ALA B N    2  
ATOM 1699  C CA   . ALA B 1 3  ? 14.885  -2.326  9.677   1.00 0.00 ? 3  ALA B CA   2  
ATOM 1700  C C    . ALA B 1 3  ? 13.522  -3.011  9.552   1.00 0.00 ? 3  ALA B C    2  
ATOM 1701  O O    . ALA B 1 3  ? 12.665  -2.489  8.825   1.00 0.00 ? 3  ALA B O    2  
ATOM 1702  C CB   . ALA B 1 3  ? 15.652  -2.661  8.396   1.00 0.00 ? 3  ALA B CB   2  
ATOM 1703  H H    . ALA B 1 3  ? 16.193  -3.678  10.679  1.00 0.00 ? 3  ALA B H    2  
ATOM 1704  H HA   . ALA B 1 3  ? 14.734  -1.252  9.778   1.00 0.00 ? 3  ALA B HA   2  
ATOM 1705  H HB1  . ALA B 1 3  ? 16.652  -2.230  8.458   1.00 0.00 ? 3  ALA B HB1  2  
ATOM 1706  H HB2  . ALA B 1 3  ? 15.738  -3.742  8.287   1.00 0.00 ? 3  ALA B HB2  2  
ATOM 1707  H HB3  . ALA B 1 3  ? 15.127  -2.257  7.531   1.00 0.00 ? 3  ALA B HB3  2  
ATOM 1708  N N    . ILE B 1 4  ? 13.353  -4.147  10.251  1.00 0.00 ? 4  ILE B N    2  
ATOM 1709  C CA   . ILE B 1 4  ? 12.106  -4.893  10.219  1.00 0.00 ? 4  ILE B CA   2  
ATOM 1710  C C    . ILE B 1 4  ? 11.049  -4.148  11.037  1.00 0.00 ? 4  ILE B C    2  
ATOM 1711  O O    . ILE B 1 4  ? 9.925   -3.986  10.539  1.00 0.00 ? 4  ILE B O    2  
ATOM 1712  C CB   . ILE B 1 4  ? 12.333  -6.336  10.676  1.00 0.00 ? 4  ILE B CB   2  
ATOM 1713  C CG1  . ILE B 1 4  ? 13.274  -7.072  9.721   1.00 0.00 ? 4  ILE B CG1  2  
ATOM 1714  C CG2  . ILE B 1 4  ? 11.003  -7.070  10.851  1.00 0.00 ? 4  ILE B CG2  2  
ATOM 1715  C CD1  . ILE B 1 4  ? 12.706  -8.441  9.338   1.00 0.00 ? 4  ILE B CD1  2  
ATOM 1716  H H    . ILE B 1 4  ? 14.113  -4.509  10.828  1.00 0.00 ? 4  ILE B H    2  
ATOM 1717  H HA   . ILE B 1 4  ? 11.792  -4.924  9.176   1.00 0.00 ? 4  ILE B HA   2  
ATOM 1718  H HB   . ILE B 1 4  ? 12.812  -6.253  11.652  1.00 0.00 ? 4  ILE B HB   2  
ATOM 1719  H HG12 . ILE B 1 4  ? 13.399  -6.475  8.817   1.00 0.00 ? 4  ILE B HG12 2  
ATOM 1720  H HG13 . ILE B 1 4  ? 14.243  -7.193  10.203  1.00 0.00 ? 4  ILE B HG13 2  
ATOM 1721  H HG21 . ILE B 1 4  ? 10.456  -7.081  9.908   1.00 0.00 ? 4  ILE B HG21 2  
ATOM 1722  H HG22 . ILE B 1 4  ? 11.202  -8.092  11.176  1.00 0.00 ? 4  ILE B HG22 2  
ATOM 1723  H HG23 . ILE B 1 4  ? 10.398  -6.569  11.606  1.00 0.00 ? 4  ILE B HG23 2  
ATOM 1724  H HD11 . ILE B 1 4  ? 11.736  -8.319  8.856   1.00 0.00 ? 4  ILE B HD11 2  
ATOM 1725  H HD12 . ILE B 1 4  ? 13.400  -8.936  8.659   1.00 0.00 ? 4  ILE B HD12 2  
ATOM 1726  H HD13 . ILE B 1 4  ? 12.584  -9.054  10.231  1.00 0.00 ? 4  ILE B HD13 2  
ATOM 1727  N N    . LYS B 1 5  ? 11.424  -3.715  12.254  1.00 0.00 ? 5  LYS B N    2  
ATOM 1728  C CA   . LYS B 1 5  ? 10.514  -2.995  13.128  1.00 0.00 ? 5  LYS B CA   2  
ATOM 1729  C C    . LYS B 1 5  ? 9.966   -1.772  12.391  1.00 0.00 ? 5  LYS B C    2  
ATOM 1730  O O    . LYS B 1 5  ? 8.808   -1.403  12.641  1.00 0.00 ? 5  LYS B O    2  
ATOM 1731  C CB   . LYS B 1 5  ? 11.201  -2.657  14.453  1.00 0.00 ? 5  LYS B CB   2  
ATOM 1732  C CG   . LYS B 1 5  ? 12.720  -2.591  14.283  1.00 0.00 ? 5  LYS B CG   2  
ATOM 1733  C CD   . LYS B 1 5  ? 13.345  -1.626  15.293  1.00 0.00 ? 5  LYS B CD   2  
ATOM 1734  C CE   . LYS B 1 5  ? 13.806  -2.369  16.548  1.00 0.00 ? 5  LYS B CE   2  
ATOM 1735  N NZ   . LYS B 1 5  ? 13.798  -1.467  17.712  1.00 0.00 ? 5  LYS B NZ   2  
ATOM 1736  H H    . LYS B 1 5  ? 12.371  -3.890  12.587  1.00 0.00 ? 5  LYS B H    2  
ATOM 1737  H HA   . LYS B 1 5  ? 9.692   -3.676  13.348  1.00 0.00 ? 5  LYS B HA   2  
ATOM 1738  H HB2  . LYS B 1 5  ? 10.841  -1.689  14.801  1.00 0.00 ? 5  LYS B HB2  2  
ATOM 1739  H HB3  . LYS B 1 5  ? 10.942  -3.417  15.190  1.00 0.00 ? 5  LYS B HB3  2  
ATOM 1740  H HG2  . LYS B 1 5  ? 13.137  -3.586  14.440  1.00 0.00 ? 5  LYS B HG2  2  
ATOM 1741  H HG3  . LYS B 1 5  ? 12.948  -2.267  13.268  1.00 0.00 ? 5  LYS B HG3  2  
ATOM 1742  H HD2  . LYS B 1 5  ? 14.204  -1.138  14.832  1.00 0.00 ? 5  LYS B HD2  2  
ATOM 1743  H HD3  . LYS B 1 5  ? 12.608  -0.867  15.559  1.00 0.00 ? 5  LYS B HD3  2  
ATOM 1744  H HE2  . LYS B 1 5  ? 13.131  -3.203  16.739  1.00 0.00 ? 5  LYS B HE2  2  
ATOM 1745  H HE3  . LYS B 1 5  ? 14.813  -2.756  16.385  1.00 0.00 ? 5  LYS B HE3  2  
ATOM 1746  H HZ1  . LYS B 1 5  ? 12.857  -1.105  17.865  1.00 0.00 ? 5  LYS B HZ1  2  
ATOM 1747  H HZ2  . LYS B 1 5  ? 14.109  -1.984  18.534  1.00 0.00 ? 5  LYS B HZ2  2  
ATOM 1748  H HZ3  . LYS B 1 5  ? 14.432  -0.685  17.551  1.00 0.00 ? 5  LYS B HZ3  2  
ATOM 1749  N N    . LYS B 1 6  ? 10.791  -1.177  11.512  1.00 0.00 ? 6  LYS B N    2  
ATOM 1750  C CA   . LYS B 1 6  ? 10.390  -0.009  10.747  1.00 0.00 ? 6  LYS B CA   2  
ATOM 1751  C C    . LYS B 1 6  ? 9.737   -0.459  9.440   1.00 0.00 ? 6  LYS B C    2  
ATOM 1752  O O    . LYS B 1 6  ? 8.899   0.287   8.912   1.00 0.00 ? 6  LYS B O    2  
ATOM 1753  C CB   . LYS B 1 6  ? 11.579  0.934   10.548  1.00 0.00 ? 6  LYS B CB   2  
ATOM 1754  C CG   . LYS B 1 6  ? 12.565  0.828   11.712  1.00 0.00 ? 6  LYS B CG   2  
ATOM 1755  C CD   . LYS B 1 6  ? 13.236  2.175   11.989  1.00 0.00 ? 6  LYS B CD   2  
ATOM 1756  C CE   . LYS B 1 6  ? 13.785  2.789   10.699  1.00 0.00 ? 6  LYS B CE   2  
ATOM 1757  N NZ   . LYS B 1 6  ? 13.747  4.260   10.772  1.00 0.00 ? 6  LYS B NZ   2  
ATOM 1758  H H    . LYS B 1 6  ? 11.732  -1.546  11.365  1.00 0.00 ? 6  LYS B H    2  
ATOM 1759  H HA   . LYS B 1 6  ? 9.651   0.517   11.351  1.00 0.00 ? 6  LYS B HA   2  
ATOM 1760  H HB2  . LYS B 1 6  ? 12.092  0.666   9.623   1.00 0.00 ? 6  LYS B HB2  2  
ATOM 1761  H HB3  . LYS B 1 6  ? 11.210  1.957   10.465  1.00 0.00 ? 6  LYS B HB3  2  
ATOM 1762  H HG2  . LYS B 1 6  ? 12.026  0.510   12.605  1.00 0.00 ? 6  LYS B HG2  2  
ATOM 1763  H HG3  . LYS B 1 6  ? 13.321  0.080   11.469  1.00 0.00 ? 6  LYS B HG3  2  
ATOM 1764  H HD2  . LYS B 1 6  ? 12.500  2.855   12.419  1.00 0.00 ? 6  LYS B HD2  2  
ATOM 1765  H HD3  . LYS B 1 6  ? 14.044  2.028   12.704  1.00 0.00 ? 6  LYS B HD3  2  
ATOM 1766  H HE2  . LYS B 1 6  ? 14.816  2.467   10.560  1.00 0.00 ? 6  LYS B HE2  2  
ATOM 1767  H HE3  . LYS B 1 6  ? 13.187  2.444   9.855   1.00 0.00 ? 6  LYS B HE3  2  
ATOM 1768  H HZ1  . LYS B 1 6  ? 14.305  4.583   11.561  1.00 0.00 ? 6  LYS B HZ1  2  
ATOM 1769  H HZ2  . LYS B 1 6  ? 14.117  4.644   9.902   1.00 0.00 ? 6  LYS B HZ2  2  
ATOM 1770  H HZ3  . LYS B 1 6  ? 12.786  4.577   10.892  1.00 0.00 ? 6  LYS B HZ3  2  
ATOM 1771  N N    . LYS B 1 7  ? 10.124  -1.651  8.952   1.00 0.00 ? 7  LYS B N    2  
ATOM 1772  C CA   . LYS B 1 7  ? 9.579   -2.192  7.719   1.00 0.00 ? 7  LYS B CA   2  
ATOM 1773  C C    . LYS B 1 7  ? 8.053   -2.242  7.819   1.00 0.00 ? 7  LYS B C    2  
ATOM 1774  O O    . LYS B 1 7  ? 7.385   -1.753  6.897   1.00 0.00 ? 7  LYS B O    2  
ATOM 1775  C CB   . LYS B 1 7  ? 10.219  -3.544  7.398   1.00 0.00 ? 7  LYS B CB   2  
ATOM 1776  C CG   . LYS B 1 7  ? 9.683   -4.106  6.080   1.00 0.00 ? 7  LYS B CG   2  
ATOM 1777  C CD   . LYS B 1 7  ? 9.867   -3.102  4.940   1.00 0.00 ? 7  LYS B CD   2  
ATOM 1778  C CE   . LYS B 1 7  ? 10.353  -3.799  3.668   1.00 0.00 ? 7  LYS B CE   2  
ATOM 1779  N NZ   . LYS B 1 7  ? 9.212   -4.311  2.892   1.00 0.00 ? 7  LYS B NZ   2  
ATOM 1780  H H    . LYS B 1 7  ? 10.821  -2.204  9.451   1.00 0.00 ? 7  LYS B H    2  
ATOM 1781  H HA   . LYS B 1 7  ? 9.860   -1.499  6.926   1.00 0.00 ? 7  LYS B HA   2  
ATOM 1782  H HB2  . LYS B 1 7  ? 11.298  -3.415  7.315   1.00 0.00 ? 7  LYS B HB2  2  
ATOM 1783  H HB3  . LYS B 1 7  ? 10.007  -4.238  8.211   1.00 0.00 ? 7  LYS B HB3  2  
ATOM 1784  H HG2  . LYS B 1 7  ? 10.224  -5.020  5.838   1.00 0.00 ? 7  LYS B HG2  2  
ATOM 1785  H HG3  . LYS B 1 7  ? 8.625   -4.341  6.201   1.00 0.00 ? 7  LYS B HG3  2  
ATOM 1786  H HD2  . LYS B 1 7  ? 8.911   -2.619  4.736   1.00 0.00 ? 7  LYS B HD2  2  
ATOM 1787  H HD3  . LYS B 1 7  ? 10.588  -2.345  5.249   1.00 0.00 ? 7  LYS B HD3  2  
ATOM 1788  H HE2  . LYS B 1 7  ? 10.906  -3.085  3.057   1.00 0.00 ? 7  LYS B HE2  2  
ATOM 1789  H HE3  . LYS B 1 7  ? 11.016  -4.620  3.941   1.00 0.00 ? 7  LYS B HE3  2  
ATOM 1790  H HZ1  . LYS B 1 7  ? 8.592   -3.542  2.637   1.00 0.00 ? 7  LYS B HZ1  2  
ATOM 1791  H HZ2  . LYS B 1 7  ? 9.561   -4.770  2.051   1.00 0.00 ? 7  LYS B HZ2  2  
ATOM 1792  H HZ3  . LYS B 1 7  ? 8.689   -4.988  3.448   1.00 0.00 ? 7  LYS B HZ3  2  
ATOM 1793  N N    . MET B 1 8  ? 7.541   -2.822  8.919   1.00 0.00 ? 8  MET B N    2  
ATOM 1794  C CA   . MET B 1 8  ? 6.108   -2.934  9.135   1.00 0.00 ? 8  MET B CA   2  
ATOM 1795  C C    . MET B 1 8  ? 5.509   -1.534  9.284   1.00 0.00 ? 8  MET B C    2  
ATOM 1796  O O    . MET B 1 8  ? 4.321   -1.365  8.972   1.00 0.00 ? 8  MET B O    2  
ATOM 1797  C CB   . MET B 1 8  ? 5.822   -3.749  10.398  1.00 0.00 ? 8  MET B CB   2  
ATOM 1798  C CG   . MET B 1 8  ? 6.577   -3.181  11.600  1.00 0.00 ? 8  MET B CG   2  
ATOM 1799  S SD   . MET B 1 8  ? 6.015   -3.990  13.127  1.00 0.00 ? 8  MET B SD   2  
ATOM 1800  C CE   . MET B 1 8  ? 6.005   -2.564  14.253  1.00 0.00 ? 8  MET B CE   2  
ATOM 1801  H H    . MET B 1 8  ? 8.163   -3.201  9.633   1.00 0.00 ? 8  MET B H    2  
ATOM 1802  H HA   . MET B 1 8  ? 5.657   -3.424  8.272   1.00 0.00 ? 8  MET B HA   2  
ATOM 1803  H HB2  . MET B 1 8  ? 4.752   -3.718  10.603  1.00 0.00 ? 8  MET B HB2  2  
ATOM 1804  H HB3  . MET B 1 8  ? 6.120   -4.783  10.226  1.00 0.00 ? 8  MET B HB3  2  
ATOM 1805  H HG2  . MET B 1 8  ? 7.645   -3.361  11.475  1.00 0.00 ? 8  MET B HG2  2  
ATOM 1806  H HG3  . MET B 1 8  ? 6.404   -2.107  11.662  1.00 0.00 ? 8  MET B HG3  2  
ATOM 1807  H HE1  . MET B 1 8  ? 5.328   -1.797  13.877  1.00 0.00 ? 8  MET B HE1  2  
ATOM 1808  H HE2  . MET B 1 8  ? 5.680   -2.894  15.241  1.00 0.00 ? 8  MET B HE2  2  
ATOM 1809  H HE3  . MET B 1 8  ? 7.007   -2.146  14.332  1.00 0.00 ? 8  MET B HE3  2  
ATOM 1810  N N    . GLN B 1 9  ? 6.329   -0.575  9.748   1.00 0.00 ? 9  GLN B N    2  
ATOM 1811  C CA   . GLN B 1 9  ? 5.882   0.795   9.935   1.00 0.00 ? 9  GLN B CA   2  
ATOM 1812  C C    . GLN B 1 9  ? 5.884   1.517   8.585   1.00 0.00 ? 9  GLN B C    2  
ATOM 1813  O O    . GLN B 1 9  ? 5.134   2.493   8.437   1.00 0.00 ? 9  GLN B O    2  
ATOM 1814  C CB   . GLN B 1 9  ? 6.751   1.537   10.953  1.00 0.00 ? 9  GLN B CB   2  
ATOM 1815  C CG   . GLN B 1 9  ? 6.579   0.945   12.354  1.00 0.00 ? 9  GLN B CG   2  
ATOM 1816  C CD   . GLN B 1 9  ? 7.191   1.863   13.414  1.00 0.00 ? 9  GLN B CD   2  
ATOM 1817  O OE1  . GLN B 1 9  ? 6.525   2.691   14.014  1.00 0.00 ? 9  GLN B OE1  2  
ATOM 1818  N NE2  . GLN B 1 9  ? 8.491   1.669   13.612  1.00 0.00 ? 9  GLN B NE2  2  
ATOM 1819  H H    . GLN B 1 9  ? 7.296   -0.799  9.981   1.00 0.00 ? 9  GLN B H    2  
ATOM 1820  H HA   . GLN B 1 9  ? 4.860   0.748   10.310  1.00 0.00 ? 9  GLN B HA   2  
ATOM 1821  H HB2  . GLN B 1 9  ? 7.796   1.449   10.656  1.00 0.00 ? 9  GLN B HB2  2  
ATOM 1822  H HB3  . GLN B 1 9  ? 6.471   2.590   10.956  1.00 0.00 ? 9  GLN B HB3  2  
ATOM 1823  H HG2  . GLN B 1 9  ? 5.515   0.825   12.559  1.00 0.00 ? 9  GLN B HG2  2  
ATOM 1824  H HG3  . GLN B 1 9  ? 7.059   -0.032  12.387  1.00 0.00 ? 9  GLN B HG3  2  
ATOM 1825  H HE21 . GLN B 1 9  ? 8.988   0.959   13.076  1.00 0.00 ? 9  GLN B HE21 2  
ATOM 1826  H HE22 . GLN B 1 9  ? 8.992   2.232   14.300  1.00 0.00 ? 9  GLN B HE22 2  
ATOM 1827  N N    . MET B 1 10 ? 6.711   1.029   7.643   1.00 0.00 ? 10 MET B N    2  
ATOM 1828  C CA   . MET B 1 10 ? 6.806   1.623   6.320   1.00 0.00 ? 10 MET B CA   2  
ATOM 1829  C C    . MET B 1 10 ? 5.680   1.079   5.438   1.00 0.00 ? 10 MET B C    2  
ATOM 1830  O O    . MET B 1 10 ? 5.110   1.859   4.663   1.00 0.00 ? 10 MET B O    2  
ATOM 1831  C CB   . MET B 1 10 ? 8.158   1.292   5.685   1.00 0.00 ? 10 MET B CB   2  
ATOM 1832  C CG   . MET B 1 10 ? 9.308   1.619   6.639   1.00 0.00 ? 10 MET B CG   2  
ATOM 1833  S SD   . MET B 1 10 ? 10.460  2.782   5.850   1.00 0.00 ? 10 MET B SD   2  
ATOM 1834  C CE   . MET B 1 10 ? 11.151  3.590   7.323   1.00 0.00 ? 10 MET B CE   2  
ATOM 1835  H H    . MET B 1 10 ? 7.296   0.218   7.847   1.00 0.00 ? 10 MET B H    2  
ATOM 1836  H HA   . MET B 1 10 ? 6.697   2.704   6.409   1.00 0.00 ? 10 MET B HA   2  
ATOM 1837  H HB2  . MET B 1 10 ? 8.186   0.229   5.446   1.00 0.00 ? 10 MET B HB2  2  
ATOM 1838  H HB3  . MET B 1 10 ? 8.266   1.866   4.764   1.00 0.00 ? 10 MET B HB3  2  
ATOM 1839  H HG2  . MET B 1 10 ? 8.909   2.076   7.545   1.00 0.00 ? 10 MET B HG2  2  
ATOM 1840  H HG3  . MET B 1 10 ? 9.831   0.701   6.905   1.00 0.00 ? 10 MET B HG3  2  
ATOM 1841  H HE1  . MET B 1 10 ? 11.630  2.850   7.964   1.00 0.00 ? 10 MET B HE1  2  
ATOM 1842  H HE2  . MET B 1 10 ? 11.880  4.337   7.009   1.00 0.00 ? 10 MET B HE2  2  
ATOM 1843  H HE3  . MET B 1 10 ? 10.357  4.084   7.884   1.00 0.00 ? 10 MET B HE3  2  
ATOM 1844  N N    . LEU B 1 11 ? 5.388   -0.228  5.573   1.00 0.00 ? 11 LEU B N    2  
ATOM 1845  C CA   . LEU B 1 11 ? 4.341   -0.866  4.794   1.00 0.00 ? 11 LEU B CA   2  
ATOM 1846  C C    . LEU B 1 11 ? 2.977   -0.490  5.376   1.00 0.00 ? 11 LEU B C    2  
ATOM 1847  O O    . LEU B 1 11 ? 1.995   -0.482  4.620   1.00 0.00 ? 11 LEU B O    2  
ATOM 1848  C CB   . LEU B 1 11 ? 4.580   -2.376  4.712   1.00 0.00 ? 11 LEU B CB   2  
ATOM 1849  C CG   . LEU B 1 11 ? 5.934   -2.811  4.149   1.00 0.00 ? 11 LEU B CG   2  
ATOM 1850  C CD1  . LEU B 1 11 ? 6.401   -4.117  4.794   1.00 0.00 ? 11 LEU B CD1  2  
ATOM 1851  C CD2  . LEU B 1 11 ? 5.887   -2.911  2.623   1.00 0.00 ? 11 LEU B CD2  2  
ATOM 1852  H H    . LEU B 1 11 ? 5.909   -0.801  6.238   1.00 0.00 ? 11 LEU B H    2  
ATOM 1853  H HA   . LEU B 1 11 ? 4.419   -0.465  3.784   1.00 0.00 ? 11 LEU B HA   2  
ATOM 1854  H HB2  . LEU B 1 11 ? 4.478   -2.759  5.729   1.00 0.00 ? 11 LEU B HB2  2  
ATOM 1855  H HB3  . LEU B 1 11 ? 3.775   -2.779  4.099   1.00 0.00 ? 11 LEU B HB3  2  
ATOM 1856  H HG   . LEU B 1 11 ? 6.627   -2.019  4.432   1.00 0.00 ? 11 LEU B HG   2  
ATOM 1857  H HD11 . LEU B 1 11 ? 5.672   -4.905  4.609   1.00 0.00 ? 11 LEU B HD11 2  
ATOM 1858  H HD12 . LEU B 1 11 ? 7.366   -4.397  4.370   1.00 0.00 ? 11 LEU B HD12 2  
ATOM 1859  H HD13 . LEU B 1 11 ? 6.512   -3.982  5.870   1.00 0.00 ? 11 LEU B HD13 2  
ATOM 1860  H HD21 . LEU B 1 11 ? 5.621   -1.944  2.196   1.00 0.00 ? 11 LEU B HD21 2  
ATOM 1861  H HD22 . LEU B 1 11 ? 6.865   -3.221  2.257   1.00 0.00 ? 11 LEU B HD22 2  
ATOM 1862  H HD23 . LEU B 1 11 ? 5.144   -3.648  2.322   1.00 0.00 ? 11 LEU B HD23 2  
ATOM 1863  N N    . LYS B 1 12 ? 2.944   -0.190  6.687   1.00 0.00 ? 12 LYS B N    2  
ATOM 1864  C CA   . LYS B 1 12 ? 1.712   0.183   7.361   1.00 0.00 ? 12 LYS B CA   2  
ATOM 1865  C C    . LYS B 1 12 ? 1.386   1.645   7.048   1.00 0.00 ? 12 LYS B C    2  
ATOM 1866  O O    . LYS B 1 12 ? 0.195   1.979   6.963   1.00 0.00 ? 12 LYS B O    2  
ATOM 1867  C CB   . LYS B 1 12 ? 1.807   -0.118  8.858   1.00 0.00 ? 12 LYS B CB   2  
ATOM 1868  C CG   . LYS B 1 12 ? 0.456   0.086   9.545   1.00 0.00 ? 12 LYS B CG   2  
ATOM 1869  C CD   . LYS B 1 12 ? -0.031  -1.210  10.197  1.00 0.00 ? 12 LYS B CD   2  
ATOM 1870  C CE   . LYS B 1 12 ? -1.534  -1.399  9.984   1.00 0.00 ? 12 LYS B CE   2  
ATOM 1871  N NZ   . LYS B 1 12 ? -2.266  -1.165  11.239  1.00 0.00 ? 12 LYS B NZ   2  
ATOM 1872  H H    . LYS B 1 12 ? 3.801   -0.220  7.240   1.00 0.00 ? 12 LYS B H    2  
ATOM 1873  H HA   . LYS B 1 12 ? 0.929   -0.452  6.947   1.00 0.00 ? 12 LYS B HA   2  
ATOM 1874  H HB2  . LYS B 1 12 ? 2.119   -1.154  8.991   1.00 0.00 ? 12 LYS B HB2  2  
ATOM 1875  H HB3  . LYS B 1 12 ? 2.554   0.538   9.304   1.00 0.00 ? 12 LYS B HB3  2  
ATOM 1876  H HG2  . LYS B 1 12 ? 0.563   0.851   10.314  1.00 0.00 ? 12 LYS B HG2  2  
ATOM 1877  H HG3  . LYS B 1 12 ? -0.269  0.426   8.806   1.00 0.00 ? 12 LYS B HG3  2  
ATOM 1878  H HD2  . LYS B 1 12 ? 0.499   -2.051  9.750   1.00 0.00 ? 12 LYS B HD2  2  
ATOM 1879  H HD3  . LYS B 1 12 ? 0.192   -1.175  11.263  1.00 0.00 ? 12 LYS B HD3  2  
ATOM 1880  H HE2  . LYS B 1 12 ? -1.882  -0.691  9.232   1.00 0.00 ? 12 LYS B HE2  2  
ATOM 1881  H HE3  . LYS B 1 12 ? -1.720  -2.413  9.629   1.00 0.00 ? 12 LYS B HE3  2  
ATOM 1882  H HZ1  . LYS B 1 12 ? -2.091  -0.216  11.571  1.00 0.00 ? 12 LYS B HZ1  2  
ATOM 1883  H HZ2  . LYS B 1 12 ? -3.264  -1.297  11.072  1.00 0.00 ? 12 LYS B HZ2  2  
ATOM 1884  H HZ3  . LYS B 1 12 ? -1.958  -1.827  11.951  1.00 0.00 ? 12 LYS B HZ3  2  
ATOM 1885  N N    . LEU B 1 13 ? 2.433   2.473   6.885   1.00 0.00 ? 13 LEU B N    2  
ATOM 1886  C CA   . LEU B 1 13 ? 2.260   3.884   6.584   1.00 0.00 ? 13 LEU B CA   2  
ATOM 1887  C C    . LEU B 1 13 ? 1.868   4.043   5.113   1.00 0.00 ? 13 LEU B C    2  
ATOM 1888  O O    . LEU B 1 13 ? 0.950   4.826   4.828   1.00 0.00 ? 13 LEU B O    2  
ATOM 1889  C CB   . LEU B 1 13 ? 3.510   4.674   6.975   1.00 0.00 ? 13 LEU B CB   2  
ATOM 1890  C CG   . LEU B 1 13 ? 3.330   6.186   7.124   1.00 0.00 ? 13 LEU B CG   2  
ATOM 1891  C CD1  . LEU B 1 13 ? 4.638   6.925   6.834   1.00 0.00 ? 13 LEU B CD1  2  
ATOM 1892  C CD2  . LEU B 1 13 ? 2.181   6.689   6.248   1.00 0.00 ? 13 LEU B CD2  2  
ATOM 1893  H H    . LEU B 1 13 ? 3.385   2.116   6.972   1.00 0.00 ? 13 LEU B H    2  
ATOM 1894  H HA   . LEU B 1 13 ? 1.439   4.235   7.209   1.00 0.00 ? 13 LEU B HA   2  
ATOM 1895  H HB2  . LEU B 1 13 ? 3.849   4.261   7.926   1.00 0.00 ? 13 LEU B HB2  2  
ATOM 1896  H HB3  . LEU B 1 13 ? 4.257   4.462   6.211   1.00 0.00 ? 13 LEU B HB3  2  
ATOM 1897  H HG   . LEU B 1 13 ? 3.072   6.339   8.171   1.00 0.00 ? 13 LEU B HG   2  
ATOM 1898  H HD11 . LEU B 1 13 ? 4.971   6.707   5.821   1.00 0.00 ? 13 LEU B HD11 2  
ATOM 1899  H HD12 . LEU B 1 13 ? 4.472   7.996   6.950   1.00 0.00 ? 13 LEU B HD12 2  
ATOM 1900  H HD13 . LEU B 1 13 ? 5.408   6.607   7.537   1.00 0.00 ? 13 LEU B HD13 2  
ATOM 1901  H HD21 . LEU B 1 13 ? 1.252   6.193   6.532   1.00 0.00 ? 13 LEU B HD21 2  
ATOM 1902  H HD22 . LEU B 1 13 ? 2.081   7.767   6.380   1.00 0.00 ? 13 LEU B HD22 2  
ATOM 1903  H HD23 . LEU B 1 13 ? 2.391   6.477   5.200   1.00 0.00 ? 13 LEU B HD23 2  
ATOM 1904  N N    . ASP B 1 14 ? 2.559   3.309   4.223   1.00 0.00 ? 14 ASP B N    2  
ATOM 1905  C CA   . ASP B 1 14 ? 2.285   3.368   2.797   1.00 0.00 ? 14 ASP B CA   2  
ATOM 1906  C C    . ASP B 1 14 ? 0.858   2.884   2.536   1.00 0.00 ? 14 ASP B C    2  
ATOM 1907  O O    . ASP B 1 14 ? 0.212   3.417   1.621   1.00 0.00 ? 14 ASP B O    2  
ATOM 1908  C CB   . ASP B 1 14 ? 3.241   2.466   2.015   1.00 0.00 ? 14 ASP B CB   2  
ATOM 1909  C CG   . ASP B 1 14 ? 3.778   3.067   0.714   1.00 0.00 ? 14 ASP B CG   2  
ATOM 1910  O OD1  . ASP B 1 14 ? 4.449   4.160   0.854   1.00 0.00 ? 14 ASP B OD1  2  
ATOM 1911  O OD2  . ASP B 1 14 ? 3.567   2.519   -0.378  1.00 0.00 ? 14 ASP B OD2  2  
ATOM 1912  H H    . ASP B 1 14 ? 3.301   2.687   4.543   1.00 0.00 ? 14 ASP B H    2  
ATOM 1913  H HA   . ASP B 1 14 ? 2.377   4.402   2.462   1.00 0.00 ? 14 ASP B HA   2  
ATOM 1914  H HB2  . ASP B 1 14 ? 4.079   2.243   2.675   1.00 0.00 ? 14 ASP B HB2  2  
ATOM 1915  H HB3  . ASP B 1 14 ? 2.701   1.543   1.803   1.00 0.00 ? 14 ASP B HB3  2  
ATOM 1916  N N    . ASN B 1 15 ? 0.401   1.901   3.331   1.00 0.00 ? 15 ASN B N    2  
ATOM 1917  C CA   . ASN B 1 15 ? -0.937  1.353   3.187   1.00 0.00 ? 15 ASN B CA   2  
ATOM 1918  C C    . ASN B 1 15 ? -1.966  2.461   3.421   1.00 0.00 ? 15 ASN B C    2  
ATOM 1919  O O    . ASN B 1 15 ? -2.874  2.608   2.590   1.00 0.00 ? 15 ASN B O    2  
ATOM 1920  C CB   . ASN B 1 15 ? -1.193  0.246   4.213   1.00 0.00 ? 15 ASN B CB   2  
ATOM 1921  C CG   . ASN B 1 15 ? -2.224  -0.757  3.692   1.00 0.00 ? 15 ASN B CG   2  
ATOM 1922  O OD1  . ASN B 1 15 ? -3.418  -0.628  3.906   1.00 0.00 ? 15 ASN B OD1  2  
ATOM 1923  N ND2  . ASN B 1 15 ? -1.698  -1.761  2.995   1.00 0.00 ? 15 ASN B ND2  2  
ATOM 1924  H H    . ASN B 1 15 ? 0.998   1.517   4.064   1.00 0.00 ? 15 ASN B H    2  
ATOM 1925  H HA   . ASN B 1 15 ? -1.055  0.967   2.174   1.00 0.00 ? 15 ASN B HA   2  
ATOM 1926  H HB2  . ASN B 1 15 ? -0.257  -0.276  4.410   1.00 0.00 ? 15 ASN B HB2  2  
ATOM 1927  H HB3  . ASN B 1 15 ? -1.550  0.698   5.139   1.00 0.00 ? 15 ASN B HB3  2  
ATOM 1928  H HD21 . ASN B 1 15 ? -0.689  -1.809  2.852   1.00 0.00 ? 15 ASN B HD21 2  
ATOM 1929  H HD22 . ASN B 1 15 ? -2.303  -2.483  2.605   1.00 0.00 ? 15 ASN B HD22 2  
ATOM 1930  N N    . TYR B 1 16 ? -1.807  3.207   4.529   1.00 0.00 ? 16 TYR B N    2  
ATOM 1931  C CA   . TYR B 1 16 ? -2.753  4.272   4.811   1.00 0.00 ? 16 TYR B CA   2  
ATOM 1932  C C    . TYR B 1 16 ? -2.744  5.275   3.655   1.00 0.00 ? 16 TYR B C    2  
ATOM 1933  O O    . TYR B 1 16 ? -3.824  5.773   3.309   1.00 0.00 ? 16 TYR B O    2  
ATOM 1934  C CB   . TYR B 1 16 ? -2.410  4.943   6.154   1.00 0.00 ? 16 TYR B CB   2  
ATOM 1935  C CG   . TYR B 1 16 ? -2.209  3.973   7.310   1.00 0.00 ? 16 TYR B CG   2  
ATOM 1936  C CD1  . TYR B 1 16 ? -3.025  2.825   7.432   1.00 0.00 ? 16 TYR B CD1  2  
ATOM 1937  C CD2  . TYR B 1 16 ? -1.203  4.221   8.274   1.00 0.00 ? 16 TYR B CD2  2  
ATOM 1938  C CE1  . TYR B 1 16 ? -2.837  1.931   8.508   1.00 0.00 ? 16 TYR B CE1  2  
ATOM 1939  C CE2  . TYR B 1 16 ? -1.015  3.327   9.348   1.00 0.00 ? 16 TYR B CE2  2  
ATOM 1940  C CZ   . TYR B 1 16 ? -1.830  2.181   9.467   1.00 0.00 ? 16 TYR B CZ   2  
ATOM 1941  O OH   . TYR B 1 16 ? -1.644  1.317   10.509  1.00 0.00 ? 16 TYR B OH   2  
ATOM 1942  H H    . TYR B 1 16 ? -1.043  3.034   5.166   1.00 0.00 ? 16 TYR B H    2  
ATOM 1943  H HA   . TYR B 1 16 ? -3.751  3.835   4.872   1.00 0.00 ? 16 TYR B HA   2  
ATOM 1944  H HB2  . TYR B 1 16 ? -1.513  5.553   6.030   1.00 0.00 ? 16 TYR B HB2  2  
ATOM 1945  H HB3  . TYR B 1 16 ? -3.222  5.620   6.426   1.00 0.00 ? 16 TYR B HB3  2  
ATOM 1946  H HD1  . TYR B 1 16 ? -3.799  2.627   6.705   1.00 0.00 ? 16 TYR B HD1  2  
ATOM 1947  H HD2  . TYR B 1 16 ? -0.576  5.097   8.190   1.00 0.00 ? 16 TYR B HD2  2  
ATOM 1948  H HE1  . TYR B 1 16 ? -3.465  1.056   8.593   1.00 0.00 ? 16 TYR B HE1  2  
ATOM 1949  H HE2  . TYR B 1 16 ? -0.243  3.523   10.080  1.00 0.00 ? 16 TYR B HE2  2  
ATOM 1950  H HH   . TYR B 1 16 ? -2.311  1.393   11.194  1.00 0.00 ? 16 TYR B HH   2  
ATOM 1951  N N    . HIS B 1 17 ? -1.552  5.555   3.098   1.00 0.00 ? 17 HIS B N    2  
ATOM 1952  C CA   . HIS B 1 17 ? -1.416  6.497   2.001   1.00 0.00 ? 17 HIS B CA   2  
ATOM 1953  C C    . HIS B 1 17 ? -2.048  5.903   0.742   1.00 0.00 ? 17 HIS B C    2  
ATOM 1954  O O    . HIS B 1 17 ? -2.724  6.645   0.015   1.00 0.00 ? 17 HIS B O    2  
ATOM 1955  C CB   . HIS B 1 17 ? 0.047   6.895   1.799   1.00 0.00 ? 17 HIS B CB   2  
ATOM 1956  C CG   . HIS B 1 17 ? 0.511   6.819   0.364   1.00 0.00 ? 17 HIS B CG   2  
ATOM 1957  N ND1  . HIS B 1 17 ? 0.425   7.889   -0.509  1.00 0.00 ? 17 HIS B ND1  2  
ATOM 1958  C CD2  . HIS B 1 17 ? 1.067   5.792   -0.340  1.00 0.00 ? 17 HIS B CD2  2  
ATOM 1959  C CE1  . HIS B 1 17 ? 0.909   7.512   -1.683  1.00 0.00 ? 17 HIS B CE1  2  
ATOM 1960  N NE2  . HIS B 1 17 ? 1.306   6.211   -1.577  1.00 0.00 ? 17 HIS B NE2  2  
ATOM 1961  H H    . HIS B 1 17 ? -0.708  5.098   3.445   1.00 0.00 ? 17 HIS B H    2  
ATOM 1962  H HA   . HIS B 1 17 ? -1.971  7.390   2.290   1.00 0.00 ? 17 HIS B HA   2  
ATOM 1963  H HB2  . HIS B 1 17 ? 0.160   7.919   2.155   1.00 0.00 ? 17 HIS B HB2  2  
ATOM 1964  H HB3  . HIS B 1 17 ? 0.653   6.234   2.420   1.00 0.00 ? 17 HIS B HB3  2  
ATOM 1965  H HD1  . HIS B 1 17 ? 0.074   8.839   -0.384  1.00 0.00 ? 17 HIS B HD1  2  
ATOM 1966  H HD2  . HIS B 1 17 ? 1.315   4.780   -0.056  1.00 0.00 ? 17 HIS B HD2  2  
ATOM 1967  H HE1  . HIS B 1 17 ? 0.931   8.209   -2.508  1.00 0.00 ? 17 HIS B HE1  2  
ATOM 1968  N N    . LEU B 1 18 ? -1.822  4.597   0.513   1.00 0.00 ? 18 LEU B N    2  
ATOM 1969  C CA   . LEU B 1 18 ? -2.366  3.912   -0.648  1.00 0.00 ? 18 LEU B CA   2  
ATOM 1970  C C    . LEU B 1 18 ? -3.891  3.863   -0.536  1.00 0.00 ? 18 LEU B C    2  
ATOM 1971  O O    . LEU B 1 18 ? -4.562  4.007   -1.569  1.00 0.00 ? 18 LEU B O    2  
ATOM 1972  C CB   . LEU B 1 18 ? -1.716  2.537   -0.812  1.00 0.00 ? 18 LEU B CB   2  
ATOM 1973  C CG   . LEU B 1 18 ? -0.263  2.534   -1.291  1.00 0.00 ? 18 LEU B CG   2  
ATOM 1974  C CD1  . LEU B 1 18 ? 0.325   1.122   -1.247  1.00 0.00 ? 18 LEU B CD1  2  
ATOM 1975  C CD2  . LEU B 1 18 ? -0.143  3.161   -2.681  1.00 0.00 ? 18 LEU B CD2  2  
ATOM 1976  H H    . LEU B 1 18 ? -1.252  4.056   1.164   1.00 0.00 ? 18 LEU B H    2  
ATOM 1977  H HA   . LEU B 1 18 ? -2.092  4.512   -1.516  1.00 0.00 ? 18 LEU B HA   2  
ATOM 1978  H HB2  . LEU B 1 18 ? -1.769  2.054   0.164   1.00 0.00 ? 18 LEU B HB2  2  
ATOM 1979  H HB3  . LEU B 1 18 ? -2.341  1.986   -1.515  1.00 0.00 ? 18 LEU B HB3  2  
ATOM 1980  H HG   . LEU B 1 18 ? 0.274   3.154   -0.574  1.00 0.00 ? 18 LEU B HG   2  
ATOM 1981  H HD11 . LEU B 1 18 ? -0.258  0.456   -1.883  1.00 0.00 ? 18 LEU B HD11 2  
ATOM 1982  H HD12 . LEU B 1 18 ? 1.359   1.158   -1.594  1.00 0.00 ? 18 LEU B HD12 2  
ATOM 1983  H HD13 . LEU B 1 18 ? 0.307   0.744   -0.225  1.00 0.00 ? 18 LEU B HD13 2  
ATOM 1984  H HD21 . LEU B 1 18 ? -0.505  4.190   -2.657  1.00 0.00 ? 18 LEU B HD21 2  
ATOM 1985  H HD22 . LEU B 1 18 ? 0.903   3.142   -2.989  1.00 0.00 ? 18 LEU B HD22 2  
ATOM 1986  H HD23 . LEU B 1 18 ? -0.735  2.594   -3.398  1.00 0.00 ? 18 LEU B HD23 2  
ATOM 1987  N N    . GLU B 1 19 ? -4.399  3.664   0.692   1.00 0.00 ? 19 GLU B N    2  
ATOM 1988  C CA   . GLU B 1 19 ? -5.830  3.598   0.932   1.00 0.00 ? 19 GLU B CA   2  
ATOM 1989  C C    . GLU B 1 19 ? -6.452  4.973   0.674   1.00 0.00 ? 19 GLU B C    2  
ATOM 1990  O O    . GLU B 1 19 ? -7.427  5.045   -0.087  1.00 0.00 ? 19 GLU B O    2  
ATOM 1991  C CB   . GLU B 1 19 ? -6.141  3.114   2.350   1.00 0.00 ? 19 GLU B CB   2  
ATOM 1992  C CG   . GLU B 1 19 ? -7.450  2.324   2.386   1.00 0.00 ? 19 GLU B CG   2  
ATOM 1993  C CD   . GLU B 1 19 ? -7.256  0.971   3.076   1.00 0.00 ? 19 GLU B CD   2  
ATOM 1994  O OE1  . GLU B 1 19 ? -7.064  1.032   4.350   1.00 0.00 ? 19 GLU B OE1  2  
ATOM 1995  O OE2  . GLU B 1 19 ? -7.288  -0.074  2.410   1.00 0.00 ? 19 GLU B OE2  2  
ATOM 1996  H H    . GLU B 1 19 ? -3.774  3.556   1.491   1.00 0.00 ? 19 GLU B H    2  
ATOM 1997  H HA   . GLU B 1 19 ? -6.239  2.884   0.218   1.00 0.00 ? 19 GLU B HA   2  
ATOM 1998  H HB2  . GLU B 1 19 ? -5.329  2.471   2.691   1.00 0.00 ? 19 GLU B HB2  2  
ATOM 1999  H HB3  . GLU B 1 19 ? -6.210  3.978   3.011   1.00 0.00 ? 19 GLU B HB3  2  
ATOM 2000  H HG2  . GLU B 1 19 ? -8.195  2.899   2.936   1.00 0.00 ? 19 GLU B HG2  2  
ATOM 2001  H HG3  . GLU B 1 19 ? -7.800  2.173   1.364   1.00 0.00 ? 19 GLU B HG3  2  
ATOM 2002  N N    . ASN B 1 20 ? -5.884  6.017   1.302   1.00 0.00 ? 20 ASN B N    2  
ATOM 2003  C CA   . ASN B 1 20 ? -6.378  7.374   1.140   1.00 0.00 ? 20 ASN B CA   2  
ATOM 2004  C C    . ASN B 1 20 ? -6.241  7.792   -0.325  1.00 0.00 ? 20 ASN B C    2  
ATOM 2005  O O    . ASN B 1 20 ? -7.078  8.575   -0.796  1.00 0.00 ? 20 ASN B O    2  
ATOM 2006  C CB   . ASN B 1 20 ? -5.572  8.359   1.990   1.00 0.00 ? 20 ASN B CB   2  
ATOM 2007  C CG   . ASN B 1 20 ? -5.428  7.854   3.427   1.00 0.00 ? 20 ASN B CG   2  
ATOM 2008  O OD1  . ASN B 1 20 ? -6.248  7.106   3.934   1.00 0.00 ? 20 ASN B OD1  2  
ATOM 2009  N ND2  . ASN B 1 20 ? -4.345  8.303   4.052   1.00 0.00 ? 20 ASN B ND2  2  
ATOM 2010  H H    . ASN B 1 20 ? -5.081  5.870   1.913   1.00 0.00 ? 20 ASN B H    2  
ATOM 2011  H HA   . ASN B 1 20 ? -7.431  7.403   1.420   1.00 0.00 ? 20 ASN B HA   2  
ATOM 2012  H HB2  . ASN B 1 20 ? -4.580  8.474   1.553   1.00 0.00 ? 20 ASN B HB2  2  
ATOM 2013  H HB3  . ASN B 1 20 ? -6.076  9.326   1.984   1.00 0.00 ? 20 ASN B HB3  2  
ATOM 2014  H HD21 . ASN B 1 20 ? -3.699  8.928   3.568   1.00 0.00 ? 20 ASN B HD21 2  
ATOM 2015  H HD22 . ASN B 1 20 ? -4.159  8.024   5.015   1.00 0.00 ? 20 ASN B HD22 2  
ATOM 2016  N N    . GLU B 1 21 ? -5.206  7.268   -1.006  1.00 0.00 ? 21 GLU B N    2  
ATOM 2017  C CA   . GLU B 1 21 ? -4.964  7.584   -2.403  1.00 0.00 ? 21 GLU B CA   2  
ATOM 2018  C C    . GLU B 1 21 ? -5.912  6.762   -3.279  1.00 0.00 ? 21 GLU B C    2  
ATOM 2019  O O    . GLU B 1 21 ? -6.295  7.250   -4.353  1.00 0.00 ? 21 GLU B O    2  
ATOM 2020  C CB   . GLU B 1 21 ? -3.505  7.336   -2.792  1.00 0.00 ? 21 GLU B CB   2  
ATOM 2021  C CG   . GLU B 1 21 ? -3.187  7.956   -4.154  1.00 0.00 ? 21 GLU B CG   2  
ATOM 2022  C CD   . GLU B 1 21 ? -2.714  9.404   -4.001  1.00 0.00 ? 21 GLU B CD   2  
ATOM 2023  O OE1  . GLU B 1 21 ? -1.880  9.694   -3.130  1.00 0.00 ? 21 GLU B OE1  2  
ATOM 2024  O OE2  . GLU B 1 21 ? -3.244  10.240  -4.826  1.00 0.00 ? 21 GLU B OE2  2  
ATOM 2025  H H    . GLU B 1 21 ? -4.561  6.628   -0.541  1.00 0.00 ? 21 GLU B H    2  
ATOM 2026  H HA   . GLU B 1 21 ? -5.190  8.642   -2.533  1.00 0.00 ? 21 GLU B HA   2  
ATOM 2027  H HB2  . GLU B 1 21 ? -2.857  7.783   -2.038  1.00 0.00 ? 21 GLU B HB2  2  
ATOM 2028  H HB3  . GLU B 1 21 ? -3.325  6.261   -2.821  1.00 0.00 ? 21 GLU B HB3  2  
ATOM 2029  H HG2  . GLU B 1 21 ? -2.399  7.374   -4.633  1.00 0.00 ? 21 GLU B HG2  2  
ATOM 2030  H HG3  . GLU B 1 21 ? -4.081  7.922   -4.775  1.00 0.00 ? 21 GLU B HG3  2  
ATOM 2031  N N    . VAL B 1 22 ? -6.264  5.550   -2.812  1.00 0.00 ? 22 VAL B N    2  
ATOM 2032  C CA   . VAL B 1 22 ? -7.158  4.673   -3.548  1.00 0.00 ? 22 VAL B CA   2  
ATOM 2033  C C    . VAL B 1 22 ? -8.601  5.146   -3.359  1.00 0.00 ? 22 VAL B C    2  
ATOM 2034  O O    . VAL B 1 22 ? -9.383  5.051   -4.317  1.00 0.00 ? 22 VAL B O    2  
ATOM 2035  C CB   . VAL B 1 22 ? -6.943  3.223   -3.110  1.00 0.00 ? 22 VAL B CB   2  
ATOM 2036  C CG1  . VAL B 1 22 ? -8.241  2.418   -3.220  1.00 0.00 ? 22 VAL B CG1  2  
ATOM 2037  C CG2  . VAL B 1 22 ? -5.823  2.566   -3.919  1.00 0.00 ? 22 VAL B CG2  2  
ATOM 2038  H H    . VAL B 1 22 ? -5.903  5.224   -1.916  1.00 0.00 ? 22 VAL B H    2  
ATOM 2039  H HA   . VAL B 1 22 ? -6.895  4.748   -4.603  1.00 0.00 ? 22 VAL B HA   2  
ATOM 2040  H HB   . VAL B 1 22 ? -6.643  3.270   -2.064  1.00 0.00 ? 22 VAL B HB   2  
ATOM 2041  H HG11 . VAL B 1 22 ? -8.599  2.428   -4.249  1.00 0.00 ? 22 VAL B HG11 2  
ATOM 2042  H HG12 . VAL B 1 22 ? -8.052  1.393   -2.901  1.00 0.00 ? 22 VAL B HG12 2  
ATOM 2043  H HG13 . VAL B 1 22 ? -9.004  2.855   -2.574  1.00 0.00 ? 22 VAL B HG13 2  
ATOM 2044  H HG21 . VAL B 1 22 ? -4.892  3.118   -3.781  1.00 0.00 ? 22 VAL B HG21 2  
ATOM 2045  H HG22 . VAL B 1 22 ? -5.698  1.537   -3.582  1.00 0.00 ? 22 VAL B HG22 2  
ATOM 2046  H HG23 . VAL B 1 22 ? -6.081  2.564   -4.978  1.00 0.00 ? 22 VAL B HG23 2  
ATOM 2047  N N    . ALA B 1 23 ? -8.919  5.639   -2.149  1.00 0.00 ? 23 ALA B N    2  
ATOM 2048  C CA   . ALA B 1 23 ? -10.256 6.121   -1.841  1.00 0.00 ? 23 ALA B CA   2  
ATOM 2049  C C    . ALA B 1 23 ? -10.517 7.415   -2.617  1.00 0.00 ? 23 ALA B C    2  
ATOM 2050  O O    . ALA B 1 23 ? -11.691 7.775   -2.784  1.00 0.00 ? 23 ALA B O    2  
ATOM 2051  C CB   . ALA B 1 23 ? -10.342 6.485   -0.358  1.00 0.00 ? 23 ALA B CB   2  
ATOM 2052  H H    . ALA B 1 23 ? -8.214  5.681   -1.413  1.00 0.00 ? 23 ALA B H    2  
ATOM 2053  H HA   . ALA B 1 23 ? -11.012 5.386   -2.112  1.00 0.00 ? 23 ALA B HA   2  
ATOM 2054  H HB1  . ALA B 1 23 ? -10.117 5.601   0.238   1.00 0.00 ? 23 ALA B HB1  2  
ATOM 2055  H HB2  . ALA B 1 23 ? -9.617  7.265   -0.123  1.00 0.00 ? 23 ALA B HB2  2  
ATOM 2056  H HB3  . ALA B 1 23 ? -11.342 6.848   -0.122  1.00 0.00 ? 23 ALA B HB3  2  
ATOM 2057  N N    . ARG B 1 24 ? -9.436  8.076   -3.066  1.00 0.00 ? 24 ARG B N    2  
ATOM 2058  C CA   . ARG B 1 24 ? -9.548  9.316   -3.815  1.00 0.00 ? 24 ARG B CA   2  
ATOM 2059  C C    . ARG B 1 24 ? -9.567  9.002   -5.313  1.00 0.00 ? 24 ARG B C    2  
ATOM 2060  O O    . ARG B 1 24 ? -10.233 9.733   -6.059  1.00 0.00 ? 24 ARG B O    2  
ATOM 2061  C CB   . ARG B 1 24 ? -8.384  10.263  -3.514  1.00 0.00 ? 24 ARG B CB   2  
ATOM 2062  C CG   . ARG B 1 24 ? -8.745  11.234  -2.389  1.00 0.00 ? 24 ARG B CG   2  
ATOM 2063  C CD   . ARG B 1 24 ? -9.518  10.522  -1.276  1.00 0.00 ? 24 ARG B CD   2  
ATOM 2064  N NE   . ARG B 1 24 ? -9.713  11.437  -0.129  1.00 0.00 ? 24 ARG B NE   2  
ATOM 2065  C CZ   . ARG B 1 24 ? -10.878 12.061  0.150   1.00 0.00 ? 24 ARG B CZ   2  
ATOM 2066  N NH1  . ARG B 1 24 ? -11.935 11.852  -0.646  1.00 0.00 ? 24 ARG B NH1  2  
ATOM 2067  N NH2  . ARG B 1 24 ? -10.975 12.876  1.210   1.00 0.00 ? 24 ARG B NH2  2  
ATOM 2068  H H    . ARG B 1 24 ? -8.501  7.709   -2.883  1.00 0.00 ? 24 ARG B H    2  
ATOM 2069  H HA   . ARG B 1 24 ? -10.490 9.789   -3.539  1.00 0.00 ? 24 ARG B HA   2  
ATOM 2070  H HB2  . ARG B 1 24 ? -7.519  9.676   -3.211  1.00 0.00 ? 24 ARG B HB2  2  
ATOM 2071  H HB3  . ARG B 1 24 ? -8.139  10.819  -4.419  1.00 0.00 ? 24 ARG B HB3  2  
ATOM 2072  H HG2  . ARG B 1 24 ? -7.828  11.652  -1.973  1.00 0.00 ? 24 ARG B HG2  2  
ATOM 2073  H HG3  . ARG B 1 24 ? -9.349  12.044  -2.800  1.00 0.00 ? 24 ARG B HG3  2  
ATOM 2074  H HD2  . ARG B 1 24 ? -10.492 10.211  -1.652  1.00 0.00 ? 24 ARG B HD2  2  
ATOM 2075  H HD3  . ARG B 1 24 ? -8.963  9.640   -0.957  1.00 0.00 ? 24 ARG B HD3  2  
ATOM 2076  H HE   . ARG B 1 24 ? -8.899  11.584  0.467   1.00 0.00 ? 24 ARG B HE   2  
ATOM 2077  H HH11 . ARG B 1 24 ? -11.852 11.230  -1.450  1.00 0.00 ? 24 ARG B HH11 2  
ATOM 2078  H HH12 . ARG B 1 24 ? -12.822 12.316  -0.449  1.00 0.00 ? 24 ARG B HH12 2  
ATOM 2079  H HH21 . ARG B 1 24 ? -10.166 13.029  1.811   1.00 0.00 ? 24 ARG B HH21 2  
ATOM 2080  H HH22 . ARG B 1 24 ? -11.859 13.344  1.414   1.00 0.00 ? 24 ARG B HH22 2  
ATOM 2081  N N    . LEU B 1 25 ? -8.848  7.938   -5.714  1.00 0.00 ? 25 LEU B N    2  
ATOM 2082  C CA   . LEU B 1 25 ? -8.783  7.535   -7.108  1.00 0.00 ? 25 LEU B CA   2  
ATOM 2083  C C    . LEU B 1 25 ? -10.064 6.782   -7.477  1.00 0.00 ? 25 LEU B C    2  
ATOM 2084  O O    . LEU B 1 25 ? -10.578 7.000   -8.582  1.00 0.00 ? 25 LEU B O    2  
ATOM 2085  C CB   . LEU B 1 25 ? -7.504  6.739   -7.377  1.00 0.00 ? 25 LEU B CB   2  
ATOM 2086  C CG   . LEU B 1 25 ? -6.218  7.559   -7.496  1.00 0.00 ? 25 LEU B CG   2  
ATOM 2087  C CD1  . LEU B 1 25 ? -4.995  6.647   -7.616  1.00 0.00 ? 25 LEU B CD1  2  
ATOM 2088  C CD2  . LEU B 1 25 ? -6.305  8.555   -8.654  1.00 0.00 ? 25 LEU B CD2  2  
ATOM 2089  H H    . LEU B 1 25 ? -8.326  7.388   -5.031  1.00 0.00 ? 25 LEU B H    2  
ATOM 2090  H HA   . LEU B 1 25 ? -8.730  8.452   -7.694  1.00 0.00 ? 25 LEU B HA   2  
ATOM 2091  H HB2  . LEU B 1 25 ? -7.400  6.034   -6.553  1.00 0.00 ? 25 LEU B HB2  2  
ATOM 2092  H HB3  . LEU B 1 25 ? -7.677  6.185   -8.299  1.00 0.00 ? 25 LEU B HB3  2  
ATOM 2093  H HG   . LEU B 1 25 ? -6.144  8.112   -6.559  1.00 0.00 ? 25 LEU B HG   2  
ATOM 2094  H HD11 . LEU B 1 25 ? -5.091  6.011   -8.495  1.00 0.00 ? 25 LEU B HD11 2  
ATOM 2095  H HD12 . LEU B 1 25 ? -4.099  7.263   -7.698  1.00 0.00 ? 25 LEU B HD12 2  
ATOM 2096  H HD13 . LEU B 1 25 ? -4.913  6.017   -6.729  1.00 0.00 ? 25 LEU B HD13 2  
ATOM 2097  H HD21 . LEU B 1 25 ? -7.144  9.233   -8.498  1.00 0.00 ? 25 LEU B HD21 2  
ATOM 2098  H HD22 . LEU B 1 25 ? -5.375  9.119   -8.708  1.00 0.00 ? 25 LEU B HD22 2  
ATOM 2099  H HD23 . LEU B 1 25 ? -6.451  8.020   -9.592  1.00 0.00 ? 25 LEU B HD23 2  
ATOM 2100  N N    . LYS B 1 26 ? -10.544 5.925   -6.557  1.00 0.00 ? 26 LYS B N    2  
ATOM 2101  C CA   . LYS B 1 26 ? -11.751 5.150   -6.785  1.00 0.00 ? 26 LYS B CA   2  
ATOM 2102  C C    . LYS B 1 26 ? -12.938 6.100   -6.954  1.00 0.00 ? 26 LYS B C    2  
ATOM 2103  O O    . LYS B 1 26 ? -13.912 5.716   -7.618  1.00 0.00 ? 26 LYS B O    2  
ATOM 2104  C CB   . LYS B 1 26 ? -11.944 4.118   -5.671  1.00 0.00 ? 26 LYS B CB   2  
ATOM 2105  C CG   . LYS B 1 26 ? -11.054 2.894   -5.898  1.00 0.00 ? 26 LYS B CG   2  
ATOM 2106  C CD   . LYS B 1 26 ? -11.888 1.611   -5.939  1.00 0.00 ? 26 LYS B CD   2  
ATOM 2107  C CE   . LYS B 1 26 ? -12.656 1.498   -7.256  1.00 0.00 ? 26 LYS B CE   2  
ATOM 2108  N NZ   . LYS B 1 26 ? -12.706 0.097   -7.705  1.00 0.00 ? 26 LYS B NZ   2  
ATOM 2109  H H    . LYS B 1 26 ? -10.057 5.805   -5.669  1.00 0.00 ? 26 LYS B H    2  
ATOM 2110  H HA   . LYS B 1 26 ? -11.598 4.604   -7.716  1.00 0.00 ? 26 LYS B HA   2  
ATOM 2111  H HB2  . LYS B 1 26 ? -11.682 4.576   -4.716  1.00 0.00 ? 26 LYS B HB2  2  
ATOM 2112  H HB3  . LYS B 1 26 ? -12.991 3.817   -5.645  1.00 0.00 ? 26 LYS B HB3  2  
ATOM 2113  H HG2  . LYS B 1 26 ? -10.531 3.008   -6.848  1.00 0.00 ? 26 LYS B HG2  2  
ATOM 2114  H HG3  . LYS B 1 26 ? -10.321 2.836   -5.094  1.00 0.00 ? 26 LYS B HG3  2  
ATOM 2115  H HD2  . LYS B 1 26 ? -11.221 0.754   -5.842  1.00 0.00 ? 26 LYS B HD2  2  
ATOM 2116  H HD3  . LYS B 1 26 ? -12.584 1.616   -5.100  1.00 0.00 ? 26 LYS B HD3  2  
ATOM 2117  H HE2  . LYS B 1 26 ? -13.674 1.860   -7.109  1.00 0.00 ? 26 LYS B HE2  2  
ATOM 2118  H HE3  . LYS B 1 26 ? -12.166 2.113   -8.011  1.00 0.00 ? 26 LYS B HE3  2  
ATOM 2119  H HZ1  . LYS B 1 26 ? -13.164 -0.478  -6.999  1.00 0.00 ? 26 LYS B HZ1  2  
ATOM 2120  H HZ2  . LYS B 1 26 ? -13.223 0.048   -8.583  1.00 0.00 ? 26 LYS B HZ2  2  
ATOM 2121  H HZ3  . LYS B 1 26 ? -11.760 -0.254  -7.856  1.00 0.00 ? 26 LYS B HZ3  2  
ATOM 2122  N N    . LYS B 1 27 ? -12.837 7.303   -6.360  1.00 0.00 ? 27 LYS B N    2  
ATOM 2123  C CA   . LYS B 1 27 ? -13.894 8.296   -6.445  1.00 0.00 ? 27 LYS B CA   2  
ATOM 2124  C C    . LYS B 1 27 ? -13.778 9.047   -7.773  1.00 0.00 ? 27 LYS B C    2  
ATOM 2125  O O    . LYS B 1 27 ? -14.707 9.795   -8.110  1.00 0.00 ? 27 LYS B O    2  
ATOM 2126  C CB   . LYS B 1 27 ? -13.870 9.209   -5.218  1.00 0.00 ? 27 LYS B CB   2  
ATOM 2127  C CG   . LYS B 1 27 ? -15.285 9.445   -4.683  1.00 0.00 ? 27 LYS B CG   2  
ATOM 2128  C CD   . LYS B 1 27 ? -15.402 8.997   -3.225  1.00 0.00 ? 27 LYS B CD   2  
ATOM 2129  C CE   . LYS B 1 27 ? -14.756 10.017  -2.285  1.00 0.00 ? 27 LYS B CE   2  
ATOM 2130  N NZ   . LYS B 1 27 ? -13.589 10.644  -2.926  1.00 0.00 ? 27 LYS B NZ   2  
ATOM 2131  H H    . LYS B 1 27 ? -11.998 7.540   -5.830  1.00 0.00 ? 27 LYS B H    2  
ATOM 2132  H HA   . LYS B 1 27 ? -14.836 7.746   -6.428  1.00 0.00 ? 27 LYS B HA   2  
ATOM 2133  H HB2  . LYS B 1 27 ? -13.270 8.740   -4.438  1.00 0.00 ? 27 LYS B HB2  2  
ATOM 2134  H HB3  . LYS B 1 27 ? -13.415 10.160  -5.493  1.00 0.00 ? 27 LYS B HB3  2  
ATOM 2135  H HG2  . LYS B 1 27 ? -15.514 10.509  -4.746  1.00 0.00 ? 27 LYS B HG2  2  
ATOM 2136  H HG3  . LYS B 1 27 ? -15.993 8.891   -5.299  1.00 0.00 ? 27 LYS B HG3  2  
ATOM 2137  H HD2  . LYS B 1 27 ? -16.456 8.897   -2.968  1.00 0.00 ? 27 LYS B HD2  2  
ATOM 2138  H HD3  . LYS B 1 27 ? -14.914 8.028   -3.112  1.00 0.00 ? 27 LYS B HD3  2  
ATOM 2139  H HE2  . LYS B 1 27 ? -15.484 10.791  -2.040  1.00 0.00 ? 27 LYS B HE2  2  
ATOM 2140  H HE3  . LYS B 1 27 ? -14.450 9.515   -1.366  1.00 0.00 ? 27 LYS B HE3  2  
ATOM 2141  H HZ1  . LYS B 1 27 ? -13.875 11.114  -3.785  1.00 0.00 ? 27 LYS B HZ1  2  
ATOM 2142  H HZ2  . LYS B 1 27 ? -13.177 11.318  -2.282  1.00 0.00 ? 27 LYS B HZ2  2  
ATOM 2143  H HZ3  . LYS B 1 27 ? -12.893 9.934   -3.154  1.00 0.00 ? 27 LYS B HZ3  2  
ATOM 2144  N N    . LEU B 1 28 ? -12.659 8.835   -8.488  1.00 0.00 ? 28 LEU B N    2  
ATOM 2145  C CA   . LEU B 1 28 ? -12.426 9.488   -9.765  1.00 0.00 ? 28 LEU B CA   2  
ATOM 2146  C C    . LEU B 1 28 ? -12.630 8.476   -10.894 1.00 0.00 ? 28 LEU B C    2  
ATOM 2147  O O    . LEU B 1 28 ? -13.121 8.872   -11.961 1.00 0.00 ? 28 LEU B O    2  
ATOM 2148  C CB   . LEU B 1 28 ? -11.053 10.160  -9.782  1.00 0.00 ? 28 LEU B CB   2  
ATOM 2149  C CG   . LEU B 1 28 ? -11.021 11.611  -10.266 1.00 0.00 ? 28 LEU B CG   2  
ATOM 2150  C CD1  . LEU B 1 28 ? -11.263 12.581  -9.107  1.00 0.00 ? 28 LEU B CD1  2  
ATOM 2151  C CD2  . LEU B 1 28 ? -9.717  11.915  -11.005 1.00 0.00 ? 28 LEU B CD2  2  
ATOM 2152  H H    . LEU B 1 28 ? -11.941 8.201   -8.137  1.00 0.00 ? 28 LEU B H    2  
ATOM 2153  H HA   . LEU B 1 28 ? -13.178 10.272  -9.853  1.00 0.00 ? 28 LEU B HA   2  
ATOM 2154  H HB2  . LEU B 1 28 ? -10.678 10.118  -8.760  1.00 0.00 ? 28 LEU B HB2  2  
ATOM 2155  H HB3  . LEU B 1 28 ? -10.418 9.542   -10.419 1.00 0.00 ? 28 LEU B HB3  2  
ATOM 2156  H HG   . LEU B 1 28 ? -11.853 11.696  -10.965 1.00 0.00 ? 28 LEU B HG   2  
ATOM 2157  H HD11 . LEU B 1 28 ? -10.496 12.446  -8.344  1.00 0.00 ? 28 LEU B HD11 2  
ATOM 2158  H HD12 . LEU B 1 28 ? -11.234 13.601  -9.487  1.00 0.00 ? 28 LEU B HD12 2  
ATOM 2159  H HD13 . LEU B 1 28 ? -12.241 12.394  -8.664  1.00 0.00 ? 28 LEU B HD13 2  
ATOM 2160  H HD21 . LEU B 1 28 ? -9.614  11.254  -11.865 1.00 0.00 ? 28 LEU B HD21 2  
ATOM 2161  H HD22 . LEU B 1 28 ? -9.729  12.953  -11.334 1.00 0.00 ? 28 LEU B HD22 2  
ATOM 2162  H HD23 . LEU B 1 28 ? -8.868  11.764  -10.338 1.00 0.00 ? 28 LEU B HD23 2  
ATOM 2163  N N    . VAL B 1 29 ? -12.255 7.208   -10.642 1.00 0.00 ? 29 VAL B N    2  
ATOM 2164  C CA   . VAL B 1 29 ? -12.395 6.153   -11.630 1.00 0.00 ? 29 VAL B CA   2  
ATOM 2165  C C    . VAL B 1 29 ? -13.505 5.194   -11.192 1.00 0.00 ? 29 VAL B C    2  
ATOM 2166  O O    . VAL B 1 29 ? -14.518 5.103   -11.901 1.00 0.00 ? 29 VAL B O    2  
ATOM 2167  C CB   . VAL B 1 29 ? -11.051 5.453   -11.843 1.00 0.00 ? 29 VAL B CB   2  
ATOM 2168  C CG1  . VAL B 1 29 ? -11.096 4.540   -13.070 1.00 0.00 ? 29 VAL B CG1  2  
ATOM 2169  C CG2  . VAL B 1 29 ? -9.915  6.471   -11.958 1.00 0.00 ? 29 VAL B CG2  2  
ATOM 2170  H H    . VAL B 1 29 ? -11.858 6.965   -9.734  1.00 0.00 ? 29 VAL B H    2  
ATOM 2171  H HA   . VAL B 1 29 ? -12.682 6.621   -12.571 1.00 0.00 ? 29 VAL B HA   2  
ATOM 2172  H HB   . VAL B 1 29 ? -10.891 4.843   -10.952 1.00 0.00 ? 29 VAL B HB   2  
ATOM 2173  H HG11 . VAL B 1 29 ? -11.335 5.125   -13.959 1.00 0.00 ? 29 VAL B HG11 2  
ATOM 2174  H HG12 . VAL B 1 29 ? -10.125 4.060   -13.191 1.00 0.00 ? 29 VAL B HG12 2  
ATOM 2175  H HG13 . VAL B 1 29 ? -11.857 3.772   -12.934 1.00 0.00 ? 29 VAL B HG13 2  
ATOM 2176  H HG21 . VAL B 1 29 ? -9.861  7.072   -11.050 1.00 0.00 ? 29 VAL B HG21 2  
ATOM 2177  H HG22 . VAL B 1 29 ? -8.975  5.939   -12.107 1.00 0.00 ? 29 VAL B HG22 2  
ATOM 2178  H HG23 . VAL B 1 29 ? -10.091 7.129   -12.808 1.00 0.00 ? 29 VAL B HG23 2  
ATOM 2179  N N    . GLY B 1 30 ? -13.296 4.512   -10.052 1.00 0.00 ? 30 GLY B N    2  
ATOM 2180  C CA   . GLY B 1 30 ? -14.272 3.571   -9.528  1.00 0.00 ? 30 GLY B CA   2  
ATOM 2181  C C    . GLY B 1 30 ? -15.624 4.273   -9.383  1.00 0.00 ? 30 GLY B C    2  
ATOM 2182  O O    . GLY B 1 30 ? -16.617 3.587   -9.103  1.00 0.00 ? 30 GLY B O    2  
ATOM 2183  H H    . GLY B 1 30 ? -12.431 4.646   -9.528  1.00 0.00 ? 30 GLY B H    2  
ATOM 2184  H HA2  . GLY B 1 30 ? -14.380 2.731   -10.214 1.00 0.00 ? 30 GLY B HA2  2  
ATOM 2185  H HA3  . GLY B 1 30 ? -13.941 3.198   -8.559  1.00 0.00 ? 30 GLY B HA3  2  
ATOM 2186  N N    . GLU B 1 31 ? -15.634 5.605   -9.571  1.00 0.00 ? 31 GLU B N    2  
ATOM 2187  C CA   . GLU B 1 31 ? -16.852 6.389   -9.462  1.00 0.00 ? 31 GLU B CA   2  
ATOM 2188  C C    . GLU B 1 31 ? -17.858 5.909   -10.509 1.00 0.00 ? 31 GLU B C    2  
ATOM 2189  O O    . GLU B 1 31 ? -17.613 6.124   -11.705 1.00 0.00 ? 31 GLU B O    2  
ATOM 2190  C CB   . GLU B 1 31 ? -16.573 7.885   -9.616  1.00 0.00 ? 31 GLU B CB   2  
ATOM 2191  C CG   . GLU B 1 31 ? -17.259 8.688   -8.507  1.00 0.00 ? 31 GLU B CG   2  
ATOM 2192  C CD   . GLU B 1 31 ? -17.477 10.140  -8.936  1.00 0.00 ? 31 GLU B CD   2  
ATOM 2193  O OE1  . GLU B 1 31 ? -16.844 10.605  -9.895  1.00 0.00 ? 31 GLU B OE1  2  
ATOM 2194  O OE2  . GLU B 1 31 ? -18.343 10.791  -8.236  1.00 0.00 ? 31 GLU B OE2  2  
ATOM 2195  H H    . GLU B 1 31 ? -14.768 6.095   -9.799  1.00 0.00 ? 31 GLU B H    2  
ATOM 2196  H HA   . GLU B 1 31 ? -17.260 6.205   -8.467  1.00 0.00 ? 31 GLU B HA   2  
ATOM 2197  H HB2  . GLU B 1 31 ? -15.497 8.052   -9.561  1.00 0.00 ? 31 GLU B HB2  2  
ATOM 2198  H HB3  . GLU B 1 31 ? -16.934 8.214   -10.590 1.00 0.00 ? 31 GLU B HB3  2  
ATOM 2199  H HG2  . GLU B 1 31 ? -18.224 8.234   -8.286  1.00 0.00 ? 31 GLU B HG2  2  
ATOM 2200  H HG3  . GLU B 1 31 ? -16.637 8.654   -7.612  1.00 0.00 ? 31 GLU B HG3  2  
ATOM 2201  N N    . ARG B 1 32 ? -18.954 5.279   -10.048 1.00 0.00 ? 32 ARG B N    2  
ATOM 2202  C CA   . ARG B 1 32 ? -19.985 4.774   -10.938 1.00 0.00 ? 32 ARG B CA   2  
ATOM 2203  C C    . ARG B 1 32 ? -20.296 5.830   -12.001 1.00 0.00 ? 32 ARG B C    2  
ATOM 2204  O O    . ARG B 1 32 ? -20.039 7.016   -11.795 1.00 0.00 ? 32 ARG B O    2  
ATOM 2205  C CB   . ARG B 1 32 ? -21.268 4.431   -10.179 1.00 0.00 ? 32 ARG B CB   2  
ATOM 2206  C CG   . ARG B 1 32 ? -20.961 4.054   -8.728  1.00 0.00 ? 32 ARG B CG   2  
ATOM 2207  C CD   . ARG B 1 32 ? -19.969 2.892   -8.661  1.00 0.00 ? 32 ARG B CD   2  
ATOM 2208  N NE   . ARG B 1 32 ? -18.911 3.185   -7.669  1.00 0.00 ? 32 ARG B NE   2  
ATOM 2209  C CZ   . ARG B 1 32 ? -18.950 2.785   -6.381  1.00 0.00 ? 32 ARG B CZ   2  
ATOM 2210  N NH1  . ARG B 1 32 ? -20.002 2.076   -5.952  1.00 0.00 ? 32 ARG B NH1  2  
ATOM 2211  N NH2  . ARG B 1 32 ? -17.950 3.093   -5.543  1.00 0.00 ? 32 ARG B NH2  2  
ATOM 2212  H H    . ARG B 1 32 ? -19.079 5.142   -9.045  1.00 0.00 ? 32 ARG B H    2  
ATOM 2213  H HA   . ARG B 1 32 ? -19.596 3.882   -11.429 1.00 0.00 ? 32 ARG B HA   2  
ATOM 2214  H HB2  . ARG B 1 32 ? -21.928 5.299   -10.189 1.00 0.00 ? 32 ARG B HB2  2  
ATOM 2215  H HB3  . ARG B 1 32 ? -21.765 3.602   -10.681 1.00 0.00 ? 32 ARG B HB3  2  
ATOM 2216  H HG2  . ARG B 1 32 ? -20.531 4.918   -8.221  1.00 0.00 ? 32 ARG B HG2  2  
ATOM 2217  H HG3  . ARG B 1 32 ? -21.892 3.778   -8.231  1.00 0.00 ? 32 ARG B HG3  2  
ATOM 2218  H HD2  . ARG B 1 32 ? -20.494 1.984   -8.362  1.00 0.00 ? 32 ARG B HD2  2  
ATOM 2219  H HD3  . ARG B 1 32 ? -19.525 2.737   -9.644  1.00 0.00 ? 32 ARG B HD3  2  
ATOM 2220  H HE   . ARG B 1 32 ? -18.117 3.726   -8.012  1.00 0.00 ? 32 ARG B HE   2  
ATOM 2221  H HH11 . ARG B 1 32 ? -20.759 1.847   -6.595  1.00 0.00 ? 32 ARG B HH11 2  
ATOM 2222  H HH12 . ARG B 1 32 ? -20.047 1.766   -4.981  1.00 0.00 ? 32 ARG B HH12 2  
ATOM 2223  H HH21 . ARG B 1 32 ? -17.152 3.633   -5.878  1.00 0.00 ? 32 ARG B HH21 2  
ATOM 2224  H HH22 . ARG B 1 32 ? -17.986 2.786   -4.571  1.00 0.00 ? 32 ARG B HH22 2  
ATOM 2225  N N    . MET A 1 1  ? 8.879   -11.579 16.813  1.00 0.00 ? 1  MET A N    3  
ATOM 2226  C CA   . MET A 1 1  ? 9.474   -11.458 15.493  1.00 0.00 ? 1  MET A CA   3  
ATOM 2227  C C    . MET A 1 1  ? 8.842   -12.491 14.557  1.00 0.00 ? 1  MET A C    3  
ATOM 2228  O O    . MET A 1 1  ? 8.603   -12.159 13.387  1.00 0.00 ? 1  MET A O    3  
ATOM 2229  C CB   . MET A 1 1  ? 10.984  -11.691 15.565  1.00 0.00 ? 1  MET A CB   3  
ATOM 2230  C CG   . MET A 1 1  ? 11.720  -10.845 14.526  1.00 0.00 ? 1  MET A CG   3  
ATOM 2231  S SD   . MET A 1 1  ? 13.203  -11.722 13.947  1.00 0.00 ? 1  MET A SD   3  
ATOM 2232  C CE   . MET A 1 1  ? 14.151  -11.793 15.496  1.00 0.00 ? 1  MET A CE   3  
ATOM 2233  H H    . MET A 1 1  ? 9.502   -11.579 17.620  1.00 0.00 ? 1  MET A H    3  
ATOM 2234  H HA   . MET A 1 1  ? 9.275   -10.459 15.104  1.00 0.00 ? 1  MET A HA   3  
ATOM 2235  H HB2  . MET A 1 1  ? 11.337  -11.418 16.559  1.00 0.00 ? 1  MET A HB2  3  
ATOM 2236  H HB3  . MET A 1 1  ? 11.187  -12.749 15.395  1.00 0.00 ? 1  MET A HB3  3  
ATOM 2237  H HG2  . MET A 1 1  ? 11.063  -10.662 13.676  1.00 0.00 ? 1  MET A HG2  3  
ATOM 2238  H HG3  . MET A 1 1  ? 12.002  -9.890  14.969  1.00 0.00 ? 1  MET A HG3  3  
ATOM 2239  H HE1  . MET A 1 1  ? 13.583  -12.328 16.256  1.00 0.00 ? 1  MET A HE1  3  
ATOM 2240  H HE2  . MET A 1 1  ? 15.096  -12.304 15.310  1.00 0.00 ? 1  MET A HE2  3  
ATOM 2241  H HE3  . MET A 1 1  ? 14.359  -10.784 15.852  1.00 0.00 ? 1  MET A HE3  3  
ATOM 2242  N N    . ASP A 1 2  ? 8.588   -13.703 15.082  1.00 0.00 ? 2  ASP A N    3  
ATOM 2243  C CA   . ASP A 1 2  ? 7.990   -14.771 14.299  1.00 0.00 ? 2  ASP A CA   3  
ATOM 2244  C C    . ASP A 1 2  ? 6.740   -14.242 13.592  1.00 0.00 ? 2  ASP A C    3  
ATOM 2245  O O    . ASP A 1 2  ? 6.508   -14.629 12.437  1.00 0.00 ? 2  ASP A O    3  
ATOM 2246  C CB   . ASP A 1 2  ? 7.568   -15.940 15.193  1.00 0.00 ? 2  ASP A CB   3  
ATOM 2247  C CG   . ASP A 1 2  ? 8.688   -16.922 15.544  1.00 0.00 ? 2  ASP A CG   3  
ATOM 2248  O OD1  . ASP A 1 2  ? 9.649   -16.426 16.247  1.00 0.00 ? 2  ASP A OD1  3  
ATOM 2249  O OD2  . ASP A 1 2  ? 8.644   -18.102 15.164  1.00 0.00 ? 2  ASP A OD2  3  
ATOM 2250  H H    . ASP A 1 2  ? 8.817   -13.895 16.058  1.00 0.00 ? 2  ASP A H    3  
ATOM 2251  H HA   . ASP A 1 2  ? 8.708   -15.105 13.549  1.00 0.00 ? 2  ASP A HA   3  
ATOM 2252  H HB2  . ASP A 1 2  ? 7.174   -15.509 16.113  1.00 0.00 ? 2  ASP A HB2  3  
ATOM 2253  H HB3  . ASP A 1 2  ? 6.766   -16.461 14.672  1.00 0.00 ? 2  ASP A HB3  3  
ATOM 2254  N N    . ALA A 1 3  ? 5.975   -13.382 14.287  1.00 0.00 ? 3  ALA A N    3  
ATOM 2255  C CA   . ALA A 1 3  ? 4.762   -12.807 13.729  1.00 0.00 ? 3  ALA A CA   3  
ATOM 2256  C C    . ALA A 1 3  ? 5.111   -11.519 12.982  1.00 0.00 ? 3  ALA A C    3  
ATOM 2257  O O    . ALA A 1 3  ? 4.268   -11.039 12.209  1.00 0.00 ? 3  ALA A O    3  
ATOM 2258  C CB   . ALA A 1 3  ? 3.816   -12.404 14.862  1.00 0.00 ? 3  ALA A CB   3  
ATOM 2259  H H    . ALA A 1 3  ? 6.239   -13.116 15.235  1.00 0.00 ? 3  ALA A H    3  
ATOM 2260  H HA   . ALA A 1 3  ? 4.280   -13.499 13.039  1.00 0.00 ? 3  ALA A HA   3  
ATOM 2261  H HB1  . ALA A 1 3  ? 3.574   -13.286 15.454  1.00 0.00 ? 3  ALA A HB1  3  
ATOM 2262  H HB2  . ALA A 1 3  ? 4.298   -11.668 15.505  1.00 0.00 ? 3  ALA A HB2  3  
ATOM 2263  H HB3  . ALA A 1 3  ? 2.904   -11.972 14.449  1.00 0.00 ? 3  ALA A HB3  3  
ATOM 2264  N N    . ILE A 1 4  ? 6.326   -10.993 13.223  1.00 0.00 ? 4  ILE A N    3  
ATOM 2265  C CA   . ILE A 1 4  ? 6.778   -9.773  12.576  1.00 0.00 ? 4  ILE A CA   3  
ATOM 2266  C C    . ILE A 1 4  ? 7.202   -10.088 11.141  1.00 0.00 ? 4  ILE A C    3  
ATOM 2267  O O    . ILE A 1 4  ? 6.808   -9.342  10.231  1.00 0.00 ? 4  ILE A O    3  
ATOM 2268  C CB   . ILE A 1 4  ? 7.872   -9.101  13.408  1.00 0.00 ? 4  ILE A CB   3  
ATOM 2269  C CG1  . ILE A 1 4  ? 7.350   -8.717  14.794  1.00 0.00 ? 4  ILE A CG1  3  
ATOM 2270  C CG2  . ILE A 1 4  ? 8.466   -7.902  12.666  1.00 0.00 ? 4  ILE A CG2  3  
ATOM 2271  C CD1  . ILE A 1 4  ? 7.763   -7.288  15.159  1.00 0.00 ? 4  ILE A CD1  3  
ATOM 2272  H H    . ILE A 1 4  ? 6.960   -11.453 13.875  1.00 0.00 ? 4  ILE A H    3  
ATOM 2273  H HA   . ILE A 1 4  ? 5.920   -9.100  12.553  1.00 0.00 ? 4  ILE A HA   3  
ATOM 2274  H HB   . ILE A 1 4  ? 8.649   -9.857  13.519  1.00 0.00 ? 4  ILE A HB   3  
ATOM 2275  H HG12 . ILE A 1 4  ? 6.261   -8.781  14.792  1.00 0.00 ? 4  ILE A HG12 3  
ATOM 2276  H HG13 . ILE A 1 4  ? 7.746   -9.417  15.528  1.00 0.00 ? 4  ILE A HG13 3  
ATOM 2277  H HG21 . ILE A 1 4  ? 7.684   -7.172  12.454  1.00 0.00 ? 4  ILE A HG21 3  
ATOM 2278  H HG22 . ILE A 1 4  ? 9.239   -7.448  13.285  1.00 0.00 ? 4  ILE A HG22 3  
ATOM 2279  H HG23 . ILE A 1 4  ? 8.910   -8.229  11.726  1.00 0.00 ? 4  ILE A HG23 3  
ATOM 2280  H HD11 . ILE A 1 4  ? 7.366   -6.588  14.425  1.00 0.00 ? 4  ILE A HD11 3  
ATOM 2281  H HD12 . ILE A 1 4  ? 7.375   -7.049  16.148  1.00 0.00 ? 4  ILE A HD12 3  
ATOM 2282  H HD13 . ILE A 1 4  ? 8.849   -7.209  15.174  1.00 0.00 ? 4  ILE A HD13 3  
ATOM 2283  N N    . LYS A 1 5  ? 7.984   -11.170 10.967  1.00 0.00 ? 5  LYS A N    3  
ATOM 2284  C CA   . LYS A 1 5  ? 8.455   -11.576 9.655   1.00 0.00 ? 5  LYS A CA   3  
ATOM 2285  C C    . LYS A 1 5  ? 7.264   -11.683 8.700   1.00 0.00 ? 5  LYS A C    3  
ATOM 2286  O O    . LYS A 1 5  ? 7.425   -11.348 7.517   1.00 0.00 ? 5  LYS A O    3  
ATOM 2287  C CB   . LYS A 1 5  ? 9.279   -12.861 9.755   1.00 0.00 ? 5  LYS A CB   3  
ATOM 2288  C CG   . LYS A 1 5  ? 10.269  -12.787 10.921  1.00 0.00 ? 5  LYS A CG   3  
ATOM 2289  C CD   . LYS A 1 5  ? 9.948   -13.845 11.980  1.00 0.00 ? 5  LYS A CD   3  
ATOM 2290  C CE   . LYS A 1 5  ? 10.574  -15.192 11.617  1.00 0.00 ? 5  LYS A CE   3  
ATOM 2291  N NZ   . LYS A 1 5  ? 9.534   -16.148 11.201  1.00 0.00 ? 5  LYS A NZ   3  
ATOM 2292  H H    . LYS A 1 5  ? 8.262   -11.732 11.771  1.00 0.00 ? 5  LYS A H    3  
ATOM 2293  H HA   . LYS A 1 5  ? 9.119   -10.786 9.306   1.00 0.00 ? 5  LYS A HA   3  
ATOM 2294  H HB2  . LYS A 1 5  ? 8.605   -13.702 9.915   1.00 0.00 ? 5  LYS A HB2  3  
ATOM 2295  H HB3  . LYS A 1 5  ? 9.818   -13.011 8.820   1.00 0.00 ? 5  LYS A HB3  3  
ATOM 2296  H HG2  . LYS A 1 5  ? 11.275  -12.960 10.542  1.00 0.00 ? 5  LYS A HG2  3  
ATOM 2297  H HG3  . LYS A 1 5  ? 10.220  -11.793 11.362  1.00 0.00 ? 5  LYS A HG3  3  
ATOM 2298  H HD2  . LYS A 1 5  ? 10.345  -13.516 12.940  1.00 0.00 ? 5  LYS A HD2  3  
ATOM 2299  H HD3  . LYS A 1 5  ? 8.865   -13.947 12.060  1.00 0.00 ? 5  LYS A HD3  3  
ATOM 2300  H HE2  . LYS A 1 5  ? 11.276  -15.052 10.795  1.00 0.00 ? 5  LYS A HE2  3  
ATOM 2301  H HE3  . LYS A 1 5  ? 11.112  -15.581 12.481  1.00 0.00 ? 5  LYS A HE3  3  
ATOM 2302  H HZ1  . LYS A 1 5  ? 9.031   -15.784 10.391  1.00 0.00 ? 5  LYS A HZ1  3  
ATOM 2303  H HZ2  . LYS A 1 5  ? 9.976   -17.037 10.964  1.00 0.00 ? 5  LYS A HZ2  3  
ATOM 2304  H HZ3  . LYS A 1 5  ? 8.874   -16.298 11.963  1.00 0.00 ? 5  LYS A HZ3  3  
ATOM 2305  N N    . LYS A 1 6  ? 6.112   -12.140 9.223   1.00 0.00 ? 6  LYS A N    3  
ATOM 2306  C CA   . LYS A 1 6  ? 4.908   -12.288 8.423   1.00 0.00 ? 6  LYS A CA   3  
ATOM 2307  C C    . LYS A 1 6  ? 4.150   -10.959 8.399   1.00 0.00 ? 6  LYS A C    3  
ATOM 2308  O O    . LYS A 1 6  ? 3.499   -10.670 7.384   1.00 0.00 ? 6  LYS A O    3  
ATOM 2309  C CB   . LYS A 1 6  ? 4.071   -13.464 8.928   1.00 0.00 ? 6  LYS A CB   3  
ATOM 2310  C CG   . LYS A 1 6  ? 4.965   -14.580 9.472   1.00 0.00 ? 6  LYS A CG   3  
ATOM 2311  C CD   . LYS A 1 6  ? 4.297   -15.948 9.311   1.00 0.00 ? 6  LYS A CD   3  
ATOM 2312  C CE   . LYS A 1 6  ? 3.806   -16.151 7.877   1.00 0.00 ? 6  LYS A CE   3  
ATOM 2313  N NZ   . LYS A 1 6  ? 3.740   -17.585 7.552   1.00 0.00 ? 6  LYS A NZ   3  
ATOM 2314  H H    . LYS A 1 6  ? 6.065   -12.393 10.210  1.00 0.00 ? 6  LYS A H    3  
ATOM 2315  H HA   . LYS A 1 6  ? 5.238   -12.527 7.412   1.00 0.00 ? 6  LYS A HA   3  
ATOM 2316  H HB2  . LYS A 1 6  ? 3.414   -13.116 9.725   1.00 0.00 ? 6  LYS A HB2  3  
ATOM 2317  H HB3  . LYS A 1 6  ? 3.463   -13.844 8.106   1.00 0.00 ? 6  LYS A HB3  3  
ATOM 2318  H HG2  . LYS A 1 6  ? 5.908   -14.579 8.924   1.00 0.00 ? 6  LYS A HG2  3  
ATOM 2319  H HG3  . LYS A 1 6  ? 5.168   -14.388 10.526  1.00 0.00 ? 6  LYS A HG3  3  
ATOM 2320  H HD2  . LYS A 1 6  ? 5.022   -16.726 9.551   1.00 0.00 ? 6  LYS A HD2  3  
ATOM 2321  H HD3  . LYS A 1 6  ? 3.459   -16.015 10.004  1.00 0.00 ? 6  LYS A HD3  3  
ATOM 2322  H HE2  . LYS A 1 6  ? 2.811   -15.718 7.774   1.00 0.00 ? 6  LYS A HE2  3  
ATOM 2323  H HE3  . LYS A 1 6  ? 4.485   -15.646 7.190   1.00 0.00 ? 6  LYS A HE3  3  
ATOM 2324  H HZ1  . LYS A 1 6  ? 3.105   -18.058 8.195   1.00 0.00 ? 6  LYS A HZ1  3  
ATOM 2325  H HZ2  . LYS A 1 6  ? 3.410   -17.694 6.593   1.00 0.00 ? 6  LYS A HZ2  3  
ATOM 2326  H HZ3  . LYS A 1 6  ? 4.667   -18.003 7.634   1.00 0.00 ? 6  LYS A HZ3  3  
ATOM 2327  N N    . LYS A 1 7  ? 4.246   -10.191 9.498   1.00 0.00 ? 7  LYS A N    3  
ATOM 2328  C CA   . LYS A 1 7  ? 3.575   -8.907  9.601   1.00 0.00 ? 7  LYS A CA   3  
ATOM 2329  C C    . LYS A 1 7  ? 3.958   -8.038  8.402   1.00 0.00 ? 7  LYS A C    3  
ATOM 2330  O O    . LYS A 1 7  ? 3.053   -7.475  7.768   1.00 0.00 ? 7  LYS A O    3  
ATOM 2331  C CB   . LYS A 1 7  ? 3.870   -8.255  10.954  1.00 0.00 ? 7  LYS A CB   3  
ATOM 2332  C CG   . LYS A 1 7  ? 3.138   -6.918  11.090  1.00 0.00 ? 7  LYS A CG   3  
ATOM 2333  C CD   . LYS A 1 7  ? 1.691   -7.034  10.606  1.00 0.00 ? 7  LYS A CD   3  
ATOM 2334  C CE   . LYS A 1 7  ? 0.782   -6.058  11.356  1.00 0.00 ? 7  LYS A CE   3  
ATOM 2335  N NZ   . LYS A 1 7  ? 1.523   -4.839  11.717  1.00 0.00 ? 7  LYS A NZ   3  
ATOM 2336  H H    . LYS A 1 7  ? 4.805   -10.504 10.293  1.00 0.00 ? 7  LYS A H    3  
ATOM 2337  H HA   . LYS A 1 7  ? 2.505   -9.114  9.562   1.00 0.00 ? 7  LYS A HA   3  
ATOM 2338  H HB2  . LYS A 1 7  ? 3.539   -8.923  11.748  1.00 0.00 ? 7  LYS A HB2  3  
ATOM 2339  H HB3  . LYS A 1 7  ? 4.945   -8.101  11.044  1.00 0.00 ? 7  LYS A HB3  3  
ATOM 2340  H HG2  . LYS A 1 7  ? 3.139   -6.619  12.137  1.00 0.00 ? 7  LYS A HG2  3  
ATOM 2341  H HG3  . LYS A 1 7  ? 3.666   -6.165  10.505  1.00 0.00 ? 7  LYS A HG3  3  
ATOM 2342  H HD2  . LYS A 1 7  ? 1.653   -6.806  9.541   1.00 0.00 ? 7  LYS A HD2  3  
ATOM 2343  H HD3  . LYS A 1 7  ? 1.346   -8.056  10.762  1.00 0.00 ? 7  LYS A HD3  3  
ATOM 2344  H HE2  . LYS A 1 7  ? -0.058  -5.787  10.717  1.00 0.00 ? 7  LYS A HE2  3  
ATOM 2345  H HE3  . LYS A 1 7  ? 0.402   -6.542  12.256  1.00 0.00 ? 7  LYS A HE3  3  
ATOM 2346  H HZ1  . LYS A 1 7  ? 1.880   -4.386  10.876  1.00 0.00 ? 7  LYS A HZ1  3  
ATOM 2347  H HZ2  . LYS A 1 7  ? 0.898   -4.205  12.215  1.00 0.00 ? 7  LYS A HZ2  3  
ATOM 2348  H HZ3  . LYS A 1 7  ? 2.308   -5.075  12.325  1.00 0.00 ? 7  LYS A HZ3  3  
ATOM 2349  N N    . MET A 1 8  ? 5.270   -7.945  8.121   1.00 0.00 ? 8  MET A N    3  
ATOM 2350  C CA   . MET A 1 8  ? 5.764   -7.151  7.009   1.00 0.00 ? 8  MET A CA   3  
ATOM 2351  C C    . MET A 1 8  ? 5.362   -7.818  5.693   1.00 0.00 ? 8  MET A C    3  
ATOM 2352  O O    . MET A 1 8  ? 5.273   -7.112  4.676   1.00 0.00 ? 8  MET A O    3  
ATOM 2353  C CB   . MET A 1 8  ? 7.288   -7.031  7.075   1.00 0.00 ? 8  MET A CB   3  
ATOM 2354  C CG   . MET A 1 8  ? 7.949   -8.408  6.990   1.00 0.00 ? 8  MET A CG   3  
ATOM 2355  S SD   . MET A 1 8  ? 9.703   -8.229  6.553   1.00 0.00 ? 8  MET A SD   3  
ATOM 2356  C CE   . MET A 1 8  ? 10.436  -9.457  7.674   1.00 0.00 ? 8  MET A CE   3  
ATOM 2357  H H    . MET A 1 8  ? 5.951   -8.441  8.695   1.00 0.00 ? 8  MET A H    3  
ATOM 2358  H HA   . MET A 1 8  ? 5.315   -6.159  7.056   1.00 0.00 ? 8  MET A HA   3  
ATOM 2359  H HB2  . MET A 1 8  ? 7.632   -6.421  6.241   1.00 0.00 ? 8  MET A HB2  3  
ATOM 2360  H HB3  . MET A 1 8  ? 7.563   -6.543  8.010   1.00 0.00 ? 8  MET A HB3  3  
ATOM 2361  H HG2  . MET A 1 8  ? 7.874   -8.907  7.957   1.00 0.00 ? 8  MET A HG2  3  
ATOM 2362  H HG3  . MET A 1 8  ? 7.438   -9.011  6.240   1.00 0.00 ? 8  MET A HG3  3  
ATOM 2363  H HE1  . MET A 1 8  ? 10.021  -10.443 7.468   1.00 0.00 ? 8  MET A HE1  3  
ATOM 2364  H HE2  . MET A 1 8  ? 11.516  -9.471  7.528   1.00 0.00 ? 8  MET A HE2  3  
ATOM 2365  H HE3  . MET A 1 8  ? 10.221  -9.191  8.708   1.00 0.00 ? 8  MET A HE3  3  
ATOM 2366  N N    . GLN A 1 9  ? 5.128   -9.142  5.734   1.00 0.00 ? 9  GLN A N    3  
ATOM 2367  C CA   . GLN A 1 9  ? 4.739   -9.894  4.553   1.00 0.00 ? 9  GLN A CA   3  
ATOM 2368  C C    . GLN A 1 9  ? 3.280   -9.581  4.213   1.00 0.00 ? 9  GLN A C    3  
ATOM 2369  O O    . GLN A 1 9  ? 2.913   -9.692  3.034   1.00 0.00 ? 9  GLN A O    3  
ATOM 2370  C CB   . GLN A 1 9  ? 4.946   -11.397 4.751   1.00 0.00 ? 9  GLN A CB   3  
ATOM 2371  C CG   . GLN A 1 9  ? 6.401   -11.790 4.487   1.00 0.00 ? 9  GLN A CG   3  
ATOM 2372  C CD   . GLN A 1 9  ? 6.492   -13.214 3.934   1.00 0.00 ? 9  GLN A CD   3  
ATOM 2373  O OE1  . GLN A 1 9  ? 6.007   -13.522 2.858   1.00 0.00 ? 9  GLN A OE1  3  
ATOM 2374  N NE2  . GLN A 1 9  ? 7.139   -14.061 4.728   1.00 0.00 ? 9  GLN A NE2  3  
ATOM 2375  H H    . GLN A 1 9  ? 5.224   -9.649  6.615   1.00 0.00 ? 9  GLN A H    3  
ATOM 2376  H HA   . GLN A 1 9  ? 5.375   -9.554  3.736   1.00 0.00 ? 9  GLN A HA   3  
ATOM 2377  H HB2  . GLN A 1 9  ? 4.689   -11.658 5.778   1.00 0.00 ? 9  GLN A HB2  3  
ATOM 2378  H HB3  . GLN A 1 9  ? 4.286   -11.936 4.072   1.00 0.00 ? 9  GLN A HB3  3  
ATOM 2379  H HG2  . GLN A 1 9  ? 6.828   -11.098 3.759   1.00 0.00 ? 9  GLN A HG2  3  
ATOM 2380  H HG3  . GLN A 1 9  ? 6.961   -11.715 5.418   1.00 0.00 ? 9  GLN A HG3  3  
ATOM 2381  H HE21 . GLN A 1 9  ? 7.521   -13.738 5.617   1.00 0.00 ? 9  GLN A HE21 3  
ATOM 2382  H HE22 . GLN A 1 9  ? 7.255   -15.035 4.448   1.00 0.00 ? 9  GLN A HE22 3  
ATOM 2383  N N    . MET A 1 10 ? 2.491   -9.202  5.235   1.00 0.00 ? 10 MET A N    3  
ATOM 2384  C CA   . MET A 1 10 ? 1.088   -8.877  5.044   1.00 0.00 ? 10 MET A CA   3  
ATOM 2385  C C    . MET A 1 10 ? 0.969   -7.458  4.486   1.00 0.00 ? 10 MET A C    3  
ATOM 2386  O O    . MET A 1 10 ? 0.110   -7.235  3.620   1.00 0.00 ? 10 MET A O    3  
ATOM 2387  C CB   . MET A 1 10 ? 0.335   -8.969  6.373   1.00 0.00 ? 10 MET A CB   3  
ATOM 2388  C CG   . MET A 1 10 ? 0.797   -10.183 7.182   1.00 0.00 ? 10 MET A CG   3  
ATOM 2389  S SD   . MET A 1 10 ? -0.641  -11.130 7.760   1.00 0.00 ? 10 MET A SD   3  
ATOM 2390  C CE   . MET A 1 10 ? -0.105  -11.517 9.452   1.00 0.00 ? 10 MET A CE   3  
ATOM 2391  H H    . MET A 1 10 ? 2.875   -9.136  6.178   1.00 0.00 ? 10 MET A H    3  
ATOM 2392  H HA   . MET A 1 10 ? 0.657   -9.578  4.328   1.00 0.00 ? 10 MET A HA   3  
ATOM 2393  H HB2  . MET A 1 10 ? 0.524   -8.064  6.950   1.00 0.00 ? 10 MET A HB2  3  
ATOM 2394  H HB3  . MET A 1 10 ? -0.733  -9.044  6.169   1.00 0.00 ? 10 MET A HB3  3  
ATOM 2395  H HG2  . MET A 1 10 ? 1.415   -10.824 6.554   1.00 0.00 ? 10 MET A HG2  3  
ATOM 2396  H HG3  . MET A 1 10 ? 1.388   -9.846  8.035   1.00 0.00 ? 10 MET A HG3  3  
ATOM 2397  H HE1  . MET A 1 10 ? 0.078   -10.596 10.005  1.00 0.00 ? 10 MET A HE1  3  
ATOM 2398  H HE2  . MET A 1 10 ? -0.882  -12.100 9.947   1.00 0.00 ? 10 MET A HE2  3  
ATOM 2399  H HE3  . MET A 1 10 ? 0.814   -12.104 9.426   1.00 0.00 ? 10 MET A HE3  3  
ATOM 2400  N N    . LEU A 1 11 ? 1.817   -6.541  4.986   1.00 0.00 ? 11 LEU A N    3  
ATOM 2401  C CA   . LEU A 1 11 ? 1.806   -5.158  4.540   1.00 0.00 ? 11 LEU A CA   3  
ATOM 2402  C C    . LEU A 1 11 ? 2.504   -5.060  3.181   1.00 0.00 ? 11 LEU A C    3  
ATOM 2403  O O    . LEU A 1 11 ? 2.185   -4.134  2.421   1.00 0.00 ? 11 LEU A O    3  
ATOM 2404  C CB   . LEU A 1 11 ? 2.410   -4.246  5.609   1.00 0.00 ? 11 LEU A CB   3  
ATOM 2405  C CG   . LEU A 1 11 ? 1.776   -4.331  7.000   1.00 0.00 ? 11 LEU A CG   3  
ATOM 2406  C CD1  . LEU A 1 11 ? 2.494   -3.409  7.986   1.00 0.00 ? 11 LEU A CD1  3  
ATOM 2407  C CD2  . LEU A 1 11 ? 0.276   -4.043  6.936   1.00 0.00 ? 11 LEU A CD2  3  
ATOM 2408  H H    . LEU A 1 11 ? 2.496   -6.809  5.699   1.00 0.00 ? 11 LEU A H    3  
ATOM 2409  H HA   . LEU A 1 11 ? 0.759   -4.879  4.423   1.00 0.00 ? 11 LEU A HA   3  
ATOM 2410  H HB2  . LEU A 1 11 ? 3.465   -4.515  5.683   1.00 0.00 ? 11 LEU A HB2  3  
ATOM 2411  H HB3  . LEU A 1 11 ? 2.330   -3.230  5.225   1.00 0.00 ? 11 LEU A HB3  3  
ATOM 2412  H HG   . LEU A 1 11 ? 1.927   -5.361  7.318   1.00 0.00 ? 11 LEU A HG   3  
ATOM 2413  H HD11 . LEU A 1 11 ? 2.444   -2.378  7.637   1.00 0.00 ? 11 LEU A HD11 3  
ATOM 2414  H HD12 . LEU A 1 11 ? 2.018   -3.494  8.964   1.00 0.00 ? 11 LEU A HD12 3  
ATOM 2415  H HD13 . LEU A 1 11 ? 3.541   -3.702  8.076   1.00 0.00 ? 11 LEU A HD13 3  
ATOM 2416  H HD21 . LEU A 1 11 ? -0.214  -4.764  6.280   1.00 0.00 ? 11 LEU A HD21 3  
ATOM 2417  H HD22 . LEU A 1 11 ? -0.143  -4.112  7.940   1.00 0.00 ? 11 LEU A HD22 3  
ATOM 2418  H HD23 . LEU A 1 11 ? 0.105   -3.039  6.548   1.00 0.00 ? 11 LEU A HD23 3  
ATOM 2419  N N    . LYS A 1 12 ? 3.426   -5.999  2.908   1.00 0.00 ? 12 LYS A N    3  
ATOM 2420  C CA   . LYS A 1 12 ? 4.159   -6.016  1.654   1.00 0.00 ? 12 LYS A CA   3  
ATOM 2421  C C    . LYS A 1 12 ? 3.251   -6.551  0.545   1.00 0.00 ? 12 LYS A C    3  
ATOM 2422  O O    . LYS A 1 12 ? 3.408   -6.118  -0.606  1.00 0.00 ? 12 LYS A O    3  
ATOM 2423  C CB   . LYS A 1 12 ? 5.466   -6.797  1.808   1.00 0.00 ? 12 LYS A CB   3  
ATOM 2424  C CG   . LYS A 1 12 ? 6.291   -6.744  0.521   1.00 0.00 ? 12 LYS A CG   3  
ATOM 2425  C CD   . LYS A 1 12 ? 7.790   -6.726  0.831   1.00 0.00 ? 12 LYS A CD   3  
ATOM 2426  C CE   . LYS A 1 12 ? 8.343   -8.147  0.942   1.00 0.00 ? 12 LYS A CE   3  
ATOM 2427  N NZ   . LYS A 1 12 ? 8.248   -8.840  -0.353  1.00 0.00 ? 12 LYS A NZ   3  
ATOM 2428  H H    . LYS A 1 12 ? 3.628   -6.728  3.592   1.00 0.00 ? 12 LYS A H    3  
ATOM 2429  H HA   . LYS A 1 12 ? 4.418   -4.981  1.432   1.00 0.00 ? 12 LYS A HA   3  
ATOM 2430  H HB2  . LYS A 1 12 ? 6.046   -6.358  2.620   1.00 0.00 ? 12 LYS A HB2  3  
ATOM 2431  H HB3  . LYS A 1 12 ? 5.232   -7.832  2.057   1.00 0.00 ? 12 LYS A HB3  3  
ATOM 2432  H HG2  . LYS A 1 12 ? 6.064   -7.623  -0.082  1.00 0.00 ? 12 LYS A HG2  3  
ATOM 2433  H HG3  . LYS A 1 12 ? 6.017   -5.850  -0.038  1.00 0.00 ? 12 LYS A HG3  3  
ATOM 2434  H HD2  . LYS A 1 12 ? 8.311   -6.203  0.028   1.00 0.00 ? 12 LYS A HD2  3  
ATOM 2435  H HD3  . LYS A 1 12 ? 7.951   -6.190  1.766   1.00 0.00 ? 12 LYS A HD3  3  
ATOM 2436  H HE2  . LYS A 1 12 ? 9.390   -8.102  1.243   1.00 0.00 ? 12 LYS A HE2  3  
ATOM 2437  H HE3  . LYS A 1 12 ? 7.780   -8.694  1.698   1.00 0.00 ? 12 LYS A HE3  3  
ATOM 2438  H HZ1  . LYS A 1 12 ? 8.776   -8.330  -1.062  1.00 0.00 ? 12 LYS A HZ1  3  
ATOM 2439  H HZ2  . LYS A 1 12 ? 8.623   -9.784  -0.254  1.00 0.00 ? 12 LYS A HZ2  3  
ATOM 2440  H HZ3  . LYS A 1 12 ? 7.273   -8.899  -0.646  1.00 0.00 ? 12 LYS A HZ3  3  
ATOM 2441  N N    . LEU A 1 13 ? 2.333   -7.465  0.906   1.00 0.00 ? 13 LEU A N    3  
ATOM 2442  C CA   . LEU A 1 13 ? 1.411   -8.051  -0.052  1.00 0.00 ? 13 LEU A CA   3  
ATOM 2443  C C    . LEU A 1 13 ? 0.318   -7.034  -0.389  1.00 0.00 ? 13 LEU A C    3  
ATOM 2444  O O    . LEU A 1 13 ? -0.058  -6.941  -1.566  1.00 0.00 ? 13 LEU A O    3  
ATOM 2445  C CB   . LEU A 1 13 ? 0.870   -9.384  0.471   1.00 0.00 ? 13 LEU A CB   3  
ATOM 2446  C CG   . LEU A 1 13 ? 0.398   -10.379 -0.591  1.00 0.00 ? 13 LEU A CG   3  
ATOM 2447  C CD1  . LEU A 1 13 ? -0.587  -11.387 0.003   1.00 0.00 ? 13 LEU A CD1  3  
ATOM 2448  C CD2  . LEU A 1 13 ? -0.187  -9.651  -1.803  1.00 0.00 ? 13 LEU A CD2  3  
ATOM 2449  H H    . LEU A 1 13 ? 2.270   -7.768  1.878   1.00 0.00 ? 13 LEU A H    3  
ATOM 2450  H HA   . LEU A 1 13 ? 1.990   -8.261  -0.951  1.00 0.00 ? 13 LEU A HA   3  
ATOM 2451  H HB2  . LEU A 1 13 ? 1.675   -9.837  1.049   1.00 0.00 ? 13 LEU A HB2  3  
ATOM 2452  H HB3  . LEU A 1 13 ? 0.046   -9.137  1.141   1.00 0.00 ? 13 LEU A HB3  3  
ATOM 2453  H HG   . LEU A 1 13 ? 1.296   -10.914 -0.898  1.00 0.00 ? 13 LEU A HG   3  
ATOM 2454  H HD11 . LEU A 1 13 ? -1.454  -10.866 0.408   1.00 0.00 ? 13 LEU A HD11 3  
ATOM 2455  H HD12 . LEU A 1 13 ? -0.902  -12.079 -0.780  1.00 0.00 ? 13 LEU A HD12 3  
ATOM 2456  H HD13 . LEU A 1 13 ? -0.106  -11.951 0.801   1.00 0.00 ? 13 LEU A HD13 3  
ATOM 2457  H HD21 . LEU A 1 13 ? 0.565   -8.996  -2.242  1.00 0.00 ? 13 LEU A HD21 3  
ATOM 2458  H HD22 . LEU A 1 13 ? -0.513  -10.389 -2.537  1.00 0.00 ? 13 LEU A HD22 3  
ATOM 2459  H HD23 . LEU A 1 13 ? -1.046  -9.052  -1.497  1.00 0.00 ? 13 LEU A HD23 3  
ATOM 2460  N N    . ASP A 1 14 ? -0.160  -6.303  0.634   1.00 0.00 ? 14 ASP A N    3  
ATOM 2461  C CA   . ASP A 1 14 ? -1.199  -5.305  0.447   1.00 0.00 ? 14 ASP A CA   3  
ATOM 2462  C C    . ASP A 1 14 ? -0.650  -4.159  -0.406  1.00 0.00 ? 14 ASP A C    3  
ATOM 2463  O O    . ASP A 1 14 ? -1.427  -3.568  -1.170  1.00 0.00 ? 14 ASP A O    3  
ATOM 2464  C CB   . ASP A 1 14 ? -1.650  -4.722  1.788   1.00 0.00 ? 14 ASP A CB   3  
ATOM 2465  C CG   . ASP A 1 14 ? -3.162  -4.535  1.936   1.00 0.00 ? 14 ASP A CG   3  
ATOM 2466  O OD1  . ASP A 1 14 ? -3.813  -5.601  2.262   1.00 0.00 ? 14 ASP A OD1  3  
ATOM 2467  O OD2  . ASP A 1 14 ? -3.690  -3.429  1.751   1.00 0.00 ? 14 ASP A OD2  3  
ATOM 2468  H H    . ASP A 1 14 ? 0.206   -6.443  1.576   1.00 0.00 ? 14 ASP A H    3  
ATOM 2469  H HA   . ASP A 1 14 ? -2.041  -5.761  -0.072  1.00 0.00 ? 14 ASP A HA   3  
ATOM 2470  H HB2  . ASP A 1 14 ? -1.298  -5.401  2.563   1.00 0.00 ? 14 ASP A HB2  3  
ATOM 2471  H HB3  . ASP A 1 14 ? -1.144  -3.762  1.901   1.00 0.00 ? 14 ASP A HB3  3  
ATOM 2472  N N    . ASN A 1 15 ? 0.656   -3.872  -0.261  1.00 0.00 ? 15 ASN A N    3  
ATOM 2473  C CA   . ASN A 1 15 ? 1.299   -2.808  -1.012  1.00 0.00 ? 15 ASN A CA   3  
ATOM 2474  C C    . ASN A 1 15 ? 1.249   -3.141  -2.505  1.00 0.00 ? 15 ASN A C    3  
ATOM 2475  O O    . ASN A 1 15 ? 0.864   -2.264  -3.293  1.00 0.00 ? 15 ASN A O    3  
ATOM 2476  C CB   . ASN A 1 15 ? 2.768   -2.660  -0.610  1.00 0.00 ? 15 ASN A CB   3  
ATOM 2477  C CG   . ASN A 1 15 ? 3.282   -1.252  -0.923  1.00 0.00 ? 15 ASN A CG   3  
ATOM 2478  O OD1  . ASN A 1 15 ? 3.747   -0.961  -2.013  1.00 0.00 ? 15 ASN A OD1  3  
ATOM 2479  N ND2  . ASN A 1 15 ? 3.174   -0.399  0.091   1.00 0.00 ? 15 ASN A ND2  3  
ATOM 2480  H H    . ASN A 1 15 ? 1.227   -4.408  0.393   1.00 0.00 ? 15 ASN A H    3  
ATOM 2481  H HA   . ASN A 1 15 ? 0.760   -1.876  -0.838  1.00 0.00 ? 15 ASN A HA   3  
ATOM 2482  H HB2  . ASN A 1 15 ? 2.862   -2.842  0.459   1.00 0.00 ? 15 ASN A HB2  3  
ATOM 2483  H HB3  . ASN A 1 15 ? 3.358   -3.400  -1.150  1.00 0.00 ? 15 ASN A HB3  3  
ATOM 2484  H HD21 . ASN A 1 15 ? 2.775   -0.709  0.977   1.00 0.00 ? 15 ASN A HD21 3  
ATOM 2485  H HD22 . ASN A 1 15 ? 3.490   0.565   -0.017  1.00 0.00 ? 15 ASN A HD22 3  
ATOM 2486  N N    . TYR A 1 16 ? 1.632   -4.381  -2.858  1.00 0.00 ? 16 TYR A N    3  
ATOM 2487  C CA   . TYR A 1 16 ? 1.611   -4.759  -4.261  1.00 0.00 ? 16 TYR A CA   3  
ATOM 2488  C C    . TYR A 1 16 ? 0.175   -4.684  -4.784  1.00 0.00 ? 16 TYR A C    3  
ATOM 2489  O O    . TYR A 1 16 ? -0.002  -4.298  -5.949  1.00 0.00 ? 16 TYR A O    3  
ATOM 2490  C CB   . TYR A 1 16 ? 2.214   -6.164  -4.440  1.00 0.00 ? 16 TYR A CB   3  
ATOM 2491  C CG   . TYR A 1 16 ? 3.563   -6.363  -3.762  1.00 0.00 ? 16 TYR A CG   3  
ATOM 2492  C CD1  . TYR A 1 16 ? 4.513   -5.316  -3.757  1.00 0.00 ? 16 TYR A CD1  3  
ATOM 2493  C CD2  . TYR A 1 16 ? 3.872   -7.589  -3.130  1.00 0.00 ? 16 TYR A CD2  3  
ATOM 2494  C CE1  . TYR A 1 16 ? 5.764   -5.495  -3.129  1.00 0.00 ? 16 TYR A CE1  3  
ATOM 2495  C CE2  . TYR A 1 16 ? 5.123   -7.768  -2.502  1.00 0.00 ? 16 TYR A CE2  3  
ATOM 2496  C CZ   . TYR A 1 16 ? 6.070   -6.720  -2.500  1.00 0.00 ? 16 TYR A CZ   3  
ATOM 2497  O OH   . TYR A 1 16 ? 7.282   -6.890  -1.893  1.00 0.00 ? 16 TYR A OH   3  
ATOM 2498  H H    . TYR A 1 16 ? 1.935   -5.049  -2.165  1.00 0.00 ? 16 TYR A H    3  
ATOM 2499  H HA   . TYR A 1 16 ? 2.212   -4.037  -4.817  1.00 0.00 ? 16 TYR A HA   3  
ATOM 2500  H HB2  . TYR A 1 16 ? 1.506   -6.907  -4.066  1.00 0.00 ? 16 TYR A HB2  3  
ATOM 2501  H HB3  . TYR A 1 16 ? 2.346   -6.358  -5.506  1.00 0.00 ? 16 TYR A HB3  3  
ATOM 2502  H HD1  . TYR A 1 16 ? 4.285   -4.374  -4.235  1.00 0.00 ? 16 TYR A HD1  3  
ATOM 2503  H HD2  . TYR A 1 16 ? 3.153   -8.396  -3.125  1.00 0.00 ? 16 TYR A HD2  3  
ATOM 2504  H HE1  . TYR A 1 16 ? 6.484   -4.689  -3.130  1.00 0.00 ? 16 TYR A HE1  3  
ATOM 2505  H HE2  . TYR A 1 16 ? 5.350   -8.709  -2.021  1.00 0.00 ? 16 TYR A HE2  3  
ATOM 2506  H HH   . TYR A 1 16 ? 7.891   -6.165  -2.046  1.00 0.00 ? 16 TYR A HH   3  
ATOM 2507  N N    . HIS A 1 17 ? -0.802  -5.055  -3.938  1.00 0.00 ? 17 HIS A N    3  
ATOM 2508  C CA   . HIS A 1 17 ? -2.203  -5.037  -4.324  1.00 0.00 ? 17 HIS A CA   3  
ATOM 2509  C C    . HIS A 1 17 ? -2.678  -3.586  -4.435  1.00 0.00 ? 17 HIS A C    3  
ATOM 2510  O O    . HIS A 1 17 ? -3.515  -3.306  -5.305  1.00 0.00 ? 17 HIS A O    3  
ATOM 2511  C CB   . HIS A 1 17 ? -3.049  -5.864  -3.355  1.00 0.00 ? 17 HIS A CB   3  
ATOM 2512  C CG   . HIS A 1 17 ? -4.248  -5.130  -2.804  1.00 0.00 ? 17 HIS A CG   3  
ATOM 2513  N ND1  . HIS A 1 17 ? -5.454  -5.050  -3.480  1.00 0.00 ? 17 HIS A ND1  3  
ATOM 2514  C CD2  . HIS A 1 17 ? -4.415  -4.444  -1.637  1.00 0.00 ? 17 HIS A CD2  3  
ATOM 2515  C CE1  . HIS A 1 17 ? -6.300  -4.346  -2.743  1.00 0.00 ? 17 HIS A CE1  3  
ATOM 2516  N NE2  . HIS A 1 17 ? -5.654  -3.970  -1.602  1.00 0.00 ? 17 HIS A NE2  3  
ATOM 2517  H H    . HIS A 1 17 ? -0.570  -5.362  -2.993  1.00 0.00 ? 17 HIS A H    3  
ATOM 2518  H HA   . HIS A 1 17 ? -2.260  -5.506  -5.306  1.00 0.00 ? 17 HIS A HA   3  
ATOM 2519  H HB2  . HIS A 1 17 ? -3.391  -6.749  -3.893  1.00 0.00 ? 17 HIS A HB2  3  
ATOM 2520  H HB3  . HIS A 1 17 ? -2.397  -6.176  -2.538  1.00 0.00 ? 17 HIS A HB3  3  
ATOM 2521  H HD1  . HIS A 1 17 ? -5.751  -5.426  -4.381  1.00 0.00 ? 17 HIS A HD1  3  
ATOM 2522  H HD2  . HIS A 1 17 ? -3.740  -4.253  -0.816  1.00 0.00 ? 17 HIS A HD2  3  
ATOM 2523  H HE1  . HIS A 1 17 ? -7.305  -4.167  -3.097  1.00 0.00 ? 17 HIS A HE1  3  
ATOM 2524  N N    . LEU A 1 18 ? -2.143  -2.709  -3.567  1.00 0.00 ? 18 LEU A N    3  
ATOM 2525  C CA   . LEU A 1 18 ? -2.509  -1.303  -3.569  1.00 0.00 ? 18 LEU A CA   3  
ATOM 2526  C C    . LEU A 1 18 ? -1.823  -0.604  -4.743  1.00 0.00 ? 18 LEU A C    3  
ATOM 2527  O O    . LEU A 1 18 ? -2.489  0.184   -5.432  1.00 0.00 ? 18 LEU A O    3  
ATOM 2528  C CB   . LEU A 1 18 ? -2.204  -0.669  -2.211  1.00 0.00 ? 18 LEU A CB   3  
ATOM 2529  C CG   . LEU A 1 18 ? -3.118  -1.084  -1.056  1.00 0.00 ? 18 LEU A CG   3  
ATOM 2530  C CD1  . LEU A 1 18 ? -2.495  -0.719  0.293   1.00 0.00 ? 18 LEU A CD1  3  
ATOM 2531  C CD2  . LEU A 1 18 ? -4.517  -0.488  -1.222  1.00 0.00 ? 18 LEU A CD2  3  
ATOM 2532  H H    . LEU A 1 18 ? -1.458  -3.025  -2.880  1.00 0.00 ? 18 LEU A H    3  
ATOM 2533  H HA   . LEU A 1 18 ? -3.589  -1.266  -3.715  1.00 0.00 ? 18 LEU A HA   3  
ATOM 2534  H HB2  . LEU A 1 18 ? -1.178  -0.941  -1.968  1.00 0.00 ? 18 LEU A HB2  3  
ATOM 2535  H HB3  . LEU A 1 18 ? -2.259  0.410   -2.359  1.00 0.00 ? 18 LEU A HB3  3  
ATOM 2536  H HG   . LEU A 1 18 ? -3.185  -2.170  -1.122  1.00 0.00 ? 18 LEU A HG   3  
ATOM 2537  H HD11 . LEU A 1 18 ? -2.326  0.356   0.347   1.00 0.00 ? 18 LEU A HD11 3  
ATOM 2538  H HD12 . LEU A 1 18 ? -3.171  -1.028  1.091   1.00 0.00 ? 18 LEU A HD12 3  
ATOM 2539  H HD13 . LEU A 1 18 ? -1.543  -1.235  0.415   1.00 0.00 ? 18 LEU A HD13 3  
ATOM 2540  H HD21 . LEU A 1 18 ? -4.957  -0.827  -2.159  1.00 0.00 ? 18 LEU A HD21 3  
ATOM 2541  H HD22 . LEU A 1 18 ? -5.138  -0.804  -0.383  1.00 0.00 ? 18 LEU A HD22 3  
ATOM 2542  H HD23 . LEU A 1 18 ? -4.459  0.601   -1.230  1.00 0.00 ? 18 LEU A HD23 3  
ATOM 2543  N N    . GLU A 1 19 ? -0.527  -0.898  -4.945  1.00 0.00 ? 19 GLU A N    3  
ATOM 2544  C CA   . GLU A 1 19 ? 0.239   -0.301  -6.026  1.00 0.00 ? 19 GLU A CA   3  
ATOM 2545  C C    . GLU A 1 19 ? -0.317  -0.783  -7.368  1.00 0.00 ? 19 GLU A C    3  
ATOM 2546  O O    . GLU A 1 19 ? -0.337  0.012   -8.317  1.00 0.00 ? 19 GLU A O    3  
ATOM 2547  C CB   . GLU A 1 19 ? 1.730   -0.623  -5.903  1.00 0.00 ? 19 GLU A CB   3  
ATOM 2548  C CG   . GLU A 1 19 ? 2.580   0.639   -6.063  1.00 0.00 ? 19 GLU A CG   3  
ATOM 2549  C CD   . GLU A 1 19 ? 2.524   1.501   -4.800  1.00 0.00 ? 19 GLU A CD   3  
ATOM 2550  O OE1  . GLU A 1 19 ? 1.609   1.169   -3.954  1.00 0.00 ? 19 GLU A OE1  3  
ATOM 2551  O OE2  . GLU A 1 19 ? 3.323   2.437   -4.652  1.00 0.00 ? 19 GLU A OE2  3  
ATOM 2552  H H    . GLU A 1 19 ? -0.051  -1.559  -4.330  1.00 0.00 ? 19 GLU A H    3  
ATOM 2553  H HA   . GLU A 1 19 ? 0.104   0.778   -5.954  1.00 0.00 ? 19 GLU A HA   3  
ATOM 2554  H HB2  . GLU A 1 19 ? 1.919   -1.057  -4.921  1.00 0.00 ? 19 GLU A HB2  3  
ATOM 2555  H HB3  . GLU A 1 19 ? 1.998   -1.351  -6.669  1.00 0.00 ? 19 GLU A HB3  3  
ATOM 2556  H HG2  . GLU A 1 19 ? 3.613   0.349   -6.250  1.00 0.00 ? 19 GLU A HG2  3  
ATOM 2557  H HG3  . GLU A 1 19 ? 2.210   1.208   -6.917  1.00 0.00 ? 19 GLU A HG3  3  
ATOM 2558  N N    . ASN A 1 20 ? -0.751  -2.055  -7.416  1.00 0.00 ? 20 ASN A N    3  
ATOM 2559  C CA   . ASN A 1 20 ? -1.301  -2.635  -8.630  1.00 0.00 ? 20 ASN A CA   3  
ATOM 2560  C C    . ASN A 1 20 ? -2.639  -1.963  -8.949  1.00 0.00 ? 20 ASN A C    3  
ATOM 2561  O O    . ASN A 1 20 ? -2.999  -1.901  -10.134 1.00 0.00 ? 20 ASN A O    3  
ATOM 2562  C CB   . ASN A 1 20 ? -1.555  -4.134  -8.459  1.00 0.00 ? 20 ASN A CB   3  
ATOM 2563  C CG   . ASN A 1 20 ? -0.341  -4.950  -8.912  1.00 0.00 ? 20 ASN A CG   3  
ATOM 2564  O OD1  . ASN A 1 20 ? 0.488   -4.501  -9.685  1.00 0.00 ? 20 ASN A OD1  3  
ATOM 2565  N ND2  . ASN A 1 20 ? -0.284  -6.170  -8.386  1.00 0.00 ? 20 ASN A ND2  3  
ATOM 2566  H H    . ASN A 1 20 ? -0.698  -2.645  -6.586  1.00 0.00 ? 20 ASN A H    3  
ATOM 2567  H HA   . ASN A 1 20 ? -0.610  -2.457  -9.453  1.00 0.00 ? 20 ASN A HA   3  
ATOM 2568  H HB2  . ASN A 1 20 ? -1.749  -4.343  -7.407  1.00 0.00 ? 20 ASN A HB2  3  
ATOM 2569  H HB3  . ASN A 1 20 ? -2.430  -4.414  -9.046  1.00 0.00 ? 20 ASN A HB3  3  
ATOM 2570  H HD21 . ASN A 1 20 ? -1.012  -6.484  -7.744  1.00 0.00 ? 20 ASN A HD21 3  
ATOM 2571  H HD22 . ASN A 1 20 ? 0.487   -6.793  -8.626  1.00 0.00 ? 20 ASN A HD22 3  
ATOM 2572  N N    . GLU A 1 21 ? -3.336  -1.483  -7.904  1.00 0.00 ? 21 GLU A N    3  
ATOM 2573  C CA   . GLU A 1 21 ? -4.619  -0.824  -8.072  1.00 0.00 ? 21 GLU A CA   3  
ATOM 2574  C C    . GLU A 1 21 ? -4.390  0.646   -8.427  1.00 0.00 ? 21 GLU A C    3  
ATOM 2575  O O    . GLU A 1 21 ? -5.146  1.179   -9.253  1.00 0.00 ? 21 GLU A O    3  
ATOM 2576  C CB   . GLU A 1 21 ? -5.488  -0.956  -6.819  1.00 0.00 ? 21 GLU A CB   3  
ATOM 2577  C CG   . GLU A 1 21 ? -6.947  -1.230  -7.190  1.00 0.00 ? 21 GLU A CG   3  
ATOM 2578  C CD   . GLU A 1 21 ? -7.831  -1.273  -5.942  1.00 0.00 ? 21 GLU A CD   3  
ATOM 2579  O OE1  . GLU A 1 21 ? -7.333  -1.077  -4.823  1.00 0.00 ? 21 GLU A OE1  3  
ATOM 2580  O OE2  . GLU A 1 21 ? -9.077  -1.520  -6.165  1.00 0.00 ? 21 GLU A OE2  3  
ATOM 2581  H H    . GLU A 1 21 ? -2.966  -1.576  -6.958  1.00 0.00 ? 21 GLU A H    3  
ATOM 2582  H HA   . GLU A 1 21 ? -5.123  -1.316  -8.905  1.00 0.00 ? 21 GLU A HA   3  
ATOM 2583  H HB2  . GLU A 1 21 ? -5.114  -1.782  -6.215  1.00 0.00 ? 21 GLU A HB2  3  
ATOM 2584  H HB3  . GLU A 1 21 ? -5.418  -0.034  -6.242  1.00 0.00 ? 21 GLU A HB3  3  
ATOM 2585  H HG2  . GLU A 1 21 ? -7.301  -0.436  -7.848  1.00 0.00 ? 21 GLU A HG2  3  
ATOM 2586  H HG3  . GLU A 1 21 ? -7.005  -2.181  -7.720  1.00 0.00 ? 21 GLU A HG3  3  
ATOM 2587  N N    . VAL A 1 22 ? -3.368  1.264   -7.808  1.00 0.00 ? 22 VAL A N    3  
ATOM 2588  C CA   . VAL A 1 22 ? -3.045  2.659   -8.057  1.00 0.00 ? 22 VAL A CA   3  
ATOM 2589  C C    . VAL A 1 22 ? -2.315  2.777   -9.396  1.00 0.00 ? 22 VAL A C    3  
ATOM 2590  O O    . VAL A 1 22 ? -2.582  3.739   -10.131 1.00 0.00 ? 22 VAL A O    3  
ATOM 2591  C CB   . VAL A 1 22 ? -2.241  3.227   -6.886  1.00 0.00 ? 22 VAL A CB   3  
ATOM 2592  C CG1  . VAL A 1 22 ? -1.647  4.591   -7.240  1.00 0.00 ? 22 VAL A CG1  3  
ATOM 2593  C CG2  . VAL A 1 22 ? -3.100  3.314   -5.622  1.00 0.00 ? 22 VAL A CG2  3  
ATOM 2594  H H    . VAL A 1 22 ? -2.793  0.751   -7.139  1.00 0.00 ? 22 VAL A H    3  
ATOM 2595  H HA   . VAL A 1 22 ? -3.986  3.206   -8.116  1.00 0.00 ? 22 VAL A HA   3  
ATOM 2596  H HB   . VAL A 1 22 ? -1.430  2.520   -6.714  1.00 0.00 ? 22 VAL A HB   3  
ATOM 2597  H HG11 . VAL A 1 22 ? -2.444  5.290   -7.493  1.00 0.00 ? 22 VAL A HG11 3  
ATOM 2598  H HG12 . VAL A 1 22 ? -1.083  4.965   -6.386  1.00 0.00 ? 22 VAL A HG12 3  
ATOM 2599  H HG13 . VAL A 1 22 ? -0.976  4.495   -8.094  1.00 0.00 ? 22 VAL A HG13 3  
ATOM 2600  H HG21 . VAL A 1 22 ? -3.465  2.323   -5.352  1.00 0.00 ? 22 VAL A HG21 3  
ATOM 2601  H HG22 . VAL A 1 22 ? -2.497  3.721   -4.811  1.00 0.00 ? 22 VAL A HG22 3  
ATOM 2602  H HG23 . VAL A 1 22 ? -3.952  3.971   -5.797  1.00 0.00 ? 22 VAL A HG23 3  
ATOM 2603  N N    . ALA A 1 23 ? -1.423  1.812   -9.684  1.00 0.00 ? 23 ALA A N    3  
ATOM 2604  C CA   . ALA A 1 23 ? -0.664  1.808   -10.922 1.00 0.00 ? 23 ALA A CA   3  
ATOM 2605  C C    . ALA A 1 23 ? -1.618  1.591   -12.098 1.00 0.00 ? 23 ALA A C    3  
ATOM 2606  O O    . ALA A 1 23 ? -1.249  1.941   -13.229 1.00 0.00 ? 23 ALA A O    3  
ATOM 2607  C CB   . ALA A 1 23 ? 0.304   0.624   -10.930 1.00 0.00 ? 23 ALA A CB   3  
ATOM 2608  H H    . ALA A 1 23 ? -1.262  1.052   -9.021  1.00 0.00 ? 23 ALA A H    3  
ATOM 2609  H HA   . ALA A 1 23 ? -0.136  2.751   -11.063 1.00 0.00 ? 23 ALA A HA   3  
ATOM 2610  H HB1  . ALA A 1 23 ? 0.978   0.711   -10.078 1.00 0.00 ? 23 ALA A HB1  3  
ATOM 2611  H HB2  . ALA A 1 23 ? -0.252  -0.310  -10.848 1.00 0.00 ? 23 ALA A HB2  3  
ATOM 2612  H HB3  . ALA A 1 23 ? 0.876   0.617   -11.858 1.00 0.00 ? 23 ALA A HB3  3  
ATOM 2613  N N    . ARG A 1 24 ? -2.805  1.026   -11.815 1.00 0.00 ? 24 ARG A N    3  
ATOM 2614  C CA   . ARG A 1 24 ? -3.799  0.766   -12.843 1.00 0.00 ? 24 ARG A CA   3  
ATOM 2615  C C    . ARG A 1 24 ? -4.736  1.970   -12.956 1.00 0.00 ? 24 ARG A C    3  
ATOM 2616  O O    . ARG A 1 24 ? -5.249  2.215   -14.058 1.00 0.00 ? 24 ARG A O    3  
ATOM 2617  C CB   . ARG A 1 24 ? -4.623  -0.484  -12.526 1.00 0.00 ? 24 ARG A CB   3  
ATOM 2618  C CG   . ARG A 1 24 ? -3.958  -1.738  -13.097 1.00 0.00 ? 24 ARG A CG   3  
ATOM 2619  C CD   . ARG A 1 24 ? -4.683  -3.003  -12.632 1.00 0.00 ? 24 ARG A CD   3  
ATOM 2620  N NE   . ARG A 1 24 ? -5.028  -3.846  -13.799 1.00 0.00 ? 24 ARG A NE   3  
ATOM 2621  C CZ   . ARG A 1 24 ? -6.127  -3.668  -14.563 1.00 0.00 ? 24 ARG A CZ   3  
ATOM 2622  N NH1  . ARG A 1 24 ? -6.971  -2.671  -14.263 1.00 0.00 ? 24 ARG A NH1  3  
ATOM 2623  N NH2  . ARG A 1 24 ? -6.370  -4.475  -15.604 1.00 0.00 ? 24 ARG A NH2  3  
ATOM 2624  H H    . ARG A 1 24 ? -3.030  0.767   -10.854 1.00 0.00 ? 24 ARG A H    3  
ATOM 2625  H HA   . ARG A 1 24 ? -3.274  0.633   -13.788 1.00 0.00 ? 24 ARG A HA   3  
ATOM 2626  H HB2  . ARG A 1 24 ? -4.706  -0.589  -11.444 1.00 0.00 ? 24 ARG A HB2  3  
ATOM 2627  H HB3  . ARG A 1 24 ? -5.620  -0.367  -12.950 1.00 0.00 ? 24 ARG A HB3  3  
ATOM 2628  H HG2  . ARG A 1 24 ? -3.989  -1.691  -14.185 1.00 0.00 ? 24 ARG A HG2  3  
ATOM 2629  H HG3  . ARG A 1 24 ? -2.917  -1.766  -12.773 1.00 0.00 ? 24 ARG A HG3  3  
ATOM 2630  H HD2  . ARG A 1 24 ? -4.032  -3.570  -11.966 1.00 0.00 ? 24 ARG A HD2  3  
ATOM 2631  H HD3  . ARG A 1 24 ? -5.588  -2.725  -12.094 1.00 0.00 ? 24 ARG A HD3  3  
ATOM 2632  H HE   . ARG A 1 24 ? -4.375  -4.599  -14.013 1.00 0.00 ? 24 ARG A HE   3  
ATOM 2633  H HH11 . ARG A 1 24 ? -6.779  -2.061  -13.469 1.00 0.00 ? 24 ARG A HH11 3  
ATOM 2634  H HH12 . ARG A 1 24 ? -7.806  -2.523  -14.830 1.00 0.00 ? 24 ARG A HH12 3  
ATOM 2635  H HH21 . ARG A 1 24 ? -5.722  -5.231  -15.824 1.00 0.00 ? 24 ARG A HH21 3  
ATOM 2636  H HH22 . ARG A 1 24 ? -7.202  -4.333  -16.176 1.00 0.00 ? 24 ARG A HH22 3  
ATOM 2637  N N    . LEU A 1 25 ? -4.937  2.685   -11.835 1.00 0.00 ? 25 LEU A N    3  
ATOM 2638  C CA   . LEU A 1 25 ? -5.803  3.851   -11.810 1.00 0.00 ? 25 LEU A CA   3  
ATOM 2639  C C    . LEU A 1 25 ? -5.023  5.072   -12.302 1.00 0.00 ? 25 LEU A C    3  
ATOM 2640  O O    . LEU A 1 25 ? -5.624  5.926   -12.970 1.00 0.00 ? 25 LEU A O    3  
ATOM 2641  C CB   . LEU A 1 25 ? -6.418  4.033   -10.421 1.00 0.00 ? 25 LEU A CB   3  
ATOM 2642  C CG   . LEU A 1 25 ? -7.523  3.045   -10.041 1.00 0.00 ? 25 LEU A CG   3  
ATOM 2643  C CD1  . LEU A 1 25 ? -7.895  3.180   -8.564  1.00 0.00 ? 25 LEU A CD1  3  
ATOM 2644  C CD2  . LEU A 1 25 ? -8.739  3.207   -10.955 1.00 0.00 ? 25 LEU A CD2  3  
ATOM 2645  H H    . LEU A 1 25 ? -4.474  2.414   -10.967 1.00 0.00 ? 25 LEU A H    3  
ATOM 2646  H HA   . LEU A 1 25 ? -6.617  3.646   -12.505 1.00 0.00 ? 25 LEU A HA   3  
ATOM 2647  H HB2  . LEU A 1 25 ? -5.598  3.939   -9.707  1.00 0.00 ? 25 LEU A HB2  3  
ATOM 2648  H HB3  . LEU A 1 25 ? -6.801  5.052   -10.388 1.00 0.00 ? 25 LEU A HB3  3  
ATOM 2649  H HG   . LEU A 1 25 ? -7.089  2.059   -10.199 1.00 0.00 ? 25 LEU A HG   3  
ATOM 2650  H HD11 . LEU A 1 25 ? -8.240  4.193   -8.357  1.00 0.00 ? 25 LEU A HD11 3  
ATOM 2651  H HD12 . LEU A 1 25 ? -8.683  2.465   -8.329  1.00 0.00 ? 25 LEU A HD12 3  
ATOM 2652  H HD13 . LEU A 1 25 ? -7.026  2.969   -7.940  1.00 0.00 ? 25 LEU A HD13 3  
ATOM 2653  H HD21 . LEU A 1 25 ? -8.450  3.033   -11.992 1.00 0.00 ? 25 LEU A HD21 3  
ATOM 2654  H HD22 . LEU A 1 25 ? -9.504  2.490   -10.658 1.00 0.00 ? 25 LEU A HD22 3  
ATOM 2655  H HD23 . LEU A 1 25 ? -9.142  4.215   -10.864 1.00 0.00 ? 25 LEU A HD23 3  
ATOM 2656  N N    . LYS A 1 26 ? -3.721  5.129   -11.968 1.00 0.00 ? 26 LYS A N    3  
ATOM 2657  C CA   . LYS A 1 26 ? -2.870  6.235   -12.372 1.00 0.00 ? 26 LYS A CA   3  
ATOM 2658  C C    . LYS A 1 26 ? -2.882  6.350   -13.898 1.00 0.00 ? 26 LYS A C    3  
ATOM 2659  O O    . LYS A 1 26 ? -2.665  7.459   -14.408 1.00 0.00 ? 26 LYS A O    3  
ATOM 2660  C CB   . LYS A 1 26 ? -1.469  6.078   -11.779 1.00 0.00 ? 26 LYS A CB   3  
ATOM 2661  C CG   . LYS A 1 26 ? -1.251  7.058   -10.623 1.00 0.00 ? 26 LYS A CG   3  
ATOM 2662  C CD   . LYS A 1 26 ? -2.485  7.125   -9.720  1.00 0.00 ? 26 LYS A CD   3  
ATOM 2663  C CE   . LYS A 1 26 ? -3.305  8.385   -10.006 1.00 0.00 ? 26 LYS A CE   3  
ATOM 2664  N NZ   . LYS A 1 26 ? -3.240  9.311   -8.864  1.00 0.00 ? 26 LYS A NZ   3  
ATOM 2665  H H    . LYS A 1 26 ? -3.304  4.382   -11.414 1.00 0.00 ? 26 LYS A H    3  
ATOM 2666  H HA   . LYS A 1 26 ? -3.310  7.136   -11.945 1.00 0.00 ? 26 LYS A HA   3  
ATOM 2667  H HB2  . LYS A 1 26 ? -1.354  5.060   -11.407 1.00 0.00 ? 26 LYS A HB2  3  
ATOM 2668  H HB3  . LYS A 1 26 ? -0.731  6.256   -12.561 1.00 0.00 ? 26 LYS A HB3  3  
ATOM 2669  H HG2  . LYS A 1 26 ? -0.397  6.724   -10.033 1.00 0.00 ? 26 LYS A HG2  3  
ATOM 2670  H HG3  . LYS A 1 26 ? -1.035  8.045   -11.032 1.00 0.00 ? 26 LYS A HG3  3  
ATOM 2671  H HD2  . LYS A 1 26 ? -3.106  6.248   -9.904  1.00 0.00 ? 26 LYS A HD2  3  
ATOM 2672  H HD3  . LYS A 1 26 ? -2.162  7.119   -8.680  1.00 0.00 ? 26 LYS A HD3  3  
ATOM 2673  H HE2  . LYS A 1 26 ? -2.903  8.881   -10.890 1.00 0.00 ? 26 LYS A HE2  3  
ATOM 2674  H HE3  . LYS A 1 26 ? -4.339  8.103   -10.198 1.00 0.00 ? 26 LYS A HE3  3  
ATOM 2675  H HZ1  . LYS A 1 26 ? -2.270  9.576   -8.686  1.00 0.00 ? 26 LYS A HZ1  3  
ATOM 2676  H HZ2  . LYS A 1 26 ? -3.792  10.142  -9.078  1.00 0.00 ? 26 LYS A HZ2  3  
ATOM 2677  H HZ3  . LYS A 1 26 ? -3.621  8.864   -8.031  1.00 0.00 ? 26 LYS A HZ3  3  
ATOM 2678  N N    . LYS A 1 27 ? -3.131  5.220   -14.586 1.00 0.00 ? 27 LYS A N    3  
ATOM 2679  C CA   . LYS A 1 27 ? -3.169  5.196   -16.038 1.00 0.00 ? 27 LYS A CA   3  
ATOM 2680  C C    . LYS A 1 27 ? -4.506  5.763   -16.519 1.00 0.00 ? 27 LYS A C    3  
ATOM 2681  O O    . LYS A 1 27 ? -4.623  6.062   -17.716 1.00 0.00 ? 27 LYS A O    3  
ATOM 2682  C CB   . LYS A 1 27 ? -2.876  3.787   -16.557 1.00 0.00 ? 27 LYS A CB   3  
ATOM 2683  C CG   . LYS A 1 27 ? -1.944  3.832   -17.769 1.00 0.00 ? 27 LYS A CG   3  
ATOM 2684  C CD   . LYS A 1 27 ? -2.570  3.116   -18.969 1.00 0.00 ? 27 LYS A CD   3  
ATOM 2685  C CE   . LYS A 1 27 ? -2.472  1.598   -18.814 1.00 0.00 ? 27 LYS A CE   3  
ATOM 2686  N NZ   . LYS A 1 27 ? -2.632  1.212   -17.402 1.00 0.00 ? 27 LYS A NZ   3  
ATOM 2687  H H    . LYS A 1 27 ? -3.299  4.347   -14.087 1.00 0.00 ? 27 LYS A H    3  
ATOM 2688  H HA   . LYS A 1 27 ? -2.363  5.846   -16.379 1.00 0.00 ? 27 LYS A HA   3  
ATOM 2689  H HB2  . LYS A 1 27 ? -2.399  3.209   -15.765 1.00 0.00 ? 27 LYS A HB2  3  
ATOM 2690  H HB3  . LYS A 1 27 ? -3.817  3.308   -16.829 1.00 0.00 ? 27 LYS A HB3  3  
ATOM 2691  H HG2  . LYS A 1 27 ? -1.758  4.872   -18.034 1.00 0.00 ? 27 LYS A HG2  3  
ATOM 2692  H HG3  . LYS A 1 27 ? -0.999  3.358   -17.506 1.00 0.00 ? 27 LYS A HG3  3  
ATOM 2693  H HD2  . LYS A 1 27 ? -3.620  3.399   -19.041 1.00 0.00 ? 27 LYS A HD2  3  
ATOM 2694  H HD3  . LYS A 1 27 ? -2.055  3.431   -19.877 1.00 0.00 ? 27 LYS A HD3  3  
ATOM 2695  H HE2  . LYS A 1 27 ? -3.260  1.126   -19.402 1.00 0.00 ? 27 LYS A HE2  3  
ATOM 2696  H HE3  . LYS A 1 27 ? -1.504  1.261   -19.184 1.00 0.00 ? 27 LYS A HE3  3  
ATOM 2697  H HZ1  . LYS A 1 27 ? -3.538  1.527   -17.055 1.00 0.00 ? 27 LYS A HZ1  3  
ATOM 2698  H HZ2  . LYS A 1 27 ? -2.563  0.198   -17.325 1.00 0.00 ? 27 LYS A HZ2  3  
ATOM 2699  H HZ3  . LYS A 1 27 ? -1.896  1.639   -16.839 1.00 0.00 ? 27 LYS A HZ3  3  
ATOM 2700  N N    . LEU A 1 28 ? -5.470  5.898   -15.591 1.00 0.00 ? 28 LEU A N    3  
ATOM 2701  C CA   . LEU A 1 28 ? -6.785  6.425   -15.918 1.00 0.00 ? 28 LEU A CA   3  
ATOM 2702  C C    . LEU A 1 28 ? -6.920  7.838   -15.349 1.00 0.00 ? 28 LEU A C    3  
ATOM 2703  O O    . LEU A 1 28 ? -7.593  8.667   -15.979 1.00 0.00 ? 28 LEU A O    3  
ATOM 2704  C CB   . LEU A 1 28 ? -7.879  5.465   -15.447 1.00 0.00 ? 28 LEU A CB   3  
ATOM 2705  C CG   . LEU A 1 28 ? -8.948  5.108   -16.480 1.00 0.00 ? 28 LEU A CG   3  
ATOM 2706  C CD1  . LEU A 1 28 ? -8.529  3.889   -17.304 1.00 0.00 ? 28 LEU A CD1  3  
ATOM 2707  C CD2  . LEU A 1 28 ? -10.310 4.907   -15.813 1.00 0.00 ? 28 LEU A CD2  3  
ATOM 2708  H H    . LEU A 1 28 ? -5.291  5.627   -14.624 1.00 0.00 ? 28 LEU A H    3  
ATOM 2709  H HA   . LEU A 1 28 ? -6.837  6.474   -17.006 1.00 0.00 ? 28 LEU A HA   3  
ATOM 2710  H HB2  . LEU A 1 28 ? -7.373  4.553   -15.130 1.00 0.00 ? 28 LEU A HB2  3  
ATOM 2711  H HB3  . LEU A 1 28 ? -8.343  5.933   -14.579 1.00 0.00 ? 28 LEU A HB3  3  
ATOM 2712  H HG   . LEU A 1 28 ? -9.002  5.970   -17.144 1.00 0.00 ? 28 LEU A HG   3  
ATOM 2713  H HD11 . LEU A 1 28 ? -8.371  3.032   -16.648 1.00 0.00 ? 28 LEU A HD11 3  
ATOM 2714  H HD12 . LEU A 1 28 ? -9.312  3.663   -18.029 1.00 0.00 ? 28 LEU A HD12 3  
ATOM 2715  H HD13 . LEU A 1 28 ? -7.603  4.102   -17.839 1.00 0.00 ? 28 LEU A HD13 3  
ATOM 2716  H HD21 . LEU A 1 28 ? -10.610 5.819   -15.297 1.00 0.00 ? 28 LEU A HD21 3  
ATOM 2717  H HD22 . LEU A 1 28 ? -11.046 4.653   -16.577 1.00 0.00 ? 28 LEU A HD22 3  
ATOM 2718  H HD23 . LEU A 1 28 ? -10.255 4.092   -15.092 1.00 0.00 ? 28 LEU A HD23 3  
ATOM 2719  N N    . VAL A 1 29 ? -6.286  8.082   -14.187 1.00 0.00 ? 29 VAL A N    3  
ATOM 2720  C CA   . VAL A 1 29 ? -6.336  9.383   -13.542 1.00 0.00 ? 29 VAL A CA   3  
ATOM 2721  C C    . VAL A 1 29 ? -4.958  10.043  -13.629 1.00 0.00 ? 29 VAL A C    3  
ATOM 2722  O O    . VAL A 1 29 ? -4.869  11.152  -14.177 1.00 0.00 ? 29 VAL A O    3  
ATOM 2723  C CB   . VAL A 1 29 ? -6.838  9.236   -12.104 1.00 0.00 ? 29 VAL A CB   3  
ATOM 2724  C CG1  . VAL A 1 29 ? -7.234  10.593  -11.520 1.00 0.00 ? 29 VAL A CG1  3  
ATOM 2725  C CG2  . VAL A 1 29 ? -8.001  8.245   -12.029 1.00 0.00 ? 29 VAL A CG2  3  
ATOM 2726  H H    . VAL A 1 29 ? -5.752  7.342   -13.732 1.00 0.00 ? 29 VAL A H    3  
ATOM 2727  H HA   . VAL A 1 29 ? -7.056  9.992   -14.089 1.00 0.00 ? 29 VAL A HA   3  
ATOM 2728  H HB   . VAL A 1 29 ? -5.996  8.838   -11.537 1.00 0.00 ? 29 VAL A HB   3  
ATOM 2729  H HG11 . VAL A 1 29 ? -8.022  11.042  -12.125 1.00 0.00 ? 29 VAL A HG11 3  
ATOM 2730  H HG12 . VAL A 1 29 ? -7.586  10.451  -10.499 1.00 0.00 ? 29 VAL A HG12 3  
ATOM 2731  H HG13 . VAL A 1 29 ? -6.372  11.259  -11.509 1.00 0.00 ? 29 VAL A HG13 3  
ATOM 2732  H HG21 . VAL A 1 29 ? -7.682  7.268   -12.394 1.00 0.00 ? 29 VAL A HG21 3  
ATOM 2733  H HG22 . VAL A 1 29 ? -8.332  8.165   -10.994 1.00 0.00 ? 29 VAL A HG22 3  
ATOM 2734  H HG23 . VAL A 1 29 ? -8.831  8.599   -12.641 1.00 0.00 ? 29 VAL A HG23 3  
ATOM 2735  N N    . GLY A 1 30 ? -3.928  9.361   -13.098 1.00 0.00 ? 30 GLY A N    3  
ATOM 2736  C CA   . GLY A 1 30 ? -2.571  9.877   -13.116 1.00 0.00 ? 30 GLY A CA   3  
ATOM 2737  C C    . GLY A 1 30 ? -2.115  10.052  -14.566 1.00 0.00 ? 30 GLY A C    3  
ATOM 2738  O O    . GLY A 1 30 ? -0.955  10.434  -14.777 1.00 0.00 ? 30 GLY A O    3  
ATOM 2739  H H    . GLY A 1 30 ? -4.089  8.451   -12.664 1.00 0.00 ? 30 GLY A H    3  
ATOM 2740  H HA2  . GLY A 1 30 ? -2.537  10.844  -12.614 1.00 0.00 ? 30 GLY A HA2  3  
ATOM 2741  H HA3  . GLY A 1 30 ? -1.905  9.186   -12.597 1.00 0.00 ? 30 GLY A HA3  3  
ATOM 2742  N N    . GLU A 1 31 ? -3.022  9.773   -15.519 1.00 0.00 ? 31 GLU A N    3  
ATOM 2743  C CA   . GLU A 1 31 ? -2.715  9.899   -16.934 1.00 0.00 ? 31 GLU A CA   3  
ATOM 2744  C C    . GLU A 1 31 ? -1.946  11.200  -17.171 1.00 0.00 ? 31 GLU A C    3  
ATOM 2745  O O    . GLU A 1 31 ? -2.059  12.112  -16.339 1.00 0.00 ? 31 GLU A O    3  
ATOM 2746  C CB   . GLU A 1 31 ? -3.981  9.846   -17.791 1.00 0.00 ? 31 GLU A CB   3  
ATOM 2747  C CG   . GLU A 1 31 ? -5.215  10.230  -16.970 1.00 0.00 ? 31 GLU A CG   3  
ATOM 2748  C CD   . GLU A 1 31 ? -6.471  10.247  -17.843 1.00 0.00 ? 31 GLU A CD   3  
ATOM 2749  O OE1  . GLU A 1 31 ? -6.468  9.401   -18.818 1.00 0.00 ? 31 GLU A OE1  3  
ATOM 2750  O OE2  . GLU A 1 31 ? -7.392  11.036  -17.588 1.00 0.00 ? 31 GLU A OE2  3  
ATOM 2751  H H    . GLU A 1 31 ? -3.957  9.463   -15.258 1.00 0.00 ? 31 GLU A H    3  
ATOM 2752  H HA   . GLU A 1 31 ? -2.076  9.056   -17.196 1.00 0.00 ? 31 GLU A HA   3  
ATOM 2753  H HB2  . GLU A 1 31 ? -3.876  10.545  -18.621 1.00 0.00 ? 31 GLU A HB2  3  
ATOM 2754  H HB3  . GLU A 1 31 ? -4.098  8.839   -18.187 1.00 0.00 ? 31 GLU A HB3  3  
ATOM 2755  H HG2  . GLU A 1 31 ? -5.348  9.502   -16.170 1.00 0.00 ? 31 GLU A HG2  3  
ATOM 2756  H HG3  . GLU A 1 31 ? -5.055  11.214  -16.530 1.00 0.00 ? 31 GLU A HG3  3  
ATOM 2757  N N    . ARG A 1 32 ? -1.191  11.260  -18.282 1.00 0.00 ? 32 ARG A N    3  
ATOM 2758  C CA   . ARG A 1 32 ? -0.413  12.439  -18.622 1.00 0.00 ? 32 ARG A CA   3  
ATOM 2759  C C    . ARG A 1 32 ? -0.940  13.035  -19.929 1.00 0.00 ? 32 ARG A C    3  
ATOM 2760  O O    . ARG A 1 32 ? -1.651  12.365  -20.676 1.00 0.00 ? 32 ARG A O    3  
ATOM 2761  C CB   . ARG A 1 32 ? 1.072   12.107  -18.784 1.00 0.00 ? 32 ARG A CB   3  
ATOM 2762  C CG   . ARG A 1 32 ? 1.270   10.625  -19.110 1.00 0.00 ? 32 ARG A CG   3  
ATOM 2763  C CD   . ARG A 1 32 ? 2.651   10.144  -18.659 1.00 0.00 ? 32 ARG A CD   3  
ATOM 2764  N NE   . ARG A 1 32 ? 3.632   11.246  -18.770 1.00 0.00 ? 32 ARG A NE   3  
ATOM 2765  C CZ   . ARG A 1 32 ? 4.942   11.069  -19.047 1.00 0.00 ? 32 ARG A CZ   3  
ATOM 2766  N NH1  . ARG A 1 32 ? 5.403   9.825   -19.235 1.00 0.00 ? 32 ARG A NH1  3  
ATOM 2767  N NH2  . ARG A 1 32 ? 5.768   12.120  -19.131 1.00 0.00 ? 32 ARG A NH2  3  
ATOM 2768  H H    . ARG A 1 32 ? -1.152  10.462  -18.917 1.00 0.00 ? 32 ARG A H    3  
ATOM 2769  H HA   . ARG A 1 32 ? -0.543  13.168  -17.822 1.00 0.00 ? 32 ARG A HA   3  
ATOM 2770  H HB2  . ARG A 1 32 ? 1.483   12.707  -19.596 1.00 0.00 ? 32 ARG A HB2  3  
ATOM 2771  H HB3  . ARG A 1 32 ? 1.594   12.357  -17.860 1.00 0.00 ? 32 ARG A HB3  3  
ATOM 2772  H HG2  . ARG A 1 32 ? 0.506   10.044  -18.594 1.00 0.00 ? 32 ARG A HG2  3  
ATOM 2773  H HG3  . ARG A 1 32 ? 1.160   10.482  -20.185 1.00 0.00 ? 32 ARG A HG3  3  
ATOM 2774  H HD2  . ARG A 1 32 ? 2.599   9.819   -17.620 1.00 0.00 ? 32 ARG A HD2  3  
ATOM 2775  H HD3  . ARG A 1 32 ? 2.963   9.305   -19.279 1.00 0.00 ? 32 ARG A HD3  3  
ATOM 2776  H HE   . ARG A 1 32 ? 3.265   12.186  -18.624 1.00 0.00 ? 32 ARG A HE   3  
ATOM 2777  H HH11 . ARG A 1 32 ? 4.767   9.030   -19.169 1.00 0.00 ? 32 ARG A HH11 3  
ATOM 2778  H HH12 . ARG A 1 32 ? 6.389   9.673   -19.444 1.00 0.00 ? 32 ARG A HH12 3  
ATOM 2779  H HH21 . ARG A 1 32 ? 5.408   13.064  -18.986 1.00 0.00 ? 32 ARG A HH21 3  
ATOM 2780  H HH22 . ARG A 1 32 ? 6.756   11.978  -19.340 1.00 0.00 ? 32 ARG A HH22 3  
ATOM 2781  N N    . MET B 1 1  ? 16.271  -6.719  12.483  1.00 0.00 ? 1  MET B N    3  
ATOM 2782  C CA   . MET B 1 1  ? 15.071  -6.580  13.290  1.00 0.00 ? 1  MET B CA   3  
ATOM 2783  C C    . MET B 1 1  ? 14.800  -5.095  13.540  1.00 0.00 ? 1  MET B C    3  
ATOM 2784  O O    . MET B 1 1  ? 13.637  -4.679  13.423  1.00 0.00 ? 1  MET B O    3  
ATOM 2785  C CB   . MET B 1 1  ? 15.243  -7.299  14.629  1.00 0.00 ? 1  MET B CB   3  
ATOM 2786  C CG   . MET B 1 1  ? 13.928  -7.941  15.078  1.00 0.00 ? 1  MET B CG   3  
ATOM 2787  S SD   . MET B 1 1  ? 13.787  -7.865  16.888  1.00 0.00 ? 1  MET B SD   3  
ATOM 2788  C CE   . MET B 1 1  ? 12.460  -9.077  17.152  1.00 0.00 ? 1  MET B CE   3  
ATOM 2789  H H    . MET B 1 1  ? 16.982  -7.383  12.793  1.00 0.00 ? 1  MET B H    3  
ATOM 2790  H HA   . MET B 1 1  ? 14.228  -7.007  12.748  1.00 0.00 ? 1  MET B HA   3  
ATOM 2791  H HB2  . MET B 1 1  ? 15.998  -8.076  14.518  1.00 0.00 ? 1  MET B HB2  3  
ATOM 2792  H HB3  . MET B 1 1  ? 15.580  -6.580  15.376  1.00 0.00 ? 1  MET B HB3  3  
ATOM 2793  H HG2  . MET B 1 1  ? 13.091  -7.403  14.634  1.00 0.00 ? 1  MET B HG2  3  
ATOM 2794  H HG3  . MET B 1 1  ? 13.901  -8.978  14.747  1.00 0.00 ? 1  MET B HG3  3  
ATOM 2795  H HE1  . MET B 1 1  ? 12.762  -10.050 16.767  1.00 0.00 ? 1  MET B HE1  3  
ATOM 2796  H HE2  . MET B 1 1  ? 12.251  -9.148  18.220  1.00 0.00 ? 1  MET B HE2  3  
ATOM 2797  H HE3  . MET B 1 1  ? 11.555  -8.756  16.635  1.00 0.00 ? 1  MET B HE3  3  
ATOM 2798  N N    . ASP B 1 2  ? 15.860  -4.336  13.872  1.00 0.00 ? 2  ASP B N    3  
ATOM 2799  C CA   . ASP B 1 2  ? 15.736  -2.912  14.134  1.00 0.00 ? 2  ASP B CA   3  
ATOM 2800  C C    . ASP B 1 2  ? 15.045  -2.238  12.948  1.00 0.00 ? 2  ASP B C    3  
ATOM 2801  O O    . ASP B 1 2  ? 14.278  -1.290  13.173  1.00 0.00 ? 2  ASP B O    3  
ATOM 2802  C CB   . ASP B 1 2  ? 17.110  -2.263  14.312  1.00 0.00 ? 2  ASP B CB   3  
ATOM 2803  C CG   . ASP B 1 2  ? 18.170  -3.158  14.960  1.00 0.00 ? 2  ASP B CG   3  
ATOM 2804  O OD1  . ASP B 1 2  ? 18.885  -3.902  14.271  1.00 0.00 ? 2  ASP B OD1  3  
ATOM 2805  O OD2  . ASP B 1 2  ? 18.245  -3.071  16.244  1.00 0.00 ? 2  ASP B OD2  3  
ATOM 2806  H H    . ASP B 1 2  ? 16.785  -4.758  13.946  1.00 0.00 ? 2  ASP B H    3  
ATOM 2807  H HA   . ASP B 1 2  ? 15.129  -2.768  15.028  1.00 0.00 ? 2  ASP B HA   3  
ATOM 2808  H HB2  . ASP B 1 2  ? 17.453  -1.970  13.319  1.00 0.00 ? 2  ASP B HB2  3  
ATOM 2809  H HB3  . ASP B 1 2  ? 16.961  -1.368  14.915  1.00 0.00 ? 2  ASP B HB3  3  
ATOM 2810  N N    . ALA B 1 3  ? 15.324  -2.730  11.728  1.00 0.00 ? 3  ALA B N    3  
ATOM 2811  C CA   . ALA B 1 3  ? 14.733  -2.178  10.521  1.00 0.00 ? 3  ALA B CA   3  
ATOM 2812  C C    . ALA B 1 3  ? 13.421  -2.907  10.221  1.00 0.00 ? 3  ALA B C    3  
ATOM 2813  O O    . ALA B 1 3  ? 12.638  -2.400  9.404   1.00 0.00 ? 3  ALA B O    3  
ATOM 2814  C CB   . ALA B 1 3  ? 15.654  -2.446  9.328   1.00 0.00 ? 3  ALA B CB   3  
ATOM 2815  H H    . ALA B 1 3  ? 15.969  -3.515  11.631  1.00 0.00 ? 3  ALA B H    3  
ATOM 2816  H HA   . ALA B 1 3  ? 14.531  -1.113  10.632  1.00 0.00 ? 3  ALA B HA   3  
ATOM 2817  H HB1  . ALA B 1 3  ? 16.623  -1.983  9.516   1.00 0.00 ? 3  ALA B HB1  3  
ATOM 2818  H HB2  . ALA B 1 3  ? 15.793  -3.520  9.200   1.00 0.00 ? 3  ALA B HB2  3  
ATOM 2819  H HB3  . ALA B 1 3  ? 15.215  -2.034  8.419   1.00 0.00 ? 3  ALA B HB3  3  
ATOM 2820  N N    . ILE B 1 4  ? 13.211  -4.061  10.878  1.00 0.00 ? 4  ILE B N    3  
ATOM 2821  C CA   . ILE B 1 4  ? 12.004  -4.848  10.684  1.00 0.00 ? 4  ILE B CA   3  
ATOM 2822  C C    . ILE B 1 4  ? 10.841  -4.182  11.421  1.00 0.00 ? 4  ILE B C    3  
ATOM 2823  O O    . ILE B 1 4  ? 9.763   -4.047  10.824  1.00 0.00 ? 4  ILE B O    3  
ATOM 2824  C CB   . ILE B 1 4  ? 12.242  -6.302  11.096  1.00 0.00 ? 4  ILE B CB   3  
ATOM 2825  C CG1  . ILE B 1 4  ? 13.330  -6.946  10.234  1.00 0.00 ? 4  ILE B CG1  3  
ATOM 2826  C CG2  . ILE B 1 4  ? 10.937  -7.101  11.063  1.00 0.00 ? 4  ILE B CG2  3  
ATOM 2827  C CD1  . ILE B 1 4  ? 12.897  -8.331  9.748   1.00 0.00 ? 4  ILE B CD1  3  
ATOM 2828  H H    . ILE B 1 4  ? 13.908  -4.408  11.536  1.00 0.00 ? 4  ILE B H    3  
ATOM 2829  H HA   . ILE B 1 4  ? 11.798  -4.839  9.614   1.00 0.00 ? 4  ILE B HA   3  
ATOM 2830  H HB   . ILE B 1 4  ? 12.589  -6.252  12.128  1.00 0.00 ? 4  ILE B HB   3  
ATOM 2831  H HG12 . ILE B 1 4  ? 13.520  -6.309  9.370   1.00 0.00 ? 4  ILE B HG12 3  
ATOM 2832  H HG13 . ILE B 1 4  ? 14.244  -7.027  10.823  1.00 0.00 ? 4  ILE B HG13 3  
ATOM 2833  H HG21 . ILE B 1 4  ? 10.515  -7.083  10.057  1.00 0.00 ? 4  ILE B HG21 3  
ATOM 2834  H HG22 . ILE B 1 4  ? 11.143  -8.130  11.361  1.00 0.00 ? 4  ILE B HG22 3  
ATOM 2835  H HG23 . ILE B 1 4  ? 10.218  -6.668  11.757  1.00 0.00 ? 4  ILE B HG23 3  
ATOM 2836  H HD11 . ILE B 1 4  ? 11.984  -8.250  9.160   1.00 0.00 ? 4  ILE B HD11 3  
ATOM 2837  H HD12 . ILE B 1 4  ? 13.694  -8.758  9.140   1.00 0.00 ? 4  ILE B HD12 3  
ATOM 2838  H HD13 . ILE B 1 4  ? 12.714  -8.983  10.601  1.00 0.00 ? 4  ILE B HD13 3  
ATOM 2839  N N    . LYS B 1 5  ? 11.078  -3.785  12.685  1.00 0.00 ? 5  LYS B N    3  
ATOM 2840  C CA   . LYS B 1 5  ? 10.056  -3.140  13.493  1.00 0.00 ? 5  LYS B CA   3  
ATOM 2841  C C    . LYS B 1 5  ? 9.520   -1.917  12.747  1.00 0.00 ? 5  LYS B C    3  
ATOM 2842  O O    . LYS B 1 5  ? 8.328   -1.611  12.897  1.00 0.00 ? 5  LYS B O    3  
ATOM 2843  C CB   . LYS B 1 5  ? 10.599  -2.822  14.887  1.00 0.00 ? 5  LYS B CB   3  
ATOM 2844  C CG   . LYS B 1 5  ? 12.121  -2.666  14.861  1.00 0.00 ? 5  LYS B CG   3  
ATOM 2845  C CD   . LYS B 1 5  ? 12.590  -1.680  15.933  1.00 0.00 ? 5  LYS B CD   3  
ATOM 2846  C CE   . LYS B 1 5  ? 12.953  -2.410  17.228  1.00 0.00 ? 5  LYS B CE   3  
ATOM 2847  N NZ   . LYS B 1 5  ? 12.721  -1.541  18.393  1.00 0.00 ? 5  LYS B NZ   3  
ATOM 2848  H H    . LYS B 1 5  ? 11.995  -3.934  13.103  1.00 0.00 ? 5  LYS B H    3  
ATOM 2849  H HA   . LYS B 1 5  ? 9.251   -3.865  13.611  1.00 0.00 ? 5  LYS B HA   3  
ATOM 2850  H HB2  . LYS B 1 5  ? 10.153  -1.890  15.237  1.00 0.00 ? 5  LYS B HB2  3  
ATOM 2851  H HB3  . LYS B 1 5  ? 10.320  -3.625  15.568  1.00 0.00 ? 5  LYS B HB3  3  
ATOM 2852  H HG2  . LYS B 1 5  ? 12.579  -3.637  15.048  1.00 0.00 ? 5  LYS B HG2  3  
ATOM 2853  H HG3  . LYS B 1 5  ? 12.423  -2.313  13.875  1.00 0.00 ? 5  LYS B HG3  3  
ATOM 2854  H HD2  . LYS B 1 5  ? 13.468  -1.149  15.567  1.00 0.00 ? 5  LYS B HD2  3  
ATOM 2855  H HD3  . LYS B 1 5  ? 11.795  -0.959  16.124  1.00 0.00 ? 5  LYS B HD3  3  
ATOM 2856  H HE2  . LYS B 1 5  ? 12.335  -3.303  17.322  1.00 0.00 ? 5  LYS B HE2  3  
ATOM 2857  H HE3  . LYS B 1 5  ? 14.002  -2.706  17.190  1.00 0.00 ? 5  LYS B HE3  3  
ATOM 2858  H HZ1  . LYS B 1 5  ? 11.740  -1.263  18.429  1.00 0.00 ? 5  LYS B HZ1  3  
ATOM 2859  H HZ2  . LYS B 1 5  ? 12.969  -2.049  19.242  1.00 0.00 ? 5  LYS B HZ2  3  
ATOM 2860  H HZ3  . LYS B 1 5  ? 13.300  -0.704  18.325  1.00 0.00 ? 5  LYS B HZ3  3  
ATOM 2861  N N    . LYS B 1 6  ? 10.395  -1.251  11.974  1.00 0.00 ? 6  LYS B N    3  
ATOM 2862  C CA   . LYS B 1 6  ? 10.011  -0.073  11.214  1.00 0.00 ? 6  LYS B CA   3  
ATOM 2863  C C    . LYS B 1 6  ? 9.498   -0.503  9.839   1.00 0.00 ? 6  LYS B C    3  
ATOM 2864  O O    . LYS B 1 6  ? 8.690   0.233   9.254   1.00 0.00 ? 6  LYS B O    3  
ATOM 2865  C CB   . LYS B 1 6  ? 11.169  0.926   11.153  1.00 0.00 ? 6  LYS B CB   3  
ATOM 2866  C CG   . LYS B 1 6  ? 12.043  0.830   12.406  1.00 0.00 ? 6  LYS B CG   3  
ATOM 2867  C CD   . LYS B 1 6  ? 12.615  2.198   12.780  1.00 0.00 ? 6  LYS B CD   3  
ATOM 2868  C CE   . LYS B 1 6  ? 13.207  2.899   11.555  1.00 0.00 ? 6  LYS B CE   3  
ATOM 2869  N NZ   . LYS B 1 6  ? 14.674  2.961   11.655  1.00 0.00 ? 6  LYS B NZ   3  
ATOM 2870  H H    . LYS B 1 6  ? 11.362  -1.570  11.906  1.00 0.00 ? 6  LYS B H    3  
ATOM 2871  H HA   . LYS B 1 6  ? 9.198   0.399   11.765  1.00 0.00 ? 6  LYS B HA   3  
ATOM 2872  H HB2  . LYS B 1 6  ? 11.779  0.708   10.278  1.00 0.00 ? 6  LYS B HB2  3  
ATOM 2873  H HB3  . LYS B 1 6  ? 10.762  1.933   11.060  1.00 0.00 ? 6  LYS B HB3  3  
ATOM 2874  H HG2  . LYS B 1 6  ? 11.437  0.460   13.232  1.00 0.00 ? 6  LYS B HG2  3  
ATOM 2875  H HG3  . LYS B 1 6  ? 12.853  0.126   12.217  1.00 0.00 ? 6  LYS B HG3  3  
ATOM 2876  H HD2  . LYS B 1 6  ? 11.818  2.816   13.192  1.00 0.00 ? 6  LYS B HD2  3  
ATOM 2877  H HD3  . LYS B 1 6  ? 13.387  2.063   13.539  1.00 0.00 ? 6  LYS B HD3  3  
ATOM 2878  H HE2  . LYS B 1 6  ? 12.935  2.342   10.658  1.00 0.00 ? 6  LYS B HE2  3  
ATOM 2879  H HE3  . LYS B 1 6  ? 12.796  3.906   11.487  1.00 0.00 ? 6  LYS B HE3  3  
ATOM 2880  H HZ1  . LYS B 1 6  ? 15.059  2.019   11.720  1.00 0.00 ? 6  LYS B HZ1  3  
ATOM 2881  H HZ2  . LYS B 1 6  ? 15.044  3.431   10.829  1.00 0.00 ? 6  LYS B HZ2  3  
ATOM 2882  H HZ3  . LYS B 1 6  ? 14.944  3.487   12.486  1.00 0.00 ? 6  LYS B HZ3  3  
ATOM 2883  N N    . LYS B 1 7  ? 9.968   -1.668  9.357   1.00 0.00 ? 7  LYS B N    3  
ATOM 2884  C CA   . LYS B 1 7  ? 9.558   -2.187  8.063   1.00 0.00 ? 7  LYS B CA   3  
ATOM 2885  C C    . LYS B 1 7  ? 8.034   -2.326  8.033   1.00 0.00 ? 7  LYS B C    3  
ATOM 2886  O O    . LYS B 1 7  ? 7.420   -1.865  7.060   1.00 0.00 ? 7  LYS B O    3  
ATOM 2887  C CB   . LYS B 1 7  ? 10.300  -3.489  7.749   1.00 0.00 ? 7  LYS B CB   3  
ATOM 2888  C CG   . LYS B 1 7  ? 9.930   -4.009  6.359   1.00 0.00 ? 7  LYS B CG   3  
ATOM 2889  C CD   . LYS B 1 7  ? 9.923   -2.874  5.333   1.00 0.00 ? 7  LYS B CD   3  
ATOM 2890  C CE   . LYS B 1 7  ? 9.820   -3.425  3.908   1.00 0.00 ? 7  LYS B CE   3  
ATOM 2891  N NZ   . LYS B 1 7  ? 9.341   -2.382  2.987   1.00 0.00 ? 7  LYS B NZ   3  
ATOM 2892  H H    . LYS B 1 7  ? 10.632  -2.215  9.904   1.00 0.00 ? 7  LYS B H    3  
ATOM 2893  H HA   . LYS B 1 7  ? 9.862   -1.448  7.323   1.00 0.00 ? 7  LYS B HA   3  
ATOM 2894  H HB2  . LYS B 1 7  ? 11.373  -3.301  7.784   1.00 0.00 ? 7  LYS B HB2  3  
ATOM 2895  H HB3  . LYS B 1 7  ? 10.047  -4.231  8.505   1.00 0.00 ? 7  LYS B HB3  3  
ATOM 2896  H HG2  . LYS B 1 7  ? 10.661  -4.758  6.056   1.00 0.00 ? 7  LYS B HG2  3  
ATOM 2897  H HG3  . LYS B 1 7  ? 8.945   -4.473  6.407   1.00 0.00 ? 7  LYS B HG3  3  
ATOM 2898  H HD2  . LYS B 1 7  ? 9.067   -2.228  5.526   1.00 0.00 ? 7  LYS B HD2  3  
ATOM 2899  H HD3  . LYS B 1 7  ? 10.839  -2.294  5.442   1.00 0.00 ? 7  LYS B HD3  3  
ATOM 2900  H HE2  . LYS B 1 7  ? 10.804  -3.762  3.583   1.00 0.00 ? 7  LYS B HE2  3  
ATOM 2901  H HE3  . LYS B 1 7  ? 9.135   -4.272  3.901   1.00 0.00 ? 7  LYS B HE3  3  
ATOM 2902  H HZ1  . LYS B 1 7  ? 9.983   -1.590  2.994   1.00 0.00 ? 7  LYS B HZ1  3  
ATOM 2903  H HZ2  . LYS B 1 7  ? 9.281   -2.773  2.046   1.00 0.00 ? 7  LYS B HZ2  3  
ATOM 2904  H HZ3  . LYS B 1 7  ? 8.415   -2.063  3.273   1.00 0.00 ? 7  LYS B HZ3  3  
ATOM 2905  N N    . MET B 1 8  ? 7.465   -2.949  9.081   1.00 0.00 ? 8  MET B N    3  
ATOM 2906  C CA   . MET B 1 8  ? 6.029   -3.145  9.172   1.00 0.00 ? 8  MET B CA   3  
ATOM 2907  C C    . MET B 1 8  ? 5.343   -1.787  9.338   1.00 0.00 ? 8  MET B C    3  
ATOM 2908  O O    . MET B 1 8  ? 4.153   -1.683  9.005   1.00 0.00 ? 8  MET B O    3  
ATOM 2909  C CB   . MET B 1 8  ? 5.688   -4.038  10.367  1.00 0.00 ? 8  MET B CB   3  
ATOM 2910  C CG   . MET B 1 8  ? 6.354   -3.523  11.644  1.00 0.00 ? 8  MET B CG   3  
ATOM 2911  S SD   . MET B 1 8  ? 5.656   -4.369  13.093  1.00 0.00 ? 8  MET B SD   3  
ATOM 2912  C CE   . MET B 1 8  ? 4.439   -3.130  13.626  1.00 0.00 ? 8  MET B CE   3  
ATOM 2913  H H    . MET B 1 8  ? 8.046   -3.299  9.842   1.00 0.00 ? 8  MET B H    3  
ATOM 2914  H HA   . MET B 1 8  ? 5.676   -3.611  8.253   1.00 0.00 ? 8  MET B HA   3  
ATOM 2915  H HB2  . MET B 1 8  ? 4.607   -4.045  10.508  1.00 0.00 ? 8  MET B HB2  3  
ATOM 2916  H HB3  . MET B 1 8  ? 6.025   -5.053  10.156  1.00 0.00 ? 8  MET B HB3  3  
ATOM 2917  H HG2  . MET B 1 8  ? 7.425   -3.721  11.600  1.00 0.00 ? 8  MET B HG2  3  
ATOM 2918  H HG3  . MET B 1 8  ? 6.194   -2.448  11.728  1.00 0.00 ? 8  MET B HG3  3  
ATOM 2919  H HE1  . MET B 1 8  ? 3.723   -2.944  12.826  1.00 0.00 ? 8  MET B HE1  3  
ATOM 2920  H HE2  . MET B 1 8  ? 3.921   -3.498  14.512  1.00 0.00 ? 8  MET B HE2  3  
ATOM 2921  H HE3  . MET B 1 8  ? 4.944   -2.195  13.873  1.00 0.00 ? 8  MET B HE3  3  
ATOM 2922  N N    . GLN B 1 9  ? 6.093   -0.791  9.842   1.00 0.00 ? 9  GLN B N    3  
ATOM 2923  C CA   . GLN B 1 9  ? 5.560   0.545   10.049  1.00 0.00 ? 9  GLN B CA   3  
ATOM 2924  C C    . GLN B 1 9  ? 5.679   1.343   8.748   1.00 0.00 ? 9  GLN B C    3  
ATOM 2925  O O    . GLN B 1 9  ? 4.930   2.317   8.584   1.00 0.00 ? 9  GLN B O    3  
ATOM 2926  C CB   . GLN B 1 9  ? 6.272   1.261   11.198  1.00 0.00 ? 9  GLN B CB   3  
ATOM 2927  C CG   . GLN B 1 9  ? 5.960   0.592   12.538  1.00 0.00 ? 9  GLN B CG   3  
ATOM 2928  C CD   . GLN B 1 9  ? 6.309   1.516   13.707  1.00 0.00 ? 9  GLN B CD   3  
ATOM 2929  O OE1  . GLN B 1 9  ? 5.523   2.348   14.130  1.00 0.00 ? 9  GLN B OE1  3  
ATOM 2930  N NE2  . GLN B 1 9  ? 7.528   1.325   14.203  1.00 0.00 ? 9  GLN B NE2  3  
ATOM 2931  H H    . GLN B 1 9  ? 7.067   -0.963  10.091  1.00 0.00 ? 9  GLN B H    3  
ATOM 2932  H HA   . GLN B 1 9  ? 4.507   0.431   10.301  1.00 0.00 ? 9  GLN B HA   3  
ATOM 2933  H HB2  . GLN B 1 9  ? 7.348   1.227   11.026  1.00 0.00 ? 9  GLN B HB2  3  
ATOM 2934  H HB3  . GLN B 1 9  ? 5.949   2.303   11.219  1.00 0.00 ? 9  GLN B HB3  3  
ATOM 2935  H HG2  . GLN B 1 9  ? 4.897   0.356   12.577  1.00 0.00 ? 9  GLN B HG2  3  
ATOM 2936  H HG3  . GLN B 1 9  ? 6.532   -0.332  12.612  1.00 0.00 ? 9  GLN B HG3  3  
ATOM 2937  H HE21 . GLN B 1 9  ? 8.136   0.612   13.800  1.00 0.00 ? 9  GLN B HE21 3  
ATOM 2938  H HE22 . GLN B 1 9  ? 7.856   1.892   14.984  1.00 0.00 ? 9  GLN B HE22 3  
ATOM 2939  N N    . MET B 1 10 ? 6.602   0.923   7.865   1.00 0.00 ? 10 MET B N    3  
ATOM 2940  C CA   . MET B 1 10 ? 6.812   1.593   6.594   1.00 0.00 ? 10 MET B CA   3  
ATOM 2941  C C    . MET B 1 10 ? 5.744   1.138   5.597   1.00 0.00 ? 10 MET B C    3  
ATOM 2942  O O    . MET B 1 10 ? 5.294   1.968   4.795   1.00 0.00 ? 10 MET B O    3  
ATOM 2943  C CB   . MET B 1 10 ? 8.201   1.263   6.041   1.00 0.00 ? 10 MET B CB   3  
ATOM 2944  C CG   . MET B 1 10 ? 9.291   1.602   7.059   1.00 0.00 ? 10 MET B CG   3  
ATOM 2945  S SD   . MET B 1 10 ? 10.484  2.761   6.328   1.00 0.00 ? 10 MET B SD   3  
ATOM 2946  C CE   . MET B 1 10 ? 12.039  1.910   6.730   1.00 0.00 ? 10 MET B CE   3  
ATOM 2947  H H    . MET B 1 10 ? 7.179   0.109   8.079   1.00 0.00 ? 10 MET B H    3  
ATOM 2948  H HA   . MET B 1 10 ? 6.723   2.670   6.742   1.00 0.00 ? 10 MET B HA   3  
ATOM 2949  H HB2  . MET B 1 10 ? 8.246   0.198   5.813   1.00 0.00 ? 10 MET B HB2  3  
ATOM 2950  H HB3  . MET B 1 10 ? 8.359   1.829   5.123   1.00 0.00 ? 10 MET B HB3  3  
ATOM 2951  H HG2  . MET B 1 10 ? 8.838   2.065   7.935   1.00 0.00 ? 10 MET B HG2  3  
ATOM 2952  H HG3  . MET B 1 10 ? 9.799   0.688   7.363   1.00 0.00 ? 10 MET B HG3  3  
ATOM 2953  H HE1  . MET B 1 10 ? 12.045  0.917   6.282   1.00 0.00 ? 10 MET B HE1  3  
ATOM 2954  H HE2  . MET B 1 10 ? 12.874  2.496   6.348   1.00 0.00 ? 10 MET B HE2  3  
ATOM 2955  H HE3  . MET B 1 10 ? 12.139  1.811   7.811   1.00 0.00 ? 10 MET B HE3  3  
ATOM 2956  N N    . LEU B 1 11 ? 5.366   -0.151  5.669   1.00 0.00 ? 11 LEU B N    3  
ATOM 2957  C CA   . LEU B 1 11 ? 4.360   -0.708  4.780   1.00 0.00 ? 11 LEU B CA   3  
ATOM 2958  C C    . LEU B 1 11 ? 2.971   -0.276  5.253   1.00 0.00 ? 11 LEU B C    3  
ATOM 2959  O O    . LEU B 1 11 ? 2.062   -0.190  4.414   1.00 0.00 ? 11 LEU B O    3  
ATOM 2960  C CB   . LEU B 1 11 ? 4.527   -2.225  4.666   1.00 0.00 ? 11 LEU B CB   3  
ATOM 2961  C CG   . LEU B 1 11 ? 5.876   -2.714  4.135   1.00 0.00 ? 11 LEU B CG   3  
ATOM 2962  C CD1  . LEU B 1 11 ? 6.022   -4.226  4.317   1.00 0.00 ? 11 LEU B CD1  3  
ATOM 2963  C CD2  . LEU B 1 11 ? 6.078   -2.290  2.678   1.00 0.00 ? 11 LEU B CD2  3  
ATOM 2964  H H    . LEU B 1 11 ? 5.788   -0.769  6.362   1.00 0.00 ? 11 LEU B H    3  
ATOM 2965  H HA   . LEU B 1 11 ? 4.548   -0.282  3.794   1.00 0.00 ? 11 LEU B HA   3  
ATOM 2966  H HB2  . LEU B 1 11 ? 4.373   -2.627  5.667   1.00 0.00 ? 11 LEU B HB2  3  
ATOM 2967  H HB3  . LEU B 1 11 ? 3.723   -2.573  4.016   1.00 0.00 ? 11 LEU B HB3  3  
ATOM 2968  H HG   . LEU B 1 11 ? 6.622   -2.218  4.756   1.00 0.00 ? 11 LEU B HG   3  
ATOM 2969  H HD11 . LEU B 1 11 ? 5.224   -4.743  3.785   1.00 0.00 ? 11 LEU B HD11 3  
ATOM 2970  H HD12 . LEU B 1 11 ? 6.992   -4.539  3.930   1.00 0.00 ? 11 LEU B HD12 3  
ATOM 2971  H HD13 . LEU B 1 11 ? 5.964   -4.479  5.376   1.00 0.00 ? 11 LEU B HD13 3  
ATOM 2972  H HD21 . LEU B 1 11 ? 6.040   -1.204  2.599   1.00 0.00 ? 11 LEU B HD21 3  
ATOM 2973  H HD22 . LEU B 1 11 ? 7.046   -2.655  2.334   1.00 0.00 ? 11 LEU B HD22 3  
ATOM 2974  H HD23 . LEU B 1 11 ? 5.295   -2.720  2.055   1.00 0.00 ? 11 LEU B HD23 3  
ATOM 2975  N N    . LYS B 1 12 ? 2.836   -0.018  6.566   1.00 0.00 ? 12 LYS B N    3  
ATOM 2976  C CA   . LYS B 1 12 ? 1.570   0.401   7.142   1.00 0.00 ? 12 LYS B CA   3  
ATOM 2977  C C    . LYS B 1 12 ? 1.341   1.883   6.839   1.00 0.00 ? 12 LYS B C    3  
ATOM 2978  O O    . LYS B 1 12 ? 0.196   2.256   6.543   1.00 0.00 ? 12 LYS B O    3  
ATOM 2979  C CB   . LYS B 1 12 ? 1.522   0.064   8.634   1.00 0.00 ? 12 LYS B CB   3  
ATOM 2980  C CG   . LYS B 1 12 ? 0.092   -0.253  9.078   1.00 0.00 ? 12 LYS B CG   3  
ATOM 2981  C CD   . LYS B 1 12 ? -0.288  -1.691  8.721   1.00 0.00 ? 12 LYS B CD   3  
ATOM 2982  C CE   . LYS B 1 12 ? -0.748  -2.461  9.961   1.00 0.00 ? 12 LYS B CE   3  
ATOM 2983  N NZ   . LYS B 1 12 ? 0.306   -2.458  10.989  1.00 0.00 ? 12 LYS B NZ   3  
ATOM 2984  H H    . LYS B 1 12 ? 3.637   -0.114  7.190   1.00 0.00 ? 12 LYS B H    3  
ATOM 2985  H HA   . LYS B 1 12 ? 0.796   -0.185  6.647   1.00 0.00 ? 12 LYS B HA   3  
ATOM 2986  H HB2  . LYS B 1 12 ? 2.152   -0.806  8.820   1.00 0.00 ? 12 LYS B HB2  3  
ATOM 2987  H HB3  . LYS B 1 12 ? 1.909   0.910   9.200   1.00 0.00 ? 12 LYS B HB3  3  
ATOM 2988  H HG2  . LYS B 1 12 ? 0.021   -0.125  10.159  1.00 0.00 ? 12 LYS B HG2  3  
ATOM 2989  H HG3  . LYS B 1 12 ? -0.591  0.444   8.593   1.00 0.00 ? 12 LYS B HG3  3  
ATOM 2990  H HD2  . LYS B 1 12 ? -1.099  -1.672  7.994   1.00 0.00 ? 12 LYS B HD2  3  
ATOM 2991  H HD3  . LYS B 1 12 ? 0.575   -2.184  8.275   1.00 0.00 ? 12 LYS B HD3  3  
ATOM 2992  H HE2  . LYS B 1 12 ? -1.641  -1.986  10.367  1.00 0.00 ? 12 LYS B HE2  3  
ATOM 2993  H HE3  . LYS B 1 12 ? -0.988  -3.485  9.677   1.00 0.00 ? 12 LYS B HE3  3  
ATOM 2994  H HZ1  . LYS B 1 12 ? 0.531   -1.499  11.254  1.00 0.00 ? 12 LYS B HZ1  3  
ATOM 2995  H HZ2  . LYS B 1 12 ? -0.024  -2.976  11.803  1.00 0.00 ? 12 LYS B HZ2  3  
ATOM 2996  H HZ3  . LYS B 1 12 ? 1.146   -2.909  10.627  1.00 0.00 ? 12 LYS B HZ3  3  
ATOM 2997  N N    . LEU B 1 13 ? 2.418   2.686   6.918   1.00 0.00 ? 13 LEU B N    3  
ATOM 2998  C CA   . LEU B 1 13 ? 2.335   4.113   6.654   1.00 0.00 ? 13 LEU B CA   3  
ATOM 2999  C C    . LEU B 1 13 ? 1.970   4.335   5.185   1.00 0.00 ? 13 LEU B C    3  
ATOM 3000  O O    . LEU B 1 13 ? 1.144   5.217   4.909   1.00 0.00 ? 13 LEU B O    3  
ATOM 3001  C CB   . LEU B 1 13 ? 3.626   4.813   7.080   1.00 0.00 ? 13 LEU B CB   3  
ATOM 3002  C CG   . LEU B 1 13 ? 3.619   6.340   7.002   1.00 0.00 ? 13 LEU B CG   3  
ATOM 3003  C CD1  . LEU B 1 13 ? 4.090   6.823   5.629   1.00 0.00 ? 13 LEU B CD1  3  
ATOM 3004  C CD2  . LEU B 1 13 ? 2.242   6.901   7.365   1.00 0.00 ? 13 LEU B CD2  3  
ATOM 3005  H H    . LEU B 1 13 ? 3.326   2.298   7.169   1.00 0.00 ? 13 LEU B H    3  
ATOM 3006  H HA   . LEU B 1 13 ? 1.529   4.497   7.281   1.00 0.00 ? 13 LEU B HA   3  
ATOM 3007  H HB2  . LEU B 1 13 ? 3.815   4.510   8.110   1.00 0.00 ? 13 LEU B HB2  3  
ATOM 3008  H HB3  . LEU B 1 13 ? 4.415   4.412   6.443   1.00 0.00 ? 13 LEU B HB3  3  
ATOM 3009  H HG   . LEU B 1 13 ? 4.343   6.667   7.750   1.00 0.00 ? 13 LEU B HG   3  
ATOM 3010  H HD11 . LEU B 1 13 ? 3.437   6.426   4.852   1.00 0.00 ? 13 LEU B HD11 3  
ATOM 3011  H HD12 . LEU B 1 13 ? 4.072   7.912   5.610   1.00 0.00 ? 13 LEU B HD12 3  
ATOM 3012  H HD13 . LEU B 1 13 ? 5.109   6.481   5.445   1.00 0.00 ? 13 LEU B HD13 3  
ATOM 3013  H HD21 . LEU B 1 13 ? 1.972   6.597   8.376   1.00 0.00 ? 13 LEU B HD21 3  
ATOM 3014  H HD22 . LEU B 1 13 ? 2.274   7.989   7.300   1.00 0.00 ? 13 LEU B HD22 3  
ATOM 3015  H HD23 . LEU B 1 13 ? 1.493   6.525   6.669   1.00 0.00 ? 13 LEU B HD23 3  
ATOM 3016  N N    . ASP B 1 14 ? 2.585   3.544   4.286   1.00 0.00 ? 14 ASP B N    3  
ATOM 3017  C CA   . ASP B 1 14 ? 2.326   3.654   2.860   1.00 0.00 ? 14 ASP B CA   3  
ATOM 3018  C C    . ASP B 1 14 ? 0.893   3.208   2.569   1.00 0.00 ? 14 ASP B C    3  
ATOM 3019  O O    . ASP B 1 14 ? 0.289   3.739   1.626   1.00 0.00 ? 14 ASP B O    3  
ATOM 3020  C CB   . ASP B 1 14 ? 3.273   2.759   2.058   1.00 0.00 ? 14 ASP B CB   3  
ATOM 3021  C CG   . ASP B 1 14 ? 3.792   3.369   0.755   1.00 0.00 ? 14 ASP B CG   3  
ATOM 3022  O OD1  . ASP B 1 14 ? 4.784   4.111   0.749   1.00 0.00 ? 14 ASP B OD1  3  
ATOM 3023  O OD2  . ASP B 1 14 ? 3.123   3.050   -0.301  1.00 0.00 ? 14 ASP B OD2  3  
ATOM 3024  H H    . ASP B 1 14 ? 3.254   2.841   4.599   1.00 0.00 ? 14 ASP B H    3  
ATOM 3025  H HA   . ASP B 1 14 ? 2.442   4.696   2.558   1.00 0.00 ? 14 ASP B HA   3  
ATOM 3026  H HB2  . ASP B 1 14 ? 4.119   2.532   2.706   1.00 0.00 ? 14 ASP B HB2  3  
ATOM 3027  H HB3  . ASP B 1 14 ? 2.730   1.837   1.848   1.00 0.00 ? 14 ASP B HB3  3  
ATOM 3028  N N    . ASN B 1 15 ? 0.384   2.256   3.372   1.00 0.00 ? 15 ASN B N    3  
ATOM 3029  C CA   . ASN B 1 15 ? -0.965  1.745   3.203   1.00 0.00 ? 15 ASN B CA   3  
ATOM 3030  C C    . ASN B 1 15 ? -1.966  2.888   3.386   1.00 0.00 ? 15 ASN B C    3  
ATOM 3031  O O    . ASN B 1 15 ? -2.848  3.043   2.528   1.00 0.00 ? 15 ASN B O    3  
ATOM 3032  C CB   . ASN B 1 15 ? -1.281  0.668   4.241   1.00 0.00 ? 15 ASN B CB   3  
ATOM 3033  C CG   . ASN B 1 15 ? -2.143  -0.443  3.636   1.00 0.00 ? 15 ASN B CG   3  
ATOM 3034  O OD1  . ASN B 1 15 ? -3.361  -0.388  3.636   1.00 0.00 ? 15 ASN B OD1  3  
ATOM 3035  N ND2  . ASN B 1 15 ? -1.443  -1.450  3.123   1.00 0.00 ? 15 ASN B ND2  3  
ATOM 3036  H H    . ASN B 1 15 ? 0.950   1.870   4.128   1.00 0.00 ? 15 ASN B H    3  
ATOM 3037  H HA   . ASN B 1 15 ? -1.067  1.343   2.194   1.00 0.00 ? 15 ASN B HA   3  
ATOM 3038  H HB2  . ASN B 1 15 ? -0.347  0.236   4.601   1.00 0.00 ? 15 ASN B HB2  3  
ATOM 3039  H HB3  . ASN B 1 15 ? -1.805  1.128   5.080   1.00 0.00 ? 15 ASN B HB3  3  
ATOM 3040  H HD21 . ASN B 1 15 ? -0.424  -1.433  3.157   1.00 0.00 ? 15 ASN B HD21 3  
ATOM 3041  H HD22 . ASN B 1 15 ? -1.925  -2.241  2.696   1.00 0.00 ? 15 ASN B HD22 3  
ATOM 3042  N N    . TYR B 1 16 ? -1.812  3.652   4.482   1.00 0.00 ? 16 TYR B N    3  
ATOM 3043  C CA   . TYR B 1 16 ? -2.733  4.751   4.717   1.00 0.00 ? 16 TYR B CA   3  
ATOM 3044  C C    . TYR B 1 16 ? -2.720  5.689   3.508   1.00 0.00 ? 16 TYR B C    3  
ATOM 3045  O O    . TYR B 1 16 ? -3.805  6.127   3.100   1.00 0.00 ? 16 TYR B O    3  
ATOM 3046  C CB   . TYR B 1 16 ? -2.359  5.486   6.018   1.00 0.00 ? 16 TYR B CB   3  
ATOM 3047  C CG   . TYR B 1 16 ? -1.815  4.585   7.117   1.00 0.00 ? 16 TYR B CG   3  
ATOM 3048  C CD1  . TYR B 1 16 ? -2.400  3.319   7.348   1.00 0.00 ? 16 TYR B CD1  3  
ATOM 3049  C CD2  . TYR B 1 16 ? -0.722  5.004   7.911   1.00 0.00 ? 16 TYR B CD2  3  
ATOM 3050  C CE1  . TYR B 1 16 ? -1.898  2.479   8.366   1.00 0.00 ? 16 TYR B CE1  3  
ATOM 3051  C CE2  . TYR B 1 16 ? -0.219  4.164   8.927   1.00 0.00 ? 16 TYR B CE2  3  
ATOM 3052  C CZ   . TYR B 1 16 ? -0.808  2.900   9.156   1.00 0.00 ? 16 TYR B CZ   3  
ATOM 3053  O OH   . TYR B 1 16 ? -0.325  2.085   10.140  1.00 0.00 ? 16 TYR B OH   3  
ATOM 3054  H H    . TYR B 1 16 ? -1.071  3.470   5.144   1.00 0.00 ? 16 TYR B H    3  
ATOM 3055  H HA   . TYR B 1 16 ? -3.739  4.338   4.815   1.00 0.00 ? 16 TYR B HA   3  
ATOM 3056  H HB2  . TYR B 1 16 ? -1.628  6.264   5.789   1.00 0.00 ? 16 TYR B HB2  3  
ATOM 3057  H HB3  . TYR B 1 16 ? -3.248  5.987   6.407   1.00 0.00 ? 16 TYR B HB3  3  
ATOM 3058  H HD1  . TYR B 1 16 ? -3.235  2.989   6.746   1.00 0.00 ? 16 TYR B HD1  3  
ATOM 3059  H HD2  . TYR B 1 16 ? -0.264  5.968   7.742   1.00 0.00 ? 16 TYR B HD2  3  
ATOM 3060  H HE1  . TYR B 1 16 ? -2.352  1.512   8.535   1.00 0.00 ? 16 TYR B HE1  3  
ATOM 3061  H HE2  . TYR B 1 16 ? 0.617   4.492   9.528   1.00 0.00 ? 16 TYR B HE2  3  
ATOM 3062  H HH   . TYR B 1 16 ? -0.990  1.823   10.781  1.00 0.00 ? 16 TYR B HH   3  
ATOM 3063  N N    . HIS B 1 17 ? -1.519  5.982   2.977   1.00 0.00 ? 17 HIS B N    3  
ATOM 3064  C CA   . HIS B 1 17 ? -1.379  6.869   1.834   1.00 0.00 ? 17 HIS B CA   3  
ATOM 3065  C C    . HIS B 1 17 ? -2.003  6.209   0.602   1.00 0.00 ? 17 HIS B C    3  
ATOM 3066  O O    . HIS B 1 17 ? -2.711  6.902   -0.142  1.00 0.00 ? 17 HIS B O    3  
ATOM 3067  C CB   . HIS B 1 17 ? 0.085   7.258   1.620   1.00 0.00 ? 17 HIS B CB   3  
ATOM 3068  C CG   . HIS B 1 17 ? 0.548   7.142   0.187   1.00 0.00 ? 17 HIS B CG   3  
ATOM 3069  N ND1  . HIS B 1 17 ? 0.519   8.205   -0.698  1.00 0.00 ? 17 HIS B ND1  3  
ATOM 3070  C CD2  . HIS B 1 17 ? 1.052   6.079   -0.504  1.00 0.00 ? 17 HIS B CD2  3  
ATOM 3071  C CE1  . HIS B 1 17 ? 0.986   7.789   -1.867  1.00 0.00 ? 17 HIS B CE1  3  
ATOM 3072  N NE2  . HIS B 1 17 ? 1.315   6.472   -1.744  1.00 0.00 ? 17 HIS B NE2  3  
ATOM 3073  H H    . HIS B 1 17 ? -0.673  5.576   3.375   1.00 0.00 ? 17 HIS B H    3  
ATOM 3074  H HA   . HIS B 1 17 ? -1.937  7.773   2.074   1.00 0.00 ? 17 HIS B HA   3  
ATOM 3075  H HB2  . HIS B 1 17 ? 0.198   8.291   1.947   1.00 0.00 ? 17 HIS B HB2  3  
ATOM 3076  H HB3  . HIS B 1 17 ? 0.689   6.615   2.259   1.00 0.00 ? 17 HIS B HB3  3  
ATOM 3077  H HD1  . HIS B 1 17 ? 0.216   9.173   -0.586  1.00 0.00 ? 17 HIS B HD1  3  
ATOM 3078  H HD2  . HIS B 1 17 ? 1.248   5.060   -0.206  1.00 0.00 ? 17 HIS B HD2  3  
ATOM 3079  H HE1  . HIS B 1 17 ? 1.045   8.474   -2.699  1.00 0.00 ? 17 HIS B HE1  3  
ATOM 3080  N N    . LEU B 1 18 ? -1.734  4.905   0.416   1.00 0.00 ? 18 LEU B N    3  
ATOM 3081  C CA   . LEU B 1 18 ? -2.266  4.161   -0.714  1.00 0.00 ? 18 LEU B CA   3  
ATOM 3082  C C    . LEU B 1 18 ? -3.792  4.119   -0.618  1.00 0.00 ? 18 LEU B C    3  
ATOM 3083  O O    . LEU B 1 18 ? -4.451  4.194   -1.667  1.00 0.00 ? 18 LEU B O    3  
ATOM 3084  C CB   . LEU B 1 18 ? -1.617  2.779   -0.800  1.00 0.00 ? 18 LEU B CB   3  
ATOM 3085  C CG   . LEU B 1 18 ? -0.148  2.752   -1.231  1.00 0.00 ? 18 LEU B CG   3  
ATOM 3086  C CD1  . LEU B 1 18 ? 0.443   1.350   -1.075  1.00 0.00 ? 18 LEU B CD1  3  
ATOM 3087  C CD2  . LEU B 1 18 ? 0.015   3.288   -2.654  1.00 0.00 ? 18 LEU B CD2  3  
ATOM 3088  H H    . LEU B 1 18 ? -1.140  4.406   1.079   1.00 0.00 ? 18 LEU B H    3  
ATOM 3089  H HA   . LEU B 1 18 ? -1.981  4.715   -1.609  1.00 0.00 ? 18 LEU B HA   3  
ATOM 3090  H HB2  . LEU B 1 18 ? -1.704  2.336   0.192   1.00 0.00 ? 18 LEU B HB2  3  
ATOM 3091  H HB3  . LEU B 1 18 ? -2.220  2.201   -1.500  1.00 0.00 ? 18 LEU B HB3  3  
ATOM 3092  H HG   . LEU B 1 18 ? 0.363   3.422   -0.538  1.00 0.00 ? 18 LEU B HG   3  
ATOM 3093  H HD11 . LEU B 1 18 ? -0.116  0.641   -1.684  1.00 0.00 ? 18 LEU B HD11 3  
ATOM 3094  H HD12 . LEU B 1 18 ? 1.487   1.368   -1.390  1.00 0.00 ? 18 LEU B HD12 3  
ATOM 3095  H HD13 . LEU B 1 18 ? 0.393   1.039   -0.031  1.00 0.00 ? 18 LEU B HD13 3  
ATOM 3096  H HD21 . LEU B 1 18 ? -0.350  4.314   -2.709  1.00 0.00 ? 18 LEU B HD21 3  
ATOM 3097  H HD22 . LEU B 1 18 ? 1.070   3.256   -2.927  1.00 0.00 ? 18 LEU B HD22 3  
ATOM 3098  H HD23 . LEU B 1 18 ? -0.551  2.671   -3.351  1.00 0.00 ? 18 LEU B HD23 3  
ATOM 3099  N N    . GLU B 1 19 ? -4.315  4.003   0.615   1.00 0.00 ? 19 GLU B N    3  
ATOM 3100  C CA   . GLU B 1 19 ? -5.749  3.953   0.842   1.00 0.00 ? 19 GLU B CA   3  
ATOM 3101  C C    . GLU B 1 19 ? -6.364  5.313   0.507   1.00 0.00 ? 19 GLU B C    3  
ATOM 3102  O O    . GLU B 1 19 ? -7.296  5.355   -0.309  1.00 0.00 ? 19 GLU B O    3  
ATOM 3103  C CB   . GLU B 1 19 ? -6.077  3.542   2.278   1.00 0.00 ? 19 GLU B CB   3  
ATOM 3104  C CG   . GLU B 1 19 ? -7.388  2.754   2.339   1.00 0.00 ? 19 GLU B CG   3  
ATOM 3105  C CD   . GLU B 1 19 ? -8.326  3.330   3.402   1.00 0.00 ? 19 GLU B CD   3  
ATOM 3106  O OE1  . GLU B 1 19 ? -8.137  2.882   4.596   1.00 0.00 ? 19 GLU B OE1  3  
ATOM 3107  O OE2  . GLU B 1 19 ? -9.186  4.164   3.083   1.00 0.00 ? 19 GLU B OE2  3  
ATOM 3108  H H    . GLU B 1 19 ? -3.700  3.948   1.426   1.00 0.00 ? 19 GLU B H    3  
ATOM 3109  H HA   . GLU B 1 19 ? -6.152  3.204   0.159   1.00 0.00 ? 19 GLU B HA   3  
ATOM 3110  H HB2  . GLU B 1 19 ? -5.270  2.916   2.661   1.00 0.00 ? 19 GLU B HB2  3  
ATOM 3111  H HB3  . GLU B 1 19 ? -6.154  4.438   2.894   1.00 0.00 ? 19 GLU B HB3  3  
ATOM 3112  H HG2  . GLU B 1 19 ? -7.878  2.808   1.366   1.00 0.00 ? 19 GLU B HG2  3  
ATOM 3113  H HG3  . GLU B 1 19 ? -7.164  1.712   2.566   1.00 0.00 ? 19 GLU B HG3  3  
ATOM 3114  N N    . ASN B 1 20 ? -5.837  6.381   1.132   1.00 0.00 ? 20 ASN B N    3  
ATOM 3115  C CA   . ASN B 1 20 ? -6.329  7.729   0.902   1.00 0.00 ? 20 ASN B CA   3  
ATOM 3116  C C    . ASN B 1 20 ? -6.203  8.066   -0.585  1.00 0.00 ? 20 ASN B C    3  
ATOM 3117  O O    . ASN B 1 20 ? -7.049  8.816   -1.094  1.00 0.00 ? 20 ASN B O    3  
ATOM 3118  C CB   . ASN B 1 20 ? -5.514  8.756   1.691   1.00 0.00 ? 20 ASN B CB   3  
ATOM 3119  C CG   . ASN B 1 20 ? -5.320  8.305   3.140   1.00 0.00 ? 20 ASN B CG   3  
ATOM 3120  O OD1  . ASN B 1 20 ? -6.124  7.583   3.706   1.00 0.00 ? 20 ASN B OD1  3  
ATOM 3121  N ND2  . ASN B 1 20 ? -4.211  8.771   3.707   1.00 0.00 ? 20 ASN B ND2  3  
ATOM 3122  H H    . ASN B 1 20 ? -5.068  6.259   1.792   1.00 0.00 ? 20 ASN B H    3  
ATOM 3123  H HA   . ASN B 1 20 ? -7.380  7.776   1.189   1.00 0.00 ? 20 ASN B HA   3  
ATOM 3124  H HB2  . ASN B 1 20 ? -4.537  8.868   1.220   1.00 0.00 ? 20 ASN B HB2  3  
ATOM 3125  H HB3  . ASN B 1 20 ? -6.033  9.714   1.666   1.00 0.00 ? 20 ASN B HB3  3  
ATOM 3126  H HD21 . ASN B 1 20 ? -3.580  9.371   3.175   1.00 0.00 ? 20 ASN B HD21 3  
ATOM 3127  H HD22 . ASN B 1 20 ? -3.990  8.527   4.672   1.00 0.00 ? 20 ASN B HD22 3  
ATOM 3128  N N    . GLU B 1 21 ? -5.167  7.515   -1.242  1.00 0.00 ? 21 GLU B N    3  
ATOM 3129  C CA   . GLU B 1 21 ? -4.936  7.756   -2.656  1.00 0.00 ? 21 GLU B CA   3  
ATOM 3130  C C    . GLU B 1 21 ? -5.883  6.882   -3.480  1.00 0.00 ? 21 GLU B C    3  
ATOM 3131  O O    . GLU B 1 21 ? -6.291  7.315   -4.567  1.00 0.00 ? 21 GLU B O    3  
ATOM 3132  C CB   . GLU B 1 21 ? -3.478  7.496   -3.039  1.00 0.00 ? 21 GLU B CB   3  
ATOM 3133  C CG   . GLU B 1 21 ? -3.124  8.192   -4.354  1.00 0.00 ? 21 GLU B CG   3  
ATOM 3134  C CD   . GLU B 1 21 ? -1.806  7.659   -4.920  1.00 0.00 ? 21 GLU B CD   3  
ATOM 3135  O OE1  . GLU B 1 21 ? -1.184  6.824   -4.158  1.00 0.00 ? 21 GLU B OE1  3  
ATOM 3136  O OE2  . GLU B 1 21 ? -1.412  8.035   -6.034  1.00 0.00 ? 21 GLU B OE2  3  
ATOM 3137  H H    . GLU B 1 21 ? -4.515  6.907   -0.746  1.00 0.00 ? 21 GLU B H    3  
ATOM 3138  H HA   . GLU B 1 21 ? -5.169  8.804   -2.841  1.00 0.00 ? 21 GLU B HA   3  
ATOM 3139  H HB2  . GLU B 1 21 ? -2.831  7.879   -2.250  1.00 0.00 ? 21 GLU B HB2  3  
ATOM 3140  H HB3  . GLU B 1 21 ? -3.324  6.421   -3.134  1.00 0.00 ? 21 GLU B HB3  3  
ATOM 3141  H HG2  . GLU B 1 21 ? -3.920  8.009   -5.077  1.00 0.00 ? 21 GLU B HG2  3  
ATOM 3142  H HG3  . GLU B 1 21 ? -3.045  9.264   -4.177  1.00 0.00 ? 21 GLU B HG3  3  
ATOM 3143  N N    . VAL B 1 22 ? -6.211  5.687   -2.955  1.00 0.00 ? 22 VAL B N    3  
ATOM 3144  C CA   . VAL B 1 22 ? -7.101  4.764   -3.636  1.00 0.00 ? 22 VAL B CA   3  
ATOM 3145  C C    . VAL B 1 22 ? -8.548  5.226   -3.451  1.00 0.00 ? 22 VAL B C    3  
ATOM 3146  O O    . VAL B 1 22 ? -9.332  5.107   -4.403  1.00 0.00 ? 22 VAL B O    3  
ATOM 3147  C CB   . VAL B 1 22 ? -6.860  3.338   -3.135  1.00 0.00 ? 22 VAL B CB   3  
ATOM 3148  C CG1  . VAL B 1 22 ? -8.146  2.511   -3.198  1.00 0.00 ? 22 VAL B CG1  3  
ATOM 3149  C CG2  . VAL B 1 22 ? -5.734  2.663   -3.922  1.00 0.00 ? 22 VAL B CG2  3  
ATOM 3150  H H    . VAL B 1 22 ? -5.830  5.406   -2.051  1.00 0.00 ? 22 VAL B H    3  
ATOM 3151  H HA   . VAL B 1 22 ? -6.852  4.794   -4.697  1.00 0.00 ? 22 VAL B HA   3  
ATOM 3152  H HB   . VAL B 1 22 ? -6.554  3.439   -2.094  1.00 0.00 ? 22 VAL B HB   3  
ATOM 3153  H HG11 . VAL B 1 22 ? -8.510  2.467   -4.225  1.00 0.00 ? 22 VAL B HG11 3  
ATOM 3154  H HG12 . VAL B 1 22 ? -7.938  1.504   -2.836  1.00 0.00 ? 22 VAL B HG12 3  
ATOM 3155  H HG13 . VAL B 1 22 ? -8.911  2.964   -2.568  1.00 0.00 ? 22 VAL B HG13 3  
ATOM 3156  H HG21 . VAL B 1 22 ? -4.813  3.236   -3.816  1.00 0.00 ? 22 VAL B HG21 3  
ATOM 3157  H HG22 . VAL B 1 22 ? -5.591  1.653   -3.539  1.00 0.00 ? 22 VAL B HG22 3  
ATOM 3158  H HG23 . VAL B 1 22 ? -5.999  2.609   -4.977  1.00 0.00 ? 22 VAL B HG23 3  
ATOM 3159  N N    . ALA B 1 23 ? -8.867  5.737   -2.248  1.00 0.00 ? 23 ALA B N    3  
ATOM 3160  C CA   . ALA B 1 23 ? -10.206 6.212   -1.944  1.00 0.00 ? 23 ALA B CA   3  
ATOM 3161  C C    . ALA B 1 23 ? -10.490 7.478   -2.755  1.00 0.00 ? 23 ALA B C    3  
ATOM 3162  O O    . ALA B 1 23 ? -11.671 7.805   -2.944  1.00 0.00 ? 23 ALA B O    3  
ATOM 3163  C CB   . ALA B 1 23 ? -10.286 6.619   -0.471  1.00 0.00 ? 23 ALA B CB   3  
ATOM 3164  H H    . ALA B 1 23 ? -8.159  5.800   -1.517  1.00 0.00 ? 23 ALA B H    3  
ATOM 3165  H HA   . ALA B 1 23 ? -10.956 5.460   -2.188  1.00 0.00 ? 23 ALA B HA   3  
ATOM 3166  H HB1  . ALA B 1 23 ? -10.046 5.754   0.148   1.00 0.00 ? 23 ALA B HB1  3  
ATOM 3167  H HB2  . ALA B 1 23 ? -9.570  7.413   -0.265  1.00 0.00 ? 23 ALA B HB2  3  
ATOM 3168  H HB3  . ALA B 1 23 ? -11.290 6.975   -0.238  1.00 0.00 ? 23 ALA B HB3  3  
ATOM 3169  N N    . ARG B 1 24 ? -9.420  8.155   -3.209  1.00 0.00 ? 24 ARG B N    3  
ATOM 3170  C CA   . ARG B 1 24 ? -9.553  9.373   -3.991  1.00 0.00 ? 24 ARG B CA   3  
ATOM 3171  C C    . ARG B 1 24 ? -9.614  9.016   -5.476  1.00 0.00 ? 24 ARG B C    3  
ATOM 3172  O O    . ARG B 1 24 ? -10.303 9.723   -6.225  1.00 0.00 ? 24 ARG B O    3  
ATOM 3173  C CB   . ARG B 1 24 ? -8.382  10.328  -3.749  1.00 0.00 ? 24 ARG B CB   3  
ATOM 3174  C CG   . ARG B 1 24 ? -8.685  11.286  -2.596  1.00 0.00 ? 24 ARG B CG   3  
ATOM 3175  C CD   . ARG B 1 24 ? -7.449  12.113  -2.232  1.00 0.00 ? 24 ARG B CD   3  
ATOM 3176  N NE   . ARG B 1 24 ? -7.861  13.445  -1.735  1.00 0.00 ? 24 ARG B NE   3  
ATOM 3177  C CZ   . ARG B 1 24 ? -7.139  14.572  -1.903  1.00 0.00 ? 24 ARG B CZ   3  
ATOM 3178  N NH1  . ARG B 1 24 ? -5.972  14.504  -2.560  1.00 0.00 ? 24 ARG B NH1  3  
ATOM 3179  N NH2  . ARG B 1 24 ? -7.580  15.742  -1.421  1.00 0.00 ? 24 ARG B NH2  3  
ATOM 3180  H H    . ARG B 1 24 ? -8.479  7.816   -3.008  1.00 0.00 ? 24 ARG B H    3  
ATOM 3181  H HA   . ARG B 1 24 ? -10.488 9.853   -3.702  1.00 0.00 ? 24 ARG B HA   3  
ATOM 3182  H HB2  . ARG B 1 24 ? -7.495  9.745   -3.504  1.00 0.00 ? 24 ARG B HB2  3  
ATOM 3183  H HB3  . ARG B 1 24 ? -8.194  10.894  -4.662  1.00 0.00 ? 24 ARG B HB3  3  
ATOM 3184  H HG2  . ARG B 1 24 ? -9.487  11.960  -2.896  1.00 0.00 ? 24 ARG B HG2  3  
ATOM 3185  H HG3  . ARG B 1 24 ? -9.012  10.707  -1.732  1.00 0.00 ? 24 ARG B HG3  3  
ATOM 3186  H HD2  . ARG B 1 24 ? -6.887  11.601  -1.452  1.00 0.00 ? 24 ARG B HD2  3  
ATOM 3187  H HD3  . ARG B 1 24 ? -6.816  12.225  -3.112  1.00 0.00 ? 24 ARG B HD3  3  
ATOM 3188  H HE   . ARG B 1 24 ? -8.751  13.479  -1.237  1.00 0.00 ? 24 ARG B HE   3  
ATOM 3189  H HH11 . ARG B 1 24 ? -5.644  13.610  -2.924  1.00 0.00 ? 24 ARG B HH11 3  
ATOM 3190  H HH12 . ARG B 1 24 ? -5.414  15.346  -2.697  1.00 0.00 ? 24 ARG B HH12 3  
ATOM 3191  H HH21 . ARG B 1 24 ? -8.469  15.785  -0.923  1.00 0.00 ? 24 ARG B HH21 3  
ATOM 3192  H HH22 . ARG B 1 24 ? -7.028  16.590  -1.553  1.00 0.00 ? 24 ARG B HH22 3  
ATOM 3193  N N    . LEU B 1 25 ? -8.903  7.943   -5.868  1.00 0.00 ? 25 LEU B N    3  
ATOM 3194  C CA   . LEU B 1 25 ? -8.876  7.499   -7.251  1.00 0.00 ? 25 LEU B CA   3  
ATOM 3195  C C    . LEU B 1 25 ? -10.154 6.714   -7.555  1.00 0.00 ? 25 LEU B C    3  
ATOM 3196  O O    . LEU B 1 25 ? -10.710 6.894   -8.649  1.00 0.00 ? 25 LEU B O    3  
ATOM 3197  C CB   . LEU B 1 25 ? -7.593  6.718   -7.539  1.00 0.00 ? 25 LEU B CB   3  
ATOM 3198  C CG   . LEU B 1 25 ? -6.326  7.555   -7.727  1.00 0.00 ? 25 LEU B CG   3  
ATOM 3199  C CD1  . LEU B 1 25 ? -5.095  6.660   -7.883  1.00 0.00 ? 25 LEU B CD1  3  
ATOM 3200  C CD2  . LEU B 1 25 ? -6.480  8.527   -8.899  1.00 0.00 ? 25 LEU B CD2  3  
ATOM 3201  H H    . LEU B 1 25 ? -8.360  7.414   -5.185  1.00 0.00 ? 25 LEU B H    3  
ATOM 3202  H HA   . LEU B 1 25 ? -8.859  8.399   -7.865  1.00 0.00 ? 25 LEU B HA   3  
ATOM 3203  H HB2  . LEU B 1 25 ? -7.448  6.041   -6.696  1.00 0.00 ? 25 LEU B HB2  3  
ATOM 3204  H HB3  . LEU B 1 25 ? -7.786  6.131   -8.436  1.00 0.00 ? 25 LEU B HB3  3  
ATOM 3205  H HG   . LEU B 1 25 ? -6.222  8.126   -6.804  1.00 0.00 ? 25 LEU B HG   3  
ATOM 3206  H HD11 . LEU B 1 25 ? -5.218  6.007   -8.747  1.00 0.00 ? 25 LEU B HD11 3  
ATOM 3207  H HD12 . LEU B 1 25 ? -4.214  7.288   -8.014  1.00 0.00 ? 25 LEU B HD12 3  
ATOM 3208  H HD13 . LEU B 1 25 ? -4.965  6.048   -6.990  1.00 0.00 ? 25 LEU B HD13 3  
ATOM 3209  H HD21 . LEU B 1 25 ? -7.322  9.196   -8.719  1.00 0.00 ? 25 LEU B HD21 3  
ATOM 3210  H HD22 . LEU B 1 25 ? -5.562  9.105   -9.003  1.00 0.00 ? 25 LEU B HD22 3  
ATOM 3211  H HD23 . LEU B 1 25 ? -6.657  7.973   -9.820  1.00 0.00 ? 25 LEU B HD23 3  
ATOM 3212  N N    . LYS B 1 26 ? -10.587 5.874   -6.598  1.00 0.00 ? 26 LYS B N    3  
ATOM 3213  C CA   . LYS B 1 26 ? -11.788 5.072   -6.763  1.00 0.00 ? 26 LYS B CA   3  
ATOM 3214  C C    . LYS B 1 26 ? -12.996 5.997   -6.919  1.00 0.00 ? 26 LYS B C    3  
ATOM 3215  O O    . LYS B 1 26 ? -13.976 5.583   -7.555  1.00 0.00 ? 26 LYS B O    3  
ATOM 3216  C CB   . LYS B 1 26 ? -11.923 4.070   -5.615  1.00 0.00 ? 26 LYS B CB   3  
ATOM 3217  C CG   . LYS B 1 26 ? -11.047 2.840   -5.854  1.00 0.00 ? 26 LYS B CG   3  
ATOM 3218  C CD   . LYS B 1 26 ? -11.844 1.550   -5.652  1.00 0.00 ? 26 LYS B CD   3  
ATOM 3219  C CE   . LYS B 1 26 ? -12.723 1.253   -6.870  1.00 0.00 ? 26 LYS B CE   3  
ATOM 3220  N NZ   . LYS B 1 26 ? -13.057 -0.181  -6.926  1.00 0.00 ? 26 LYS B NZ   3  
ATOM 3221  H H    . LYS B 1 26 ? -10.069 5.787   -5.724  1.00 0.00 ? 26 LYS B H    3  
ATOM 3222  H HA   . LYS B 1 26 ? -11.655 4.503   -7.683  1.00 0.00 ? 26 LYS B HA   3  
ATOM 3223  H HB2  . LYS B 1 26 ? -11.615 4.551   -4.686  1.00 0.00 ? 26 LYS B HB2  3  
ATOM 3224  H HB3  . LYS B 1 26 ? -12.968 3.771   -5.529  1.00 0.00 ? 26 LYS B HB3  3  
ATOM 3225  H HG2  . LYS B 1 26 ? -10.669 2.868   -6.876  1.00 0.00 ? 26 LYS B HG2  3  
ATOM 3226  H HG3  . LYS B 1 26 ? -10.204 2.867   -5.163  1.00 0.00 ? 26 LYS B HG3  3  
ATOM 3227  H HD2  . LYS B 1 26 ? -11.149 0.723   -5.506  1.00 0.00 ? 26 LYS B HD2  3  
ATOM 3228  H HD3  . LYS B 1 26 ? -12.465 1.654   -4.762  1.00 0.00 ? 26 LYS B HD3  3  
ATOM 3229  H HE2  . LYS B 1 26 ? -13.643 1.830   -6.797  1.00 0.00 ? 26 LYS B HE2  3  
ATOM 3230  H HE3  . LYS B 1 26 ? -12.191 1.546   -7.775  1.00 0.00 ? 26 LYS B HE3  3  
ATOM 3231  H HZ1  . LYS B 1 26 ? -13.555 -0.455  -6.079  1.00 0.00 ? 26 LYS B HZ1  3  
ATOM 3232  H HZ2  . LYS B 1 26 ? -13.642 -0.353  -7.745  1.00 0.00 ? 26 LYS B HZ2  3  
ATOM 3233  H HZ3  . LYS B 1 26 ? -12.205 -0.734  -7.004  1.00 0.00 ? 26 LYS B HZ3  3  
ATOM 3234  N N    . LYS B 1 27 ? -12.905 7.209   -6.345  1.00 0.00 ? 27 LYS B N    3  
ATOM 3235  C CA   . LYS B 1 27 ? -13.984 8.180   -6.419  1.00 0.00 ? 27 LYS B CA   3  
ATOM 3236  C C    . LYS B 1 27 ? -13.938 8.884   -7.777  1.00 0.00 ? 27 LYS B C    3  
ATOM 3237  O O    . LYS B 1 27 ? -14.905 9.583   -8.112  1.00 0.00 ? 27 LYS B O    3  
ATOM 3238  C CB   . LYS B 1 27 ? -13.926 9.139   -5.228  1.00 0.00 ? 27 LYS B CB   3  
ATOM 3239  C CG   . LYS B 1 27 ? -15.326 9.410   -4.674  1.00 0.00 ? 27 LYS B CG   3  
ATOM 3240  C CD   . LYS B 1 27 ? -15.311 10.592  -3.702  1.00 0.00 ? 27 LYS B CD   3  
ATOM 3241  C CE   . LYS B 1 27 ? -14.714 10.183  -2.353  1.00 0.00 ? 27 LYS B CE   3  
ATOM 3242  N NZ   . LYS B 1 27 ? -13.777 11.211  -1.871  1.00 0.00 ? 27 LYS B NZ   3  
ATOM 3243  H H    . LYS B 1 27 ? -12.059 7.472   -5.837  1.00 0.00 ? 27 LYS B H    3  
ATOM 3244  H HA   . LYS B 1 27 ? -14.913 7.616   -6.343  1.00 0.00 ? 27 LYS B HA   3  
ATOM 3245  H HB2  . LYS B 1 27 ? -13.315 8.691   -4.443  1.00 0.00 ? 27 LYS B HB2  3  
ATOM 3246  H HB3  . LYS B 1 27 ? -13.465 10.073  -5.548  1.00 0.00 ? 27 LYS B HB3  3  
ATOM 3247  H HG2  . LYS B 1 27 ? -15.995 9.642   -5.502  1.00 0.00 ? 27 LYS B HG2  3  
ATOM 3248  H HG3  . LYS B 1 27 ? -15.686 8.515   -4.167  1.00 0.00 ? 27 LYS B HG3  3  
ATOM 3249  H HD2  . LYS B 1 27 ? -14.709 11.394  -4.127  1.00 0.00 ? 27 LYS B HD2  3  
ATOM 3250  H HD3  . LYS B 1 27 ? -16.331 10.948  -3.563  1.00 0.00 ? 27 LYS B HD3  3  
ATOM 3251  H HE2  . LYS B 1 27 ? -15.517 10.067  -1.626  1.00 0.00 ? 27 LYS B HE2  3  
ATOM 3252  H HE3  . LYS B 1 27 ? -14.196 9.231   -2.464  1.00 0.00 ? 27 LYS B HE3  3  
ATOM 3253  H HZ1  . LYS B 1 27 ? -14.262 12.103  -1.767  1.00 0.00 ? 27 LYS B HZ1  3  
ATOM 3254  H HZ2  . LYS B 1 27 ? -13.393 10.917  -0.974  1.00 0.00 ? 27 LYS B HZ2  3  
ATOM 3255  H HZ3  . LYS B 1 27 ? -13.014 11.325  -2.538  1.00 0.00 ? 27 LYS B HZ3  3  
ATOM 3256  N N    . LEU B 1 28 ? -12.833 8.688   -8.519  1.00 0.00 ? 28 LEU B N    3  
ATOM 3257  C CA   . LEU B 1 28 ? -12.666 9.300   -9.826  1.00 0.00 ? 28 LEU B CA   3  
ATOM 3258  C C    . LEU B 1 28 ? -12.889 8.244   -10.911 1.00 0.00 ? 28 LEU B C    3  
ATOM 3259  O O    . LEU B 1 28 ? -13.428 8.593   -11.972 1.00 0.00 ? 28 LEU B O    3  
ATOM 3260  C CB   . LEU B 1 28 ? -11.309 10.000  -9.921  1.00 0.00 ? 28 LEU B CB   3  
ATOM 3261  C CG   . LEU B 1 28 ? -11.330 11.436  -10.451 1.00 0.00 ? 28 LEU B CG   3  
ATOM 3262  C CD1  . LEU B 1 28 ? -11.534 12.437  -9.312  1.00 0.00 ? 28 LEU B CD1  3  
ATOM 3263  C CD2  . LEU B 1 28 ? -10.069 11.740  -11.263 1.00 0.00 ? 28 LEU B CD2  3  
ATOM 3264  H H    . LEU B 1 28 ? -12.081 8.096   -8.168  1.00 0.00 ? 28 LEU B H    3  
ATOM 3265  H HA   . LEU B 1 28 ? -13.438 10.065  -9.911  1.00 0.00 ? 28 LEU B HA   3  
ATOM 3266  H HB2  . LEU B 1 28 ? -10.892 10.000  -8.914  1.00 0.00 ? 28 LEU B HB2  3  
ATOM 3267  H HB3  . LEU B 1 28 ? -10.687 9.377   -10.563 1.00 0.00 ? 28 LEU B HB3  3  
ATOM 3268  H HG   . LEU B 1 28 ? -12.197 11.483  -11.110 1.00 0.00 ? 28 LEU B HG   3  
ATOM 3269  H HD11 . LEU B 1 28 ? -10.728 12.341  -8.584  1.00 0.00 ? 28 LEU B HD11 3  
ATOM 3270  H HD12 . LEU B 1 28 ? -11.543 13.446  -9.724  1.00 0.00 ? 28 LEU B HD12 3  
ATOM 3271  H HD13 . LEU B 1 28 ? -12.486 12.247  -8.816  1.00 0.00 ? 28 LEU B HD13 3  
ATOM 3272  H HD21 . LEU B 1 28 ? -9.997  11.053  -12.106 1.00 0.00 ? 28 LEU B HD21 3  
ATOM 3273  H HD22 . LEU B 1 28 ? -10.119 12.767  -11.623 1.00 0.00 ? 28 LEU B HD22 3  
ATOM 3274  H HD23 . LEU B 1 28 ? -9.186  11.625  -10.634 1.00 0.00 ? 28 LEU B HD23 3  
ATOM 3275  N N    . VAL B 1 29 ? -12.479 6.994   -10.629 1.00 0.00 ? 29 VAL B N    3  
ATOM 3276  C CA   . VAL B 1 29 ? -12.634 5.901   -11.573 1.00 0.00 ? 29 VAL B CA   3  
ATOM 3277  C C    . VAL B 1 29 ? -13.708 4.939   -11.061 1.00 0.00 ? 29 VAL B C    3  
ATOM 3278  O O    . VAL B 1 29 ? -14.738 4.792   -11.735 1.00 0.00 ? 29 VAL B O    3  
ATOM 3279  C CB   . VAL B 1 29 ? -11.285 5.219   -11.810 1.00 0.00 ? 29 VAL B CB   3  
ATOM 3280  C CG1  . VAL B 1 29 ? -11.351 4.279   -13.015 1.00 0.00 ? 29 VAL B CG1  3  
ATOM 3281  C CG2  . VAL B 1 29 ? -10.171 6.254   -11.983 1.00 0.00 ? 29 VAL B CG2  3  
ATOM 3282  H H    . VAL B 1 29 ? -12.045 6.792   -9.729  1.00 0.00 ? 29 VAL B H    3  
ATOM 3283  H HA   . VAL B 1 29 ? -12.965 6.330   -12.519 1.00 0.00 ? 29 VAL B HA   3  
ATOM 3284  H HB   . VAL B 1 29 ? -11.089 4.634   -10.913 1.00 0.00 ? 29 VAL B HB   3  
ATOM 3285  H HG11 . VAL B 1 29 ? -11.627 4.839   -13.910 1.00 0.00 ? 29 VAL B HG11 3  
ATOM 3286  H HG12 . VAL B 1 29 ? -10.376 3.812   -13.155 1.00 0.00 ? 29 VAL B HG12 3  
ATOM 3287  H HG13 . VAL B 1 29 ? -12.095 3.501   -12.840 1.00 0.00 ? 29 VAL B HG13 3  
ATOM 3288  H HG21 . VAL B 1 29 ? -10.100 6.876   -11.090 1.00 0.00 ? 29 VAL B HG21 3  
ATOM 3289  H HG22 . VAL B 1 29 ? -9.228  5.735   -12.149 1.00 0.00 ? 29 VAL B HG22 3  
ATOM 3290  H HG23 . VAL B 1 29 ? -10.384 6.889   -12.842 1.00 0.00 ? 29 VAL B HG23 3  
ATOM 3291  N N    . GLY B 1 30 ? -13.452 4.314   -9.898  1.00 0.00 ? 30 GLY B N    3  
ATOM 3292  C CA   . GLY B 1 30 ? -14.390 3.376   -9.305  1.00 0.00 ? 30 GLY B CA   3  
ATOM 3293  C C    . GLY B 1 30 ? -15.754 4.052   -9.154  1.00 0.00 ? 30 GLY B C    3  
ATOM 3294  O O    . GLY B 1 30 ? -16.725 3.356   -8.822  1.00 0.00 ? 30 GLY B O    3  
ATOM 3295  H H    . GLY B 1 30 ? -12.577 4.492   -9.406  1.00 0.00 ? 30 GLY B H    3  
ATOM 3296  H HA2  . GLY B 1 30 ? -14.495 2.503   -9.948  1.00 0.00 ? 30 GLY B HA2  3  
ATOM 3297  H HA3  . GLY B 1 30 ? -14.024 3.056   -8.329  1.00 0.00 ? 30 GLY B HA3  3  
ATOM 3298  N N    . GLU B 1 31 ? -15.802 5.375   -9.399  1.00 0.00 ? 31 GLU B N    3  
ATOM 3299  C CA   . GLU B 1 31 ? -17.036 6.134   -9.291  1.00 0.00 ? 31 GLU B CA   3  
ATOM 3300  C C    . GLU B 1 31 ? -18.053 5.589   -10.295 1.00 0.00 ? 31 GLU B C    3  
ATOM 3301  O O    . GLU B 1 31 ? -17.642 4.889   -11.231 1.00 0.00 ? 31 GLU B O    3  
ATOM 3302  C CB   . GLU B 1 31 ? -16.797 7.629   -9.510  1.00 0.00 ? 31 GLU B CB   3  
ATOM 3303  C CG   . GLU B 1 31 ? -17.467 8.457   -8.412  1.00 0.00 ? 31 GLU B CG   3  
ATOM 3304  C CD   . GLU B 1 31 ? -17.703 9.896   -8.879  1.00 0.00 ? 31 GLU B CD   3  
ATOM 3305  O OE1  . GLU B 1 31 ? -17.156 10.201  -10.006 1.00 0.00 ? 31 GLU B OE1  3  
ATOM 3306  O OE2  . GLU B 1 31 ? -18.379 10.670  -8.184  1.00 0.00 ? 31 GLU B OE2  3  
ATOM 3307  H H    . GLU B 1 31 ? -14.954 5.874   -9.668  1.00 0.00 ? 31 GLU B H    3  
ATOM 3308  H HA   . GLU B 1 31 ? -17.416 5.981   -8.281  1.00 0.00 ? 31 GLU B HA   3  
ATOM 3309  H HB2  . GLU B 1 31 ? -15.724 7.822   -9.494  1.00 0.00 ? 31 GLU B HB2  3  
ATOM 3310  H HB3  . GLU B 1 31 ? -17.194 7.911   -10.484 1.00 0.00 ? 31 GLU B HB3  3  
ATOM 3311  H HG2  . GLU B 1 31 ? -18.426 8.003   -8.162  1.00 0.00 ? 31 GLU B HG2  3  
ATOM 3312  H HG3  . GLU B 1 31 ? -16.830 8.454   -7.527  1.00 0.00 ? 31 GLU B HG3  3  
ATOM 3313  N N    . ARG B 1 32 ? -19.342 5.914   -10.083 1.00 0.00 ? 32 ARG B N    3  
ATOM 3314  C CA   . ARG B 1 32 ? -20.404 5.460   -10.964 1.00 0.00 ? 32 ARG B CA   3  
ATOM 3315  C C    . ARG B 1 32 ? -21.054 6.670   -11.638 1.00 0.00 ? 32 ARG B C    3  
ATOM 3316  O O    . ARG B 1 32 ? -21.502 7.595   -10.960 1.00 0.00 ? 32 ARG B O    3  
ATOM 3317  C CB   . ARG B 1 32 ? -21.473 4.675   -10.199 1.00 0.00 ? 32 ARG B CB   3  
ATOM 3318  C CG   . ARG B 1 32 ? -21.465 5.043   -8.714  1.00 0.00 ? 32 ARG B CG   3  
ATOM 3319  C CD   . ARG B 1 32 ? -22.019 3.898   -7.863  1.00 0.00 ? 32 ARG B CD   3  
ATOM 3320  N NE   . ARG B 1 32 ? -23.055 3.160   -8.621  1.00 0.00 ? 32 ARG B NE   3  
ATOM 3321  C CZ   . ARG B 1 32 ? -24.116 2.550   -8.053  1.00 0.00 ? 32 ARG B CZ   3  
ATOM 3322  N NH1  . ARG B 1 32 ? -24.263 2.605   -6.722  1.00 0.00 ? 32 ARG B NH1  3  
ATOM 3323  N NH2  . ARG B 1 32 ? -25.013 1.901   -8.809  1.00 0.00 ? 32 ARG B NH2  3  
ATOM 3324  H H    . ARG B 1 32 ? -19.596 6.497   -9.285  1.00 0.00 ? 32 ARG B H    3  
ATOM 3325  H HA   . ARG B 1 32 ? -19.957 4.826   -11.729 1.00 0.00 ? 32 ARG B HA   3  
ATOM 3326  H HB2  . ARG B 1 32 ? -22.452 4.911   -10.617 1.00 0.00 ? 32 ARG B HB2  3  
ATOM 3327  H HB3  . ARG B 1 32 ? -21.283 3.610   -10.320 1.00 0.00 ? 32 ARG B HB3  3  
ATOM 3328  H HG2  . ARG B 1 32 ? -20.439 5.249   -8.406  1.00 0.00 ? 32 ARG B HG2  3  
ATOM 3329  H HG3  . ARG B 1 32 ? -22.067 5.939   -8.568  1.00 0.00 ? 32 ARG B HG3  3  
ATOM 3330  H HD2  . ARG B 1 32 ? -21.211 3.213   -7.607  1.00 0.00 ? 32 ARG B HD2  3  
ATOM 3331  H HD3  . ARG B 1 32 ? -22.446 4.301   -6.945  1.00 0.00 ? 32 ARG B HD3  3  
ATOM 3332  H HE   . ARG B 1 32 ? -22.929 3.128   -9.633  1.00 0.00 ? 32 ARG B HE   3  
ATOM 3333  H HH11 . ARG B 1 32 ? -23.576 3.101   -6.153  1.00 0.00 ? 32 ARG B HH11 3  
ATOM 3334  H HH12 . ARG B 1 32 ? -25.060 2.150   -6.277  1.00 0.00 ? 32 ARG B HH12 3  
ATOM 3335  H HH21 . ARG B 1 32 ? -24.895 1.864   -9.821  1.00 0.00 ? 32 ARG B HH21 3  
ATOM 3336  H HH22 . ARG B 1 32 ? -25.813 1.444   -8.372  1.00 0.00 ? 32 ARG B HH22 3  
ATOM 3337  N N    . MET A 1 1  ? 8.366   -11.307 16.987  1.00 0.00 ? 1  MET A N    4  
ATOM 3338  C CA   . MET A 1 1  ? 9.044   -11.181 15.708  1.00 0.00 ? 1  MET A CA   4  
ATOM 3339  C C    . MET A 1 1  ? 8.461   -12.198 14.724  1.00 0.00 ? 1  MET A C    4  
ATOM 3340  O O    . MET A 1 1  ? 8.282   -11.847 13.549  1.00 0.00 ? 1  MET A O    4  
ATOM 3341  C CB   . MET A 1 1  ? 10.545  -11.431 15.873  1.00 0.00 ? 1  MET A CB   4  
ATOM 3342  C CG   . MET A 1 1  ? 11.353  -10.588 14.886  1.00 0.00 ? 1  MET A CG   4  
ATOM 3343  S SD   . MET A 1 1  ? 12.879  -11.459 14.427  1.00 0.00 ? 1  MET A SD   4  
ATOM 3344  C CE   . MET A 1 1  ? 12.624  -11.623 12.636  1.00 0.00 ? 1  MET A CE   4  
ATOM 3345  H H    . MET A 1 1  ? 8.936   -11.302 17.832  1.00 0.00 ? 1  MET A H    4  
ATOM 3346  H HA   . MET A 1 1  ? 8.881   -10.176 15.318  1.00 0.00 ? 1  MET A HA   4  
ATOM 3347  H HB2  . MET A 1 1  ? 10.838  -11.167 16.889  1.00 0.00 ? 1  MET A HB2  4  
ATOM 3348  H HB3  . MET A 1 1  ? 10.746  -12.490 15.709  1.00 0.00 ? 1  MET A HB3  4  
ATOM 3349  H HG2  . MET A 1 1  ? 10.761  -10.412 13.988  1.00 0.00 ? 1  MET A HG2  4  
ATOM 3350  H HG3  . MET A 1 1  ? 11.596  -9.628  15.344  1.00 0.00 ? 1  MET A HG3  4  
ATOM 3351  H HE1  . MET A 1 1  ? 12.519  -10.636 12.185  1.00 0.00 ? 1  MET A HE1  4  
ATOM 3352  H HE2  . MET A 1 1  ? 13.479  -12.140 12.201  1.00 0.00 ? 1  MET A HE2  4  
ATOM 3353  H HE3  . MET A 1 1  ? 11.722  -12.201 12.441  1.00 0.00 ? 1  MET A HE3  4  
ATOM 3354  N N    . ASP A 1 2  ? 8.182   -13.419 15.216  1.00 0.00 ? 2  ASP A N    4  
ATOM 3355  C CA   . ASP A 1 2  ? 7.626   -14.474 14.386  1.00 0.00 ? 2  ASP A CA   4  
ATOM 3356  C C    . ASP A 1 2  ? 6.396   -13.942 13.647  1.00 0.00 ? 2  ASP A C    4  
ATOM 3357  O O    . ASP A 1 2  ? 6.175   -14.353 12.499  1.00 0.00 ? 2  ASP A O    4  
ATOM 3358  C CB   . ASP A 1 2  ? 7.187   -15.669 15.236  1.00 0.00 ? 2  ASP A CB   4  
ATOM 3359  C CG   . ASP A 1 2  ? 8.037   -15.923 16.482  1.00 0.00 ? 2  ASP A CG   4  
ATOM 3360  O OD1  . ASP A 1 2  ? 7.812   -15.123 17.468  1.00 0.00 ? 2  ASP A OD1  4  
ATOM 3361  O OD2  . ASP A 1 2  ? 8.870   -16.840 16.509  1.00 0.00 ? 2  ASP A OD2  4  
ATOM 3362  H H    . ASP A 1 2  ? 8.361   -13.626 16.198  1.00 0.00 ? 2  ASP A H    4  
ATOM 3363  H HA   . ASP A 1 2  ? 8.374   -14.781 13.655  1.00 0.00 ? 2  ASP A HA   4  
ATOM 3364  H HB2  . ASP A 1 2  ? 6.158   -15.479 15.541  1.00 0.00 ? 2  ASP A HB2  4  
ATOM 3365  H HB3  . ASP A 1 2  ? 7.209   -16.543 14.585  1.00 0.00 ? 2  ASP A HB3  4  
ATOM 3366  N N    . ALA A 1 3  ? 5.635   -13.053 14.309  1.00 0.00 ? 3  ALA A N    4  
ATOM 3367  C CA   . ALA A 1 3  ? 4.441   -12.471 13.719  1.00 0.00 ? 3  ALA A CA   4  
ATOM 3368  C C    . ALA A 1 3  ? 4.813   -11.173 12.999  1.00 0.00 ? 3  ALA A C    4  
ATOM 3369  O O    . ALA A 1 3  ? 3.994   -10.682 12.209  1.00 0.00 ? 3  ALA A O    4  
ATOM 3370  C CB   . ALA A 1 3  ? 3.457   -12.082 14.824  1.00 0.00 ? 3  ALA A CB   4  
ATOM 3371  H H    . ALA A 1 3  ? 5.890   -12.767 15.255  1.00 0.00 ? 3  ALA A H    4  
ATOM 3372  H HA   . ALA A 1 3  ? 3.982   -13.154 13.004  1.00 0.00 ? 3  ALA A HA   4  
ATOM 3373  H HB1  . ALA A 1 3  ? 3.197   -12.973 15.396  1.00 0.00 ? 3  ALA A HB1  4  
ATOM 3374  H HB2  . ALA A 1 3  ? 3.917   -11.354 15.491  1.00 0.00 ? 3  ALA A HB2  4  
ATOM 3375  H HB3  . ALA A 1 3  ? 2.559   -11.646 14.386  1.00 0.00 ? 3  ALA A HB3  4  
ATOM 3376  N N    . ILE A 1 4  ? 6.021   -10.652 13.283  1.00 0.00 ? 4  ILE A N    4  
ATOM 3377  C CA   . ILE A 1 4  ? 6.492   -9.423  12.668  1.00 0.00 ? 4  ILE A CA   4  
ATOM 3378  C C    . ILE A 1 4  ? 6.983   -9.724  11.250  1.00 0.00 ? 4  ILE A C    4  
ATOM 3379  O O    . ILE A 1 4  ? 6.635   -8.966  10.332  1.00 0.00 ? 4  ILE A O    4  
ATOM 3380  C CB   . ILE A 1 4  ? 7.545   -8.751  13.551  1.00 0.00 ? 4  ILE A CB   4  
ATOM 3381  C CG1  . ILE A 1 4  ? 6.967   -8.408  14.926  1.00 0.00 ? 4  ILE A CG1  4  
ATOM 3382  C CG2  . ILE A 1 4  ? 8.142   -7.526  12.859  1.00 0.00 ? 4  ILE A CG2  4  
ATOM 3383  C CD1  . ILE A 1 4  ? 7.378   -6.999  15.357  1.00 0.00 ? 4  ILE A CD1  4  
ATOM 3384  H H    . ILE A 1 4  ? 6.635   -11.122 13.948  1.00 0.00 ? 4  ILE A H    4  
ATOM 3385  H HA   . ILE A 1 4  ? 5.634   -8.756  12.611  1.00 0.00 ? 4  ILE A HA   4  
ATOM 3386  H HB   . ILE A 1 4  ? 8.331   -9.496  13.673  1.00 0.00 ? 4  ILE A HB   4  
ATOM 3387  H HG12 . ILE A 1 4  ? 5.880   -8.461  14.877  1.00 0.00 ? 4  ILE A HG12 4  
ATOM 3388  H HG13 . ILE A 1 4  ? 7.325   -9.138  15.653  1.00 0.00 ? 4  ILE A HG13 4  
ATOM 3389  H HG21 . ILE A 1 4  ? 7.355   -6.805  12.635  1.00 0.00 ? 4  ILE A HG21 4  
ATOM 3390  H HG22 . ILE A 1 4  ? 8.885   -7.073  13.515  1.00 0.00 ? 4  ILE A HG22 4  
ATOM 3391  H HG23 . ILE A 1 4  ? 8.625   -7.824  11.928  1.00 0.00 ? 4  ILE A HG23 4  
ATOM 3392  H HD11 . ILE A 1 4  ? 7.020   -6.269  14.631  1.00 0.00 ? 4  ILE A HD11 4  
ATOM 3393  H HD12 . ILE A 1 4  ? 6.950   -6.788  16.337  1.00 0.00 ? 4  ILE A HD12 4  
ATOM 3394  H HD13 . ILE A 1 4  ? 8.464   -6.931  15.422  1.00 0.00 ? 4  ILE A HD13 4  
ATOM 3395  N N    . LYS A 1 5  ? 7.767   -10.807 11.100  1.00 0.00 ? 5  LYS A N    4  
ATOM 3396  C CA   . LYS A 1 5  ? 8.297   -11.200 9.805   1.00 0.00 ? 5  LYS A CA   4  
ATOM 3397  C C    . LYS A 1 5  ? 7.149   -11.312 8.801   1.00 0.00 ? 5  LYS A C    4  
ATOM 3398  O O    . LYS A 1 5  ? 7.357   -10.971 7.628   1.00 0.00 ? 5  LYS A O    4  
ATOM 3399  C CB   . LYS A 1 5  ? 9.129   -12.478 9.934   1.00 0.00 ? 5  LYS A CB   4  
ATOM 3400  C CG   . LYS A 1 5  ? 8.680   -13.306 11.140  1.00 0.00 ? 5  LYS A CG   4  
ATOM 3401  C CD   . LYS A 1 5  ? 8.841   -14.804 10.868  1.00 0.00 ? 5  LYS A CD   4  
ATOM 3402  C CE   . LYS A 1 5  ? 10.197  -15.309 11.365  1.00 0.00 ? 5  LYS A CE   4  
ATOM 3403  N NZ   . LYS A 1 5  ? 10.620  -16.491 10.597  1.00 0.00 ? 5  LYS A NZ   4  
ATOM 3404  H H    . LYS A 1 5  ? 8.005   -11.380 11.909  1.00 0.00 ? 5  LYS A H    4  
ATOM 3405  H HA   . LYS A 1 5  ? 8.968   -10.401 9.491   1.00 0.00 ? 5  LYS A HA   4  
ATOM 3406  H HB2  . LYS A 1 5  ? 9.005   -13.073 9.029   1.00 0.00 ? 5  LYS A HB2  4  
ATOM 3407  H HB3  . LYS A 1 5  ? 10.179  -12.208 10.040  1.00 0.00 ? 5  LYS A HB3  4  
ATOM 3408  H HG2  . LYS A 1 5  ? 9.288   -13.035 12.002  1.00 0.00 ? 5  LYS A HG2  4  
ATOM 3409  H HG3  . LYS A 1 5  ? 7.635   -13.078 11.356  1.00 0.00 ? 5  LYS A HG3  4  
ATOM 3410  H HD2  . LYS A 1 5  ? 8.049   -15.345 11.386  1.00 0.00 ? 5  LYS A HD2  4  
ATOM 3411  H HD3  . LYS A 1 5  ? 8.749   -14.980 9.796   1.00 0.00 ? 5  LYS A HD3  4  
ATOM 3412  H HE2  . LYS A 1 5  ? 10.940  -14.520 11.241  1.00 0.00 ? 5  LYS A HE2  4  
ATOM 3413  H HE3  . LYS A 1 5  ? 10.120  -15.560 12.423  1.00 0.00 ? 5  LYS A HE3  4  
ATOM 3414  H HZ1  . LYS A 1 5  ? 10.693  -16.255 9.607   1.00 0.00 ? 5  LYS A HZ1  4  
ATOM 3415  H HZ2  . LYS A 1 5  ? 11.524  -16.807 10.947  1.00 0.00 ? 5  LYS A HZ2  4  
ATOM 3416  H HZ3  . LYS A 1 5  ? 9.939   -17.241 10.711  1.00 0.00 ? 5  LYS A HZ3  4  
ATOM 3417  N N    . LYS A 1 6  ? 5.980   -11.781 9.273   1.00 0.00 ? 6  LYS A N    4  
ATOM 3418  C CA   . LYS A 1 6  ? 4.812   -11.935 8.421   1.00 0.00 ? 6  LYS A CA   4  
ATOM 3419  C C    . LYS A 1 6  ? 4.050   -10.609 8.363   1.00 0.00 ? 6  LYS A C    4  
ATOM 3420  O O    . LYS A 1 6  ? 3.427   -10.333 7.327   1.00 0.00 ? 6  LYS A O    4  
ATOM 3421  C CB   . LYS A 1 6  ? 3.959   -13.114 8.891   1.00 0.00 ? 6  LYS A CB   4  
ATOM 3422  C CG   . LYS A 1 6  ? 4.831   -14.221 9.486   1.00 0.00 ? 6  LYS A CG   4  
ATOM 3423  C CD   . LYS A 1 6  ? 4.130   -15.577 9.407   1.00 0.00 ? 6  LYS A CD   4  
ATOM 3424  C CE   . LYS A 1 6  ? 4.134   -16.113 7.973   1.00 0.00 ? 6  LYS A CE   4  
ATOM 3425  N NZ   . LYS A 1 6  ? 2.868   -16.802 7.676   1.00 0.00 ? 6  LYS A NZ   4  
ATOM 3426  H H    . LYS A 1 6  ? 5.893   -12.040 10.255  1.00 0.00 ? 6  LYS A H    4  
ATOM 3427  H HA   . LYS A 1 6  ? 5.185   -12.175 7.425   1.00 0.00 ? 6  LYS A HA   4  
ATOM 3428  H HB2  . LYS A 1 6  ? 3.260   -12.766 9.651   1.00 0.00 ? 6  LYS A HB2  4  
ATOM 3429  H HB3  . LYS A 1 6  ? 3.395   -13.503 8.043   1.00 0.00 ? 6  LYS A HB3  4  
ATOM 3430  H HG2  . LYS A 1 6  ? 5.767   -14.272 8.930   1.00 0.00 ? 6  LYS A HG2  4  
ATOM 3431  H HG3  . LYS A 1 6  ? 5.050   -13.976 10.526  1.00 0.00 ? 6  LYS A HG3  4  
ATOM 3432  H HD2  . LYS A 1 6  ? 4.651   -16.284 10.051  1.00 0.00 ? 6  LYS A HD2  4  
ATOM 3433  H HD3  . LYS A 1 6  ? 3.104   -15.466 9.758   1.00 0.00 ? 6  LYS A HD3  4  
ATOM 3434  H HE2  . LYS A 1 6  ? 4.256   -15.281 7.280   1.00 0.00 ? 6  LYS A HE2  4  
ATOM 3435  H HE3  . LYS A 1 6  ? 4.969   -16.803 7.851   1.00 0.00 ? 6  LYS A HE3  4  
ATOM 3436  H HZ1  . LYS A 1 6  ? 2.086   -16.156 7.790   1.00 0.00 ? 6  LYS A HZ1  4  
ATOM 3437  H HZ2  . LYS A 1 6  ? 2.895   -17.149 6.717   1.00 0.00 ? 6  LYS A HZ2  4  
ATOM 3438  H HZ3  . LYS A 1 6  ? 2.742   -17.590 8.311   1.00 0.00 ? 6  LYS A HZ3  4  
ATOM 3439  N N    . LYS A 1 7  ? 4.114   -9.829  9.457   1.00 0.00 ? 7  LYS A N    4  
ATOM 3440  C CA   . LYS A 1 7  ? 3.435   -8.547  9.528   1.00 0.00 ? 7  LYS A CA   4  
ATOM 3441  C C    . LYS A 1 7  ? 3.794   -7.715  8.296   1.00 0.00 ? 7  LYS A C    4  
ATOM 3442  O O    . LYS A 1 7  ? 2.888   -7.102  7.713   1.00 0.00 ? 7  LYS A O    4  
ATOM 3443  C CB   . LYS A 1 7  ? 3.746   -7.849  10.853  1.00 0.00 ? 7  LYS A CB   4  
ATOM 3444  C CG   . LYS A 1 7  ? 3.043   -6.493  10.938  1.00 0.00 ? 7  LYS A CG   4  
ATOM 3445  C CD   . LYS A 1 7  ? 1.571   -6.614  10.537  1.00 0.00 ? 7  LYS A CD   4  
ATOM 3446  C CE   . LYS A 1 7  ? 0.772   -5.399  11.013  1.00 0.00 ? 7  LYS A CE   4  
ATOM 3447  N NZ   . LYS A 1 7  ? -0.427  -5.212  10.180  1.00 0.00 ? 7  LYS A NZ   4  
ATOM 3448  H H    . LYS A 1 7  ? 4.651   -10.133 10.268  1.00 0.00 ? 7  LYS A H    4  
ATOM 3449  H HA   . LYS A 1 7  ? 2.367   -8.761  9.512   1.00 0.00 ? 7  LYS A HA   4  
ATOM 3450  H HB2  . LYS A 1 7  ? 3.403   -8.479  11.674  1.00 0.00 ? 7  LYS A HB2  4  
ATOM 3451  H HB3  . LYS A 1 7  ? 4.824   -7.714  10.937  1.00 0.00 ? 7  LYS A HB3  4  
ATOM 3452  H HG2  . LYS A 1 7  ? 3.102   -6.127  11.963  1.00 0.00 ? 7  LYS A HG2  4  
ATOM 3453  H HG3  . LYS A 1 7  ? 3.551   -5.789  10.279  1.00 0.00 ? 7  LYS A HG3  4  
ATOM 3454  H HD2  . LYS A 1 7  ? 1.504   -6.679  9.450   1.00 0.00 ? 7  LYS A HD2  4  
ATOM 3455  H HD3  . LYS A 1 7  ? 1.158   -7.523  10.973  1.00 0.00 ? 7  LYS A HD3  4  
ATOM 3456  H HE2  . LYS A 1 7  ? 0.465   -5.554  12.047  1.00 0.00 ? 7  LYS A HE2  4  
ATOM 3457  H HE3  . LYS A 1 7  ? 1.404   -4.512  10.960  1.00 0.00 ? 7  LYS A HE3  4  
ATOM 3458  H HZ1  . LYS A 1 7  ? -1.018  -6.041  10.230  1.00 0.00 ? 7  LYS A HZ1  4  
ATOM 3459  H HZ2  . LYS A 1 7  ? -0.942  -4.397  10.516  1.00 0.00 ? 7  LYS A HZ2  4  
ATOM 3460  H HZ3  . LYS A 1 7  ? -0.156  -5.055  9.209   1.00 0.00 ? 7  LYS A HZ3  4  
ATOM 3461  N N    . MET A 1 8  ? 5.088   -7.709  7.929   1.00 0.00 ? 8  MET A N    4  
ATOM 3462  C CA   . MET A 1 8  ? 5.560   -6.959  6.778   1.00 0.00 ? 8  MET A CA   4  
ATOM 3463  C C    . MET A 1 8  ? 5.170   -7.700  5.498   1.00 0.00 ? 8  MET A C    4  
ATOM 3464  O O    . MET A 1 8  ? 5.101   -7.056  4.441   1.00 0.00 ? 8  MET A O    4  
ATOM 3465  C CB   . MET A 1 8  ? 7.081   -6.798  6.833   1.00 0.00 ? 8  MET A CB   4  
ATOM 3466  C CG   . MET A 1 8  ? 7.769   -8.152  7.013   1.00 0.00 ? 8  MET A CG   4  
ATOM 3467  S SD   . MET A 1 8  ? 9.473   -8.071  6.387   1.00 0.00 ? 8  MET A SD   4  
ATOM 3468  C CE   . MET A 1 8  ? 10.220  -6.995  7.645   1.00 0.00 ? 8  MET A CE   4  
ATOM 3469  H H    . MET A 1 8  ? 5.773   -8.243  8.465   1.00 0.00 ? 8  MET A H    4  
ATOM 3470  H HA   . MET A 1 8  ? 5.087   -5.977  6.777   1.00 0.00 ? 8  MET A HA   4  
ATOM 3471  H HB2  . MET A 1 8  ? 7.423   -6.346  5.901   1.00 0.00 ? 8  MET A HB2  4  
ATOM 3472  H HB3  . MET A 1 8  ? 7.337   -6.138  7.662   1.00 0.00 ? 8  MET A HB3  4  
ATOM 3473  H HG2  . MET A 1 8  ? 7.791   -8.410  8.071   1.00 0.00 ? 8  MET A HG2  4  
ATOM 3474  H HG3  . MET A 1 8  ? 7.210   -8.918  6.473   1.00 0.00 ? 8  MET A HG3  4  
ATOM 3475  H HE1  . MET A 1 8  ? 10.125  -7.452  8.630   1.00 0.00 ? 8  MET A HE1  4  
ATOM 3476  H HE2  . MET A 1 8  ? 11.273  -6.845  7.406   1.00 0.00 ? 8  MET A HE2  4  
ATOM 3477  H HE3  . MET A 1 8  ? 9.717   -6.027  7.653   1.00 0.00 ? 8  MET A HE3  4  
ATOM 3478  N N    . GLN A 1 9  ? 4.929   -9.018  5.614   1.00 0.00 ? 9  GLN A N    4  
ATOM 3479  C CA   . GLN A 1 9  ? 4.551   -9.836  4.474   1.00 0.00 ? 9  GLN A CA   4  
ATOM 3480  C C    . GLN A 1 9  ? 3.106   -9.520  4.083   1.00 0.00 ? 9  GLN A C    4  
ATOM 3481  O O    . GLN A 1 9  ? 2.777   -9.640  2.894   1.00 0.00 ? 9  GLN A O    4  
ATOM 3482  C CB   . GLN A 1 9  ? 4.726   -11.327 4.769   1.00 0.00 ? 9  GLN A CB   4  
ATOM 3483  C CG   . GLN A 1 9  ? 6.195   -11.739 4.655   1.00 0.00 ? 9  GLN A CG   4  
ATOM 3484  C CD   . GLN A 1 9  ? 6.323   -13.226 4.320   1.00 0.00 ? 9  GLN A CD   4  
ATOM 3485  O OE1  . GLN A 1 9  ? 5.778   -13.719 3.347   1.00 0.00 ? 9  GLN A OE1  4  
ATOM 3486  N NE2  . GLN A 1 9  ? 7.072   -13.912 5.179   1.00 0.00 ? 9  GLN A NE2  4  
ATOM 3487  H H    . GLN A 1 9  ? 5.010   -9.473  6.524   1.00 0.00 ? 9  GLN A H    4  
ATOM 3488  H HA   . GLN A 1 9  ? 5.209   -9.558  3.652   1.00 0.00 ? 9  GLN A HA   4  
ATOM 3489  H HB2  . GLN A 1 9  ? 4.378   -11.531 5.781   1.00 0.00 ? 9  GLN A HB2  4  
ATOM 3490  H HB3  . GLN A 1 9  ? 4.124   -11.899 4.064   1.00 0.00 ? 9  GLN A HB3  4  
ATOM 3491  H HG2  . GLN A 1 9  ? 6.667   -11.155 3.864   1.00 0.00 ? 9  GLN A HG2  4  
ATOM 3492  H HG3  . GLN A 1 9  ? 6.697   -11.526 5.599   1.00 0.00 ? 9  GLN A HG3  4  
ATOM 3493  H HE21 . GLN A 1 9  ? 7.500   -13.436 5.974   1.00 0.00 ? 9  GLN A HE21 4  
ATOM 3494  H HE22 . GLN A 1 9  ? 7.219   -14.912 5.044   1.00 0.00 ? 9  GLN A HE22 4  
ATOM 3495  N N    . MET A 1 10 ? 2.284   -9.132  5.075   1.00 0.00 ? 10 MET A N    4  
ATOM 3496  C CA   . MET A 1 10 ? 0.889   -8.804  4.835   1.00 0.00 ? 10 MET A CA   4  
ATOM 3497  C C    . MET A 1 10 ? 0.793   -7.386  4.270   1.00 0.00 ? 10 MET A C    4  
ATOM 3498  O O    . MET A 1 10 ? -0.069  -7.151  3.410   1.00 0.00 ? 10 MET A O    4  
ATOM 3499  C CB   . MET A 1 10 ? 0.091   -8.892  6.138   1.00 0.00 ? 10 MET A CB   4  
ATOM 3500  C CG   . MET A 1 10 ? 0.900   -9.590  7.232   1.00 0.00 ? 10 MET A CG   4  
ATOM 3501  S SD   . MET A 1 10 ? -0.126  -9.818  8.714   1.00 0.00 ? 10 MET A SD   4  
ATOM 3502  C CE   . MET A 1 10 ? -1.780  -9.762  7.965   1.00 0.00 ? 10 MET A CE   4  
ATOM 3503  H H    . MET A 1 10 ? 2.636   -9.060  6.029   1.00 0.00 ? 10 MET A H    4  
ATOM 3504  H HA   . MET A 1 10 ? 0.481   -9.505  4.107   1.00 0.00 ? 10 MET A HA   4  
ATOM 3505  H HB2  . MET A 1 10 ? -0.157  -7.883  6.468   1.00 0.00 ? 10 MET A HB2  4  
ATOM 3506  H HB3  . MET A 1 10 ? -0.833  -9.440  5.950   1.00 0.00 ? 10 MET A HB3  4  
ATOM 3507  H HG2  . MET A 1 10 ? 1.228   -10.566 6.873   1.00 0.00 ? 10 MET A HG2  4  
ATOM 3508  H HG3  . MET A 1 10 ? 1.776   -8.989  7.474   1.00 0.00 ? 10 MET A HG3  4  
ATOM 3509  H HE1  . MET A 1 10 ? -1.879  -10.556 7.224   1.00 0.00 ? 10 MET A HE1  4  
ATOM 3510  H HE2  . MET A 1 10 ? -2.528  -9.889  8.747   1.00 0.00 ? 10 MET A HE2  4  
ATOM 3511  H HE3  . MET A 1 10 ? -1.935  -8.800  7.477   1.00 0.00 ? 10 MET A HE3  4  
ATOM 3512  N N    . LEU A 1 11 ? 1.663   -6.483  4.756   1.00 0.00 ? 11 LEU A N    4  
ATOM 3513  C CA   . LEU A 1 11 ? 1.676   -5.103  4.303   1.00 0.00 ? 11 LEU A CA   4  
ATOM 3514  C C    . LEU A 1 11 ? 2.365   -5.025  2.940   1.00 0.00 ? 11 LEU A C    4  
ATOM 3515  O O    . LEU A 1 11 ? 2.053   -4.102  2.173   1.00 0.00 ? 11 LEU A O    4  
ATOM 3516  C CB   . LEU A 1 11 ? 2.305   -4.196  5.364   1.00 0.00 ? 11 LEU A CB   4  
ATOM 3517  C CG   . LEU A 1 11 ? 1.649   -4.227  6.747   1.00 0.00 ? 11 LEU A CG   4  
ATOM 3518  C CD1  . LEU A 1 11 ? 2.562   -3.593  7.798   1.00 0.00 ? 11 LEU A CD1  4  
ATOM 3519  C CD2  . LEU A 1 11 ? 0.269   -3.570  6.714   1.00 0.00 ? 11 LEU A CD2  4  
ATOM 3520  H H    . LEU A 1 11 ? 2.342   -6.761  5.466   1.00 0.00 ? 11 LEU A H    4  
ATOM 3521  H HA   . LEU A 1 11 ? 0.633   -4.805  4.191   1.00 0.00 ? 11 LEU A HA   4  
ATOM 3522  H HB2  . LEU A 1 11 ? 3.345   -4.508  5.457   1.00 0.00 ? 11 LEU A HB2  4  
ATOM 3523  H HB3  . LEU A 1 11 ? 2.271   -3.185  4.959   1.00 0.00 ? 11 LEU A HB3  4  
ATOM 3524  H HG   . LEU A 1 11 ? 1.534   -5.285  6.982   1.00 0.00 ? 11 LEU A HG   4  
ATOM 3525  H HD11 . LEU A 1 11 ? 2.775   -2.559  7.531   1.00 0.00 ? 11 LEU A HD11 4  
ATOM 3526  H HD12 . LEU A 1 11 ? 2.066   -3.632  8.768   1.00 0.00 ? 11 LEU A HD12 4  
ATOM 3527  H HD13 . LEU A 1 11 ? 3.501   -4.145  7.858   1.00 0.00 ? 11 LEU A HD13 4  
ATOM 3528  H HD21 . LEU A 1 11 ? -0.375  -4.092  6.006   1.00 0.00 ? 11 LEU A HD21 4  
ATOM 3529  H HD22 . LEU A 1 11 ? -0.167  -3.610  7.713   1.00 0.00 ? 11 LEU A HD22 4  
ATOM 3530  H HD23 . LEU A 1 11 ? 0.360   -2.527  6.408   1.00 0.00 ? 11 LEU A HD23 4  
ATOM 3531  N N    . LYS A 1 12 ? 3.274   -5.979  2.669   1.00 0.00 ? 12 LYS A N    4  
ATOM 3532  C CA   . LYS A 1 12 ? 3.998   -6.017  1.410   1.00 0.00 ? 12 LYS A CA   4  
ATOM 3533  C C    . LYS A 1 12 ? 3.070   -6.530  0.307   1.00 0.00 ? 12 LYS A C    4  
ATOM 3534  O O    . LYS A 1 12 ? 3.176   -6.043  -0.828  1.00 0.00 ? 12 LYS A O    4  
ATOM 3535  C CB   . LYS A 1 12 ? 5.286   -6.829  1.558   1.00 0.00 ? 12 LYS A CB   4  
ATOM 3536  C CG   . LYS A 1 12 ? 6.449   -5.940  1.999   1.00 0.00 ? 12 LYS A CG   4  
ATOM 3537  C CD   . LYS A 1 12 ? 7.775   -6.445  1.427   1.00 0.00 ? 12 LYS A CD   4  
ATOM 3538  C CE   . LYS A 1 12 ? 8.398   -7.504  2.339   1.00 0.00 ? 12 LYS A CE   4  
ATOM 3539  N NZ   . LYS A 1 12 ? 8.803   -6.907  3.620   1.00 0.00 ? 12 LYS A NZ   4  
ATOM 3540  H H    . LYS A 1 12 ? 3.471   -6.705  3.357   1.00 0.00 ? 12 LYS A H    4  
ATOM 3541  H HA   . LYS A 1 12 ? 4.282   -4.988  1.185   1.00 0.00 ? 12 LYS A HA   4  
ATOM 3542  H HB2  . LYS A 1 12 ? 5.130   -7.607  2.305   1.00 0.00 ? 12 LYS A HB2  4  
ATOM 3543  H HB3  . LYS A 1 12 ? 5.519   -7.298  0.601   1.00 0.00 ? 12 LYS A HB3  4  
ATOM 3544  H HG2  . LYS A 1 12 ? 6.272   -4.925  1.643   1.00 0.00 ? 12 LYS A HG2  4  
ATOM 3545  H HG3  . LYS A 1 12 ? 6.494   -5.931  3.089   1.00 0.00 ? 12 LYS A HG3  4  
ATOM 3546  H HD2  . LYS A 1 12 ? 7.592   -6.884  0.446   1.00 0.00 ? 12 LYS A HD2  4  
ATOM 3547  H HD3  . LYS A 1 12 ? 8.457   -5.602  1.317   1.00 0.00 ? 12 LYS A HD3  4  
ATOM 3548  H HE2  . LYS A 1 12 ? 7.665   -8.289  2.529   1.00 0.00 ? 12 LYS A HE2  4  
ATOM 3549  H HE3  . LYS A 1 12 ? 9.263   -7.941  1.841   1.00 0.00 ? 12 LYS A HE3  4  
ATOM 3550  H HZ1  . LYS A 1 12 ? 7.994   -6.498  4.086   1.00 0.00 ? 12 LYS A HZ1  4  
ATOM 3551  H HZ2  . LYS A 1 12 ? 9.215   -7.631  4.209   1.00 0.00 ? 12 LYS A HZ2  4  
ATOM 3552  H HZ3  . LYS A 1 12 ? 9.497   -6.176  3.459   1.00 0.00 ? 12 LYS A HZ3  4  
ATOM 3553  N N    . LEU A 1 13 ? 2.193   -7.487  0.656   1.00 0.00 ? 13 LEU A N    4  
ATOM 3554  C CA   . LEU A 1 13 ? 1.256   -8.058  -0.297  1.00 0.00 ? 13 LEU A CA   4  
ATOM 3555  C C    . LEU A 1 13 ? 0.162   -7.035  -0.606  1.00 0.00 ? 13 LEU A C    4  
ATOM 3556  O O    . LEU A 1 13 ? -0.217  -6.912  -1.781  1.00 0.00 ? 13 LEU A O    4  
ATOM 3557  C CB   . LEU A 1 13 ? 0.720   -9.398  0.214   1.00 0.00 ? 13 LEU A CB   4  
ATOM 3558  C CG   . LEU A 1 13 ? 0.198   -10.362 -0.853  1.00 0.00 ? 13 LEU A CG   4  
ATOM 3559  C CD1  . LEU A 1 13 ? -0.816  -11.341 -0.256  1.00 0.00 ? 13 LEU A CD1  4  
ATOM 3560  C CD2  . LEU A 1 13 ? -0.378  -9.599  -2.048  1.00 0.00 ? 13 LEU A CD2  4  
ATOM 3561  H H    . LEU A 1 13 ? 2.170   -7.834  1.615   1.00 0.00 ? 13 LEU A H    4  
ATOM 3562  H HA   . LEU A 1 13 ? 1.824   -8.257  -1.207  1.00 0.00 ? 13 LEU A HA   4  
ATOM 3563  H HB2  . LEU A 1 13 ? 1.541   -9.873  0.750   1.00 0.00 ? 13 LEU A HB2  4  
ATOM 3564  H HB3  . LEU A 1 13 ? -0.074  -9.159  0.920   1.00 0.00 ? 13 LEU A HB3  4  
ATOM 3565  H HG   . LEU A 1 13 ? 1.072   -10.926 -1.179  1.00 0.00 ? 13 LEU A HG   4  
ATOM 3566  H HD11 . LEU A 1 13 ? -1.656  -10.794 0.167   1.00 0.00 ? 13 LEU A HD11 4  
ATOM 3567  H HD12 . LEU A 1 13 ? -1.165  -12.011 -1.041  1.00 0.00 ? 13 LEU A HD12 4  
ATOM 3568  H HD13 . LEU A 1 13 ? -0.344  -11.931 0.530   1.00 0.00 ? 13 LEU A HD13 4  
ATOM 3569  H HD21 . LEU A 1 13 ? 0.392   -8.966  -2.490  1.00 0.00 ? 13 LEU A HD21 4  
ATOM 3570  H HD22 . LEU A 1 13 ? -0.740  -10.316 -2.785  1.00 0.00 ? 13 LEU A HD22 4  
ATOM 3571  H HD23 . LEU A 1 13 ? -1.209  -8.973  -1.723  1.00 0.00 ? 13 LEU A HD23 4  
ATOM 3572  N N    . ASP A 1 14 ? -0.318  -6.334  0.436   1.00 0.00 ? 14 ASP A N    4  
ATOM 3573  C CA   . ASP A 1 14 ? -1.358  -5.332  0.277   1.00 0.00 ? 14 ASP A CA   4  
ATOM 3574  C C    . ASP A 1 14 ? -0.811  -4.159  -0.538  1.00 0.00 ? 14 ASP A C    4  
ATOM 3575  O O    . ASP A 1 14 ? -1.593  -3.531  -1.267  1.00 0.00 ? 14 ASP A O    4  
ATOM 3576  C CB   . ASP A 1 14 ? -1.816  -4.793  1.634   1.00 0.00 ? 14 ASP A CB   4  
ATOM 3577  C CG   . ASP A 1 14 ? -3.326  -4.590  1.773   1.00 0.00 ? 14 ASP A CG   4  
ATOM 3578  O OD1  . ASP A 1 14 ? -4.087  -5.553  1.947   1.00 0.00 ? 14 ASP A OD1  4  
ATOM 3579  O OD2  . ASP A 1 14 ? -3.721  -3.364  1.694   1.00 0.00 ? 14 ASP A OD2  4  
ATOM 3580  H H    . ASP A 1 14 ? 0.049   -6.497  1.374   1.00 0.00 ? 14 ASP A H    4  
ATOM 3581  H HA   . ASP A 1 14 ? -2.198  -5.775  -0.259  1.00 0.00 ? 14 ASP A HA   4  
ATOM 3582  H HB2  . ASP A 1 14 ? -1.483  -5.507  2.387   1.00 0.00 ? 14 ASP A HB2  4  
ATOM 3583  H HB3  . ASP A 1 14 ? -1.298  -3.846  1.788   1.00 0.00 ? 14 ASP A HB3  4  
ATOM 3584  N N    . ASN A 1 15 ? 0.500   -3.890  -0.401  1.00 0.00 ? 15 ASN A N    4  
ATOM 3585  C CA   . ASN A 1 15 ? 1.143   -2.803  -1.119  1.00 0.00 ? 15 ASN A CA   4  
ATOM 3586  C C    . ASN A 1 15 ? 1.102   -3.095  -2.621  1.00 0.00 ? 15 ASN A C    4  
ATOM 3587  O O    . ASN A 1 15 ? 0.718   -2.198  -3.385  1.00 0.00 ? 15 ASN A O    4  
ATOM 3588  C CB   . ASN A 1 15 ? 2.609   -2.660  -0.704  1.00 0.00 ? 15 ASN A CB   4  
ATOM 3589  C CG   . ASN A 1 15 ? 3.094   -1.221  -0.893  1.00 0.00 ? 15 ASN A CG   4  
ATOM 3590  O OD1  . ASN A 1 15 ? 3.490   -0.809  -1.970  1.00 0.00 ? 15 ASN A OD1  4  
ATOM 3591  N ND2  . ASN A 1 15 ? 3.040   -0.483  0.212   1.00 0.00 ? 15 ASN A ND2  4  
ATOM 3592  H H    . ASN A 1 15 ? 1.074   -4.458  0.223   1.00 0.00 ? 15 ASN A H    4  
ATOM 3593  H HA   . ASN A 1 15 ? 0.600   -1.878  -0.922  1.00 0.00 ? 15 ASN A HA   4  
ATOM 3594  H HB2  . ASN A 1 15 ? 2.708   -2.934  0.346   1.00 0.00 ? 15 ASN A HB2  4  
ATOM 3595  H HB3  . ASN A 1 15 ? 3.214   -3.338  -1.307  1.00 0.00 ? 15 ASN A HB3  4  
ATOM 3596  H HD21 . ASN A 1 15 ? 2.697   -0.891  1.081   1.00 0.00 ? 15 ASN A HD21 4  
ATOM 3597  H HD22 . ASN A 1 15 ? 3.342   0.491   0.190   1.00 0.00 ? 15 ASN A HD22 4  
ATOM 3598  N N    . TYR A 1 16 ? 1.492   -4.324  -3.006  1.00 0.00 ? 16 TYR A N    4  
ATOM 3599  C CA   . TYR A 1 16 ? 1.480   -4.662  -4.419  1.00 0.00 ? 16 TYR A CA   4  
ATOM 3600  C C    . TYR A 1 16 ? 0.039   -4.648  -4.930  1.00 0.00 ? 16 TYR A C    4  
ATOM 3601  O O    . TYR A 1 16 ? -0.167  -4.238  -6.082  1.00 0.00 ? 16 TYR A O    4  
ATOM 3602  C CB   . TYR A 1 16 ? 2.154   -6.028  -4.641  1.00 0.00 ? 16 TYR A CB   4  
ATOM 3603  C CG   . TYR A 1 16 ? 3.449   -6.227  -3.865  1.00 0.00 ? 16 TYR A CG   4  
ATOM 3604  C CD1  . TYR A 1 16 ? 4.356   -5.154  -3.718  1.00 0.00 ? 16 TYR A CD1  4  
ATOM 3605  C CD2  . TYR A 1 16 ? 3.749   -7.481  -3.284  1.00 0.00 ? 16 TYR A CD2  4  
ATOM 3606  C CE1  . TYR A 1 16 ? 5.556   -5.332  -2.998  1.00 0.00 ? 16 TYR A CE1  4  
ATOM 3607  C CE2  . TYR A 1 16 ? 4.950   -7.660  -2.564  1.00 0.00 ? 16 TYR A CE2  4  
ATOM 3608  C CZ   . TYR A 1 16 ? 5.855   -6.585  -2.421  1.00 0.00 ? 16 TYR A CZ   4  
ATOM 3609  O OH   . TYR A 1 16 ? 7.019   -6.754  -1.725  1.00 0.00 ? 16 TYR A OH   4  
ATOM 3610  H H    . TYR A 1 16 ? 1.793   -5.010  -2.329  1.00 0.00 ? 16 TYR A H    4  
ATOM 3611  H HA   . TYR A 1 16 ? 2.039   -3.895  -4.957  1.00 0.00 ? 16 TYR A HA   4  
ATOM 3612  H HB2  . TYR A 1 16 ? 1.448   -6.821  -4.380  1.00 0.00 ? 16 TYR A HB2  4  
ATOM 3613  H HB3  . TYR A 1 16 ? 2.382   -6.141  -5.702  1.00 0.00 ? 16 TYR A HB3  4  
ATOM 3614  H HD1  . TYR A 1 16 ? 4.135   -4.191  -4.156  1.00 0.00 ? 16 TYR A HD1  4  
ATOM 3615  H HD2  . TYR A 1 16 ? 3.062   -8.308  -3.387  1.00 0.00 ? 16 TYR A HD2  4  
ATOM 3616  H HE1  . TYR A 1 16 ? 6.245   -4.505  -2.891  1.00 0.00 ? 16 TYR A HE1  4  
ATOM 3617  H HE2  . TYR A 1 16 ? 5.172   -8.621  -2.123  1.00 0.00 ? 16 TYR A HE2  4  
ATOM 3618  H HH   . TYR A 1 16 ? 7.104   -6.165  -0.971  1.00 0.00 ? 16 TYR A HH   4  
ATOM 3619  N N    . HIS A 1 17 ? -0.913  -5.093  -4.089  1.00 0.00 ? 17 HIS A N    4  
ATOM 3620  C CA   . HIS A 1 17 ? -2.314  -5.138  -4.466  1.00 0.00 ? 17 HIS A CA   4  
ATOM 3621  C C    . HIS A 1 17 ? -2.841  -3.710  -4.627  1.00 0.00 ? 17 HIS A C    4  
ATOM 3622  O O    . HIS A 1 17 ? -3.700  -3.491  -5.493  1.00 0.00 ? 17 HIS A O    4  
ATOM 3623  C CB   . HIS A 1 17 ? -3.127  -5.958  -3.462  1.00 0.00 ? 17 HIS A CB   4  
ATOM 3624  C CG   . HIS A 1 17 ? -4.380  -5.272  -2.979  1.00 0.00 ? 17 HIS A CG   4  
ATOM 3625  N ND1  . HIS A 1 17 ? -5.583  -5.336  -3.663  1.00 0.00 ? 17 HIS A ND1  4  
ATOM 3626  C CD2  . HIS A 1 17 ? -4.608  -4.506  -1.873  1.00 0.00 ? 17 HIS A CD2  4  
ATOM 3627  C CE1  . HIS A 1 17 ? -6.485  -4.637  -2.990  1.00 0.00 ? 17 HIS A CE1  4  
ATOM 3628  N NE2  . HIS A 1 17 ? -5.879  -4.123  -1.881  1.00 0.00 ? 17 HIS A NE2  4  
ATOM 3629  H H    . HIS A 1 17 ? -0.657  -5.414  -3.155  1.00 0.00 ? 17 HIS A H    4  
ATOM 3630  H HA   . HIS A 1 17 ? -2.361  -5.643  -5.431  1.00 0.00 ? 17 HIS A HA   4  
ATOM 3631  H HB2  . HIS A 1 17 ? -3.400  -6.894  -3.951  1.00 0.00 ? 17 HIS A HB2  4  
ATOM 3632  H HB3  . HIS A 1 17 ? -2.473  -6.177  -2.618  1.00 0.00 ? 17 HIS A HB3  4  
ATOM 3633  H HD1  . HIS A 1 17 ? -5.843  -5.804  -4.530  1.00 0.00 ? 17 HIS A HD1  4  
ATOM 3634  H HD2  . HIS A 1 17 ? -3.957  -4.199  -1.068  1.00 0.00 ? 17 HIS A HD2  4  
ATOM 3635  H HE1  . HIS A 1 17 ? -7.496  -4.563  -3.361  1.00 0.00 ? 17 HIS A HE1  4  
ATOM 3636  N N    . LEU A 1 18 ? -2.322  -2.781  -3.803  1.00 0.00 ? 18 LEU A N    4  
ATOM 3637  C CA   . LEU A 1 18 ? -2.736  -1.389  -3.854  1.00 0.00 ? 18 LEU A CA   4  
ATOM 3638  C C    . LEU A 1 18 ? -2.069  -0.707  -5.049  1.00 0.00 ? 18 LEU A C    4  
ATOM 3639  O O    . LEU A 1 18 ? -2.758  0.032   -5.767  1.00 0.00 ? 18 LEU A O    4  
ATOM 3640  C CB   . LEU A 1 18 ? -2.459  -0.699  -2.517  1.00 0.00 ? 18 LEU A CB   4  
ATOM 3641  C CG   . LEU A 1 18 ? -3.340  -1.131  -1.343  1.00 0.00 ? 18 LEU A CG   4  
ATOM 3642  C CD1  . LEU A 1 18 ? -2.700  -0.746  -0.007  1.00 0.00 ? 18 LEU A CD1  4  
ATOM 3643  C CD2  . LEU A 1 18 ? -4.755  -0.568  -1.484  1.00 0.00 ? 18 LEU A CD2  4  
ATOM 3644  H H    . LEU A 1 18 ? -1.616  -3.046  -3.115  1.00 0.00 ? 18 LEU A H    4  
ATOM 3645  H HA   . LEU A 1 18 ? -3.815  -1.394  -4.005  1.00 0.00 ? 18 LEU A HA   4  
ATOM 3646  H HB2  . LEU A 1 18 ? -1.417  -0.906  -2.274  1.00 0.00 ? 18 LEU A HB2  4  
ATOM 3647  H HB3  . LEU A 1 18 ? -2.576  0.371   -2.695  1.00 0.00 ? 18 LEU A HB3  4  
ATOM 3648  H HG   . LEU A 1 18 ? -3.381  -2.218  -1.405  1.00 0.00 ? 18 LEU A HG   4  
ATOM 3649  H HD11 . LEU A 1 18 ? -2.555  0.332   0.039   1.00 0.00 ? 18 LEU A HD11 4  
ATOM 3650  H HD12 . LEU A 1 18 ? -3.352  -1.068  0.805   1.00 0.00 ? 18 LEU A HD12 4  
ATOM 3651  H HD13 . LEU A 1 18 ? -1.733  -1.239  0.098   1.00 0.00 ? 18 LEU A HD13 4  
ATOM 3652  H HD21 . LEU A 1 18 ? -5.205  -0.922  -2.411  1.00 0.00 ? 18 LEU A HD21 4  
ATOM 3653  H HD22 . LEU A 1 18 ? -5.353  -0.896  -0.632  1.00 0.00 ? 18 LEU A HD22 4  
ATOM 3654  H HD23 . LEU A 1 18 ? -4.723  0.520   -1.496  1.00 0.00 ? 18 LEU A HD23 4  
ATOM 3655  N N    . GLU A 1 19 ? -0.762  -0.962  -5.236  1.00 0.00 ? 19 GLU A N    4  
ATOM 3656  C CA   . GLU A 1 19 ? -0.011  -0.376  -6.333  1.00 0.00 ? 19 GLU A CA   4  
ATOM 3657  C C    . GLU A 1 19 ? -0.497  -0.976  -7.655  1.00 0.00 ? 19 GLU A C    4  
ATOM 3658  O O    . GLU A 1 19 ? -0.501  -0.255  -8.664  1.00 0.00 ? 19 GLU A O    4  
ATOM 3659  C CB   . GLU A 1 19 ? 1.494   -0.582  -6.158  1.00 0.00 ? 19 GLU A CB   4  
ATOM 3660  C CG   . GLU A 1 19 ? 2.242   0.751   -6.232  1.00 0.00 ? 19 GLU A CG   4  
ATOM 3661  C CD   . GLU A 1 19 ? 2.822   0.977   -7.629  1.00 0.00 ? 19 GLU A CD   4  
ATOM 3662  O OE1  . GLU A 1 19 ? 2.154   0.688   -8.633  1.00 0.00 ? 19 GLU A OE1  4  
ATOM 3663  O OE2  . GLU A 1 19 ? 4.013   1.475   -7.651  1.00 0.00 ? 19 GLU A OE2  4  
ATOM 3664  H H    . GLU A 1 19 ? -0.267  -1.584  -4.596  1.00 0.00 ? 19 GLU A H    4  
ATOM 3665  H HA   . GLU A 1 19 ? -0.226  0.693   -6.330  1.00 0.00 ? 19 GLU A HA   4  
ATOM 3666  H HB2  . GLU A 1 19 ? 1.678   -1.038  -5.186  1.00 0.00 ? 19 GLU A HB2  4  
ATOM 3667  H HB3  . GLU A 1 19 ? 1.853   -1.252  -6.940  1.00 0.00 ? 19 GLU A HB3  4  
ATOM 3668  H HG2  . GLU A 1 19 ? 1.548   1.560   -6.001  1.00 0.00 ? 19 GLU A HG2  4  
ATOM 3669  H HG3  . GLU A 1 19 ? 3.043   0.749   -5.493  1.00 0.00 ? 19 GLU A HG3  4  
ATOM 3670  N N    . ASN A 1 20 ? -0.889  -2.262  -7.624  1.00 0.00 ? 20 ASN A N    4  
ATOM 3671  C CA   . ASN A 1 20 ? -1.371  -2.949  -8.810  1.00 0.00 ? 20 ASN A CA   4  
ATOM 3672  C C    . ASN A 1 20 ? -2.704  -2.335  -9.244  1.00 0.00 ? 20 ASN A C    4  
ATOM 3673  O O    . ASN A 1 20 ? -2.954  -2.266  -10.457 1.00 0.00 ? 20 ASN A O    4  
ATOM 3674  C CB   . ASN A 1 20 ? -1.604  -4.435  -8.529  1.00 0.00 ? 20 ASN A CB   4  
ATOM 3675  C CG   . ASN A 1 20 ? -0.344  -5.253  -8.819  1.00 0.00 ? 20 ASN A CG   4  
ATOM 3676  O OD1  . ASN A 1 20 ? 0.545   -4.834  -9.542  1.00 0.00 ? 20 ASN A OD1  4  
ATOM 3677  N ND2  . ASN A 1 20 ? -0.317  -6.438  -8.217  1.00 0.00 ? 20 ASN A ND2  4  
ATOM 3678  H H    . ASN A 1 20 ? -0.854  -2.786  -6.749  1.00 0.00 ? 20 ASN A H    4  
ATOM 3679  H HA   . ASN A 1 20 ? -0.644  -2.823  -9.612  1.00 0.00 ? 20 ASN A HA   4  
ATOM 3680  H HB2  . ASN A 1 20 ? -1.875  -4.560  -7.481  1.00 0.00 ? 20 ASN A HB2  4  
ATOM 3681  H HB3  . ASN A 1 20 ? -2.427  -4.787  -9.152  1.00 0.00 ? 20 ASN A HB3  4  
ATOM 3682  H HD21 . ASN A 1 20 ? -1.096  -6.726  -7.625  1.00 0.00 ? 20 ASN A HD21 4  
ATOM 3683  H HD22 . ASN A 1 20 ? 0.482   -7.058  -8.347  1.00 0.00 ? 20 ASN A HD22 4  
ATOM 3684  N N    . GLU A 1 21 ? -3.518  -1.908  -8.262  1.00 0.00 ? 21 GLU A N    4  
ATOM 3685  C CA   . GLU A 1 21 ? -4.810  -1.306  -8.541  1.00 0.00 ? 21 GLU A CA   4  
ATOM 3686  C C    . GLU A 1 21 ? -4.613  0.163   -8.919  1.00 0.00 ? 21 GLU A C    4  
ATOM 3687  O O    . GLU A 1 21 ? -5.236  0.610   -9.894  1.00 0.00 ? 21 GLU A O    4  
ATOM 3688  C CB   . GLU A 1 21 ? -5.763  -1.444  -7.352  1.00 0.00 ? 21 GLU A CB   4  
ATOM 3689  C CG   . GLU A 1 21 ? -7.171  -1.818  -7.817  1.00 0.00 ? 21 GLU A CG   4  
ATOM 3690  C CD   . GLU A 1 21 ? -8.202  -1.540  -6.721  1.00 0.00 ? 21 GLU A CD   4  
ATOM 3691  O OE1  . GLU A 1 21 ? -7.832  -1.135  -5.610  1.00 0.00 ? 21 GLU A OE1  4  
ATOM 3692  O OE2  . GLU A 1 21 ? -9.428  -1.759  -7.058  1.00 0.00 ? 21 GLU A OE2  4  
ATOM 3693  H H    . GLU A 1 21 ? -3.234  -2.002  -7.287  1.00 0.00 ? 21 GLU A H    4  
ATOM 3694  H HA   . GLU A 1 21 ? -5.231  -1.839  -9.394  1.00 0.00 ? 21 GLU A HA   4  
ATOM 3695  H HB2  . GLU A 1 21 ? -5.389  -2.222  -6.687  1.00 0.00 ? 21 GLU A HB2  4  
ATOM 3696  H HB3  . GLU A 1 21 ? -5.789  -0.498  -6.810  1.00 0.00 ? 21 GLU A HB3  4  
ATOM 3697  H HG2  . GLU A 1 21 ? -7.422  -1.228  -8.698  1.00 0.00 ? 21 GLU A HG2  4  
ATOM 3698  H HG3  . GLU A 1 21 ? -7.186  -2.875  -8.082  1.00 0.00 ? 21 GLU A HG3  4  
ATOM 3699  N N    . VAL A 1 22 ? -3.764  0.874   -8.155  1.00 0.00 ? 22 VAL A N    4  
ATOM 3700  C CA   . VAL A 1 22 ? -3.491  2.277   -8.409  1.00 0.00 ? 22 VAL A CA   4  
ATOM 3701  C C    . VAL A 1 22 ? -2.796  2.420   -9.764  1.00 0.00 ? 22 VAL A C    4  
ATOM 3702  O O    . VAL A 1 22 ? -3.012  3.442   -10.433 1.00 0.00 ? 22 VAL A O    4  
ATOM 3703  C CB   . VAL A 1 22 ? -2.677  2.868   -7.255  1.00 0.00 ? 22 VAL A CB   4  
ATOM 3704  C CG1  . VAL A 1 22 ? -1.995  4.172   -7.676  1.00 0.00 ? 22 VAL A CG1  4  
ATOM 3705  C CG2  . VAL A 1 22 ? -3.554  3.082   -6.019  1.00 0.00 ? 22 VAL A CG2  4  
ATOM 3706  H H    . VAL A 1 22 ? -3.291  0.427   -7.369  1.00 0.00 ? 22 VAL A H    4  
ATOM 3707  H HA   . VAL A 1 22 ? -4.448  2.796   -8.444  1.00 0.00 ? 22 VAL A HA   4  
ATOM 3708  H HB   . VAL A 1 22 ? -1.913  2.127   -7.023  1.00 0.00 ? 22 VAL A HB   4  
ATOM 3709  H HG11 . VAL A 1 22 ? -2.744  4.898   -7.989  1.00 0.00 ? 22 VAL A HG11 4  
ATOM 3710  H HG12 . VAL A 1 22 ? -1.426  4.563   -6.833  1.00 0.00 ? 22 VAL A HG12 4  
ATOM 3711  H HG13 . VAL A 1 22 ? -1.314  3.983   -8.506  1.00 0.00 ? 22 VAL A HG13 4  
ATOM 3712  H HG21 . VAL A 1 22 ? -3.983  2.133   -5.699  1.00 0.00 ? 22 VAL A HG21 4  
ATOM 3713  H HG22 . VAL A 1 22 ? -2.943  3.503   -5.220  1.00 0.00 ? 22 VAL A HG22 4  
ATOM 3714  H HG23 . VAL A 1 22 ? -4.361  3.777   -6.252  1.00 0.00 ? 22 VAL A HG23 4  
ATOM 3715  N N    . ALA A 1 23 ? -1.988  1.411   -10.137 1.00 0.00 ? 23 ALA A N    4  
ATOM 3716  C CA   . ALA A 1 23 ? -1.271  1.424   -11.400 1.00 0.00 ? 23 ALA A CA   4  
ATOM 3717  C C    . ALA A 1 23 ? -2.275  1.528   -12.550 1.00 0.00 ? 23 ALA A C    4  
ATOM 3718  O O    . ALA A 1 23 ? -1.872  1.940   -13.648 1.00 0.00 ? 23 ALA A O    4  
ATOM 3719  C CB   . ALA A 1 23 ? -0.538  0.096   -11.590 1.00 0.00 ? 23 ALA A CB   4  
ATOM 3720  H H    . ALA A 1 23 ? -1.865  0.604   -9.525  1.00 0.00 ? 23 ALA A H    4  
ATOM 3721  H HA   . ALA A 1 23 ? -0.582  2.267   -11.452 1.00 0.00 ? 23 ALA A HA   4  
ATOM 3722  H HB1  . ALA A 1 23 ? 0.160   -0.046  -10.765 1.00 0.00 ? 23 ALA A HB1  4  
ATOM 3723  H HB2  . ALA A 1 23 ? -1.253  -0.727  -11.594 1.00 0.00 ? 23 ALA A HB2  4  
ATOM 3724  H HB3  . ALA A 1 23 ? 0.002   0.101   -12.537 1.00 0.00 ? 23 ALA A HB3  4  
ATOM 3725  N N    . ARG A 1 24 ? -3.540  1.161   -12.280 1.00 0.00 ? 24 ARG A N    4  
ATOM 3726  C CA   . ARG A 1 24 ? -4.588  1.214   -13.286 1.00 0.00 ? 24 ARG A CA   4  
ATOM 3727  C C    . ARG A 1 24 ? -5.292  2.570   -13.213 1.00 0.00 ? 24 ARG A C    4  
ATOM 3728  O O    . ARG A 1 24 ? -5.611  3.127   -14.274 1.00 0.00 ? 24 ARG A O    4  
ATOM 3729  C CB   . ARG A 1 24 ? -5.619  0.101   -13.083 1.00 0.00 ? 24 ARG A CB   4  
ATOM 3730  C CG   . ARG A 1 24 ? -4.980  -1.126  -12.430 1.00 0.00 ? 24 ARG A CG   4  
ATOM 3731  C CD   . ARG A 1 24 ? -6.016  -2.231  -12.209 1.00 0.00 ? 24 ARG A CD   4  
ATOM 3732  N NE   . ARG A 1 24 ? -5.723  -3.381  -13.093 1.00 0.00 ? 24 ARG A NE   4  
ATOM 3733  C CZ   . ARG A 1 24 ? -6.260  -3.549  -14.320 1.00 0.00 ? 24 ARG A CZ   4  
ATOM 3734  N NH1  . ARG A 1 24 ? -7.114  -2.628  -14.787 1.00 0.00 ? 24 ARG A NH1  4  
ATOM 3735  N NH2  . ARG A 1 24 ? -5.944  -4.621  -15.060 1.00 0.00 ? 24 ARG A NH2  4  
ATOM 3736  H H    . ARG A 1 24 ? -3.788  0.834   -11.346 1.00 0.00 ? 24 ARG A H    4  
ATOM 3737  H HA   . ARG A 1 24 ? -4.118  1.110   -14.264 1.00 0.00 ? 24 ARG A HA   4  
ATOM 3738  H HB2  . ARG A 1 24 ? -6.417  0.472   -12.440 1.00 0.00 ? 24 ARG A HB2  4  
ATOM 3739  H HB3  . ARG A 1 24 ? -6.040  -0.171  -14.051 1.00 0.00 ? 24 ARG A HB3  4  
ATOM 3740  H HG2  . ARG A 1 24 ? -4.191  -1.503  -13.080 1.00 0.00 ? 24 ARG A HG2  4  
ATOM 3741  H HG3  . ARG A 1 24 ? -4.543  -0.830  -11.476 1.00 0.00 ? 24 ARG A HG3  4  
ATOM 3742  H HD2  . ARG A 1 24 ? -5.979  -2.562  -11.172 1.00 0.00 ? 24 ARG A HD2  4  
ATOM 3743  H HD3  . ARG A 1 24 ? -7.012  -1.842  -12.422 1.00 0.00 ? 24 ARG A HD3  4  
ATOM 3744  H HE   . ARG A 1 24 ? -5.072  -4.073  -12.722 1.00 0.00 ? 24 ARG A HE   4  
ATOM 3745  H HH11 . ARG A 1 24 ? -7.349  -1.815  -14.218 1.00 0.00 ? 24 ARG A HH11 4  
ATOM 3746  H HH12 . ARG A 1 24 ? -7.528  -2.740  -15.712 1.00 0.00 ? 24 ARG A HH12 4  
ATOM 3747  H HH21 . ARG A 1 24 ? -5.293  -5.318  -14.697 1.00 0.00 ? 24 ARG A HH21 4  
ATOM 3748  H HH22 . ARG A 1 24 ? -6.354  -4.740  -15.987 1.00 0.00 ? 24 ARG A HH22 4  
ATOM 3749  N N    . LEU A 1 25 ? -5.515  3.068   -11.983 1.00 0.00 ? 25 LEU A N    4  
ATOM 3750  C CA   . LEU A 1 25 ? -6.174  4.346   -11.778 1.00 0.00 ? 25 LEU A CA   4  
ATOM 3751  C C    . LEU A 1 25 ? -5.218  5.476   -12.167 1.00 0.00 ? 25 LEU A C    4  
ATOM 3752  O O    . LEU A 1 25 ? -5.674  6.448   -12.787 1.00 0.00 ? 25 LEU A O    4  
ATOM 3753  C CB   . LEU A 1 25 ? -6.702  4.453   -10.346 1.00 0.00 ? 25 LEU A CB   4  
ATOM 3754  C CG   . LEU A 1 25 ? -7.890  3.554   -10.000 1.00 0.00 ? 25 LEU A CG   4  
ATOM 3755  C CD1  . LEU A 1 25 ? -7.439  2.108   -9.787  1.00 0.00 ? 25 LEU A CD1  4  
ATOM 3756  C CD2  . LEU A 1 25 ? -8.657  4.098   -8.794  1.00 0.00 ? 25 LEU A CD2  4  
ATOM 3757  H H    . LEU A 1 25 ? -5.220  2.543   -11.160 1.00 0.00 ? 25 LEU A H    4  
ATOM 3758  H HA   . LEU A 1 25 ? -7.034  4.363   -12.448 1.00 0.00 ? 25 LEU A HA   4  
ATOM 3759  H HB2  . LEU A 1 25 ? -5.866  4.206   -9.691  1.00 0.00 ? 25 LEU A HB2  4  
ATOM 3760  H HB3  . LEU A 1 25 ? -6.971  5.499   -10.197 1.00 0.00 ? 25 LEU A HB3  4  
ATOM 3761  H HG   . LEU A 1 25 ? -8.537  3.588   -10.877 1.00 0.00 ? 25 LEU A HG   4  
ATOM 3762  H HD11 . LEU A 1 25 ? -6.712  2.060   -8.975  1.00 0.00 ? 25 LEU A HD11 4  
ATOM 3763  H HD12 . LEU A 1 25 ? -8.308  1.497   -9.543  1.00 0.00 ? 25 LEU A HD12 4  
ATOM 3764  H HD13 . LEU A 1 25 ? -6.979  1.723   -10.697 1.00 0.00 ? 25 LEU A HD13 4  
ATOM 3765  H HD21 . LEU A 1 25 ? -9.024  5.102   -9.009  1.00 0.00 ? 25 LEU A HD21 4  
ATOM 3766  H HD22 . LEU A 1 25 ? -9.494  3.435   -8.577  1.00 0.00 ? 25 LEU A HD22 4  
ATOM 3767  H HD23 . LEU A 1 25 ? -8.002  4.140   -7.924  1.00 0.00 ? 25 LEU A HD23 4  
ATOM 3768  N N    . LYS A 1 26 ? -3.932  5.329   -11.801 1.00 0.00 ? 26 LYS A N    4  
ATOM 3769  C CA   . LYS A 1 26 ? -2.925  6.331   -12.108 1.00 0.00 ? 26 LYS A CA   4  
ATOM 3770  C C    . LYS A 1 26 ? -2.844  6.517   -13.625 1.00 0.00 ? 26 LYS A C    4  
ATOM 3771  O O    . LYS A 1 26 ? -2.424  7.597   -14.065 1.00 0.00 ? 26 LYS A O    4  
ATOM 3772  C CB   . LYS A 1 26 ? -1.588  5.962   -11.463 1.00 0.00 ? 26 LYS A CB   4  
ATOM 3773  C CG   . LYS A 1 26 ? -1.294  6.858   -10.259 1.00 0.00 ? 26 LYS A CG   4  
ATOM 3774  C CD   . LYS A 1 26 ? -2.553  7.076   -9.417  1.00 0.00 ? 26 LYS A CD   4  
ATOM 3775  C CE   . LYS A 1 26 ? -3.176  8.444   -9.707  1.00 0.00 ? 26 LYS A CE   4  
ATOM 3776  N NZ   . LYS A 1 26 ? -3.049  9.326   -8.535  1.00 0.00 ? 26 LYS A NZ   4  
ATOM 3777  H H    . LYS A 1 26 ? -3.639  4.496   -11.290 1.00 0.00 ? 26 LYS A H    4  
ATOM 3778  H HA   . LYS A 1 26 ? -3.264  7.262   -11.654 1.00 0.00 ? 26 LYS A HA   4  
ATOM 3779  H HB2  . LYS A 1 26 ? -1.629  4.924   -11.131 1.00 0.00 ? 26 LYS A HB2  4  
ATOM 3780  H HB3  . LYS A 1 26 ? -0.796  6.065   -12.206 1.00 0.00 ? 26 LYS A HB3  4  
ATOM 3781  H HG2  . LYS A 1 26 ? -0.533  6.383   -9.641  1.00 0.00 ? 26 LYS A HG2  4  
ATOM 3782  H HG3  . LYS A 1 26 ? -0.916  7.816   -10.615 1.00 0.00 ? 26 LYS A HG3  4  
ATOM 3783  H HD2  . LYS A 1 26 ? -3.278  6.299   -9.658  1.00 0.00 ? 26 LYS A HD2  4  
ATOM 3784  H HD3  . LYS A 1 26 ? -2.291  7.003   -8.363  1.00 0.00 ? 26 LYS A HD3  4  
ATOM 3785  H HE2  . LYS A 1 26 ? -2.661  8.901   -10.552 1.00 0.00 ? 26 LYS A HE2  4  
ATOM 3786  H HE3  . LYS A 1 26 ? -4.228  8.311   -9.960  1.00 0.00 ? 26 LYS A HE3  4  
ATOM 3787  H HZ1  . LYS A 1 26 ? -2.065  9.449   -8.297  1.00 0.00 ? 26 LYS A HZ1  4  
ATOM 3788  H HZ2  . LYS A 1 26 ? -3.470  10.228  -8.752  1.00 0.00 ? 26 LYS A HZ2  4  
ATOM 3789  H HZ3  . LYS A 1 26 ? -3.534  8.916   -7.737  1.00 0.00 ? 26 LYS A HZ3  4  
ATOM 3790  N N    . LYS A 1 27 ? -3.243  5.479   -14.382 1.00 0.00 ? 27 LYS A N    4  
ATOM 3791  C CA   . LYS A 1 27 ? -3.215  5.528   -15.834 1.00 0.00 ? 27 LYS A CA   4  
ATOM 3792  C C    . LYS A 1 27 ? -4.459  6.264   -16.338 1.00 0.00 ? 27 LYS A C    4  
ATOM 3793  O O    . LYS A 1 27 ? -4.470  6.669   -17.509 1.00 0.00 ? 27 LYS A O    4  
ATOM 3794  C CB   . LYS A 1 27 ? -3.055  4.122   -16.415 1.00 0.00 ? 27 LYS A CB   4  
ATOM 3795  C CG   . LYS A 1 27 ? -2.096  4.128   -17.608 1.00 0.00 ? 27 LYS A CG   4  
ATOM 3796  C CD   . LYS A 1 27 ? -2.188  2.818   -18.391 1.00 0.00 ? 27 LYS A CD   4  
ATOM 3797  C CE   . LYS A 1 27 ? -1.970  1.613   -17.473 1.00 0.00 ? 27 LYS A CE   4  
ATOM 3798  N NZ   . LYS A 1 27 ? -0.943  0.719   -18.030 1.00 0.00 ? 27 LYS A NZ   4  
ATOM 3799  H H    . LYS A 1 27 ? -3.577  4.623   -13.938 1.00 0.00 ? 27 LYS A H    4  
ATOM 3800  H HA   . LYS A 1 27 ? -2.329  6.101   -16.107 1.00 0.00 ? 27 LYS A HA   4  
ATOM 3801  H HB2  . LYS A 1 27 ? -2.656  3.463   -15.643 1.00 0.00 ? 27 LYS A HB2  4  
ATOM 3802  H HB3  . LYS A 1 27 ? -4.032  3.754   -16.726 1.00 0.00 ? 27 LYS A HB3  4  
ATOM 3803  H HG2  . LYS A 1 27 ? -2.358  4.955   -18.268 1.00 0.00 ? 27 LYS A HG2  4  
ATOM 3804  H HG3  . LYS A 1 27 ? -1.079  4.274   -17.243 1.00 0.00 ? 27 LYS A HG3  4  
ATOM 3805  H HD2  . LYS A 1 27 ? -3.176  2.745   -18.845 1.00 0.00 ? 27 LYS A HD2  4  
ATOM 3806  H HD3  . LYS A 1 27 ? -1.435  2.824   -19.180 1.00 0.00 ? 27 LYS A HD3  4  
ATOM 3807  H HE2  . LYS A 1 27 ? -1.643  1.963   -16.493 1.00 0.00 ? 27 LYS A HE2  4  
ATOM 3808  H HE3  . LYS A 1 27 ? -2.912  1.075   -17.361 1.00 0.00 ? 27 LYS A HE3  4  
ATOM 3809  H HZ1  . LYS A 1 27 ? -0.063  1.223   -18.135 1.00 0.00 ? 27 LYS A HZ1  4  
ATOM 3810  H HZ2  . LYS A 1 27 ? -0.817  -0.075  -17.401 1.00 0.00 ? 27 LYS A HZ2  4  
ATOM 3811  H HZ3  . LYS A 1 27 ? -1.239  0.375   -18.943 1.00 0.00 ? 27 LYS A HZ3  4  
ATOM 3812  N N    . LEU A 1 28 ? -5.466  6.418   -15.458 1.00 0.00 ? 28 LEU A N    4  
ATOM 3813  C CA   . LEU A 1 28 ? -6.699  7.097   -15.812 1.00 0.00 ? 28 LEU A CA   4  
ATOM 3814  C C    . LEU A 1 28 ? -6.731  8.471   -15.140 1.00 0.00 ? 28 LEU A C    4  
ATOM 3815  O O    . LEU A 1 28 ? -7.271  9.410   -15.743 1.00 0.00 ? 28 LEU A O    4  
ATOM 3816  C CB   . LEU A 1 28 ? -7.909  6.221   -15.478 1.00 0.00 ? 28 LEU A CB   4  
ATOM 3817  C CG   . LEU A 1 28 ? -8.926  6.024   -16.604 1.00 0.00 ? 28 LEU A CG   4  
ATOM 3818  C CD1  . LEU A 1 28 ? -8.442  4.971   -17.602 1.00 0.00 ? 28 LEU A CD1  4  
ATOM 3819  C CD2  . LEU A 1 28 ? -10.309 5.688   -16.041 1.00 0.00 ? 28 LEU A CD2  4  
ATOM 3820  H H    . LEU A 1 28 ? -5.374  6.052   -14.510 1.00 0.00 ? 28 LEU A H    4  
ATOM 3821  H HA   . LEU A 1 28 ? -6.679  7.232   -16.894 1.00 0.00 ? 28 LEU A HA   4  
ATOM 3822  H HB2  . LEU A 1 28 ? -7.512  5.249   -15.184 1.00 0.00 ? 28 LEU A HB2  4  
ATOM 3823  H HB3  . LEU A 1 28 ? -8.392  6.682   -14.617 1.00 0.00 ? 28 LEU A HB3  4  
ATOM 3824  H HG   . LEU A 1 28 ? -8.975  6.985   -17.115 1.00 0.00 ? 28 LEU A HG   4  
ATOM 3825  H HD11 . LEU A 1 28 ? -8.289  4.019   -17.093 1.00 0.00 ? 28 LEU A HD11 4  
ATOM 3826  H HD12 . LEU A 1 28 ? -9.189  4.856   -18.388 1.00 0.00 ? 28 LEU A HD12 4  
ATOM 3827  H HD13 . LEU A 1 28 ? -7.500  5.288   -18.051 1.00 0.00 ? 28 LEU A HD13 4  
ATOM 3828  H HD21 . LEU A 1 28 ? -10.651 6.494   -15.392 1.00 0.00 ? 28 LEU A HD21 4  
ATOM 3829  H HD22 . LEU A 1 28 ? -11.006 5.554   -16.869 1.00 0.00 ? 28 LEU A HD22 4  
ATOM 3830  H HD23 . LEU A 1 28 ? -10.261 4.764   -15.465 1.00 0.00 ? 28 LEU A HD23 4  
ATOM 3831  N N    . VAL A 1 29 ? -6.162  8.561   -13.925 1.00 0.00 ? 29 VAL A N    4  
ATOM 3832  C CA   . VAL A 1 29 ? -6.125  9.808   -13.181 1.00 0.00 ? 29 VAL A CA   4  
ATOM 3833  C C    . VAL A 1 29 ? -4.708  10.383  -13.227 1.00 0.00 ? 29 VAL A C    4  
ATOM 3834  O O    . VAL A 1 29 ? -4.545  11.510  -13.717 1.00 0.00 ? 29 VAL A O    4  
ATOM 3835  C CB   . VAL A 1 29 ? -6.632  9.581   -11.755 1.00 0.00 ? 29 VAL A CB   4  
ATOM 3836  C CG1  . VAL A 1 29 ? -6.926  10.912  -11.061 1.00 0.00 ? 29 VAL A CG1  4  
ATOM 3837  C CG2  . VAL A 1 29 ? -7.865  8.676   -11.749 1.00 0.00 ? 29 VAL A CG2  4  
ATOM 3838  H H    . VAL A 1 29 ? -5.737  7.736   -13.499 1.00 0.00 ? 29 VAL A H    4  
ATOM 3839  H HA   . VAL A 1 29 ? -6.806  10.502  -13.674 1.00 0.00 ? 29 VAL A HA   4  
ATOM 3840  H HB   . VAL A 1 29 ? -5.820  9.079   -11.229 1.00 0.00 ? 29 VAL A HB   4  
ATOM 3841  H HG11 . VAL A 1 29 ? -7.680  11.465  -11.620 1.00 0.00 ? 29 VAL A HG11 4  
ATOM 3842  H HG12 . VAL A 1 29 ? -7.285  10.715  -10.051 1.00 0.00 ? 29 VAL A HG12 4  
ATOM 3843  H HG13 . VAL A 1 29 ? -6.017  11.511  -11.004 1.00 0.00 ? 29 VAL A HG13 4  
ATOM 3844  H HG21 . VAL A 1 29 ? -7.619  7.711   -12.194 1.00 0.00 ? 29 VAL A HG21 4  
ATOM 3845  H HG22 . VAL A 1 29 ? -8.198  8.537   -10.721 1.00 0.00 ? 29 VAL A HG22 4  
ATOM 3846  H HG23 . VAL A 1 29 ? -8.668  9.137   -12.323 1.00 0.00 ? 29 VAL A HG23 4  
ATOM 3847  N N    . GLY A 1 30 ? -3.727  9.610   -12.726 1.00 0.00 ? 30 GLY A N    4  
ATOM 3848  C CA   . GLY A 1 30 ? -2.340  10.040  -12.710 1.00 0.00 ? 30 GLY A CA   4  
ATOM 3849  C C    . GLY A 1 30 ? -1.862  10.259  -14.147 1.00 0.00 ? 30 GLY A C    4  
ATOM 3850  O O    . GLY A 1 30 ? -0.703  10.658  -14.329 1.00 0.00 ? 30 GLY A O    4  
ATOM 3851  H H    . GLY A 1 30 ? -3.948  8.692   -12.341 1.00 0.00 ? 30 GLY A H    4  
ATOM 3852  H HA2  . GLY A 1 30 ? -2.249  10.977  -12.160 1.00 0.00 ? 30 GLY A HA2  4  
ATOM 3853  H HA3  . GLY A 1 30 ? -1.724  9.283   -12.225 1.00 0.00 ? 30 GLY A HA3  4  
ATOM 3854  N N    . GLU A 1 31 ? -2.750  9.998   -15.123 1.00 0.00 ? 31 GLU A N    4  
ATOM 3855  C CA   . GLU A 1 31 ? -2.421  10.165  -16.529 1.00 0.00 ? 31 GLU A CA   4  
ATOM 3856  C C    . GLU A 1 31 ? -1.654  11.476  -16.715 1.00 0.00 ? 31 GLU A C    4  
ATOM 3857  O O    . GLU A 1 31 ? -2.087  12.497  -16.162 1.00 0.00 ? 31 GLU A O    4  
ATOM 3858  C CB   . GLU A 1 31 ? -3.674  10.134  -17.406 1.00 0.00 ? 31 GLU A CB   4  
ATOM 3859  C CG   . GLU A 1 31 ? -4.228  11.543  -17.623 1.00 0.00 ? 31 GLU A CG   4  
ATOM 3860  C CD   . GLU A 1 31 ? -5.564  11.498  -18.369 1.00 0.00 ? 31 GLU A CD   4  
ATOM 3861  O OE1  . GLU A 1 31 ? -5.487  11.122  -19.601 1.00 0.00 ? 31 GLU A OE1  4  
ATOM 3862  O OE2  . GLU A 1 31 ? -6.610  11.814  -17.784 1.00 0.00 ? 31 GLU A OE2  4  
ATOM 3863  H H    . GLU A 1 31 ? -3.687  9.672   -14.887 1.00 0.00 ? 31 GLU A H    4  
ATOM 3864  H HA   . GLU A 1 31 ? -1.774  9.333   -16.804 1.00 0.00 ? 31 GLU A HA   4  
ATOM 3865  H HB2  . GLU A 1 31 ? -3.417  9.700   -18.373 1.00 0.00 ? 31 GLU A HB2  4  
ATOM 3866  H HB3  . GLU A 1 31 ? -4.426  9.508   -16.926 1.00 0.00 ? 31 GLU A HB3  4  
ATOM 3867  H HG2  . GLU A 1 31 ? -4.379  12.016  -16.653 1.00 0.00 ? 31 GLU A HG2  4  
ATOM 3868  H HG3  . GLU A 1 31 ? -3.503  12.124  -18.194 1.00 0.00 ? 31 GLU A HG3  4  
ATOM 3869  N N    . ARG A 1 32 ? -0.547  11.422  -17.479 1.00 0.00 ? 32 ARG A N    4  
ATOM 3870  C CA   . ARG A 1 32 ? 0.269   12.596  -17.734 1.00 0.00 ? 32 ARG A CA   4  
ATOM 3871  C C    . ARG A 1 32 ? -0.639  13.783  -18.059 1.00 0.00 ? 32 ARG A C    4  
ATOM 3872  O O    . ARG A 1 32 ? -0.158  14.881  -18.331 1.00 0.00 ? 32 ARG A O    4  
ATOM 3873  C CB   . ARG A 1 32 ? 1.235   12.369  -18.900 1.00 0.00 ? 32 ARG A CB   4  
ATOM 3874  C CG   . ARG A 1 32 ? 1.635   10.895  -19.000 1.00 0.00 ? 32 ARG A CG   4  
ATOM 3875  C CD   . ARG A 1 32 ? 0.819   10.178  -20.077 1.00 0.00 ? 32 ARG A CD   4  
ATOM 3876  N NE   . ARG A 1 32 ? -0.556  10.725  -20.119 1.00 0.00 ? 32 ARG A NE   4  
ATOM 3877  C CZ   . ARG A 1 32 ? -1.227  11.002  -21.257 1.00 0.00 ? 32 ARG A CZ   4  
ATOM 3878  N NH1  . ARG A 1 32 ? -0.629  10.775  -22.435 1.00 0.00 ? 32 ARG A NH1  4  
ATOM 3879  N NH2  . ARG A 1 32 ? -2.471  11.497  -21.211 1.00 0.00 ? 32 ARG A NH2  4  
ATOM 3880  H H    . ARG A 1 32 ? -0.260  10.538  -17.898 1.00 0.00 ? 32 ARG A H    4  
ATOM 3881  H HA   . ARG A 1 32 ? 0.830   12.816  -16.827 1.00 0.00 ? 32 ARG A HA   4  
ATOM 3882  H HB2  . ARG A 1 32 ? 0.747   12.668  -19.827 1.00 0.00 ? 32 ARG A HB2  4  
ATOM 3883  H HB3  . ARG A 1 32 ? 2.121   12.985  -18.749 1.00 0.00 ? 32 ARG A HB3  4  
ATOM 3884  H HG2  . ARG A 1 32 ? 2.693   10.833  -19.256 1.00 0.00 ? 32 ARG A HG2  4  
ATOM 3885  H HG3  . ARG A 1 32 ? 1.475   10.419  -18.033 1.00 0.00 ? 32 ARG A HG3  4  
ATOM 3886  H HD2  . ARG A 1 32 ? 1.289   10.327  -21.049 1.00 0.00 ? 32 ARG A HD2  4  
ATOM 3887  H HD3  . ARG A 1 32 ? 0.787   9.110   -19.858 1.00 0.00 ? 32 ARG A HD3  4  
ATOM 3888  H HE   . ARG A 1 32 ? -0.996  10.892  -19.214 1.00 0.00 ? 32 ARG A HE   4  
ATOM 3889  H HH11 . ARG A 1 32 ? 0.319   10.399  -22.461 1.00 0.00 ? 32 ARG A HH11 4  
ATOM 3890  H HH12 . ARG A 1 32 ? -1.121  10.979  -23.305 1.00 0.00 ? 32 ARG A HH12 4  
ATOM 3891  H HH21 . ARG A 1 32 ? -2.919  11.666  -20.310 1.00 0.00 ? 32 ARG A HH21 4  
ATOM 3892  H HH22 . ARG A 1 32 ? -2.970  11.702  -22.076 1.00 0.00 ? 32 ARG A HH22 4  
ATOM 3893  N N    . MET B 1 1  ? 15.976  -7.024  12.834  1.00 0.00 ? 1  MET B N    4  
ATOM 3894  C CA   . MET B 1 1  ? 14.809  -6.711  13.642  1.00 0.00 ? 1  MET B CA   4  
ATOM 3895  C C    . MET B 1 1  ? 14.692  -5.192  13.792  1.00 0.00 ? 1  MET B C    4  
ATOM 3896  O O    . MET B 1 1  ? 13.575  -4.671  13.658  1.00 0.00 ? 1  MET B O    4  
ATOM 3897  C CB   . MET B 1 1  ? 14.929  -7.354  15.025  1.00 0.00 ? 1  MET B CB   4  
ATOM 3898  C CG   . MET B 1 1  ? 13.567  -7.837  15.525  1.00 0.00 ? 1  MET B CG   4  
ATOM 3899  S SD   . MET B 1 1  ? 13.468  -7.656  17.331  1.00 0.00 ? 1  MET B SD   4  
ATOM 3900  C CE   . MET B 1 1  ? 12.695  -9.243  17.764  1.00 0.00 ? 1  MET B CE   4  
ATOM 3901  H H    . MET B 1 1  ? 16.633  -7.717  13.194  1.00 0.00 ? 1  MET B H    4  
ATOM 3902  H HA   . MET B 1 1  ? 13.919  -7.087  13.138  1.00 0.00 ? 1  MET B HA   4  
ATOM 3903  H HB2  . MET B 1 1  ? 15.607  -8.205  14.962  1.00 0.00 ? 1  MET B HB2  4  
ATOM 3904  H HB3  . MET B 1 1  ? 15.342  -6.622  15.719  1.00 0.00 ? 1  MET B HB3  4  
ATOM 3905  H HG2  . MET B 1 1  ? 12.779  -7.241  15.065  1.00 0.00 ? 1  MET B HG2  4  
ATOM 3906  H HG3  . MET B 1 1  ? 13.429  -8.882  15.248  1.00 0.00 ? 1  MET B HG3  4  
ATOM 3907  H HE1  . MET B 1 1  ? 13.326  -10.066 17.430  1.00 0.00 ? 1  MET B HE1  4  
ATOM 3908  H HE2  . MET B 1 1  ? 12.564  -9.290  18.845  1.00 0.00 ? 1  MET B HE2  4  
ATOM 3909  H HE3  . MET B 1 1  ? 11.720  -9.324  17.285  1.00 0.00 ? 1  MET B HE3  4  
ATOM 3910  N N    . ASP B 1 2  ? 15.828  -4.525  14.064  1.00 0.00 ? 2  ASP B N    4  
ATOM 3911  C CA   . ASP B 1 2  ? 15.852  -3.081  14.230  1.00 0.00 ? 2  ASP B CA   4  
ATOM 3912  C C    . ASP B 1 2  ? 15.201  -2.421  13.012  1.00 0.00 ? 2  ASP B C    4  
ATOM 3913  O O    . ASP B 1 2  ? 14.431  -1.467  13.200  1.00 0.00 ? 2  ASP B O    4  
ATOM 3914  C CB   . ASP B 1 2  ? 17.287  -2.563  14.337  1.00 0.00 ? 2  ASP B CB   4  
ATOM 3915  C CG   . ASP B 1 2  ? 18.269  -3.517  15.022  1.00 0.00 ? 2  ASP B CG   4  
ATOM 3916  O OD1  . ASP B 1 2  ? 18.714  -4.469  14.274  1.00 0.00 ? 2  ASP B OD1  4  
ATOM 3917  O OD2  . ASP B 1 2  ? 18.594  -3.356  16.208  1.00 0.00 ? 2  ASP B OD2  4  
ATOM 3918  H H    . ASP B 1 2  ? 16.707  -5.032  14.158  1.00 0.00 ? 2  ASP B H    4  
ATOM 3919  H HA   . ASP B 1 2  ? 15.284  -2.818  15.123  1.00 0.00 ? 2  ASP B HA   4  
ATOM 3920  H HB2  . ASP B 1 2  ? 17.631  -2.368  13.322  1.00 0.00 ? 2  ASP B HB2  4  
ATOM 3921  H HB3  . ASP B 1 2  ? 17.242  -1.621  14.884  1.00 0.00 ? 2  ASP B HB3  4  
ATOM 3922  N N    . ALA B 1 3  ? 15.516  -2.933  11.810  1.00 0.00 ? 3  ALA B N    4  
ATOM 3923  C CA   . ALA B 1 3  ? 14.966  -2.396  10.576  1.00 0.00 ? 3  ALA B CA   4  
ATOM 3924  C C    . ALA B 1 3  ? 13.572  -2.986  10.346  1.00 0.00 ? 3  ALA B C    4  
ATOM 3925  O O    . ALA B 1 3  ? 12.816  -2.415  9.547   1.00 0.00 ? 3  ALA B O    4  
ATOM 3926  C CB   . ALA B 1 3  ? 15.823  -2.846  9.391   1.00 0.00 ? 3  ALA B CB   4  
ATOM 3927  H H    . ALA B 1 3  ? 16.160  -3.721  11.743  1.00 0.00 ? 3  ALA B H    4  
ATOM 3928  H HA   . ALA B 1 3  ? 14.889  -1.310  10.619  1.00 0.00 ? 3  ALA B HA   4  
ATOM 3929  H HB1  . ALA B 1 3  ? 16.842  -2.486  9.534   1.00 0.00 ? 3  ALA B HB1  4  
ATOM 3930  H HB2  . ALA B 1 3  ? 15.835  -3.934  9.334   1.00 0.00 ? 3  ALA B HB2  4  
ATOM 3931  H HB3  . ALA B 1 3  ? 15.414  -2.446  8.464   1.00 0.00 ? 3  ALA B HB3  4  
ATOM 3932  N N    . ILE B 1 4  ? 13.268  -4.098  11.038  1.00 0.00 ? 4  ILE B N    4  
ATOM 3933  C CA   . ILE B 1 4  ? 11.978  -4.755  10.911  1.00 0.00 ? 4  ILE B CA   4  
ATOM 3934  C C    . ILE B 1 4  ? 10.911  -3.919  11.623  1.00 0.00 ? 4  ILE B C    4  
ATOM 3935  O O    . ILE B 1 4  ? 9.846   -3.694  11.030  1.00 0.00 ? 4  ILE B O    4  
ATOM 3936  C CB   . ILE B 1 4  ? 12.061  -6.199  11.407  1.00 0.00 ? 4  ILE B CB   4  
ATOM 3937  C CG1  . ILE B 1 4  ? 13.079  -7.001  10.594  1.00 0.00 ? 4  ILE B CG1  4  
ATOM 3938  C CG2  . ILE B 1 4  ? 10.680  -6.860  11.407  1.00 0.00 ? 4  ILE B CG2  4  
ATOM 3939  C CD1  . ILE B 1 4  ? 12.529  -8.382  10.235  1.00 0.00 ? 4  ILE B CD1  4  
ATOM 3940  H H    . ILE B 1 4  ? 13.951  -4.504  11.678  1.00 0.00 ? 4  ILE B H    4  
ATOM 3941  H HA   . ILE B 1 4  ? 11.751  -4.785  9.844   1.00 0.00 ? 4  ILE B HA   4  
ATOM 3942  H HB   . ILE B 1 4  ? 12.408  -6.126  12.438  1.00 0.00 ? 4  ILE B HB   4  
ATOM 3943  H HG12 . ILE B 1 4  ? 13.304  -6.459  9.676   1.00 0.00 ? 4  ILE B HG12 4  
ATOM 3944  H HG13 . ILE B 1 4  ? 13.994  -7.105  11.177  1.00 0.00 ? 4  ILE B HG13 4  
ATOM 3945  H HG21 . ILE B 1 4  ? 10.266  -6.856  10.399  1.00 0.00 ? 4  ILE B HG21 4  
ATOM 3946  H HG22 . ILE B 1 4  ? 10.777  -7.884  11.766  1.00 0.00 ? 4  ILE B HG22 4  
ATOM 3947  H HG23 . ILE B 1 4  ? 10.007  -6.313  12.069  1.00 0.00 ? 4  ILE B HG23 4  
ATOM 3948  H HD11 . ILE B 1 4  ? 11.614  -8.278  9.652   1.00 0.00 ? 4  ILE B HD11 4  
ATOM 3949  H HD12 . ILE B 1 4  ? 13.279  -8.925  9.659   1.00 0.00 ? 4  ILE B HD12 4  
ATOM 3950  H HD13 . ILE B 1 4  ? 12.308  -8.942  11.144  1.00 0.00 ? 4  ILE B HD13 4  
ATOM 3951  N N    . LYS B 1 5  ? 11.213  -3.485  12.859  1.00 0.00 ? 5  LYS B N    4  
ATOM 3952  C CA   . LYS B 1 5  ? 10.287  -2.684  13.641  1.00 0.00 ? 5  LYS B CA   4  
ATOM 3953  C C    . LYS B 1 5  ? 9.847   -1.472  12.817  1.00 0.00 ? 5  LYS B C    4  
ATOM 3954  O O    . LYS B 1 5  ? 8.690   -1.050  12.961  1.00 0.00 ? 5  LYS B O    4  
ATOM 3955  C CB   . LYS B 1 5  ? 10.905  -2.318  14.992  1.00 0.00 ? 5  LYS B CB   4  
ATOM 3956  C CG   . LYS B 1 5  ? 11.229  -3.573  15.804  1.00 0.00 ? 5  LYS B CG   4  
ATOM 3957  C CD   . LYS B 1 5  ? 12.740  -3.728  15.992  1.00 0.00 ? 5  LYS B CD   4  
ATOM 3958  C CE   . LYS B 1 5  ? 13.165  -3.298  17.398  1.00 0.00 ? 5  LYS B CE   4  
ATOM 3959  N NZ   . LYS B 1 5  ? 12.859  -4.355  18.375  1.00 0.00 ? 5  LYS B NZ   4  
ATOM 3960  H H    . LYS B 1 5  ? 12.116  -3.716  13.274  1.00 0.00 ? 5  LYS B H    4  
ATOM 3961  H HA   . LYS B 1 5  ? 9.420   -3.314  13.835  1.00 0.00 ? 5  LYS B HA   4  
ATOM 3962  H HB2  . LYS B 1 5  ? 11.824  -1.757  14.821  1.00 0.00 ? 5  LYS B HB2  4  
ATOM 3963  H HB3  . LYS B 1 5  ? 10.203  -1.690  15.543  1.00 0.00 ? 5  LYS B HB3  4  
ATOM 3964  H HG2  . LYS B 1 5  ? 10.757  -3.493  16.783  1.00 0.00 ? 5  LYS B HG2  4  
ATOM 3965  H HG3  . LYS B 1 5  ? 10.828  -4.443  15.285  1.00 0.00 ? 5  LYS B HG3  4  
ATOM 3966  H HD2  . LYS B 1 5  ? 13.009  -4.775  15.845  1.00 0.00 ? 5  LYS B HD2  4  
ATOM 3967  H HD3  . LYS B 1 5  ? 13.254  -3.122  15.246  1.00 0.00 ? 5  LYS B HD3  4  
ATOM 3968  H HE2  . LYS B 1 5  ? 14.238  -3.107  17.404  1.00 0.00 ? 5  LYS B HE2  4  
ATOM 3969  H HE3  . LYS B 1 5  ? 12.640  -2.381  17.665  1.00 0.00 ? 5  LYS B HE3  4  
ATOM 3970  H HZ1  . LYS B 1 5  ? 13.351  -5.213  18.125  1.00 0.00 ? 5  LYS B HZ1  4  
ATOM 3971  H HZ2  . LYS B 1 5  ? 13.151  -4.044  19.302  1.00 0.00 ? 5  LYS B HZ2  4  
ATOM 3972  H HZ3  . LYS B 1 5  ? 11.856  -4.538  18.387  1.00 0.00 ? 5  LYS B HZ3  4  
ATOM 3973  N N    . LYS B 1 6  ? 10.762  -0.944  11.985  1.00 0.00 ? 6  LYS B N    4  
ATOM 3974  C CA   . LYS B 1 6  ? 10.470  0.208   11.149  1.00 0.00 ? 6  LYS B CA   4  
ATOM 3975  C C    . LYS B 1 6  ? 9.919   -0.270  9.804   1.00 0.00 ? 6  LYS B C    4  
ATOM 3976  O O    . LYS B 1 6  ? 9.156   0.481   9.179   1.00 0.00 ? 6  LYS B O    4  
ATOM 3977  C CB   . LYS B 1 6  ? 11.703  1.105   11.024  1.00 0.00 ? 6  LYS B CB   4  
ATOM 3978  C CG   . LYS B 1 6  ? 12.613  0.960   12.245  1.00 0.00 ? 6  LYS B CG   4  
ATOM 3979  C CD   . LYS B 1 6  ? 13.400  2.249   12.500  1.00 0.00 ? 6  LYS B CD   4  
ATOM 3980  C CE   . LYS B 1 6  ? 13.936  2.831   11.190  1.00 0.00 ? 6  LYS B CE   4  
ATOM 3981  N NZ   . LYS B 1 6  ? 15.383  3.079   11.291  1.00 0.00 ? 6  LYS B NZ   4  
ATOM 3982  H H    . LYS B 1 6  ? 11.695  -1.353  11.928  1.00 0.00 ? 6  LYS B H    4  
ATOM 3983  H HA   . LYS B 1 6  ? 9.699   0.778   11.667  1.00 0.00 ? 6  LYS B HA   4  
ATOM 3984  H HB2  . LYS B 1 6  ? 12.259  0.821   10.130  1.00 0.00 ? 6  LYS B HB2  4  
ATOM 3985  H HB3  . LYS B 1 6  ? 11.377  2.141   10.924  1.00 0.00 ? 6  LYS B HB3  4  
ATOM 3986  H HG2  . LYS B 1 6  ? 12.000  0.741   13.119  1.00 0.00 ? 6  LYS B HG2  4  
ATOM 3987  H HG3  . LYS B 1 6  ? 13.301  0.132   12.077  1.00 0.00 ? 6  LYS B HG3  4  
ATOM 3988  H HD2  . LYS B 1 6  ? 12.740  2.978   12.968  1.00 0.00 ? 6  LYS B HD2  4  
ATOM 3989  H HD3  . LYS B 1 6  ? 14.226  2.031   13.175  1.00 0.00 ? 6  LYS B HD3  4  
ATOM 3990  H HE2  . LYS B 1 6  ? 13.753  2.123   10.381  1.00 0.00 ? 6  LYS B HE2  4  
ATOM 3991  H HE3  . LYS B 1 6  ? 13.414  3.762   10.972  1.00 0.00 ? 6  LYS B HE3  4  
ATOM 3992  H HZ1  . LYS B 1 6  ? 15.872  2.207   11.496  1.00 0.00 ? 6  LYS B HZ1  4  
ATOM 3993  H HZ2  . LYS B 1 6  ? 15.716  3.465   10.408  1.00 0.00 ? 6  LYS B HZ2  4  
ATOM 3994  H HZ3  . LYS B 1 6  ? 15.571  3.747   12.039  1.00 0.00 ? 6  LYS B HZ3  4  
ATOM 3995  N N    . LYS B 1 7  ? 10.308  -1.489  9.393   1.00 0.00 ? 7  LYS B N    4  
ATOM 3996  C CA   . LYS B 1 7  ? 9.856   -2.059  8.135   1.00 0.00 ? 7  LYS B CA   4  
ATOM 3997  C C    . LYS B 1 7  ? 8.327   -2.074  8.107   1.00 0.00 ? 7  LYS B C    4  
ATOM 3998  O O    . LYS B 1 7  ? 7.750   -1.596  7.120   1.00 0.00 ? 7  LYS B O    4  
ATOM 3999  C CB   . LYS B 1 7  ? 10.489  -3.434  7.911   1.00 0.00 ? 7  LYS B CB   4  
ATOM 4000  C CG   . LYS B 1 7  ? 10.085  -4.008  6.551   1.00 0.00 ? 7  LYS B CG   4  
ATOM 4001  C CD   . LYS B 1 7  ? 10.343  -2.998  5.431   1.00 0.00 ? 7  LYS B CD   4  
ATOM 4002  C CE   . LYS B 1 7  ? 10.872  -3.695  4.176   1.00 0.00 ? 7  LYS B CE   4  
ATOM 4003  N NZ   . LYS B 1 7  ? 9.757   -4.134  3.321   1.00 0.00 ? 7  LYS B NZ   4  
ATOM 4004  H H    . LYS B 1 7  ? 10.940  -2.044  9.970   1.00 0.00 ? 7  LYS B H    4  
ATOM 4005  H HA   . LYS B 1 7  ? 10.219  -1.397  7.348   1.00 0.00 ? 7  LYS B HA   4  
ATOM 4006  H HB2  . LYS B 1 7  ? 11.573  -3.334  7.946   1.00 0.00 ? 7  LYS B HB2  4  
ATOM 4007  H HB3  . LYS B 1 7  ? 10.168  -4.105  8.707   1.00 0.00 ? 7  LYS B HB3  4  
ATOM 4008  H HG2  . LYS B 1 7  ? 10.669  -4.907  6.360   1.00 0.00 ? 7  LYS B HG2  4  
ATOM 4009  H HG3  . LYS B 1 7  ? 9.028   -4.271  6.579   1.00 0.00 ? 7  LYS B HG3  4  
ATOM 4010  H HD2  . LYS B 1 7  ? 9.408   -2.492  5.189   1.00 0.00 ? 7  LYS B HD2  4  
ATOM 4011  H HD3  . LYS B 1 7  ? 11.066  -2.260  5.780   1.00 0.00 ? 7  LYS B HD3  4  
ATOM 4012  H HE2  . LYS B 1 7  ? 11.497  -2.999  3.615   1.00 0.00 ? 7  LYS B HE2  4  
ATOM 4013  H HE3  . LYS B 1 7  ? 11.475  -4.554  4.470   1.00 0.00 ? 7  LYS B HE3  4  
ATOM 4014  H HZ1  . LYS B 1 7  ? 9.194   -3.329  3.045   1.00 0.00 ? 7  LYS B HZ1  4  
ATOM 4015  H HZ2  . LYS B 1 7  ? 10.134  -4.594  2.492   1.00 0.00 ? 7  LYS B HZ2  4  
ATOM 4016  H HZ3  . LYS B 1 7  ? 9.168   -4.794  3.828   1.00 0.00 ? 7  LYS B HZ3  4  
ATOM 4017  N N    . MET B 1 8  ? 7.710   -2.613  9.175   1.00 0.00 ? 8  MET B N    4  
ATOM 4018  C CA   . MET B 1 8  ? 6.262   -2.688  9.271   1.00 0.00 ? 8  MET B CA   4  
ATOM 4019  C C    . MET B 1 8  ? 5.689   -1.274  9.381   1.00 0.00 ? 8  MET B C    4  
ATOM 4020  O O    . MET B 1 8  ? 4.514   -1.086  9.034   1.00 0.00 ? 8  MET B O    4  
ATOM 4021  C CB   . MET B 1 8  ? 5.852   -3.503  10.500  1.00 0.00 ? 8  MET B CB   4  
ATOM 4022  C CG   . MET B 1 8  ? 6.537   -2.975  11.761  1.00 0.00 ? 8  MET B CG   4  
ATOM 4023  S SD   . MET B 1 8  ? 5.325   -2.815  13.106  1.00 0.00 ? 8  MET B SD   4  
ATOM 4024  C CE   . MET B 1 8  ? 6.437   -2.869  14.541  1.00 0.00 ? 8  MET B CE   4  
ATOM 4025  H H    . MET B 1 8  ? 8.262   -2.985  9.948   1.00 0.00 ? 8  MET B H    4  
ATOM 4026  H HA   . MET B 1 8  ? 5.872   -3.161  8.370   1.00 0.00 ? 8  MET B HA   4  
ATOM 4027  H HB2  . MET B 1 8  ? 4.772   -3.433  10.626  1.00 0.00 ? 8  MET B HB2  4  
ATOM 4028  H HB3  . MET B 1 8  ? 6.124   -4.547  10.338  1.00 0.00 ? 8  MET B HB3  4  
ATOM 4029  H HG2  . MET B 1 8  ? 7.318   -3.670  12.069  1.00 0.00 ? 8  MET B HG2  4  
ATOM 4030  H HG3  . MET B 1 8  ? 6.987   -2.006  11.551  1.00 0.00 ? 8  MET B HG3  4  
ATOM 4031  H HE1  . MET B 1 8  ? 7.156   -2.051  14.485  1.00 0.00 ? 8  MET B HE1  4  
ATOM 4032  H HE2  . MET B 1 8  ? 5.845   -2.782  15.453  1.00 0.00 ? 8  MET B HE2  4  
ATOM 4033  H HE3  . MET B 1 8  ? 6.978   -3.815  14.558  1.00 0.00 ? 8  MET B HE3  4  
ATOM 4034  N N    . GLN B 1 9  ? 6.515   -0.325  9.854   1.00 0.00 ? 9  GLN B N    4  
ATOM 4035  C CA   . GLN B 1 9  ? 6.092   1.057   10.007  1.00 0.00 ? 9  GLN B CA   4  
ATOM 4036  C C    . GLN B 1 9  ? 6.132   1.752   8.645   1.00 0.00 ? 9  GLN B C    4  
ATOM 4037  O O    . GLN B 1 9  ? 5.430   2.760   8.477   1.00 0.00 ? 9  GLN B O    4  
ATOM 4038  C CB   . GLN B 1 9  ? 6.959   1.800   11.027  1.00 0.00 ? 9  GLN B CB   4  
ATOM 4039  C CG   . GLN B 1 9  ? 6.620   1.364   12.455  1.00 0.00 ? 9  GLN B CG   4  
ATOM 4040  C CD   . GLN B 1 9  ? 7.078   2.413   13.471  1.00 0.00 ? 9  GLN B CD   4  
ATOM 4041  O OE1  . GLN B 1 9  ? 6.359   3.335   13.816  1.00 0.00 ? 9  GLN B OE1  4  
ATOM 4042  N NE2  . GLN B 1 9  ? 8.313   2.220   13.927  1.00 0.00 ? 9  GLN B NE2  4  
ATOM 4043  H H    . GLN B 1 9  ? 7.471   -0.566  10.118  1.00 0.00 ? 9  GLN B H    4  
ATOM 4044  H HA   . GLN B 1 9  ? 5.064   1.036   10.366  1.00 0.00 ? 9  GLN B HA   4  
ATOM 4045  H HB2  . GLN B 1 9  ? 8.007   1.580   10.829  1.00 0.00 ? 9  GLN B HB2  4  
ATOM 4046  H HB3  . GLN B 1 9  ? 6.794   2.872   10.916  1.00 0.00 ? 9  GLN B HB3  4  
ATOM 4047  H HG2  . GLN B 1 9  ? 5.541   1.237   12.539  1.00 0.00 ? 9  GLN B HG2  4  
ATOM 4048  H HG3  . GLN B 1 9  ? 7.108   0.411   12.659  1.00 0.00 ? 9  GLN B HG3  4  
ATOM 4049  H HE21 . GLN B 1 9  ? 8.861   1.428   13.595  1.00 0.00 ? 9  GLN B HE21 4  
ATOM 4050  H HE22 . GLN B 1 9  ? 8.710   2.865   14.610  1.00 0.00 ? 9  GLN B HE22 4  
ATOM 4051  N N    . MET B 1 10 ? 6.939   1.210   7.716   1.00 0.00 ? 10 MET B N    4  
ATOM 4052  C CA   . MET B 1 10 ? 7.066   1.774   6.383   1.00 0.00 ? 10 MET B CA   4  
ATOM 4053  C C    . MET B 1 10 ? 5.961   1.210   5.487   1.00 0.00 ? 10 MET B C    4  
ATOM 4054  O O    . MET B 1 10 ? 5.431   1.966   4.659   1.00 0.00 ? 10 MET B O    4  
ATOM 4055  C CB   . MET B 1 10 ? 8.432   1.428   5.787   1.00 0.00 ? 10 MET B CB   4  
ATOM 4056  C CG   . MET B 1 10 ? 9.551   1.672   6.801   1.00 0.00 ? 10 MET B CG   4  
ATOM 4057  S SD   . MET B 1 10 ? 10.825  2.747   6.077   1.00 0.00 ? 10 MET B SD   4  
ATOM 4058  C CE   . MET B 1 10 ? 11.180  3.817   7.502   1.00 0.00 ? 10 MET B CE   4  
ATOM 4059  H H    . MET B 1 10 ? 7.485   0.377   7.937   1.00 0.00 ? 10 MET B H    4  
ATOM 4060  H HA   . MET B 1 10 ? 6.956   2.857   6.445   1.00 0.00 ? 10 MET B HA   4  
ATOM 4061  H HB2  . MET B 1 10 ? 8.437   0.378   5.498   1.00 0.00 ? 10 MET B HB2  4  
ATOM 4062  H HB3  . MET B 1 10 ? 8.595   2.040   4.899   1.00 0.00 ? 10 MET B HB3  4  
ATOM 4063  H HG2  . MET B 1 10 ? 9.139   2.156   7.686   1.00 0.00 ? 10 MET B HG2  4  
ATOM 4064  H HG3  . MET B 1 10 ? 9.991   0.718   7.092   1.00 0.00 ? 10 MET B HG3  4  
ATOM 4065  H HE1  . MET B 1 10 ? 11.526  3.215   8.342   1.00 0.00 ? 10 MET B HE1  4  
ATOM 4066  H HE2  . MET B 1 10 ? 11.948  4.538   7.220   1.00 0.00 ? 10 MET B HE2  4  
ATOM 4067  H HE3  . MET B 1 10 ? 10.280  4.355   7.797   1.00 0.00 ? 10 MET B HE3  4  
ATOM 4068  N N    . LEU B 1 11 ? 5.640   -0.083  5.669   1.00 0.00 ? 11 LEU B N    4  
ATOM 4069  C CA   . LEU B 1 11 ? 4.608   -0.737  4.883   1.00 0.00 ? 11 LEU B CA   4  
ATOM 4070  C C    . LEU B 1 11 ? 3.233   -0.318  5.405   1.00 0.00 ? 11 LEU B C    4  
ATOM 4071  O O    . LEU B 1 11 ? 2.279   -0.305  4.612   1.00 0.00 ? 11 LEU B O    4  
ATOM 4072  C CB   . LEU B 1 11 ? 4.824   -2.252  4.869   1.00 0.00 ? 11 LEU B CB   4  
ATOM 4073  C CG   . LEU B 1 11 ? 6.163   -2.733  4.303   1.00 0.00 ? 11 LEU B CG   4  
ATOM 4074  C CD1  . LEU B 1 11 ? 6.468   -4.161  4.760   1.00 0.00 ? 11 LEU B CD1  4  
ATOM 4075  C CD2  . LEU B 1 11 ? 6.195   -2.599  2.780   1.00 0.00 ? 11 LEU B CD2  4  
ATOM 4076  H H    . LEU B 1 11 ? 6.126   -0.635  6.374   1.00 0.00 ? 11 LEU B H    4  
ATOM 4077  H HA   . LEU B 1 11 ? 4.724   -0.379  3.859   1.00 0.00 ? 11 LEU B HA   4  
ATOM 4078  H HB2  . LEU B 1 11 ? 4.735   -2.585  5.903   1.00 0.00 ? 11 LEU B HB2  4  
ATOM 4079  H HB3  . LEU B 1 11 ? 4.003   -2.673  4.288   1.00 0.00 ? 11 LEU B HB3  4  
ATOM 4080  H HG   . LEU B 1 11 ? 6.910   -2.066  4.734   1.00 0.00 ? 11 LEU B HG   4  
ATOM 4081  H HD11 . LEU B 1 11 ? 5.680   -4.835  4.425   1.00 0.00 ? 11 LEU B HD11 4  
ATOM 4082  H HD12 . LEU B 1 11 ? 7.426   -4.471  4.341   1.00 0.00 ? 11 LEU B HD12 4  
ATOM 4083  H HD13 . LEU B 1 11 ? 6.529   -4.198  5.848   1.00 0.00 ? 11 LEU B HD13 4  
ATOM 4084  H HD21 . LEU B 1 11 ? 6.045   -1.558  2.495   1.00 0.00 ? 11 LEU B HD21 4  
ATOM 4085  H HD22 . LEU B 1 11 ? 7.159   -2.950  2.413   1.00 0.00 ? 11 LEU B HD22 4  
ATOM 4086  H HD23 . LEU B 1 11 ? 5.404   -3.206  2.337   1.00 0.00 ? 11 LEU B HD23 4  
ATOM 4087  N N    . LYS B 1 12 ? 3.157   0.013   6.706   1.00 0.00 ? 12 LYS B N    4  
ATOM 4088  C CA   . LYS B 1 12 ? 1.910   0.428   7.325   1.00 0.00 ? 12 LYS B CA   4  
ATOM 4089  C C    . LYS B 1 12 ? 1.617   1.881   6.946   1.00 0.00 ? 12 LYS B C    4  
ATOM 4090  O O    . LYS B 1 12 ? 0.434   2.229   6.813   1.00 0.00 ? 12 LYS B O    4  
ATOM 4091  C CB   . LYS B 1 12 ? 1.952   0.183   8.834   1.00 0.00 ? 12 LYS B CB   4  
ATOM 4092  C CG   . LYS B 1 12 ? 2.918   1.153   9.520   1.00 0.00 ? 12 LYS B CG   4  
ATOM 4093  C CD   . LYS B 1 12 ? 2.291   2.540   9.664   1.00 0.00 ? 12 LYS B CD   4  
ATOM 4094  C CE   . LYS B 1 12 ? 2.287   2.991   11.126  1.00 0.00 ? 12 LYS B CE   4  
ATOM 4095  N NZ   . LYS B 1 12 ? 2.620   4.422   11.226  1.00 0.00 ? 12 LYS B NZ   4  
ATOM 4096  H H    . LYS B 1 12 ? 3.993   -0.024  7.291   1.00 0.00 ? 12 LYS B H    4  
ATOM 4097  H HA   . LYS B 1 12 ? 1.130   -0.211  6.909   1.00 0.00 ? 12 LYS B HA   4  
ATOM 4098  H HB2  . LYS B 1 12 ? 0.954   0.328   9.245   1.00 0.00 ? 12 LYS B HB2  4  
ATOM 4099  H HB3  . LYS B 1 12 ? 2.266   -0.845  9.017   1.00 0.00 ? 12 LYS B HB3  4  
ATOM 4100  H HG2  . LYS B 1 12 ? 3.160   0.768   10.511  1.00 0.00 ? 12 LYS B HG2  4  
ATOM 4101  H HG3  . LYS B 1 12 ? 3.832   1.217   8.930   1.00 0.00 ? 12 LYS B HG3  4  
ATOM 4102  H HD2  . LYS B 1 12 ? 2.869   3.252   9.075   1.00 0.00 ? 12 LYS B HD2  4  
ATOM 4103  H HD3  . LYS B 1 12 ? 1.270   2.509   9.282   1.00 0.00 ? 12 LYS B HD3  4  
ATOM 4104  H HE2  . LYS B 1 12 ? 1.296   2.828   11.549  1.00 0.00 ? 12 LYS B HE2  4  
ATOM 4105  H HE3  . LYS B 1 12 ? 3.012   2.400   11.684  1.00 0.00 ? 12 LYS B HE3  4  
ATOM 4106  H HZ1  . LYS B 1 12 ? 1.942   4.975   10.703  1.00 0.00 ? 12 LYS B HZ1  4  
ATOM 4107  H HZ2  . LYS B 1 12 ? 2.612   4.697   12.208  1.00 0.00 ? 12 LYS B HZ2  4  
ATOM 4108  H HZ3  . LYS B 1 12 ? 3.551   4.589   10.842  1.00 0.00 ? 12 LYS B HZ3  4  
ATOM 4109  N N    . LEU B 1 13 ? 2.680   2.687   6.783   1.00 0.00 ? 13 LEU B N    4  
ATOM 4110  C CA   . LEU B 1 13 ? 2.538   4.088   6.422   1.00 0.00 ? 13 LEU B CA   4  
ATOM 4111  C C    . LEU B 1 13 ? 2.156   4.193   4.944   1.00 0.00 ? 13 LEU B C    4  
ATOM 4112  O O    . LEU B 1 13 ? 1.267   4.995   4.620   1.00 0.00 ? 13 LEU B O    4  
ATOM 4113  C CB   . LEU B 1 13 ? 3.804   4.867   6.787   1.00 0.00 ? 13 LEU B CB   4  
ATOM 4114  C CG   . LEU B 1 13 ? 3.644   6.383   6.913   1.00 0.00 ? 13 LEU B CG   4  
ATOM 4115  C CD1  . LEU B 1 13 ? 4.965   7.098   6.622   1.00 0.00 ? 13 LEU B CD1  4  
ATOM 4116  C CD2  . LEU B 1 13 ? 2.509   6.892   6.023   1.00 0.00 ? 13 LEU B CD2  4  
ATOM 4117  H H    . LEU B 1 13 ? 3.624   2.320   6.911   1.00 0.00 ? 13 LEU B H    4  
ATOM 4118  H HA   . LEU B 1 13 ? 1.722   4.481   7.029   1.00 0.00 ? 13 LEU B HA   4  
ATOM 4119  H HB2  . LEU B 1 13 ? 4.147   4.465   7.741   1.00 0.00 ? 13 LEU B HB2  4  
ATOM 4120  H HB3  . LEU B 1 13 ? 4.539   4.633   6.018   1.00 0.00 ? 13 LEU B HB3  4  
ATOM 4121  H HG   . LEU B 1 13 ? 3.381   6.556   7.956   1.00 0.00 ? 13 LEU B HG   4  
ATOM 4122  H HD11 . LEU B 1 13 ? 5.302   6.861   5.614   1.00 0.00 ? 13 LEU B HD11 4  
ATOM 4123  H HD12 . LEU B 1 13 ? 4.816   8.174   6.720   1.00 0.00 ? 13 LEU B HD12 4  
ATOM 4124  H HD13 . LEU B 1 13 ? 5.726   6.779   7.335   1.00 0.00 ? 13 LEU B HD13 4  
ATOM 4125  H HD21 . LEU B 1 13 ? 1.571   6.414   6.306   1.00 0.00 ? 13 LEU B HD21 4  
ATOM 4126  H HD22 . LEU B 1 13 ? 2.425   7.973   6.137   1.00 0.00 ? 13 LEU B HD22 4  
ATOM 4127  H HD23 . LEU B 1 13 ? 2.724   6.662   4.979   1.00 0.00 ? 13 LEU B HD23 4  
ATOM 4128  N N    . ASP B 1 14 ? 2.823   3.396   4.091   1.00 0.00 ? 14 ASP B N    4  
ATOM 4129  C CA   . ASP B 1 14 ? 2.555   3.400   2.663   1.00 0.00 ? 14 ASP B CA   4  
ATOM 4130  C C    . ASP B 1 14 ? 1.136   2.887   2.414   1.00 0.00 ? 14 ASP B C    4  
ATOM 4131  O O    . ASP B 1 14 ? 0.506   3.341   1.447   1.00 0.00 ? 14 ASP B O    4  
ATOM 4132  C CB   . ASP B 1 14 ? 3.528   2.485   1.918   1.00 0.00 ? 14 ASP B CB   4  
ATOM 4133  C CG   . ASP B 1 14 ? 4.055   3.043   0.593   1.00 0.00 ? 14 ASP B CG   4  
ATOM 4134  O OD1  . ASP B 1 14 ? 4.741   4.076   0.564   1.00 0.00 ? 14 ASP B OD1  4  
ATOM 4135  O OD2  . ASP B 1 14 ? 3.732   2.362   -0.453  1.00 0.00 ? 14 ASP B OD2  4  
ATOM 4136  H H    . ASP B 1 14 ? 3.543   2.763   4.441   1.00 0.00 ? 14 ASP B H    4  
ATOM 4137  H HA   . ASP B 1 14 ? 2.633   4.422   2.291   1.00 0.00 ? 14 ASP B HA   4  
ATOM 4138  H HB2  . ASP B 1 14 ? 4.369   2.304   2.587   1.00 0.00 ? 14 ASP B HB2  4  
ATOM 4139  H HB3  . ASP B 1 14 ? 3.005   1.545   1.742   1.00 0.00 ? 14 ASP B HB3  4  
ATOM 4140  N N    . ASN B 1 15 ? 0.670   1.965   3.275   1.00 0.00 ? 15 ASN B N    4  
ATOM 4141  C CA   . ASN B 1 15 ? -0.661  1.396   3.147   1.00 0.00 ? 15 ASN B CA   4  
ATOM 4142  C C    . ASN B 1 15 ? -1.704  2.490   3.394   1.00 0.00 ? 15 ASN B C    4  
ATOM 4143  O O    . ASN B 1 15 ? -2.623  2.623   2.572   1.00 0.00 ? 15 ASN B O    4  
ATOM 4144  C CB   . ASN B 1 15 ? -0.887  0.287   4.177   1.00 0.00 ? 15 ASN B CB   4  
ATOM 4145  C CG   . ASN B 1 15 ? -2.026  -0.639  3.745   1.00 0.00 ? 15 ASN B CG   4  
ATOM 4146  O OD1  . ASN B 1 15 ? -3.189  -0.410  4.031   1.00 0.00 ? 15 ASN B OD1  4  
ATOM 4147  N ND2  . ASN B 1 15 ? -1.627  -1.695  3.043   1.00 0.00 ? 15 ASN B ND2  4  
ATOM 4148  H H    . ASN B 1 15 ? 1.255   1.644   4.045   1.00 0.00 ? 15 ASN B H    4  
ATOM 4149  H HA   . ASN B 1 15 ? -0.787  1.008   2.137   1.00 0.00 ? 15 ASN B HA   4  
ATOM 4150  H HB2  . ASN B 1 15 ? 0.028   -0.296  4.276   1.00 0.00 ? 15 ASN B HB2  4  
ATOM 4151  H HB3  . ASN B 1 15 ? -1.123  0.742   5.140   1.00 0.00 ? 15 ASN B HB3  4  
ATOM 4152  H HD21 . ASN B 1 15 ? -0.636  -1.827  2.839   1.00 0.00 ? 15 ASN B HD21 4  
ATOM 4153  H HD22 . ASN B 1 15 ? -2.311  -2.374  2.708   1.00 0.00 ? 15 ASN B HD22 4  
ATOM 4154  N N    . TYR B 1 16 ? -1.543  3.237   4.500   1.00 0.00 ? 16 TYR B N    4  
ATOM 4155  C CA   . TYR B 1 16 ? -2.501  4.289   4.793   1.00 0.00 ? 16 TYR B CA   4  
ATOM 4156  C C    . TYR B 1 16 ? -2.522  5.290   3.636   1.00 0.00 ? 16 TYR B C    4  
ATOM 4157  O O    . TYR B 1 16 ? -3.602  5.828   3.352   1.00 0.00 ? 16 TYR B O    4  
ATOM 4158  C CB   . TYR B 1 16 ? -2.151  4.966   6.131   1.00 0.00 ? 16 TYR B CB   4  
ATOM 4159  C CG   . TYR B 1 16 ? -1.859  3.999   7.270   1.00 0.00 ? 16 TYR B CG   4  
ATOM 4160  C CD1  . TYR B 1 16 ? -2.308  2.661   7.195   1.00 0.00 ? 16 TYR B CD1  4  
ATOM 4161  C CD2  . TYR B 1 16 ? -1.133  4.429   8.405   1.00 0.00 ? 16 TYR B CD2  4  
ATOM 4162  C CE1  . TYR B 1 16 ? -2.037  1.760   8.246   1.00 0.00 ? 16 TYR B CE1  4  
ATOM 4163  C CE2  . TYR B 1 16 ? -0.861  3.528   9.458   1.00 0.00 ? 16 TYR B CE2  4  
ATOM 4164  C CZ   . TYR B 1 16 ? -1.314  2.193   9.379   1.00 0.00 ? 16 TYR B CZ   4  
ATOM 4165  O OH   . TYR B 1 16 ? -1.055  1.318   10.396  1.00 0.00 ? 16 TYR B OH   4  
ATOM 4166  H H    . TYR B 1 16 ? -0.769  3.076   5.129   1.00 0.00 ? 16 TYR B H    4  
ATOM 4167  H HA   . TYR B 1 16 ? -3.491  3.836   4.868   1.00 0.00 ? 16 TYR B HA   4  
ATOM 4168  H HB2  . TYR B 1 16 ? -1.293  5.626   5.984   1.00 0.00 ? 16 TYR B HB2  4  
ATOM 4169  H HB3  . TYR B 1 16 ? -2.989  5.596   6.437   1.00 0.00 ? 16 TYR B HB3  4  
ATOM 4170  H HD1  . TYR B 1 16 ? -2.861  2.321   6.331   1.00 0.00 ? 16 TYR B HD1  4  
ATOM 4171  H HD2  . TYR B 1 16 ? -0.781  5.449   8.473   1.00 0.00 ? 16 TYR B HD2  4  
ATOM 4172  H HE1  . TYR B 1 16 ? -2.385  0.739   8.180   1.00 0.00 ? 16 TYR B HE1  4  
ATOM 4173  H HE2  . TYR B 1 16 ? -0.306  3.866   10.321  1.00 0.00 ? 16 TYR B HE2  4  
ATOM 4174  H HH   . TYR B 1 16 ? -0.449  0.614   10.151  1.00 0.00 ? 16 TYR B HH   4  
ATOM 4175  N N    . HIS B 1 17 ? -1.354  5.524   3.010   1.00 0.00 ? 17 HIS B N    4  
ATOM 4176  C CA   . HIS B 1 17 ? -1.248  6.462   1.905   1.00 0.00 ? 17 HIS B CA   4  
ATOM 4177  C C    . HIS B 1 17 ? -1.850  5.832   0.648   1.00 0.00 ? 17 HIS B C    4  
ATOM 4178  O O    . HIS B 1 17 ? -2.480  6.560   -0.132  1.00 0.00 ? 17 HIS B O    4  
ATOM 4179  C CB   . HIS B 1 17 ? 0.201   6.912   1.707   1.00 0.00 ? 17 HIS B CB   4  
ATOM 4180  C CG   . HIS B 1 17 ? 0.673   6.849   0.274   1.00 0.00 ? 17 HIS B CG   4  
ATOM 4181  N ND1  . HIS B 1 17 ? 0.575   7.922   -0.595  1.00 0.00 ? 17 HIS B ND1  4  
ATOM 4182  C CD2  . HIS B 1 17 ? 1.246   5.832   -0.432  1.00 0.00 ? 17 HIS B CD2  4  
ATOM 4183  C CE1  . HIS B 1 17 ? 1.070   7.556   -1.768  1.00 0.00 ? 17 HIS B CE1  4  
ATOM 4184  N NE2  . HIS B 1 17 ? 1.484   6.261   -1.666  1.00 0.00 ? 17 HIS B NE2  4  
ATOM 4185  H H    . HIS B 1 17 ? -0.509  5.037   3.309   1.00 0.00 ? 17 HIS B H    4  
ATOM 4186  H HA   . HIS B 1 17 ? -1.838  7.336   2.183   1.00 0.00 ? 17 HIS B HA   4  
ATOM 4187  H HB2  . HIS B 1 17 ? 0.275   7.940   2.061   1.00 0.00 ? 17 HIS B HB2  4  
ATOM 4188  H HB3  . HIS B 1 17 ? 0.827   6.275   2.332   1.00 0.00 ? 17 HIS B HB3  4  
ATOM 4189  H HD1  . HIS B 1 17 ? 0.210   8.866   -0.468  1.00 0.00 ? 17 HIS B HD1  4  
ATOM 4190  H HD2  . HIS B 1 17 ? 1.507   4.823   -0.151  1.00 0.00 ? 17 HIS B HD2  4  
ATOM 4191  H HE1  . HIS B 1 17 ? 1.086   8.257   -2.590  1.00 0.00 ? 17 HIS B HE1  4  
ATOM 4192  N N    . LEU B 1 18 ? -1.649  4.513   0.480   1.00 0.00 ? 18 LEU B N    4  
ATOM 4193  C CA   . LEU B 1 18 ? -2.169  3.795   -0.672  1.00 0.00 ? 18 LEU B CA   4  
ATOM 4194  C C    . LEU B 1 18 ? -3.692  3.693   -0.559  1.00 0.00 ? 18 LEU B C    4  
ATOM 4195  O O    . LEU B 1 18 ? -4.370  3.815   -1.590  1.00 0.00 ? 18 LEU B O    4  
ATOM 4196  C CB   . LEU B 1 18 ? -1.472  2.441   -0.819  1.00 0.00 ? 18 LEU B CB   4  
ATOM 4197  C CG   . LEU B 1 18 ? -0.054  2.477   -1.390  1.00 0.00 ? 18 LEU B CG   4  
ATOM 4198  C CD1  . LEU B 1 18 ? 0.625   1.112   -1.256  1.00 0.00 ? 18 LEU B CD1  4  
ATOM 4199  C CD2  . LEU B 1 18 ? -0.056  2.975   -2.837  1.00 0.00 ? 18 LEU B CD2  4  
ATOM 4200  H H    . LEU B 1 18 ? -1.118  3.985   1.173   1.00 0.00 ? 18 LEU B H    4  
ATOM 4201  H HA   . LEU B 1 18 ? -1.917  4.393   -1.548  1.00 0.00 ? 18 LEU B HA   4  
ATOM 4202  H HB2  . LEU B 1 18 ? -1.444  2.001   0.177   1.00 0.00 ? 18 LEU B HB2  4  
ATOM 4203  H HB3  . LEU B 1 18 ? -2.116  1.834   -1.457  1.00 0.00 ? 18 LEU B HB3  4  
ATOM 4204  H HG   . LEU B 1 18 ? 0.485   3.192   -0.770  1.00 0.00 ? 18 LEU B HG   4  
ATOM 4205  H HD11 . LEU B 1 18 ? 0.048   0.356   -1.788  1.00 0.00 ? 18 LEU B HD11 4  
ATOM 4206  H HD12 . LEU B 1 18 ? 1.631   1.173   -1.671  1.00 0.00 ? 18 LEU B HD12 4  
ATOM 4207  H HD13 . LEU B 1 18 ? 0.692   0.832   -0.205  1.00 0.00 ? 18 LEU B HD13 4  
ATOM 4208  H HD21 . LEU B 1 18 ? -0.481  3.978   -2.883  1.00 0.00 ? 18 LEU B HD21 4  
ATOM 4209  H HD22 . LEU B 1 18 ? 0.967   2.986   -3.210  1.00 0.00 ? 18 LEU B HD22 4  
ATOM 4210  H HD23 . LEU B 1 18 ? -0.654  2.308   -3.459  1.00 0.00 ? 18 LEU B HD23 4  
ATOM 4211  N N    . GLU B 1 19 ? -4.192  3.477   0.672   1.00 0.00 ? 19 GLU B N    4  
ATOM 4212  C CA   . GLU B 1 19 ? -5.620  3.361   0.912   1.00 0.00 ? 19 GLU B CA   4  
ATOM 4213  C C    . GLU B 1 19 ? -6.286  4.717   0.669   1.00 0.00 ? 19 GLU B C    4  
ATOM 4214  O O    . GLU B 1 19 ? -7.288  4.759   -0.060  1.00 0.00 ? 19 GLU B O    4  
ATOM 4215  C CB   . GLU B 1 19 ? -5.911  2.854   2.327   1.00 0.00 ? 19 GLU B CB   4  
ATOM 4216  C CG   . GLU B 1 19 ? -7.075  1.861   2.324   1.00 0.00 ? 19 GLU B CG   4  
ATOM 4217  C CD   . GLU B 1 19 ? -6.620  0.484   1.837   1.00 0.00 ? 19 GLU B CD   4  
ATOM 4218  O OE1  . GLU B 1 19 ? -5.454  0.110   2.035   1.00 0.00 ? 19 GLU B OE1  4  
ATOM 4219  O OE2  . GLU B 1 19 ? -7.527  -0.207  1.233   1.00 0.00 ? 19 GLU B OE2  4  
ATOM 4220  H H    . GLU B 1 19 ? -3.562  3.389   1.469   1.00 0.00 ? 19 GLU B H    4  
ATOM 4221  H HA   . GLU B 1 19 ? -6.007  2.640   0.192   1.00 0.00 ? 19 GLU B HA   4  
ATOM 4222  H HB2  . GLU B 1 19 ? -5.022  2.358   2.715   1.00 0.00 ? 19 GLU B HB2  4  
ATOM 4223  H HB3  . GLU B 1 19 ? -6.150  3.705   2.965   1.00 0.00 ? 19 GLU B HB3  4  
ATOM 4224  H HG2  . GLU B 1 19 ? -7.463  1.768   3.339   1.00 0.00 ? 19 GLU B HG2  4  
ATOM 4225  H HG3  . GLU B 1 19 ? -7.864  2.243   1.676   1.00 0.00 ? 19 GLU B HG3  4  
ATOM 4226  N N    . ASN B 1 20 ? -5.726  5.781   1.272   1.00 0.00 ? 20 ASN B N    4  
ATOM 4227  C CA   . ASN B 1 20 ? -6.262  7.122   1.120   1.00 0.00 ? 20 ASN B CA   4  
ATOM 4228  C C    . ASN B 1 20 ? -6.144  7.552   -0.344  1.00 0.00 ? 20 ASN B C    4  
ATOM 4229  O O    . ASN B 1 20 ? -6.988  8.338   -0.798  1.00 0.00 ? 20 ASN B O    4  
ATOM 4230  C CB   . ASN B 1 20 ? -5.482  8.127   1.971   1.00 0.00 ? 20 ASN B CB   4  
ATOM 4231  C CG   . ASN B 1 20 ? -6.107  8.270   3.361   1.00 0.00 ? 20 ASN B CG   4  
ATOM 4232  O OD1  . ASN B 1 20 ? -7.306  8.136   3.548   1.00 0.00 ? 20 ASN B OD1  4  
ATOM 4233  N ND2  . ASN B 1 20 ? -5.231  8.548   4.323   1.00 0.00 ? 20 ASN B ND2  4  
ATOM 4234  H H    . ASN B 1 20 ? -4.899  5.659   1.857   1.00 0.00 ? 20 ASN B H    4  
ATOM 4235  H HA   . ASN B 1 20 ? -7.314  7.118   1.405   1.00 0.00 ? 20 ASN B HA   4  
ATOM 4236  H HB2  . ASN B 1 20 ? -4.455  7.777   2.079   1.00 0.00 ? 20 ASN B HB2  4  
ATOM 4237  H HB3  . ASN B 1 20 ? -5.478  9.091   1.465   1.00 0.00 ? 20 ASN B HB3  4  
ATOM 4238  H HD21 . ASN B 1 20 ? -4.242  8.647   4.097   1.00 0.00 ? 20 ASN B HD21 4  
ATOM 4239  H HD22 . ASN B 1 20 ? -5.549  8.662   5.284   1.00 0.00 ? 20 ASN B HD22 4  
ATOM 4240  N N    . GLU B 1 21 ? -5.116  7.036   -1.041  1.00 0.00 ? 21 GLU B N    4  
ATOM 4241  C CA   . GLU B 1 21 ? -4.893  7.364   -2.439  1.00 0.00 ? 21 GLU B CA   4  
ATOM 4242  C C    . GLU B 1 21 ? -5.820  6.515   -3.312  1.00 0.00 ? 21 GLU B C    4  
ATOM 4243  O O    . GLU B 1 21 ? -6.241  7.003   -4.372  1.00 0.00 ? 21 GLU B O    4  
ATOM 4244  C CB   . GLU B 1 21 ? -3.429  7.162   -2.836  1.00 0.00 ? 21 GLU B CB   4  
ATOM 4245  C CG   . GLU B 1 21 ? -3.150  7.753   -4.221  1.00 0.00 ? 21 GLU B CG   4  
ATOM 4246  C CD   . GLU B 1 21 ? -1.820  7.242   -4.777  1.00 0.00 ? 21 GLU B CD   4  
ATOM 4247  O OE1  . GLU B 1 21 ? -1.103  6.502   -4.088  1.00 0.00 ? 21 GLU B OE1  4  
ATOM 4248  O OE2  . GLU B 1 21 ? -1.542  7.637   -5.973  1.00 0.00 ? 21 GLU B OE2  4  
ATOM 4249  H H    . GLU B 1 21 ? -4.465  6.394   -0.591  1.00 0.00 ? 21 GLU B H    4  
ATOM 4250  H HA   . GLU B 1 21 ? -5.152  8.416   -2.564  1.00 0.00 ? 21 GLU B HA   4  
ATOM 4251  H HB2  . GLU B 1 21 ? -2.792  7.659   -2.105  1.00 0.00 ? 21 GLU B HB2  4  
ATOM 4252  H HB3  . GLU B 1 21 ? -3.207  6.096   -2.836  1.00 0.00 ? 21 GLU B HB3  4  
ATOM 4253  H HG2  . GLU B 1 21 ? -3.954  7.462   -4.898  1.00 0.00 ? 21 GLU B HG2  4  
ATOM 4254  H HG3  . GLU B 1 21 ? -3.128  8.840   -4.143  1.00 0.00 ? 21 GLU B HG3  4  
ATOM 4255  N N    . VAL B 1 22 ? -6.114  5.284   -2.859  1.00 0.00 ? 22 VAL B N    4  
ATOM 4256  C CA   . VAL B 1 22 ? -6.983  4.380   -3.593  1.00 0.00 ? 22 VAL B CA   4  
ATOM 4257  C C    . VAL B 1 22 ? -8.439  4.803   -3.391  1.00 0.00 ? 22 VAL B C    4  
ATOM 4258  O O    . VAL B 1 22 ? -9.214  4.726   -4.356  1.00 0.00 ? 22 VAL B O    4  
ATOM 4259  C CB   . VAL B 1 22 ? -6.715  2.935   -3.166  1.00 0.00 ? 22 VAL B CB   4  
ATOM 4260  C CG1  . VAL B 1 22 ? -7.985  2.088   -3.273  1.00 0.00 ? 22 VAL B CG1  4  
ATOM 4261  C CG2  . VAL B 1 22 ? -5.576  2.323   -3.984  1.00 0.00 ? 22 VAL B CG2  4  
ATOM 4262  H H    . VAL B 1 22 ? -5.724  4.960   -1.973  1.00 0.00 ? 22 VAL B H    4  
ATOM 4263  H HA   . VAL B 1 22 ? -6.730  4.469   -4.649  1.00 0.00 ? 22 VAL B HA   4  
ATOM 4264  H HB   . VAL B 1 22 ? -6.411  2.988   -2.120  1.00 0.00 ? 22 VAL B HB   4  
ATOM 4265  H HG11 . VAL B 1 22 ? -8.348  2.091   -4.301  1.00 0.00 ? 22 VAL B HG11 4  
ATOM 4266  H HG12 . VAL B 1 22 ? -7.758  1.068   -2.962  1.00 0.00 ? 22 VAL B HG12 4  
ATOM 4267  H HG13 . VAL B 1 22 ? -8.759  2.494   -2.622  1.00 0.00 ? 22 VAL B HG13 4  
ATOM 4268  H HG21 . VAL B 1 22 ? -4.665  2.907   -3.847  1.00 0.00 ? 22 VAL B HG21 4  
ATOM 4269  H HG22 . VAL B 1 22 ? -5.414  1.298   -3.653  1.00 0.00 ? 22 VAL B HG22 4  
ATOM 4270  H HG23 . VAL B 1 22 ? -5.840  2.318   -5.041  1.00 0.00 ? 22 VAL B HG23 4  
ATOM 4271  N N    . ALA B 1 23 ? -8.777  5.234   -2.164  1.00 0.00 ? 23 ALA B N    4  
ATOM 4272  C CA   . ALA B 1 23 ? -10.127 5.665   -1.843  1.00 0.00 ? 23 ALA B CA   4  
ATOM 4273  C C    . ALA B 1 23 ? -10.418 6.989   -2.551  1.00 0.00 ? 23 ALA B C    4  
ATOM 4274  O O    . ALA B 1 23 ? -11.600 7.305   -2.749  1.00 0.00 ? 23 ALA B O    4  
ATOM 4275  C CB   . ALA B 1 23 ? -10.234 5.947   -0.343  1.00 0.00 ? 23 ALA B CB   4  
ATOM 4276  H H    . ALA B 1 23 ? -8.075  5.267   -1.423  1.00 0.00 ? 23 ALA B H    4  
ATOM 4277  H HA   . ALA B 1 23 ? -10.862 4.925   -2.158  1.00 0.00 ? 23 ALA B HA   4  
ATOM 4278  H HB1  . ALA B 1 23 ? -9.990  5.040   0.209   1.00 0.00 ? 23 ALA B HB1  4  
ATOM 4279  H HB2  . ALA B 1 23 ? -9.533  6.733   -0.062  1.00 0.00 ? 23 ALA B HB2  4  
ATOM 4280  H HB3  . ALA B 1 23 ? -11.246 6.271   -0.097  1.00 0.00 ? 23 ALA B HB3  4  
ATOM 4281  N N    . ARG B 1 24 ? -9.351  7.726   -2.912  1.00 0.00 ? 24 ARG B N    4  
ATOM 4282  C CA   . ARG B 1 24 ? -9.492  9.002   -3.591  1.00 0.00 ? 24 ARG B CA   4  
ATOM 4283  C C    . ARG B 1 24 ? -9.480  8.775   -5.103  1.00 0.00 ? 24 ARG B C    4  
ATOM 4284  O O    . ARG B 1 24 ? -10.066 9.593   -5.827  1.00 0.00 ? 24 ARG B O    4  
ATOM 4285  C CB   . ARG B 1 24 ? -8.363  9.966   -3.218  1.00 0.00 ? 24 ARG B CB   4  
ATOM 4286  C CG   . ARG B 1 24 ? -8.714  10.762  -1.960  1.00 0.00 ? 24 ARG B CG   4  
ATOM 4287  C CD   . ARG B 1 24 ? -7.505  11.552  -1.455  1.00 0.00 ? 24 ARG B CD   4  
ATOM 4288  N NE   . ARG B 1 24 ? -7.923  12.492  -0.391  1.00 0.00 ? 24 ARG B NE   4  
ATOM 4289  C CZ   . ARG B 1 24 ? -8.373  13.744  -0.621  1.00 0.00 ? 24 ARG B CZ   4  
ATOM 4290  N NH1  . ARG B 1 24 ? -8.455  14.182  -1.885  1.00 0.00 ? 24 ARG B NH1  4  
ATOM 4291  N NH2  . ARG B 1 24 ? -8.732  14.535  0.399   1.00 0.00 ? 24 ARG B NH2  4  
ATOM 4292  H H    . ARG B 1 24 ? -8.409  7.391   -2.709  1.00 0.00 ? 24 ARG B H    4  
ATOM 4293  H HA   . ARG B 1 24 ? -10.453 9.430   -3.304  1.00 0.00 ? 24 ARG B HA   4  
ATOM 4294  H HB2  . ARG B 1 24 ? -7.455  9.393   -3.033  1.00 0.00 ? 24 ARG B HB2  4  
ATOM 4295  H HB3  . ARG B 1 24 ? -8.190  10.646  -4.052  1.00 0.00 ? 24 ARG B HB3  4  
ATOM 4296  H HG2  . ARG B 1 24 ? -9.520  11.458  -2.194  1.00 0.00 ? 24 ARG B HG2  4  
ATOM 4297  H HG3  . ARG B 1 24 ? -9.057  10.072  -1.189  1.00 0.00 ? 24 ARG B HG3  4  
ATOM 4298  H HD2  . ARG B 1 24 ? -6.765  10.861  -1.048  1.00 0.00 ? 24 ARG B HD2  4  
ATOM 4299  H HD3  . ARG B 1 24 ? -7.060  12.101  -2.283  1.00 0.00 ? 24 ARG B HD3  4  
ATOM 4300  H HE   . ARG B 1 24 ? -7.855  12.143  0.565   1.00 0.00 ? 24 ARG B HE   4  
ATOM 4301  H HH11 . ARG B 1 24 ? -8.179  13.573  -2.654  1.00 0.00 ? 24 ARG B HH11 4  
ATOM 4302  H HH12 . ARG B 1 24 ? -8.793  15.125  -2.076  1.00 0.00 ? 24 ARG B HH12 4  
ATOM 4303  H HH21 . ARG B 1 24 ? -8.667  14.194  1.357   1.00 0.00 ? 24 ARG B HH21 4  
ATOM 4304  H HH22 . ARG B 1 24 ? -9.072  15.480  0.216   1.00 0.00 ? 24 ARG B HH22 4  
ATOM 4305  N N    . LEU B 1 25 ? -8.824  7.686   -5.543  1.00 0.00 ? 25 LEU B N    4  
ATOM 4306  C CA   . LEU B 1 25 ? -8.739  7.357   -6.956  1.00 0.00 ? 25 LEU B CA   4  
ATOM 4307  C C    . LEU B 1 25 ? -9.979  6.560   -7.365  1.00 0.00 ? 25 LEU B C    4  
ATOM 4308  O O    . LEU B 1 25 ? -10.513 6.817   -8.453  1.00 0.00 ? 25 LEU B O    4  
ATOM 4309  C CB   . LEU B 1 25 ? -7.419  6.644   -7.262  1.00 0.00 ? 25 LEU B CB   4  
ATOM 4310  C CG   . LEU B 1 25 ? -6.177  7.534   -7.337  1.00 0.00 ? 25 LEU B CG   4  
ATOM 4311  C CD1  . LEU B 1 25 ? -4.906  6.691   -7.457  1.00 0.00 ? 25 LEU B CD1  4  
ATOM 4312  C CD2  . LEU B 1 25 ? -6.300  8.552   -8.472  1.00 0.00 ? 25 LEU B CD2  4  
ATOM 4313  H H    . LEU B 1 25 ? -8.367  7.062   -4.878  1.00 0.00 ? 25 LEU B H    4  
ATOM 4314  H HA   . LEU B 1 25 ? -8.733  8.305   -7.495  1.00 0.00 ? 25 LEU B HA   4  
ATOM 4315  H HB2  . LEU B 1 25 ? -7.280  5.904   -6.472  1.00 0.00 ? 25 LEU B HB2  4  
ATOM 4316  H HB3  . LEU B 1 25 ? -7.564  6.127   -8.210  1.00 0.00 ? 25 LEU B HB3  4  
ATOM 4317  H HG   . LEU B 1 25 ? -6.150  8.065   -6.385  1.00 0.00 ? 25 LEU B HG   4  
ATOM 4318  H HD11 . LEU B 1 25 ? -4.953  6.074   -8.354  1.00 0.00 ? 25 LEU B HD11 4  
ATOM 4319  H HD12 . LEU B 1 25 ? -4.043  7.355   -7.508  1.00 0.00 ? 25 LEU B HD12 4  
ATOM 4320  H HD13 . LEU B 1 25 ? -4.805  6.044   -6.586  1.00 0.00 ? 25 LEU B HD13 4  
ATOM 4321  H HD21 . LEU B 1 25 ? -7.176  9.181   -8.314  1.00 0.00 ? 25 LEU B HD21 4  
ATOM 4322  H HD22 . LEU B 1 25 ? -5.401  9.166   -8.496  1.00 0.00 ? 25 LEU B HD22 4  
ATOM 4323  H HD23 . LEU B 1 25 ? -6.402  8.035   -9.426  1.00 0.00 ? 25 LEU B HD23 4  
ATOM 4324  N N    . LYS B 1 26 ? -10.403 5.621   -6.500  1.00 0.00 ? 26 LYS B N    4  
ATOM 4325  C CA   . LYS B 1 26 ? -11.568 4.796   -6.770  1.00 0.00 ? 26 LYS B CA   4  
ATOM 4326  C C    . LYS B 1 26 ? -12.807 5.688   -6.874  1.00 0.00 ? 26 LYS B C    4  
ATOM 4327  O O    . LYS B 1 26 ? -13.771 5.283   -7.541  1.00 0.00 ? 26 LYS B O    4  
ATOM 4328  C CB   . LYS B 1 26 ? -11.694 3.688   -5.723  1.00 0.00 ? 26 LYS B CB   4  
ATOM 4329  C CG   . LYS B 1 26 ? -10.695 2.562   -5.992  1.00 0.00 ? 26 LYS B CG   4  
ATOM 4330  C CD   . LYS B 1 26 ? -11.127 1.720   -7.193  1.00 0.00 ? 26 LYS B CD   4  
ATOM 4331  C CE   . LYS B 1 26 ? -12.610 1.357   -7.103  1.00 0.00 ? 26 LYS B CE   4  
ATOM 4332  N NZ   . LYS B 1 26 ? -12.942 0.298   -8.070  1.00 0.00 ? 26 LYS B NZ   4  
ATOM 4333  H H    . LYS B 1 26 ? -9.904  5.473   -5.623  1.00 0.00 ? 26 LYS B H    4  
ATOM 4334  H HA   . LYS B 1 26 ? -11.392 4.319   -7.734  1.00 0.00 ? 26 LYS B HA   4  
ATOM 4335  H HB2  . LYS B 1 26 ? -11.498 4.110   -4.736  1.00 0.00 ? 26 LYS B HB2  4  
ATOM 4336  H HB3  . LYS B 1 26 ? -12.711 3.295   -5.744  1.00 0.00 ? 26 LYS B HB3  4  
ATOM 4337  H HG2  . LYS B 1 26 ? -9.717  2.999   -6.198  1.00 0.00 ? 26 LYS B HG2  4  
ATOM 4338  H HG3  . LYS B 1 26 ? -10.622 1.934   -5.104  1.00 0.00 ? 26 LYS B HG3  4  
ATOM 4339  H HD2  . LYS B 1 26 ? -10.956 2.291   -8.106  1.00 0.00 ? 26 LYS B HD2  4  
ATOM 4340  H HD3  . LYS B 1 26 ? -10.524 0.812   -7.224  1.00 0.00 ? 26 LYS B HD3  4  
ATOM 4341  H HE2  . LYS B 1 26 ? -12.832 1.001   -6.096  1.00 0.00 ? 26 LYS B HE2  4  
ATOM 4342  H HE3  . LYS B 1 26 ? -13.209 2.246   -7.304  1.00 0.00 ? 26 LYS B HE3  4  
ATOM 4343  H HZ1  . LYS B 1 26 ? -12.382 -0.533  -7.881  1.00 0.00 ? 26 LYS B HZ1  4  
ATOM 4344  H HZ2  . LYS B 1 26 ? -13.934 0.075   -7.990  1.00 0.00 ? 26 LYS B HZ2  4  
ATOM 4345  H HZ3  . LYS B 1 26 ? -12.749 0.620   -9.019  1.00 0.00 ? 26 LYS B HZ3  4  
ATOM 4346  N N    . LYS B 1 27 ? -12.758 6.864   -6.225  1.00 0.00 ? 27 LYS B N    4  
ATOM 4347  C CA   . LYS B 1 27 ? -13.869 7.802   -6.245  1.00 0.00 ? 27 LYS B CA   4  
ATOM 4348  C C    . LYS B 1 27 ? -13.796 8.644   -7.519  1.00 0.00 ? 27 LYS B C    4  
ATOM 4349  O O    . LYS B 1 27 ? -14.780 9.333   -7.827  1.00 0.00 ? 27 LYS B O    4  
ATOM 4350  C CB   . LYS B 1 27 ? -13.891 8.632   -4.960  1.00 0.00 ? 27 LYS B CB   4  
ATOM 4351  C CG   . LYS B 1 27 ? -15.319 8.777   -4.426  1.00 0.00 ? 27 LYS B CG   4  
ATOM 4352  C CD   . LYS B 1 27 ? -15.451 8.149   -3.038  1.00 0.00 ? 27 LYS B CD   4  
ATOM 4353  C CE   . LYS B 1 27 ? -14.869 9.068   -1.961  1.00 0.00 ? 27 LYS B CE   4  
ATOM 4354  N NZ   . LYS B 1 27 ? -13.706 9.802   -2.486  1.00 0.00 ? 27 LYS B NZ   4  
ATOM 4355  H H    . LYS B 1 27 ? -11.924 7.122   -5.697  1.00 0.00 ? 27 LYS B H    4  
ATOM 4356  H HA   . LYS B 1 27 ? -14.778 7.202   -6.266  1.00 0.00 ? 27 LYS B HA   4  
ATOM 4357  H HB2  . LYS B 1 27 ? -13.280 8.135   -4.207  1.00 0.00 ? 27 LYS B HB2  4  
ATOM 4358  H HB3  . LYS B 1 27 ? -13.470 9.616   -5.167  1.00 0.00 ? 27 LYS B HB3  4  
ATOM 4359  H HG2  . LYS B 1 27 ? -15.565 9.837   -4.362  1.00 0.00 ? 27 LYS B HG2  4  
ATOM 4360  H HG3  . LYS B 1 27 ? -16.006 8.294   -5.120  1.00 0.00 ? 27 LYS B HG3  4  
ATOM 4361  H HD2  . LYS B 1 27 ? -16.507 7.979   -2.825  1.00 0.00 ? 27 LYS B HD2  4  
ATOM 4362  H HD3  . LYS B 1 27 ? -14.930 7.192   -3.031  1.00 0.00 ? 27 LYS B HD3  4  
ATOM 4363  H HE2  . LYS B 1 27 ? -15.631 9.785   -1.652  1.00 0.00 ? 27 LYS B HE2  4  
ATOM 4364  H HE3  . LYS B 1 27 ? -14.573 8.469   -1.100  1.00 0.00 ? 27 LYS B HE3  4  
ATOM 4365  H HZ1  . LYS B 1 27 ? -13.982 10.363  -3.292  1.00 0.00 ? 27 LYS B HZ1  4  
ATOM 4366  H HZ2  . LYS B 1 27 ? -13.336 10.406  -1.752  1.00 0.00 ? 27 LYS B HZ2  4  
ATOM 4367  H HZ3  . LYS B 1 27 ? -12.980 9.145   -2.772  1.00 0.00 ? 27 LYS B HZ3  4  
ATOM 4368  N N    . LEU B 1 28 ? -12.653 8.574   -8.224  1.00 0.00 ? 28 LEU B N    4  
ATOM 4369  C CA   . LEU B 1 28 ? -12.458 9.325   -9.453  1.00 0.00 ? 28 LEU B CA   4  
ATOM 4370  C C    . LEU B 1 28 ? -12.677 8.399   -10.651 1.00 0.00 ? 28 LEU B C    4  
ATOM 4371  O O    . LEU B 1 28 ? -13.205 8.869   -11.671 1.00 0.00 ? 28 LEU B O    4  
ATOM 4372  C CB   . LEU B 1 28 ? -11.092 10.013  -9.449  1.00 0.00 ? 28 LEU B CB   4  
ATOM 4373  C CG   . LEU B 1 28 ? -11.091 11.504  -9.794  1.00 0.00 ? 28 LEU B CG   4  
ATOM 4374  C CD1  . LEU B 1 28 ? -11.416 12.352  -8.562  1.00 0.00 ? 28 LEU B CD1  4  
ATOM 4375  C CD2  . LEU B 1 28 ? -9.767  11.917  -10.440 1.00 0.00 ? 28 LEU B CD2  4  
ATOM 4376  H H    . LEU B 1 28 ? -11.890 7.980   -7.900  1.00 0.00 ? 28 LEU B H    4  
ATOM 4377  H HA   . LEU B 1 28 ? -13.220 10.104  -9.463  1.00 0.00 ? 28 LEU B HA   4  
ATOM 4378  H HB2  . LEU B 1 28 ? -10.684 9.880   -8.448  1.00 0.00 ? 28 LEU B HB2  4  
ATOM 4379  H HB3  . LEU B 1 28 ? -10.473 9.467   -10.161 1.00 0.00 ? 28 LEU B HB3  4  
ATOM 4380  H HG   . LEU B 1 28 ? -11.895 11.628  -10.520 1.00 0.00 ? 28 LEU B HG   4  
ATOM 4381  H HD11 . LEU B 1 28 ? -10.679 12.169  -7.780  1.00 0.00 ? 28 LEU B HD11 4  
ATOM 4382  H HD12 . LEU B 1 28 ? -11.406 13.405  -8.844  1.00 0.00 ? 28 LEU B HD12 4  
ATOM 4383  H HD13 . LEU B 1 28 ? -12.406 12.094  -8.185  1.00 0.00 ? 28 LEU B HD13 4  
ATOM 4384  H HD21 . LEU B 1 28 ? -9.605  11.343  -11.353 1.00 0.00 ? 28 LEU B HD21 4  
ATOM 4385  H HD22 . LEU B 1 28 ? -9.802  12.981  -10.672 1.00 0.00 ? 28 LEU B HD22 4  
ATOM 4386  H HD23 . LEU B 1 28 ? -8.943  11.730  -9.752  1.00 0.00 ? 28 LEU B HD23 4  
ATOM 4387  N N    . VAL B 1 29 ? -12.275 7.123   -10.508 1.00 0.00 ? 29 VAL B N    4  
ATOM 4388  C CA   . VAL B 1 29 ? -12.427 6.144   -11.571 1.00 0.00 ? 29 VAL B CA   4  
ATOM 4389  C C    . VAL B 1 29 ? -13.593 5.212   -11.238 1.00 0.00 ? 29 VAL B C    4  
ATOM 4390  O O    . VAL B 1 29 ? -14.602 5.251   -11.956 1.00 0.00 ? 29 VAL B O    4  
ATOM 4391  C CB   . VAL B 1 29 ? -11.109 5.399   -11.787 1.00 0.00 ? 29 VAL B CB   4  
ATOM 4392  C CG1  . VAL B 1 29 ? -11.116 4.648   -13.121 1.00 0.00 ? 29 VAL B CG1  4  
ATOM 4393  C CG2  . VAL B 1 29 ? -9.917  6.355   -11.703 1.00 0.00 ? 29 VAL B CG2  4  
ATOM 4394  H H    . VAL B 1 29 ? -11.849 6.818   -9.633  1.00 0.00 ? 29 VAL B H    4  
ATOM 4395  H HA   . VAL B 1 29 ? -12.659 6.689   -12.486 1.00 0.00 ? 29 VAL B HA   4  
ATOM 4396  H HB   . VAL B 1 29 ? -11.041 4.676   -10.974 1.00 0.00 ? 29 VAL B HB   4  
ATOM 4397  H HG11 . VAL B 1 29 ? -11.263 5.349   -13.941 1.00 0.00 ? 29 VAL B HG11 4  
ATOM 4398  H HG12 . VAL B 1 29 ? -10.164 4.131   -13.242 1.00 0.00 ? 29 VAL B HG12 4  
ATOM 4399  H HG13 . VAL B 1 29 ? -11.922 3.915   -13.131 1.00 0.00 ? 29 VAL B HG13 4  
ATOM 4400  H HG21 . VAL B 1 29 ? -9.894  6.836   -10.725 1.00 0.00 ? 29 VAL B HG21 4  
ATOM 4401  H HG22 . VAL B 1 29 ? -8.997  5.791   -11.861 1.00 0.00 ? 29 VAL B HG22 4  
ATOM 4402  H HG23 . VAL B 1 29 ? -10.001 7.122   -12.473 1.00 0.00 ? 29 VAL B HG23 4  
ATOM 4403  N N    . GLY B 1 30 ? -13.434 4.406   -10.172 1.00 0.00 ? 30 GLY B N    4  
ATOM 4404  C CA   . GLY B 1 30 ? -14.467 3.476   -9.749  1.00 0.00 ? 30 GLY B CA   4  
ATOM 4405  C C    . GLY B 1 30 ? -15.703 4.259   -9.305  1.00 0.00 ? 30 GLY B C    4  
ATOM 4406  O O    . GLY B 1 30 ? -16.689 3.625   -8.901  1.00 0.00 ? 30 GLY B O    4  
ATOM 4407  H H    . GLY B 1 30 ? -12.569 4.438   -9.633  1.00 0.00 ? 30 GLY B H    4  
ATOM 4408  H HA2  . GLY B 1 30 ? -14.739 2.825   -10.580 1.00 0.00 ? 30 GLY B HA2  4  
ATOM 4409  H HA3  . GLY B 1 30 ? -14.098 2.864   -8.926  1.00 0.00 ? 30 GLY B HA3  4  
ATOM 4410  N N    . GLU B 1 31 ? -15.629 5.599   -9.387  1.00 0.00 ? 31 GLU B N    4  
ATOM 4411  C CA   . GLU B 1 31 ? -16.734 6.457   -8.995  1.00 0.00 ? 31 GLU B CA   4  
ATOM 4412  C C    . GLU B 1 31 ? -18.046 5.858   -9.507  1.00 0.00 ? 31 GLU B C    4  
ATOM 4413  O O    . GLU B 1 31 ? -18.110 5.512   -10.696 1.00 0.00 ? 31 GLU B O    4  
ATOM 4414  C CB   . GLU B 1 31 ? -16.546 7.886   -9.510  1.00 0.00 ? 31 GLU B CB   4  
ATOM 4415  C CG   . GLU B 1 31 ? -17.214 8.069   -10.875 1.00 0.00 ? 31 GLU B CG   4  
ATOM 4416  C CD   . GLU B 1 31 ? -16.928 9.462   -11.442 1.00 0.00 ? 31 GLU B CD   4  
ATOM 4417  O OE1  . GLU B 1 31 ? -15.834 10.005  -11.027 1.00 0.00 ? 31 GLU B OE1  4  
ATOM 4418  O OE2  . GLU B 1 31 ? -17.724 9.982   -12.238 1.00 0.00 ? 31 GLU B OE2  4  
ATOM 4419  H H    . GLU B 1 31 ? -14.777 6.043   -9.731  1.00 0.00 ? 31 GLU B H    4  
ATOM 4420  H HA   . GLU B 1 31 ? -16.753 6.475   -7.905  1.00 0.00 ? 31 GLU B HA   4  
ATOM 4421  H HB2  . GLU B 1 31 ? -16.994 8.581   -8.799  1.00 0.00 ? 31 GLU B HB2  4  
ATOM 4422  H HB3  . GLU B 1 31 ? -15.479 8.096   -9.587  1.00 0.00 ? 31 GLU B HB3  4  
ATOM 4423  H HG2  . GLU B 1 31 ? -16.825 7.319   -11.563 1.00 0.00 ? 31 GLU B HG2  4  
ATOM 4424  H HG3  . GLU B 1 31 ? -18.289 7.927   -10.764 1.00 0.00 ? 31 GLU B HG3  4  
ATOM 4425  N N    . ARG B 1 32 ? -19.047 5.750   -8.616  1.00 0.00 ? 32 ARG B N    4  
ATOM 4426  C CA   . ARG B 1 32 ? -20.342 5.198   -8.976  1.00 0.00 ? 32 ARG B CA   4  
ATOM 4427  C C    . ARG B 1 32 ? -20.786 5.784   -10.318 1.00 0.00 ? 32 ARG B C    4  
ATOM 4428  O O    . ARG B 1 32 ? -20.960 5.051   -11.290 1.00 0.00 ? 32 ARG B O    4  
ATOM 4429  C CB   . ARG B 1 32 ? -21.401 5.508   -7.916  1.00 0.00 ? 32 ARG B CB   4  
ATOM 4430  C CG   . ARG B 1 32 ? -20.763 5.678   -6.536  1.00 0.00 ? 32 ARG B CG   4  
ATOM 4431  C CD   . ARG B 1 32 ? -19.958 4.436   -6.147  1.00 0.00 ? 32 ARG B CD   4  
ATOM 4432  N NE   . ARG B 1 32 ? -20.640 3.218   -6.637  1.00 0.00 ? 32 ARG B NE   4  
ATOM 4433  C CZ   . ARG B 1 32 ? -21.212 2.295   -5.834  1.00 0.00 ? 32 ARG B CZ   4  
ATOM 4434  N NH1  . ARG B 1 32 ? -21.171 2.474   -4.507  1.00 0.00 ? 32 ARG B NH1  4  
ATOM 4435  N NH2  . ARG B 1 32 ? -21.811 1.216   -6.357  1.00 0.00 ? 32 ARG B NH2  4  
ATOM 4436  H H    . ARG B 1 32 ? -18.909 6.061   -7.654  1.00 0.00 ? 32 ARG B H    4  
ATOM 4437  H HA   . ARG B 1 32 ? -20.228 4.119   -9.080  1.00 0.00 ? 32 ARG B HA   4  
ATOM 4438  H HB2  . ARG B 1 32 ? -21.913 6.431   -8.187  1.00 0.00 ? 32 ARG B HB2  4  
ATOM 4439  H HB3  . ARG B 1 32 ? -22.126 4.695   -7.893  1.00 0.00 ? 32 ARG B HB3  4  
ATOM 4440  H HG2  . ARG B 1 32 ? -20.096 6.541   -6.559  1.00 0.00 ? 32 ARG B HG2  4  
ATOM 4441  H HG3  . ARG B 1 32 ? -21.549 5.857   -5.803  1.00 0.00 ? 32 ARG B HG3  4  
ATOM 4442  H HD2  . ARG B 1 32 ? -18.966 4.492   -6.595  1.00 0.00 ? 32 ARG B HD2  4  
ATOM 4443  H HD3  . ARG B 1 32 ? -19.857 4.395   -5.062  1.00 0.00 ? 32 ARG B HD3  4  
ATOM 4444  H HE   . ARG B 1 32 ? -20.662 3.096   -7.650  1.00 0.00 ? 32 ARG B HE   4  
ATOM 4445  H HH11 . ARG B 1 32 ? -20.713 3.298   -4.117  1.00 0.00 ? 32 ARG B HH11 4  
ATOM 4446  H HH12 . ARG B 1 32 ? -21.598 1.787   -3.886  1.00 0.00 ? 32 ARG B HH12 4  
ATOM 4447  H HH21 . ARG B 1 32 ? -21.838 1.088   -7.368  1.00 0.00 ? 32 ARG B HH21 4  
ATOM 4448  H HH22 . ARG B 1 32 ? -22.240 0.524   -5.743  1.00 0.00 ? 32 ARG B HH22 4  
ATOM 4449  N N    . MET A 1 1  ? 8.614   -11.511 16.789  1.00 0.00 ? 1  MET A N    5  
ATOM 4450  C CA   . MET A 1 1  ? 9.263   -11.382 15.495  1.00 0.00 ? 1  MET A CA   5  
ATOM 4451  C C    . MET A 1 1  ? 8.637   -12.374 14.514  1.00 0.00 ? 1  MET A C    5  
ATOM 4452  O O    . MET A 1 1  ? 8.425   -12.000 13.351  1.00 0.00 ? 1  MET A O    5  
ATOM 4453  C CB   . MET A 1 1  ? 10.762  -11.664 15.621  1.00 0.00 ? 1  MET A CB   5  
ATOM 4454  C CG   . MET A 1 1  ? 11.564  -10.819 14.630  1.00 0.00 ? 1  MET A CG   5  
ATOM 4455  S SD   . MET A 1 1  ? 13.021  -11.743 14.061  1.00 0.00 ? 1  MET A SD   5  
ATOM 4456  C CE   . MET A 1 1  ? 13.358  -10.873 12.502  1.00 0.00 ? 1  MET A CE   5  
ATOM 4457  H H    . MET A 1 1  ? 9.204   -11.535 17.620  1.00 0.00 ? 1  MET A H    5  
ATOM 4458  H HA   . MET A 1 1  ? 9.110   -10.369 15.122  1.00 0.00 ? 1  MET A HA   5  
ATOM 4459  H HB2  . MET A 1 1  ? 11.083  -11.423 16.634  1.00 0.00 ? 1  MET A HB2  5  
ATOM 4460  H HB3  . MET A 1 1  ? 10.939  -12.723 15.435  1.00 0.00 ? 1  MET A HB3  5  
ATOM 4461  H HG2  . MET A 1 1  ? 10.939  -10.578 13.770  1.00 0.00 ? 1  MET A HG2  5  
ATOM 4462  H HG3  . MET A 1 1  ? 11.876  -9.893  15.112  1.00 0.00 ? 1  MET A HG3  5  
ATOM 4463  H HE1  . MET A 1 1  ? 13.546  -9.817  12.699  1.00 0.00 ? 1  MET A HE1  5  
ATOM 4464  H HE2  . MET A 1 1  ? 14.230  -11.323 12.026  1.00 0.00 ? 1  MET A HE2  5  
ATOM 4465  H HE3  . MET A 1 1  ? 12.503  -10.963 11.834  1.00 0.00 ? 1  MET A HE3  5  
ATOM 4466  N N    . ASP A 1 2  ? 8.358   -13.600 14.992  1.00 0.00 ? 2  ASP A N    5  
ATOM 4467  C CA   . ASP A 1 2  ? 7.762   -14.633 14.163  1.00 0.00 ? 2  ASP A CA   5  
ATOM 4468  C C    . ASP A 1 2  ? 6.511   -14.076 13.481  1.00 0.00 ? 2  ASP A C    5  
ATOM 4469  O O    . ASP A 1 2  ? 6.247   -14.456 12.331  1.00 0.00 ? 2  ASP A O    5  
ATOM 4470  C CB   . ASP A 1 2  ? 7.344   -15.841 15.004  1.00 0.00 ? 2  ASP A CB   5  
ATOM 4471  C CG   . ASP A 1 2  ? 8.239   -16.130 16.211  1.00 0.00 ? 2  ASP A CG   5  
ATOM 4472  O OD1  . ASP A 1 2  ? 9.268   -16.811 16.094  1.00 0.00 ? 2  ASP A OD1  5  
ATOM 4473  O OD2  . ASP A 1 2  ? 7.835   -15.617 17.323  1.00 0.00 ? 2  ASP A OD2  5  
ATOM 4474  H H    . ASP A 1 2  ? 8.564   -13.827 15.965  1.00 0.00 ? 2  ASP A H    5  
ATOM 4475  H HA   . ASP A 1 2  ? 8.480   -14.932 13.398  1.00 0.00 ? 2  ASP A HA   5  
ATOM 4476  H HB2  . ASP A 1 2  ? 6.329   -15.649 15.352  1.00 0.00 ? 2  ASP A HB2  5  
ATOM 4477  H HB3  . ASP A 1 2  ? 7.332   -16.702 14.335  1.00 0.00 ? 2  ASP A HB3  5  
ATOM 4478  N N    . ALA A 1 3  ? 5.777   -13.201 14.191  1.00 0.00 ? 3  ALA A N    5  
ATOM 4479  C CA   . ALA A 1 3  ? 4.568   -12.598 13.658  1.00 0.00 ? 3  ALA A CA   5  
ATOM 4480  C C    . ALA A 1 3  ? 4.924   -11.291 12.948  1.00 0.00 ? 3  ALA A C    5  
ATOM 4481  O O    . ALA A 1 3  ? 4.076   -10.772 12.205  1.00 0.00 ? 3  ALA A O    5  
ATOM 4482  C CB   . ALA A 1 3  ? 3.631   -12.220 14.808  1.00 0.00 ? 3  ALA A CB   5  
ATOM 4483  H H    . ALA A 1 3  ? 6.066   -12.940 15.134  1.00 0.00 ? 3  ALA A H    5  
ATOM 4484  H HA   . ALA A 1 3  ? 4.075   -13.264 12.949  1.00 0.00 ? 3  ALA A HA   5  
ATOM 4485  H HB1  . ALA A 1 3  ? 3.384   -13.119 15.374  1.00 0.00 ? 3  ALA A HB1  5  
ATOM 4486  H HB2  . ALA A 1 3  ? 4.122   -11.508 15.469  1.00 0.00 ? 3  ALA A HB2  5  
ATOM 4487  H HB3  . ALA A 1 3  ? 2.721   -11.769 14.412  1.00 0.00 ? 3  ALA A HB3  5  
ATOM 4488  N N    . ILE A 1 4  ? 6.150   -10.792 13.184  1.00 0.00 ? 4  ILE A N    5  
ATOM 4489  C CA   . ILE A 1 4  ? 6.610   -9.557  12.572  1.00 0.00 ? 4  ILE A CA   5  
ATOM 4490  C C    . ILE A 1 4  ? 7.040   -9.837  11.130  1.00 0.00 ? 4  ILE A C    5  
ATOM 4491  O O    . ILE A 1 4  ? 6.659   -9.063  10.240  1.00 0.00 ? 4  ILE A O    5  
ATOM 4492  C CB   . ILE A 1 4  ? 7.703   -8.911  13.424  1.00 0.00 ? 4  ILE A CB   5  
ATOM 4493  C CG1  . ILE A 1 4  ? 7.182   -8.576  14.823  1.00 0.00 ? 4  ILE A CG1  5  
ATOM 4494  C CG2  . ILE A 1 4  ? 8.293   -7.685  12.725  1.00 0.00 ? 4  ILE A CG2  5  
ATOM 4495  C CD1  . ILE A 1 4  ? 7.623   -7.175  15.252  1.00 0.00 ? 4  ILE A CD1  5  
ATOM 4496  H H    . ILE A 1 4  ? 6.788   -11.283 13.811  1.00 0.00 ? 4  ILE A H    5  
ATOM 4497  H HA   . ILE A 1 4  ? 5.757   -8.879  12.562  1.00 0.00 ? 4  ILE A HA   5  
ATOM 4498  H HB   . ILE A 1 4  ? 8.484   -9.668  13.509  1.00 0.00 ? 4  ILE A HB   5  
ATOM 4499  H HG12 . ILE A 1 4  ? 6.093   -8.619  14.815  1.00 0.00 ? 4  ILE A HG12 5  
ATOM 4500  H HG13 . ILE A 1 4  ? 7.561   -9.316  15.528  1.00 0.00 ? 4  ILE A HG13 5  
ATOM 4501  H HG21 . ILE A 1 4  ? 7.510   -6.951  12.538  1.00 0.00 ? 4  ILE A HG21 5  
ATOM 4502  H HG22 . ILE A 1 4  ? 9.066   -7.252  13.358  1.00 0.00 ? 4  ILE A HG22 5  
ATOM 4503  H HG23 . ILE A 1 4  ? 8.737   -7.978  11.773  1.00 0.00 ? 4  ILE A HG23 5  
ATOM 4504  H HD11 . ILE A 1 4  ? 7.244   -6.434  14.547  1.00 0.00 ? 4  ILE A HD11 5  
ATOM 4505  H HD12 . ILE A 1 4  ? 7.234   -6.971  16.250  1.00 0.00 ? 4  ILE A HD12 5  
ATOM 4506  H HD13 . ILE A 1 4  ? 8.711   -7.119  15.276  1.00 0.00 ? 4  ILE A HD13 5  
ATOM 4507  N N    . LYS A 1 5  ? 7.811   -10.922 10.932  1.00 0.00 ? 5  LYS A N    5  
ATOM 4508  C CA   . LYS A 1 5  ? 8.286   -11.297 9.611   1.00 0.00 ? 5  LYS A CA   5  
ATOM 4509  C C    . LYS A 1 5  ? 7.095   -11.393 8.654   1.00 0.00 ? 5  LYS A C    5  
ATOM 4510  O O    . LYS A 1 5  ? 7.256   -11.043 7.476   1.00 0.00 ? 5  LYS A O    5  
ATOM 4511  C CB   . LYS A 1 5  ? 9.120   -12.578 9.686   1.00 0.00 ? 5  LYS A CB   5  
ATOM 4512  C CG   . LYS A 1 5  ? 8.725   -13.420 10.900  1.00 0.00 ? 5  LYS A CG   5  
ATOM 4513  C CD   . LYS A 1 5  ? 8.870   -14.913 10.602  1.00 0.00 ? 5  LYS A CD   5  
ATOM 4514  C CE   . LYS A 1 5  ? 10.243  -15.428 11.041  1.00 0.00 ? 5  LYS A CE   5  
ATOM 4515  N NZ   . LYS A 1 5  ? 10.627  -16.609 10.250  1.00 0.00 ? 5  LYS A NZ   5  
ATOM 4516  H H    . LYS A 1 5  ? 8.080   -11.508 11.722  1.00 0.00 ? 5  LYS A H    5  
ATOM 4517  H HA   . LYS A 1 5  ? 8.944   -10.495 9.279   1.00 0.00 ? 5  LYS A HA   5  
ATOM 4518  H HB2  . LYS A 1 5  ? 8.955   -13.161 8.780   1.00 0.00 ? 5  LYS A HB2  5  
ATOM 4519  H HB3  . LYS A 1 5  ? 10.175  -12.309 9.747   1.00 0.00 ? 5  LYS A HB3  5  
ATOM 4520  H HG2  . LYS A 1 5  ? 9.373   -13.159 11.737  1.00 0.00 ? 5  LYS A HG2  5  
ATOM 4521  H HG3  . LYS A 1 5  ? 7.693   -13.193 11.167  1.00 0.00 ? 5  LYS A HG3  5  
ATOM 4522  H HD2  . LYS A 1 5  ? 8.098   -15.459 11.143  1.00 0.00 ? 5  LYS A HD2  5  
ATOM 4523  H HD3  . LYS A 1 5  ? 8.737   -15.076 9.533   1.00 0.00 ? 5  LYS A HD3  5  
ATOM 4524  H HE2  . LYS A 1 5  ? 10.985  -14.644 10.891  1.00 0.00 ? 5  LYS A HE2  5  
ATOM 4525  H HE3  . LYS A 1 5  ? 10.208  -15.686 12.099  1.00 0.00 ? 5  LYS A HE3  5  
ATOM 4526  H HZ1  . LYS A 1 5  ? 10.661  -16.368 9.259   1.00 0.00 ? 5  LYS A HZ1  5  
ATOM 4527  H HZ2  . LYS A 1 5  ? 11.544  -16.932 10.560  1.00 0.00 ? 5  LYS A HZ2  5  
ATOM 4528  H HZ3  . LYS A 1 5  ? 9.947   -17.357 10.388  1.00 0.00 ? 5  LYS A HZ3  5  
ATOM 4529  N N    . LYS A 1 6  ? 5.944   -11.860 9.170   1.00 0.00 ? 6  LYS A N    5  
ATOM 4530  C CA   . LYS A 1 6  ? 4.741   -12.001 8.367   1.00 0.00 ? 6  LYS A CA   5  
ATOM 4531  C C    . LYS A 1 6  ? 3.974   -10.677 8.369   1.00 0.00 ? 6  LYS A C    5  
ATOM 4532  O O    . LYS A 1 6  ? 3.324   -10.371 7.359   1.00 0.00 ? 6  LYS A O    5  
ATOM 4533  C CB   . LYS A 1 6  ? 3.912   -13.193 8.849   1.00 0.00 ? 6  LYS A CB   5  
ATOM 4534  C CG   . LYS A 1 6  ? 4.814   -14.316 9.365   1.00 0.00 ? 6  LYS A CG   5  
ATOM 4535  C CD   . LYS A 1 6  ? 4.135   -15.678 9.212   1.00 0.00 ? 6  LYS A CD   5  
ATOM 4536  C CE   . LYS A 1 6  ? 3.729   -15.929 7.759   1.00 0.00 ? 6  LYS A CE   5  
ATOM 4537  N NZ   . LYS A 1 6  ? 3.594   -17.372 7.502   1.00 0.00 ? 6  LYS A NZ   5  
ATOM 4538  H H    . LYS A 1 6  ? 5.898   -12.128 10.154  1.00 0.00 ? 6  LYS A H    5  
ATOM 4539  H HA   . LYS A 1 6  ? 5.071   -12.219 7.352   1.00 0.00 ? 6  LYS A HA   5  
ATOM 4540  H HB2  . LYS A 1 6  ? 3.257   -12.865 9.656   1.00 0.00 ? 6  LYS A HB2  5  
ATOM 4541  H HB3  . LYS A 1 6  ? 3.302   -13.556 8.022   1.00 0.00 ? 6  LYS A HB3  5  
ATOM 4542  H HG2  . LYS A 1 6  ? 5.742   -14.316 8.792   1.00 0.00 ? 6  LYS A HG2  5  
ATOM 4543  H HG3  . LYS A 1 6  ? 5.044   -14.131 10.415  1.00 0.00 ? 6  LYS A HG3  5  
ATOM 4544  H HD2  . LYS A 1 6  ? 4.829   -16.458 9.527   1.00 0.00 ? 6  LYS A HD2  5  
ATOM 4545  H HD3  . LYS A 1 6  ? 3.254   -15.709 9.854   1.00 0.00 ? 6  LYS A HD3  5  
ATOM 4546  H HE2  . LYS A 1 6  ? 2.772   -15.444 7.565   1.00 0.00 ? 6  LYS A HE2  5  
ATOM 4547  H HE3  . LYS A 1 6  ? 4.484   -15.503 7.098   1.00 0.00 ? 6  LYS A HE3  5  
ATOM 4548  H HZ1  . LYS A 1 6  ? 2.889   -17.772 8.121   1.00 0.00 ? 6  LYS A HZ1  5  
ATOM 4549  H HZ2  . LYS A 1 6  ? 3.324   -17.513 6.529   1.00 0.00 ? 6  LYS A HZ2  5  
ATOM 4550  H HZ3  . LYS A 1 6  ? 4.486   -17.840 7.671   1.00 0.00 ? 6  LYS A HZ3  5  
ATOM 4551  N N    . LYS A 1 7  ? 4.065   -9.930  9.485   1.00 0.00 ? 7  LYS A N    5  
ATOM 4552  C CA   . LYS A 1 7  ? 3.384   -8.654  9.613   1.00 0.00 ? 7  LYS A CA   5  
ATOM 4553  C C    . LYS A 1 7  ? 3.710   -7.781  8.399   1.00 0.00 ? 7  LYS A C    5  
ATOM 4554  O O    . LYS A 1 7  ? 2.787   -7.157  7.857   1.00 0.00 ? 7  LYS A O    5  
ATOM 4555  C CB   . LYS A 1 7  ? 3.726   -7.996  10.952  1.00 0.00 ? 7  LYS A CB   5  
ATOM 4556  C CG   . LYS A 1 7  ? 3.020   -6.647  11.097  1.00 0.00 ? 7  LYS A CG   5  
ATOM 4557  C CD   . LYS A 1 7  ? 1.536   -6.764  10.743  1.00 0.00 ? 7  LYS A CD   5  
ATOM 4558  C CE   . LYS A 1 7  ? 0.757   -5.543  11.235  1.00 0.00 ? 7  LYS A CE   5  
ATOM 4559  N NZ   . LYS A 1 7  ? -0.143  -5.047  10.181  1.00 0.00 ? 7  LYS A NZ   5  
ATOM 4560  H H    . LYS A 1 7  ? 4.624   -10.256 10.273  1.00 0.00 ? 7  LYS A H    5  
ATOM 4561  H HA   . LYS A 1 7  ? 2.316   -8.871  9.617   1.00 0.00 ? 7  LYS A HA   5  
ATOM 4562  H HB2  . LYS A 1 7  ? 3.407   -8.653  11.760  1.00 0.00 ? 7  LYS A HB2  5  
ATOM 4563  H HB3  . LYS A 1 7  ? 4.807   -7.858  11.012  1.00 0.00 ? 7  LYS A HB3  5  
ATOM 4564  H HG2  . LYS A 1 7  ? 3.112   -6.309  12.129  1.00 0.00 ? 7  LYS A HG2  5  
ATOM 4565  H HG3  . LYS A 1 7  ? 3.503   -5.922  10.441  1.00 0.00 ? 7  LYS A HG3  5  
ATOM 4566  H HD2  . LYS A 1 7  ? 1.436   -6.836  9.660   1.00 0.00 ? 7  LYS A HD2  5  
ATOM 4567  H HD3  . LYS A 1 7  ? 1.134   -7.669  11.197  1.00 0.00 ? 7  LYS A HD3  5  
ATOM 4568  H HE2  . LYS A 1 7  ? 0.162   -5.824  12.105  1.00 0.00 ? 7  LYS A HE2  5  
ATOM 4569  H HE3  . LYS A 1 7  ? 1.459   -4.762  11.523  1.00 0.00 ? 7  LYS A HE3  5  
ATOM 4570  H HZ1  . LYS A 1 7  ? -0.801  -5.777  9.912   1.00 0.00 ? 7  LYS A HZ1  5  
ATOM 4571  H HZ2  . LYS A 1 7  ? -0.650  -4.235  10.533  1.00 0.00 ? 7  LYS A HZ2  5  
ATOM 4572  H HZ3  . LYS A 1 7  ? 0.400   -4.770  9.363   1.00 0.00 ? 7  LYS A HZ3  5  
ATOM 4573  N N    . MET A 1 8  ? 4.996   -7.757  8.003   1.00 0.00 ? 8  MET A N    5  
ATOM 4574  C CA   . MET A 1 8  ? 5.435   -6.969  6.864   1.00 0.00 ? 8  MET A CA   5  
ATOM 4575  C C    . MET A 1 8  ? 5.031   -7.680  5.571   1.00 0.00 ? 8  MET A C    5  
ATOM 4576  O O    . MET A 1 8  ? 4.952   -7.011  4.531   1.00 0.00 ? 8  MET A O    5  
ATOM 4577  C CB   . MET A 1 8  ? 6.954   -6.790  6.895   1.00 0.00 ? 8  MET A CB   5  
ATOM 4578  C CG   . MET A 1 8  ? 7.662   -8.139  7.028   1.00 0.00 ? 8  MET A CG   5  
ATOM 4579  S SD   . MET A 1 8  ? 9.372   -7.892  7.591   1.00 0.00 ? 8  MET A SD   5  
ATOM 4580  C CE   . MET A 1 8  ? 10.144  -7.360  6.035   1.00 0.00 ? 8  MET A CE   5  
ATOM 4581  H H    . MET A 1 8  ? 5.694   -8.302  8.507   1.00 0.00 ? 8  MET A H    5  
ATOM 4582  H HA   . MET A 1 8  ? 4.950   -5.994  6.900   1.00 0.00 ? 8  MET A HA   5  
ATOM 4583  H HB2  . MET A 1 8  ? 7.273   -6.312  5.970   1.00 0.00 ? 8  MET A HB2  5  
ATOM 4584  H HB3  . MET A 1 8  ? 7.217   -6.148  7.736   1.00 0.00 ? 8  MET A HB3  5  
ATOM 4585  H HG2  . MET A 1 8  ? 7.135   -8.756  7.756   1.00 0.00 ? 8  MET A HG2  5  
ATOM 4586  H HG3  . MET A 1 8  ? 7.658   -8.648  6.064   1.00 0.00 ? 8  MET A HG3  5  
ATOM 4587  H HE1  . MET A 1 8  ? 9.656   -6.457  5.668   1.00 0.00 ? 8  MET A HE1  5  
ATOM 4588  H HE2  . MET A 1 8  ? 11.201  -7.167  6.211   1.00 0.00 ? 8  MET A HE2  5  
ATOM 4589  H HE3  . MET A 1 8  ? 10.046  -8.145  5.284   1.00 0.00 ? 8  MET A HE3  5  
ATOM 4590  N N    . GLN A 1 9  ? 4.788   -8.999  5.660   1.00 0.00 ? 9  GLN A N    5  
ATOM 4591  C CA   . GLN A 1 9  ? 4.396   -9.789  4.506   1.00 0.00 ? 9  GLN A CA   5  
ATOM 4592  C C    . GLN A 1 9  ? 2.942   -9.473  4.146   1.00 0.00 ? 9  GLN A C    5  
ATOM 4593  O O    . GLN A 1 9  ? 2.588   -9.593  2.964   1.00 0.00 ? 9  GLN A O    5  
ATOM 4594  C CB   . GLN A 1 9  ? 4.585   -11.286 4.759   1.00 0.00 ? 9  GLN A CB   5  
ATOM 4595  C CG   . GLN A 1 9  ? 6.049   -11.693 4.574   1.00 0.00 ? 9  GLN A CG   5  
ATOM 4596  C CD   . GLN A 1 9  ? 6.161   -13.160 4.153   1.00 0.00 ? 9  GLN A CD   5  
ATOM 4597  O OE1  . GLN A 1 9  ? 5.580   -13.598 3.174   1.00 0.00 ? 9  GLN A OE1  5  
ATOM 4598  N NE2  . GLN A 1 9  ? 6.940   -13.891 4.946   1.00 0.00 ? 9  GLN A NE2  5  
ATOM 4599  H H    . GLN A 1 9  ? 4.876   -9.475  6.558   1.00 0.00 ? 9  GLN A H    5  
ATOM 4600  H HA   . GLN A 1 9  ? 5.039   -9.486  3.679   1.00 0.00 ? 9  GLN A HA   5  
ATOM 4601  H HB2  . GLN A 1 9  ? 4.279   -11.515 5.779   1.00 0.00 ? 9  GLN A HB2  5  
ATOM 4602  H HB3  . GLN A 1 9  ? 3.955   -11.844 4.066   1.00 0.00 ? 9  GLN A HB3  5  
ATOM 4603  H HG2  . GLN A 1 9  ? 6.495   -11.067 3.802   1.00 0.00 ? 9  GLN A HG2  5  
ATOM 4604  H HG3  . GLN A 1 9  ? 6.581   -11.533 5.512   1.00 0.00 ? 9  GLN A HG3  5  
ATOM 4605  H HE21 . GLN A 1 9  ? 7.397   -13.460 5.750   1.00 0.00 ? 9  GLN A HE21 5  
ATOM 4606  H HE22 . GLN A 1 9  ? 7.079   -14.882 4.749   1.00 0.00 ? 9  GLN A HE22 5  
ATOM 4607  N N    . MET A 1 10 ? 2.144   -9.083  5.155   1.00 0.00 ? 10 MET A N    5  
ATOM 4608  C CA   . MET A 1 10 ? 0.743   -8.755  4.947   1.00 0.00 ? 10 MET A CA   5  
ATOM 4609  C C    . MET A 1 10 ? 0.634   -7.331  4.399   1.00 0.00 ? 10 MET A C    5  
ATOM 4610  O O    . MET A 1 10 ? -0.203  -7.102  3.513   1.00 0.00 ? 10 MET A O    5  
ATOM 4611  C CB   . MET A 1 10 ? -0.030  -8.857  6.264   1.00 0.00 ? 10 MET A CB   5  
ATOM 4612  C CG   . MET A 1 10 ? 0.791   -9.592  7.325   1.00 0.00 ? 10 MET A CG   5  
ATOM 4613  S SD   . MET A 1 10 ? -0.204  -9.825  8.827   1.00 0.00 ? 10 MET A SD   5  
ATOM 4614  C CE   . MET A 1 10 ? -1.874  -9.724  8.119   1.00 0.00 ? 10 MET A CE   5  
ATOM 4615  H H    . MET A 1 10 ? 2.517   -9.012  6.102   1.00 0.00 ? 10 MET A H    5  
ATOM 4616  H HA   . MET A 1 10 ? 0.322   -9.449  4.219   1.00 0.00 ? 10 MET A HA   5  
ATOM 4617  H HB2  . MET A 1 10 ? -0.253  -7.852  6.621   1.00 0.00 ? 10 MET A HB2  5  
ATOM 4618  H HB3  . MET A 1 10 ? -0.965  -9.386  6.083   1.00 0.00 ? 10 MET A HB3  5  
ATOM 4619  H HG2  . MET A 1 10 ? 1.088   -10.568 6.941   1.00 0.00 ? 10 MET A HG2  5  
ATOM 4620  H HG3  . MET A 1 10 ? 1.685   -9.014  7.558   1.00 0.00 ? 10 MET A HG3  5  
ATOM 4621  H HE1  . MET A 1 10 ? -2.008  -10.502 7.368   1.00 0.00 ? 10 MET A HE1  5  
ATOM 4622  H HE2  . MET A 1 10 ? -2.607  -9.849  8.917   1.00 0.00 ? 10 MET A HE2  5  
ATOM 4623  H HE3  . MET A 1 10 ? -2.021  -8.750  7.651   1.00 0.00 ? 10 MET A HE3  5  
ATOM 4624  N N    . LEU A 1 11 ? 1.469   -6.418  4.928   1.00 0.00 ? 11 LEU A N    5  
ATOM 4625  C CA   . LEU A 1 11 ? 1.465   -5.031  4.494   1.00 0.00 ? 11 LEU A CA   5  
ATOM 4626  C C    . LEU A 1 11 ? 2.201   -4.916  3.157   1.00 0.00 ? 11 LEU A C    5  
ATOM 4627  O O    . LEU A 1 11 ? 1.902   -3.983  2.398   1.00 0.00 ? 11 LEU A O    5  
ATOM 4628  C CB   . LEU A 1 11 ? 2.035   -4.126  5.589   1.00 0.00 ? 11 LEU A CB   5  
ATOM 4629  C CG   . LEU A 1 11 ? 1.298   -4.148  6.928   1.00 0.00 ? 11 LEU A CG   5  
ATOM 4630  C CD1  . LEU A 1 11 ? 2.152   -3.524  8.035   1.00 0.00 ? 11 LEU A CD1  5  
ATOM 4631  C CD2  . LEU A 1 11 ? -0.071  -3.475  6.813   1.00 0.00 ? 11 LEU A CD2  5  
ATOM 4632  H H    . LEU A 1 11 ? 2.129   -6.690  5.655   1.00 0.00 ? 11 LEU A H    5  
ATOM 4633  H HA   . LEU A 1 11 ? 0.420   -4.753  4.349   1.00 0.00 ? 11 LEU A HA   5  
ATOM 4634  H HB2  . LEU A 1 11 ? 3.066   -4.445  5.745   1.00 0.00 ? 11 LEU A HB2  5  
ATOM 4635  H HB3  . LEU A 1 11 ? 2.035   -3.116  5.180   1.00 0.00 ? 11 LEU A HB3  5  
ATOM 4636  H HG   . LEU A 1 11 ? 1.156   -5.204  7.158   1.00 0.00 ? 11 LEU A HG   5  
ATOM 4637  H HD11 . LEU A 1 11 ? 2.392   -2.492  7.780   1.00 0.00 ? 11 LEU A HD11 5  
ATOM 4638  H HD12 . LEU A 1 11 ? 1.597   -3.557  8.972   1.00 0.00 ? 11 LEU A HD12 5  
ATOM 4639  H HD13 . LEU A 1 11 ? 3.078   -4.085  8.151   1.00 0.00 ? 11 LEU A HD13 5  
ATOM 4640  H HD21 . LEU A 1 11 ? -0.677  -3.991  6.068   1.00 0.00 ? 11 LEU A HD21 5  
ATOM 4641  H HD22 . LEU A 1 11 ? -0.566  -3.509  7.783   1.00 0.00 ? 11 LEU A HD22 5  
ATOM 4642  H HD23 . LEU A 1 11 ? 0.051   -2.435  6.513   1.00 0.00 ? 11 LEU A HD23 5  
ATOM 4643  N N    . LYS A 1 12 ? 3.132   -5.853  2.900   1.00 0.00 ? 12 LYS A N    5  
ATOM 4644  C CA   . LYS A 1 12 ? 3.900   -5.856  1.668   1.00 0.00 ? 12 LYS A CA   5  
ATOM 4645  C C    . LYS A 1 12 ? 3.041   -6.426  0.537   1.00 0.00 ? 12 LYS A C    5  
ATOM 4646  O O    . LYS A 1 12 ? 3.200   -5.979  -0.608  1.00 0.00 ? 12 LYS A O    5  
ATOM 4647  C CB   . LYS A 1 12 ? 5.226   -6.594  1.865   1.00 0.00 ? 12 LYS A CB   5  
ATOM 4648  C CG   . LYS A 1 12 ? 6.090   -6.516  0.604   1.00 0.00 ? 12 LYS A CG   5  
ATOM 4649  C CD   . LYS A 1 12 ? 7.435   -5.849  0.904   1.00 0.00 ? 12 LYS A CD   5  
ATOM 4650  C CE   . LYS A 1 12 ? 7.440   -4.392  0.437   1.00 0.00 ? 12 LYS A CE   5  
ATOM 4651  N NZ   . LYS A 1 12 ? 8.289   -4.235  -0.754  1.00 0.00 ? 12 LYS A NZ   5  
ATOM 4652  H H    . LYS A 1 12 ? 3.316   -6.589  3.582   1.00 0.00 ? 12 LYS A H    5  
ATOM 4653  H HA   . LYS A 1 12 ? 4.134   -4.814  1.446   1.00 0.00 ? 12 LYS A HA   5  
ATOM 4654  H HB2  . LYS A 1 12 ? 5.765   -6.138  2.694   1.00 0.00 ? 12 LYS A HB2  5  
ATOM 4655  H HB3  . LYS A 1 12 ? 5.017   -7.637  2.107   1.00 0.00 ? 12 LYS A HB3  5  
ATOM 4656  H HG2  . LYS A 1 12 ? 6.269   -7.524  0.234   1.00 0.00 ? 12 LYS A HG2  5  
ATOM 4657  H HG3  . LYS A 1 12 ? 5.555   -5.947  -0.156  1.00 0.00 ? 12 LYS A HG3  5  
ATOM 4658  H HD2  . LYS A 1 12 ? 7.613   -5.880  1.978   1.00 0.00 ? 12 LYS A HD2  5  
ATOM 4659  H HD3  . LYS A 1 12 ? 8.225   -6.404  0.396   1.00 0.00 ? 12 LYS A HD3  5  
ATOM 4660  H HE2  . LYS A 1 12 ? 6.423   -4.091  0.191   1.00 0.00 ? 12 LYS A HE2  5  
ATOM 4661  H HE3  . LYS A 1 12 ? 7.811   -3.759  1.245   1.00 0.00 ? 12 LYS A HE3  5  
ATOM 4662  H HZ1  . LYS A 1 12 ? 7.942   -4.827  -1.510  1.00 0.00 ? 12 LYS A HZ1  5  
ATOM 4663  H HZ2  . LYS A 1 12 ? 8.276   -3.257  -1.045  1.00 0.00 ? 12 LYS A HZ2  5  
ATOM 4664  H HZ3  . LYS A 1 12 ? 9.248   -4.503  -0.536  1.00 0.00 ? 12 LYS A HZ3  5  
ATOM 4665  N N    . LEU A 1 13 ? 2.160   -7.385  0.876   1.00 0.00 ? 13 LEU A N    5  
ATOM 4666  C CA   . LEU A 1 13 ? 1.286   -8.007  -0.104  1.00 0.00 ? 13 LEU A CA   5  
ATOM 4667  C C    . LEU A 1 13 ? 0.188   -7.019  -0.501  1.00 0.00 ? 13 LEU A C    5  
ATOM 4668  O O    . LEU A 1 13 ? -0.134  -6.945  -1.696  1.00 0.00 ? 13 LEU A O    5  
ATOM 4669  C CB   . LEU A 1 13 ? 0.753   -9.340  0.426   1.00 0.00 ? 13 LEU A CB   5  
ATOM 4670  C CG   . LEU A 1 13 ? 0.287   -10.343 -0.632  1.00 0.00 ? 13 LEU A CG   5  
ATOM 4671  C CD1  . LEU A 1 13 ? -0.727  -11.328 -0.045  1.00 0.00 ? 13 LEU A CD1  5  
ATOM 4672  C CD2  . LEU A 1 13 ? -0.261  -9.625  -1.866  1.00 0.00 ? 13 LEU A CD2  5  
ATOM 4673  H H    . LEU A 1 13 ? 2.093   -7.697  1.844   1.00 0.00 ? 13 LEU A H    5  
ATOM 4674  H HA   . LEU A 1 13 ? 1.902   -8.223  -0.976  1.00 0.00 ? 13 LEU A HA   5  
ATOM 4675  H HB2  . LEU A 1 13 ? 1.560   -9.786  1.007   1.00 0.00 ? 13 LEU A HB2  5  
ATOM 4676  H HB3  . LEU A 1 13 ? -0.073  -9.096  1.095   1.00 0.00 ? 13 LEU A HB3  5  
ATOM 4677  H HG   . LEU A 1 13 ? 1.183   -10.898 -0.912  1.00 0.00 ? 13 LEU A HG   5  
ATOM 4678  H HD11 . LEU A 1 13 ? -1.593  -10.787 0.335   1.00 0.00 ? 13 LEU A HD11 5  
ATOM 4679  H HD12 . LEU A 1 13 ? -1.036  -12.025 -0.823  1.00 0.00 ? 13 LEU A HD12 5  
ATOM 4680  H HD13 . LEU A 1 13 ? -0.272  -11.887 0.773   1.00 0.00 ? 13 LEU A HD13 5  
ATOM 4681  H HD21 . LEU A 1 13 ? 0.510   -8.988  -2.299  1.00 0.00 ? 13 LEU A HD21 5  
ATOM 4682  H HD22 . LEU A 1 13 ? -0.583  -10.368 -2.596  1.00 0.00 ? 13 LEU A HD22 5  
ATOM 4683  H HD23 . LEU A 1 13 ? -1.117  -9.008  -1.588  1.00 0.00 ? 13 LEU A HD23 5  
ATOM 4684  N N    . ASP A 1 14 ? -0.358  -6.293  0.491   1.00 0.00 ? 14 ASP A N    5  
ATOM 4685  C CA   . ASP A 1 14 ? -1.408  -5.320  0.247   1.00 0.00 ? 14 ASP A CA   5  
ATOM 4686  C C    . ASP A 1 14 ? -0.841  -4.159  -0.572  1.00 0.00 ? 14 ASP A C    5  
ATOM 4687  O O    . ASP A 1 14 ? -1.601  -3.556  -1.345  1.00 0.00 ? 14 ASP A O    5  
ATOM 4688  C CB   . ASP A 1 14 ? -1.951  -4.754  1.560   1.00 0.00 ? 14 ASP A CB   5  
ATOM 4689  C CG   . ASP A 1 14 ? -3.468  -4.562  1.603   1.00 0.00 ? 14 ASP A CG   5  
ATOM 4690  O OD1  . ASP A 1 14 ? -4.147  -5.637  1.825   1.00 0.00 ? 14 ASP A OD1  5  
ATOM 4691  O OD2  . ASP A 1 14 ? -3.976  -3.443  1.435   1.00 0.00 ? 14 ASP A OD2  5  
ATOM 4692  H H    . ASP A 1 14 ? -0.033  -6.417  1.451   1.00 0.00 ? 14 ASP A H    5  
ATOM 4693  H HA   . ASP A 1 14 ? -2.207  -5.798  -0.321  1.00 0.00 ? 14 ASP A HA   5  
ATOM 4694  H HB2  . ASP A 1 14 ? -1.657  -5.445  2.349   1.00 0.00 ? 14 ASP A HB2  5  
ATOM 4695  H HB3  . ASP A 1 14 ? -1.451  -3.798  1.722   1.00 0.00 ? 14 ASP A HB3  5  
ATOM 4696  N N    . ASN A 1 15 ? 0.460   -3.872  -0.389  1.00 0.00 ? 15 ASN A N    5  
ATOM 4697  C CA   . ASN A 1 15 ? 1.118   -2.793  -1.106  1.00 0.00 ? 15 ASN A CA   5  
ATOM 4698  C C    . ASN A 1 15 ? 1.132   -3.113  -2.601  1.00 0.00 ? 15 ASN A C    5  
ATOM 4699  O O    . ASN A 1 15 ? 0.758   -2.237  -3.396  1.00 0.00 ? 15 ASN A O    5  
ATOM 4700  C CB   . ASN A 1 15 ? 2.568   -2.630  -0.643  1.00 0.00 ? 15 ASN A CB   5  
ATOM 4701  C CG   . ASN A 1 15 ? 3.027   -1.176  -0.781  1.00 0.00 ? 15 ASN A CG   5  
ATOM 4702  O OD1  . ASN A 1 15 ? 3.504   -0.744  -1.816  1.00 0.00 ? 15 ASN A OD1  5  
ATOM 4703  N ND2  . ASN A 1 15 ? 2.855   -0.450  0.321   1.00 0.00 ? 15 ASN A ND2  5  
ATOM 4704  H H    . ASN A 1 15 ? 1.016   -4.419  0.269   1.00 0.00 ? 15 ASN A H    5  
ATOM 4705  H HA   . ASN A 1 15 ? 0.562   -1.870  -0.946  1.00 0.00 ? 15 ASN A HA   5  
ATOM 4706  H HB2  . ASN A 1 15 ? 2.642   -2.929  0.402   1.00 0.00 ? 15 ASN A HB2  5  
ATOM 4707  H HB3  . ASN A 1 15 ? 3.205   -3.279  -1.244  1.00 0.00 ? 15 ASN A HB3  5  
ATOM 4708  H HD21 . ASN A 1 15 ? 2.449   -0.875  1.154   1.00 0.00 ? 15 ASN A HD21 5  
ATOM 4709  H HD22 . ASN A 1 15 ? 3.131   0.532   0.330   1.00 0.00 ? 15 ASN A HD22 5  
ATOM 4710  N N    . TYR A 1 16 ? 1.555   -4.341  -2.951  1.00 0.00 ? 16 TYR A N    5  
ATOM 4711  C CA   . TYR A 1 16 ? 1.596   -4.706  -4.356  1.00 0.00 ? 16 TYR A CA   5  
ATOM 4712  C C    . TYR A 1 16 ? 0.182   -4.639  -4.938  1.00 0.00 ? 16 TYR A C    5  
ATOM 4713  O O    . TYR A 1 16 ? 0.050   -4.230  -6.101  1.00 0.00 ? 16 TYR A O    5  
ATOM 4714  C CB   . TYR A 1 16 ? 2.218   -6.105  -4.522  1.00 0.00 ? 16 TYR A CB   5  
ATOM 4715  C CG   . TYR A 1 16 ? 3.535   -6.302  -3.785  1.00 0.00 ? 16 TYR A CG   5  
ATOM 4716  C CD1  . TYR A 1 16 ? 4.489   -5.258  -3.749  1.00 0.00 ? 16 TYR A CD1  5  
ATOM 4717  C CD2  . TYR A 1 16 ? 3.812   -7.523  -3.127  1.00 0.00 ? 16 TYR A CD2  5  
ATOM 4718  C CE1  . TYR A 1 16 ? 5.709   -5.434  -3.065  1.00 0.00 ? 16 TYR A CE1  5  
ATOM 4719  C CE2  . TYR A 1 16 ? 5.034   -7.698  -2.443  1.00 0.00 ? 16 TYR A CE2  5  
ATOM 4720  C CZ   . TYR A 1 16 ? 5.984   -6.654  -2.412  1.00 0.00 ? 16 TYR A CZ   5  
ATOM 4721  O OH   . TYR A 1 16 ? 7.167   -6.821  -1.750  1.00 0.00 ? 16 TYR A OH   5  
ATOM 4722  H H    . TYR A 1 16 ? 1.847   -5.010  -2.252  1.00 0.00 ? 16 TYR A H    5  
ATOM 4723  H HA   . TYR A 1 16 ? 2.213   -3.975  -4.881  1.00 0.00 ? 16 TYR A HA   5  
ATOM 4724  H HB2  . TYR A 1 16 ? 1.499   -6.857  -4.190  1.00 0.00 ? 16 TYR A HB2  5  
ATOM 4725  H HB3  . TYR A 1 16 ? 2.401   -6.285  -5.583  1.00 0.00 ? 16 TYR A HB3  5  
ATOM 4726  H HD1  . TYR A 1 16 ? 4.285   -4.320  -4.247  1.00 0.00 ? 16 TYR A HD1  5  
ATOM 4727  H HD2  . TYR A 1 16 ? 3.090   -8.326  -3.145  1.00 0.00 ? 16 TYR A HD2  5  
ATOM 4728  H HE1  . TYR A 1 16 ? 6.433   -4.631  -3.044  1.00 0.00 ? 16 TYR A HE1  5  
ATOM 4729  H HE2  . TYR A 1 16 ? 5.237   -8.635  -1.943  1.00 0.00 ? 16 TYR A HE2  5  
ATOM 4730  H HH   . TYR A 1 16 ? 7.431   -6.055  -1.235  1.00 0.00 ? 16 TYR A HH   5  
ATOM 4731  N N    . HIS A 1 17 ? -0.825  -5.040  -4.141  1.00 0.00 ? 17 HIS A N    5  
ATOM 4732  C CA   . HIS A 1 17 ? -2.208  -5.031  -4.585  1.00 0.00 ? 17 HIS A CA   5  
ATOM 4733  C C    . HIS A 1 17 ? -2.680  -3.585  -4.742  1.00 0.00 ? 17 HIS A C    5  
ATOM 4734  O O    . HIS A 1 17 ? -3.503  -3.325  -5.632  1.00 0.00 ? 17 HIS A O    5  
ATOM 4735  C CB   . HIS A 1 17 ? -3.093  -5.844  -3.638  1.00 0.00 ? 17 HIS A CB   5  
ATOM 4736  C CG   . HIS A 1 17 ? -4.330  -5.113  -3.174  1.00 0.00 ? 17 HIS A CG   5  
ATOM 4737  N ND1  . HIS A 1 17 ? -5.489  -5.047  -3.928  1.00 0.00 ? 17 HIS A ND1  5  
ATOM 4738  C CD2  . HIS A 1 17 ? -4.577  -4.417  -2.027  1.00 0.00 ? 17 HIS A CD2  5  
ATOM 4739  C CE1  . HIS A 1 17 ? -6.386  -4.341  -3.256  1.00 0.00 ? 17 HIS A CE1  5  
ATOM 4740  N NE2  . HIS A 1 17 ? -5.819  -3.951  -2.077  1.00 0.00 ? 17 HIS A NE2  5  
ATOM 4741  H H    . HIS A 1 17 ? -0.628  -5.363  -3.194  1.00 0.00 ? 17 HIS A H    5  
ATOM 4742  H HA   . HIS A 1 17 ? -2.224  -5.517  -5.561  1.00 0.00 ? 17 HIS A HA   5  
ATOM 4743  H HB2  . HIS A 1 17 ? -3.393  -6.749  -4.167  1.00 0.00 ? 17 HIS A HB2  5  
ATOM 4744  H HB3  . HIS A 1 17 ? -2.481  -6.121  -2.779  1.00 0.00 ? 17 HIS A HB3  5  
ATOM 4745  H HD1  . HIS A 1 17 ? -5.724  -5.432  -4.843  1.00 0.00 ? 17 HIS A HD1  5  
ATOM 4746  H HD2  . HIS A 1 17 ? -3.958  -4.214  -1.165  1.00 0.00 ? 17 HIS A HD2  5  
ATOM 4747  H HE1  . HIS A 1 17 ? -7.367  -4.173  -3.676  1.00 0.00 ? 17 HIS A HE1  5  
ATOM 4748  N N    . LEU A 1 18 ? -2.157  -2.685  -3.889  1.00 0.00 ? 18 LEU A N    5  
ATOM 4749  C CA   . LEU A 1 18 ? -2.522  -1.280  -3.933  1.00 0.00 ? 18 LEU A CA   5  
ATOM 4750  C C    . LEU A 1 18 ? -1.808  -0.607  -5.107  1.00 0.00 ? 18 LEU A C    5  
ATOM 4751  O O    . LEU A 1 18 ? -2.455  0.168   -5.826  1.00 0.00 ? 18 LEU A O    5  
ATOM 4752  C CB   . LEU A 1 18 ? -2.250  -0.612  -2.583  1.00 0.00 ? 18 LEU A CB   5  
ATOM 4753  C CG   . LEU A 1 18 ? -3.170  -1.024  -1.433  1.00 0.00 ? 18 LEU A CG   5  
ATOM 4754  C CD1  . LEU A 1 18 ? -2.501  -0.774  -0.079  1.00 0.00 ? 18 LEU A CD1  5  
ATOM 4755  C CD2  . LEU A 1 18 ? -4.527  -0.325  -1.539  1.00 0.00 ? 18 LEU A CD2  5  
ATOM 4756  H H    . LEU A 1 18 ? -1.483  -2.983  -3.184  1.00 0.00 ? 18 LEU A H    5  
ATOM 4757  H HA   . LEU A 1 18 ? -3.599  -1.244  -4.105  1.00 0.00 ? 18 LEU A HA   5  
ATOM 4758  H HB2  . LEU A 1 18 ? -1.221  -0.859  -2.320  1.00 0.00 ? 18 LEU A HB2  5  
ATOM 4759  H HB3  . LEU A 1 18 ? -2.324  0.462   -2.753  1.00 0.00 ? 18 LEU A HB3  5  
ATOM 4760  H HG   . LEU A 1 18 ? -3.313  -2.098  -1.554  1.00 0.00 ? 18 LEU A HG   5  
ATOM 4761  H HD11 . LEU A 1 18 ? -2.256  0.282   0.025   1.00 0.00 ? 18 LEU A HD11 5  
ATOM 4762  H HD12 . LEU A 1 18 ? -3.184  -1.078  0.715   1.00 0.00 ? 18 LEU A HD12 5  
ATOM 4763  H HD13 . LEU A 1 18 ? -1.585  -1.360  -0.003  1.00 0.00 ? 18 LEU A HD13 5  
ATOM 4764  H HD21 . LEU A 1 18 ? -5.005  -0.584  -2.484  1.00 0.00 ? 18 LEU A HD21 5  
ATOM 4765  H HD22 . LEU A 1 18 ? -5.155  -0.642  -0.706  1.00 0.00 ? 18 LEU A HD22 5  
ATOM 4766  H HD23 . LEU A 1 18 ? -4.393  0.755   -1.492  1.00 0.00 ? 18 LEU A HD23 5  
ATOM 4767  N N    . GLU A 1 19 ? -0.508  -0.912  -5.274  1.00 0.00 ? 19 GLU A N    5  
ATOM 4768  C CA   . GLU A 1 19 ? 0.284   -0.341  -6.351  1.00 0.00 ? 19 GLU A CA   5  
ATOM 4769  C C    . GLU A 1 19 ? -0.189  -0.919  -7.686  1.00 0.00 ? 19 GLU A C    5  
ATOM 4770  O O    . GLU A 1 19 ? -0.151  -0.192  -8.690  1.00 0.00 ? 19 GLU A O    5  
ATOM 4771  C CB   . GLU A 1 19 ? 1.778   -0.594  -6.143  1.00 0.00 ? 19 GLU A CB   5  
ATOM 4772  C CG   . GLU A 1 19 ? 2.564   0.719   -6.174  1.00 0.00 ? 19 GLU A CG   5  
ATOM 4773  C CD   . GLU A 1 19 ? 3.963   0.506   -6.758  1.00 0.00 ? 19 GLU A CD   5  
ATOM 4774  O OE1  . GLU A 1 19 ? 4.143   0.594   -7.981  1.00 0.00 ? 19 GLU A OE1  5  
ATOM 4775  O OE2  . GLU A 1 19 ? 4.882   0.243   -5.891  1.00 0.00 ? 19 GLU A OE2  5  
ATOM 4776  H H    . GLU A 1 19 ? -0.050  -1.562  -4.635  1.00 0.00 ? 19 GLU A H    5  
ATOM 4777  H HA   . GLU A 1 19 ? 0.101   0.733   -6.344  1.00 0.00 ? 19 GLU A HA   5  
ATOM 4778  H HB2  . GLU A 1 19 ? 1.925   -1.073  -5.175  1.00 0.00 ? 19 GLU A HB2  5  
ATOM 4779  H HB3  . GLU A 1 19 ? 2.137   -1.260  -6.927  1.00 0.00 ? 19 GLU A HB3  5  
ATOM 4780  H HG2  . GLU A 1 19 ? 2.028   1.438   -6.792  1.00 0.00 ? 19 GLU A HG2  5  
ATOM 4781  H HG3  . GLU A 1 19 ? 2.641   1.109   -5.159  1.00 0.00 ? 19 GLU A HG3  5  
ATOM 4782  N N    . ASN A 1 20 ? -0.619  -2.194  -7.674  1.00 0.00 ? 20 ASN A N    5  
ATOM 4783  C CA   . ASN A 1 20 ? -1.093  -2.858  -8.876  1.00 0.00 ? 20 ASN A CA   5  
ATOM 4784  C C    . ASN A 1 20 ? -2.404  -2.212  -9.327  1.00 0.00 ? 20 ASN A C    5  
ATOM 4785  O O    . ASN A 1 20 ? -2.641  -2.141  -10.542 1.00 0.00 ? 20 ASN A O    5  
ATOM 4786  C CB   . ASN A 1 20 ? -1.363  -4.341  -8.615  1.00 0.00 ? 20 ASN A CB   5  
ATOM 4787  C CG   . ASN A 1 20 ? -0.124  -5.187  -8.924  1.00 0.00 ? 20 ASN A CG   5  
ATOM 4788  O OD1  . ASN A 1 20 ? 0.671   -4.873  -9.795  1.00 0.00 ? 20 ASN A OD1  5  
ATOM 4789  N ND2  . ASN A 1 20 ? -0.007  -6.272  -8.166  1.00 0.00 ? 20 ASN A ND2  5  
ATOM 4790  H H    . ASN A 1 20 ? -0.617  -2.723  -6.803  1.00 0.00 ? 20 ASN A H    5  
ATOM 4791  H HA   . ASN A 1 20 ? -0.350  -2.740  -9.664  1.00 0.00 ? 20 ASN A HA   5  
ATOM 4792  H HB2  . ASN A 1 20 ? -1.630  -4.474  -7.567  1.00 0.00 ? 20 ASN A HB2  5  
ATOM 4793  H HB3  . ASN A 1 20 ? -2.197  -4.664  -9.238  1.00 0.00 ? 20 ASN A HB3  5  
ATOM 4794  H HD21 . ASN A 1 20 ? -0.710  -6.476  -7.455  1.00 0.00 ? 20 ASN A HD21 5  
ATOM 4795  H HD22 . ASN A 1 20 ? 0.785   -6.901  -8.295  1.00 0.00 ? 20 ASN A HD22 5  
ATOM 4796  N N    . GLU A 1 21 ? -3.218  -1.760  -8.356  1.00 0.00 ? 21 GLU A N    5  
ATOM 4797  C CA   . GLU A 1 21 ? -4.492  -1.126  -8.652  1.00 0.00 ? 21 GLU A CA   5  
ATOM 4798  C C    . GLU A 1 21 ? -4.253  0.334   -9.040  1.00 0.00 ? 21 GLU A C    5  
ATOM 4799  O O    . GLU A 1 21 ? -4.836  0.782   -10.038 1.00 0.00 ? 21 GLU A O    5  
ATOM 4800  C CB   . GLU A 1 21 ? -5.458  -1.227  -7.470  1.00 0.00 ? 21 GLU A CB   5  
ATOM 4801  C CG   . GLU A 1 21 ? -6.883  -1.512  -7.949  1.00 0.00 ? 21 GLU A CG   5  
ATOM 4802  C CD   . GLU A 1 21 ? -7.137  -3.018  -8.049  1.00 0.00 ? 21 GLU A CD   5  
ATOM 4803  O OE1  . GLU A 1 21 ? -6.183  -3.802  -8.167  1.00 0.00 ? 21 GLU A OE1  5  
ATOM 4804  O OE2  . GLU A 1 21 ? -8.379  -3.366  -7.998  1.00 0.00 ? 21 GLU A OE2  5  
ATOM 4805  H H    . GLU A 1 21 ? -2.948  -1.858  -7.378  1.00 0.00 ? 21 GLU A H    5  
ATOM 4806  H HA   . GLU A 1 21 ? -4.919  -1.655  -9.504  1.00 0.00 ? 21 GLU A HA   5  
ATOM 4807  H HB2  . GLU A 1 21 ? -5.135  -2.039  -6.817  1.00 0.00 ? 21 GLU A HB2  5  
ATOM 4808  H HB3  . GLU A 1 21 ? -5.434  -0.291  -6.912  1.00 0.00 ? 21 GLU A HB3  5  
ATOM 4809  H HG2  . GLU A 1 21 ? -7.588  -1.080  -7.240  1.00 0.00 ? 21 GLU A HG2  5  
ATOM 4810  H HG3  . GLU A 1 21 ? -7.028  -1.046  -8.923  1.00 0.00 ? 21 GLU A HG3  5  
ATOM 4811  N N    . VAL A 1 22 ? -3.413  1.035   -8.258  1.00 0.00 ? 22 VAL A N    5  
ATOM 4812  C CA   . VAL A 1 22 ? -3.100  2.431   -8.518  1.00 0.00 ? 22 VAL A CA   5  
ATOM 4813  C C    . VAL A 1 22 ? -2.482  2.558   -9.913  1.00 0.00 ? 22 VAL A C    5  
ATOM 4814  O O    . VAL A 1 22 ? -2.705  3.589   -10.563 1.00 0.00 ? 22 VAL A O    5  
ATOM 4815  C CB   . VAL A 1 22 ? -2.199  2.981   -7.412  1.00 0.00 ? 22 VAL A CB   5  
ATOM 4816  C CG1  . VAL A 1 22 ? -1.411  4.197   -7.901  1.00 0.00 ? 22 VAL A CG1  5  
ATOM 4817  C CG2  . VAL A 1 22 ? -3.013  3.321   -6.161  1.00 0.00 ? 22 VAL A CG2  5  
ATOM 4818  H H    . VAL A 1 22 ? -2.973  0.588   -7.453  1.00 0.00 ? 22 VAL A H    5  
ATOM 4819  H HA   . VAL A 1 22 ? -4.039  2.984   -8.494  1.00 0.00 ? 22 VAL A HA   5  
ATOM 4820  H HB   . VAL A 1 22 ? -1.501  2.178   -7.172  1.00 0.00 ? 22 VAL A HB   5  
ATOM 4821  H HG11 . VAL A 1 22 ? -2.098  4.981   -8.220  1.00 0.00 ? 22 VAL A HG11 5  
ATOM 4822  H HG12 . VAL A 1 22 ? -0.782  4.563   -7.090  1.00 0.00 ? 22 VAL A HG12 5  
ATOM 4823  H HG13 . VAL A 1 22 ? -0.778  3.916   -8.742  1.00 0.00 ? 22 VAL A HG13 5  
ATOM 4824  H HG21 . VAL A 1 22 ? -3.519  2.428   -5.792  1.00 0.00 ? 22 VAL A HG21 5  
ATOM 4825  H HG22 . VAL A 1 22 ? -2.341  3.709   -5.396  1.00 0.00 ? 22 VAL A HG22 5  
ATOM 4826  H HG23 . VAL A 1 22 ? -3.758  4.080   -6.397  1.00 0.00 ? 22 VAL A HG23 5  
ATOM 4827  N N    . ALA A 1 23 ? -1.731  1.526   -10.335 1.00 0.00 ? 23 ALA A N    5  
ATOM 4828  C CA   . ALA A 1 23 ? -1.089  1.524   -11.638 1.00 0.00 ? 23 ALA A CA   5  
ATOM 4829  C C    . ALA A 1 23 ? -2.160  1.585   -12.729 1.00 0.00 ? 23 ALA A C    5  
ATOM 4830  O O    . ALA A 1 23 ? -1.834  1.999   -13.852 1.00 0.00 ? 23 ALA A O    5  
ATOM 4831  C CB   . ALA A 1 23 ? -0.343  0.203   -11.843 1.00 0.00 ? 23 ALA A CB   5  
ATOM 4832  H H    . ALA A 1 23 ? -1.598  0.712   -9.734  1.00 0.00 ? 23 ALA A H    5  
ATOM 4833  H HA   . ALA A 1 23 ? -0.419  2.376   -11.749 1.00 0.00 ? 23 ALA A HA   5  
ATOM 4834  H HB1  . ALA A 1 23 ? 0.404   0.092   -11.056 1.00 0.00 ? 23 ALA A HB1  5  
ATOM 4835  H HB2  . ALA A 1 23 ? -1.042  -0.631  -11.786 1.00 0.00 ? 23 ALA A HB2  5  
ATOM 4836  H HB3  . ALA A 1 23 ? 0.140   0.196   -12.819 1.00 0.00 ? 23 ALA A HB3  5  
ATOM 4837  N N    . ARG A 1 24 ? -3.394  1.178   -12.385 1.00 0.00 ? 24 ARG A N    5  
ATOM 4838  C CA   . ARG A 1 24 ? -4.499  1.188   -13.329 1.00 0.00 ? 24 ARG A CA   5  
ATOM 4839  C C    . ARG A 1 24 ? -5.224  2.532   -13.246 1.00 0.00 ? 24 ARG A C    5  
ATOM 4840  O O    . ARG A 1 24 ? -5.596  3.068   -14.300 1.00 0.00 ? 24 ARG A O    5  
ATOM 4841  C CB   . ARG A 1 24 ? -5.494  0.061   -13.043 1.00 0.00 ? 24 ARG A CB   5  
ATOM 4842  C CG   . ARG A 1 24 ? -4.793  -1.140  -12.403 1.00 0.00 ? 24 ARG A CG   5  
ATOM 4843  C CD   . ARG A 1 24 ? -5.796  -2.248  -12.073 1.00 0.00 ? 24 ARG A CD   5  
ATOM 4844  N NE   . ARG A 1 24 ? -5.107  -3.558  -12.033 1.00 0.00 ? 24 ARG A NE   5  
ATOM 4845  C CZ   . ARG A 1 24 ? -5.045  -4.413  -13.076 1.00 0.00 ? 24 ARG A CZ   5  
ATOM 4846  N NH1  . ARG A 1 24 ? -5.636  -4.075  -14.229 1.00 0.00 ? 24 ARG A NH1  5  
ATOM 4847  N NH2  . ARG A 1 24 ? -4.401  -5.582  -12.958 1.00 0.00 ? 24 ARG A NH2  5  
ATOM 4848  H H    . ARG A 1 24 ? -3.578  0.851   -11.437 1.00 0.00 ? 24 ARG A H    5  
ATOM 4849  H HA   . ARG A 1 24 ? -4.084  1.070   -14.330 1.00 0.00 ? 24 ARG A HA   5  
ATOM 4850  H HB2  . ARG A 1 24 ? -6.260  0.429   -12.362 1.00 0.00 ? 24 ARG A HB2  5  
ATOM 4851  H HB3  . ARG A 1 24 ? -5.965  -0.240  -13.979 1.00 0.00 ? 24 ARG A HB3  5  
ATOM 4852  H HG2  . ARG A 1 24 ? -4.050  -1.528  -13.100 1.00 0.00 ? 24 ARG A HG2  5  
ATOM 4853  H HG3  . ARG A 1 24 ? -4.289  -0.811  -11.495 1.00 0.00 ? 24 ARG A HG3  5  
ATOM 4854  H HD2  . ARG A 1 24 ? -6.245  -2.053  -11.100 1.00 0.00 ? 24 ARG A HD2  5  
ATOM 4855  H HD3  . ARG A 1 24 ? -6.580  -2.264  -12.831 1.00 0.00 ? 24 ARG A HD3  5  
ATOM 4856  H HE   . ARG A 1 24 ? -4.662  -3.799  -11.147 1.00 0.00 ? 24 ARG A HE   5  
ATOM 4857  H HH11 . ARG A 1 24 ? -6.124  -3.183  -14.310 1.00 0.00 ? 24 ARG A HH11 5  
ATOM 4858  H HH12 . ARG A 1 24 ? -5.600  -4.710  -15.026 1.00 0.00 ? 24 ARG A HH12 5  
ATOM 4859  H HH21 . ARG A 1 24 ? -3.953  -5.832  -12.077 1.00 0.00 ? 24 ARG A HH21 5  
ATOM 4860  H HH22 . ARG A 1 24 ? -4.358  -6.223  -13.751 1.00 0.00 ? 24 ARG A HH22 5  
ATOM 4861  N N    . LEU A 1 25 ? -5.409  3.041   -12.015 1.00 0.00 ? 25 LEU A N    5  
ATOM 4862  C CA   . LEU A 1 25 ? -6.083  4.311   -11.799 1.00 0.00 ? 25 LEU A CA   5  
ATOM 4863  C C    . LEU A 1 25 ? -5.197  5.447   -12.311 1.00 0.00 ? 25 LEU A C    5  
ATOM 4864  O O    . LEU A 1 25 ? -5.738  6.408   -12.879 1.00 0.00 ? 25 LEU A O    5  
ATOM 4865  C CB   . LEU A 1 25 ? -6.488  4.459   -10.331 1.00 0.00 ? 25 LEU A CB   5  
ATOM 4866  C CG   . LEU A 1 25 ? -7.612  3.540   -9.848  1.00 0.00 ? 25 LEU A CG   5  
ATOM 4867  C CD1  . LEU A 1 25 ? -7.105  2.109   -9.659  1.00 0.00 ? 25 LEU A CD1  5  
ATOM 4868  C CD2  . LEU A 1 25 ? -8.262  4.090   -8.578  1.00 0.00 ? 25 LEU A CD2  5  
ATOM 4869  H H    . LEU A 1 25 ? -5.071  2.534   -11.197 1.00 0.00 ? 25 LEU A H    5  
ATOM 4870  H HA   . LEU A 1 25 ? -6.997  4.279   -12.392 1.00 0.00 ? 25 LEU A HA   5  
ATOM 4871  H HB2  . LEU A 1 25 ? -5.592  4.264   -9.744  1.00 0.00 ? 25 LEU A HB2  5  
ATOM 4872  H HB3  . LEU A 1 25 ? -6.778  5.501   -10.199 1.00 0.00 ? 25 LEU A HB3  5  
ATOM 4873  H HG   . LEU A 1 25 ? -8.346  3.541   -10.653 1.00 0.00 ? 25 LEU A HG   5  
ATOM 4874  H HD11 . LEU A 1 25 ? -6.297  2.094   -8.927  1.00 0.00 ? 25 LEU A HD11 5  
ATOM 4875  H HD12 . LEU A 1 25 ? -7.929  1.483   -9.316  1.00 0.00 ? 25 LEU A HD12 5  
ATOM 4876  H HD13 . LEU A 1 25 ? -6.733  1.718   -10.606 1.00 0.00 ? 25 LEU A HD13 5  
ATOM 4877  H HD21 . LEU A 1 25 ? -8.675  5.080   -8.770  1.00 0.00 ? 25 LEU A HD21 5  
ATOM 4878  H HD22 . LEU A 1 25 ? -9.056  3.411   -8.263  1.00 0.00 ? 25 LEU A HD22 5  
ATOM 4879  H HD23 . LEU A 1 25 ? -7.522  4.163   -7.782  1.00 0.00 ? 25 LEU A HD23 5  
ATOM 4880  N N    . LYS A 1 26 ? -3.874  5.320   -12.104 1.00 0.00 ? 26 LYS A N    5  
ATOM 4881  C CA   . LYS A 1 26 ? -2.926  6.329   -12.542 1.00 0.00 ? 26 LYS A CA   5  
ATOM 4882  C C    . LYS A 1 26 ? -3.029  6.497   -14.060 1.00 0.00 ? 26 LYS A C    5  
ATOM 4883  O O    . LYS A 1 26 ? -2.643  7.562   -14.562 1.00 0.00 ? 26 LYS A O    5  
ATOM 4884  C CB   . LYS A 1 26 ? -1.516  5.987   -12.056 1.00 0.00 ? 26 LYS A CB   5  
ATOM 4885  C CG   . LYS A 1 26 ? -1.128  6.845   -10.850 1.00 0.00 ? 26 LYS A CG   5  
ATOM 4886  C CD   . LYS A 1 26 ? -2.304  6.996   -9.883  1.00 0.00 ? 26 LYS A CD   5  
ATOM 4887  C CE   . LYS A 1 26 ? -3.042  8.315   -10.120 1.00 0.00 ? 26 LYS A CE   5  
ATOM 4888  N NZ   . LYS A 1 26 ? -3.045  9.132   -8.896  1.00 0.00 ? 26 LYS A NZ   5  
ATOM 4889  H H    . LYS A 1 26 ? -3.509  4.495   -11.628 1.00 0.00 ? 26 LYS A H    5  
ATOM 4890  H HA   . LYS A 1 26 ? -3.222  7.262   -12.061 1.00 0.00 ? 26 LYS A HA   5  
ATOM 4891  H HB2  . LYS A 1 26 ? -1.487  4.936   -11.768 1.00 0.00 ? 26 LYS A HB2  5  
ATOM 4892  H HB3  . LYS A 1 26 ? -0.811  6.150   -12.871 1.00 0.00 ? 26 LYS A HB3  5  
ATOM 4893  H HG2  . LYS A 1 26 ? -0.299  6.367   -10.328 1.00 0.00 ? 26 LYS A HG2  5  
ATOM 4894  H HG3  . LYS A 1 26 ? -0.808  7.825   -11.202 1.00 0.00 ? 26 LYS A HG3  5  
ATOM 4895  H HD2  . LYS A 1 26 ? -2.997  6.169   -10.036 1.00 0.00 ? 26 LYS A HD2  5  
ATOM 4896  H HD3  . LYS A 1 26 ? -1.928  6.959   -8.861  1.00 0.00 ? 26 LYS A HD3  5  
ATOM 4897  H HE2  . LYS A 1 26 ? -2.541  8.868   -10.915 1.00 0.00 ? 26 LYS A HE2  5  
ATOM 4898  H HE3  . LYS A 1 26 ? -4.066  8.102   -10.428 1.00 0.00 ? 26 LYS A HE3  5  
ATOM 4899  H HZ1  . LYS A 1 26 ? -2.087  9.331   -8.608  1.00 0.00 ? 26 LYS A HZ1  5  
ATOM 4900  H HZ2  . LYS A 1 26 ? -3.542  10.003  -9.079  1.00 0.00 ? 26 LYS A HZ2  5  
ATOM 4901  H HZ3  . LYS A 1 26 ? -3.520  8.631   -8.145  1.00 0.00 ? 26 LYS A HZ3  5  
ATOM 4902  N N    . LYS A 1 27 ? -3.537  5.458   -14.746 1.00 0.00 ? 27 LYS A N    5  
ATOM 4903  C CA   . LYS A 1 27 ? -3.687  5.491   -16.192 1.00 0.00 ? 27 LYS A CA   5  
ATOM 4904  C C    . LYS A 1 27 ? -4.942  6.288   -16.551 1.00 0.00 ? 27 LYS A C    5  
ATOM 4905  O O    . LYS A 1 27 ? -5.096  6.645   -17.729 1.00 0.00 ? 27 LYS A O    5  
ATOM 4906  C CB   . LYS A 1 27 ? -3.676  4.072   -16.763 1.00 0.00 ? 27 LYS A CB   5  
ATOM 4907  C CG   . LYS A 1 27 ? -2.815  3.996   -18.025 1.00 0.00 ? 27 LYS A CG   5  
ATOM 4908  C CD   . LYS A 1 27 ? -2.788  2.573   -18.587 1.00 0.00 ? 27 LYS A CD   5  
ATOM 4909  C CE   . LYS A 1 27 ? -2.292  1.578   -17.535 1.00 0.00 ? 27 LYS A CE   5  
ATOM 4910  N NZ   . LYS A 1 27 ? -1.268  0.689   -18.108 1.00 0.00 ? 27 LYS A NZ   5  
ATOM 4911  H H    . LYS A 1 27 ? -3.830  4.615   -14.253 1.00 0.00 ? 27 LYS A H    5  
ATOM 4912  H HA   . LYS A 1 27 ? -2.813  6.011   -16.582 1.00 0.00 ? 27 LYS A HA   5  
ATOM 4913  H HB2  . LYS A 1 27 ? -3.269  3.392   -16.015 1.00 0.00 ? 27 LYS A HB2  5  
ATOM 4914  H HB3  . LYS A 1 27 ? -4.699  3.775   -16.993 1.00 0.00 ? 27 LYS A HB3  5  
ATOM 4915  H HG2  . LYS A 1 27 ? -3.230  4.666   -18.778 1.00 0.00 ? 27 LYS A HG2  5  
ATOM 4916  H HG3  . LYS A 1 27 ? -1.803  4.319   -17.783 1.00 0.00 ? 27 LYS A HG3  5  
ATOM 4917  H HD2  . LYS A 1 27 ? -3.796  2.293   -18.892 1.00 0.00 ? 27 LYS A HD2  5  
ATOM 4918  H HD3  . LYS A 1 27 ? -2.134  2.549   -19.458 1.00 0.00 ? 27 LYS A HD3  5  
ATOM 4919  H HE2  . LYS A 1 27 ? -1.858  2.127   -16.699 1.00 0.00 ? 27 LYS A HE2  5  
ATOM 4920  H HE3  . LYS A 1 27 ? -3.135  0.990   -17.173 1.00 0.00 ? 27 LYS A HE3  5  
ATOM 4921  H HZ1  . LYS A 1 27 ? -0.479  1.240   -18.446 1.00 0.00 ? 27 LYS A HZ1  5  
ATOM 4922  H HZ2  . LYS A 1 27 ? -0.954  0.037   -17.389 1.00 0.00 ? 27 LYS A HZ2  5  
ATOM 4923  H HZ3  . LYS A 1 27 ? -1.663  0.161   -18.886 1.00 0.00 ? 27 LYS A HZ3  5  
ATOM 4924  N N    . LEU A 1 28 ? -5.800  6.547   -15.548 1.00 0.00 ? 28 LEU A N    5  
ATOM 4925  C CA   . LEU A 1 28 ? -7.028  7.295   -15.758 1.00 0.00 ? 28 LEU A CA   5  
ATOM 4926  C C    . LEU A 1 28 ? -6.911  8.660   -15.076 1.00 0.00 ? 28 LEU A C    5  
ATOM 4927  O O    . LEU A 1 28 ? -7.460  9.635   -15.609 1.00 0.00 ? 28 LEU A O    5  
ATOM 4928  C CB   . LEU A 1 28 ? -8.237  6.480   -15.299 1.00 0.00 ? 28 LEU A CB   5  
ATOM 4929  C CG   . LEU A 1 28 ? -9.415  6.418   -16.274 1.00 0.00 ? 28 LEU A CG   5  
ATOM 4930  C CD1  . LEU A 1 28 ? -9.310  5.192   -17.183 1.00 0.00 ? 28 LEU A CD1  5  
ATOM 4931  C CD2  . LEU A 1 28 ? -10.749 6.465   -15.527 1.00 0.00 ? 28 LEU A CD2  5  
ATOM 4932  H H    . LEU A 1 28 ? -5.596  6.215   -14.605 1.00 0.00 ? 28 LEU A H    5  
ATOM 4933  H HA   . LEU A 1 28 ? -7.119  7.443   -16.834 1.00 0.00 ? 28 LEU A HA   5  
ATOM 4934  H HB2  . LEU A 1 28 ? -7.875  5.468   -15.116 1.00 0.00 ? 28 LEU A HB2  5  
ATOM 4935  H HB3  . LEU A 1 28 ? -8.560  6.917   -14.354 1.00 0.00 ? 28 LEU A HB3  5  
ATOM 4936  H HG   . LEU A 1 28 ? -9.321  7.313   -16.889 1.00 0.00 ? 28 LEU A HG   5  
ATOM 4937  H HD11 . LEU A 1 28 ? -9.301  4.283   -16.582 1.00 0.00 ? 28 LEU A HD11 5  
ATOM 4938  H HD12 . LEU A 1 28 ? -10.161 5.180   -17.862 1.00 0.00 ? 28 LEU A HD12 5  
ATOM 4939  H HD13 . LEU A 1 28 ? -8.391  5.240   -17.768 1.00 0.00 ? 28 LEU A HD13 5  
ATOM 4940  H HD21 . LEU A 1 28 ? -10.818 7.385   -14.947 1.00 0.00 ? 28 LEU A HD21 5  
ATOM 4941  H HD22 . LEU A 1 28 ? -11.562 6.419   -16.251 1.00 0.00 ? 28 LEU A HD22 5  
ATOM 4942  H HD23 . LEU A 1 28 ? -10.827 5.613   -14.851 1.00 0.00 ? 28 LEU A HD23 5  
ATOM 4943  N N    . VAL A 1 29 ? -6.209  8.703   -13.929 1.00 0.00 ? 29 VAL A N    5  
ATOM 4944  C CA   . VAL A 1 29 ? -6.025  9.936   -13.184 1.00 0.00 ? 29 VAL A CA   5  
ATOM 4945  C C    . VAL A 1 29 ? -4.582  10.418  -13.353 1.00 0.00 ? 29 VAL A C    5  
ATOM 4946  O O    . VAL A 1 29 ? -4.387  11.513  -13.901 1.00 0.00 ? 29 VAL A O    5  
ATOM 4947  C CB   . VAL A 1 29 ? -6.417  9.726   -11.720 1.00 0.00 ? 29 VAL A CB   5  
ATOM 4948  C CG1  . VAL A 1 29 ? -6.687  11.064  -11.028 1.00 0.00 ? 29 VAL A CG1  5  
ATOM 4949  C CG2  . VAL A 1 29 ? -7.625  8.795   -11.604 1.00 0.00 ? 29 VAL A CG2  5  
ATOM 4950  H H    . VAL A 1 29 ? -5.788  7.850   -13.557 1.00 0.00 ? 29 VAL A H    5  
ATOM 4951  H HA   . VAL A 1 29 ? -6.699  10.679  -13.609 1.00 0.00 ? 29 VAL A HA   5  
ATOM 4952  H HB   . VAL A 1 29 ? -5.557  9.251   -11.248 1.00 0.00 ? 29 VAL A HB   5  
ATOM 4953  H HG11 . VAL A 1 29 ? -7.495  11.590  -11.539 1.00 0.00 ? 29 VAL A HG11 5  
ATOM 4954  H HG12 . VAL A 1 29 ? -6.964  10.878  -9.991  1.00 0.00 ? 29 VAL A HG12 5  
ATOM 4955  H HG13 . VAL A 1 29 ? -5.791  11.683  -11.052 1.00 0.00 ? 29 VAL A HG13 5  
ATOM 4956  H HG21 . VAL A 1 29 ? -7.392  7.827   -12.049 1.00 0.00 ? 29 VAL A HG21 5  
ATOM 4957  H HG22 . VAL A 1 29 ? -7.875  8.668   -10.550 1.00 0.00 ? 29 VAL A HG22 5  
ATOM 4958  H HG23 . VAL A 1 29 ? -8.480  9.228   -12.123 1.00 0.00 ? 29 VAL A HG23 5  
ATOM 4959  N N    . GLY A 1 30 ? -3.617  9.605   -12.890 1.00 0.00 ? 30 GLY A N    5  
ATOM 4960  C CA   . GLY A 1 30 ? -2.209  9.947   -12.990 1.00 0.00 ? 30 GLY A CA   5  
ATOM 4961  C C    . GLY A 1 30 ? -1.876  10.301  -14.440 1.00 0.00 ? 30 GLY A C    5  
ATOM 4962  O O    . GLY A 1 30 ? -0.777  10.820  -14.683 1.00 0.00 ? 30 GLY A O    5  
ATOM 4963  H H    . GLY A 1 30 ? -3.865  8.718   -12.451 1.00 0.00 ? 30 GLY A H    5  
ATOM 4964  H HA2  . GLY A 1 30 ? -1.991  10.805  -12.355 1.00 0.00 ? 30 GLY A HA2  5  
ATOM 4965  H HA3  . GLY A 1 30 ? -1.600  9.103   -12.665 1.00 0.00 ? 30 GLY A HA3  5  
ATOM 4966  N N    . GLU A 1 31 ? -2.816  10.018  -15.360 1.00 0.00 ? 31 GLU A N    5  
ATOM 4967  C CA   . GLU A 1 31 ? -2.623  10.306  -16.771 1.00 0.00 ? 31 GLU A CA   5  
ATOM 4968  C C    . GLU A 1 31 ? -2.396  11.808  -16.955 1.00 0.00 ? 31 GLU A C    5  
ATOM 4969  O O    . GLU A 1 31 ? -3.340  12.580  -16.729 1.00 0.00 ? 31 GLU A O    5  
ATOM 4970  C CB   . GLU A 1 31 ? -3.809  9.824   -17.609 1.00 0.00 ? 31 GLU A CB   5  
ATOM 4971  C CG   . GLU A 1 31 ? -3.332  9.052   -18.840 1.00 0.00 ? 31 GLU A CG   5  
ATOM 4972  C CD   . GLU A 1 31 ? -4.409  9.032   -19.927 1.00 0.00 ? 31 GLU A CD   5  
ATOM 4973  O OE1  . GLU A 1 31 ? -5.018  10.073  -20.216 1.00 0.00 ? 31 GLU A OE1  5  
ATOM 4974  O OE2  . GLU A 1 31 ? -4.603  7.884   -20.481 1.00 0.00 ? 31 GLU A OE2  5  
ATOM 4975  H H    . GLU A 1 31 ? -3.696  9.590   -15.075 1.00 0.00 ? 31 GLU A H    5  
ATOM 4976  H HA   . GLU A 1 31 ? -1.727  9.771   -17.084 1.00 0.00 ? 31 GLU A HA   5  
ATOM 4977  H HB2  . GLU A 1 31 ? -4.432  9.170   -16.999 1.00 0.00 ? 31 GLU A HB2  5  
ATOM 4978  H HB3  . GLU A 1 31 ? -4.397  10.688  -17.918 1.00 0.00 ? 31 GLU A HB3  5  
ATOM 4979  H HG2  . GLU A 1 31 ? -2.437  9.532   -19.236 1.00 0.00 ? 31 GLU A HG2  5  
ATOM 4980  H HG3  . GLU A 1 31 ? -3.085  8.032   -18.543 1.00 0.00 ? 31 GLU A HG3  5  
ATOM 4981  N N    . ARG A 1 32 ? -1.169  12.187  -17.354 1.00 0.00 ? 32 ARG A N    5  
ATOM 4982  C CA   . ARG A 1 32 ? -0.825  13.583  -17.566 1.00 0.00 ? 32 ARG A CA   5  
ATOM 4983  C C    . ARG A 1 32 ? -1.343  14.031  -18.934 1.00 0.00 ? 32 ARG A C    5  
ATOM 4984  O O    . ARG A 1 32 ? -2.550  14.156  -19.133 1.00 0.00 ? 32 ARG A O    5  
ATOM 4985  C CB   . ARG A 1 32 ? 0.687   13.806  -17.503 1.00 0.00 ? 32 ARG A CB   5  
ATOM 4986  C CG   . ARG A 1 32 ? 1.083   14.521  -16.210 1.00 0.00 ? 32 ARG A CG   5  
ATOM 4987  C CD   . ARG A 1 32 ? 1.264   13.523  -15.065 1.00 0.00 ? 32 ARG A CD   5  
ATOM 4988  N NE   . ARG A 1 32 ? 1.464   14.247  -13.789 1.00 0.00 ? 32 ARG A NE   5  
ATOM 4989  C CZ   . ARG A 1 32 ? 2.317   13.851  -12.820 1.00 0.00 ? 32 ARG A CZ   5  
ATOM 4990  N NH1  . ARG A 1 32 ? 3.038   12.736  -13.004 1.00 0.00 ? 32 ARG A NH1  5  
ATOM 4991  N NH2  . ARG A 1 32 ? 2.442   14.563  -11.692 1.00 0.00 ? 32 ARG A NH2  5  
ATOM 4992  H H    . ARG A 1 32 ? -0.447  11.486  -17.519 1.00 0.00 ? 32 ARG A H    5  
ATOM 4993  H HA   . ARG A 1 32 ? -1.317  14.169  -16.790 1.00 0.00 ? 32 ARG A HA   5  
ATOM 4994  H HB2  . ARG A 1 32 ? 1.190   12.840  -17.542 1.00 0.00 ? 32 ARG A HB2  5  
ATOM 4995  H HB3  . ARG A 1 32 ? 0.993   14.400  -18.364 1.00 0.00 ? 32 ARG A HB3  5  
ATOM 4996  H HG2  . ARG A 1 32 ? 2.023   15.051  -16.371 1.00 0.00 ? 32 ARG A HG2  5  
ATOM 4997  H HG3  . ARG A 1 32 ? 0.308   15.244  -15.955 1.00 0.00 ? 32 ARG A HG3  5  
ATOM 4998  H HD2  . ARG A 1 32 ? 0.373   12.899  -14.983 1.00 0.00 ? 32 ARG A HD2  5  
ATOM 4999  H HD3  . ARG A 1 32 ? 2.125   12.887  -15.270 1.00 0.00 ? 32 ARG A HD3  5  
ATOM 5000  H HE   . ARG A 1 32 ? 0.908   15.092  -13.665 1.00 0.00 ? 32 ARG A HE   5  
ATOM 5001  H HH11 . ARG A 1 32 ? 2.936   12.201  -13.867 1.00 0.00 ? 32 ARG A HH11 5  
ATOM 5002  H HH12 . ARG A 1 32 ? 3.687   12.423  -12.283 1.00 0.00 ? 32 ARG A HH12 5  
ATOM 5003  H HH21 . ARG A 1 32 ? 1.890   15.410  -11.559 1.00 0.00 ? 32 ARG A HH21 5  
ATOM 5004  H HH22 . ARG A 1 32 ? 3.088   14.256  -10.964 1.00 0.00 ? 32 ARG A HH22 5  
ATOM 5005  N N    . MET B 1 1  ? 16.144  -7.075  12.328  1.00 0.00 ? 1  MET B N    5  
ATOM 5006  C CA   . MET B 1 1  ? 14.947  -6.764  13.090  1.00 0.00 ? 1  MET B CA   5  
ATOM 5007  C C    . MET B 1 1  ? 14.860  -5.250  13.299  1.00 0.00 ? 1  MET B C    5  
ATOM 5008  O O    . MET B 1 1  ? 13.750  -4.707  13.215  1.00 0.00 ? 1  MET B O    5  
ATOM 5009  C CB   . MET B 1 1  ? 14.984  -7.466  14.449  1.00 0.00 ? 1  MET B CB   5  
ATOM 5010  C CG   . MET B 1 1  ? 13.582  -7.905  14.878  1.00 0.00 ? 1  MET B CG   5  
ATOM 5011  S SD   . MET B 1 1  ? 13.597  -8.415  16.621  1.00 0.00 ? 1  MET B SD   5  
ATOM 5012  C CE   . MET B 1 1  ? 12.558  -7.110  17.341  1.00 0.00 ? 1  MET B CE   5  
ATOM 5013  H H    . MET B 1 1  ? 16.773  -7.789  12.695  1.00 0.00 ? 1  MET B H    5  
ATOM 5014  H HA   . MET B 1 1  ? 14.074  -7.096  12.528  1.00 0.00 ? 1  MET B HA   5  
ATOM 5015  H HB2  . MET B 1 1  ? 15.624  -8.344  14.376  1.00 0.00 ? 1  MET B HB2  5  
ATOM 5016  H HB3  . MET B 1 1  ? 15.402  -6.783  15.188  1.00 0.00 ? 1  MET B HB3  5  
ATOM 5017  H HG2  . MET B 1 1  ? 12.889  -7.073  14.757  1.00 0.00 ? 1  MET B HG2  5  
ATOM 5018  H HG3  . MET B 1 1  ? 13.254  -8.733  14.250  1.00 0.00 ? 1  MET B HG3  5  
ATOM 5019  H HE1  . MET B 1 1  ? 11.571  -7.123  16.878  1.00 0.00 ? 1  MET B HE1  5  
ATOM 5020  H HE2  . MET B 1 1  ? 12.467  -7.279  18.413  1.00 0.00 ? 1  MET B HE2  5  
ATOM 5021  H HE3  . MET B 1 1  ? 13.016  -6.135  17.173  1.00 0.00 ? 1  MET B HE3  5  
ATOM 5022  N N    . ASP B 1 2  ? 16.014  -4.611  13.563  1.00 0.00 ? 2  ASP B N    5  
ATOM 5023  C CA   . ASP B 1 2  ? 16.067  -3.176  13.781  1.00 0.00 ? 2  ASP B CA   5  
ATOM 5024  C C    . ASP B 1 2  ? 15.368  -2.462  12.623  1.00 0.00 ? 2  ASP B C    5  
ATOM 5025  O O    . ASP B 1 2  ? 14.711  -1.441  12.870  1.00 0.00 ? 2  ASP B O    5  
ATOM 5026  C CB   . ASP B 1 2  ? 17.514  -2.681  13.838  1.00 0.00 ? 2  ASP B CB   5  
ATOM 5027  C CG   . ASP B 1 2  ? 18.511  -3.667  14.448  1.00 0.00 ? 2  ASP B CG   5  
ATOM 5028  O OD1  . ASP B 1 2  ? 18.446  -3.984  15.644  1.00 0.00 ? 2  ASP B OD1  5  
ATOM 5029  O OD2  . ASP B 1 2  ? 19.398  -4.123  13.629  1.00 0.00 ? 2  ASP B OD2  5  
ATOM 5030  H H    . ASP B 1 2  ? 16.887  -5.136  13.615  1.00 0.00 ? 2  ASP B H    5  
ATOM 5031  H HA   . ASP B 1 2  ? 15.547  -2.939  14.710  1.00 0.00 ? 2  ASP B HA   5  
ATOM 5032  H HB2  . ASP B 1 2  ? 17.813  -2.460  12.813  1.00 0.00 ? 2  ASP B HB2  5  
ATOM 5033  H HB3  . ASP B 1 2  ? 17.507  -1.755  14.413  1.00 0.00 ? 2  ASP B HB3  5  
ATOM 5034  N N    . ALA B 1 3  ? 15.519  -3.006  11.401  1.00 0.00 ? 3  ALA B N    5  
ATOM 5035  C CA   . ALA B 1 3  ? 14.907  -2.424  10.219  1.00 0.00 ? 3  ALA B CA   5  
ATOM 5036  C C    . ALA B 1 3  ? 13.518  -3.034  10.017  1.00 0.00 ? 3  ALA B C    5  
ATOM 5037  O O    . ALA B 1 3  ? 12.727  -2.460  9.255   1.00 0.00 ? 3  ALA B O    5  
ATOM 5038  C CB   . ALA B 1 3  ? 15.723  -2.797  8.980   1.00 0.00 ? 3  ALA B CB   5  
ATOM 5039  H H    . ALA B 1 3  ? 16.078  -3.850  11.285  1.00 0.00 ? 3  ALA B H    5  
ATOM 5040  H HA   . ALA B 1 3  ? 14.808  -1.343  10.317  1.00 0.00 ? 3  ALA B HA   5  
ATOM 5041  H HB1  . ALA B 1 3  ? 16.740  -2.420  9.098   1.00 0.00 ? 3  ALA B HB1  5  
ATOM 5042  H HB2  . ALA B 1 3  ? 15.758  -3.880  8.869   1.00 0.00 ? 3  ALA B HB2  5  
ATOM 5043  H HB3  . ALA B 1 3  ? 15.268  -2.363  8.090   1.00 0.00 ? 3  ALA B HB3  5  
ATOM 5044  N N    . ILE B 1 4  ? 13.255  -4.168  10.692  1.00 0.00 ? 4  ILE B N    5  
ATOM 5045  C CA   . ILE B 1 4  ? 11.974  -4.847  10.587  1.00 0.00 ? 4  ILE B CA   5  
ATOM 5046  C C    . ILE B 1 4  ? 10.921  -4.065  11.372  1.00 0.00 ? 4  ILE B C    5  
ATOM 5047  O O    . ILE B 1 4  ? 9.827   -3.842  10.834  1.00 0.00 ? 4  ILE B O    5  
ATOM 5048  C CB   . ILE B 1 4  ? 12.106  -6.308  11.020  1.00 0.00 ? 4  ILE B CB   5  
ATOM 5049  C CG1  . ILE B 1 4  ? 13.057  -7.072  10.095  1.00 0.00 ? 4  ILE B CG1  5  
ATOM 5050  C CG2  . ILE B 1 4  ? 10.734  -6.979  11.111  1.00 0.00 ? 4  ILE B CG2  5  
ATOM 5051  C CD1  . ILE B 1 4  ? 12.439  -8.397  9.646   1.00 0.00 ? 4  ILE B CD1  5  
ATOM 5052  H H    . ILE B 1 4  ? 13.965  -4.577  11.299  1.00 0.00 ? 4  ILE B H    5  
ATOM 5053  H HA   . ILE B 1 4  ? 11.706  -4.840  9.529   1.00 0.00 ? 4  ILE B HA   5  
ATOM 5054  H HB   . ILE B 1 4  ? 12.538  -6.270  12.020  1.00 0.00 ? 4  ILE B HB   5  
ATOM 5055  H HG12 . ILE B 1 4  ? 13.262  -6.461  9.216   1.00 0.00 ? 4  ILE B HG12 5  
ATOM 5056  H HG13 . ILE B 1 4  ? 13.991  -7.257  10.623  1.00 0.00 ? 4  ILE B HG13 5  
ATOM 5057  H HG21 . ILE B 1 4  ? 10.236  -6.942  10.142  1.00 0.00 ? 4  ILE B HG21 5  
ATOM 5058  H HG22 . ILE B 1 4  ? 10.865  -8.015  11.421  1.00 0.00 ? 4  ILE B HG22 5  
ATOM 5059  H HG23 . ILE B 1 4  ? 10.116  -6.464  11.846  1.00 0.00 ? 4  ILE B HG23 5  
ATOM 5060  H HD11 . ILE B 1 4  ? 11.503  -8.212  9.117   1.00 0.00 ? 4  ILE B HD11 5  
ATOM 5061  H HD12 . ILE B 1 4  ? 13.140  -8.913  8.991   1.00 0.00 ? 4  ILE B HD12 5  
ATOM 5062  H HD13 . ILE B 1 4  ? 12.236  -9.026  10.513  1.00 0.00 ? 4  ILE B HD13 5  
ATOM 5063  N N    . LYS B 1 5  ? 11.265  -3.669  12.612  1.00 0.00 ? 5  LYS B N    5  
ATOM 5064  C CA   . LYS B 1 5  ? 10.355  -2.919  13.461  1.00 0.00 ? 5  LYS B CA   5  
ATOM 5065  C C    . LYS B 1 5  ? 9.889   -1.665  12.719  1.00 0.00 ? 5  LYS B C    5  
ATOM 5066  O O    . LYS B 1 5  ? 8.740   -1.249  12.929  1.00 0.00 ? 5  LYS B O    5  
ATOM 5067  C CB   . LYS B 1 5  ? 11.005  -2.627  14.815  1.00 0.00 ? 5  LYS B CB   5  
ATOM 5068  C CG   . LYS B 1 5  ? 12.436  -2.117  14.638  1.00 0.00 ? 5  LYS B CG   5  
ATOM 5069  C CD   . LYS B 1 5  ? 13.248  -2.307  15.921  1.00 0.00 ? 5  LYS B CD   5  
ATOM 5070  C CE   . LYS B 1 5  ? 13.349  -3.789  16.291  1.00 0.00 ? 5  LYS B CE   5  
ATOM 5071  N NZ   . LYS B 1 5  ? 14.635  -4.068  16.951  1.00 0.00 ? 5  LYS B NZ   5  
ATOM 5072  H H    . LYS B 1 5  ? 12.189  -3.894  12.981  1.00 0.00 ? 5  LYS B H    5  
ATOM 5073  H HA   . LYS B 1 5  ? 9.497   -3.566  13.640  1.00 0.00 ? 5  LYS B HA   5  
ATOM 5074  H HB2  . LYS B 1 5  ? 10.419  -1.868  15.333  1.00 0.00 ? 5  LYS B HB2  5  
ATOM 5075  H HB3  . LYS B 1 5  ? 11.007  -3.541  15.411  1.00 0.00 ? 5  LYS B HB3  5  
ATOM 5076  H HG2  . LYS B 1 5  ? 12.913  -2.673  13.831  1.00 0.00 ? 5  LYS B HG2  5  
ATOM 5077  H HG3  . LYS B 1 5  ? 12.404  -1.061  14.372  1.00 0.00 ? 5  LYS B HG3  5  
ATOM 5078  H HD2  . LYS B 1 5  ? 14.252  -1.911  15.766  1.00 0.00 ? 5  LYS B HD2  5  
ATOM 5079  H HD3  . LYS B 1 5  ? 12.769  -1.754  16.729  1.00 0.00 ? 5  LYS B HD3  5  
ATOM 5080  H HE2  . LYS B 1 5  ? 12.538  -4.043  16.972  1.00 0.00 ? 5  LYS B HE2  5  
ATOM 5081  H HE3  . LYS B 1 5  ? 13.256  -4.390  15.388  1.00 0.00 ? 5  LYS B HE3  5  
ATOM 5082  H HZ1  . LYS B 1 5  ? 14.722  -3.505  17.797  1.00 0.00 ? 5  LYS B HZ1  5  
ATOM 5083  H HZ2  . LYS B 1 5  ? 14.677  -5.059  17.189  1.00 0.00 ? 5  LYS B HZ2  5  
ATOM 5084  H HZ3  . LYS B 1 5  ? 15.405  -3.843  16.322  1.00 0.00 ? 5  LYS B HZ3  5  
ATOM 5085  N N    . LYS B 1 6  ? 10.774  -1.097  11.881  1.00 0.00 ? 6  LYS B N    5  
ATOM 5086  C CA   . LYS B 1 6  ? 10.455  0.098   11.119  1.00 0.00 ? 6  LYS B CA   5  
ATOM 5087  C C    . LYS B 1 6  ? 9.813   -0.307  9.790   1.00 0.00 ? 6  LYS B C    5  
ATOM 5088  O O    . LYS B 1 6  ? 9.023   0.483   9.251   1.00 0.00 ? 6  LYS B O    5  
ATOM 5089  C CB   . LYS B 1 6  ? 11.695  0.979   10.959  1.00 0.00 ? 6  LYS B CB   5  
ATOM 5090  C CG   . LYS B 1 6  ? 12.646  0.809   12.145  1.00 0.00 ? 6  LYS B CG   5  
ATOM 5091  C CD   . LYS B 1 6  ? 13.374  2.117   12.456  1.00 0.00 ? 6  LYS B CD   5  
ATOM 5092  C CE   . LYS B 1 6  ? 14.162  2.610   11.240  1.00 0.00 ? 6  LYS B CE   5  
ATOM 5093  N NZ   . LYS B 1 6  ? 13.320  3.475   10.397  1.00 0.00 ? 6  LYS B NZ   5  
ATOM 5094  H H    . LYS B 1 6  ? 11.702  -1.504  11.766  1.00 0.00 ? 6  LYS B H    5  
ATOM 5095  H HA   . LYS B 1 6  ? 9.728   0.656   11.708  1.00 0.00 ? 6  LYS B HA   5  
ATOM 5096  H HB2  . LYS B 1 6  ? 12.215  0.695   10.044  1.00 0.00 ? 6  LYS B HB2  5  
ATOM 5097  H HB3  . LYS B 1 6  ? 11.382  2.020   10.880  1.00 0.00 ? 6  LYS B HB3  5  
ATOM 5098  H HG2  . LYS B 1 6  ? 12.069  0.506   13.020  1.00 0.00 ? 6  LYS B HG2  5  
ATOM 5099  H HG3  . LYS B 1 6  ? 13.368  0.028   11.909  1.00 0.00 ? 6  LYS B HG3  5  
ATOM 5100  H HD2  . LYS B 1 6  ? 12.641  2.874   12.734  1.00 0.00 ? 6  LYS B HD2  5  
ATOM 5101  H HD3  . LYS B 1 6  ? 14.051  1.954   13.295  1.00 0.00 ? 6  LYS B HD3  5  
ATOM 5102  H HE2  . LYS B 1 6  ? 15.027  3.179   11.579  1.00 0.00 ? 6  LYS B HE2  5  
ATOM 5103  H HE3  . LYS B 1 6  ? 14.505  1.750   10.664  1.00 0.00 ? 6  LYS B HE3  5  
ATOM 5104  H HZ1  . LYS B 1 6  ? 12.998  4.278   10.935  1.00 0.00 ? 6  LYS B HZ1  5  
ATOM 5105  H HZ2  . LYS B 1 6  ? 13.865  3.789   9.594   1.00 0.00 ? 6  LYS B HZ2  5  
ATOM 5106  H HZ3  . LYS B 1 6  ? 12.509  2.952   10.064  1.00 0.00 ? 6  LYS B HZ3  5  
ATOM 5107  N N    . LYS B 1 7  ? 10.157  -1.510  9.296   1.00 0.00 ? 7  LYS B N    5  
ATOM 5108  C CA   . LYS B 1 7  ? 9.619   -2.011  8.044   1.00 0.00 ? 7  LYS B CA   5  
ATOM 5109  C C    . LYS B 1 7  ? 8.090   -2.002  8.111   1.00 0.00 ? 7  LYS B C    5  
ATOM 5110  O O    . LYS B 1 7  ? 7.462   -1.469  7.184   1.00 0.00 ? 7  LYS B O    5  
ATOM 5111  C CB   . LYS B 1 7  ? 10.212  -3.383  7.716   1.00 0.00 ? 7  LYS B CB   5  
ATOM 5112  C CG   . LYS B 1 7  ? 9.711   -3.888  6.362   1.00 0.00 ? 7  LYS B CG   5  
ATOM 5113  C CD   . LYS B 1 7  ? 9.689   -2.759  5.329   1.00 0.00 ? 7  LYS B CD   5  
ATOM 5114  C CE   . LYS B 1 7  ? 9.798   -3.313  3.908   1.00 0.00 ? 7  LYS B CE   5  
ATOM 5115  N NZ   . LYS B 1 7  ? 11.011  -4.134  3.766   1.00 0.00 ? 7  LYS B NZ   5  
ATOM 5116  H H    . LYS B 1 7  ? 10.816  -2.100  9.804   1.00 0.00 ? 7  LYS B H    5  
ATOM 5117  H HA   . LYS B 1 7  ? 9.944   -1.318  7.267   1.00 0.00 ? 7  LYS B HA   5  
ATOM 5118  H HB2  . LYS B 1 7  ? 11.298  -3.300  7.684   1.00 0.00 ? 7  LYS B HB2  5  
ATOM 5119  H HB3  . LYS B 1 7  ? 9.932   -4.085  8.501   1.00 0.00 ? 7  LYS B HB3  5  
ATOM 5120  H HG2  . LYS B 1 7  ? 10.375  -4.676  6.010   1.00 0.00 ? 7  LYS B HG2  5  
ATOM 5121  H HG3  . LYS B 1 7  ? 8.708   -4.297  6.486   1.00 0.00 ? 7  LYS B HG3  5  
ATOM 5122  H HD2  . LYS B 1 7  ? 8.753   -2.209  5.425   1.00 0.00 ? 7  LYS B HD2  5  
ATOM 5123  H HD3  . LYS B 1 7  ? 10.521  -2.081  5.528   1.00 0.00 ? 7  LYS B HD3  5  
ATOM 5124  H HE2  . LYS B 1 7  ? 8.925   -3.930  3.696   1.00 0.00 ? 7  LYS B HE2  5  
ATOM 5125  H HE3  . LYS B 1 7  ? 9.826   -2.484  3.200   1.00 0.00 ? 7  LYS B HE3  5  
ATOM 5126  H HZ1  . LYS B 1 7  ? 10.986  -4.910  4.427   1.00 0.00 ? 7  LYS B HZ1  5  
ATOM 5127  H HZ2  . LYS B 1 7  ? 11.061  -4.492  2.812   1.00 0.00 ? 7  LYS B HZ2  5  
ATOM 5128  H HZ3  . LYS B 1 7  ? 11.838  -3.567  3.952   1.00 0.00 ? 7  LYS B HZ3  5  
ATOM 5129  N N    . MET B 1 8  ? 7.531   -2.583  9.188   1.00 0.00 ? 8  MET B N    5  
ATOM 5130  C CA   . MET B 1 8  ? 6.091   -2.640  9.371   1.00 0.00 ? 8  MET B CA   5  
ATOM 5131  C C    . MET B 1 8  ? 5.541   -1.219  9.511   1.00 0.00 ? 8  MET B C    5  
ATOM 5132  O O    . MET B 1 8  ? 4.369   -1.004  9.168   1.00 0.00 ? 8  MET B O    5  
ATOM 5133  C CB   . MET B 1 8  ? 5.745   -3.448  10.623  1.00 0.00 ? 8  MET B CB   5  
ATOM 5134  C CG   . MET B 1 8  ? 6.672   -3.083  11.784  1.00 0.00 ? 8  MET B CG   5  
ATOM 5135  S SD   . MET B 1 8  ? 5.690   -2.663  13.255  1.00 0.00 ? 8  MET B SD   5  
ATOM 5136  C CE   . MET B 1 8  ? 5.169   -4.324  13.772  1.00 0.00 ? 8  MET B CE   5  
ATOM 5137  H H    . MET B 1 8  ? 8.122   -2.999  9.907   1.00 0.00 ? 8  MET B H    5  
ATOM 5138  H HA   . MET B 1 8  ? 5.642   -3.110  8.495   1.00 0.00 ? 8  MET B HA   5  
ATOM 5139  H HB2  . MET B 1 8  ? 4.715   -3.233  10.910  1.00 0.00 ? 8  MET B HB2  5  
ATOM 5140  H HB3  . MET B 1 8  ? 5.836   -4.510  10.395  1.00 0.00 ? 8  MET B HB3  5  
ATOM 5141  H HG2  . MET B 1 8  ? 7.314   -3.932  12.017  1.00 0.00 ? 8  MET B HG2  5  
ATOM 5142  H HG3  . MET B 1 8  ? 7.294   -2.234  11.498  1.00 0.00 ? 8  MET B HG3  5  
ATOM 5143  H HE1  . MET B 1 8  ? 6.044   -4.941  13.977  1.00 0.00 ? 8  MET B HE1  5  
ATOM 5144  H HE2  . MET B 1 8  ? 4.554   -4.241  14.668  1.00 0.00 ? 8  MET B HE2  5  
ATOM 5145  H HE3  . MET B 1 8  ? 4.583   -4.793  12.980  1.00 0.00 ? 8  MET B HE3  5  
ATOM 5146  N N    . GLN B 1 9  ? 6.384   -0.294  10.004  1.00 0.00 ? 9  GLN B N    5  
ATOM 5147  C CA   . GLN B 1 9  ? 5.984   1.091   10.187  1.00 0.00 ? 9  GLN B CA   5  
ATOM 5148  C C    . GLN B 1 9  ? 5.975   1.798   8.831   1.00 0.00 ? 9  GLN B C    5  
ATOM 5149  O O    . GLN B 1 9  ? 5.256   2.798   8.691   1.00 0.00 ? 9  GLN B O    5  
ATOM 5150  C CB   . GLN B 1 9  ? 6.901   1.814   11.176  1.00 0.00 ? 9  GLN B CB   5  
ATOM 5151  C CG   . GLN B 1 9  ? 6.754   1.234   12.585  1.00 0.00 ? 9  GLN B CG   5  
ATOM 5152  C CD   . GLN B 1 9  ? 7.537   2.065   13.604  1.00 0.00 ? 9  GLN B CD   5  
ATOM 5153  O OE1  . GLN B 1 9  ? 7.051   3.041   14.153  1.00 0.00 ? 9  GLN B OE1  5  
ATOM 5154  N NE2  . GLN B 1 9  ? 8.772   1.626   13.825  1.00 0.00 ? 9  GLN B NE2  5  
ATOM 5155  H H    . GLN B 1 9  ? 7.335   -0.556  10.263  1.00 0.00 ? 9  GLN B H    5  
ATOM 5156  H HA   . GLN B 1 9  ? 4.971   1.079   10.589  1.00 0.00 ? 9  GLN B HA   5  
ATOM 5157  H HB2  . GLN B 1 9  ? 7.935   1.698   10.850  1.00 0.00 ? 9  GLN B HB2  5  
ATOM 5158  H HB3  . GLN B 1 9  ? 6.648   2.874   11.183  1.00 0.00 ? 9  GLN B HB3  5  
ATOM 5159  H HG2  . GLN B 1 9  ? 5.699   1.237   12.860  1.00 0.00 ? 9  GLN B HG2  5  
ATOM 5160  H HG3  . GLN B 1 9  ? 7.119   0.207   12.584  1.00 0.00 ? 9  GLN B HG3  5  
ATOM 5161  H HE21 . GLN B 1 9  ? 9.117   0.802   13.332  1.00 0.00 ? 9  GLN B HE21 5  
ATOM 5162  H HE22 . GLN B 1 9  ? 9.376   2.111   14.489  1.00 0.00 ? 9  GLN B HE22 5  
ATOM 5163  N N    . MET B 1 10 ? 6.762   1.275   7.874   1.00 0.00 ? 10 MET B N    5  
ATOM 5164  C CA   . MET B 1 10 ? 6.843   1.853   6.543   1.00 0.00 ? 10 MET B CA   5  
ATOM 5165  C C    . MET B 1 10 ? 5.729   1.272   5.671   1.00 0.00 ? 10 MET B C    5  
ATOM 5166  O O    . MET B 1 10 ? 5.163   2.022   4.861   1.00 0.00 ? 10 MET B O    5  
ATOM 5167  C CB   . MET B 1 10 ? 8.201   1.541   5.909   1.00 0.00 ? 10 MET B CB   5  
ATOM 5168  C CG   . MET B 1 10 ? 9.339   1.781   6.904   1.00 0.00 ? 10 MET B CG   5  
ATOM 5169  S SD   . MET B 1 10 ? 10.564  2.915   6.186   1.00 0.00 ? 10 MET B SD   5  
ATOM 5170  C CE   . MET B 1 10 ? 11.272  1.843   4.902   1.00 0.00 ? 10 MET B CE   5  
ATOM 5171  H H    . MET B 1 10 ? 7.325   0.448   8.072   1.00 0.00 ? 10 MET B H    5  
ATOM 5172  H HA   . MET B 1 10 ? 6.712   2.931   6.616   1.00 0.00 ? 10 MET B HA   5  
ATOM 5173  H HB2  . MET B 1 10 ? 8.216   0.496   5.599   1.00 0.00 ? 10 MET B HB2  5  
ATOM 5174  H HB3  . MET B 1 10 ? 8.335   2.174   5.031   1.00 0.00 ? 10 MET B HB3  5  
ATOM 5175  H HG2  . MET B 1 10 ? 8.936   2.223   7.815   1.00 0.00 ? 10 MET B HG2  5  
ATOM 5176  H HG3  . MET B 1 10 ? 9.812   0.830   7.151   1.00 0.00 ? 10 MET B HG3  5  
ATOM 5177  H HE1  . MET B 1 10 ? 10.492  1.528   4.209   1.00 0.00 ? 10 MET B HE1  5  
ATOM 5178  H HE2  . MET B 1 10 ? 12.045  2.394   4.366   1.00 0.00 ? 10 MET B HE2  5  
ATOM 5179  H HE3  . MET B 1 10 ? 11.719  0.961   5.360   1.00 0.00 ? 10 MET B HE3  5  
ATOM 5180  N N    . LEU B 1 11 ? 5.439   -0.028  5.849   1.00 0.00 ? 11 LEU B N    5  
ATOM 5181  C CA   . LEU B 1 11 ? 4.402   -0.699  5.084   1.00 0.00 ? 11 LEU B CA   5  
ATOM 5182  C C    . LEU B 1 11 ? 3.030   -0.305  5.638   1.00 0.00 ? 11 LEU B C    5  
ATOM 5183  O O    . LEU B 1 11 ? 2.062   -0.296  4.864   1.00 0.00 ? 11 LEU B O    5  
ATOM 5184  C CB   . LEU B 1 11 ? 4.645   -2.210  5.061   1.00 0.00 ? 11 LEU B CB   5  
ATOM 5185  C CG   . LEU B 1 11 ? 5.979   -2.665  4.467   1.00 0.00 ? 11 LEU B CG   5  
ATOM 5186  C CD1  . LEU B 1 11 ? 6.075   -4.192  4.442   1.00 0.00 ? 11 LEU B CD1  5  
ATOM 5187  C CD2  . LEU B 1 11 ? 6.200   -2.054  3.081   1.00 0.00 ? 11 LEU B CD2  5  
ATOM 5188  H H    . LEU B 1 11 ? 5.955   -0.576  6.539   1.00 0.00 ? 11 LEU B H    5  
ATOM 5189  H HA   . LEU B 1 11 ? 4.488   -0.336  4.060   1.00 0.00 ? 11 LEU B HA   5  
ATOM 5190  H HB2  . LEU B 1 11 ? 4.582   -2.547  6.094   1.00 0.00 ? 11 LEU B HB2  5  
ATOM 5191  H HB3  . LEU B 1 11 ? 3.819   -2.643  4.496   1.00 0.00 ? 11 LEU B HB3  5  
ATOM 5192  H HG   . LEU B 1 11 ? 6.738   -2.283  5.148   1.00 0.00 ? 11 LEU B HG   5  
ATOM 5193  H HD11 . LEU B 1 11 ? 5.263   -4.606  3.845   1.00 0.00 ? 11 LEU B HD11 5  
ATOM 5194  H HD12 . LEU B 1 11 ? 7.035   -4.480  4.014   1.00 0.00 ? 11 LEU B HD12 5  
ATOM 5195  H HD13 . LEU B 1 11 ? 6.006   -4.585  5.457   1.00 0.00 ? 11 LEU B HD13 5  
ATOM 5196  H HD21 . LEU B 1 11 ? 6.197   -0.966  3.150   1.00 0.00 ? 11 LEU B HD21 5  
ATOM 5197  H HD22 . LEU B 1 11 ? 7.157   -2.399  2.690   1.00 0.00 ? 11 LEU B HD22 5  
ATOM 5198  H HD23 . LEU B 1 11 ? 5.406   -2.370  2.405   1.00 0.00 ? 11 LEU B HD23 5  
ATOM 5199  N N    . LYS B 1 12 ? 2.976   0.008   6.945   1.00 0.00 ? 12 LYS B N    5  
ATOM 5200  C CA   . LYS B 1 12 ? 1.736   0.397   7.593   1.00 0.00 ? 12 LYS B CA   5  
ATOM 5201  C C    . LYS B 1 12 ? 1.426   1.857   7.256   1.00 0.00 ? 12 LYS B C    5  
ATOM 5202  O O    . LYS B 1 12 ? 0.239   2.204   7.173   1.00 0.00 ? 12 LYS B O    5  
ATOM 5203  C CB   . LYS B 1 12 ? 1.804   0.114   9.095   1.00 0.00 ? 12 LYS B CB   5  
ATOM 5204  C CG   . LYS B 1 12 ? 2.777   1.068   9.789   1.00 0.00 ? 12 LYS B CG   5  
ATOM 5205  C CD   . LYS B 1 12 ? 2.089   2.387   10.148  1.00 0.00 ? 12 LYS B CD   5  
ATOM 5206  C CE   . LYS B 1 12 ? 2.567   2.904   11.507  1.00 0.00 ? 12 LYS B CE   5  
ATOM 5207  N NZ   . LYS B 1 12 ? 3.958   3.377   11.418  1.00 0.00 ? 12 LYS B NZ   5  
ATOM 5208  H H    . LYS B 1 12 ? 3.824   -0.026  7.513   1.00 0.00 ? 12 LYS B H    5  
ATOM 5209  H HA   . LYS B 1 12 ? 0.955   -0.238  7.174   1.00 0.00 ? 12 LYS B HA   5  
ATOM 5210  H HB2  . LYS B 1 12 ? 0.811   0.244   9.525   1.00 0.00 ? 12 LYS B HB2  5  
ATOM 5211  H HB3  . LYS B 1 12 ? 2.123   -0.917  9.247   1.00 0.00 ? 12 LYS B HB3  5  
ATOM 5212  H HG2  . LYS B 1 12 ? 3.142   0.599   10.702  1.00 0.00 ? 12 LYS B HG2  5  
ATOM 5213  H HG3  . LYS B 1 12 ? 3.620   1.258   9.126   1.00 0.00 ? 12 LYS B HG3  5  
ATOM 5214  H HD2  . LYS B 1 12 ? 2.325   3.129   9.384   1.00 0.00 ? 12 LYS B HD2  5  
ATOM 5215  H HD3  . LYS B 1 12 ? 1.011   2.230   10.170  1.00 0.00 ? 12 LYS B HD3  5  
ATOM 5216  H HE2  . LYS B 1 12 ? 1.931   3.730   11.821  1.00 0.00 ? 12 LYS B HE2  5  
ATOM 5217  H HE3  . LYS B 1 12 ? 2.495   2.101   12.240  1.00 0.00 ? 12 LYS B HE3  5  
ATOM 5218  H HZ1  . LYS B 1 12 ? 4.027   4.128   10.731  1.00 0.00 ? 12 LYS B HZ1  5  
ATOM 5219  H HZ2  . LYS B 1 12 ? 4.254   3.715   12.334  1.00 0.00 ? 12 LYS B HZ2  5  
ATOM 5220  H HZ3  . LYS B 1 12 ? 4.569   2.611   11.134  1.00 0.00 ? 12 LYS B HZ3  5  
ATOM 5221  N N    . LEU B 1 13 ? 2.482   2.669   7.071   1.00 0.00 ? 13 LEU B N    5  
ATOM 5222  C CA   . LEU B 1 13 ? 2.323   4.076   6.745   1.00 0.00 ? 13 LEU B CA   5  
ATOM 5223  C C    . LEU B 1 13 ? 1.949   4.215   5.268   1.00 0.00 ? 13 LEU B C    5  
ATOM 5224  O O    . LEU B 1 13 ? 1.068   5.030   4.957   1.00 0.00 ? 13 LEU B O    5  
ATOM 5225  C CB   . LEU B 1 13 ? 3.576   4.861   7.139   1.00 0.00 ? 13 LEU B CB   5  
ATOM 5226  C CG   . LEU B 1 13 ? 3.397   6.373   7.301   1.00 0.00 ? 13 LEU B CG   5  
ATOM 5227  C CD1  . LEU B 1 13 ? 4.709   7.112   7.034   1.00 0.00 ? 13 LEU B CD1  5  
ATOM 5228  C CD2  . LEU B 1 13 ? 2.258   6.888   6.420   1.00 0.00 ? 13 LEU B CD2  5  
ATOM 5229  H H    . LEU B 1 13 ? 3.430   2.302   7.157   1.00 0.00 ? 13 LEU B H    5  
ATOM 5230  H HA   . LEU B 1 13 ? 1.499   4.444   7.357   1.00 0.00 ? 13 LEU B HA   5  
ATOM 5231  H HB2  . LEU B 1 13 ? 3.918   4.441   8.084   1.00 0.00 ? 13 LEU B HB2  5  
ATOM 5232  H HB3  . LEU B 1 13 ? 4.320   4.657   6.368   1.00 0.00 ? 13 LEU B HB3  5  
ATOM 5233  H HG   . LEU B 1 13 ? 3.128   6.515   8.349   1.00 0.00 ? 13 LEU B HG   5  
ATOM 5234  H HD11 . LEU B 1 13 ? 5.052   6.905   6.021   1.00 0.00 ? 13 LEU B HD11 5  
ATOM 5235  H HD12 . LEU B 1 13 ? 4.545   8.183   7.158   1.00 0.00 ? 13 LEU B HD12 5  
ATOM 5236  H HD13 . LEU B 1 13 ? 5.471   6.785   7.741   1.00 0.00 ? 13 LEU B HD13 5  
ATOM 5237  H HD21 . LEU B 1 13 ? 1.326   6.391   6.688   1.00 0.00 ? 13 LEU B HD21 5  
ATOM 5238  H HD22 . LEU B 1 13 ? 2.159   7.964   6.562   1.00 0.00 ? 13 LEU B HD22 5  
ATOM 5239  H HD23 . LEU B 1 13 ? 2.478   6.687   5.372   1.00 0.00 ? 13 LEU B HD23 5  
ATOM 5240  N N    . ASP B 1 14 ? 2.614   3.430   4.402   1.00 0.00 ? 14 ASP B N    5  
ATOM 5241  C CA   . ASP B 1 14 ? 2.351   3.466   2.974   1.00 0.00 ? 14 ASP B CA   5  
ATOM 5242  C C    . ASP B 1 14 ? 0.938   2.945   2.705   1.00 0.00 ? 14 ASP B C    5  
ATOM 5243  O O    . ASP B 1 14 ? 0.292   3.448   1.774   1.00 0.00 ? 14 ASP B O    5  
ATOM 5244  C CB   . ASP B 1 14 ? 3.336   2.575   2.211   1.00 0.00 ? 14 ASP B CB   5  
ATOM 5245  C CG   . ASP B 1 14 ? 3.875   3.175   0.911   1.00 0.00 ? 14 ASP B CG   5  
ATOM 5246  O OD1  . ASP B 1 14 ? 4.082   4.392   0.805   1.00 0.00 ? 14 ASP B OD1  5  
ATOM 5247  O OD2  . ASP B 1 14 ? 4.087   2.323   -0.035  1.00 0.00 ? 14 ASP B OD2  5  
ATOM 5248  H H    . ASP B 1 14 ? 3.327   2.785   4.742   1.00 0.00 ? 14 ASP B H    5  
ATOM 5249  H HA   . ASP B 1 14 ? 2.423   4.496   2.625   1.00 0.00 ? 14 ASP B HA   5  
ATOM 5250  H HB2  . ASP B 1 14 ? 4.170   2.377   2.883   1.00 0.00 ? 14 ASP B HB2  5  
ATOM 5251  H HB3  . ASP B 1 14 ? 2.818   1.640   2.002   1.00 0.00 ? 14 ASP B HB3  5  
ATOM 5252  N N    . ASN B 1 15 ? 0.494   1.965   3.512   1.00 0.00 ? 15 ASN B N    5  
ATOM 5253  C CA   . ASN B 1 15 ? -0.829  1.385   3.363   1.00 0.00 ? 15 ASN B CA   5  
ATOM 5254  C C    . ASN B 1 15 ? -1.886  2.459   3.632   1.00 0.00 ? 15 ASN B C    5  
ATOM 5255  O O    . ASN B 1 15 ? -2.794  2.613   2.803   1.00 0.00 ? 15 ASN B O    5  
ATOM 5256  C CB   . ASN B 1 15 ? -1.048  0.247   4.361   1.00 0.00 ? 15 ASN B CB   5  
ATOM 5257  C CG   . ASN B 1 15 ? -2.198  -0.660  3.917   1.00 0.00 ? 15 ASN B CG   5  
ATOM 5258  O OD1  . ASN B 1 15 ? -3.350  -0.462  4.269   1.00 0.00 ? 15 ASN B OD1  5  
ATOM 5259  N ND2  . ASN B 1 15 ? -1.823  -1.662  3.127   1.00 0.00 ? 15 ASN B ND2  5  
ATOM 5260  H H    . ASN B 1 15 ? 1.092   1.607   4.257   1.00 0.00 ? 15 ASN B H    5  
ATOM 5261  H HA   . ASN B 1 15 ? -0.944  1.022   2.342   1.00 0.00 ? 15 ASN B HA   5  
ATOM 5262  H HB2  . ASN B 1 15 ? -0.135  -0.345  4.429   1.00 0.00 ? 15 ASN B HB2  5  
ATOM 5263  H HB3  . ASN B 1 15 ? -1.268  0.673   5.340   1.00 0.00 ? 15 ASN B HB3  5  
ATOM 5264  H HD21 . ASN B 1 15 ? -0.842  -1.769  2.871   1.00 0.00 ? 15 ASN B HD21 5  
ATOM 5265  H HD22 . ASN B 1 15 ? -2.517  -2.322  2.776   1.00 0.00 ? 15 ASN B HD22 5  
ATOM 5266  N N    . TYR B 1 16 ? -1.748  3.168   4.767   1.00 0.00 ? 16 TYR B N    5  
ATOM 5267  C CA   . TYR B 1 16 ? -2.722  4.200   5.082   1.00 0.00 ? 16 TYR B CA   5  
ATOM 5268  C C    . TYR B 1 16 ? -2.740  5.238   3.959   1.00 0.00 ? 16 TYR B C    5  
ATOM 5269  O O    . TYR B 1 16 ? -3.827  5.757   3.665   1.00 0.00 ? 16 TYR B O    5  
ATOM 5270  C CB   . TYR B 1 16 ? -2.394  4.837   6.445   1.00 0.00 ? 16 TYR B CB   5  
ATOM 5271  C CG   . TYR B 1 16 ? -2.074  3.837   7.549   1.00 0.00 ? 16 TYR B CG   5  
ATOM 5272  C CD1  . TYR B 1 16 ? -2.498  2.494   7.430   1.00 0.00 ? 16 TYR B CD1  5  
ATOM 5273  C CD2  . TYR B 1 16 ? -1.348  4.242   8.693   1.00 0.00 ? 16 TYR B CD2  5  
ATOM 5274  C CE1  . TYR B 1 16 ? -2.200  1.563   8.448   1.00 0.00 ? 16 TYR B CE1  5  
ATOM 5275  C CE2  . TYR B 1 16 ? -1.052  3.311   9.711   1.00 0.00 ? 16 TYR B CE2  5  
ATOM 5276  C CZ   . TYR B 1 16 ? -1.478  1.970   9.590   1.00 0.00 ? 16 TYR B CZ   5  
ATOM 5277  O OH   . TYR B 1 16 ? -1.194  1.067   10.574  1.00 0.00 ? 16 TYR B OH   5  
ATOM 5278  H H    . TYR B 1 16 ? -0.983  2.991   5.401   1.00 0.00 ? 16 TYR B H    5  
ATOM 5279  H HA   . TYR B 1 16 ? -3.707  3.735   5.131   1.00 0.00 ? 16 TYR B HA   5  
ATOM 5280  H HB2  . TYR B 1 16 ? -1.557  5.527   6.325   1.00 0.00 ? 16 TYR B HB2  5  
ATOM 5281  H HB3  . TYR B 1 16 ? -3.251  5.429   6.772   1.00 0.00 ? 16 TYR B HB3  5  
ATOM 5282  H HD1  . TYR B 1 16 ? -3.050  2.173   6.558   1.00 0.00 ? 16 TYR B HD1  5  
ATOM 5283  H HD2  . TYR B 1 16 ? -1.017  5.266   8.793   1.00 0.00 ? 16 TYR B HD2  5  
ATOM 5284  H HE1  . TYR B 1 16 ? -2.529  0.538   8.349   1.00 0.00 ? 16 TYR B HE1  5  
ATOM 5285  H HE2  . TYR B 1 16 ? -0.497  3.630   10.582  1.00 0.00 ? 16 TYR B HE2  5  
ATOM 5286  H HH   . TYR B 1 16 ? -1.616  0.214   10.445  1.00 0.00 ? 16 TYR B HH   5  
ATOM 5287  N N    . HIS B 1 17 ? -1.565  5.521   3.370   1.00 0.00 ? 17 HIS B N    5  
ATOM 5288  C CA   . HIS B 1 17 ? -1.456  6.497   2.298   1.00 0.00 ? 17 HIS B CA   5  
ATOM 5289  C C    . HIS B 1 17 ? -2.049  5.909   1.017   1.00 0.00 ? 17 HIS B C    5  
ATOM 5290  O O    . HIS B 1 17 ? -2.746  6.642   0.300   1.00 0.00 ? 17 HIS B O    5  
ATOM 5291  C CB   . HIS B 1 17 ? -0.008  6.959   2.125   1.00 0.00 ? 17 HIS B CB   5  
ATOM 5292  C CG   . HIS B 1 17 ? 0.472   6.947   0.692   1.00 0.00 ? 17 HIS B CG   5  
ATOM 5293  N ND1  . HIS B 1 17 ? 0.344   8.036   -0.151  1.00 0.00 ? 17 HIS B ND1  5  
ATOM 5294  C CD2  . HIS B 1 17 ? 1.083   5.968   -0.034  1.00 0.00 ? 17 HIS B CD2  5  
ATOM 5295  C CE1  . HIS B 1 17 ? 0.856   7.715   -1.330  1.00 0.00 ? 17 HIS B CE1  5  
ATOM 5296  N NE2  . HIS B 1 17 ? 1.314   6.432   -1.256  1.00 0.00 ? 17 HIS B NE2  5  
ATOM 5297  H H    . HIS B 1 17 ? -0.715  5.047   3.673   1.00 0.00 ? 17 HIS B H    5  
ATOM 5298  H HA   . HIS B 1 17 ? -2.051  7.359   2.603   1.00 0.00 ? 17 HIS B HA   5  
ATOM 5299  H HB2  . HIS B 1 17 ? 0.060   7.976   2.513   1.00 0.00 ? 17 HIS B HB2  5  
ATOM 5300  H HB3  . HIS B 1 17 ? 0.617   6.305   2.732   1.00 0.00 ? 17 HIS B HB3  5  
ATOM 5301  H HD1  . HIS B 1 17 ? -0.054  8.964   -0.003  1.00 0.00 ? 17 HIS B HD1  5  
ATOM 5302  H HD2  . HIS B 1 17 ? 1.377   4.960   0.225   1.00 0.00 ? 17 HIS B HD2  5  
ATOM 5303  H HE1  . HIS B 1 17 ? 0.852   8.436   -2.135  1.00 0.00 ? 17 HIS B HE1  5  
ATOM 5304  N N    . LEU B 1 18 ? -1.766  4.619   0.759   1.00 0.00 ? 18 LEU B N    5  
ATOM 5305  C CA   . LEU B 1 18 ? -2.269  3.943   -0.425  1.00 0.00 ? 18 LEU B CA   5  
ATOM 5306  C C    . LEU B 1 18 ? -3.791  3.826   -0.333  1.00 0.00 ? 18 LEU B C    5  
ATOM 5307  O O    . LEU B 1 18 ? -4.458  3.975   -1.367  1.00 0.00 ? 18 LEU B O    5  
ATOM 5308  C CB   . LEU B 1 18 ? -1.559  2.602   -0.617  1.00 0.00 ? 18 LEU B CB   5  
ATOM 5309  C CG   . LEU B 1 18 ? -0.122  2.671   -1.139  1.00 0.00 ? 18 LEU B CG   5  
ATOM 5310  C CD1  . LEU B 1 18 ? 0.553   1.300   -1.070  1.00 0.00 ? 18 LEU B CD1  5  
ATOM 5311  C CD2  . LEU B 1 18 ? -0.080  3.260   -2.550  1.00 0.00 ? 18 LEU B CD2  5  
ATOM 5312  H H    . LEU B 1 18 ? -1.183  4.087   1.404   1.00 0.00 ? 18 LEU B H    5  
ATOM 5313  H HA   . LEU B 1 18 ? -2.012  4.576   -1.275  1.00 0.00 ? 18 LEU B HA   5  
ATOM 5314  H HB2  . LEU B 1 18 ? -1.559  2.111   0.357   1.00 0.00 ? 18 LEU B HB2  5  
ATOM 5315  H HB3  . LEU B 1 18 ? -2.177  2.025   -1.304  1.00 0.00 ? 18 LEU B HB3  5  
ATOM 5316  H HG   . LEU B 1 18 ? 0.396   3.345   -0.458  1.00 0.00 ? 18 LEU B HG   5  
ATOM 5317  H HD11 . LEU B 1 18 ? -0.006  0.579   -1.668  1.00 0.00 ? 18 LEU B HD11 5  
ATOM 5318  H HD12 . LEU B 1 18 ? 1.572   1.386   -1.448  1.00 0.00 ? 18 LEU B HD12 5  
ATOM 5319  H HD13 . LEU B 1 18 ? 0.587   0.954   -0.036  1.00 0.00 ? 18 LEU B HD13 5  
ATOM 5320  H HD21 . LEU B 1 18 ? -0.503  4.264   -2.547  1.00 0.00 ? 18 LEU B HD21 5  
ATOM 5321  H HD22 . LEU B 1 18 ? 0.956   3.294   -2.890  1.00 0.00 ? 18 LEU B HD22 5  
ATOM 5322  H HD23 . LEU B 1 18 ? -0.656  2.634   -3.232  1.00 0.00 ? 18 LEU B HD23 5  
ATOM 5323  N N    . GLU B 1 19 ? -4.303  3.566   0.883   1.00 0.00 ? 19 GLU B N    5  
ATOM 5324  C CA   . GLU B 1 19 ? -5.732  3.431   1.105   1.00 0.00 ? 19 GLU B CA   5  
ATOM 5325  C C    . GLU B 1 19 ? -6.410  4.782   0.872   1.00 0.00 ? 19 GLU B C    5  
ATOM 5326  O O    . GLU B 1 19 ? -7.363  4.836   0.081   1.00 0.00 ? 19 GLU B O    5  
ATOM 5327  C CB   . GLU B 1 19 ? -6.035  2.899   2.507   1.00 0.00 ? 19 GLU B CB   5  
ATOM 5328  C CG   . GLU B 1 19 ? -7.300  2.036   2.505   1.00 0.00 ? 19 GLU B CG   5  
ATOM 5329  C CD   . GLU B 1 19 ? -8.510  2.835   2.992   1.00 0.00 ? 19 GLU B CD   5  
ATOM 5330  O OE1  . GLU B 1 19 ? -8.532  3.073   4.260   1.00 0.00 ? 19 GLU B OE1  5  
ATOM 5331  O OE2  . GLU B 1 19 ? -9.376  3.202   2.184   1.00 0.00 ? 19 GLU B OE2  5  
ATOM 5332  H H    . GLU B 1 19 ? -3.681  3.457   1.685   1.00 0.00 ? 19 GLU B H    5  
ATOM 5333  H HA   . GLU B 1 19 ? -6.101  2.717   0.368   1.00 0.00 ? 19 GLU B HA   5  
ATOM 5334  H HB2  . GLU B 1 19 ? -5.195  2.295   2.847   1.00 0.00 ? 19 GLU B HB2  5  
ATOM 5335  H HB3  . GLU B 1 19 ? -6.163  3.744   3.185   1.00 0.00 ? 19 GLU B HB3  5  
ATOM 5336  H HG2  . GLU B 1 19 ? -7.489  1.689   1.490   1.00 0.00 ? 19 GLU B HG2  5  
ATOM 5337  H HG3  . GLU B 1 19 ? -7.140  1.173   3.152   1.00 0.00 ? 19 GLU B HG3  5  
ATOM 5338  N N    . ASN B 1 20 ? -5.914  5.830   1.554   1.00 0.00 ? 20 ASN B N    5  
ATOM 5339  C CA   . ASN B 1 20 ? -6.468  7.167   1.422   1.00 0.00 ? 20 ASN B CA   5  
ATOM 5340  C C    . ASN B 1 20 ? -6.302  7.643   -0.023  1.00 0.00 ? 20 ASN B C    5  
ATOM 5341  O O    . ASN B 1 20 ? -7.147  8.421   -0.489  1.00 0.00 ? 20 ASN B O    5  
ATOM 5342  C CB   . ASN B 1 20 ? -5.740  8.158   2.333   1.00 0.00 ? 20 ASN B CB   5  
ATOM 5343  C CG   . ASN B 1 20 ? -5.684  7.640   3.772   1.00 0.00 ? 20 ASN B CG   5  
ATOM 5344  O OD1  . ASN B 1 20 ? -6.481  6.820   4.195   1.00 0.00 ? 20 ASN B OD1  5  
ATOM 5345  N ND2  . ASN B 1 20 ? -4.699  8.164   4.497   1.00 0.00 ? 20 ASN B ND2  5  
ATOM 5346  H H    . ASN B 1 20 ? -5.125  5.700   2.187   1.00 0.00 ? 20 ASN B H    5  
ATOM 5347  H HA   . ASN B 1 20 ? -7.530  7.136   1.665   1.00 0.00 ? 20 ASN B HA   5  
ATOM 5348  H HB2  . ASN B 1 20 ? -4.723  8.295   1.965   1.00 0.00 ? 20 ASN B HB2  5  
ATOM 5349  H HB3  . ASN B 1 20 ? -6.261  9.115   2.302   1.00 0.00 ? 20 ASN B HB3  5  
ATOM 5350  H HD21 . ASN B 1 20 ? -4.066  8.846   4.079   1.00 0.00 ? 20 ASN B HD21 5  
ATOM 5351  H HD22 . ASN B 1 20 ? -4.577  7.882   5.469   1.00 0.00 ? 20 ASN B HD22 5  
ATOM 5352  N N    . GLU B 1 21 ? -5.233  7.174   -0.692  1.00 0.00 ? 21 GLU B N    5  
ATOM 5353  C CA   . GLU B 1 21 ? -4.961  7.549   -2.069  1.00 0.00 ? 21 GLU B CA   5  
ATOM 5354  C C    . GLU B 1 21 ? -5.858  6.731   -3.002  1.00 0.00 ? 21 GLU B C    5  
ATOM 5355  O O    . GLU B 1 21 ? -6.249  7.258   -4.054  1.00 0.00 ? 21 GLU B O    5  
ATOM 5356  C CB   . GLU B 1 21 ? -3.485  7.360   -2.423  1.00 0.00 ? 21 GLU B CB   5  
ATOM 5357  C CG   . GLU B 1 21 ? -3.148  8.038   -3.752  1.00 0.00 ? 21 GLU B CG   5  
ATOM 5358  C CD   . GLU B 1 21 ? -2.090  9.126   -3.560  1.00 0.00 ? 21 GLU B CD   5  
ATOM 5359  O OE1  . GLU B 1 21 ? -2.276  9.894   -2.541  1.00 0.00 ? 21 GLU B OE1  5  
ATOM 5360  O OE2  . GLU B 1 21 ? -1.145  9.219   -4.358  1.00 0.00 ? 21 GLU B OE2  5  
ATOM 5361  H H    . GLU B 1 21 ? -4.584  6.535   -0.232  1.00 0.00 ? 21 GLU B H    5  
ATOM 5362  H HA   . GLU B 1 21 ? -5.216  8.604   -2.167  1.00 0.00 ? 21 GLU B HA   5  
ATOM 5363  H HB2  . GLU B 1 21 ? -2.874  7.800   -1.635  1.00 0.00 ? 21 GLU B HB2  5  
ATOM 5364  H HB3  . GLU B 1 21 ? -3.270  6.294   -2.484  1.00 0.00 ? 21 GLU B HB3  5  
ATOM 5365  H HG2  . GLU B 1 21 ? -2.765  7.288   -4.445  1.00 0.00 ? 21 GLU B HG2  5  
ATOM 5366  H HG3  . GLU B 1 21 ? -4.057  8.472   -4.168  1.00 0.00 ? 21 GLU B HG3  5  
ATOM 5367  N N    . VAL B 1 22 ? -6.159  5.483   -2.606  1.00 0.00 ? 22 VAL B N    5  
ATOM 5368  C CA   . VAL B 1 22 ? -7.001  4.604   -3.401  1.00 0.00 ? 22 VAL B CA   5  
ATOM 5369  C C    . VAL B 1 22 ? -8.466  5.007   -3.220  1.00 0.00 ? 22 VAL B C    5  
ATOM 5370  O O    . VAL B 1 22 ? -9.222  4.934   -4.198  1.00 0.00 ? 22 VAL B O    5  
ATOM 5371  C CB   . VAL B 1 22 ? -6.731  3.144   -3.029  1.00 0.00 ? 22 VAL B CB   5  
ATOM 5372  C CG1  . VAL B 1 22 ? -7.985  2.289   -3.223  1.00 0.00 ? 22 VAL B CG1  5  
ATOM 5373  C CG2  . VAL B 1 22 ? -5.555  2.583   -3.829  1.00 0.00 ? 22 VAL B CG2  5  
ATOM 5374  H H    . VAL B 1 22 ? -5.793  5.125   -1.723  1.00 0.00 ? 22 VAL B H    5  
ATOM 5375  H HA   . VAL B 1 22 ? -6.721  4.741   -4.445  1.00 0.00 ? 22 VAL B HA   5  
ATOM 5376  H HB   . VAL B 1 22 ? -6.468  3.153   -1.971  1.00 0.00 ? 22 VAL B HB   5  
ATOM 5377  H HG11 . VAL B 1 22 ? -8.309  2.335   -4.263  1.00 0.00 ? 22 VAL B HG11 5  
ATOM 5378  H HG12 . VAL B 1 22 ? -7.759  1.259   -2.950  1.00 0.00 ? 22 VAL B HG12 5  
ATOM 5379  H HG13 . VAL B 1 22 ? -8.789  2.656   -2.585  1.00 0.00 ? 22 VAL B HG13 5  
ATOM 5380  H HG21 . VAL B 1 22 ? -4.657  3.168   -3.631  1.00 0.00 ? 22 VAL B HG21 5  
ATOM 5381  H HG22 . VAL B 1 22 ? -5.392  1.545   -3.539  1.00 0.00 ? 22 VAL B HG22 5  
ATOM 5382  H HG23 . VAL B 1 22 ? -5.778  2.623   -4.894  1.00 0.00 ? 22 VAL B HG23 5  
ATOM 5383  N N    . ALA B 1 23 ? -8.830  5.417   -1.991  1.00 0.00 ? 23 ALA B N    5  
ATOM 5384  C CA   . ALA B 1 23 ? -10.191 5.827   -1.688  1.00 0.00 ? 23 ALA B CA   5  
ATOM 5385  C C    . ALA B 1 23 ? -10.501 7.133   -2.422  1.00 0.00 ? 23 ALA B C    5  
ATOM 5386  O O    . ALA B 1 23 ? -11.688 7.429   -2.622  1.00 0.00 ? 23 ALA B O    5  
ATOM 5387  C CB   . ALA B 1 23 ? -10.315 6.134   -0.195  1.00 0.00 ? 23 ALA B CB   5  
ATOM 5388  H H    . ALA B 1 23 ? -8.142  5.446   -1.239  1.00 0.00 ? 23 ALA B H    5  
ATOM 5389  H HA   . ALA B 1 23 ? -10.909 5.066   -1.997  1.00 0.00 ? 23 ALA B HA   5  
ATOM 5390  H HB1  . ALA B 1 23 ? -10.059 5.241   0.374   1.00 0.00 ? 23 ALA B HB1  5  
ATOM 5391  H HB2  . ALA B 1 23 ? -9.631  6.937   0.077   1.00 0.00 ? 23 ALA B HB2  5  
ATOM 5392  H HB3  . ALA B 1 23 ? -11.336 6.442   0.038   1.00 0.00 ? 23 ALA B HB3  5  
ATOM 5393  N N    . ARG B 1 24 ? -9.446  7.873   -2.804  1.00 0.00 ? 24 ARG B N    5  
ATOM 5394  C CA   . ARG B 1 24 ? -9.605  9.134   -3.509  1.00 0.00 ? 24 ARG B CA   5  
ATOM 5395  C C    . ARG B 1 24 ? -9.551  8.881   -5.018  1.00 0.00 ? 24 ARG B C    5  
ATOM 5396  O O    . ARG B 1 24 ? -10.184 9.640   -5.766  1.00 0.00 ? 24 ARG B O    5  
ATOM 5397  C CB   . ARG B 1 24 ? -8.513  10.135  -3.128  1.00 0.00 ? 24 ARG B CB   5  
ATOM 5398  C CG   . ARG B 1 24 ? -8.933  10.971  -1.918  1.00 0.00 ? 24 ARG B CG   5  
ATOM 5399  C CD   . ARG B 1 24 ? -7.744  11.747  -1.347  1.00 0.00 ? 24 ARG B CD   5  
ATOM 5400  N NE   . ARG B 1 24 ? -8.202  12.660  -0.276  1.00 0.00 ? 24 ARG B NE   5  
ATOM 5401  C CZ   . ARG B 1 24 ? -7.696  13.893  -0.066  1.00 0.00 ? 24 ARG B CZ   5  
ATOM 5402  N NH1  . ARG B 1 24 ? -6.718  14.340  -0.865  1.00 0.00 ? 24 ARG B NH1  5  
ATOM 5403  N NH2  . ARG B 1 24 ? -8.166  14.661  0.926   1.00 0.00 ? 24 ARG B NH2  5  
ATOM 5404  H H    . ARG B 1 24 ? -8.498  7.555   -2.601  1.00 0.00 ? 24 ARG B H    5  
ATOM 5405  H HA   . ARG B 1 24 ? -10.583 9.539   -3.253  1.00 0.00 ? 24 ARG B HA   5  
ATOM 5406  H HB2  . ARG B 1 24 ? -7.602  9.589   -2.882  1.00 0.00 ? 24 ARG B HB2  5  
ATOM 5407  H HB3  . ARG B 1 24 ? -8.316  10.786  -3.980  1.00 0.00 ? 24 ARG B HB3  5  
ATOM 5408  H HG2  . ARG B 1 24 ? -9.703  11.679  -2.226  1.00 0.00 ? 24 ARG B HG2  5  
ATOM 5409  H HG3  . ARG B 1 24 ? -9.345  10.309  -1.157  1.00 0.00 ? 24 ARG B HG3  5  
ATOM 5410  H HD2  . ARG B 1 24 ? -7.021  11.046  -0.930  1.00 0.00 ? 24 ARG B HD2  5  
ATOM 5411  H HD3  . ARG B 1 24 ? -7.267  12.317  -2.144  1.00 0.00 ? 24 ARG B HD3  5  
ATOM 5412  H HE   . ARG B 1 24 ? -8.948  12.305  0.323   1.00 0.00 ? 24 ARG B HE   5  
ATOM 5413  H HH11 . ARG B 1 24 ? -6.366  13.749  -1.619  1.00 0.00 ? 24 ARG B HH11 5  
ATOM 5414  H HH12 . ARG B 1 24 ? -6.324  15.269  -0.720  1.00 0.00 ? 24 ARG B HH12 5  
ATOM 5415  H HH21 . ARG B 1 24 ? -8.911  14.315  1.531   1.00 0.00 ? 24 ARG B HH21 5  
ATOM 5416  H HH22 . ARG B 1 24 ? -7.778  15.592  1.079   1.00 0.00 ? 24 ARG B HH22 5  
ATOM 5417  N N    . LEU B 1 25 ? -8.808  7.837   -5.427  1.00 0.00 ? 25 LEU B N    5  
ATOM 5418  C CA   . LEU B 1 25 ? -8.675  7.490   -6.831  1.00 0.00 ? 25 LEU B CA   5  
ATOM 5419  C C    . LEU B 1 25 ? -9.887  6.663   -7.265  1.00 0.00 ? 25 LEU B C    5  
ATOM 5420  O O    . LEU B 1 25 ? -10.362 6.860   -8.393  1.00 0.00 ? 25 LEU B O    5  
ATOM 5421  C CB   . LEU B 1 25 ? -7.335  6.798   -7.087  1.00 0.00 ? 25 LEU B CB   5  
ATOM 5422  C CG   . LEU B 1 25 ? -6.095  7.693   -7.033  1.00 0.00 ? 25 LEU B CG   5  
ATOM 5423  C CD1  . LEU B 1 25 ? -4.813  6.857   -7.046  1.00 0.00 ? 25 LEU B CD1  5  
ATOM 5424  C CD2  . LEU B 1 25 ? -6.116  8.727   -8.160  1.00 0.00 ? 25 LEU B CD2  5  
ATOM 5425  H H    . LEU B 1 25 ? -8.317  7.261   -4.743  1.00 0.00 ? 25 LEU B H    5  
ATOM 5426  H HA   . LEU B 1 25 ? -8.670  8.430   -7.383  1.00 0.00 ? 25 LEU B HA   5  
ATOM 5427  H HB2  . LEU B 1 25 ? -7.242  6.018   -6.332  1.00 0.00 ? 25 LEU B HB2  5  
ATOM 5428  H HB3  . LEU B 1 25 ? -7.413  6.332   -8.070  1.00 0.00 ? 25 LEU B HB3  5  
ATOM 5429  H HG   . LEU B 1 25 ? -6.160  8.211   -6.076  1.00 0.00 ? 25 LEU B HG   5  
ATOM 5430  H HD11 . LEU B 1 25 ? -4.773  6.253   -7.951  1.00 0.00 ? 25 LEU B HD11 5  
ATOM 5431  H HD12 . LEU B 1 25 ? -3.954  7.527   -7.006  1.00 0.00 ? 25 LEU B HD12 5  
ATOM 5432  H HD13 . LEU B 1 25 ? -4.791  6.199   -6.178  1.00 0.00 ? 25 LEU B HD13 5  
ATOM 5433  H HD21 . LEU B 1 25 ? -7.007  9.350   -8.077  1.00 0.00 ? 25 LEU B HD21 5  
ATOM 5434  H HD22 . LEU B 1 25 ? -5.222  9.346   -8.091  1.00 0.00 ? 25 LEU B HD22 5  
ATOM 5435  H HD23 . LEU B 1 25 ? -6.125  8.223   -9.127  1.00 0.00 ? 25 LEU B HD23 5  
ATOM 5436  N N    . LYS B 1 26 ? -10.355 5.770   -6.376  1.00 0.00 ? 26 LYS B N    5  
ATOM 5437  C CA   . LYS B 1 26 ? -11.500 4.922   -6.665  1.00 0.00 ? 26 LYS B CA   5  
ATOM 5438  C C    . LYS B 1 26 ? -12.716 5.801   -6.966  1.00 0.00 ? 26 LYS B C    5  
ATOM 5439  O O    . LYS B 1 26 ? -13.625 5.332   -7.665  1.00 0.00 ? 26 LYS B O    5  
ATOM 5440  C CB   . LYS B 1 26 ? -11.729 3.924   -5.530  1.00 0.00 ? 26 LYS B CB   5  
ATOM 5441  C CG   . LYS B 1 26 ? -10.796 2.719   -5.663  1.00 0.00 ? 26 LYS B CG   5  
ATOM 5442  C CD   . LYS B 1 26 ? -11.495 1.560   -6.380  1.00 0.00 ? 26 LYS B CD   5  
ATOM 5443  C CE   . LYS B 1 26 ? -10.916 1.355   -7.781  1.00 0.00 ? 26 LYS B CE   5  
ATOM 5444  N NZ   . LYS B 1 26 ? -10.960 -0.068  -8.153  1.00 0.00 ? 26 LYS B NZ   5  
ATOM 5445  H H    . LYS B 1 26 ? -9.905  5.670   -5.466  1.00 0.00 ? 26 LYS B H    5  
ATOM 5446  H HA   . LYS B 1 26 ? -11.245 4.353   -7.559  1.00 0.00 ? 26 LYS B HA   5  
ATOM 5447  H HB2  . LYS B 1 26 ? -11.534 4.418   -4.578  1.00 0.00 ? 26 LYS B HB2  5  
ATOM 5448  H HB3  . LYS B 1 26 ? -12.768 3.594   -5.552  1.00 0.00 ? 26 LYS B HB3  5  
ATOM 5449  H HG2  . LYS B 1 26 ? -9.917  3.013   -6.238  1.00 0.00 ? 26 LYS B HG2  5  
ATOM 5450  H HG3  . LYS B 1 26 ? -10.481 2.403   -4.669  1.00 0.00 ? 26 LYS B HG3  5  
ATOM 5451  H HD2  . LYS B 1 26 ? -11.354 0.649   -5.800  1.00 0.00 ? 26 LYS B HD2  5  
ATOM 5452  H HD3  . LYS B 1 26 ? -12.560 1.778   -6.446  1.00 0.00 ? 26 LYS B HD3  5  
ATOM 5453  H HE2  . LYS B 1 26 ? -11.503 1.928   -8.499  1.00 0.00 ? 26 LYS B HE2  5  
ATOM 5454  H HE3  . LYS B 1 26 ? -9.886  1.712   -7.800  1.00 0.00 ? 26 LYS B HE3  5  
ATOM 5455  H HZ1  . LYS B 1 26 ? -11.923 -0.403  -8.136  1.00 0.00 ? 26 LYS B HZ1  5  
ATOM 5456  H HZ2  . LYS B 1 26 ? -10.570 -0.180  -9.089  1.00 0.00 ? 26 LYS B HZ2  5  
ATOM 5457  H HZ3  . LYS B 1 26 ? -10.406 -0.618  -7.495  1.00 0.00 ? 26 LYS B HZ3  5  
ATOM 5458  N N    . LYS B 1 27 ? -12.709 7.039   -6.439  1.00 0.00 ? 27 LYS B N    5  
ATOM 5459  C CA   . LYS B 1 27 ? -13.803 7.971   -6.649  1.00 0.00 ? 27 LYS B CA   5  
ATOM 5460  C C    . LYS B 1 27 ? -13.686 8.583   -8.047  1.00 0.00 ? 27 LYS B C    5  
ATOM 5461  O O    . LYS B 1 27 ? -14.657 9.205   -8.501  1.00 0.00 ? 27 LYS B O    5  
ATOM 5462  C CB   . LYS B 1 27 ? -13.846 9.009   -5.526  1.00 0.00 ? 27 LYS B CB   5  
ATOM 5463  C CG   . LYS B 1 27 ? -15.283 9.250   -5.056  1.00 0.00 ? 27 LYS B CG   5  
ATOM 5464  C CD   . LYS B 1 27 ? -15.610 10.745  -5.036  1.00 0.00 ? 27 LYS B CD   5  
ATOM 5465  C CE   . LYS B 1 27 ? -14.707 11.490  -4.051  1.00 0.00 ? 27 LYS B CE   5  
ATOM 5466  N NZ   . LYS B 1 27 ? -15.171 11.283  -2.669  1.00 0.00 ? 27 LYS B NZ   5  
ATOM 5467  H H    . LYS B 1 27 ? -11.918 7.348   -5.873  1.00 0.00 ? 27 LYS B H    5  
ATOM 5468  H HA   . LYS B 1 27 ? -14.722 7.387   -6.593  1.00 0.00 ? 27 LYS B HA   5  
ATOM 5469  H HB2  . LYS B 1 27 ? -13.255 8.646   -4.685  1.00 0.00 ? 27 LYS B HB2  5  
ATOM 5470  H HB3  . LYS B 1 27 ? -13.413 9.941   -5.889  1.00 0.00 ? 27 LYS B HB3  5  
ATOM 5471  H HG2  . LYS B 1 27 ? -15.967 8.747   -5.738  1.00 0.00 ? 27 LYS B HG2  5  
ATOM 5472  H HG3  . LYS B 1 27 ? -15.403 8.830   -4.058  1.00 0.00 ? 27 LYS B HG3  5  
ATOM 5473  H HD2  . LYS B 1 27 ? -15.458 11.153  -6.035  1.00 0.00 ? 27 LYS B HD2  5  
ATOM 5474  H HD3  . LYS B 1 27 ? -16.654 10.874  -4.754  1.00 0.00 ? 27 LYS B HD3  5  
ATOM 5475  H HE2  . LYS B 1 27 ? -13.688 11.114  -4.142  1.00 0.00 ? 27 LYS B HE2  5  
ATOM 5476  H HE3  . LYS B 1 27 ? -14.715 12.553  -4.291  1.00 0.00 ? 27 LYS B HE3  5  
ATOM 5477  H HZ1  . LYS B 1 27 ? -15.163 10.289  -2.444  1.00 0.00 ? 27 LYS B HZ1  5  
ATOM 5478  H HZ2  . LYS B 1 27 ? -14.555 11.789  -2.033  1.00 0.00 ? 27 LYS B HZ2  5  
ATOM 5479  H HZ3  . LYS B 1 27 ? -16.121 11.640  -2.564  1.00 0.00 ? 27 LYS B HZ3  5  
ATOM 5480  N N    . LEU B 1 28 ? -12.519 8.398   -8.689  1.00 0.00 ? 28 LEU B N    5  
ATOM 5481  C CA   . LEU B 1 28 ? -12.281 8.926   -10.021 1.00 0.00 ? 28 LEU B CA   5  
ATOM 5482  C C    . LEU B 1 28 ? -12.260 7.775   -11.028 1.00 0.00 ? 28 LEU B C    5  
ATOM 5483  O O    . LEU B 1 28 ? -12.667 7.990   -12.178 1.00 0.00 ? 28 LEU B O    5  
ATOM 5484  C CB   . LEU B 1 28 ? -11.011 9.781   -10.039 1.00 0.00 ? 28 LEU B CB   5  
ATOM 5485  C CG   . LEU B 1 28 ? -11.143 11.166  -10.672 1.00 0.00 ? 28 LEU B CG   5  
ATOM 5486  C CD1  . LEU B 1 28 ? -11.714 12.174  -9.672  1.00 0.00 ? 28 LEU B CD1  5  
ATOM 5487  C CD2  . LEU B 1 28 ? -9.808  11.633  -11.255 1.00 0.00 ? 28 LEU B CD2  5  
ATOM 5488  H H    . LEU B 1 28 ? -11.768 7.871   -8.241  1.00 0.00 ? 28 LEU B H    5  
ATOM 5489  H HA   . LEU B 1 28 ? -13.121 9.582   -10.249 1.00 0.00 ? 28 LEU B HA   5  
ATOM 5490  H HB2  . LEU B 1 28 ? -10.701 9.893   -8.999  1.00 0.00 ? 28 LEU B HB2  5  
ATOM 5491  H HB3  . LEU B 1 28 ? -10.258 9.199   -10.572 1.00 0.00 ? 28 LEU B HB3  5  
ATOM 5492  H HG   . LEU B 1 28 ? -11.859 11.041  -11.483 1.00 0.00 ? 28 LEU B HG   5  
ATOM 5493  H HD11 . LEU B 1 28 ? -11.063 12.244  -8.801  1.00 0.00 ? 28 LEU B HD11 5  
ATOM 5494  H HD12 . LEU B 1 28 ? -11.795 13.147  -10.155 1.00 0.00 ? 28 LEU B HD12 5  
ATOM 5495  H HD13 . LEU B 1 28 ? -12.705 11.855  -9.349  1.00 0.00 ? 28 LEU B HD13 5  
ATOM 5496  H HD21 . LEU B 1 28 ? -9.467  10.929  -12.014 1.00 0.00 ? 28 LEU B HD21 5  
ATOM 5497  H HD22 . LEU B 1 28 ? -9.939  12.621  -11.696 1.00 0.00 ? 28 LEU B HD22 5  
ATOM 5498  H HD23 . LEU B 1 28 ? -9.058  11.694  -10.466 1.00 0.00 ? 28 LEU B HD23 5  
ATOM 5499  N N    . VAL B 1 29 ? -11.796 6.593   -10.582 1.00 0.00 ? 29 VAL B N    5  
ATOM 5500  C CA   . VAL B 1 29 ? -11.726 5.421   -11.437 1.00 0.00 ? 29 VAL B CA   5  
ATOM 5501  C C    . VAL B 1 29 ? -12.806 4.422   -11.015 1.00 0.00 ? 29 VAL B C    5  
ATOM 5502  O O    . VAL B 1 29 ? -13.718 4.167   -11.815 1.00 0.00 ? 29 VAL B O    5  
ATOM 5503  C CB   . VAL B 1 29 ? -10.316 4.829   -11.398 1.00 0.00 ? 29 VAL B CB   5  
ATOM 5504  C CG1  . VAL B 1 29 ? -10.110 3.829   -12.538 1.00 0.00 ? 29 VAL B CG1  5  
ATOM 5505  C CG2  . VAL B 1 29 ? -9.257  5.932   -11.438 1.00 0.00 ? 29 VAL B CG2  5  
ATOM 5506  H H    . VAL B 1 29 ? -11.480 6.502   -9.616  1.00 0.00 ? 29 VAL B H    5  
ATOM 5507  H HA   . VAL B 1 29 ? -11.925 5.748   -12.458 1.00 0.00 ? 29 VAL B HA   5  
ATOM 5508  H HB   . VAL B 1 29 ? -10.242 4.302   -10.447 1.00 0.00 ? 29 VAL B HB   5  
ATOM 5509  H HG11 . VAL B 1 29 ? -10.259 4.324   -13.498 1.00 0.00 ? 29 VAL B HG11 5  
ATOM 5510  H HG12 . VAL B 1 29 ? -9.097  3.429   -12.481 1.00 0.00 ? 29 VAL B HG12 5  
ATOM 5511  H HG13 . VAL B 1 29 ? -10.822 3.010   -12.447 1.00 0.00 ? 29 VAL B HG13 5  
ATOM 5512  H HG21 . VAL B 1 29 ? -9.383  6.600   -10.585 1.00 0.00 ? 29 VAL B HG21 5  
ATOM 5513  H HG22 . VAL B 1 29 ? -8.267  5.476   -11.409 1.00 0.00 ? 29 VAL B HG22 5  
ATOM 5514  H HG23 . VAL B 1 29 ? -9.355  6.509   -12.357 1.00 0.00 ? 29 VAL B HG23 5  
ATOM 5515  N N    . GLY B 1 30 ? -12.683 3.884   -9.788  1.00 0.00 ? 30 GLY B N    5  
ATOM 5516  C CA   . GLY B 1 30 ? -13.641 2.924   -9.269  1.00 0.00 ? 30 GLY B CA   5  
ATOM 5517  C C    . GLY B 1 30 ? -15.051 3.509   -9.372  1.00 0.00 ? 30 GLY B C    5  
ATOM 5518  O O    . GLY B 1 30 ? -16.016 2.764   -9.152  1.00 0.00 ? 30 GLY B O    5  
ATOM 5519  H H    . GLY B 1 30 ? -11.898 4.149   -9.192  1.00 0.00 ? 30 GLY B H    5  
ATOM 5520  H HA2  . GLY B 1 30 ? -13.594 2.005   -9.852  1.00 0.00 ? 30 GLY B HA2  5  
ATOM 5521  H HA3  . GLY B 1 30 ? -13.408 2.695   -8.229  1.00 0.00 ? 30 GLY B HA3  5  
ATOM 5522  N N    . GLU B 1 31 ? -15.140 4.811   -9.699  1.00 0.00 ? 31 GLU B N    5  
ATOM 5523  C CA   . GLU B 1 31 ? -16.420 5.486   -9.829  1.00 0.00 ? 31 GLU B CA   5  
ATOM 5524  C C    . GLU B 1 31 ? -17.261 4.774   -10.889 1.00 0.00 ? 31 GLU B C    5  
ATOM 5525  O O    . GLU B 1 31 ? -16.873 4.798   -12.066 1.00 0.00 ? 31 GLU B O    5  
ATOM 5526  C CB   . GLU B 1 31 ? -16.242 6.966   -10.174 1.00 0.00 ? 31 GLU B CB   5  
ATOM 5527  C CG   . GLU B 1 31 ? -17.127 7.846   -9.288  1.00 0.00 ? 31 GLU B CG   5  
ATOM 5528  C CD   . GLU B 1 31 ? -17.357 9.215   -9.931  1.00 0.00 ? 31 GLU B CD   5  
ATOM 5529  O OE1  . GLU B 1 31 ? -17.652 9.294   -11.133 1.00 0.00 ? 31 GLU B OE1  5  
ATOM 5530  O OE2  . GLU B 1 31 ? -17.221 10.220  -9.135  1.00 0.00 ? 31 GLU B OE2  5  
ATOM 5531  H H    . GLU B 1 31 ? -14.293 5.355   -9.864  1.00 0.00 ? 31 GLU B H    5  
ATOM 5532  H HA   . GLU B 1 31 ? -16.920 5.405   -8.864  1.00 0.00 ? 31 GLU B HA   5  
ATOM 5533  H HB2  . GLU B 1 31 ? -15.198 7.242   -10.019 1.00 0.00 ? 31 GLU B HB2  5  
ATOM 5534  H HB3  . GLU B 1 31 ? -16.498 7.119   -11.222 1.00 0.00 ? 31 GLU B HB3  5  
ATOM 5535  H HG2  . GLU B 1 31 ? -18.089 7.353   -9.148  1.00 0.00 ? 31 GLU B HG2  5  
ATOM 5536  H HG3  . GLU B 1 31 ? -16.646 7.967   -8.318  1.00 0.00 ? 31 GLU B HG3  5  
ATOM 5537  N N    . ARG B 1 32 ? -18.381 4.164   -10.459 1.00 0.00 ? 32 ARG B N    5  
ATOM 5538  C CA   . ARG B 1 32 ? -19.267 3.453   -11.366 1.00 0.00 ? 32 ARG B CA   5  
ATOM 5539  C C    . ARG B 1 32 ? -19.481 4.293   -12.627 1.00 0.00 ? 32 ARG B C    5  
ATOM 5540  O O    . ARG B 1 32 ? -19.481 5.522   -12.564 1.00 0.00 ? 32 ARG B O    5  
ATOM 5541  C CB   . ARG B 1 32 ? -20.623 3.165   -10.718 1.00 0.00 ? 32 ARG B CB   5  
ATOM 5542  C CG   . ARG B 1 32 ? -20.492 3.058   -9.197  1.00 0.00 ? 32 ARG B CG   5  
ATOM 5543  C CD   . ARG B 1 32 ? -19.474 1.983   -8.809  1.00 0.00 ? 32 ARG B CD   5  
ATOM 5544  N NE   . ARG B 1 32 ? -20.118 0.650   -8.815  1.00 0.00 ? 32 ARG B NE   5  
ATOM 5545  C CZ   . ARG B 1 32 ? -20.425 -0.047  -7.701  1.00 0.00 ? 32 ARG B CZ   5  
ATOM 5546  N NH1  . ARG B 1 32 ? -20.139 0.482   -6.504  1.00 0.00 ? 32 ARG B NH1  5  
ATOM 5547  N NH2  . ARG B 1 32 ? -21.008 -1.251  -7.792  1.00 0.00 ? 32 ARG B NH2  5  
ATOM 5548  H H    . ARG B 1 32 ? -18.630 4.192   -9.471  1.00 0.00 ? 32 ARG B H    5  
ATOM 5549  H HA   . ARG B 1 32 ? -18.782 2.517   -11.641 1.00 0.00 ? 32 ARG B HA   5  
ATOM 5550  H HB2  . ARG B 1 32 ? -21.310 3.975   -10.959 1.00 0.00 ? 32 ARG B HB2  5  
ATOM 5551  H HB3  . ARG B 1 32 ? -21.017 2.233   -11.123 1.00 0.00 ? 32 ARG B HB3  5  
ATOM 5552  H HG2  . ARG B 1 32 ? -20.162 4.019   -8.802  1.00 0.00 ? 32 ARG B HG2  5  
ATOM 5553  H HG3  . ARG B 1 32 ? -21.468 2.817   -8.775  1.00 0.00 ? 32 ARG B HG3  5  
ATOM 5554  H HD2  . ARG B 1 32 ? -18.653 1.985   -9.526  1.00 0.00 ? 32 ARG B HD2  5  
ATOM 5555  H HD3  . ARG B 1 32 ? -19.080 2.200   -7.816  1.00 0.00 ? 32 ARG B HD3  5  
ATOM 5556  H HE   . ARG B 1 32 ? -20.329 0.263   -9.734  1.00 0.00 ? 32 ARG B HE   5  
ATOM 5557  H HH11 . ARG B 1 32 ? -19.695 1.397   -6.444  1.00 0.00 ? 32 ARG B HH11 5  
ATOM 5558  H HH12 . ARG B 1 32 ? -20.365 -0.032  -5.652  1.00 0.00 ? 32 ARG B HH12 5  
ATOM 5559  H HH21 . ARG B 1 32 ? -21.223 -1.646  -8.707  1.00 0.00 ? 32 ARG B HH21 5  
ATOM 5560  H HH22 . ARG B 1 32 ? -21.238 -1.771  -6.945  1.00 0.00 ? 32 ARG B HH22 5  
ATOM 5561  N N    . MET A 1 1  ? 8.565   -11.078 17.018  1.00 0.00 ? 1  MET A N    6  
ATOM 5562  C CA   . MET A 1 1  ? 9.250   -10.985 15.740  1.00 0.00 ? 1  MET A CA   6  
ATOM 5563  C C    . MET A 1 1  ? 8.692   -12.045 14.788  1.00 0.00 ? 1  MET A C    6  
ATOM 5564  O O    . MET A 1 1  ? 8.508   -11.735 13.602  1.00 0.00 ? 1  MET A O    6  
ATOM 5565  C CB   . MET A 1 1  ? 10.753  -11.205 15.924  1.00 0.00 ? 1  MET A CB   6  
ATOM 5566  C CG   . MET A 1 1  ? 11.556  -10.353 14.938  1.00 0.00 ? 1  MET A CG   6  
ATOM 5567  S SD   . MET A 1 1  ? 13.110  -11.193 14.514  1.00 0.00 ? 1  MET A SD   6  
ATOM 5568  C CE   . MET A 1 1  ? 12.514  -12.330 13.228  1.00 0.00 ? 1  MET A CE   6  
ATOM 5569  H H    . MET A 1 1  ? 9.129   -11.040 17.867  1.00 0.00 ? 1  MET A H    6  
ATOM 5570  H HA   . MET A 1 1  ? 9.073   -9.998  15.314  1.00 0.00 ? 1  MET A HA   6  
ATOM 5571  H HB2  . MET A 1 1  ? 11.030  -10.927 16.940  1.00 0.00 ? 1  MET A HB2  6  
ATOM 5572  H HB3  . MET A 1 1  ? 10.977  -12.260 15.771  1.00 0.00 ? 1  MET A HB3  6  
ATOM 5573  H HG2  . MET A 1 1  ? 10.974  -10.203 14.029  1.00 0.00 ? 1  MET A HG2  6  
ATOM 5574  H HG3  . MET A 1 1  ? 11.768  -9.383  15.387  1.00 0.00 ? 1  MET A HG3  6  
ATOM 5575  H HE1  . MET A 1 1  ? 12.071  -11.764 12.408  1.00 0.00 ? 1  MET A HE1  6  
ATOM 5576  H HE2  . MET A 1 1  ? 13.352  -12.922 12.861  1.00 0.00 ? 1  MET A HE2  6  
ATOM 5577  H HE3  . MET A 1 1  ? 11.761  -12.999 13.644  1.00 0.00 ? 1  MET A HE3  6  
ATOM 5578  N N    . ASP A 1 2  ? 8.436   -13.255 15.317  1.00 0.00 ? 2  ASP A N    6  
ATOM 5579  C CA   . ASP A 1 2  ? 7.905   -14.348 14.521  1.00 0.00 ? 2  ASP A CA   6  
ATOM 5580  C C    . ASP A 1 2  ? 6.664   -13.866 13.767  1.00 0.00 ? 2  ASP A C    6  
ATOM 5581  O O    . ASP A 1 2  ? 6.453   -14.314 12.631  1.00 0.00 ? 2  ASP A O    6  
ATOM 5582  C CB   . ASP A 1 2  ? 7.493   -15.525 15.407  1.00 0.00 ? 2  ASP A CB   6  
ATOM 5583  C CG   . ASP A 1 2  ? 8.346   -15.720 16.661  1.00 0.00 ? 2  ASP A CG   6  
ATOM 5584  O OD1  . ASP A 1 2  ? 9.568   -16.071 16.440  1.00 0.00 ? 2  ASP A OD1  6  
ATOM 5585  O OD2  . ASP A 1 2  ? 7.868   -15.547 17.792  1.00 0.00 ? 2  ASP A OD2  6  
ATOM 5586  H H    . ASP A 1 2  ? 8.617   -13.428 16.307  1.00 0.00 ? 2  ASP A H    6  
ATOM 5587  H HA   . ASP A 1 2  ? 8.660   -14.661 13.799  1.00 0.00 ? 2  ASP A HA   6  
ATOM 5588  H HB2  . ASP A 1 2  ? 6.458   -15.350 15.705  1.00 0.00 ? 2  ASP A HB2  6  
ATOM 5589  H HB3  . ASP A 1 2  ? 7.537   -16.418 14.783  1.00 0.00 ? 2  ASP A HB3  6  
ATOM 5590  N N    . ALA A 1 3  ? 5.880   -12.977 14.403  1.00 0.00 ? 3  ALA A N    6  
ATOM 5591  C CA   . ALA A 1 3  ? 4.672   -12.442 13.796  1.00 0.00 ? 3  ALA A CA   6  
ATOM 5592  C C    . ALA A 1 3  ? 5.016   -11.161 13.033  1.00 0.00 ? 3  ALA A C    6  
ATOM 5593  O O    . ALA A 1 3  ? 4.186   -10.714 12.228  1.00 0.00 ? 3  ALA A O    6  
ATOM 5594  C CB   . ALA A 1 3  ? 3.682   -12.037 14.890  1.00 0.00 ? 3  ALA A CB   6  
ATOM 5595  H H    . ALA A 1 3  ? 6.127   -12.659 15.340  1.00 0.00 ? 3  ALA A H    6  
ATOM 5596  H HA   . ALA A 1 3  ? 4.228   -13.158 13.106  1.00 0.00 ? 3  ALA A HA   6  
ATOM 5597  H HB1  . ALA A 1 3  ? 3.442   -12.912 15.493  1.00 0.00 ? 3  ALA A HB1  6  
ATOM 5598  H HB2  . ALA A 1 3  ? 4.127   -11.276 15.531  1.00 0.00 ? 3  ALA A HB2  6  
ATOM 5599  H HB3  . ALA A 1 3  ? 2.775   -11.634 14.440  1.00 0.00 ? 3  ALA A HB3  6  
ATOM 5600  N N    . ILE A 1 4  ? 6.212   -10.606 13.294  1.00 0.00 ? 4  ILE A N    6  
ATOM 5601  C CA   . ILE A 1 4  ? 6.658   -9.389  12.636  1.00 0.00 ? 4  ILE A CA   6  
ATOM 5602  C C    . ILE A 1 4  ? 7.145   -9.727  11.226  1.00 0.00 ? 4  ILE A C    6  
ATOM 5603  O O    . ILE A 1 4  ? 6.778   -9.005  10.287  1.00 0.00 ? 4  ILE A O    6  
ATOM 5604  C CB   . ILE A 1 4  ? 7.702   -8.669  13.492  1.00 0.00 ? 4  ILE A CB   6  
ATOM 5605  C CG1  . ILE A 1 4  ? 7.124   -8.284  14.855  1.00 0.00 ? 4  ILE A CG1  6  
ATOM 5606  C CG2  . ILE A 1 4  ? 8.278   -7.460  12.751  1.00 0.00 ? 4  ILE A CG2  6  
ATOM 5607  C CD1  . ILE A 1 4  ? 7.503   -6.849  15.226  1.00 0.00 ? 4  ILE A CD1  6  
ATOM 5608  H H    . ILE A 1 4  ? 6.838   -11.040 13.972  1.00 0.00 ? 4  ILE A H    6  
ATOM 5609  H HA   . ILE A 1 4  ? 5.786   -8.740  12.565  1.00 0.00 ? 4  ILE A HA   6  
ATOM 5610  H HB   . ILE A 1 4  ? 8.501   -9.396  13.637  1.00 0.00 ? 4  ILE A HB   6  
ATOM 5611  H HG12 . ILE A 1 4  ? 6.037   -8.365  14.814  1.00 0.00 ? 4  ILE A HG12 6  
ATOM 5612  H HG13 . ILE A 1 4  ? 7.502   -8.976  15.607  1.00 0.00 ? 4  ILE A HG13 6  
ATOM 5613  H HG21 . ILE A 1 4  ? 7.479   -6.761  12.505  1.00 0.00 ? 4  ILE A HG21 6  
ATOM 5614  H HG22 . ILE A 1 4  ? 9.016   -6.973  13.389  1.00 0.00 ? 4  ILE A HG22 6  
ATOM 5615  H HG23 . ILE A 1 4  ? 8.762   -7.784  11.831  1.00 0.00 ? 4  ILE A HG23 6  
ATOM 5616  H HD11 . ILE A 1 4  ? 7.124   -6.158  14.474  1.00 0.00 ? 4  ILE A HD11 6  
ATOM 5617  H HD12 . ILE A 1 4  ? 7.076   -6.611  16.201  1.00 0.00 ? 4  ILE A HD12 6  
ATOM 5618  H HD13 . ILE A 1 4  ? 8.588   -6.755  15.283  1.00 0.00 ? 4  ILE A HD13 6  
ATOM 5619  N N    . LYS A 1 5  ? 7.948   -10.799 11.107  1.00 0.00 ? 5  LYS A N    6  
ATOM 5620  C CA   . LYS A 1 5  ? 8.478   -11.225 9.823   1.00 0.00 ? 5  LYS A CA   6  
ATOM 5621  C C    . LYS A 1 5  ? 7.326   -11.404 8.833   1.00 0.00 ? 5  LYS A C    6  
ATOM 5622  O O    . LYS A 1 5  ? 7.514   -11.100 7.646   1.00 0.00 ? 5  LYS A O    6  
ATOM 5623  C CB   . LYS A 1 5  ? 9.346   -12.475 9.989   1.00 0.00 ? 5  LYS A CB   6  
ATOM 5624  C CG   . LYS A 1 5  ? 8.939   -13.262 11.235  1.00 0.00 ? 5  LYS A CG   6  
ATOM 5625  C CD   . LYS A 1 5  ? 9.153   -14.763 11.030  1.00 0.00 ? 5  LYS A CD   6  
ATOM 5626  C CE   . LYS A 1 5  ? 10.551  -15.185 11.487  1.00 0.00 ? 5  LYS A CE   6  
ATOM 5627  N NZ   . LYS A 1 5  ? 11.008  -16.362 10.730  1.00 0.00 ? 5  LYS A NZ   6  
ATOM 5628  H H    . LYS A 1 5  ? 8.202   -11.341 11.932  1.00 0.00 ? 5  LYS A H    6  
ATOM 5629  H HA   . LYS A 1 5  ? 9.125   -10.420 9.472   1.00 0.00 ? 5  LYS A HA   6  
ATOM 5630  H HB2  . LYS A 1 5  ? 9.222   -13.110 9.111   1.00 0.00 ? 5  LYS A HB2  6  
ATOM 5631  H HB3  . LYS A 1 5  ? 10.390  -12.172 10.063  1.00 0.00 ? 5  LYS A HB3  6  
ATOM 5632  H HG2  . LYS A 1 5  ? 9.546   -12.929 12.077  1.00 0.00 ? 5  LYS A HG2  6  
ATOM 5633  H HG3  . LYS A 1 5  ? 7.890   -13.063 11.453  1.00 0.00 ? 5  LYS A HG3  6  
ATOM 5634  H HD2  . LYS A 1 5  ? 8.410   -15.309 11.610  1.00 0.00 ? 5  LYS A HD2  6  
ATOM 5635  H HD3  . LYS A 1 5  ? 9.021   -14.998 9.974   1.00 0.00 ? 5  LYS A HD3  6  
ATOM 5636  H HE2  . LYS A 1 5  ? 11.247  -14.363 11.317  1.00 0.00 ? 5  LYS A HE2  6  
ATOM 5637  H HE3  . LYS A 1 5  ? 10.526  -15.415 12.552  1.00 0.00 ? 5  LYS A HE3  6  
ATOM 5638  H HZ1  . LYS A 1 5  ? 11.032  -16.148 9.733   1.00 0.00 ? 5  LYS A HZ1  6  
ATOM 5639  H HZ2  . LYS A 1 5  ? 11.940  -16.623 11.053  1.00 0.00 ? 5  LYS A HZ2  6  
ATOM 5640  H HZ3  . LYS A 1 5  ? 10.371  -17.144 10.886  1.00 0.00 ? 5  LYS A HZ3  6  
ATOM 5641  N N    . LYS A 1 6  ? 6.173   -11.885 9.332   1.00 0.00 ? 6  LYS A N    6  
ATOM 5642  C CA   . LYS A 1 6  ? 5.003   -12.102 8.498   1.00 0.00 ? 6  LYS A CA   6  
ATOM 5643  C C    . LYS A 1 6  ? 4.196   -10.805 8.413   1.00 0.00 ? 6  LYS A C    6  
ATOM 5644  O O    . LYS A 1 6  ? 3.565   -10.569 7.371   1.00 0.00 ? 6  LYS A O    6  
ATOM 5645  C CB   . LYS A 1 6  ? 4.195   -13.296 9.007   1.00 0.00 ? 6  LYS A CB   6  
ATOM 5646  C CG   . LYS A 1 6  ? 5.113   -14.364 9.605   1.00 0.00 ? 6  LYS A CG   6  
ATOM 5647  C CD   . LYS A 1 6  ? 4.328   -15.633 9.947   1.00 0.00 ? 6  LYS A CD   6  
ATOM 5648  C CE   . LYS A 1 6  ? 4.826   -16.824 9.128   1.00 0.00 ? 6  LYS A CE   6  
ATOM 5649  N NZ   . LYS A 1 6  ? 4.256   -18.079 9.645   1.00 0.00 ? 6  LYS A NZ   6  
ATOM 5650  H H    . LYS A 1 6  ? 6.101   -12.110 10.324  1.00 0.00 ? 6  LYS A H    6  
ATOM 5651  H HA   . LYS A 1 6  ? 5.373   -12.354 7.504   1.00 0.00 ? 6  LYS A HA   6  
ATOM 5652  H HB2  . LYS A 1 6  ? 3.502   -12.953 9.775   1.00 0.00 ? 6  LYS A HB2  6  
ATOM 5653  H HB3  . LYS A 1 6  ? 3.625   -13.717 8.178   1.00 0.00 ? 6  LYS A HB3  6  
ATOM 5654  H HG2  . LYS A 1 6  ? 5.887   -14.612 8.879   1.00 0.00 ? 6  LYS A HG2  6  
ATOM 5655  H HG3  . LYS A 1 6  ? 5.583   -13.964 10.503  1.00 0.00 ? 6  LYS A HG3  6  
ATOM 5656  H HD2  . LYS A 1 6  ? 4.457   -15.852 11.007  1.00 0.00 ? 6  LYS A HD2  6  
ATOM 5657  H HD3  . LYS A 1 6  ? 3.271   -15.459 9.747   1.00 0.00 ? 6  LYS A HD3  6  
ATOM 5658  H HE2  . LYS A 1 6  ? 4.521   -16.697 8.089   1.00 0.00 ? 6  LYS A HE2  6  
ATOM 5659  H HE3  . LYS A 1 6  ? 5.914   -16.862 9.176   1.00 0.00 ? 6  LYS A HE3  6  
ATOM 5660  H HZ1  . LYS A 1 6  ? 3.239   -18.044 9.599   1.00 0.00 ? 6  LYS A HZ1  6  
ATOM 5661  H HZ2  . LYS A 1 6  ? 4.602   -18.857 9.082   1.00 0.00 ? 6  LYS A HZ2  6  
ATOM 5662  H HZ3  . LYS A 1 6  ? 4.541   -18.217 10.614  1.00 0.00 ? 6  LYS A HZ3  6  
ATOM 5663  N N    . LYS A 1 7  ? 4.230   -10.002 9.491   1.00 0.00 ? 7  LYS A N    6  
ATOM 5664  C CA   . LYS A 1 7  ? 3.506   -8.742  9.538   1.00 0.00 ? 7  LYS A CA   6  
ATOM 5665  C C    . LYS A 1 7  ? 3.849   -7.916  8.296   1.00 0.00 ? 7  LYS A C    6  
ATOM 5666  O O    . LYS A 1 7  ? 2.927   -7.357  7.686   1.00 0.00 ? 7  LYS A O    6  
ATOM 5667  C CB   . LYS A 1 7  ? 3.781   -8.015  10.855  1.00 0.00 ? 7  LYS A CB   6  
ATOM 5668  C CG   . LYS A 1 7  ? 3.038   -6.679  10.909  1.00 0.00 ? 7  LYS A CG   6  
ATOM 5669  C CD   . LYS A 1 7  ? 1.587   -6.840  10.451  1.00 0.00 ? 7  LYS A CD   6  
ATOM 5670  C CE   . LYS A 1 7  ? 0.691   -5.774  11.085  1.00 0.00 ? 7  LYS A CE   6  
ATOM 5671  N NZ   . LYS A 1 7  ? -0.728  -6.081  10.841  1.00 0.00 ? 7  LYS A NZ   6  
ATOM 5672  H H    . LYS A 1 7  ? 4.776   -10.271 10.310  1.00 0.00 ? 7  LYS A H    6  
ATOM 5673  H HA   . LYS A 1 7  ? 2.446   -8.993  9.515   1.00 0.00 ? 7  LYS A HA   6  
ATOM 5674  H HB2  . LYS A 1 7  ? 3.445   -8.641  11.682  1.00 0.00 ? 7  LYS A HB2  6  
ATOM 5675  H HB3  . LYS A 1 7  ? 4.854   -7.848  10.950  1.00 0.00 ? 7  LYS A HB3  6  
ATOM 5676  H HG2  . LYS A 1 7  ? 3.048   -6.309  11.934  1.00 0.00 ? 7  LYS A HG2  6  
ATOM 5677  H HG3  . LYS A 1 7  ? 3.553   -5.963  10.269  1.00 0.00 ? 7  LYS A HG3  6  
ATOM 5678  H HD2  . LYS A 1 7  ? 1.545   -6.739  9.366   1.00 0.00 ? 7  LYS A HD2  6  
ATOM 5679  H HD3  . LYS A 1 7  ? 1.237   -7.834  10.729  1.00 0.00 ? 7  LYS A HD3  6  
ATOM 5680  H HE2  . LYS A 1 7  ? 0.868   -5.750  12.161  1.00 0.00 ? 7  LYS A HE2  6  
ATOM 5681  H HE3  . LYS A 1 7  ? 0.939   -4.800  10.663  1.00 0.00 ? 7  LYS A HE3  6  
ATOM 5682  H HZ1  . LYS A 1 7  ? -0.959  -6.992  11.236  1.00 0.00 ? 7  LYS A HZ1  6  
ATOM 5683  H HZ2  . LYS A 1 7  ? -1.304  -5.358  11.272  1.00 0.00 ? 7  LYS A HZ2  6  
ATOM 5684  H HZ3  . LYS A 1 7  ? -0.912  -6.097  9.837   1.00 0.00 ? 7  LYS A HZ3  6  
ATOM 5685  N N    . MET A 1 8  ? 5.149   -7.857  7.952   1.00 0.00 ? 8  MET A N    6  
ATOM 5686  C CA   . MET A 1 8  ? 5.605   -7.105  6.795   1.00 0.00 ? 8  MET A CA   6  
ATOM 5687  C C    . MET A 1 8  ? 5.245   -7.872  5.521   1.00 0.00 ? 8  MET A C    6  
ATOM 5688  O O    . MET A 1 8  ? 5.165   -7.241  4.457   1.00 0.00 ? 8  MET A O    6  
ATOM 5689  C CB   . MET A 1 8  ? 7.120   -6.901  6.858   1.00 0.00 ? 8  MET A CB   6  
ATOM 5690  C CG   . MET A 1 8  ? 7.851   -8.240  6.964   1.00 0.00 ? 8  MET A CG   6  
ATOM 5691  S SD   . MET A 1 8  ? 9.457   -8.141  6.120   1.00 0.00 ? 8  MET A SD   6  
ATOM 5692  C CE   . MET A 1 8  ? 10.552  -7.910  7.553   1.00 0.00 ? 8  MET A CE   6  
ATOM 5693  H H    . MET A 1 8  ? 5.847   -8.348  8.511   1.00 0.00 ? 8  MET A H    6  
ATOM 5694  H HA   . MET A 1 8  ? 5.104   -6.138  6.781   1.00 0.00 ? 8  MET A HA   6  
ATOM 5695  H HB2  . MET A 1 8  ? 7.446   -6.389  5.952   1.00 0.00 ? 8  MET A HB2  6  
ATOM 5696  H HB3  . MET A 1 8  ? 7.357   -6.278  7.720   1.00 0.00 ? 8  MET A HB3  6  
ATOM 5697  H HG2  . MET A 1 8  ? 8.016   -8.481  8.014   1.00 0.00 ? 8  MET A HG2  6  
ATOM 5698  H HG3  . MET A 1 8  ? 7.242   -9.022  6.512   1.00 0.00 ? 8  MET A HG3  6  
ATOM 5699  H HE1  . MET A 1 8  ? 10.454  -8.754  8.235   1.00 0.00 ? 8  MET A HE1  6  
ATOM 5700  H HE2  . MET A 1 8  ? 11.581  -7.830  7.203   1.00 0.00 ? 8  MET A HE2  6  
ATOM 5701  H HE3  . MET A 1 8  ? 10.285  -6.994  8.081   1.00 0.00 ? 8  MET A HE3  6  
ATOM 5702  N N    . GLN A 1 9  ? 5.041   -9.195  5.652   1.00 0.00 ? 9  GLN A N    6  
ATOM 5703  C CA   . GLN A 1 9  ? 4.693   -10.036 4.518   1.00 0.00 ? 9  GLN A CA   6  
ATOM 5704  C C    . GLN A 1 9  ? 3.246   -9.757  4.106   1.00 0.00 ? 9  GLN A C    6  
ATOM 5705  O O    . GLN A 1 9  ? 2.939   -9.883  2.912   1.00 0.00 ? 9  GLN A O    6  
ATOM 5706  C CB   . GLN A 1 9  ? 4.897   -11.519 4.836   1.00 0.00 ? 9  GLN A CB   6  
ATOM 5707  C CG   . GLN A 1 9  ? 6.371   -11.909 4.709   1.00 0.00 ? 9  GLN A CG   6  
ATOM 5708  C CD   . GLN A 1 9  ? 6.518   -13.399 4.398   1.00 0.00 ? 9  GLN A CD   6  
ATOM 5709  O OE1  . GLN A 1 9  ? 6.035   -13.902 3.396   1.00 0.00 ? 9  GLN A OE1  6  
ATOM 5710  N NE2  . GLN A 1 9  ? 7.212   -14.077 5.309   1.00 0.00 ? 9  GLN A NE2  6  
ATOM 5711  H H    . GLN A 1 9  ? 5.128   -9.636  6.567   1.00 0.00 ? 9  GLN A H    6  
ATOM 5712  H HA   . GLN A 1 9  ? 5.356   -9.755  3.699   1.00 0.00 ? 9  GLN A HA   6  
ATOM 5713  H HB2  . GLN A 1 9  ? 4.565   -11.711 5.856   1.00 0.00 ? 9  GLN A HB2  6  
ATOM 5714  H HB3  . GLN A 1 9  ? 4.295   -12.113 4.149   1.00 0.00 ? 9  GLN A HB3  6  
ATOM 5715  H HG2  . GLN A 1 9  ? 6.823   -11.331 3.903   1.00 0.00 ? 9  GLN A HG2  6  
ATOM 5716  H HG3  . GLN A 1 9  ? 6.881   -11.673 5.644   1.00 0.00 ? 9  GLN A HG3  6  
ATOM 5717  H HE21 . GLN A 1 9  ? 7.589   -13.595 6.125   1.00 0.00 ? 9  GLN A HE21 6  
ATOM 5718  H HE22 . GLN A 1 9  ? 7.366   -15.078 5.192   1.00 0.00 ? 9  GLN A HE22 6  
ATOM 5719  N N    . MET A 1 10 ? 2.402   -9.390  5.086   1.00 0.00 ? 10 MET A N    6  
ATOM 5720  C CA   . MET A 1 10 ? 1.002   -9.097  4.826   1.00 0.00 ? 10 MET A CA   6  
ATOM 5721  C C    . MET A 1 10 ? 0.878   -7.678  4.268   1.00 0.00 ? 10 MET A C    6  
ATOM 5722  O O    . MET A 1 10 ? 0.006   -7.453  3.416   1.00 0.00 ? 10 MET A O    6  
ATOM 5723  C CB   . MET A 1 10 ? 0.186   -9.213  6.114   1.00 0.00 ? 10 MET A CB   6  
ATOM 5724  C CG   . MET A 1 10 ? 0.998   -9.892  7.219   1.00 0.00 ? 10 MET A CG   6  
ATOM 5725  S SD   . MET A 1 10 ? -0.044  -10.155 8.684   1.00 0.00 ? 10 MET A SD   6  
ATOM 5726  C CE   . MET A 1 10 ? -1.687  -10.146 7.910   1.00 0.00 ? 10 MET A CE   6  
ATOM 5727  H H    . MET A 1 10 ? 2.737   -9.310  6.045   1.00 0.00 ? 10 MET A H    6  
ATOM 5728  H HA   . MET A 1 10 ? 0.625   -9.804  4.086   1.00 0.00 ? 10 MET A HA   6  
ATOM 5729  H HB2  . MET A 1 10 ? -0.097  -8.214  6.445   1.00 0.00 ? 10 MET A HB2  6  
ATOM 5730  H HB3  . MET A 1 10 ? -0.717  -9.788  5.910   1.00 0.00 ? 10 MET A HB3  6  
ATOM 5731  H HG2  . MET A 1 10 ? 1.359   -10.856 6.862   1.00 0.00 ? 10 MET A HG2  6  
ATOM 5732  H HG3  . MET A 1 10 ? 1.852   -9.266  7.477   1.00 0.00 ? 10 MET A HG3  6  
ATOM 5733  H HE1  . MET A 1 10 ? -1.752  -10.938 7.164   1.00 0.00 ? 10 MET A HE1  6  
ATOM 5734  H HE2  . MET A 1 10 ? -2.444  -10.296 8.679   1.00 0.00 ? 10 MET A HE2  6  
ATOM 5735  H HE3  . MET A 1 10 ? -1.862  -9.187  7.422   1.00 0.00 ? 10 MET A HE3  6  
ATOM 5736  N N    . LEU A 1 11 ? 1.736   -6.762  4.752   1.00 0.00 ? 11 LEU A N    6  
ATOM 5737  C CA   . LEU A 1 11 ? 1.722   -5.381  4.305   1.00 0.00 ? 11 LEU A CA   6  
ATOM 5738  C C    . LEU A 1 11 ? 2.399   -5.285  2.937   1.00 0.00 ? 11 LEU A C    6  
ATOM 5739  O O    . LEU A 1 11 ? 2.064   -4.365  2.176   1.00 0.00 ? 11 LEU A O    6  
ATOM 5740  C CB   . LEU A 1 11 ? 2.344   -4.468  5.365   1.00 0.00 ? 11 LEU A CB   6  
ATOM 5741  C CG   . LEU A 1 11 ? 1.737   -4.556  6.766   1.00 0.00 ? 11 LEU A CG   6  
ATOM 5742  C CD1  . LEU A 1 11 ? 2.739   -4.095  7.827   1.00 0.00 ? 11 LEU A CD1  6  
ATOM 5743  C CD2  . LEU A 1 11 ? 0.422   -3.778  6.843   1.00 0.00 ? 11 LEU A CD2  6  
ATOM 5744  H H    . LEU A 1 11 ? 2.425   -7.031  5.456   1.00 0.00 ? 11 LEU A H    6  
ATOM 5745  H HA   . LEU A 1 11 ? 0.674   -5.099  4.204   1.00 0.00 ? 11 LEU A HA   6  
ATOM 5746  H HB2  . LEU A 1 11 ? 3.401   -4.735  5.418   1.00 0.00 ? 11 LEU A HB2  6  
ATOM 5747  H HB3  . LEU A 1 11 ? 2.254   -3.452  4.983   1.00 0.00 ? 11 LEU A HB3  6  
ATOM 5748  H HG   . LEU A 1 11 ? 1.533   -5.615  6.921   1.00 0.00 ? 11 LEU A HG   6  
ATOM 5749  H HD11 . LEU A 1 11 ? 3.037   -3.065  7.635   1.00 0.00 ? 11 LEU A HD11 6  
ATOM 5750  H HD12 . LEU A 1 11 ? 2.274   -4.171  8.810   1.00 0.00 ? 11 LEU A HD12 6  
ATOM 5751  H HD13 . LEU A 1 11 ? 3.624   -4.731  7.803   1.00 0.00 ? 11 LEU A HD13 6  
ATOM 5752  H HD21 . LEU A 1 11 ? -0.291  -4.180  6.124   1.00 0.00 ? 11 LEU A HD21 6  
ATOM 5753  H HD22 . LEU A 1 11 ? 0.019   -3.862  7.852   1.00 0.00 ? 11 LEU A HD22 6  
ATOM 5754  H HD23 . LEU A 1 11 ? 0.599   -2.726  6.618   1.00 0.00 ? 11 LEU A HD23 6  
ATOM 5755  N N    . LYS A 1 12 ? 3.323   -6.220  2.654   1.00 0.00 ? 12 LYS A N    6  
ATOM 5756  C CA   . LYS A 1 12 ? 4.038   -6.240  1.390   1.00 0.00 ? 12 LYS A CA   6  
ATOM 5757  C C    . LYS A 1 12 ? 3.113   -6.775  0.294   1.00 0.00 ? 12 LYS A C    6  
ATOM 5758  O O    . LYS A 1 12 ? 3.192   -6.277  -0.839  1.00 0.00 ? 12 LYS A O    6  
ATOM 5759  C CB   . LYS A 1 12 ? 5.346   -7.023  1.526   1.00 0.00 ? 12 LYS A CB   6  
ATOM 5760  C CG   . LYS A 1 12 ? 6.488   -6.108  1.972   1.00 0.00 ? 12 LYS A CG   6  
ATOM 5761  C CD   . LYS A 1 12 ? 7.833   -6.614  1.447   1.00 0.00 ? 12 LYS A CD   6  
ATOM 5762  C CE   . LYS A 1 12 ? 8.790   -6.925  2.599   1.00 0.00 ? 12 LYS A CE   6  
ATOM 5763  N NZ   . LYS A 1 12 ? 9.729   -7.992  2.216   1.00 0.00 ? 12 LYS A NZ   6  
ATOM 5764  H H    . LYS A 1 12 ? 3.540   -6.945  3.339   1.00 0.00 ? 12 LYS A H    6  
ATOM 5765  H HA   . LYS A 1 12 ? 4.295   -5.205  1.164   1.00 0.00 ? 12 LYS A HA   6  
ATOM 5766  H HB2  . LYS A 1 12 ? 5.212   -7.811  2.267   1.00 0.00 ? 12 LYS A HB2  6  
ATOM 5767  H HB3  . LYS A 1 12 ? 5.588   -7.477  0.566   1.00 0.00 ? 12 LYS A HB3  6  
ATOM 5768  H HG2  . LYS A 1 12 ? 6.311   -5.105  1.585   1.00 0.00 ? 12 LYS A HG2  6  
ATOM 5769  H HG3  . LYS A 1 12 ? 6.505   -6.070  3.062   1.00 0.00 ? 12 LYS A HG3  6  
ATOM 5770  H HD2  . LYS A 1 12 ? 7.668   -7.522  0.868   1.00 0.00 ? 12 LYS A HD2  6  
ATOM 5771  H HD3  . LYS A 1 12 ? 8.268   -5.853  0.798   1.00 0.00 ? 12 LYS A HD3  6  
ATOM 5772  H HE2  . LYS A 1 12 ? 9.356   -6.027  2.848   1.00 0.00 ? 12 LYS A HE2  6  
ATOM 5773  H HE3  . LYS A 1 12 ? 8.212   -7.233  3.470   1.00 0.00 ? 12 LYS A HE3  6  
ATOM 5774  H HZ1  . LYS A 1 12 ? 10.270  -7.704  1.400   1.00 0.00 ? 12 LYS A HZ1  6  
ATOM 5775  H HZ2  . LYS A 1 12 ? 10.354  -8.181  2.999   1.00 0.00 ? 12 LYS A HZ2  6  
ATOM 5776  H HZ3  . LYS A 1 12 ? 9.215   -8.843  1.989   1.00 0.00 ? 12 LYS A HZ3  6  
ATOM 5777  N N    . LEU A 1 13 ? 2.269   -7.761  0.647   1.00 0.00 ? 13 LEU A N    6  
ATOM 5778  C CA   . LEU A 1 13 ? 1.340   -8.354  -0.299  1.00 0.00 ? 13 LEU A CA   6  
ATOM 5779  C C    . LEU A 1 13 ? 0.225   -7.353  -0.609  1.00 0.00 ? 13 LEU A C    6  
ATOM 5780  O O    . LEU A 1 13 ? -0.161  -7.244  -1.782  1.00 0.00 ? 13 LEU A O    6  
ATOM 5781  C CB   . LEU A 1 13 ? 0.831   -9.699  0.221   1.00 0.00 ? 13 LEU A CB   6  
ATOM 5782  C CG   . LEU A 1 13 ? 0.312   -10.675 -0.837  1.00 0.00 ? 13 LEU A CG   6  
ATOM 5783  C CD1  . LEU A 1 13 ? -0.697  -11.653 -0.232  1.00 0.00 ? 13 LEU A CD1  6  
ATOM 5784  C CD2  . LEU A 1 13 ? -0.266  -9.925  -2.038  1.00 0.00 ? 13 LEU A CD2  6  
ATOM 5785  H H    . LEU A 1 13 ? 2.269   -8.114  1.604   1.00 0.00 ? 13 LEU A H    6  
ATOM 5786  H HA   . LEU A 1 13 ? 1.907   -8.546  -1.210  1.00 0.00 ? 13 LEU A HA   6  
ATOM 5787  H HB2  . LEU A 1 13 ? 1.666   -10.160 0.750   1.00 0.00 ? 13 LEU A HB2  6  
ATOM 5788  H HB3  . LEU A 1 13 ? 0.041   -9.471  0.937   1.00 0.00 ? 13 LEU A HB3  6  
ATOM 5789  H HG   . LEU A 1 13 ? 1.188   -11.238 -1.158  1.00 0.00 ? 13 LEU A HG   6  
ATOM 5790  H HD11 . LEU A 1 13 ? -1.541  -11.106 0.187   1.00 0.00 ? 13 LEU A HD11 6  
ATOM 5791  H HD12 . LEU A 1 13 ? -1.045  -12.331 -1.011  1.00 0.00 ? 13 LEU A HD12 6  
ATOM 5792  H HD13 . LEU A 1 13 ? -0.224  -12.235 0.558   1.00 0.00 ? 13 LEU A HD13 6  
ATOM 5793  H HD21 . LEU A 1 13 ? 0.500   -9.294  -2.486  1.00 0.00 ? 13 LEU A HD21 6  
ATOM 5794  H HD22 . LEU A 1 13 ? -0.626  -10.649 -2.769  1.00 0.00 ? 13 LEU A HD22 6  
ATOM 5795  H HD23 . LEU A 1 13 ? -1.100  -9.299  -1.719  1.00 0.00 ? 13 LEU A HD23 6  
ATOM 5796  N N    . ASP A 1 14 ? -0.262  -6.654  0.432   1.00 0.00 ? 14 ASP A N    6  
ATOM 5797  C CA   . ASP A 1 14 ? -1.322  -5.673  0.271   1.00 0.00 ? 14 ASP A CA   6  
ATOM 5798  C C    . ASP A 1 14 ? -0.796  -4.489  -0.542  1.00 0.00 ? 14 ASP A C    6  
ATOM 5799  O O    . ASP A 1 14 ? -1.568  -3.929  -1.334  1.00 0.00 ? 14 ASP A O    6  
ATOM 5800  C CB   . ASP A 1 14 ? -1.791  -5.142  1.628   1.00 0.00 ? 14 ASP A CB   6  
ATOM 5801  C CG   . ASP A 1 14 ? -3.306  -4.988  1.773   1.00 0.00 ? 14 ASP A CG   6  
ATOM 5802  O OD1  . ASP A 1 14 ? -4.002  -5.966  1.300   1.00 0.00 ? 14 ASP A OD1  6  
ATOM 5803  O OD2  . ASP A 1 14 ? -3.797  -3.984  2.310   1.00 0.00 ? 14 ASP A OD2  6  
ATOM 5804  H H    . ASP A 1 14 ? 0.113   -6.805  1.368   1.00 0.00 ? 14 ASP A H    6  
ATOM 5805  H HA   . ASP A 1 14 ? -2.152  -6.132  -0.265  1.00 0.00 ? 14 ASP A HA   6  
ATOM 5806  H HB2  . ASP A 1 14 ? -1.432  -5.841  2.383   1.00 0.00 ? 14 ASP A HB2  6  
ATOM 5807  H HB3  . ASP A 1 14 ? -1.303  -4.179  1.776   1.00 0.00 ? 14 ASP A HB3  6  
ATOM 5808  N N    . ASN A 1 15 ? 0.486   -4.137  -0.335  1.00 0.00 ? 15 ASN A N    6  
ATOM 5809  C CA   . ASN A 1 15 ? 1.106   -3.030  -1.044  1.00 0.00 ? 15 ASN A CA   6  
ATOM 5810  C C    . ASN A 1 15 ? 1.086   -3.320  -2.546  1.00 0.00 ? 15 ASN A C    6  
ATOM 5811  O O    . ASN A 1 15 ? 0.650   -2.445  -3.310  1.00 0.00 ? 15 ASN A O    6  
ATOM 5812  C CB   . ASN A 1 15 ? 2.563   -2.849  -0.616  1.00 0.00 ? 15 ASN A CB   6  
ATOM 5813  C CG   . ASN A 1 15 ? 3.038   -1.420  -0.882  1.00 0.00 ? 15 ASN A CG   6  
ATOM 5814  O OD1  . ASN A 1 15 ? 3.503   -1.083  -1.959  1.00 0.00 ? 15 ASN A OD1  6  
ATOM 5815  N ND2  . ASN A 1 15 ? 2.897   -0.600  0.155   1.00 0.00 ? 15 ASN A ND2  6  
ATOM 5816  H H    . ASN A 1 15 ? 1.054   -4.652  0.338   1.00 0.00 ? 15 ASN A H    6  
ATOM 5817  H HA   . ASN A 1 15 ? 0.536   -2.122  -0.850  1.00 0.00 ? 15 ASN A HA   6  
ATOM 5818  H HB2  . ASN A 1 15 ? 2.648   -3.059  0.451   1.00 0.00 ? 15 ASN A HB2  6  
ATOM 5819  H HB3  . ASN A 1 15 ? 3.184   -3.557  -1.167  1.00 0.00 ? 15 ASN A HB3  6  
ATOM 5820  H HD21 . ASN A 1 15 ? 2.500   -0.948  1.029   1.00 0.00 ? 15 ASN A HD21 6  
ATOM 5821  H HD22 . ASN A 1 15 ? 3.186   0.374   0.079   1.00 0.00 ? 15 ASN A HD22 6  
ATOM 5822  N N    . TYR A 1 16 ? 1.550   -4.520  -2.935  1.00 0.00 ? 16 TYR A N    6  
ATOM 5823  C CA   . TYR A 1 16 ? 1.563   -4.855  -4.349  1.00 0.00 ? 16 TYR A CA   6  
ATOM 5824  C C    . TYR A 1 16 ? 0.125   -4.926  -4.864  1.00 0.00 ? 16 TYR A C    6  
ATOM 5825  O O    . TYR A 1 16 ? -0.102  -4.525  -6.016  1.00 0.00 ? 16 TYR A O    6  
ATOM 5826  C CB   . TYR A 1 16 ? 2.320   -6.176  -4.574  1.00 0.00 ? 16 TYR A CB   6  
ATOM 5827  C CG   . TYR A 1 16 ? 3.537   -6.368  -3.679  1.00 0.00 ? 16 TYR A CG   6  
ATOM 5828  C CD1  . TYR A 1 16 ? 4.304   -5.250  -3.281  1.00 0.00 ? 16 TYR A CD1  6  
ATOM 5829  C CD2  . TYR A 1 16 ? 3.902   -7.660  -3.236  1.00 0.00 ? 16 TYR A CD2  6  
ATOM 5830  C CE1  . TYR A 1 16 ? 5.431   -5.422  -2.450  1.00 0.00 ? 16 TYR A CE1  6  
ATOM 5831  C CE2  . TYR A 1 16 ? 5.029   -7.832  -2.403  1.00 0.00 ? 16 TYR A CE2  6  
ATOM 5832  C CZ   . TYR A 1 16 ? 5.795   -6.713  -2.010  1.00 0.00 ? 16 TYR A CZ   6  
ATOM 5833  O OH   . TYR A 1 16 ? 6.887   -6.876  -1.206  1.00 0.00 ? 16 TYR A OH   6  
ATOM 5834  H H    . TYR A 1 16 ? 1.893   -5.190  -2.260  1.00 0.00 ? 16 TYR A H    6  
ATOM 5835  H HA   . TYR A 1 16 ? 2.076   -4.052  -4.884  1.00 0.00 ? 16 TYR A HA   6  
ATOM 5836  H HB2  . TYR A 1 16 ? 1.629   -7.011  -4.433  1.00 0.00 ? 16 TYR A HB2  6  
ATOM 5837  H HB3  . TYR A 1 16 ? 2.659   -6.215  -5.611  1.00 0.00 ? 16 TYR A HB3  6  
ATOM 5838  H HD1  . TYR A 1 16 ? 4.032   -4.258  -3.612  1.00 0.00 ? 16 TYR A HD1  6  
ATOM 5839  H HD2  . TYR A 1 16 ? 3.320   -8.522  -3.531  1.00 0.00 ? 16 TYR A HD2  6  
ATOM 5840  H HE1  . TYR A 1 16 ? 6.013   -4.561  -2.151  1.00 0.00 ? 16 TYR A HE1  6  
ATOM 5841  H HE2  . TYR A 1 16 ? 5.301   -8.823  -2.070  1.00 0.00 ? 16 TYR A HE2  6  
ATOM 5842  H HH   . TYR A 1 16 ? 6.797   -6.455  -0.348  1.00 0.00 ? 16 TYR A HH   6  
ATOM 5843  N N    . HIS A 1 17 ? -0.798  -5.433  -4.029  1.00 0.00 ? 17 HIS A N    6  
ATOM 5844  C CA   . HIS A 1 17 ? -2.196  -5.560  -4.410  1.00 0.00 ? 17 HIS A CA   6  
ATOM 5845  C C    . HIS A 1 17 ? -2.817  -4.167  -4.529  1.00 0.00 ? 17 HIS A C    6  
ATOM 5846  O O    . HIS A 1 17 ? -3.696  -3.985  -5.383  1.00 0.00 ? 17 HIS A O    6  
ATOM 5847  C CB   . HIS A 1 17 ? -2.949  -6.464  -3.432  1.00 0.00 ? 17 HIS A CB   6  
ATOM 5848  C CG   . HIS A 1 17 ? -4.261  -5.890  -2.951  1.00 0.00 ? 17 HIS A CG   6  
ATOM 5849  N ND1  . HIS A 1 17 ? -5.461  -6.112  -3.605  1.00 0.00 ? 17 HIS A ND1  6  
ATOM 5850  C CD2  . HIS A 1 17 ? -4.548  -5.103  -1.875  1.00 0.00 ? 17 HIS A CD2  6  
ATOM 5851  C CE1  . HIS A 1 17 ? -6.419  -5.481  -2.945  1.00 0.00 ? 17 HIS A CE1  6  
ATOM 5852  N NE2  . HIS A 1 17 ? -5.853  -4.854  -1.873  1.00 0.00 ? 17 HIS A NE2  6  
ATOM 5853  H H    . HIS A 1 17 ? -0.527  -5.740  -3.094  1.00 0.00 ? 17 HIS A H    6  
ATOM 5854  H HA   . HIS A 1 17 ? -2.207  -6.039  -5.389  1.00 0.00 ? 17 HIS A HA   6  
ATOM 5855  H HB2  . HIS A 1 17 ? -3.140  -7.408  -3.941  1.00 0.00 ? 17 HIS A HB2  6  
ATOM 5856  H HB3  . HIS A 1 17 ? -2.290  -6.645  -2.582  1.00 0.00 ? 17 HIS A HB3  6  
ATOM 5857  H HD1  . HIS A 1 17 ? -5.685  -6.644  -4.445  1.00 0.00 ? 17 HIS A HD1  6  
ATOM 5858  H HD2  . HIS A 1 17 ? -3.920  -4.691  -1.100  1.00 0.00 ? 17 HIS A HD2  6  
ATOM 5859  H HE1  . HIS A 1 17 ? -7.440  -5.529  -3.296  1.00 0.00 ? 17 HIS A HE1  6  
ATOM 5860  N N    . LEU A 1 18 ? -2.354  -3.227  -3.684  1.00 0.00 ? 18 LEU A N    6  
ATOM 5861  C CA   . LEU A 1 18 ? -2.862  -1.866  -3.695  1.00 0.00 ? 18 LEU A CA   6  
ATOM 5862  C C    . LEU A 1 18 ? -2.251  -1.109  -4.876  1.00 0.00 ? 18 LEU A C    6  
ATOM 5863  O O    . LEU A 1 18 ? -3.010  -0.485  -5.632  1.00 0.00 ? 18 LEU A O    6  
ATOM 5864  C CB   . LEU A 1 18 ? -2.620  -1.193  -2.342  1.00 0.00 ? 18 LEU A CB   6  
ATOM 5865  C CG   . LEU A 1 18 ? -3.482  -1.693  -1.181  1.00 0.00 ? 18 LEU A CG   6  
ATOM 5866  C CD1  . LEU A 1 18 ? -2.872  -1.296  0.165   1.00 0.00 ? 18 LEU A CD1  6  
ATOM 5867  C CD2  . LEU A 1 18 ? -4.926  -1.208  -1.321  1.00 0.00 ? 18 LEU A CD2  6  
ATOM 5868  H H    . LEU A 1 18 ? -1.627  -3.462  -3.009  1.00 0.00 ? 18 LEU A H    6  
ATOM 5869  H HA   . LEU A 1 18 ? -3.939  -1.938  -3.839  1.00 0.00 ? 18 LEU A HA   6  
ATOM 5870  H HB2  . LEU A 1 18 ? -1.570  -1.357  -2.101  1.00 0.00 ? 18 LEU A HB2  6  
ATOM 5871  H HB3  . LEU A 1 18 ? -2.786  -0.127  -2.497  1.00 0.00 ? 18 LEU A HB3  6  
ATOM 5872  H HG   . LEU A 1 18 ? -3.464  -2.780  -1.260  1.00 0.00 ? 18 LEU A HG   6  
ATOM 5873  H HD11 . LEU A 1 18 ? -2.788  -0.210  0.229   1.00 0.00 ? 18 LEU A HD11 6  
ATOM 5874  H HD12 . LEU A 1 18 ? -3.510  -1.666  0.967   1.00 0.00 ? 18 LEU A HD12 6  
ATOM 5875  H HD13 . LEU A 1 18 ? -1.880  -1.735  0.268   1.00 0.00 ? 18 LEU A HD13 6  
ATOM 5876  H HD21 . LEU A 1 18 ? -5.351  -1.570  -2.258  1.00 0.00 ? 18 LEU A HD21 6  
ATOM 5877  H HD22 . LEU A 1 18 ? -5.510  -1.581  -0.480  1.00 0.00 ? 18 LEU A HD22 6  
ATOM 5878  H HD23 . LEU A 1 18 ? -4.954  -0.118  -1.318  1.00 0.00 ? 18 LEU A HD23 6  
ATOM 5879  N N    . GLU A 1 19 ? -0.915  -1.177  -5.009  1.00 0.00 ? 19 GLU A N    6  
ATOM 5880  C CA   . GLU A 1 19 ? -0.213  -0.503  -6.088  1.00 0.00 ? 19 GLU A CA   6  
ATOM 5881  C C    . GLU A 1 19 ? -0.733  -1.020  -7.431  1.00 0.00 ? 19 GLU A C    6  
ATOM 5882  O O    . GLU A 1 19 ? -0.684  -0.265  -8.412  1.00 0.00 ? 19 GLU A O    6  
ATOM 5883  C CB   . GLU A 1 19 ? 1.301   -0.693  -5.978  1.00 0.00 ? 19 GLU A CB   6  
ATOM 5884  C CG   . GLU A 1 19 ? 2.013   0.654   -5.827  1.00 0.00 ? 19 GLU A CG   6  
ATOM 5885  C CD   . GLU A 1 19 ? 3.527   0.494   -5.977  1.00 0.00 ? 19 GLU A CD   6  
ATOM 5886  O OE1  . GLU A 1 19 ? 4.000   0.004   -7.014  1.00 0.00 ? 19 GLU A OE1  6  
ATOM 5887  O OE2  . GLU A 1 19 ? 4.221   0.902   -4.969  1.00 0.00 ? 19 GLU A OE2  6  
ATOM 5888  H H    . GLU A 1 19 ? -0.362  -1.715  -4.341  1.00 0.00 ? 19 GLU A H    6  
ATOM 5889  H HA   . GLU A 1 19 ? -0.443  0.559   -6.003  1.00 0.00 ? 19 GLU A HA   6  
ATOM 5890  H HB2  . GLU A 1 19 ? 1.519   -1.307  -5.105  1.00 0.00 ? 19 GLU A HB2  6  
ATOM 5891  H HB3  . GLU A 1 19 ? 1.660   -1.204  -6.870  1.00 0.00 ? 19 GLU A HB3  6  
ATOM 5892  H HG2  . GLU A 1 19 ? 1.650   1.334   -6.598  1.00 0.00 ? 19 GLU A HG2  6  
ATOM 5893  H HG3  . GLU A 1 19 ? 1.778   1.070   -4.848  1.00 0.00 ? 19 GLU A HG3  6  
ATOM 5894  N N    . ASN A 1 20 ? -1.212  -2.277  -7.447  1.00 0.00 ? 20 ASN A N    6  
ATOM 5895  C CA   . ASN A 1 20 ? -1.735  -2.885  -8.658  1.00 0.00 ? 20 ASN A CA   6  
ATOM 5896  C C    . ASN A 1 20 ? -3.078  -2.241  -9.009  1.00 0.00 ? 20 ASN A C    6  
ATOM 5897  O O    . ASN A 1 20 ? -3.434  -2.228  -10.196 1.00 0.00 ? 20 ASN A O    6  
ATOM 5898  C CB   . ASN A 1 20 ? -1.968  -4.385  -8.465  1.00 0.00 ? 20 ASN A CB   6  
ATOM 5899  C CG   . ASN A 1 20 ? -0.709  -5.184  -8.813  1.00 0.00 ? 20 ASN A CG   6  
ATOM 5900  O OD1  . ASN A 1 20 ? 0.101   -4.788  -9.635  1.00 0.00 ? 20 ASN A OD1  6  
ATOM 5901  N ND2  . ASN A 1 20 ? -0.592  -6.328  -8.145  1.00 0.00 ? 20 ASN A ND2  6  
ATOM 5902  H H    . ASN A 1 20 ? -1.215  -2.833  -6.593  1.00 0.00 ? 20 ASN A H    6  
ATOM 5903  H HA   . ASN A 1 20 ? -1.034  -2.711  -9.475  1.00 0.00 ? 20 ASN A HA   6  
ATOM 5904  H HB2  . ASN A 1 20 ? -2.229  -4.572  -7.425  1.00 0.00 ? 20 ASN A HB2  6  
ATOM 5905  H HB3  . ASN A 1 20 ? -2.795  -4.700  -9.101  1.00 0.00 ? 20 ASN A HB3  6  
ATOM 5906  H HD21 . ASN A 1 20 ? -1.308  -6.600  -7.471  1.00 0.00 ? 20 ASN A HD21 6  
ATOM 5907  H HD22 . ASN A 1 20 ? 0.213   -6.932  -8.306  1.00 0.00 ? 20 ASN A HD22 6  
ATOM 5908  N N    . GLU A 1 21 ? -3.784  -1.727  -7.986  1.00 0.00 ? 21 GLU A N    6  
ATOM 5909  C CA   . GLU A 1 21 ? -5.074  -1.088  -8.185  1.00 0.00 ? 21 GLU A CA   6  
ATOM 5910  C C    . GLU A 1 21 ? -4.861  0.397   -8.490  1.00 0.00 ? 21 GLU A C    6  
ATOM 5911  O O    . GLU A 1 21 ? -5.605  0.941   -9.320  1.00 0.00 ? 21 GLU A O    6  
ATOM 5912  C CB   . GLU A 1 21 ? -5.986  -1.272  -6.971  1.00 0.00 ? 21 GLU A CB   6  
ATOM 5913  C CG   . GLU A 1 21 ? -7.460  -1.207  -7.377  1.00 0.00 ? 21 GLU A CG   6  
ATOM 5914  C CD   . GLU A 1 21 ? -8.200  -0.131  -6.581  1.00 0.00 ? 21 GLU A CD   6  
ATOM 5915  O OE1  . GLU A 1 21 ? -7.516  0.935   -6.336  1.00 0.00 ? 21 GLU A OE1  6  
ATOM 5916  O OE2  . GLU A 1 21 ? -9.372  -0.322  -6.221  1.00 0.00 ? 21 GLU A OE2  6  
ATOM 5917  H H    . GLU A 1 21 ? -3.417  -1.779  -7.036  1.00 0.00 ? 21 GLU A H    6  
ATOM 5918  H HA   . GLU A 1 21 ? -5.534  -1.565  -9.051  1.00 0.00 ? 21 GLU A HA   6  
ATOM 5919  H HB2  . GLU A 1 21 ? -5.785  -2.246  -6.522  1.00 0.00 ? 21 GLU A HB2  6  
ATOM 5920  H HB3  . GLU A 1 21 ? -5.766  -0.492  -6.242  1.00 0.00 ? 21 GLU A HB3  6  
ATOM 5921  H HG2  . GLU A 1 21 ? -7.524  -0.968  -8.439  1.00 0.00 ? 21 GLU A HG2  6  
ATOM 5922  H HG3  . GLU A 1 21 ? -7.918  -2.180  -7.204  1.00 0.00 ? 21 GLU A HG3  6  
ATOM 5923  N N    . VAL A 1 22 ? -3.866  1.011   -7.825  1.00 0.00 ? 22 VAL A N    6  
ATOM 5924  C CA   . VAL A 1 22 ? -3.561  2.418   -8.024  1.00 0.00 ? 22 VAL A CA   6  
ATOM 5925  C C    . VAL A 1 22 ? -2.804  2.590   -9.342  1.00 0.00 ? 22 VAL A C    6  
ATOM 5926  O O    . VAL A 1 22 ? -3.113  3.537   -10.081 1.00 0.00 ? 22 VAL A O    6  
ATOM 5927  C CB   . VAL A 1 22 ? -2.793  2.962   -6.818  1.00 0.00 ? 22 VAL A CB   6  
ATOM 5928  C CG1  . VAL A 1 22 ? -2.523  4.461   -6.971  1.00 0.00 ? 22 VAL A CG1  6  
ATOM 5929  C CG2  . VAL A 1 22 ? -3.538  2.669   -5.514  1.00 0.00 ? 22 VAL A CG2  6  
ATOM 5930  H H    . VAL A 1 22 ? -3.299  0.488   -7.157  1.00 0.00 ? 22 VAL A H    6  
ATOM 5931  H HA   . VAL A 1 22 ? -4.510  2.952   -8.086  1.00 0.00 ? 22 VAL A HA   6  
ATOM 5932  H HB   . VAL A 1 22 ? -1.842  2.430   -6.809  1.00 0.00 ? 22 VAL A HB   6  
ATOM 5933  H HG11 . VAL A 1 22 ? -3.466  5.000   -7.061  1.00 0.00 ? 22 VAL A HG11 6  
ATOM 5934  H HG12 . VAL A 1 22 ? -1.976  4.814   -6.096  1.00 0.00 ? 22 VAL A HG12 6  
ATOM 5935  H HG13 . VAL A 1 22 ? -1.924  4.642   -7.862  1.00 0.00 ? 22 VAL A HG13 6  
ATOM 5936  H HG21 . VAL A 1 22 ? -3.668  1.593   -5.394  1.00 0.00 ? 22 VAL A HG21 6  
ATOM 5937  H HG22 . VAL A 1 22 ? -2.964  3.069   -4.679  1.00 0.00 ? 22 VAL A HG22 6  
ATOM 5938  H HG23 . VAL A 1 22 ? -4.519  3.145   -5.532  1.00 0.00 ? 22 VAL A HG23 6  
ATOM 5939  N N    . ALA A 1 23 ? -1.845  1.686   -9.608  1.00 0.00 ? 23 ALA A N    6  
ATOM 5940  C CA   . ALA A 1 23 ? -1.053  1.738   -10.826 1.00 0.00 ? 23 ALA A CA   6  
ATOM 5941  C C    . ALA A 1 23 ? -1.965  1.498   -12.031 1.00 0.00 ? 23 ALA A C    6  
ATOM 5942  O O    . ALA A 1 23 ? -1.575  1.868   -13.148 1.00 0.00 ? 23 ALA A O    6  
ATOM 5943  C CB   . ALA A 1 23 ? -0.033  0.599   -10.825 1.00 0.00 ? 23 ALA A CB   6  
ATOM 5944  H H    . ALA A 1 23 ? -1.653  0.936   -8.945  1.00 0.00 ? 23 ALA A H    6  
ATOM 5945  H HA   . ALA A 1 23 ? -0.565  2.707   -10.937 1.00 0.00 ? 23 ALA A HA   6  
ATOM 5946  H HB1  . ALA A 1 23 ? 0.614   0.702   -9.954  1.00 0.00 ? 23 ALA A HB1  6  
ATOM 5947  H HB2  . ALA A 1 23 ? -0.547  -0.360  -10.774 1.00 0.00 ? 23 ALA A HB2  6  
ATOM 5948  H HB3  . ALA A 1 23 ? 0.563   0.633   -11.738 1.00 0.00 ? 23 ALA A HB3  6  
ATOM 5949  N N    . ARG A 1 24 ? -3.140  0.892   -11.786 1.00 0.00 ? 24 ARG A N    6  
ATOM 5950  C CA   . ARG A 1 24 ? -4.094  0.608   -12.844 1.00 0.00 ? 24 ARG A CA   6  
ATOM 5951  C C    . ARG A 1 24 ? -5.124  1.736   -12.915 1.00 0.00 ? 24 ARG A C    6  
ATOM 5952  O O    . ARG A 1 24 ? -5.847  1.814   -13.919 1.00 0.00 ? 24 ARG A O    6  
ATOM 5953  C CB   . ARG A 1 24 ? -4.820  -0.719  -12.606 1.00 0.00 ? 24 ARG A CB   6  
ATOM 5954  C CG   . ARG A 1 24 ? -4.013  -1.893  -13.166 1.00 0.00 ? 24 ARG A CG   6  
ATOM 5955  C CD   . ARG A 1 24 ? -4.680  -3.228  -12.826 1.00 0.00 ? 24 ARG A CD   6  
ATOM 5956  N NE   . ARG A 1 24 ? -4.843  -4.038  -14.053 1.00 0.00 ? 24 ARG A NE   6  
ATOM 5957  C CZ   . ARG A 1 24 ? -3.993  -5.016  -14.433 1.00 0.00 ? 24 ARG A CZ   6  
ATOM 5958  N NH1  . ARG A 1 24 ? -2.929  -5.286  -13.665 1.00 0.00 ? 24 ARG A NH1  6  
ATOM 5959  N NH2  . ARG A 1 24 ? -4.211  -5.707  -15.561 1.00 0.00 ? 24 ARG A NH2  6  
ATOM 5960  H H    . ARG A 1 24 ? -3.384  0.619   -10.834 1.00 0.00 ? 24 ARG A H    6  
ATOM 5961  H HA   . ARG A 1 24 ? -3.548  0.566   -13.786 1.00 0.00 ? 24 ARG A HA   6  
ATOM 5962  H HB2  . ARG A 1 24 ? -4.955  -0.862  -11.534 1.00 0.00 ? 24 ARG A HB2  6  
ATOM 5963  H HB3  . ARG A 1 24 ? -5.798  -0.678  -13.085 1.00 0.00 ? 24 ARG A HB3  6  
ATOM 5964  H HG2  . ARG A 1 24 ? -3.950  -1.793  -14.249 1.00 0.00 ? 24 ARG A HG2  6  
ATOM 5965  H HG3  . ARG A 1 24 ? -3.008  -1.862  -12.747 1.00 0.00 ? 24 ARG A HG3  6  
ATOM 5966  H HD2  . ARG A 1 24 ? -4.056  -3.775  -12.120 1.00 0.00 ? 24 ARG A HD2  6  
ATOM 5967  H HD3  . ARG A 1 24 ? -5.652  -3.041  -12.372 1.00 0.00 ? 24 ARG A HD3  6  
ATOM 5968  H HE   . ARG A 1 24 ? -5.658  -3.821  -14.627 1.00 0.00 ? 24 ARG A HE   6  
ATOM 5969  H HH11 . ARG A 1 24 ? -2.770  -4.756  -12.808 1.00 0.00 ? 24 ARG A HH11 6  
ATOM 5970  H HH12 . ARG A 1 24 ? -2.277  -6.022  -13.938 1.00 0.00 ? 24 ARG A HH12 6  
ATOM 5971  H HH21 . ARG A 1 24 ? -5.023  -5.494  -16.140 1.00 0.00 ? 24 ARG A HH21 6  
ATOM 5972  H HH22 . ARG A 1 24 ? -3.564  -6.444  -15.840 1.00 0.00 ? 24 ARG A HH22 6  
ATOM 5973  N N    . LEU A 1 25 ? -5.169  2.577   -11.865 1.00 0.00 ? 25 LEU A N    6  
ATOM 5974  C CA   . LEU A 1 25 ? -6.101  3.690   -11.810 1.00 0.00 ? 25 LEU A CA   6  
ATOM 5975  C C    . LEU A 1 25 ? -5.372  4.980   -12.194 1.00 0.00 ? 25 LEU A C    6  
ATOM 5976  O O    . LEU A 1 25 ? -5.985  5.829   -12.856 1.00 0.00 ? 25 LEU A O    6  
ATOM 5977  C CB   . LEU A 1 25 ? -6.781  3.752   -10.440 1.00 0.00 ? 25 LEU A CB   6  
ATOM 5978  C CG   . LEU A 1 25 ? -7.873  2.712   -10.186 1.00 0.00 ? 25 LEU A CG   6  
ATOM 5979  C CD1  . LEU A 1 25 ? -8.301  2.715   -8.717  1.00 0.00 ? 25 LEU A CD1  6  
ATOM 5980  C CD2  . LEU A 1 25 ? -9.059  2.920   -11.130 1.00 0.00 ? 25 LEU A CD2  6  
ATOM 5981  H H    . LEU A 1 25 ? -4.536  2.443   -11.076 1.00 0.00 ? 25 LEU A H    6  
ATOM 5982  H HA   . LEU A 1 25 ? -6.873  3.485   -12.552 1.00 0.00 ? 25 LEU A HA   6  
ATOM 5983  H HB2  . LEU A 1 25 ? -5.992  3.627   -9.699  1.00 0.00 ? 25 LEU A HB2  6  
ATOM 5984  H HB3  . LEU A 1 25 ? -7.196  4.757   -10.350 1.00 0.00 ? 25 LEU A HB3  6  
ATOM 5985  H HG   . LEU A 1 25 ? -7.407  1.751   -10.407 1.00 0.00 ? 25 LEU A HG   6  
ATOM 5986  H HD11 . LEU A 1 25 ? -8.680  3.700   -8.443  1.00 0.00 ? 25 LEU A HD11 6  
ATOM 5987  H HD12 . LEU A 1 25 ? -9.078  1.964   -8.573  1.00 0.00 ? 25 LEU A HD12 6  
ATOM 5988  H HD13 . LEU A 1 25 ? -7.451  2.472   -8.081  1.00 0.00 ? 25 LEU A HD13 6  
ATOM 5989  H HD21 . LEU A 1 25 ? -8.728  2.839   -12.165 1.00 0.00 ? 25 LEU A HD21 6  
ATOM 5990  H HD22 . LEU A 1 25 ? -9.815  2.163   -10.922 1.00 0.00 ? 25 LEU A HD22 6  
ATOM 5991  H HD23 . LEU A 1 25 ? -9.491  3.908   -10.971 1.00 0.00 ? 25 LEU A HD23 6  
ATOM 5992  N N    . LYS A 1 26 ? -4.099  5.098   -11.777 1.00 0.00 ? 26 LYS A N    6  
ATOM 5993  C CA   . LYS A 1 26 ? -3.297  6.273   -12.074 1.00 0.00 ? 26 LYS A CA   6  
ATOM 5994  C C    . LYS A 1 26 ? -3.235  6.472   -13.590 1.00 0.00 ? 26 LYS A C    6  
ATOM 5995  O O    . LYS A 1 26 ? -3.094  7.623   -14.029 1.00 0.00 ? 26 LYS A O    6  
ATOM 5996  C CB   . LYS A 1 26 ? -1.923  6.166   -11.411 1.00 0.00 ? 26 LYS A CB   6  
ATOM 5997  C CG   . LYS A 1 26 ? -2.057  5.897   -9.911  1.00 0.00 ? 26 LYS A CG   6  
ATOM 5998  C CD   . LYS A 1 26 ? -1.710  7.145   -9.096  1.00 0.00 ? 26 LYS A CD   6  
ATOM 5999  C CE   . LYS A 1 26 ? -0.596  7.948   -9.771  1.00 0.00 ? 26 LYS A CE   6  
ATOM 6000  N NZ   . LYS A 1 26 ? 0.210   8.659   -8.764  1.00 0.00 ? 26 LYS A NZ   6  
ATOM 6001  H H    . LYS A 1 26 ? -3.667  4.350   -11.235 1.00 0.00 ? 26 LYS A H    6  
ATOM 6002  H HA   . LYS A 1 26 ? -3.814  7.121   -11.626 1.00 0.00 ? 26 LYS A HA   6  
ATOM 6003  H HB2  . LYS A 1 26 ? -1.371  5.346   -11.870 1.00 0.00 ? 26 LYS A HB2  6  
ATOM 6004  H HB3  . LYS A 1 26 ? -1.378  7.097   -11.574 1.00 0.00 ? 26 LYS A HB3  6  
ATOM 6005  H HG2  . LYS A 1 26 ? -3.085  5.607   -9.694  1.00 0.00 ? 26 LYS A HG2  6  
ATOM 6006  H HG3  . LYS A 1 26 ? -1.392  5.078   -9.637  1.00 0.00 ? 26 LYS A HG3  6  
ATOM 6007  H HD2  . LYS A 1 26 ? -2.599  7.772   -9.013  1.00 0.00 ? 26 LYS A HD2  6  
ATOM 6008  H HD3  . LYS A 1 26 ? -1.396  6.840   -8.098  1.00 0.00 ? 26 LYS A HD3  6  
ATOM 6009  H HE2  . LYS A 1 26 ? 0.049   7.269   -10.327 1.00 0.00 ? 26 LYS A HE2  6  
ATOM 6010  H HE3  . LYS A 1 26 ? -1.040  8.663   -10.464 1.00 0.00 ? 26 LYS A HE3  6  
ATOM 6011  H HZ1  . LYS A 1 26 ? 0.624   7.990   -8.116  1.00 0.00 ? 26 LYS A HZ1  6  
ATOM 6012  H HZ2  . LYS A 1 26 ? 0.943   9.185   -9.238  1.00 0.00 ? 26 LYS A HZ2  6  
ATOM 6013  H HZ3  . LYS A 1 26 ? -0.380  9.307   -8.242  1.00 0.00 ? 26 LYS A HZ3  6  
ATOM 6014  N N    . LYS A 1 27 ? -3.338  5.365   -14.347 1.00 0.00 ? 27 LYS A N    6  
ATOM 6015  C CA   . LYS A 1 27 ? -3.293  5.419   -15.798 1.00 0.00 ? 27 LYS A CA   6  
ATOM 6016  C C    . LYS A 1 27 ? -4.527  6.161   -16.316 1.00 0.00 ? 27 LYS A C    6  
ATOM 6017  O O    . LYS A 1 27 ? -4.549  6.510   -17.506 1.00 0.00 ? 27 LYS A O    6  
ATOM 6018  C CB   . LYS A 1 27 ? -3.132  4.013   -16.381 1.00 0.00 ? 27 LYS A CB   6  
ATOM 6019  C CG   . LYS A 1 27 ? -2.132  4.010   -17.538 1.00 0.00 ? 27 LYS A CG   6  
ATOM 6020  C CD   . LYS A 1 27 ? -2.215  2.706   -18.334 1.00 0.00 ? 27 LYS A CD   6  
ATOM 6021  C CE   . LYS A 1 27 ? -3.589  2.551   -18.990 1.00 0.00 ? 27 LYS A CE   6  
ATOM 6022  N NZ   . LYS A 1 27 ? -3.946  3.771   -19.732 1.00 0.00 ? 27 LYS A NZ   6  
ATOM 6023  H H    . LYS A 1 27 ? -3.453  4.453   -13.905 1.00 0.00 ? 27 LYS A H    6  
ATOM 6024  H HA   . LYS A 1 27 ? -2.401  5.987   -16.060 1.00 0.00 ? 27 LYS A HA   6  
ATOM 6025  H HB2  . LYS A 1 27 ? -2.771  3.344   -15.599 1.00 0.00 ? 27 LYS A HB2  6  
ATOM 6026  H HB3  . LYS A 1 27 ? -4.103  3.661   -16.729 1.00 0.00 ? 27 LYS A HB3  6  
ATOM 6027  H HG2  . LYS A 1 27 ? -2.357  4.846   -18.203 1.00 0.00 ? 27 LYS A HG2  6  
ATOM 6028  H HG3  . LYS A 1 27 ? -1.126  4.138   -17.137 1.00 0.00 ? 27 LYS A HG3  6  
ATOM 6029  H HD2  . LYS A 1 27 ? -1.450  2.714   -19.110 1.00 0.00 ? 27 LYS A HD2  6  
ATOM 6030  H HD3  . LYS A 1 27 ? -2.028  1.869   -17.660 1.00 0.00 ? 27 LYS A HD3  6  
ATOM 6031  H HE2  . LYS A 1 27 ? -3.562  1.709   -19.683 1.00 0.00 ? 27 LYS A HE2  6  
ATOM 6032  H HE3  . LYS A 1 27 ? -4.334  2.353   -18.220 1.00 0.00 ? 27 LYS A HE3  6  
ATOM 6033  H HZ1  . LYS A 1 27 ? -3.248  3.957   -20.452 1.00 0.00 ? 27 LYS A HZ1  6  
ATOM 6034  H HZ2  . LYS A 1 27 ? -4.863  3.644   -20.159 1.00 0.00 ? 27 LYS A HZ2  6  
ATOM 6035  H HZ3  . LYS A 1 27 ? -3.984  4.566   -19.094 1.00 0.00 ? 27 LYS A HZ3  6  
ATOM 6036  N N    . LEU A 1 28 ? -5.513  6.382   -15.428 1.00 0.00 ? 28 LEU A N    6  
ATOM 6037  C CA   . LEU A 1 28 ? -6.736  7.077   -15.793 1.00 0.00 ? 28 LEU A CA   6  
ATOM 6038  C C    . LEU A 1 28 ? -6.729  8.475   -15.173 1.00 0.00 ? 28 LEU A C    6  
ATOM 6039  O O    . LEU A 1 28 ? -7.289  9.395   -15.787 1.00 0.00 ? 28 LEU A O    6  
ATOM 6040  C CB   . LEU A 1 28 ? -7.960  6.242   -15.412 1.00 0.00 ? 28 LEU A CB   6  
ATOM 6041  C CG   . LEU A 1 28 ? -9.003  6.037   -16.512 1.00 0.00 ? 28 LEU A CG   6  
ATOM 6042  C CD1  . LEU A 1 28 ? -8.563  4.945   -17.488 1.00 0.00 ? 28 LEU A CD1  6  
ATOM 6043  C CD2  . LEU A 1 28 ? -10.382 5.750   -15.915 1.00 0.00 ? 28 LEU A CD2  6  
ATOM 6044  H H    . LEU A 1 28 ? -5.414  6.060   -14.465 1.00 0.00 ? 28 LEU A H    6  
ATOM 6045  H HA   . LEU A 1 28 ? -6.727  7.169   -16.879 1.00 0.00 ? 28 LEU A HA   6  
ATOM 6046  H HB2  . LEU A 1 28 ? -7.583  5.269   -15.096 1.00 0.00 ? 28 LEU A HB2  6  
ATOM 6047  H HB3  . LEU A 1 28 ? -8.415  6.740   -14.555 1.00 0.00 ? 28 LEU A HB3  6  
ATOM 6048  H HG   . LEU A 1 28 ? -9.038  6.985   -17.049 1.00 0.00 ? 28 LEU A HG   6  
ATOM 6049  H HD11 . LEU A 1 28 ? -8.423  4.004   -16.955 1.00 0.00 ? 28 LEU A HD11 6  
ATOM 6050  H HD12 . LEU A 1 28 ? -9.327  4.826   -18.257 1.00 0.00 ? 28 LEU A HD12 6  
ATOM 6051  H HD13 . LEU A 1 28 ? -7.624  5.226   -17.963 1.00 0.00 ? 28 LEU A HD13 6  
ATOM 6052  H HD21 . LEU A 1 28 ? -10.693 6.582   -15.283 1.00 0.00 ? 28 LEU A HD21 6  
ATOM 6053  H HD22 . LEU A 1 28 ? -11.098 5.612   -16.725 1.00 0.00 ? 28 LEU A HD22 6  
ATOM 6054  H HD23 . LEU A 1 28 ? -10.345 4.842   -15.313 1.00 0.00 ? 28 LEU A HD23 6  
ATOM 6055  N N    . VAL A 1 29 ? -6.105  8.605   -13.988 1.00 0.00 ? 29 VAL A N    6  
ATOM 6056  C CA   . VAL A 1 29 ? -6.026  9.880   -13.296 1.00 0.00 ? 29 VAL A CA   6  
ATOM 6057  C C    . VAL A 1 29 ? -4.597  10.418  -13.387 1.00 0.00 ? 29 VAL A C    6  
ATOM 6058  O O    . VAL A 1 29 ? -4.394  11.442  -14.056 1.00 0.00 ? 29 VAL A O    6  
ATOM 6059  C CB   . VAL A 1 29 ? -6.515  9.723   -11.855 1.00 0.00 ? 29 VAL A CB   6  
ATOM 6060  C CG1  . VAL A 1 29 ? -6.726  11.087  -11.195 1.00 0.00 ? 29 VAL A CG1  6  
ATOM 6061  C CG2  . VAL A 1 29 ? -7.793  8.883   -11.797 1.00 0.00 ? 29 VAL A CG2  6  
ATOM 6062  H H    . VAL A 1 29 ? -5.668  7.794   -13.551 1.00 0.00 ? 29 VAL A H    6  
ATOM 6063  H HA   . VAL A 1 29 ? -6.698  10.570  -13.805 1.00 0.00 ? 29 VAL A HA   6  
ATOM 6064  H HB   . VAL A 1 29 ? -5.721  9.194   -11.329 1.00 0.00 ? 29 VAL A HB   6  
ATOM 6065  H HG11 . VAL A 1 29 ? -7.462  11.662  -11.758 1.00 0.00 ? 29 VAL A HG11 6  
ATOM 6066  H HG12 . VAL A 1 29 ? -7.073  10.937  -10.173 1.00 0.00 ? 29 VAL A HG12 6  
ATOM 6067  H HG13 . VAL A 1 29 ? -5.786  11.638  -11.173 1.00 0.00 ? 29 VAL A HG13 6  
ATOM 6068  H HG21 . VAL A 1 29 ? -7.607  7.895   -12.218 1.00 0.00 ? 29 VAL A HG21 6  
ATOM 6069  H HG22 . VAL A 1 29 ? -8.111  8.792   -10.760 1.00 0.00 ? 29 VAL A HG22 6  
ATOM 6070  H HG23 . VAL A 1 29 ? -8.583  9.369   -12.370 1.00 0.00 ? 29 VAL A HG23 6  
ATOM 6071  N N    . GLY A 1 30 ? -3.650  9.730   -12.723 1.00 0.00 ? 30 GLY A N    6  
ATOM 6072  C CA   . GLY A 1 30 ? -2.256  10.136  -12.730 1.00 0.00 ? 30 GLY A CA   6  
ATOM 6073  C C    . GLY A 1 30 ? -1.790  10.320  -14.175 1.00 0.00 ? 30 GLY A C    6  
ATOM 6074  O O    . GLY A 1 30 ? -0.691  10.859  -14.376 1.00 0.00 ? 30 GLY A O    6  
ATOM 6075  H H    . GLY A 1 30 ? -3.904  8.894   -12.195 1.00 0.00 ? 30 GLY A H    6  
ATOM 6076  H HA2  . GLY A 1 30 ? -2.144  11.080  -12.197 1.00 0.00 ? 30 GLY A HA2  6  
ATOM 6077  H HA3  . GLY A 1 30 ? -1.648  9.377   -12.238 1.00 0.00 ? 30 GLY A HA3  6  
ATOM 6078  N N    . GLU A 1 31 ? -2.619  9.879   -15.137 1.00 0.00 ? 31 GLU A N    6  
ATOM 6079  C CA   . GLU A 1 31 ? -2.294  9.996   -16.549 1.00 0.00 ? 31 GLU A CA   6  
ATOM 6080  C C    . GLU A 1 31 ? -2.129  11.474  -16.909 1.00 0.00 ? 31 GLU A C    6  
ATOM 6081  O O    . GLU A 1 31 ? -2.586  12.325  -16.131 1.00 0.00 ? 31 GLU A O    6  
ATOM 6082  C CB   . GLU A 1 31 ? -3.357  9.333   -17.427 1.00 0.00 ? 31 GLU A CB   6  
ATOM 6083  C CG   . GLU A 1 31 ? -2.711  8.432   -18.481 1.00 0.00 ? 31 GLU A CG   6  
ATOM 6084  C CD   . GLU A 1 31 ? -3.631  8.260   -19.693 1.00 0.00 ? 31 GLU A CD   6  
ATOM 6085  O OE1  . GLU A 1 31 ? -4.202  9.341   -20.101 1.00 0.00 ? 31 GLU A OE1  6  
ATOM 6086  O OE2  . GLU A 1 31 ? -3.781  7.140   -20.204 1.00 0.00 ? 31 GLU A OE2  6  
ATOM 6087  H H    . GLU A 1 31 ? -3.508  9.447   -14.885 1.00 0.00 ? 31 GLU A H    6  
ATOM 6088  H HA   . GLU A 1 31 ? -1.343  9.486   -16.698 1.00 0.00 ? 31 GLU A HA   6  
ATOM 6089  H HB2  . GLU A 1 31 ? -4.011  8.730   -16.797 1.00 0.00 ? 31 GLU A HB2  6  
ATOM 6090  H HB3  . GLU A 1 31 ? -3.949  10.108  -17.912 1.00 0.00 ? 31 GLU A HB3  6  
ATOM 6091  H HG2  . GLU A 1 31 ? -1.775  8.883   -18.809 1.00 0.00 ? 31 GLU A HG2  6  
ATOM 6092  H HG3  . GLU A 1 31 ? -2.500  7.460   -18.035 1.00 0.00 ? 31 GLU A HG3  6  
ATOM 6093  N N    . ARG A 1 32 ? -1.490  11.745  -18.061 1.00 0.00 ? 32 ARG A N    6  
ATOM 6094  C CA   . ARG A 1 32 ? -1.269  13.107  -18.517 1.00 0.00 ? 32 ARG A CA   6  
ATOM 6095  C C    . ARG A 1 32 ? -2.037  13.335  -19.820 1.00 0.00 ? 32 ARG A C    6  
ATOM 6096  O O    . ARG A 1 32 ? -3.113  12.775  -20.015 1.00 0.00 ? 32 ARG A O    6  
ATOM 6097  C CB   . ARG A 1 32 ? 0.216   13.388  -18.753 1.00 0.00 ? 32 ARG A CB   6  
ATOM 6098  C CG   . ARG A 1 32 ? 0.987   12.090  -18.998 1.00 0.00 ? 32 ARG A CG   6  
ATOM 6099  C CD   . ARG A 1 32 ? 2.457   12.243  -18.602 1.00 0.00 ? 32 ARG A CD   6  
ATOM 6100  N NE   . ARG A 1 32 ? 2.904   13.634  -18.840 1.00 0.00 ? 32 ARG A NE   6  
ATOM 6101  C CZ   . ARG A 1 32 ? 4.165   13.976  -19.183 1.00 0.00 ? 32 ARG A CZ   6  
ATOM 6102  N NH1  . ARG A 1 32 ? 5.085   13.012  -19.322 1.00 0.00 ? 32 ARG A NH1  6  
ATOM 6103  N NH2  . ARG A 1 32 ? 4.490   15.260  -19.380 1.00 0.00 ? 32 ARG A NH2  6  
ATOM 6104  H H    . ARG A 1 32 ? -1.145  10.983  -18.644 1.00 0.00 ? 32 ARG A H    6  
ATOM 6105  H HA   . ARG A 1 32 ? -1.657  13.782  -17.754 1.00 0.00 ? 32 ARG A HA   6  
ATOM 6106  H HB2  . ARG A 1 32 ? 0.320   14.034  -19.625 1.00 0.00 ? 32 ARG A HB2  6  
ATOM 6107  H HB3  . ARG A 1 32 ? 0.621   13.902  -17.881 1.00 0.00 ? 32 ARG A HB3  6  
ATOM 6108  H HG2  . ARG A 1 32 ? 0.541   11.294  -18.403 1.00 0.00 ? 32 ARG A HG2  6  
ATOM 6109  H HG3  . ARG A 1 32 ? 0.912   11.828  -20.054 1.00 0.00 ? 32 ARG A HG3  6  
ATOM 6110  H HD2  . ARG A 1 32 ? 2.575   12.008  -17.544 1.00 0.00 ? 32 ARG A HD2  6  
ATOM 6111  H HD3  . ARG A 1 32 ? 3.064   11.552  -19.188 1.00 0.00 ? 32 ARG A HD3  6  
ATOM 6112  H HE   . ARG A 1 32 ? 2.192   14.355  -18.730 1.00 0.00 ? 32 ARG A HE   6  
ATOM 6113  H HH11 . ARG A 1 32 ? 4.829   12.036  -19.169 1.00 0.00 ? 32 ARG A HH11 6  
ATOM 6114  H HH12 . ARG A 1 32 ? 6.041   13.254  -19.580 1.00 0.00 ? 32 ARG A HH12 6  
ATOM 6115  H HH21 . ARG A 1 32 ? 3.783   15.988  -19.272 1.00 0.00 ? 32 ARG A HH21 6  
ATOM 6116  H HH22 . ARG A 1 32 ? 5.444   15.510  -19.638 1.00 0.00 ? 32 ARG A HH22 6  
ATOM 6117  N N    . MET B 1 1  ? 16.489  -6.782  12.395  1.00 0.00 ? 1  MET B N    6  
ATOM 6118  C CA   . MET B 1 1  ? 15.300  -6.546  13.196  1.00 0.00 ? 1  MET B CA   6  
ATOM 6119  C C    . MET B 1 1  ? 15.095  -5.040  13.368  1.00 0.00 ? 1  MET B C    6  
ATOM 6120  O O    . MET B 1 1  ? 13.950  -4.582  13.239  1.00 0.00 ? 1  MET B O    6  
ATOM 6121  C CB   . MET B 1 1  ? 15.446  -7.202  14.572  1.00 0.00 ? 1  MET B CB   6  
ATOM 6122  C CG   . MET B 1 1  ? 14.108  -7.765  15.056  1.00 0.00 ? 1  MET B CG   6  
ATOM 6123  S SD   . MET B 1 1  ? 13.999  -7.636  16.864  1.00 0.00 ? 1  MET B SD   6  
ATOM 6124  C CE   . MET B 1 1  ? 13.906  -9.398  17.300  1.00 0.00 ? 1  MET B CE   6  
ATOM 6125  H H    . MET B 1 1  ? 17.157  -7.479  12.722  1.00 0.00 ? 1  MET B H    6  
ATOM 6126  H HA   . MET B 1 1  ? 14.436  -6.966  12.680  1.00 0.00 ? 1  MET B HA   6  
ATOM 6127  H HB2  . MET B 1 1  ? 16.168  -8.016  14.501  1.00 0.00 ? 1  MET B HB2  6  
ATOM 6128  H HB3  . MET B 1 1  ? 15.816  -6.460  15.279  1.00 0.00 ? 1  MET B HB3  6  
ATOM 6129  H HG2  . MET B 1 1  ? 13.293  -7.196  14.609  1.00 0.00 ? 1  MET B HG2  6  
ATOM 6130  H HG3  . MET B 1 1  ? 14.022  -8.808  14.750  1.00 0.00 ? 1  MET B HG3  6  
ATOM 6131  H HE1  . MET B 1 1  ? 14.794  -9.918  16.941  1.00 0.00 ? 1  MET B HE1  6  
ATOM 6132  H HE2  . MET B 1 1  ? 13.833  -9.492  18.384  1.00 0.00 ? 1  MET B HE2  6  
ATOM 6133  H HE3  . MET B 1 1  ? 13.022  -9.847  16.845  1.00 0.00 ? 1  MET B HE3  6  
ATOM 6134  N N    . ASP B 1 2  ? 16.190  -4.312  13.651  1.00 0.00 ? 2  ASP B N    6  
ATOM 6135  C CA   . ASP B 1 2  ? 16.131  -2.872  13.838  1.00 0.00 ? 2  ASP B CA   6  
ATOM 6136  C C    . ASP B 1 2  ? 15.430  -2.235  12.635  1.00 0.00 ? 2  ASP B C    6  
ATOM 6137  O O    . ASP B 1 2  ? 14.711  -1.244  12.829  1.00 0.00 ? 2  ASP B O    6  
ATOM 6138  C CB   . ASP B 1 2  ? 17.533  -2.272  13.942  1.00 0.00 ? 2  ASP B CB   6  
ATOM 6139  C CG   . ASP B 1 2  ? 18.417  -2.879  15.032  1.00 0.00 ? 2  ASP B CG   6  
ATOM 6140  O OD1  . ASP B 1 2  ? 18.081  -3.916  15.623  1.00 0.00 ? 2  ASP B OD1  6  
ATOM 6141  O OD2  . ASP B 1 2  ? 19.508  -2.233  15.272  1.00 0.00 ? 2  ASP B OD2  6  
ATOM 6142  H H    . ASP B 1 2  ? 17.097  -4.769  13.741  1.00 0.00 ? 2  ASP B H    6  
ATOM 6143  H HA   . ASP B 1 2  ? 15.556  -2.656  14.739  1.00 0.00 ? 2  ASP B HA   6  
ATOM 6144  H HB2  . ASP B 1 2  ? 18.013  -2.418  12.973  1.00 0.00 ? 2  ASP B HB2  6  
ATOM 6145  H HB3  . ASP B 1 2  ? 17.407  -1.203  14.118  1.00 0.00 ? 2  ASP B HB3  6  
ATOM 6146  N N    . ALA B 1 3  ? 15.651  -2.806  11.439  1.00 0.00 ? 3  ALA B N    6  
ATOM 6147  C CA   . ALA B 1 3  ? 15.047  -2.297  10.219  1.00 0.00 ? 3  ALA B CA   6  
ATOM 6148  C C    . ALA B 1 3  ? 13.693  -2.977  10.004  1.00 0.00 ? 3  ALA B C    6  
ATOM 6149  O O    . ALA B 1 3  ? 12.890  -2.457  9.215   1.00 0.00 ? 3  ALA B O    6  
ATOM 6150  C CB   . ALA B 1 3  ? 15.913  -2.677  9.017   1.00 0.00 ? 3  ALA B CB   6  
ATOM 6151  H H    . ALA B 1 3  ? 16.259  -3.622  11.367  1.00 0.00 ? 3  ALA B H    6  
ATOM 6152  H HA   . ALA B 1 3  ? 14.897  -1.219  10.274  1.00 0.00 ? 3  ALA B HA   6  
ATOM 6153  H HB1  . ALA B 1 3  ? 16.908  -2.250  9.148   1.00 0.00 ? 3  ALA B HB1  6  
ATOM 6154  H HB2  . ALA B 1 3  ? 15.998  -3.761  8.948   1.00 0.00 ? 3  ALA B HB2  6  
ATOM 6155  H HB3  . ALA B 1 3  ? 15.464  -2.297  8.099   1.00 0.00 ? 3  ALA B HB3  6  
ATOM 6156  N N    . ILE B 1 4  ? 13.471  -4.109  10.697  1.00 0.00 ? 4  ILE B N    6  
ATOM 6157  C CA   . ILE B 1 4  ? 12.226  -4.850  10.583  1.00 0.00 ? 4  ILE B CA   6  
ATOM 6158  C C    . ILE B 1 4  ? 11.120  -4.100  11.327  1.00 0.00 ? 4  ILE B C    6  
ATOM 6159  O O    . ILE B 1 4  ? 10.028  -3.944  10.761  1.00 0.00 ? 4  ILE B O    6  
ATOM 6160  C CB   . ILE B 1 4  ? 12.417  -6.293  11.055  1.00 0.00 ? 4  ILE B CB   6  
ATOM 6161  C CG1  . ILE B 1 4  ? 13.473  -7.010  10.211  1.00 0.00 ? 4  ILE B CG1  6  
ATOM 6162  C CG2  . ILE B 1 4  ? 11.085  -7.046  11.068  1.00 0.00 ? 4  ILE B CG2  6  
ATOM 6163  C CD1  . ILE B 1 4  ? 12.999  -8.410  9.813   1.00 0.00 ? 4  ILE B CD1  6  
ATOM 6164  H H    . ILE B 1 4  ? 14.187  -4.470  11.326  1.00 0.00 ? 4  ILE B H    6  
ATOM 6165  H HA   . ILE B 1 4  ? 11.982  -4.880  9.521   1.00 0.00 ? 4  ILE B HA   6  
ATOM 6166  H HB   . ILE B 1 4  ? 12.777  -6.211  12.080  1.00 0.00 ? 4  ILE B HB   6  
ATOM 6167  H HG12 . ILE B 1 4  ? 13.660  -6.429  9.308   1.00 0.00 ? 4  ILE B HG12 6  
ATOM 6168  H HG13 . ILE B 1 4  ? 14.397  -7.081  10.786  1.00 0.00 ? 4  ILE B HG13 6  
ATOM 6169  H HG21 . ILE B 1 4  ? 10.654  -7.056  10.067  1.00 0.00 ? 4  ILE B HG21 6  
ATOM 6170  H HG22 . ILE B 1 4  ? 11.258  -8.067  11.408  1.00 0.00 ? 4  ILE B HG22 6  
ATOM 6171  H HG23 . ILE B 1 4  ? 10.389  -6.558  11.750  1.00 0.00 ? 4  ILE B HG23 6  
ATOM 6172  H HD11 . ILE B 1 4  ? 12.075  -8.340  9.239   1.00 0.00 ? 4  ILE B HD11 6  
ATOM 6173  H HD12 . ILE B 1 4  ? 13.773  -8.891  9.215   1.00 0.00 ? 4  ILE B HD12 6  
ATOM 6174  H HD13 . ILE B 1 4  ? 12.817  -9.009  10.706  1.00 0.00 ? 4  ILE B HD13 6  
ATOM 6175  N N    . LYS B 1 5  ? 11.418  -3.658  12.563  1.00 0.00 ? 5  LYS B N    6  
ATOM 6176  C CA   . LYS B 1 5  ? 10.456  -2.934  13.374  1.00 0.00 ? 5  LYS B CA   6  
ATOM 6177  C C    . LYS B 1 5  ? 9.942   -1.724  12.590  1.00 0.00 ? 5  LYS B C    6  
ATOM 6178  O O    . LYS B 1 5  ? 8.767   -1.368  12.759  1.00 0.00 ? 5  LYS B O    6  
ATOM 6179  C CB   . LYS B 1 5  ? 11.064  -2.572  14.731  1.00 0.00 ? 5  LYS B CB   6  
ATOM 6180  C CG   . LYS B 1 5  ? 12.590  -2.499  14.646  1.00 0.00 ? 5  LYS B CG   6  
ATOM 6181  C CD   . LYS B 1 5  ? 13.146  -1.484  15.646  1.00 0.00 ? 5  LYS B CD   6  
ATOM 6182  C CE   . LYS B 1 5  ? 13.432  -2.143  16.997  1.00 0.00 ? 5  LYS B CE   6  
ATOM 6183  N NZ   . LYS B 1 5  ? 13.294  -1.164  18.088  1.00 0.00 ? 5  LYS B NZ   6  
ATOM 6184  H H    . LYS B 1 5  ? 12.345  -3.829  12.955  1.00 0.00 ? 5  LYS B H    6  
ATOM 6185  H HA   . LYS B 1 5  ? 9.628   -3.617  13.556  1.00 0.00 ? 5  LYS B HA   6  
ATOM 6186  H HB2  . LYS B 1 5  ? 10.679  -1.601  15.044  1.00 0.00 ? 5  LYS B HB2  6  
ATOM 6187  H HB3  . LYS B 1 5  ? 10.768  -3.325  15.462  1.00 0.00 ? 5  LYS B HB3  6  
ATOM 6188  H HG2  . LYS B 1 5  ? 13.005  -3.482  14.871  1.00 0.00 ? 5  LYS B HG2  6  
ATOM 6189  H HG3  . LYS B 1 5  ? 12.875  -2.217  13.633  1.00 0.00 ? 5  LYS B HG3  6  
ATOM 6190  H HD2  . LYS B 1 5  ? 14.073  -1.069  15.251  1.00 0.00 ? 5  LYS B HD2  6  
ATOM 6191  H HD3  . LYS B 1 5  ? 12.423  -0.678  15.771  1.00 0.00 ? 5  LYS B HD3  6  
ATOM 6192  H HE2  . LYS B 1 5  ? 12.721  -2.955  17.156  1.00 0.00 ? 5  LYS B HE2  6  
ATOM 6193  H HE3  . LYS B 1 5  ? 14.442  -2.552  16.990  1.00 0.00 ? 5  LYS B HE3  6  
ATOM 6194  H HZ1  . LYS B 1 5  ? 12.347  -0.783  18.095  1.00 0.00 ? 5  LYS B HZ1  6  
ATOM 6195  H HZ2  . LYS B 1 5  ? 13.488  -1.627  18.977  1.00 0.00 ? 5  LYS B HZ2  6  
ATOM 6196  H HZ3  . LYS B 1 5  ? 13.958  -0.403  17.959  1.00 0.00 ? 5  LYS B HZ3  6  
ATOM 6197  N N    . LYS B 1 6  ? 10.817  -1.128  11.761  1.00 0.00 ? 6  LYS B N    6  
ATOM 6198  C CA   . LYS B 1 6  ? 10.453  0.028   10.959  1.00 0.00 ? 6  LYS B CA   6  
ATOM 6199  C C    . LYS B 1 6  ? 9.885   -0.442  9.620   1.00 0.00 ? 6  LYS B C    6  
ATOM 6200  O O    . LYS B 1 6  ? 9.068   0.286   9.037   1.00 0.00 ? 6  LYS B O    6  
ATOM 6201  C CB   . LYS B 1 6  ? 11.643  0.981   10.822  1.00 0.00 ? 6  LYS B CB   6  
ATOM 6202  C CG   . LYS B 1 6  ? 12.392  1.118   12.149  1.00 0.00 ? 6  LYS B CG   6  
ATOM 6203  C CD   . LYS B 1 6  ? 13.539  2.124   12.030  1.00 0.00 ? 6  LYS B CD   6  
ATOM 6204  C CE   . LYS B 1 6  ? 13.598  3.036   13.256  1.00 0.00 ? 6  LYS B CE   6  
ATOM 6205  N NZ   . LYS B 1 6  ? 13.214  4.411   12.894  1.00 0.00 ? 6  LYS B NZ   6  
ATOM 6206  H H    . LYS B 1 6  ? 11.768  -1.486  11.680  1.00 0.00 ? 6  LYS B H    6  
ATOM 6207  H HA   . LYS B 1 6  ? 9.674   0.553   11.511  1.00 0.00 ? 6  LYS B HA   6  
ATOM 6208  H HB2  . LYS B 1 6  ? 12.326  0.588   10.069  1.00 0.00 ? 6  LYS B HB2  6  
ATOM 6209  H HB3  . LYS B 1 6  ? 11.280  1.956   10.498  1.00 0.00 ? 6  LYS B HB3  6  
ATOM 6210  H HG2  . LYS B 1 6  ? 11.696  1.463   12.915  1.00 0.00 ? 6  LYS B HG2  6  
ATOM 6211  H HG3  . LYS B 1 6  ? 12.781  0.142   12.438  1.00 0.00 ? 6  LYS B HG3  6  
ATOM 6212  H HD2  . LYS B 1 6  ? 14.480  1.579   11.949  1.00 0.00 ? 6  LYS B HD2  6  
ATOM 6213  H HD3  . LYS B 1 6  ? 13.395  2.720   11.129  1.00 0.00 ? 6  LYS B HD3  6  
ATOM 6214  H HE2  . LYS B 1 6  ? 12.909  2.664   14.014  1.00 0.00 ? 6  LYS B HE2  6  
ATOM 6215  H HE3  . LYS B 1 6  ? 14.609  3.029   13.662  1.00 0.00 ? 6  LYS B HE3  6  
ATOM 6216  H HZ1  . LYS B 1 6  ? 12.266  4.418   12.514  1.00 0.00 ? 6  LYS B HZ1  6  
ATOM 6217  H HZ2  . LYS B 1 6  ? 13.260  4.999   13.726  1.00 0.00 ? 6  LYS B HZ2  6  
ATOM 6218  H HZ3  . LYS B 1 6  ? 13.855  4.778   12.192  1.00 0.00 ? 6  LYS B HZ3  6  
ATOM 6219  N N    . LYS B 1 7  ? 10.319  -1.631  9.165   1.00 0.00 ? 7  LYS B N    6  
ATOM 6220  C CA   . LYS B 1 7  ? 9.857   -2.190  7.907   1.00 0.00 ? 7  LYS B CA   6  
ATOM 6221  C C    . LYS B 1 7  ? 8.330   -2.277  7.923   1.00 0.00 ? 7  LYS B C    6  
ATOM 6222  O O    . LYS B 1 7  ? 7.704   -1.837  6.946   1.00 0.00 ? 7  LYS B O    6  
ATOM 6223  C CB   . LYS B 1 7  ? 10.546  -3.529  7.630   1.00 0.00 ? 7  LYS B CB   6  
ATOM 6224  C CG   . LYS B 1 7  ? 10.080  -4.120  6.298   1.00 0.00 ? 7  LYS B CG   6  
ATOM 6225  C CD   . LYS B 1 7  ? 9.999   -3.041  5.217   1.00 0.00 ? 7  LYS B CD   6  
ATOM 6226  C CE   . LYS B 1 7  ? 10.191  -3.644  3.824   1.00 0.00 ? 7  LYS B CE   6  
ATOM 6227  N NZ   . LYS B 1 7  ? 10.489  -2.589  2.842   1.00 0.00 ? 7  LYS B NZ   6  
ATOM 6228  H H    . LYS B 1 7  ? 10.994  -2.168  9.709   1.00 0.00 ? 7  LYS B H    6  
ATOM 6229  H HA   . LYS B 1 7  ? 10.166  -1.494  7.127   1.00 0.00 ? 7  LYS B HA   6  
ATOM 6230  H HB2  . LYS B 1 7  ? 11.623  -3.370  7.589   1.00 0.00 ? 7  LYS B HB2  6  
ATOM 6231  H HB3  . LYS B 1 7  ? 10.318  -4.218  8.442   1.00 0.00 ? 7  LYS B HB3  6  
ATOM 6232  H HG2  . LYS B 1 7  ? 10.789  -4.886  5.983   1.00 0.00 ? 7  LYS B HG2  6  
ATOM 6233  H HG3  . LYS B 1 7  ? 9.101   -4.579  6.439   1.00 0.00 ? 7  LYS B HG3  6  
ATOM 6234  H HD2  . LYS B 1 7  ? 9.020   -2.564  5.265   1.00 0.00 ? 7  LYS B HD2  6  
ATOM 6235  H HD3  . LYS B 1 7  ? 10.767  -2.291  5.407   1.00 0.00 ? 7  LYS B HD3  6  
ATOM 6236  H HE2  . LYS B 1 7  ? 11.021  -4.349  3.851   1.00 0.00 ? 7  LYS B HE2  6  
ATOM 6237  H HE3  . LYS B 1 7  ? 9.284   -4.175  3.535   1.00 0.00 ? 7  LYS B HE3  6  
ATOM 6238  H HZ1  . LYS B 1 7  ? 11.338  -2.092  3.113   1.00 0.00 ? 7  LYS B HZ1  6  
ATOM 6239  H HZ2  . LYS B 1 7  ? 10.613  -3.015  1.923   1.00 0.00 ? 7  LYS B HZ2  6  
ATOM 6240  H HZ3  . LYS B 1 7  ? 9.716   -1.925  2.798   1.00 0.00 ? 7  LYS B HZ3  6  
ATOM 6241  N N    . MET B 1 8  ? 7.769   -2.833  9.012   1.00 0.00 ? 8  MET B N    6  
ATOM 6242  C CA   . MET B 1 8  ? 6.330   -2.973  9.149   1.00 0.00 ? 8  MET B CA   6  
ATOM 6243  C C    . MET B 1 8  ? 5.693   -1.586  9.261   1.00 0.00 ? 8  MET B C    6  
ATOM 6244  O O    . MET B 1 8  ? 4.512   -1.448  8.910   1.00 0.00 ? 8  MET B O    6  
ATOM 6245  C CB   . MET B 1 8  ? 5.991   -3.792  10.397  1.00 0.00 ? 8  MET B CB   6  
ATOM 6246  C CG   . MET B 1 8  ? 6.726   -3.249  11.624  1.00 0.00 ? 8  MET B CG   6  
ATOM 6247  S SD   . MET B 1 8  ? 5.531   -2.809  12.920  1.00 0.00 ? 8  MET B SD   6  
ATOM 6248  C CE   . MET B 1 8  ? 5.827   -4.161  14.096  1.00 0.00 ? 8  MET B CE   6  
ATOM 6249  H H    . MET B 1 8  ? 8.358   -3.170  9.772   1.00 0.00 ? 8  MET B H    6  
ATOM 6250  H HA   . MET B 1 8  ? 5.937   -3.474  8.264   1.00 0.00 ? 8  MET B HA   6  
ATOM 6251  H HB2  . MET B 1 8  ? 4.917   -3.741  10.573  1.00 0.00 ? 8  MET B HB2  6  
ATOM 6252  H HB3  . MET B 1 8  ? 6.272   -4.831  10.224  1.00 0.00 ? 8  MET B HB3  6  
ATOM 6253  H HG2  . MET B 1 8  ? 7.401   -4.013  12.010  1.00 0.00 ? 8  MET B HG2  6  
ATOM 6254  H HG3  . MET B 1 8  ? 7.307   -2.372  11.340  1.00 0.00 ? 8  MET B HG3  6  
ATOM 6255  H HE1  . MET B 1 8  ? 6.867   -4.148  14.422  1.00 0.00 ? 8  MET B HE1  6  
ATOM 6256  H HE2  . MET B 1 8  ? 5.166   -4.035  14.954  1.00 0.00 ? 8  MET B HE2  6  
ATOM 6257  H HE3  . MET B 1 8  ? 5.615   -5.119  13.622  1.00 0.00 ? 8  MET B HE3  6  
ATOM 6258  N N    . GLN B 1 9  ? 6.476   -0.602  9.740   1.00 0.00 ? 9  GLN B N    6  
ATOM 6259  C CA   . GLN B 1 9  ? 5.993   0.759   9.895   1.00 0.00 ? 9  GLN B CA   6  
ATOM 6260  C C    . GLN B 1 9  ? 6.008   1.460   8.534   1.00 0.00 ? 9  GLN B C    6  
ATOM 6261  O O    . GLN B 1 9  ? 5.243   2.419   8.356   1.00 0.00 ? 9  GLN B O    6  
ATOM 6262  C CB   . GLN B 1 9  ? 6.820   1.536   10.920  1.00 0.00 ? 9  GLN B CB   6  
ATOM 6263  C CG   . GLN B 1 9  ? 6.542   1.038   12.340  1.00 0.00 ? 9  GLN B CG   6  
ATOM 6264  C CD   . GLN B 1 9  ? 6.967   2.077   13.379  1.00 0.00 ? 9  GLN B CD   6  
ATOM 6265  O OE1  . GLN B 1 9  ? 6.352   3.119   13.541  1.00 0.00 ? 9  GLN B OE1  6  
ATOM 6266  N NE2  . GLN B 1 9  ? 8.050   1.738   14.073  1.00 0.00 ? 9  GLN B NE2  6  
ATOM 6267  H H    . GLN B 1 9  ? 7.441   -0.801  10.005  1.00 0.00 ? 9  GLN B H    6  
ATOM 6268  H HA   . GLN B 1 9  ? 4.963   0.693   10.247  1.00 0.00 ? 9  GLN B HA   6  
ATOM 6269  H HB2  . GLN B 1 9  ? 7.879   1.400   10.697  1.00 0.00 ? 9  GLN B HB2  6  
ATOM 6270  H HB3  . GLN B 1 9  ? 6.575   2.595   10.843  1.00 0.00 ? 9  GLN B HB3  6  
ATOM 6271  H HG2  . GLN B 1 9  ? 5.474   0.847   12.445  1.00 0.00 ? 9  GLN B HG2  6  
ATOM 6272  H HG3  . GLN B 1 9  ? 7.086   0.107   12.501  1.00 0.00 ? 9  GLN B HG3  6  
ATOM 6273  H HE21 . GLN B 1 9  ? 8.516   0.850   13.887  1.00 0.00 ? 9  GLN B HE21 6  
ATOM 6274  H HE22 . GLN B 1 9  ? 8.413   2.365   14.791  1.00 0.00 ? 9  GLN B HE22 6  
ATOM 6275  N N    . MET B 1 10 ? 6.865   0.976   7.617   1.00 0.00 ? 10 MET B N    6  
ATOM 6276  C CA   . MET B 1 10 ? 6.977   1.552   6.288   1.00 0.00 ? 10 MET B CA   6  
ATOM 6277  C C    . MET B 1 10 ? 5.843   1.020   5.409   1.00 0.00 ? 10 MET B C    6  
ATOM 6278  O O    . MET B 1 10 ? 5.293   1.801   4.619   1.00 0.00 ? 10 MET B O    6  
ATOM 6279  C CB   . MET B 1 10 ? 8.323   1.186   5.660   1.00 0.00 ? 10 MET B CB   6  
ATOM 6280  C CG   . MET B 1 10 ? 9.473   1.455   6.635   1.00 0.00 ? 10 MET B CG   6  
ATOM 6281  S SD   . MET B 1 10 ? 10.717  2.520   5.849   1.00 0.00 ? 10 MET B SD   6  
ATOM 6282  C CE   . MET B 1 10 ? 9.841   4.111   5.887   1.00 0.00 ? 10 MET B CE   6  
ATOM 6283  H H    . MET B 1 10 ? 7.462   0.181   7.846   1.00 0.00 ? 10 MET B H    6  
ATOM 6284  H HA   . MET B 1 10 ? 6.889   2.636   6.364   1.00 0.00 ? 10 MET B HA   6  
ATOM 6285  H HB2  . MET B 1 10 ? 8.318   0.128   5.402   1.00 0.00 ? 10 MET B HB2  6  
ATOM 6286  H HB3  . MET B 1 10 ? 8.462   1.774   4.753   1.00 0.00 ? 10 MET B HB3  6  
ATOM 6287  H HG2  . MET B 1 10 ? 9.087   1.956   7.523   1.00 0.00 ? 10 MET B HG2  6  
ATOM 6288  H HG3  . MET B 1 10 ? 9.927   0.509   6.929   1.00 0.00 ? 10 MET B HG3  6  
ATOM 6289  H HE1  . MET B 1 10 ? 9.604   4.381   6.916   1.00 0.00 ? 10 MET B HE1  6  
ATOM 6290  H HE2  . MET B 1 10 ? 10.474  4.876   5.438   1.00 0.00 ? 10 MET B HE2  6  
ATOM 6291  H HE3  . MET B 1 10 ? 8.914   4.039   5.317   1.00 0.00 ? 10 MET B HE3  6  
ATOM 6292  N N    . LEU B 1 11 ? 5.521   -0.277  5.563   1.00 0.00 ? 11 LEU B N    6  
ATOM 6293  C CA   . LEU B 1 11 ? 4.462   -0.904  4.789   1.00 0.00 ? 11 LEU B CA   6  
ATOM 6294  C C    . LEU B 1 11 ? 3.105   -0.494  5.363   1.00 0.00 ? 11 LEU B C    6  
ATOM 6295  O O    . LEU B 1 11 ? 2.125   -0.475  4.604   1.00 0.00 ? 11 LEU B O    6  
ATOM 6296  C CB   . LEU B 1 11 ? 4.671   -2.419  4.726   1.00 0.00 ? 11 LEU B CB   6  
ATOM 6297  C CG   . LEU B 1 11 ? 6.017   -2.888  4.169   1.00 0.00 ? 11 LEU B CG   6  
ATOM 6298  C CD1  . LEU B 1 11 ? 6.385   -4.269  4.716   1.00 0.00 ? 11 LEU B CD1  6  
ATOM 6299  C CD2  . LEU B 1 11 ? 6.016   -2.859  2.639   1.00 0.00 ? 11 LEU B CD2  6  
ATOM 6300  H H    . LEU B 1 11 ? 6.024   -0.851  6.239   1.00 0.00 ? 11 LEU B H    6  
ATOM 6301  H HA   . LEU B 1 11 ? 4.550   -0.517  3.774   1.00 0.00 ? 11 LEU B HA   6  
ATOM 6302  H HB2  . LEU B 1 11 ? 4.561   -2.787  5.746   1.00 0.00 ? 11 LEU B HB2  6  
ATOM 6303  H HB3  . LEU B 1 11 ? 3.858   -2.813  4.117   1.00 0.00 ? 11 LEU B HB3  6  
ATOM 6304  H HG   . LEU B 1 11 ? 6.744   -2.165  4.537   1.00 0.00 ? 11 LEU B HG   6  
ATOM 6305  H HD11 . LEU B 1 11 ? 5.617   -4.993  4.444   1.00 0.00 ? 11 LEU B HD11 6  
ATOM 6306  H HD12 . LEU B 1 11 ? 7.345   -4.571  4.300   1.00 0.00 ? 11 LEU B HD12 6  
ATOM 6307  H HD13 . LEU B 1 11 ? 6.466   -4.228  5.803   1.00 0.00 ? 11 LEU B HD13 6  
ATOM 6308  H HD21 . LEU B 1 11 ? 5.822   -1.847  2.286   1.00 0.00 ? 11 LEU B HD21 6  
ATOM 6309  H HD22 . LEU B 1 11 ? 6.987   -3.199  2.278   1.00 0.00 ? 11 LEU B HD22 6  
ATOM 6310  H HD23 . LEU B 1 11 ? 5.243   -3.524  2.255   1.00 0.00 ? 11 LEU B HD23 6  
ATOM 6311  N N    . LYS B 1 12 ? 3.074   -0.178  6.670   1.00 0.00 ? 12 LYS B N    6  
ATOM 6312  C CA   . LYS B 1 12 ? 1.848   0.227   7.335   1.00 0.00 ? 12 LYS B CA   6  
ATOM 6313  C C    . LYS B 1 12 ? 1.527   1.677   6.966   1.00 0.00 ? 12 LYS B C    6  
ATOM 6314  O O    . LYS B 1 12 ? 0.337   2.014   6.878   1.00 0.00 ? 12 LYS B O    6  
ATOM 6315  C CB   . LYS B 1 12 ? 1.951   -0.014  8.843   1.00 0.00 ? 12 LYS B CB   6  
ATOM 6316  C CG   . LYS B 1 12 ? 1.555   -1.450  9.197   1.00 0.00 ? 12 LYS B CG   6  
ATOM 6317  C CD   . LYS B 1 12 ? 0.256   -1.475  10.005  1.00 0.00 ? 12 LYS B CD   6  
ATOM 6318  C CE   . LYS B 1 12 ? -0.961  -1.587  9.083   1.00 0.00 ? 12 LYS B CE   6  
ATOM 6319  N NZ   . LYS B 1 12 ? -1.971  -2.483  9.671   1.00 0.00 ? 12 LYS B NZ   6  
ATOM 6320  H H    . LYS B 1 12 ? 3.929   -0.220  7.225   1.00 0.00 ? 12 LYS B H    6  
ATOM 6321  H HA   . LYS B 1 12 ? 1.059   -0.420  6.952   1.00 0.00 ? 12 LYS B HA   6  
ATOM 6322  H HB2  . LYS B 1 12 ? 2.980   0.157   9.159   1.00 0.00 ? 12 LYS B HB2  6  
ATOM 6323  H HB3  . LYS B 1 12 ? 1.299   0.690   9.360   1.00 0.00 ? 12 LYS B HB3  6  
ATOM 6324  H HG2  . LYS B 1 12 ? 1.411   -2.014  8.276   1.00 0.00 ? 12 LYS B HG2  6  
ATOM 6325  H HG3  . LYS B 1 12 ? 2.359   -1.906  9.772   1.00 0.00 ? 12 LYS B HG3  6  
ATOM 6326  H HD2  . LYS B 1 12 ? 0.273   -2.335  10.675  1.00 0.00 ? 12 LYS B HD2  6  
ATOM 6327  H HD3  . LYS B 1 12 ? 0.190   -0.564  10.599  1.00 0.00 ? 12 LYS B HD3  6  
ATOM 6328  H HE2  . LYS B 1 12 ? -1.399  -0.598  8.947   1.00 0.00 ? 12 LYS B HE2  6  
ATOM 6329  H HE3  . LYS B 1 12 ? -0.642  -1.971  8.114   1.00 0.00 ? 12 LYS B HE3  6  
ATOM 6330  H HZ1  . LYS B 1 12 ? -2.269  -2.123  10.577  1.00 0.00 ? 12 LYS B HZ1  6  
ATOM 6331  H HZ2  . LYS B 1 12 ? -2.771  -2.540  9.040   1.00 0.00 ? 12 LYS B HZ2  6  
ATOM 6332  H HZ3  . LYS B 1 12 ? -1.579  -3.415  9.796   1.00 0.00 ? 12 LYS B HZ3  6  
ATOM 6333  N N    . LEU B 1 13 ? 2.577   2.492   6.761   1.00 0.00 ? 13 LEU B N    6  
ATOM 6334  C CA   . LEU B 1 13 ? 2.408   3.891   6.404   1.00 0.00 ? 13 LEU B CA   6  
ATOM 6335  C C    . LEU B 1 13 ? 1.989   3.991   4.936   1.00 0.00 ? 13 LEU B C    6  
ATOM 6336  O O    . LEU B 1 13 ? 1.061   4.756   4.639   1.00 0.00 ? 13 LEU B O    6  
ATOM 6337  C CB   . LEU B 1 13 ? 3.671   4.686   6.740   1.00 0.00 ? 13 LEU B CB   6  
ATOM 6338  C CG   . LEU B 1 13 ? 3.505   6.205   6.825   1.00 0.00 ? 13 LEU B CG   6  
ATOM 6339  C CD1  . LEU B 1 13 ? 4.810   6.919   6.471   1.00 0.00 ? 13 LEU B CD1  6  
ATOM 6340  C CD2  . LEU B 1 13 ? 2.338   6.678   5.955   1.00 0.00 ? 13 LEU B CD2  6  
ATOM 6341  H H    . LEU B 1 13 ? 3.527   2.134   6.855   1.00 0.00 ? 13 LEU B H    6  
ATOM 6342  H HA   . LEU B 1 13 ? 1.601   4.274   7.030   1.00 0.00 ? 13 LEU B HA   6  
ATOM 6343  H HB2  . LEU B 1 13 ? 4.022   4.313   7.702   1.00 0.00 ? 13 LEU B HB2  6  
ATOM 6344  H HB3  . LEU B 1 13 ? 4.403   4.434   5.973   1.00 0.00 ? 13 LEU B HB3  6  
ATOM 6345  H HG   . LEU B 1 13 ? 3.273   6.407   7.870   1.00 0.00 ? 13 LEU B HG   6  
ATOM 6346  H HD11 . LEU B 1 13 ? 5.117   6.654   5.460   1.00 0.00 ? 13 LEU B HD11 6  
ATOM 6347  H HD12 . LEU B 1 13 ? 4.655   7.996   6.541   1.00 0.00 ? 13 LEU B HD12 6  
ATOM 6348  H HD13 . LEU B 1 13 ? 5.595   6.628   7.169   1.00 0.00 ? 13 LEU B HD13 6  
ATOM 6349  H HD21 . LEU B 1 13 ? 1.413   6.202   6.283   1.00 0.00 ? 13 LEU B HD21 6  
ATOM 6350  H HD22 . LEU B 1 13 ? 2.249   7.761   6.040   1.00 0.00 ? 13 LEU B HD22 6  
ATOM 6351  H HD23 . LEU B 1 13 ? 2.521   6.417   4.913   1.00 0.00 ? 13 LEU B HD23 6  
ATOM 6352  N N    . ASP B 1 14 ? 2.671   3.229   4.062   1.00 0.00 ? 14 ASP B N    6  
ATOM 6353  C CA   . ASP B 1 14 ? 2.373   3.233   2.640   1.00 0.00 ? 14 ASP B CA   6  
ATOM 6354  C C    . ASP B 1 14 ? 0.940   2.739   2.423   1.00 0.00 ? 14 ASP B C    6  
ATOM 6355  O O    . ASP B 1 14 ? 0.295   3.205   1.473   1.00 0.00 ? 14 ASP B O    6  
ATOM 6356  C CB   . ASP B 1 14 ? 3.315   2.300   1.877   1.00 0.00 ? 14 ASP B CB   6  
ATOM 6357  C CG   . ASP B 1 14 ? 3.824   2.846   0.541   1.00 0.00 ? 14 ASP B CG   6  
ATOM 6358  O OD1  . ASP B 1 14 ? 4.815   3.591   0.492   1.00 0.00 ? 14 ASP B OD1  6  
ATOM 6359  O OD2  . ASP B 1 14 ? 3.150   2.474   -0.492  1.00 0.00 ? 14 ASP B OD2  6  
ATOM 6360  H H    . ASP B 1 14 ? 3.424   2.625   4.392   1.00 0.00 ? 14 ASP B H    6  
ATOM 6361  H HA   . ASP B 1 14 ? 2.458   4.252   2.263   1.00 0.00 ? 14 ASP B HA   6  
ATOM 6362  H HB2  . ASP B 1 14 ? 4.167   2.107   2.529   1.00 0.00 ? 14 ASP B HB2  6  
ATOM 6363  H HB3  . ASP B 1 14 ? 2.774   1.368   1.715   1.00 0.00 ? 14 ASP B HB3  6  
ATOM 6364  N N    . ASN B 1 15 ? 0.482   1.822   3.293   1.00 0.00 ? 15 ASN B N    6  
ATOM 6365  C CA   . ASN B 1 15 ? -0.860  1.272   3.196   1.00 0.00 ? 15 ASN B CA   6  
ATOM 6366  C C    . ASN B 1 15 ? -1.881  2.390   3.419   1.00 0.00 ? 15 ASN B C    6  
ATOM 6367  O O    . ASN B 1 15 ? -2.796  2.526   2.594   1.00 0.00 ? 15 ASN B O    6  
ATOM 6368  C CB   . ASN B 1 15 ? -1.093  0.199   4.262   1.00 0.00 ? 15 ASN B CB   6  
ATOM 6369  C CG   . ASN B 1 15 ? -2.142  -0.814  3.798   1.00 0.00 ? 15 ASN B CG   6  
ATOM 6370  O OD1  . ASN B 1 15 ? -3.328  -0.681  4.055   1.00 0.00 ? 15 ASN B OD1  6  
ATOM 6371  N ND2  . ASN B 1 15 ? -1.641  -1.830  3.102   1.00 0.00 ? 15 ASN B ND2  6  
ATOM 6372  H H    . ASN B 1 15 ? 1.081   1.491   4.049   1.00 0.00 ? 15 ASN B H    6  
ATOM 6373  H HA   . ASN B 1 15 ? -1.001  0.856   2.199   1.00 0.00 ? 15 ASN B HA   6  
ATOM 6374  H HB2  . ASN B 1 15 ? -0.155  -0.322  4.450   1.00 0.00 ? 15 ASN B HB2  6  
ATOM 6375  H HB3  . ASN B 1 15 ? -1.424  0.681   5.182   1.00 0.00 ? 15 ASN B HB3  6  
ATOM 6376  H HD21 . ASN B 1 15 ? -0.638  -1.880  2.922   1.00 0.00 ? 15 ASN B HD21 6  
ATOM 6377  H HD22 . ASN B 1 15 ? -2.260  -2.561  2.748   1.00 0.00 ? 15 ASN B HD22 6  
ATOM 6378  N N    . TYR B 1 16 ? -1.707  3.155   4.512   1.00 0.00 ? 16 TYR B N    6  
ATOM 6379  C CA   . TYR B 1 16 ? -2.646  4.231   4.783   1.00 0.00 ? 16 TYR B CA   6  
ATOM 6380  C C    . TYR B 1 16 ? -2.603  5.240   3.634   1.00 0.00 ? 16 TYR B C    6  
ATOM 6381  O O    . TYR B 1 16 ? -3.653  5.830   3.338   1.00 0.00 ? 16 TYR B O    6  
ATOM 6382  C CB   . TYR B 1 16 ? -2.321  4.888   6.137   1.00 0.00 ? 16 TYR B CB   6  
ATOM 6383  C CG   . TYR B 1 16 ? -2.013  3.905   7.258   1.00 0.00 ? 16 TYR B CG   6  
ATOM 6384  C CD1  . TYR B 1 16 ? -2.663  2.651   7.309   1.00 0.00 ? 16 TYR B CD1  6  
ATOM 6385  C CD2  . TYR B 1 16 ? -1.076  4.248   8.260   1.00 0.00 ? 16 TYR B CD2  6  
ATOM 6386  C CE1  . TYR B 1 16 ? -2.377  1.744   8.352   1.00 0.00 ? 16 TYR B CE1  6  
ATOM 6387  C CE2  . TYR B 1 16 ? -0.789  3.341   9.303   1.00 0.00 ? 16 TYR B CE2  6  
ATOM 6388  C CZ   . TYR B 1 16 ? -1.438  2.088   9.350   1.00 0.00 ? 16 TYR B CZ   6  
ATOM 6389  O OH   . TYR B 1 16 ? -1.157  1.214   10.361  1.00 0.00 ? 16 TYR B OH   6  
ATOM 6390  H H    . TYR B 1 16 ? -0.939  2.990   5.146   1.00 0.00 ? 16 TYR B H    6  
ATOM 6391  H HA   . TYR B 1 16 ? -3.650  3.804   4.823   1.00 0.00 ? 16 TYR B HA   6  
ATOM 6392  H HB2  . TYR B 1 16 ? -1.478  5.571   6.009   1.00 0.00 ? 16 TYR B HB2  6  
ATOM 6393  H HB3  . TYR B 1 16 ? -3.175  5.492   6.450   1.00 0.00 ? 16 TYR B HB3  6  
ATOM 6394  H HD1  . TYR B 1 16 ? -3.383  2.380   6.551   1.00 0.00 ? 16 TYR B HD1  6  
ATOM 6395  H HD2  . TYR B 1 16 ? -0.575  5.205   8.232   1.00 0.00 ? 16 TYR B HD2  6  
ATOM 6396  H HE1  . TYR B 1 16 ? -2.878  0.788   8.384   1.00 0.00 ? 16 TYR B HE1  6  
ATOM 6397  H HE2  . TYR B 1 16 ? -0.070  3.611   10.064  1.00 0.00 ? 16 TYR B HE2  6  
ATOM 6398  H HH   . TYR B 1 16 ? -1.713  1.330   11.135  1.00 0.00 ? 16 TYR B HH   6  
ATOM 6399  N N    . HIS B 1 17 ? -1.416  5.426   3.029   1.00 0.00 ? 17 HIS B N    6  
ATOM 6400  C CA   . HIS B 1 17 ? -1.250  6.366   1.933   1.00 0.00 ? 17 HIS B CA   6  
ATOM 6401  C C    . HIS B 1 17 ? -1.904  5.795   0.674   1.00 0.00 ? 17 HIS B C    6  
ATOM 6402  O O    . HIS B 1 17 ? -2.458  6.580   -0.110  1.00 0.00 ? 17 HIS B O    6  
ATOM 6403  C CB   . HIS B 1 17 ? 0.227   6.713   1.729   1.00 0.00 ? 17 HIS B CB   6  
ATOM 6404  C CG   . HIS B 1 17 ? 0.676   6.661   0.288   1.00 0.00 ? 17 HIS B CG   6  
ATOM 6405  N ND1  . HIS B 1 17 ? 0.667   7.771   -0.539  1.00 0.00 ? 17 HIS B ND1  6  
ATOM 6406  C CD2  . HIS B 1 17 ? 1.148   5.625   -0.462  1.00 0.00 ? 17 HIS B CD2  6  
ATOM 6407  C CE1  . HIS B 1 17 ? 1.115   7.406   -1.732  1.00 0.00 ? 17 HIS B CE1  6  
ATOM 6408  N NE2  . HIS B 1 17 ? 1.411   6.075   -1.682  1.00 0.00 ? 17 HIS B NE2  6  
ATOM 6409  H H    . HIS B 1 17 ? -0.599  4.898   3.336   1.00 0.00 ? 17 HIS B H    6  
ATOM 6410  H HA   . HIS B 1 17 ? -1.772  7.276   2.224   1.00 0.00 ? 17 HIS B HA   6  
ATOM 6411  H HB2  . HIS B 1 17 ? 0.381   7.720   2.114   1.00 0.00 ? 17 HIS B HB2  6  
ATOM 6412  H HB3  . HIS B 1 17 ? 0.810   6.012   2.326   1.00 0.00 ? 17 HIS B HB3  6  
ATOM 6413  H HD1  . HIS B 1 17 ? 0.390   8.738   -0.372  1.00 0.00 ? 17 HIS B HD1  6  
ATOM 6414  H HD2  . HIS B 1 17 ? 1.320   4.586   -0.221  1.00 0.00 ? 17 HIS B HD2  6  
ATOM 6415  H HE1  . HIS B 1 17 ? 1.185   8.133   -2.527  1.00 0.00 ? 17 HIS B HE1  6  
ATOM 6416  N N    . LEU B 1 18 ? -1.829  4.463   0.507   1.00 0.00 ? 18 LEU B N    6  
ATOM 6417  C CA   . LEU B 1 18 ? -2.411  3.798   -0.646  1.00 0.00 ? 18 LEU B CA   6  
ATOM 6418  C C    . LEU B 1 18 ? -3.936  3.820   -0.528  1.00 0.00 ? 18 LEU B C    6  
ATOM 6419  O O    . LEU B 1 18 ? -4.605  3.977   -1.559  1.00 0.00 ? 18 LEU B O    6  
ATOM 6420  C CB   . LEU B 1 18 ? -1.826  2.392   -0.806  1.00 0.00 ? 18 LEU B CB   6  
ATOM 6421  C CG   . LEU B 1 18 ? -0.399  2.317   -1.353  1.00 0.00 ? 18 LEU B CG   6  
ATOM 6422  C CD1  . LEU B 1 18 ? 0.186   0.915   -1.167  1.00 0.00 ? 18 LEU B CD1  6  
ATOM 6423  C CD2  . LEU B 1 18 ? -0.349  2.770   -2.814  1.00 0.00 ? 18 LEU B CD2  6  
ATOM 6424  H H    . LEU B 1 18 ? -1.354  3.888   1.202   1.00 0.00 ? 18 LEU B H    6  
ATOM 6425  H HA   . LEU B 1 18 ? -2.114  4.378   -1.520  1.00 0.00 ? 18 LEU B HA   6  
ATOM 6426  H HB2  . LEU B 1 18 ? -1.850  1.936   0.184   1.00 0.00 ? 18 LEU B HB2  6  
ATOM 6427  H HB3  . LEU B 1 18 ? -2.507  1.851   -1.464  1.00 0.00 ? 18 LEU B HB3  6  
ATOM 6428  H HG   . LEU B 1 18 ? 0.176   3.015   -0.746  1.00 0.00 ? 18 LEU B HG   6  
ATOM 6429  H HD11 . LEU B 1 18 ? -0.432  0.183   -1.687  1.00 0.00 ? 18 LEU B HD11 6  
ATOM 6430  H HD12 . LEU B 1 18 ? 1.199   0.899   -1.568  1.00 0.00 ? 18 LEU B HD12 6  
ATOM 6431  H HD13 . LEU B 1 18 ? 0.219   0.664   -0.107  1.00 0.00 ? 18 LEU B HD13 6  
ATOM 6432  H HD21 . LEU B 1 18 ? -0.706  3.796   -2.898  1.00 0.00 ? 18 LEU B HD21 6  
ATOM 6433  H HD22 . LEU B 1 18 ? 0.679   2.703   -3.171  1.00 0.00 ? 18 LEU B HD22 6  
ATOM 6434  H HD23 . LEU B 1 18 ? -0.979  2.124   -3.426  1.00 0.00 ? 18 LEU B HD23 6  
ATOM 6435  N N    . GLU B 1 19 ? -4.446  3.663   0.707   1.00 0.00 ? 19 GLU B N    6  
ATOM 6436  C CA   . GLU B 1 19 ? -5.877  3.664   0.955   1.00 0.00 ? 19 GLU B CA   6  
ATOM 6437  C C    . GLU B 1 19 ? -6.439  5.058   0.664   1.00 0.00 ? 19 GLU B C    6  
ATOM 6438  O O    . GLU B 1 19 ? -7.436  5.151   -0.066  1.00 0.00 ? 19 GLU B O    6  
ATOM 6439  C CB   . GLU B 1 19 ? -6.200  3.231   2.386   1.00 0.00 ? 19 GLU B CB   6  
ATOM 6440  C CG   . GLU B 1 19 ? -7.497  2.418   2.433   1.00 0.00 ? 19 GLU B CG   6  
ATOM 6441  C CD   . GLU B 1 19 ? -8.707  3.330   2.646   1.00 0.00 ? 19 GLU B CD   6  
ATOM 6442  O OE1  . GLU B 1 19 ? -8.772  4.422   2.063   1.00 0.00 ? 19 GLU B OE1  6  
ATOM 6443  O OE2  . GLU B 1 19 ? -9.603  2.867   3.452   1.00 0.00 ? 19 GLU B OE2  6  
ATOM 6444  H H    . GLU B 1 19 ? -3.822  3.538   1.504   1.00 0.00 ? 19 GLU B H    6  
ATOM 6445  H HA   . GLU B 1 19 ? -6.321  2.951   0.259   1.00 0.00 ? 19 GLU B HA   6  
ATOM 6446  H HB2  . GLU B 1 19 ? -5.383  2.615   2.763   1.00 0.00 ? 19 GLU B HB2  6  
ATOM 6447  H HB3  . GLU B 1 19 ? -6.295  4.117   3.012   1.00 0.00 ? 19 GLU B HB3  6  
ATOM 6448  H HG2  . GLU B 1 19 ? -7.615  1.886   1.489   1.00 0.00 ? 19 GLU B HG2  6  
ATOM 6449  H HG3  . GLU B 1 19 ? -7.430  1.693   3.244   1.00 0.00 ? 19 GLU B HG3  6  
ATOM 6450  N N    . ASN B 1 20 ? -5.799  6.096   1.232   1.00 0.00 ? 20 ASN B N    6  
ATOM 6451  C CA   . ASN B 1 20 ? -6.232  7.468   1.034   1.00 0.00 ? 20 ASN B CA   6  
ATOM 6452  C C    . ASN B 1 20 ? -6.113  7.828   -0.448  1.00 0.00 ? 20 ASN B C    6  
ATOM 6453  O O    . ASN B 1 20 ? -6.925  8.634   -0.926  1.00 0.00 ? 20 ASN B O    6  
ATOM 6454  C CB   . ASN B 1 20 ? -5.357  8.441   1.828   1.00 0.00 ? 20 ASN B CB   6  
ATOM 6455  C CG   . ASN B 1 20 ? -5.896  8.630   3.248   1.00 0.00 ? 20 ASN B CG   6  
ATOM 6456  O OD1  . ASN B 1 20 ? -6.959  9.185   3.467   1.00 0.00 ? 20 ASN B OD1  6  
ATOM 6457  N ND2  . ASN B 1 20 ? -5.104  8.137   4.196   1.00 0.00 ? 20 ASN B ND2  6  
ATOM 6458  H H    . ASN B 1 20 ? -4.983  5.930   1.821   1.00 0.00 ? 20 ASN B H    6  
ATOM 6459  H HA   . ASN B 1 20 ? -7.275  7.559   1.340   1.00 0.00 ? 20 ASN B HA   6  
ATOM 6460  H HB2  . ASN B 1 20 ? -4.344  8.042   1.883   1.00 0.00 ? 20 ASN B HB2  6  
ATOM 6461  H HB3  . ASN B 1 20 ? -5.334  9.400   1.309   1.00 0.00 ? 20 ASN B HB3  6  
ATOM 6462  H HD21 . ASN B 1 20 ? -4.225  7.684   3.944   1.00 0.00 ? 20 ASN B HD21 6  
ATOM 6463  H HD22 . ASN B 1 20 ? -5.374  8.213   5.177   1.00 0.00 ? 20 ASN B HD22 6  
ATOM 6464  N N    . GLU B 1 21 ? -5.121  7.233   -1.135  1.00 0.00 ? 21 GLU B N    6  
ATOM 6465  C CA   . GLU B 1 21 ? -4.902  7.490   -2.548  1.00 0.00 ? 21 GLU B CA   6  
ATOM 6466  C C    . GLU B 1 21 ? -5.909  6.684   -3.370  1.00 0.00 ? 21 GLU B C    6  
ATOM 6467  O O    . GLU B 1 21 ? -6.277  7.140   -4.463  1.00 0.00 ? 21 GLU B O    6  
ATOM 6468  C CB   . GLU B 1 21 ? -3.466  7.159   -2.963  1.00 0.00 ? 21 GLU B CB   6  
ATOM 6469  C CG   . GLU B 1 21 ? -3.171  7.675   -4.373  1.00 0.00 ? 21 GLU B CG   6  
ATOM 6470  C CD   . GLU B 1 21 ? -2.401  8.996   -4.324  1.00 0.00 ? 21 GLU B CD   6  
ATOM 6471  O OE1  . GLU B 1 21 ? -2.794  9.823   -3.415  1.00 0.00 ? 21 GLU B OE1  6  
ATOM 6472  O OE2  . GLU B 1 21 ? -1.478  9.205   -5.123  1.00 0.00 ? 21 GLU B OE2  6  
ATOM 6473  H H    . GLU B 1 21 ? -4.495  6.581   -0.663  1.00 0.00 ? 21 GLU B H    6  
ATOM 6474  H HA   . GLU B 1 21 ? -5.081  8.553   -2.710  1.00 0.00 ? 21 GLU B HA   6  
ATOM 6475  H HB2  . GLU B 1 21 ? -2.778  7.631   -2.262  1.00 0.00 ? 21 GLU B HB2  6  
ATOM 6476  H HB3  . GLU B 1 21 ? -3.327  6.080   -2.925  1.00 0.00 ? 21 GLU B HB3  6  
ATOM 6477  H HG2  . GLU B 1 21 ? -2.571  6.934   -4.901  1.00 0.00 ? 21 GLU B HG2  6  
ATOM 6478  H HG3  . GLU B 1 21 ? -4.113  7.813   -4.903  1.00 0.00 ? 21 GLU B HG3  6  
ATOM 6479  N N    . VAL B 1 22 ? -6.329  5.522   -2.839  1.00 0.00 ? 22 VAL B N    6  
ATOM 6480  C CA   . VAL B 1 22 ? -7.285  4.665   -3.518  1.00 0.00 ? 22 VAL B CA   6  
ATOM 6481  C C    . VAL B 1 22 ? -8.693  5.236   -3.340  1.00 0.00 ? 22 VAL B C    6  
ATOM 6482  O O    . VAL B 1 22 ? -9.448  5.257   -4.322  1.00 0.00 ? 22 VAL B O    6  
ATOM 6483  C CB   . VAL B 1 22 ? -7.153  3.228   -3.009  1.00 0.00 ? 22 VAL B CB   6  
ATOM 6484  C CG1  . VAL B 1 22 ? -8.490  2.489   -3.101  1.00 0.00 ? 22 VAL B CG1  6  
ATOM 6485  C CG2  . VAL B 1 22 ? -6.058  2.475   -3.766  1.00 0.00 ? 22 VAL B CG2  6  
ATOM 6486  H H    . VAL B 1 22 ? -5.976  5.220   -1.931  1.00 0.00 ? 22 VAL B H    6  
ATOM 6487  H HA   . VAL B 1 22 ? -7.030  4.669   -4.579  1.00 0.00 ? 22 VAL B HA   6  
ATOM 6488  H HB   . VAL B 1 22 ? -6.865  3.311   -1.961  1.00 0.00 ? 22 VAL B HB   6  
ATOM 6489  H HG11 . VAL B 1 22 ? -8.831  2.467   -4.135  1.00 0.00 ? 22 VAL B HG11 6  
ATOM 6490  H HG12 . VAL B 1 22 ? -8.360  1.472   -2.730  1.00 0.00 ? 22 VAL B HG12 6  
ATOM 6491  H HG13 . VAL B 1 22 ? -9.237  2.996   -2.491  1.00 0.00 ? 22 VAL B HG13 6  
ATOM 6492  H HG21 . VAL B 1 22 ? -5.101  2.984   -3.640  1.00 0.00 ? 22 VAL B HG21 6  
ATOM 6493  H HG22 . VAL B 1 22 ? -5.992  1.459   -3.378  1.00 0.00 ? 22 VAL B HG22 6  
ATOM 6494  H HG23 . VAL B 1 22 ? -6.300  2.436   -4.828  1.00 0.00 ? 22 VAL B HG23 6  
ATOM 6495  N N    . ALA B 1 23 ? -9.012  5.679   -2.112  1.00 0.00 ? 23 ALA B N    6  
ATOM 6496  C CA   . ALA B 1 23 ? -10.317 6.244   -1.811  1.00 0.00 ? 23 ALA B CA   6  
ATOM 6497  C C    . ALA B 1 23 ? -10.458 7.594   -2.518  1.00 0.00 ? 23 ALA B C    6  
ATOM 6498  O O    . ALA B 1 23 ? -11.595 8.069   -2.661  1.00 0.00 ? 23 ALA B O    6  
ATOM 6499  C CB   . ALA B 1 23 ? -10.421 6.531   -0.312  1.00 0.00 ? 23 ALA B CB   6  
ATOM 6500  H H    . ALA B 1 23 ? -8.329  5.625   -1.356  1.00 0.00 ? 23 ALA B H    6  
ATOM 6501  H HA   . ALA B 1 23 ? -11.118 5.584   -2.144  1.00 0.00 ? 23 ALA B HA   6  
ATOM 6502  H HB1  . ALA B 1 23 ? -10.281 5.601   0.238   1.00 0.00 ? 23 ALA B HB1  6  
ATOM 6503  H HB2  . ALA B 1 23 ? -9.648  7.240   -0.015  1.00 0.00 ? 23 ALA B HB2  6  
ATOM 6504  H HB3  . ALA B 1 23 ? -11.398 6.956   -0.082  1.00 0.00 ? 23 ALA B HB3  6  
ATOM 6505  N N    . ARG B 1 24 ? -9.320  8.176   -2.938  1.00 0.00 ? 24 ARG B N    6  
ATOM 6506  C CA   . ARG B 1 24 ? -9.317  9.457   -3.622  1.00 0.00 ? 24 ARG B CA   6  
ATOM 6507  C C    . ARG B 1 24 ? -9.336  9.225   -5.133  1.00 0.00 ? 24 ARG B C    6  
ATOM 6508  O O    . ARG B 1 24 ? -9.791  10.117  -5.863  1.00 0.00 ? 24 ARG B O    6  
ATOM 6509  C CB   . ARG B 1 24 ? -8.087  10.290  -3.255  1.00 0.00 ? 24 ARG B CB   6  
ATOM 6510  C CG   . ARG B 1 24 ? -8.403  11.264  -2.119  1.00 0.00 ? 24 ARG B CG   6  
ATOM 6511  C CD   . ARG B 1 24 ? -8.770  10.513  -0.838  1.00 0.00 ? 24 ARG B CD   6  
ATOM 6512  N NE   . ARG B 1 24 ? -9.948  11.142  -0.201  1.00 0.00 ? 24 ARG B NE   6  
ATOM 6513  C CZ   . ARG B 1 24 ? -10.534 10.686  0.927   1.00 0.00 ? 24 ARG B CZ   6  
ATOM 6514  N NH1  . ARG B 1 24 ? -10.031 9.597   1.524   1.00 0.00 ? 24 ARG B NH1  6  
ATOM 6515  N NH2  . ARG B 1 24 ? -11.600 11.313  1.442   1.00 0.00 ? 24 ARG B NH2  6  
ATOM 6516  H H    . ARG B 1 24 ? -8.424  7.716   -2.779  1.00 0.00 ? 24 ARG B H    6  
ATOM 6517  H HA   . ARG B 1 24 ? -10.224 9.991   -3.334  1.00 0.00 ? 24 ARG B HA   6  
ATOM 6518  H HB2  . ARG B 1 24 ? -7.289  9.620   -2.937  1.00 0.00 ? 24 ARG B HB2  6  
ATOM 6519  H HB3  . ARG B 1 24 ? -7.757  10.841  -4.136  1.00 0.00 ? 24 ARG B HB3  6  
ATOM 6520  H HG2  . ARG B 1 24 ? -7.526  11.883  -1.929  1.00 0.00 ? 24 ARG B HG2  6  
ATOM 6521  H HG3  . ARG B 1 24 ? -9.230  11.906  -2.423  1.00 0.00 ? 24 ARG B HG3  6  
ATOM 6522  H HD2  . ARG B 1 24 ? -9.008  9.477   -1.080  1.00 0.00 ? 24 ARG B HD2  6  
ATOM 6523  H HD3  . ARG B 1 24 ? -7.923  10.531  -0.152  1.00 0.00 ? 24 ARG B HD3  6  
ATOM 6524  H HE   . ARG B 1 24 ? -10.317 11.971  -0.668  1.00 0.00 ? 24 ARG B HE   6  
ATOM 6525  H HH11 . ARG B 1 24 ? -9.219  9.125   1.126   1.00 0.00 ? 24 ARG B HH11 6  
ATOM 6526  H HH12 . ARG B 1 24 ? -10.462 9.239   2.376   1.00 0.00 ? 24 ARG B HH12 6  
ATOM 6527  H HH21 . ARG B 1 24 ? -11.975 12.143  0.980   1.00 0.00 ? 24 ARG B HH21 6  
ATOM 6528  H HH22 . ARG B 1 24 ? -12.035 10.963  2.294   1.00 0.00 ? 24 ARG B HH22 6  
ATOM 6529  N N    . LEU B 1 25 ? -8.847  8.048   -5.567  1.00 0.00 ? 25 LEU B N    6  
ATOM 6530  C CA   . LEU B 1 25 ? -8.808  7.705   -6.978  1.00 0.00 ? 25 LEU B CA   6  
ATOM 6531  C C    . LEU B 1 25 ? -10.135 7.058   -7.379  1.00 0.00 ? 25 LEU B C    6  
ATOM 6532  O O    . LEU B 1 25 ? -10.614 7.332   -8.490  1.00 0.00 ? 25 LEU B O    6  
ATOM 6533  C CB   . LEU B 1 25 ? -7.584  6.838   -7.284  1.00 0.00 ? 25 LEU B CB   6  
ATOM 6534  C CG   . LEU B 1 25 ? -6.250  7.576   -7.399  1.00 0.00 ? 25 LEU B CG   6  
ATOM 6535  C CD1  . LEU B 1 25 ? -5.079  6.592   -7.432  1.00 0.00 ? 25 LEU B CD1  6  
ATOM 6536  C CD2  . LEU B 1 25 ? -6.244  8.515   -8.606  1.00 0.00 ? 25 LEU B CD2  6  
ATOM 6537  H H    . LEU B 1 25 ? -8.490  7.367   -4.898  1.00 0.00 ? 25 LEU B H    6  
ATOM 6538  H HA   . LEU B 1 25 ? -8.690  8.642   -7.522  1.00 0.00 ? 25 LEU B HA   6  
ATOM 6539  H HB2  . LEU B 1 25 ? -7.517  6.106   -6.480  1.00 0.00 ? 25 LEU B HB2  6  
ATOM 6540  H HB3  . LEU B 1 25 ? -7.803  6.318   -8.218  1.00 0.00 ? 25 LEU B HB3  6  
ATOM 6541  H HG   . LEU B 1 25 ? -6.175  8.170   -6.487  1.00 0.00 ? 25 LEU B HG   6  
ATOM 6542  H HD11 . LEU B 1 25 ? -5.185  5.919   -8.283  1.00 0.00 ? 25 LEU B HD11 6  
ATOM 6543  H HD12 . LEU B 1 25 ? -4.147  7.152   -7.514  1.00 0.00 ? 25 LEU B HD12 6  
ATOM 6544  H HD13 . LEU B 1 25 ? -5.061  6.004   -6.514  1.00 0.00 ? 25 LEU B HD13 6  
ATOM 6545  H HD21 . LEU B 1 25 ? -7.046  9.247   -8.512  1.00 0.00 ? 25 LEU B HD21 6  
ATOM 6546  H HD22 . LEU B 1 25 ? -5.281  9.023   -8.656  1.00 0.00 ? 25 LEU B HD22 6  
ATOM 6547  H HD23 . LEU B 1 25 ? -6.392  7.943   -9.522  1.00 0.00 ? 25 LEU B HD23 6  
ATOM 6548  N N    . LYS B 1 26 ? -10.695 6.227   -6.482  1.00 0.00 ? 26 LYS B N    6  
ATOM 6549  C CA   . LYS B 1 26 ? -11.955 5.550   -6.740  1.00 0.00 ? 26 LYS B CA   6  
ATOM 6550  C C    . LYS B 1 26 ? -13.066 6.590   -6.891  1.00 0.00 ? 26 LYS B C    6  
ATOM 6551  O O    . LYS B 1 26 ? -14.067 6.291   -7.558  1.00 0.00 ? 26 LYS B O    6  
ATOM 6552  C CB   . LYS B 1 26 ? -12.233 4.505   -5.658  1.00 0.00 ? 26 LYS B CB   6  
ATOM 6553  C CG   . LYS B 1 26 ? -12.158 3.089   -6.232  1.00 0.00 ? 26 LYS B CG   6  
ATOM 6554  C CD   . LYS B 1 26 ? -10.980 2.950   -7.198  1.00 0.00 ? 26 LYS B CD   6  
ATOM 6555  C CE   . LYS B 1 26 ? -11.454 2.996   -8.652  1.00 0.00 ? 26 LYS B CE   6  
ATOM 6556  N NZ   . LYS B 1 26 ? -11.404 1.653   -9.253  1.00 0.00 ? 26 LYS B NZ   6  
ATOM 6557  H H    . LYS B 1 26 ? -10.234 6.056   -5.588  1.00 0.00 ? 26 LYS B H    6  
ATOM 6558  H HA   . LYS B 1 26 ? -11.833 5.021   -7.686  1.00 0.00 ? 26 LYS B HA   6  
ATOM 6559  H HB2  . LYS B 1 26 ? -11.491 4.608   -4.867  1.00 0.00 ? 26 LYS B HB2  6  
ATOM 6560  H HB3  . LYS B 1 26 ? -13.224 4.685   -5.241  1.00 0.00 ? 26 LYS B HB3  6  
ATOM 6561  H HG2  . LYS B 1 26 ? -12.030 2.381   -5.412  1.00 0.00 ? 26 LYS B HG2  6  
ATOM 6562  H HG3  . LYS B 1 26 ? -13.092 2.867   -6.749  1.00 0.00 ? 26 LYS B HG3  6  
ATOM 6563  H HD2  . LYS B 1 26 ? -10.282 3.770   -7.027  1.00 0.00 ? 26 LYS B HD2  6  
ATOM 6564  H HD3  . LYS B 1 26 ? -10.472 2.005   -7.003  1.00 0.00 ? 26 LYS B HD3  6  
ATOM 6565  H HE2  . LYS B 1 26 ? -12.481 3.359   -8.682  1.00 0.00 ? 26 LYS B HE2  6  
ATOM 6566  H HE3  . LYS B 1 26 ? -10.819 3.679   -9.215  1.00 0.00 ? 26 LYS B HE3  6  
ATOM 6567  H HZ1  . LYS B 1 26 ? -11.999 1.013   -8.726  1.00 0.00 ? 26 LYS B HZ1  6  
ATOM 6568  H HZ2  . LYS B 1 26 ? -11.724 1.709   -10.220 1.00 0.00 ? 26 LYS B HZ2  6  
ATOM 6569  H HZ3  . LYS B 1 26 ? -10.446 1.302   -9.241  1.00 0.00 ? 26 LYS B HZ3  6  
ATOM 6570  N N    . LYS B 1 27 ? -12.872 7.773   -6.280  1.00 0.00 ? 27 LYS B N    6  
ATOM 6571  C CA   . LYS B 1 27 ? -13.851 8.844   -6.347  1.00 0.00 ? 27 LYS B CA   6  
ATOM 6572  C C    . LYS B 1 27 ? -13.708 9.578   -7.682  1.00 0.00 ? 27 LYS B C    6  
ATOM 6573  O O    . LYS B 1 27 ? -14.597 10.374  -8.015  1.00 0.00 ? 27 LYS B O    6  
ATOM 6574  C CB   . LYS B 1 27 ? -13.728 9.759   -5.126  1.00 0.00 ? 27 LYS B CB   6  
ATOM 6575  C CG   . LYS B 1 27 ? -15.105 10.100  -4.556  1.00 0.00 ? 27 LYS B CG   6  
ATOM 6576  C CD   . LYS B 1 27 ? -15.305 11.615  -4.473  1.00 0.00 ? 27 LYS B CD   6  
ATOM 6577  C CE   . LYS B 1 27 ? -14.605 12.193  -3.242  1.00 0.00 ? 27 LYS B CE   6  
ATOM 6578  N NZ   . LYS B 1 27 ? -14.063 13.530  -3.537  1.00 0.00 ? 27 LYS B NZ   6  
ATOM 6579  H H    . LYS B 1 27 ? -12.016 7.938   -5.751  1.00 0.00 ? 27 LYS B H    6  
ATOM 6580  H HA   . LYS B 1 27 ? -14.831 8.370   -6.305  1.00 0.00 ? 27 LYS B HA   6  
ATOM 6581  H HB2  . LYS B 1 27 ? -13.143 9.249   -4.360  1.00 0.00 ? 27 LYS B HB2  6  
ATOM 6582  H HB3  . LYS B 1 27 ? -13.211 10.672  -5.420  1.00 0.00 ? 27 LYS B HB3  6  
ATOM 6583  H HG2  . LYS B 1 27 ? -15.873 9.676   -5.205  1.00 0.00 ? 27 LYS B HG2  6  
ATOM 6584  H HG3  . LYS B 1 27 ? -15.196 9.658   -3.563  1.00 0.00 ? 27 LYS B HG3  6  
ATOM 6585  H HD2  . LYS B 1 27 ? -14.888 12.076  -5.368  1.00 0.00 ? 27 LYS B HD2  6  
ATOM 6586  H HD3  . LYS B 1 27 ? -16.373 11.829  -4.428  1.00 0.00 ? 27 LYS B HD3  6  
ATOM 6587  H HE2  . LYS B 1 27 ? -15.322 12.274  -2.426  1.00 0.00 ? 27 LYS B HE2  6  
ATOM 6588  H HE3  . LYS B 1 27 ? -13.799 11.525  -2.941  1.00 0.00 ? 27 LYS B HE3  6  
ATOM 6589  H HZ1  . LYS B 1 27 ? -14.819 14.157  -3.820  1.00 0.00 ? 27 LYS B HZ1  6  
ATOM 6590  H HZ2  . LYS B 1 27 ? -13.603 13.894  -2.703  1.00 0.00 ? 27 LYS B HZ2  6  
ATOM 6591  H HZ3  . LYS B 1 27 ? -13.383 13.471  -4.294  1.00 0.00 ? 27 LYS B HZ3  6  
ATOM 6592  N N    . LEU B 1 28 ? -12.611 9.300   -8.407  1.00 0.00 ? 28 LEU B N    6  
ATOM 6593  C CA   . LEU B 1 28 ? -12.356 9.929   -9.693  1.00 0.00 ? 28 LEU B CA   6  
ATOM 6594  C C    . LEU B 1 28 ? -12.618 8.918   -10.811 1.00 0.00 ? 28 LEU B C    6  
ATOM 6595  O O    . LEU B 1 28 ? -13.083 9.331   -11.883 1.00 0.00 ? 28 LEU B O    6  
ATOM 6596  C CB   . LEU B 1 28 ? -10.952 10.533  -9.726  1.00 0.00 ? 28 LEU B CB   6  
ATOM 6597  C CG   . LEU B 1 28 ? -10.855 11.980  -10.213 1.00 0.00 ? 28 LEU B CG   6  
ATOM 6598  C CD1  . LEU B 1 28 ? -11.079 12.962  -9.062  1.00 0.00 ? 28 LEU B CD1  6  
ATOM 6599  C CD2  . LEU B 1 28 ? -9.525  12.229  -10.928 1.00 0.00 ? 28 LEU B CD2  6  
ATOM 6600  H H    . LEU B 1 28 ? -11.925 8.629   -8.059  1.00 0.00 ? 28 LEU B H    6  
ATOM 6601  H HA   . LEU B 1 28 ? -13.069 10.749  -9.782  1.00 0.00 ? 28 LEU B HA   6  
ATOM 6602  H HB2  . LEU B 1 28 ? -10.568 10.476  -8.707  1.00 0.00 ? 28 LEU B HB2  6  
ATOM 6603  H HB3  . LEU B 1 28 ? -10.355 9.884   -10.367 1.00 0.00 ? 28 LEU B HB3  6  
ATOM 6604  H HG   . LEU B 1 28 ? -11.670 12.094  -10.928 1.00 0.00 ? 28 LEU B HG   6  
ATOM 6605  H HD11 . LEU B 1 28 ? -10.333 12.801  -8.285  1.00 0.00 ? 28 LEU B HD11 6  
ATOM 6606  H HD12 . LEU B 1 28 ? -11.004 13.980  -9.444  1.00 0.00 ? 28 LEU B HD12 6  
ATOM 6607  H HD13 . LEU B 1 28 ? -12.073 12.816  -8.637  1.00 0.00 ? 28 LEU B HD13 6  
ATOM 6608  H HD21 . LEU B 1 28 ? -9.433  11.561  -11.784 1.00 0.00 ? 28 LEU B HD21 6  
ATOM 6609  H HD22 . LEU B 1 28 ? -9.491  13.267  -11.261 1.00 0.00 ? 28 LEU B HD22 6  
ATOM 6610  H HD23 . LEU B 1 28 ? -8.696  12.048  -10.245 1.00 0.00 ? 28 LEU B HD23 6  
ATOM 6611  N N    . VAL B 1 29 ? -12.318 7.634   -10.544 1.00 0.00 ? 29 VAL B N    6  
ATOM 6612  C CA   . VAL B 1 29 ? -12.519 6.577   -11.520 1.00 0.00 ? 29 VAL B CA   6  
ATOM 6613  C C    . VAL B 1 29 ? -13.709 5.714   -11.094 1.00 0.00 ? 29 VAL B C    6  
ATOM 6614  O O    . VAL B 1 29 ? -14.682 5.632   -11.858 1.00 0.00 ? 29 VAL B O    6  
ATOM 6615  C CB   . VAL B 1 29 ? -11.229 5.774   -11.695 1.00 0.00 ? 29 VAL B CB   6  
ATOM 6616  C CG1  . VAL B 1 29 ? -11.299 4.889   -12.942 1.00 0.00 ? 29 VAL B CG1  6  
ATOM 6617  C CG2  . VAL B 1 29 ? -10.011 6.697   -11.746 1.00 0.00 ? 29 VAL B CG2  6  
ATOM 6618  H H    . VAL B 1 29 ? -11.937 7.378   -9.633  1.00 0.00 ? 29 VAL B H    6  
ATOM 6619  H HA   . VAL B 1 29 ? -12.750 7.052   -12.474 1.00 0.00 ? 29 VAL B HA   6  
ATOM 6620  H HB   . VAL B 1 29 ? -11.156 5.138   -10.813 1.00 0.00 ? 29 VAL B HB   6  
ATOM 6621  H HG11 . VAL B 1 29 ? -11.453 5.506   -13.827 1.00 0.00 ? 29 VAL B HG11 6  
ATOM 6622  H HG12 . VAL B 1 29 ? -10.366 4.332   -13.035 1.00 0.00 ? 29 VAL B HG12 6  
ATOM 6623  H HG13 . VAL B 1 29 ? -12.125 4.184   -12.851 1.00 0.00 ? 29 VAL B HG13 6  
ATOM 6624  H HG21 . VAL B 1 29 ? -9.945  7.276   -10.824 1.00 0.00 ? 29 VAL B HG21 6  
ATOM 6625  H HG22 . VAL B 1 29 ? -9.112  6.093   -11.870 1.00 0.00 ? 29 VAL B HG22 6  
ATOM 6626  H HG23 . VAL B 1 29 ? -10.098 7.382   -12.588 1.00 0.00 ? 29 VAL B HG23 6  
ATOM 6627  N N    . GLY B 1 30 ? -13.609 5.097   -9.902  1.00 0.00 ? 30 GLY B N    6  
ATOM 6628  C CA   . GLY B 1 30 ? -14.668 4.249   -9.383  1.00 0.00 ? 30 GLY B CA   6  
ATOM 6629  C C    . GLY B 1 30 ? -15.937 5.083   -9.197  1.00 0.00 ? 30 GLY B C    6  
ATOM 6630  O O    . GLY B 1 30 ? -16.961 4.516   -8.788  1.00 0.00 ? 30 GLY B O    6  
ATOM 6631  H H    . GLY B 1 30 ? -12.770 5.218   -9.335  1.00 0.00 ? 30 GLY B H    6  
ATOM 6632  H HA2  . GLY B 1 30 ? -14.873 3.443   -10.087 1.00 0.00 ? 30 GLY B HA2  6  
ATOM 6633  H HA3  . GLY B 1 30 ? -14.362 3.820   -8.429  1.00 0.00 ? 30 GLY B HA3  6  
ATOM 6634  N N    . GLU B 1 31 ? -15.847 6.391   -9.497  1.00 0.00 ? 31 GLU B N    6  
ATOM 6635  C CA   . GLU B 1 31 ? -16.981 7.292   -9.363  1.00 0.00 ? 31 GLU B CA   6  
ATOM 6636  C C    . GLU B 1 31 ? -18.183 6.703   -10.102 1.00 0.00 ? 31 GLU B C    6  
ATOM 6637  O O    . GLU B 1 31 ? -17.992 5.757   -10.881 1.00 0.00 ? 31 GLU B O    6  
ATOM 6638  C CB   . GLU B 1 31 ? -16.650 8.692   -9.882  1.00 0.00 ? 31 GLU B CB   6  
ATOM 6639  C CG   . GLU B 1 31 ? -17.142 8.874   -11.319 1.00 0.00 ? 31 GLU B CG   6  
ATOM 6640  C CD   . GLU B 1 31 ? -16.408 7.930   -12.273 1.00 0.00 ? 31 GLU B CD   6  
ATOM 6641  O OE1  . GLU B 1 31 ? -15.182 8.033   -12.428 1.00 0.00 ? 31 GLU B OE1  6  
ATOM 6642  O OE2  . GLU B 1 31 ? -17.158 7.064   -12.866 1.00 0.00 ? 31 GLU B OE2  6  
ATOM 6643  H H    . GLU B 1 31 ? -14.964 6.780   -9.828  1.00 0.00 ? 31 GLU B H    6  
ATOM 6644  H HA   . GLU B 1 31 ? -17.214 7.354   -8.299  1.00 0.00 ? 31 GLU B HA   6  
ATOM 6645  H HB2  . GLU B 1 31 ? -17.137 9.430   -9.244  1.00 0.00 ? 31 GLU B HB2  6  
ATOM 6646  H HB3  . GLU B 1 31 ? -15.572 8.841   -9.837  1.00 0.00 ? 31 GLU B HB3  6  
ATOM 6647  H HG2  . GLU B 1 31 ? -18.209 8.660   -11.358 1.00 0.00 ? 31 GLU B HG2  6  
ATOM 6648  H HG3  . GLU B 1 31 ? -16.977 9.909   -11.621 1.00 0.00 ? 31 GLU B HG3  6  
ATOM 6649  N N    . ARG B 1 32 ? -19.380 7.263   -9.848  1.00 0.00 ? 32 ARG B N    6  
ATOM 6650  C CA   . ARG B 1 32 ? -20.600 6.796   -10.485 1.00 0.00 ? 32 ARG B CA   6  
ATOM 6651  C C    . ARG B 1 32 ? -20.339 6.575   -11.977 1.00 0.00 ? 32 ARG B C    6  
ATOM 6652  O O    . ARG B 1 32 ? -21.223 6.795   -12.803 1.00 0.00 ? 32 ARG B O    6  
ATOM 6653  C CB   . ARG B 1 32 ? -21.743 7.800   -10.318 1.00 0.00 ? 32 ARG B CB   6  
ATOM 6654  C CG   . ARG B 1 32 ? -21.562 8.629   -9.045  1.00 0.00 ? 32 ARG B CG   6  
ATOM 6655  C CD   . ARG B 1 32 ? -21.444 7.727   -7.815  1.00 0.00 ? 32 ARG B CD   6  
ATOM 6656  N NE   . ARG B 1 32 ? -22.286 6.522   -7.990  1.00 0.00 ? 32 ARG B NE   6  
ATOM 6657  C CZ   . ARG B 1 32 ? -21.879 5.266   -7.698  1.00 0.00 ? 32 ARG B CZ   6  
ATOM 6658  N NH1  . ARG B 1 32 ? -20.641 5.078   -7.222  1.00 0.00 ? 32 ARG B NH1  6  
ATOM 6659  N NH2  . ARG B 1 32 ? -22.702 4.225   -7.885  1.00 0.00 ? 32 ARG B NH2  6  
ATOM 6660  H H    . ARG B 1 32 ? -19.450 8.040   -9.191  1.00 0.00 ? 32 ARG B H    6  
ATOM 6661  H HA   . ARG B 1 32 ? -20.872 5.845   -10.028 1.00 0.00 ? 32 ARG B HA   6  
ATOM 6662  H HB2  . ARG B 1 32 ? -21.754 8.468   -11.178 1.00 0.00 ? 32 ARG B HB2  6  
ATOM 6663  H HB3  . ARG B 1 32 ? -22.687 7.257   -10.277 1.00 0.00 ? 32 ARG B HB3  6  
ATOM 6664  H HG2  . ARG B 1 32 ? -20.654 9.224   -9.137  1.00 0.00 ? 32 ARG B HG2  6  
ATOM 6665  H HG3  . ARG B 1 32 ? -22.416 9.298   -8.935  1.00 0.00 ? 32 ARG B HG3  6  
ATOM 6666  H HD2  . ARG B 1 32 ? -20.407 7.420   -7.688  1.00 0.00 ? 32 ARG B HD2  6  
ATOM 6667  H HD3  . ARG B 1 32 ? -21.762 8.278   -6.930  1.00 0.00 ? 32 ARG B HD3  6  
ATOM 6668  H HE   . ARG B 1 32 ? -23.224 6.681   -8.353  1.00 0.00 ? 32 ARG B HE   6  
ATOM 6669  H HH11 . ARG B 1 32 ? -20.022 5.876   -7.083  1.00 0.00 ? 32 ARG B HH11 6  
ATOM 6670  H HH12 . ARG B 1 32 ? -20.319 4.138   -6.997  1.00 0.00 ? 32 ARG B HH12 6  
ATOM 6671  H HH21 . ARG B 1 32 ? -23.642 4.377   -8.249  1.00 0.00 ? 32 ARG B HH21 6  
ATOM 6672  H HH22 . ARG B 1 32 ? -22.387 3.281   -7.663  1.00 0.00 ? 32 ARG B HH22 6  
ATOM 6673  N N    . MET A 1 1  ? 8.432   -11.893 16.899  1.00 0.00 ? 1  MET A N    7  
ATOM 6674  C CA   . MET A 1 1  ? 9.149   -11.714 15.648  1.00 0.00 ? 1  MET A CA   7  
ATOM 6675  C C    . MET A 1 1  ? 8.588   -12.678 14.602  1.00 0.00 ? 1  MET A C    7  
ATOM 6676  O O    . MET A 1 1  ? 8.433   -12.266 13.443  1.00 0.00 ? 1  MET A O    7  
ATOM 6677  C CB   . MET A 1 1  ? 10.641  -11.986 15.845  1.00 0.00 ? 1  MET A CB   7  
ATOM 6678  C CG   . MET A 1 1  ? 11.488  -11.062 14.968  1.00 0.00 ? 1  MET A CG   7  
ATOM 6679  S SD   . MET A 1 1  ? 13.005  -11.916 14.449  1.00 0.00 ? 1  MET A SD   7  
ATOM 6680  C CE   . MET A 1 1  ? 13.151  -11.293 12.747  1.00 0.00 ? 1  MET A CE   7  
ATOM 6681  H H    . MET A 1 1  ? 8.976   -11.937 17.760  1.00 0.00 ? 1  MET A H    7  
ATOM 6682  H HA   . MET A 1 1  ? 9.005   -10.690 15.300  1.00 0.00 ? 1  MET A HA   7  
ATOM 6683  H HB2  . MET A 1 1  ? 10.897  -11.816 16.892  1.00 0.00 ? 1  MET A HB2  7  
ATOM 6684  H HB3  . MET A 1 1  ? 10.847  -13.027 15.595  1.00 0.00 ? 1  MET A HB3  7  
ATOM 6685  H HG2  . MET A 1 1  ? 10.918  -10.780 14.083  1.00 0.00 ? 1  MET A HG2  7  
ATOM 6686  H HG3  . MET A 1 1  ? 11.742  -10.162 15.529  1.00 0.00 ? 1  MET A HG3  7  
ATOM 6687  H HE1  . MET A 1 1  ? 13.228  -10.207 12.755  1.00 0.00 ? 1  MET A HE1  7  
ATOM 6688  H HE2  . MET A 1 1  ? 14.038  -11.726 12.286  1.00 0.00 ? 1  MET A HE2  7  
ATOM 6689  H HE3  . MET A 1 1  ? 12.273  -11.583 12.170  1.00 0.00 ? 1  MET A HE3  7  
ATOM 6690  N N    . ASP A 1 2  ? 8.298   -13.923 15.023  1.00 0.00 ? 2  ASP A N    7  
ATOM 6691  C CA   . ASP A 1 2  ? 7.760   -14.933 14.128  1.00 0.00 ? 2  ASP A CA   7  
ATOM 6692  C C    . ASP A 1 2  ? 6.530   -14.372 13.413  1.00 0.00 ? 2  ASP A C    7  
ATOM 6693  O O    . ASP A 1 2  ? 6.322   -14.714 12.240  1.00 0.00 ? 2  ASP A O    7  
ATOM 6694  C CB   . ASP A 1 2  ? 7.329   -16.181 14.902  1.00 0.00 ? 2  ASP A CB   7  
ATOM 6695  C CG   . ASP A 1 2  ? 8.365   -16.719 15.890  1.00 0.00 ? 2  ASP A CG   7  
ATOM 6696  O OD1  . ASP A 1 2  ? 9.094   -15.950 16.535  1.00 0.00 ? 2  ASP A OD1  7  
ATOM 6697  O OD2  . ASP A 1 2  ? 8.410   -18.005 15.986  1.00 0.00 ? 2  ASP A OD2  7  
ATOM 6698  H H    . ASP A 1 2  ? 8.457   -14.180 15.997  1.00 0.00 ? 2  ASP A H    7  
ATOM 6699  H HA   . ASP A 1 2  ? 8.516   -15.189 13.387  1.00 0.00 ? 2  ASP A HA   7  
ATOM 6700  H HB2  . ASP A 1 2  ? 6.422   -15.917 15.448  1.00 0.00 ? 2  ASP A HB2  7  
ATOM 6701  H HB3  . ASP A 1 2  ? 7.087   -16.944 14.162  1.00 0.00 ? 2  ASP A HB3  7  
ATOM 6702  N N    . ALA A 1 3  ? 5.752   -13.534 14.121  1.00 0.00 ? 3  ALA A N    7  
ATOM 6703  C CA   . ALA A 1 3  ? 4.555   -12.933 13.558  1.00 0.00 ? 3  ALA A CA   7  
ATOM 6704  C C    . ALA A 1 3  ? 4.919   -11.597 12.905  1.00 0.00 ? 3  ALA A C    7  
ATOM 6705  O O    . ALA A 1 3  ? 4.094   -11.066 12.148  1.00 0.00 ? 3  ALA A O    7  
ATOM 6706  C CB   . ALA A 1 3  ? 3.565   -12.607 14.678  1.00 0.00 ? 3  ALA A CB   7  
ATOM 6707  H H    . ALA A 1 3  ? 5.995   -13.303 15.084  1.00 0.00 ? 3  ALA A H    7  
ATOM 6708  H HA   . ALA A 1 3  ? 4.103   -13.582 12.808  1.00 0.00 ? 3  ALA A HA   7  
ATOM 6709  H HB1  . ALA A 1 3  ? 3.309   -13.527 15.204  1.00 0.00 ? 3  ALA A HB1  7  
ATOM 6710  H HB2  . ALA A 1 3  ? 4.018   -11.910 15.383  1.00 0.00 ? 3  ALA A HB2  7  
ATOM 6711  H HB3  . ALA A 1 3  ? 2.666   -12.155 14.260  1.00 0.00 ? 3  ALA A HB3  7  
ATOM 6712  N N    . ILE A 1 4  ? 6.127   -11.089 13.208  1.00 0.00 ? 4  ILE A N    7  
ATOM 6713  C CA   . ILE A 1 4  ? 6.593   -9.829  12.655  1.00 0.00 ? 4  ILE A CA   7  
ATOM 6714  C C    . ILE A 1 4  ? 7.080   -10.053 11.222  1.00 0.00 ? 4  ILE A C    7  
ATOM 6715  O O    . ILE A 1 4  ? 6.723   -9.252  10.345  1.00 0.00 ? 4  ILE A O    7  
ATOM 6716  C CB   . ILE A 1 4  ? 7.646   -9.199  13.570  1.00 0.00 ? 4  ILE A CB   7  
ATOM 6717  C CG1  . ILE A 1 4  ? 7.067   -8.917  14.957  1.00 0.00 ? 4  ILE A CG1  7  
ATOM 6718  C CG2  . ILE A 1 4  ? 8.245   -7.944  12.932  1.00 0.00 ? 4  ILE A CG2  7  
ATOM 6719  C CD1  . ILE A 1 4  ? 7.459   -7.518  15.441  1.00 0.00 ? 4  ILE A CD1  7  
ATOM 6720  H H    . ILE A 1 4  ? 6.748   -11.592 13.842  1.00 0.00 ? 4  ILE A H    7  
ATOM 6721  H HA   . ILE A 1 4  ? 5.731   -9.162  12.637  1.00 0.00 ? 4  ILE A HA   7  
ATOM 6722  H HB   . ILE A 1 4  ? 8.431   -9.949  13.658  1.00 0.00 ? 4  ILE A HB   7  
ATOM 6723  H HG12 . ILE A 1 4  ? 5.980   -8.983  14.908  1.00 0.00 ? 4  ILE A HG12 7  
ATOM 6724  H HG13 . ILE A 1 4  ? 7.437   -9.667  15.655  1.00 0.00 ? 4  ILE A HG13 7  
ATOM 6725  H HG21 . ILE A 1 4  ? 7.460   -7.213  12.741  1.00 0.00 ? 4  ILE A HG21 7  
ATOM 6726  H HG22 . ILE A 1 4  ? 8.989   -7.523  13.610  1.00 0.00 ? 4  ILE A HG22 7  
ATOM 6727  H HG23 . ILE A 1 4  ? 8.729   -8.201  11.990  1.00 0.00 ? 4  ILE A HG23 7  
ATOM 6728  H HD11 . ILE A 1 4  ? 7.089   -6.766  14.744  1.00 0.00 ? 4  ILE A HD11 7  
ATOM 6729  H HD12 . ILE A 1 4  ? 7.031   -7.352  16.430  1.00 0.00 ? 4  ILE A HD12 7  
ATOM 6730  H HD13 . ILE A 1 4  ? 8.544   -7.438  15.505  1.00 0.00 ? 4  ILE A HD13 7  
ATOM 6731  N N    . LYS A 1 5  ? 7.872   -11.121 11.015  1.00 0.00 ? 5  LYS A N    7  
ATOM 6732  C CA   . LYS A 1 5  ? 8.400   -11.445 9.701   1.00 0.00 ? 5  LYS A CA   7  
ATOM 6733  C C    . LYS A 1 5  ? 7.248   -11.522 8.698   1.00 0.00 ? 5  LYS A C    7  
ATOM 6734  O O    . LYS A 1 5  ? 7.447   -11.128 7.539   1.00 0.00 ? 5  LYS A O    7  
ATOM 6735  C CB   . LYS A 1 5  ? 9.248   -12.717 9.763   1.00 0.00 ? 5  LYS A CB   7  
ATOM 6736  C CG   . LYS A 1 5  ? 8.824   -13.602 10.937  1.00 0.00 ? 5  LYS A CG   7  
ATOM 6737  C CD   . LYS A 1 5  ? 9.006   -15.084 10.600  1.00 0.00 ? 5  LYS A CD   7  
ATOM 6738  C CE   . LYS A 1 5  ? 10.375  -15.586 11.063  1.00 0.00 ? 5  LYS A CE   7  
ATOM 6739  N NZ   . LYS A 1 5  ? 10.874  -16.632 10.157  1.00 0.00 ? 5  LYS A NZ   7  
ATOM 6740  H H    . LYS A 1 5  ? 8.118   -11.732 11.794  1.00 0.00 ? 5  LYS A H    7  
ATOM 6741  H HA   . LYS A 1 5  ? 9.060   -10.624 9.422   1.00 0.00 ? 5  LYS A HA   7  
ATOM 6742  H HB2  . LYS A 1 5  ? 9.119   -13.274 8.835   1.00 0.00 ? 5  LYS A HB2  7  
ATOM 6743  H HB3  . LYS A 1 5  ? 10.296  -12.439 9.868   1.00 0.00 ? 5  LYS A HB3  7  
ATOM 6744  H HG2  . LYS A 1 5  ? 9.436   -13.357 11.804  1.00 0.00 ? 5  LYS A HG2  7  
ATOM 6745  H HG3  . LYS A 1 5  ? 7.778   -13.401 11.171  1.00 0.00 ? 5  LYS A HG3  7  
ATOM 6746  H HD2  . LYS A 1 5  ? 8.229   -15.659 11.103  1.00 0.00 ? 5  LYS A HD2  7  
ATOM 6747  H HD3  . LYS A 1 5  ? 8.906   -15.217 9.524   1.00 0.00 ? 5  LYS A HD3  7  
ATOM 6748  H HE2  . LYS A 1 5  ? 11.079  -14.754 11.067  1.00 0.00 ? 5  LYS A HE2  7  
ATOM 6749  H HE3  . LYS A 1 5  ? 10.288  -15.981 12.076  1.00 0.00 ? 5  LYS A HE3  7  
ATOM 6750  H HZ1  . LYS A 1 5  ? 10.956  -16.263 9.210   1.00 0.00 ? 5  LYS A HZ1  7  
ATOM 6751  H HZ2  . LYS A 1 5  ? 11.786  -16.950 10.487  1.00 0.00 ? 5  LYS A HZ2  7  
ATOM 6752  H HZ3  . LYS A 1 5  ? 10.230  -17.423 10.150  1.00 0.00 ? 5  LYS A HZ3  7  
ATOM 6753  N N    . LYS A 1 6  ? 6.084   -12.018 9.153   1.00 0.00 ? 6  LYS A N    7  
ATOM 6754  C CA   . LYS A 1 6  ? 4.914   -12.145 8.302   1.00 0.00 ? 6  LYS A CA   7  
ATOM 6755  C C    . LYS A 1 6  ? 4.146   -10.821 8.297   1.00 0.00 ? 6  LYS A C    7  
ATOM 6756  O O    . LYS A 1 6  ? 3.533   -10.499 7.270   1.00 0.00 ? 6  LYS A O    7  
ATOM 6757  C CB   . LYS A 1 6  ? 4.067   -13.346 8.729   1.00 0.00 ? 6  LYS A CB   7  
ATOM 6758  C CG   . LYS A 1 6  ? 4.948   -14.474 9.267   1.00 0.00 ? 6  LYS A CG   7  
ATOM 6759  C CD   . LYS A 1 6  ? 4.163   -15.783 9.365   1.00 0.00 ? 6  LYS A CD   7  
ATOM 6760  C CE   . LYS A 1 6  ? 4.429   -16.675 8.151   1.00 0.00 ? 6  LYS A CE   7  
ATOM 6761  N NZ   . LYS A 1 6  ? 5.736   -17.341 8.277   1.00 0.00 ? 6  LYS A NZ   7  
ATOM 6762  H H    . LYS A 1 6  ? 6.004   -12.321 10.125  1.00 0.00 ? 6  LYS A H    7  
ATOM 6763  H HA   . LYS A 1 6  ? 5.284   -12.344 7.296   1.00 0.00 ? 6  LYS A HA   7  
ATOM 6764  H HB2  . LYS A 1 6  ? 3.376   -13.031 9.511   1.00 0.00 ? 6  LYS A HB2  7  
ATOM 6765  H HB3  . LYS A 1 6  ? 3.496   -13.698 7.870   1.00 0.00 ? 6  LYS A HB3  7  
ATOM 6766  H HG2  . LYS A 1 6  ? 5.793   -14.616 8.593   1.00 0.00 ? 6  LYS A HG2  7  
ATOM 6767  H HG3  . LYS A 1 6  ? 5.323   -14.191 10.251  1.00 0.00 ? 6  LYS A HG3  7  
ATOM 6768  H HD2  . LYS A 1 6  ? 4.469   -16.312 10.268  1.00 0.00 ? 6  LYS A HD2  7  
ATOM 6769  H HD3  . LYS A 1 6  ? 3.099   -15.554 9.432   1.00 0.00 ? 6  LYS A HD3  7  
ATOM 6770  H HE2  . LYS A 1 6  ? 3.649   -17.433 8.084   1.00 0.00 ? 6  LYS A HE2  7  
ATOM 6771  H HE3  . LYS A 1 6  ? 4.409   -16.065 7.248   1.00 0.00 ? 6  LYS A HE3  7  
ATOM 6772  H HZ1  . LYS A 1 6  ? 5.755   -17.912 9.123   1.00 0.00 ? 6  LYS A HZ1  7  
ATOM 6773  H HZ2  . LYS A 1 6  ? 5.890   -17.928 7.457   1.00 0.00 ? 6  LYS A HZ2  7  
ATOM 6774  H HZ3  . LYS A 1 6  ? 6.478   -16.644 8.331   1.00 0.00 ? 6  LYS A HZ3  7  
ATOM 6775  N N    . LYS A 1 7  ? 4.195   -10.094 9.427   1.00 0.00 ? 7  LYS A N    7  
ATOM 6776  C CA   . LYS A 1 7  ? 3.508   -8.819  9.552   1.00 0.00 ? 7  LYS A CA   7  
ATOM 6777  C C    . LYS A 1 7  ? 3.874   -7.929  8.363   1.00 0.00 ? 7  LYS A C    7  
ATOM 6778  O O    . LYS A 1 7  ? 2.971   -7.293  7.802   1.00 0.00 ? 7  LYS A O    7  
ATOM 6779  C CB   . LYS A 1 7  ? 3.805   -8.182  10.912  1.00 0.00 ? 7  LYS A CB   7  
ATOM 6780  C CG   . LYS A 1 7  ? 3.102   -6.830  11.048  1.00 0.00 ? 7  LYS A CG   7  
ATOM 6781  C CD   . LYS A 1 7  ? 1.635   -6.929  10.628  1.00 0.00 ? 7  LYS A CD   7  
ATOM 6782  C CE   . LYS A 1 7  ? 0.825   -5.757  11.186  1.00 0.00 ? 7  LYS A CE   7  
ATOM 6783  N NZ   . LYS A 1 7  ? 0.979   -5.673  12.648  1.00 0.00 ? 7  LYS A NZ   7  
ATOM 6784  H H    . LYS A 1 7  ? 4.725   -10.433 10.230  1.00 0.00 ? 7  LYS A H    7  
ATOM 6785  H HA   . LYS A 1 7  ? 2.441   -9.038  9.517   1.00 0.00 ? 7  LYS A HA   7  
ATOM 6786  H HB2  . LYS A 1 7  ? 3.450   -8.847  11.699  1.00 0.00 ? 7  LYS A HB2  7  
ATOM 6787  H HB3  . LYS A 1 7  ? 4.882   -8.053  11.014  1.00 0.00 ? 7  LYS A HB3  7  
ATOM 6788  H HG2  . LYS A 1 7  ? 3.153   -6.508  12.088  1.00 0.00 ? 7  LYS A HG2  7  
ATOM 6789  H HG3  . LYS A 1 7  ? 3.619   -6.099  10.425  1.00 0.00 ? 7  LYS A HG3  7  
ATOM 6790  H HD2  . LYS A 1 7  ? 1.576   -6.915  9.540   1.00 0.00 ? 7  LYS A HD2  7  
ATOM 6791  H HD3  . LYS A 1 7  ? 1.226   -7.871  10.993  1.00 0.00 ? 7  LYS A HD3  7  
ATOM 6792  H HE2  . LYS A 1 7  ? 1.181   -4.830  10.738  1.00 0.00 ? 7  LYS A HE2  7  
ATOM 6793  H HE3  . LYS A 1 7  ? -0.226  -5.894  10.931  1.00 0.00 ? 7  LYS A HE3  7  
ATOM 6794  H HZ1  . LYS A 1 7  ? 1.962   -5.545  12.887  1.00 0.00 ? 7  LYS A HZ1  7  
ATOM 6795  H HZ2  . LYS A 1 7  ? 0.430   -4.887  12.995  1.00 0.00 ? 7  LYS A HZ2  7  
ATOM 6796  H HZ3  . LYS A 1 7  ? 0.641   -6.531  13.083  1.00 0.00 ? 7  LYS A HZ3  7  
ATOM 6797  N N    . MET A 1 8  ? 5.172   -7.902  8.007   1.00 0.00 ? 8  MET A N    7  
ATOM 6798  C CA   . MET A 1 8  ? 5.649   -7.097  6.896   1.00 0.00 ? 8  MET A CA   7  
ATOM 6799  C C    . MET A 1 8  ? 5.276   -7.782  5.579   1.00 0.00 ? 8  MET A C    7  
ATOM 6800  O O    . MET A 1 8  ? 5.243   -7.096  4.547   1.00 0.00 ? 8  MET A O    7  
ATOM 6801  C CB   . MET A 1 8  ? 7.168   -6.930  6.973   1.00 0.00 ? 8  MET A CB   7  
ATOM 6802  C CG   . MET A 1 8  ? 7.883   -8.214  6.552   1.00 0.00 ? 8  MET A CG   7  
ATOM 6803  S SD   . MET A 1 8  ? 8.411   -8.092  4.818   1.00 0.00 ? 8  MET A SD   7  
ATOM 6804  C CE   . MET A 1 8  ? 10.211  -7.987  5.042   1.00 0.00 ? 8  MET A CE   7  
ATOM 6805  H H    . MET A 1 8  ? 5.853   -8.458  8.524   1.00 0.00 ? 8  MET A H    7  
ATOM 6806  H HA   . MET A 1 8  ? 5.169   -6.119  6.936   1.00 0.00 ? 8  MET A HA   7  
ATOM 6807  H HB2  . MET A 1 8  ? 7.469   -6.121  6.308   1.00 0.00 ? 8  MET A HB2  7  
ATOM 6808  H HB3  . MET A 1 8  ? 7.442   -6.669  7.995   1.00 0.00 ? 8  MET A HB3  7  
ATOM 6809  H HG2  . MET A 1 8  ? 8.761   -8.363  7.180   1.00 0.00 ? 8  MET A HG2  7  
ATOM 6810  H HG3  . MET A 1 8  ? 7.209   -9.062  6.677   1.00 0.00 ? 8  MET A HG3  7  
ATOM 6811  H HE1  . MET A 1 8  ? 10.573  -8.875  5.560   1.00 0.00 ? 8  MET A HE1  7  
ATOM 6812  H HE2  . MET A 1 8  ? 10.686  -7.907  4.065   1.00 0.00 ? 8  MET A HE2  7  
ATOM 6813  H HE3  . MET A 1 8  ? 10.461  -7.105  5.633   1.00 0.00 ? 8  MET A HE3  7  
ATOM 6814  N N    . GLN A 1 9  ? 5.008   -9.099  5.640   1.00 0.00 ? 9  GLN A N    7  
ATOM 6815  C CA   . GLN A 1 9  ? 4.643   -9.865  4.462   1.00 0.00 ? 9  GLN A CA   7  
ATOM 6816  C C    . GLN A 1 9  ? 3.191   -9.560  4.089   1.00 0.00 ? 9  GLN A C    7  
ATOM 6817  O O    . GLN A 1 9  ? 2.854   -9.652  2.900   1.00 0.00 ? 9  GLN A O    7  
ATOM 6818  C CB   . GLN A 1 9  ? 4.850   -11.365 4.680   1.00 0.00 ? 9  GLN A CB   7  
ATOM 6819  C CG   . GLN A 1 9  ? 6.326   -11.742 4.545   1.00 0.00 ? 9  GLN A CG   7  
ATOM 6820  C CD   . GLN A 1 9  ? 6.483   -13.197 4.100   1.00 0.00 ? 9  GLN A CD   7  
ATOM 6821  O OE1  . GLN A 1 9  ? 5.948   -13.626 3.092   1.00 0.00 ? 9  GLN A OE1  7  
ATOM 6822  N NE2  . GLN A 1 9  ? 7.243   -13.930 4.909   1.00 0.00 ? 9  GLN A NE2  7  
ATOM 6823  H H    . GLN A 1 9  ? 5.059   -9.589  6.533   1.00 0.00 ? 9  GLN A H    7  
ATOM 6824  H HA   . GLN A 1 9  ? 5.294   -9.533  3.652   1.00 0.00 ? 9  GLN A HA   7  
ATOM 6825  H HB2  . GLN A 1 9  ? 4.507   -11.627 5.681   1.00 0.00 ? 9  GLN A HB2  7  
ATOM 6826  H HB3  . GLN A 1 9  ? 4.257   -11.914 3.948   1.00 0.00 ? 9  GLN A HB3  7  
ATOM 6827  H HG2  . GLN A 1 9  ? 6.790   -11.092 3.802   1.00 0.00 ? 9  GLN A HG2  7  
ATOM 6828  H HG3  . GLN A 1 9  ? 6.818   -11.590 5.505   1.00 0.00 ? 9  GLN A HG3  7  
ATOM 6829  H HE21 . GLN A 1 9  ? 7.661   -13.508 5.738   1.00 0.00 ? 9  GLN A HE21 7  
ATOM 6830  H HE22 . GLN A 1 9  ? 7.408   -14.915 4.699   1.00 0.00 ? 9  GLN A HE22 7  
ATOM 6831  N N    . MET A 1 10 ? 2.372   -9.208  5.097   1.00 0.00 ? 10 MET A N    7  
ATOM 6832  C CA   . MET A 1 10 ? 0.972   -8.893  4.878   1.00 0.00 ? 10 MET A CA   7  
ATOM 6833  C C    . MET A 1 10 ? 0.852   -7.467  4.339   1.00 0.00 ? 10 MET A C    7  
ATOM 6834  O O    . MET A 1 10 ? -0.021  -7.227  3.492   1.00 0.00 ? 10 MET A O    7  
ATOM 6835  C CB   . MET A 1 10 ? 0.187   -9.011  6.186   1.00 0.00 ? 10 MET A CB   7  
ATOM 6836  C CG   . MET A 1 10 ? 1.004   -9.747  7.249   1.00 0.00 ? 10 MET A CG   7  
ATOM 6837  S SD   . MET A 1 10 ? -0.005  -10.006 8.739   1.00 0.00 ? 10 MET A SD   7  
ATOM 6838  C CE   . MET A 1 10 ? -1.668  -9.915  8.014   1.00 0.00 ? 10 MET A CE   7  
ATOM 6839  H H    . MET A 1 10 ? 2.731   -9.155  6.051   1.00 0.00 ? 10 MET A H    7  
ATOM 6840  H HA   . MET A 1 10 ? 0.564   -9.586  4.141   1.00 0.00 ? 10 MET A HA   7  
ATOM 6841  H HB2  . MET A 1 10 ? -0.049  -8.011  6.549   1.00 0.00 ? 10 MET A HB2  7  
ATOM 6842  H HB3  . MET A 1 10 ? -0.743  -9.547  5.993   1.00 0.00 ? 10 MET A HB3  7  
ATOM 6843  H HG2  . MET A 1 10 ? 1.316   -10.717 6.861   1.00 0.00 ? 10 MET A HG2  7  
ATOM 6844  H HG3  . MET A 1 10 ? 1.889   -9.163  7.497   1.00 0.00 ? 10 MET A HG3  7  
ATOM 6845  H HE1  . MET A 1 10 ? -1.785  -10.686 7.254   1.00 0.00 ? 10 MET A HE1  7  
ATOM 6846  H HE2  . MET A 1 10 ? -2.408  -10.054 8.803   1.00 0.00 ? 10 MET A HE2  7  
ATOM 6847  H HE3  . MET A 1 10 ? -1.820  -8.938  7.555   1.00 0.00 ? 10 MET A HE3  7  
ATOM 6848  N N    . LEU A 1 11 ? 1.718   -6.562  4.830   1.00 0.00 ? 11 LEU A N    7  
ATOM 6849  C CA   . LEU A 1 11 ? 1.710   -5.174  4.401   1.00 0.00 ? 11 LEU A CA   7  
ATOM 6850  C C    . LEU A 1 11 ? 2.366   -5.067  3.023   1.00 0.00 ? 11 LEU A C    7  
ATOM 6851  O O    . LEU A 1 11 ? 2.002   -4.156  2.265   1.00 0.00 ? 11 LEU A O    7  
ATOM 6852  C CB   . LEU A 1 11 ? 2.356   -4.281  5.462   1.00 0.00 ? 11 LEU A CB   7  
ATOM 6853  C CG   . LEU A 1 11 ? 1.772   -4.384  6.871   1.00 0.00 ? 11 LEU A CG   7  
ATOM 6854  C CD1  . LEU A 1 11 ? 2.682   -3.698  7.893   1.00 0.00 ? 11 LEU A CD1  7  
ATOM 6855  C CD2  . LEU A 1 11 ? 0.345   -3.834  6.915   1.00 0.00 ? 11 LEU A CD2  7  
ATOM 6856  H H    . LEU A 1 11 ? 2.408   -6.843  5.527   1.00 0.00 ? 11 LEU A H    7  
ATOM 6857  H HA   . LEU A 1 11 ? 0.662   -4.883  4.318   1.00 0.00 ? 11 LEU A HA   7  
ATOM 6858  H HB2  . LEU A 1 11 ? 3.411   -4.555  5.493   1.00 0.00 ? 11 LEU A HB2  7  
ATOM 6859  H HB3  . LEU A 1 11 ? 2.267   -3.258  5.095   1.00 0.00 ? 11 LEU A HB3  7  
ATOM 6860  H HG   . LEU A 1 11 ? 1.748   -5.451  7.092   1.00 0.00 ? 11 LEU A HG   7  
ATOM 6861  H HD11 . LEU A 1 11 ? 2.802   -2.645  7.636   1.00 0.00 ? 11 LEU A HD11 7  
ATOM 6862  H HD12 . LEU A 1 11 ? 2.235   -3.790  8.883   1.00 0.00 ? 11 LEU A HD12 7  
ATOM 6863  H HD13 . LEU A 1 11 ? 3.661   -4.176  7.898   1.00 0.00 ? 11 LEU A HD13 7  
ATOM 6864  H HD21 . LEU A 1 11 ? -0.290  -4.394  6.229   1.00 0.00 ? 11 LEU A HD21 7  
ATOM 6865  H HD22 . LEU A 1 11 ? -0.038  -3.923  7.932   1.00 0.00 ? 11 LEU A HD22 7  
ATOM 6866  H HD23 . LEU A 1 11 ? 0.341   -2.784  6.625   1.00 0.00 ? 11 LEU A HD23 7  
ATOM 6867  N N    . LYS A 1 12 ? 3.306   -5.983  2.731   1.00 0.00 ? 12 LYS A N    7  
ATOM 6868  C CA   . LYS A 1 12 ? 4.005   -5.992  1.458   1.00 0.00 ? 12 LYS A CA   7  
ATOM 6869  C C    . LYS A 1 12 ? 3.082   -6.561  0.378   1.00 0.00 ? 12 LYS A C    7  
ATOM 6870  O O    . LYS A 1 12 ? 3.177   -6.113  -0.774  1.00 0.00 ? 12 LYS A O    7  
ATOM 6871  C CB   . LYS A 1 12 ? 5.338   -6.733  1.582   1.00 0.00 ? 12 LYS A CB   7  
ATOM 6872  C CG   . LYS A 1 12 ? 6.484   -5.760  1.860   1.00 0.00 ? 12 LYS A CG   7  
ATOM 6873  C CD   . LYS A 1 12 ? 7.356   -5.570  0.617   1.00 0.00 ? 12 LYS A CD   7  
ATOM 6874  C CE   . LYS A 1 12 ? 8.366   -4.440  0.824   1.00 0.00 ? 12 LYS A CE   7  
ATOM 6875  N NZ   . LYS A 1 12 ? 7.793   -3.152  0.401   1.00 0.00 ? 12 LYS A NZ   7  
ATOM 6876  H H    . LYS A 1 12 ? 3.548   -6.702  3.414   1.00 0.00 ? 12 LYS A H    7  
ATOM 6877  H HA   . LYS A 1 12 ? 4.229   -4.952  1.221   1.00 0.00 ? 12 LYS A HA   7  
ATOM 6878  H HB2  . LYS A 1 12 ? 5.270   -7.446  2.404   1.00 0.00 ? 12 LYS A HB2  7  
ATOM 6879  H HB3  . LYS A 1 12 ? 5.527   -7.277  0.657   1.00 0.00 ? 12 LYS A HB3  7  
ATOM 6880  H HG2  . LYS A 1 12 ? 6.066   -4.796  2.152   1.00 0.00 ? 12 LYS A HG2  7  
ATOM 6881  H HG3  . LYS A 1 12 ? 7.087   -6.149  2.681   1.00 0.00 ? 12 LYS A HG3  7  
ATOM 6882  H HD2  . LYS A 1 12 ? 7.894   -6.496  0.417   1.00 0.00 ? 12 LYS A HD2  7  
ATOM 6883  H HD3  . LYS A 1 12 ? 6.713   -5.343  -0.234  1.00 0.00 ? 12 LYS A HD3  7  
ATOM 6884  H HE2  . LYS A 1 12 ? 8.628   -4.382  1.881   1.00 0.00 ? 12 LYS A HE2  7  
ATOM 6885  H HE3  . LYS A 1 12 ? 9.266   -4.654  0.246   1.00 0.00 ? 12 LYS A HE3  7  
ATOM 6886  H HZ1  . LYS A 1 12 ? 6.951   -2.951  0.941   1.00 0.00 ? 12 LYS A HZ1  7  
ATOM 6887  H HZ2  . LYS A 1 12 ? 8.484   -2.417  0.548   1.00 0.00 ? 12 LYS A HZ2  7  
ATOM 6888  H HZ3  . LYS A 1 12 ? 7.552   -3.188  -0.590  1.00 0.00 ? 12 LYS A HZ3  7  
ATOM 6889  N N    . LEU A 1 13 ? 2.224   -7.521  0.765   1.00 0.00 ? 13 LEU A N    7  
ATOM 6890  C CA   . LEU A 1 13 ? 1.295   -8.143  -0.163  1.00 0.00 ? 13 LEU A CA   7  
ATOM 6891  C C    . LEU A 1 13 ? 0.208   -7.135  -0.543  1.00 0.00 ? 13 LEU A C    7  
ATOM 6892  O O    . LEU A 1 13 ? -0.185  -7.107  -1.718  1.00 0.00 ? 13 LEU A O    7  
ATOM 6893  C CB   . LEU A 1 13 ? 0.747   -9.447  0.420   1.00 0.00 ? 13 LEU A CB   7  
ATOM 6894  C CG   . LEU A 1 13 ? 0.239   -10.474 -0.595  1.00 0.00 ? 13 LEU A CG   7  
ATOM 6895  C CD1  . LEU A 1 13 ? -0.781  -11.417 0.045   1.00 0.00 ? 13 LEU A CD1  7  
ATOM 6896  C CD2  . LEU A 1 13 ? -0.320  -9.784  -1.840  1.00 0.00 ? 13 LEU A CD2  7  
ATOM 6897  H H    . LEU A 1 13 ? 2.211   -7.833  1.735   1.00 0.00 ? 13 LEU A H    7  
ATOM 6898  H HA   . LEU A 1 13 ? 1.870   -8.396  -1.054  1.00 0.00 ? 13 LEU A HA   7  
ATOM 6899  H HB2  . LEU A 1 13 ? 1.558   -9.890  0.998   1.00 0.00 ? 13 LEU A HB2  7  
ATOM 6900  H HB3  . LEU A 1 13 ? -0.058  -9.164  1.097   1.00 0.00 ? 13 LEU A HB3  7  
ATOM 6901  H HG   . LEU A 1 13 ? 1.117   -11.055 -0.874  1.00 0.00 ? 13 LEU A HG   7  
ATOM 6902  H HD11 . LEU A 1 13 ? -1.629  -10.846 0.425   1.00 0.00 ? 13 LEU A HD11 7  
ATOM 6903  H HD12 . LEU A 1 13 ? -1.121  -12.133 -0.704  1.00 0.00 ? 13 LEU A HD12 7  
ATOM 6904  H HD13 . LEU A 1 13 ? -0.320  -11.959 0.871   1.00 0.00 ? 13 LEU A HD13 7  
ATOM 6905  H HD21 . LEU A 1 13 ? 0.455   -9.178  -2.310  1.00 0.00 ? 13 LEU A HD21 7  
ATOM 6906  H HD22 . LEU A 1 13 ? -0.671  -10.544 -2.539  1.00 0.00 ? 13 LEU A HD22 7  
ATOM 6907  H HD23 . LEU A 1 13 ? -1.156  -9.141  -1.566  1.00 0.00 ? 13 LEU A HD23 7  
ATOM 6908  N N    . ASP A 1 14 ? -0.248  -6.341  0.442   1.00 0.00 ? 14 ASP A N    7  
ATOM 6909  C CA   . ASP A 1 14 ? -1.278  -5.343  0.213   1.00 0.00 ? 14 ASP A CA   7  
ATOM 6910  C C    . ASP A 1 14 ? -0.704  -4.211  -0.641  1.00 0.00 ? 14 ASP A C    7  
ATOM 6911  O O    . ASP A 1 14 ? -1.468  -3.604  -1.406  1.00 0.00 ? 14 ASP A O    7  
ATOM 6912  C CB   . ASP A 1 14 ? -1.765  -4.740  1.532   1.00 0.00 ? 14 ASP A CB   7  
ATOM 6913  C CG   . ASP A 1 14 ? -3.278  -4.537  1.631   1.00 0.00 ? 14 ASP A CG   7  
ATOM 6914  O OD1  . ASP A 1 14 ? -4.065  -5.464  1.390   1.00 0.00 ? 14 ASP A OD1  7  
ATOM 6915  O OD2  . ASP A 1 14 ? -3.647  -3.349  1.976   1.00 0.00 ? 14 ASP A OD2  7  
ATOM 6916  H H    . ASP A 1 14 ? 0.131   -6.430  1.385   1.00 0.00 ? 14 ASP A H    7  
ATOM 6917  H HA   . ASP A 1 14 ? -2.107  -5.806  -0.322  1.00 0.00 ? 14 ASP A HA   7  
ATOM 6918  H HB2  . ASP A 1 14 ? -1.445  -5.415  2.327   1.00 0.00 ? 14 ASP A HB2  7  
ATOM 6919  H HB3  . ASP A 1 14 ? -1.252  -3.785  1.650   1.00 0.00 ? 14 ASP A HB3  7  
ATOM 6920  N N    . ASN A 1 15 ? 0.608   -3.953  -0.496  1.00 0.00 ? 15 ASN A N    7  
ATOM 6921  C CA   . ASN A 1 15 ? 1.274   -2.903  -1.249  1.00 0.00 ? 15 ASN A CA   7  
ATOM 6922  C C    . ASN A 1 15 ? 1.213   -3.235  -2.741  1.00 0.00 ? 15 ASN A C    7  
ATOM 6923  O O    . ASN A 1 15 ? 0.843   -2.351  -3.526  1.00 0.00 ? 15 ASN A O    7  
ATOM 6924  C CB   . ASN A 1 15 ? 2.747   -2.791  -0.850  1.00 0.00 ? 15 ASN A CB   7  
ATOM 6925  C CG   . ASN A 1 15 ? 3.256   -1.360  -1.032  1.00 0.00 ? 15 ASN A CG   7  
ATOM 6926  O OD1  . ASN A 1 15 ? 3.697   -0.961  -2.097  1.00 0.00 ? 15 ASN A OD1  7  
ATOM 6927  N ND2  . ASN A 1 15 ? 3.171   -0.611  0.065   1.00 0.00 ? 15 ASN A ND2  7  
ATOM 6928  H H    . ASN A 1 15 ? 1.166   -4.501  0.158   1.00 0.00 ? 15 ASN A H    7  
ATOM 6929  H HA   . ASN A 1 15 ? 0.760   -1.959  -1.073  1.00 0.00 ? 15 ASN A HA   7  
ATOM 6930  H HB2  . ASN A 1 15 ? 2.853   -3.075  0.197   1.00 0.00 ? 15 ASN A HB2  7  
ATOM 6931  H HB3  . ASN A 1 15 ? 3.334   -3.474  -1.463  1.00 0.00 ? 15 ASN A HB3  7  
ATOM 6932  H HD21 . ASN A 1 15 ? 2.792   -1.008  0.924   1.00 0.00 ? 15 ASN A HD21 7  
ATOM 6933  H HD22 . ASN A 1 15 ? 3.486   0.359   0.046   1.00 0.00 ? 15 ASN A HD22 7  
ATOM 6934  N N    . TYR A 1 16 ? 1.572   -4.482  -3.096  1.00 0.00 ? 16 TYR A N    7  
ATOM 6935  C CA   . TYR A 1 16 ? 1.540   -4.858  -4.500  1.00 0.00 ? 16 TYR A CA   7  
ATOM 6936  C C    . TYR A 1 16 ? 0.106   -4.741  -5.021  1.00 0.00 ? 16 TYR A C    7  
ATOM 6937  O O    . TYR A 1 16 ? -0.060  -4.338  -6.181  1.00 0.00 ? 16 TYR A O    7  
ATOM 6938  C CB   . TYR A 1 16 ? 2.100   -6.280  -4.679  1.00 0.00 ? 16 TYR A CB   7  
ATOM 6939  C CG   . TYR A 1 16 ? 3.325   -6.589  -3.827  1.00 0.00 ? 16 TYR A CG   7  
ATOM 6940  C CD1  . TYR A 1 16 ? 4.278   -5.581  -3.552  1.00 0.00 ? 16 TYR A CD1  7  
ATOM 6941  C CD2  . TYR A 1 16 ? 3.515   -7.890  -3.310  1.00 0.00 ? 16 TYR A CD2  7  
ATOM 6942  C CE1  . TYR A 1 16 ? 5.411   -5.873  -2.766  1.00 0.00 ? 16 TYR A CE1  7  
ATOM 6943  C CE2  . TYR A 1 16 ? 4.650   -8.182  -2.522  1.00 0.00 ? 16 TYR A CE2  7  
ATOM 6944  C CZ   . TYR A 1 16 ? 5.599   -7.174  -2.248  1.00 0.00 ? 16 TYR A CZ   7  
ATOM 6945  O OH   . TYR A 1 16 ? 6.694   -7.460  -1.484  1.00 0.00 ? 16 TYR A OH   7  
ATOM 6946  H H    . TYR A 1 16 ? 1.865   -5.156  -2.404  1.00 0.00 ? 16 TYR A H    7  
ATOM 6947  H HA   . TYR A 1 16 ? 2.162   -4.154  -5.055  1.00 0.00 ? 16 TYR A HA   7  
ATOM 6948  H HB2  . TYR A 1 16 ? 1.313   -7.005  -4.460  1.00 0.00 ? 16 TYR A HB2  7  
ATOM 6949  H HB3  . TYR A 1 16 ? 2.380   -6.420  -5.725  1.00 0.00 ? 16 TYR A HB3  7  
ATOM 6950  H HD1  . TYR A 1 16 ? 4.143   -4.584  -3.945  1.00 0.00 ? 16 TYR A HD1  7  
ATOM 6951  H HD2  . TYR A 1 16 ? 2.794   -8.668  -3.516  1.00 0.00 ? 16 TYR A HD2  7  
ATOM 6952  H HE1  . TYR A 1 16 ? 6.135   -5.096  -2.561  1.00 0.00 ? 16 TYR A HE1  7  
ATOM 6953  H HE2  . TYR A 1 16 ? 4.788   -9.180  -2.131  1.00 0.00 ? 16 TYR A HE2  7  
ATOM 6954  H HH   . TYR A 1 16 ? 7.103   -6.684  -1.094  1.00 0.00 ? 16 TYR A HH   7  
ATOM 6955  N N    . HIS A 1 17 ? -0.881  -5.096  -4.179  1.00 0.00 ? 17 HIS A N    7  
ATOM 6956  C CA   . HIS A 1 17 ? -2.280  -5.037  -4.565  1.00 0.00 ? 17 HIS A CA   7  
ATOM 6957  C C    . HIS A 1 17 ? -2.714  -3.574  -4.673  1.00 0.00 ? 17 HIS A C    7  
ATOM 6958  O O    . HIS A 1 17 ? -3.563  -3.271  -5.525  1.00 0.00 ? 17 HIS A O    7  
ATOM 6959  C CB   . HIS A 1 17 ? -3.149  -5.844  -3.599  1.00 0.00 ? 17 HIS A CB   7  
ATOM 6960  C CG   . HIS A 1 17 ? -4.328  -5.079  -3.047  1.00 0.00 ? 17 HIS A CG   7  
ATOM 6961  N ND1  . HIS A 1 17 ? -5.512  -4.919  -3.746  1.00 0.00 ? 17 HIS A ND1  7  
ATOM 6962  C CD2  . HIS A 1 17 ? -4.493  -4.432  -1.858  1.00 0.00 ? 17 HIS A CD2  7  
ATOM 6963  C CE1  . HIS A 1 17 ? -6.344  -4.205  -3.001  1.00 0.00 ? 17 HIS A CE1  7  
ATOM 6964  N NE2  . HIS A 1 17 ? -5.710  -3.904  -1.831  1.00 0.00 ? 17 HIS A NE2  7  
ATOM 6965  H H    . HIS A 1 17 ? -0.657  -5.418  -3.238  1.00 0.00 ? 17 HIS A H    7  
ATOM 6966  H HA   . HIS A 1 17 ? -2.350  -5.501  -5.549  1.00 0.00 ? 17 HIS A HA   7  
ATOM 6967  H HB2  . HIS A 1 17 ? -3.515  -6.717  -4.141  1.00 0.00 ? 17 HIS A HB2  7  
ATOM 6968  H HB3  . HIS A 1 17 ? -2.507  -6.176  -2.784  1.00 0.00 ? 17 HIS A HB3  7  
ATOM 6969  H HD1  . HIS A 1 17 ? -5.803  -5.244  -4.667  1.00 0.00 ? 17 HIS A HD1  7  
ATOM 6970  H HD2  . HIS A 1 17 ? -3.830  -4.303  -1.014  1.00 0.00 ? 17 HIS A HD2  7  
ATOM 6971  H HE1  . HIS A 1 17 ? -7.331  -3.969  -3.370  1.00 0.00 ? 17 HIS A HE1  7  
ATOM 6972  N N    . LEU A 1 18 ? -2.136  -2.710  -3.820  1.00 0.00 ? 18 LEU A N    7  
ATOM 6973  C CA   . LEU A 1 18 ? -2.460  -1.294  -3.819  1.00 0.00 ? 18 LEU A CA   7  
ATOM 6974  C C    . LEU A 1 18 ? -1.776  -0.617  -5.009  1.00 0.00 ? 18 LEU A C    7  
ATOM 6975  O O    . LEU A 1 18 ? -2.434  0.178   -5.694  1.00 0.00 ? 18 LEU A O    7  
ATOM 6976  C CB   . LEU A 1 18 ? -2.111  -0.665  -2.469  1.00 0.00 ? 18 LEU A CB   7  
ATOM 6977  C CG   . LEU A 1 18 ? -3.012  -1.052  -1.295  1.00 0.00 ? 18 LEU A CG   7  
ATOM 6978  C CD1  . LEU A 1 18 ? -2.339  -0.734  0.042   1.00 0.00 ? 18 LEU A CD1  7  
ATOM 6979  C CD2  . LEU A 1 18 ? -4.387  -0.392  -1.416  1.00 0.00 ? 18 LEU A CD2  7  
ATOM 6980  H H    . LEU A 1 18 ? -1.444  -3.043  -3.147  1.00 0.00 ? 18 LEU A H    7  
ATOM 6981  H HA   . LEU A 1 18 ? -3.541  -1.225  -3.946  1.00 0.00 ? 18 LEU A HA   7  
ATOM 6982  H HB2  . LEU A 1 18 ? -1.088  -0.965  -2.245  1.00 0.00 ? 18 LEU A HB2  7  
ATOM 6983  H HB3  . LEU A 1 18 ? -2.139  0.414   -2.619  1.00 0.00 ? 18 LEU A HB3  7  
ATOM 6984  H HG   . LEU A 1 18 ? -3.130  -2.134  -1.373  1.00 0.00 ? 18 LEU A HG   7  
ATOM 6985  H HD11 . LEU A 1 18 ? -2.120  0.331   0.102   1.00 0.00 ? 18 LEU A HD11 7  
ATOM 6986  H HD12 . LEU A 1 18 ? -3.007  -1.023  0.853   1.00 0.00 ? 18 LEU A HD12 7  
ATOM 6987  H HD13 . LEU A 1 18 ? -1.409  -1.294  0.131   1.00 0.00 ? 18 LEU A HD13 7  
ATOM 6988  H HD21 . LEU A 1 18 ? -4.865  -0.699  -2.346  1.00 0.00 ? 18 LEU A HD21 7  
ATOM 6989  H HD22 . LEU A 1 18 ? -5.000  -0.690  -0.566  1.00 0.00 ? 18 LEU A HD22 7  
ATOM 6990  H HD23 . LEU A 1 18 ? -4.279  0.692   -1.414  1.00 0.00 ? 18 LEU A HD23 7  
ATOM 6991  N N    . GLU A 1 19 ? -0.489  -0.941  -5.226  1.00 0.00 ? 19 GLU A N    7  
ATOM 6992  C CA   . GLU A 1 19 ? 0.275   -0.369  -6.322  1.00 0.00 ? 19 GLU A CA   7  
ATOM 6993  C C    . GLU A 1 19 ? -0.358  -0.786  -7.651  1.00 0.00 ? 19 GLU A C    7  
ATOM 6994  O O    . GLU A 1 19 ? -0.346  0.024   -8.589  1.00 0.00 ? 19 GLU A O    7  
ATOM 6995  C CB   . GLU A 1 19 ? 1.746   -0.785  -6.260  1.00 0.00 ? 19 GLU A CB   7  
ATOM 6996  C CG   . GLU A 1 19 ? 2.666   0.421   -6.451  1.00 0.00 ? 19 GLU A CG   7  
ATOM 6997  C CD   . GLU A 1 19 ? 3.913   0.305   -5.571  1.00 0.00 ? 19 GLU A CD   7  
ATOM 6998  O OE1  . GLU A 1 19 ? 4.725   -0.610  -5.765  1.00 0.00 ? 19 GLU A OE1  7  
ATOM 6999  O OE2  . GLU A 1 19 ? 4.021   1.210   -4.658  1.00 0.00 ? 19 GLU A OE2  7  
ATOM 7000  H H    . GLU A 1 19 ? -0.020  -1.607  -4.613  1.00 0.00 ? 19 GLU A H    7  
ATOM 7001  H HA   . GLU A 1 19 ? 0.210   0.715   -6.223  1.00 0.00 ? 19 GLU A HA   7  
ATOM 7002  H HB2  . GLU A 1 19 ? 1.945   -1.234  -5.287  1.00 0.00 ? 19 GLU A HB2  7  
ATOM 7003  H HB3  . GLU A 1 19 ? 1.937   -1.525  -7.038  1.00 0.00 ? 19 GLU A HB3  7  
ATOM 7004  H HG2  . GLU A 1 19 ? 2.974   0.471   -7.496  1.00 0.00 ? 19 GLU A HG2  7  
ATOM 7005  H HG3  . GLU A 1 19 ? 2.116   1.328   -6.199  1.00 0.00 ? 19 GLU A HG3  7  
ATOM 7006  N N    . ASN A 1 20 ? -0.888  -2.021  -7.704  1.00 0.00 ? 20 ASN A N    7  
ATOM 7007  C CA   . ASN A 1 20 ? -1.519  -2.537  -8.908  1.00 0.00 ? 20 ASN A CA   7  
ATOM 7008  C C    . ASN A 1 20 ? -2.833  -1.793  -9.149  1.00 0.00 ? 20 ASN A C    7  
ATOM 7009  O O    . ASN A 1 20 ? -3.259  -1.708  -10.310 1.00 0.00 ? 20 ASN A O    7  
ATOM 7010  C CB   . ASN A 1 20 ? -1.837  -4.027  -8.767  1.00 0.00 ? 20 ASN A CB   7  
ATOM 7011  C CG   . ASN A 1 20 ? -0.643  -4.885  -9.192  1.00 0.00 ? 20 ASN A CG   7  
ATOM 7012  O OD1  . ASN A 1 20 ? 0.167   -4.502  -10.019 1.00 0.00 ? 20 ASN A OD1  7  
ATOM 7013  N ND2  . ASN A 1 20 ? -0.582  -6.065  -8.582  1.00 0.00 ? 20 ASN A ND2  7  
ATOM 7014  H H    . ASN A 1 20 ? -0.855  -2.626  -6.884  1.00 0.00 ? 20 ASN A H    7  
ATOM 7015  H HA   . ASN A 1 20 ? -0.855  -2.369  -9.755  1.00 0.00 ? 20 ASN A HA   7  
ATOM 7016  H HB2  . ASN A 1 20 ? -2.074  -4.241  -7.725  1.00 0.00 ? 20 ASN A HB2  7  
ATOM 7017  H HB3  . ASN A 1 20 ? -2.704  -4.263  -9.384  1.00 0.00 ? 20 ASN A HB3  7  
ATOM 7018  H HD21 . ASN A 1 20 ? -1.294  -6.324  -7.899  1.00 0.00 ? 20 ASN A HD21 7  
ATOM 7019  H HD22 . ASN A 1 20 ? 0.177   -6.712  -8.797  1.00 0.00 ? 20 ASN A HD22 7  
ATOM 7020  N N    . GLU A 1 21 ? -3.440  -1.278  -8.065  1.00 0.00 ? 21 GLU A N    7  
ATOM 7021  C CA   . GLU A 1 21 ? -4.694  -0.548  -8.159  1.00 0.00 ? 21 GLU A CA   7  
ATOM 7022  C C    . GLU A 1 21 ? -4.406  0.906   -8.541  1.00 0.00 ? 21 GLU A C    7  
ATOM 7023  O O    . GLU A 1 21 ? -5.215  1.494   -9.274  1.00 0.00 ? 21 GLU A O    7  
ATOM 7024  C CB   . GLU A 1 21 ? -5.487  -0.626  -6.853  1.00 0.00 ? 21 GLU A CB   7  
ATOM 7025  C CG   . GLU A 1 21 ? -6.994  -0.607  -7.125  1.00 0.00 ? 21 GLU A CG   7  
ATOM 7026  C CD   . GLU A 1 21 ? -7.595  -2.004  -6.971  1.00 0.00 ? 21 GLU A CD   7  
ATOM 7027  O OE1  . GLU A 1 21 ? -6.883  -2.962  -7.462  1.00 0.00 ? 21 GLU A OE1  7  
ATOM 7028  O OE2  . GLU A 1 21 ? -8.691  -2.150  -6.410  1.00 0.00 ? 21 GLU A OE2  7  
ATOM 7029  H H    . GLU A 1 21 ? -3.022  -1.392  -7.142  1.00 0.00 ? 21 GLU A H    7  
ATOM 7030  H HA   . GLU A 1 21 ? -5.274  -1.016  -8.955  1.00 0.00 ? 21 GLU A HA   7  
ATOM 7031  H HB2  . GLU A 1 21 ? -5.232  -1.550  -6.337  1.00 0.00 ? 21 GLU A HB2  7  
ATOM 7032  H HB3  . GLU A 1 21 ? -5.213  0.220   -6.223  1.00 0.00 ? 21 GLU A HB3  7  
ATOM 7033  H HG2  . GLU A 1 21 ? -7.473  0.067   -6.415  1.00 0.00 ? 21 GLU A HG2  7  
ATOM 7034  H HG3  . GLU A 1 21 ? -7.165  -0.236  -8.136  1.00 0.00 ? 21 GLU A HG3  7  
ATOM 7035  N N    . VAL A 1 22 ? -3.279  1.447   -8.046  1.00 0.00 ? 22 VAL A N    7  
ATOM 7036  C CA   . VAL A 1 22 ? -2.892  2.817   -8.334  1.00 0.00 ? 22 VAL A CA   7  
ATOM 7037  C C    . VAL A 1 22 ? -2.283  2.887   -9.735  1.00 0.00 ? 22 VAL A C    7  
ATOM 7038  O O    . VAL A 1 22 ? -2.597  3.837   -10.467 1.00 0.00 ? 22 VAL A O    7  
ATOM 7039  C CB   . VAL A 1 22 ? -1.948  3.334   -7.246  1.00 0.00 ? 22 VAL A CB   7  
ATOM 7040  C CG1  . VAL A 1 22 ? -1.358  4.692   -7.631  1.00 0.00 ? 22 VAL A CG1  7  
ATOM 7041  C CG2  . VAL A 1 22 ? -2.660  3.408   -5.893  1.00 0.00 ? 22 VAL A CG2  7  
ATOM 7042  H H    . VAL A 1 22 ? -2.667  0.891   -7.448  1.00 0.00 ? 22 VAL A H    7  
ATOM 7043  H HA   . VAL A 1 22 ? -3.797  3.424   -8.309  1.00 0.00 ? 22 VAL A HA   7  
ATOM 7044  H HB   . VAL A 1 22 ? -1.142  2.601   -7.182  1.00 0.00 ? 22 VAL A HB   7  
ATOM 7045  H HG11 . VAL A 1 22 ? -2.159  5.416   -7.777  1.00 0.00 ? 22 VAL A HG11 7  
ATOM 7046  H HG12 . VAL A 1 22 ? -0.693  5.028   -6.836  1.00 0.00 ? 22 VAL A HG12 7  
ATOM 7047  H HG13 . VAL A 1 22 ? -0.788  4.600   -8.556  1.00 0.00 ? 22 VAL A HG13 7  
ATOM 7048  H HG21 . VAL A 1 22 ? -3.020  2.420   -5.607  1.00 0.00 ? 22 VAL A HG21 7  
ATOM 7049  H HG22 . VAL A 1 22 ? -1.959  3.779   -5.144  1.00 0.00 ? 22 VAL A HG22 7  
ATOM 7050  H HG23 . VAL A 1 22 ? -3.507  4.091   -5.955  1.00 0.00 ? 22 VAL A HG23 7  
ATOM 7051  N N    . ALA A 1 23 ? -1.440  1.895   -10.076 1.00 0.00 ? 23 ALA A N    7  
ATOM 7052  C CA   . ALA A 1 23 ? -0.795  1.846   -11.377 1.00 0.00 ? 23 ALA A CA   7  
ATOM 7053  C C    . ALA A 1 23 ? -1.852  1.593   -12.455 1.00 0.00 ? 23 ALA A C    7  
ATOM 7054  O O    . ALA A 1 23 ? -1.557  1.827   -13.636 1.00 0.00 ? 23 ALA A O    7  
ATOM 7055  C CB   . ALA A 1 23 ? 0.166   0.657   -11.430 1.00 0.00 ? 23 ALA A CB   7  
ATOM 7056  H H    . ALA A 1 23 ? -1.236  1.149   -9.411  1.00 0.00 ? 23 ALA A H    7  
ATOM 7057  H HA   . ALA A 1 23 ? -0.280  2.780   -11.598 1.00 0.00 ? 23 ALA A HA   7  
ATOM 7058  H HB1  . ALA A 1 23 ? 0.914   0.769   -10.647 1.00 0.00 ? 23 ALA A HB1  7  
ATOM 7059  H HB2  . ALA A 1 23 ? -0.383  -0.272  -11.267 1.00 0.00 ? 23 ALA A HB2  7  
ATOM 7060  H HB3  . ALA A 1 23 ? 0.651   0.614   -12.406 1.00 0.00 ? 23 ALA A HB3  7  
ATOM 7061  N N    . ARG A 1 24 ? -3.042  1.127   -12.035 1.00 0.00 ? 24 ARG A N    7  
ATOM 7062  C CA   . ARG A 1 24 ? -4.128  0.847   -12.957 1.00 0.00 ? 24 ARG A CA   7  
ATOM 7063  C C    . ARG A 1 24 ? -5.092  2.035   -12.980 1.00 0.00 ? 24 ARG A C    7  
ATOM 7064  O O    . ARG A 1 24 ? -5.779  2.218   -13.995 1.00 0.00 ? 24 ARG A O    7  
ATOM 7065  C CB   . ARG A 1 24 ? -4.895  -0.415  -12.557 1.00 0.00 ? 24 ARG A CB   7  
ATOM 7066  C CG   . ARG A 1 24 ? -4.373  -1.637  -13.316 1.00 0.00 ? 24 ARG A CG   7  
ATOM 7067  C CD   . ARG A 1 24 ? -2.948  -1.984  -12.883 1.00 0.00 ? 24 ARG A CD   7  
ATOM 7068  N NE   . ARG A 1 24 ? -2.127  -2.323  -14.066 1.00 0.00 ? 24 ARG A NE   7  
ATOM 7069  C CZ   . ARG A 1 24 ? -1.291  -3.382  -14.129 1.00 0.00 ? 24 ARG A CZ   7  
ATOM 7070  N NH1  . ARG A 1 24 ? -1.182  -4.188  -13.064 1.00 0.00 ? 24 ARG A NH1  7  
ATOM 7071  N NH2  . ARG A 1 24 ? -0.581  -3.622  -15.240 1.00 0.00 ? 24 ARG A NH2  7  
ATOM 7072  H H    . ARG A 1 24 ? -3.202  0.962   -11.041 1.00 0.00 ? 24 ARG A H    7  
ATOM 7073  H HA   . ARG A 1 24 ? -3.698  0.720   -13.950 1.00 0.00 ? 24 ARG A HA   7  
ATOM 7074  H HB2  . ARG A 1 24 ? -4.771  -0.581  -11.488 1.00 0.00 ? 24 ARG A HB2  7  
ATOM 7075  H HB3  . ARG A 1 24 ? -5.954  -0.268  -12.772 1.00 0.00 ? 24 ARG A HB3  7  
ATOM 7076  H HG2  . ARG A 1 24 ? -5.024  -2.487  -13.109 1.00 0.00 ? 24 ARG A HG2  7  
ATOM 7077  H HG3  . ARG A 1 24 ? -4.396  -1.425  -14.385 1.00 0.00 ? 24 ARG A HG3  7  
ATOM 7078  H HD2  . ARG A 1 24 ? -2.503  -1.126  -12.377 1.00 0.00 ? 24 ARG A HD2  7  
ATOM 7079  H HD3  . ARG A 1 24 ? -2.973  -2.828  -12.193 1.00 0.00 ? 24 ARG A HD3  7  
ATOM 7080  H HE   . ARG A 1 24 ? -2.221  -1.700  -14.868 1.00 0.00 ? 24 ARG A HE   7  
ATOM 7081  H HH11 . ARG A 1 24 ? -1.726  -3.998  -12.223 1.00 0.00 ? 24 ARG A HH11 7  
ATOM 7082  H HH12 . ARG A 1 24 ? -0.555  -4.992  -13.095 1.00 0.00 ? 24 ARG A HH12 7  
ATOM 7083  H HH21 . ARG A 1 24 ? -0.669  -3.004  -16.045 1.00 0.00 ? 24 ARG A HH21 7  
ATOM 7084  H HH22 . ARG A 1 24 ? 0.049   -4.423  -15.279 1.00 0.00 ? 24 ARG A HH22 7  
ATOM 7085  N N    . LEU A 1 25 ? -5.124  2.806   -11.878 1.00 0.00 ? 25 LEU A N    7  
ATOM 7086  C CA   . LEU A 1 25 ? -5.996  3.964   -11.773 1.00 0.00 ? 25 LEU A CA   7  
ATOM 7087  C C    . LEU A 1 25 ? -5.273  5.193   -12.329 1.00 0.00 ? 25 LEU A C    7  
ATOM 7088  O O    . LEU A 1 25 ? -5.939  6.045   -12.934 1.00 0.00 ? 25 LEU A O    7  
ATOM 7089  C CB   . LEU A 1 25 ? -6.485  4.137   -10.334 1.00 0.00 ? 25 LEU A CB   7  
ATOM 7090  C CG   . LEU A 1 25 ? -7.572  3.164   -9.874  1.00 0.00 ? 25 LEU A CG   7  
ATOM 7091  C CD1  . LEU A 1 25 ? -7.762  3.232   -8.357  1.00 0.00 ? 25 LEU A CD1  7  
ATOM 7092  C CD2  . LEU A 1 25 ? -8.881  3.408   -10.626 1.00 0.00 ? 25 LEU A CD2  7  
ATOM 7093  H H    . LEU A 1 25 ? -4.524  2.585   -11.083 1.00 0.00 ? 25 LEU A H    7  
ATOM 7094  H HA   . LEU A 1 25 ? -6.866  3.753   -12.394 1.00 0.00 ? 25 LEU A HA   7  
ATOM 7095  H HB2  . LEU A 1 25 ? -5.610  4.020   -9.695  1.00 0.00 ? 25 LEU A HB2  7  
ATOM 7096  H HB3  . LEU A 1 25 ? -6.847  5.163   -10.256 1.00 0.00 ? 25 LEU A HB3  7  
ATOM 7097  H HG   . LEU A 1 25 ? -7.194  2.174   -10.129 1.00 0.00 ? 25 LEU A HG   7  
ATOM 7098  H HD11 . LEU A 1 25 ? -8.045  4.243   -8.063  1.00 0.00 ? 25 LEU A HD11 7  
ATOM 7099  H HD12 . LEU A 1 25 ? -8.542  2.528   -8.065  1.00 0.00 ? 25 LEU A HD12 7  
ATOM 7100  H HD13 . LEU A 1 25 ? -6.833  2.963   -7.853  1.00 0.00 ? 25 LEU A HD13 7  
ATOM 7101  H HD21 . LEU A 1 25 ? -8.723  3.279   -11.697 1.00 0.00 ? 25 LEU A HD21 7  
ATOM 7102  H HD22 . LEU A 1 25 ? -9.630  2.699   -10.274 1.00 0.00 ? 25 LEU A HD22 7  
ATOM 7103  H HD23 . LEU A 1 25 ? -9.235  4.421   -10.438 1.00 0.00 ? 25 LEU A HD23 7  
ATOM 7104  N N    . LYS A 1 26 ? -3.946  5.258   -12.117 1.00 0.00 ? 26 LYS A N    7  
ATOM 7105  C CA   . LYS A 1 26 ? -3.145  6.372   -12.593 1.00 0.00 ? 26 LYS A CA   7  
ATOM 7106  C C    . LYS A 1 26 ? -3.266  6.468   -14.116 1.00 0.00 ? 26 LYS A C    7  
ATOM 7107  O O    . LYS A 1 26 ? -3.081  7.570   -14.653 1.00 0.00 ? 26 LYS A O    7  
ATOM 7108  C CB   . LYS A 1 26 ? -1.702  6.245   -12.098 1.00 0.00 ? 26 LYS A CB   7  
ATOM 7109  C CG   . LYS A 1 26 ? -1.421  7.241   -10.970 1.00 0.00 ? 26 LYS A CG   7  
ATOM 7110  C CD   . LYS A 1 26 ? -2.579  7.281   -9.972  1.00 0.00 ? 26 LYS A CD   7  
ATOM 7111  C CE   . LYS A 1 26 ? -3.455  8.515   -10.198 1.00 0.00 ? 26 LYS A CE   7  
ATOM 7112  N NZ   . LYS A 1 26 ? -3.378  9.421   -9.041  1.00 0.00 ? 26 LYS A NZ   7  
ATOM 7113  H H    . LYS A 1 26 ? -3.473  4.512   -11.608 1.00 0.00 ? 26 LYS A H    7  
ATOM 7114  H HA   . LYS A 1 26 ? -3.569  7.272   -12.146 1.00 0.00 ? 26 LYS A HA   7  
ATOM 7115  H HB2  . LYS A 1 26 ? -1.544  5.233   -11.726 1.00 0.00 ? 26 LYS A HB2  7  
ATOM 7116  H HB3  . LYS A 1 26 ? -1.025  6.427   -12.932 1.00 0.00 ? 26 LYS A HB3  7  
ATOM 7117  H HG2  . LYS A 1 26 ? -0.513  6.936   -10.449 1.00 0.00 ? 26 LYS A HG2  7  
ATOM 7118  H HG3  . LYS A 1 26 ? -1.267  8.230   -11.402 1.00 0.00 ? 26 LYS A HG3  7  
ATOM 7119  H HD2  . LYS A 1 26 ? -3.188  6.386   -10.100 1.00 0.00 ? 26 LYS A HD2  7  
ATOM 7120  H HD3  . LYS A 1 26 ? -2.175  7.293   -8.960  1.00 0.00 ? 26 LYS A HD3  7  
ATOM 7121  H HE2  . LYS A 1 26 ? -3.106  9.043   -11.086 1.00 0.00 ? 26 LYS A HE2  7  
ATOM 7122  H HE3  . LYS A 1 26 ? -4.486  8.199   -10.355 1.00 0.00 ? 26 LYS A HE3  7  
ATOM 7123  H HZ1  . LYS A 1 26 ? -2.413  9.717   -8.894  1.00 0.00 ? 26 LYS A HZ1  7  
ATOM 7124  H HZ2  . LYS A 1 26 ? -3.968  10.234  -9.215  1.00 0.00 ? 26 LYS A HZ2  7  
ATOM 7125  H HZ3  . LYS A 1 26 ? -3.709  8.944   -8.203  1.00 0.00 ? 26 LYS A HZ3  7  
ATOM 7126  N N    . LYS A 1 27 ? -3.569  5.332   -14.769 1.00 0.00 ? 27 LYS A N    7  
ATOM 7127  C CA   . LYS A 1 27 ? -3.712  5.290   -16.214 1.00 0.00 ? 27 LYS A CA   7  
ATOM 7128  C C    . LYS A 1 27 ? -5.083  5.847   -16.602 1.00 0.00 ? 27 LYS A C    7  
ATOM 7129  O O    . LYS A 1 27 ? -5.295  6.112   -17.794 1.00 0.00 ? 27 LYS A O    7  
ATOM 7130  C CB   . LYS A 1 27 ? -3.454  3.875   -16.736 1.00 0.00 ? 27 LYS A CB   7  
ATOM 7131  C CG   . LYS A 1 27 ? -2.592  3.907   -18.000 1.00 0.00 ? 27 LYS A CG   7  
ATOM 7132  C CD   . LYS A 1 27 ? -2.186  2.493   -18.423 1.00 0.00 ? 27 LYS A CD   7  
ATOM 7133  C CE   . LYS A 1 27 ? -1.003  1.992   -17.593 1.00 0.00 ? 27 LYS A CE   7  
ATOM 7134  N NZ   . LYS A 1 27 ? 0.235   2.684   -17.990 1.00 0.00 ? 27 LYS A NZ   7  
ATOM 7135  H H    . LYS A 1 27 ? -3.706  4.466   -14.247 1.00 0.00 ? 27 LYS A H    7  
ATOM 7136  H HA   . LYS A 1 27 ? -2.937  5.939   -16.621 1.00 0.00 ? 27 LYS A HA   7  
ATOM 7137  H HB2  . LYS A 1 27 ? -2.934  3.304   -15.967 1.00 0.00 ? 27 LYS A HB2  7  
ATOM 7138  H HB3  . LYS A 1 27 ? -4.410  3.396   -16.949 1.00 0.00 ? 27 LYS A HB3  7  
ATOM 7139  H HG2  . LYS A 1 27 ? -3.163  4.367   -18.806 1.00 0.00 ? 27 LYS A HG2  7  
ATOM 7140  H HG3  . LYS A 1 27 ? -1.703  4.507   -17.807 1.00 0.00 ? 27 LYS A HG3  7  
ATOM 7141  H HD2  . LYS A 1 27 ? -3.033  1.823   -18.273 1.00 0.00 ? 27 LYS A HD2  7  
ATOM 7142  H HD3  . LYS A 1 27 ? -1.923  2.502   -19.479 1.00 0.00 ? 27 LYS A HD3  7  
ATOM 7143  H HE2  . LYS A 1 27 ? -1.196  2.188   -16.538 1.00 0.00 ? 27 LYS A HE2  7  
ATOM 7144  H HE3  . LYS A 1 27 ? -0.891  0.917   -17.740 1.00 0.00 ? 27 LYS A HE3  7  
ATOM 7145  H HZ1  . LYS A 1 27 ? 0.131   3.689   -17.853 1.00 0.00 ? 27 LYS A HZ1  7  
ATOM 7146  H HZ2  . LYS A 1 27 ? 1.007   2.333   -17.425 1.00 0.00 ? 27 LYS A HZ2  7  
ATOM 7147  H HZ3  . LYS A 1 27 ? 0.434   2.502   -18.974 1.00 0.00 ? 27 LYS A HZ3  7  
ATOM 7148  N N    . LEU A 1 28 ? -5.971  6.012   -15.606 1.00 0.00 ? 28 LEU A N    7  
ATOM 7149  C CA   . LEU A 1 28 ? -7.306  6.534   -15.843 1.00 0.00 ? 28 LEU A CA   7  
ATOM 7150  C C    . LEU A 1 28 ? -7.407  7.948   -15.268 1.00 0.00 ? 28 LEU A C    7  
ATOM 7151  O O    . LEU A 1 28 ? -8.116  8.776   -15.860 1.00 0.00 ? 28 LEU A O    7  
ATOM 7152  C CB   . LEU A 1 28 ? -8.363  5.571   -15.295 1.00 0.00 ? 28 LEU A CB   7  
ATOM 7153  C CG   . LEU A 1 28 ? -9.499  5.207   -16.252 1.00 0.00 ? 28 LEU A CG   7  
ATOM 7154  C CD1  . LEU A 1 28 ? -9.114  4.016   -17.132 1.00 0.00 ? 28 LEU A CD1  7  
ATOM 7155  C CD2  . LEU A 1 28 ? -10.801 4.957   -15.489 1.00 0.00 ? 28 LEU A CD2  7  
ATOM 7156  H H    . LEU A 1 28 ? -5.715  5.769   -14.649 1.00 0.00 ? 28 LEU A H    7  
ATOM 7157  H HA   . LEU A 1 28 ? -7.432  6.580   -16.924 1.00 0.00 ? 28 LEU A HA   7  
ATOM 7158  H HB2  . LEU A 1 28 ? -7.832  4.663   -15.011 1.00 0.00 ? 28 LEU A HB2  7  
ATOM 7159  H HB3  . LEU A 1 28 ? -8.768  6.040   -14.398 1.00 0.00 ? 28 LEU A HB3  7  
ATOM 7160  H HG   . LEU A 1 28 ? -9.624  6.080   -16.892 1.00 0.00 ? 28 LEU A HG   7  
ATOM 7161  H HD11 . LEU A 1 28 ? -8.886  3.151   -16.508 1.00 0.00 ? 28 LEU A HD11 7  
ATOM 7162  H HD12 . LEU A 1 28 ? -9.944  3.784   -17.799 1.00 0.00 ? 28 LEU A HD12 7  
ATOM 7163  H HD13 . LEU A 1 28 ? -8.236  4.263   -17.730 1.00 0.00 ? 28 LEU A HD13 7  
ATOM 7164  H HD21 . LEU A 1 28 ? -11.082 5.851   -14.931 1.00 0.00 ? 28 LEU A HD21 7  
ATOM 7165  H HD22 . LEU A 1 28 ? -11.586 4.702   -16.200 1.00 0.00 ? 28 LEU A HD22 7  
ATOM 7166  H HD23 . LEU A 1 28 ? -10.670 4.131   -14.790 1.00 0.00 ? 28 LEU A HD23 7  
ATOM 7167  N N    . VAL A 1 29 ? -6.707  8.193   -14.146 1.00 0.00 ? 29 VAL A N    7  
ATOM 7168  C CA   . VAL A 1 29 ? -6.717  9.495   -13.501 1.00 0.00 ? 29 VAL A CA   7  
ATOM 7169  C C    . VAL A 1 29 ? -5.355  10.165  -13.691 1.00 0.00 ? 29 VAL A C    7  
ATOM 7170  O O    . VAL A 1 29 ? -5.305  11.231  -14.321 1.00 0.00 ? 29 VAL A O    7  
ATOM 7171  C CB   . VAL A 1 29 ? -7.110  9.347   -12.029 1.00 0.00 ? 29 VAL A CB   7  
ATOM 7172  C CG1  . VAL A 1 29 ? -7.452  10.705  -11.414 1.00 0.00 ? 29 VAL A CG1  7  
ATOM 7173  C CG2  . VAL A 1 29 ? -8.271  8.364   -11.869 1.00 0.00 ? 29 VAL A CG2  7  
ATOM 7174  H H    . VAL A 1 29 ? -6.147  7.453   -13.723 1.00 0.00 ? 29 VAL A H    7  
ATOM 7175  H HA   . VAL A 1 29 ? -7.480  10.098  -13.993 1.00 0.00 ? 29 VAL A HA   7  
ATOM 7176  H HB   . VAL A 1 29 ? -6.231  8.941   -11.528 1.00 0.00 ? 29 VAL A HB   7  
ATOM 7177  H HG11 . VAL A 1 29 ? -8.280  11.161  -11.956 1.00 0.00 ? 29 VAL A HG11 7  
ATOM 7178  H HG12 . VAL A 1 29 ? -7.726  10.562  -10.368 1.00 0.00 ? 29 VAL A HG12 7  
ATOM 7179  H HG13 . VAL A 1 29 ? -6.587  11.365  -11.466 1.00 0.00 ? 29 VAL A HG13 7  
ATOM 7180  H HG21 . VAL A 1 29 ? -7.988  7.386   -12.258 1.00 0.00 ? 29 VAL A HG21 7  
ATOM 7181  H HG22 . VAL A 1 29 ? -8.524  8.283   -10.812 1.00 0.00 ? 29 VAL A HG22 7  
ATOM 7182  H HG23 . VAL A 1 29 ? -9.142  8.725   -12.415 1.00 0.00 ? 29 VAL A HG23 7  
ATOM 7183  N N    . GLY A 1 30 ? -4.294  9.536   -13.152 1.00 0.00 ? 30 GLY A N    7  
ATOM 7184  C CA   . GLY A 1 30 ? -2.947  10.068  -13.263 1.00 0.00 ? 30 GLY A CA   7  
ATOM 7185  C C    . GLY A 1 30 ? -2.635  10.354  -14.732 1.00 0.00 ? 30 GLY A C    7  
ATOM 7186  O O    . GLY A 1 30 ? -1.604  10.987  -15.004 1.00 0.00 ? 30 GLY A O    7  
ATOM 7187  H H    . GLY A 1 30 ? -4.423  8.659   -12.648 1.00 0.00 ? 30 GLY A H    7  
ATOM 7188  H HA2  . GLY A 1 30 ? -2.869  10.995  -12.696 1.00 0.00 ? 30 GLY A HA2  7  
ATOM 7189  H HA3  . GLY A 1 30 ? -2.232  9.347   -12.864 1.00 0.00 ? 30 GLY A HA3  7  
ATOM 7190  N N    . GLU A 1 31 ? -3.516  9.890   -15.636 1.00 0.00 ? 31 GLU A N    7  
ATOM 7191  C CA   . GLU A 1 31 ? -3.335  10.097  -17.064 1.00 0.00 ? 31 GLU A CA   7  
ATOM 7192  C C    . GLU A 1 31 ? -3.270  11.597  -17.354 1.00 0.00 ? 31 GLU A C    7  
ATOM 7193  O O    . GLU A 1 31 ? -3.749  12.380  -16.521 1.00 0.00 ? 31 GLU A O    7  
ATOM 7194  C CB   . GLU A 1 31 ? -4.449  9.428   -17.874 1.00 0.00 ? 31 GLU A CB   7  
ATOM 7195  C CG   . GLU A 1 31 ? -3.873  8.628   -19.043 1.00 0.00 ? 31 GLU A CG   7  
ATOM 7196  C CD   . GLU A 1 31 ? -4.931  8.398   -20.124 1.00 0.00 ? 31 GLU A CD   7  
ATOM 7197  O OE1  . GLU A 1 31 ? -5.639  9.340   -20.509 1.00 0.00 ? 31 GLU A OE1  7  
ATOM 7198  O OE2  . GLU A 1 31 ? -5.003  7.190   -20.567 1.00 0.00 ? 31 GLU A OE2  7  
ATOM 7199  H H    . GLU A 1 31 ? -4.342  9.378   -15.328 1.00 0.00 ? 31 GLU A H    7  
ATOM 7200  H HA   . GLU A 1 31 ? -2.381  9.641   -17.332 1.00 0.00 ? 31 GLU A HA   7  
ATOM 7201  H HB2  . GLU A 1 31 ? -5.004  8.755   -17.222 1.00 0.00 ? 31 GLU A HB2  7  
ATOM 7202  H HB3  . GLU A 1 31 ? -5.124  10.198  -18.246 1.00 0.00 ? 31 GLU A HB3  7  
ATOM 7203  H HG2  . GLU A 1 31 ? -3.039  9.183   -19.475 1.00 0.00 ? 31 GLU A HG2  7  
ATOM 7204  H HG3  . GLU A 1 31 ? -3.508  7.672   -18.671 1.00 0.00 ? 31 GLU A HG3  7  
ATOM 7205  N N    . ARG A 1 32 ? -2.688  11.962  -18.511 1.00 0.00 ? 32 ARG A N    7  
ATOM 7206  C CA   . ARG A 1 32 ? -2.564  13.355  -18.904 1.00 0.00 ? 32 ARG A CA   7  
ATOM 7207  C C    . ARG A 1 32 ? -3.948  13.909  -19.250 1.00 0.00 ? 32 ARG A C    7  
ATOM 7208  O O    . ARG A 1 32 ? -4.883  13.147  -19.485 1.00 0.00 ? 32 ARG A O    7  
ATOM 7209  C CB   . ARG A 1 32 ? -1.639  13.519  -20.113 1.00 0.00 ? 32 ARG A CB   7  
ATOM 7210  C CG   . ARG A 1 32 ? -0.208  13.829  -19.669 1.00 0.00 ? 32 ARG A CG   7  
ATOM 7211  C CD   . ARG A 1 32 ? 0.337   12.723  -18.764 1.00 0.00 ? 32 ARG A CD   7  
ATOM 7212  N NE   . ARG A 1 32 ? -0.047  11.397  -19.296 1.00 0.00 ? 32 ARG A NE   7  
ATOM 7213  C CZ   . ARG A 1 32 ? 0.023   10.248  -18.592 1.00 0.00 ? 32 ARG A CZ   7  
ATOM 7214  N NH1  . ARG A 1 32 ? 0.467   10.288  -17.327 1.00 0.00 ? 32 ARG A NH1  7  
ATOM 7215  N NH2  . ARG A 1 32 ? -0.344  9.085   -19.146 1.00 0.00 ? 32 ARG A NH2  7  
ATOM 7216  H H    . ARG A 1 32 ? -2.319  11.251  -19.142 1.00 0.00 ? 32 ARG A H    7  
ATOM 7217  H HA   . ARG A 1 32 ? -2.163  13.907  -18.054 1.00 0.00 ? 32 ARG A HA   7  
ATOM 7218  H HB2  . ARG A 1 32 ? -1.640  12.593  -20.688 1.00 0.00 ? 32 ARG A HB2  7  
ATOM 7219  H HB3  . ARG A 1 32 ? -2.017  14.327  -20.739 1.00 0.00 ? 32 ARG A HB3  7  
ATOM 7220  H HG2  . ARG A 1 32 ? 0.426   13.909  -20.553 1.00 0.00 ? 32 ARG A HG2  7  
ATOM 7221  H HG3  . ARG A 1 32 ? -0.200  14.781  -19.140 1.00 0.00 ? 32 ARG A HG3  7  
ATOM 7222  H HD2  . ARG A 1 32 ? 1.424   12.788  -18.726 1.00 0.00 ? 32 ARG A HD2  7  
ATOM 7223  H HD3  . ARG A 1 32 ? -0.062  12.849  -17.757 1.00 0.00 ? 32 ARG A HD3  7  
ATOM 7224  H HE   . ARG A 1 32 ? -0.383  11.384  -20.260 1.00 0.00 ? 32 ARG A HE   7  
ATOM 7225  H HH11 . ARG A 1 32 ? 0.745   11.178  -16.913 1.00 0.00 ? 32 ARG A HH11 7  
ATOM 7226  H HH12 . ARG A 1 32 ? 0.527   9.429   -16.780 1.00 0.00 ? 32 ARG A HH12 7  
ATOM 7227  H HH21 . ARG A 1 32 ? -0.681  9.063   -20.108 1.00 0.00 ? 32 ARG A HH21 7  
ATOM 7228  H HH22 . ARG A 1 32 ? -0.287  8.221   -18.606 1.00 0.00 ? 32 ARG A HH22 7  
ATOM 7229  N N    . MET B 1 1  ? 16.318  -6.828  13.104  1.00 0.00 ? 1  MET B N    7  
ATOM 7230  C CA   . MET B 1 1  ? 15.000  -6.469  13.599  1.00 0.00 ? 1  MET B CA   7  
ATOM 7231  C C    . MET B 1 1  ? 14.891  -4.945  13.686  1.00 0.00 ? 1  MET B C    7  
ATOM 7232  O O    . MET B 1 1  ? 13.801  -4.416  13.427  1.00 0.00 ? 1  MET B O    7  
ATOM 7233  C CB   . MET B 1 1  ? 14.767  -7.078  14.984  1.00 0.00 ? 1  MET B CB   7  
ATOM 7234  C CG   . MET B 1 1  ? 13.318  -7.543  15.140  1.00 0.00 ? 1  MET B CG   7  
ATOM 7235  S SD   . MET B 1 1  ? 13.090  -8.330  16.763  1.00 0.00 ? 1  MET B SD   7  
ATOM 7236  C CE   . MET B 1 1  ? 13.419  -6.911  17.850  1.00 0.00 ? 1  MET B CE   7  
ATOM 7237  H H    . MET B 1 1  ? 16.827  -7.566  13.590  1.00 0.00 ? 1  MET B H    7  
ATOM 7238  H HA   . MET B 1 1  ? 14.247  -6.839  12.903  1.00 0.00 ? 1  MET B HA   7  
ATOM 7239  H HB2  . MET B 1 1  ? 15.431  -7.933  15.110  1.00 0.00 ? 1  MET B HB2  7  
ATOM 7240  H HB3  . MET B 1 1  ? 15.002  -6.330  15.742  1.00 0.00 ? 1  MET B HB3  7  
ATOM 7241  H HG2  . MET B 1 1  ? 12.651  -6.685  15.065  1.00 0.00 ? 1  MET B HG2  7  
ATOM 7242  H HG3  . MET B 1 1  ? 13.077  -8.251  14.347  1.00 0.00 ? 1  MET B HG3  7  
ATOM 7243  H HE1  . MET B 1 1  ? 12.713  -6.108  17.636  1.00 0.00 ? 1  MET B HE1  7  
ATOM 7244  H HE2  . MET B 1 1  ? 13.319  -7.229  18.888  1.00 0.00 ? 1  MET B HE2  7  
ATOM 7245  H HE3  . MET B 1 1  ? 14.433  -6.545  17.686  1.00 0.00 ? 1  MET B HE3  7  
ATOM 7246  N N    . ASP B 1 2  ? 16.005  -4.281  14.044  1.00 0.00 ? 2  ASP B N    7  
ATOM 7247  C CA   . ASP B 1 2  ? 16.035  -2.833  14.163  1.00 0.00 ? 2  ASP B CA   7  
ATOM 7248  C C    . ASP B 1 2  ? 15.392  -2.211  12.921  1.00 0.00 ? 2  ASP B C    7  
ATOM 7249  O O    . ASP B 1 2  ? 14.876  -1.088  13.024  1.00 0.00 ? 2  ASP B O    7  
ATOM 7250  C CB   . ASP B 1 2  ? 17.471  -2.318  14.261  1.00 0.00 ? 2  ASP B CB   7  
ATOM 7251  C CG   . ASP B 1 2  ? 18.126  -2.486  15.634  1.00 0.00 ? 2  ASP B CG   7  
ATOM 7252  O OD1  . ASP B 1 2  ? 18.011  -3.543  16.272  1.00 0.00 ? 2  ASP B OD1  7  
ATOM 7253  O OD2  . ASP B 1 2  ? 18.789  -1.461  16.052  1.00 0.00 ? 2  ASP B OD2  7  
ATOM 7254  H H    . ASP B 1 2  ? 16.864  -4.795  14.241  1.00 0.00 ? 2  ASP B H    7  
ATOM 7255  H HA   . ASP B 1 2  ? 15.464  -2.539  15.044  1.00 0.00 ? 2  ASP B HA   7  
ATOM 7256  H HB2  . ASP B 1 2  ? 18.055  -2.863  13.520  1.00 0.00 ? 2  ASP B HB2  7  
ATOM 7257  H HB3  . ASP B 1 2  ? 17.447  -1.262  13.988  1.00 0.00 ? 2  ASP B HB3  7  
ATOM 7258  N N    . ALA B 1 3  ? 15.435  -2.940  11.792  1.00 0.00 ? 3  ALA B N    7  
ATOM 7259  C CA   . ALA B 1 3  ? 14.862  -2.462  10.545  1.00 0.00 ? 3  ALA B CA   7  
ATOM 7260  C C    . ALA B 1 3  ? 13.511  -3.142  10.317  1.00 0.00 ? 3  ALA B C    7  
ATOM 7261  O O    . ALA B 1 3  ? 12.705  -2.608  9.540   1.00 0.00 ? 3  ALA B O    7  
ATOM 7262  C CB   . ALA B 1 3  ? 15.755  -2.879  9.375   1.00 0.00 ? 3  ALA B CB   7  
ATOM 7263  H H    . ALA B 1 3  ? 15.881  -3.858  11.793  1.00 0.00 ? 3  ALA B H    7  
ATOM 7264  H HA   . ALA B 1 3  ? 14.717  -1.382  10.567  1.00 0.00 ? 3  ALA B HA   7  
ATOM 7265  H HB1  . ALA B 1 3  ? 16.748  -2.452  9.517   1.00 0.00 ? 3  ALA B HB1  7  
ATOM 7266  H HB2  . ALA B 1 3  ? 15.837  -3.964  9.338   1.00 0.00 ? 3  ALA B HB2  7  
ATOM 7267  H HB3  . ALA B 1 3  ? 15.329  -2.522  8.437   1.00 0.00 ? 3  ALA B HB3  7  
ATOM 7268  N N    . ILE B 1 4  ? 13.293  -4.288  10.986  1.00 0.00 ? 4  ILE B N    7  
ATOM 7269  C CA   . ILE B 1 4  ? 12.051  -5.032  10.856  1.00 0.00 ? 4  ILE B CA   7  
ATOM 7270  C C    . ILE B 1 4  ? 10.935  -4.286  11.591  1.00 0.00 ? 4  ILE B C    7  
ATOM 7271  O O    . ILE B 1 4  ? 9.831   -4.184  11.039  1.00 0.00 ? 4  ILE B O    7  
ATOM 7272  C CB   . ILE B 1 4  ? 12.238  -6.475  11.327  1.00 0.00 ? 4  ILE B CB   7  
ATOM 7273  C CG1  . ILE B 1 4  ? 13.282  -7.199  10.474  1.00 0.00 ? 4  ILE B CG1  7  
ATOM 7274  C CG2  . ILE B 1 4  ? 10.903  -7.221  11.355  1.00 0.00 ? 4  ILE B CG2  7  
ATOM 7275  C CD1  . ILE B 1 4  ? 12.743  -8.539  9.968   1.00 0.00 ? 4  ILE B CD1  7  
ATOM 7276  H H    . ILE B 1 4  ? 14.011  -4.660  11.607  1.00 0.00 ? 4  ILE B H    7  
ATOM 7277  H HA   . ILE B 1 4  ? 11.818  -5.060  9.792   1.00 0.00 ? 4  ILE B HA   7  
ATOM 7278  H HB   . ILE B 1 4  ? 12.610  -6.395  12.349  1.00 0.00 ? 4  ILE B HB   7  
ATOM 7279  H HG12 . ILE B 1 4  ? 13.536  -6.572  9.618   1.00 0.00 ? 4  ILE B HG12 7  
ATOM 7280  H HG13 . ILE B 1 4  ? 14.178  -7.362  11.073  1.00 0.00 ? 4  ILE B HG13 7  
ATOM 7281  H HG21 . ILE B 1 4  ? 10.461  -7.229  10.359  1.00 0.00 ? 4  ILE B HG21 7  
ATOM 7282  H HG22 . ILE B 1 4  ? 11.074  -8.243  11.695  1.00 0.00 ? 4  ILE B HG22 7  
ATOM 7283  H HG23 . ILE B 1 4  ? 10.217  -6.728  12.044  1.00 0.00 ? 4  ILE B HG23 7  
ATOM 7284  H HD11 . ILE B 1 4  ? 11.847  -8.376  9.368   1.00 0.00 ? 4  ILE B HD11 7  
ATOM 7285  H HD12 . ILE B 1 4  ? 13.510  -9.025  9.366   1.00 0.00 ? 4  ILE B HD12 7  
ATOM 7286  H HD13 . ILE B 1 4  ? 12.494  -9.181  10.811  1.00 0.00 ? 4  ILE B HD13 7  
ATOM 7287  N N    . LYS B 1 5  ? 11.242  -3.786  12.802  1.00 0.00 ? 5  LYS B N    7  
ATOM 7288  C CA   . LYS B 1 5  ? 10.272  -3.057  13.602  1.00 0.00 ? 5  LYS B CA   7  
ATOM 7289  C C    . LYS B 1 5  ? 9.803   -1.823  12.828  1.00 0.00 ? 5  LYS B C    7  
ATOM 7290  O O    . LYS B 1 5  ? 8.640   -1.428  12.997  1.00 0.00 ? 5  LYS B O    7  
ATOM 7291  C CB   . LYS B 1 5  ? 10.849  -2.734  14.982  1.00 0.00 ? 5  LYS B CB   7  
ATOM 7292  C CG   . LYS B 1 5  ? 12.155  -1.946  14.859  1.00 0.00 ? 5  LYS B CG   7  
ATOM 7293  C CD   . LYS B 1 5  ? 13.219  -2.495  15.812  1.00 0.00 ? 5  LYS B CD   7  
ATOM 7294  C CE   . LYS B 1 5  ? 12.587  -2.973  17.121  1.00 0.00 ? 5  LYS B CE   7  
ATOM 7295  N NZ   . LYS B 1 5  ? 13.326  -2.439  18.277  1.00 0.00 ? 5  LYS B NZ   7  
ATOM 7296  H H    . LYS B 1 5  ? 12.178  -3.914  13.185  1.00 0.00 ? 5  LYS B H    7  
ATOM 7297  H HA   . LYS B 1 5  ? 9.425   -3.727  13.749  1.00 0.00 ? 5  LYS B HA   7  
ATOM 7298  H HB2  . LYS B 1 5  ? 10.126  -2.139  15.538  1.00 0.00 ? 5  LYS B HB2  7  
ATOM 7299  H HB3  . LYS B 1 5  ? 11.027  -3.667  15.517  1.00 0.00 ? 5  LYS B HB3  7  
ATOM 7300  H HG2  . LYS B 1 5  ? 12.522  -2.025  13.835  1.00 0.00 ? 5  LYS B HG2  7  
ATOM 7301  H HG3  . LYS B 1 5  ? 11.958  -0.899  15.085  1.00 0.00 ? 5  LYS B HG3  7  
ATOM 7302  H HD2  . LYS B 1 5  ? 13.724  -3.334  15.334  1.00 0.00 ? 5  LYS B HD2  7  
ATOM 7303  H HD3  . LYS B 1 5  ? 13.948  -1.711  16.017  1.00 0.00 ? 5  LYS B HD3  7  
ATOM 7304  H HE2  . LYS B 1 5  ? 11.554  -2.626  17.169  1.00 0.00 ? 5  LYS B HE2  7  
ATOM 7305  H HE3  . LYS B 1 5  ? 12.597  -4.063  17.147  1.00 0.00 ? 5  LYS B HE3  7  
ATOM 7306  H HZ1  . LYS B 1 5  ? 13.317  -1.418  18.253  1.00 0.00 ? 5  LYS B HZ1  7  
ATOM 7307  H HZ2  . LYS B 1 5  ? 12.887  -2.770  19.135  1.00 0.00 ? 5  LYS B HZ2  7  
ATOM 7308  H HZ3  . LYS B 1 5  ? 14.294  -2.763  18.251  1.00 0.00 ? 5  LYS B HZ3  7  
ATOM 7309  N N    . LYS B 1 6  ? 10.702  -1.249  12.008  1.00 0.00 ? 6  LYS B N    7  
ATOM 7310  C CA   . LYS B 1 6  ? 10.381  -0.073  11.218  1.00 0.00 ? 6  LYS B CA   7  
ATOM 7311  C C    . LYS B 1 6  ? 9.827   -0.510  9.861   1.00 0.00 ? 6  LYS B C    7  
ATOM 7312  O O    . LYS B 1 6  ? 9.038   0.245   9.275   1.00 0.00 ? 6  LYS B O    7  
ATOM 7313  C CB   . LYS B 1 6  ? 11.597  0.852   11.117  1.00 0.00 ? 6  LYS B CB   7  
ATOM 7314  C CG   . LYS B 1 6  ? 12.464  0.757   12.373  1.00 0.00 ? 6  LYS B CG   7  
ATOM 7315  C CD   . LYS B 1 6  ? 13.602  1.780   12.333  1.00 0.00 ? 6  LYS B CD   7  
ATOM 7316  C CE   . LYS B 1 6  ? 14.270  1.910   13.703  1.00 0.00 ? 6  LYS B CE   7  
ATOM 7317  N NZ   . LYS B 1 6  ? 14.313  3.321   14.123  1.00 0.00 ? 6  LYS B NZ   7  
ATOM 7318  H H    . LYS B 1 6  ? 11.640  -1.639  11.928  1.00 0.00 ? 6  LYS B H    7  
ATOM 7319  H HA   . LYS B 1 6  ? 9.604   0.464   11.763  1.00 0.00 ? 6  LYS B HA   7  
ATOM 7320  H HB2  . LYS B 1 6  ? 12.192  0.559   10.252  1.00 0.00 ? 6  LYS B HB2  7  
ATOM 7321  H HB3  . LYS B 1 6  ? 11.251  1.876   10.980  1.00 0.00 ? 6  LYS B HB3  7  
ATOM 7322  H HG2  . LYS B 1 6  ? 11.842  0.953   13.247  1.00 0.00 ? 6  LYS B HG2  7  
ATOM 7323  H HG3  . LYS B 1 6  ? 12.872  -0.251  12.446  1.00 0.00 ? 6  LYS B HG3  7  
ATOM 7324  H HD2  . LYS B 1 6  ? 14.345  1.454   11.605  1.00 0.00 ? 6  LYS B HD2  7  
ATOM 7325  H HD3  . LYS B 1 6  ? 13.200  2.744   12.022  1.00 0.00 ? 6  LYS B HD3  7  
ATOM 7326  H HE2  . LYS B 1 6  ? 13.700  1.339   14.436  1.00 0.00 ? 6  LYS B HE2  7  
ATOM 7327  H HE3  . LYS B 1 6  ? 15.281  1.509   13.648  1.00 0.00 ? 6  LYS B HE3  7  
ATOM 7328  H HZ1  . LYS B 1 6  ? 13.366  3.697   14.174  1.00 0.00 ? 6  LYS B HZ1  7  
ATOM 7329  H HZ2  . LYS B 1 6  ? 14.761  3.382   15.036  1.00 0.00 ? 6  LYS B HZ2  7  
ATOM 7330  H HZ3  . LYS B 1 6  ? 14.851  3.868   13.451  1.00 0.00 ? 6  LYS B HZ3  7  
ATOM 7331  N N    . LYS B 1 7  ? 10.242  -1.702  9.397   1.00 0.00 ? 7  LYS B N    7  
ATOM 7332  C CA   . LYS B 1 7  ? 9.791   -2.232  8.121   1.00 0.00 ? 7  LYS B CA   7  
ATOM 7333  C C    . LYS B 1 7  ? 8.263   -2.335  8.129   1.00 0.00 ? 7  LYS B C    7  
ATOM 7334  O O    . LYS B 1 7  ? 7.636   -1.866  7.169   1.00 0.00 ? 7  LYS B O    7  
ATOM 7335  C CB   . LYS B 1 7  ? 10.494  -3.554  7.811   1.00 0.00 ? 7  LYS B CB   7  
ATOM 7336  C CG   . LYS B 1 7  ? 9.997   -4.143  6.489   1.00 0.00 ? 7  LYS B CG   7  
ATOM 7337  C CD   . LYS B 1 7  ? 9.906   -3.064  5.408   1.00 0.00 ? 7  LYS B CD   7  
ATOM 7338  C CE   . LYS B 1 7  ? 10.127  -3.661  4.017   1.00 0.00 ? 7  LYS B CE   7  
ATOM 7339  N NZ   . LYS B 1 7  ? 9.663   -5.058  3.976   1.00 0.00 ? 7  LYS B NZ   7  
ATOM 7340  H H    . LYS B 1 7  ? 10.895  -2.263  9.944   1.00 0.00 ? 7  LYS B H    7  
ATOM 7341  H HA   . LYS B 1 7  ? 10.093  -1.511  7.362   1.00 0.00 ? 7  LYS B HA   7  
ATOM 7342  H HB2  . LYS B 1 7  ? 11.568  -3.375  7.738   1.00 0.00 ? 7  LYS B HB2  7  
ATOM 7343  H HB3  . LYS B 1 7  ? 10.306  -4.255  8.624   1.00 0.00 ? 7  LYS B HB3  7  
ATOM 7344  H HG2  . LYS B 1 7  ? 10.692  -4.915  6.161   1.00 0.00 ? 7  LYS B HG2  7  
ATOM 7345  H HG3  . LYS B 1 7  ? 9.017   -4.592  6.649   1.00 0.00 ? 7  LYS B HG3  7  
ATOM 7346  H HD2  . LYS B 1 7  ? 8.916   -2.608  5.444   1.00 0.00 ? 7  LYS B HD2  7  
ATOM 7347  H HD3  . LYS B 1 7  ? 10.657  -2.299  5.608   1.00 0.00 ? 7  LYS B HD3  7  
ATOM 7348  H HE2  . LYS B 1 7  ? 9.570   -3.079  3.284   1.00 0.00 ? 7  LYS B HE2  7  
ATOM 7349  H HE3  . LYS B 1 7  ? 11.189  -3.616  3.772   1.00 0.00 ? 7  LYS B HE3  7  
ATOM 7350  H HZ1  . LYS B 1 7  ? 8.670   -5.100  4.205   1.00 0.00 ? 7  LYS B HZ1  7  
ATOM 7351  H HZ2  . LYS B 1 7  ? 9.820   -5.433  3.041   1.00 0.00 ? 7  LYS B HZ2  7  
ATOM 7352  H HZ3  . LYS B 1 7  ? 10.183  -5.618  4.651   1.00 0.00 ? 7  LYS B HZ3  7  
ATOM 7353  N N    . MET B 1 8  ? 7.707   -2.937  9.195   1.00 0.00 ? 8  MET B N    7  
ATOM 7354  C CA   . MET B 1 8  ? 6.268   -3.099  9.323   1.00 0.00 ? 8  MET B CA   7  
ATOM 7355  C C    . MET B 1 8  ? 5.610   -1.721  9.412   1.00 0.00 ? 8  MET B C    7  
ATOM 7356  O O    . MET B 1 8  ? 4.427   -1.608  9.058   1.00 0.00 ? 8  MET B O    7  
ATOM 7357  C CB   . MET B 1 8  ? 5.933   -3.907  10.578  1.00 0.00 ? 8  MET B CB   7  
ATOM 7358  C CG   . MET B 1 8  ? 6.715   -3.391  11.787  1.00 0.00 ? 8  MET B CG   7  
ATOM 7359  S SD   . MET B 1 8  ? 5.594   -3.152  13.197  1.00 0.00 ? 8  MET B SD   7  
ATOM 7360  C CE   . MET B 1 8  ? 5.825   -4.737  14.056  1.00 0.00 ? 8  MET B CE   7  
ATOM 7361  H H    . MET B 1 8  ? 8.297   -3.297  9.944   1.00 0.00 ? 8  MET B H    7  
ATOM 7362  H HA   . MET B 1 8  ? 5.890   -3.616  8.441   1.00 0.00 ? 8  MET B HA   7  
ATOM 7363  H HB2  . MET B 1 8  ? 4.866   -3.818  10.782  1.00 0.00 ? 8  MET B HB2  7  
ATOM 7364  H HB3  . MET B 1 8  ? 6.174   -4.955  10.399  1.00 0.00 ? 8  MET B HB3  7  
ATOM 7365  H HG2  . MET B 1 8  ? 7.480   -4.117  12.062  1.00 0.00 ? 8  MET B HG2  7  
ATOM 7366  H HG3  . MET B 1 8  ? 7.196   -2.447  11.532  1.00 0.00 ? 8  MET B HG3  7  
ATOM 7367  H HE1  . MET B 1 8  ? 6.873   -4.860  14.332  1.00 0.00 ? 8  MET B HE1  7  
ATOM 7368  H HE2  . MET B 1 8  ? 5.201   -4.750  14.950  1.00 0.00 ? 8  MET B HE2  7  
ATOM 7369  H HE3  . MET B 1 8  ? 5.530   -5.559  13.405  1.00 0.00 ? 8  MET B HE3  7  
ATOM 7370  N N    . GLN B 1 9  ? 6.376   -0.716  9.874   1.00 0.00 ? 9  GLN B N    7  
ATOM 7371  C CA   . GLN B 1 9  ? 5.870   0.639   10.008  1.00 0.00 ? 9  GLN B CA   7  
ATOM 7372  C C    . GLN B 1 9  ? 5.970   1.351   8.657   1.00 0.00 ? 9  GLN B C    7  
ATOM 7373  O O    . GLN B 1 9  ? 5.230   2.322   8.446   1.00 0.00 ? 9  GLN B O    7  
ATOM 7374  C CB   . GLN B 1 9  ? 6.620   1.415   11.092  1.00 0.00 ? 9  GLN B CB   7  
ATOM 7375  C CG   . GLN B 1 9  ? 6.340   0.830   12.478  1.00 0.00 ? 9  GLN B CG   7  
ATOM 7376  C CD   . GLN B 1 9  ? 6.772   1.799   13.581  1.00 0.00 ? 9  GLN B CD   7  
ATOM 7377  O OE1  . GLN B 1 9  ? 6.226   2.879   13.741  1.00 0.00 ? 9  GLN B OE1  7  
ATOM 7378  N NE2  . GLN B 1 9  ? 7.779   1.355   14.327  1.00 0.00 ? 9  GLN B NE2  7  
ATOM 7379  H H    . GLN B 1 9  ? 7.343   -0.895  10.145  1.00 0.00 ? 9  GLN B H    7  
ATOM 7380  H HA   . GLN B 1 9  ? 4.821   0.561   10.290  1.00 0.00 ? 9  GLN B HA   7  
ATOM 7381  H HB2  . GLN B 1 9  ? 7.690   1.358   10.893  1.00 0.00 ? 9  GLN B HB2  7  
ATOM 7382  H HB3  . GLN B 1 9  ? 6.309   2.458   11.060  1.00 0.00 ? 9  GLN B HB3  7  
ATOM 7383  H HG2  . GLN B 1 9  ? 5.271   0.639   12.571  1.00 0.00 ? 9  GLN B HG2  7  
ATOM 7384  H HG3  . GLN B 1 9  ? 6.879   -0.113  12.579  1.00 0.00 ? 9  GLN B HG3  7  
ATOM 7385  H HE21 . GLN B 1 9  ? 8.189   0.441   14.138  1.00 0.00 ? 9  GLN B HE21 7  
ATOM 7386  H HE22 . GLN B 1 9  ? 8.139   1.929   15.089  1.00 0.00 ? 9  GLN B HE22 7  
ATOM 7387  N N    . MET B 1 10 ? 6.869   0.862   7.783   1.00 0.00 ? 10 MET B N    7  
ATOM 7388  C CA   . MET B 1 10 ? 7.061   1.447   6.467   1.00 0.00 ? 10 MET B CA   7  
ATOM 7389  C C    . MET B 1 10 ? 5.951   0.964   5.532   1.00 0.00 ? 10 MET B C    7  
ATOM 7390  O O    . MET B 1 10 ? 5.501   1.758   4.693   1.00 0.00 ? 10 MET B O    7  
ATOM 7391  C CB   . MET B 1 10 ? 8.422   1.042   5.898   1.00 0.00 ? 10 MET B CB   7  
ATOM 7392  C CG   . MET B 1 10 ? 9.549   1.382   6.875   1.00 0.00 ? 10 MET B CG   7  
ATOM 7393  S SD   . MET B 1 10 ? 10.754  2.482   6.075   1.00 0.00 ? 10 MET B SD   7  
ATOM 7394  C CE   . MET B 1 10 ? 11.609  1.288   5.003   1.00 0.00 ? 10 MET B CE   7  
ATOM 7395  H H    . MET B 1 10 ? 7.441   0.057   8.038   1.00 0.00 ? 10 MET B H    7  
ATOM 7396  H HA   . MET B 1 10 ? 7.008   2.533   6.552   1.00 0.00 ? 10 MET B HA   7  
ATOM 7397  H HB2  . MET B 1 10 ? 8.423   -0.033  5.716   1.00 0.00 ? 10 MET B HB2  7  
ATOM 7398  H HB3  . MET B 1 10 ? 8.579   1.562   4.953   1.00 0.00 ? 10 MET B HB3  7  
ATOM 7399  H HG2  . MET B 1 10 ? 9.133   1.886   7.747   1.00 0.00 ? 10 MET B HG2  7  
ATOM 7400  H HG3  . MET B 1 10 ? 10.040  0.464   7.196   1.00 0.00 ? 10 MET B HG3  7  
ATOM 7401  H HE1  . MET B 1 10 ? 10.896  0.829   4.318   1.00 0.00 ? 10 MET B HE1  7  
ATOM 7402  H HE2  . MET B 1 10 ? 12.384  1.808   4.440   1.00 0.00 ? 10 MET B HE2  7  
ATOM 7403  H HE3  . MET B 1 10 ? 12.071  0.510   5.609   1.00 0.00 ? 10 MET B HE3  7  
ATOM 7404  N N    . LEU B 1 11 ? 5.540   -0.306  5.691   1.00 0.00 ? 11 LEU B N    7  
ATOM 7405  C CA   . LEU B 1 11 ? 4.494   -0.885  4.866   1.00 0.00 ? 11 LEU B CA   7  
ATOM 7406  C C    . LEU B 1 11 ? 3.132   -0.390  5.356   1.00 0.00 ? 11 LEU B C    7  
ATOM 7407  O O    . LEU B 1 11 ? 2.202   -0.317  4.540   1.00 0.00 ? 11 LEU B O    7  
ATOM 7408  C CB   . LEU B 1 11 ? 4.619   -2.411  4.836   1.00 0.00 ? 11 LEU B CB   7  
ATOM 7409  C CG   . LEU B 1 11 ? 5.977   -2.963  4.397   1.00 0.00 ? 11 LEU B CG   7  
ATOM 7410  C CD1  . LEU B 1 11 ? 6.027   -4.484  4.558   1.00 0.00 ? 11 LEU B CD1  7  
ATOM 7411  C CD2  . LEU B 1 11 ? 6.312   -2.527  2.970   1.00 0.00 ? 11 LEU B CD2  7  
ATOM 7412  H H    . LEU B 1 11 ? 5.966   -0.894  6.407   1.00 0.00 ? 11 LEU B H    7  
ATOM 7413  H HA   . LEU B 1 11 ? 4.660   -0.521  3.853   1.00 0.00 ? 11 LEU B HA   7  
ATOM 7414  H HB2  . LEU B 1 11 ? 4.404   -2.757  5.846   1.00 0.00 ? 11 LEU B HB2  7  
ATOM 7415  H HB3  . LEU B 1 11 ? 3.838   -2.767  4.164   1.00 0.00 ? 11 LEU B HB3  7  
ATOM 7416  H HG   . LEU B 1 11 ? 6.699   -2.520  5.083   1.00 0.00 ? 11 LEU B HG   7  
ATOM 7417  H HD11 . LEU B 1 11 ? 5.246   -4.947  3.956   1.00 0.00 ? 11 LEU B HD11 7  
ATOM 7418  H HD12 . LEU B 1 11 ? 7.005   -4.843  4.238   1.00 0.00 ? 11 LEU B HD12 7  
ATOM 7419  H HD13 . LEU B 1 11 ? 5.876   -4.752  5.604   1.00 0.00 ? 11 LEU B HD13 7  
ATOM 7420  H HD21 . LEU B 1 11 ? 6.338   -1.438  2.911   1.00 0.00 ? 11 LEU B HD21 7  
ATOM 7421  H HD22 . LEU B 1 11 ? 7.283   -2.937  2.692   1.00 0.00 ? 11 LEU B HD22 7  
ATOM 7422  H HD23 . LEU B 1 11 ? 5.557   -2.901  2.279   1.00 0.00 ? 11 LEU B HD23 7  
ATOM 7423  N N    . LYS B 1 12 ? 3.042   -0.067  6.659   1.00 0.00 ? 12 LYS B N    7  
ATOM 7424  C CA   . LYS B 1 12 ? 1.805   0.417   7.248   1.00 0.00 ? 12 LYS B CA   7  
ATOM 7425  C C    . LYS B 1 12 ? 1.613   1.891   6.887   1.00 0.00 ? 12 LYS B C    7  
ATOM 7426  O O    . LYS B 1 12 ? 0.472   2.288   6.613   1.00 0.00 ? 12 LYS B O    7  
ATOM 7427  C CB   . LYS B 1 12 ? 1.787   0.145   8.754   1.00 0.00 ? 12 LYS B CB   7  
ATOM 7428  C CG   . LYS B 1 12 ? 0.397   -0.297  9.216   1.00 0.00 ? 12 LYS B CG   7  
ATOM 7429  C CD   . LYS B 1 12 ? 0.144   -1.765  8.866   1.00 0.00 ? 12 LYS B CD   7  
ATOM 7430  C CE   . LYS B 1 12 ? -0.147  -2.586  10.124  1.00 0.00 ? 12 LYS B CE   7  
ATOM 7431  N NZ   . LYS B 1 12 ? 0.881   -2.339  11.149  1.00 0.00 ? 12 LYS B NZ   7  
ATOM 7432  H H    . LYS B 1 12 ? 3.857   -0.157  7.264   1.00 0.00 ? 12 LYS B H    7  
ATOM 7433  H HA   . LYS B 1 12 ? 1.000   -0.166  6.799   1.00 0.00 ? 12 LYS B HA   7  
ATOM 7434  H HB2  . LYS B 1 12 ? 2.503   -0.645  8.979   1.00 0.00 ? 12 LYS B HB2  7  
ATOM 7435  H HB3  . LYS B 1 12 ? 2.082   1.053   9.280   1.00 0.00 ? 12 LYS B HB3  7  
ATOM 7436  H HG2  . LYS B 1 12 ? 0.326   -0.171  10.296  1.00 0.00 ? 12 LYS B HG2  7  
ATOM 7437  H HG3  . LYS B 1 12 ? -0.352  0.334   8.736   1.00 0.00 ? 12 LYS B HG3  7  
ATOM 7438  H HD2  . LYS B 1 12 ? -0.714  -1.827  8.197   1.00 0.00 ? 12 LYS B HD2  7  
ATOM 7439  H HD3  . LYS B 1 12 ? 1.021   -2.164  8.357   1.00 0.00 ? 12 LYS B HD3  7  
ATOM 7440  H HE2  . LYS B 1 12 ? -1.121  -2.299  10.522  1.00 0.00 ? 12 LYS B HE2  7  
ATOM 7441  H HE3  . LYS B 1 12 ? -0.167  -3.644  9.865   1.00 0.00 ? 12 LYS B HE3  7  
ATOM 7442  H HZ1  . LYS B 1 12 ? 0.899   -1.348  11.392  1.00 0.00 ? 12 LYS B HZ1  7  
ATOM 7443  H HZ2  . LYS B 1 12 ? 0.665   -2.895  11.976  1.00 0.00 ? 12 LYS B HZ2  7  
ATOM 7444  H HZ3  . LYS B 1 12 ? 1.798   -2.611  10.796  1.00 0.00 ? 12 LYS B HZ3  7  
ATOM 7445  N N    . LEU B 1 13 ? 2.717   2.660   6.894   1.00 0.00 ? 13 LEU B N    7  
ATOM 7446  C CA   . LEU B 1 13 ? 2.670   4.075   6.569   1.00 0.00 ? 13 LEU B CA   7  
ATOM 7447  C C    . LEU B 1 13 ? 2.301   4.245   5.094   1.00 0.00 ? 13 LEU B C    7  
ATOM 7448  O O    . LEU B 1 13 ? 1.506   5.144   4.784   1.00 0.00 ? 13 LEU B O    7  
ATOM 7449  C CB   . LEU B 1 13 ? 3.984   4.758   6.956   1.00 0.00 ? 13 LEU B CB   7  
ATOM 7450  C CG   . LEU B 1 13 ? 3.989   6.287   6.898   1.00 0.00 ? 13 LEU B CG   7  
ATOM 7451  C CD1  . LEU B 1 13 ? 4.499   6.782   5.543   1.00 0.00 ? 13 LEU B CD1  7  
ATOM 7452  C CD2  . LEU B 1 13 ? 2.608   6.852   7.231   1.00 0.00 ? 13 LEU B CD2  7  
ATOM 7453  H H    . LEU B 1 13 ? 3.621   2.253   7.132   1.00 0.00 ? 13 LEU B H    7  
ATOM 7454  H HA   . LEU B 1 13 ? 1.881   4.509   7.184   1.00 0.00 ? 13 LEU B HA   7  
ATOM 7455  H HB2  . LEU B 1 13 ? 4.207   4.440   7.975   1.00 0.00 ? 13 LEU B HB2  7  
ATOM 7456  H HB3  . LEU B 1 13 ? 4.745   4.358   6.285   1.00 0.00 ? 13 LEU B HB3  7  
ATOM 7457  H HG   . LEU B 1 13 ? 4.695   6.598   7.668   1.00 0.00 ? 13 LEU B HG   7  
ATOM 7458  H HD11 . LEU B 1 13 ? 3.866   6.400   4.744   1.00 0.00 ? 13 LEU B HD11 7  
ATOM 7459  H HD12 . LEU B 1 13 ? 4.490   7.872   5.537   1.00 0.00 ? 13 LEU B HD12 7  
ATOM 7460  H HD13 . LEU B 1 13 ? 5.521   6.436   5.382   1.00 0.00 ? 13 LEU B HD13 7  
ATOM 7461  H HD21 . LEU B 1 13 ? 2.308   6.538   8.230   1.00 0.00 ? 13 LEU B HD21 7  
ATOM 7462  H HD22 . LEU B 1 13 ? 2.648   7.940   7.180   1.00 0.00 ? 13 LEU B HD22 7  
ATOM 7463  H HD23 . LEU B 1 13 ? 1.874   6.490   6.510   1.00 0.00 ? 13 LEU B HD23 7  
ATOM 7464  N N    . ASP B 1 14 ? 2.874   3.390   4.228   1.00 0.00 ? 14 ASP B N    7  
ATOM 7465  C CA   . ASP B 1 14 ? 2.606   3.444   2.802   1.00 0.00 ? 14 ASP B CA   7  
ATOM 7466  C C    . ASP B 1 14 ? 1.158   3.024   2.541   1.00 0.00 ? 14 ASP B C    7  
ATOM 7467  O O    . ASP B 1 14 ? 0.563   3.525   1.576   1.00 0.00 ? 14 ASP B O    7  
ATOM 7468  C CB   . ASP B 1 14 ? 3.521   2.487   2.033   1.00 0.00 ? 14 ASP B CB   7  
ATOM 7469  C CG   . ASP B 1 14 ? 4.057   3.030   0.707   1.00 0.00 ? 14 ASP B CG   7  
ATOM 7470  O OD1  . ASP B 1 14 ? 5.117   3.674   0.663   1.00 0.00 ? 14 ASP B OD1  7  
ATOM 7471  O OD2  . ASP B 1 14 ? 3.330   2.766   -0.325  1.00 0.00 ? 14 ASP B OD2  7  
ATOM 7472  H H    . ASP B 1 14 ? 3.519   2.675   4.568   1.00 0.00 ? 14 ASP B H    7  
ATOM 7473  H HA   . ASP B 1 14 ? 2.748   4.467   2.453   1.00 0.00 ? 14 ASP B HA   7  
ATOM 7474  H HB2  . ASP B 1 14 ? 4.361   2.256   2.688   1.00 0.00 ? 14 ASP B HB2  7  
ATOM 7475  H HB3  . ASP B 1 14 ? 2.947   1.577   1.856   1.00 0.00 ? 14 ASP B HB3  7  
ATOM 7476  N N    . ASN B 1 15 ? 0.629   2.129   3.394   1.00 0.00 ? 15 ASN B N    7  
ATOM 7477  C CA   . ASN B 1 15 ? -0.736  1.650   3.257   1.00 0.00 ? 15 ASN B CA   7  
ATOM 7478  C C    . ASN B 1 15 ? -1.704  2.820   3.440   1.00 0.00 ? 15 ASN B C    7  
ATOM 7479  O O    . ASN B 1 15 ? -2.606  2.975   2.605   1.00 0.00 ? 15 ASN B O    7  
ATOM 7480  C CB   . ASN B 1 15 ? -1.059  0.599   4.321   1.00 0.00 ? 15 ASN B CB   7  
ATOM 7481  C CG   . ASN B 1 15 ? -2.068  -0.424  3.793   1.00 0.00 ? 15 ASN B CG   7  
ATOM 7482  O OD1  . ASN B 1 15 ? -3.270  -0.288  3.951   1.00 0.00 ? 15 ASN B OD1  7  
ATOM 7483  N ND2  . ASN B 1 15 ? -1.512  -1.452  3.157   1.00 0.00 ? 15 ASN B ND2  7  
ATOM 7484  H H    . ASN B 1 15 ? 1.188   1.766   4.165   1.00 0.00 ? 15 ASN B H    7  
ATOM 7485  H HA   . ASN B 1 15 ? -0.867  1.234   2.259   1.00 0.00 ? 15 ASN B HA   7  
ATOM 7486  H HB2  . ASN B 1 15 ? -0.141  0.081   4.599   1.00 0.00 ? 15 ASN B HB2  7  
ATOM 7487  H HB3  . ASN B 1 15 ? -1.464  1.099   5.201   1.00 0.00 ? 15 ASN B HB3  7  
ATOM 7488  H HD21 . ASN B 1 15 ? -0.499  -1.504  3.060   1.00 0.00 ? 15 ASN B HD21 7  
ATOM 7489  H HD22 . ASN B 1 15 ? -2.101  -2.189  2.767   1.00 0.00 ? 15 ASN B HD22 7  
ATOM 7490  N N    . TYR B 1 16 ? -1.501  3.608   4.511   1.00 0.00 ? 16 TYR B N    7  
ATOM 7491  C CA   . TYR B 1 16 ? -2.389  4.735   4.744   1.00 0.00 ? 16 TYR B CA   7  
ATOM 7492  C C    . TYR B 1 16 ? -2.353  5.665   3.530   1.00 0.00 ? 16 TYR B C    7  
ATOM 7493  O O    . TYR B 1 16 ? -3.418  6.182   3.162   1.00 0.00 ? 16 TYR B O    7  
ATOM 7494  C CB   . TYR B 1 16 ? -1.989  5.466   6.039   1.00 0.00 ? 16 TYR B CB   7  
ATOM 7495  C CG   . TYR B 1 16 ? -1.476  4.555   7.145   1.00 0.00 ? 16 TYR B CG   7  
ATOM 7496  C CD1  . TYR B 1 16 ? -2.136  3.337   7.432   1.00 0.00 ? 16 TYR B CD1  7  
ATOM 7497  C CD2  . TYR B 1 16 ? -0.339  4.927   7.899   1.00 0.00 ? 16 TYR B CD2  7  
ATOM 7498  C CE1  . TYR B 1 16 ? -1.659  2.498   8.462   1.00 0.00 ? 16 TYR B CE1  7  
ATOM 7499  C CE2  . TYR B 1 16 ? 0.138   4.088   8.927   1.00 0.00 ? 16 TYR B CE2  7  
ATOM 7500  C CZ   . TYR B 1 16 ? -0.521  2.872   9.210   1.00 0.00 ? 16 TYR B CZ   7  
ATOM 7501  O OH   . TYR B 1 16 ? -0.056  2.061   10.207  1.00 0.00 ? 16 TYR B OH   7  
ATOM 7502  H H    . TYR B 1 16 ? -0.745  3.426   5.155   1.00 0.00 ? 16 TYR B H    7  
ATOM 7503  H HA   . TYR B 1 16 ? -3.405  4.352   4.849   1.00 0.00 ? 16 TYR B HA   7  
ATOM 7504  H HB2  . TYR B 1 16 ? -1.230  6.217   5.804   1.00 0.00 ? 16 TYR B HB2  7  
ATOM 7505  H HB3  . TYR B 1 16 ? -2.858  6.001   6.424   1.00 0.00 ? 16 TYR B HB3  7  
ATOM 7506  H HD1  . TYR B 1 16 ? -3.007  3.043   6.867   1.00 0.00 ? 16 TYR B HD1  7  
ATOM 7507  H HD2  . TYR B 1 16 ? 0.170   5.857   7.689   1.00 0.00 ? 16 TYR B HD2  7  
ATOM 7508  H HE1  . TYR B 1 16 ? -2.169  1.568   8.674   1.00 0.00 ? 16 TYR B HE1  7  
ATOM 7509  H HE2  . TYR B 1 16 ? 1.009   4.380   9.497   1.00 0.00 ? 16 TYR B HE2  7  
ATOM 7510  H HH   . TYR B 1 16 ? -0.540  1.236   10.288  1.00 0.00 ? 16 TYR B HH   7  
ATOM 7511  N N    . HIS B 1 17 ? -1.157  5.867   2.949   1.00 0.00 ? 17 HIS B N    7  
ATOM 7512  C CA   . HIS B 1 17 ? -0.997  6.736   1.797   1.00 0.00 ? 17 HIS B CA   7  
ATOM 7513  C C    . HIS B 1 17 ? -1.639  6.079   0.573   1.00 0.00 ? 17 HIS B C    7  
ATOM 7514  O O    . HIS B 1 17 ? -2.261  6.796   -0.223  1.00 0.00 ? 17 HIS B O    7  
ATOM 7515  C CB   . HIS B 1 17 ? 0.476   7.088   1.577   1.00 0.00 ? 17 HIS B CB   7  
ATOM 7516  C CG   . HIS B 1 17 ? 0.933   6.947   0.145   1.00 0.00 ? 17 HIS B CG   7  
ATOM 7517  N ND1  . HIS B 1 17 ? 0.930   8.001   -0.751  1.00 0.00 ? 17 HIS B ND1  7  
ATOM 7518  C CD2  . HIS B 1 17 ? 1.409   5.864   -0.536  1.00 0.00 ? 17 HIS B CD2  7  
ATOM 7519  C CE1  . HIS B 1 17 ? 1.384   7.563   -1.916  1.00 0.00 ? 17 HIS B CE1  7  
ATOM 7520  N NE2  . HIS B 1 17 ? 1.680   6.238   -1.781  1.00 0.00 ? 17 HIS B NE2  7  
ATOM 7521  H H    . HIS B 1 17 ? -0.327  5.401   3.318   1.00 0.00 ? 17 HIS B H    7  
ATOM 7522  H HA   . HIS B 1 17 ? -1.533  7.657   2.027   1.00 0.00 ? 17 HIS B HA   7  
ATOM 7523  H HB2  . HIS B 1 17 ? 0.616   8.121   1.894   1.00 0.00 ? 17 HIS B HB2  7  
ATOM 7524  H HB3  . HIS B 1 17 ? 1.066   6.435   2.222   1.00 0.00 ? 17 HIS B HB3  7  
ATOM 7525  H HD1  . HIS B 1 17 ? 0.653   8.977   -0.647  1.00 0.00 ? 17 HIS B HD1  7  
ATOM 7526  H HD2  . HIS B 1 17 ? 1.578   4.843   -0.231  1.00 0.00 ? 17 HIS B HD2  7  
ATOM 7527  H HE1  . HIS B 1 17 ? 1.460   8.238   -2.755  1.00 0.00 ? 17 HIS B HE1  7  
ATOM 7528  N N    . LEU B 1 18 ? -1.478  4.749   0.451   1.00 0.00 ? 18 LEU B N    7  
ATOM 7529  C CA   . LEU B 1 18 ? -2.038  4.006   -0.665  1.00 0.00 ? 18 LEU B CA   7  
ATOM 7530  C C    . LEU B 1 18 ? -3.563  3.977   -0.539  1.00 0.00 ? 18 LEU B C    7  
ATOM 7531  O O    . LEU B 1 18 ? -4.241  4.059   -1.573  1.00 0.00 ? 18 LEU B O    7  
ATOM 7532  C CB   . LEU B 1 18 ? -1.402  2.617   -0.757  1.00 0.00 ? 18 LEU B CB   7  
ATOM 7533  C CG   . LEU B 1 18 ? 0.046   2.573   -1.247  1.00 0.00 ? 18 LEU B CG   7  
ATOM 7534  C CD1  . LEU B 1 18 ? 0.646   1.178   -1.061  1.00 0.00 ? 18 LEU B CD1  7  
ATOM 7535  C CD2  . LEU B 1 18 ? 0.148   3.052   -2.696  1.00 0.00 ? 18 LEU B CD2  7  
ATOM 7536  H H    . LEU B 1 18 ? -0.949  4.232   1.153   1.00 0.00 ? 18 LEU B H    7  
ATOM 7537  H HA   . LEU B 1 18 ? -1.767  4.552   -1.568  1.00 0.00 ? 18 LEU B HA   7  
ATOM 7538  H HB2  . LEU B 1 18 ? -1.451  2.190   0.246   1.00 0.00 ? 18 LEU B HB2  7  
ATOM 7539  H HB3  . LEU B 1 18 ? -2.039  2.033   -1.422  1.00 0.00 ? 18 LEU B HB3  7  
ATOM 7540  H HG   . LEU B 1 18 ? 0.585   3.269   -0.605  1.00 0.00 ? 18 LEU B HG   7  
ATOM 7541  H HD11 . LEU B 1 18 ? 0.062   0.445   -1.618  1.00 0.00 ? 18 LEU B HD11 7  
ATOM 7542  H HD12 . LEU B 1 18 ? 1.675   1.183   -1.420  1.00 0.00 ? 18 LEU B HD12 7  
ATOM 7543  H HD13 . LEU B 1 18 ? 0.640   0.909   -0.005  1.00 0.00 ? 18 LEU B HD13 7  
ATOM 7544  H HD21 . LEU B 1 18 ? -0.221  4.074   -2.777  1.00 0.00 ? 18 LEU B HD21 7  
ATOM 7545  H HD22 . LEU B 1 18 ? 1.191   3.007   -3.012  1.00 0.00 ? 18 LEU B HD22 7  
ATOM 7546  H HD23 . LEU B 1 18 ? -0.446  2.407   -3.344  1.00 0.00 ? 18 LEU B HD23 7  
ATOM 7547  N N    . GLU B 1 19 ? -4.063  3.863   0.704   1.00 0.00 ? 19 GLU B N    7  
ATOM 7548  C CA   . GLU B 1 19 ? -5.492  3.824   0.959   1.00 0.00 ? 19 GLU B CA   7  
ATOM 7549  C C    . GLU B 1 19 ? -6.094  5.203   0.680   1.00 0.00 ? 19 GLU B C    7  
ATOM 7550  O O    . GLU B 1 19 ? -7.085  5.275   -0.062  1.00 0.00 ? 19 GLU B O    7  
ATOM 7551  C CB   . GLU B 1 19 ? -5.796  3.373   2.390   1.00 0.00 ? 19 GLU B CB   7  
ATOM 7552  C CG   . GLU B 1 19 ? -7.049  2.495   2.434   1.00 0.00 ? 19 GLU B CG   7  
ATOM 7553  C CD   . GLU B 1 19 ? -6.747  1.083   1.928   1.00 0.00 ? 19 GLU B CD   7  
ATOM 7554  O OE1  . GLU B 1 19 ? -5.586  0.768   1.626   1.00 0.00 ? 19 GLU B OE1  7  
ATOM 7555  O OE2  . GLU B 1 19 ? -7.769  0.300   1.855   1.00 0.00 ? 19 GLU B OE2  7  
ATOM 7556  H H    . GLU B 1 19 ? -3.432  3.800   1.504   1.00 0.00 ? 19 GLU B H    7  
ATOM 7557  H HA   . GLU B 1 19 ? -5.919  3.103   0.263   1.00 0.00 ? 19 GLU B HA   7  
ATOM 7558  H HB2  . GLU B 1 19 ? -4.949  2.801   2.768   1.00 0.00 ? 19 GLU B HB2  7  
ATOM 7559  H HB3  . GLU B 1 19 ? -5.938  4.254   3.015   1.00 0.00 ? 19 GLU B HB3  7  
ATOM 7560  H HG2  . GLU B 1 19 ? -7.403  2.436   3.462   1.00 0.00 ? 19 GLU B HG2  7  
ATOM 7561  H HG3  . GLU B 1 19 ? -7.822  2.954   1.817   1.00 0.00 ? 19 GLU B HG3  7  
ATOM 7562  N N    . ASN B 1 20 ? -5.492  6.252   1.268   1.00 0.00 ? 20 ASN B N    7  
ATOM 7563  C CA   . ASN B 1 20 ? -5.965  7.613   1.083   1.00 0.00 ? 20 ASN B CA   7  
ATOM 7564  C C    . ASN B 1 20 ? -5.867  7.987   -0.397  1.00 0.00 ? 20 ASN B C    7  
ATOM 7565  O O    . ASN B 1 20 ? -6.687  8.793   -0.859  1.00 0.00 ? 20 ASN B O    7  
ATOM 7566  C CB   . ASN B 1 20 ? -5.114  8.605   1.878   1.00 0.00 ? 20 ASN B CB   7  
ATOM 7567  C CG   . ASN B 1 20 ? -5.708  8.848   3.267   1.00 0.00 ? 20 ASN B CG   7  
ATOM 7568  O OD1  . ASN B 1 20 ? -6.630  9.626   3.448   1.00 0.00 ? 20 ASN B OD1  7  
ATOM 7569  N ND2  . ASN B 1 20 ? -5.129  8.141   4.234   1.00 0.00 ? 20 ASN B ND2  7  
ATOM 7570  H H    . ASN B 1 20 ? -4.678  6.105   1.865   1.00 0.00 ? 20 ASN B H    7  
ATOM 7571  H HA   . ASN B 1 20 ? -7.008  7.672   1.395   1.00 0.00 ? 20 ASN B HA   7  
ATOM 7572  H HB2  . ASN B 1 20 ? -4.107  8.199   1.988   1.00 0.00 ? 20 ASN B HB2  7  
ATOM 7573  H HB3  . ASN B 1 20 ? -5.059  9.545   1.327   1.00 0.00 ? 20 ASN B HB3  7  
ATOM 7574  H HD21 . ASN B 1 20 ? -4.362  7.507   4.012   1.00 0.00 ? 20 ASN B HD21 7  
ATOM 7575  H HD22 . ASN B 1 20 ? -5.454  8.232   5.196   1.00 0.00 ? 20 ASN B HD22 7  
ATOM 7576  N N    . GLU B 1 21 ? -4.881  7.402   -1.102  1.00 0.00 ? 21 GLU B N    7  
ATOM 7577  C CA   . GLU B 1 21 ? -4.680  7.671   -2.515  1.00 0.00 ? 21 GLU B CA   7  
ATOM 7578  C C    . GLU B 1 21 ? -5.660  6.830   -3.335  1.00 0.00 ? 21 GLU B C    7  
ATOM 7579  O O    . GLU B 1 21 ? -6.098  7.300   -4.394  1.00 0.00 ? 21 GLU B O    7  
ATOM 7580  C CB   . GLU B 1 21 ? -3.235  7.398   -2.940  1.00 0.00 ? 21 GLU B CB   7  
ATOM 7581  C CG   . GLU B 1 21 ? -2.934  8.029   -4.301  1.00 0.00 ? 21 GLU B CG   7  
ATOM 7582  C CD   . GLU B 1 21 ? -1.711  7.377   -4.948  1.00 0.00 ? 21 GLU B CD   7  
ATOM 7583  O OE1  . GLU B 1 21 ? -1.879  6.154   -5.322  1.00 0.00 ? 21 GLU B OE1  7  
ATOM 7584  O OE2  . GLU B 1 21 ? -0.661  8.023   -5.080  1.00 0.00 ? 21 GLU B OE2  7  
ATOM 7585  H H    . GLU B 1 21 ? -4.245  6.748   -0.643  1.00 0.00 ? 21 GLU B H    7  
ATOM 7586  H HA   . GLU B 1 21 ? -4.900  8.727   -2.671  1.00 0.00 ? 21 GLU B HA   7  
ATOM 7587  H HB2  . GLU B 1 21 ? -2.561  7.822   -2.195  1.00 0.00 ? 21 GLU B HB2  7  
ATOM 7588  H HB3  . GLU B 1 21 ? -3.078  6.320   -2.986  1.00 0.00 ? 21 GLU B HB3  7  
ATOM 7589  H HG2  . GLU B 1 21 ? -3.797  7.891   -4.952  1.00 0.00 ? 21 GLU B HG2  7  
ATOM 7590  H HG3  . GLU B 1 21 ? -2.759  9.096   -4.165  1.00 0.00 ? 21 GLU B HG3  7  
ATOM 7591  N N    . VAL B 1 22 ? -5.980  5.623   -2.836  1.00 0.00 ? 22 VAL B N    7  
ATOM 7592  C CA   . VAL B 1 22 ? -6.900  4.727   -3.518  1.00 0.00 ? 22 VAL B CA   7  
ATOM 7593  C C    . VAL B 1 22 ? -8.335  5.204   -3.285  1.00 0.00 ? 22 VAL B C    7  
ATOM 7594  O O    . VAL B 1 22 ? -9.147  5.109   -4.217  1.00 0.00 ? 22 VAL B O    7  
ATOM 7595  C CB   . VAL B 1 22 ? -6.667  3.287   -3.057  1.00 0.00 ? 22 VAL B CB   7  
ATOM 7596  C CG1  . VAL B 1 22 ? -7.962  2.476   -3.115  1.00 0.00 ? 22 VAL B CG1  7  
ATOM 7597  C CG2  . VAL B 1 22 ? -5.564  2.620   -3.880  1.00 0.00 ? 22 VAL B CG2  7  
ATOM 7598  H H    . VAL B 1 22 ? -5.574  5.311   -1.953  1.00 0.00 ? 22 VAL B H    7  
ATOM 7599  H HA   . VAL B 1 22 ? -6.677  4.779   -4.582  1.00 0.00 ? 22 VAL B HA   7  
ATOM 7600  H HB   . VAL B 1 22 ? -6.339  3.359   -2.020  1.00 0.00 ? 22 VAL B HB   7  
ATOM 7601  H HG11 . VAL B 1 22 ? -8.347  2.462   -4.135  1.00 0.00 ? 22 VAL B HG11 7  
ATOM 7602  H HG12 . VAL B 1 22 ? -7.759  1.458   -2.781  1.00 0.00 ? 22 VAL B HG12 7  
ATOM 7603  H HG13 . VAL B 1 22 ? -8.710  2.922   -2.460  1.00 0.00 ? 22 VAL B HG13 7  
ATOM 7604  H HG21 . VAL B 1 22 ? -4.634  3.179   -3.779  1.00 0.00 ? 22 VAL B HG21 7  
ATOM 7605  H HG22 . VAL B 1 22 ? -5.425  1.599   -3.526  1.00 0.00 ? 22 VAL B HG22 7  
ATOM 7606  H HG23 . VAL B 1 22 ? -5.850  2.594   -4.932  1.00 0.00 ? 22 VAL B HG23 7  
ATOM 7607  N N    . ALA B 1 23 ? -8.615  5.699   -2.066  1.00 0.00 ? 23 ALA B N    7  
ATOM 7608  C CA   . ALA B 1 23 ? -9.940  6.185   -1.718  1.00 0.00 ? 23 ALA B CA   7  
ATOM 7609  C C    . ALA B 1 23 ? -10.219 7.482   -2.480  1.00 0.00 ? 23 ALA B C    7  
ATOM 7610  O O    . ALA B 1 23 ? -11.397 7.840   -2.621  1.00 0.00 ? 23 ALA B O    7  
ATOM 7611  C CB   . ALA B 1 23 ? -9.982  6.544   -0.231  1.00 0.00 ? 23 ALA B CB   7  
ATOM 7612  H H    . ALA B 1 23 ? -7.887  5.741   -1.353  1.00 0.00 ? 23 ALA B H    7  
ATOM 7613  H HA   . ALA B 1 23 ? -10.706 5.453   -1.969  1.00 0.00 ? 23 ALA B HA   7  
ATOM 7614  H HB1  . ALA B 1 23 ? -9.743  5.656   0.355   1.00 0.00 ? 23 ALA B HB1  7  
ATOM 7615  H HB2  . ALA B 1 23 ? -9.248  7.320   -0.015  1.00 0.00 ? 23 ALA B HB2  7  
ATOM 7616  H HB3  . ALA B 1 23 ? -10.974 6.909   0.035   1.00 0.00 ? 23 ALA B HB3  7  
ATOM 7617  N N    . ARG B 1 24 ? -9.148  8.148   -2.949  1.00 0.00 ? 24 ARG B N    7  
ATOM 7618  C CA   . ARG B 1 24 ? -9.278  9.392   -3.688  1.00 0.00 ? 24 ARG B CA   7  
ATOM 7619  C C    . ARG B 1 24 ? -9.402  9.081   -5.182  1.00 0.00 ? 24 ARG B C    7  
ATOM 7620  O O    . ARG B 1 24 ? -10.015 9.882   -5.902  1.00 0.00 ? 24 ARG B O    7  
ATOM 7621  C CB   . ARG B 1 24 ? -8.075  10.309  -3.464  1.00 0.00 ? 24 ARG B CB   7  
ATOM 7622  C CG   . ARG B 1 24 ? -8.290  11.204  -2.241  1.00 0.00 ? 24 ARG B CG   7  
ATOM 7623  C CD   . ARG B 1 24 ? -7.032  12.019  -1.930  1.00 0.00 ? 24 ARG B CD   7  
ATOM 7624  N NE   . ARG B 1 24 ? -7.377  13.452  -1.799  1.00 0.00 ? 24 ARG B NE   7  
ATOM 7625  C CZ   . ARG B 1 24 ? -7.165  14.373  -2.762  1.00 0.00 ? 24 ARG B CZ   7  
ATOM 7626  N NH1  . ARG B 1 24 ? -6.608  13.987  -3.919  1.00 0.00 ? 24 ARG B NH1  7  
ATOM 7627  N NH2  . ARG B 1 24 ? -7.506  15.654  -2.566  1.00 0.00 ? 24 ARG B NH2  7  
ATOM 7628  H H    . ARG B 1 24 ? -8.210  7.782   -2.788  1.00 0.00 ? 24 ARG B H    7  
ATOM 7629  H HA   . ARG B 1 24 ? -10.190 9.886   -3.353  1.00 0.00 ? 24 ARG B HA   7  
ATOM 7630  H HB2  . ARG B 1 24 ? -7.188  9.698   -3.304  1.00 0.00 ? 24 ARG B HB2  7  
ATOM 7631  H HB3  . ARG B 1 24 ? -7.928  10.923  -4.353  1.00 0.00 ? 24 ARG B HB3  7  
ATOM 7632  H HG2  . ARG B 1 24 ? -9.115  11.888  -2.444  1.00 0.00 ? 24 ARG B HG2  7  
ATOM 7633  H HG3  . ARG B 1 24 ? -8.549  10.579  -1.387  1.00 0.00 ? 24 ARG B HG3  7  
ATOM 7634  H HD2  . ARG B 1 24 ? -6.598  11.671  -0.993  1.00 0.00 ? 24 ARG B HD2  7  
ATOM 7635  H HD3  . ARG B 1 24 ? -6.306  11.883  -2.731  1.00 0.00 ? 24 ARG B HD3  7  
ATOM 7636  H HE   . ARG B 1 24 ? -7.800  13.729  -0.913  1.00 0.00 ? 24 ARG B HE   7  
ATOM 7637  H HH11 . ARG B 1 24 ? -6.351  13.010  -4.061  1.00 0.00 ? 24 ARG B HH11 7  
ATOM 7638  H HH12 . ARG B 1 24 ? -6.440  14.671  -4.657  1.00 0.00 ? 24 ARG B HH12 7  
ATOM 7639  H HH21 . ARG B 1 24 ? -7.929  15.940  -1.684  1.00 0.00 ? 24 ARG B HH21 7  
ATOM 7640  H HH22 . ARG B 1 24 ? -7.342  16.344  -3.300  1.00 0.00 ? 24 ARG B HH22 7  
ATOM 7641  N N    . LEU B 1 25 ? -8.826  7.942   -5.610  1.00 0.00 ? 25 LEU B N    7  
ATOM 7642  C CA   . LEU B 1 25 ? -8.872  7.533   -7.003  1.00 0.00 ? 25 LEU B CA   7  
ATOM 7643  C C    . LEU B 1 25 ? -10.159 6.746   -7.257  1.00 0.00 ? 25 LEU B C    7  
ATOM 7644  O O    . LEU B 1 25 ? -10.758 6.926   -8.328  1.00 0.00 ? 25 LEU B O    7  
ATOM 7645  C CB   . LEU B 1 25 ? -7.599  6.771   -7.380  1.00 0.00 ? 25 LEU B CB   7  
ATOM 7646  C CG   . LEU B 1 25 ? -6.359  7.625   -7.648  1.00 0.00 ? 25 LEU B CG   7  
ATOM 7647  C CD1  . LEU B 1 25 ? -5.130  6.746   -7.892  1.00 0.00 ? 25 LEU B CD1  7  
ATOM 7648  C CD2  . LEU B 1 25 ? -6.605  8.600   -8.801  1.00 0.00 ? 25 LEU B CD2  7  
ATOM 7649  H H    . LEU B 1 25 ? -8.338  7.338   -4.949  1.00 0.00 ? 25 LEU B H    7  
ATOM 7650  H HA   . LEU B 1 25 ? -8.893  8.449   -7.594  1.00 0.00 ? 25 LEU B HA   7  
ATOM 7651  H HB2  . LEU B 1 25 ? -7.391  6.093   -6.552  1.00 0.00 ? 25 LEU B HB2  7  
ATOM 7652  H HB3  . LEU B 1 25 ? -7.846  6.184   -8.265  1.00 0.00 ? 25 LEU B HB3  7  
ATOM 7653  H HG   . LEU B 1 25 ? -6.201  8.193   -6.731  1.00 0.00 ? 25 LEU B HG   7  
ATOM 7654  H HD11 . LEU B 1 25 ? -5.303  6.095   -8.748  1.00 0.00 ? 25 LEU B HD11 7  
ATOM 7655  H HD12 . LEU B 1 25 ? -4.268  7.387   -8.079  1.00 0.00 ? 25 LEU B HD12 7  
ATOM 7656  H HD13 . LEU B 1 25 ? -4.933  6.132   -7.014  1.00 0.00 ? 25 LEU B HD13 7  
ATOM 7657  H HD21 . LEU B 1 25 ? -7.441  9.257   -8.561  1.00 0.00 ? 25 LEU B HD21 7  
ATOM 7658  H HD22 . LEU B 1 25 ? -5.703  9.191   -8.964  1.00 0.00 ? 25 LEU B HD22 7  
ATOM 7659  H HD23 . LEU B 1 25 ? -6.837  8.047   -9.712  1.00 0.00 ? 25 LEU B HD23 7  
ATOM 7660  N N    . LYS B 1 26 ? -10.552 5.904   -6.286  1.00 0.00 ? 26 LYS B N    7  
ATOM 7661  C CA   . LYS B 1 26 ? -11.756 5.100   -6.404  1.00 0.00 ? 26 LYS B CA   7  
ATOM 7662  C C    . LYS B 1 26 ? -12.974 6.022   -6.487  1.00 0.00 ? 26 LYS B C    7  
ATOM 7663  O O    . LYS B 1 26 ? -13.995 5.600   -7.049  1.00 0.00 ? 26 LYS B O    7  
ATOM 7664  C CB   . LYS B 1 26 ? -11.832 4.080   -5.266  1.00 0.00 ? 26 LYS B CB   7  
ATOM 7665  C CG   . LYS B 1 26 ? -10.999 2.838   -5.585  1.00 0.00 ? 26 LYS B CG   7  
ATOM 7666  C CD   . LYS B 1 26 ? -11.811 1.560   -5.361  1.00 0.00 ? 26 LYS B CD   7  
ATOM 7667  C CE   . LYS B 1 26 ? -12.769 1.308   -6.527  1.00 0.00 ? 26 LYS B CE   7  
ATOM 7668  N NZ   . LYS B 1 26 ? -13.085 -0.125  -6.634  1.00 0.00 ? 26 LYS B NZ   7  
ATOM 7669  H H    . LYS B 1 26 ? -9.999  5.817   -5.432  1.00 0.00 ? 26 LYS B H    7  
ATOM 7670  H HA   . LYS B 1 26 ? -11.666 4.545   -7.337  1.00 0.00 ? 26 LYS B HA   7  
ATOM 7671  H HB2  . LYS B 1 26 ? -11.451 4.539   -4.353  1.00 0.00 ? 26 LYS B HB2  7  
ATOM 7672  H HB3  . LYS B 1 26 ? -12.874 3.799   -5.113  1.00 0.00 ? 26 LYS B HB3  7  
ATOM 7673  H HG2  . LYS B 1 26 ? -10.685 2.881   -6.628  1.00 0.00 ? 26 LYS B HG2  7  
ATOM 7674  H HG3  . LYS B 1 26 ? -10.114 2.832   -4.948  1.00 0.00 ? 26 LYS B HG3  7  
ATOM 7675  H HD2  . LYS B 1 26 ? -11.125 0.716   -5.276  1.00 0.00 ? 26 LYS B HD2  7  
ATOM 7676  H HD3  . LYS B 1 26 ? -12.372 1.656   -4.431  1.00 0.00 ? 26 LYS B HD3  7  
ATOM 7677  H HE2  . LYS B 1 26 ? -13.693 1.863   -6.357  1.00 0.00 ? 26 LYS B HE2  7  
ATOM 7678  H HE3  . LYS B 1 26 ? -12.309 1.659   -7.450  1.00 0.00 ? 26 LYS B HE3  7  
ATOM 7679  H HZ1  . LYS B 1 26 ? -13.514 -0.453  -5.769  1.00 0.00 ? 26 LYS B HZ1  7  
ATOM 7680  H HZ2  . LYS B 1 26 ? -13.724 -0.267  -7.417  1.00 0.00 ? 26 LYS B HZ2  7  
ATOM 7681  H HZ3  . LYS B 1 26 ? -12.231 -0.657  -6.803  1.00 0.00 ? 26 LYS B HZ3  7  
ATOM 7682  N N    . LYS B 1 27 ? -12.845 7.241   -5.934  1.00 0.00 ? 27 LYS B N    7  
ATOM 7683  C CA   . LYS B 1 27 ? -13.928 8.210   -5.946  1.00 0.00 ? 27 LYS B CA   7  
ATOM 7684  C C    . LYS B 1 27 ? -13.962 8.914   -7.305  1.00 0.00 ? 27 LYS B C    7  
ATOM 7685  O O    . LYS B 1 27 ? -14.935 9.634   -7.571  1.00 0.00 ? 27 LYS B O    7  
ATOM 7686  C CB   . LYS B 1 27 ? -13.803 9.168   -4.760  1.00 0.00 ? 27 LYS B CB   7  
ATOM 7687  C CG   . LYS B 1 27 ? -15.160 9.388   -4.087  1.00 0.00 ? 27 LYS B CG   7  
ATOM 7688  C CD   . LYS B 1 27 ? -15.070 10.473  -3.013  1.00 0.00 ? 27 LYS B CD   7  
ATOM 7689  C CE   . LYS B 1 27 ? -14.956 11.862  -3.645  1.00 0.00 ? 27 LYS B CE   7  
ATOM 7690  N NZ   . LYS B 1 27 ? -15.986 12.761  -3.104  1.00 0.00 ? 27 LYS B NZ   7  
ATOM 7691  H H    . LYS B 1 27 ? -11.968 7.509   -5.490  1.00 0.00 ? 27 LYS B H    7  
ATOM 7692  H HA   . LYS B 1 27 ? -14.851 7.645   -5.818  1.00 0.00 ? 27 LYS B HA   7  
ATOM 7693  H HB2  . LYS B 1 27 ? -13.112 8.742   -4.032  1.00 0.00 ? 27 LYS B HB2  7  
ATOM 7694  H HB3  . LYS B 1 27 ? -13.405 10.119  -5.113  1.00 0.00 ? 27 LYS B HB3  7  
ATOM 7695  H HG2  . LYS B 1 27 ? -15.883 9.694   -4.842  1.00 0.00 ? 27 LYS B HG2  7  
ATOM 7696  H HG3  . LYS B 1 27 ? -15.490 8.450   -3.641  1.00 0.00 ? 27 LYS B HG3  7  
ATOM 7697  H HD2  . LYS B 1 27 ? -15.969 10.437  -2.397  1.00 0.00 ? 27 LYS B HD2  7  
ATOM 7698  H HD3  . LYS B 1 27 ? -14.201 10.278  -2.384  1.00 0.00 ? 27 LYS B HD3  7  
ATOM 7699  H HE2  . LYS B 1 27 ? -13.971 12.276  -3.424  1.00 0.00 ? 27 LYS B HE2  7  
ATOM 7700  H HE3  . LYS B 1 27 ? -15.068 11.774  -4.726  1.00 0.00 ? 27 LYS B HE3  7  
ATOM 7701  H HZ1  . LYS B 1 27 ? -15.881 12.844  -2.092  1.00 0.00 ? 27 LYS B HZ1  7  
ATOM 7702  H HZ2  . LYS B 1 27 ? -15.889 13.679  -3.539  1.00 0.00 ? 27 LYS B HZ2  7  
ATOM 7703  H HZ3  . LYS B 1 27 ? -16.915 12.392  -3.311  1.00 0.00 ? 27 LYS B HZ3  7  
ATOM 7704  N N    . LEU B 1 28 ? -12.915 8.698   -8.121  1.00 0.00 ? 28 LEU B N    7  
ATOM 7705  C CA   . LEU B 1 28 ? -12.826 9.309   -9.437  1.00 0.00 ? 28 LEU B CA   7  
ATOM 7706  C C    . LEU B 1 28 ? -13.117 8.252   -10.504 1.00 0.00 ? 28 LEU B C    7  
ATOM 7707  O O    . LEU B 1 28 ? -13.723 8.600   -11.529 1.00 0.00 ? 28 LEU B O    7  
ATOM 7708  C CB   . LEU B 1 28 ? -11.475 10.005  -9.614  1.00 0.00 ? 28 LEU B CB   7  
ATOM 7709  C CG   . LEU B 1 28 ? -11.525 11.442  -10.138 1.00 0.00 ? 28 LEU B CG   7  
ATOM 7710  C CD1  . LEU B 1 28 ? -11.707 12.437  -8.990  1.00 0.00 ? 28 LEU B CD1  7  
ATOM 7711  C CD2  . LEU B 1 28 ? -10.290 11.761  -10.982 1.00 0.00 ? 28 LEU B CD2  7  
ATOM 7712  H H    . LEU B 1 28 ? -12.152 8.090   -7.823  1.00 0.00 ? 28 LEU B H    7  
ATOM 7713  H HA   . LEU B 1 28 ? -13.600 10.075  -9.475  1.00 0.00 ? 28 LEU B HA   7  
ATOM 7714  H HB2  . LEU B 1 28 ? -10.996 10.001  -8.634  1.00 0.00 ? 28 LEU B HB2  7  
ATOM 7715  H HB3  . LEU B 1 28 ? -10.896 9.381   -10.295 1.00 0.00 ? 28 LEU B HB3  7  
ATOM 7716  H HG   . LEU B 1 28 ? -12.410 11.483  -10.772 1.00 0.00 ? 28 LEU B HG   7  
ATOM 7717  H HD11 . LEU B 1 28 ? -10.881 12.347  -8.284  1.00 0.00 ? 28 LEU B HD11 7  
ATOM 7718  H HD12 . LEU B 1 28 ? -11.739 13.448  -9.397  1.00 0.00 ? 28 LEU B HD12 7  
ATOM 7719  H HD13 . LEU B 1 28 ? -12.643 12.236  -8.467  1.00 0.00 ? 28 LEU B HD13 7  
ATOM 7720  H HD21 . LEU B 1 28 ? -10.234 11.078  -11.830 1.00 0.00 ? 28 LEU B HD21 7  
ATOM 7721  H HD22 . LEU B 1 28 ? -10.360 12.789  -11.337 1.00 0.00 ? 28 LEU B HD22 7  
ATOM 7722  H HD23 . LEU B 1 28 ? -9.389  11.654  -10.378 1.00 0.00 ? 28 LEU B HD23 7  
ATOM 7723  N N    . VAL B 1 29 ? -12.689 7.003   -10.249 1.00 0.00 ? 29 VAL B N    7  
ATOM 7724  C CA   . VAL B 1 29 ? -12.903 5.910   -11.181 1.00 0.00 ? 29 VAL B CA   7  
ATOM 7725  C C    . VAL B 1 29 ? -13.961 4.962   -10.615 1.00 0.00 ? 29 VAL B C    7  
ATOM 7726  O O    . VAL B 1 29 ? -15.038 4.849   -11.221 1.00 0.00 ? 29 VAL B O    7  
ATOM 7727  C CB   . VAL B 1 29 ? -11.575 5.211   -11.483 1.00 0.00 ? 29 VAL B CB   7  
ATOM 7728  C CG1  . VAL B 1 29 ? -11.717 4.251   -12.666 1.00 0.00 ? 29 VAL B CG1  7  
ATOM 7729  C CG2  . VAL B 1 29 ? -10.463 6.232   -11.736 1.00 0.00 ? 29 VAL B CG2  7  
ATOM 7730  H H    . VAL B 1 29 ? -12.197 6.801   -9.379  1.00 0.00 ? 29 VAL B H    7  
ATOM 7731  H HA   . VAL B 1 29 ? -13.274 6.341   -12.111 1.00 0.00 ? 29 VAL B HA   7  
ATOM 7732  H HB   . VAL B 1 29 ? -11.333 4.639   -10.588 1.00 0.00 ? 29 VAL B HB   7  
ATOM 7733  H HG11 . VAL B 1 29 ? -12.038 4.799   -13.552 1.00 0.00 ? 29 VAL B HG11 7  
ATOM 7734  H HG12 . VAL B 1 29 ? -10.756 3.773   -12.852 1.00 0.00 ? 29 VAL B HG12 7  
ATOM 7735  H HG13 . VAL B 1 29 ? -12.456 3.485   -12.435 1.00 0.00 ? 29 VAL B HG13 7  
ATOM 7736  H HG21 . VAL B 1 29 ? -10.338 6.869   -10.859 1.00 0.00 ? 29 VAL B HG21 7  
ATOM 7737  H HG22 . VAL B 1 29 ? -9.535  5.702   -11.946 1.00 0.00 ? 29 VAL B HG22 7  
ATOM 7738  H HG23 . VAL B 1 29 ? -10.719 6.855   -12.592 1.00 0.00 ? 29 VAL B HG23 7  
ATOM 7739  N N    . GLY B 1 30 ? -13.643 4.310   -9.482  1.00 0.00 ? 30 GLY B N    7  
ATOM 7740  C CA   . GLY B 1 30 ? -14.559 3.382   -8.843  1.00 0.00 ? 30 GLY B CA   7  
ATOM 7741  C C    . GLY B 1 30 ? -15.882 4.096   -8.555  1.00 0.00 ? 30 GLY B C    7  
ATOM 7742  O O    . GLY B 1 30 ? -16.831 3.426   -8.122  1.00 0.00 ? 30 GLY B O    7  
ATOM 7743  H H    . GLY B 1 30 ? -12.733 4.462   -9.047  1.00 0.00 ? 30 GLY B H    7  
ATOM 7744  H HA2  . GLY B 1 30 ? -14.749 2.537   -9.504  1.00 0.00 ? 30 GLY B HA2  7  
ATOM 7745  H HA3  . GLY B 1 30 ? -14.125 3.015   -7.913  1.00 0.00 ? 30 GLY B HA3  7  
ATOM 7746  N N    . GLU B 1 31 ? -15.918 5.418   -8.798  1.00 0.00 ? 31 GLU B N    7  
ATOM 7747  C CA   . GLU B 1 31 ? -17.113 6.211   -8.566  1.00 0.00 ? 31 GLU B CA   7  
ATOM 7748  C C    . GLU B 1 31 ? -18.172 5.847   -9.609  1.00 0.00 ? 31 GLU B C    7  
ATOM 7749  O O    . GLU B 1 31 ? -17.905 6.019   -10.807 1.00 0.00 ? 31 GLU B O    7  
ATOM 7750  C CB   . GLU B 1 31 ? -16.807 7.710   -8.597  1.00 0.00 ? 31 GLU B CB   7  
ATOM 7751  C CG   . GLU B 1 31 ? -17.888 8.474   -9.365  1.00 0.00 ? 31 GLU B CG   7  
ATOM 7752  C CD   . GLU B 1 31 ? -17.784 9.979   -9.106  1.00 0.00 ? 31 GLU B CD   7  
ATOM 7753  O OE1  . GLU B 1 31 ? -17.957 10.334  -7.879  1.00 0.00 ? 31 GLU B OE1  7  
ATOM 7754  O OE2  . GLU B 1 31 ? -17.551 10.755  -10.045 1.00 0.00 ? 31 GLU B OE2  7  
ATOM 7755  H H    . GLU B 1 31 ? -15.089 5.894   -9.155  1.00 0.00 ? 31 GLU B H    7  
ATOM 7756  H HA   . GLU B 1 31 ? -17.483 5.946   -7.576  1.00 0.00 ? 31 GLU B HA   7  
ATOM 7757  H HB2  . GLU B 1 31 ? -16.767 8.084   -7.575  1.00 0.00 ? 31 GLU B HB2  7  
ATOM 7758  H HB3  . GLU B 1 31 ? -15.838 7.864   -9.069  1.00 0.00 ? 31 GLU B HB3  7  
ATOM 7759  H HG2  . GLU B 1 31 ? -17.763 8.289   -10.432 1.00 0.00 ? 31 GLU B HG2  7  
ATOM 7760  H HG3  . GLU B 1 31 ? -18.867 8.110   -9.054  1.00 0.00 ? 31 GLU B HG3  7  
ATOM 7761  N N    . ARG B 1 32 ? -19.335 5.357   -9.140  1.00 0.00 ? 32 ARG B N    7  
ATOM 7762  C CA   . ARG B 1 32 ? -20.420 4.973   -10.026 1.00 0.00 ? 32 ARG B CA   7  
ATOM 7763  C C    . ARG B 1 32 ? -20.811 6.170   -10.896 1.00 0.00 ? 32 ARG B C    7  
ATOM 7764  O O    . ARG B 1 32 ? -21.776 6.098   -11.657 1.00 0.00 ? 32 ARG B O    7  
ATOM 7765  C CB   . ARG B 1 32 ? -21.646 4.499   -9.242  1.00 0.00 ? 32 ARG B CB   7  
ATOM 7766  C CG   . ARG B 1 32 ? -21.362 4.480   -7.739  1.00 0.00 ? 32 ARG B CG   7  
ATOM 7767  C CD   . ARG B 1 32 ? -21.371 5.897   -7.162  1.00 0.00 ? 32 ARG B CD   7  
ATOM 7768  N NE   . ARG B 1 32 ? -22.485 6.675   -7.748  1.00 0.00 ? 32 ARG B NE   7  
ATOM 7769  C CZ   . ARG B 1 32 ? -23.420 7.323   -7.020  1.00 0.00 ? 32 ARG B CZ   7  
ATOM 7770  N NH1  . ARG B 1 32 ? -23.354 7.272   -5.684  1.00 0.00 ? 32 ARG B NH1  7  
ATOM 7771  N NH2  . ARG B 1 32 ? -24.399 8.009   -7.628  1.00 0.00 ? 32 ARG B NH2  7  
ATOM 7772  H H    . ARG B 1 32 ? -19.474 5.248   -8.137  1.00 0.00 ? 32 ARG B H    7  
ATOM 7773  H HA   . ARG B 1 32 ? -20.059 4.170   -10.669 1.00 0.00 ? 32 ARG B HA   7  
ATOM 7774  H HB2  . ARG B 1 32 ? -22.475 5.178   -9.438  1.00 0.00 ? 32 ARG B HB2  7  
ATOM 7775  H HB3  . ARG B 1 32 ? -21.918 3.500   -9.582  1.00 0.00 ? 32 ARG B HB3  7  
ATOM 7776  H HG2  . ARG B 1 32 ? -22.131 3.889   -7.241  1.00 0.00 ? 32 ARG B HG2  7  
ATOM 7777  H HG3  . ARG B 1 32 ? -20.391 4.016   -7.569  1.00 0.00 ? 32 ARG B HG3  7  
ATOM 7778  H HD2  . ARG B 1 32 ? -21.502 5.848   -6.080  1.00 0.00 ? 32 ARG B HD2  7  
ATOM 7779  H HD3  . ARG B 1 32 ? -20.421 6.384   -7.381  1.00 0.00 ? 32 ARG B HD3  7  
ATOM 7780  H HE   . ARG B 1 32 ? -22.521 6.706   -8.767  1.00 0.00 ? 32 ARG B HE   7  
ATOM 7781  H HH11 . ARG B 1 32 ? -22.606 6.748   -5.229  1.00 0.00 ? 32 ARG B HH11 7  
ATOM 7782  H HH12 . ARG B 1 32 ? -24.053 7.755   -5.120  1.00 0.00 ? 32 ARG B HH12 7  
ATOM 7783  H HH21 . ARG B 1 32 ? -24.442 8.042   -8.646  1.00 0.00 ? 32 ARG B HH21 7  
ATOM 7784  H HH22 . ARG B 1 32 ? -25.102 8.494   -7.070  1.00 0.00 ? 32 ARG B HH22 7  
ATOM 7785  N N    . MET A 1 1  ? 8.320   -11.490 17.092  1.00 0.00 ? 1  MET A N    8  
ATOM 7786  C CA   . MET A 1 1  ? 9.065   -11.412 15.847  1.00 0.00 ? 1  MET A CA   8  
ATOM 7787  C C    . MET A 1 1  ? 8.484   -12.416 14.848  1.00 0.00 ? 1  MET A C    8  
ATOM 7788  O O    . MET A 1 1  ? 8.376   -12.072 13.661  1.00 0.00 ? 1  MET A O    8  
ATOM 7789  C CB   . MET A 1 1  ? 10.542  -11.728 16.089  1.00 0.00 ? 1  MET A CB   8  
ATOM 7790  C CG   . MET A 1 1  ? 11.439  -10.878 15.188  1.00 0.00 ? 1  MET A CG   8  
ATOM 7791  S SD   . MET A 1 1  ? 12.944  -11.802 14.759  1.00 0.00 ? 1  MET A SD   8  
ATOM 7792  C CE   . MET A 1 1  ? 12.245  -13.027 13.613  1.00 0.00 ? 1  MET A CE   8  
ATOM 7793  H H    . MET A 1 1  ? 8.847   -11.521 17.964  1.00 0.00 ? 1  MET A H    8  
ATOM 7794  H HA   . MET A 1 1  ? 8.966   -10.407 15.437  1.00 0.00 ? 1  MET A HA   8  
ATOM 7795  H HB2  . MET A 1 1  ? 10.782  -11.517 17.131  1.00 0.00 ? 1  MET A HB2  8  
ATOM 7796  H HB3  . MET A 1 1  ? 10.714  -12.786 15.892  1.00 0.00 ? 1  MET A HB3  8  
ATOM 7797  H HG2  . MET A 1 1  ? 10.903  -10.629 14.272  1.00 0.00 ? 1  MET A HG2  8  
ATOM 7798  H HG3  . MET A 1 1  ? 11.705  -9.956  15.706  1.00 0.00 ? 1  MET A HG3  8  
ATOM 7799  H HE1  . MET A 1 1  ? 11.772  -12.522 12.771  1.00 0.00 ? 1  MET A HE1  8  
ATOM 7800  H HE2  . MET A 1 1  ? 13.045  -13.676 13.257  1.00 0.00 ? 1  MET A HE2  8  
ATOM 7801  H HE3  . MET A 1 1  ? 11.499  -13.633 14.128  1.00 0.00 ? 1  MET A HE3  8  
ATOM 7802  N N    . ASP A 1 2  ? 8.130   -13.617 15.338  1.00 0.00 ? 2  ASP A N    8  
ATOM 7803  C CA   . ASP A 1 2  ? 7.568   -14.658 14.495  1.00 0.00 ? 2  ASP A CA   8  
ATOM 7804  C C    . ASP A 1 2  ? 6.378   -14.092 13.717  1.00 0.00 ? 2  ASP A C    8  
ATOM 7805  O O    . ASP A 1 2  ? 6.185   -14.492 12.560  1.00 0.00 ? 2  ASP A O    8  
ATOM 7806  C CB   . ASP A 1 2  ? 7.066   -15.836 15.333  1.00 0.00 ? 2  ASP A CB   8  
ATOM 7807  C CG   . ASP A 1 2  ? 7.870   -16.112 16.606  1.00 0.00 ? 2  ASP A CG   8  
ATOM 7808  O OD1  . ASP A 1 2  ? 9.093   -16.473 16.411  1.00 0.00 ? 2  ASP A OD1  8  
ATOM 7809  O OD2  . ASP A 1 2  ? 7.354   -15.988 17.727  1.00 0.00 ? 2  ASP A OD2  8  
ATOM 7810  H H    . ASP A 1 2  ? 8.253   -13.820 16.330  1.00 0.00 ? 2  ASP A H    8  
ATOM 7811  H HA   . ASP A 1 2  ? 8.328   -14.991 13.788  1.00 0.00 ? 2  ASP A HA   8  
ATOM 7812  H HB2  . ASP A 1 2  ? 6.035   -15.614 15.606  1.00 0.00 ? 2  ASP A HB2  8  
ATOM 7813  H HB3  . ASP A 1 2  ? 7.082   -16.713 14.686  1.00 0.00 ? 2  ASP A HB3  8  
ATOM 7814  N N    . ALA A 1 3  ? 5.619   -13.184 14.356  1.00 0.00 ? 3  ALA A N    8  
ATOM 7815  C CA   . ALA A 1 3  ? 4.461   -12.570 13.728  1.00 0.00 ? 3  ALA A CA   8  
ATOM 7816  C C    . ALA A 1 3  ? 4.895   -11.293 13.007  1.00 0.00 ? 3  ALA A C    8  
ATOM 7817  O O    . ALA A 1 3  ? 4.113   -10.782 12.192  1.00 0.00 ? 3  ALA A O    8  
ATOM 7818  C CB   . ALA A 1 3  ? 3.461   -12.136 14.803  1.00 0.00 ? 3  ALA A CB   8  
ATOM 7819  H H    . ALA A 1 3  ? 5.848   -12.908 15.311  1.00 0.00 ? 3  ALA A H    8  
ATOM 7820  H HA   . ALA A 1 3  ? 3.999   -13.245 13.009  1.00 0.00 ? 3  ALA A HA   8  
ATOM 7821  H HB1  . ALA A 1 3  ? 3.157   -13.011 15.378  1.00 0.00 ? 3  ALA A HB1  8  
ATOM 7822  H HB2  . ALA A 1 3  ? 3.928   -11.416 15.476  1.00 0.00 ? 3  ALA A HB2  8  
ATOM 7823  H HB3  . ALA A 1 3  ? 2.591   -11.675 14.338  1.00 0.00 ? 3  ALA A HB3  8  
ATOM 7824  N N    . ILE A 1 4  ? 6.112   -10.811 13.315  1.00 0.00 ? 4  ILE A N    8  
ATOM 7825  C CA   . ILE A 1 4  ? 6.642   -9.605  12.699  1.00 0.00 ? 4  ILE A CA   8  
ATOM 7826  C C    . ILE A 1 4  ? 7.114   -9.928  11.281  1.00 0.00 ? 4  ILE A C    8  
ATOM 7827  O O    . ILE A 1 4  ? 6.794   -9.159  10.363  1.00 0.00 ? 4  ILE A O    8  
ATOM 7828  C CB   . ILE A 1 4  ? 7.726   -8.985  13.583  1.00 0.00 ? 4  ILE A CB   8  
ATOM 7829  C CG1  . ILE A 1 4  ? 7.148   -8.541  14.929  1.00 0.00 ? 4  ILE A CG1  8  
ATOM 7830  C CG2  . ILE A 1 4  ? 8.435   -7.840  12.857  1.00 0.00 ? 4  ILE A CG2  8  
ATOM 7831  C CD1  . ILE A 1 4  ? 7.606   -7.123  15.281  1.00 0.00 ? 4  ILE A CD1  8  
ATOM 7832  H H    . ILE A 1 4  ? 6.693   -11.295 14.000  1.00 0.00 ? 4  ILE A H    8  
ATOM 7833  H HA   . ILE A 1 4  ? 5.815   -8.897  12.646  1.00 0.00 ? 4  ILE A HA   8  
ATOM 7834  H HB   . ILE A 1 4  ? 8.446   -9.785  13.753  1.00 0.00 ? 4  ILE A HB   8  
ATOM 7835  H HG12 . ILE A 1 4  ? 6.060   -8.559  14.870  1.00 0.00 ? 4  ILE A HG12 8  
ATOM 7836  H HG13 . ILE A 1 4  ? 7.474   -9.238  15.701  1.00 0.00 ? 4  ILE A HG13 8  
ATOM 7837  H HG21 . ILE A 1 4  ? 7.715   -7.068  12.587  1.00 0.00 ? 4  ILE A HG21 8  
ATOM 7838  H HG22 . ILE A 1 4  ? 9.199   -7.423  13.514  1.00 0.00 ? 4  ILE A HG22 8  
ATOM 7839  H HG23 . ILE A 1 4  ? 8.913   -8.213  11.951  1.00 0.00 ? 4  ILE A HG23 8  
ATOM 7840  H HD11 . ILE A 1 4  ? 7.280   -6.426  14.508  1.00 0.00 ? 4  ILE A HD11 8  
ATOM 7841  H HD12 . ILE A 1 4  ? 7.177   -6.840  16.241  1.00 0.00 ? 4  ILE A HD12 8  
ATOM 7842  H HD13 . ILE A 1 4  ? 8.693   -7.091  15.352  1.00 0.00 ? 4  ILE A HD13 8  
ATOM 7843  N N    . LYS A 1 5  ? 7.855   -11.040 11.132  1.00 0.00 ? 5  LYS A N    8  
ATOM 7844  C CA   . LYS A 1 5  ? 8.366   -11.457 9.836   1.00 0.00 ? 5  LYS A CA   8  
ATOM 7845  C C    . LYS A 1 5  ? 7.204   -11.571 8.847   1.00 0.00 ? 5  LYS A C    8  
ATOM 7846  O O    . LYS A 1 5  ? 7.408   -11.271 7.662   1.00 0.00 ? 5  LYS A O    8  
ATOM 7847  C CB   . LYS A 1 5  ? 9.186   -12.743 9.972   1.00 0.00 ? 5  LYS A CB   8  
ATOM 7848  C CG   . LYS A 1 5  ? 8.748   -13.545 11.199  1.00 0.00 ? 5  LYS A CG   8  
ATOM 7849  C CD   . LYS A 1 5  ? 8.923   -15.046 10.962  1.00 0.00 ? 5  LYS A CD   8  
ATOM 7850  C CE   . LYS A 1 5  ? 10.290  -15.524 11.453  1.00 0.00 ? 5  LYS A CE   8  
ATOM 7851  N NZ   . LYS A 1 5  ? 10.718  -16.720 10.708  1.00 0.00 ? 5  LYS A NZ   8  
ATOM 7852  H H    . LYS A 1 5  ? 8.074   -11.620 11.941  1.00 0.00 ? 5  LYS A H    8  
ATOM 7853  H HA   . LYS A 1 5  ? 9.041   -10.669 9.501   1.00 0.00 ? 5  LYS A HA   8  
ATOM 7854  H HB2  . LYS A 1 5  ? 9.040   -13.351 9.079   1.00 0.00 ? 5  LYS A HB2  8  
ATOM 7855  H HB3  . LYS A 1 5  ? 10.241  -12.482 10.055  1.00 0.00 ? 5  LYS A HB3  8  
ATOM 7856  H HG2  . LYS A 1 5  ? 9.358   -13.247 12.052  1.00 0.00 ? 5  LYS A HG2  8  
ATOM 7857  H HG3  . LYS A 1 5  ? 7.703   -13.321 11.413  1.00 0.00 ? 5  LYS A HG3  8  
ATOM 7858  H HD2  . LYS A 1 5  ? 8.144   -15.583 11.505  1.00 0.00 ? 5  LYS A HD2  8  
ATOM 7859  H HD3  . LYS A 1 5  ? 8.818   -15.251 9.897   1.00 0.00 ? 5  LYS A HD3  8  
ATOM 7860  H HE2  . LYS A 1 5  ? 11.023  -14.731 11.300  1.00 0.00 ? 5  LYS A HE2  8  
ATOM 7861  H HE3  . LYS A 1 5  ? 10.231  -15.751 12.517  1.00 0.00 ? 5  LYS A HE3  8  
ATOM 7862  H HZ1  . LYS A 1 5  ? 10.774  -16.507 9.712   1.00 0.00 ? 5  LYS A HZ1  8  
ATOM 7863  H HZ2  . LYS A 1 5  ? 11.629  -17.018 11.052  1.00 0.00 ? 5  LYS A HZ2  8  
ATOM 7864  H HZ3  . LYS A 1 5  ? 10.046  -17.475 10.848  1.00 0.00 ? 5  LYS A HZ3  8  
ATOM 7865  N N    . LYS A 1 6  ? 6.028   -11.994 9.345   1.00 0.00 ? 6  LYS A N    8  
ATOM 7866  C CA   . LYS A 1 6  ? 4.848   -12.145 8.511   1.00 0.00 ? 6  LYS A CA   8  
ATOM 7867  C C    . LYS A 1 6  ? 4.107   -10.808 8.437   1.00 0.00 ? 6  LYS A C    8  
ATOM 7868  O O    . LYS A 1 6  ? 3.502   -10.526 7.393   1.00 0.00 ? 6  LYS A O    8  
ATOM 7869  C CB   . LYS A 1 6  ? 3.981   -13.302 9.012   1.00 0.00 ? 6  LYS A CB   8  
ATOM 7870  C CG   . LYS A 1 6  ? 4.834   -14.361 9.714   1.00 0.00 ? 6  LYS A CG   8  
ATOM 7871  C CD   . LYS A 1 6  ? 4.220   -15.753 9.554   1.00 0.00 ? 6  LYS A CD   8  
ATOM 7872  C CE   . LYS A 1 6  ? 4.725   -16.432 8.279   1.00 0.00 ? 6  LYS A CE   8  
ATOM 7873  N NZ   . LYS A 1 6  ? 4.209   -15.740 7.087   1.00 0.00 ? 6  LYS A NZ   8  
ATOM 7874  H H    . LYS A 1 6  ? 5.946   -12.221 10.336  1.00 0.00 ? 6  LYS A H    8  
ATOM 7875  H HA   . LYS A 1 6  ? 5.205   -12.408 7.515   1.00 0.00 ? 6  LYS A HA   8  
ATOM 7876  H HB2  . LYS A 1 6  ? 3.246   -12.914 9.717   1.00 0.00 ? 6  LYS A HB2  8  
ATOM 7877  H HB3  . LYS A 1 6  ? 3.461   -13.746 8.164   1.00 0.00 ? 6  LYS A HB3  8  
ATOM 7878  H HG2  . LYS A 1 6  ? 5.832   -14.361 9.275   1.00 0.00 ? 6  LYS A HG2  8  
ATOM 7879  H HG3  . LYS A 1 6  ? 4.911   -14.108 10.771  1.00 0.00 ? 6  LYS A HG3  8  
ATOM 7880  H HD2  . LYS A 1 6  ? 4.497   -16.363 10.414  1.00 0.00 ? 6  LYS A HD2  8  
ATOM 7881  H HD3  . LYS A 1 6  ? 3.134   -15.659 9.520   1.00 0.00 ? 6  LYS A HD3  8  
ATOM 7882  H HE2  . LYS A 1 6  ? 5.815   -16.399 8.264   1.00 0.00 ? 6  LYS A HE2  8  
ATOM 7883  H HE3  . LYS A 1 6  ? 4.400   -17.473 8.274   1.00 0.00 ? 6  LYS A HE3  8  
ATOM 7884  H HZ1  . LYS A 1 6  ? 4.512   -14.766 7.091   1.00 0.00 ? 6  LYS A HZ1  8  
ATOM 7885  H HZ2  . LYS A 1 6  ? 4.558   -16.210 6.252   1.00 0.00 ? 6  LYS A HZ2  8  
ATOM 7886  H HZ3  . LYS A 1 6  ? 3.189   -15.769 7.082   1.00 0.00 ? 6  LYS A HZ3  8  
ATOM 7887  N N    . LYS A 1 7  ? 4.167   -10.026 9.530   1.00 0.00 ? 7  LYS A N    8  
ATOM 7888  C CA   . LYS A 1 7  ? 3.506   -8.733  9.588   1.00 0.00 ? 7  LYS A CA   8  
ATOM 7889  C C    . LYS A 1 7  ? 3.926   -7.895  8.379   1.00 0.00 ? 7  LYS A C    8  
ATOM 7890  O O    . LYS A 1 7  ? 3.041   -7.347  7.705   1.00 0.00 ? 7  LYS A O    8  
ATOM 7891  C CB   . LYS A 1 7  ? 3.777   -8.053  10.932  1.00 0.00 ? 7  LYS A CB   8  
ATOM 7892  C CG   . LYS A 1 7  ? 3.091   -6.687  11.003  1.00 0.00 ? 7  LYS A CG   8  
ATOM 7893  C CD   . LYS A 1 7  ? 1.654   -6.768  10.484  1.00 0.00 ? 7  LYS A CD   8  
ATOM 7894  C CE   . LYS A 1 7  ? 0.753   -5.762  11.203  1.00 0.00 ? 7  LYS A CE   8  
ATOM 7895  N NZ   . LYS A 1 7  ? 1.534   -4.594  11.643  1.00 0.00 ? 7  LYS A NZ   8  
ATOM 7896  H H    . LYS A 1 7  ? 4.688   -10.334 10.350  1.00 0.00 ? 7  LYS A H    8  
ATOM 7897  H HA   . LYS A 1 7  ? 2.435   -8.930  9.529   1.00 0.00 ? 7  LYS A HA   8  
ATOM 7898  H HB2  . LYS A 1 7  ? 3.393   -8.686  11.732  1.00 0.00 ? 7  LYS A HB2  8  
ATOM 7899  H HB3  . LYS A 1 7  ? 4.853   -7.935  11.057  1.00 0.00 ? 7  LYS A HB3  8  
ATOM 7900  H HG2  . LYS A 1 7  ? 3.074   -6.353  12.040  1.00 0.00 ? 7  LYS A HG2  8  
ATOM 7901  H HG3  . LYS A 1 7  ? 3.661   -5.974  10.410  1.00 0.00 ? 7  LYS A HG3  8  
ATOM 7902  H HD2  . LYS A 1 7  ? 1.651   -6.547  9.416   1.00 0.00 ? 7  LYS A HD2  8  
ATOM 7903  H HD3  . LYS A 1 7  ? 1.278   -7.779  10.637  1.00 0.00 ? 7  LYS A HD3  8  
ATOM 7904  H HE2  . LYS A 1 7  ? -0.030  -5.429  10.521  1.00 0.00 ? 7  LYS A HE2  8  
ATOM 7905  H HE3  . LYS A 1 7  ? 0.292   -6.246  12.064  1.00 0.00 ? 7  LYS A HE3  8  
ATOM 7906  H HZ1  . LYS A 1 7  ? 1.966   -4.142  10.838  1.00 0.00 ? 7  LYS A HZ1  8  
ATOM 7907  H HZ2  . LYS A 1 7  ? 0.913   -3.940  12.119  1.00 0.00 ? 7  LYS A HZ2  8  
ATOM 7908  H HZ3  . LYS A 1 7  ? 2.265   -4.889  12.291  1.00 0.00 ? 7  LYS A HZ3  8  
ATOM 7909  N N    . MET A 1 8  ? 5.246   -7.813  8.132   1.00 0.00 ? 8  MET A N    8  
ATOM 7910  C CA   . MET A 1 8  ? 5.774   -7.048  7.015   1.00 0.00 ? 8  MET A CA   8  
ATOM 7911  C C    . MET A 1 8  ? 5.395   -7.740  5.705   1.00 0.00 ? 8  MET A C    8  
ATOM 7912  O O    . MET A 1 8  ? 5.306   -7.050  4.678   1.00 0.00 ? 8  MET A O    8  
ATOM 7913  C CB   . MET A 1 8  ? 7.297   -6.944  7.114   1.00 0.00 ? 8  MET A CB   8  
ATOM 7914  C CG   . MET A 1 8  ? 7.934   -8.329  7.243   1.00 0.00 ? 8  MET A CG   8  
ATOM 7915  S SD   . MET A 1 8  ? 9.696   -8.165  7.660   1.00 0.00 ? 8  MET A SD   8  
ATOM 7916  C CE   . MET A 1 8  ? 10.345  -9.672  6.880   1.00 0.00 ? 8  MET A CE   8  
ATOM 7917  H H    . MET A 1 8  ? 5.908   -8.296  8.739   1.00 0.00 ? 8  MET A H    8  
ATOM 7918  H HA   . MET A 1 8  ? 5.335   -6.051  7.030   1.00 0.00 ? 8  MET A HA   8  
ATOM 7919  H HB2  . MET A 1 8  ? 7.678   -6.460  6.216   1.00 0.00 ? 8  MET A HB2  8  
ATOM 7920  H HB3  . MET A 1 8  ? 7.554   -6.334  7.981   1.00 0.00 ? 8  MET A HB3  8  
ATOM 7921  H HG2  . MET A 1 8  ? 7.433   -8.887  8.034   1.00 0.00 ? 8  MET A HG2  8  
ATOM 7922  H HG3  . MET A 1 8  ? 7.823   -8.867  6.303   1.00 0.00 ? 8  MET A HG3  8  
ATOM 7923  H HE1  . MET A 1 8  ? 10.133  -9.658  5.811   1.00 0.00 ? 8  MET A HE1  8  
ATOM 7924  H HE2  . MET A 1 8  ? 11.421  -9.723  7.045   1.00 0.00 ? 8  MET A HE2  8  
ATOM 7925  H HE3  . MET A 1 8  ? 9.877   -10.552 7.322   1.00 0.00 ? 8  MET A HE3  8  
ATOM 7926  N N    . GLN A 1 9  ? 5.181   -9.066  5.764   1.00 0.00 ? 9  GLN A N    8  
ATOM 7927  C CA   . GLN A 1 9  ? 4.815   -9.841  4.590   1.00 0.00 ? 9  GLN A CA   8  
ATOM 7928  C C    . GLN A 1 9  ? 3.356   -9.554  4.230   1.00 0.00 ? 9  GLN A C    8  
ATOM 7929  O O    . GLN A 1 9  ? 2.998   -9.706  3.053   1.00 0.00 ? 9  GLN A O    8  
ATOM 7930  C CB   . GLN A 1 9  ? 5.040   -11.338 4.810   1.00 0.00 ? 9  GLN A CB   8  
ATOM 7931  C CG   . GLN A 1 9  ? 6.513   -11.705 4.616   1.00 0.00 ? 9  GLN A CG   8  
ATOM 7932  C CD   . GLN A 1 9  ? 6.661   -13.165 4.181   1.00 0.00 ? 9  GLN A CD   8  
ATOM 7933  O OE1  . GLN A 1 9  ? 6.332   -13.545 3.069   1.00 0.00 ? 9  GLN A OE1  8  
ATOM 7934  N NE2  . GLN A 1 9  ? 7.174   -13.958 5.117   1.00 0.00 ? 9  GLN A NE2  8  
ATOM 7935  H H    . GLN A 1 9  ? 5.275   -9.560  6.652   1.00 0.00 ? 9  GLN A H    8  
ATOM 7936  H HA   . GLN A 1 9  ? 5.454   -9.503  3.774   1.00 0.00 ? 9  GLN A HA   8  
ATOM 7937  H HB2  . GLN A 1 9  ? 4.742   -11.595 5.827   1.00 0.00 ? 9  GLN A HB2  8  
ATOM 7938  H HB3  . GLN A 1 9  ? 4.422   -11.896 4.108   1.00 0.00 ? 9  GLN A HB3  8  
ATOM 7939  H HG2  . GLN A 1 9  ? 6.940   -11.061 3.847   1.00 0.00 ? 9  GLN A HG2  8  
ATOM 7940  H HG3  . GLN A 1 9  ? 7.045   -11.541 5.553   1.00 0.00 ? 9  GLN A HG3  8  
ATOM 7941  H HE21 . GLN A 1 9  ? 7.428   -13.576 6.027   1.00 0.00 ? 9  GLN A HE21 8  
ATOM 7942  H HE22 . GLN A 1 9  ? 7.312   -14.950 4.923   1.00 0.00 ? 9  GLN A HE22 8  
ATOM 7943  N N    . MET A 1 10 ? 2.556   -9.150  5.233   1.00 0.00 ? 10 MET A N    8  
ATOM 7944  C CA   . MET A 1 10 ? 1.150   -8.845  5.023   1.00 0.00 ? 10 MET A CA   8  
ATOM 7945  C C    . MET A 1 10 ? 1.022   -7.445  4.422   1.00 0.00 ? 10 MET A C    8  
ATOM 7946  O O    . MET A 1 10 ? 0.170   -7.257  3.540   1.00 0.00 ? 10 MET A O    8  
ATOM 7947  C CB   . MET A 1 10 ? 0.389   -8.905  6.348   1.00 0.00 ? 10 MET A CB   8  
ATOM 7948  C CG   . MET A 1 10 ? 0.777   -10.150 7.148   1.00 0.00 ? 10 MET A CG   8  
ATOM 7949  S SD   . MET A 1 10 ? -0.711  -11.095 7.589   1.00 0.00 ? 10 MET A SD   8  
ATOM 7950  C CE   . MET A 1 10 ? 0.011   -12.303 8.738   1.00 0.00 ? 10 MET A CE   8  
ATOM 7951  H H    . MET A 1 10 ? 2.932   -9.050  6.176   1.00 0.00 ? 10 MET A H    8  
ATOM 7952  H HA   . MET A 1 10 ? 0.732   -9.571  4.325   1.00 0.00 ? 10 MET A HA   8  
ATOM 7953  H HB2  . MET A 1 10 ? 0.628   -8.018  6.935   1.00 0.00 ? 10 MET A HB2  8  
ATOM 7954  H HB3  . MET A 1 10 ? -0.681  -8.916  6.141   1.00 0.00 ? 10 MET A HB3  8  
ATOM 7955  H HG2  . MET A 1 10 ? 1.431   -10.779 6.545   1.00 0.00 ? 10 MET A HG2  8  
ATOM 7956  H HG3  . MET A 1 10 ? 1.308   -9.850  8.052   1.00 0.00 ? 10 MET A HG3  8  
ATOM 7957  H HE1  . MET A 1 10 ? 0.478   -11.787 9.575   1.00 0.00 ? 10 MET A HE1  8  
ATOM 7958  H HE2  . MET A 1 10 ? -0.778  -12.963 9.101   1.00 0.00 ? 10 MET A HE2  8  
ATOM 7959  H HE3  . MET A 1 10 ? 0.764   -12.901 8.223   1.00 0.00 ? 10 MET A HE3  8  
ATOM 7960  N N    . LEU A 1 11 ? 1.854   -6.504  4.902   1.00 0.00 ? 11 LEU A N    8  
ATOM 7961  C CA   . LEU A 1 11 ? 1.832   -5.136  4.415   1.00 0.00 ? 11 LEU A CA   8  
ATOM 7962  C C    . LEU A 1 11 ? 2.547   -5.068  3.064   1.00 0.00 ? 11 LEU A C    8  
ATOM 7963  O O    . LEU A 1 11 ? 2.222   -4.173  2.268   1.00 0.00 ? 11 LEU A O    8  
ATOM 7964  C CB   . LEU A 1 11 ? 2.411   -4.185  5.464   1.00 0.00 ? 11 LEU A CB   8  
ATOM 7965  C CG   . LEU A 1 11 ? 1.702   -4.172  6.821   1.00 0.00 ? 11 LEU A CG   8  
ATOM 7966  C CD1  . LEU A 1 11 ? 2.603   -3.573  7.904   1.00 0.00 ? 11 LEU A CD1  8  
ATOM 7967  C CD2  . LEU A 1 11 ? 0.358   -3.448  6.730   1.00 0.00 ? 11 LEU A CD2  8  
ATOM 7968  H H    . LEU A 1 11 ? 2.528   -6.743  5.630   1.00 0.00 ? 11 LEU A H    8  
ATOM 7969  H HA   . LEU A 1 11 ? 0.783   -4.874  4.275   1.00 0.00 ? 11 LEU A HA   8  
ATOM 7970  H HB2  . LEU A 1 11 ? 3.449   -4.481  5.610   1.00 0.00 ? 11 LEU A HB2  8  
ATOM 7971  H HB3  . LEU A 1 11 ? 2.385   -3.188  5.022   1.00 0.00 ? 11 LEU A HB3  8  
ATOM 7972  H HG   . LEU A 1 11 ? 1.526   -5.220  7.059   1.00 0.00 ? 11 LEU A HG   8  
ATOM 7973  H HD11 . LEU A 1 11 ? 2.876   -2.552  7.638   1.00 0.00 ? 11 LEU A HD11 8  
ATOM 7974  H HD12 . LEU A 1 11 ? 2.068   -3.580  8.854   1.00 0.00 ? 11 LEU A HD12 8  
ATOM 7975  H HD13 . LEU A 1 11 ? 3.510   -4.169  8.003   1.00 0.00 ? 11 LEU A HD13 8  
ATOM 7976  H HD21 . LEU A 1 11 ? -0.284  -3.945  6.001   1.00 0.00 ? 11 LEU A HD21 8  
ATOM 7977  H HD22 . LEU A 1 11 ? -0.118  -3.458  7.711   1.00 0.00 ? 11 LEU A HD22 8  
ATOM 7978  H HD23 . LEU A 1 11 ? 0.512   -2.415  6.421   1.00 0.00 ? 11 LEU A HD23 8  
ATOM 7979  N N    . LYS A 1 12 ? 3.491   -5.998  2.834   1.00 0.00 ? 12 LYS A N    8  
ATOM 7980  C CA   . LYS A 1 12 ? 4.243   -6.043  1.591   1.00 0.00 ? 12 LYS A CA   8  
ATOM 7981  C C    . LYS A 1 12 ? 3.360   -6.630  0.488   1.00 0.00 ? 12 LYS A C    8  
ATOM 7982  O O    . LYS A 1 12 ? 3.540   -6.246  -0.678  1.00 0.00 ? 12 LYS A O    8  
ATOM 7983  C CB   . LYS A 1 12 ? 5.561   -6.794  1.789   1.00 0.00 ? 12 LYS A CB   8  
ATOM 7984  C CG   . LYS A 1 12 ? 6.064   -7.373  0.466   1.00 0.00 ? 12 LYS A CG   8  
ATOM 7985  C CD   . LYS A 1 12 ? 5.469   -8.761  0.213   1.00 0.00 ? 12 LYS A CD   8  
ATOM 7986  C CE   . LYS A 1 12 ? 6.558   -9.834  0.212   1.00 0.00 ? 12 LYS A CE   8  
ATOM 7987  N NZ   . LYS A 1 12 ? 7.079   -10.038 -1.151  1.00 0.00 ? 12 LYS A NZ   8  
ATOM 7988  H H    . LYS A 1 12 ? 3.697   -6.700  3.544   1.00 0.00 ? 12 LYS A H    8  
ATOM 7989  H HA   . LYS A 1 12 ? 4.486   -5.011  1.340   1.00 0.00 ? 12 LYS A HA   8  
ATOM 7990  H HB2  . LYS A 1 12 ? 6.306   -6.103  2.180   1.00 0.00 ? 12 LYS A HB2  8  
ATOM 7991  H HB3  . LYS A 1 12 ? 5.406   -7.595  2.511   1.00 0.00 ? 12 LYS A HB3  8  
ATOM 7992  H HG2  . LYS A 1 12 ? 5.773   -6.709  -0.346  1.00 0.00 ? 12 LYS A HG2  8  
ATOM 7993  H HG3  . LYS A 1 12 ? 7.152   -7.437  0.500   1.00 0.00 ? 12 LYS A HG3  8  
ATOM 7994  H HD2  . LYS A 1 12 ? 4.750   -8.986  1.000   1.00 0.00 ? 12 LYS A HD2  8  
ATOM 7995  H HD3  . LYS A 1 12 ? 4.953   -8.753  -0.748  1.00 0.00 ? 12 LYS A HD3  8  
ATOM 7996  H HE2  . LYS A 1 12 ? 7.376   -9.516  0.859   1.00 0.00 ? 12 LYS A HE2  8  
ATOM 7997  H HE3  . LYS A 1 12 ? 6.144   -10.766 0.595   1.00 0.00 ? 12 LYS A HE3  8  
ATOM 7998  H HZ1  . LYS A 1 12 ? 7.467   -9.166  -1.510  1.00 0.00 ? 12 LYS A HZ1  8  
ATOM 7999  H HZ2  . LYS A 1 12 ? 7.803   -10.757 -1.126  1.00 0.00 ? 12 LYS A HZ2  8  
ATOM 8000  H HZ3  . LYS A 1 12 ? 6.328   -10.345 -1.767  1.00 0.00 ? 12 LYS A HZ3  8  
ATOM 8001  N N    . LEU A 1 13 ? 2.438   -7.533  0.869   1.00 0.00 ? 13 LEU A N    8  
ATOM 8002  C CA   . LEU A 1 13 ? 1.538   -8.163  -0.081  1.00 0.00 ? 13 LEU A CA   8  
ATOM 8003  C C    . LEU A 1 13 ? 0.434   -7.176  -0.464  1.00 0.00 ? 13 LEU A C    8  
ATOM 8004  O O    . LEU A 1 13 ? 0.084   -7.114  -1.651  1.00 0.00 ? 13 LEU A O    8  
ATOM 8005  C CB   . LEU A 1 13 ? 1.013   -9.488  0.477   1.00 0.00 ? 13 LEU A CB   8  
ATOM 8006  C CG   . LEU A 1 13 ? 0.601   -10.535 -0.559  1.00 0.00 ? 13 LEU A CG   8  
ATOM 8007  C CD1  . LEU A 1 13 ? -0.328  -11.583 0.059   1.00 0.00 ? 13 LEU A CD1  8  
ATOM 8008  C CD2  . LEU A 1 13 ? -0.022  -9.874  -1.790  1.00 0.00 ? 13 LEU A CD2  8  
ATOM 8009  H H    . LEU A 1 13 ? 2.357   -7.792  1.853   1.00 0.00 ? 13 LEU A H    8  
ATOM 8010  H HA   . LEU A 1 13 ? 2.134   -8.391  -0.965  1.00 0.00 ? 13 LEU A HA   8  
ATOM 8011  H HB2  . LEU A 1 13 ? 1.810   -9.898  1.098   1.00 0.00 ? 13 LEU A HB2  8  
ATOM 8012  H HB3  . LEU A 1 13 ? 0.164   -9.237  1.110   1.00 0.00 ? 13 LEU A HB3  8  
ATOM 8013  H HG   . LEU A 1 13 ? 1.528   -11.026 -0.852  1.00 0.00 ? 13 LEU A HG   8  
ATOM 8014  H HD11 . LEU A 1 13 ? -1.223  -11.100 0.451   1.00 0.00 ? 13 LEU A HD11 8  
ATOM 8015  H HD12 . LEU A 1 13 ? -0.600  -12.311 -0.705  1.00 0.00 ? 13 LEU A HD12 8  
ATOM 8016  H HD13 . LEU A 1 13 ? 0.184   -12.098 0.873   1.00 0.00 ? 13 LEU A HD13 8  
ATOM 8017  H HD21 . LEU A 1 13 ? 0.693   -9.188  -2.246  1.00 0.00 ? 13 LEU A HD21 8  
ATOM 8018  H HD22 . LEU A 1 13 ? -0.303  -10.647 -2.505  1.00 0.00 ? 13 LEU A HD22 8  
ATOM 8019  H HD23 . LEU A 1 13 ? -0.913  -9.316  -1.501  1.00 0.00 ? 13 LEU A HD23 8  
ATOM 8020  N N    . ASP A 1 14 ? -0.084  -6.436  0.533   1.00 0.00 ? 14 ASP A N    8  
ATOM 8021  C CA   . ASP A 1 14 ? -1.138  -5.463  0.302   1.00 0.00 ? 14 ASP A CA   8  
ATOM 8022  C C    . ASP A 1 14 ? -0.589  -4.317  -0.550  1.00 0.00 ? 14 ASP A C    8  
ATOM 8023  O O    . ASP A 1 14 ? -1.363  -3.734  -1.324  1.00 0.00 ? 14 ASP A O    8  
ATOM 8024  C CB   . ASP A 1 14 ? -1.642  -4.874  1.621   1.00 0.00 ? 14 ASP A CB   8  
ATOM 8025  C CG   . ASP A 1 14 ? -3.163  -4.743  1.731   1.00 0.00 ? 14 ASP A CG   8  
ATOM 8026  O OD1  . ASP A 1 14 ? -3.895  -5.743  1.681   1.00 0.00 ? 14 ASP A OD1  8  
ATOM 8027  O OD2  . ASP A 1 14 ? -3.598  -3.538  1.875   1.00 0.00 ? 14 ASP A OD2  8  
ATOM 8028  H H    . ASP A 1 14 ? 0.262   -6.550  1.486   1.00 0.00 ? 14 ASP A H    8  
ATOM 8029  H HA   . ASP A 1 14 ? -1.954  -5.946  -0.236  1.00 0.00 ? 14 ASP A HA   8  
ATOM 8030  H HB2  . ASP A 1 14 ? -1.284  -5.526  2.417   1.00 0.00 ? 14 ASP A HB2  8  
ATOM 8031  H HB3  . ASP A 1 14 ? -1.177  -3.895  1.727   1.00 0.00 ? 14 ASP A HB3  8  
ATOM 8032  N N    . ASN A 1 15 ? 0.713   -4.019  -0.392  1.00 0.00 ? 15 ASN A N    8  
ATOM 8033  C CA   . ASN A 1 15 ? 1.356   -2.953  -1.141  1.00 0.00 ? 15 ASN A CA   8  
ATOM 8034  C C    . ASN A 1 15 ? 1.307   -3.282  -2.635  1.00 0.00 ? 15 ASN A C    8  
ATOM 8035  O O    . ASN A 1 15 ? 0.905   -2.410  -3.418  1.00 0.00 ? 15 ASN A O    8  
ATOM 8036  C CB   . ASN A 1 15 ? 2.824   -2.805  -0.738  1.00 0.00 ? 15 ASN A CB   8  
ATOM 8037  C CG   . ASN A 1 15 ? 3.351   -1.411  -1.089  1.00 0.00 ? 15 ASN A CG   8  
ATOM 8038  O OD1  . ASN A 1 15 ? 3.774   -1.142  -2.201  1.00 0.00 ? 15 ASN A OD1  8  
ATOM 8039  N ND2  . ASN A 1 15 ? 3.301   -0.545  -0.083  1.00 0.00 ? 15 ASN A ND2  8  
ATOM 8040  H H    . ASN A 1 15 ? 1.281   -4.550  0.268   1.00 0.00 ? 15 ASN A H    8  
ATOM 8041  H HA   . ASN A 1 15 ? 0.816   -2.022  -0.965  1.00 0.00 ? 15 ASN A HA   8  
ATOM 8042  H HB2  . ASN A 1 15 ? 2.913   -2.956  0.338   1.00 0.00 ? 15 ASN A HB2  8  
ATOM 8043  H HB3  . ASN A 1 15 ? 3.410   -3.565  -1.253  1.00 0.00 ? 15 ASN A HB3  8  
ATOM 8044  H HD21 . ASN A 1 15 ? 2.934   -0.835  0.824   1.00 0.00 ? 15 ASN A HD21 8  
ATOM 8045  H HD22 . ASN A 1 15 ? 3.630   0.411   -0.216  1.00 0.00 ? 15 ASN A HD22 8  
ATOM 8046  N N    . TYR A 1 16 ? 1.708   -4.515  -2.992  1.00 0.00 ? 16 TYR A N    8  
ATOM 8047  C CA   . TYR A 1 16 ? 1.690   -4.889  -4.396  1.00 0.00 ? 16 TYR A CA   8  
ATOM 8048  C C    . TYR A 1 16 ? 0.254   -4.822  -4.918  1.00 0.00 ? 16 TYR A C    8  
ATOM 8049  O O    . TYR A 1 16 ? 0.075   -4.425  -6.080  1.00 0.00 ? 16 TYR A O    8  
ATOM 8050  C CB   . TYR A 1 16 ? 2.300   -6.291  -4.579  1.00 0.00 ? 16 TYR A CB   8  
ATOM 8051  C CG   . TYR A 1 16 ? 3.663   -6.476  -3.927  1.00 0.00 ? 16 TYR A CG   8  
ATOM 8052  C CD1  . TYR A 1 16 ? 4.465   -5.349  -3.633  1.00 0.00 ? 16 TYR A CD1  8  
ATOM 8053  C CD2  . TYR A 1 16 ? 4.134   -7.770  -3.606  1.00 0.00 ? 16 TYR A CD2  8  
ATOM 8054  C CE1  . TYR A 1 16 ? 5.728   -5.514  -3.025  1.00 0.00 ? 16 TYR A CE1  8  
ATOM 8055  C CE2  . TYR A 1 16 ? 5.397   -7.936  -2.999  1.00 0.00 ? 16 TYR A CE2  8  
ATOM 8056  C CZ   . TYR A 1 16 ? 6.196   -6.808  -2.709  1.00 0.00 ? 16 TYR A CZ   8  
ATOM 8057  O OH   . TYR A 1 16 ? 7.419   -6.965  -2.122  1.00 0.00 ? 16 TYR A OH   8  
ATOM 8058  H H    . TYR A 1 16 ? 2.025   -5.180  -2.301  1.00 0.00 ? 16 TYR A H    8  
ATOM 8059  H HA   . TYR A 1 16 ? 2.287   -4.163  -4.951  1.00 0.00 ? 16 TYR A HA   8  
ATOM 8060  H HB2  . TYR A 1 16 ? 1.605   -7.037  -4.187  1.00 0.00 ? 16 TYR A HB2  8  
ATOM 8061  H HB3  . TYR A 1 16 ? 2.413   -6.490  -5.647  1.00 0.00 ? 16 TYR A HB3  8  
ATOM 8062  H HD1  . TYR A 1 16 ? 4.114   -4.355  -3.871  1.00 0.00 ? 16 TYR A HD1  8  
ATOM 8063  H HD2  . TYR A 1 16 ? 3.528   -8.638  -3.822  1.00 0.00 ? 16 TYR A HD2  8  
ATOM 8064  H HE1  . TYR A 1 16 ? 6.334   -4.647  -2.805  1.00 0.00 ? 16 TYR A HE1  8  
ATOM 8065  H HE2  . TYR A 1 16 ? 5.748   -8.929  -2.757  1.00 0.00 ? 16 TYR A HE2  8  
ATOM 8066  H HH   . TYR A 1 16 ? 7.805   -6.142  -1.813  1.00 0.00 ? 16 TYR A HH   8  
ATOM 8067  N N    . HIS A 1 17 ? -0.722  -5.208  -4.076  1.00 0.00 ? 17 HIS A N    8  
ATOM 8068  C CA   . HIS A 1 17 ? -2.122  -5.197  -4.463  1.00 0.00 ? 17 HIS A CA   8  
ATOM 8069  C C    . HIS A 1 17 ? -2.608  -3.750  -4.560  1.00 0.00 ? 17 HIS A C    8  
ATOM 8070  O O    . HIS A 1 17 ? -3.459  -3.469  -5.417  1.00 0.00 ? 17 HIS A O    8  
ATOM 8071  C CB   . HIS A 1 17 ? -2.961  -6.041  -3.503  1.00 0.00 ? 17 HIS A CB   8  
ATOM 8072  C CG   . HIS A 1 17 ? -4.133  -5.304  -2.899  1.00 0.00 ? 17 HIS A CG   8  
ATOM 8073  N ND1  . HIS A 1 17 ? -5.359  -5.198  -3.531  1.00 0.00 ? 17 HIS A ND1  8  
ATOM 8074  C CD2  . HIS A 1 17 ? -4.251  -4.638  -1.715  1.00 0.00 ? 17 HIS A CD2  8  
ATOM 8075  C CE1  . HIS A 1 17 ? -6.172  -4.496  -2.754  1.00 0.00 ? 17 HIS A CE1  8  
ATOM 8076  N NE2  . HIS A 1 17 ? -5.483  -4.151  -1.629  1.00 0.00 ? 17 HIS A NE2  8  
ATOM 8077  H H    . HIS A 1 17 ? -0.487  -5.522  -3.135  1.00 0.00 ? 17 HIS A H    8  
ATOM 8078  H HA   . HIS A 1 17 ? -2.175  -5.655  -5.451  1.00 0.00 ? 17 HIS A HA   8  
ATOM 8079  H HB2  . HIS A 1 17 ? -3.334  -6.900  -4.063  1.00 0.00 ? 17 HIS A HB2  8  
ATOM 8080  H HB3  . HIS A 1 17 ? -2.297  -6.395  -2.714  1.00 0.00 ? 17 HIS A HB3  8  
ATOM 8081  H HD1  . HIS A 1 17 ? -5.691  -5.552  -4.429  1.00 0.00 ? 17 HIS A HD1  8  
ATOM 8082  H HD2  . HIS A 1 17 ? -3.547  -4.469  -0.914  1.00 0.00 ? 17 HIS A HD2  8  
ATOM 8083  H HE1  . HIS A 1 17 ? -7.185  -4.300  -3.071  1.00 0.00 ? 17 HIS A HE1  8  
ATOM 8084  N N    . LEU A 1 18 ? -2.068  -2.873  -3.694  1.00 0.00 ? 18 LEU A N    8  
ATOM 8085  C CA   . LEU A 1 18 ? -2.445  -1.470  -3.682  1.00 0.00 ? 18 LEU A CA   8  
ATOM 8086  C C    . LEU A 1 18 ? -1.765  -0.755  -4.851  1.00 0.00 ? 18 LEU A C    8  
ATOM 8087  O O    . LEU A 1 18 ? -2.439  0.031   -5.533  1.00 0.00 ? 18 LEU A O    8  
ATOM 8088  C CB   . LEU A 1 18 ? -2.142  -0.846  -2.318  1.00 0.00 ? 18 LEU A CB   8  
ATOM 8089  C CG   . LEU A 1 18 ? -3.051  -1.276  -1.166  1.00 0.00 ? 18 LEU A CG   8  
ATOM 8090  C CD1  . LEU A 1 18 ? -2.401  -0.977  0.186   1.00 0.00 ? 18 LEU A CD1  8  
ATOM 8091  C CD2  . LEU A 1 18 ? -4.435  -0.637  -1.290  1.00 0.00 ? 18 LEU A CD2  8  
ATOM 8092  H H    . LEU A 1 18 ? -1.373  -3.188  -3.017  1.00 0.00 ? 18 LEU A H    8  
ATOM 8093  H HA   . LEU A 1 18 ? -3.525  -1.439  -3.825  1.00 0.00 ? 18 LEU A HA   8  
ATOM 8094  H HB2  . LEU A 1 18 ? -1.113  -1.115  -2.079  1.00 0.00 ? 18 LEU A HB2  8  
ATOM 8095  H HB3  . LEU A 1 18 ? -2.204  0.234   -2.457  1.00 0.00 ? 18 LEU A HB3  8  
ATOM 8096  H HG   . LEU A 1 18 ? -3.149  -2.357  -1.269  1.00 0.00 ? 18 LEU A HG   8  
ATOM 8097  H HD11 . LEU A 1 18 ? -2.201  0.091   0.274   1.00 0.00 ? 18 LEU A HD11 8  
ATOM 8098  H HD12 . LEU A 1 18 ? -3.074  -1.296  0.982   1.00 0.00 ? 18 LEU A HD12 8  
ATOM 8099  H HD13 . LEU A 1 18 ? -1.462  -1.522  0.276   1.00 0.00 ? 18 LEU A HD13 8  
ATOM 8100  H HD21 . LEU A 1 18 ? -4.897  -0.931  -2.234  1.00 0.00 ? 18 LEU A HD21 8  
ATOM 8101  H HD22 . LEU A 1 18 ? -5.054  -0.966  -0.456  1.00 0.00 ? 18 LEU A HD22 8  
ATOM 8102  H HD23 . LEU A 1 18 ? -4.346  0.449   -1.262  1.00 0.00 ? 18 LEU A HD23 8  
ATOM 8103  N N    . GLU A 1 19 ? -0.466  -1.037  -5.056  1.00 0.00 ? 19 GLU A N    8  
ATOM 8104  C CA   . GLU A 1 19 ? 0.294   -0.424  -6.133  1.00 0.00 ? 19 GLU A CA   8  
ATOM 8105  C C    . GLU A 1 19 ? -0.321  -0.824  -7.476  1.00 0.00 ? 19 GLU A C    8  
ATOM 8106  O O    . GLU A 1 19 ? -0.326  0.009   -8.394  1.00 0.00 ? 19 GLU A O    8  
ATOM 8107  C CB   . GLU A 1 19 ? 1.772   -0.811  -6.068  1.00 0.00 ? 19 GLU A CB   8  
ATOM 8108  C CG   . GLU A 1 19 ? 2.662   0.431   -5.997  1.00 0.00 ? 19 GLU A CG   8  
ATOM 8109  C CD   . GLU A 1 19 ? 2.985   0.955   -7.398  1.00 0.00 ? 19 GLU A CD   8  
ATOM 8110  O OE1  . GLU A 1 19 ? 2.075   1.117   -8.224  1.00 0.00 ? 19 GLU A OE1  8  
ATOM 8111  O OE2  . GLU A 1 19 ? 4.233   1.197   -7.615  1.00 0.00 ? 19 GLU A OE2  8  
ATOM 8112  H H    . GLU A 1 19 ? 0.014   -1.697  -4.447  1.00 0.00 ? 19 GLU A H    8  
ATOM 8113  H HA   . GLU A 1 19 ? 0.205   0.655   -6.010  1.00 0.00 ? 19 GLU A HA   8  
ATOM 8114  H HB2  . GLU A 1 19 ? 1.940   -1.419  -5.179  1.00 0.00 ? 19 GLU A HB2  8  
ATOM 8115  H HB3  . GLU A 1 19 ? 2.022   -1.398  -6.952  1.00 0.00 ? 19 GLU A HB3  8  
ATOM 8116  H HG2  . GLU A 1 19 ? 2.140   1.209   -5.439  1.00 0.00 ? 19 GLU A HG2  8  
ATOM 8117  H HG3  . GLU A 1 19 ? 3.583   0.177   -5.474  1.00 0.00 ? 19 GLU A HG3  8  
ATOM 8118  N N    . ASN A 1 20 ? -0.816  -2.072  -7.564  1.00 0.00 ? 20 ASN A N    8  
ATOM 8119  C CA   . ASN A 1 20 ? -1.424  -2.575  -8.784  1.00 0.00 ? 20 ASN A CA   8  
ATOM 8120  C C    . ASN A 1 20 ? -2.763  -1.868  -9.009  1.00 0.00 ? 20 ASN A C    8  
ATOM 8121  O O    . ASN A 1 20 ? -3.185  -1.760  -10.170 1.00 0.00 ? 20 ASN A O    8  
ATOM 8122  C CB   . ASN A 1 20 ? -1.693  -4.078  -8.686  1.00 0.00 ? 20 ASN A CB   8  
ATOM 8123  C CG   . ASN A 1 20 ? -0.523  -4.882  -9.258  1.00 0.00 ? 20 ASN A CG   8  
ATOM 8124  O OD1  . ASN A 1 20 ? 0.218   -4.426  -10.112 1.00 0.00 ? 20 ASN A OD1  8  
ATOM 8125  N ND2  . ASN A 1 20 ? -0.402  -6.101  -8.740  1.00 0.00 ? 20 ASN A ND2  8  
ATOM 8126  H H    . ASN A 1 20 ? -0.770  -2.697  -6.759  1.00 0.00 ? 20 ASN A H    8  
ATOM 8127  H HA   . ASN A 1 20 ? -0.764  -2.360  -9.624  1.00 0.00 ? 20 ASN A HA   8  
ATOM 8128  H HB2  . ASN A 1 20 ? -1.830  -4.345  -7.639  1.00 0.00 ? 20 ASN A HB2  8  
ATOM 8129  H HB3  . ASN A 1 20 ? -2.607  -4.309  -9.235  1.00 0.00 ? 20 ASN A HB3  8  
ATOM 8130  H HD21 . ASN A 1 20 ? -1.059  -6.421  -8.028  1.00 0.00 ? 20 ASN A HD21 8  
ATOM 8131  H HD22 . ASN A 1 20 ? 0.348   -6.717  -9.056  1.00 0.00 ? 20 ASN A HD22 8  
ATOM 8132  N N    . GLU A 1 21 ? -3.393  -1.410  -7.913  1.00 0.00 ? 21 GLU A N    8  
ATOM 8133  C CA   . GLU A 1 21 ? -4.671  -0.721  -7.992  1.00 0.00 ? 21 GLU A CA   8  
ATOM 8134  C C    . GLU A 1 21 ? -4.430  0.756   -8.310  1.00 0.00 ? 21 GLU A C    8  
ATOM 8135  O O    . GLU A 1 21 ? -5.223  1.332   -9.069  1.00 0.00 ? 21 GLU A O    8  
ATOM 8136  C CB   . GLU A 1 21 ? -5.475  -0.879  -6.700  1.00 0.00 ? 21 GLU A CB   8  
ATOM 8137  C CG   . GLU A 1 21 ? -6.950  -1.148  -7.001  1.00 0.00 ? 21 GLU A CG   8  
ATOM 8138  C CD   . GLU A 1 21 ? -7.693  0.154   -7.306  1.00 0.00 ? 21 GLU A CD   8  
ATOM 8139  O OE1  . GLU A 1 21 ? -7.672  1.028   -6.358  1.00 0.00 ? 21 GLU A OE1  8  
ATOM 8140  O OE2  . GLU A 1 21 ? -8.258  0.305   -8.400  1.00 0.00 ? 21 GLU A OE2  8  
ATOM 8141  H H    . GLU A 1 21 ? -2.975  -1.541  -6.992  1.00 0.00 ? 21 GLU A H    8  
ATOM 8142  H HA   . GLU A 1 21 ? -5.226  -1.175  -8.812  1.00 0.00 ? 21 GLU A HA   8  
ATOM 8143  H HB2  . GLU A 1 21 ? -5.070  -1.718  -6.132  1.00 0.00 ? 21 GLU A HB2  8  
ATOM 8144  H HB3  . GLU A 1 21 ? -5.376  0.030   -6.108  1.00 0.00 ? 21 GLU A HB3  8  
ATOM 8145  H HG2  . GLU A 1 21 ? -7.020  -1.807  -7.867  1.00 0.00 ? 21 GLU A HG2  8  
ATOM 8146  H HG3  . GLU A 1 21 ? -7.403  -1.642  -6.142  1.00 0.00 ? 21 GLU A HG3  8  
ATOM 8147  N N    . VAL A 1 22 ? -3.359  1.330   -7.734  1.00 0.00 ? 22 VAL A N    8  
ATOM 8148  C CA   . VAL A 1 22 ? -3.021  2.725   -7.955  1.00 0.00 ? 22 VAL A CA   8  
ATOM 8149  C C    . VAL A 1 22 ? -2.353  2.873   -9.324  1.00 0.00 ? 22 VAL A C    8  
ATOM 8150  O O    . VAL A 1 22 ? -2.611  3.880   -10.000 1.00 0.00 ? 22 VAL A O    8  
ATOM 8151  C CB   . VAL A 1 22 ? -2.150  3.241   -6.808  1.00 0.00 ? 22 VAL A CB   8  
ATOM 8152  C CG1  . VAL A 1 22 ? -1.587  4.628   -7.127  1.00 0.00 ? 22 VAL A CG1  8  
ATOM 8153  C CG2  . VAL A 1 22 ? -2.930  3.256   -5.492  1.00 0.00 ? 22 VAL A CG2  8  
ATOM 8154  H H    . VAL A 1 22 ? -2.756  0.782   -7.120  1.00 0.00 ? 22 VAL A H    8  
ATOM 8155  H HA   . VAL A 1 22 ? -3.952  3.292   -7.952  1.00 0.00 ? 22 VAL A HA   8  
ATOM 8156  H HB   . VAL A 1 22 ? -1.325  2.534   -6.722  1.00 0.00 ? 22 VAL A HB   8  
ATOM 8157  H HG11 . VAL A 1 22 ? -2.402  5.330   -7.296  1.00 0.00 ? 22 VAL A HG11 8  
ATOM 8158  H HG12 . VAL A 1 22 ? -0.974  4.963   -6.290  1.00 0.00 ? 22 VAL A HG12 8  
ATOM 8159  H HG13 . VAL A 1 22 ? -0.969  4.580   -8.023  1.00 0.00 ? 22 VAL A HG13 8  
ATOM 8160  H HG21 . VAL A 1 22 ? -3.273  2.250   -5.251  1.00 0.00 ? 22 VAL A HG21 8  
ATOM 8161  H HG22 . VAL A 1 22 ? -2.281  3.628   -4.699  1.00 0.00 ? 22 VAL A HG22 8  
ATOM 8162  H HG23 . VAL A 1 22 ? -3.795  3.913   -5.580  1.00 0.00 ? 22 VAL A HG23 8  
ATOM 8163  N N    . ALA A 1 23 ? -1.524  1.883   -9.700  1.00 0.00 ? 23 ALA A N    8  
ATOM 8164  C CA   . ALA A 1 23 ? -0.829  1.904   -10.976 1.00 0.00 ? 23 ALA A CA   8  
ATOM 8165  C C    . ALA A 1 23 ? -1.848  1.774   -12.109 1.00 0.00 ? 23 ALA A C    8  
ATOM 8166  O O    . ALA A 1 23 ? -1.553  2.231   -13.223 1.00 0.00 ? 23 ALA A O    8  
ATOM 8167  C CB   . ALA A 1 23 ? 0.089   0.684   -11.082 1.00 0.00 ? 23 ALA A CB   8  
ATOM 8168  H H    . ALA A 1 23 ? -1.367  1.087   -9.082  1.00 0.00 ? 23 ALA A H    8  
ATOM 8169  H HA   . ALA A 1 23 ? -0.271  2.831   -11.106 1.00 0.00 ? 23 ALA A HA   8  
ATOM 8170  H HB1  . ALA A 1 23 ? 0.807   0.708   -10.263 1.00 0.00 ? 23 ALA A HB1  8  
ATOM 8171  H HB2  . ALA A 1 23 ? -0.500  -0.231  -11.010 1.00 0.00 ? 23 ALA A HB2  8  
ATOM 8172  H HB3  . ALA A 1 23 ? 0.613   0.694   -12.038 1.00 0.00 ? 23 ALA A HB3  8  
ATOM 8173  N N    . ARG A 1 24 ? -3.008  1.164   -11.808 1.00 0.00 ? 24 ARG A N    8  
ATOM 8174  C CA   . ARG A 1 24 ? -4.059  0.977   -12.795 1.00 0.00 ? 24 ARG A CA   8  
ATOM 8175  C C    . ARG A 1 24 ? -4.971  2.205   -12.801 1.00 0.00 ? 24 ARG A C    8  
ATOM 8176  O O    . ARG A 1 24 ? -5.550  2.504   -13.855 1.00 0.00 ? 24 ARG A O    8  
ATOM 8177  C CB   . ARG A 1 24 ? -4.895  -0.270  -12.499 1.00 0.00 ? 24 ARG A CB   8  
ATOM 8178  C CG   . ARG A 1 24 ? -4.286  -1.508  -13.159 1.00 0.00 ? 24 ARG A CG   8  
ATOM 8179  C CD   . ARG A 1 24 ? -5.051  -2.773  -12.762 1.00 0.00 ? 24 ARG A CD   8  
ATOM 8180  N NE   . ARG A 1 24 ? -5.689  -3.373  -13.954 1.00 0.00 ? 24 ARG A NE   8  
ATOM 8181  C CZ   . ARG A 1 24 ? -6.960  -3.828  -13.984 1.00 0.00 ? 24 ARG A CZ   8  
ATOM 8182  N NH1  . ARG A 1 24 ? -7.708  -3.738  -12.875 1.00 0.00 ? 24 ARG A NH1  8  
ATOM 8183  N NH2  . ARG A 1 24 ? -7.466  -4.360  -15.105 1.00 0.00 ? 24 ARG A NH2  8  
ATOM 8184  H H    . ARG A 1 24 ? -3.171  0.815   -10.863 1.00 0.00 ? 24 ARG A H    8  
ATOM 8185  H HA   . ARG A 1 24 ? -3.586  0.882   -13.773 1.00 0.00 ? 24 ARG A HA   8  
ATOM 8186  H HB2  . ARG A 1 24 ? -4.931  -0.424  -11.421 1.00 0.00 ? 24 ARG A HB2  8  
ATOM 8187  H HB3  . ARG A 1 24 ? -5.908  -0.112  -12.869 1.00 0.00 ? 24 ARG A HB3  8  
ATOM 8188  H HG2  . ARG A 1 24 ? -4.332  -1.392  -14.241 1.00 0.00 ? 24 ARG A HG2  8  
ATOM 8189  H HG3  . ARG A 1 24 ? -3.243  -1.594  -12.855 1.00 0.00 ? 24 ARG A HG3  8  
ATOM 8190  H HD2  . ARG A 1 24 ? -4.358  -3.494  -12.329 1.00 0.00 ? 24 ARG A HD2  8  
ATOM 8191  H HD3  . ARG A 1 24 ? -5.809  -2.521  -12.021 1.00 0.00 ? 24 ARG A HD3  8  
ATOM 8192  H HE   . ARG A 1 24 ? -5.106  -3.435  -14.789 1.00 0.00 ? 24 ARG A HE   8  
ATOM 8193  H HH11 . ARG A 1 24 ? -7.315  -3.332  -12.026 1.00 0.00 ? 24 ARG A HH11 8  
ATOM 8194  H HH12 . ARG A 1 24 ? -8.670  -4.076  -12.881 1.00 0.00 ? 24 ARG A HH12 8  
ATOM 8195  H HH21 . ARG A 1 24 ? -6.890  -4.425  -15.944 1.00 0.00 ? 24 ARG A HH21 8  
ATOM 8196  H HH22 . ARG A 1 24 ? -8.427  -4.700  -15.119 1.00 0.00 ? 24 ARG A HH22 8  
ATOM 8197  N N    . LEU A 1 25 ? -5.079  2.881   -11.643 1.00 0.00 ? 25 LEU A N    8  
ATOM 8198  C CA   . LEU A 1 25 ? -5.913  4.064   -11.516 1.00 0.00 ? 25 LEU A CA   8  
ATOM 8199  C C    . LEU A 1 25 ? -5.141  5.283   -12.025 1.00 0.00 ? 25 LEU A C    8  
ATOM 8200  O O    . LEU A 1 25 ? -5.763  6.156   -12.649 1.00 0.00 ? 25 LEU A O    8  
ATOM 8201  C CB   . LEU A 1 25 ? -6.418  4.212   -10.080 1.00 0.00 ? 25 LEU A CB   8  
ATOM 8202  C CG   . LEU A 1 25 ? -7.503  3.224   -9.646  1.00 0.00 ? 25 LEU A CG   8  
ATOM 8203  C CD1  . LEU A 1 25 ? -7.729  3.288   -8.134  1.00 0.00 ? 25 LEU A CD1  8  
ATOM 8204  C CD2  . LEU A 1 25 ? -8.798  3.454   -10.428 1.00 0.00 ? 25 LEU A CD2  8  
ATOM 8205  H H    . LEU A 1 25 ? -4.567  2.566   -10.819 1.00 0.00 ? 25 LEU A H    8  
ATOM 8206  H HA   . LEU A 1 25 ? -6.780  3.900   -12.156 1.00 0.00 ? 25 LEU A HA   8  
ATOM 8207  H HB2  . LEU A 1 25 ? -5.549  4.091   -9.434  1.00 0.00 ? 25 LEU A HB2  8  
ATOM 8208  H HB3  . LEU A 1 25 ? -6.787  5.233   -9.989  1.00 0.00 ? 25 LEU A HB3  8  
ATOM 8209  H HG   . LEU A 1 25 ? -7.108  2.240   -9.894  1.00 0.00 ? 25 LEU A HG   8  
ATOM 8210  H HD11 . LEU A 1 25 ? -8.031  4.295   -7.844  1.00 0.00 ? 25 LEU A HD11 8  
ATOM 8211  H HD12 . LEU A 1 25 ? -8.506  2.574   -7.860  1.00 0.00 ? 25 LEU A HD12 8  
ATOM 8212  H HD13 . LEU A 1 25 ? -6.809  3.030   -7.609  1.00 0.00 ? 25 LEU A HD13 8  
ATOM 8213  H HD21 . LEU A 1 25 ? -8.615  3.330   -11.495 1.00 0.00 ? 25 LEU A HD21 8  
ATOM 8214  H HD22 . LEU A 1 25 ? -9.547  2.735   -10.094 1.00 0.00 ? 25 LEU A HD22 8  
ATOM 8215  H HD23 . LEU A 1 25 ? -9.168  4.462   -10.246 1.00 0.00 ? 25 LEU A HD23 8  
ATOM 8216  N N    . LYS A 1 26 ? -3.824  5.319   -11.755 1.00 0.00 ? 26 LYS A N    8  
ATOM 8217  C CA   . LYS A 1 26 ? -2.979  6.420   -12.183 1.00 0.00 ? 26 LYS A CA   8  
ATOM 8218  C C    . LYS A 1 26 ? -3.041  6.544   -13.706 1.00 0.00 ? 26 LYS A C    8  
ATOM 8219  O O    . LYS A 1 26 ? -2.772  7.640   -14.220 1.00 0.00 ? 26 LYS A O    8  
ATOM 8220  C CB   . LYS A 1 26 ? -1.560  6.250   -11.637 1.00 0.00 ? 26 LYS A CB   8  
ATOM 8221  C CG   . LYS A 1 26 ? -1.303  7.207   -10.470 1.00 0.00 ? 26 LYS A CG   8  
ATOM 8222  C CD   . LYS A 1 26 ? -2.512  7.268   -9.535  1.00 0.00 ? 26 LYS A CD   8  
ATOM 8223  C CE   . LYS A 1 26 ? -3.329  8.537   -9.778  1.00 0.00 ? 26 LYS A CE   8  
ATOM 8224  N NZ   . LYS A 1 26 ? -3.418  9.338   -8.545  1.00 0.00 ? 26 LYS A NZ   8  
ATOM 8225  H H    . LYS A 1 26 ? -3.390  4.556   -11.235 1.00 0.00 ? 26 LYS A H    8  
ATOM 8226  H HA   . LYS A 1 26 ? -3.398  7.323   -11.736 1.00 0.00 ? 26 LYS A HA   8  
ATOM 8227  H HB2  . LYS A 1 26 ? -1.435  5.225   -11.289 1.00 0.00 ? 26 LYS A HB2  8  
ATOM 8228  H HB3  . LYS A 1 26 ? -0.848  6.443   -12.439 1.00 0.00 ? 26 LYS A HB3  8  
ATOM 8229  H HG2  . LYS A 1 26 ? -0.437  6.855   -9.909  1.00 0.00 ? 26 LYS A HG2  8  
ATOM 8230  H HG3  . LYS A 1 26 ? -1.090  8.198   -10.867 1.00 0.00 ? 26 LYS A HG3  8  
ATOM 8231  H HD2  . LYS A 1 26 ? -3.144  6.398   -9.716  1.00 0.00 ? 26 LYS A HD2  8  
ATOM 8232  H HD3  . LYS A 1 26 ? -2.163  7.243   -8.503  1.00 0.00 ? 26 LYS A HD3  8  
ATOM 8233  H HE2  . LYS A 1 26 ? -2.846  9.133   -10.553 1.00 0.00 ? 26 LYS A HE2  8  
ATOM 8234  H HE3  . LYS A 1 26 ? -4.329  8.262   -10.114 1.00 0.00 ? 26 LYS A HE3  8  
ATOM 8235  H HZ1  . LYS A 1 26 ? -2.483  9.597   -8.231  1.00 0.00 ? 26 LYS A HZ1  8  
ATOM 8236  H HZ2  . LYS A 1 26 ? -3.966  10.178  -8.733  1.00 0.00 ? 26 LYS A HZ2  8  
ATOM 8237  H HZ3  . LYS A 1 26 ? -3.878  8.798   -7.812  1.00 0.00 ? 26 LYS A HZ3  8  
ATOM 8238  N N    . LYS A 1 27 ? -3.390  5.436   -14.387 1.00 0.00 ? 27 LYS A N    8  
ATOM 8239  C CA   . LYS A 1 27 ? -3.485  5.422   -15.836 1.00 0.00 ? 27 LYS A CA   8  
ATOM 8240  C C    . LYS A 1 27 ? -4.810  6.057   -16.262 1.00 0.00 ? 27 LYS A C    8  
ATOM 8241  O O    . LYS A 1 27 ? -4.986  6.304   -17.464 1.00 0.00 ? 27 LYS A O    8  
ATOM 8242  C CB   . LYS A 1 27 ? -3.282  4.003   -16.372 1.00 0.00 ? 27 LYS A CB   8  
ATOM 8243  C CG   . LYS A 1 27 ? -2.348  4.003   -17.583 1.00 0.00 ? 27 LYS A CG   8  
ATOM 8244  C CD   . LYS A 1 27 ? -1.862  2.587   -17.901 1.00 0.00 ? 27 LYS A CD   8  
ATOM 8245  C CE   . LYS A 1 27 ? -2.993  1.739   -18.488 1.00 0.00 ? 27 LYS A CE   8  
ATOM 8246  N NZ   . LYS A 1 27 ? -2.838  0.329   -18.092 1.00 0.00 ? 27 LYS A NZ   8  
ATOM 8247  H H    . LYS A 1 27 ? -3.596  4.573   -13.884 1.00 0.00 ? 27 LYS A H    8  
ATOM 8248  H HA   . LYS A 1 27 ? -2.663  6.034   -16.207 1.00 0.00 ? 27 LYS A HA   8  
ATOM 8249  H HB2  . LYS A 1 27 ? -2.845  3.387   -15.586 1.00 0.00 ? 27 LYS A HB2  8  
ATOM 8250  H HB3  . LYS A 1 27 ? -4.251  3.589   -16.650 1.00 0.00 ? 27 LYS A HB3  8  
ATOM 8251  H HG2  . LYS A 1 27 ? -2.885  4.396   -18.445 1.00 0.00 ? 27 LYS A HG2  8  
ATOM 8252  H HG3  . LYS A 1 27 ? -1.496  4.650   -17.372 1.00 0.00 ? 27 LYS A HG3  8  
ATOM 8253  H HD2  . LYS A 1 27 ? -1.050  2.646   -18.626 1.00 0.00 ? 27 LYS A HD2  8  
ATOM 8254  H HD3  . LYS A 1 27 ? -1.489  2.128   -16.986 1.00 0.00 ? 27 LYS A HD3  8  
ATOM 8255  H HE2  . LYS A 1 27 ? -3.948  2.109   -18.115 1.00 0.00 ? 27 LYS A HE2  8  
ATOM 8256  H HE3  . LYS A 1 27 ? -2.978  1.824   -19.573 1.00 0.00 ? 27 LYS A HE3  8  
ATOM 8257  H HZ1  . LYS A 1 27 ? -2.852  0.250   -17.075 1.00 0.00 ? 27 LYS A HZ1  8  
ATOM 8258  H HZ2  . LYS A 1 27 ? -3.602  -0.214  -18.495 1.00 0.00 ? 27 LYS A HZ2  8  
ATOM 8259  H HZ3  . LYS A 1 27 ? -1.951  -0.034  -18.442 1.00 0.00 ? 27 LYS A HZ3  8  
ATOM 8260  N N    . LEU A 1 28 ? -5.701  6.304   -15.286 1.00 0.00 ? 28 LEU A N    8  
ATOM 8261  C CA   . LEU A 1 28 ? -6.996  6.903   -15.558 1.00 0.00 ? 28 LEU A CA   8  
ATOM 8262  C C    . LEU A 1 28 ? -7.035  8.315   -14.967 1.00 0.00 ? 28 LEU A C    8  
ATOM 8263  O O    . LEU A 1 28 ? -7.648  9.196   -15.586 1.00 0.00 ? 28 LEU A O    8  
ATOM 8264  C CB   . LEU A 1 28 ? -8.123  5.997   -15.058 1.00 0.00 ? 28 LEU A CB   8  
ATOM 8265  C CG   . LEU A 1 28 ? -9.268  5.745   -16.042 1.00 0.00 ? 28 LEU A CG   8  
ATOM 8266  C CD1  . LEU A 1 28 ? -9.037  4.456   -16.833 1.00 0.00 ? 28 LEU A CD1  8  
ATOM 8267  C CD2  . LEU A 1 28 ? -10.618 5.742   -15.323 1.00 0.00 ? 28 LEU A CD2  8  
ATOM 8268  H H    . LEU A 1 28 ? -5.476  6.069   -14.318 1.00 0.00 ? 28 LEU A H    8  
ATOM 8269  H HA   . LEU A 1 28 ? -7.084  6.971   -16.642 1.00 0.00 ? 28 LEU A HA   8  
ATOM 8270  H HB2  . LEU A 1 28 ? -7.660  5.043   -14.802 1.00 0.00 ? 28 LEU A HB2  8  
ATOM 8271  H HB3  . LEU A 1 28 ? -8.508  6.459   -14.151 1.00 0.00 ? 28 LEU A HB3  8  
ATOM 8272  H HG   . LEU A 1 28 ? -9.237  6.585   -16.735 1.00 0.00 ? 28 LEU A HG   8  
ATOM 8273  H HD11 . LEU A 1 28 ? -8.964  3.609   -16.151 1.00 0.00 ? 28 LEU A HD11 8  
ATOM 8274  H HD12 . LEU A 1 28 ? -9.869  4.308   -17.522 1.00 0.00 ? 28 LEU A HD12 8  
ATOM 8275  H HD13 . LEU A 1 28 ? -8.113  4.531   -17.405 1.00 0.00 ? 28 LEU A HD13 8  
ATOM 8276  H HD21 . LEU A 1 28 ? -10.779 6.701   -14.831 1.00 0.00 ? 28 LEU A HD21 8  
ATOM 8277  H HD22 . LEU A 1 28 ? -11.408 5.561   -16.051 1.00 0.00 ? 28 LEU A HD22 8  
ATOM 8278  H HD23 . LEU A 1 28 ? -10.638 4.951   -14.574 1.00 0.00 ? 28 LEU A HD23 8  
ATOM 8279  N N    . VAL A 1 29 ? -6.390  8.496   -13.801 1.00 0.00 ? 29 VAL A N    8  
ATOM 8280  C CA   . VAL A 1 29 ? -6.351  9.787   -13.136 1.00 0.00 ? 29 VAL A CA   8  
ATOM 8281  C C    . VAL A 1 29 ? -4.935  10.358  -13.223 1.00 0.00 ? 29 VAL A C    8  
ATOM 8282  O O    . VAL A 1 29 ? -4.776  11.461  -13.766 1.00 0.00 ? 29 VAL A O    8  
ATOM 8283  C CB   . VAL A 1 29 ? -6.852  9.649   -11.696 1.00 0.00 ? 29 VAL A CB   8  
ATOM 8284  C CG1  . VAL A 1 29 ? -7.135  11.021  -11.081 1.00 0.00 ? 29 VAL A CG1  8  
ATOM 8285  C CG2  . VAL A 1 29 ? -8.091  8.754   -11.631 1.00 0.00 ? 29 VAL A CG2  8  
ATOM 8286  H H    . VAL A 1 29 ? -5.909  7.713   -13.356 1.00 0.00 ? 29 VAL A H    8  
ATOM 8287  H HA   . VAL A 1 29 ? -7.034  10.450  -13.667 1.00 0.00 ? 29 VAL A HA   8  
ATOM 8288  H HB   . VAL A 1 29 ? -6.042  9.173   -11.145 1.00 0.00 ? 29 VAL A HB   8  
ATOM 8289  H HG11 . VAL A 1 29 ? -7.889  11.545  -11.669 1.00 0.00 ? 29 VAL A HG11 8  
ATOM 8290  H HG12 . VAL A 1 29 ? -7.490  10.886  -10.059 1.00 0.00 ? 29 VAL A HG12 8  
ATOM 8291  H HG13 . VAL A 1 29 ? -6.222  11.617  -11.063 1.00 0.00 ? 29 VAL A HG13 8  
ATOM 8292  H HG21 . VAL A 1 29 ? -7.854  7.763   -12.018 1.00 0.00 ? 29 VAL A HG21 8  
ATOM 8293  H HG22 . VAL A 1 29 ? -8.420  8.678   -10.594 1.00 0.00 ? 29 VAL A HG22 8  
ATOM 8294  H HG23 . VAL A 1 29 ? -8.894  9.185   -12.227 1.00 0.00 ? 29 VAL A HG23 8  
ATOM 8295  N N    . GLY A 1 30 ? -3.949  9.610   -12.694 1.00 0.00 ? 30 GLY A N    8  
ATOM 8296  C CA   . GLY A 1 30 ? -2.562  10.039  -12.713 1.00 0.00 ? 30 GLY A CA   8  
ATOM 8297  C C    . GLY A 1 30 ? -2.152  10.363  -14.151 1.00 0.00 ? 30 GLY A C    8  
ATOM 8298  O O    . GLY A 1 30 ? -1.043  10.882  -14.345 1.00 0.00 ? 30 GLY A O    8  
ATOM 8299  H H    . GLY A 1 30 ? -4.167  8.711   -12.264 1.00 0.00 ? 30 GLY A H    8  
ATOM 8300  H HA2  . GLY A 1 30 ? -2.444  10.933  -12.100 1.00 0.00 ? 30 GLY A HA2  8  
ATOM 8301  H HA3  . GLY A 1 30 ? -1.925  9.249   -12.314 1.00 0.00 ? 30 GLY A HA3  8  
ATOM 8302  N N    . GLU A 1 31 ? -3.039  10.056  -15.114 1.00 0.00 ? 31 GLU A N    8  
ATOM 8303  C CA   . GLU A 1 31 ? -2.771  10.314  -16.519 1.00 0.00 ? 31 GLU A CA   8  
ATOM 8304  C C    . GLU A 1 31 ? -3.009  11.795  -16.816 1.00 0.00 ? 31 GLU A C    8  
ATOM 8305  O O    . GLU A 1 31 ? -4.178  12.201  -16.896 1.00 0.00 ? 31 GLU A O    8  
ATOM 8306  C CB   . GLU A 1 31 ? -3.628  9.428   -17.426 1.00 0.00 ? 31 GLU A CB   8  
ATOM 8307  C CG   . GLU A 1 31 ? -2.755  8.628   -18.394 1.00 0.00 ? 31 GLU A CG   8  
ATOM 8308  C CD   . GLU A 1 31 ? -2.699  9.302   -19.766 1.00 0.00 ? 31 GLU A CD   8  
ATOM 8309  O OE1  . GLU A 1 31 ? -2.859  10.582  -19.752 1.00 0.00 ? 31 GLU A OE1  8  
ATOM 8310  O OE2  . GLU A 1 31 ? -2.510  8.621   -20.785 1.00 0.00 ? 31 GLU A OE2  8  
ATOM 8311  H H    . GLU A 1 31 ? -3.933  9.630   -14.868 1.00 0.00 ? 31 GLU A H    8  
ATOM 8312  H HA   . GLU A 1 31 ? -1.720  10.081  -16.689 1.00 0.00 ? 31 GLU A HA   8  
ATOM 8313  H HB2  . GLU A 1 31 ? -4.199  8.736   -16.808 1.00 0.00 ? 31 GLU A HB2  8  
ATOM 8314  H HB3  . GLU A 1 31 ? -4.320  10.059  -17.983 1.00 0.00 ? 31 GLU A HB3  8  
ATOM 8315  H HG2  . GLU A 1 31 ? -1.746  8.561   -17.989 1.00 0.00 ? 31 GLU A HG2  8  
ATOM 8316  H HG3  . GLU A 1 31 ? -3.165  7.622   -18.491 1.00 0.00 ? 31 GLU A HG3  8  
ATOM 8317  N N    . ARG A 1 32 ? -1.914  12.561  -16.971 1.00 0.00 ? 32 ARG A N    8  
ATOM 8318  C CA   . ARG A 1 32 ? -2.003  13.984  -17.257 1.00 0.00 ? 32 ARG A CA   8  
ATOM 8319  C C    . ARG A 1 32 ? -3.068  14.218  -18.330 1.00 0.00 ? 32 ARG A C    8  
ATOM 8320  O O    . ARG A 1 32 ? -4.125  14.778  -18.049 1.00 0.00 ? 32 ARG A O    8  
ATOM 8321  C CB   . ARG A 1 32 ? -0.667  14.546  -17.743 1.00 0.00 ? 32 ARG A CB   8  
ATOM 8322  C CG   . ARG A 1 32 ? 0.454   13.516  -17.580 1.00 0.00 ? 32 ARG A CG   8  
ATOM 8323  C CD   . ARG A 1 32 ? 0.271   12.348  -18.551 1.00 0.00 ? 32 ARG A CD   8  
ATOM 8324  N NE   . ARG A 1 32 ? -0.837  12.638  -19.489 1.00 0.00 ? 32 ARG A NE   8  
ATOM 8325  C CZ   . ARG A 1 32 ? -0.668  13.172  -20.718 1.00 0.00 ? 32 ARG A CZ   8  
ATOM 8326  N NH1  . ARG A 1 32 ? 0.572   13.464  -21.135 1.00 0.00 ? 32 ARG A NH1  8  
ATOM 8327  N NH2  . ARG A 1 32 ? -1.724  13.405  -21.509 1.00 0.00 ? 32 ARG A NH2  8  
ATOM 8328  H H    . ARG A 1 32 ? -0.986  12.146  -16.889 1.00 0.00 ? 32 ARG A H    8  
ATOM 8329  H HA   . ARG A 1 32 ? -2.306  14.490  -16.341 1.00 0.00 ? 32 ARG A HA   8  
ATOM 8330  H HB2  . ARG A 1 32 ? -0.755  14.809  -18.797 1.00 0.00 ? 32 ARG A HB2  8  
ATOM 8331  H HB3  . ARG A 1 32 ? -0.432  15.444  -17.172 1.00 0.00 ? 32 ARG A HB3  8  
ATOM 8332  H HG2  . ARG A 1 32 ? 1.410   13.999  -17.781 1.00 0.00 ? 32 ARG A HG2  8  
ATOM 8333  H HG3  . ARG A 1 32 ? 0.450   13.150  -16.553 1.00 0.00 ? 32 ARG A HG3  8  
ATOM 8334  H HD2  . ARG A 1 32 ? 1.189   12.203  -19.121 1.00 0.00 ? 32 ARG A HD2  8  
ATOM 8335  H HD3  . ARG A 1 32 ? 0.054   11.440  -17.989 1.00 0.00 ? 32 ARG A HD3  8  
ATOM 8336  H HE   . ARG A 1 32 ? -1.774  12.411  -19.157 1.00 0.00 ? 32 ARG A HE   8  
ATOM 8337  H HH11 . ARG A 1 32 ? 1.370   13.283  -20.526 1.00 0.00 ? 32 ARG A HH11 8  
ATOM 8338  H HH12 . ARG A 1 32 ? 0.717   13.868  -22.060 1.00 0.00 ? 32 ARG A HH12 8  
ATOM 8339  H HH21 . ARG A 1 32 ? -2.664  13.180  -21.184 1.00 0.00 ? 32 ARG A HH21 8  
ATOM 8340  H HH22 . ARG A 1 32 ? -1.588  13.809  -22.436 1.00 0.00 ? 32 ARG A HH22 8  
ATOM 8341  N N    . MET B 1 1  ? 16.324  -6.850  12.651  1.00 0.00 ? 1  MET B N    8  
ATOM 8342  C CA   . MET B 1 1  ? 15.073  -6.679  13.370  1.00 0.00 ? 1  MET B CA   8  
ATOM 8343  C C    . MET B 1 1  ? 14.824  -5.187  13.604  1.00 0.00 ? 1  MET B C    8  
ATOM 8344  O O    . MET B 1 1  ? 13.672  -4.752  13.465  1.00 0.00 ? 1  MET B O    8  
ATOM 8345  C CB   . MET B 1 1  ? 15.128  -7.404  14.716  1.00 0.00 ? 1  MET B CB   8  
ATOM 8346  C CG   . MET B 1 1  ? 13.790  -8.074  15.034  1.00 0.00 ? 1  MET B CG   8  
ATOM 8347  S SD   . MET B 1 1  ? 13.571  -8.203  16.832  1.00 0.00 ? 1  MET B SD   8  
ATOM 8348  C CE   . MET B 1 1  ? 15.203  -8.847  17.305  1.00 0.00 ? 1  MET B CE   8  
ATOM 8349  H H    . MET B 1 1  ? 17.047  -7.427  13.080  1.00 0.00 ? 1  MET B H    8  
ATOM 8350  H HA   . MET B 1 1  ? 14.259  -7.084  12.768  1.00 0.00 ? 1  MET B HA   8  
ATOM 8351  H HB2  . MET B 1 1  ? 15.906  -8.167  14.675  1.00 0.00 ? 1  MET B HB2  8  
ATOM 8352  H HB3  . MET B 1 1  ? 15.378  -6.685  15.496  1.00 0.00 ? 1  MET B HB3  8  
ATOM 8353  H HG2  . MET B 1 1  ? 12.978  -7.476  14.620  1.00 0.00 ? 1  MET B HG2  8  
ATOM 8354  H HG3  . MET B 1 1  ? 13.765  -9.067  14.584  1.00 0.00 ? 1  MET B HG3  8  
ATOM 8355  H HE1  . MET B 1 1  ? 15.982  -8.149  16.996  1.00 0.00 ? 1  MET B HE1  8  
ATOM 8356  H HE2  . MET B 1 1  ? 15.233  -8.983  18.385  1.00 0.00 ? 1  MET B HE2  8  
ATOM 8357  H HE3  . MET B 1 1  ? 15.377  -9.808  16.820  1.00 0.00 ? 1  MET B HE3  8  
ATOM 8358  N N    . ASP B 1 2  ? 15.892  -4.445  13.949  1.00 0.00 ? 2  ASP B N    8  
ATOM 8359  C CA   . ASP B 1 2  ? 15.790  -3.018  14.198  1.00 0.00 ? 2  ASP B CA   8  
ATOM 8360  C C    . ASP B 1 2  ? 15.117  -2.342  13.002  1.00 0.00 ? 2  ASP B C    8  
ATOM 8361  O O    . ASP B 1 2  ? 14.379  -1.368  13.212  1.00 0.00 ? 2  ASP B O    8  
ATOM 8362  C CB   . ASP B 1 2  ? 17.174  -2.389  14.378  1.00 0.00 ? 2  ASP B CB   8  
ATOM 8363  C CG   . ASP B 1 2  ? 17.831  -2.651  15.734  1.00 0.00 ? 2  ASP B CG   8  
ATOM 8364  O OD1  . ASP B 1 2  ? 18.210  -3.869  15.932  1.00 0.00 ? 2  ASP B OD1  8  
ATOM 8365  O OD2  . ASP B 1 2  ? 17.974  -1.739  16.562  1.00 0.00 ? 2  ASP B OD2  8  
ATOM 8366  H H    . ASP B 1 2  ? 16.809  -4.883  14.042  1.00 0.00 ? 2  ASP B H    8  
ATOM 8367  H HA   . ASP B 1 2  ? 15.180  -2.856  15.086  1.00 0.00 ? 2  ASP B HA   8  
ATOM 8368  H HB2  . ASP B 1 2  ? 17.810  -2.795  13.592  1.00 0.00 ? 2  ASP B HB2  8  
ATOM 8369  H HB3  . ASP B 1 2  ? 17.056  -1.318  14.223  1.00 0.00 ? 2  ASP B HB3  8  
ATOM 8370  N N    . ALA B 1 3  ? 15.379  -2.863  11.789  1.00 0.00 ? 3  ALA B N    8  
ATOM 8371  C CA   . ALA B 1 3  ? 14.802  -2.314  10.574  1.00 0.00 ? 3  ALA B CA   8  
ATOM 8372  C C    . ALA B 1 3  ? 13.495  -3.043  10.260  1.00 0.00 ? 3  ALA B C    8  
ATOM 8373  O O    . ALA B 1 3  ? 12.729  -2.546  9.422   1.00 0.00 ? 3  ALA B O    8  
ATOM 8374  C CB   . ALA B 1 3  ? 15.737  -2.583  9.393   1.00 0.00 ? 3  ALA B CB   8  
ATOM 8375  H H    . ALA B 1 3  ? 16.000  -3.668  11.704  1.00 0.00 ? 3  ALA B H    8  
ATOM 8376  H HA   . ALA B 1 3  ? 14.598  -1.249  10.681  1.00 0.00 ? 3  ALA B HA   8  
ATOM 8377  H HB1  . ALA B 1 3  ? 16.703  -2.118  9.593   1.00 0.00 ? 3  ALA B HB1  8  
ATOM 8378  H HB2  . ALA B 1 3  ? 15.880  -3.656  9.269   1.00 0.00 ? 3  ALA B HB2  8  
ATOM 8379  H HB3  . ALA B 1 3  ? 15.309  -2.172  8.479   1.00 0.00 ? 3  ALA B HB3  8  
ATOM 8380  N N    . ILE B 1 4  ? 13.269  -4.188  10.929  1.00 0.00 ? 4  ILE B N    8  
ATOM 8381  C CA   . ILE B 1 4  ? 12.065  -4.976  10.723  1.00 0.00 ? 4  ILE B CA   8  
ATOM 8382  C C    . ILE B 1 4  ? 10.881  -4.273  11.388  1.00 0.00 ? 4  ILE B C    8  
ATOM 8383  O O    . ILE B 1 4  ? 9.832   -4.143  10.740  1.00 0.00 ? 4  ILE B O    8  
ATOM 8384  C CB   . ILE B 1 4  ? 12.277  -6.413  11.203  1.00 0.00 ? 4  ILE B CB   8  
ATOM 8385  C CG1  . ILE B 1 4  ? 13.274  -7.150  10.307  1.00 0.00 ? 4  ILE B CG1  8  
ATOM 8386  C CG2  . ILE B 1 4  ? 10.944  -7.158  11.309  1.00 0.00 ? 4  ILE B CG2  8  
ATOM 8387  C CD1  . ILE B 1 4  ? 12.668  -8.443  9.758   1.00 0.00 ? 4  ILE B CD1  8  
ATOM 8388  H H    . ILE B 1 4  ? 13.953  -4.529  11.605  1.00 0.00 ? 4  ILE B H    8  
ATOM 8389  H HA   . ILE B 1 4  ? 11.898  -5.010  9.646   1.00 0.00 ? 4  ILE B HA   8  
ATOM 8390  H HB   . ILE B 1 4  ? 12.700  -6.319  12.203  1.00 0.00 ? 4  ILE B HB   8  
ATOM 8391  H HG12 . ILE B 1 4  ? 13.546  -6.503  9.472   1.00 0.00 ? 4  ILE B HG12 8  
ATOM 8392  H HG13 . ILE B 1 4  ? 14.170  -7.376  10.886  1.00 0.00 ? 4  ILE B HG13 8  
ATOM 8393  H HG21 . ILE B 1 4  ? 10.451  -7.179  10.336  1.00 0.00 ? 4  ILE B HG21 8  
ATOM 8394  H HG22 . ILE B 1 4  ? 11.132  -8.174  11.653  1.00 0.00 ? 4  ILE B HG22 8  
ATOM 8395  H HG23 . ILE B 1 4  ? 10.294  -6.655  12.025  1.00 0.00 ? 4  ILE B HG23 8  
ATOM 8396  H HD11 . ILE B 1 4  ? 11.773  -8.218  9.179   1.00 0.00 ? 4  ILE B HD11 8  
ATOM 8397  H HD12 . ILE B 1 4  ? 13.404  -8.940  9.127   1.00 0.00 ? 4  ILE B HD12 8  
ATOM 8398  H HD13 . ILE B 1 4  ? 12.401  -9.107  10.581  1.00 0.00 ? 4  ILE B HD13 8  
ATOM 8399  N N    . LYS B 1 5  ? 11.068  -3.840  12.648  1.00 0.00 ? 5  LYS B N    8  
ATOM 8400  C CA   . LYS B 1 5  ? 10.021  -3.158  13.391  1.00 0.00 ? 5  LYS B CA   8  
ATOM 8401  C C    . LYS B 1 5  ? 9.587   -1.910  12.622  1.00 0.00 ? 5  LYS B C    8  
ATOM 8402  O O    . LYS B 1 5  ? 8.407   -1.541  12.714  1.00 0.00 ? 5  LYS B O    8  
ATOM 8403  C CB   . LYS B 1 5  ? 10.481  -2.870  14.822  1.00 0.00 ? 5  LYS B CB   8  
ATOM 8404  C CG   . LYS B 1 5  ? 11.298  -4.037  15.380  1.00 0.00 ? 5  LYS B CG   8  
ATOM 8405  C CD   . LYS B 1 5  ? 12.717  -3.591  15.739  1.00 0.00 ? 5  LYS B CD   8  
ATOM 8406  C CE   . LYS B 1 5  ? 13.586  -4.788  16.129  1.00 0.00 ? 5  LYS B CE   8  
ATOM 8407  N NZ   . LYS B 1 5  ? 13.368  -5.148  17.539  1.00 0.00 ? 5  LYS B NZ   8  
ATOM 8408  H H    . LYS B 1 5  ? 11.964  -3.988  13.110  1.00 0.00 ? 5  LYS B H    8  
ATOM 8409  H HA   . LYS B 1 5  ? 9.181   -3.851  13.449  1.00 0.00 ? 5  LYS B HA   8  
ATOM 8410  H HB2  . LYS B 1 5  ? 11.100  -1.973  14.821  1.00 0.00 ? 5  LYS B HB2  8  
ATOM 8411  H HB3  . LYS B 1 5  ? 9.605   -2.698  15.446  1.00 0.00 ? 5  LYS B HB3  8  
ATOM 8412  H HG2  . LYS B 1 5  ? 10.808  -4.415  16.277  1.00 0.00 ? 5  LYS B HG2  8  
ATOM 8413  H HG3  . LYS B 1 5  ? 11.336  -4.832  14.635  1.00 0.00 ? 5  LYS B HG3  8  
ATOM 8414  H HD2  . LYS B 1 5  ? 13.162  -3.095  14.876  1.00 0.00 ? 5  LYS B HD2  8  
ATOM 8415  H HD3  . LYS B 1 5  ? 12.666  -2.884  16.568  1.00 0.00 ? 5  LYS B HD3  8  
ATOM 8416  H HE2  . LYS B 1 5  ? 13.325  -5.640  15.500  1.00 0.00 ? 5  LYS B HE2  8  
ATOM 8417  H HE3  . LYS B 1 5  ? 14.635  -4.537  15.966  1.00 0.00 ? 5  LYS B HE3  8  
ATOM 8418  H HZ1  . LYS B 1 5  ? 12.387  -5.383  17.690  1.00 0.00 ? 5  LYS B HZ1  8  
ATOM 8419  H HZ2  . LYS B 1 5  ? 13.957  -5.946  17.774  1.00 0.00 ? 5  LYS B HZ2  8  
ATOM 8420  H HZ3  . LYS B 1 5  ? 13.618  -4.362  18.141  1.00 0.00 ? 5  LYS B HZ3  8  
ATOM 8421  N N    . LYS B 1 6  ? 10.532  -1.294  11.890  1.00 0.00 ? 6  LYS B N    8  
ATOM 8422  C CA   . LYS B 1 6  ? 10.248  -0.099  11.114  1.00 0.00 ? 6  LYS B CA   8  
ATOM 8423  C C    . LYS B 1 6  ? 9.724   -0.504  9.735   1.00 0.00 ? 6  LYS B C    8  
ATOM 8424  O O    . LYS B 1 6  ? 8.939   0.261   9.154   1.00 0.00 ? 6  LYS B O    8  
ATOM 8425  C CB   . LYS B 1 6  ? 11.479  0.810   11.061  1.00 0.00 ? 6  LYS B CB   8  
ATOM 8426  C CG   . LYS B 1 6  ? 12.548  0.345   12.051  1.00 0.00 ? 6  LYS B CG   8  
ATOM 8427  C CD   . LYS B 1 6  ? 13.591  1.439   12.287  1.00 0.00 ? 6  LYS B CD   8  
ATOM 8428  C CE   . LYS B 1 6  ? 13.983  1.513   13.764  1.00 0.00 ? 6  LYS B CE   8  
ATOM 8429  N NZ   . LYS B 1 6  ? 14.466  2.862   14.102  1.00 0.00 ? 6  LYS B NZ   8  
ATOM 8430  H H    . LYS B 1 6  ? 11.482  -1.664  11.869  1.00 0.00 ? 6  LYS B H    8  
ATOM 8431  H HA   . LYS B 1 6  ? 9.465   0.439   11.649  1.00 0.00 ? 6  LYS B HA   8  
ATOM 8432  H HB2  . LYS B 1 6  ? 11.893  0.787   10.053  1.00 0.00 ? 6  LYS B HB2  8  
ATOM 8433  H HB3  . LYS B 1 6  ? 11.174  1.831   11.296  1.00 0.00 ? 6  LYS B HB3  8  
ATOM 8434  H HG2  . LYS B 1 6  ? 12.070  0.100   12.999  1.00 0.00 ? 6  LYS B HG2  8  
ATOM 8435  H HG3  . LYS B 1 6  ? 13.030  -0.550  11.655  1.00 0.00 ? 6  LYS B HG3  8  
ATOM 8436  H HD2  . LYS B 1 6  ? 14.478  1.214   11.695  1.00 0.00 ? 6  LYS B HD2  8  
ATOM 8437  H HD3  . LYS B 1 6  ? 13.180  2.394   11.962  1.00 0.00 ? 6  LYS B HD3  8  
ATOM 8438  H HE2  . LYS B 1 6  ? 13.113  1.282   14.378  1.00 0.00 ? 6  LYS B HE2  8  
ATOM 8439  H HE3  . LYS B 1 6  ? 14.764  0.778   13.964  1.00 0.00 ? 6  LYS B HE3  8  
ATOM 8440  H HZ1  . LYS B 1 6  ? 13.735  3.550   13.914  1.00 0.00 ? 6  LYS B HZ1  8  
ATOM 8441  H HZ2  . LYS B 1 6  ? 14.720  2.886   15.088  1.00 0.00 ? 6  LYS B HZ2  8  
ATOM 8442  H HZ3  . LYS B 1 6  ? 15.287  3.089   13.541  1.00 0.00 ? 6  LYS B HZ3  8  
ATOM 8443  N N    . LYS B 1 7  ? 10.159  -1.678  9.246   1.00 0.00 ? 7  LYS B N    8  
ATOM 8444  C CA   . LYS B 1 7  ? 9.736   -2.177  7.949   1.00 0.00 ? 7  LYS B CA   8  
ATOM 8445  C C    . LYS B 1 7  ? 8.207   -2.233  7.902   1.00 0.00 ? 7  LYS B C    8  
ATOM 8446  O O    . LYS B 1 7  ? 7.632   -1.790  6.898   1.00 0.00 ? 7  LYS B O    8  
ATOM 8447  C CB   . LYS B 1 7  ? 10.410  -3.516  7.643   1.00 0.00 ? 7  LYS B CB   8  
ATOM 8448  C CG   . LYS B 1 7  ? 10.000  -4.034  6.264   1.00 0.00 ? 7  LYS B CG   8  
ATOM 8449  C CD   . LYS B 1 7  ? 10.072  -2.922  5.216   1.00 0.00 ? 7  LYS B CD   8  
ATOM 8450  C CE   . LYS B 1 7  ? 9.992   -3.497  3.800   1.00 0.00 ? 7  LYS B CE   8  
ATOM 8451  N NZ   . LYS B 1 7  ? 10.984  -4.570  3.622   1.00 0.00 ? 7  LYS B NZ   8  
ATOM 8452  H H    . LYS B 1 7  ? 10.806  -2.249  9.791   1.00 0.00 ? 7  LYS B H    8  
ATOM 8453  H HA   . LYS B 1 7  ? 10.088  -1.455  7.211   1.00 0.00 ? 7  LYS B HA   8  
ATOM 8454  H HB2  . LYS B 1 7  ? 11.492  -3.380  7.664   1.00 0.00 ? 7  LYS B HB2  8  
ATOM 8455  H HB3  . LYS B 1 7  ? 10.129  -4.236  8.411   1.00 0.00 ? 7  LYS B HB3  8  
ATOM 8456  H HG2  . LYS B 1 7  ? 10.674  -4.841  5.974   1.00 0.00 ? 7  LYS B HG2  8  
ATOM 8457  H HG3  . LYS B 1 7  ? 8.983   -4.425  6.321   1.00 0.00 ? 7  LYS B HG3  8  
ATOM 8458  H HD2  . LYS B 1 7  ? 9.238   -2.237  5.368   1.00 0.00 ? 7  LYS B HD2  8  
ATOM 8459  H HD3  . LYS B 1 7  ? 11.008  -2.377  5.342   1.00 0.00 ? 7  LYS B HD3  8  
ATOM 8460  H HE2  . LYS B 1 7  ? 8.994   -3.904  3.634   1.00 0.00 ? 7  LYS B HE2  8  
ATOM 8461  H HE3  . LYS B 1 7  ? 10.173  -2.700  3.079   1.00 0.00 ? 7  LYS B HE3  8  
ATOM 8462  H HZ1  . LYS B 1 7  ? 10.813  -5.316  4.296   1.00 0.00 ? 7  LYS B HZ1  8  
ATOM 8463  H HZ2  . LYS B 1 7  ? 10.910  -4.936  2.673   1.00 0.00 ? 7  LYS B HZ2  8  
ATOM 8464  H HZ3  . LYS B 1 7  ? 11.924  -4.202  3.765   1.00 0.00 ? 7  LYS B HZ3  8  
ATOM 8465  N N    . MET B 1 8  ? 7.592   -2.768  8.972   1.00 0.00 ? 8  MET B N    8  
ATOM 8466  C CA   . MET B 1 8  ? 6.146   -2.879  9.052   1.00 0.00 ? 8  MET B CA   8  
ATOM 8467  C C    . MET B 1 8  ? 5.537   -1.483  9.198   1.00 0.00 ? 8  MET B C    8  
ATOM 8468  O O    . MET B 1 8  ? 4.358   -1.315  8.859   1.00 0.00 ? 8  MET B O    8  
ATOM 8469  C CB   . MET B 1 8  ? 5.743   -3.741  10.250  1.00 0.00 ? 8  MET B CB   8  
ATOM 8470  C CG   . MET B 1 8  ? 6.382   -3.219  11.539  1.00 0.00 ? 8  MET B CG   8  
ATOM 8471  S SD   . MET B 1 8  ? 5.277   -3.522  12.948  1.00 0.00 ? 8  MET B SD   8  
ATOM 8472  C CE   . MET B 1 8  ? 5.295   -5.339  12.979  1.00 0.00 ? 8  MET B CE   8  
ATOM 8473  H H    . MET B 1 8  ? 8.143   -3.109  9.759   1.00 0.00 ? 8  MET B H    8  
ATOM 8474  H HA   . MET B 1 8  ? 5.774   -3.333  8.132   1.00 0.00 ? 8  MET B HA   8  
ATOM 8475  H HB2  . MET B 1 8  ? 4.659   -3.714  10.357  1.00 0.00 ? 8  MET B HB2  8  
ATOM 8476  H HB3  . MET B 1 8  ? 6.057   -4.768  10.069  1.00 0.00 ? 8  MET B HB3  8  
ATOM 8477  H HG2  . MET B 1 8  ? 7.327   -3.737  11.710  1.00 0.00 ? 8  MET B HG2  8  
ATOM 8478  H HG3  . MET B 1 8  ? 6.577   -2.151  11.441  1.00 0.00 ? 8  MET B HG3  8  
ATOM 8479  H HE1  . MET B 1 8  ? 6.314   -5.698  13.122  1.00 0.00 ? 8  MET B HE1  8  
ATOM 8480  H HE2  . MET B 1 8  ? 4.660   -5.686  13.793  1.00 0.00 ? 8  MET B HE2  8  
ATOM 8481  H HE3  . MET B 1 8  ? 4.910   -5.730  12.038  1.00 0.00 ? 8  MET B HE3  8  
ATOM 8482  N N    . GLN B 1 9  ? 6.343   -0.525  9.692   1.00 0.00 ? 9  GLN B N    8  
ATOM 8483  C CA   . GLN B 1 9  ? 5.887   0.842   9.880   1.00 0.00 ? 9  GLN B CA   8  
ATOM 8484  C C    . GLN B 1 9  ? 5.960   1.588   8.546   1.00 0.00 ? 9  GLN B C    8  
ATOM 8485  O O    . GLN B 1 9  ? 5.214   2.565   8.375   1.00 0.00 ? 9  GLN B O    8  
ATOM 8486  C CB   . GLN B 1 9  ? 6.702   1.563   10.957  1.00 0.00 ? 9  GLN B CB   8  
ATOM 8487  C CG   . GLN B 1 9  ? 6.356   1.035   12.351  1.00 0.00 ? 9  GLN B CG   8  
ATOM 8488  C CD   . GLN B 1 9  ? 6.695   2.068   13.427  1.00 0.00 ? 9  GLN B CD   8  
ATOM 8489  O OE1  . GLN B 1 9  ? 5.910   2.944   13.752  1.00 0.00 ? 9  GLN B OE1  8  
ATOM 8490  N NE2  . GLN B 1 9  ? 7.904   1.918   13.960  1.00 0.00 ? 9  GLN B NE2  8  
ATOM 8491  H H    . GLN B 1 9  ? 7.304   -0.748  9.947   1.00 0.00 ? 9  GLN B H    8  
ATOM 8492  H HA   . GLN B 1 9  ? 4.847   0.788   10.200  1.00 0.00 ? 9  GLN B HA   8  
ATOM 8493  H HB2  . GLN B 1 9  ? 7.762   1.398   10.767  1.00 0.00 ? 9  GLN B HB2  8  
ATOM 8494  H HB3  . GLN B 1 9  ? 6.493   2.632   10.901  1.00 0.00 ? 9  GLN B HB3  8  
ATOM 8495  H HG2  . GLN B 1 9  ? 5.289   0.816   12.392  1.00 0.00 ? 9  GLN B HG2  8  
ATOM 8496  H HG3  . GLN B 1 9  ? 6.915   0.116   12.529  1.00 0.00 ? 9  GLN B HG3  8  
ATOM 8497  H HE21 . GLN B 1 9  ? 8.511   1.163   13.642  1.00 0.00 ? 9  GLN B HE21 8  
ATOM 8498  H HE22 . GLN B 1 9  ? 8.224   2.557   14.687  1.00 0.00 ? 9  GLN B HE22 8  
ATOM 8499  N N    . MET B 1 10 ? 6.840   1.122   7.643   1.00 0.00 ? 10 MET B N    8  
ATOM 8500  C CA   . MET B 1 10 ? 7.007   1.741   6.339   1.00 0.00 ? 10 MET B CA   8  
ATOM 8501  C C    . MET B 1 10 ? 5.904   1.246   5.400   1.00 0.00 ? 10 MET B C    8  
ATOM 8502  O O    . MET B 1 10 ? 5.408   2.049   4.598   1.00 0.00 ? 10 MET B O    8  
ATOM 8503  C CB   . MET B 1 10 ? 8.374   1.387   5.752   1.00 0.00 ? 10 MET B CB   8  
ATOM 8504  C CG   . MET B 1 10 ? 9.477   1.538   6.801   1.00 0.00 ? 10 MET B CG   8  
ATOM 8505  S SD   . MET B 1 10 ? 10.799  2.608   6.163   1.00 0.00 ? 10 MET B SD   8  
ATOM 8506  C CE   . MET B 1 10 ? 10.552  4.074   7.208   1.00 0.00 ? 10 MET B CE   8  
ATOM 8507  H H    . MET B 1 10 ? 7.417   0.310   7.865   1.00 0.00 ? 10 MET B H    8  
ATOM 8508  H HA   . MET B 1 10 ? 6.921   2.822   6.447   1.00 0.00 ? 10 MET B HA   8  
ATOM 8509  H HB2  . MET B 1 10 ? 8.354   0.354   5.404   1.00 0.00 ? 10 MET B HB2  8  
ATOM 8510  H HB3  . MET B 1 10 ? 8.575   2.043   4.905   1.00 0.00 ? 10 MET B HB3  8  
ATOM 8511  H HG2  . MET B 1 10 ? 9.061   1.988   7.703   1.00 0.00 ? 10 MET B HG2  8  
ATOM 8512  H HG3  . MET B 1 10 ? 9.880   0.556   7.048   1.00 0.00 ? 10 MET B HG3  8  
ATOM 8513  H HE1  . MET B 1 10 ? 10.661  3.804   8.258   1.00 0.00 ? 10 MET B HE1  8  
ATOM 8514  H HE2  . MET B 1 10 ? 11.291  4.830   6.940   1.00 0.00 ? 10 MET B HE2  8  
ATOM 8515  H HE3  . MET B 1 10 ? 9.554   4.481   7.047   1.00 0.00 ? 10 MET B HE3  8  
ATOM 8516  N N    . LEU B 1 11 ? 5.549   -0.047  5.518   1.00 0.00 ? 11 LEU B N    8  
ATOM 8517  C CA   . LEU B 1 11 ? 4.516   -0.639  4.686   1.00 0.00 ? 11 LEU B CA   8  
ATOM 8518  C C    . LEU B 1 11 ? 3.141   -0.216  5.207   1.00 0.00 ? 11 LEU B C    8  
ATOM 8519  O O    . LEU B 1 11 ? 2.191   -0.186  4.410   1.00 0.00 ? 11 LEU B O    8  
ATOM 8520  C CB   . LEU B 1 11 ? 4.700   -2.157  4.602   1.00 0.00 ? 11 LEU B CB   8  
ATOM 8521  C CG   . LEU B 1 11 ? 6.037   -2.639  4.036   1.00 0.00 ? 11 LEU B CG   8  
ATOM 8522  C CD1  . LEU B 1 11 ? 6.065   -4.164  3.920   1.00 0.00 ? 11 LEU B CD1  8  
ATOM 8523  C CD2  . LEU B 1 11 ? 6.347   -1.957  2.703   1.00 0.00 ? 11 LEU B CD2  8  
ATOM 8524  H H    . LEU B 1 11 ? 6.009   -0.641  6.206   1.00 0.00 ? 11 LEU B H    8  
ATOM 8525  H HA   . LEU B 1 11 ? 4.656   -0.235  3.683   1.00 0.00 ? 11 LEU B HA   8  
ATOM 8526  H HB2  . LEU B 1 11 ? 4.586   -2.536  5.617   1.00 0.00 ? 11 LEU B HB2  8  
ATOM 8527  H HB3  . LEU B 1 11 ? 3.880   -2.530  3.988   1.00 0.00 ? 11 LEU B HB3  8  
ATOM 8528  H HG   . LEU B 1 11 ? 6.783   -2.335  4.771   1.00 0.00 ? 11 LEU B HG   8  
ATOM 8529  H HD11 . LEU B 1 11 ? 5.262   -4.502  3.265   1.00 0.00 ? 11 LEU B HD11 8  
ATOM 8530  H HD12 . LEU B 1 11 ? 7.030   -4.472  3.515   1.00 0.00 ? 11 LEU B HD12 8  
ATOM 8531  H HD13 . LEU B 1 11 ? 5.934   -4.614  4.904   1.00 0.00 ? 11 LEU B HD13 8  
ATOM 8532  H HD21 . LEU B 1 11 ? 6.390   -0.876  2.838   1.00 0.00 ? 11 LEU B HD21 8  
ATOM 8533  H HD22 . LEU B 1 11 ? 7.303   -2.324  2.330   1.00 0.00 ? 11 LEU B HD22 8  
ATOM 8534  H HD23 . LEU B 1 11 ? 5.570   -2.193  1.976   1.00 0.00 ? 11 LEU B HD23 8  
ATOM 8535  N N    . LYS B 1 12 ? 3.063   0.099   6.513   1.00 0.00 ? 12 LYS B N    8  
ATOM 8536  C CA   . LYS B 1 12 ? 1.816   0.516   7.131   1.00 0.00 ? 12 LYS B CA   8  
ATOM 8537  C C    . LYS B 1 12 ? 1.534   1.975   6.765   1.00 0.00 ? 12 LYS B C    8  
ATOM 8538  O O    . LYS B 1 12 ? 0.360   2.313   6.553   1.00 0.00 ? 12 LYS B O    8  
ATOM 8539  C CB   . LYS B 1 12 ? 1.851   0.256   8.638   1.00 0.00 ? 12 LYS B CB   8  
ATOM 8540  C CG   . LYS B 1 12 ? 1.340   -1.148  8.964   1.00 0.00 ? 12 LYS B CG   8  
ATOM 8541  C CD   . LYS B 1 12 ? -0.006  -1.087  9.688   1.00 0.00 ? 12 LYS B CD   8  
ATOM 8542  C CE   . LYS B 1 12 ? -0.088  -2.150  10.786  1.00 0.00 ? 12 LYS B CE   8  
ATOM 8543  N NZ   . LYS B 1 12 ? 0.873   -1.856  11.862  1.00 0.00 ? 12 LYS B NZ   8  
ATOM 8544  H H    . LYS B 1 12 ? 3.895   0.048   7.100   1.00 0.00 ? 12 LYS B H    8  
ATOM 8545  H HA   . LYS B 1 12 ? 1.034   -0.114  6.707   1.00 0.00 ? 12 LYS B HA   8  
ATOM 8546  H HB2  . LYS B 1 12 ? 2.880   0.349   8.989   1.00 0.00 ? 12 LYS B HB2  8  
ATOM 8547  H HB3  . LYS B 1 12 ? 1.236   1.002   9.140   1.00 0.00 ? 12 LYS B HB3  8  
ATOM 8548  H HG2  . LYS B 1 12 ? 1.217   -1.705  8.035   1.00 0.00 ? 12 LYS B HG2  8  
ATOM 8549  H HG3  . LYS B 1 12 ? 2.074   -1.656  9.588   1.00 0.00 ? 12 LYS B HG3  8  
ATOM 8550  H HD2  . LYS B 1 12 ? -0.121  -0.101  10.140  1.00 0.00 ? 12 LYS B HD2  8  
ATOM 8551  H HD3  . LYS B 1 12 ? -0.806  -1.239  8.963   1.00 0.00 ? 12 LYS B HD3  8  
ATOM 8552  H HE2  . LYS B 1 12 ? -1.096  -2.160  11.202  1.00 0.00 ? 12 LYS B HE2  8  
ATOM 8553  H HE3  . LYS B 1 12 ? 0.126   -3.127  10.353  1.00 0.00 ? 12 LYS B HE3  8  
ATOM 8554  H HZ1  . LYS B 1 12 ? 0.672   -0.941  12.266  1.00 0.00 ? 12 LYS B HZ1  8  
ATOM 8555  H HZ2  . LYS B 1 12 ? 0.799   -2.577  12.579  1.00 0.00 ? 12 LYS B HZ2  8  
ATOM 8556  H HZ3  . LYS B 1 12 ? 1.822   -1.852  11.490  1.00 0.00 ? 12 LYS B HZ3  8  
ATOM 8557  N N    . LEU B 1 13 ? 2.597   2.796   6.699   1.00 0.00 ? 13 LEU B N    8  
ATOM 8558  C CA   . LEU B 1 13 ? 2.464   4.203   6.363   1.00 0.00 ? 13 LEU B CA   8  
ATOM 8559  C C    . LEU B 1 13 ? 2.083   4.336   4.887   1.00 0.00 ? 13 LEU B C    8  
ATOM 8560  O O    . LEU B 1 13 ? 1.198   5.148   4.577   1.00 0.00 ? 13 LEU B O    8  
ATOM 8561  C CB   . LEU B 1 13 ? 3.735   4.967   6.740   1.00 0.00 ? 13 LEU B CB   8  
ATOM 8562  C CG   . LEU B 1 13 ? 3.619   6.493   6.760   1.00 0.00 ? 13 LEU B CG   8  
ATOM 8563  C CD1  . LEU B 1 13 ? 4.182   7.101   5.473   1.00 0.00 ? 13 LEU B CD1  8  
ATOM 8564  C CD2  . LEU B 1 13 ? 2.177   6.930   7.016   1.00 0.00 ? 13 LEU B CD2  8  
ATOM 8565  H H    . LEU B 1 13 ? 3.532   2.436   6.889   1.00 0.00 ? 13 LEU B H    8  
ATOM 8566  H HA   . LEU B 1 13 ? 1.651   4.592   6.975   1.00 0.00 ? 13 LEU B HA   8  
ATOM 8567  H HB2  . LEU B 1 13 ? 4.018   4.620   7.734   1.00 0.00 ? 13 LEU B HB2  8  
ATOM 8568  H HB3  . LEU B 1 13 ? 4.499   4.661   6.026   1.00 0.00 ? 13 LEU B HB3  8  
ATOM 8569  H HG   . LEU B 1 13 ? 4.242   6.814   7.595   1.00 0.00 ? 13 LEU B HG   8  
ATOM 8570  H HD11 . LEU B 1 13 ? 3.638   6.716   4.611   1.00 0.00 ? 13 LEU B HD11 8  
ATOM 8571  H HD12 . LEU B 1 13 ? 4.085   8.185   5.522   1.00 0.00 ? 13 LEU B HD12 8  
ATOM 8572  H HD13 . LEU B 1 13 ? 5.237   6.844   5.371   1.00 0.00 ? 13 LEU B HD13 8  
ATOM 8573  H HD21 . LEU B 1 13 ? 1.834   6.538   7.975   1.00 0.00 ? 13 LEU B HD21 8  
ATOM 8574  H HD22 . LEU B 1 13 ? 2.132   8.019   7.024   1.00 0.00 ? 13 LEU B HD22 8  
ATOM 8575  H HD23 . LEU B 1 13 ? 1.528   6.554   6.226   1.00 0.00 ? 13 LEU B HD23 8  
ATOM 8576  N N    . ASP B 1 14 ? 2.745   3.549   4.020   1.00 0.00 ? 14 ASP B N    8  
ATOM 8577  C CA   . ASP B 1 14 ? 2.477   3.579   2.593   1.00 0.00 ? 14 ASP B CA   8  
ATOM 8578  C C    . ASP B 1 14 ? 1.037   3.126   2.338   1.00 0.00 ? 14 ASP B C    8  
ATOM 8579  O O    . ASP B 1 14 ? 0.410   3.652   1.408   1.00 0.00 ? 14 ASP B O    8  
ATOM 8580  C CB   . ASP B 1 14 ? 3.411   2.631   1.837   1.00 0.00 ? 14 ASP B CB   8  
ATOM 8581  C CG   . ASP B 1 14 ? 3.898   3.147   0.481   1.00 0.00 ? 14 ASP B CG   8  
ATOM 8582  O OD1  . ASP B 1 14 ? 4.862   3.921   0.402   1.00 0.00 ? 14 ASP B OD1  8  
ATOM 8583  O OD2  . ASP B 1 14 ? 3.232   2.716   -0.537  1.00 0.00 ? 14 ASP B OD2  8  
ATOM 8584  H H    . ASP B 1 14 ? 3.461   2.906   4.360   1.00 0.00 ? 14 ASP B H    8  
ATOM 8585  H HA   . ASP B 1 14 ? 2.597   4.600   2.231   1.00 0.00 ? 14 ASP B HA   8  
ATOM 8586  H HB2  . ASP B 1 14 ? 4.272   2.455   2.480   1.00 0.00 ? 14 ASP B HB2  8  
ATOM 8587  H HB3  . ASP B 1 14 ? 2.869   1.694   1.706   1.00 0.00 ? 14 ASP B HB3  8  
ATOM 8588  N N    . ASN B 1 15 ? 0.551   2.177   3.158   1.00 0.00 ? 15 ASN B N    8  
ATOM 8589  C CA   . ASN B 1 15 ? -0.801  1.662   3.023   1.00 0.00 ? 15 ASN B CA   8  
ATOM 8590  C C    . ASN B 1 15 ? -1.799  2.808   3.203   1.00 0.00 ? 15 ASN B C    8  
ATOM 8591  O O    . ASN B 1 15 ? -2.695  2.948   2.357   1.00 0.00 ? 15 ASN B O    8  
ATOM 8592  C CB   . ASN B 1 15 ? -1.097  0.605   4.089   1.00 0.00 ? 15 ASN B CB   8  
ATOM 8593  C CG   . ASN B 1 15 ? -2.030  -0.477  3.544   1.00 0.00 ? 15 ASN B CG   8  
ATOM 8594  O OD1  . ASN B 1 15 ? -3.244  -0.383  3.617   1.00 0.00 ? 15 ASN B OD1  8  
ATOM 8595  N ND2  . ASN B 1 15 ? -1.397  -1.510  2.993   1.00 0.00 ? 15 ASN B ND2  8  
ATOM 8596  H H    . ASN B 1 15 ? 1.136   1.797   3.902   1.00 0.00 ? 15 ASN B H    8  
ATOM 8597  H HA   . ASN B 1 15 ? -0.922  1.240   2.025   1.00 0.00 ? 15 ASN B HA   8  
ATOM 8598  H HB2  . ASN B 1 15 ? -0.159  0.143   4.399   1.00 0.00 ? 15 ASN B HB2  8  
ATOM 8599  H HB3  . ASN B 1 15 ? -1.554  1.091   4.950   1.00 0.00 ? 15 ASN B HB3  8  
ATOM 8600  H HD21 . ASN B 1 15 ? -0.377  -1.526  2.964   1.00 0.00 ? 15 ASN B HD21 8  
ATOM 8601  H HD22 . ASN B 1 15 ? -1.930  -2.284  2.600   1.00 0.00 ? 15 ASN B HD22 8  
ATOM 8602  N N    . TYR B 1 16 ? -1.628  3.592   4.283   1.00 0.00 ? 16 TYR B N    8  
ATOM 8603  C CA   . TYR B 1 16 ? -2.544  4.694   4.514   1.00 0.00 ? 16 TYR B CA   8  
ATOM 8604  C C    . TYR B 1 16 ? -2.554  5.609   3.287   1.00 0.00 ? 16 TYR B C    8  
ATOM 8605  O O    . TYR B 1 16 ? -3.648  6.035   2.887   1.00 0.00 ? 16 TYR B O    8  
ATOM 8606  C CB   . TYR B 1 16 ? -2.148  5.454   5.792   1.00 0.00 ? 16 TYR B CB   8  
ATOM 8607  C CG   . TYR B 1 16 ? -1.701  4.564   6.943   1.00 0.00 ? 16 TYR B CG   8  
ATOM 8608  C CD1  . TYR B 1 16 ? -2.389  3.357   7.212   1.00 0.00 ? 16 TYR B CD1  8  
ATOM 8609  C CD2  . TYR B 1 16 ? -0.597  4.931   7.745   1.00 0.00 ? 16 TYR B CD2  8  
ATOM 8610  C CE1  . TYR B 1 16 ? -1.977  2.526   8.275   1.00 0.00 ? 16 TYR B CE1  8  
ATOM 8611  C CE2  . TYR B 1 16 ? -0.184  4.100   8.809   1.00 0.00 ? 16 TYR B CE2  8  
ATOM 8612  C CZ   . TYR B 1 16 ? -0.874  2.897   9.075   1.00 0.00 ? 16 TYR B CZ   8  
ATOM 8613  O OH   . TYR B 1 16 ? -0.479  2.091   10.105  1.00 0.00 ? 16 TYR B OH   8  
ATOM 8614  H H    . TYR B 1 16 ? -0.874  3.422   4.934   1.00 0.00 ? 16 TYR B H    8  
ATOM 8615  H HA   . TYR B 1 16 ? -3.548  4.282   4.638   1.00 0.00 ? 16 TYR B HA   8  
ATOM 8616  H HB2  . TYR B 1 16 ? -1.355  6.166   5.554   1.00 0.00 ? 16 TYR B HB2  8  
ATOM 8617  H HB3  . TYR B 1 16 ? -3.005  6.037   6.137   1.00 0.00 ? 16 TYR B HB3  8  
ATOM 8618  H HD1  . TYR B 1 16 ? -3.232  3.066   6.602   1.00 0.00 ? 16 TYR B HD1  8  
ATOM 8619  H HD2  . TYR B 1 16 ? -0.061  5.849   7.548   1.00 0.00 ? 16 TYR B HD2  8  
ATOM 8620  H HE1  . TYR B 1 16 ? -2.509  1.607   8.473   1.00 0.00 ? 16 TYR B HE1  8  
ATOM 8621  H HE2  . TYR B 1 16 ? 0.661   4.389   9.418   1.00 0.00 ? 16 TYR B HE2  8  
ATOM 8622  H HH   . TYR B 1 16 ? 0.010   2.554   10.789  1.00 0.00 ? 16 TYR B HH   8  
ATOM 8623  N N    . HIS B 1 17 ? -1.364  5.896   2.731   1.00 0.00 ? 17 HIS B N    8  
ATOM 8624  C CA   . HIS B 1 17 ? -1.245  6.762   1.569   1.00 0.00 ? 17 HIS B CA   8  
ATOM 8625  C C    . HIS B 1 17 ? -1.903  6.084   0.366   1.00 0.00 ? 17 HIS B C    8  
ATOM 8626  O O    . HIS B 1 17 ? -2.601  6.776   -0.392  1.00 0.00 ? 17 HIS B O    8  
ATOM 8627  C CB   . HIS B 1 17 ? 0.215   7.138   1.313   1.00 0.00 ? 17 HIS B CB   8  
ATOM 8628  C CG   . HIS B 1 17 ? 0.652   6.966   -0.122  1.00 0.00 ? 17 HIS B CG   8  
ATOM 8629  N ND1  . HIS B 1 17 ? 0.584   7.988   -1.054  1.00 0.00 ? 17 HIS B ND1  8  
ATOM 8630  C CD2  . HIS B 1 17 ? 1.161   5.883   -0.775  1.00 0.00 ? 17 HIS B CD2  8  
ATOM 8631  C CE1  . HIS B 1 17 ? 1.035   7.529   -2.211  1.00 0.00 ? 17 HIS B CE1  8  
ATOM 8632  N NE2  . HIS B 1 17 ? 1.392   6.224   -2.037  1.00 0.00 ? 17 HIS B NE2  8  
ATOM 8633  H H    . HIS B 1 17 ? -0.509  5.503   3.124   1.00 0.00 ? 17 HIS B H    8  
ATOM 8634  H HA   . HIS B 1 17 ? -1.793  7.674   1.806   1.00 0.00 ? 17 HIS B HA   8  
ATOM 8635  H HB2  . HIS B 1 17 ? 0.337   8.183   1.599   1.00 0.00 ? 17 HIS B HB2  8  
ATOM 8636  H HB3  . HIS B 1 17 ? 0.830   6.517   1.966   1.00 0.00 ? 17 HIS B HB3  8  
ATOM 8637  H HD1  . HIS B 1 17 ? 0.265   8.954   -0.977  1.00 0.00 ? 17 HIS B HD1  8  
ATOM 8638  H HD2  . HIS B 1 17 ? 1.382   4.881   -0.437  1.00 0.00 ? 17 HIS B HD2  8  
ATOM 8639  H HE1  . HIS B 1 17 ? 1.064   8.177   -3.075  1.00 0.00 ? 17 HIS B HE1  8  
ATOM 8640  N N    . LEU B 1 18 ? -1.671  4.769   0.213   1.00 0.00 ? 18 LEU B N    8  
ATOM 8641  C CA   . LEU B 1 18 ? -2.238  4.009   -0.889  1.00 0.00 ? 18 LEU B CA   8  
ATOM 8642  C C    . LEU B 1 18 ? -3.759  3.956   -0.738  1.00 0.00 ? 18 LEU B C    8  
ATOM 8643  O O    . LEU B 1 18 ? -4.456  4.024   -1.761  1.00 0.00 ? 18 LEU B O    8  
ATOM 8644  C CB   . LEU B 1 18 ? -1.580  2.630   -0.981  1.00 0.00 ? 18 LEU B CB   8  
ATOM 8645  C CG   . LEU B 1 18 ? -0.124  2.610   -1.450  1.00 0.00 ? 18 LEU B CG   8  
ATOM 8646  C CD1  . LEU B 1 18 ? 0.457   1.198   -1.375  1.00 0.00 ? 18 LEU B CD1  8  
ATOM 8647  C CD2  . LEU B 1 18 ? 0.009   3.212   -2.851  1.00 0.00 ? 18 LEU B CD2  8  
ATOM 8648  H H    . LEU B 1 18 ? -1.083  4.274   0.883   1.00 0.00 ? 18 LEU B H    8  
ATOM 8649  H HA   . LEU B 1 18 ? -1.989  4.554   -1.799  1.00 0.00 ? 18 LEU B HA   8  
ATOM 8650  H HB2  . LEU B 1 18 ? -1.639  2.193   0.016   1.00 0.00 ? 18 LEU B HB2  8  
ATOM 8651  H HB3  . LEU B 1 18 ? -2.198  2.043   -1.662  1.00 0.00 ? 18 LEU B HB3  8  
ATOM 8652  H HG   . LEU B 1 18 ? 0.411   3.242   -0.740  1.00 0.00 ? 18 LEU B HG   8  
ATOM 8653  H HD11 . LEU B 1 18 ? -0.124  0.523   -2.003  1.00 0.00 ? 18 LEU B HD11 8  
ATOM 8654  H HD12 . LEU B 1 18 ? 1.492   1.221   -1.715  1.00 0.00 ? 18 LEU B HD12 8  
ATOM 8655  H HD13 . LEU B 1 18 ? 0.430   0.838   -0.347  1.00 0.00 ? 18 LEU B HD13 8  
ATOM 8656  H HD21 . LEU B 1 18 ? -0.348  4.242   -2.848  1.00 0.00 ? 18 LEU B HD21 8  
ATOM 8657  H HD22 . LEU B 1 18 ? 1.057   3.182   -3.151  1.00 0.00 ? 18 LEU B HD22 8  
ATOM 8658  H HD23 . LEU B 1 18 ? -0.581  2.634   -3.561  1.00 0.00 ? 18 LEU B HD23 8  
ATOM 8659  N N    . GLU B 1 19 ? -4.236  3.839   0.514   1.00 0.00 ? 19 GLU B N    8  
ATOM 8660  C CA   . GLU B 1 19 ? -5.661  3.778   0.793   1.00 0.00 ? 19 GLU B CA   8  
ATOM 8661  C C    . GLU B 1 19 ? -6.296  5.134   0.477   1.00 0.00 ? 19 GLU B C    8  
ATOM 8662  O O    . GLU B 1 19 ? -7.279  5.163   -0.277  1.00 0.00 ? 19 GLU B O    8  
ATOM 8663  C CB   . GLU B 1 19 ? -5.934  3.368   2.241   1.00 0.00 ? 19 GLU B CB   8  
ATOM 8664  C CG   . GLU B 1 19 ? -7.235  2.571   2.350   1.00 0.00 ? 19 GLU B CG   8  
ATOM 8665  C CD   . GLU B 1 19 ? -7.107  1.450   3.383   1.00 0.00 ? 19 GLU B CD   8  
ATOM 8666  O OE1  . GLU B 1 19 ? -6.748  1.712   4.541   1.00 0.00 ? 19 GLU B OE1  8  
ATOM 8667  O OE2  . GLU B 1 19 ? -7.395  0.271   2.948   1.00 0.00 ? 19 GLU B OE2  8  
ATOM 8668  H H    . GLU B 1 19 ? -3.591  3.789   1.303   1.00 0.00 ? 19 GLU B H    8  
ATOM 8669  H HA   . GLU B 1 19 ? -6.083  3.026   0.127   1.00 0.00 ? 19 GLU B HA   8  
ATOM 8670  H HB2  . GLU B 1 19 ? -5.108  2.750   2.596   1.00 0.00 ? 19 GLU B HB2  8  
ATOM 8671  H HB3  . GLU B 1 19 ? -5.995  4.266   2.857   1.00 0.00 ? 19 GLU B HB3  8  
ATOM 8672  H HG2  . GLU B 1 19 ? -8.037  3.243   2.653   1.00 0.00 ? 19 GLU B HG2  8  
ATOM 8673  H HG3  . GLU B 1 19 ? -7.474  2.150   1.373   1.00 0.00 ? 19 GLU B HG3  8  
ATOM 8674  N N    . ASN B 1 20 ? -5.732  6.211   1.051   1.00 0.00 ? 20 ASN B N    8  
ATOM 8675  C CA   . ASN B 1 20 ? -6.239  7.555   0.833   1.00 0.00 ? 20 ASN B CA   8  
ATOM 8676  C C    . ASN B 1 20 ? -6.148  7.894   -0.656  1.00 0.00 ? 20 ASN B C    8  
ATOM 8677  O O    . ASN B 1 20 ? -7.015  8.632   -1.147  1.00 0.00 ? 20 ASN B O    8  
ATOM 8678  C CB   . ASN B 1 20 ? -5.415  8.587   1.604   1.00 0.00 ? 20 ASN B CB   8  
ATOM 8679  C CG   . ASN B 1 20 ? -5.200  8.146   3.054   1.00 0.00 ? 20 ASN B CG   8  
ATOM 8680  O OD1  . ASN B 1 20 ? -5.968  7.383   3.618   1.00 0.00 ? 20 ASN B OD1  8  
ATOM 8681  N ND2  . ASN B 1 20 ? -4.118  8.666   3.623   1.00 0.00 ? 20 ASN B ND2  8  
ATOM 8682  H H    . ASN B 1 20 ? -4.922  6.098   1.662   1.00 0.00 ? 20 ASN B H    8  
ATOM 8683  H HA   . ASN B 1 20 ? -7.284  7.595   1.143   1.00 0.00 ? 20 ASN B HA   8  
ATOM 8684  H HB2  . ASN B 1 20 ? -4.444  8.699   1.121   1.00 0.00 ? 20 ASN B HB2  8  
ATOM 8685  H HB3  . ASN B 1 20 ? -5.935  9.544   1.581   1.00 0.00 ? 20 ASN B HB3  8  
ATOM 8686  H HD21 . ASN B 1 20 ? -3.517  9.299   3.094   1.00 0.00 ? 20 ASN B HD21 8  
ATOM 8687  H HD22 . ASN B 1 20 ? -3.887  8.433   4.589   1.00 0.00 ? 20 ASN B HD22 8  
ATOM 8688  N N    . GLU B 1 21 ? -5.118  7.357   -1.334  1.00 0.00 ? 21 GLU B N    8  
ATOM 8689  C CA   . GLU B 1 21 ? -4.918  7.602   -2.753  1.00 0.00 ? 21 GLU B CA   8  
ATOM 8690  C C    . GLU B 1 21 ? -5.894  6.739   -3.556  1.00 0.00 ? 21 GLU B C    8  
ATOM 8691  O O    . GLU B 1 21 ? -6.314  7.176   -4.638  1.00 0.00 ? 21 GLU B O    8  
ATOM 8692  C CB   . GLU B 1 21 ? -3.473  7.329   -3.172  1.00 0.00 ? 21 GLU B CB   8  
ATOM 8693  C CG   . GLU B 1 21 ? -3.179  7.924   -4.550  1.00 0.00 ? 21 GLU B CG   8  
ATOM 8694  C CD   . GLU B 1 21 ? -1.854  7.400   -5.104  1.00 0.00 ? 21 GLU B CD   8  
ATOM 8695  O OE1  . GLU B 1 21 ? -1.320  6.442   -4.424  1.00 0.00 ? 21 GLU B OE1  8  
ATOM 8696  O OE2  . GLU B 1 21 ? -1.371  7.896   -6.133  1.00 0.00 ? 21 GLU B OE2  8  
ATOM 8697  H H    . GLU B 1 21 ? -4.447  6.758   -0.852  1.00 0.00 ? 21 GLU B H    8  
ATOM 8698  H HA   . GLU B 1 21 ? -5.146  8.653   -2.928  1.00 0.00 ? 21 GLU B HA   8  
ATOM 8699  H HB2  . GLU B 1 21 ? -2.802  7.780   -2.440  1.00 0.00 ? 21 GLU B HB2  8  
ATOM 8700  H HB3  . GLU B 1 21 ? -3.307  6.251   -3.190  1.00 0.00 ? 21 GLU B HB3  8  
ATOM 8701  H HG2  . GLU B 1 21 ? -3.984  7.649   -5.233  1.00 0.00 ? 21 GLU B HG2  8  
ATOM 8702  H HG3  . GLU B 1 21 ? -3.143  9.011   -4.465  1.00 0.00 ? 21 GLU B HG3  8  
ATOM 8703  N N    . VAL B 1 22 ? -6.231  5.552   -3.021  1.00 0.00 ? 22 VAL B N    8  
ATOM 8704  C CA   . VAL B 1 22 ? -7.147  4.641   -3.683  1.00 0.00 ? 22 VAL B CA   8  
ATOM 8705  C C    . VAL B 1 22 ? -8.584  5.111   -3.451  1.00 0.00 ? 22 VAL B C    8  
ATOM 8706  O O    . VAL B 1 22 ? -9.401  4.989   -4.376  1.00 0.00 ? 22 VAL B O    8  
ATOM 8707  C CB   . VAL B 1 22 ? -6.902  3.209   -3.201  1.00 0.00 ? 22 VAL B CB   8  
ATOM 8708  C CG1  . VAL B 1 22 ? -8.195  2.393   -3.227  1.00 0.00 ? 22 VAL B CG1  8  
ATOM 8709  C CG2  . VAL B 1 22 ? -5.810  2.531   -4.031  1.00 0.00 ? 22 VAL B CG2  8  
ATOM 8710  H H    . VAL B 1 22 ? -5.838  5.268   -2.123  1.00 0.00 ? 22 VAL B H    8  
ATOM 8711  H HA   . VAL B 1 22 ? -6.930  4.677   -4.751  1.00 0.00 ? 22 VAL B HA   8  
ATOM 8712  H HB   . VAL B 1 22 ? -6.559  3.299   -2.172  1.00 0.00 ? 22 VAL B HB   8  
ATOM 8713  H HG11 . VAL B 1 22 ? -8.595  2.360   -4.241  1.00 0.00 ? 22 VAL B HG11 8  
ATOM 8714  H HG12 . VAL B 1 22 ? -7.984  1.382   -2.879  1.00 0.00 ? 22 VAL B HG12 8  
ATOM 8715  H HG13 . VAL B 1 22 ? -8.935  2.847   -2.568  1.00 0.00 ? 22 VAL B HG13 8  
ATOM 8716  H HG21 . VAL B 1 22 ? -4.879  3.095   -3.953  1.00 0.00 ? 22 VAL B HG21 8  
ATOM 8717  H HG22 . VAL B 1 22 ? -5.661  1.517   -3.662  1.00 0.00 ? 22 VAL B HG22 8  
ATOM 8718  H HG23 . VAL B 1 22 ? -6.111  2.487   -5.077  1.00 0.00 ? 22 VAL B HG23 8  
ATOM 8719  N N    . ALA B 1 23 ? -8.860  5.631   -2.241  1.00 0.00 ? 23 ALA B N    8  
ATOM 8720  C CA   . ALA B 1 23 ? -10.185 6.114   -1.894  1.00 0.00 ? 23 ALA B CA   8  
ATOM 8721  C C    . ALA B 1 23 ? -10.479 7.394   -2.679  1.00 0.00 ? 23 ALA B C    8  
ATOM 8722  O O    . ALA B 1 23 ? -11.661 7.734   -2.834  1.00 0.00 ? 23 ALA B O    8  
ATOM 8723  C CB   . ALA B 1 23 ? -10.221 6.500   -0.415  1.00 0.00 ? 23 ALA B CB   8  
ATOM 8724  H H    . ALA B 1 23 ? -8.127  5.695   -1.535  1.00 0.00 ? 23 ALA B H    8  
ATOM 8725  H HA   . ALA B 1 23 ? -10.948 5.372   -2.128  1.00 0.00 ? 23 ALA B HA   8  
ATOM 8726  H HB1  . ALA B 1 23 ? -9.972  5.626   0.186   1.00 0.00 ? 23 ALA B HB1  8  
ATOM 8727  H HB2  . ALA B 1 23 ? -9.492  7.286   -0.218  1.00 0.00 ? 23 ALA B HB2  8  
ATOM 8728  H HB3  . ALA B 1 23 ? -11.214 6.863   -0.150  1.00 0.00 ? 23 ALA B HB3  8  
ATOM 8729  N N    . ARG B 1 24 ? -9.414  8.067   -3.153  1.00 0.00 ? 24 ARG B N    8  
ATOM 8730  C CA   . ARG B 1 24 ? -9.556  9.297   -3.913  1.00 0.00 ? 24 ARG B CA   8  
ATOM 8731  C C    . ARG B 1 24 ? -9.659  8.962   -5.402  1.00 0.00 ? 24 ARG B C    8  
ATOM 8732  O O    . ARG B 1 24 ? -10.324 9.712   -6.132  1.00 0.00 ? 24 ARG B O    8  
ATOM 8733  C CB   . ARG B 1 24 ? -8.372  10.239  -3.689  1.00 0.00 ? 24 ARG B CB   8  
ATOM 8734  C CG   . ARG B 1 24 ? -8.639  11.188  -2.519  1.00 0.00 ? 24 ARG B CG   8  
ATOM 8735  C CD   . ARG B 1 24 ? -7.373  11.957  -2.137  1.00 0.00 ? 24 ARG B CD   8  
ATOM 8736  N NE   . ARG B 1 24 ? -7.729  13.163  -1.357  1.00 0.00 ? 24 ARG B NE   8  
ATOM 8737  C CZ   . ARG B 1 24 ? -7.766  13.209  -0.008  1.00 0.00 ? 24 ARG B CZ   8  
ATOM 8738  N NH1  . ARG B 1 24 ? -7.464  12.104  0.687   1.00 0.00 ? 24 ARG B NH1  8  
ATOM 8739  N NH2  . ARG B 1 24 ? -8.098  14.341  0.625   1.00 0.00 ? 24 ARG B NH2  8  
ATOM 8740  H H    . ARG B 1 24 ? -8.472  7.717   -2.980  1.00 0.00 ? 24 ARG B H    8  
ATOM 8741  H HA   . ARG B 1 24 ? -10.480 9.782   -3.595  1.00 0.00 ? 24 ARG B HA   8  
ATOM 8742  H HB2  . ARG B 1 24 ? -7.485  9.646   -3.470  1.00 0.00 ? 24 ARG B HB2  8  
ATOM 8743  H HB3  . ARG B 1 24 ? -8.199  10.812  -4.600  1.00 0.00 ? 24 ARG B HB3  8  
ATOM 8744  H HG2  . ARG B 1 24 ? -9.412  11.900  -2.810  1.00 0.00 ? 24 ARG B HG2  8  
ATOM 8745  H HG3  . ARG B 1 24 ? -8.993  10.608  -1.667  1.00 0.00 ? 24 ARG B HG3  8  
ATOM 8746  H HD2  . ARG B 1 24 ? -6.730  11.319  -1.530  1.00 0.00 ? 24 ARG B HD2  8  
ATOM 8747  H HD3  . ARG B 1 24 ? -6.836  12.245  -3.041  1.00 0.00 ? 24 ARG B HD3  8  
ATOM 8748  H HE   . ARG B 1 24 ? -7.956  13.995  -1.901  1.00 0.00 ? 24 ARG B HE   8  
ATOM 8749  H HH11 . ARG B 1 24 ? -7.211  11.246  0.198   1.00 0.00 ? 24 ARG B HH11 8  
ATOM 8750  H HH12 . ARG B 1 24 ? -7.487  12.121  1.707   1.00 0.00 ? 24 ARG B HH12 8  
ATOM 8751  H HH21 . ARG B 1 24 ? -8.327  15.178  0.089   1.00 0.00 ? 24 ARG B HH21 8  
ATOM 8752  H HH22 . ARG B 1 24 ? -8.124  14.368  1.645   1.00 0.00 ? 24 ARG B HH22 8  
ATOM 8753  N N    . LEU B 1 25 ? -9.009  7.860   -5.818  1.00 0.00 ? 25 LEU B N    8  
ATOM 8754  C CA   . LEU B 1 25 ? -9.027  7.432   -7.206  1.00 0.00 ? 25 LEU B CA   8  
ATOM 8755  C C    . LEU B 1 25 ? -10.313 6.650   -7.477  1.00 0.00 ? 25 LEU B C    8  
ATOM 8756  O O    . LEU B 1 25 ? -10.883 6.811   -8.567  1.00 0.00 ? 25 LEU B O    8  
ATOM 8757  C CB   . LEU B 1 25 ? -7.752  6.657   -7.544  1.00 0.00 ? 25 LEU B CB   8  
ATOM 8758  C CG   . LEU B 1 25 ? -6.482  7.493   -7.710  1.00 0.00 ? 25 LEU B CG   8  
ATOM 8759  C CD1  . LEU B 1 25 ? -5.251  6.598   -7.863  1.00 0.00 ? 25 LEU B CD1  8  
ATOM 8760  C CD2  . LEU B 1 25 ? -6.622  8.478   -8.874  1.00 0.00 ? 25 LEU B CD2  8  
ATOM 8761  H H    . LEU B 1 25 ? -8.483  7.296   -5.150  1.00 0.00 ? 25 LEU B H    8  
ATOM 8762  H HA   . LEU B 1 25 ? -9.030  8.340   -7.809  1.00 0.00 ? 25 LEU B HA   8  
ATOM 8763  H HB2  . LEU B 1 25 ? -7.603  5.942   -6.735  1.00 0.00 ? 25 LEU B HB2  8  
ATOM 8764  H HB3  . LEU B 1 25 ? -7.961  6.112   -8.465  1.00 0.00 ? 25 LEU B HB3  8  
ATOM 8765  H HG   . LEU B 1 25 ? -6.387  8.054   -6.781  1.00 0.00 ? 25 LEU B HG   8  
ATOM 8766  H HD11 . LEU B 1 25 ? -5.367  5.953   -8.734  1.00 0.00 ? 25 LEU B HD11 8  
ATOM 8767  H HD12 . LEU B 1 25 ? -4.367  7.225   -7.979  1.00 0.00 ? 25 LEU B HD12 8  
ATOM 8768  H HD13 . LEU B 1 25 ? -5.131  5.977   -6.976  1.00 0.00 ? 25 LEU B HD13 8  
ATOM 8769  H HD21 . LEU B 1 25 ? -7.465  9.146   -8.696  1.00 0.00 ? 25 LEU B HD21 8  
ATOM 8770  H HD22 . LEU B 1 25 ? -5.702  9.055   -8.963  1.00 0.00 ? 25 LEU B HD22 8  
ATOM 8771  H HD23 . LEU B 1 25 ? -6.791  7.933   -9.802  1.00 0.00 ? 25 LEU B HD23 8  
ATOM 8772  N N    . LYS B 1 26 ? -10.737 5.830   -6.499  1.00 0.00 ? 26 LYS B N    8  
ATOM 8773  C CA   . LYS B 1 26 ? -11.944 5.032   -6.632  1.00 0.00 ? 26 LYS B CA   8  
ATOM 8774  C C    . LYS B 1 26 ? -13.139 5.958   -6.865  1.00 0.00 ? 26 LYS B C    8  
ATOM 8775  O O    . LYS B 1 26 ? -14.155 5.487   -7.400  1.00 0.00 ? 26 LYS B O    8  
ATOM 8776  C CB   . LYS B 1 26 ? -12.110 4.106   -5.425  1.00 0.00 ? 26 LYS B CB   8  
ATOM 8777  C CG   . LYS B 1 26 ? -11.154 2.915   -5.513  1.00 0.00 ? 26 LYS B CG   8  
ATOM 8778  C CD   . LYS B 1 26 ? -11.850 1.696   -6.124  1.00 0.00 ? 26 LYS B CD   8  
ATOM 8779  C CE   . LYS B 1 26 ? -11.377 1.459   -7.560  1.00 0.00 ? 26 LYS B CE   8  
ATOM 8780  N NZ   . LYS B 1 26 ? -11.407 0.023   -7.882  1.00 0.00 ? 26 LYS B NZ   8  
ATOM 8781  H H    . LYS B 1 26 ? -10.208 5.756   -5.631  1.00 0.00 ? 26 LYS B H    8  
ATOM 8782  H HA   . LYS B 1 26 ? -11.804 4.404   -7.512  1.00 0.00 ? 26 LYS B HA   8  
ATOM 8783  H HB2  . LYS B 1 26 ? -11.895 4.668   -4.516  1.00 0.00 ? 26 LYS B HB2  8  
ATOM 8784  H HB3  . LYS B 1 26 ? -13.140 3.753   -5.389  1.00 0.00 ? 26 LYS B HB3  8  
ATOM 8785  H HG2  . LYS B 1 26 ? -10.303 3.188   -6.138  1.00 0.00 ? 26 LYS B HG2  8  
ATOM 8786  H HG3  . LYS B 1 26 ? -10.796 2.674   -4.512  1.00 0.00 ? 26 LYS B HG3  8  
ATOM 8787  H HD2  . LYS B 1 26 ? -11.617 0.818   -5.524  1.00 0.00 ? 26 LYS B HD2  8  
ATOM 8788  H HD3  . LYS B 1 26 ? -12.927 1.861   -6.110  1.00 0.00 ? 26 LYS B HD3  8  
ATOM 8789  H HE2  . LYS B 1 26 ? -12.035 1.990   -8.247  1.00 0.00 ? 26 LYS B HE2  8  
ATOM 8790  H HE3  . LYS B 1 26 ? -10.363 1.843   -7.671  1.00 0.00 ? 26 LYS B HE3  8  
ATOM 8791  H HZ1  . LYS B 1 26 ? -12.356 -0.337  -7.777  1.00 0.00 ? 26 LYS B HZ1  8  
ATOM 8792  H HZ2  . LYS B 1 26 ? -11.088 -0.109  -8.841  1.00 0.00 ? 26 LYS B HZ2  8  
ATOM 8793  H HZ3  . LYS B 1 26 ? -10.787 -0.488  -7.253  1.00 0.00 ? 26 LYS B HZ3  8  
ATOM 8794  N N    . LYS B 1 27 ? -13.000 7.234   -6.466  1.00 0.00 ? 27 LYS B N    8  
ATOM 8795  C CA   . LYS B 1 27 ? -14.061 8.213   -6.631  1.00 0.00 ? 27 LYS B CA   8  
ATOM 8796  C C    . LYS B 1 27 ? -14.085 8.694   -8.083  1.00 0.00 ? 27 LYS B C    8  
ATOM 8797  O O    . LYS B 1 27 ? -15.036 9.395   -8.456  1.00 0.00 ? 27 LYS B O    8  
ATOM 8798  C CB   . LYS B 1 27 ? -13.910 9.343   -5.611  1.00 0.00 ? 27 LYS B CB   8  
ATOM 8799  C CG   . LYS B 1 27 ? -15.263 9.715   -5.000  1.00 0.00 ? 27 LYS B CG   8  
ATOM 8800  C CD   . LYS B 1 27 ? -15.101 10.187  -3.554  1.00 0.00 ? 27 LYS B CD   8  
ATOM 8801  C CE   . LYS B 1 27 ? -14.441 9.105   -2.695  1.00 0.00 ? 27 LYS B CE   8  
ATOM 8802  N NZ   . LYS B 1 27 ? -14.844 7.766   -3.154  1.00 0.00 ? 27 LYS B NZ   8  
ATOM 8803  H H    . LYS B 1 27 ? -12.129 7.540   -6.033  1.00 0.00 ? 27 LYS B H    8  
ATOM 8804  H HA   . LYS B 1 27 ? -14.995 7.695   -6.413  1.00 0.00 ? 27 LYS B HA   8  
ATOM 8805  H HB2  . LYS B 1 27 ? -13.240 9.016   -4.816  1.00 0.00 ? 27 LYS B HB2  8  
ATOM 8806  H HB3  . LYS B 1 27 ? -13.476 10.211  -6.107  1.00 0.00 ? 27 LYS B HB3  8  
ATOM 8807  H HG2  . LYS B 1 27 ? -15.707 10.519  -5.588  1.00 0.00 ? 27 LYS B HG2  8  
ATOM 8808  H HG3  . LYS B 1 27 ? -15.919 8.846   -5.036  1.00 0.00 ? 27 LYS B HG3  8  
ATOM 8809  H HD2  . LYS B 1 27 ? -14.477 11.080  -3.541  1.00 0.00 ? 27 LYS B HD2  8  
ATOM 8810  H HD3  . LYS B 1 27 ? -16.083 10.433  -3.150  1.00 0.00 ? 27 LYS B HD3  8  
ATOM 8811  H HE2  . LYS B 1 27 ? -13.358 9.196   -2.775  1.00 0.00 ? 27 LYS B HE2  8  
ATOM 8812  H HE3  . LYS B 1 27 ? -14.733 9.246   -1.655  1.00 0.00 ? 27 LYS B HE3  8  
ATOM 8813  H HZ1  . LYS B 1 27 ? -14.571 7.635   -4.128  1.00 0.00 ? 27 LYS B HZ1  8  
ATOM 8814  H HZ2  . LYS B 1 27 ? -14.392 7.064   -2.568  1.00 0.00 ? 27 LYS B HZ2  8  
ATOM 8815  H HZ3  . LYS B 1 27 ? -15.856 7.662   -3.077  1.00 0.00 ? 27 LYS B HZ3  8  
ATOM 8816  N N    . LEU B 1 28 ? -13.054 8.314   -8.860  1.00 0.00 ? 28 LEU B N    8  
ATOM 8817  C CA   . LEU B 1 28 ? -12.958 8.704   -10.257 1.00 0.00 ? 28 LEU B CA   8  
ATOM 8818  C C    . LEU B 1 28 ? -13.133 7.467   -11.140 1.00 0.00 ? 28 LEU B C    8  
ATOM 8819  O O    . LEU B 1 28 ? -13.741 7.591   -12.214 1.00 0.00 ? 28 LEU B O    8  
ATOM 8820  C CB   . LEU B 1 28 ? -11.655 9.464   -10.512 1.00 0.00 ? 28 LEU B CB   8  
ATOM 8821  C CG   . LEU B 1 28 ? -11.781 10.762  -11.312 1.00 0.00 ? 28 LEU B CG   8  
ATOM 8822  C CD1  . LEU B 1 28 ? -11.908 11.969  -10.380 1.00 0.00 ? 28 LEU B CD1  8  
ATOM 8823  C CD2  . LEU B 1 28 ? -10.619 10.916  -12.294 1.00 0.00 ? 28 LEU B CD2  8  
ATOM 8824  H H    . LEU B 1 28 ? -12.310 7.735   -8.473  1.00 0.00 ? 28 LEU B H    8  
ATOM 8825  H HA   . LEU B 1 28 ? -13.783 9.393   -10.443 1.00 0.00 ? 28 LEU B HA   8  
ATOM 8826  H HB2  . LEU B 1 28 ? -11.233 9.690   -9.532  1.00 0.00 ? 28 LEU B HB2  8  
ATOM 8827  H HB3  . LEU B 1 28 ? -10.994 8.770   -11.031 1.00 0.00 ? 28 LEU B HB3  8  
ATOM 8828  H HG   . LEU B 1 28 ? -12.710 10.662  -11.873 1.00 0.00 ? 28 LEU B HG   8  
ATOM 8829  H HD11 . LEU B 1 28 ? -11.032 12.035  -9.734  1.00 0.00 ? 28 LEU B HD11 8  
ATOM 8830  H HD12 . LEU B 1 28 ? -11.996 12.874  -10.981 1.00 0.00 ? 28 LEU B HD12 8  
ATOM 8831  H HD13 . LEU B 1 28 ? -12.798 11.868  -9.759  1.00 0.00 ? 28 LEU B HD13 8  
ATOM 8832  H HD21 . LEU B 1 28 ? -10.603 10.076  -12.986 1.00 0.00 ? 28 LEU B HD21 8  
ATOM 8833  H HD22 . LEU B 1 28 ? -10.740 11.849  -12.844 1.00 0.00 ? 28 LEU B HD22 8  
ATOM 8834  H HD23 . LEU B 1 28 ? -9.674  10.946  -11.750 1.00 0.00 ? 28 LEU B HD23 8  
ATOM 8835  N N    . VAL B 1 29 ? -12.605 6.319   -10.680 1.00 0.00 ? 29 VAL B N    8  
ATOM 8836  C CA   . VAL B 1 29 ? -12.703 5.075   -11.422 1.00 0.00 ? 29 VAL B CA   8  
ATOM 8837  C C    . VAL B 1 29 ? -13.666 4.130   -10.703 1.00 0.00 ? 29 VAL B C    8  
ATOM 8838  O O    . VAL B 1 29 ? -14.665 3.724   -11.317 1.00 0.00 ? 29 VAL B O    8  
ATOM 8839  C CB   . VAL B 1 29 ? -11.311 4.472   -11.619 1.00 0.00 ? 29 VAL B CB   8  
ATOM 8840  C CG1  . VAL B 1 29 ? -11.337 3.360   -12.668 1.00 0.00 ? 29 VAL B CG1  8  
ATOM 8841  C CG2  . VAL B 1 29 ? -10.292 5.553   -11.991 1.00 0.00 ? 29 VAL B CG2  8  
ATOM 8842  H H    . VAL B 1 29 ? -12.120 6.304   -9.783  1.00 0.00 ? 29 VAL B H    8  
ATOM 8843  H HA   . VAL B 1 29 ? -13.107 5.312   -12.406 1.00 0.00 ? 29 VAL B HA   8  
ATOM 8844  H HB   . VAL B 1 29 ? -11.036 4.044   -10.655 1.00 0.00 ? 29 VAL B HB   8  
ATOM 8845  H HG11 . VAL B 1 29 ? -11.688 3.756   -13.621 1.00 0.00 ? 29 VAL B HG11 8  
ATOM 8846  H HG12 . VAL B 1 29 ? -10.332 2.954   -12.783 1.00 0.00 ? 29 VAL B HG12 8  
ATOM 8847  H HG13 . VAL B 1 29 ? -12.006 2.562   -12.347 1.00 0.00 ? 29 VAL B HG13 8  
ATOM 8848  H HG21 . VAL B 1 29 ? -10.245 6.305   -11.204 1.00 0.00 ? 29 VAL B HG21 8  
ATOM 8849  H HG22 . VAL B 1 29 ? -9.315  5.089   -12.122 1.00 0.00 ? 29 VAL B HG22 8  
ATOM 8850  H HG23 . VAL B 1 29 ? -10.586 6.034   -12.924 1.00 0.00 ? 29 VAL B HG23 8  
ATOM 8851  N N    . GLY B 1 30 ? -13.356 3.802   -9.436  1.00 0.00 ? 30 GLY B N    8  
ATOM 8852  C CA   . GLY B 1 30 ? -14.189 2.914   -8.643  1.00 0.00 ? 30 GLY B CA   8  
ATOM 8853  C C    . GLY B 1 30 ? -15.615 3.466   -8.596  1.00 0.00 ? 30 GLY B C    8  
ATOM 8854  O O    . GLY B 1 30 ? -16.493 2.788   -8.043  1.00 0.00 ? 30 GLY B O    8  
ATOM 8855  H H    . GLY B 1 30 ? -12.514 4.182   -9.003  1.00 0.00 ? 30 GLY B H    8  
ATOM 8856  H HA2  . GLY B 1 30 ? -14.206 1.923   -9.096  1.00 0.00 ? 30 GLY B HA2  8  
ATOM 8857  H HA3  . GLY B 1 30 ? -13.788 2.836   -7.632  1.00 0.00 ? 30 GLY B HA3  8  
ATOM 8858  N N    . GLU B 1 31 ? -15.816 4.666   -9.169  1.00 0.00 ? 31 GLU B N    8  
ATOM 8859  C CA   . GLU B 1 31 ? -17.123 5.299   -9.193  1.00 0.00 ? 31 GLU B CA   8  
ATOM 8860  C C    . GLU B 1 31 ? -18.017 4.578   -10.204 1.00 0.00 ? 31 GLU B C    8  
ATOM 8861  O O    . GLU B 1 31 ? -18.945 5.212   -10.728 1.00 0.00 ? 31 GLU B O    8  
ATOM 8862  C CB   . GLU B 1 31 ? -17.019 6.791   -9.519  1.00 0.00 ? 31 GLU B CB   8  
ATOM 8863  C CG   . GLU B 1 31 ? -16.937 7.018   -11.029 1.00 0.00 ? 31 GLU B CG   8  
ATOM 8864  C CD   . GLU B 1 31 ? -18.229 7.642   -11.562 1.00 0.00 ? 31 GLU B CD   8  
ATOM 8865  O OE1  . GLU B 1 31 ? -18.841 8.477   -10.879 1.00 0.00 ? 31 GLU B OE1  8  
ATOM 8866  O OE2  . GLU B 1 31 ? -18.593 7.229   -12.728 1.00 0.00 ? 31 GLU B OE2  8  
ATOM 8867  H H    . GLU B 1 31 ? -15.037 5.160   -9.604  1.00 0.00 ? 31 GLU B H    8  
ATOM 8868  H HA   . GLU B 1 31 ? -17.551 5.184   -8.196  1.00 0.00 ? 31 GLU B HA   8  
ATOM 8869  H HB2  . GLU B 1 31 ? -17.902 7.300   -9.130  1.00 0.00 ? 31 GLU B HB2  8  
ATOM 8870  H HB3  . GLU B 1 31 ? -16.133 7.198   -9.032  1.00 0.00 ? 31 GLU B HB3  8  
ATOM 8871  H HG2  . GLU B 1 31 ? -16.106 7.690   -11.242 1.00 0.00 ? 31 GLU B HG2  8  
ATOM 8872  H HG3  . GLU B 1 31 ? -16.756 6.063   -11.521 1.00 0.00 ? 31 GLU B HG3  8  
ATOM 8873  N N    . ARG B 1 32 ? -17.724 3.290   -10.455 1.00 0.00 ? 32 ARG B N    8  
ATOM 8874  C CA   . ARG B 1 32 ? -18.494 2.493   -11.395 1.00 0.00 ? 32 ARG B CA   8  
ATOM 8875  C C    . ARG B 1 32 ? -19.393 1.528   -10.621 1.00 0.00 ? 32 ARG B C    8  
ATOM 8876  O O    . ARG B 1 32 ? -18.903 0.698   -9.855  1.00 0.00 ? 32 ARG B O    8  
ATOM 8877  C CB   . ARG B 1 32 ? -17.588 1.695   -12.334 1.00 0.00 ? 32 ARG B CB   8  
ATOM 8878  C CG   . ARG B 1 32 ? -17.469 2.381   -13.695 1.00 0.00 ? 32 ARG B CG   8  
ATOM 8879  C CD   . ARG B 1 32 ? -17.008 3.832   -13.540 1.00 0.00 ? 32 ARG B CD   8  
ATOM 8880  N NE   . ARG B 1 32 ? -17.170 4.555   -14.821 1.00 0.00 ? 32 ARG B NE   8  
ATOM 8881  C CZ   . ARG B 1 32 ? -16.456 4.291   -15.936 1.00 0.00 ? 32 ARG B CZ   8  
ATOM 8882  N NH1  . ARG B 1 32 ? -15.536 3.316   -15.902 1.00 0.00 ? 32 ARG B NH1  8  
ATOM 8883  N NH2  . ARG B 1 32 ? -16.663 4.992   -17.059 1.00 0.00 ? 32 ARG B NH2  8  
ATOM 8884  H H    . ARG B 1 32 ? -16.939 2.843   -9.979  1.00 0.00 ? 32 ARG B H    8  
ATOM 8885  H HA   . ARG B 1 32 ? -19.120 3.174   -11.974 1.00 0.00 ? 32 ARG B HA   8  
ATOM 8886  H HB2  . ARG B 1 32 ? -16.598 1.617   -11.887 1.00 0.00 ? 32 ARG B HB2  8  
ATOM 8887  H HB3  . ARG B 1 32 ? -18.002 0.694   -12.457 1.00 0.00 ? 32 ARG B HB3  8  
ATOM 8888  H HG2  . ARG B 1 32 ? -16.741 1.841   -14.301 1.00 0.00 ? 32 ARG B HG2  8  
ATOM 8889  H HG3  . ARG B 1 32 ? -18.438 2.350   -14.193 1.00 0.00 ? 32 ARG B HG3  8  
ATOM 8890  H HD2  . ARG B 1 32 ? -17.610 4.324   -12.777 1.00 0.00 ? 32 ARG B HD2  8  
ATOM 8891  H HD3  . ARG B 1 32 ? -15.962 3.850   -13.234 1.00 0.00 ? 32 ARG B HD3  8  
ATOM 8892  H HE   . ARG B 1 32 ? -17.874 5.293   -14.830 1.00 0.00 ? 32 ARG B HE   8  
ATOM 8893  H HH11 . ARG B 1 32 ? -15.385 2.788   -15.043 1.00 0.00 ? 32 ARG B HH11 8  
ATOM 8894  H HH12 . ARG B 1 32 ? -14.987 3.105   -16.735 1.00 0.00 ? 32 ARG B HH12 8  
ATOM 8895  H HH21 . ARG B 1 32 ? -17.365 5.732   -17.076 1.00 0.00 ? 32 ARG B HH21 8  
ATOM 8896  H HH22 . ARG B 1 32 ? -16.118 4.785   -17.896 1.00 0.00 ? 32 ARG B HH22 8  
ATOM 8897  N N    . MET A 1 1  ? 8.043   -11.155 17.097  1.00 0.00 ? 1  MET A N    9  
ATOM 8898  C CA   . MET A 1 1  ? 8.763   -11.210 15.836  1.00 0.00 ? 1  MET A CA   9  
ATOM 8899  C C    . MET A 1 1  ? 8.068   -12.199 14.899  1.00 0.00 ? 1  MET A C    9  
ATOM 8900  O O    . MET A 1 1  ? 7.970   -11.905 13.699  1.00 0.00 ? 1  MET A O    9  
ATOM 8901  C CB   . MET A 1 1  ? 10.208  -11.655 16.066  1.00 0.00 ? 1  MET A CB   9  
ATOM 8902  C CG   . MET A 1 1  ? 11.162  -10.941 15.108  1.00 0.00 ? 1  MET A CG   9  
ATOM 8903  S SD   . MET A 1 1  ? 12.602  -11.994 14.765  1.00 0.00 ? 1  MET A SD   9  
ATOM 8904  C CE   . MET A 1 1  ? 11.809  -13.308 13.793  1.00 0.00 ? 1  MET A CE   9  
ATOM 8905  H H    . MET A 1 1  ? 8.584   -11.207 17.959  1.00 0.00 ? 1  MET A H    9  
ATOM 8906  H HA   . MET A 1 1  ? 8.752   -10.220 15.378  1.00 0.00 ? 1  MET A HA   9  
ATOM 8907  H HB2  . MET A 1 1  ? 10.492  -11.418 17.092  1.00 0.00 ? 1  MET A HB2  9  
ATOM 8908  H HB3  . MET A 1 1  ? 10.274  -12.734 15.920  1.00 0.00 ? 1  MET A HB3  9  
ATOM 8909  H HG2  . MET A 1 1  ? 10.645  -10.730 14.172  1.00 0.00 ? 1  MET A HG2  9  
ATOM 8910  H HG3  . MET A 1 1  ? 11.487  -10.000 15.553  1.00 0.00 ? 1  MET A HG3  9  
ATOM 8911  H HE1  . MET A 1 1  ? 11.341  -12.883 12.905  1.00 0.00 ? 1  MET A HE1  9  
ATOM 8912  H HE2  . MET A 1 1  ? 12.563  -14.039 13.503  1.00 0.00 ? 1  MET A HE2  9  
ATOM 8913  H HE3  . MET A 1 1  ? 11.046  -13.803 14.393  1.00 0.00 ? 1  MET A HE3  9  
ATOM 8914  N N    . ASP A 1 2  ? 7.604   -13.333 15.455  1.00 0.00 ? 2  ASP A N    9  
ATOM 8915  C CA   . ASP A 1 2  ? 6.925   -14.352 14.676  1.00 0.00 ? 2  ASP A CA   9  
ATOM 8916  C C    . ASP A 1 2  ? 5.792   -13.707 13.876  1.00 0.00 ? 2  ASP A C    9  
ATOM 8917  O O    . ASP A 1 2  ? 5.551   -14.139 12.739  1.00 0.00 ? 2  ASP A O    9  
ATOM 8918  C CB   . ASP A 1 2  ? 6.314   -15.423 15.581  1.00 0.00 ? 2  ASP A CB   9  
ATOM 8919  C CG   . ASP A 1 2  ? 7.099   -15.712 16.862  1.00 0.00 ? 2  ASP A CG   9  
ATOM 8920  O OD1  . ASP A 1 2  ? 8.068   -16.487 16.856  1.00 0.00 ? 2  ASP A OD1  9  
ATOM 8921  O OD2  . ASP A 1 2  ? 6.675   -15.096 17.912  1.00 0.00 ? 2  ASP A OD2  9  
ATOM 8922  H H    . ASP A 1 2  ? 7.727   -13.496 16.455  1.00 0.00 ? 2  ASP A H    9  
ATOM 8923  H HA   . ASP A 1 2  ? 7.637   -14.801 13.983  1.00 0.00 ? 2  ASP A HA   9  
ATOM 8924  H HB2  . ASP A 1 2  ? 5.314   -15.080 15.848  1.00 0.00 ? 2  ASP A HB2  9  
ATOM 8925  H HB3  . ASP A 1 2  ? 6.229   -16.331 14.984  1.00 0.00 ? 2  ASP A HB3  9  
ATOM 8926  N N    . ALA A 1 3  ? 5.131   -12.699 14.474  1.00 0.00 ? 3  ALA A N    9  
ATOM 8927  C CA   . ALA A 1 3  ? 4.035   -12.002 13.822  1.00 0.00 ? 3  ALA A CA   9  
ATOM 8928  C C    . ALA A 1 3  ? 4.588   -10.811 13.039  1.00 0.00 ? 3  ALA A C    9  
ATOM 8929  O O    . ALA A 1 3  ? 3.854   -10.259 12.207  1.00 0.00 ? 3  ALA A O    9  
ATOM 8930  C CB   . ALA A 1 3  ? 3.093   -11.421 14.878  1.00 0.00 ? 3  ALA A CB   9  
ATOM 8931  H H    . ALA A 1 3  ? 5.394   -12.404 15.414  1.00 0.00 ? 3  ALA A H    9  
ATOM 8932  H HA   . ALA A 1 3  ? 3.501   -12.661 13.137  1.00 0.00 ? 3  ALA A HA   9  
ATOM 8933  H HB1  . ALA A 1 3  ? 2.706   -12.234 15.495  1.00 0.00 ? 3  ALA A HB1  9  
ATOM 8934  H HB2  . ALA A 1 3  ? 3.634   -10.721 15.514  1.00 0.00 ? 3  ALA A HB2  9  
ATOM 8935  H HB3  . ALA A 1 3  ? 2.269   -10.898 14.395  1.00 0.00 ? 3  ALA A HB3  9  
ATOM 8936  N N    . ILE A 1 4  ? 5.852   -10.443 13.315  1.00 0.00 ? 4  ILE A N    9  
ATOM 8937  C CA   . ILE A 1 4  ? 6.495   -9.328  12.641  1.00 0.00 ? 4  ILE A CA   9  
ATOM 8938  C C    . ILE A 1 4  ? 6.928   -9.766  11.240  1.00 0.00 ? 4  ILE A C    9  
ATOM 8939  O O    . ILE A 1 4  ? 6.676   -9.017  10.284  1.00 0.00 ? 4  ILE A O    9  
ATOM 8940  C CB   . ILE A 1 4  ? 7.638   -8.774  13.493  1.00 0.00 ? 4  ILE A CB   9  
ATOM 8941  C CG1  . ILE A 1 4  ? 7.115   -8.227  14.824  1.00 0.00 ? 4  ILE A CG1  9  
ATOM 8942  C CG2  . ILE A 1 4  ? 8.441   -7.726  12.719  1.00 0.00 ? 4  ILE A CG2  9  
ATOM 8943  C CD1  . ILE A 1 4  ? 7.692   -6.839  15.110  1.00 0.00 ? 4  ILE A CD1  9  
ATOM 8944  H H    . ILE A 1 4  ? 6.390   -10.953 14.017  1.00 0.00 ? 4  ILE A H    9  
ATOM 8945  H HA   . ILE A 1 4  ? 5.741   -8.545  12.551  1.00 0.00 ? 4  ILE A HA   9  
ATOM 8946  H HB   . ILE A 1 4  ? 8.286   -9.628  13.690  1.00 0.00 ? 4  ILE A HB   9  
ATOM 8947  H HG12 . ILE A 1 4  ? 6.029   -8.157  14.774  1.00 0.00 ? 4  ILE A HG12 9  
ATOM 8948  H HG13 . ILE A 1 4  ? 7.391   -8.917  15.621  1.00 0.00 ? 4  ILE A HG13 9  
ATOM 8949  H HG21 . ILE A 1 4  ? 7.790   -6.903  12.422  1.00 0.00 ? 4  ILE A HG21 9  
ATOM 8950  H HG22 . ILE A 1 4  ? 9.245   -7.354  13.354  1.00 0.00 ? 4  ILE A HG22 9  
ATOM 8951  H HG23 . ILE A 1 4  ? 8.875   -8.175  11.825  1.00 0.00 ? 4  ILE A HG23 9  
ATOM 8952  H HD11 . ILE A 1 4  ? 7.417   -6.149  14.313  1.00 0.00 ? 4  ILE A HD11 9  
ATOM 8953  H HD12 . ILE A 1 4  ? 7.300   -6.482  16.062  1.00 0.00 ? 4  ILE A HD12 9  
ATOM 8954  H HD13 . ILE A 1 4  ? 8.779   -6.895  15.173  1.00 0.00 ? 4  ILE A HD13 9  
ATOM 8955  N N    . LYS A 1 5  ? 7.561   -10.948 11.147  1.00 0.00 ? 5  LYS A N    9  
ATOM 8956  C CA   . LYS A 1 5  ? 8.024   -11.477 9.876   1.00 0.00 ? 5  LYS A CA   9  
ATOM 8957  C C    . LYS A 1 5  ? 6.849   -11.538 8.897   1.00 0.00 ? 5  LYS A C    9  
ATOM 8958  O O    . LYS A 1 5  ? 7.071   -11.321 7.696   1.00 0.00 ? 5  LYS A O    9  
ATOM 8959  C CB   . LYS A 1 5  ? 8.725   -12.821 10.078  1.00 0.00 ? 5  LYS A CB   9  
ATOM 8960  C CG   . LYS A 1 5  ? 8.212   -13.526 11.334  1.00 0.00 ? 5  LYS A CG   9  
ATOM 8961  C CD   . LYS A 1 5  ? 8.213   -15.045 11.152  1.00 0.00 ? 5  LYS A CD   9  
ATOM 8962  C CE   . LYS A 1 5  ? 9.513   -15.659 11.675  1.00 0.00 ? 5  LYS A CE   9  
ATOM 8963  N NZ   . LYS A 1 5  ? 9.944   -16.769 10.811  1.00 0.00 ? 5  LYS A NZ   9  
ATOM 8964  H H    . LYS A 1 5  ? 7.729   -11.504 11.986  1.00 0.00 ? 5  LYS A H    9  
ATOM 8965  H HA   . LYS A 1 5  ? 8.764   -10.772 9.498   1.00 0.00 ? 5  LYS A HA   9  
ATOM 8966  H HB2  . LYS A 1 5  ? 8.534   -13.454 9.211   1.00 0.00 ? 5  LYS A HB2  9  
ATOM 8967  H HB3  . LYS A 1 5  ? 9.799   -12.650 10.160  1.00 0.00 ? 5  LYS A HB3  9  
ATOM 8968  H HG2  . LYS A 1 5  ? 8.858   -13.269 12.174  1.00 0.00 ? 5  LYS A HG2  9  
ATOM 8969  H HG3  . LYS A 1 5  ? 7.200   -13.178 11.545  1.00 0.00 ? 5  LYS A HG3  9  
ATOM 8970  H HD2  . LYS A 1 5  ? 7.374   -15.469 11.702  1.00 0.00 ? 5  LYS A HD2  9  
ATOM 8971  H HD3  . LYS A 1 5  ? 8.094   -15.273 10.092  1.00 0.00 ? 5  LYS A HD3  9  
ATOM 8972  H HE2  . LYS A 1 5  ? 10.291  -14.895 11.685  1.00 0.00 ? 5  LYS A HE2  9  
ATOM 8973  H HE3  . LYS A 1 5  ? 9.356   -16.018 12.691  1.00 0.00 ? 5  LYS A HE3  9  
ATOM 8974  H HZ1  . LYS A 1 5  ? 10.091  -16.432 9.858   1.00 0.00 ? 5  LYS A HZ1  9  
ATOM 8975  H HZ2  . LYS A 1 5  ? 10.810  -17.161 11.179  1.00 0.00 ? 5  LYS A HZ2  9  
ATOM 8976  H HZ3  . LYS A 1 5  ? 9.229   -17.498 10.798  1.00 0.00 ? 5  LYS A HZ3  9  
ATOM 8977  N N    . LYS A 1 6  ? 5.644   -11.827 9.418   1.00 0.00 ? 6  LYS A N    9  
ATOM 8978  C CA   . LYS A 1 6  ? 4.450   -11.915 8.596   1.00 0.00 ? 6  LYS A CA   9  
ATOM 8979  C C    . LYS A 1 6  ? 3.838   -10.520 8.441   1.00 0.00 ? 6  LYS A C    9  
ATOM 8980  O O    . LYS A 1 6  ? 3.232   -10.255 7.392   1.00 0.00 ? 6  LYS A O    9  
ATOM 8981  C CB   . LYS A 1 6  ? 3.480   -12.951 9.168   1.00 0.00 ? 6  LYS A CB   9  
ATOM 8982  C CG   . LYS A 1 6  ? 4.233   -14.175 9.693   1.00 0.00 ? 6  LYS A CG   9  
ATOM 8983  C CD   . LYS A 1 6  ? 4.984   -14.884 8.564   1.00 0.00 ? 6  LYS A CD   9  
ATOM 8984  C CE   . LYS A 1 6  ? 4.011   -15.570 7.605   1.00 0.00 ? 6  LYS A CE   9  
ATOM 8985  N NZ   . LYS A 1 6  ? 3.252   -16.621 8.305   1.00 0.00 ? 6  LYS A NZ   9  
ATOM 8986  H H    . LYS A 1 6  ? 5.549   -11.993 10.421  1.00 0.00 ? 6  LYS A H    9  
ATOM 8987  H HA   . LYS A 1 6  ? 4.773   -12.271 7.617   1.00 0.00 ? 6  LYS A HA   9  
ATOM 8988  H HB2  . LYS A 1 6  ? 2.922   -12.499 9.987   1.00 0.00 ? 6  LYS A HB2  9  
ATOM 8989  H HB3  . LYS A 1 6  ? 2.783   -13.252 8.386   1.00 0.00 ? 6  LYS A HB3  9  
ATOM 8990  H HG2  . LYS A 1 6  ? 4.950   -13.852 10.449  1.00 0.00 ? 6  LYS A HG2  9  
ATOM 8991  H HG3  . LYS A 1 6  ? 3.519   -14.859 10.152  1.00 0.00 ? 6  LYS A HG3  9  
ATOM 8992  H HD2  . LYS A 1 6  ? 5.568   -14.148 8.012   1.00 0.00 ? 6  LYS A HD2  9  
ATOM 8993  H HD3  . LYS A 1 6  ? 5.660   -15.620 8.998   1.00 0.00 ? 6  LYS A HD3  9  
ATOM 8994  H HE2  . LYS A 1 6  ? 3.312   -14.832 7.212   1.00 0.00 ? 6  LYS A HE2  9  
ATOM 8995  H HE3  . LYS A 1 6  ? 4.570   -16.005 6.777   1.00 0.00 ? 6  LYS A HE3  9  
ATOM 8996  H HZ1  . LYS A 1 6  ? 2.728   -16.214 9.079   1.00 0.00 ? 6  LYS A HZ1  9  
ATOM 8997  H HZ2  . LYS A 1 6  ? 2.611   -17.063 7.645   1.00 0.00 ? 6  LYS A HZ2  9  
ATOM 8998  H HZ3  . LYS A 1 6  ? 3.891   -17.326 8.670   1.00 0.00 ? 6  LYS A HZ3  9  
ATOM 8999  N N    . LYS A 1 7  ? 4.006   -9.672  9.470   1.00 0.00 ? 7  LYS A N    9  
ATOM 9000  C CA   . LYS A 1 7  ? 3.474   -8.320  9.449   1.00 0.00 ? 7  LYS A CA   9  
ATOM 9001  C C    . LYS A 1 7  ? 3.942   -7.614  8.174   1.00 0.00 ? 7  LYS A C    9  
ATOM 9002  O O    . LYS A 1 7  ? 3.089   -7.077  7.451   1.00 0.00 ? 7  LYS A O    9  
ATOM 9003  C CB   . LYS A 1 7  ? 3.845   -7.578  10.734  1.00 0.00 ? 7  LYS A CB   9  
ATOM 9004  C CG   . LYS A 1 7  ? 3.365   -6.126  10.686  1.00 0.00 ? 7  LYS A CG   9  
ATOM 9005  C CD   . LYS A 1 7  ? 1.925   -6.039  10.177  1.00 0.00 ? 7  LYS A CD   9  
ATOM 9006  C CE   . LYS A 1 7  ? 0.973   -6.814  11.091  1.00 0.00 ? 7  LYS A CE   9  
ATOM 9007  N NZ   . LYS A 1 7  ? 1.077   -6.324  12.476  1.00 0.00 ? 7  LYS A NZ   9  
ATOM 9008  H H    . LYS A 1 7  ? 4.519   -9.971  10.300  1.00 0.00 ? 7  LYS A H    9  
ATOM 9009  H HA   . LYS A 1 7  ? 2.388   -8.415  9.424   1.00 0.00 ? 7  LYS A HA   9  
ATOM 9010  H HB2  . LYS A 1 7  ? 3.374   -8.078  11.580  1.00 0.00 ? 7  LYS A HB2  9  
ATOM 9011  H HB3  . LYS A 1 7  ? 4.927   -7.609  10.861  1.00 0.00 ? 7  LYS A HB3  9  
ATOM 9012  H HG2  . LYS A 1 7  ? 3.412   -5.704  11.690  1.00 0.00 ? 7  LYS A HG2  9  
ATOM 9013  H HG3  . LYS A 1 7  ? 4.026   -5.557  10.031  1.00 0.00 ? 7  LYS A HG3  9  
ATOM 9014  H HD2  . LYS A 1 7  ? 1.620   -4.993  10.151  1.00 0.00 ? 7  LYS A HD2  9  
ATOM 9015  H HD3  . LYS A 1 7  ? 1.882   -6.446  9.166   1.00 0.00 ? 7  LYS A HD3  9  
ATOM 9016  H HE2  . LYS A 1 7  ? -0.051  -6.675  10.742  1.00 0.00 ? 7  LYS A HE2  9  
ATOM 9017  H HE3  . LYS A 1 7  ? 1.222   -7.874  11.052  1.00 0.00 ? 7  LYS A HE3  9  
ATOM 9018  H HZ1  . LYS A 1 7  ? 0.845   -5.332  12.512  1.00 0.00 ? 7  LYS A HZ1  9  
ATOM 9019  H HZ2  . LYS A 1 7  ? 0.434   -6.854  13.064  1.00 0.00 ? 7  LYS A HZ2  9  
ATOM 9020  H HZ3  . LYS A 1 7  ? 2.029   -6.455  12.820  1.00 0.00 ? 7  LYS A HZ3  9  
ATOM 9021  N N    . MET A 1 8  ? 5.264   -7.626  7.929   1.00 0.00 ? 8  MET A N    9  
ATOM 9022  C CA   . MET A 1 8  ? 5.834   -6.992  6.754   1.00 0.00 ? 8  MET A CA   9  
ATOM 9023  C C    . MET A 1 8  ? 5.393   -7.753  5.502   1.00 0.00 ? 8  MET A C    9  
ATOM 9024  O O    . MET A 1 8  ? 5.309   -7.132  4.432   1.00 0.00 ? 8  MET A O    9  
ATOM 9025  C CB   . MET A 1 8  ? 7.362   -6.990  6.838   1.00 0.00 ? 8  MET A CB   9  
ATOM 9026  C CG   . MET A 1 8  ? 7.904   -8.411  7.006   1.00 0.00 ? 8  MET A CG   9  
ATOM 9027  S SD   . MET A 1 8  ? 9.697   -8.363  7.293   1.00 0.00 ? 8  MET A SD   9  
ATOM 9028  C CE   . MET A 1 8  ? 10.209  -9.817  6.331   1.00 0.00 ? 8  MET A CE   9  
ATOM 9029  H H    . MET A 1 8  ? 5.899   -8.092  8.578   1.00 0.00 ? 8  MET A H    9  
ATOM 9030  H HA   . MET A 1 8  ? 5.469   -5.966  6.692   1.00 0.00 ? 8  MET A HA   9  
ATOM 9031  H HB2  . MET A 1 8  ? 7.767   -6.561  5.921   1.00 0.00 ? 8  MET A HB2  9  
ATOM 9032  H HB3  . MET A 1 8  ? 7.669   -6.373  7.684   1.00 0.00 ? 8  MET A HB3  9  
ATOM 9033  H HG2  . MET A 1 8  ? 7.419   -8.885  7.860   1.00 0.00 ? 8  MET A HG2  9  
ATOM 9034  H HG3  . MET A 1 8  ? 7.686   -8.990  6.108   1.00 0.00 ? 8  MET A HG3  9  
ATOM 9035  H HE1  . MET A 1 8  ? 9.919   -9.694  5.289   1.00 0.00 ? 8  MET A HE1  9  
ATOM 9036  H HE2  . MET A 1 8  ? 11.292  -9.928  6.405   1.00 0.00 ? 8  MET A HE2  9  
ATOM 9037  H HE3  . MET A 1 8  ? 9.732   -10.713 6.729   1.00 0.00 ? 8  MET A HE3  9  
ATOM 9038  N N    . GLN A 1 9  ? 5.124   -9.062  5.658   1.00 0.00 ? 9  GLN A N    9  
ATOM 9039  C CA   . GLN A 1 9  ? 4.696   -9.897  4.548   1.00 0.00 ? 9  GLN A CA   9  
ATOM 9040  C C    . GLN A 1 9  ? 3.230   -9.597  4.226   1.00 0.00 ? 9  GLN A C    9  
ATOM 9041  O O    . GLN A 1 9  ? 2.825   -9.812  3.075   1.00 0.00 ? 9  GLN A O    9  
ATOM 9042  C CB   . GLN A 1 9  ? 4.898   -11.382 4.854   1.00 0.00 ? 9  GLN A CB   9  
ATOM 9043  C CG   . GLN A 1 9  ? 6.354   -11.796 4.628   1.00 0.00 ? 9  GLN A CG   9  
ATOM 9044  C CD   . GLN A 1 9  ? 6.447   -13.261 4.197   1.00 0.00 ? 9  GLN A CD   9  
ATOM 9045  O OE1  . GLN A 1 9  ? 5.951   -13.662 3.156   1.00 0.00 ? 9  GLN A OE1  9  
ATOM 9046  N NE2  . GLN A 1 9  ? 7.109   -14.035 5.051   1.00 0.00 ? 9  GLN A NE2  9  
ATOM 9047  H H    . GLN A 1 9  ? 5.218   -9.497  6.576   1.00 0.00 ? 9  GLN A H    9  
ATOM 9048  H HA   . GLN A 1 9  ? 5.311   -9.625  3.691   1.00 0.00 ? 9  GLN A HA   9  
ATOM 9049  H HB2  . GLN A 1 9  ? 4.633   -11.569 5.894   1.00 0.00 ? 9  GLN A HB2  9  
ATOM 9050  H HB3  . GLN A 1 9  ? 4.241   -11.968 4.210   1.00 0.00 ? 9  GLN A HB3  9  
ATOM 9051  H HG2  . GLN A 1 9  ? 6.783   -11.168 3.847   1.00 0.00 ? 9  GLN A HG2  9  
ATOM 9052  H HG3  . GLN A 1 9  ? 6.911   -11.644 5.552   1.00 0.00 ? 9  GLN A HG3  9  
ATOM 9053  H HE21 . GLN A 1 9  ? 7.499   -13.635 5.905   1.00 0.00 ? 9  GLN A HE21 9  
ATOM 9054  H HE22 . GLN A 1 9  ? 7.226   -15.029 4.854   1.00 0.00 ? 9  GLN A HE22 9  
ATOM 9055  N N    . MET A 1 10 ? 2.479   -9.116  5.233   1.00 0.00 ? 10 MET A N    9  
ATOM 9056  C CA   . MET A 1 10 ? 1.073   -8.792  5.057   1.00 0.00 ? 10 MET A CA   9  
ATOM 9057  C C    . MET A 1 10 ? 0.950   -7.411  4.410   1.00 0.00 ? 10 MET A C    9  
ATOM 9058  O O    . MET A 1 10 ? 0.103   -7.251  3.520   1.00 0.00 ? 10 MET A O    9  
ATOM 9059  C CB   . MET A 1 10 ? 0.354   -8.790  6.407   1.00 0.00 ? 10 MET A CB   9  
ATOM 9060  C CG   . MET A 1 10 ? 0.595   -10.102 7.158   1.00 0.00 ? 10 MET A CG   9  
ATOM 9061  S SD   . MET A 1 10 ? -0.990  -10.931 7.484   1.00 0.00 ? 10 MET A SD   9  
ATOM 9062  C CE   . MET A 1 10 ? -1.808  -9.663  8.495   1.00 0.00 ? 10 MET A CE   9  
ATOM 9063  H H    . MET A 1 10 ? 2.892   -8.969  6.154   1.00 0.00 ? 10 MET A H    9  
ATOM 9064  H HA   . MET A 1 10 ? 0.619   -9.534  4.400   1.00 0.00 ? 10 MET A HA   9  
ATOM 9065  H HB2  . MET A 1 10 ? 0.732   -7.963  7.008   1.00 0.00 ? 10 MET A HB2  9  
ATOM 9066  H HB3  . MET A 1 10 ? -0.713  -8.648  6.240   1.00 0.00 ? 10 MET A HB3  9  
ATOM 9067  H HG2  . MET A 1 10 ? 1.221   -10.757 6.553   1.00 0.00 ? 10 MET A HG2  9  
ATOM 9068  H HG3  . MET A 1 10 ? 1.104   -9.892  8.099   1.00 0.00 ? 10 MET A HG3  9  
ATOM 9069  H HE1  . MET A 1 10 ? -1.895  -8.736  7.929   1.00 0.00 ? 10 MET A HE1  9  
ATOM 9070  H HE2  . MET A 1 10 ? -2.798  -10.020 8.778   1.00 0.00 ? 10 MET A HE2  9  
ATOM 9071  H HE3  . MET A 1 10 ? -1.226  -9.475  9.398   1.00 0.00 ? 10 MET A HE3  9  
ATOM 9072  N N    . LEU A 1 11 ? 1.783   -6.458  4.864   1.00 0.00 ? 11 LEU A N    9  
ATOM 9073  C CA   . LEU A 1 11 ? 1.767   -5.105  4.333   1.00 0.00 ? 11 LEU A CA   9  
ATOM 9074  C C    . LEU A 1 11 ? 2.500   -5.080  2.991   1.00 0.00 ? 11 LEU A C    9  
ATOM 9075  O O    . LEU A 1 11 ? 2.206   -4.193  2.175   1.00 0.00 ? 11 LEU A O    9  
ATOM 9076  C CB   . LEU A 1 11 ? 2.330   -4.120  5.359   1.00 0.00 ? 11 LEU A CB   9  
ATOM 9077  C CG   . LEU A 1 11 ? 1.583   -4.040  6.692   1.00 0.00 ? 11 LEU A CG   9  
ATOM 9078  C CD1  . LEU A 1 11 ? 2.282   -3.079  7.656   1.00 0.00 ? 11 LEU A CD1  9  
ATOM 9079  C CD2  . LEU A 1 11 ? 0.115   -3.670  6.477   1.00 0.00 ? 11 LEU A CD2  9  
ATOM 9080  H H    . LEU A 1 11 ? 2.453   -6.674  5.603   1.00 0.00 ? 11 LEU A H    9  
ATOM 9081  H HA   . LEU A 1 11 ? 0.720   -4.849  4.171   1.00 0.00 ? 11 LEU A HA   9  
ATOM 9082  H HB2  . LEU A 1 11 ? 3.359   -4.426  5.548   1.00 0.00 ? 11 LEU A HB2  9  
ATOM 9083  H HB3  . LEU A 1 11 ? 2.333   -3.143  4.876   1.00 0.00 ? 11 LEU A HB3  9  
ATOM 9084  H HG   . LEU A 1 11 ? 1.637   -5.046  7.110   1.00 0.00 ? 11 LEU A HG   9  
ATOM 9085  H HD11 . LEU A 1 11 ? 2.328   -2.081  7.217   1.00 0.00 ? 11 LEU A HD11 9  
ATOM 9086  H HD12 . LEU A 1 11 ? 1.724   -3.046  8.592   1.00 0.00 ? 11 LEU A HD12 9  
ATOM 9087  H HD13 . LEU A 1 11 ? 3.294   -3.425  7.857   1.00 0.00 ? 11 LEU A HD13 9  
ATOM 9088  H HD21 . LEU A 1 11 ? -0.368  -4.415  5.846   1.00 0.00 ? 11 LEU A HD21 9  
ATOM 9089  H HD22 . LEU A 1 11 ? -0.385  -3.621  7.444   1.00 0.00 ? 11 LEU A HD22 9  
ATOM 9090  H HD23 . LEU A 1 11 ? 0.044   -2.695  5.993   1.00 0.00 ? 11 LEU A HD23 9  
ATOM 9091  N N    . LYS A 1 12 ? 3.423   -6.036  2.791   1.00 0.00 ? 12 LYS A N    9  
ATOM 9092  C CA   . LYS A 1 12 ? 4.189   -6.122  1.559   1.00 0.00 ? 12 LYS A CA   9  
ATOM 9093  C C    . LYS A 1 12 ? 3.306   -6.707  0.454   1.00 0.00 ? 12 LYS A C    9  
ATOM 9094  O O    . LYS A 1 12 ? 3.496   -6.333  -0.712  1.00 0.00 ? 12 LYS A O    9  
ATOM 9095  C CB   . LYS A 1 12 ? 5.486   -6.902  1.787   1.00 0.00 ? 12 LYS A CB   9  
ATOM 9096  C CG   . LYS A 1 12 ? 6.067   -7.399  0.462   1.00 0.00 ? 12 LYS A CG   9  
ATOM 9097  C CD   . LYS A 1 12 ? 5.509   -8.777  0.101   1.00 0.00 ? 12 LYS A CD   9  
ATOM 9098  C CE   . LYS A 1 12 ? 6.615   -9.700  -0.414  1.00 0.00 ? 12 LYS A CE   9  
ATOM 9099  N NZ   . LYS A 1 12 ? 7.690   -9.823  0.585   1.00 0.00 ? 12 LYS A NZ   9  
ATOM 9100  H H    . LYS A 1 12 ? 3.604   -6.730  3.516   1.00 0.00 ? 12 LYS A H    9  
ATOM 9101  H HA   . LYS A 1 12 ? 4.462   -5.102  1.292   1.00 0.00 ? 12 LYS A HA   9  
ATOM 9102  H HB2  . LYS A 1 12 ? 6.212   -6.248  2.270   1.00 0.00 ? 12 LYS A HB2  9  
ATOM 9103  H HB3  . LYS A 1 12 ? 5.279   -7.748  2.442   1.00 0.00 ? 12 LYS A HB3  9  
ATOM 9104  H HG2  . LYS A 1 12 ? 5.807   -6.693  -0.326  1.00 0.00 ? 12 LYS A HG2  9  
ATOM 9105  H HG3  . LYS A 1 12 ? 7.153   -7.449  0.549   1.00 0.00 ? 12 LYS A HG3  9  
ATOM 9106  H HD2  . LYS A 1 12 ? 5.061   -9.222  0.989   1.00 0.00 ? 12 LYS A HD2  9  
ATOM 9107  H HD3  . LYS A 1 12 ? 4.739   -8.658  -0.662  1.00 0.00 ? 12 LYS A HD3  9  
ATOM 9108  H HE2  . LYS A 1 12 ? 6.197   -10.687 -0.610  1.00 0.00 ? 12 LYS A HE2  9  
ATOM 9109  H HE3  . LYS A 1 12 ? 7.016   -9.293  -1.343  1.00 0.00 ? 12 LYS A HE3  9  
ATOM 9110  H HZ1  . LYS A 1 12 ? 7.315   -10.203 1.454   1.00 0.00 ? 12 LYS A HZ1  9  
ATOM 9111  H HZ2  . LYS A 1 12 ? 8.413   -10.442 0.220   1.00 0.00 ? 12 LYS A HZ2  9  
ATOM 9112  H HZ3  . LYS A 1 12 ? 8.098   -8.907  0.772   1.00 0.00 ? 12 LYS A HZ3  9  
ATOM 9113  N N    . LEU A 1 13 ? 2.375   -7.598  0.837   1.00 0.00 ? 13 LEU A N    9  
ATOM 9114  C CA   . LEU A 1 13 ? 1.473   -8.226  -0.114  1.00 0.00 ? 13 LEU A CA   9  
ATOM 9115  C C    . LEU A 1 13 ? 0.378   -7.232  -0.505  1.00 0.00 ? 13 LEU A C    9  
ATOM 9116  O O    . LEU A 1 13 ? 0.057   -7.149  -1.700  1.00 0.00 ? 13 LEU A O    9  
ATOM 9117  C CB   . LEU A 1 13 ? 0.935   -9.544  0.448   1.00 0.00 ? 13 LEU A CB   9  
ATOM 9118  C CG   . LEU A 1 13 ? 0.495   -10.583 -0.585  1.00 0.00 ? 13 LEU A CG   9  
ATOM 9119  C CD1  . LEU A 1 13 ? -0.463  -11.602 0.036   1.00 0.00 ? 13 LEU A CD1  9  
ATOM 9120  C CD2  . LEU A 1 13 ? -0.106  -9.910  -1.820  1.00 0.00 ? 13 LEU A CD2  9  
ATOM 9121  H H    . LEU A 1 13 ? 2.284   -7.852  1.821   1.00 0.00 ? 13 LEU A H    9  
ATOM 9122  H HA   . LEU A 1 13 ? 2.069   -8.463  -0.995  1.00 0.00 ? 13 LEU A HA   9  
ATOM 9123  H HB2  . LEU A 1 13 ? 1.733   -9.966  1.059   1.00 0.00 ? 13 LEU A HB2  9  
ATOM 9124  H HB3  . LEU A 1 13 ? 0.096   -9.282  1.091   1.00 0.00 ? 13 LEU A HB3  9  
ATOM 9125  H HG   . LEU A 1 13 ? 1.410   -11.101 -0.874  1.00 0.00 ? 13 LEU A HG   9  
ATOM 9126  H HD11 . LEU A 1 13 ? -1.346  -11.094 0.423   1.00 0.00 ? 13 LEU A HD11 9  
ATOM 9127  H HD12 . LEU A 1 13 ? -0.755  -12.325 -0.727  1.00 0.00 ? 13 LEU A HD12 9  
ATOM 9128  H HD13 . LEU A 1 13 ? 0.032   -12.128 0.853   1.00 0.00 ? 13 LEU A HD13 9  
ATOM 9129  H HD21 . LEU A 1 13 ? 0.628   -9.246  -2.277  1.00 0.00 ? 13 LEU A HD21 9  
ATOM 9130  H HD22 . LEU A 1 13 ? -0.407  -10.677 -2.533  1.00 0.00 ? 13 LEU A HD22 9  
ATOM 9131  H HD23 . LEU A 1 13 ? -0.982  -9.326  -1.535  1.00 0.00 ? 13 LEU A HD23 9  
ATOM 9132  N N    . ASP A 1 14 ? -0.164  -6.509  0.492   1.00 0.00 ? 14 ASP A N    9  
ATOM 9133  C CA   . ASP A 1 14 ? -1.211  -5.532  0.253   1.00 0.00 ? 14 ASP A CA   9  
ATOM 9134  C C    . ASP A 1 14 ? -0.646  -4.377  -0.577  1.00 0.00 ? 14 ASP A C    9  
ATOM 9135  O O    . ASP A 1 14 ? -1.407  -3.781  -1.352  1.00 0.00 ? 14 ASP A O    9  
ATOM 9136  C CB   . ASP A 1 14 ? -1.737  -4.956  1.569   1.00 0.00 ? 14 ASP A CB   9  
ATOM 9137  C CG   . ASP A 1 14 ? -3.256  -4.789  1.641   1.00 0.00 ? 14 ASP A CG   9  
ATOM 9138  O OD1  . ASP A 1 14 ? -3.937  -5.777  1.165   1.00 0.00 ? 14 ASP A OD1  9  
ATOM 9139  O OD2  . ASP A 1 14 ? -3.764  -3.767  2.127   1.00 0.00 ? 14 ASP A OD2  9  
ATOM 9140  H H    . ASP A 1 14 ? 0.160   -6.641  1.450   1.00 0.00 ? 14 ASP A H    9  
ATOM 9141  H HA   . ASP A 1 14 ? -2.019  -6.006  -0.304  1.00 0.00 ? 14 ASP A HA   9  
ATOM 9142  H HB2  . ASP A 1 14 ? -1.417  -5.631  2.361   1.00 0.00 ? 14 ASP A HB2  9  
ATOM 9143  H HB3  . ASP A 1 14 ? -1.250  -3.990  1.707   1.00 0.00 ? 14 ASP A HB3  9  
ATOM 9144  N N    . ASN A 1 15 ? 0.656   -4.090  -0.401  1.00 0.00 ? 15 ASN A N    9  
ATOM 9145  C CA   . ASN A 1 15 ? 1.313   -3.018  -1.128  1.00 0.00 ? 15 ASN A CA   9  
ATOM 9146  C C    . ASN A 1 15 ? 1.268   -3.321  -2.626  1.00 0.00 ? 15 ASN A C    9  
ATOM 9147  O O    . ASN A 1 15 ? 0.868   -2.434  -3.395  1.00 0.00 ? 15 ASN A O    9  
ATOM 9148  C CB   . ASN A 1 15 ? 2.781   -2.891  -0.715  1.00 0.00 ? 15 ASN A CB   9  
ATOM 9149  C CG   . ASN A 1 15 ? 3.339   -1.516  -1.085  1.00 0.00 ? 15 ASN A CG   9  
ATOM 9150  O OD1  . ASN A 1 15 ? 3.839   -1.293  -2.176  1.00 0.00 ? 15 ASN A OD1  9  
ATOM 9151  N ND2  . ASN A 1 15 ? 3.225   -0.609  -0.119  1.00 0.00 ? 15 ASN A ND2  9  
ATOM 9152  H H    . ASN A 1 15 ? 1.213   -4.632  0.261   1.00 0.00 ? 15 ASN A H    9  
ATOM 9153  H HA   . ASN A 1 15 ? 0.784   -2.084  -0.938  1.00 0.00 ? 15 ASN A HA   9  
ATOM 9154  H HB2  . ASN A 1 15 ? 2.858   -3.027  0.364   1.00 0.00 ? 15 ASN A HB2  9  
ATOM 9155  H HB3  . ASN A 1 15 ? 3.356   -3.672  -1.213  1.00 0.00 ? 15 ASN A HB3  9  
ATOM 9156  H HD21 . ASN A 1 15 ? 2.796   -0.862  0.770   1.00 0.00 ? 15 ASN A HD21 9  
ATOM 9157  H HD22 . ASN A 1 15 ? 3.568   0.341   -0.268  1.00 0.00 ? 15 ASN A HD22 9  
ATOM 9158  N N    . TYR A 1 16 ? 1.671   -4.546  -3.005  1.00 0.00 ? 16 TYR A N    9  
ATOM 9159  C CA   . TYR A 1 16 ? 1.657   -4.895  -4.416  1.00 0.00 ? 16 TYR A CA   9  
ATOM 9160  C C    . TYR A 1 16 ? 0.226   -4.793  -4.946  1.00 0.00 ? 16 TYR A C    9  
ATOM 9161  O O    . TYR A 1 16 ? 0.061   -4.371  -6.101  1.00 0.00 ? 16 TYR A O    9  
ATOM 9162  C CB   . TYR A 1 16 ? 2.244   -6.304  -4.619  1.00 0.00 ? 16 TYR A CB   9  
ATOM 9163  C CG   . TYR A 1 16 ? 3.597   -6.525  -3.956  1.00 0.00 ? 16 TYR A CG   9  
ATOM 9164  C CD1  . TYR A 1 16 ? 4.481   -5.438  -3.775  1.00 0.00 ? 16 TYR A CD1  9  
ATOM 9165  C CD2  . TYR A 1 16 ? 3.975   -7.814  -3.515  1.00 0.00 ? 16 TYR A CD2  9  
ATOM 9166  C CE1  . TYR A 1 16 ? 5.735   -5.637  -3.160  1.00 0.00 ? 16 TYR A CE1  9  
ATOM 9167  C CE2  . TYR A 1 16 ? 5.229   -8.014  -2.899  1.00 0.00 ? 16 TYR A CE2  9  
ATOM 9168  C CZ   . TYR A 1 16 ? 6.111   -6.926  -2.721  1.00 0.00 ? 16 TYR A CZ   9  
ATOM 9169  O OH   . TYR A 1 16 ? 7.326   -7.114  -2.127  1.00 0.00 ? 16 TYR A OH   9  
ATOM 9170  H H    . TYR A 1 16 ? 1.987   -5.223  -2.326  1.00 0.00 ? 16 TYR A H    9  
ATOM 9171  H HA   . TYR A 1 16 ? 2.271   -4.169  -4.953  1.00 0.00 ? 16 TYR A HA   9  
ATOM 9172  H HB2  . TYR A 1 16 ? 1.531   -7.045  -4.249  1.00 0.00 ? 16 TYR A HB2  9  
ATOM 9173  H HB3  . TYR A 1 16 ? 2.364   -6.485  -5.689  1.00 0.00 ? 16 TYR A HB3  9  
ATOM 9174  H HD1  . TYR A 1 16 ? 4.201   -4.448  -4.108  1.00 0.00 ? 16 TYR A HD1  9  
ATOM 9175  H HD2  . TYR A 1 16 ? 3.306   -8.652  -3.645  1.00 0.00 ? 16 TYR A HD2  9  
ATOM 9176  H HE1  . TYR A 1 16 ? 6.406   -4.800  -3.026  1.00 0.00 ? 16 TYR A HE1  9  
ATOM 9177  H HE2  . TYR A 1 16 ? 5.510   -9.002  -2.564  1.00 0.00 ? 16 TYR A HE2  9  
ATOM 9178  H HH   . TYR A 1 16 ? 7.834   -7.833  -2.512  1.00 0.00 ? 16 TYR A HH   9  
ATOM 9179  N N    . HIS A 1 17 ? -0.762  -5.180  -4.119  1.00 0.00 ? 17 HIS A N    9  
ATOM 9180  C CA   . HIS A 1 17 ? -2.159  -5.137  -4.515  1.00 0.00 ? 17 HIS A CA   9  
ATOM 9181  C C    . HIS A 1 17 ? -2.621  -3.680  -4.585  1.00 0.00 ? 17 HIS A C    9  
ATOM 9182  O O    . HIS A 1 17 ? -3.457  -3.367  -5.446  1.00 0.00 ? 17 HIS A O    9  
ATOM 9183  C CB   . HIS A 1 17 ? -3.020  -5.987  -3.578  1.00 0.00 ? 17 HIS A CB   9  
ATOM 9184  C CG   . HIS A 1 17 ? -4.197  -5.249  -2.987  1.00 0.00 ? 17 HIS A CG   9  
ATOM 9185  N ND1  . HIS A 1 17 ? -5.395  -5.089  -3.661  1.00 0.00 ? 17 HIS A ND1  9  
ATOM 9186  C CD2  . HIS A 1 17 ? -4.348  -4.632  -1.781  1.00 0.00 ? 17 HIS A CD2  9  
ATOM 9187  C CE1  . HIS A 1 17 ? -6.222  -4.403  -2.886  1.00 0.00 ? 17 HIS A CE1  9  
ATOM 9188  N NE2  . HIS A 1 17 ? -5.571  -4.121  -1.721  1.00 0.00 ? 17 HIS A NE2  9  
ATOM 9189  H H    . HIS A 1 17 ? -0.540  -5.515  -3.182  1.00 0.00 ? 17 HIS A H    9  
ATOM 9190  H HA   . HIS A 1 17 ? -2.212  -5.575  -5.512  1.00 0.00 ? 17 HIS A HA   9  
ATOM 9191  H HB2  . HIS A 1 17 ? -3.386  -6.837  -4.154  1.00 0.00 ? 17 HIS A HB2  9  
ATOM 9192  H HB3  . HIS A 1 17 ? -2.371  -6.351  -2.782  1.00 0.00 ? 17 HIS A HB3  9  
ATOM 9193  H HD1  . HIS A 1 17 ? -5.700  -5.396  -4.585  1.00 0.00 ? 17 HIS A HD1  9  
ATOM 9194  H HD2  . HIS A 1 17 ? -3.672  -4.515  -0.947  1.00 0.00 ? 17 HIS A HD2  9  
ATOM 9195  H HE1  . HIS A 1 17 ? -7.219  -4.170  -3.231  1.00 0.00 ? 17 HIS A HE1  9  
ATOM 9196  N N    . LEU A 1 18 ? -2.077  -2.832  -3.694  1.00 0.00 ? 18 LEU A N    9  
ATOM 9197  C CA   . LEU A 1 18 ? -2.430  -1.424  -3.656  1.00 0.00 ? 18 LEU A CA   9  
ATOM 9198  C C    . LEU A 1 18 ? -1.716  -0.692  -4.794  1.00 0.00 ? 18 LEU A C    9  
ATOM 9199  O O    . LEU A 1 18 ? -2.367  0.108   -5.481  1.00 0.00 ? 18 LEU A O    9  
ATOM 9200  C CB   . LEU A 1 18 ? -2.145  -0.837  -2.272  1.00 0.00 ? 18 LEU A CB   9  
ATOM 9201  C CG   . LEU A 1 18 ? -3.069  -1.299  -1.144  1.00 0.00 ? 18 LEU A CG   9  
ATOM 9202  C CD1  . LEU A 1 18 ? -2.412  -1.093  0.222   1.00 0.00 ? 18 LEU A CD1  9  
ATOM 9203  C CD2  . LEU A 1 18 ? -4.432  -0.611  -1.234  1.00 0.00 ? 18 LEU A CD2  9  
ATOM 9204  H H    . LEU A 1 18 ? -1.393  -3.173  -3.017  1.00 0.00 ? 18 LEU A H    9  
ATOM 9205  H HA   . LEU A 1 18 ? -3.507  -1.370  -3.821  1.00 0.00 ? 18 LEU A HA   9  
ATOM 9206  H HB2  . LEU A 1 18 ? -1.120  -1.112  -2.027  1.00 0.00 ? 18 LEU A HB2  9  
ATOM 9207  H HB3  . LEU A 1 18 ? -2.205  0.246   -2.382  1.00 0.00 ? 18 LEU A HB3  9  
ATOM 9208  H HG   . LEU A 1 18 ? -3.200  -2.369  -1.305  1.00 0.00 ? 18 LEU A HG   9  
ATOM 9209  H HD11 . LEU A 1 18 ? -2.178  -0.038  0.367   1.00 0.00 ? 18 LEU A HD11 9  
ATOM 9210  H HD12 . LEU A 1 18 ? -3.095  -1.433  1.000   1.00 0.00 ? 18 LEU A HD12 9  
ATOM 9211  H HD13 . LEU A 1 18 ? -1.490  -1.673  0.282   1.00 0.00 ? 18 LEU A HD13 9  
ATOM 9212  H HD21 . LEU A 1 18 ? -4.902  -0.839  -2.190  1.00 0.00 ? 18 LEU A HD21 9  
ATOM 9213  H HD22 . LEU A 1 18 ? -5.062  -0.963  -0.417  1.00 0.00 ? 18 LEU A HD22 9  
ATOM 9214  H HD23 . LEU A 1 18 ? -4.310  0.469   -1.147  1.00 0.00 ? 18 LEU A HD23 9  
ATOM 9215  N N    . GLU A 1 19 ? -0.413  -0.975  -4.967  1.00 0.00 ? 19 GLU A N    9  
ATOM 9216  C CA   . GLU A 1 19 ? 0.380   -0.348  -6.012  1.00 0.00 ? 19 GLU A CA   9  
ATOM 9217  C C    . GLU A 1 19 ? -0.171  -0.758  -7.379  1.00 0.00 ? 19 GLU A C    9  
ATOM 9218  O O    . GLU A 1 19 ? -0.180  0.085   -8.288  1.00 0.00 ? 19 GLU A O    9  
ATOM 9219  C CB   . GLU A 1 19 ? 1.861   -0.709  -5.886  1.00 0.00 ? 19 GLU A CB   9  
ATOM 9220  C CG   . GLU A 1 19 ? 2.740   0.538   -5.992  1.00 0.00 ? 19 GLU A CG   9  
ATOM 9221  C CD   . GLU A 1 19 ? 2.719   1.337   -4.687  1.00 0.00 ? 19 GLU A CD   9  
ATOM 9222  O OE1  . GLU A 1 19 ? 2.372   0.664   -3.642  1.00 0.00 ? 19 GLU A OE1  9  
ATOM 9223  O OE2  . GLU A 1 19 ? 3.019   2.539   -4.690  1.00 0.00 ? 19 GLU A OE2  9  
ATOM 9224  H H    . GLU A 1 19 ? 0.049   -1.648  -4.355  1.00 0.00 ? 19 GLU A H    9  
ATOM 9225  H HA   . GLU A 1 19 ? 0.267   0.730   -5.892  1.00 0.00 ? 19 GLU A HA   9  
ATOM 9226  H HB2  . GLU A 1 19 ? 2.030   -1.181  -4.919  1.00 0.00 ? 19 GLU A HB2  9  
ATOM 9227  H HB3  . GLU A 1 19 ? 2.121   -1.414  -6.676  1.00 0.00 ? 19 GLU A HB3  9  
ATOM 9228  H HG2  . GLU A 1 19 ? 3.765   0.233   -6.203  1.00 0.00 ? 19 GLU A HG2  9  
ATOM 9229  H HG3  . GLU A 1 19 ? 2.378   1.158   -6.813  1.00 0.00 ? 19 GLU A HG3  9  
ATOM 9230  N N    . ASN A 1 20 ? -0.613  -2.023  -7.495  1.00 0.00 ? 20 ASN A N    9  
ATOM 9231  C CA   . ASN A 1 20 ? -1.159  -2.537  -8.741  1.00 0.00 ? 20 ASN A CA   9  
ATOM 9232  C C    . ASN A 1 20 ? -2.500  -1.855  -9.023  1.00 0.00 ? 20 ASN A C    9  
ATOM 9233  O O    . ASN A 1 20 ? -2.859  -1.727  -10.203 1.00 0.00 ? 20 ASN A O    9  
ATOM 9234  C CB   . ASN A 1 20 ? -1.404  -4.044  -8.655  1.00 0.00 ? 20 ASN A CB   9  
ATOM 9235  C CG   . ASN A 1 20 ? -0.180  -4.826  -9.135  1.00 0.00 ? 20 ASN A CG   9  
ATOM 9236  O OD1  . ASN A 1 20 ? 0.643   -4.338  -9.893  1.00 0.00 ? 20 ASN A OD1  9  
ATOM 9237  N ND2  . ASN A 1 20 ? -0.106  -6.064  -8.654  1.00 0.00 ? 20 ASN A ND2  9  
ATOM 9238  H H    . ASN A 1 20 ? -0.570  -2.654  -6.695  1.00 0.00 ? 20 ASN A H    9  
ATOM 9239  H HA   . ASN A 1 20 ? -0.468  -2.309  -9.551  1.00 0.00 ? 20 ASN A HA   9  
ATOM 9240  H HB2  . ASN A 1 20 ? -1.611  -4.310  -7.617  1.00 0.00 ? 20 ASN A HB2  9  
ATOM 9241  H HB3  . ASN A 1 20 ? -2.270  -4.297  -9.266  1.00 0.00 ? 20 ASN A HB3  9  
ATOM 9242  H HD21 . ASN A 1 20 ? -0.829  -6.410  -8.023  1.00 0.00 ? 20 ASN A HD21 9  
ATOM 9243  H HD22 . ASN A 1 20 ? 0.675   -6.667  -8.915  1.00 0.00 ? 20 ASN A HD22 9  
ATOM 9244  N N    . GLU A 1 21 ? -3.201  -1.439  -7.953  1.00 0.00 ? 21 GLU A N    9  
ATOM 9245  C CA   . GLU A 1 21 ? -4.489  -0.778  -8.086  1.00 0.00 ? 21 GLU A CA   9  
ATOM 9246  C C    . GLU A 1 21 ? -4.267  0.711   -8.360  1.00 0.00 ? 21 GLU A C    9  
ATOM 9247  O O    . GLU A 1 21 ? -5.014  1.279   -9.169  1.00 0.00 ? 21 GLU A O    9  
ATOM 9248  C CB   . GLU A 1 21 ? -5.357  -0.984  -6.843  1.00 0.00 ? 21 GLU A CB   9  
ATOM 9249  C CG   . GLU A 1 21 ? -6.819  -1.214  -7.227  1.00 0.00 ? 21 GLU A CG   9  
ATOM 9250  C CD   . GLU A 1 21 ? -7.508  -2.146  -6.228  1.00 0.00 ? 21 GLU A CD   9  
ATOM 9251  O OE1  . GLU A 1 21 ? -7.059  -2.081  -5.022  1.00 0.00 ? 21 GLU A OE1  9  
ATOM 9252  O OE2  . GLU A 1 21 ? -8.425  -2.890  -6.607  1.00 0.00 ? 21 GLU A OE2  9  
ATOM 9253  H H    . GLU A 1 21 ? -2.832  -1.585  -7.013  1.00 0.00 ? 21 GLU A H    9  
ATOM 9254  H HA   . GLU A 1 21 ? -4.989  -1.226  -8.945  1.00 0.00 ? 21 GLU A HA   9  
ATOM 9255  H HB2  . GLU A 1 21 ? -4.992  -1.854  -6.296  1.00 0.00 ? 21 GLU A HB2  9  
ATOM 9256  H HB3  . GLU A 1 21 ? -5.274  -0.104  -6.204  1.00 0.00 ? 21 GLU A HB3  9  
ATOM 9257  H HG2  . GLU A 1 21 ? -7.339  -0.256  -7.234  1.00 0.00 ? 21 GLU A HG2  9  
ATOM 9258  H HG3  . GLU A 1 21 ? -6.858  -1.646  -8.226  1.00 0.00 ? 21 GLU A HG3  9  
ATOM 9259  N N    . VAL A 1 22 ? -3.262  1.303   -7.691  1.00 0.00 ? 22 VAL A N    9  
ATOM 9260  C CA   . VAL A 1 22 ? -2.947  2.711   -7.861  1.00 0.00 ? 22 VAL A CA   9  
ATOM 9261  C C    . VAL A 1 22 ? -2.206  2.907   -9.186  1.00 0.00 ? 22 VAL A C    9  
ATOM 9262  O O    . VAL A 1 22 ? -2.474  3.906   -9.870  1.00 0.00 ? 22 VAL A O    9  
ATOM 9263  C CB   . VAL A 1 22 ? -2.158  3.222   -6.654  1.00 0.00 ? 22 VAL A CB   9  
ATOM 9264  C CG1  . VAL A 1 22 ? -1.535  4.589   -6.944  1.00 0.00 ? 22 VAL A CG1  9  
ATOM 9265  C CG2  . VAL A 1 22 ? -3.042  3.275   -5.406  1.00 0.00 ? 22 VAL A CG2  9  
ATOM 9266  H H    . VAL A 1 22 ? -2.692  0.761   -7.041  1.00 0.00 ? 22 VAL A H    9  
ATOM 9267  H HA   . VAL A 1 22 ? -3.892  3.254   -7.900  1.00 0.00 ? 22 VAL A HA   9  
ATOM 9268  H HB   . VAL A 1 22 ? -1.362  2.495   -6.493  1.00 0.00 ? 22 VAL A HB   9  
ATOM 9269  H HG11 . VAL A 1 22 ? -2.317  5.309   -7.186  1.00 0.00 ? 22 VAL A HG11 9  
ATOM 9270  H HG12 . VAL A 1 22 ? -0.984  4.921   -6.065  1.00 0.00 ? 22 VAL A HG12 9  
ATOM 9271  H HG13 . VAL A 1 22 ? -0.849  4.513   -7.787  1.00 0.00 ? 22 VAL A HG13 9  
ATOM 9272  H HG21 . VAL A 1 22 ? -3.428  2.280   -5.180  1.00 0.00 ? 22 VAL A HG21 9  
ATOM 9273  H HG22 . VAL A 1 22 ? -2.449  3.642   -4.568  1.00 0.00 ? 22 VAL A HG22 9  
ATOM 9274  H HG23 . VAL A 1 22 ? -3.879  3.952   -5.572  1.00 0.00 ? 22 VAL A HG23 9  
ATOM 9275  N N    . ALA A 1 23 ? -1.303  1.967   -9.516  1.00 0.00 ? 23 ALA A N    9  
ATOM 9276  C CA   . ALA A 1 23 ? -0.533  2.036   -10.745 1.00 0.00 ? 23 ALA A CA   9  
ATOM 9277  C C    . ALA A 1 23 ? -1.473  1.864   -11.941 1.00 0.00 ? 23 ALA A C    9  
ATOM 9278  O O    . ALA A 1 23 ? -1.116  2.312   -13.040 1.00 0.00 ? 23 ALA A O    9  
ATOM 9279  C CB   . ALA A 1 23 ? 0.453   0.866   -10.803 1.00 0.00 ? 23 ALA A CB   9  
ATOM 9280  H H    . ALA A 1 23 ? -1.143  1.174   -8.894  1.00 0.00 ? 23 ALA A H    9  
ATOM 9281  H HA   . ALA A 1 23 ? -0.017  2.991   -10.835 1.00 0.00 ? 23 ALA A HA   9  
ATOM 9282  H HB1  . ALA A 1 23 ? 1.117   0.921   -9.941  1.00 0.00 ? 23 ALA A HB1  9  
ATOM 9283  H HB2  . ALA A 1 23 ? -0.090  -0.078  -10.773 1.00 0.00 ? 23 ALA A HB2  9  
ATOM 9284  H HB3  . ALA A 1 23 ? 1.033   0.914   -11.724 1.00 0.00 ? 23 ALA A HB3  9  
ATOM 9285  N N    . ARG A 1 24 ? -2.635  1.229   -11.707 1.00 0.00 ? 24 ARG A N    9  
ATOM 9286  C CA   . ARG A 1 24 ? -3.613  1.001   -12.757 1.00 0.00 ? 24 ARG A CA   9  
ATOM 9287  C C    . ARG A 1 24 ? -4.580  2.186   -12.812 1.00 0.00 ? 24 ARG A C    9  
ATOM 9288  O O    . ARG A 1 24 ? -5.119  2.458   -13.894 1.00 0.00 ? 24 ARG A O    9  
ATOM 9289  C CB   . ARG A 1 24 ? -4.407  -0.285  -12.519 1.00 0.00 ? 24 ARG A CB   9  
ATOM 9290  C CG   . ARG A 1 24 ? -3.704  -1.487  -13.153 1.00 0.00 ? 24 ARG A CG   9  
ATOM 9291  C CD   . ARG A 1 24 ? -4.228  -2.800  -12.568 1.00 0.00 ? 24 ARG A CD   9  
ATOM 9292  N NE   . ARG A 1 24 ? -3.203  -3.860  -12.703 1.00 0.00 ? 24 ARG A NE   9  
ATOM 9293  C CZ   . ARG A 1 24 ? -3.110  -4.690  -13.763 1.00 0.00 ? 24 ARG A CZ   9  
ATOM 9294  N NH1  . ARG A 1 24 ? -3.990  -4.566  -14.766 1.00 0.00 ? 24 ARG A NH1  9  
ATOM 9295  N NH2  . ARG A 1 24 ? -2.151  -5.627  -13.810 1.00 0.00 ? 24 ARG A NH2  9  
ATOM 9296  H H    . ARG A 1 24 ? -2.851  0.890   -10.770 1.00 0.00 ? 24 ARG A H    9  
ATOM 9297  H HA   . ARG A 1 24 ? -3.078  0.937   -13.704 1.00 0.00 ? 24 ARG A HA   9  
ATOM 9298  H HB2  . ARG A 1 24 ? -4.497  -0.452  -11.446 1.00 0.00 ? 24 ARG A HB2  9  
ATOM 9299  H HB3  . ARG A 1 24 ? -5.403  -0.170  -12.946 1.00 0.00 ? 24 ARG A HB3  9  
ATOM 9300  H HG2  . ARG A 1 24 ? -3.888  -1.479  -14.228 1.00 0.00 ? 24 ARG A HG2  9  
ATOM 9301  H HG3  . ARG A 1 24 ? -2.631  -1.403  -12.976 1.00 0.00 ? 24 ARG A HG3  9  
ATOM 9302  H HD2  . ARG A 1 24 ? -4.456  -2.660  -11.511 1.00 0.00 ? 24 ARG A HD2  9  
ATOM 9303  H HD3  . ARG A 1 24 ? -5.137  -3.093  -13.092 1.00 0.00 ? 24 ARG A HD3  9  
ATOM 9304  H HE   . ARG A 1 24 ? -2.541  -3.940  -11.931 1.00 0.00 ? 24 ARG A HE   9  
ATOM 9305  H HH11 . ARG A 1 24 ? -4.716  -3.851  -14.721 1.00 0.00 ? 24 ARG A HH11 9  
ATOM 9306  H HH12 . ARG A 1 24 ? -3.933  -5.187  -15.573 1.00 0.00 ? 24 ARG A HH12 9  
ATOM 9307  H HH21 . ARG A 1 24 ? -1.487  -5.714  -13.043 1.00 0.00 ? 24 ARG A HH21 9  
ATOM 9308  H HH22 . ARG A 1 24 ? -2.088  -6.251  -14.615 1.00 0.00 ? 24 ARG A HH22 9  
ATOM 9309  N N    . LEU A 1 25 ? -4.778  2.856   -11.662 1.00 0.00 ? 25 LEU A N    9  
ATOM 9310  C CA   . LEU A 1 25 ? -5.671  3.999   -11.580 1.00 0.00 ? 25 LEU A CA   9  
ATOM 9311  C C    . LEU A 1 25 ? -4.916  5.262   -11.999 1.00 0.00 ? 25 LEU A C    9  
ATOM 9312  O O    . LEU A 1 25 ? -5.526  6.128   -12.643 1.00 0.00 ? 25 LEU A O    9  
ATOM 9313  C CB   . LEU A 1 25 ? -6.299  4.091   -10.188 1.00 0.00 ? 25 LEU A CB   9  
ATOM 9314  C CG   . LEU A 1 25 ? -7.380  3.057   -9.870  1.00 0.00 ? 25 LEU A CG   9  
ATOM 9315  C CD1  . LEU A 1 25 ? -7.779  3.116   -8.394  1.00 0.00 ? 25 LEU A CD1  9  
ATOM 9316  C CD2  . LEU A 1 25 ? -8.587  3.224   -10.797 1.00 0.00 ? 25 LEU A CD2  9  
ATOM 9317  H H    . LEU A 1 25 ? -4.293  2.565   -10.812 1.00 0.00 ? 25 LEU A H    9  
ATOM 9318  H HA   . LEU A 1 25 ? -6.475  3.814   -12.292 1.00 0.00 ? 25 LEU A HA   9  
ATOM 9319  H HB2  . LEU A 1 25 ? -5.481  3.979   -9.475  1.00 0.00 ? 25 LEU A HB2  9  
ATOM 9320  H HB3  . LEU A 1 25 ? -6.708  5.097   -10.102 1.00 0.00 ? 25 LEU A HB3  9  
ATOM 9321  H HG   . LEU A 1 25 ? -6.916  2.090   -10.063 1.00 0.00 ? 25 LEU A HG   9  
ATOM 9322  H HD11 . LEU A 1 25 ? -8.157  4.110   -8.151  1.00 0.00 ? 25 LEU A HD11 9  
ATOM 9323  H HD12 . LEU A 1 25 ? -8.550  2.369   -8.204  1.00 0.00 ? 25 LEU A HD12 9  
ATOM 9324  H HD13 . LEU A 1 25 ? -6.915  2.902   -7.767  1.00 0.00 ? 25 LEU A HD13 9  
ATOM 9325  H HD21 . LEU A 1 25 ? -8.277  3.104   -11.835 1.00 0.00 ? 25 LEU A HD21 9  
ATOM 9326  H HD22 . LEU A 1 25 ? -9.335  2.474   -10.542 1.00 0.00 ? 25 LEU A HD22 9  
ATOM 9327  H HD23 . LEU A 1 25 ? -9.019  4.216   -10.668 1.00 0.00 ? 25 LEU A HD23 9  
ATOM 9328  N N    . LYS A 1 26 ? -3.625  5.341   -11.631 1.00 0.00 ? 26 LYS A N    9  
ATOM 9329  C CA   . LYS A 1 26 ? -2.797  6.488   -11.965 1.00 0.00 ? 26 LYS A CA   9  
ATOM 9330  C C    . LYS A 1 26 ? -2.764  6.661   -13.485 1.00 0.00 ? 26 LYS A C    9  
ATOM 9331  O O    . LYS A 1 26 ? -2.570  7.795   -13.946 1.00 0.00 ? 26 LYS A O    9  
ATOM 9332  C CB   . LYS A 1 26 ? -1.412  6.353   -11.330 1.00 0.00 ? 26 LYS A CB   9  
ATOM 9333  C CG   . LYS A 1 26 ? -1.263  7.293   -10.133 1.00 0.00 ? 26 LYS A CG   9  
ATOM 9334  C CD   . LYS A 1 26 ? -2.534  7.299   -9.280  1.00 0.00 ? 26 LYS A CD   9  
ATOM 9335  C CE   . LYS A 1 26 ? -3.374  8.547   -9.556  1.00 0.00 ? 26 LYS A CE   9  
ATOM 9336  N NZ   . LYS A 1 26 ? -3.553  9.331   -8.324  1.00 0.00 ? 26 LYS A NZ   9  
ATOM 9337  H H    . LYS A 1 26 ? -3.198  4.582   -11.100 1.00 0.00 ? 26 LYS A H    9  
ATOM 9338  H HA   . LYS A 1 26 ? -3.280  7.358   -11.520 1.00 0.00 ? 26 LYS A HA   9  
ATOM 9339  H HB2  . LYS A 1 26 ? -1.275  5.325   -10.994 1.00 0.00 ? 26 LYS A HB2  9  
ATOM 9340  H HB3  . LYS A 1 26 ? -0.656  6.584   -12.080 1.00 0.00 ? 26 LYS A HB3  9  
ATOM 9341  H HG2  . LYS A 1 26 ? -0.427  6.958   -9.522  1.00 0.00 ? 26 LYS A HG2  9  
ATOM 9342  H HG3  . LYS A 1 26 ? -1.056  8.299   -10.498 1.00 0.00 ? 26 LYS A HG3  9  
ATOM 9343  H HD2  . LYS A 1 26 ? -3.124  6.414   -9.518  1.00 0.00 ? 26 LYS A HD2  9  
ATOM 9344  H HD3  . LYS A 1 26 ? -2.253  7.266   -8.228  1.00 0.00 ? 26 LYS A HD3  9  
ATOM 9345  H HE2  . LYS A 1 26 ? -2.867  9.163   -10.299 1.00 0.00 ? 26 LYS A HE2  9  
ATOM 9346  H HE3  . LYS A 1 26 ? -4.345  8.246   -9.950  1.00 0.00 ? 26 LYS A HE3  9  
ATOM 9347  H HZ1  . LYS A 1 26 ? -2.644  9.614   -7.956  1.00 0.00 ? 26 LYS A HZ1  9  
ATOM 9348  H HZ2  . LYS A 1 26 ? -4.115  10.156  -8.534  1.00 0.00 ? 26 LYS A HZ2  9  
ATOM 9349  H HZ3  . LYS A 1 26 ? -4.036  8.771   -7.622  1.00 0.00 ? 26 LYS A HZ3  9  
ATOM 9350  N N    . LYS A 1 27 ? -2.948  5.550   -14.222 1.00 0.00 ? 27 LYS A N    9  
ATOM 9351  C CA   . LYS A 1 27 ? -2.938  5.578   -15.674 1.00 0.00 ? 27 LYS A CA   9  
ATOM 9352  C C    . LYS A 1 27 ? -4.292  6.081   -16.180 1.00 0.00 ? 27 LYS A C    9  
ATOM 9353  O O    . LYS A 1 27 ? -4.400  6.381   -17.378 1.00 0.00 ? 27 LYS A O    9  
ATOM 9354  C CB   . LYS A 1 27 ? -2.541  4.211   -16.235 1.00 0.00 ? 27 LYS A CB   9  
ATOM 9355  C CG   . LYS A 1 27 ? -1.538  4.359   -17.380 1.00 0.00 ? 27 LYS A CG   9  
ATOM 9356  C CD   . LYS A 1 27 ? -1.260  3.008   -18.043 1.00 0.00 ? 27 LYS A CD   9  
ATOM 9357  C CE   . LYS A 1 27 ? -2.539  2.412   -18.633 1.00 0.00 ? 27 LYS A CE   9  
ATOM 9358  N NZ   . LYS A 1 27 ? -2.251  1.728   -19.904 1.00 0.00 ? 27 LYS A NZ   9  
ATOM 9359  H H    . LYS A 1 27 ? -3.101  4.652   -13.762 1.00 0.00 ? 27 LYS A H    9  
ATOM 9360  H HA   . LYS A 1 27 ? -2.165  6.291   -15.964 1.00 0.00 ? 27 LYS A HA   9  
ATOM 9361  H HB2  . LYS A 1 27 ? -2.086  3.622   -15.439 1.00 0.00 ? 27 LYS A HB2  9  
ATOM 9362  H HB3  . LYS A 1 27 ? -3.436  3.701   -16.588 1.00 0.00 ? 27 LYS A HB3  9  
ATOM 9363  H HG2  . LYS A 1 27 ? -1.948  5.041   -18.125 1.00 0.00 ? 27 LYS A HG2  9  
ATOM 9364  H HG3  . LYS A 1 27 ? -0.611  4.778   -16.988 1.00 0.00 ? 27 LYS A HG3  9  
ATOM 9365  H HD2  . LYS A 1 27 ? -0.532  3.148   -18.843 1.00 0.00 ? 27 LYS A HD2  9  
ATOM 9366  H HD3  . LYS A 1 27 ? -0.843  2.329   -17.299 1.00 0.00 ? 27 LYS A HD3  9  
ATOM 9367  H HE2  . LYS A 1 27 ? -2.958  1.693   -17.929 1.00 0.00 ? 27 LYS A HE2  9  
ATOM 9368  H HE3  . LYS A 1 27 ? -3.263  3.211   -18.797 1.00 0.00 ? 27 LYS A HE3  9  
ATOM 9369  H HZ1  . LYS A 1 27 ? -1.574  0.981   -19.751 1.00 0.00 ? 27 LYS A HZ1  9  
ATOM 9370  H HZ2  . LYS A 1 27 ? -3.118  1.340   -20.276 1.00 0.00 ? 27 LYS A HZ2  9  
ATOM 9371  H HZ3  . LYS A 1 27 ? -1.867  2.391   -20.577 1.00 0.00 ? 27 LYS A HZ3  9  
ATOM 9372  N N    . LEU A 1 28 ? -5.281  6.161   -15.272 1.00 0.00 ? 28 LEU A N    9  
ATOM 9373  C CA   . LEU A 1 28 ? -6.613  6.622   -15.624 1.00 0.00 ? 28 LEU A CA   9  
ATOM 9374  C C    . LEU A 1 28 ? -6.833  8.021   -15.044 1.00 0.00 ? 28 LEU A C    9  
ATOM 9375  O O    . LEU A 1 28 ? -7.523  8.826   -15.689 1.00 0.00 ? 28 LEU A O    9  
ATOM 9376  C CB   . LEU A 1 28 ? -7.666  5.603   -15.186 1.00 0.00 ? 28 LEU A CB   9  
ATOM 9377  C CG   . LEU A 1 28 ? -8.694  5.202   -16.247 1.00 0.00 ? 28 LEU A CG   9  
ATOM 9378  C CD1  . LEU A 1 28 ? -8.196  4.013   -17.070 1.00 0.00 ? 28 LEU A CD1  9  
ATOM 9379  C CD2  . LEU A 1 28 ? -10.059 4.931   -15.614 1.00 0.00 ? 28 LEU A CD2  9  
ATOM 9380  H H    . LEU A 1 28 ? -5.108  5.894   -14.303 1.00 0.00 ? 28 LEU A H    9  
ATOM 9381  H HA   . LEU A 1 28 ? -6.643  6.681   -16.712 1.00 0.00 ? 28 LEU A HA   9  
ATOM 9382  H HB2  . LEU A 1 28 ? -7.121  4.715   -14.868 1.00 0.00 ? 28 LEU A HB2  9  
ATOM 9383  H HB3  . LEU A 1 28 ? -8.173  6.037   -14.324 1.00 0.00 ? 28 LEU A HB3  9  
ATOM 9384  H HG   . LEU A 1 28 ? -8.774  6.068   -16.905 1.00 0.00 ? 28 LEU A HG   9  
ATOM 9385  H HD11 . LEU A 1 28 ? -8.012  3.160   -16.416 1.00 0.00 ? 28 LEU A HD11 9  
ATOM 9386  H HD12 . LEU A 1 28 ? -8.951  3.755   -17.813 1.00 0.00 ? 28 LEU A HD12 9  
ATOM 9387  H HD13 . LEU A 1 28 ? -7.270  4.275   -17.581 1.00 0.00 ? 28 LEU A HD13 9  
ATOM 9388  H HD21 . LEU A 1 28 ? -10.414 5.823   -15.097 1.00 0.00 ? 28 LEU A HD21 9  
ATOM 9389  H HD22 . LEU A 1 28 ? -10.764 4.649   -16.395 1.00 0.00 ? 28 LEU A HD22 9  
ATOM 9390  H HD23 . LEU A 1 28 ? -9.980  4.113   -14.896 1.00 0.00 ? 28 LEU A HD23 9  
ATOM 9391  N N    . VAL A 1 29 ? -6.255  8.280   -13.858 1.00 0.00 ? 29 VAL A N    9  
ATOM 9392  C CA   . VAL A 1 29 ? -6.387  9.569   -13.200 1.00 0.00 ? 29 VAL A CA   9  
ATOM 9393  C C    . VAL A 1 29 ? -5.039  10.293  -13.231 1.00 0.00 ? 29 VAL A C    9  
ATOM 9394  O O    . VAL A 1 29 ? -4.958  11.360  -13.857 1.00 0.00 ? 29 VAL A O    9  
ATOM 9395  C CB   . VAL A 1 29 ? -6.931  9.380   -11.784 1.00 0.00 ? 29 VAL A CB   9  
ATOM 9396  C CG1  . VAL A 1 29 ? -7.400  10.712  -11.195 1.00 0.00 ? 29 VAL A CG1  9  
ATOM 9397  C CG2  . VAL A 1 29 ? -8.058  8.344   -11.763 1.00 0.00 ? 29 VAL A CG2  9  
ATOM 9398  H H    . VAL A 1 29 ? -5.702  7.559   -13.393 1.00 0.00 ? 29 VAL A H    9  
ATOM 9399  H HA   . VAL A 1 29 ? -7.114  10.151  -13.766 1.00 0.00 ? 29 VAL A HA   9  
ATOM 9400  H HB   . VAL A 1 29 ? -6.095  9.006   -11.193 1.00 0.00 ? 29 VAL A HB   9  
ATOM 9401  H HG11 . VAL A 1 29 ? -8.184  11.140  -11.821 1.00 0.00 ? 29 VAL A HG11 9  
ATOM 9402  H HG12 . VAL A 1 29 ? -7.781  10.540  -10.187 1.00 0.00 ? 29 VAL A HG12 9  
ATOM 9403  H HG13 . VAL A 1 29 ? -6.565  11.411  -11.144 1.00 0.00 ? 29 VAL A HG13 9  
ATOM 9404  H HG21 . VAL A 1 29 ? -7.689  7.387   -12.129 1.00 0.00 ? 29 VAL A HG21 9  
ATOM 9405  H HG22 . VAL A 1 29 ? -8.420  8.236   -10.740 1.00 0.00 ? 29 VAL A HG22 9  
ATOM 9406  H HG23 . VAL A 1 29 ? -8.879  8.676   -12.398 1.00 0.00 ? 29 VAL A HG23 9  
ATOM 9407  N N    . GLY A 1 30 ? -4.026  9.708   -12.568 1.00 0.00 ? 30 GLY A N    9  
ATOM 9408  C CA   . GLY A 1 30 ? -2.697  10.294  -12.519 1.00 0.00 ? 30 GLY A CA   9  
ATOM 9409  C C    . GLY A 1 30 ? -2.218  10.578  -13.945 1.00 0.00 ? 30 GLY A C    9  
ATOM 9410  O O    . GLY A 1 30 ? -1.174  11.228  -14.097 1.00 0.00 ? 30 GLY A O    9  
ATOM 9411  H H    . GLY A 1 30 ? -4.179  8.827   -12.077 1.00 0.00 ? 30 GLY A H    9  
ATOM 9412  H HA2  . GLY A 1 30 ? -2.726  11.229  -11.961 1.00 0.00 ? 30 GLY A HA2  9  
ATOM 9413  H HA3  . GLY A 1 30 ? -2.009  9.607   -12.026 1.00 0.00 ? 30 GLY A HA3  9  
ATOM 9414  N N    . GLU A 1 31 ? -2.979  10.096  -14.943 1.00 0.00 ? 31 GLU A N    9  
ATOM 9415  C CA   . GLU A 1 31 ? -2.635  10.298  -16.341 1.00 0.00 ? 31 GLU A CA   9  
ATOM 9416  C C    . GLU A 1 31 ? -2.556  11.799  -16.629 1.00 0.00 ? 31 GLU A C    9  
ATOM 9417  O O    . GLU A 1 31 ? -3.181  12.575  -15.894 1.00 0.00 ? 31 GLU A O    9  
ATOM 9418  C CB   . GLU A 1 31 ? -3.637  9.612   -17.271 1.00 0.00 ? 31 GLU A CB   9  
ATOM 9419  C CG   . GLU A 1 31 ? -2.918  8.816   -18.361 1.00 0.00 ? 31 GLU A CG   9  
ATOM 9420  C CD   . GLU A 1 31 ? -3.839  8.563   -19.555 1.00 0.00 ? 31 GLU A CD   9  
ATOM 9421  O OE1  . GLU A 1 31 ? -5.096  8.731   -19.318 1.00 0.00 ? 31 GLU A OE1  9  
ATOM 9422  O OE2  . GLU A 1 31 ? -3.362  8.223   -20.647 1.00 0.00 ? 31 GLU A OE2  9  
ATOM 9423  H H    . GLU A 1 31 ? -3.827  9.571   -14.730 1.00 0.00 ? 31 GLU A H    9  
ATOM 9424  H HA   . GLU A 1 31 ? -1.650  9.855   -16.492 1.00 0.00 ? 31 GLU A HA   9  
ATOM 9425  H HB2  . GLU A 1 31 ? -4.256  8.933   -16.686 1.00 0.00 ? 31 GLU A HB2  9  
ATOM 9426  H HB3  . GLU A 1 31 ? -4.275  10.371  -17.725 1.00 0.00 ? 31 GLU A HB3  9  
ATOM 9427  H HG2  . GLU A 1 31 ? -2.049  9.382   -18.698 1.00 0.00 ? 31 GLU A HG2  9  
ATOM 9428  H HG3  . GLU A 1 31 ? -2.582  7.867   -17.943 1.00 0.00 ? 31 GLU A HG3  9  
ATOM 9429  N N    . ARG A 1 32 ? -1.800  12.170  -17.678 1.00 0.00 ? 32 ARG A N    9  
ATOM 9430  C CA   . ARG A 1 32 ? -1.643  13.564  -18.058 1.00 0.00 ? 32 ARG A CA   9  
ATOM 9431  C C    . ARG A 1 32 ? -2.880  14.020  -18.835 1.00 0.00 ? 32 ARG A C    9  
ATOM 9432  O O    . ARG A 1 32 ? -3.247  13.409  -19.836 1.00 0.00 ? 32 ARG A O    9  
ATOM 9433  C CB   . ARG A 1 32 ? -0.400  13.776  -18.925 1.00 0.00 ? 32 ARG A CB   9  
ATOM 9434  C CG   . ARG A 1 32 ? 0.703   14.487  -18.138 1.00 0.00 ? 32 ARG A CG   9  
ATOM 9435  C CD   . ARG A 1 32 ? 1.078   13.698  -16.883 1.00 0.00 ? 32 ARG A CD   9  
ATOM 9436  N NE   . ARG A 1 32 ? 2.022   12.612  -17.230 1.00 0.00 ? 32 ARG A NE   9  
ATOM 9437  C CZ   . ARG A 1 32 ? 3.366   12.725  -17.155 1.00 0.00 ? 32 ARG A CZ   9  
ATOM 9438  N NH1  . ARG A 1 32 ? 3.898   13.883  -16.742 1.00 0.00 ? 32 ARG A NH1  9  
ATOM 9439  N NH2  . ARG A 1 32 ? 4.154   11.694  -17.489 1.00 0.00 ? 32 ARG A NH2  9  
ATOM 9440  H H    . ARG A 1 32 ? -1.317  11.465  -18.235 1.00 0.00 ? 32 ARG A H    9  
ATOM 9441  H HA   . ARG A 1 32 ? -1.561  14.153  -17.145 1.00 0.00 ? 32 ARG A HA   9  
ATOM 9442  H HB2  . ARG A 1 32 ? -0.030  12.805  -19.255 1.00 0.00 ? 32 ARG A HB2  9  
ATOM 9443  H HB3  . ARG A 1 32 ? -0.673  14.367  -19.799 1.00 0.00 ? 32 ARG A HB3  9  
ATOM 9444  H HG2  . ARG A 1 32 ? 1.584   14.585  -18.772 1.00 0.00 ? 32 ARG A HG2  9  
ATOM 9445  H HG3  . ARG A 1 32 ? 0.353   15.482  -17.861 1.00 0.00 ? 32 ARG A HG3  9  
ATOM 9446  H HD2  . ARG A 1 32 ? 1.552   14.363  -16.163 1.00 0.00 ? 32 ARG A HD2  9  
ATOM 9447  H HD3  . ARG A 1 32 ? 0.176   13.276  -16.436 1.00 0.00 ? 32 ARG A HD3  9  
ATOM 9448  H HE   . ARG A 1 32 ? 1.600   11.738  -17.543 1.00 0.00 ? 32 ARG A HE   9  
ATOM 9449  H HH11 . ARG A 1 32 ? 3.290   14.663  -16.491 1.00 0.00 ? 32 ARG A HH11 9  
ATOM 9450  H HH12 . ARG A 1 32 ? 4.911   13.985  -16.680 1.00 0.00 ? 32 ARG A HH12 9  
ATOM 9451  H HH21 . ARG A 1 32 ? 3.741   10.817  -17.801 1.00 0.00 ? 32 ARG A HH21 9  
ATOM 9452  H HH22 . ARG A 1 32 ? 5.168   11.788  -17.429 1.00 0.00 ? 32 ARG A HH22 9  
ATOM 9453  N N    . MET B 1 1  ? 16.425  -6.929  12.279  1.00 0.00 ? 1  MET B N    9  
ATOM 9454  C CA   . MET B 1 1  ? 15.134  -6.581  12.846  1.00 0.00 ? 1  MET B CA   9  
ATOM 9455  C C    . MET B 1 1  ? 15.032  -5.060  12.976  1.00 0.00 ? 1  MET B C    9  
ATOM 9456  O O    . MET B 1 1  ? 13.938  -4.521  12.754  1.00 0.00 ? 1  MET B O    9  
ATOM 9457  C CB   . MET B 1 1  ? 14.966  -7.224  14.223  1.00 0.00 ? 1  MET B CB   9  
ATOM 9458  C CG   . MET B 1 1  ? 13.528  -7.703  14.433  1.00 0.00 ? 1  MET B CG   9  
ATOM 9459  S SD   . MET B 1 1  ? 13.310  -8.286  16.140  1.00 0.00 ? 1  MET B SD   9  
ATOM 9460  C CE   . MET B 1 1  ? 11.840  -7.330  16.615  1.00 0.00 ? 1  MET B CE   9  
ATOM 9461  H H    . MET B 1 1  ? 16.996  -7.617  12.773  1.00 0.00 ? 1  MET B H    9  
ATOM 9462  H HA   . MET B 1 1  ? 14.348  -6.933  12.178  1.00 0.00 ? 1  MET B HA   9  
ATOM 9463  H HB2  . MET B 1 1  ? 15.639  -8.078  14.300  1.00 0.00 ? 1  MET B HB2  9  
ATOM 9464  H HB3  . MET B 1 1  ? 15.230  -6.495  14.989  1.00 0.00 ? 1  MET B HB3  9  
ATOM 9465  H HG2  . MET B 1 1  ? 12.841  -6.878  14.250  1.00 0.00 ? 1  MET B HG2  9  
ATOM 9466  H HG3  . MET B 1 1  ? 13.309  -8.509  13.734  1.00 0.00 ? 1  MET B HG3  9  
ATOM 9467  H HE1  . MET B 1 1  ? 11.010  -7.567  15.950  1.00 0.00 ? 1  MET B HE1  9  
ATOM 9468  H HE2  . MET B 1 1  ? 11.574  -7.574  17.644  1.00 0.00 ? 1  MET B HE2  9  
ATOM 9469  H HE3  . MET B 1 1  ? 12.054  -6.263  16.548  1.00 0.00 ? 1  MET B HE3  9  
ATOM 9470  N N    . ASP B 1 2  ? 16.156  -4.409  13.328  1.00 0.00 ? 2  ASP B N    9  
ATOM 9471  C CA   . ASP B 1 2  ? 16.193  -2.966  13.486  1.00 0.00 ? 2  ASP B CA   9  
ATOM 9472  C C    . ASP B 1 2  ? 15.507  -2.308  12.287  1.00 0.00 ? 2  ASP B C    9  
ATOM 9473  O O    . ASP B 1 2  ? 14.993  -1.191  12.441  1.00 0.00 ? 2  ASP B O    9  
ATOM 9474  C CB   . ASP B 1 2  ? 17.634  -2.454  13.545  1.00 0.00 ? 2  ASP B CB   9  
ATOM 9475  C CG   . ASP B 1 2  ? 18.629  -3.403  14.217  1.00 0.00 ? 2  ASP B CG   9  
ATOM 9476  O OD1  . ASP B 1 2  ? 18.922  -4.457  13.536  1.00 0.00 ? 2  ASP B OD1  9  
ATOM 9477  O OD2  . ASP B 1 2  ? 19.101  -3.146  15.336  1.00 0.00 ? 2  ASP B OD2  9  
ATOM 9478  H H    . ASP B 1 2  ? 17.017  -4.932  13.494  1.00 0.00 ? 2  ASP B H    9  
ATOM 9479  H HA   . ASP B 1 2  ? 15.655  -2.695  14.395  1.00 0.00 ? 2  ASP B HA   9  
ATOM 9480  H HB2  . ASP B 1 2  ? 17.950  -2.278  12.517  1.00 0.00 ? 2  ASP B HB2  9  
ATOM 9481  H HB3  . ASP B 1 2  ? 17.609  -1.504  14.078  1.00 0.00 ? 2  ASP B HB3  9  
ATOM 9482  N N    . ALA B 1 3  ? 15.512  -3.002  11.135  1.00 0.00 ? 3  ALA B N    9  
ATOM 9483  C CA   . ALA B 1 3  ? 14.895  -2.489  9.924   1.00 0.00 ? 3  ALA B CA   9  
ATOM 9484  C C    . ALA B 1 3  ? 13.543  -3.176  9.715   1.00 0.00 ? 3  ALA B C    9  
ATOM 9485  O O    . ALA B 1 3  ? 12.711  -2.628  8.977   1.00 0.00 ? 3  ALA B O    9  
ATOM 9486  C CB   . ALA B 1 3  ? 15.755  -2.858  8.713   1.00 0.00 ? 3  ALA B CB   9  
ATOM 9487  H H    . ALA B 1 3  ? 15.959  -3.918  11.094  1.00 0.00 ? 3  ALA B H    9  
ATOM 9488  H HA   . ALA B 1 3  ? 14.741  -1.412  9.986   1.00 0.00 ? 3  ALA B HA   9  
ATOM 9489  H HB1  . ALA B 1 3  ? 16.747  -2.427  8.838   1.00 0.00 ? 3  ALA B HB1  9  
ATOM 9490  H HB2  . ALA B 1 3  ? 15.845  -3.941  8.636   1.00 0.00 ? 3  ALA B HB2  9  
ATOM 9491  H HB3  . ALA B 1 3  ? 15.296  -2.476  7.801   1.00 0.00 ? 3  ALA B HB3  9  
ATOM 9492  N N    . ILE B 1 4  ? 13.354  -4.342  10.359  1.00 0.00 ? 4  ILE B N    9  
ATOM 9493  C CA   . ILE B 1 4  ? 12.115  -5.092  10.244  1.00 0.00 ? 4  ILE B CA   9  
ATOM 9494  C C    . ILE B 1 4  ? 11.018  -4.382  11.039  1.00 0.00 ? 4  ILE B C    9  
ATOM 9495  O O    . ILE B 1 4  ? 9.894   -4.277  10.527  1.00 0.00 ? 4  ILE B O    9  
ATOM 9496  C CB   . ILE B 1 4  ? 12.331  -6.549  10.661  1.00 0.00 ? 4  ILE B CB   9  
ATOM 9497  C CG1  . ILE B 1 4  ? 13.360  -7.231  9.756   1.00 0.00 ? 4  ILE B CG1  9  
ATOM 9498  C CG2  . ILE B 1 4  ? 11.004  -7.310  10.697  1.00 0.00 ? 4  ILE B CG2  9  
ATOM 9499  C CD1  . ILE B 1 4  ? 12.812  -8.546  9.199   1.00 0.00 ? 4  ILE B CD1  9  
ATOM 9500  H H    . ILE B 1 4  ? 14.093  -4.725  10.949  1.00 0.00 ? 4  ILE B H    9  
ATOM 9501  H HA   . ILE B 1 4  ? 11.848  -5.089  9.188   1.00 0.00 ? 4  ILE B HA   9  
ATOM 9502  H HB   . ILE B 1 4  ? 12.728  -6.499  11.675  1.00 0.00 ? 4  ILE B HB   9  
ATOM 9503  H HG12 . ILE B 1 4  ? 13.598  -6.566  8.927   1.00 0.00 ? 4  ILE B HG12 9  
ATOM 9504  H HG13 . ILE B 1 4  ? 14.265  -7.420  10.332  1.00 0.00 ? 4  ILE B HG13 9  
ATOM 9505  H HG21 . ILE B 1 4  ? 10.537  -7.291  9.712   1.00 0.00 ? 4  ILE B HG21 9  
ATOM 9506  H HG22 . ILE B 1 4  ? 11.196  -8.341  10.997  1.00 0.00 ? 4  ILE B HG22 9  
ATOM 9507  H HG23 . ILE B 1 4  ? 10.331  -6.850  11.420  1.00 0.00 ? 4  ILE B HG23 9  
ATOM 9508  H HD11 . ILE B 1 4  ? 11.905  -8.358  8.624   1.00 0.00 ? 4  ILE B HD11 9  
ATOM 9509  H HD12 . ILE B 1 4  ? 13.568  -9.005  8.562   1.00 0.00 ? 4  ILE B HD12 9  
ATOM 9510  H HD13 . ILE B 1 4  ? 12.578  -9.229  10.017  1.00 0.00 ? 4  ILE B HD13 9  
ATOM 9511  N N    . LYS B 1 5  ? 11.360  -3.915  12.253  1.00 0.00 ? 5  LYS B N    9  
ATOM 9512  C CA   . LYS B 1 5  ? 10.410  -3.221  13.107  1.00 0.00 ? 5  LYS B CA   9  
ATOM 9513  C C    . LYS B 1 5  ? 9.915   -1.962  12.393  1.00 0.00 ? 5  LYS B C    9  
ATOM 9514  O O    . LYS B 1 5  ? 8.756   -1.578  12.613  1.00 0.00 ? 5  LYS B O    9  
ATOM 9515  C CB   . LYS B 1 5  ? 11.027  -2.947  14.481  1.00 0.00 ? 5  LYS B CB   9  
ATOM 9516  C CG   . LYS B 1 5  ? 12.334  -2.165  14.349  1.00 0.00 ? 5  LYS B CG   9  
ATOM 9517  C CD   . LYS B 1 5  ? 13.420  -2.756  15.252  1.00 0.00 ? 5  LYS B CD   9  
ATOM 9518  C CE   . LYS B 1 5  ? 12.814  -3.323  16.537  1.00 0.00 ? 5  LYS B CE   9  
ATOM 9519  N NZ   . LYS B 1 5  ? 13.600  -2.900  17.708  1.00 0.00 ? 5  LYS B NZ   9  
ATOM 9520  H H    . LYS B 1 5  ? 12.311  -4.043  12.600  1.00 0.00 ? 5  LYS B H    9  
ATOM 9521  H HA   . LYS B 1 5  ? 9.572   -3.901  13.252  1.00 0.00 ? 5  LYS B HA   9  
ATOM 9522  H HB2  . LYS B 1 5  ? 10.322  -2.364  15.074  1.00 0.00 ? 5  LYS B HB2  9  
ATOM 9523  H HB3  . LYS B 1 5  ? 11.211  -3.898  14.981  1.00 0.00 ? 5  LYS B HB3  9  
ATOM 9524  H HG2  . LYS B 1 5  ? 12.671  -2.210  13.313  1.00 0.00 ? 5  LYS B HG2  9  
ATOM 9525  H HG3  . LYS B 1 5  ? 12.152  -1.125  14.618  1.00 0.00 ? 5  LYS B HG3  9  
ATOM 9526  H HD2  . LYS B 1 5  ? 13.929  -3.556  14.716  1.00 0.00 ? 5  LYS B HD2  9  
ATOM 9527  H HD3  . LYS B 1 5  ? 14.142  -1.975  15.493  1.00 0.00 ? 5  LYS B HD3  9  
ATOM 9528  H HE2  . LYS B 1 5  ? 11.794  -2.957  16.644  1.00 0.00 ? 5  LYS B HE2  9  
ATOM 9529  H HE3  . LYS B 1 5  ? 12.797  -4.411  16.475  1.00 0.00 ? 5  LYS B HE3  9  
ATOM 9530  H HZ1  . LYS B 1 5  ? 13.617  -1.882  17.767  1.00 0.00 ? 5  LYS B HZ1  9  
ATOM 9531  H HZ2  . LYS B 1 5  ? 13.178  -3.290  18.550  1.00 0.00 ? 5  LYS B HZ2  9  
ATOM 9532  H HZ3  . LYS B 1 5  ? 14.558  -3.243  17.626  1.00 0.00 ? 5  LYS B HZ3  9  
ATOM 9533  N N    . LYS B 1 6  ? 10.785  -1.356  11.566  1.00 0.00 ? 6  LYS B N    9  
ATOM 9534  C CA   . LYS B 1 6  ? 10.437  -0.153  10.829  1.00 0.00 ? 6  LYS B CA   9  
ATOM 9535  C C    . LYS B 1 6  ? 9.831   -0.543  9.480   1.00 0.00 ? 6  LYS B C    9  
ATOM 9536  O O    . LYS B 1 6  ? 9.033   0.239   8.942   1.00 0.00 ? 6  LYS B O    9  
ATOM 9537  C CB   . LYS B 1 6  ? 11.648  0.774   10.714  1.00 0.00 ? 6  LYS B CB   9  
ATOM 9538  C CG   . LYS B 1 6  ? 12.541  0.666   11.951  1.00 0.00 ? 6  LYS B CG   9  
ATOM 9539  C CD   . LYS B 1 6  ? 13.647  1.723   11.923  1.00 0.00 ? 6  LYS B CD   9  
ATOM 9540  C CE   . LYS B 1 6  ? 14.240  1.933   13.318  1.00 0.00 ? 6  LYS B CE   9  
ATOM 9541  N NZ   . LYS B 1 6  ? 15.524  2.647   13.231  1.00 0.00 ? 6  LYS B NZ   9  
ATOM 9542  H H    . LYS B 1 6  ? 11.721  -1.740  11.441  1.00 0.00 ? 6  LYS B H    9  
ATOM 9543  H HA   . LYS B 1 6  ? 9.681   0.365   11.421  1.00 0.00 ? 6  LYS B HA   9  
ATOM 9544  H HB2  . LYS B 1 6  ? 12.225  0.493   9.833   1.00 0.00 ? 6  LYS B HB2  9  
ATOM 9545  H HB3  . LYS B 1 6  ? 11.299  1.799   10.597  1.00 0.00 ? 6  LYS B HB3  9  
ATOM 9546  H HG2  . LYS B 1 6  ? 11.932  0.813   12.842  1.00 0.00 ? 6  LYS B HG2  9  
ATOM 9547  H HG3  . LYS B 1 6  ? 12.981  -0.331  11.983  1.00 0.00 ? 6  LYS B HG3  9  
ATOM 9548  H HD2  . LYS B 1 6  ? 14.437  1.393   11.249  1.00 0.00 ? 6  LYS B HD2  9  
ATOM 9549  H HD3  . LYS B 1 6  ? 13.231  2.660   11.552  1.00 0.00 ? 6  LYS B HD3  9  
ATOM 9550  H HE2  . LYS B 1 6  ? 13.546  2.523   13.918  1.00 0.00 ? 6  LYS B HE2  9  
ATOM 9551  H HE3  . LYS B 1 6  ? 14.385  0.964   13.795  1.00 0.00 ? 6  LYS B HE3  9  
ATOM 9552  H HZ1  . LYS B 1 6  ? 15.388  3.554   12.785  1.00 0.00 ? 6  LYS B HZ1  9  
ATOM 9553  H HZ2  . LYS B 1 6  ? 15.898  2.774   14.171  1.00 0.00 ? 6  LYS B HZ2  9  
ATOM 9554  H HZ3  . LYS B 1 6  ? 16.188  2.103   12.681  1.00 0.00 ? 6  LYS B HZ3  9  
ATOM 9555  N N    . LYS B 1 7  ? 10.214  -1.727  8.968   1.00 0.00 ? 7  LYS B N    9  
ATOM 9556  C CA   . LYS B 1 7  ? 9.711   -2.213  7.693   1.00 0.00 ? 7  LYS B CA   9  
ATOM 9557  C C    . LYS B 1 7  ? 8.182   -2.232  7.727   1.00 0.00 ? 7  LYS B C    9  
ATOM 9558  O O    . LYS B 1 7  ? 7.566   -1.687  6.800   1.00 0.00 ? 7  LYS B O    9  
ATOM 9559  C CB   . LYS B 1 7  ? 10.336  -3.568  7.354   1.00 0.00 ? 7  LYS B CB   9  
ATOM 9560  C CG   . LYS B 1 7  ? 9.863   -4.063  5.986   1.00 0.00 ? 7  LYS B CG   9  
ATOM 9561  C CD   . LYS B 1 7  ? 9.851   -2.923  4.964   1.00 0.00 ? 7  LYS B CD   9  
ATOM 9562  C CE   . LYS B 1 7  ? 10.008  -3.461  3.541   1.00 0.00 ? 7  LYS B CE   9  
ATOM 9563  N NZ   . LYS B 1 7  ? 9.160   -2.702  2.607   1.00 0.00 ? 7  LYS B NZ   9  
ATOM 9564  H H    . LYS B 1 7  ? 10.876  -2.313  9.476   1.00 0.00 ? 7  LYS B H    9  
ATOM 9565  H HA   . LYS B 1 7  ? 10.041  -1.500  6.938   1.00 0.00 ? 7  LYS B HA   9  
ATOM 9566  H HB2  . LYS B 1 7  ? 11.421  -3.463  7.337   1.00 0.00 ? 7  LYS B HB2  9  
ATOM 9567  H HB3  . LYS B 1 7  ? 10.061  -4.287  8.125   1.00 0.00 ? 7  LYS B HB3  9  
ATOM 9568  H HG2  . LYS B 1 7  ? 10.539  -4.843  5.638   1.00 0.00 ? 7  LYS B HG2  9  
ATOM 9569  H HG3  . LYS B 1 7  ? 8.861   -4.480  6.089   1.00 0.00 ? 7  LYS B HG3  9  
ATOM 9570  H HD2  . LYS B 1 7  ? 8.903   -2.391  5.040   1.00 0.00 ? 7  LYS B HD2  9  
ATOM 9571  H HD3  . LYS B 1 7  ? 10.664  -2.234  5.194   1.00 0.00 ? 7  LYS B HD3  9  
ATOM 9572  H HE2  . LYS B 1 7  ? 11.049  -3.364  3.235   1.00 0.00 ? 7  LYS B HE2  9  
ATOM 9573  H HE3  . LYS B 1 7  ? 9.729   -4.515  3.524   1.00 0.00 ? 7  LYS B HE3  9  
ATOM 9574  H HZ1  . LYS B 1 7  ? 9.421   -1.716  2.623   1.00 0.00 ? 7  LYS B HZ1  9  
ATOM 9575  H HZ2  . LYS B 1 7  ? 9.282   -3.079  1.667   1.00 0.00 ? 7  LYS B HZ2  9  
ATOM 9576  H HZ3  . LYS B 1 7  ? 8.180   -2.791  2.875   1.00 0.00 ? 7  LYS B HZ3  9  
ATOM 9577  N N    . MET B 1 8  ? 7.611   -2.849  8.777   1.00 0.00 ? 8  MET B N    9  
ATOM 9578  C CA   . MET B 1 8  ? 6.167   -2.938  8.925   1.00 0.00 ? 8  MET B CA   9  
ATOM 9579  C C    . MET B 1 8  ? 5.591   -1.531  9.104   1.00 0.00 ? 8  MET B C    9  
ATOM 9580  O O    . MET B 1 8  ? 4.417   -1.327  8.762   1.00 0.00 ? 8  MET B O    9  
ATOM 9581  C CB   . MET B 1 8  ? 5.808   -3.794  10.142  1.00 0.00 ? 8  MET B CB   9  
ATOM 9582  C CG   . MET B 1 8  ? 6.549   -3.310  11.390  1.00 0.00 ? 8  MET B CG   9  
ATOM 9583  S SD   . MET B 1 8  ? 5.364   -3.005  12.734  1.00 0.00 ? 8  MET B SD   9  
ATOM 9584  C CE   . MET B 1 8  ? 5.815   -4.354  13.865  1.00 0.00 ? 8  MET B CE   9  
ATOM 9585  H H    . MET B 1 8  ? 8.193   -3.274  9.498   1.00 0.00 ? 8  MET B H    9  
ATOM 9586  H HA   . MET B 1 8  ? 5.745   -3.382  8.024   1.00 0.00 ? 8  MET B HA   9  
ATOM 9587  H HB2  . MET B 1 8  ? 4.735   -3.727  10.317  1.00 0.00 ? 8  MET B HB2  9  
ATOM 9588  H HB3  . MET B 1 8  ? 6.071   -4.831  9.933   1.00 0.00 ? 8  MET B HB3  9  
ATOM 9589  H HG2  . MET B 1 8  ? 7.259   -4.073  11.709  1.00 0.00 ? 8  MET B HG2  9  
ATOM 9590  H HG3  . MET B 1 8  ? 7.092   -2.395  11.157  1.00 0.00 ? 8  MET B HG3  9  
ATOM 9591  H HE1  . MET B 1 8  ? 6.861   -4.260  14.158  1.00 0.00 ? 8  MET B HE1  9  
ATOM 9592  H HE2  . MET B 1 8  ? 5.176   -4.306  14.746  1.00 0.00 ? 8  MET B HE2  9  
ATOM 9593  H HE3  . MET B 1 8  ? 5.670   -5.315  13.372  1.00 0.00 ? 8  MET B HE3  9  
ATOM 9594  N N    . GLN B 1 9  ? 6.415   -0.605  9.626   1.00 0.00 ? 9  GLN B N    9  
ATOM 9595  C CA   . GLN B 1 9  ? 5.989   0.767   9.846   1.00 0.00 ? 9  GLN B CA   9  
ATOM 9596  C C    . GLN B 1 9  ? 6.057   1.535   8.524   1.00 0.00 ? 9  GLN B C    9  
ATOM 9597  O O    . GLN B 1 9  ? 5.345   2.542   8.390   1.00 0.00 ? 9  GLN B O    9  
ATOM 9598  C CB   . GLN B 1 9  ? 6.834   1.452   10.921  1.00 0.00 ? 9  GLN B CB   9  
ATOM 9599  C CG   . GLN B 1 9  ? 6.588   0.824   12.295  1.00 0.00 ? 9  GLN B CG   9  
ATOM 9600  C CD   . GLN B 1 9  ? 7.143   1.711   13.411  1.00 0.00 ? 9  GLN B CD   9  
ATOM 9601  O OE1  . GLN B 1 9  ? 6.737   2.846   13.598  1.00 0.00 ? 9  GLN B OE1  9  
ATOM 9602  N NE2  . GLN B 1 9  ? 8.094   1.132   14.139  1.00 0.00 ? 9  GLN B NE2  9  
ATOM 9603  H H    . GLN B 1 9  ? 7.369   -0.857  9.881   1.00 0.00 ? 9  GLN B H    9  
ATOM 9604  H HA   . GLN B 1 9  ? 4.953   0.729   10.181  1.00 0.00 ? 9  GLN B HA   9  
ATOM 9605  H HB2  . GLN B 1 9  ? 7.889   1.344   10.666  1.00 0.00 ? 9  GLN B HB2  9  
ATOM 9606  H HB3  . GLN B 1 9  ? 6.582   2.512   10.947  1.00 0.00 ? 9  GLN B HB3  9  
ATOM 9607  H HG2  . GLN B 1 9  ? 5.515   0.702   12.440  1.00 0.00 ? 9  GLN B HG2  9  
ATOM 9608  H HG3  . GLN B 1 9  ? 7.064   -0.156  12.326  1.00 0.00 ? 9  GLN B HG3  9  
ATOM 9609  H HE21 . GLN B 1 9  ? 8.389   0.179   13.928  1.00 0.00 ? 9  GLN B HE21 9  
ATOM 9610  H HE22 . GLN B 1 9  ? 8.529   1.642   14.908  1.00 0.00 ? 9  GLN B HE22 9  
ATOM 9611  N N    . MET B 1 10 ? 6.896   1.055   7.590   1.00 0.00 ? 10 MET B N    9  
ATOM 9612  C CA   . MET B 1 10 ? 7.053   1.692   6.294   1.00 0.00 ? 10 MET B CA   9  
ATOM 9613  C C    . MET B 1 10 ? 5.907   1.260   5.376   1.00 0.00 ? 10 MET B C    9  
ATOM 9614  O O    . MET B 1 10 ? 5.373   2.117   4.656   1.00 0.00 ? 10 MET B O    9  
ATOM 9615  C CB   . MET B 1 10 ? 8.389   1.296   5.663   1.00 0.00 ? 10 MET B CB   9  
ATOM 9616  C CG   . MET B 1 10 ? 9.544   1.512   6.643   1.00 0.00 ? 10 MET B CG   9  
ATOM 9617  S SD   . MET B 1 10 ? 10.777  2.631   5.915   1.00 0.00 ? 10 MET B SD   9  
ATOM 9618  C CE   . MET B 1 10 ? 11.326  1.620   4.507   1.00 0.00 ? 10 MET B CE   9  
ATOM 9619  H H    . MET B 1 10 ? 7.448   0.218   7.782   1.00 0.00 ? 10 MET B H    9  
ATOM 9620  H HA   . MET B 1 10 ? 7.014   2.773   6.424   1.00 0.00 ? 10 MET B HA   9  
ATOM 9621  H HB2  . MET B 1 10 ? 8.351   0.242   5.386   1.00 0.00 ? 10 MET B HB2  9  
ATOM 9622  H HB3  . MET B 1 10 ? 8.547   1.893   4.765   1.00 0.00 ? 10 MET B HB3  9  
ATOM 9623  H HG2  . MET B 1 10 ? 9.161   1.956   7.562   1.00 0.00 ? 10 MET B HG2  9  
ATOM 9624  H HG3  . MET B 1 10 ? 10.004  0.553   6.878   1.00 0.00 ? 10 MET B HG3  9  
ATOM 9625  H HE1  . MET B 1 10 ? 10.481  1.398   3.856   1.00 0.00 ? 10 MET B HE1  9  
ATOM 9626  H HE2  . MET B 1 10 ? 12.089  2.168   3.954   1.00 0.00 ? 10 MET B HE2  9  
ATOM 9627  H HE3  . MET B 1 10 ? 11.753  0.683   4.867   1.00 0.00 ? 10 MET B HE3  9  
ATOM 9628  N N    . LEU B 1 11 ? 5.557   -0.038  5.420   1.00 0.00 ? 11 LEU B N    9  
ATOM 9629  C CA   . LEU B 1 11 ? 4.485   -0.575  4.599   1.00 0.00 ? 11 LEU B CA   9  
ATOM 9630  C C    . LEU B 1 11 ? 3.138   -0.211  5.225   1.00 0.00 ? 11 LEU B C    9  
ATOM 9631  O O    . LEU B 1 11 ? 2.141   -0.157  4.489   1.00 0.00 ? 11 LEU B O    9  
ATOM 9632  C CB   . LEU B 1 11 ? 4.677   -2.077  4.382   1.00 0.00 ? 11 LEU B CB   9  
ATOM 9633  C CG   . LEU B 1 11 ? 5.958   -2.492  3.656   1.00 0.00 ? 11 LEU B CG   9  
ATOM 9634  C CD1  . LEU B 1 11 ? 6.475   -3.835  4.179   1.00 0.00 ? 11 LEU B CD1  9  
ATOM 9635  C CD2  . LEU B 1 11 ? 5.748   -2.510  2.141   1.00 0.00 ? 11 LEU B CD2  9  
ATOM 9636  H H    . LEU B 1 11 ? 6.050   -0.678  6.043   1.00 0.00 ? 11 LEU B H    9  
ATOM 9637  H HA   . LEU B 1 11 ? 4.567   -0.089  3.627   1.00 0.00 ? 11 LEU B HA   9  
ATOM 9638  H HB2  . LEU B 1 11 ? 4.667   -2.534  5.372   1.00 0.00 ? 11 LEU B HB2  9  
ATOM 9639  H HB3  . LEU B 1 11 ? 3.805   -2.419  3.825   1.00 0.00 ? 11 LEU B HB3  9  
ATOM 9640  H HG   . LEU B 1 11 ? 6.688   -1.722  3.904   1.00 0.00 ? 11 LEU B HG   9  
ATOM 9641  H HD11 . LEU B 1 11 ? 5.719   -4.607  4.032   1.00 0.00 ? 11 LEU B HD11 9  
ATOM 9642  H HD12 . LEU B 1 11 ? 7.385   -4.099  3.640   1.00 0.00 ? 11 LEU B HD12 9  
ATOM 9643  H HD13 . LEU B 1 11 ? 6.700   -3.757  5.243   1.00 0.00 ? 11 LEU B HD13 9  
ATOM 9644  H HD21 . LEU B 1 11 ? 5.451   -1.520  1.795   1.00 0.00 ? 11 LEU B HD21 9  
ATOM 9645  H HD22 . LEU B 1 11 ? 6.678   -2.808  1.658   1.00 0.00 ? 11 LEU B HD22 9  
ATOM 9646  H HD23 . LEU B 1 11 ? 4.967   -3.225  1.883   1.00 0.00 ? 11 LEU B HD23 9  
ATOM 9647  N N    . LYS B 1 12 ? 3.133   0.027   6.549   1.00 0.00 ? 12 LYS B N    9  
ATOM 9648  C CA   . LYS B 1 12 ? 1.919   0.381   7.264   1.00 0.00 ? 12 LYS B CA   9  
ATOM 9649  C C    . LYS B 1 12 ? 1.566   1.840   6.967   1.00 0.00 ? 12 LYS B C    9  
ATOM 9650  O O    . LYS B 1 12 ? 0.368   2.160   6.923   1.00 0.00 ? 12 LYS B O    9  
ATOM 9651  C CB   . LYS B 1 12 ? 2.067   0.075   8.756   1.00 0.00 ? 12 LYS B CB   9  
ATOM 9652  C CG   . LYS B 1 12 ? 1.060   0.877   9.582   1.00 0.00 ? 12 LYS B CG   9  
ATOM 9653  C CD   . LYS B 1 12 ? 1.626   2.249   9.956   1.00 0.00 ? 12 LYS B CD   9  
ATOM 9654  C CE   . LYS B 1 12 ? 1.295   2.601   11.408  1.00 0.00 ? 12 LYS B CE   9  
ATOM 9655  N NZ   . LYS B 1 12 ? 2.240   1.944   12.326  1.00 0.00 ? 12 LYS B NZ   9  
ATOM 9656  H H    . LYS B 1 12 ? 4.001   -0.039  7.082   1.00 0.00 ? 12 LYS B H    9  
ATOM 9657  H HA   . LYS B 1 12 ? 1.131   -0.261  6.872   1.00 0.00 ? 12 LYS B HA   9  
ATOM 9658  H HB2  . LYS B 1 12 ? 1.892   -0.988  8.917   1.00 0.00 ? 12 LYS B HB2  9  
ATOM 9659  H HB3  . LYS B 1 12 ? 3.082   0.319   9.068   1.00 0.00 ? 12 LYS B HB3  9  
ATOM 9660  H HG2  . LYS B 1 12 ? 0.151   1.016   8.996   1.00 0.00 ? 12 LYS B HG2  9  
ATOM 9661  H HG3  . LYS B 1 12 ? 0.817   0.317   10.485  1.00 0.00 ? 12 LYS B HG3  9  
ATOM 9662  H HD2  . LYS B 1 12 ? 2.709   2.231   9.833   1.00 0.00 ? 12 LYS B HD2  9  
ATOM 9663  H HD3  . LYS B 1 12 ? 1.206   3.000   9.286   1.00 0.00 ? 12 LYS B HD3  9  
ATOM 9664  H HE2  . LYS B 1 12 ? 1.366   3.681   11.540  1.00 0.00 ? 12 LYS B HE2  9  
ATOM 9665  H HE3  . LYS B 1 12 ? 0.278   2.283   11.630  1.00 0.00 ? 12 LYS B HE3  9  
ATOM 9666  H HZ1  . LYS B 1 12 ? 3.193   2.243   12.116  1.00 0.00 ? 12 LYS B HZ1  9  
ATOM 9667  H HZ2  . LYS B 1 12 ? 1.999   2.194   13.285  1.00 0.00 ? 12 LYS B HZ2  9  
ATOM 9668  H HZ3  . LYS B 1 12 ? 2.179   0.931   12.221  1.00 0.00 ? 12 LYS B HZ3  9  
ATOM 9669  N N    . LEU B 1 13 ? 2.597   2.682   6.774   1.00 0.00 ? 13 LEU B N    9  
ATOM 9670  C CA   . LEU B 1 13 ? 2.396   4.092   6.485   1.00 0.00 ? 13 LEU B CA   9  
ATOM 9671  C C    . LEU B 1 13 ? 1.957   4.253   5.028   1.00 0.00 ? 13 LEU B C    9  
ATOM 9672  O O    . LEU B 1 13 ? 1.025   5.029   4.774   1.00 0.00 ? 13 LEU B O    9  
ATOM 9673  C CB   . LEU B 1 13 ? 3.647   4.896   6.842   1.00 0.00 ? 13 LEU B CB   9  
ATOM 9674  C CG   . LEU B 1 13 ? 3.446   6.401   7.035   1.00 0.00 ? 13 LEU B CG   9  
ATOM 9675  C CD1  . LEU B 1 13 ? 4.733   7.169   6.734   1.00 0.00 ? 13 LEU B CD1  9  
ATOM 9676  C CD2  . LEU B 1 13 ? 2.267   6.908   6.202   1.00 0.00 ? 13 LEU B CD2  9  
ATOM 9677  H H    . LEU B 1 13 ? 3.554   2.337   6.829   1.00 0.00 ? 13 LEU B H    9  
ATOM 9678  H HA   . LEU B 1 13 ? 1.589   4.430   7.137   1.00 0.00 ? 13 LEU B HA   9  
ATOM 9679  H HB2  . LEU B 1 13 ? 4.034   4.468   7.767   1.00 0.00 ? 13 LEU B HB2  9  
ATOM 9680  H HB3  . LEU B 1 13 ? 4.364   4.717   6.042   1.00 0.00 ? 13 LEU B HB3  9  
ATOM 9681  H HG   . LEU B 1 13 ? 3.211   6.523   8.093   1.00 0.00 ? 13 LEU B HG   9  
ATOM 9682  H HD11 . LEU B 1 13 ? 5.045   6.984   5.706   1.00 0.00 ? 13 LEU B HD11 9  
ATOM 9683  H HD12 . LEU B 1 13 ? 4.553   8.234   6.881   1.00 0.00 ? 13 LEU B HD12 9  
ATOM 9684  H HD13 . LEU B 1 13 ? 5.526   6.846   7.408   1.00 0.00 ? 13 LEU B HD13 9  
ATOM 9685  H HD21 . LEU B 1 13 ? 1.354   6.389   6.495   1.00 0.00 ? 13 LEU B HD21 9  
ATOM 9686  H HD22 . LEU B 1 13 ? 2.153   7.980   6.364   1.00 0.00 ? 13 LEU B HD22 9  
ATOM 9687  H HD23 . LEU B 1 13 ? 2.455   6.726   5.145   1.00 0.00 ? 13 LEU B HD23 9  
ATOM 9688  N N    . ASP B 1 14 ? 2.628   3.527   4.115   1.00 0.00 ? 14 ASP B N    9  
ATOM 9689  C CA   . ASP B 1 14 ? 2.309   3.589   2.698   1.00 0.00 ? 14 ASP B CA   9  
ATOM 9690  C C    . ASP B 1 14 ? 0.889   3.066   2.476   1.00 0.00 ? 14 ASP B C    9  
ATOM 9691  O O    . ASP B 1 14 ? 0.211   3.567   1.566   1.00 0.00 ? 14 ASP B O    9  
ATOM 9692  C CB   . ASP B 1 14 ? 3.267   2.719   1.880   1.00 0.00 ? 14 ASP B CB   9  
ATOM 9693  C CG   . ASP B 1 14 ? 3.746   3.343   0.568   1.00 0.00 ? 14 ASP B CG   9  
ATOM 9694  O OD1  . ASP B 1 14 ? 3.984   4.610   0.622   1.00 0.00 ? 14 ASP B OD1  9  
ATOM 9695  O OD2  . ASP B 1 14 ? 3.886   2.654   -0.453  1.00 0.00 ? 14 ASP B OD2  9  
ATOM 9696  H H    . ASP B 1 14 ? 3.385   2.911   4.409   1.00 0.00 ? 14 ASP B H    9  
ATOM 9697  H HA   . ASP B 1 14 ? 2.361   4.627   2.368   1.00 0.00 ? 14 ASP B HA   9  
ATOM 9698  H HB2  . ASP B 1 14 ? 4.131   2.516   2.513   1.00 0.00 ? 14 ASP B HB2  9  
ATOM 9699  H HB3  . ASP B 1 14 ? 2.747   1.783   1.678   1.00 0.00 ? 14 ASP B HB3  9  
ATOM 9700  N N    . ASN B 1 15 ? 0.472   2.086   3.297   1.00 0.00 ? 15 ASN B N    9  
ATOM 9701  C CA   . ASN B 1 15 ? -0.854  1.503   3.190   1.00 0.00 ? 15 ASN B CA   9  
ATOM 9702  C C    . ASN B 1 15 ? -1.905  2.591   3.422   1.00 0.00 ? 15 ASN B C    9  
ATOM 9703  O O    . ASN B 1 15 ? -2.827  2.705   2.601   1.00 0.00 ? 15 ASN B O    9  
ATOM 9704  C CB   . ASN B 1 15 ? -1.064  0.413   4.243   1.00 0.00 ? 15 ASN B CB   9  
ATOM 9705  C CG   . ASN B 1 15 ? -2.129  -0.589  3.791   1.00 0.00 ? 15 ASN B CG   9  
ATOM 9706  O OD1  . ASN B 1 15 ? -3.316  -0.408  4.000   1.00 0.00 ? 15 ASN B OD1  9  
ATOM 9707  N ND2  . ASN B 1 15 ? -1.637  -1.653  3.162   1.00 0.00 ? 15 ASN B ND2  9  
ATOM 9708  H H    . ASN B 1 15 ? 1.095   1.729   4.022   1.00 0.00 ? 15 ASN B H    9  
ATOM 9709  H HA   . ASN B 1 15 ? -0.983  1.094   2.189   1.00 0.00 ? 15 ASN B HA   9  
ATOM 9710  H HB2  . ASN B 1 15 ? -0.122  -0.115  4.397   1.00 0.00 ? 15 ASN B HB2  9  
ATOM 9711  H HB3  . ASN B 1 15 ? -1.367  0.880   5.180   1.00 0.00 ? 15 ASN B HB3  9  
ATOM 9712  H HD21 . ASN B 1 15 ? -0.631  -1.742  3.020   1.00 0.00 ? 15 ASN B HD21 9  
ATOM 9713  H HD22 . ASN B 1 15 ? -2.267  -2.380  2.821   1.00 0.00 ? 15 ASN B HD22 9  
ATOM 9714  N N    . TYR B 1 16 ? -1.747  3.357   4.516   1.00 0.00 ? 16 TYR B N    9  
ATOM 9715  C CA   . TYR B 1 16 ? -2.713  4.406   4.795   1.00 0.00 ? 16 TYR B CA   9  
ATOM 9716  C C    . TYR B 1 16 ? -2.732  5.399   3.632   1.00 0.00 ? 16 TYR B C    9  
ATOM 9717  O O    . TYR B 1 16 ? -3.821  5.895   3.307   1.00 0.00 ? 16 TYR B O    9  
ATOM 9718  C CB   . TYR B 1 16 ? -2.376  5.094   6.130   1.00 0.00 ? 16 TYR B CB   9  
ATOM 9719  C CG   . TYR B 1 16 ? -2.157  4.140   7.296   1.00 0.00 ? 16 TYR B CG   9  
ATOM 9720  C CD1  . TYR B 1 16 ? -2.803  2.883   7.322   1.00 0.00 ? 16 TYR B CD1  9  
ATOM 9721  C CD2  . TYR B 1 16 ? -1.307  4.511   8.363   1.00 0.00 ? 16 TYR B CD2  9  
ATOM 9722  C CE1  . TYR B 1 16 ? -2.598  2.002   8.406   1.00 0.00 ? 16 TYR B CE1  9  
ATOM 9723  C CE2  . TYR B 1 16 ? -1.103  3.630   9.447   1.00 0.00 ? 16 TYR B CE2  9  
ATOM 9724  C CZ   . TYR B 1 16 ? -1.748  2.375   9.469   1.00 0.00 ? 16 TYR B CZ   9  
ATOM 9725  O OH   . TYR B 1 16 ? -1.547  1.525   10.520  1.00 0.00 ? 16 TYR B OH   9  
ATOM 9726  H H    . TYR B 1 16 ? -0.971  3.212   5.146   1.00 0.00 ? 16 TYR B H    9  
ATOM 9727  H HA   . TYR B 1 16 ? -3.701  3.948   4.867   1.00 0.00 ? 16 TYR B HA   9  
ATOM 9728  H HB2  . TYR B 1 16 ? -1.488  5.717   5.998   1.00 0.00 ? 16 TYR B HB2  9  
ATOM 9729  H HB3  . TYR B 1 16 ? -3.196  5.763   6.399   1.00 0.00 ? 16 TYR B HB3  9  
ATOM 9730  H HD1  . TYR B 1 16 ? -3.457  2.589   6.514   1.00 0.00 ? 16 TYR B HD1  9  
ATOM 9731  H HD2  . TYR B 1 16 ? -0.811  5.470   8.354   1.00 0.00 ? 16 TYR B HD2  9  
ATOM 9732  H HE1  . TYR B 1 16 ? -3.096  1.042   8.418   1.00 0.00 ? 16 TYR B HE1  9  
ATOM 9733  H HE2  . TYR B 1 16 ? -0.451  3.922   10.259  1.00 0.00 ? 16 TYR B HE2  9  
ATOM 9734  H HH   . TYR B 1 16 ? -1.998  0.683   10.424  1.00 0.00 ? 16 TYR B HH   9  
ATOM 9735  N N    . HIS B 1 17 ? -1.554  5.672   3.042   1.00 0.00 ? 17 HIS B N    9  
ATOM 9736  C CA   . HIS B 1 17 ? -1.446  6.605   1.934   1.00 0.00 ? 17 HIS B CA   9  
ATOM 9737  C C    . HIS B 1 17 ? -2.063  5.978   0.682   1.00 0.00 ? 17 HIS B C    9  
ATOM 9738  O O    . HIS B 1 17 ? -2.738  6.699   -0.067  1.00 0.00 ? 17 HIS B O    9  
ATOM 9739  C CB   . HIS B 1 17 ? 0.006   7.040   1.725   1.00 0.00 ? 17 HIS B CB   9  
ATOM 9740  C CG   . HIS B 1 17 ? 0.484   6.923   0.297   1.00 0.00 ? 17 HIS B CG   9  
ATOM 9741  N ND1  . HIS B 1 17 ? 0.397   7.966   -0.609  1.00 0.00 ? 17 HIS B ND1  9  
ATOM 9742  C CD2  . HIS B 1 17 ? 1.051   5.878   -0.371  1.00 0.00 ? 17 HIS B CD2  9  
ATOM 9743  C CE1  . HIS B 1 17 ? 0.894   7.554   -1.768  1.00 0.00 ? 17 HIS B CE1  9  
ATOM 9744  N NE2  . HIS B 1 17 ? 1.298   6.261   -1.617  1.00 0.00 ? 17 HIS B NE2  9  
ATOM 9745  H H    . HIS B 1 17 ? -0.702  5.217   3.371   1.00 0.00 ? 17 HIS B H    9  
ATOM 9746  H HA   . HIS B 1 17 ? -2.024  7.485   2.213   1.00 0.00 ? 17 HIS B HA   9  
ATOM 9747  H HB2  . HIS B 1 17 ? 0.085   8.080   2.042   1.00 0.00 ? 17 HIS B HB2  9  
ATOM 9748  H HB3  . HIS B 1 17 ? 0.627   6.424   2.376   1.00 0.00 ? 17 HIS B HB3  9  
ATOM 9749  H HD1  . HIS B 1 17 ? 0.039   8.916   -0.517  1.00 0.00 ? 17 HIS B HD1  9  
ATOM 9750  H HD2  . HIS B 1 17 ? 1.304   4.877   -0.052  1.00 0.00 ? 17 HIS B HD2  9  
ATOM 9751  H HE1  . HIS B 1 17 ? 0.918   8.226   -2.613  1.00 0.00 ? 17 HIS B HE1  9  
ATOM 9752  N N    . LEU B 1 18 ? -1.822  4.670   0.483   1.00 0.00 ? 18 LEU B N    9  
ATOM 9753  C CA   . LEU B 1 18 ? -2.351  3.956   -0.668  1.00 0.00 ? 18 LEU B CA   9  
ATOM 9754  C C    . LEU B 1 18 ? -3.874  3.861   -0.547  1.00 0.00 ? 18 LEU B C    9  
ATOM 9755  O O    . LEU B 1 18 ? -4.555  3.982   -1.576  1.00 0.00 ? 18 LEU B O    9  
ATOM 9756  C CB   . LEU B 1 18 ? -1.660  2.600   -0.821  1.00 0.00 ? 18 LEU B CB   9  
ATOM 9757  C CG   . LEU B 1 18 ? -0.214  2.636   -1.318  1.00 0.00 ? 18 LEU B CG   9  
ATOM 9758  C CD1  . LEU B 1 18 ? 0.428   1.251   -1.238  1.00 0.00 ? 18 LEU B CD1  9  
ATOM 9759  C CD2  . LEU B 1 18 ? -0.134  3.224   -2.729  1.00 0.00 ? 18 LEU B CD2  9  
ATOM 9760  H H    . LEU B 1 18 ? -1.254  4.148   1.150   1.00 0.00 ? 18 LEU B H    9  
ATOM 9761  H HA   . LEU B 1 18 ? -2.101  4.554   -1.544  1.00 0.00 ? 18 LEU B HA   9  
ATOM 9762  H HB2  . LEU B 1 18 ? -1.685  2.129   0.162   1.00 0.00 ? 18 LEU B HB2  9  
ATOM 9763  H HB3  . LEU B 1 18 ? -2.276  2.020   -1.509  1.00 0.00 ? 18 LEU B HB3  9  
ATOM 9764  H HG   . LEU B 1 18 ? 0.308   3.299   -0.628  1.00 0.00 ? 18 LEU B HG   9  
ATOM 9765  H HD11 . LEU B 1 18 ? -0.137  0.543   -1.845  1.00 0.00 ? 18 LEU B HD11 9  
ATOM 9766  H HD12 . LEU B 1 18 ? 1.456   1.313   -1.599  1.00 0.00 ? 18 LEU B HD12 9  
ATOM 9767  H HD13 . LEU B 1 18 ? 0.437   0.904   -0.205  1.00 0.00 ? 18 LEU B HD13 9  
ATOM 9768  H HD21 . LEU B 1 18 ? -0.534  4.238   -2.732  1.00 0.00 ? 18 LEU B HD21 9  
ATOM 9769  H HD22 . LEU B 1 18 ? 0.907   3.235   -3.050  1.00 0.00 ? 18 LEU B HD22 9  
ATOM 9770  H HD23 . LEU B 1 18 ? -0.713  2.611   -3.420  1.00 0.00 ? 18 LEU B HD23 9  
ATOM 9771  N N    . GLU B 1 19 ? -4.368  3.648   0.686   1.00 0.00 ? 19 GLU B N    9  
ATOM 9772  C CA   . GLU B 1 19 ? -5.795  3.538   0.934   1.00 0.00 ? 19 GLU B CA   9  
ATOM 9773  C C    . GLU B 1 19 ? -6.464  4.885   0.650   1.00 0.00 ? 19 GLU B C    9  
ATOM 9774  O O    . GLU B 1 19 ? -7.429  4.912   -0.129  1.00 0.00 ? 19 GLU B O    9  
ATOM 9775  C CB   . GLU B 1 19 ? -6.083  3.074   2.363   1.00 0.00 ? 19 GLU B CB   9  
ATOM 9776  C CG   . GLU B 1 19 ? -7.166  1.994   2.383   1.00 0.00 ? 19 GLU B CG   9  
ATOM 9777  C CD   . GLU B 1 19 ? -8.532  2.582   2.022   1.00 0.00 ? 19 GLU B CD   9  
ATOM 9778  O OE1  . GLU B 1 19 ? -8.843  3.717   2.413   1.00 0.00 ? 19 GLU B OE1  9  
ATOM 9779  O OE2  . GLU B 1 19 ? -9.284  1.815   1.306   1.00 0.00 ? 19 GLU B OE2  9  
ATOM 9780  H H    . GLU B 1 19 ? -3.735  3.559   1.480   1.00 0.00 ? 19 GLU B H    9  
ATOM 9781  H HA   . GLU B 1 19 ? -6.183  2.795   0.237   1.00 0.00 ? 19 GLU B HA   9  
ATOM 9782  H HB2  . GLU B 1 19 ? -5.168  2.668   2.794   1.00 0.00 ? 19 GLU B HB2  9  
ATOM 9783  H HB3  . GLU B 1 19 ? -6.402  3.933   2.956   1.00 0.00 ? 19 GLU B HB3  9  
ATOM 9784  H HG2  . GLU B 1 19 ? -6.909  1.222   1.658   1.00 0.00 ? 19 GLU B HG2  9  
ATOM 9785  H HG3  . GLU B 1 19 ? -7.204  1.550   3.377   1.00 0.00 ? 19 GLU B HG3  9  
ATOM 9786  N N    . ASN B 1 20 ? -5.947  5.957   1.275   1.00 0.00 ? 20 ASN B N    9  
ATOM 9787  C CA   . ASN B 1 20 ? -6.490  7.293   1.089   1.00 0.00 ? 20 ASN B CA   9  
ATOM 9788  C C    . ASN B 1 20 ? -6.357  7.694   -0.382  1.00 0.00 ? 20 ASN B C    9  
ATOM 9789  O O    . ASN B 1 20 ? -7.197  8.468   -0.861  1.00 0.00 ? 20 ASN B O    9  
ATOM 9790  C CB   . ASN B 1 20 ? -5.729  8.319   1.930   1.00 0.00 ? 20 ASN B CB   9  
ATOM 9791  C CG   . ASN B 1 20 ? -6.372  8.483   3.309   1.00 0.00 ? 20 ASN B CG   9  
ATOM 9792  O OD1  . ASN B 1 20 ? -7.580  8.436   3.469   1.00 0.00 ? 20 ASN B OD1  9  
ATOM 9793  N ND2  . ASN B 1 20 ? -5.499  8.679   4.293   1.00 0.00 ? 20 ASN B ND2  9  
ATOM 9794  H H    . ASN B 1 20 ? -5.150  5.848   1.901   1.00 0.00 ? 20 ASN B H    9  
ATOM 9795  H HA   . ASN B 1 20 ? -7.546  7.286   1.361   1.00 0.00 ? 20 ASN B HA   9  
ATOM 9796  H HB2  . ASN B 1 20 ? -4.701  7.980   2.056   1.00 0.00 ? 20 ASN B HB2  9  
ATOM 9797  H HB3  . ASN B 1 20 ? -5.726  9.274   1.405   1.00 0.00 ? 20 ASN B HB3  9  
ATOM 9798  H HD21 . ASN B 1 20 ? -4.500  8.708   4.089   1.00 0.00 ? 20 ASN B HD21 9  
ATOM 9799  H HD22 . ASN B 1 20 ? -5.828  8.800   5.250   1.00 0.00 ? 20 ASN B HD22 9  
ATOM 9800  N N    . GLU B 1 21 ? -5.320  7.166   -1.057  1.00 0.00 ? 21 GLU B N    9  
ATOM 9801  C CA   . GLU B 1 21 ? -5.080  7.467   -2.459  1.00 0.00 ? 21 GLU B CA   9  
ATOM 9802  C C    . GLU B 1 21 ? -6.008  6.612   -3.324  1.00 0.00 ? 21 GLU B C    9  
ATOM 9803  O O    . GLU B 1 21 ? -6.413  7.083   -4.397  1.00 0.00 ? 21 GLU B O    9  
ATOM 9804  C CB   . GLU B 1 21 ? -3.616  7.246   -2.839  1.00 0.00 ? 21 GLU B CB   9  
ATOM 9805  C CG   . GLU B 1 21 ? -3.322  7.796   -4.236  1.00 0.00 ? 21 GLU B CG   9  
ATOM 9806  C CD   . GLU B 1 21 ? -2.065  7.154   -4.826  1.00 0.00 ? 21 GLU B CD   9  
ATOM 9807  O OE1  . GLU B 1 21 ? -1.438  6.355   -4.032  1.00 0.00 ? 21 GLU B OE1  9  
ATOM 9808  O OE2  . GLU B 1 21 ? -1.719  7.420   -5.987  1.00 0.00 ? 21 GLU B OE2  9  
ATOM 9809  H H    . GLU B 1 21 ? -4.672  6.535   -0.585  1.00 0.00 ? 21 GLU B H    9  
ATOM 9810  H HA   . GLU B 1 21 ? -5.329  8.519   -2.604  1.00 0.00 ? 21 GLU B HA   9  
ATOM 9811  H HB2  . GLU B 1 21 ? -2.981  7.757   -2.116  1.00 0.00 ? 21 GLU B HB2  9  
ATOM 9812  H HB3  . GLU B 1 21 ? -3.400  6.178   -2.808  1.00 0.00 ? 21 GLU B HB3  9  
ATOM 9813  H HG2  . GLU B 1 21 ? -4.170  7.580   -4.887  1.00 0.00 ? 21 GLU B HG2  9  
ATOM 9814  H HG3  . GLU B 1 21 ? -3.192  8.876   -4.171  1.00 0.00 ? 21 GLU B HG3  9  
ATOM 9815  N N    . VAL B 1 22 ? -6.318  5.392   -2.851  1.00 0.00 ? 22 VAL B N    9  
ATOM 9816  C CA   . VAL B 1 22 ? -7.188  4.482   -3.576  1.00 0.00 ? 22 VAL B CA   9  
ATOM 9817  C C    . VAL B 1 22 ? -8.643  4.919   -3.391  1.00 0.00 ? 22 VAL B C    9  
ATOM 9818  O O    . VAL B 1 22 ? -9.413  4.831   -4.359  1.00 0.00 ? 22 VAL B O    9  
ATOM 9819  C CB   . VAL B 1 22 ? -6.934  3.043   -3.126  1.00 0.00 ? 22 VAL B CB   9  
ATOM 9820  C CG1  . VAL B 1 22 ? -8.218  2.214   -3.189  1.00 0.00 ? 22 VAL B CG1  9  
ATOM 9821  C CG2  . VAL B 1 22 ? -5.823  2.398   -3.955  1.00 0.00 ? 22 VAL B CG2  9  
ATOM 9822  H H    . VAL B 1 22 ? -5.940  5.080   -1.956  1.00 0.00 ? 22 VAL B H    9  
ATOM 9823  H HA   . VAL B 1 22 ? -6.929  4.555   -4.633  1.00 0.00 ? 22 VAL B HA   9  
ATOM 9824  H HB   . VAL B 1 22 ? -6.607  3.112   -2.088  1.00 0.00 ? 22 VAL B HB   9  
ATOM 9825  H HG11 . VAL B 1 22 ? -8.603  2.201   -4.209  1.00 0.00 ? 22 VAL B HG11 9  
ATOM 9826  H HG12 . VAL B 1 22 ? -8.000  1.197   -2.862  1.00 0.00 ? 22 VAL B HG12 9  
ATOM 9827  H HG13 . VAL B 1 22 ? -8.972  2.645   -2.530  1.00 0.00 ? 22 VAL B HG13 9  
ATOM 9828  H HG21 . VAL B 1 22 ? -4.901  2.968   -3.850  1.00 0.00 ? 22 VAL B HG21 9  
ATOM 9829  H HG22 . VAL B 1 22 ? -5.668  1.375   -3.608  1.00 0.00 ? 22 VAL B HG22 9  
ATOM 9830  H HG23 . VAL B 1 22 ? -6.109  2.375   -5.007  1.00 0.00 ? 22 VAL B HG23 9  
ATOM 9831  N N    . ALA B 1 23 ? -8.986  5.372   -2.172  1.00 0.00 ? 23 ALA B N    9  
ATOM 9832  C CA   . ALA B 1 23 ? -10.335 5.817   -1.866  1.00 0.00 ? 23 ALA B CA   9  
ATOM 9833  C C    . ALA B 1 23 ? -10.619 7.122   -2.613  1.00 0.00 ? 23 ALA B C    9  
ATOM 9834  O O    . ALA B 1 23 ? -11.800 7.444   -2.809  1.00 0.00 ? 23 ALA B O    9  
ATOM 9835  C CB   . ALA B 1 23 ? -10.444 6.143   -0.375  1.00 0.00 ? 23 ALA B CB   9  
ATOM 9836  H H    . ALA B 1 23 ? -8.289  5.412   -1.428  1.00 0.00 ? 23 ALA B H    9  
ATOM 9837  H HA   . ALA B 1 23 ? -11.072 5.070   -2.163  1.00 0.00 ? 23 ALA B HA   9  
ATOM 9838  H HB1  . ALA B 1 23 ? -10.204 5.250   0.202   1.00 0.00 ? 23 ALA B HB1  9  
ATOM 9839  H HB2  . ALA B 1 23 ? -9.739  6.933   -0.115  1.00 0.00 ? 23 ALA B HB2  9  
ATOM 9840  H HB3  . ALA B 1 23 ? -11.454 6.477   -0.140  1.00 0.00 ? 23 ALA B HB3  9  
ATOM 9841  N N    . ARG B 1 24 ? -9.549  7.835   -3.007  1.00 0.00 ? 24 ARG B N    9  
ATOM 9842  C CA   . ARG B 1 24 ? -9.682  9.091   -3.724  1.00 0.00 ? 24 ARG B CA   9  
ATOM 9843  C C    . ARG B 1 24 ? -9.724  8.813   -5.228  1.00 0.00 ? 24 ARG B C    9  
ATOM 9844  O O    . ARG B 1 24 ? -10.317 9.619   -5.961  1.00 0.00 ? 24 ARG B O    9  
ATOM 9845  C CB   . ARG B 1 24 ? -8.522  10.040  -3.421  1.00 0.00 ? 24 ARG B CB   9  
ATOM 9846  C CG   . ARG B 1 24 ? -8.802  10.866  -2.163  1.00 0.00 ? 24 ARG B CG   9  
ATOM 9847  C CD   . ARG B 1 24 ? -7.499  11.348  -1.523  1.00 0.00 ? 24 ARG B CD   9  
ATOM 9848  N NE   . ARG B 1 24 ? -7.601  11.267  -0.048  1.00 0.00 ? 24 ARG B NE   9  
ATOM 9849  C CZ   . ARG B 1 24 ? -7.068  12.175  0.798   1.00 0.00 ? 24 ARG B CZ   9  
ATOM 9850  N NH1  . ARG B 1 24 ? -6.404  13.223  0.292   1.00 0.00 ? 24 ARG B NH1  9  
ATOM 9851  N NH2  . ARG B 1 24 ? -7.205  12.030  2.124   1.00 0.00 ? 24 ARG B NH2  9  
ATOM 9852  H H    . ARG B 1 24 ? -8.608  7.497   -2.804  1.00 0.00 ? 24 ARG B H    9  
ATOM 9853  H HA   . ARG B 1 24 ? -10.624 9.550   -3.422  1.00 0.00 ? 24 ARG B HA   9  
ATOM 9854  H HB2  . ARG B 1 24 ? -7.616  9.453   -3.265  1.00 0.00 ? 24 ARG B HB2  9  
ATOM 9855  H HB3  . ARG B 1 24 ? -8.374  10.702  -4.275  1.00 0.00 ? 24 ARG B HB3  9  
ATOM 9856  H HG2  . ARG B 1 24 ? -9.405  11.732  -2.436  1.00 0.00 ? 24 ARG B HG2  9  
ATOM 9857  H HG3  . ARG B 1 24 ? -9.360  10.252  -1.456  1.00 0.00 ? 24 ARG B HG3  9  
ATOM 9858  H HD2  . ARG B 1 24 ? -6.675  10.718  -1.857  1.00 0.00 ? 24 ARG B HD2  9  
ATOM 9859  H HD3  . ARG B 1 24 ? -7.305  12.377  -1.825  1.00 0.00 ? 24 ARG B HD3  9  
ATOM 9860  H HE   . ARG B 1 24 ? -8.109  10.464  0.320   1.00 0.00 ? 24 ARG B HE   9  
ATOM 9861  H HH11 . ARG B 1 24 ? -6.306  13.326  -0.717  1.00 0.00 ? 24 ARG B HH11 9  
ATOM 9862  H HH12 . ARG B 1 24 ? -5.996  13.918  0.918   1.00 0.00 ? 24 ARG B HH12 9  
ATOM 9863  H HH21 . ARG B 1 24 ? -7.711  11.230  2.500   1.00 0.00 ? 24 ARG B HH21 9  
ATOM 9864  H HH22 . ARG B 1 24 ? -6.800  12.721  2.755   1.00 0.00 ? 24 ARG B HH22 9  
ATOM 9865  N N    . LEU B 1 25 ? -9.106  7.696   -5.652  1.00 0.00 ? 25 LEU B N    9  
ATOM 9866  C CA   . LEU B 1 25 ? -9.074  7.318   -7.055  1.00 0.00 ? 25 LEU B CA   9  
ATOM 9867  C C    . LEU B 1 25 ? -10.345 6.539   -7.397  1.00 0.00 ? 25 LEU B C    9  
ATOM 9868  O O    . LEU B 1 25 ? -10.887 6.747   -8.493  1.00 0.00 ? 25 LEU B O    9  
ATOM 9869  C CB   . LEU B 1 25 ? -7.784  6.563   -7.377  1.00 0.00 ? 25 LEU B CB   9  
ATOM 9870  C CG   . LEU B 1 25 ? -6.525  7.419   -7.532  1.00 0.00 ? 25 LEU B CG   9  
ATOM 9871  C CD1  . LEU B 1 25 ? -5.284  6.543   -7.713  1.00 0.00 ? 25 LEU B CD1  9  
ATOM 9872  C CD2  . LEU B 1 25 ? -6.686  8.426   -8.673  1.00 0.00 ? 25 LEU B CD2  9  
ATOM 9873  H H    . LEU B 1 25 ? -8.641  7.085   -4.981  1.00 0.00 ? 25 LEU B H    9  
ATOM 9874  H HA   . LEU B 1 25 ? -9.062  8.247   -7.625  1.00 0.00 ? 25 LEU B HA   9  
ATOM 9875  H HB2  . LEU B 1 25 ? -7.631  5.854   -6.563  1.00 0.00 ? 25 LEU B HB2  9  
ATOM 9876  H HB3  . LEU B 1 25 ? -7.974  6.011   -8.297  1.00 0.00 ? 25 LEU B HB3  9  
ATOM 9877  H HG   . LEU B 1 25 ? -6.432  7.961   -6.591  1.00 0.00 ? 25 LEU B HG   9  
ATOM 9878  H HD11 . LEU B 1 25 ? -5.397  5.916   -8.597  1.00 0.00 ? 25 LEU B HD11 9  
ATOM 9879  H HD12 . LEU B 1 25 ? -4.410  7.184   -7.821  1.00 0.00 ? 25 LEU B HD12 9  
ATOM 9880  H HD13 . LEU B 1 25 ? -5.150  5.904   -6.840  1.00 0.00 ? 25 LEU B HD13 9  
ATOM 9881  H HD21 . LEU B 1 25 ? -7.535  9.079   -8.475  1.00 0.00 ? 25 LEU B HD21 9  
ATOM 9882  H HD22 . LEU B 1 25 ? -5.774  9.018   -8.755  1.00 0.00 ? 25 LEU B HD22 9  
ATOM 9883  H HD23 . LEU B 1 25 ? -6.854  7.901   -9.613  1.00 0.00 ? 25 LEU B HD23 9  
ATOM 9884  N N    . LYS B 1 26 ? -10.788 5.671   -6.470  1.00 0.00 ? 26 LYS B N    9  
ATOM 9885  C CA   . LYS B 1 26 ? -11.983 4.870   -6.674  1.00 0.00 ? 26 LYS B CA   9  
ATOM 9886  C C    . LYS B 1 26 ? -13.191 5.795   -6.830  1.00 0.00 ? 26 LYS B C    9  
ATOM 9887  O O    . LYS B 1 26 ? -14.164 5.390   -7.484  1.00 0.00 ? 26 LYS B O    9  
ATOM 9888  C CB   . LYS B 1 26 ? -12.137 3.842   -5.551  1.00 0.00 ? 26 LYS B CB   9  
ATOM 9889  C CG   . LYS B 1 26 ? -11.194 2.656   -5.760  1.00 0.00 ? 26 LYS B CG   9  
ATOM 9890  C CD   . LYS B 1 26 ? -11.902 1.515   -6.495  1.00 0.00 ? 26 LYS B CD   9  
ATOM 9891  C CE   . LYS B 1 26 ? -11.457 1.444   -7.956  1.00 0.00 ? 26 LYS B CE   9  
ATOM 9892  N NZ   . LYS B 1 26 ? -11.746 0.116   -8.519  1.00 0.00 ? 26 LYS B NZ   9  
ATOM 9893  H H    . LYS B 1 26 ? -10.281 5.560   -5.593  1.00 0.00 ? 26 LYS B H    9  
ATOM 9894  H HA   . LYS B 1 26 ? -11.833 4.321   -7.604  1.00 0.00 ? 26 LYS B HA   9  
ATOM 9895  H HB2  . LYS B 1 26 ? -11.901 4.320   -4.600  1.00 0.00 ? 26 LYS B HB2  9  
ATOM 9896  H HB3  . LYS B 1 26 ? -13.170 3.496   -5.528  1.00 0.00 ? 26 LYS B HB3  9  
ATOM 9897  H HG2  . LYS B 1 26 ? -10.340 2.983   -6.354  1.00 0.00 ? 26 LYS B HG2  9  
ATOM 9898  H HG3  . LYS B 1 26 ? -10.840 2.310   -4.789  1.00 0.00 ? 26 LYS B HG3  9  
ATOM 9899  H HD2  . LYS B 1 26 ? -11.658 0.573   -6.003  1.00 0.00 ? 26 LYS B HD2  9  
ATOM 9900  H HD3  . LYS B 1 26 ? -12.979 1.674   -6.440  1.00 0.00 ? 26 LYS B HD3  9  
ATOM 9901  H HE2  . LYS B 1 26 ? -11.996 2.198   -8.531  1.00 0.00 ? 26 LYS B HE2  9  
ATOM 9902  H HE3  . LYS B 1 26 ? -10.388 1.649   -8.016  1.00 0.00 ? 26 LYS B HE3  9  
ATOM 9903  H HZ1  . LYS B 1 26 ? -12.747 -0.076  -8.463  1.00 0.00 ? 26 LYS B HZ1  9  
ATOM 9904  H HZ2  . LYS B 1 26 ? -11.442 0.093   -9.493  1.00 0.00 ? 26 LYS B HZ2  9  
ATOM 9905  H HZ3  . LYS B 1 26 ? -11.242 -0.601  -7.997  1.00 0.00 ? 26 LYS B HZ3  9  
ATOM 9906  N N    . LYS B 1 27 ? -13.109 7.000   -6.238  1.00 0.00 ? 27 LYS B N    9  
ATOM 9907  C CA   . LYS B 1 27 ? -14.188 7.969   -6.312  1.00 0.00 ? 27 LYS B CA   9  
ATOM 9908  C C    . LYS B 1 27 ? -14.122 8.699   -7.655  1.00 0.00 ? 27 LYS B C    9  
ATOM 9909  O O    . LYS B 1 27 ? -15.081 9.411   -7.987  1.00 0.00 ? 27 LYS B O    9  
ATOM 9910  C CB   . LYS B 1 27 ? -14.150 8.906   -5.101  1.00 0.00 ? 27 LYS B CB   9  
ATOM 9911  C CG   . LYS B 1 27 ? -15.552 9.116   -4.527  1.00 0.00 ? 27 LYS B CG   9  
ATOM 9912  C CD   . LYS B 1 27 ? -15.616 10.396  -3.691  1.00 0.00 ? 27 LYS B CD   9  
ATOM 9913  C CE   . LYS B 1 27 ? -14.618 10.344  -2.532  1.00 0.00 ? 27 LYS B CE   9  
ATOM 9914  N NZ   . LYS B 1 27 ? -14.905 9.196   -1.655  1.00 0.00 ? 27 LYS B NZ   9  
ATOM 9915  H H    . LYS B 1 27 ? -12.270 7.255   -5.717  1.00 0.00 ? 27 LYS B H    9  
ATOM 9916  H HA   . LYS B 1 27 ? -15.117 7.402   -6.260  1.00 0.00 ? 27 LYS B HA   9  
ATOM 9917  H HB2  . LYS B 1 27 ? -13.514 8.465   -4.334  1.00 0.00 ? 27 LYS B HB2  9  
ATOM 9918  H HB3  . LYS B 1 27 ? -13.727 9.862   -5.408  1.00 0.00 ? 27 LYS B HB3  9  
ATOM 9919  H HG2  . LYS B 1 27 ? -16.264 9.193   -5.349  1.00 0.00 ? 27 LYS B HG2  9  
ATOM 9920  H HG3  . LYS B 1 27 ? -15.814 8.255   -3.910  1.00 0.00 ? 27 LYS B HG3  9  
ATOM 9921  H HD2  . LYS B 1 27 ? -15.377 11.246  -4.328  1.00 0.00 ? 27 LYS B HD2  9  
ATOM 9922  H HD3  . LYS B 1 27 ? -16.628 10.516  -3.305  1.00 0.00 ? 27 LYS B HD3  9  
ATOM 9923  H HE2  . LYS B 1 27 ? -13.610 10.243  -2.931  1.00 0.00 ? 27 LYS B HE2  9  
ATOM 9924  H HE3  . LYS B 1 27 ? -14.683 11.272  -1.962  1.00 0.00 ? 27 LYS B HE3  9  
ATOM 9925  H HZ1  . LYS B 1 27 ? -14.845 8.329   -2.188  1.00 0.00 ? 27 LYS B HZ1  9  
ATOM 9926  H HZ2  . LYS B 1 27 ? -14.228 9.184   -0.893  1.00 0.00 ? 27 LYS B HZ2  9  
ATOM 9927  H HZ3  . LYS B 1 27 ? -15.844 9.282   -1.266  1.00 0.00 ? 27 LYS B HZ3  9  
ATOM 9928  N N    . LEU B 1 28 ? -13.011 8.509   -8.390  1.00 0.00 ? 28 LEU B N    9  
ATOM 9929  C CA   . LEU B 1 28 ? -12.826 9.144   -9.683  1.00 0.00 ? 28 LEU B CA   9  
ATOM 9930  C C    . LEU B 1 28 ? -12.971 8.094   -10.787 1.00 0.00 ? 28 LEU B C    9  
ATOM 9931  O O    . LEU B 1 28 ? -13.479 8.437   -11.864 1.00 0.00 ? 28 LEU B O    9  
ATOM 9932  C CB   . LEU B 1 28 ? -11.495 9.898   -9.724  1.00 0.00 ? 28 LEU B CB   9  
ATOM 9933  C CG   . LEU B 1 28 ? -11.558 11.339  -10.235 1.00 0.00 ? 28 LEU B CG   9  
ATOM 9934  C CD1  . LEU B 1 28 ? -11.827 12.317  -9.089  1.00 0.00 ? 28 LEU B CD1  9  
ATOM 9935  C CD2  . LEU B 1 28 ? -10.290 11.701  -11.011 1.00 0.00 ? 28 LEU B CD2  9  
ATOM 9936  H H    . LEU B 1 28 ? -12.267 7.904   -8.041  1.00 0.00 ? 28 LEU B H    9  
ATOM 9937  H HA   . LEU B 1 28 ? -13.625 9.878   -9.784  1.00 0.00 ? 28 LEU B HA   9  
ATOM 9938  H HB2  . LEU B 1 28 ? -11.112 9.901   -8.703  1.00 0.00 ? 28 LEU B HB2  9  
ATOM 9939  H HB3  . LEU B 1 28 ? -10.829 9.309   -10.353 1.00 0.00 ? 28 LEU B HB3  9  
ATOM 9940  H HG   . LEU B 1 28 ? -12.409 11.363  -10.915 1.00 0.00 ? 28 LEU B HG   9  
ATOM 9941  H HD11 . LEU B 1 28 ? -11.037 12.241  -8.342  1.00 0.00 ? 28 LEU B HD11 9  
ATOM 9942  H HD12 . LEU B 1 28 ? -11.865 13.331  -9.488  1.00 0.00 ? 28 LEU B HD12 9  
ATOM 9943  H HD13 . LEU B 1 28 ? -12.783 12.084  -8.619  1.00 0.00 ? 28 LEU B HD13 9  
ATOM 9944  H HD21 . LEU B 1 28 ? -10.170 11.029  -11.861 1.00 0.00 ? 28 LEU B HD21 9  
ATOM 9945  H HD22 . LEU B 1 28 ? -10.369 12.732  -11.359 1.00 0.00 ? 28 LEU B HD22 9  
ATOM 9946  H HD23 . LEU B 1 28 ? -9.419  11.612  -10.361 1.00 0.00 ? 28 LEU B HD23 9  
ATOM 9947  N N    . VAL B 1 29 ? -12.530 6.855   -10.502 1.00 0.00 ? 29 VAL B N    9  
ATOM 9948  C CA   . VAL B 1 29 ? -12.610 5.769   -11.463 1.00 0.00 ? 29 VAL B CA   9  
ATOM 9949  C C    . VAL B 1 29 ? -13.661 4.760   -10.999 1.00 0.00 ? 29 VAL B C    9  
ATOM 9950  O O    . VAL B 1 29 ? -14.671 4.595   -11.699 1.00 0.00 ? 29 VAL B O    9  
ATOM 9951  C CB   . VAL B 1 29 ? -11.227 5.144   -11.663 1.00 0.00 ? 29 VAL B CB   9  
ATOM 9952  C CG1  . VAL B 1 29 ? -11.211 4.231   -12.891 1.00 0.00 ? 29 VAL B CG1  9  
ATOM 9953  C CG2  . VAL B 1 29 ? -10.148 6.223   -11.768 1.00 0.00 ? 29 VAL B CG2  9  
ATOM 9954  H H    . VAL B 1 29 ? -12.123 6.657   -9.588  1.00 0.00 ? 29 VAL B H    9  
ATOM 9955  H HA   . VAL B 1 29 ? -12.926 6.198   -12.415 1.00 0.00 ? 29 VAL B HA   9  
ATOM 9956  H HB   . VAL B 1 29 ? -11.043 4.544   -10.772 1.00 0.00 ? 29 VAL B HB   9  
ATOM 9957  H HG11 . VAL B 1 29 ? -11.474 4.801   -13.782 1.00 0.00 ? 29 VAL B HG11 9  
ATOM 9958  H HG12 . VAL B 1 29 ? -10.214 3.805   -13.002 1.00 0.00 ? 29 VAL B HG12 9  
ATOM 9959  H HG13 . VAL B 1 29 ? -11.930 3.422   -12.762 1.00 0.00 ? 29 VAL B HG13 9  
ATOM 9960  H HG21 . VAL B 1 29 ? -10.135 6.826   -10.860 1.00 0.00 ? 29 VAL B HG21 9  
ATOM 9961  H HG22 . VAL B 1 29 ? -9.179  5.743   -11.910 1.00 0.00 ? 29 VAL B HG22 9  
ATOM 9962  H HG23 . VAL B 1 29 ? -10.351 6.872   -12.621 1.00 0.00 ? 29 VAL B HG23 9  
ATOM 9963  N N    . GLY B 1 30 ? -13.407 4.114   -9.846  1.00 0.00 ? 30 GLY B N    9  
ATOM 9964  C CA   . GLY B 1 30 ? -14.325 3.131   -9.296  1.00 0.00 ? 30 GLY B CA   9  
ATOM 9965  C C    . GLY B 1 30 ? -15.719 3.750   -9.179  1.00 0.00 ? 30 GLY B C    9  
ATOM 9966  O O    . GLY B 1 30 ? -16.669 3.012   -8.880  1.00 0.00 ? 30 GLY B O    9  
ATOM 9967  H H    . GLY B 1 30 ? -12.550 4.309   -9.330  1.00 0.00 ? 30 GLY B H    9  
ATOM 9968  H HA2  . GLY B 1 30 ? -14.375 2.265   -9.955  1.00 0.00 ? 30 GLY B HA2  9  
ATOM 9969  H HA3  . GLY B 1 30 ? -13.977 2.810   -8.313  1.00 0.00 ? 30 GLY B HA3  9  
ATOM 9970  N N    . GLU B 1 31 ? -15.813 5.071   -9.413  1.00 0.00 ? 31 GLU B N    9  
ATOM 9971  C CA   . GLU B 1 31 ? -17.079 5.779   -9.336  1.00 0.00 ? 31 GLU B CA   9  
ATOM 9972  C C    . GLU B 1 31 ? -18.062 5.170   -10.337 1.00 0.00 ? 31 GLU B C    9  
ATOM 9973  O O    . GLU B 1 31 ? -18.023 5.560   -11.514 1.00 0.00 ? 31 GLU B O    9  
ATOM 9974  C CB   . GLU B 1 31 ? -16.902 7.278   -9.584  1.00 0.00 ? 31 GLU B CB   9  
ATOM 9975  C CG   . GLU B 1 31 ? -17.646 8.101   -8.532  1.00 0.00 ? 31 GLU B CG   9  
ATOM 9976  C CD   . GLU B 1 31 ? -17.922 9.520   -9.037  1.00 0.00 ? 31 GLU B CD   9  
ATOM 9977  O OE1  . GLU B 1 31 ? -17.295 9.843   -10.117 1.00 0.00 ? 31 GLU B OE1  9  
ATOM 9978  O OE2  . GLU B 1 31 ? -18.697 10.260  -8.415  1.00 0.00 ? 31 GLU B OE2  9  
ATOM 9979  H H    . GLU B 1 31 ? -14.979 5.607   -9.655  1.00 0.00 ? 31 GLU B H    9  
ATOM 9980  H HA   . GLU B 1 31 ? -17.464 5.632   -8.327  1.00 0.00 ? 31 GLU B HA   9  
ATOM 9981  H HB2  . GLU B 1 31 ? -15.840 7.521   -9.539  1.00 0.00 ? 31 GLU B HB2  9  
ATOM 9982  H HB3  . GLU B 1 31 ? -17.278 7.519   -10.579 1.00 0.00 ? 31 GLU B HB3  9  
ATOM 9983  H HG2  . GLU B 1 31 ? -18.595 7.614   -8.308  1.00 0.00 ? 31 GLU B HG2  9  
ATOM 9984  H HG3  . GLU B 1 31 ? -17.045 8.141   -7.623  1.00 0.00 ? 31 GLU B HG3  9  
ATOM 9985  N N    . ARG B 1 32 ? -18.909 4.241   -9.861  1.00 0.00 ? 32 ARG B N    9  
ATOM 9986  C CA   . ARG B 1 32 ? -19.892 3.586   -10.709 1.00 0.00 ? 32 ARG B CA   9  
ATOM 9987  C C    . ARG B 1 32 ? -20.563 4.631   -11.604 1.00 0.00 ? 32 ARG B C    9  
ATOM 9988  O O    . ARG B 1 32 ? -21.772 4.577   -11.824 1.00 0.00 ? 32 ARG B O    9  
ATOM 9989  C CB   . ARG B 1 32 ? -20.961 2.869   -9.883  1.00 0.00 ? 32 ARG B CB   9  
ATOM 9990  C CG   . ARG B 1 32 ? -20.394 2.396   -8.544  1.00 0.00 ? 32 ARG B CG   9  
ATOM 9991  C CD   . ARG B 1 32 ? -20.762 3.365   -7.419  1.00 0.00 ? 32 ARG B CD   9  
ATOM 9992  N NE   . ARG B 1 32 ? -20.773 4.754   -7.931  1.00 0.00 ? 32 ARG B NE   9  
ATOM 9993  C CZ   . ARG B 1 32 ? -20.972 5.843   -7.159  1.00 0.00 ? 32 ARG B CZ   9  
ATOM 9994  N NH1  . ARG B 1 32 ? -21.173 5.681   -5.844  1.00 0.00 ? 32 ARG B NH1  9  
ATOM 9995  N NH2  . ARG B 1 32 ? -20.969 7.069   -7.700  1.00 0.00 ? 32 ARG B NH2  9  
ATOM 9996  H H    . ARG B 1 32 ? -18.875 3.976   -8.877  1.00 0.00 ? 32 ARG B H    9  
ATOM 9997  H HA   . ARG B 1 32 ? -19.365 2.868   -11.337 1.00 0.00 ? 32 ARG B HA   9  
ATOM 9998  H HB2  . ARG B 1 32 ? -21.785 3.558   -9.695  1.00 0.00 ? 32 ARG B HB2  9  
ATOM 9999  H HB3  . ARG B 1 32 ? -21.334 2.017   -10.452 1.00 0.00 ? 32 ARG B HB3  9  
ATOM 10000 H HG2  . ARG B 1 32 ? -20.805 1.412   -8.313  1.00 0.00 ? 32 ARG B HG2  9  
ATOM 10001 H HG3  . ARG B 1 32 ? -19.310 2.316   -8.627  1.00 0.00 ? 32 ARG B HG3  9  
ATOM 10002 H HD2  . ARG B 1 32 ? -21.752 3.119   -7.037  1.00 0.00 ? 32 ARG B HD2  9  
ATOM 10003 H HD3  . ARG B 1 32 ? -20.036 3.274   -6.610  1.00 0.00 ? 32 ARG B HD3  9  
ATOM 10004 H HE   . ARG B 1 32 ? -20.619 4.860   -8.933  1.00 0.00 ? 32 ARG B HE   9  
ATOM 10005 H HH11 . ARG B 1 32 ? -21.173 4.744   -5.441  1.00 0.00 ? 32 ARG B HH11 9  
ATOM 10006 H HH12 . ARG B 1 32 ? -21.324 6.493   -5.247  1.00 0.00 ? 32 ARG B HH12 9  
ATOM 10007 H HH21 . ARG B 1 32 ? -20.815 7.184   -8.703  1.00 0.00 ? 32 ARG B HH21 9  
ATOM 10008 H HH22 . ARG B 1 32 ? -21.120 7.888   -7.110  1.00 0.00 ? 32 ARG B HH22 9  
ATOM 10009 N N    . MET A 1 1  ? 7.769   -11.245 17.044  1.00 0.00 ? 1  MET A N    10 
ATOM 10010 C CA   . MET A 1 1  ? 8.479   -11.271 15.777  1.00 0.00 ? 1  MET A CA   10 
ATOM 10011 C C    . MET A 1 1  ? 7.779   -12.245 14.825  1.00 0.00 ? 1  MET A C    10 
ATOM 10012 O O    . MET A 1 1  ? 7.681   -11.933 13.630  1.00 0.00 ? 1  MET A O    10 
ATOM 10013 C CB   . MET A 1 1  ? 9.927   -11.715 15.987  1.00 0.00 ? 1  MET A CB   10 
ATOM 10014 C CG   . MET A 1 1  ? 10.873  -10.964 15.046  1.00 0.00 ? 1  MET A CG   10 
ATOM 10015 S SD   . MET A 1 1  ? 12.344  -11.975 14.706  1.00 0.00 ? 1  MET A SD   10 
ATOM 10016 C CE   . MET A 1 1  ? 12.284  -12.020 12.891  1.00 0.00 ? 1  MET A CE   10 
ATOM 10017 H H    . MET A 1 1  ? 8.314   -11.345 17.900  1.00 0.00 ? 1  MET A H    10 
ATOM 10018 H HA   . MET A 1 1  ? 8.459   -10.273 15.339  1.00 0.00 ? 1  MET A HA   10 
ATOM 10019 H HB2  . MET A 1 1  ? 10.215  -11.508 17.017  1.00 0.00 ? 1  MET A HB2  10 
ATOM 10020 H HB3  . MET A 1 1  ? 9.999   -12.787 15.807  1.00 0.00 ? 1  MET A HB3  10 
ATOM 10021 H HG2  . MET A 1 1  ? 10.360  -10.758 14.107  1.00 0.00 ? 1  MET A HG2  10 
ATOM 10022 H HG3  . MET A 1 1  ? 11.167  -10.021 15.505  1.00 0.00 ? 1  MET A HG3  10 
ATOM 10023 H HE1  . MET A 1 1  ? 12.334  -11.007 12.492  1.00 0.00 ? 1  MET A HE1  10 
ATOM 10024 H HE2  . MET A 1 1  ? 13.125  -12.606 12.522  1.00 0.00 ? 1  MET A HE2  10 
ATOM 10025 H HE3  . MET A 1 1  ? 11.355  -12.486 12.562  1.00 0.00 ? 1  MET A HE3  10 
ATOM 10026 N N    . ASP A 1 2  ? 7.314   -13.385 15.367  1.00 0.00 ? 2  ASP A N    10 
ATOM 10027 C CA   . ASP A 1 2  ? 6.632   -14.392 14.572  1.00 0.00 ? 2  ASP A CA   10 
ATOM 10028 C C    . ASP A 1 2  ? 5.501   -13.731 13.781  1.00 0.00 ? 2  ASP A C    10 
ATOM 10029 O O    . ASP A 1 2  ? 5.307   -14.095 12.612  1.00 0.00 ? 2  ASP A O    10 
ATOM 10030 C CB   . ASP A 1 2  ? 6.016   -15.473 15.463  1.00 0.00 ? 2  ASP A CB   10 
ATOM 10031 C CG   . ASP A 1 2  ? 6.801   -15.783 16.739  1.00 0.00 ? 2  ASP A CG   10 
ATOM 10032 O OD1  . ASP A 1 2  ? 7.836   -16.465 16.703  1.00 0.00 ? 2  ASP A OD1  10 
ATOM 10033 O OD2  . ASP A 1 2  ? 6.302   -15.286 17.821  1.00 0.00 ? 2  ASP A OD2  10 
ATOM 10034 H H    . ASP A 1 2  ? 7.437   -13.564 16.364  1.00 0.00 ? 2  ASP A H    10 
ATOM 10035 H HA   . ASP A 1 2  ? 7.342   -14.834 13.873  1.00 0.00 ? 2  ASP A HA   10 
ATOM 10036 H HB2  . ASP A 1 2  ? 5.018   -15.130 15.734  1.00 0.00 ? 2  ASP A HB2  10 
ATOM 10037 H HB3  . ASP A 1 2  ? 5.929   -16.373 14.853  1.00 0.00 ? 2  ASP A HB3  10 
ATOM 10038 N N    . ALA A 1 3  ? 4.788   -12.788 14.424  1.00 0.00 ? 3  ALA A N    10 
ATOM 10039 C CA   . ALA A 1 3  ? 3.689   -12.085 13.784  1.00 0.00 ? 3  ALA A CA   10 
ATOM 10040 C C    . ALA A 1 3  ? 4.238   -10.881 13.015  1.00 0.00 ? 3  ALA A C    10 
ATOM 10041 O O    . ALA A 1 3  ? 3.507   -10.335 12.175  1.00 0.00 ? 3  ALA A O    10 
ATOM 10042 C CB   . ALA A 1 3  ? 2.749   -11.521 14.851  1.00 0.00 ? 3  ALA A CB   10 
ATOM 10043 H H    . ALA A 1 3  ? 5.013   -12.548 15.388  1.00 0.00 ? 3  ALA A H    10 
ATOM 10044 H HA   . ALA A 1 3  ? 3.155   -12.736 13.091  1.00 0.00 ? 3  ALA A HA   10 
ATOM 10045 H HB1  . ALA A 1 3  ? 2.366   -12.342 15.458  1.00 0.00 ? 3  ALA A HB1  10 
ATOM 10046 H HB2  . ALA A 1 3  ? 3.290   -10.828 15.494  1.00 0.00 ? 3  ALA A HB2  10 
ATOM 10047 H HB3  . ALA A 1 3  ? 1.922   -10.993 14.376  1.00 0.00 ? 3  ALA A HB3  10 
ATOM 10048 N N    . ILE A 1 4  ? 5.492   -10.498 13.312  1.00 0.00 ? 4  ILE A N    10 
ATOM 10049 C CA   . ILE A 1 4  ? 6.128   -9.370  12.653  1.00 0.00 ? 4  ILE A CA   10 
ATOM 10050 C C    . ILE A 1 4  ? 6.592   -9.796  11.258  1.00 0.00 ? 4  ILE A C    10 
ATOM 10051 O O    . ILE A 1 4  ? 6.355   -9.042  10.303  1.00 0.00 ? 4  ILE A O    10 
ATOM 10052 C CB   . ILE A 1 4  ? 7.248   -8.801  13.527  1.00 0.00 ? 4  ILE A CB   10 
ATOM 10053 C CG1  . ILE A 1 4  ? 6.707   -8.343  14.883  1.00 0.00 ? 4  ILE A CG1  10 
ATOM 10054 C CG2  . ILE A 1 4  ? 7.997   -7.683  12.800  1.00 0.00 ? 4  ILE A CG2  10 
ATOM 10055 C CD1  . ILE A 1 4  ? 7.274   -6.974  15.265  1.00 0.00 ? 4  ILE A CD1  10 
ATOM 10056 H H    . ILE A 1 4  ? 6.026   -11.003 14.019  1.00 0.00 ? 4  ILE A H    10 
ATOM 10057 H HA   . ILE A 1 4  ? 5.365   -8.599  12.553  1.00 0.00 ? 4  ILE A HA   10 
ATOM 10058 H HB   . ILE A 1 4  ? 7.936   -9.633  13.683  1.00 0.00 ? 4  ILE A HB   10 
ATOM 10059 H HG12 . ILE A 1 4  ? 5.620   -8.273  14.824  1.00 0.00 ? 4  ILE A HG12 10 
ATOM 10060 H HG13 . ILE A 1 4  ? 6.975   -9.080  15.639  1.00 0.00 ? 4  ILE A HG13 10 
ATOM 10061 H HG21 . ILE A 1 4  ? 7.306   -6.879  12.543  1.00 0.00 ? 4  ILE A HG21 10 
ATOM 10062 H HG22 . ILE A 1 4  ? 8.785   -7.303  13.450  1.00 0.00 ? 4  ILE A HG22 10 
ATOM 10063 H HG23 . ILE A 1 4  ? 8.447   -8.069  11.886  1.00 0.00 ? 4  ILE A HG23 10 
ATOM 10064 H HD11 . ILE A 1 4  ? 7.006   -6.236  14.508  1.00 0.00 ? 4  ILE A HD11 10 
ATOM 10065 H HD12 . ILE A 1 4  ? 6.868   -6.679  16.232  1.00 0.00 ? 4  ILE A HD12 10 
ATOM 10066 H HD13 . ILE A 1 4  ? 8.361   -7.029  15.337  1.00 0.00 ? 4  ILE A HD13 10 
ATOM 10067 N N    . LYS A 1 5  ? 7.235   -10.974 11.170  1.00 0.00 ? 5  LYS A N    10 
ATOM 10068 C CA   . LYS A 1 5  ? 7.726   -11.491 9.905   1.00 0.00 ? 5  LYS A CA   10 
ATOM 10069 C C    . LYS A 1 5  ? 6.585   -11.497 8.885   1.00 0.00 ? 5  LYS A C    10 
ATOM 10070 O O    . LYS A 1 5  ? 6.853   -11.245 7.701   1.00 0.00 ? 5  LYS A O    10 
ATOM 10071 C CB   . LYS A 1 5  ? 8.381   -12.858 10.103  1.00 0.00 ? 5  LYS A CB   10 
ATOM 10072 C CG   . LYS A 1 5  ? 9.517   -12.781 11.124  1.00 0.00 ? 5  LYS A CG   10 
ATOM 10073 C CD   . LYS A 1 5  ? 9.214   -13.645 12.350  1.00 0.00 ? 5  LYS A CD   10 
ATOM 10074 C CE   . LYS A 1 5  ? 9.911   -15.003 12.249  1.00 0.00 ? 5  LYS A CE   10 
ATOM 10075 N NZ   . LYS A 1 5  ? 11.349  -14.866 12.530  1.00 0.00 ? 5  LYS A NZ   10 
ATOM 10076 H H    . LYS A 1 5  ? 7.389   -11.534 12.009  1.00 0.00 ? 5  LYS A H    10 
ATOM 10077 H HA   . LYS A 1 5  ? 8.499   -10.800 9.568   1.00 0.00 ? 5  LYS A HA   10 
ATOM 10078 H HB2  . LYS A 1 5  ? 7.630   -13.563 10.462  1.00 0.00 ? 5  LYS A HB2  10 
ATOM 10079 H HB3  . LYS A 1 5  ? 8.766   -13.209 9.145   1.00 0.00 ? 5  LYS A HB3  10 
ATOM 10080 H HG2  . LYS A 1 5  ? 10.437  -13.135 10.659  1.00 0.00 ? 5  LYS A HG2  10 
ATOM 10081 H HG3  . LYS A 1 5  ? 9.651   -11.741 11.425  1.00 0.00 ? 5  LYS A HG3  10 
ATOM 10082 H HD2  . LYS A 1 5  ? 9.568   -13.130 13.242  1.00 0.00 ? 5  LYS A HD2  10 
ATOM 10083 H HD3  . LYS A 1 5  ? 8.136   -13.785 12.425  1.00 0.00 ? 5  LYS A HD3  10 
ATOM 10084 H HE2  . LYS A 1 5  ? 9.471   -15.686 12.974  1.00 0.00 ? 5  LYS A HE2  10 
ATOM 10085 H HE3  . LYS A 1 5  ? 9.765   -15.407 11.247  1.00 0.00 ? 5  LYS A HE3  10 
ATOM 10086 H HZ1  . LYS A 1 5  ? 11.486  -14.487 13.469  1.00 0.00 ? 5  LYS A HZ1  10 
ATOM 10087 H HZ2  . LYS A 1 5  ? 11.792  -15.782 12.457  1.00 0.00 ? 5  LYS A HZ2  10 
ATOM 10088 H HZ3  . LYS A 1 5  ? 11.779  -14.235 11.853  1.00 0.00 ? 5  LYS A HZ3  10 
ATOM 10089 N N    . LYS A 1 6  ? 5.358   -11.779 9.355   1.00 0.00 ? 6  LYS A N    10 
ATOM 10090 C CA   . LYS A 1 6  ? 4.191   -11.817 8.489   1.00 0.00 ? 6  LYS A CA   10 
ATOM 10091 C C    . LYS A 1 6  ? 3.631   -10.402 8.333   1.00 0.00 ? 6  LYS A C    10 
ATOM 10092 O O    . LYS A 1 6  ? 3.084   -10.099 7.263   1.00 0.00 ? 6  LYS A O    10 
ATOM 10093 C CB   . LYS A 1 6  ? 3.169   -12.829 9.011   1.00 0.00 ? 6  LYS A CB   10 
ATOM 10094 C CG   . LYS A 1 6  ? 3.858   -13.960 9.777   1.00 0.00 ? 6  LYS A CG   10 
ATOM 10095 C CD   . LYS A 1 6  ? 3.059   -15.260 9.671   1.00 0.00 ? 6  LYS A CD   10 
ATOM 10096 C CE   . LYS A 1 6  ? 3.213   -15.888 8.284   1.00 0.00 ? 6  LYS A CE   10 
ATOM 10097 N NZ   . LYS A 1 6  ? 4.610   -16.290 8.053   1.00 0.00 ? 6  LYS A NZ   10 
ATOM 10098 H H    . LYS A 1 6  ? 5.224   -11.975 10.347  1.00 0.00 ? 6  LYS A H    10 
ATOM 10099 H HA   . LYS A 1 6  ? 4.538   -12.170 7.519   1.00 0.00 ? 6  LYS A HA   10 
ATOM 10100 H HB2  . LYS A 1 6  ? 2.477   -12.319 9.680   1.00 0.00 ? 6  LYS A HB2  10 
ATOM 10101 H HB3  . LYS A 1 6  ? 2.612   -13.236 8.167   1.00 0.00 ? 6  LYS A HB3  10 
ATOM 10102 H HG2  . LYS A 1 6  ? 4.851   -14.119 9.354   1.00 0.00 ? 6  LYS A HG2  10 
ATOM 10103 H HG3  . LYS A 1 6  ? 3.960   -13.669 10.822  1.00 0.00 ? 6  LYS A HG3  10 
ATOM 10104 H HD2  . LYS A 1 6  ? 3.424   -15.962 10.421  1.00 0.00 ? 6  LYS A HD2  10 
ATOM 10105 H HD3  . LYS A 1 6  ? 2.008   -15.046 9.867   1.00 0.00 ? 6  LYS A HD3  10 
ATOM 10106 H HE2  . LYS A 1 6  ? 2.574   -16.769 8.217   1.00 0.00 ? 6  LYS A HE2  10 
ATOM 10107 H HE3  . LYS A 1 6  ? 2.905   -15.167 7.528   1.00 0.00 ? 6  LYS A HE3  10 
ATOM 10108 H HZ1  . LYS A 1 6  ? 4.900   -16.966 8.761   1.00 0.00 ? 6  LYS A HZ1  10 
ATOM 10109 H HZ2  . LYS A 1 6  ? 4.687   -16.705 7.125   1.00 0.00 ? 6  LYS A HZ2  10 
ATOM 10110 H HZ3  . LYS A 1 6  ? 5.220   -15.475 8.105   1.00 0.00 ? 6  LYS A HZ3  10 
ATOM 10111 N N    . LYS A 1 7  ? 3.776   -9.577  9.386   1.00 0.00 ? 7  LYS A N    10 
ATOM 10112 C CA   . LYS A 1 7  ? 3.288   -8.209  9.365   1.00 0.00 ? 7  LYS A CA   10 
ATOM 10113 C C    . LYS A 1 7  ? 3.810   -7.504  8.112   1.00 0.00 ? 7  LYS A C    10 
ATOM 10114 O O    . LYS A 1 7  ? 2.999   -6.898  7.396   1.00 0.00 ? 7  LYS A O    10 
ATOM 10115 C CB   . LYS A 1 7  ? 3.648   -7.492  10.668  1.00 0.00 ? 7  LYS A CB   10 
ATOM 10116 C CG   . LYS A 1 7  ? 3.294   -6.005  10.592  1.00 0.00 ? 7  LYS A CG   10 
ATOM 10117 C CD   . LYS A 1 7  ? 1.864   -5.807  10.088  1.00 0.00 ? 7  LYS A CD   10 
ATOM 10118 C CE   . LYS A 1 7  ? 0.854   -6.453  11.039  1.00 0.00 ? 7  LYS A CE   10 
ATOM 10119 N NZ   . LYS A 1 7  ? 1.312   -6.338  12.433  1.00 0.00 ? 7  LYS A NZ   10 
ATOM 10120 H H    . LYS A 1 7  ? 4.241   -9.907  10.232  1.00 0.00 ? 7  LYS A H    10 
ATOM 10121 H HA   . LYS A 1 7  ? 2.201   -8.269  9.312   1.00 0.00 ? 7  LYS A HA   10 
ATOM 10122 H HB2  . LYS A 1 7  ? 3.092   -7.946  11.487  1.00 0.00 ? 7  LYS A HB2  10 
ATOM 10123 H HB3  . LYS A 1 7  ? 4.715   -7.611  10.854  1.00 0.00 ? 7  LYS A HB3  10 
ATOM 10124 H HG2  . LYS A 1 7  ? 3.385   -5.568  11.586  1.00 0.00 ? 7  LYS A HG2  10 
ATOM 10125 H HG3  . LYS A 1 7  ? 3.997   -5.510  9.921   1.00 0.00 ? 7  LYS A HG3  10 
ATOM 10126 H HD2  . LYS A 1 7  ? 1.657   -4.738  10.023  1.00 0.00 ? 7  LYS A HD2  10 
ATOM 10127 H HD3  . LYS A 1 7  ? 1.774   -6.247  9.095   1.00 0.00 ? 7  LYS A HD3  10 
ATOM 10128 H HE2  . LYS A 1 7  ? -0.106  -5.947  10.939  1.00 0.00 ? 7  LYS A HE2  10 
ATOM 10129 H HE3  . LYS A 1 7  ? 0.732   -7.502  10.773  1.00 0.00 ? 7  LYS A HE3  10 
ATOM 10130 H HZ1  . LYS A 1 7  ? 1.426   -5.356  12.682  1.00 0.00 ? 7  LYS A HZ1  10 
ATOM 10131 H HZ2  . LYS A 1 7  ? 0.623   -6.776  13.046  1.00 0.00 ? 7  LYS A HZ2  10 
ATOM 10132 H HZ3  . LYS A 1 7  ? 2.206   -6.816  12.545  1.00 0.00 ? 7  LYS A HZ3  10 
ATOM 10133 N N    . MET A 1 8  ? 5.131   -7.596  7.874   1.00 0.00 ? 8  MET A N    10 
ATOM 10134 C CA   . MET A 1 8  ? 5.751   -6.972  6.719   1.00 0.00 ? 8  MET A CA   10 
ATOM 10135 C C    . MET A 1 8  ? 5.322   -7.715  5.452   1.00 0.00 ? 8  MET A C    10 
ATOM 10136 O O    . MET A 1 8  ? 5.314   -7.095  4.378   1.00 0.00 ? 8  MET A O    10 
ATOM 10137 C CB   . MET A 1 8  ? 7.275   -7.015  6.844   1.00 0.00 ? 8  MET A CB   10 
ATOM 10138 C CG   . MET A 1 8  ? 7.776   -8.456  6.964   1.00 0.00 ? 8  MET A CG   10 
ATOM 10139 S SD   . MET A 1 8  ? 9.559   -8.467  7.311   1.00 0.00 ? 8  MET A SD   10 
ATOM 10140 C CE   . MET A 1 8  ? 10.060  -9.915  6.335   1.00 0.00 ? 8  MET A CE   10 
ATOM 10141 H H    . MET A 1 8  ? 5.729   -8.116  8.517   1.00 0.00 ? 8  MET A H    10 
ATOM 10142 H HA   . MET A 1 8  ? 5.416   -5.936  6.653   1.00 0.00 ? 8  MET A HA   10 
ATOM 10143 H HB2  . MET A 1 8  ? 7.716   -6.558  5.957   1.00 0.00 ? 8  MET A HB2  10 
ATOM 10144 H HB3  . MET A 1 8  ? 7.574   -6.444  7.723   1.00 0.00 ? 8  MET A HB3  10 
ATOM 10145 H HG2  . MET A 1 8  ? 7.252   -8.955  7.778   1.00 0.00 ? 8  MET A HG2  10 
ATOM 10146 H HG3  . MET A 1 8  ? 7.575   -8.988  6.034   1.00 0.00 ? 8  MET A HG3  10 
ATOM 10147 H HE1  . MET A 1 8  ? 9.809   -9.762  5.286   1.00 0.00 ? 8  MET A HE1  10 
ATOM 10148 H HE2  . MET A 1 8  ? 11.135  -10.060 6.442   1.00 0.00 ? 8  MET A HE2  10 
ATOM 10149 H HE3  . MET A 1 8  ? 9.545   -10.805 6.697   1.00 0.00 ? 8  MET A HE3  10 
ATOM 10150 N N    . GLN A 1 9  ? 4.979   -9.008  5.599   1.00 0.00 ? 9  GLN A N    10 
ATOM 10151 C CA   . GLN A 1 9  ? 4.553   -9.824  4.474   1.00 0.00 ? 9  GLN A CA   10 
ATOM 10152 C C    . GLN A 1 9  ? 3.122   -9.447  4.089   1.00 0.00 ? 9  GLN A C    10 
ATOM 10153 O O    . GLN A 1 9  ? 2.763   -9.619  2.915   1.00 0.00 ? 9  GLN A O    10 
ATOM 10154 C CB   . GLN A 1 9  ? 4.661   -11.317 4.792   1.00 0.00 ? 9  GLN A CB   10 
ATOM 10155 C CG   . GLN A 1 9  ? 6.095   -11.816 4.601   1.00 0.00 ? 9  GLN A CG   10 
ATOM 10156 C CD   . GLN A 1 9  ? 6.110   -13.270 4.124   1.00 0.00 ? 9  GLN A CD   10 
ATOM 10157 O OE1  . GLN A 1 9  ? 5.868   -13.575 2.969   1.00 0.00 ? 9  GLN A OE1  10 
ATOM 10158 N NE2  . GLN A 1 9  ? 6.407   -14.148 5.079   1.00 0.00 ? 9  GLN A NE2  10 
ATOM 10159 H H    . GLN A 1 9  ? 5.013   -9.443  6.521   1.00 0.00 ? 9  GLN A H    10 
ATOM 10160 H HA   . GLN A 1 9  ? 5.218   -9.590  3.643   1.00 0.00 ? 9  GLN A HA   10 
ATOM 10161 H HB2  . GLN A 1 9  ? 4.363   -11.481 5.827   1.00 0.00 ? 9  GLN A HB2  10 
ATOM 10162 H HB3  . GLN A 1 9  ? 3.986   -11.867 4.137   1.00 0.00 ? 9  GLN A HB3  10 
ATOM 10163 H HG2  . GLN A 1 9  ? 6.590   -11.193 3.855   1.00 0.00 ? 9  GLN A HG2  10 
ATOM 10164 H HG3  . GLN A 1 9  ? 6.629   -11.729 5.547   1.00 0.00 ? 9  GLN A HG3  10 
ATOM 10165 H HE21 . GLN A 1 9  ? 6.599   -13.825 6.027   1.00 0.00 ? 9  GLN A HE21 10 
ATOM 10166 H HE22 . GLN A 1 9  ? 6.443   -15.144 4.861   1.00 0.00 ? 9  GLN A HE22 10 
ATOM 10167 N N    . MET A 1 10 ? 2.346   -8.949  5.069   1.00 0.00 ? 10 MET A N    10 
ATOM 10168 C CA   . MET A 1 10 ? 0.967   -8.554  4.832   1.00 0.00 ? 10 MET A CA   10 
ATOM 10169 C C    . MET A 1 10 ? 0.942   -7.150  4.224   1.00 0.00 ? 10 MET A C    10 
ATOM 10170 O O    . MET A 1 10 ? 0.150   -6.923  3.298   1.00 0.00 ? 10 MET A O    10 
ATOM 10171 C CB   . MET A 1 10 ? 0.181   -8.556  6.145   1.00 0.00 ? 10 MET A CB   10 
ATOM 10172 C CG   . MET A 1 10 ? 0.446   -9.835  6.941   1.00 0.00 ? 10 MET A CG   10 
ATOM 10173 S SD   . MET A 1 10 ? -1.124  -10.658 7.336   1.00 0.00 ? 10 MET A SD   10 
ATOM 10174 C CE   . MET A 1 10 ? -1.580  -9.759  8.847   1.00 0.00 ? 10 MET A CE   10 
ATOM 10175 H H    . MET A 1 10 ? 2.720   -8.840  6.011   1.00 0.00 ? 10 MET A H    10 
ATOM 10176 H HA   . MET A 1 10 ? 0.514   -9.253  4.131   1.00 0.00 ? 10 MET A HA   10 
ATOM 10177 H HB2  . MET A 1 10 ? 0.486   -7.697  6.743   1.00 0.00 ? 10 MET A HB2  10 
ATOM 10178 H HB3  . MET A 1 10 ? -0.882  -8.472  5.920   1.00 0.00 ? 10 MET A HB3  10 
ATOM 10179 H HG2  . MET A 1 10 ? 1.062   -10.511 6.347   1.00 0.00 ? 10 MET A HG2  10 
ATOM 10180 H HG3  . MET A 1 10 ? 0.977   -9.587  7.859   1.00 0.00 ? 10 MET A HG3  10 
ATOM 10181 H HE1  . MET A 1 10 ? -1.674  -8.694  8.634   1.00 0.00 ? 10 MET A HE1  10 
ATOM 10182 H HE2  . MET A 1 10 ? -2.529  -10.148 9.219   1.00 0.00 ? 10 MET A HE2  10 
ATOM 10183 H HE3  . MET A 1 10 ? -0.815  -9.901  9.610   1.00 0.00 ? 10 MET A HE3  10 
ATOM 10184 N N    . LEU A 1 11 ? 1.794   -6.250  4.748   1.00 0.00 ? 11 LEU A N    10 
ATOM 10185 C CA   . LEU A 1 11 ? 1.868   -4.884  4.260   1.00 0.00 ? 11 LEU A CA   10 
ATOM 10186 C C    . LEU A 1 11 ? 2.656   -4.857  2.948   1.00 0.00 ? 11 LEU A C    10 
ATOM 10187 O O    . LEU A 1 11 ? 2.436   -3.938  2.146   1.00 0.00 ? 11 LEU A O    10 
ATOM 10188 C CB   . LEU A 1 11 ? 2.436   -3.960  5.338   1.00 0.00 ? 11 LEU A CB   10 
ATOM 10189 C CG   . LEU A 1 11 ? 1.652   -3.898  6.650   1.00 0.00 ? 11 LEU A CG   10 
ATOM 10190 C CD1  . LEU A 1 11 ? 2.377   -3.029  7.681   1.00 0.00 ? 11 LEU A CD1  10 
ATOM 10191 C CD2  . LEU A 1 11 ? 0.217   -3.426  6.410   1.00 0.00 ? 11 LEU A CD2  10 
ATOM 10192 H H    . LEU A 1 11 ? 2.414   -6.520  5.511   1.00 0.00 ? 11 LEU A H    10 
ATOM 10193 H HA   . LEU A 1 11 ? 0.843   -4.571  4.064   1.00 0.00 ? 11 LEU A HA   10 
ATOM 10194 H HB2  . LEU A 1 11 ? 3.446   -4.313  5.544   1.00 0.00 ? 11 LEU A HB2  10 
ATOM 10195 H HB3  . LEU A 1 11 ? 2.491   -2.967  4.891   1.00 0.00 ? 11 LEU A HB3  10 
ATOM 10196 H HG   . LEU A 1 11 ? 1.632   -4.924  7.017   1.00 0.00 ? 11 LEU A HG   10 
ATOM 10197 H HD11 . LEU A 1 11 ? 2.499   -2.018  7.295   1.00 0.00 ? 11 LEU A HD11 10 
ATOM 10198 H HD12 . LEU A 1 11 ? 1.791   -3.008  8.601   1.00 0.00 ? 11 LEU A HD12 10 
ATOM 10199 H HD13 . LEU A 1 11 ? 3.360   -3.448  7.895   1.00 0.00 ? 11 LEU A HD13 10 
ATOM 10200 H HD21 . LEU A 1 11 ? -0.290  -4.109  5.727   1.00 0.00 ? 11 LEU A HD21 10 
ATOM 10201 H HD22 . LEU A 1 11 ? -0.310  -3.395  7.363   1.00 0.00 ? 11 LEU A HD22 10 
ATOM 10202 H HD23 . LEU A 1 11 ? 0.222   -2.427  5.973   1.00 0.00 ? 11 LEU A HD23 10 
ATOM 10203 N N    . LYS A 1 12 ? 3.544   -5.850  2.759   1.00 0.00 ? 12 LYS A N    10 
ATOM 10204 C CA   . LYS A 1 12 ? 4.355   -5.939  1.558   1.00 0.00 ? 12 LYS A CA   10 
ATOM 10205 C C    . LYS A 1 12 ? 3.499   -6.474  0.408   1.00 0.00 ? 12 LYS A C    10 
ATOM 10206 O O    . LYS A 1 12 ? 3.744   -6.080  -0.742  1.00 0.00 ? 12 LYS A O    10 
ATOM 10207 C CB   . LYS A 1 12 ? 5.615   -6.765  1.821   1.00 0.00 ? 12 LYS A CB   10 
ATOM 10208 C CG   . LYS A 1 12 ? 6.395   -7.004  0.527   1.00 0.00 ? 12 LYS A CG   10 
ATOM 10209 C CD   . LYS A 1 12 ? 5.999   -8.336  -0.114  1.00 0.00 ? 12 LYS A CD   10 
ATOM 10210 C CE   . LYS A 1 12 ? 6.641   -9.512  0.624   1.00 0.00 ? 12 LYS A CE   10 
ATOM 10211 N NZ   . LYS A 1 12 ? 8.107   -9.373  0.640   1.00 0.00 ? 12 LYS A NZ   10 
ATOM 10212 H H    . LYS A 1 12 ? 3.664   -6.570  3.472   1.00 0.00 ? 12 LYS A H    10 
ATOM 10213 H HA   . LYS A 1 12 ? 4.672   -4.922  1.321   1.00 0.00 ? 12 LYS A HA   10 
ATOM 10214 H HB2  . LYS A 1 12 ? 6.251   -6.227  2.525   1.00 0.00 ? 12 LYS A HB2  10 
ATOM 10215 H HB3  . LYS A 1 12 ? 5.326   -7.719  2.263   1.00 0.00 ? 12 LYS A HB3  10 
ATOM 10216 H HG2  . LYS A 1 12 ? 6.179   -6.196  -0.171  1.00 0.00 ? 12 LYS A HG2  10 
ATOM 10217 H HG3  . LYS A 1 12 ? 7.462   -7.003  0.752   1.00 0.00 ? 12 LYS A HG3  10 
ATOM 10218 H HD2  . LYS A 1 12 ? 4.915   -8.440  -0.073  1.00 0.00 ? 12 LYS A HD2  10 
ATOM 10219 H HD3  . LYS A 1 12 ? 6.316   -8.334  -1.157  1.00 0.00 ? 12 LYS A HD3  10 
ATOM 10220 H HE2  . LYS A 1 12 ? 6.275   -9.534  1.650   1.00 0.00 ? 12 LYS A HE2  10 
ATOM 10221 H HE3  . LYS A 1 12 ? 6.362   -10.442 0.128   1.00 0.00 ? 12 LYS A HE3  10 
ATOM 10222 H HZ1  . LYS A 1 12 ? 8.368   -8.503  1.105   1.00 0.00 ? 12 LYS A HZ1  10 
ATOM 10223 H HZ2  . LYS A 1 12 ? 8.510   -10.167 1.136   1.00 0.00 ? 12 LYS A HZ2  10 
ATOM 10224 H HZ3  . LYS A 1 12 ? 8.466   -9.360  -0.314  1.00 0.00 ? 12 LYS A HZ3  10 
ATOM 10225 N N    . LEU A 1 13 ? 2.527   -7.344  0.734   1.00 0.00 ? 13 LEU A N    10 
ATOM 10226 C CA   . LEU A 1 13 ? 1.646   -7.924  -0.264  1.00 0.00 ? 13 LEU A CA   10 
ATOM 10227 C C    . LEU A 1 13 ? 0.548   -6.918  -0.615  1.00 0.00 ? 13 LEU A C    10 
ATOM 10228 O O    . LEU A 1 13 ? 0.252   -6.760  -1.809  1.00 0.00 ? 13 LEU A O    10 
ATOM 10229 C CB   . LEU A 1 13 ? 1.111   -9.276  0.214   1.00 0.00 ? 13 LEU A CB   10 
ATOM 10230 C CG   . LEU A 1 13 ? 0.757   -10.284 -0.882  1.00 0.00 ? 13 LEU A CG   10 
ATOM 10231 C CD1  . LEU A 1 13 ? -0.086  -11.429 -0.321  1.00 0.00 ? 13 LEU A CD1  10 
ATOM 10232 C CD2  . LEU A 1 13 ? 0.074   -9.592  -2.062  1.00 0.00 ? 13 LEU A CD2  10 
ATOM 10233 H H    . LEU A 1 13 ? 2.392   -7.615  1.708   1.00 0.00 ? 13 LEU A H    10 
ATOM 10234 H HA   . LEU A 1 13 ? 2.256   -8.107  -1.148  1.00 0.00 ? 13 LEU A HA   10 
ATOM 10235 H HB2  . LEU A 1 13 ? 1.883   -9.703  0.855   1.00 0.00 ? 13 LEU A HB2  10 
ATOM 10236 H HB3  . LEU A 1 13 ? 0.230   -9.059  0.818   1.00 0.00 ? 13 LEU A HB3  10 
ATOM 10237 H HG   . LEU A 1 13 ? 1.714   -10.689 -1.213  1.00 0.00 ? 13 LEU A HG   10 
ATOM 10238 H HD11 . LEU A 1 13 ? -1.008  -11.038 0.108   1.00 0.00 ? 13 LEU A HD11 10 
ATOM 10239 H HD12 . LEU A 1 13 ? -0.319  -12.126 -1.126  1.00 0.00 ? 13 LEU A HD12 10 
ATOM 10240 H HD13 . LEU A 1 13 ? 0.470   -11.956 0.455   1.00 0.00 ? 13 LEU A HD13 10 
ATOM 10241 H HD21 . LEU A 1 13 ? 0.733   -8.832  -2.480  1.00 0.00 ? 13 LEU A HD21 10 
ATOM 10242 H HD22 . LEU A 1 13 ? -0.162  -10.338 -2.822  1.00 0.00 ? 13 LEU A HD22 10 
ATOM 10243 H HD23 . LEU A 1 13 ? -0.850  -9.118  -1.731  1.00 0.00 ? 13 LEU A HD23 10 
ATOM 10244 N N    . ASP A 1 14 ? -0.025  -6.267  0.414   1.00 0.00 ? 14 ASP A N    10 
ATOM 10245 C CA   . ASP A 1 14 ? -1.078  -5.287  0.215   1.00 0.00 ? 14 ASP A CA   10 
ATOM 10246 C C    . ASP A 1 14 ? -0.533  -4.120  -0.612  1.00 0.00 ? 14 ASP A C    10 
ATOM 10247 O O    . ASP A 1 14 ? -1.309  -3.524  -1.373  1.00 0.00 ? 14 ASP A O    10 
ATOM 10248 C CB   . ASP A 1 14 ? -1.573  -4.731  1.550   1.00 0.00 ? 14 ASP A CB   10 
ATOM 10249 C CG   . ASP A 1 14 ? -3.091  -4.591  1.671   1.00 0.00 ? 14 ASP A CG   10 
ATOM 10250 O OD1  . ASP A 1 14 ? -3.764  -5.642  1.344   1.00 0.00 ? 14 ASP A OD1  10 
ATOM 10251 O OD2  . ASP A 1 14 ? -3.606  -3.531  2.058   1.00 0.00 ? 14 ASP A OD2  10 
ATOM 10252 H H    . ASP A 1 14 ? 0.278   -6.458  1.368   1.00 0.00 ? 14 ASP A H    10 
ATOM 10253 H HA   . ASP A 1 14 ? -1.899  -5.755  -0.330  1.00 0.00 ? 14 ASP A HA   10 
ATOM 10254 H HB2  . ASP A 1 14 ? -1.216  -5.407  2.327   1.00 0.00 ? 14 ASP A HB2  10 
ATOM 10255 H HB3  . ASP A 1 14 ? -1.098  -3.758  1.682   1.00 0.00 ? 14 ASP A HB3  10 
ATOM 10256 N N    . ASN A 1 15 ? 0.768   -3.823  -0.448  1.00 0.00 ? 15 ASN A N    10 
ATOM 10257 C CA   . ASN A 1 15 ? 1.407   -2.739  -1.174  1.00 0.00 ? 15 ASN A CA   10 
ATOM 10258 C C    . ASN A 1 15 ? 1.375   -3.044  -2.673  1.00 0.00 ? 15 ASN A C    10 
ATOM 10259 O O    . ASN A 1 15 ? 0.946   -2.174  -3.444  1.00 0.00 ? 15 ASN A O    10 
ATOM 10260 C CB   . ASN A 1 15 ? 2.870   -2.582  -0.755  1.00 0.00 ? 15 ASN A CB   10 
ATOM 10261 C CG   . ASN A 1 15 ? 3.384   -1.176  -1.072  1.00 0.00 ? 15 ASN A CG   10 
ATOM 10262 O OD1  . ASN A 1 15 ? 3.811   -0.878  -2.175  1.00 0.00 ? 15 ASN A OD1  10 
ATOM 10263 N ND2  . ASN A 1 15 ? 3.319   -0.332  -0.047  1.00 0.00 ? 15 ASN A ND2  10 
ATOM 10264 H H    . ASN A 1 15 ? 1.337   -4.366  0.201   1.00 0.00 ? 15 ASN A H    10 
ATOM 10265 H HA   . ASN A 1 15 ? 0.857   -1.815  -0.989  1.00 0.00 ? 15 ASN A HA   10 
ATOM 10266 H HB2  . ASN A 1 15 ? 2.951   -2.754  0.319   1.00 0.00 ? 15 ASN A HB2  10 
ATOM 10267 H HB3  . ASN A 1 15 ? 3.470   -3.325  -1.280  1.00 0.00 ? 15 ASN A HB3  10 
ATOM 10268 H HD21 . ASN A 1 15 ? 2.950   -0.647  0.851   1.00 0.00 ? 15 ASN A HD21 10 
ATOM 10269 H HD22 . ASN A 1 15 ? 3.638   0.631   -0.157  1.00 0.00 ? 15 ASN A HD22 10 
ATOM 10270 N N    . TYR A 1 16 ? 1.824   -4.255  -3.050  1.00 0.00 ? 16 TYR A N    10 
ATOM 10271 C CA   . TYR A 1 16 ? 1.824   -4.606  -4.460  1.00 0.00 ? 16 TYR A CA   10 
ATOM 10272 C C    . TYR A 1 16 ? 0.386   -4.594  -4.984  1.00 0.00 ? 16 TYR A C    10 
ATOM 10273 O O    . TYR A 1 16 ? 0.190   -4.176  -6.134  1.00 0.00 ? 16 TYR A O    10 
ATOM 10274 C CB   . TYR A 1 16 ? 2.498   -5.975  -4.664  1.00 0.00 ? 16 TYR A CB   10 
ATOM 10275 C CG   . TYR A 1 16 ? 3.870   -6.107  -4.019  1.00 0.00 ? 16 TYR A CG   10 
ATOM 10276 C CD1  . TYR A 1 16 ? 4.534   -4.958  -3.530  1.00 0.00 ? 16 TYR A CD1  10 
ATOM 10277 C CD2  . TYR A 1 16 ? 4.487   -7.374  -3.900  1.00 0.00 ? 16 TYR A CD2  10 
ATOM 10278 C CE1  . TYR A 1 16 ? 5.805   -5.075  -2.928  1.00 0.00 ? 16 TYR A CE1  10 
ATOM 10279 C CE2  . TYR A 1 16 ? 5.758   -7.490  -3.298  1.00 0.00 ? 16 TYR A CE2  10 
ATOM 10280 C CZ   . TYR A 1 16 ? 6.419   -6.340  -2.813  1.00 0.00 ? 16 TYR A CZ   10 
ATOM 10281 O OH   . TYR A 1 16 ? 7.649   -6.450  -2.231  1.00 0.00 ? 16 TYR A OH   10 
ATOM 10282 H H    . TYR A 1 16 ? 2.162   -4.920  -2.368  1.00 0.00 ? 16 TYR A H    10 
ATOM 10283 H HA   . TYR A 1 16 ? 2.389   -3.844  -5.000  1.00 0.00 ? 16 TYR A HA   10 
ATOM 10284 H HB2  . TYR A 1 16 ? 1.839   -6.757  -4.282  1.00 0.00 ? 16 TYR A HB2  10 
ATOM 10285 H HB3  . TYR A 1 16 ? 2.615   -6.154  -5.735  1.00 0.00 ? 16 TYR A HB3  10 
ATOM 10286 H HD1  . TYR A 1 16 ? 4.070   -3.985  -3.614  1.00 0.00 ? 16 TYR A HD1  10 
ATOM 10287 H HD2  . TYR A 1 16 ? 3.988   -8.258  -4.267  1.00 0.00 ? 16 TYR A HD2  10 
ATOM 10288 H HE1  . TYR A 1 16 ? 6.306   -4.191  -2.558  1.00 0.00 ? 16 TYR A HE1  10 
ATOM 10289 H HE2  . TYR A 1 16 ? 6.222   -8.462  -3.212  1.00 0.00 ? 16 TYR A HE2  10 
ATOM 10290 H HH   . TYR A 1 16 ? 7.737   -5.942  -1.420  1.00 0.00 ? 16 TYR A HH   10 
ATOM 10291 N N    . HIS A 1 17 ? -0.569  -5.051  -4.155  1.00 0.00 ? 17 HIS A N    10 
ATOM 10292 C CA   . HIS A 1 17 ? -1.968  -5.098  -4.545  1.00 0.00 ? 17 HIS A CA   10 
ATOM 10293 C C    . HIS A 1 17 ? -2.499  -3.670  -4.694  1.00 0.00 ? 17 HIS A C    10 
ATOM 10294 O O    . HIS A 1 17 ? -3.365  -3.449  -5.553  1.00 0.00 ? 17 HIS A O    10 
ATOM 10295 C CB   . HIS A 1 17 ? -2.784  -5.934  -3.558  1.00 0.00 ? 17 HIS A CB   10 
ATOM 10296 C CG   . HIS A 1 17 ? -4.015  -5.236  -3.031  1.00 0.00 ? 17 HIS A CG   10 
ATOM 10297 N ND1  . HIS A 1 17 ? -5.199  -5.165  -3.744  1.00 0.00 ? 17 HIS A ND1  10 
ATOM 10298 C CD2  . HIS A 1 17 ? -4.233  -4.580  -1.855  1.00 0.00 ? 17 HIS A CD2  10 
ATOM 10299 C CE1  . HIS A 1 17 ? -6.083  -4.494  -3.020  1.00 0.00 ? 17 HIS A CE1  10 
ATOM 10300 N NE2  . HIS A 1 17 ? -5.482  -4.131  -1.851  1.00 0.00 ? 17 HIS A NE2  10 
ATOM 10301 H H    . HIS A 1 17 ? -0.321  -5.377  -3.222  1.00 0.00 ? 17 HIS A H    10 
ATOM 10302 H HA   . HIS A 1 17 ? -2.002  -5.591  -5.516  1.00 0.00 ? 17 HIS A HA   10 
ATOM 10303 H HB2  . HIS A 1 17 ? -3.087  -6.845  -4.074  1.00 0.00 ? 17 HIS A HB2  10 
ATOM 10304 H HB3  . HIS A 1 17 ? -2.123  -6.197  -2.732  1.00 0.00 ? 17 HIS A HB3  10 
ATOM 10305 H HD1  . HIS A 1 17 ? -5.460  -5.524  -4.662  1.00 0.00 ? 17 HIS A HD1  10 
ATOM 10306 H HD2  . HIS A 1 17 ? -3.589  -4.393  -1.009  1.00 0.00 ? 17 HIS A HD2  10 
ATOM 10307 H HE1  . HIS A 1 17 ? -7.080  -4.326  -3.403  1.00 0.00 ? 17 HIS A HE1  10 
ATOM 10308 N N    . LEU A 1 18 ? -1.981  -2.745  -3.866  1.00 0.00 ? 18 LEU A N    10 
ATOM 10309 C CA   . LEU A 1 18 ? -2.401  -1.355  -3.905  1.00 0.00 ? 18 LEU A CA   10 
ATOM 10310 C C    . LEU A 1 18 ? -1.753  -0.665  -5.106  1.00 0.00 ? 18 LEU A C    10 
ATOM 10311 O O    . LEU A 1 18 ? -2.462  0.052   -5.829  1.00 0.00 ? 18 LEU A O    10 
ATOM 10312 C CB   . LEU A 1 18 ? -2.108  -0.668  -2.569  1.00 0.00 ? 18 LEU A CB   10 
ATOM 10313 C CG   . LEU A 1 18 ? -2.976  -1.102  -1.387  1.00 0.00 ? 18 LEU A CG   10 
ATOM 10314 C CD1  . LEU A 1 18 ? -2.274  -0.820  -0.058  1.00 0.00 ? 18 LEU A CD1  10 
ATOM 10315 C CD2  . LEU A 1 18 ? -4.359  -0.450  -1.454  1.00 0.00 ? 18 LEU A CD2  10 
ATOM 10316 H H    . LEU A 1 18 ? -1.271  -3.011  -3.184  1.00 0.00 ? 18 LEU A H    10 
ATOM 10317 H HA   . LEU A 1 18 ? -3.482  -1.362  -4.041  1.00 0.00 ? 18 LEU A HA   10 
ATOM 10318 H HB2  . LEU A 1 18 ? -1.063  -0.879  -2.338  1.00 0.00 ? 18 LEU A HB2  10 
ATOM 10319 H HB3  . LEU A 1 18 ? -2.224  0.401   -2.744  1.00 0.00 ? 18 LEU A HB3  10 
ATOM 10320 H HG   . LEU A 1 18 ? -3.087  -2.181  -1.496  1.00 0.00 ? 18 LEU A HG   10 
ATOM 10321 H HD11 . LEU A 1 18 ? -2.062  0.245   0.031   1.00 0.00 ? 18 LEU A HD11 10 
ATOM 10322 H HD12 . LEU A 1 18 ? -2.919  -1.140  0.760   1.00 0.00 ? 18 LEU A HD12 10 
ATOM 10323 H HD13 . LEU A 1 18 ? -1.336  -1.374  -0.007  1.00 0.00 ? 18 LEU A HD13 10 
ATOM 10324 H HD21 . LEU A 1 18 ? -4.858  -0.731  -2.381  1.00 0.00 ? 18 LEU A HD21 10 
ATOM 10325 H HD22 . LEU A 1 18 ? -4.949  -0.780  -0.599  1.00 0.00 ? 18 LEU A HD22 10 
ATOM 10326 H HD23 . LEU A 1 18 ? -4.260  0.634   -1.419  1.00 0.00 ? 18 LEU A HD23 10 
ATOM 10327 N N    . GLU A 1 19 ? -0.440  -0.890  -5.294  1.00 0.00 ? 19 GLU A N    10 
ATOM 10328 C CA   . GLU A 1 19 ? 0.294   -0.293  -6.398  1.00 0.00 ? 19 GLU A CA   10 
ATOM 10329 C C    . GLU A 1 19 ? -0.178  -0.916  -7.714  1.00 0.00 ? 19 GLU A C    10 
ATOM 10330 O O    . GLU A 1 19 ? -0.168  -0.214  -8.736  1.00 0.00 ? 19 GLU A O    10 
ATOM 10331 C CB   . GLU A 1 19 ? 1.804   -0.461  -6.223  1.00 0.00 ? 19 GLU A CB   10 
ATOM 10332 C CG   . GLU A 1 19 ? 2.516   0.893   -6.286  1.00 0.00 ? 19 GLU A CG   10 
ATOM 10333 C CD   . GLU A 1 19 ? 1.996   1.836   -5.200  1.00 0.00 ? 19 GLU A CD   10 
ATOM 10334 O OE1  . GLU A 1 19 ? 1.234   1.285   -4.318  1.00 0.00 ? 19 GLU A OE1  10 
ATOM 10335 O OE2  . GLU A 1 19 ? 2.316   3.035   -5.215  1.00 0.00 ? 19 GLU A OE2  10 
ATOM 10336 H H    . GLU A 1 19 ? 0.070   -1.494  -4.651  1.00 0.00 ? 19 GLU A H    10 
ATOM 10337 H HA   . GLU A 1 19 ? 0.053   0.769   -6.401  1.00 0.00 ? 19 GLU A HA   10 
ATOM 10338 H HB2  . GLU A 1 19 ? 2.000   -0.920  -5.255  1.00 0.00 ? 19 GLU A HB2  10 
ATOM 10339 H HB3  . GLU A 1 19 ? 2.181   -1.115  -7.009  1.00 0.00 ? 19 GLU A HB3  10 
ATOM 10340 H HG2  . GLU A 1 19 ? 3.585   0.738   -6.141  1.00 0.00 ? 19 GLU A HG2  10 
ATOM 10341 H HG3  . GLU A 1 19 ? 2.352   1.333   -7.270  1.00 0.00 ? 19 GLU A HG3  10 
ATOM 10342 N N    . ASN A 1 20 ? -0.576  -2.200  -7.664  1.00 0.00 ? 20 ASN A N    10 
ATOM 10343 C CA   . ASN A 1 20 ? -1.046  -2.906  -8.843  1.00 0.00 ? 20 ASN A CA   10 
ATOM 10344 C C    . ASN A 1 20 ? -2.417  -2.360  -9.246  1.00 0.00 ? 20 ASN A C    10 
ATOM 10345 O O    . ASN A 1 20 ? -2.707  -2.326  -10.451 1.00 0.00 ? 20 ASN A O    10 
ATOM 10346 C CB   . ASN A 1 20 ? -1.198  -4.403  -8.564  1.00 0.00 ? 20 ASN A CB   10 
ATOM 10347 C CG   . ASN A 1 20 ? 0.104   -5.151  -8.861  1.00 0.00 ? 20 ASN A CG   10 
ATOM 10348 O OD1  . ASN A 1 20 ? 0.918   -4.736  -9.670  1.00 0.00 ? 20 ASN A OD1  10 
ATOM 10349 N ND2  . ASN A 1 20 ? 0.257   -6.271  -8.160  1.00 0.00 ? 20 ASN A ND2  10 
ATOM 10350 H H    . ASN A 1 20 ? -0.552  -2.707  -6.779  1.00 0.00 ? 20 ASN A H    10 
ATOM 10351 H HA   . ASN A 1 20 ? -0.344  -2.741  -9.659  1.00 0.00 ? 20 ASN A HA   10 
ATOM 10352 H HB2  . ASN A 1 20 ? -1.457  -4.544  -7.515  1.00 0.00 ? 20 ASN A HB2  10 
ATOM 10353 H HB3  . ASN A 1 20 ? -2.002  -4.799  -9.185  1.00 0.00 ? 20 ASN A HB3  10 
ATOM 10354 H HD21 . ASN A 1 20 ? -0.463  -6.560  -7.498  1.00 0.00 ? 20 ASN A HD21 10 
ATOM 10355 H HD22 . ASN A 1 20 ? 1.093   -6.842  -8.286  1.00 0.00 ? 20 ASN A HD22 10 
ATOM 10356 N N    . GLU A 1 21 ? -3.220  -1.951  -8.248  1.00 0.00 ? 21 GLU A N    10 
ATOM 10357 C CA   . GLU A 1 21 ? -4.546  -1.412  -8.498  1.00 0.00 ? 21 GLU A CA   10 
ATOM 10358 C C    . GLU A 1 21 ? -4.429  0.065   -8.879  1.00 0.00 ? 21 GLU A C    10 
ATOM 10359 O O    . GLU A 1 21 ? -5.098  0.483   -9.835  1.00 0.00 ? 21 GLU A O    10 
ATOM 10360 C CB   . GLU A 1 21 ? -5.465  -1.595  -7.287  1.00 0.00 ? 21 GLU A CB   10 
ATOM 10361 C CG   . GLU A 1 21 ? -6.854  -2.068  -7.720  1.00 0.00 ? 21 GLU A CG   10 
ATOM 10362 C CD   . GLU A 1 21 ? -7.865  -1.914  -6.581  1.00 0.00 ? 21 GLU A CD   10 
ATOM 10363 O OE1  . GLU A 1 21 ? -7.384  -2.097  -5.398  1.00 0.00 ? 21 GLU A OE1  10 
ATOM 10364 O OE2  . GLU A 1 21 ? -9.046  -1.634  -6.834  1.00 0.00 ? 21 GLU A OE2  10 
ATOM 10365 H H    . GLU A 1 21 ? -2.904  -2.014  -7.281  1.00 0.00 ? 21 GLU A H    10 
ATOM 10366 H HA   . GLU A 1 21 ? -4.960  -1.964  -9.342  1.00 0.00 ? 21 GLU A HA   10 
ATOM 10367 H HB2  . GLU A 1 21 ? -5.028  -2.338  -6.621  1.00 0.00 ? 21 GLU A HB2  10 
ATOM 10368 H HB3  . GLU A 1 21 ? -5.544  -0.646  -6.757  1.00 0.00 ? 21 GLU A HB3  10 
ATOM 10369 H HG2  . GLU A 1 21 ? -7.183  -1.472  -8.570  1.00 0.00 ? 21 GLU A HG2  10 
ATOM 10370 H HG3  . GLU A 1 21 ? -6.792  -3.114  -8.023  1.00 0.00 ? 21 GLU A HG3  10 
ATOM 10371 N N    . VAL A 1 22 ? -3.595  0.814   -8.135  1.00 0.00 ? 22 VAL A N    10 
ATOM 10372 C CA   . VAL A 1 22 ? -3.394  2.229   -8.393  1.00 0.00 ? 22 VAL A CA   10 
ATOM 10373 C C    . VAL A 1 22 ? -2.721  2.405   -9.757  1.00 0.00 ? 22 VAL A C    10 
ATOM 10374 O O    . VAL A 1 22 ? -2.995  3.412   -10.425 1.00 0.00 ? 22 VAL A O    10 
ATOM 10375 C CB   . VAL A 1 22 ? -2.600  2.863   -7.249  1.00 0.00 ? 22 VAL A CB   10 
ATOM 10376 C CG1  . VAL A 1 22 ? -1.934  4.165   -7.698  1.00 0.00 ? 22 VAL A CG1  10 
ATOM 10377 C CG2  . VAL A 1 22 ? -3.490  3.095   -6.027  1.00 0.00 ? 22 VAL A CG2  10 
ATOM 10378 H H    . VAL A 1 22 ? -3.081  0.390   -7.362  1.00 0.00 ? 22 VAL A H    10 
ATOM 10379 H HA   . VAL A 1 22 ? -4.377  2.700   -8.420  1.00 0.00 ? 22 VAL A HA   10 
ATOM 10380 H HB   . VAL A 1 22 ? -1.826  2.140   -6.991  1.00 0.00 ? 22 VAL A HB   10 
ATOM 10381 H HG11 . VAL A 1 22 ? -2.692  4.873   -8.036  1.00 0.00 ? 22 VAL A HG11 10 
ATOM 10382 H HG12 . VAL A 1 22 ? -1.379  4.588   -6.861  1.00 0.00 ? 22 VAL A HG12 10 
ATOM 10383 H HG13 . VAL A 1 22 ? -1.244  3.966   -8.517  1.00 0.00 ? 22 VAL A HG13 10 
ATOM 10384 H HG21 . VAL A 1 22 ? -3.908  2.148   -5.686  1.00 0.00 ? 22 VAL A HG21 10 
ATOM 10385 H HG22 . VAL A 1 22 ? -2.894  3.545   -5.234  1.00 0.00 ? 22 VAL A HG22 10 
ATOM 10386 H HG23 . VAL A 1 22 ? -4.306  3.770   -6.285  1.00 0.00 ? 22 VAL A HG23 10 
ATOM 10387 N N    . ALA A 1 23 ? -1.866  1.436   -10.134 1.00 0.00 ? 23 ALA A N    10 
ATOM 10388 C CA   . ALA A 1 23 ? -1.163  1.484   -11.405 1.00 0.00 ? 23 ALA A CA   10 
ATOM 10389 C C    . ALA A 1 23 ? -2.182  1.542   -12.545 1.00 0.00 ? 23 ALA A C    10 
ATOM 10390 O O    . ALA A 1 23 ? -1.808  1.967   -13.649 1.00 0.00 ? 23 ALA A O    10 
ATOM 10391 C CB   . ALA A 1 23 ? -0.371  0.190   -11.603 1.00 0.00 ? 23 ALA A CB   10 
ATOM 10392 H H    . ALA A 1 23 ? -1.696  0.639   -9.522  1.00 0.00 ? 23 ALA A H    10 
ATOM 10393 H HA   . ALA A 1 23 ? -0.514  2.358   -11.464 1.00 0.00 ? 23 ALA A HA   10 
ATOM 10394 H HB1  . ALA A 1 23 ? 0.341   0.081   -10.785 1.00 0.00 ? 23 ALA A HB1  10 
ATOM 10395 H HB2  . ALA A 1 23 ? -1.048  -0.664  -11.601 1.00 0.00 ? 23 ALA A HB2  10 
ATOM 10396 H HB3  . ALA A 1 23 ? 0.159   0.220   -12.555 1.00 0.00 ? 23 ALA A HB3  10 
ATOM 10397 N N    . ARG A 1 24 ? -3.428  1.121   -12.262 1.00 0.00 ? 24 ARG A N    10 
ATOM 10398 C CA   . ARG A 1 24 ? -4.486  1.125   -13.256 1.00 0.00 ? 24 ARG A CA   10 
ATOM 10399 C C    . ARG A 1 24 ? -5.245  2.452   -13.182 1.00 0.00 ? 24 ARG A C    10 
ATOM 10400 O O    . ARG A 1 24 ? -5.586  2.996   -14.243 1.00 0.00 ? 24 ARG A O    10 
ATOM 10401 C CB   . ARG A 1 24 ? -5.469  -0.028  -13.039 1.00 0.00 ? 24 ARG A CB   10 
ATOM 10402 C CG   . ARG A 1 24 ? -4.775  -1.221  -12.381 1.00 0.00 ? 24 ARG A CG   10 
ATOM 10403 C CD   . ARG A 1 24 ? -5.767  -2.358  -12.122 1.00 0.00 ? 24 ARG A CD   10 
ATOM 10404 N NE   . ARG A 1 24 ? -5.633  -3.395  -13.171 1.00 0.00 ? 24 ARG A NE   10 
ATOM 10405 C CZ   . ARG A 1 24 ? -5.624  -4.722  -12.925 1.00 0.00 ? 24 ARG A CZ   10 
ATOM 10406 N NH1  . ARG A 1 24 ? -5.742  -5.150  -11.661 1.00 0.00 ? 24 ARG A NH1  10 
ATOM 10407 N NH2  . ARG A 1 24 ? -5.499  -5.599  -13.932 1.00 0.00 ? 24 ARG A NH2  10 
ATOM 10408 H H    . ARG A 1 24 ? -3.651  0.786   -11.325 1.00 0.00 ? 24 ARG A H    10 
ATOM 10409 H HA   . ARG A 1 24 ? -4.023  1.036   -14.239 1.00 0.00 ? 24 ARG A HA   10 
ATOM 10410 H HB2  . ARG A 1 24 ? -6.278  0.313   -12.394 1.00 0.00 ? 24 ARG A HB2  10 
ATOM 10411 H HB3  . ARG A 1 24 ? -5.885  -0.324  -14.002 1.00 0.00 ? 24 ARG A HB3  10 
ATOM 10412 H HG2  . ARG A 1 24 ? -3.987  -1.582  -13.042 1.00 0.00 ? 24 ARG A HG2  10 
ATOM 10413 H HG3  . ARG A 1 24 ? -4.329  -0.898  -11.441 1.00 0.00 ? 24 ARG A HG3  10 
ATOM 10414 H HD2  . ARG A 1 24 ? -5.560  -2.807  -11.151 1.00 0.00 ? 24 ARG A HD2  10 
ATOM 10415 H HD3  . ARG A 1 24 ? -6.782  -1.960  -12.120 1.00 0.00 ? 24 ARG A HD3  10 
ATOM 10416 H HE   . ARG A 1 24 ? -5.545  -3.052  -14.127 1.00 0.00 ? 24 ARG A HE   10 
ATOM 10417 H HH11 . ARG A 1 24 ? -5.837  -4.476  -10.901 1.00 0.00 ? 24 ARG A HH11 10 
ATOM 10418 H HH12 . ARG A 1 24 ? -5.736  -6.150  -11.458 1.00 0.00 ? 24 ARG A HH12 10 
ATOM 10419 H HH21 . ARG A 1 24 ? -5.410  -5.265  -14.891 1.00 0.00 ? 24 ARG A HH21 10 
ATOM 10420 H HH22 . ARG A 1 24 ? -5.493  -6.600  -13.737 1.00 0.00 ? 24 ARG A HH22 10 
ATOM 10421 N N    . LEU A 1 25 ? -5.488  2.938   -11.952 1.00 0.00 ? 25 LEU A N    10 
ATOM 10422 C CA   . LEU A 1 25 ? -6.199  4.190   -11.745 1.00 0.00 ? 25 LEU A CA   10 
ATOM 10423 C C    . LEU A 1 25 ? -5.286  5.358   -12.123 1.00 0.00 ? 25 LEU A C    10 
ATOM 10424 O O    . LEU A 1 25 ? -5.782  6.326   -12.716 1.00 0.00 ? 25 LEU A O    10 
ATOM 10425 C CB   . LEU A 1 25 ? -6.739  4.268   -10.316 1.00 0.00 ? 25 LEU A CB   10 
ATOM 10426 C CG   . LEU A 1 25 ? -7.888  3.316   -9.979  1.00 0.00 ? 25 LEU A CG   10 
ATOM 10427 C CD1  . LEU A 1 25 ? -7.374  1.890   -9.769  1.00 0.00 ? 25 LEU A CD1  10 
ATOM 10428 C CD2  . LEU A 1 25 ? -8.685  3.821   -8.776  1.00 0.00 ? 25 LEU A CD2  10 
ATOM 10429 H H    . LEU A 1 25 ? -5.172  2.426   -11.129 1.00 0.00 ? 25 LEU A H    10 
ATOM 10430 H HA   . LEU A 1 25 ? -7.054  4.174   -12.420 1.00 0.00 ? 25 LEU A HA   10 
ATOM 10431 H HB2  . LEU A 1 25 ? -5.897  4.056   -9.657  1.00 0.00 ? 25 LEU A HB2  10 
ATOM 10432 H HB3  . LEU A 1 25 ? -7.056  5.300   -10.165 1.00 0.00 ? 25 LEU A HB3  10 
ATOM 10433 H HG   . LEU A 1 25 ? -8.531  3.324   -10.859 1.00 0.00 ? 25 LEU A HG   10 
ATOM 10434 H HD11 . LEU A 1 25 ? -6.650  1.872   -8.955  1.00 0.00 ? 25 LEU A HD11 10 
ATOM 10435 H HD12 . LEU A 1 25 ? -8.217  1.240   -9.533  1.00 0.00 ? 25 LEU A HD12 10 
ATOM 10436 H HD13 . LEU A 1 25 ? -6.894  1.530   -10.680 1.00 0.00 ? 25 LEU A HD13 10 
ATOM 10437 H HD21 . LEU A 1 25 ? -9.095  4.808   -8.989  1.00 0.00 ? 25 LEU A HD21 10 
ATOM 10438 H HD22 . LEU A 1 25 ? -9.493  3.120   -8.565  1.00 0.00 ? 25 LEU A HD22 10 
ATOM 10439 H HD23 . LEU A 1 25 ? -8.036  3.888   -7.902  1.00 0.00 ? 25 LEU A HD23 10 
ATOM 10440 N N    . LYS A 1 26 ? -3.990  5.246   -11.777 1.00 0.00 ? 26 LYS A N    10 
ATOM 10441 C CA   . LYS A 1 26 ? -3.021  6.287   -12.078 1.00 0.00 ? 26 LYS A CA   10 
ATOM 10442 C C    . LYS A 1 26 ? -2.984  6.521   -13.589 1.00 0.00 ? 26 LYS A C    10 
ATOM 10443 O O    . LYS A 1 26 ? -2.700  7.654   -14.003 1.00 0.00 ? 26 LYS A O    10 
ATOM 10444 C CB   . LYS A 1 26 ? -1.658  5.938   -11.476 1.00 0.00 ? 26 LYS A CB   10 
ATOM 10445 C CG   . LYS A 1 26 ? -1.342  6.836   -10.277 1.00 0.00 ? 26 LYS A CG   10 
ATOM 10446 C CD   . LYS A 1 26 ? -2.591  7.071   -9.425  1.00 0.00 ? 26 LYS A CD   10 
ATOM 10447 C CE   . LYS A 1 26 ? -3.223  8.428   -9.739  1.00 0.00 ? 26 LYS A CE   10 
ATOM 10448 N NZ   . LYS A 1 26 ? -3.223  9.286   -8.543  1.00 0.00 ? 26 LYS A NZ   10 
ATOM 10449 H H    . LYS A 1 26 ? -3.663  4.413   -11.289 1.00 0.00 ? 26 LYS A H    10 
ATOM 10450 H HA   . LYS A 1 26 ? -3.377  7.192   -11.586 1.00 0.00 ? 26 LYS A HA   10 
ATOM 10451 H HB2  . LYS A 1 26 ? -1.672  4.899   -11.147 1.00 0.00 ? 26 LYS A HB2  10 
ATOM 10452 H HB3  . LYS A 1 26 ? -0.892  6.058   -12.242 1.00 0.00 ? 26 LYS A HB3  10 
ATOM 10453 H HG2  . LYS A 1 26 ? -0.580  6.354   -9.666  1.00 0.00 ? 26 LYS A HG2  10 
ATOM 10454 H HG3  . LYS A 1 26 ? -0.957  7.788   -10.642 1.00 0.00 ? 26 LYS A HG3  10 
ATOM 10455 H HD2  . LYS A 1 26 ? -3.316  6.284   -9.635  1.00 0.00 ? 26 LYS A HD2  10 
ATOM 10456 H HD3  . LYS A 1 26 ? -2.313  7.025   -8.371  1.00 0.00 ? 26 LYS A HD3  10 
ATOM 10457 H HE2  . LYS A 1 26 ? -2.648  8.917   -10.525 1.00 0.00 ? 26 LYS A HE2  10 
ATOM 10458 H HE3  . LYS A 1 26 ? -4.244  8.277   -10.088 1.00 0.00 ? 26 LYS A HE3  10 
ATOM 10459 H HZ1  . LYS A 1 26 ? -2.267  9.428   -8.215  1.00 0.00 ? 26 LYS A HZ1  10 
ATOM 10460 H HZ2  . LYS A 1 26 ? -3.648  10.183  -8.777  1.00 0.00 ? 26 LYS A HZ2  10 
ATOM 10461 H HZ3  . LYS A 1 26 ? -3.765  8.845   -7.799  1.00 0.00 ? 26 LYS A HZ3  10 
ATOM 10462 N N    . LYS A 1 27 ? -3.267  5.464   -14.370 1.00 0.00 ? 27 LYS A N    10 
ATOM 10463 C CA   . LYS A 1 27 ? -3.264  5.555   -15.821 1.00 0.00 ? 27 LYS A CA   10 
ATOM 10464 C C    . LYS A 1 27 ? -4.600  6.133   -16.292 1.00 0.00 ? 27 LYS A C    10 
ATOM 10465 O O    . LYS A 1 27 ? -4.692  6.525   -17.465 1.00 0.00 ? 27 LYS A O    10 
ATOM 10466 C CB   . LYS A 1 27 ? -2.927  4.198   -16.443 1.00 0.00 ? 27 LYS A CB   10 
ATOM 10467 C CG   . LYS A 1 27 ? -1.929  4.354   -17.590 1.00 0.00 ? 27 LYS A CG   10 
ATOM 10468 C CD   . LYS A 1 27 ? -0.633  3.595   -17.296 1.00 0.00 ? 27 LYS A CD   10 
ATOM 10469 C CE   . LYS A 1 27 ? -0.917  2.121   -16.997 1.00 0.00 ? 27 LYS A CE   10 
ATOM 10470 N NZ   . LYS A 1 27 ? -0.269  1.257   -17.998 1.00 0.00 ? 27 LYS A NZ   10 
ATOM 10471 H H    . LYS A 1 27 ? -3.490  4.563   -13.948 1.00 0.00 ? 27 LYS A H    10 
ATOM 10472 H HA   . LYS A 1 27 ? -2.465  6.246   -16.086 1.00 0.00 ? 27 LYS A HA   10 
ATOM 10473 H HB2  . LYS A 1 27 ? -2.491  3.556   -15.677 1.00 0.00 ? 27 LYS A HB2  10 
ATOM 10474 H HB3  . LYS A 1 27 ? -3.846  3.739   -16.808 1.00 0.00 ? 27 LYS A HB3  10 
ATOM 10475 H HG2  . LYS A 1 27 ? -2.373  3.957   -18.502 1.00 0.00 ? 27 LYS A HG2  10 
ATOM 10476 H HG3  . LYS A 1 27 ? -1.715  5.414   -17.731 1.00 0.00 ? 27 LYS A HG3  10 
ATOM 10477 H HD2  . LYS A 1 27 ? 0.020   3.660   -18.167 1.00 0.00 ? 27 LYS A HD2  10 
ATOM 10478 H HD3  . LYS A 1 27 ? -0.137  4.059   -16.445 1.00 0.00 ? 27 LYS A HD3  10 
ATOM 10479 H HE2  . LYS A 1 27 ? -0.526  1.875   -16.009 1.00 0.00 ? 27 LYS A HE2  10 
ATOM 10480 H HE3  . LYS A 1 27 ? -1.994  1.956   -17.003 1.00 0.00 ? 27 LYS A HE3  10 
ATOM 10481 H HZ1  . LYS A 1 27 ? 0.738   1.412   -17.991 1.00 0.00 ? 27 LYS A HZ1  10 
ATOM 10482 H HZ2  . LYS A 1 27 ? -0.473  0.283   -17.776 1.00 0.00 ? 27 LYS A HZ2  10 
ATOM 10483 H HZ3  . LYS A 1 27 ? -0.632  1.470   -18.927 1.00 0.00 ? 27 LYS A HZ3  10 
ATOM 10484 N N    . LEU A 1 28 ? -5.593  6.173   -15.386 1.00 0.00 ? 28 LEU A N    10 
ATOM 10485 C CA   . LEU A 1 28 ? -6.909  6.699   -15.708 1.00 0.00 ? 28 LEU A CA   10 
ATOM 10486 C C    . LEU A 1 28 ? -7.059  8.094   -15.099 1.00 0.00 ? 28 LEU A C    10 
ATOM 10487 O O    . LEU A 1 28 ? -7.777  8.919   -15.684 1.00 0.00 ? 28 LEU A O    10 
ATOM 10488 C CB   . LEU A 1 28 ? -7.998  5.717   -15.271 1.00 0.00 ? 28 LEU A CB   10 
ATOM 10489 C CG   . LEU A 1 28 ? -9.047  5.366   -16.329 1.00 0.00 ? 28 LEU A CG   10 
ATOM 10490 C CD1  . LEU A 1 28 ? -8.556  4.231   -17.232 1.00 0.00 ? 28 LEU A CD1  10 
ATOM 10491 C CD2  . LEU A 1 28 ? -10.393 5.039   -15.680 1.00 0.00 ? 28 LEU A CD2  10 
ATOM 10492 H H    . LEU A 1 28 ? -5.434  5.828   -14.439 1.00 0.00 ? 28 LEU A H    10 
ATOM 10493 H HA   . LEU A 1 28 ? -6.953  6.779   -16.794 1.00 0.00 ? 28 LEU A HA   10 
ATOM 10494 H HB2  . LEU A 1 28 ? -7.486  4.806   -14.962 1.00 0.00 ? 28 LEU A HB2  10 
ATOM 10495 H HB3  . LEU A 1 28 ? -8.483  6.164   -14.403 1.00 0.00 ? 28 LEU A HB3  10 
ATOM 10496 H HG   . LEU A 1 28 ? -9.154  6.266   -16.934 1.00 0.00 ? 28 LEU A HG   10 
ATOM 10497 H HD11 . LEU A 1 28 ? -8.346  3.345   -16.634 1.00 0.00 ? 28 LEU A HD11 10 
ATOM 10498 H HD12 . LEU A 1 28 ? -9.325  4.007   -17.971 1.00 0.00 ? 28 LEU A HD12 10 
ATOM 10499 H HD13 . LEU A 1 28 ? -7.644  4.535   -17.748 1.00 0.00 ? 28 LEU A HD13 10 
ATOM 10500 H HD21 . LEU A 1 28 ? -10.746 5.895   -15.105 1.00 0.00 ? 28 LEU A HD21 10 
ATOM 10501 H HD22 . LEU A 1 28 ? -11.113 4.794   -16.461 1.00 0.00 ? 28 LEU A HD22 10 
ATOM 10502 H HD23 . LEU A 1 28 ? -10.287 4.182   -15.014 1.00 0.00 ? 28 LEU A HD23 10 
ATOM 10503 N N    . VAL A 1 29 ? -6.390  8.328   -13.956 1.00 0.00 ? 29 VAL A N    10 
ATOM 10504 C CA   . VAL A 1 29 ? -6.450  9.611   -13.277 1.00 0.00 ? 29 VAL A CA   10 
ATOM 10505 C C    . VAL A 1 29 ? -5.080  10.291  -13.361 1.00 0.00 ? 29 VAL A C    10 
ATOM 10506 O O    . VAL A 1 29 ? -5.007  11.404  -13.900 1.00 0.00 ? 29 VAL A O    10 
ATOM 10507 C CB   . VAL A 1 29 ? -6.935  9.421   -11.839 1.00 0.00 ? 29 VAL A CB   10 
ATOM 10508 C CG1  . VAL A 1 29 ? -7.314  10.763  -11.207 1.00 0.00 ? 29 VAL A CG1  10 
ATOM 10509 C CG2  . VAL A 1 29 ? -8.107  8.439   -11.782 1.00 0.00 ? 29 VAL A CG2  10 
ATOM 10510 H H    . VAL A 1 29 ? -5.820  7.592   -13.539 1.00 0.00 ? 29 VAL A H    10 
ATOM 10511 H HA   . VAL A 1 29 ? -7.182  10.225  -13.801 1.00 0.00 ? 29 VAL A HA   10 
ATOM 10512 H HB   . VAL A 1 29 ? -6.091  8.998   -11.296 1.00 0.00 ? 29 VAL A HB   10 
ATOM 10513 H HG11 . VAL A 1 29 ? -8.104  11.238  -11.788 1.00 0.00 ? 29 VAL A HG11 10 
ATOM 10514 H HG12 . VAL A 1 29 ? -7.654  10.590  -10.186 1.00 0.00 ? 29 VAL A HG12 10 
ATOM 10515 H HG13 . VAL A 1 29 ? -6.445  11.421  -11.184 1.00 0.00 ? 29 VAL A HG13 10 
ATOM 10516 H HG21 . VAL A 1 29 ? -7.801  7.472   -12.182 1.00 0.00 ? 29 VAL A HG21 10 
ATOM 10517 H HG22 . VAL A 1 29 ? -8.427  8.328   -10.746 1.00 0.00 ? 29 VAL A HG22 10 
ATOM 10518 H HG23 . VAL A 1 29 ? -8.941  8.819   -12.373 1.00 0.00 ? 29 VAL A HG23 10 
ATOM 10519 N N    . GLY A 1 30 ? -4.042  9.618   -12.833 1.00 0.00 ? 30 GLY A N    10 
ATOM 10520 C CA   . GLY A 1 30 ? -2.691  10.154  -12.848 1.00 0.00 ? 30 GLY A CA   10 
ATOM 10521 C C    . GLY A 1 30 ? -2.228  10.317  -14.297 1.00 0.00 ? 30 GLY A C    10 
ATOM 10522 O O    . GLY A 1 30 ? -1.083  10.745  -14.506 1.00 0.00 ? 30 GLY A O    10 
ATOM 10523 H H    . GLY A 1 30 ? -4.190  8.704   -12.406 1.00 0.00 ? 30 GLY A H    10 
ATOM 10524 H HA2  . GLY A 1 30 ? -2.674  11.127  -12.359 1.00 0.00 ? 30 GLY A HA2  10 
ATOM 10525 H HA3  . GLY A 1 30 ? -2.021  9.478   -12.318 1.00 0.00 ? 30 GLY A HA3  10 
ATOM 10526 N N    . GLU A 1 31 ? -3.111  9.979   -15.253 1.00 0.00 ? 31 GLU A N    10 
ATOM 10527 C CA   . GLU A 1 31 ? -2.794  10.088  -16.668 1.00 0.00 ? 31 GLU A CA   10 
ATOM 10528 C C    . GLU A 1 31 ? -2.083  11.418  -16.925 1.00 0.00 ? 31 GLU A C    10 
ATOM 10529 O O    . GLU A 1 31 ? -2.399  12.398  -16.236 1.00 0.00 ? 31 GLU A O    10 
ATOM 10530 C CB   . GLU A 1 31 ? -4.048  9.959   -17.536 1.00 0.00 ? 31 GLU A CB   10 
ATOM 10531 C CG   . GLU A 1 31 ? -5.301  10.354  -16.751 1.00 0.00 ? 31 GLU A CG   10 
ATOM 10532 C CD   . GLU A 1 31 ? -6.543  10.307  -17.643 1.00 0.00 ? 31 GLU A CD   10 
ATOM 10533 O OE1  . GLU A 1 31 ? -6.404  9.639   -18.738 1.00 0.00 ? 31 GLU A OE1  10 
ATOM 10534 O OE2  . GLU A 1 31 ? -7.582  10.887  -17.291 1.00 0.00 ? 31 GLU A OE2  10 
ATOM 10535 H H    . GLU A 1 31 ? -4.036  9.633   -14.996 1.00 0.00 ? 31 GLU A H    10 
ATOM 10536 H HA   . GLU A 1 31 ? -2.115  9.269   -16.904 1.00 0.00 ? 31 GLU A HA   10 
ATOM 10537 H HB2  . GLU A 1 31 ? -3.949  10.616  -18.400 1.00 0.00 ? 31 GLU A HB2  10 
ATOM 10538 H HB3  . GLU A 1 31 ? -4.135  8.929   -17.881 1.00 0.00 ? 31 GLU A HB3  10 
ATOM 10539 H HG2  . GLU A 1 31 ? -5.432  9.660   -15.922 1.00 0.00 ? 31 GLU A HG2  10 
ATOM 10540 H HG3  . GLU A 1 31 ? -5.166  11.361  -16.355 1.00 0.00 ? 31 GLU A HG3  10 
ATOM 10541 N N    . ARG A 1 32 ? -1.151  11.423  -17.896 1.00 0.00 ? 32 ARG A N    10 
ATOM 10542 C CA   . ARG A 1 32 ? -0.405  12.622  -18.239 1.00 0.00 ? 32 ARG A CA   10 
ATOM 10543 C C    . ARG A 1 32 ? -1.363  13.813  -18.307 1.00 0.00 ? 32 ARG A C    10 
ATOM 10544 O O    . ARG A 1 32 ? -1.335  14.686  -17.442 1.00 0.00 ? 32 ARG A O    10 
ATOM 10545 C CB   . ARG A 1 32 ? 0.311   12.475  -19.583 1.00 0.00 ? 32 ARG A CB   10 
ATOM 10546 C CG   . ARG A 1 32 ? 0.650   11.010  -19.866 1.00 0.00 ? 32 ARG A CG   10 
ATOM 10547 C CD   . ARG A 1 32 ? 1.503   10.418  -18.744 1.00 0.00 ? 32 ARG A CD   10 
ATOM 10548 N NE   . ARG A 1 32 ? 0.828   9.235   -18.165 1.00 0.00 ? 32 ARG A NE   10 
ATOM 10549 C CZ   . ARG A 1 32 ? 1.244   7.963   -18.344 1.00 0.00 ? 32 ARG A CZ   10 
ATOM 10550 N NH1  . ARG A 1 32 ? 2.335   7.735   -19.087 1.00 0.00 ? 32 ARG A NH1  10 
ATOM 10551 N NH2  . ARG A 1 32 ? 0.577   6.944   -17.785 1.00 0.00 ? 32 ARG A NH2  10 
ATOM 10552 H H    . ARG A 1 32 ? -0.952  10.570  -18.417 1.00 0.00 ? 32 ARG A H    10 
ATOM 10553 H HA   . ARG A 1 32 ? 0.325   12.798  -17.449 1.00 0.00 ? 32 ARG A HA   10 
ATOM 10554 H HB2  . ARG A 1 32 ? -0.340  12.848  -20.374 1.00 0.00 ? 32 ARG A HB2  10 
ATOM 10555 H HB3  . ARG A 1 32 ? 1.223   13.071  -19.565 1.00 0.00 ? 32 ARG A HB3  10 
ATOM 10556 H HG2  . ARG A 1 32 ? -0.277  10.442  -19.946 1.00 0.00 ? 32 ARG A HG2  10 
ATOM 10557 H HG3  . ARG A 1 32 ? 1.187   10.948  -20.813 1.00 0.00 ? 32 ARG A HG3  10 
ATOM 10558 H HD2  . ARG A 1 32 ? 2.471   10.113  -19.144 1.00 0.00 ? 32 ARG A HD2  10 
ATOM 10559 H HD3  . ARG A 1 32 ? 1.660   11.171  -17.971 1.00 0.00 ? 32 ARG A HD3  10 
ATOM 10560 H HE   . ARG A 1 32 ? -0.001  9.425   -17.601 1.00 0.00 ? 32 ARG A HE   10 
ATOM 10561 H HH11 . ARG A 1 32 ? 2.836   8.516   -19.510 1.00 0.00 ? 32 ARG A HH11 10 
ATOM 10562 H HH12 . ARG A 1 32 ? 2.663   6.780   -19.233 1.00 0.00 ? 32 ARG A HH12 10 
ATOM 10563 H HH21 . ARG A 1 32 ? -0.253  7.127   -17.219 1.00 0.00 ? 32 ARG A HH21 10 
ATOM 10564 H HH22 . ARG A 1 32 ? 0.897   5.986   -17.925 1.00 0.00 ? 32 ARG A HH22 10 
ATOM 10565 N N    . MET B 1 1  ? 15.878  -7.455  12.856  1.00 0.00 ? 1  MET B N    10 
ATOM 10566 C CA   . MET B 1 1  ? 14.643  -7.073  13.518  1.00 0.00 ? 1  MET B CA   10 
ATOM 10567 C C    . MET B 1 1  ? 14.588  -5.549  13.645  1.00 0.00 ? 1  MET B C    10 
ATOM 10568 O O    . MET B 1 1  ? 13.508  -4.978  13.435  1.00 0.00 ? 1  MET B O    10 
ATOM 10569 C CB   . MET B 1 1  ? 14.567  -7.705  14.910  1.00 0.00 ? 1  MET B CB   10 
ATOM 10570 C CG   . MET B 1 1  ? 13.121  -8.030  15.287  1.00 0.00 ? 1  MET B CG   10 
ATOM 10571 S SD   . MET B 1 1  ? 12.877  -7.805  17.073  1.00 0.00 ? 1  MET B SD   10 
ATOM 10572 C CE   . MET B 1 1  ? 11.068  -7.661  17.130  1.00 0.00 ? 1  MET B CE   10 
ATOM 10573 H H    . MET B 1 1  ? 16.428  -8.210  13.267  1.00 0.00 ? 1  MET B H    10 
ATOM 10574 H HA   . MET B 1 1  ? 13.799  -7.409  12.916  1.00 0.00 ? 1  MET B HA   10 
ATOM 10575 H HB2  . MET B 1 1  ? 15.151  -8.625  14.913  1.00 0.00 ? 1  MET B HB2  10 
ATOM 10576 H HB3  . MET B 1 1  ? 14.993  -7.011  15.636  1.00 0.00 ? 1  MET B HB3  10 
ATOM 10577 H HG2  . MET B 1 1  ? 12.447  -7.363  14.750  1.00 0.00 ? 1  MET B HG2  10 
ATOM 10578 H HG3  . MET B 1 1  ? 12.897  -9.060  15.008  1.00 0.00 ? 1  MET B HG3  10 
ATOM 10579 H HE1  . MET B 1 1  ? 10.609  -8.564  16.724  1.00 0.00 ? 1  MET B HE1  10 
ATOM 10580 H HE2  . MET B 1 1  ? 10.755  -7.518  18.164  1.00 0.00 ? 1  MET B HE2  10 
ATOM 10581 H HE3  . MET B 1 1  ? 10.744  -6.804  16.539  1.00 0.00 ? 1  MET B HE3  10 
ATOM 10582 N N    . ASP B 1 2  ? 15.735  -4.932  13.981  1.00 0.00 ? 2  ASP B N    10 
ATOM 10583 C CA   . ASP B 1 2  ? 15.816  -3.489  14.134  1.00 0.00 ? 2  ASP B CA   10 
ATOM 10584 C C    . ASP B 1 2  ? 15.223  -2.815  12.894  1.00 0.00 ? 2  ASP B C    10 
ATOM 10585 O O    . ASP B 1 2  ? 14.587  -1.761  13.043  1.00 0.00 ? 2  ASP B O    10 
ATOM 10586 C CB   . ASP B 1 2  ? 17.269  -3.030  14.271  1.00 0.00 ? 2  ASP B CB   10 
ATOM 10587 C CG   . ASP B 1 2  ? 18.063  -3.721  15.382  1.00 0.00 ? 2  ASP B CG   10 
ATOM 10588 O OD1  . ASP B 1 2  ? 17.894  -4.924  15.633  1.00 0.00 ? 2  ASP B OD1  10 
ATOM 10589 O OD2  . ASP B 1 2  ? 18.895  -2.962  16.010  1.00 0.00 ? 2  ASP B OD2  10 
ATOM 10590 H H    . ASP B 1 2  ? 16.581  -5.478  14.137  1.00 0.00 ? 2  ASP B H    10 
ATOM 10591 H HA   . ASP B 1 2  ? 15.239  -3.192  15.010  1.00 0.00 ? 2  ASP B HA   10 
ATOM 10592 H HB2  . ASP B 1 2  ? 17.755  -3.225  13.314  1.00 0.00 ? 2  ASP B HB2  10 
ATOM 10593 H HB3  . ASP B 1 2  ? 17.245  -1.955  14.445  1.00 0.00 ? 2  ASP B HB3  10 
ATOM 10594 N N    . ALA B 1 3  ? 15.438  -3.426  11.715  1.00 0.00 ? 3  ALA B N    10 
ATOM 10595 C CA   . ALA B 1 3  ? 14.928  -2.888  10.465  1.00 0.00 ? 3  ALA B CA   10 
ATOM 10596 C C    . ALA B 1 3  ? 13.533  -3.458  10.202  1.00 0.00 ? 3  ALA B C    10 
ATOM 10597 O O    . ALA B 1 3  ? 12.811  -2.889  9.371   1.00 0.00 ? 3  ALA B O    10 
ATOM 10598 C CB   . ALA B 1 3  ? 15.809  -3.359  9.306   1.00 0.00 ? 3  ALA B CB   10 
ATOM 10599 H H    . ALA B 1 3  ? 15.973  -4.294  11.682  1.00 0.00 ? 3  ALA B H    10 
ATOM 10600 H HA   . ALA B 1 3  ? 14.867  -1.801  10.499  1.00 0.00 ? 3  ALA B HA   10 
ATOM 10601 H HB1  . ALA B 1 3  ? 16.829  -3.014  9.473   1.00 0.00 ? 3  ALA B HB1  10 
ATOM 10602 H HB2  . ALA B 1 3  ? 15.807  -4.448  9.255   1.00 0.00 ? 3  ALA B HB2  10 
ATOM 10603 H HB3  . ALA B 1 3  ? 15.430  -2.958  8.365   1.00 0.00 ? 3  ALA B HB3  10 
ATOM 10604 N N    . ILE B 1 4  ? 13.186  -4.551  10.905  1.00 0.00 ? 4  ILE B N    10 
ATOM 10605 C CA   . ILE B 1 4  ? 11.889  -5.188  10.748  1.00 0.00 ? 4  ILE B CA   10 
ATOM 10606 C C    . ILE B 1 4  ? 10.822  -4.341  11.444  1.00 0.00 ? 4  ILE B C    10 
ATOM 10607 O O    . ILE B 1 4  ? 9.770   -4.100  10.835  1.00 0.00 ? 4  ILE B O    10 
ATOM 10608 C CB   . ILE B 1 4  ? 11.942  -6.637  11.237  1.00 0.00 ? 4  ILE B CB   10 
ATOM 10609 C CG1  . ILE B 1 4  ? 12.943  -7.455  10.420  1.00 0.00 ? 4  ILE B CG1  10 
ATOM 10610 C CG2  . ILE B 1 4  ? 10.547  -7.268  11.233  1.00 0.00 ? 4  ILE B CG2  10 
ATOM 10611 C CD1  . ILE B 1 4  ? 12.342  -8.798  10.001  1.00 0.00 ? 4  ILE B CD1  10 
ATOM 10612 H H    . ILE B 1 4  ? 13.841  -4.958  11.571  1.00 0.00 ? 4  ILE B H    10 
ATOM 10613 H HA   . ILE B 1 4  ? 11.682  -5.209  9.677   1.00 0.00 ? 4  ILE B HA   10 
ATOM 10614 H HB   . ILE B 1 4  ? 12.289  -6.576  12.268  1.00 0.00 ? 4  ILE B HB   10 
ATOM 10615 H HG12 . ILE B 1 4  ? 13.215  -6.893  9.527   1.00 0.00 ? 4  ILE B HG12 10 
ATOM 10616 H HG13 . ILE B 1 4  ? 13.838  -7.620  11.021  1.00 0.00 ? 4  ILE B HG13 10 
ATOM 10617 H HG21 . ILE B 1 4  ? 10.134  -7.250  10.224  1.00 0.00 ? 4  ILE B HG21 10 
ATOM 10618 H HG22 . ILE B 1 4  ? 10.622  -8.296  11.586  1.00 0.00 ? 4  ILE B HG22 10 
ATOM 10619 H HG23 . ILE B 1 4  ? 9.886   -6.711  11.897  1.00 0.00 ? 4  ILE B HG23 10 
ATOM 10620 H HD11 . ILE B 1 4  ? 11.447  -8.633  9.400   1.00 0.00 ? 4  ILE B HD11 10 
ATOM 10621 H HD12 . ILE B 1 4  ? 13.080  -9.354  9.423   1.00 0.00 ? 4  ILE B HD12 10 
ATOM 10622 H HD13 . ILE B 1 4  ? 12.073  -9.378  10.884  1.00 0.00 ? 4  ILE B HD13 10 
ATOM 10623 N N    . LYS B 1 5  ? 11.110  -3.915  12.687  1.00 0.00 ? 5  LYS B N    10 
ATOM 10624 C CA   . LYS B 1 5  ? 10.181  -3.104  13.456  1.00 0.00 ? 5  LYS B CA   10 
ATOM 10625 C C    . LYS B 1 5  ? 9.796   -1.867  12.643  1.00 0.00 ? 5  LYS B C    10 
ATOM 10626 O O    . LYS B 1 5  ? 8.648   -1.416  12.765  1.00 0.00 ? 5  LYS B O    10 
ATOM 10627 C CB   . LYS B 1 5  ? 10.767  -2.777  14.832  1.00 0.00 ? 5  LYS B CB   10 
ATOM 10628 C CG   . LYS B 1 5  ? 12.296  -2.810  14.798  1.00 0.00 ? 5  LYS B CG   10 
ATOM 10629 C CD   . LYS B 1 5  ? 12.889  -1.800  15.783  1.00 0.00 ? 5  LYS B CD   10 
ATOM 10630 C CE   . LYS B 1 5  ? 13.060  -2.423  17.170  1.00 0.00 ? 5  LYS B CE   10 
ATOM 10631 N NZ   . LYS B 1 5  ? 12.902  -1.401  18.217  1.00 0.00 ? 5  LYS B NZ   10 
ATOM 10632 H H    . LYS B 1 5  ? 12.001  -4.159  13.117  1.00 0.00 ? 5  LYS B H    10 
ATOM 10633 H HA   . LYS B 1 5  ? 9.293   -3.716  13.614  1.00 0.00 ? 5  LYS B HA   10 
ATOM 10634 H HB2  . LYS B 1 5  ? 10.440  -1.781  15.128  1.00 0.00 ? 5  LYS B HB2  10 
ATOM 10635 H HB3  . LYS B 1 5  ? 10.395  -3.502  15.556  1.00 0.00 ? 5  LYS B HB3  10 
ATOM 10636 H HG2  . LYS B 1 5  ? 12.635  -3.810  15.069  1.00 0.00 ? 5  LYS B HG2  10 
ATOM 10637 H HG3  . LYS B 1 5  ? 12.632  -2.583  13.786  1.00 0.00 ? 5  LYS B HG3  10 
ATOM 10638 H HD2  . LYS B 1 5  ? 13.863  -1.478  15.416  1.00 0.00 ? 5  LYS B HD2  10 
ATOM 10639 H HD3  . LYS B 1 5  ? 12.227  -0.935  15.843  1.00 0.00 ? 5  LYS B HD3  10 
ATOM 10640 H HE2  . LYS B 1 5  ? 12.305  -3.196  17.311  1.00 0.00 ? 5  LYS B HE2  10 
ATOM 10641 H HE3  . LYS B 1 5  ? 14.049  -2.876  17.239  1.00 0.00 ? 5  LYS B HE3  10 
ATOM 10642 H HZ1  . LYS B 1 5  ? 11.976  -0.977  18.152  1.00 0.00 ? 5  LYS B HZ1  10 
ATOM 10643 H HZ2  . LYS B 1 5  ? 13.021  -1.840  19.130  1.00 0.00 ? 5  LYS B HZ2  10 
ATOM 10644 H HZ3  . LYS B 1 5  ? 13.609  -0.674  18.104  1.00 0.00 ? 5  LYS B HZ3  10 
ATOM 10645 N N    . LYS B 1 6  ? 10.746  -1.352  11.843  1.00 0.00 ? 6  LYS B N    10 
ATOM 10646 C CA   . LYS B 1 6  ? 10.507  -0.179  11.019  1.00 0.00 ? 6  LYS B CA   10 
ATOM 10647 C C    . LYS B 1 6  ? 9.941   -0.618  9.666   1.00 0.00 ? 6  LYS B C    10 
ATOM 10648 O O    . LYS B 1 6  ? 9.211   0.172   9.049   1.00 0.00 ? 6  LYS B O    10 
ATOM 10649 C CB   . LYS B 1 6  ? 11.777  0.666   10.909  1.00 0.00 ? 6  LYS B CB   10 
ATOM 10650 C CG   . LYS B 1 6  ? 12.496  0.754   12.257  1.00 0.00 ? 6  LYS B CG   10 
ATOM 10651 C CD   . LYS B 1 6  ? 13.750  1.626   12.154  1.00 0.00 ? 6  LYS B CD   10 
ATOM 10652 C CE   . LYS B 1 6  ? 13.932  2.474   13.414  1.00 0.00 ? 6  LYS B CE   10 
ATOM 10653 N NZ   . LYS B 1 6  ? 15.172  2.099   14.113  1.00 0.00 ? 6  LYS B NZ   10 
ATOM 10654 H H    . LYS B 1 6  ? 11.668  -1.786  11.801  1.00 0.00 ? 6  LYS B H    10 
ATOM 10655 H HA   . LYS B 1 6  ? 9.758   0.417   11.540  1.00 0.00 ? 6  LYS B HA   10 
ATOM 10656 H HB2  . LYS B 1 6  ? 12.445  0.208   10.179  1.00 0.00 ? 6  LYS B HB2  10 
ATOM 10657 H HB3  . LYS B 1 6  ? 11.508  1.665   10.566  1.00 0.00 ? 6  LYS B HB3  10 
ATOM 10658 H HG2  . LYS B 1 6  ? 11.820  1.189   12.991  1.00 0.00 ? 6  LYS B HG2  10 
ATOM 10659 H HG3  . LYS B 1 6  ? 12.768  -0.252  12.578  1.00 0.00 ? 6  LYS B HG3  10 
ATOM 10660 H HD2  . LYS B 1 6  ? 14.620  0.981   12.031  1.00 0.00 ? 6  LYS B HD2  10 
ATOM 10661 H HD3  . LYS B 1 6  ? 13.660  2.271   11.281  1.00 0.00 ? 6  LYS B HD3  10 
ATOM 10662 H HE2  . LYS B 1 6  ? 13.986  3.526   13.134  1.00 0.00 ? 6  LYS B HE2  10 
ATOM 10663 H HE3  . LYS B 1 6  ? 13.076  2.325   14.072  1.00 0.00 ? 6  LYS B HE3  10 
ATOM 10664 H HZ1  . LYS B 1 6  ? 15.974  2.239   13.497  1.00 0.00 ? 6  LYS B HZ1  10 
ATOM 10665 H HZ2  . LYS B 1 6  ? 15.271  2.677   14.947  1.00 0.00 ? 6  LYS B HZ2  10 
ATOM 10666 H HZ3  . LYS B 1 6  ? 15.133  1.119   14.390  1.00 0.00 ? 6  LYS B HZ3  10 
ATOM 10667 N N    . LYS B 1 7  ? 10.283  -1.847  9.241   1.00 0.00 ? 7  LYS B N    10 
ATOM 10668 C CA   . LYS B 1 7  ? 9.812   -2.381  7.974   1.00 0.00 ? 7  LYS B CA   10 
ATOM 10669 C C    . LYS B 1 7  ? 8.284   -2.319  7.935   1.00 0.00 ? 7  LYS B C    10 
ATOM 10670 O O    . LYS B 1 7  ? 7.740   -1.818  6.941   1.00 0.00 ? 7  LYS B O    10 
ATOM 10671 C CB   . LYS B 1 7  ? 10.377  -3.784  7.742   1.00 0.00 ? 7  LYS B CB   10 
ATOM 10672 C CG   . LYS B 1 7  ? 9.916   -4.345  6.395   1.00 0.00 ? 7  LYS B CG   10 
ATOM 10673 C CD   . LYS B 1 7  ? 9.993   -3.277  5.302   1.00 0.00 ? 7  LYS B CD   10 
ATOM 10674 C CE   . LYS B 1 7  ? 10.174  -3.916  3.924   1.00 0.00 ? 7  LYS B CE   10 
ATOM 10675 N NZ   . LYS B 1 7  ? 11.395  -3.409  3.276   1.00 0.00 ? 7  LYS B NZ   10 
ATOM 10676 H H    . LYS B 1 7  ? 10.890  -2.434  9.813   1.00 0.00 ? 7  LYS B H    10 
ATOM 10677 H HA   . LYS B 1 7  ? 10.215  -1.732  7.196   1.00 0.00 ? 7  LYS B HA   10 
ATOM 10678 H HB2  . LYS B 1 7  ? 11.466  -3.733  7.752   1.00 0.00 ? 7  LYS B HB2  10 
ATOM 10679 H HB3  . LYS B 1 7  ? 10.046  -4.437  8.550   1.00 0.00 ? 7  LYS B HB3  10 
ATOM 10680 H HG2  . LYS B 1 7  ? 10.560  -5.180  6.121   1.00 0.00 ? 7  LYS B HG2  10 
ATOM 10681 H HG3  . LYS B 1 7  ? 8.891   -4.704  6.494   1.00 0.00 ? 7  LYS B HG3  10 
ATOM 10682 H HD2  . LYS B 1 7  ? 9.069   -2.699  5.307   1.00 0.00 ? 7  LYS B HD2  10 
ATOM 10683 H HD3  . LYS B 1 7  ? 10.830  -2.612  5.515   1.00 0.00 ? 7  LYS B HD3  10 
ATOM 10684 H HE2  . LYS B 1 7  ? 10.255  -4.997  4.038   1.00 0.00 ? 7  LYS B HE2  10 
ATOM 10685 H HE3  . LYS B 1 7  ? 9.305   -3.689  3.307   1.00 0.00 ? 7  LYS B HE3  10 
ATOM 10686 H HZ1  . LYS B 1 7  ? 12.209  -3.622  3.854   1.00 0.00 ? 7  LYS B HZ1  10 
ATOM 10687 H HZ2  . LYS B 1 7  ? 11.492  -3.849  2.361   1.00 0.00 ? 7  LYS B HZ2  10 
ATOM 10688 H HZ3  . LYS B 1 7  ? 11.330  -2.399  3.154   1.00 0.00 ? 7  LYS B HZ3  10 
ATOM 10689 N N    . MET B 1 8  ? 7.635   -2.821  9.001   1.00 0.00 ? 8  MET B N    10 
ATOM 10690 C CA   . MET B 1 8  ? 6.184   -2.822  9.086   1.00 0.00 ? 8  MET B CA   10 
ATOM 10691 C C    . MET B 1 8  ? 5.682   -1.380  9.190   1.00 0.00 ? 8  MET B C    10 
ATOM 10692 O O    . MET B 1 8  ? 4.532   -1.128  8.801   1.00 0.00 ? 8  MET B O    10 
ATOM 10693 C CB   . MET B 1 8  ? 5.724   -3.612  10.314  1.00 0.00 ? 8  MET B CB   10 
ATOM 10694 C CG   . MET B 1 8  ? 6.307   -3.019  11.598  1.00 0.00 ? 8  MET B CG   10 
ATOM 10695 S SD   . MET B 1 8  ? 5.457   -3.714  13.046  1.00 0.00 ? 8  MET B SD   10 
ATOM 10696 C CE   . MET B 1 8  ? 4.054   -2.567  13.169  1.00 0.00 ? 8  MET B CE   10 
ATOM 10697 H H    . MET B 1 8  ? 8.161   -3.216  9.780   1.00 0.00 ? 8  MET B H    10 
ATOM 10698 H HA   . MET B 1 8  ? 5.776   -3.276  8.183   1.00 0.00 ? 8  MET B HA   10 
ATOM 10699 H HB2  . MET B 1 8  ? 4.636   -3.579  10.369  1.00 0.00 ? 8  MET B HB2  10 
ATOM 10700 H HB3  . MET B 1 8  ? 6.042   -4.650  10.205  1.00 0.00 ? 8  MET B HB3  10 
ATOM 10701 H HG2  . MET B 1 8  ? 7.368   -3.260  11.659  1.00 0.00 ? 8  MET B HG2  10 
ATOM 10702 H HG3  . MET B 1 8  ? 6.189   -1.936  11.583  1.00 0.00 ? 8  MET B HG3  10 
ATOM 10703 H HE1  . MET B 1 8  ? 3.469   -2.595  12.249  1.00 0.00 ? 8  MET B HE1  10 
ATOM 10704 H HE2  . MET B 1 8  ? 3.431   -2.857  14.015  1.00 0.00 ? 8  MET B HE2  10 
ATOM 10705 H HE3  . MET B 1 8  ? 4.416   -1.551  13.328  1.00 0.00 ? 8  MET B HE3  10 
ATOM 10706 N N    . GLN B 1 9  ? 6.539   -0.480  9.703   1.00 0.00 ? 9  GLN B N    10 
ATOM 10707 C CA   . GLN B 1 9  ? 6.185   0.921   9.854   1.00 0.00 ? 9  GLN B CA   10 
ATOM 10708 C C    . GLN B 1 9  ? 6.304   1.622   8.500   1.00 0.00 ? 9  GLN B C    10 
ATOM 10709 O O    . GLN B 1 9  ? 5.641   2.652   8.308   1.00 0.00 ? 9  GLN B O    10 
ATOM 10710 C CB   . GLN B 1 9  ? 7.055   1.611   10.907  1.00 0.00 ? 9  GLN B CB   10 
ATOM 10711 C CG   . GLN B 1 9  ? 6.676   1.154   12.317  1.00 0.00 ? 9  GLN B CG   10 
ATOM 10712 C CD   . GLN B 1 9  ? 7.182   2.142   13.369  1.00 0.00 ? 9  GLN B CD   10 
ATOM 10713 O OE1  . GLN B 1 9  ? 6.664   3.234   13.532  1.00 0.00 ? 9  GLN B OE1  10 
ATOM 10714 N NE2  . GLN B 1 9  ? 8.223   1.701   14.070  1.00 0.00 ? 9  GLN B NE2  10 
ATOM 10715 H H    . GLN B 1 9  ? 7.470   -0.773  10.000  1.00 0.00 ? 9  GLN B H    10 
ATOM 10716 H HA   . GLN B 1 9  ? 5.144   0.952   10.179  1.00 0.00 ? 9  GLN B HA   10 
ATOM 10717 H HB2  . GLN B 1 9  ? 8.099   1.360   10.721  1.00 0.00 ? 9  GLN B HB2  10 
ATOM 10718 H HB3  . GLN B 1 9  ? 6.928   2.689   10.819  1.00 0.00 ? 9  GLN B HB3  10 
ATOM 10719 H HG2  . GLN B 1 9  ? 5.590   1.086   12.387  1.00 0.00 ? 9  GLN B HG2  10 
ATOM 10720 H HG3  . GLN B 1 9  ? 7.105   0.168   12.496  1.00 0.00 ? 9  GLN B HG3  10 
ATOM 10721 H HE21 . GLN B 1 9  ? 8.609   0.775   13.882  1.00 0.00 ? 9  GLN B HE21 10 
ATOM 10722 H HE22 . GLN B 1 9  ? 8.634   2.287   14.796  1.00 0.00 ? 9  GLN B HE22 10 
ATOM 10723 N N    . MET B 1 10 ? 7.133   1.060   7.602   1.00 0.00 ? 10 MET B N    10 
ATOM 10724 C CA   . MET B 1 10 ? 7.335   1.628   6.280   1.00 0.00 ? 10 MET B CA   10 
ATOM 10725 C C    . MET B 1 10 ? 6.195   1.185   5.359   1.00 0.00 ? 10 MET B C    10 
ATOM 10726 O O    . MET B 1 10 ? 5.692   2.024   4.597   1.00 0.00 ? 10 MET B O    10 
ATOM 10727 C CB   . MET B 1 10 ? 8.671   1.162   5.698   1.00 0.00 ? 10 MET B CB   10 
ATOM 10728 C CG   . MET B 1 10 ? 9.802   1.339   6.712   1.00 0.00 ? 10 MET B CG   10 
ATOM 10729 S SD   . MET B 1 10 ? 11.152  2.306   5.975   1.00 0.00 ? 10 MET B SD   10 
ATOM 10730 C CE   . MET B 1 10 ? 12.572  1.588   6.853   1.00 0.00 ? 10 MET B CE   10 
ATOM 10731 H H    . MET B 1 10 ? 7.642   0.210   7.840   1.00 0.00 ? 10 MET B H    10 
ATOM 10732 H HA   . MET B 1 10 ? 7.327   2.715   6.356   1.00 0.00 ? 10 MET B HA   10 
ATOM 10733 H HB2  . MET B 1 10 ? 8.593   0.107   5.434   1.00 0.00 ? 10 MET B HB2  10 
ATOM 10734 H HB3  . MET B 1 10 ? 8.885   1.738   4.798   1.00 0.00 ? 10 MET B HB3  10 
ATOM 10735 H HG2  . MET B 1 10 ? 9.425   1.866   7.589   1.00 0.00 ? 10 MET B HG2  10 
ATOM 10736 H HG3  . MET B 1 10 ? 10.171  0.361   7.019   1.00 0.00 ? 10 MET B HG3  10 
ATOM 10737 H HE1  . MET B 1 10 ? 12.627  0.517   6.657   1.00 0.00 ? 10 MET B HE1  10 
ATOM 10738 H HE2  . MET B 1 10 ? 13.485  2.076   6.513   1.00 0.00 ? 10 MET B HE2  10 
ATOM 10739 H HE3  . MET B 1 10 ? 12.464  1.746   7.927   1.00 0.00 ? 10 MET B HE3  10 
ATOM 10740 N N    . LEU B 1 11 ? 5.816   -0.102  5.447   1.00 0.00 ? 11 LEU B N    10 
ATOM 10741 C CA   . LEU B 1 11 ? 4.746   -0.648  4.629   1.00 0.00 ? 11 LEU B CA   10 
ATOM 10742 C C    . LEU B 1 11 ? 3.397   -0.217  5.208   1.00 0.00 ? 11 LEU B C    10 
ATOM 10743 O O    . LEU B 1 11 ? 2.425   -0.137  4.442   1.00 0.00 ? 11 LEU B O    10 
ATOM 10744 C CB   . LEU B 1 11 ? 4.899   -2.164  4.488   1.00 0.00 ? 11 LEU B CB   10 
ATOM 10745 C CG   . LEU B 1 11 ? 6.216   -2.651  3.880   1.00 0.00 ? 11 LEU B CG   10 
ATOM 10746 C CD1  . LEU B 1 11 ? 6.377   -4.162  4.063   1.00 0.00 ? 11 LEU B CD1  10 
ATOM 10747 C CD2  . LEU B 1 11 ? 6.327   -2.237  2.411   1.00 0.00 ? 11 LEU B CD2  10 
ATOM 10748 H H    . LEU B 1 11 ? 6.283   -0.728  6.103   1.00 0.00 ? 11 LEU B H    10 
ATOM 10749 H HA   . LEU B 1 11 ? 4.863   -0.211  3.637   1.00 0.00 ? 11 LEU B HA   10 
ATOM 10750 H HB2  . LEU B 1 11 ? 4.797   -2.577  5.491   1.00 0.00 ? 11 LEU B HB2  10 
ATOM 10751 H HB3  . LEU B 1 11 ? 4.061   -2.499  3.879   1.00 0.00 ? 11 LEU B HB3  10 
ATOM 10752 H HG   . LEU B 1 11 ? 6.996   -2.149  4.451   1.00 0.00 ? 11 LEU B HG   10 
ATOM 10753 H HD11 . LEU B 1 11 ? 5.551   -4.686  3.583   1.00 0.00 ? 11 LEU B HD11 10 
ATOM 10754 H HD12 . LEU B 1 11 ? 7.322   -4.474  3.619   1.00 0.00 ? 11 LEU B HD12 10 
ATOM 10755 H HD13 . LEU B 1 11 ? 6.385   -4.408  5.125   1.00 0.00 ? 11 LEU B HD13 10 
ATOM 10756 H HD21 . LEU B 1 11 ? 6.280   -1.151  2.327   1.00 0.00 ? 11 LEU B HD21 10 
ATOM 10757 H HD22 . LEU B 1 11 ? 7.274   -2.601  2.012   1.00 0.00 ? 11 LEU B HD22 10 
ATOM 10758 H HD23 . LEU B 1 11 ? 5.510   -2.673  1.839   1.00 0.00 ? 11 LEU B HD23 10 
ATOM 10759 N N    . LYS B 1 12 ? 3.364   0.050   6.525   1.00 0.00 ? 12 LYS B N    10 
ATOM 10760 C CA   . LYS B 1 12 ? 2.145   0.468   7.197   1.00 0.00 ? 12 LYS B CA   10 
ATOM 10761 C C    . LYS B 1 12 ? 1.869   1.937   6.874   1.00 0.00 ? 12 LYS B C    10 
ATOM 10762 O O    . LYS B 1 12 ? 0.690   2.309   6.780   1.00 0.00 ? 12 LYS B O    10 
ATOM 10763 C CB   . LYS B 1 12 ? 2.231   0.173   8.696   1.00 0.00 ? 12 LYS B CB   10 
ATOM 10764 C CG   . LYS B 1 12 ? 0.944   0.591   9.411   1.00 0.00 ? 12 LYS B CG   10 
ATOM 10765 C CD   . LYS B 1 12 ? 0.326   -0.592  10.160  1.00 0.00 ? 12 LYS B CD   10 
ATOM 10766 C CE   . LYS B 1 12 ? -0.865  -1.166  9.388   1.00 0.00 ? 12 LYS B CE   10 
ATOM 10767 N NZ   . LYS B 1 12 ? -1.924  -1.593  10.317  1.00 0.00 ? 12 LYS B NZ   10 
ATOM 10768 H H    . LYS B 1 12 ? 4.212   -0.041  7.085   1.00 0.00 ? 12 LYS B H    10 
ATOM 10769 H HA   . LYS B 1 12 ? 1.342   -0.143  6.787   1.00 0.00 ? 12 LYS B HA   10 
ATOM 10770 H HB2  . LYS B 1 12 ? 2.385   -0.897  8.838   1.00 0.00 ? 12 LYS B HB2  10 
ATOM 10771 H HB3  . LYS B 1 12 ? 3.080   0.713   9.113   1.00 0.00 ? 12 LYS B HB3  10 
ATOM 10772 H HG2  . LYS B 1 12 ? 1.177   1.381   10.125  1.00 0.00 ? 12 LYS B HG2  10 
ATOM 10773 H HG3  . LYS B 1 12 ? 0.240   0.974   8.674   1.00 0.00 ? 12 LYS B HG3  10 
ATOM 10774 H HD2  . LYS B 1 12 ? 1.080   -1.369  10.279  1.00 0.00 ? 12 LYS B HD2  10 
ATOM 10775 H HD3  . LYS B 1 12 ? 0.002   -0.256  11.145  1.00 0.00 ? 12 LYS B HD3  10 
ATOM 10776 H HE2  . LYS B 1 12 ? -1.264  -0.401  8.723   1.00 0.00 ? 12 LYS B HE2  10 
ATOM 10777 H HE3  . LYS B 1 12 ? -0.529  -2.015  8.792   1.00 0.00 ? 12 LYS B HE3  10 
ATOM 10778 H HZ1  . LYS B 1 12 ? -2.238  -0.800  10.876  1.00 0.00 ? 12 LYS B HZ1  10 
ATOM 10779 H HZ2  . LYS B 1 12 ? -2.703  -1.972  9.780   1.00 0.00 ? 12 LYS B HZ2  10 
ATOM 10780 H HZ3  . LYS B 1 12 ? -1.567  -2.317  10.942  1.00 0.00 ? 12 LYS B HZ3  10 
ATOM 10781 N N    . LEU B 1 13 ? 2.942   2.731   6.712   1.00 0.00 ? 13 LEU B N    10 
ATOM 10782 C CA   . LEU B 1 13 ? 2.815   4.145   6.402   1.00 0.00 ? 13 LEU B CA   10 
ATOM 10783 C C    . LEU B 1 13 ? 2.376   4.306   4.946   1.00 0.00 ? 13 LEU B C    10 
ATOM 10784 O O    . LEU B 1 13 ? 1.470   5.112   4.689   1.00 0.00 ? 13 LEU B O    10 
ATOM 10785 C CB   . LEU B 1 13 ? 4.111   4.886   6.739   1.00 0.00 ? 13 LEU B CB   10 
ATOM 10786 C CG   . LEU B 1 13 ? 4.000   6.406   6.869   1.00 0.00 ? 13 LEU B CG   10 
ATOM 10787 C CD1  . LEU B 1 13 ? 5.326   7.084   6.519   1.00 0.00 ? 13 LEU B CD1  10 
ATOM 10788 C CD2  . LEU B 1 13 ? 2.841   6.944   6.029   1.00 0.00 ? 13 LEU B CD2  10 
ATOM 10789 H H    . LEU B 1 13 ? 3.882   2.344   6.807   1.00 0.00 ? 13 LEU B H    10 
ATOM 10790 H HA   . LEU B 1 13 ? 2.033   4.535   7.054   1.00 0.00 ? 13 LEU B HA   10 
ATOM 10791 H HB2  . LEU B 1 13 ? 4.464   4.473   7.685   1.00 0.00 ? 13 LEU B HB2  10 
ATOM 10792 H HB3  . LEU B 1 13 ? 4.823   4.630   5.954   1.00 0.00 ? 13 LEU B HB3  10 
ATOM 10793 H HG   . LEU B 1 13 ? 3.788   6.587   7.923   1.00 0.00 ? 13 LEU B HG   10 
ATOM 10794 H HD11 . LEU B 1 13 ? 5.612   6.837   5.496   1.00 0.00 ? 13 LEU B HD11 10 
ATOM 10795 H HD12 . LEU B 1 13 ? 5.211   8.164   6.622   1.00 0.00 ? 13 LEU B HD12 10 
ATOM 10796 H HD13 . LEU B 1 13 ? 6.108   6.745   7.197   1.00 0.00 ? 13 LEU B HD13 10 
ATOM 10797 H HD21 . LEU B 1 13 ? 1.904   6.494   6.355   1.00 0.00 ? 13 LEU B HD21 10 
ATOM 10798 H HD22 . LEU B 1 13 ? 2.792   8.028   6.145   1.00 0.00 ? 13 LEU B HD22 10 
ATOM 10799 H HD23 . LEU B 1 13 ? 3.002   6.708   4.977   1.00 0.00 ? 13 LEU B HD23 10 
ATOM 10800 N N    . ASP B 1 14 ? 3.016   3.549   4.036   1.00 0.00 ? 14 ASP B N    10 
ATOM 10801 C CA   . ASP B 1 14 ? 2.693   3.608   2.621   1.00 0.00 ? 14 ASP B CA   10 
ATOM 10802 C C    . ASP B 1 14 ? 1.247   3.156   2.413   1.00 0.00 ? 14 ASP B C    10 
ATOM 10803 O O    . ASP B 1 14 ? 0.588   3.686   1.506   1.00 0.00 ? 14 ASP B O    10 
ATOM 10804 C CB   . ASP B 1 14 ? 3.600   2.680   1.810   1.00 0.00 ? 14 ASP B CB   10 
ATOM 10805 C CG   . ASP B 1 14 ? 4.098   3.257   0.484   1.00 0.00 ? 14 ASP B CG   10 
ATOM 10806 O OD1  . ASP B 1 14 ? 4.696   4.398   0.576   1.00 0.00 ? 14 ASP B OD1  10 
ATOM 10807 O OD2  . ASP B 1 14 ? 3.923   2.650   -0.583  1.00 0.00 ? 14 ASP B OD2  10 
ATOM 10808 H H    . ASP B 1 14 ? 3.753   2.910   4.333   1.00 0.00 ? 14 ASP B H    10 
ATOM 10809 H HA   . ASP B 1 14 ? 2.797   4.637   2.277   1.00 0.00 ? 14 ASP B HA   10 
ATOM 10810 H HB2  . ASP B 1 14 ? 4.459   2.446   2.440   1.00 0.00 ? 14 ASP B HB2  10 
ATOM 10811 H HB3  . ASP B 1 14 ? 3.035   1.766   1.628   1.00 0.00 ? 14 ASP B HB3  10 
ATOM 10812 N N    . ASN B 1 15 ? 0.789   2.202   3.242   1.00 0.00 ? 15 ASN B N    10 
ATOM 10813 C CA   . ASN B 1 15 ? -0.566  1.686   3.150   1.00 0.00 ? 15 ASN B CA   10 
ATOM 10814 C C    . ASN B 1 15 ? -1.558  2.813   3.446   1.00 0.00 ? 15 ASN B C    10 
ATOM 10815 O O    . ASN B 1 15 ? -2.517  2.972   2.678   1.00 0.00 ? 15 ASN B O    10 
ATOM 10816 C CB   . ASN B 1 15 ? -0.801  0.570   4.168   1.00 0.00 ? 15 ASN B CB   10 
ATOM 10817 C CG   . ASN B 1 15 ? -1.869  -0.408  3.674   1.00 0.00 ? 15 ASN B CG   10 
ATOM 10818 O OD1  . ASN B 1 15 ? -3.049  -0.272  3.952   1.00 0.00 ? 15 ASN B OD1  10 
ATOM 10819 N ND2  . ASN B 1 15 ? -1.390  -1.400  2.927   1.00 0.00 ? 15 ASN B ND2  10 
ATOM 10820 H H    . ASN B 1 15 ? 1.399   1.818   3.964   1.00 0.00 ? 15 ASN B H    10 
ATOM 10821 H HA   . ASN B 1 15 ? -0.737  1.320   2.138   1.00 0.00 ? 15 ASN B HA   10 
ATOM 10822 H HB2  . ASN B 1 15 ? 0.132   0.028   4.322   1.00 0.00 ? 15 ASN B HB2  10 
ATOM 10823 H HB3  . ASN B 1 15 ? -1.114  1.014   5.114   1.00 0.00 ? 15 ASN B HB3  10 
ATOM 10824 H HD21 . ASN B 1 15 ? -0.391  -1.455  2.733   1.00 0.00 ? 15 ASN B HD21 10 
ATOM 10825 H HD22 . ASN B 1 15 ? -2.023  -2.105  2.549   1.00 0.00 ? 15 ASN B HD22 10 
ATOM 10826 N N    . TYR B 1 16 ? -1.311  3.560   4.537   1.00 0.00 ? 16 TYR B N    10 
ATOM 10827 C CA   . TYR B 1 16 ? -2.218  4.644   4.877   1.00 0.00 ? 16 TYR B CA   10 
ATOM 10828 C C    . TYR B 1 16 ? -2.298  5.622   3.703   1.00 0.00 ? 16 TYR B C    10 
ATOM 10829 O O    . TYR B 1 16 ? -3.401  6.120   3.434   1.00 0.00 ? 16 TYR B O    10 
ATOM 10830 C CB   . TYR B 1 16 ? -1.753  5.337   6.170   1.00 0.00 ? 16 TYR B CB   10 
ATOM 10831 C CG   . TYR B 1 16 ? -1.559  4.401   7.355   1.00 0.00 ? 16 TYR B CG   10 
ATOM 10832 C CD1  . TYR B 1 16 ? -2.501  3.377   7.607   1.00 0.00 ? 16 TYR B CD1  10 
ATOM 10833 C CD2  . TYR B 1 16 ? -0.437  4.543   8.203   1.00 0.00 ? 16 TYR B CD2  10 
ATOM 10834 C CE1  . TYR B 1 16 ? -2.324  2.505   8.703   1.00 0.00 ? 16 TYR B CE1  10 
ATOM 10835 C CE2  . TYR B 1 16 ? -0.260  3.670   9.298   1.00 0.00 ? 16 TYR B CE2  10 
ATOM 10836 C CZ   . TYR B 1 16 ? -1.203  2.650   9.549   1.00 0.00 ? 16 TYR B CZ   10 
ATOM 10837 O OH   . TYR B 1 16 ? -1.037  1.804   10.608  1.00 0.00 ? 16 TYR B OH   10 
ATOM 10838 H H    . TYR B 1 16 ? -0.510  3.377   5.123   1.00 0.00 ? 16 TYR B H    10 
ATOM 10839 H HA   . TYR B 1 16 ? -3.211  4.220   5.034   1.00 0.00 ? 16 TYR B HA   10 
ATOM 10840 H HB2  . TYR B 1 16 ? -0.822  5.874   5.973   1.00 0.00 ? 16 TYR B HB2  10 
ATOM 10841 H HB3  . TYR B 1 16 ? -2.496  6.085   6.456   1.00 0.00 ? 16 TYR B HB3  10 
ATOM 10842 H HD1  . TYR B 1 16 ? -3.361  3.258   6.963   1.00 0.00 ? 16 TYR B HD1  10 
ATOM 10843 H HD2  . TYR B 1 16 ? 0.291   5.320   8.018   1.00 0.00 ? 16 TYR B HD2  10 
ATOM 10844 H HE1  . TYR B 1 16 ? -3.050  1.725   8.888   1.00 0.00 ? 16 TYR B HE1  10 
ATOM 10845 H HE2  . TYR B 1 16 ? 0.601   3.786   9.941   1.00 0.00 ? 16 TYR B HE2  10 
ATOM 10846 H HH   . TYR B 1 16 ? -1.688  1.099   10.642  1.00 0.00 ? 16 TYR B HH   10 
ATOM 10847 N N    . HIS B 1 17 ? -1.154  5.881   3.045   1.00 0.00 ? 17 HIS B N    10 
ATOM 10848 C CA   . HIS B 1 17 ? -1.105  6.800   1.921   1.00 0.00 ? 17 HIS B CA   10 
ATOM 10849 C C    . HIS B 1 17 ? -1.780  6.155   0.710   1.00 0.00 ? 17 HIS B C    10 
ATOM 10850 O O    . HIS B 1 17 ? -2.516  6.858   0.001   1.00 0.00 ? 17 HIS B O    10 
ATOM 10851 C CB   . HIS B 1 17 ? 0.334   7.238   1.635   1.00 0.00 ? 17 HIS B CB   10 
ATOM 10852 C CG   . HIS B 1 17 ? 0.736   7.116   0.184   1.00 0.00 ? 17 HIS B CG   10 
ATOM 10853 N ND1  . HIS B 1 17 ? 0.595   8.153   -0.723  1.00 0.00 ? 17 HIS B ND1  10 
ATOM 10854 C CD2  . HIS B 1 17 ? 1.276   6.071   -0.506  1.00 0.00 ? 17 HIS B CD2  10 
ATOM 10855 C CE1  . HIS B 1 17 ? 1.033   7.739   -1.903  1.00 0.00 ? 17 HIS B CE1  10 
ATOM 10856 N NE2  . HIS B 1 17 ? 1.454   6.448   -1.767  1.00 0.00 ? 17 HIS B NE2  10 
ATOM 10857 H H    . HIS B 1 17 ? -0.287  5.427   3.331   1.00 0.00 ? 17 HIS B H    10 
ATOM 10858 H HA   . HIS B 1 17 ? -1.672  7.683   2.216   1.00 0.00 ? 17 HIS B HA   10 
ATOM 10859 H HB2  . HIS B 1 17 ? 0.427   8.280   1.942   1.00 0.00 ? 17 HIS B HB2  10 
ATOM 10860 H HB3  . HIS B 1 17 ? 0.989   6.626   2.254   1.00 0.00 ? 17 HIS B HB3  10 
ATOM 10861 H HD1  . HIS B 1 17 ? 0.234   9.100   -0.616  1.00 0.00 ? 17 HIS B HD1  10 
ATOM 10862 H HD2  . HIS B 1 17 ? 1.553   5.074   -0.197  1.00 0.00 ? 17 HIS B HD2  10 
ATOM 10863 H HE1  . HIS B 1 17 ? 1.008   8.405   -2.752  1.00 0.00 ? 17 HIS B HE1  10 
ATOM 10864 N N    . LEU B 1 18 ? -1.521  4.852   0.498   1.00 0.00 ? 18 LEU B N    10 
ATOM 10865 C CA   . LEU B 1 18 ? -2.100  4.122   -0.617  1.00 0.00 ? 18 LEU B CA   10 
ATOM 10866 C C    . LEU B 1 18 ? -3.619  4.060   -0.445  1.00 0.00 ? 18 LEU B C    10 
ATOM 10867 O O    . LEU B 1 18 ? -4.332  4.164   -1.455  1.00 0.00 ? 18 LEU B O    10 
ATOM 10868 C CB   . LEU B 1 18 ? -1.441  2.749   -0.759  1.00 0.00 ? 18 LEU B CB   10 
ATOM 10869 C CG   . LEU B 1 18 ? -0.017  2.744   -1.320  1.00 0.00 ? 18 LEU B CG   10 
ATOM 10870 C CD1  . LEU B 1 18 ? 0.620   1.360   -1.185  1.00 0.00 ? 18 LEU B CD1  10 
ATOM 10871 C CD2  . LEU B 1 18 ? 0.004   3.246   -2.765  1.00 0.00 ? 18 LEU B CD2  10 
ATOM 10872 H H    . LEU B 1 18 ? -0.902  4.346   1.132   1.00 0.00 ? 18 LEU B H    10 
ATOM 10873 H HA   . LEU B 1 18 ? -1.868  4.694   -1.514  1.00 0.00 ? 18 LEU B HA   10 
ATOM 10874 H HB2  . LEU B 1 18 ? -1.431  2.308   0.237   1.00 0.00 ? 18 LEU B HB2  10 
ATOM 10875 H HB3  . LEU B 1 18 ? -2.095  2.161   -1.401  1.00 0.00 ? 18 LEU B HB3  10 
ATOM 10876 H HG   . LEU B 1 18 ? 0.538   3.442   -0.694  1.00 0.00 ? 18 LEU B HG   10 
ATOM 10877 H HD11 . LEU B 1 18 ? 0.025   0.622   -1.723  1.00 0.00 ? 18 LEU B HD11 10 
ATOM 10878 H HD12 . LEU B 1 18 ? 1.630   1.393   -1.594  1.00 0.00 ? 18 LEU B HD12 10 
ATOM 10879 H HD13 . LEU B 1 18 ? 0.672   1.076   -0.133  1.00 0.00 ? 18 LEU B HD13 10 
ATOM 10880 H HD21 . LEU B 1 18 ? -0.390  4.261   -2.812  1.00 0.00 ? 18 LEU B HD21 10 
ATOM 10881 H HD22 . LEU B 1 18 ? 1.031   3.228   -3.132  1.00 0.00 ? 18 LEU B HD22 10 
ATOM 10882 H HD23 . LEU B 1 18 ? -0.608  2.598   -3.393  1.00 0.00 ? 18 LEU B HD23 10 
ATOM 10883 N N    . GLU B 1 19 ? -4.078  3.895   0.808   1.00 0.00 ? 19 GLU B N    10 
ATOM 10884 C CA   . GLU B 1 19 ? -5.498  3.820   1.104   1.00 0.00 ? 19 GLU B CA   10 
ATOM 10885 C C    . GLU B 1 19 ? -6.150  5.171   0.803   1.00 0.00 ? 19 GLU B C    10 
ATOM 10886 O O    . GLU B 1 19 ? -7.157  5.192   0.080   1.00 0.00 ? 19 GLU B O    10 
ATOM 10887 C CB   . GLU B 1 19 ? -5.748  3.402   2.555   1.00 0.00 ? 19 GLU B CB   10 
ATOM 10888 C CG   . GLU B 1 19 ? -7.004  2.535   2.667   1.00 0.00 ? 19 GLU B CG   10 
ATOM 10889 C CD   . GLU B 1 19 ? -8.028  3.172   3.608   1.00 0.00 ? 19 GLU B CD   10 
ATOM 10890 O OE1  . GLU B 1 19 ? -7.835  3.160   4.834   1.00 0.00 ? 19 GLU B OE1  10 
ATOM 10891 O OE2  . GLU B 1 19 ? -9.053  3.694   3.026   1.00 0.00 ? 19 GLU B OE2  10 
ATOM 10892 H H    . GLU B 1 19 ? -3.422  3.819   1.585   1.00 0.00 ? 19 GLU B H    10 
ATOM 10893 H HA   . GLU B 1 19 ? -5.922  3.066   0.441   1.00 0.00 ? 19 GLU B HA   10 
ATOM 10894 H HB2  . GLU B 1 19 ? -4.890  2.831   2.911   1.00 0.00 ? 19 GLU B HB2  10 
ATOM 10895 H HB3  . GLU B 1 19 ? -5.859  4.297   3.167   1.00 0.00 ? 19 GLU B HB3  10 
ATOM 10896 H HG2  . GLU B 1 19 ? -7.449  2.428   1.678   1.00 0.00 ? 19 GLU B HG2  10 
ATOM 10897 H HG3  . GLU B 1 19 ? -6.721  1.549   3.037   1.00 0.00 ? 19 GLU B HG3  10 
ATOM 10898 N N    . ASN B 1 20 ? -5.573  6.254   1.355   1.00 0.00 ? 20 ASN B N    10 
ATOM 10899 C CA   . ASN B 1 20 ? -6.094  7.595   1.146   1.00 0.00 ? 20 ASN B CA   10 
ATOM 10900 C C    . ASN B 1 20 ? -6.025  7.938   -0.343  1.00 0.00 ? 20 ASN B C    10 
ATOM 10901 O O    . ASN B 1 20 ? -6.890  8.690   -0.816  1.00 0.00 ? 20 ASN B O    10 
ATOM 10902 C CB   . ASN B 1 20 ? -5.268  8.631   1.909   1.00 0.00 ? 20 ASN B CB   10 
ATOM 10903 C CG   . ASN B 1 20 ? -5.055  8.202   3.363   1.00 0.00 ? 20 ASN B CG   10 
ATOM 10904 O OD1  . ASN B 1 20 ? -5.820  7.440   3.930   1.00 0.00 ? 20 ASN B OD1  10 
ATOM 10905 N ND2  . ASN B 1 20 ? -3.977  8.732   3.931   1.00 0.00 ? 20 ASN B ND2  10 
ATOM 10906 H H    . ASN B 1 20 ? -4.744  6.149   1.939   1.00 0.00 ? 20 ASN B H    10 
ATOM 10907 H HA   . ASN B 1 20 ? -7.135  7.624   1.470   1.00 0.00 ? 20 ASN B HA   10 
ATOM 10908 H HB2  . ASN B 1 20 ? -4.296  8.736   1.425   1.00 0.00 ? 20 ASN B HB2  10 
ATOM 10909 H HB3  . ASN B 1 20 ? -5.786  9.590   1.876   1.00 0.00 ? 20 ASN B HB3  10 
ATOM 10910 H HD21 . ASN B 1 20 ? -3.378  9.364   3.399   1.00 0.00 ? 20 ASN B HD21 10 
ATOM 10911 H HD22 . ASN B 1 20 ? -3.747  8.507   4.899   1.00 0.00 ? 20 ASN B HD22 10 
ATOM 10912 N N    . GLU B 1 21 ? -5.015  7.389   -1.041  1.00 0.00 ? 21 GLU B N    10 
ATOM 10913 C CA   . GLU B 1 21 ? -4.839  7.636   -2.463  1.00 0.00 ? 21 GLU B CA   10 
ATOM 10914 C C    . GLU B 1 21 ? -5.822  6.769   -3.252  1.00 0.00 ? 21 GLU B C    10 
ATOM 10915 O O    . GLU B 1 21 ? -6.277  7.214   -4.316  1.00 0.00 ? 21 GLU B O    10 
ATOM 10916 C CB   . GLU B 1 21 ? -3.398  7.372   -2.904  1.00 0.00 ? 21 GLU B CB   10 
ATOM 10917 C CG   . GLU B 1 21 ? -3.146  7.920   -4.310  1.00 0.00 ? 21 GLU B CG   10 
ATOM 10918 C CD   . GLU B 1 21 ? -1.876  7.317   -4.914  1.00 0.00 ? 21 GLU B CD   10 
ATOM 10919 O OE1  . GLU B 1 21 ? -1.846  6.027   -4.946  1.00 0.00 ? 21 GLU B OE1  10 
ATOM 10920 O OE2  . GLU B 1 21 ? -0.972  8.059   -5.326  1.00 0.00 ? 21 GLU B OE2  10 
ATOM 10921 H H    . GLU B 1 21 ? -4.345  6.778   -0.574  1.00 0.00 ? 21 GLU B H    10 
ATOM 10922 H HA   . GLU B 1 21 ? -5.075  8.686   -2.634  1.00 0.00 ? 21 GLU B HA   10 
ATOM 10923 H HB2  . GLU B 1 21 ? -2.719  7.861   -2.205  1.00 0.00 ? 21 GLU B HB2  10 
ATOM 10924 H HB3  . GLU B 1 21 ? -3.214  6.298   -2.885  1.00 0.00 ? 21 GLU B HB3  10 
ATOM 10925 H HG2  . GLU B 1 21 ? -3.995  7.668   -4.945  1.00 0.00 ? 21 GLU B HG2  10 
ATOM 10926 H HG3  . GLU B 1 21 ? -3.053  9.004   -4.255  1.00 0.00 ? 21 GLU B HG3  10 
ATOM 10927 N N    . VAL B 1 22 ? -6.124  5.568   -2.726  1.00 0.00 ? 22 VAL B N    10 
ATOM 10928 C CA   . VAL B 1 22 ? -7.044  4.651   -3.378  1.00 0.00 ? 22 VAL B CA   10 
ATOM 10929 C C    . VAL B 1 22 ? -8.481  5.101   -3.110  1.00 0.00 ? 22 VAL B C    10 
ATOM 10930 O O    . VAL B 1 22 ? -9.316  4.978   -4.018  1.00 0.00 ? 22 VAL B O    10 
ATOM 10931 C CB   . VAL B 1 22 ? -6.769  3.219   -2.914  1.00 0.00 ? 22 VAL B CB   10 
ATOM 10932 C CG1  . VAL B 1 22 ? -8.038  2.367   -2.986  1.00 0.00 ? 22 VAL B CG1  10 
ATOM 10933 C CG2  . VAL B 1 22 ? -5.638  2.586   -3.729  1.00 0.00 ? 22 VAL B CG2  10 
ATOM 10934 H H    . VAL B 1 22 ? -5.703  5.278   -1.844  1.00 0.00 ? 22 VAL B H    10 
ATOM 10935 H HA   . VAL B 1 22 ? -6.850  4.700   -4.449  1.00 0.00 ? 22 VAL B HA   10 
ATOM 10936 H HB   . VAL B 1 22 ? -6.454  3.299   -1.874  1.00 0.00 ? 22 VAL B HB   10 
ATOM 10937 H HG11 . VAL B 1 22 ? -8.412  2.343   -4.009  1.00 0.00 ? 22 VAL B HG11 10 
ATOM 10938 H HG12 . VAL B 1 22 ? -7.807  1.357   -2.650  1.00 0.00 ? 22 VAL B HG12 10 
ATOM 10939 H HG13 . VAL B 1 22 ? -8.807  2.790   -2.338  1.00 0.00 ? 22 VAL B HG13 10 
ATOM 10940 H HG21 . VAL B 1 22 ? -4.727  3.174   -3.617  1.00 0.00 ? 22 VAL B HG21 10 
ATOM 10941 H HG22 . VAL B 1 22 ? -5.471  1.569   -3.373  1.00 0.00 ? 22 VAL B HG22 10 
ATOM 10942 H HG23 . VAL B 1 22 ? -5.913  2.553   -4.782  1.00 0.00 ? 22 VAL B HG23 10 
ATOM 10943 N N    . ALA B 1 23 ? -8.737  5.606   -1.890  1.00 0.00 ? 23 ALA B N    10 
ATOM 10944 C CA   . ALA B 1 23 ? -10.060 6.068   -1.510  1.00 0.00 ? 23 ALA B CA   10 
ATOM 10945 C C    . ALA B 1 23 ? -10.405 7.327   -2.310  1.00 0.00 ? 23 ALA B C    10 
ATOM 10946 O O    . ALA B 1 23 ? -11.588 7.699   -2.344  1.00 0.00 ? 23 ALA B O    10 
ATOM 10947 C CB   . ALA B 1 23 ? -10.058 6.485   -0.037  1.00 0.00 ? 23 ALA B CB   10 
ATOM 10948 H H    . ALA B 1 23 ? -7.990  5.673   -1.198  1.00 0.00 ? 23 ALA B H    10 
ATOM 10949 H HA   . ALA B 1 23 ? -10.815 5.307   -1.704  1.00 0.00 ? 23 ALA B HA   10 
ATOM 10950 H HB1  . ALA B 1 23 ? -9.772  5.627   0.572   1.00 0.00 ? 23 ALA B HB1  10 
ATOM 10951 H HB2  . ALA B 1 23 ? -9.339  7.289   0.121   1.00 0.00 ? 23 ALA B HB2  10 
ATOM 10952 H HB3  . ALA B 1 23 ? -11.049 6.833   0.252   1.00 0.00 ? 23 ALA B HB3  10 
ATOM 10953 N N    . ARG B 1 24 ? -9.383  7.947   -2.927  1.00 0.00 ? 24 ARG B N    10 
ATOM 10954 C CA   . ARG B 1 24 ? -9.577  9.150   -3.719  1.00 0.00 ? 24 ARG B CA   10 
ATOM 10955 C C    . ARG B 1 24 ? -9.639  8.776   -5.200  1.00 0.00 ? 24 ARG B C    10 
ATOM 10956 O O    . ARG B 1 24 ? -10.374 9.440   -5.946  1.00 0.00 ? 24 ARG B O    10 
ATOM 10957 C CB   . ARG B 1 24 ? -8.446  10.157  -3.499  1.00 0.00 ? 24 ARG B CB   10 
ATOM 10958 C CG   . ARG B 1 24 ? -8.821  11.177  -2.422  1.00 0.00 ? 24 ARG B CG   10 
ATOM 10959 C CD   . ARG B 1 24 ? -9.479  10.491  -1.222  1.00 0.00 ? 24 ARG B CD   10 
ATOM 10960 N NE   . ARG B 1 24 ? -9.877  11.501  -0.218  1.00 0.00 ? 24 ARG B NE   10 
ATOM 10961 C CZ   . ARG B 1 24 ? -11.126 12.002  -0.101  1.00 0.00 ? 24 ARG B CZ   10 
ATOM 10962 N NH1  . ARG B 1 24 ? -12.079 11.571  -0.938  1.00 0.00 ? 24 ARG B NH1  10 
ATOM 10963 N NH2  . ARG B 1 24 ? -11.406 12.917  0.837   1.00 0.00 ? 24 ARG B NH2  10 
ATOM 10964 H H    . ARG B 1 24 ? -8.438  7.574   -2.848  1.00 0.00 ? 24 ARG B H    10 
ATOM 10965 H HA   . ARG B 1 24 ? -10.529 9.593   -3.424  1.00 0.00 ? 24 ARG B HA   10 
ATOM 10966 H HB2  . ARG B 1 24 ? -7.552  9.620   -3.184  1.00 0.00 ? 24 ARG B HB2  10 
ATOM 10967 H HB3  . ARG B 1 24 ? -8.242  10.668  -4.439  1.00 0.00 ? 24 ARG B HB3  10 
ATOM 10968 H HG2  . ARG B 1 24 ? -7.918  11.687  -2.088  1.00 0.00 ? 24 ARG B HG2  10 
ATOM 10969 H HG3  . ARG B 1 24 ? -9.504  11.910  -2.852  1.00 0.00 ? 24 ARG B HG3  10 
ATOM 10970 H HD2  . ARG B 1 24 ? -10.366 9.951   -1.554  1.00 0.00 ? 24 ARG B HD2  10 
ATOM 10971 H HD3  . ARG B 1 24 ? -8.778  9.782   -0.781  1.00 0.00 ? 24 ARG B HD3  10 
ATOM 10972 H HE   . ARG B 1 24 ? -9.139  11.818  0.412   1.00 0.00 ? 24 ARG B HE   10 
ATOM 10973 H HH11 . ARG B 1 24 ? -11.856 10.874  -1.650  1.00 0.00 ? 24 ARG B HH11 10 
ATOM 10974 H HH12 . ARG B 1 24 ? -13.027 11.939  -0.863  1.00 0.00 ? 24 ARG B HH12 10 
ATOM 10975 H HH21 . ARG B 1 24 ? -10.675 13.239  1.471   1.00 0.00 ? 24 ARG B HH21 10 
ATOM 10976 H HH22 . ARG B 1 24 ? -12.352 13.290  0.918   1.00 0.00 ? 24 ARG B HH22 10 
ATOM 10977 N N    . LEU B 1 25 ? -8.877  7.739   -5.592  1.00 0.00 ? 25 LEU B N    10 
ATOM 10978 C CA   . LEU B 1 25 ? -8.846  7.284   -6.972  1.00 0.00 ? 25 LEU B CA   10 
ATOM 10979 C C    . LEU B 1 25 ? -10.095 6.448   -7.258  1.00 0.00 ? 25 LEU B C    10 
ATOM 10980 O O    . LEU B 1 25 ? -10.657 6.582   -8.355  1.00 0.00 ? 25 LEU B O    10 
ATOM 10981 C CB   . LEU B 1 25 ? -7.536  6.551   -7.265  1.00 0.00 ? 25 LEU B CB   10 
ATOM 10982 C CG   . LEU B 1 25 ? -6.301  7.435   -7.455  1.00 0.00 ? 25 LEU B CG   10 
ATOM 10983 C CD1  . LEU B 1 25 ? -5.028  6.589   -7.532  1.00 0.00 ? 25 LEU B CD1  10 
ATOM 10984 C CD2  . LEU B 1 25 ? -6.460  8.345   -8.674  1.00 0.00 ? 25 LEU B CD2  10 
ATOM 10985 H H    . LEU B 1 25 ? -8.300  7.246   -4.912  1.00 0.00 ? 25 LEU B H    10 
ATOM 10986 H HA   . LEU B 1 25 ? -8.869  8.180   -7.593  1.00 0.00 ? 25 LEU B HA   10 
ATOM 10987 H HB2  . LEU B 1 25 ? -7.364  5.879   -6.424  1.00 0.00 ? 25 LEU B HB2  10 
ATOM 10988 H HB3  . LEU B 1 25 ? -7.711  5.960   -8.163  1.00 0.00 ? 25 LEU B HB3  10 
ATOM 10989 H HG   . LEU B 1 25 ? -6.251  8.050   -6.556  1.00 0.00 ? 25 LEU B HG   10 
ATOM 10990 H HD11 . LEU B 1 25 ? -5.096  5.893   -8.368  1.00 0.00 ? 25 LEU B HD11 10 
ATOM 10991 H HD12 . LEU B 1 25 ? -4.171  7.249   -7.668  1.00 0.00 ? 25 LEU B HD12 10 
ATOM 10992 H HD13 . LEU B 1 25 ? -4.899  6.025   -6.609  1.00 0.00 ? 25 LEU B HD13 10 
ATOM 10993 H HD21 . LEU B 1 25 ? -7.335  8.983   -8.550  1.00 0.00 ? 25 LEU B HD21 10 
ATOM 10994 H HD22 . LEU B 1 25 ? -5.565  8.958   -8.778  1.00 0.00 ? 25 LEU B HD22 10 
ATOM 10995 H HD23 . LEU B 1 25 ? -6.584  7.742   -9.574  1.00 0.00 ? 25 LEU B HD23 10 
ATOM 10996 N N    . LYS B 1 26 ? -10.498 5.615   -6.281  1.00 0.00 ? 26 LYS B N    10 
ATOM 10997 C CA   . LYS B 1 26 ? -11.669 4.767   -6.428  1.00 0.00 ? 26 LYS B CA   10 
ATOM 10998 C C    . LYS B 1 26 ? -12.919 5.643   -6.525  1.00 0.00 ? 26 LYS B C    10 
ATOM 10999 O O    . LYS B 1 26 ? -13.934 5.166   -7.054  1.00 0.00 ? 26 LYS B O    10 
ATOM 11000 C CB   . LYS B 1 26 ? -11.727 3.735   -5.300  1.00 0.00 ? 26 LYS B CB   10 
ATOM 11001 C CG   . LYS B 1 26 ? -12.547 2.513   -5.717  1.00 0.00 ? 26 LYS B CG   10 
ATOM 11002 C CD   . LYS B 1 26 ? -11.829 1.719   -6.812  1.00 0.00 ? 26 LYS B CD   10 
ATOM 11003 C CE   . LYS B 1 26 ? -10.314 1.744   -6.603  1.00 0.00 ? 26 LYS B CE   10 
ATOM 11004 N NZ   . LYS B 1 26 ? -9.647  0.852   -7.566  1.00 0.00 ? 26 LYS B NZ   10 
ATOM 11005 H H    . LYS B 1 26 ? -9.977  5.566   -5.406  1.00 0.00 ? 26 LYS B H    10 
ATOM 11006 H HA   . LYS B 1 26 ? -11.542 4.224   -7.365  1.00 0.00 ? 26 LYS B HA   10 
ATOM 11007 H HB2  . LYS B 1 26 ? -10.713 3.417   -5.058  1.00 0.00 ? 26 LYS B HB2  10 
ATOM 11008 H HB3  . LYS B 1 26 ? -12.173 4.198   -4.420  1.00 0.00 ? 26 LYS B HB3  10 
ATOM 11009 H HG2  . LYS B 1 26 ? -12.690 1.869   -4.848  1.00 0.00 ? 26 LYS B HG2  10 
ATOM 11010 H HG3  . LYS B 1 26 ? -13.521 2.846   -6.076  1.00 0.00 ? 26 LYS B HG3  10 
ATOM 11011 H HD2  . LYS B 1 26 ? -12.175 0.686   -6.784  1.00 0.00 ? 26 LYS B HD2  10 
ATOM 11012 H HD3  . LYS B 1 26 ? -12.079 2.150   -7.781  1.00 0.00 ? 26 LYS B HD3  10 
ATOM 11013 H HE2  . LYS B 1 26 ? -9.949  2.761   -6.749  1.00 0.00 ? 26 LYS B HE2  10 
ATOM 11014 H HE3  . LYS B 1 26 ? -10.087 1.428   -5.585  1.00 0.00 ? 26 LYS B HE3  10 
ATOM 11015 H HZ1  . LYS B 1 26 ? -9.859  1.148   -8.518  1.00 0.00 ? 26 LYS B HZ1  10 
ATOM 11016 H HZ2  . LYS B 1 26 ? -8.640  0.886   -7.407  1.00 0.00 ? 26 LYS B HZ2  10 
ATOM 11017 H HZ3  . LYS B 1 26 ? -9.971  -0.105  -7.435  1.00 0.00 ? 26 LYS B HZ3  10 
ATOM 11018 N N    . LYS B 1 27 ? -12.824 6.887   -6.022  1.00 0.00 ? 27 LYS B N    10 
ATOM 11019 C CA   . LYS B 1 27 ? -13.939 7.817   -6.051  1.00 0.00 ? 27 LYS B CA   10 
ATOM 11020 C C    . LYS B 1 27 ? -13.939 8.565   -7.387  1.00 0.00 ? 27 LYS B C    10 
ATOM 11021 O O    . LYS B 1 27 ? -14.916 9.274   -7.666  1.00 0.00 ? 27 LYS B O    10 
ATOM 11022 C CB   . LYS B 1 27 ? -13.901 8.739   -4.831  1.00 0.00 ? 27 LYS B CB   10 
ATOM 11023 C CG   . LYS B 1 27 ? -15.294 8.895   -4.217  1.00 0.00 ? 27 LYS B CG   10 
ATOM 11024 C CD   . LYS B 1 27 ? -15.333 8.332   -2.795  1.00 0.00 ? 27 LYS B CD   10 
ATOM 11025 C CE   . LYS B 1 27 ? -14.748 9.332   -1.795  1.00 0.00 ? 27 LYS B CE   10 
ATOM 11026 N NZ   . LYS B 1 27 ? -15.060 8.922   -0.415  1.00 0.00 ? 27 LYS B NZ   10 
ATOM 11027 H H    . LYS B 1 27 ? -11.949 7.201   -5.603  1.00 0.00 ? 27 LYS B H    10 
ATOM 11028 H HA   . LYS B 1 27 ? -14.846 7.216   -5.982  1.00 0.00 ? 27 LYS B HA   10 
ATOM 11029 H HB2  . LYS B 1 27 ? -13.230 8.311   -4.086  1.00 0.00 ? 27 LYS B HB2  10 
ATOM 11030 H HB3  . LYS B 1 27 ? -13.518 9.713   -5.136  1.00 0.00 ? 27 LYS B HB3  10 
ATOM 11031 H HG2  . LYS B 1 27 ? -15.551 9.954   -4.187  1.00 0.00 ? 27 LYS B HG2  10 
ATOM 11032 H HG3  . LYS B 1 27 ? -16.016 8.371   -4.844  1.00 0.00 ? 27 LYS B HG3  10 
ATOM 11033 H HD2  . LYS B 1 27 ? -16.368 8.123   -2.526  1.00 0.00 ? 27 LYS B HD2  10 
ATOM 11034 H HD3  . LYS B 1 27 ? -14.765 7.402   -2.767  1.00 0.00 ? 27 LYS B HD3  10 
ATOM 11035 H HE2  . LYS B 1 27 ? -13.666 9.371   -1.917  1.00 0.00 ? 27 LYS B HE2  10 
ATOM 11036 H HE3  . LYS B 1 27 ? -15.165 10.319  -1.991  1.00 0.00 ? 27 LYS B HE3  10 
ATOM 11037 H HZ1  . LYS B 1 27 ? -14.671 7.996   -0.231  1.00 0.00 ? 27 LYS B HZ1  10 
ATOM 11038 H HZ2  . LYS B 1 27 ? -14.661 9.601   0.232   1.00 0.00 ? 27 LYS B HZ2  10 
ATOM 11039 H HZ3  . LYS B 1 27 ? -16.071 8.889   -0.282  1.00 0.00 ? 27 LYS B HZ3  10 
ATOM 11040 N N    . LEU B 1 28 ? -12.859 8.395   -8.172  1.00 0.00 ? 28 LEU B N    10 
ATOM 11041 C CA   . LEU B 1 28 ? -12.736 9.048   -9.463  1.00 0.00 ? 28 LEU B CA   10 
ATOM 11042 C C    . LEU B 1 28 ? -12.952 8.018   -10.574 1.00 0.00 ? 28 LEU B C    10 
ATOM 11043 O O    . LEU B 1 28 ? -13.552 8.373   -11.600 1.00 0.00 ? 28 LEU B O    10 
ATOM 11044 C CB   . LEU B 1 28 ? -11.402 9.790   -9.563  1.00 0.00 ? 28 LEU B CB   10 
ATOM 11045 C CG   . LEU B 1 28 ? -11.473 11.235  -10.061 1.00 0.00 ? 28 LEU B CG   10 
ATOM 11046 C CD1  . LEU B 1 28 ? -11.761 12.198  -8.908  1.00 0.00 ? 28 LEU B CD1  10 
ATOM 11047 C CD2  . LEU B 1 28 ? -10.202 11.616  -10.823 1.00 0.00 ? 28 LEU B CD2  10 
ATOM 11048 H H    . LEU B 1 28 ? -12.096 7.792   -7.865  1.00 0.00 ? 28 LEU B H    10 
ATOM 11049 H HA   . LEU B 1 28 ? -13.531 9.793   -9.511  1.00 0.00 ? 28 LEU B HA   10 
ATOM 11050 H HB2  . LEU B 1 28 ? -10.969 9.780   -8.564  1.00 0.00 ? 28 LEU B HB2  10 
ATOM 11051 H HB3  . LEU B 1 28 ? -10.772 9.198   -10.228 1.00 0.00 ? 28 LEU B HB3  10 
ATOM 11052 H HG   . LEU B 1 28 ? -12.318 11.257  -10.749 1.00 0.00 ? 28 LEU B HG   10 
ATOM 11053 H HD11 . LEU B 1 28 ? -10.976 12.123  -8.156  1.00 0.00 ? 28 LEU B HD11 10 
ATOM 11054 H HD12 . LEU B 1 28 ? -11.805 13.216  -9.299  1.00 0.00 ? 28 LEU B HD12 10 
ATOM 11055 H HD13 . LEU B 1 28 ? -12.718 11.953  -8.450  1.00 0.00 ? 28 LEU B HD13 10 
ATOM 11056 H HD21 . LEU B 1 28 ? -10.068 10.954  -11.678 1.00 0.00 ? 28 LEU B HD21 10 
ATOM 11057 H HD22 . LEU B 1 28 ? -10.287 12.648  -11.162 1.00 0.00 ? 28 LEU B HD22 10 
ATOM 11058 H HD23 . LEU B 1 28 ? -9.335  11.528  -10.168 1.00 0.00 ? 28 LEU B HD23 10 
ATOM 11059 N N    . VAL B 1 29 ? -12.469 6.783   -10.352 1.00 0.00 ? 29 VAL B N    10 
ATOM 11060 C CA   . VAL B 1 29 ? -12.607 5.715   -11.327 1.00 0.00 ? 29 VAL B CA   10 
ATOM 11061 C C    . VAL B 1 29 ? -13.683 4.735   -10.854 1.00 0.00 ? 29 VAL B C    10 
ATOM 11062 O O    . VAL B 1 29 ? -14.748 4.676   -11.487 1.00 0.00 ? 29 VAL B O    10 
ATOM 11063 C CB   . VAL B 1 29 ? -11.253 5.046   -11.568 1.00 0.00 ? 29 VAL B CB   10 
ATOM 11064 C CG1  . VAL B 1 29 ? -11.289 4.167   -12.820 1.00 0.00 ? 29 VAL B CG1  10 
ATOM 11065 C CG2  . VAL B 1 29 ? -10.136 6.086   -11.660 1.00 0.00 ? 29 VAL B CG2  10 
ATOM 11066 H H    . VAL B 1 29 ? -11.985 6.574   -9.479  1.00 0.00 ? 29 VAL B H    10 
ATOM 11067 H HA   . VAL B 1 29 ? -12.928 6.169   -12.265 1.00 0.00 ? 29 VAL B HA   10 
ATOM 11068 H HB   . VAL B 1 29 ? -11.077 4.415   -10.696 1.00 0.00 ? 29 VAL B HB   10 
ATOM 11069 H HG11 . VAL B 1 29 ? -11.545 4.772   -13.691 1.00 0.00 ? 29 VAL B HG11 10 
ATOM 11070 H HG12 . VAL B 1 29 ? -10.311 3.708   -12.959 1.00 0.00 ? 29 VAL B HG12 10 
ATOM 11071 H HG13 . VAL B 1 29 ? -12.037 3.383   -12.701 1.00 0.00 ? 29 VAL B HG13 10 
ATOM 11072 H HG21 . VAL B 1 29 ? -10.086 6.663   -10.736 1.00 0.00 ? 29 VAL B HG21 10 
ATOM 11073 H HG22 . VAL B 1 29 ? -9.188  5.576   -11.831 1.00 0.00 ? 29 VAL B HG22 10 
ATOM 11074 H HG23 . VAL B 1 29 ? -10.328 6.765   -12.491 1.00 0.00 ? 29 VAL B HG23 10 
ATOM 11075 N N    . GLY B 1 30 ? -13.389 3.998   -9.767  1.00 0.00 ? 30 GLY B N    10 
ATOM 11076 C CA   . GLY B 1 30 ? -14.325 3.032   -9.218  1.00 0.00 ? 30 GLY B CA   10 
ATOM 11077 C C    . GLY B 1 30 ? -15.646 3.733   -8.894  1.00 0.00 ? 30 GLY B C    10 
ATOM 11078 O O    . GLY B 1 30 ? -16.624 3.037   -8.585  1.00 0.00 ? 30 GLY B O    10 
ATOM 11079 H H    . GLY B 1 30 ? -12.487 4.109   -9.305  1.00 0.00 ? 30 GLY B H    10 
ATOM 11080 H HA2  . GLY B 1 30 ? -14.512 2.243   -9.945  1.00 0.00 ? 30 GLY B HA2  10 
ATOM 11081 H HA3  . GLY B 1 30 ? -13.908 2.589   -8.313  1.00 0.00 ? 30 GLY B HA3  10 
ATOM 11082 N N    . GLU B 1 31 ? -15.648 5.077   -8.968  1.00 0.00 ? 31 GLU B N    10 
ATOM 11083 C CA   . GLU B 1 31 ? -16.837 5.861   -8.686  1.00 0.00 ? 31 GLU B CA   10 
ATOM 11084 C C    . GLU B 1 31 ? -17.873 5.624   -9.787  1.00 0.00 ? 31 GLU B C    10 
ATOM 11085 O O    . GLU B 1 31 ? -17.595 5.974   -10.944 1.00 0.00 ? 31 GLU B O    10 
ATOM 11086 C CB   . GLU B 1 31 ? -16.509 7.350   -8.552  1.00 0.00 ? 31 GLU B CB   10 
ATOM 11087 C CG   . GLU B 1 31 ? -17.563 8.208   -9.256  1.00 0.00 ? 31 GLU B CG   10 
ATOM 11088 C CD   . GLU B 1 31 ? -17.461 9.670   -8.816  1.00 0.00 ? 31 GLU B CD   10 
ATOM 11089 O OE1  . GLU B 1 31 ? -17.491 9.859   -7.540  1.00 0.00 ? 31 GLU B OE1  10 
ATOM 11090 O OE2  . GLU B 1 31 ? -17.361 10.568  -9.665  1.00 0.00 ? 31 GLU B OE2  10 
ATOM 11091 H H    . GLU B 1 31 ? -14.797 5.574   -9.230  1.00 0.00 ? 31 GLU B H    10 
ATOM 11092 H HA   . GLU B 1 31 ? -17.238 5.500   -7.739  1.00 0.00 ? 31 GLU B HA   10 
ATOM 11093 H HB2  . GLU B 1 31 ? -16.486 7.614   -7.495  1.00 0.00 ? 31 GLU B HB2  10 
ATOM 11094 H HB3  . GLU B 1 31 ? -15.528 7.536   -8.987  1.00 0.00 ? 31 GLU B HB3  10 
ATOM 11095 H HG2  . GLU B 1 31 ? -17.406 8.150   -10.332 1.00 0.00 ? 31 GLU B HG2  10 
ATOM 11096 H HG3  . GLU B 1 31 ? -18.553 7.818   -9.020  1.00 0.00 ? 31 GLU B HG3  10 
ATOM 11097 N N    . ARG B 1 32 ? -19.028 5.045   -9.413  1.00 0.00 ? 32 ARG B N    10 
ATOM 11098 C CA   . ARG B 1 32 ? -20.092 4.767   -10.363 1.00 0.00 ? 32 ARG B CA   10 
ATOM 11099 C C    . ARG B 1 32 ? -20.288 5.980   -11.274 1.00 0.00 ? 32 ARG B C    10 
ATOM 11100 O O    . ARG B 1 32 ? -19.753 6.019   -12.381 1.00 0.00 ? 32 ARG B O    10 
ATOM 11101 C CB   . ARG B 1 32 ? -21.411 4.451   -9.654  1.00 0.00 ? 32 ARG B CB   10 
ATOM 11102 C CG   . ARG B 1 32 ? -21.160 3.803   -8.292  1.00 0.00 ? 32 ARG B CG   10 
ATOM 11103 C CD   . ARG B 1 32 ? -21.280 4.831   -7.165  1.00 0.00 ? 32 ARG B CD   10 
ATOM 11104 N NE   . ARG B 1 32 ? -20.779 6.146   -7.626  1.00 0.00 ? 32 ARG B NE   10 
ATOM 11105 C CZ   . ARG B 1 32 ? -20.631 7.223   -6.824  1.00 0.00 ? 32 ARG B CZ   10 
ATOM 11106 N NH1  . ARG B 1 32 ? -20.951 7.116   -5.527  1.00 0.00 ? 32 ARG B NH1  10 
ATOM 11107 N NH2  . ARG B 1 32 ? -20.172 8.380   -7.318  1.00 0.00 ? 32 ARG B NH2  10 
ATOM 11108 H H    . ARG B 1 32 ? -19.176 4.788   -8.438  1.00 0.00 ? 32 ARG B H    10 
ATOM 11109 H HA   . ARG B 1 32 ? -19.784 3.914   -10.968 1.00 0.00 ? 32 ARG B HA   10 
ATOM 11110 H HB2  . ARG B 1 32 ? -21.965 5.379   -9.510  1.00 0.00 ? 32 ARG B HB2  10 
ATOM 11111 H HB3  . ARG B 1 32 ? -21.999 3.781   -10.283 1.00 0.00 ? 32 ARG B HB3  10 
ATOM 11112 H HG2  . ARG B 1 32 ? -21.898 3.016   -8.133  1.00 0.00 ? 32 ARG B HG2  10 
ATOM 11113 H HG3  . ARG B 1 32 ? -20.164 3.362   -8.288  1.00 0.00 ? 32 ARG B HG3  10 
ATOM 11114 H HD2  . ARG B 1 32 ? -22.325 4.932   -6.874  1.00 0.00 ? 32 ARG B HD2  10 
ATOM 11115 H HD3  . ARG B 1 32 ? -20.701 4.495   -6.304  1.00 0.00 ? 32 ARG B HD3  10 
ATOM 11116 H HE   . ARG B 1 32 ? -20.541 6.211   -8.615  1.00 0.00 ? 32 ARG B HE   10 
ATOM 11117 H HH11 . ARG B 1 32 ? -21.300 6.230   -5.159  1.00 0.00 ? 32 ARG B HH11 10 
ATOM 11118 H HH12 . ARG B 1 32 ? -20.845 7.919   -4.908  1.00 0.00 ? 32 ARG B HH12 10 
ATOM 11119 H HH21 . ARG B 1 32 ? -19.931 8.454   -8.306  1.00 0.00 ? 32 ARG B HH21 10 
ATOM 11120 H HH22 . ARG B 1 32 ? -20.063 9.189   -6.705  1.00 0.00 ? 32 ARG B HH22 10 
ATOM 11121 N N    . MET A 1 1  ? 7.488   -11.586 17.108  1.00 0.00 ? 1  MET A N    11 
ATOM 11122 C CA   . MET A 1 1  ? 8.461   -11.500 16.033  1.00 0.00 ? 1  MET A CA   11 
ATOM 11123 C C    . MET A 1 1  ? 8.054   -12.450 14.905  1.00 0.00 ? 1  MET A C    11 
ATOM 11124 O O    . MET A 1 1  ? 8.154   -12.053 13.735  1.00 0.00 ? 1  MET A O    11 
ATOM 11125 C CB   . MET A 1 1  ? 9.853   -11.879 16.543  1.00 0.00 ? 1  MET A CB   11 
ATOM 11126 C CG   . MET A 1 1  ? 10.928  -10.990 15.915  1.00 0.00 ? 1  MET A CG   11 
ATOM 11127 S SD   . MET A 1 1  ? 12.514  -11.875 15.864  1.00 0.00 ? 1  MET A SD   11 
ATOM 11128 C CE   . MET A 1 1  ? 12.850  -12.024 17.644  1.00 0.00 ? 1  MET A CE   11 
ATOM 11129 H H    . MET A 1 1  ? 7.835   -11.688 18.061  1.00 0.00 ? 1  MET A H    11 
ATOM 11130 H HA   . MET A 1 1  ? 8.476   -10.480 15.650  1.00 0.00 ? 1  MET A HA   11 
ATOM 11131 H HB2  . MET A 1 1  ? 9.879   -11.755 17.626  1.00 0.00 ? 1  MET A HB2  11 
ATOM 11132 H HB3  . MET A 1 1  ? 10.046  -12.924 16.300  1.00 0.00 ? 1  MET A HB3  11 
ATOM 11133 H HG2  . MET A 1 1  ? 10.634  -10.729 14.898  1.00 0.00 ? 1  MET A HG2  11 
ATOM 11134 H HG3  . MET A 1 1  ? 11.031  -10.076 16.501  1.00 0.00 ? 1  MET A HG3  11 
ATOM 11135 H HE1  . MET A 1 1  ? 12.044  -12.576 18.128  1.00 0.00 ? 1  MET A HE1  11 
ATOM 11136 H HE2  . MET A 1 1  ? 13.794  -12.548 17.784  1.00 0.00 ? 1  MET A HE2  11 
ATOM 11137 H HE3  . MET A 1 1  ? 12.921  -11.034 18.093  1.00 0.00 ? 1  MET A HE3  11 
ATOM 11138 N N    . ASP A 1 2  ? 7.611   -13.666 15.273  1.00 0.00 ? 2  ASP A N    11 
ATOM 11139 C CA   . ASP A 1 2  ? 7.194   -14.661 14.299  1.00 0.00 ? 2  ASP A CA   11 
ATOM 11140 C C    . ASP A 1 2  ? 6.124   -14.057 13.387  1.00 0.00 ? 2  ASP A C    11 
ATOM 11141 O O    . ASP A 1 2  ? 6.066   -14.441 12.210  1.00 0.00 ? 2  ASP A O    11 
ATOM 11142 C CB   . ASP A 1 2  ? 6.593   -15.887 14.988  1.00 0.00 ? 2  ASP A CB   11 
ATOM 11143 C CG   . ASP A 1 2  ? 7.590   -16.743 15.770  1.00 0.00 ? 2  ASP A CG   11 
ATOM 11144 O OD1  . ASP A 1 2  ? 8.183   -16.288 16.760  1.00 0.00 ? 2  ASP A OD1  11 
ATOM 11145 O OD2  . ASP A 1 2  ? 7.753   -17.941 15.320  1.00 0.00 ? 2  ASP A OD2  11 
ATOM 11146 H H    . ASP A 1 2  ? 7.560   -13.913 16.260  1.00 0.00 ? 2  ASP A H    11 
ATOM 11147 H HA   . ASP A 1 2  ? 8.055   -14.947 13.694  1.00 0.00 ? 2  ASP A HA   11 
ATOM 11148 H HB2  . ASP A 1 2  ? 5.825   -15.523 15.670  1.00 0.00 ? 2  ASP A HB2  11 
ATOM 11149 H HB3  . ASP A 1 2  ? 6.121   -16.486 14.208  1.00 0.00 ? 2  ASP A HB3  11 
ATOM 11150 N N    . ALA A 1 3  ? 5.309   -13.141 13.940  1.00 0.00 ? 3  ALA A N    11 
ATOM 11151 C CA   . ALA A 1 3  ? 4.252   -12.494 13.182  1.00 0.00 ? 3  ALA A CA   11 
ATOM 11152 C C    . ALA A 1 3  ? 4.779   -11.180 12.599  1.00 0.00 ? 3  ALA A C    11 
ATOM 11153 O O    . ALA A 1 3  ? 4.112   -10.617 11.718  1.00 0.00 ? 3  ALA A O    11 
ATOM 11154 C CB   . ALA A 1 3  ? 3.103   -12.116 14.119  1.00 0.00 ? 3  ALA A CB   11 
ATOM 11155 H H    . ALA A 1 3  ? 5.423   -12.881 14.919  1.00 0.00 ? 3  ALA A H    11 
ATOM 11156 H HA   . ALA A 1 3  ? 3.905   -13.129 12.367  1.00 0.00 ? 3  ALA A HA   11 
ATOM 11157 H HB1  . ALA A 1 3  ? 2.722   -13.020 14.596  1.00 0.00 ? 3  ALA A HB1  11 
ATOM 11158 H HB2  . ALA A 1 3  ? 3.460   -11.433 14.889  1.00 0.00 ? 3  ALA A HB2  11 
ATOM 11159 H HB3  . ALA A 1 3  ? 2.307   -11.630 13.555  1.00 0.00 ? 3  ALA A HB3  11 
ATOM 11160 N N    . ILE A 1 4  ? 5.944   -10.727 13.093  1.00 0.00 ? 4  ILE A N    11 
ATOM 11161 C CA   . ILE A 1 4  ? 6.552   -9.493  12.625  1.00 0.00 ? 4  ILE A CA   11 
ATOM 11162 C C    . ILE A 1 4  ? 7.127   -9.712  11.224  1.00 0.00 ? 4  ILE A C    11 
ATOM 11163 O O    . ILE A 1 4  ? 6.874   -8.876  10.344  1.00 0.00 ? 4  ILE A O    11 
ATOM 11164 C CB   . ILE A 1 4  ? 7.578   -8.982  13.638  1.00 0.00 ? 4  ILE A CB   11 
ATOM 11165 C CG1  . ILE A 1 4  ? 6.890   -8.464  14.902  1.00 0.00 ? 4  ILE A CG1  11 
ATOM 11166 C CG2  . ILE A 1 4  ? 8.492   -7.929  13.010  1.00 0.00 ? 4  ILE A CG2  11 
ATOM 11167 C CD1  . ILE A 1 4  ? 7.296   -7.018  15.194  1.00 0.00 ? 4  ILE A CD1  11 
ATOM 11168 H H    . ILE A 1 4  ? 6.430   -11.254 13.820  1.00 0.00 ? 4  ILE A H    11 
ATOM 11169 H HA   . ILE A 1 4  ? 5.750   -8.756  12.568  1.00 0.00 ? 4  ILE A HA   11 
ATOM 11170 H HB   . ILE A 1 4  ? 8.181   -9.853  13.894  1.00 0.00 ? 4  ILE A HB   11 
ATOM 11171 H HG12 . ILE A 1 4  ? 5.810   -8.506  14.760  1.00 0.00 ? 4  ILE A HG12 11 
ATOM 11172 H HG13 . ILE A 1 4  ? 7.162   -9.103  15.741  1.00 0.00 ? 4  ILE A HG13 11 
ATOM 11173 H HG21 . ILE A 1 4  ? 7.899   -7.087  12.653  1.00 0.00 ? 4  ILE A HG21 11 
ATOM 11174 H HG22 . ILE A 1 4  ? 9.209   -7.589  13.758  1.00 0.00 ? 4  ILE A HG22 11 
ATOM 11175 H HG23 . ILE A 1 4  ? 9.035   -8.362  12.169  1.00 0.00 ? 4  ILE A HG23 11 
ATOM 11176 H HD11 . ILE A 1 4  ? 7.024   -6.378  14.355  1.00 0.00 ? 4  ILE A HD11 11 
ATOM 11177 H HD12 . ILE A 1 4  ? 6.789   -6.682  16.098  1.00 0.00 ? 4  ILE A HD12 11 
ATOM 11178 H HD13 . ILE A 1 4  ? 8.374   -6.960  15.350  1.00 0.00 ? 4  ILE A HD13 11 
ATOM 11179 N N    . LYS A 1 5  ? 7.877   -10.814 11.047  1.00 0.00 ? 5  LYS A N    11 
ATOM 11180 C CA   . LYS A 1 5  ? 8.481   -11.137 9.766   1.00 0.00 ? 5  LYS A CA   11 
ATOM 11181 C C    . LYS A 1 5  ? 7.384   -11.264 8.707   1.00 0.00 ? 5  LYS A C    11 
ATOM 11182 O O    . LYS A 1 5  ? 7.649   -10.937 7.541   1.00 0.00 ? 5  LYS A O    11 
ATOM 11183 C CB   . LYS A 1 5  ? 9.364   -12.380 9.887   1.00 0.00 ? 5  LYS A CB   11 
ATOM 11184 C CG   . LYS A 1 5  ? 10.131  -12.381 11.211  1.00 0.00 ? 5  LYS A CG   11 
ATOM 11185 C CD   . LYS A 1 5  ? 9.734   -13.580 12.075  1.00 0.00 ? 5  LYS A CD   11 
ATOM 11186 C CE   . LYS A 1 5  ? 10.358  -13.481 13.468  1.00 0.00 ? 5  LYS A CE   11 
ATOM 11187 N NZ   . LYS A 1 5  ? 11.739  -13.991 13.453  1.00 0.00 ? 5  LYS A NZ   11 
ATOM 11188 H H    . LYS A 1 5  ? 8.037   -11.453 11.826  1.00 0.00 ? 5  LYS A H    11 
ATOM 11189 H HA   . LYS A 1 5  ? 9.128   -10.298 9.508   1.00 0.00 ? 5  LYS A HA   11 
ATOM 11190 H HB2  . LYS A 1 5  ? 8.734   -13.268 9.843   1.00 0.00 ? 5  LYS A HB2  11 
ATOM 11191 H HB3  . LYS A 1 5  ? 10.064  -12.400 9.052   1.00 0.00 ? 5  LYS A HB3  11 
ATOM 11192 H HG2  . LYS A 1 5  ? 11.200  -12.432 11.001  1.00 0.00 ? 5  LYS A HG2  11 
ATOM 11193 H HG3  . LYS A 1 5  ? 9.919   -11.453 11.742  1.00 0.00 ? 5  LYS A HG3  11 
ATOM 11194 H HD2  . LYS A 1 5  ? 8.650   -13.603 12.172  1.00 0.00 ? 5  LYS A HD2  11 
ATOM 11195 H HD3  . LYS A 1 5  ? 10.066  -14.494 11.583  1.00 0.00 ? 5  LYS A HD3  11 
ATOM 11196 H HE2  . LYS A 1 5  ? 10.369  -12.437 13.783  1.00 0.00 ? 5  LYS A HE2  11 
ATOM 11197 H HE3  . LYS A 1 5  ? 9.757   -14.058 14.171  1.00 0.00 ? 5  LYS A HE3  11 
ATOM 11198 H HZ1  . LYS A 1 5  ? 12.301  -13.452 12.795  1.00 0.00 ? 5  LYS A HZ1  11 
ATOM 11199 H HZ2  . LYS A 1 5  ? 12.131  -13.915 14.391  1.00 0.00 ? 5  LYS A HZ2  11 
ATOM 11200 H HZ3  . LYS A 1 5  ? 11.744  -14.971 13.169  1.00 0.00 ? 5  LYS A HZ3  11 
ATOM 11201 N N    . LYS A 1 6  ? 6.193   -11.727 9.126   1.00 0.00 ? 6  LYS A N    11 
ATOM 11202 C CA   . LYS A 1 6  ? 5.069   -11.894 8.221   1.00 0.00 ? 6  LYS A CA   11 
ATOM 11203 C C    . LYS A 1 6  ? 4.297   -10.576 8.125   1.00 0.00 ? 6  LYS A C    11 
ATOM 11204 O O    . LYS A 1 6  ? 3.739   -10.297 7.053   1.00 0.00 ? 6  LYS A O    11 
ATOM 11205 C CB   . LYS A 1 6  ? 4.206   -13.082 8.651   1.00 0.00 ? 6  LYS A CB   11 
ATOM 11206 C CG   . LYS A 1 6  ? 4.934   -13.942 9.686   1.00 0.00 ? 6  LYS A CG   11 
ATOM 11207 C CD   . LYS A 1 6  ? 4.342   -15.352 9.741   1.00 0.00 ? 6  LYS A CD   11 
ATOM 11208 C CE   . LYS A 1 6  ? 5.330   -16.383 9.191   1.00 0.00 ? 6  LYS A CE   11 
ATOM 11209 N NZ   . LYS A 1 6  ? 4.674   -17.691 9.029   1.00 0.00 ? 6  LYS A NZ   11 
ATOM 11210 H H    . LYS A 1 6  ? 6.058   -11.973 10.107  1.00 0.00 ? 6  LYS A H    11 
ATOM 11211 H HA   . LYS A 1 6  ? 5.492   -12.131 7.244   1.00 0.00 ? 6  LYS A HA   11 
ATOM 11212 H HB2  . LYS A 1 6  ? 3.281   -12.708 9.088   1.00 0.00 ? 6  LYS A HB2  11 
ATOM 11213 H HB3  . LYS A 1 6  ? 3.966   -13.681 7.772   1.00 0.00 ? 6  LYS A HB3  11 
ATOM 11214 H HG2  . LYS A 1 6  ? 5.987   -14.009 9.413   1.00 0.00 ? 6  LYS A HG2  11 
ATOM 11215 H HG3  . LYS A 1 6  ? 4.850   -13.466 10.663  1.00 0.00 ? 6  LYS A HG3  11 
ATOM 11216 H HD2  . LYS A 1 6  ? 4.112   -15.599 10.778  1.00 0.00 ? 6  LYS A HD2  11 
ATOM 11217 H HD3  . LYS A 1 6  ? 3.421   -15.372 9.159   1.00 0.00 ? 6  LYS A HD3  11 
ATOM 11218 H HE2  . LYS A 1 6  ? 5.695   -16.046 8.221   1.00 0.00 ? 6  LYS A HE2  11 
ATOM 11219 H HE3  . LYS A 1 6  ? 6.173   -16.473 9.876   1.00 0.00 ? 6  LYS A HE3  11 
ATOM 11220 H HZ1  . LYS A 1 6  ? 3.885   -17.607 8.388   1.00 0.00 ? 6  LYS A HZ1  11 
ATOM 11221 H HZ2  . LYS A 1 6  ? 5.351   -18.358 8.661   1.00 0.00 ? 6  LYS A HZ2  11 
ATOM 11222 H HZ3  . LYS A 1 6  ? 4.335   -18.024 9.931   1.00 0.00 ? 6  LYS A HZ3  11 
ATOM 11223 N N    . LYS A 1 7  ? 4.280   -9.806  9.227   1.00 0.00 ? 7  LYS A N    11 
ATOM 11224 C CA   . LYS A 1 7  ? 3.582   -8.533  9.266   1.00 0.00 ? 7  LYS A CA   11 
ATOM 11225 C C    . LYS A 1 7  ? 3.995   -7.693  8.055   1.00 0.00 ? 7  LYS A C    11 
ATOM 11226 O O    . LYS A 1 7  ? 3.111   -7.104  7.417   1.00 0.00 ? 7  LYS A O    11 
ATOM 11227 C CB   . LYS A 1 7  ? 3.817   -7.834  10.607  1.00 0.00 ? 7  LYS A CB   11 
ATOM 11228 C CG   . LYS A 1 7  ? 3.104   -6.481  10.652  1.00 0.00 ? 7  LYS A CG   11 
ATOM 11229 C CD   . LYS A 1 7  ? 1.679   -6.593  10.107  1.00 0.00 ? 7  LYS A CD   11 
ATOM 11230 C CE   . LYS A 1 7  ? 0.756   -5.567  10.769  1.00 0.00 ? 7  LYS A CE   11 
ATOM 11231 N NZ   . LYS A 1 7  ? -0.140  -6.227  11.733  1.00 0.00 ? 7  LYS A NZ   11 
ATOM 11232 H H    . LYS A 1 7  ? 4.767   -10.112 10.070  1.00 0.00 ? 7  LYS A H    11 
ATOM 11233 H HA   . LYS A 1 7  ? 2.519   -8.760  9.195   1.00 0.00 ? 7  LYS A HA   11 
ATOM 11234 H HB2  . LYS A 1 7  ? 3.431   -8.465  11.407  1.00 0.00 ? 7  LYS A HB2  11 
ATOM 11235 H HB3  . LYS A 1 7  ? 4.888   -7.694  10.750  1.00 0.00 ? 7  LYS A HB3  11 
ATOM 11236 H HG2  . LYS A 1 7  ? 3.063   -6.137  11.686  1.00 0.00 ? 7  LYS A HG2  11 
ATOM 11237 H HG3  . LYS A 1 7  ? 3.672   -5.762  10.062  1.00 0.00 ? 7  LYS A HG3  11 
ATOM 11238 H HD2  . LYS A 1 7  ? 1.696   -6.413  9.032   1.00 0.00 ? 7  LYS A HD2  11 
ATOM 11239 H HD3  . LYS A 1 7  ? 1.308   -7.601  10.291  1.00 0.00 ? 7  LYS A HD3  11 
ATOM 11240 H HE2  . LYS A 1 7  ? 1.361   -4.829  11.295  1.00 0.00 ? 7  LYS A HE2  11 
ATOM 11241 H HE3  . LYS A 1 7  ? 0.170   -5.065  10.000  1.00 0.00 ? 7  LYS A HE3  11 
ATOM 11242 H HZ1  . LYS A 1 7  ? 0.409   -6.699  12.452  1.00 0.00 ? 7  LYS A HZ1  11 
ATOM 11243 H HZ2  . LYS A 1 7  ? -0.743  -5.525  12.160  1.00 0.00 ? 7  LYS A HZ2  11 
ATOM 11244 H HZ3  . LYS A 1 7  ? -0.720  -6.917  11.253  1.00 0.00 ? 7  LYS A HZ3  11 
ATOM 11245 N N    . MET A 1 8  ? 5.309   -7.656  7.767   1.00 0.00 ? 8  MET A N    11 
ATOM 11246 C CA   . MET A 1 8  ? 5.829   -6.896  6.644   1.00 0.00 ? 8  MET A CA   11 
ATOM 11247 C C    . MET A 1 8  ? 5.494   -7.625  5.341   1.00 0.00 ? 8  MET A C    11 
ATOM 11248 O O    . MET A 1 8  ? 5.493   -6.975  4.285   1.00 0.00 ? 8  MET A O    11 
ATOM 11249 C CB   . MET A 1 8  ? 7.346   -6.738  6.765   1.00 0.00 ? 8  MET A CB   11 
ATOM 11250 C CG   . MET A 1 8  ? 8.038   -8.102  6.806   1.00 0.00 ? 8  MET A CG   11 
ATOM 11251 S SD   . MET A 1 8  ? 9.808   -7.914  6.447   1.00 0.00 ? 8  MET A SD   11 
ATOM 11252 C CE   . MET A 1 8  ? 10.375  -7.196  8.017   1.00 0.00 ? 8  MET A CE   11 
ATOM 11253 H H    . MET A 1 8  ? 5.972   -8.173  8.345   1.00 0.00 ? 8  MET A H    11 
ATOM 11254 H HA   . MET A 1 8  ? 5.358   -5.913  6.632   1.00 0.00 ? 8  MET A HA   11 
ATOM 11255 H HB2  . MET A 1 8  ? 7.714   -6.180  5.904   1.00 0.00 ? 8  MET A HB2  11 
ATOM 11256 H HB3  . MET A 1 8  ? 7.572   -6.179  7.673   1.00 0.00 ? 8  MET A HB3  11 
ATOM 11257 H HG2  . MET A 1 8  ? 7.921   -8.538  7.799   1.00 0.00 ? 8  MET A HG2  11 
ATOM 11258 H HG3  . MET A 1 8  ? 7.578   -8.764  6.072   1.00 0.00 ? 8  MET A HG3  11 
ATOM 11259 H HE1  . MET A 1 8  ? 10.154  -7.878  8.839   1.00 0.00 ? 8  MET A HE1  11 
ATOM 11260 H HE2  . MET A 1 8  ? 11.448  -7.018  7.961   1.00 0.00 ? 8  MET A HE2  11 
ATOM 11261 H HE3  . MET A 1 8  ? 9.867   -6.248  8.197   1.00 0.00 ? 8  MET A HE3  11 
ATOM 11262 N N    . GLN A 1 9  ? 5.221   -8.938  5.439   1.00 0.00 ? 9  GLN A N    11 
ATOM 11263 C CA   . GLN A 1 9  ? 4.888   -9.744  4.276   1.00 0.00 ? 9  GLN A CA   11 
ATOM 11264 C C    . GLN A 1 9  ? 3.438   -9.471  3.870   1.00 0.00 ? 9  GLN A C    11 
ATOM 11265 O O    . GLN A 1 9  ? 3.128   -9.585  2.676   1.00 0.00 ? 9  GLN A O    11 
ATOM 11266 C CB   . GLN A 1 9  ? 5.113   -11.234 4.541   1.00 0.00 ? 9  GLN A CB   11 
ATOM 11267 C CG   . GLN A 1 9  ? 6.596   -11.594 4.429   1.00 0.00 ? 9  GLN A CG   11 
ATOM 11268 C CD   . GLN A 1 9  ? 6.775   -13.040 3.963   1.00 0.00 ? 9  GLN A CD   11 
ATOM 11269 O OE1  . GLN A 1 9  ? 6.517   -13.389 2.824   1.00 0.00 ? 9  GLN A OE1  11 
ATOM 11270 N NE2  . GLN A 1 9  ? 7.230   -13.858 4.908   1.00 0.00 ? 9  GLN A NE2  11 
ATOM 11271 H H    . GLN A 1 9  ? 5.245   -9.398  6.349   1.00 0.00 ? 9  GLN A H    11 
ATOM 11272 H HA   . GLN A 1 9  ? 5.548   -9.425  3.469   1.00 0.00 ? 9  GLN A HA   11 
ATOM 11273 H HB2  . GLN A 1 9  ? 4.766   -11.469 5.548   1.00 0.00 ? 9  GLN A HB2  11 
ATOM 11274 H HB3  . GLN A 1 9  ? 4.534   -11.812 3.821   1.00 0.00 ? 9  GLN A HB3  11 
ATOM 11275 H HG2  . GLN A 1 9  ? 7.067   -10.927 3.707   1.00 0.00 ? 9  GLN A HG2  11 
ATOM 11276 H HG3  . GLN A 1 9  ? 7.068   -11.454 5.401   1.00 0.00 ? 9  GLN A HG3  11 
ATOM 11277 H HE21 . GLN A 1 9  ? 7.425   -13.501 5.842   1.00 0.00 ? 9  GLN A HE21 11 
ATOM 11278 H HE22 . GLN A 1 9  ? 7.383   -14.845 4.696   1.00 0.00 ? 9  GLN A HE22 11 
ATOM 11279 N N    . MET A 1 10 ? 2.592   -9.124  4.857   1.00 0.00 ? 10 MET A N    11 
ATOM 11280 C CA   . MET A 1 10 ? 1.190   -8.839  4.604   1.00 0.00 ? 10 MET A CA   11 
ATOM 11281 C C    . MET A 1 10 ? 1.051   -7.412  4.072   1.00 0.00 ? 10 MET A C    11 
ATOM 11282 O O    . MET A 1 10 ? 0.181   -7.183  3.219   1.00 0.00 ? 10 MET A O    11 
ATOM 11283 C CB   . MET A 1 10 ? 0.376   -8.986  5.891   1.00 0.00 ? 10 MET A CB   11 
ATOM 11284 C CG   . MET A 1 10 ? 1.199   -9.668  6.986   1.00 0.00 ? 10 MET A CG   11 
ATOM 11285 S SD   . MET A 1 10 ? 0.163   -9.969  8.448   1.00 0.00 ? 10 MET A SD   11 
ATOM 11286 C CE   . MET A 1 10 ? -1.481  -9.975  7.673   1.00 0.00 ? 10 MET A CE   11 
ATOM 11287 H H    . MET A 1 10 ? 2.929   -9.053  5.816   1.00 0.00 ? 10 MET A H    11 
ATOM 11288 H HA   . MET A 1 10 ? 0.817   -9.537  3.853   1.00 0.00 ? 10 MET A HA   11 
ATOM 11289 H HB2  . MET A 1 10 ? 0.078   -7.996  6.236   1.00 0.00 ? 10 MET A HB2  11 
ATOM 11290 H HB3  . MET A 1 10 ? -0.518  -9.572  5.680   1.00 0.00 ? 10 MET A HB3  11 
ATOM 11291 H HG2  . MET A 1 10 ? 1.576   -10.621 6.615   1.00 0.00 ? 10 MET A HG2  11 
ATOM 11292 H HG3  . MET A 1 10 ? 2.044   -9.033  7.254   1.00 0.00 ? 10 MET A HG3  11 
ATOM 11293 H HE1  . MET A 1 10 ? -1.532  -10.758 6.917   1.00 0.00 ? 10 MET A HE1  11 
ATOM 11294 H HE2  . MET A 1 10 ? -2.234  -10.149 8.440   1.00 0.00 ? 10 MET A HE2  11 
ATOM 11295 H HE3  . MET A 1 10 ? -1.672  -9.012  7.200   1.00 0.00 ? 10 MET A HE3  11 
ATOM 11296 N N    . LEU A 1 11 ? 1.897   -6.497  4.576   1.00 0.00 ? 11 LEU A N    11 
ATOM 11297 C CA   . LEU A 1 11 ? 1.868   -5.106  4.154   1.00 0.00 ? 11 LEU A CA   11 
ATOM 11298 C C    . LEU A 1 11 ? 2.522   -4.983  2.777   1.00 0.00 ? 11 LEU A C    11 
ATOM 11299 O O    . LEU A 1 11 ? 2.158   -4.062  2.032   1.00 0.00 ? 11 LEU A O    11 
ATOM 11300 C CB   . LEU A 1 11 ? 2.505   -4.210  5.219   1.00 0.00 ? 11 LEU A CB   11 
ATOM 11301 C CG   . LEU A 1 11 ? 1.858   -4.254  6.605   1.00 0.00 ? 11 LEU A CG   11 
ATOM 11302 C CD1  . LEU A 1 11 ? 2.800   -3.683  7.668   1.00 0.00 ? 11 LEU A CD1  11 
ATOM 11303 C CD2  . LEU A 1 11 ? 0.503   -3.545  6.602   1.00 0.00 ? 11 LEU A CD2  11 
ATOM 11304 H H    . LEU A 1 11 ? 2.585   -6.770  5.278   1.00 0.00 ? 11 LEU A H    11 
ATOM 11305 H HA   . LEU A 1 11 ? 0.817   -4.828  4.075   1.00 0.00 ? 11 LEU A HA   11 
ATOM 11306 H HB2  . LEU A 1 11 ? 3.546   -4.522  5.302   1.00 0.00 ? 11 LEU A HB2  11 
ATOM 11307 H HB3  . LEU A 1 11 ? 2.469   -3.195  4.825   1.00 0.00 ? 11 LEU A HB3  11 
ATOM 11308 H HG   . LEU A 1 11 ? 1.705   -5.312  6.814   1.00 0.00 ? 11 LEU A HG   11 
ATOM 11309 H HD11 . LEU A 1 11 ? 3.050   -2.649  7.427   1.00 0.00 ? 11 LEU A HD11 11 
ATOM 11310 H HD12 . LEU A 1 11 ? 2.309   -3.729  8.640   1.00 0.00 ? 11 LEU A HD12 11 
ATOM 11311 H HD13 . LEU A 1 11 ? 3.718   -4.270  7.705   1.00 0.00 ? 11 LEU A HD13 11 
ATOM 11312 H HD21 . LEU A 1 11 ? -0.165  -4.025  5.886   1.00 0.00 ? 11 LEU A HD21 11 
ATOM 11313 H HD22 . LEU A 1 11 ? 0.073   -3.596  7.603   1.00 0.00 ? 11 LEU A HD22 11 
ATOM 11314 H HD23 . LEU A 1 11 ? 0.631   -2.499  6.323   1.00 0.00 ? 11 LEU A HD23 11 
ATOM 11315 N N    . LYS A 1 12 ? 3.460   -5.898  2.471   1.00 0.00 ? 12 LYS A N    11 
ATOM 11316 C CA   . LYS A 1 12 ? 4.155   -5.890  1.195   1.00 0.00 ? 12 LYS A CA   11 
ATOM 11317 C C    . LYS A 1 12 ? 3.236   -6.464  0.115   1.00 0.00 ? 12 LYS A C    11 
ATOM 11318 O O    . LYS A 1 12 ? 3.290   -5.978  -1.025  1.00 0.00 ? 12 LYS A O    11 
ATOM 11319 C CB   . LYS A 1 12 ? 5.495   -6.618  1.311   1.00 0.00 ? 12 LYS A CB   11 
ATOM 11320 C CG   . LYS A 1 12 ? 6.624   -5.639  1.641   1.00 0.00 ? 12 LYS A CG   11 
ATOM 11321 C CD   . LYS A 1 12 ? 7.772   -5.767  0.637   1.00 0.00 ? 12 LYS A CD   11 
ATOM 11322 C CE   . LYS A 1 12 ? 9.122   -5.521  1.314   1.00 0.00 ? 12 LYS A CE   11 
ATOM 11323 N NZ   . LYS A 1 12 ? 10.220  -5.679  0.347   1.00 0.00 ? 12 LYS A NZ   11 
ATOM 11324 H H    . LYS A 1 12 ? 3.701   -6.625  3.143   1.00 0.00 ? 12 LYS A H    11 
ATOM 11325 H HA   . LYS A 1 12 ? 4.365   -4.846  0.964   1.00 0.00 ? 12 LYS A HA   11 
ATOM 11326 H HB2  . LYS A 1 12 ? 5.427   -7.361  2.105   1.00 0.00 ? 12 LYS A HB2  11 
ATOM 11327 H HB3  . LYS A 1 12 ? 5.706   -7.124  0.369   1.00 0.00 ? 12 LYS A HB3  11 
ATOM 11328 H HG2  . LYS A 1 12 ? 6.233   -4.623  1.606   1.00 0.00 ? 12 LYS A HG2  11 
ATOM 11329 H HG3  . LYS A 1 12 ? 6.986   -5.845  2.648   1.00 0.00 ? 12 LYS A HG3  11 
ATOM 11330 H HD2  . LYS A 1 12 ? 7.764   -6.772  0.217   1.00 0.00 ? 12 LYS A HD2  11 
ATOM 11331 H HD3  . LYS A 1 12 ? 7.621   -5.045  -0.165  1.00 0.00 ? 12 LYS A HD3  11 
ATOM 11332 H HE2  . LYS A 1 12 ? 9.143   -4.507  1.713   1.00 0.00 ? 12 LYS A HE2  11 
ATOM 11333 H HE3  . LYS A 1 12 ? 9.245   -6.228  2.136   1.00 0.00 ? 12 LYS A HE3  11 
ATOM 11334 H HZ1  . LYS A 1 12 ? 10.105  -5.018  -0.421  1.00 0.00 ? 12 LYS A HZ1  11 
ATOM 11335 H HZ2  . LYS A 1 12 ? 11.107  -5.510  0.820   1.00 0.00 ? 12 LYS A HZ2  11 
ATOM 11336 H HZ3  . LYS A 1 12 ? 10.218  -6.628  -0.029  1.00 0.00 ? 12 LYS A HZ3  11 
ATOM 11337 N N    . LEU A 1 13 ? 2.422   -7.469  0.486   1.00 0.00 ? 13 LEU A N    11 
ATOM 11338 C CA   . LEU A 1 13 ? 1.502   -8.099  -0.444  1.00 0.00 ? 13 LEU A CA   11 
ATOM 11339 C C    . LEU A 1 13 ? 0.376   -7.120  -0.783  1.00 0.00 ? 13 LEU A C    11 
ATOM 11340 O O    . LEU A 1 13 ? -0.005  -7.046  -1.960  1.00 0.00 ? 13 LEU A O    11 
ATOM 11341 C CB   . LEU A 1 13 ? 1.008   -9.435  0.114   1.00 0.00 ? 13 LEU A CB   11 
ATOM 11342 C CG   . LEU A 1 13 ? 0.477   -10.436 -0.915  1.00 0.00 ? 13 LEU A CG   11 
ATOM 11343 C CD1  . LEU A 1 13 ? -0.523  -11.401 -0.275  1.00 0.00 ? 13 LEU A CD1  11 
ATOM 11344 C CD2  . LEU A 1 13 ? -0.116  -9.716  -2.127  1.00 0.00 ? 13 LEU A CD2  11 
ATOM 11345 H H    . LEU A 1 13 ? 2.440   -7.810  1.448   1.00 0.00 ? 13 LEU A H    11 
ATOM 11346 H HA   . LEU A 1 13 ? 2.073   -8.311  -1.348  1.00 0.00 ? 13 LEU A HA   11 
ATOM 11347 H HB2  . LEU A 1 13 ? 1.852   -9.881  0.639   1.00 0.00 ? 13 LEU A HB2  11 
ATOM 11348 H HB3  . LEU A 1 13 ? 0.228   -9.195  0.835   1.00 0.00 ? 13 LEU A HB3  11 
ATOM 11349 H HG   . LEU A 1 13 ? 1.351   -11.006 -1.234  1.00 0.00 ? 13 LEU A HG   11 
ATOM 11350 H HD11 . LEU A 1 13 ? -1.362  -10.844 0.141   1.00 0.00 ? 13 LEU A HD11 11 
ATOM 11351 H HD12 . LEU A 1 13 ? -0.880  -12.098 -1.034  1.00 0.00 ? 13 LEU A HD12 11 
ATOM 11352 H HD13 . LEU A 1 13 ? -0.039  -11.964 0.523   1.00 0.00 ? 13 LEU A HD13 11 
ATOM 11353 H HD21 . LEU A 1 13 ? 0.644   -9.094  -2.599  1.00 0.00 ? 13 LEU A HD21 11 
ATOM 11354 H HD22 . LEU A 1 13 ? -0.483  -10.457 -2.836  1.00 0.00 ? 13 LEU A HD22 11 
ATOM 11355 H HD23 . LEU A 1 13 ? -0.947  -9.083  -1.812  1.00 0.00 ? 13 LEU A HD23 11 
ATOM 11356 N N    . ASP A 1 14 ? -0.125  -6.402  0.237   1.00 0.00 ? 14 ASP A N    11 
ATOM 11357 C CA   . ASP A 1 14 ? -1.196  -5.438  0.047   1.00 0.00 ? 14 ASP A CA   11 
ATOM 11358 C C    . ASP A 1 14 ? -0.670  -4.250  -0.761  1.00 0.00 ? 14 ASP A C    11 
ATOM 11359 O O    . ASP A 1 14 ? -1.461  -3.640  -1.495  1.00 0.00 ? 14 ASP A O    11 
ATOM 11360 C CB   . ASP A 1 14 ? -1.703  -4.908  1.390   1.00 0.00 ? 14 ASP A CB   11 
ATOM 11361 C CG   . ASP A 1 14 ? -3.224  -4.776  1.499   1.00 0.00 ? 14 ASP A CG   11 
ATOM 11362 O OD1  . ASP A 1 14 ? -3.971  -5.709  1.167   1.00 0.00 ? 14 ASP A OD1  11 
ATOM 11363 O OD2  . ASP A 1 14 ? -3.641  -3.643  1.954   1.00 0.00 ? 14 ASP A OD2  11 
ATOM 11364 H H    . ASP A 1 14 ? 0.248   -6.525  1.178   1.00 0.00 ? 14 ASP A H    11 
ATOM 11365 H HA   . ASP A 1 14 ? -2.006  -5.913  -0.505  1.00 0.00 ? 14 ASP A HA   11 
ATOM 11366 H HB2  . ASP A 1 14 ? -1.351  -5.598  2.157   1.00 0.00 ? 14 ASP A HB2  11 
ATOM 11367 H HB3  . ASP A 1 14 ? -1.234  -3.937  1.544   1.00 0.00 ? 14 ASP A HB3  11 
ATOM 11368 N N    . ASN A 1 15 ? 0.633   -3.950  -0.613  1.00 0.00 ? 15 ASN A N    11 
ATOM 11369 C CA   . ASN A 1 15 ? 1.254   -2.846  -1.324  1.00 0.00 ? 15 ASN A CA   11 
ATOM 11370 C C    . ASN A 1 15 ? 1.179   -3.108  -2.830  1.00 0.00 ? 15 ASN A C    11 
ATOM 11371 O O    . ASN A 1 15 ? 0.745   -2.208  -3.564  1.00 0.00 ? 15 ASN A O    11 
ATOM 11372 C CB   . ASN A 1 15 ? 2.729   -2.706  -0.942  1.00 0.00 ? 15 ASN A CB   11 
ATOM 11373 C CG   . ASN A 1 15 ? 3.174   -1.242  -1.001  1.00 0.00 ? 15 ASN A CG   11 
ATOM 11374 O OD1  . ASN A 1 15 ? 3.569   -0.728  -2.033  1.00 0.00 ? 15 ASN A OD1  11 
ATOM 11375 N ND2  . ASN A 1 15 ? 3.088   -0.605  0.163   1.00 0.00 ? 15 ASN A ND2  11 
ATOM 11376 H H    . ASN A 1 15 ? 1.216   -4.505  0.014   1.00 0.00 ? 15 ASN A H    11 
ATOM 11377 H HA   . ASN A 1 15 ? 0.714   -1.927  -1.096  1.00 0.00 ? 15 ASN A HA   11 
ATOM 11378 H HB2  . ASN A 1 15 ? 2.869   -3.079  0.071   1.00 0.00 ? 15 ASN A HB2  11 
ATOM 11379 H HB3  . ASN A 1 15 ? 3.330   -3.304  -1.627  1.00 0.00 ? 15 ASN A HB3  11 
ATOM 11380 H HD21 . ASN A 1 15 ? 2.749   -1.096  0.990   1.00 0.00 ? 15 ASN A HD21 11 
ATOM 11381 H HD22 . ASN A 1 15 ? 3.362   0.376   0.228   1.00 0.00 ? 15 ASN A HD22 11 
ATOM 11382 N N    . TYR A 1 16 ? 1.595   -4.315  -3.253  1.00 0.00 ? 16 TYR A N    11 
ATOM 11383 C CA   . TYR A 1 16 ? 1.552   -4.624  -4.671  1.00 0.00 ? 16 TYR A CA   11 
ATOM 11384 C C    . TYR A 1 16 ? 0.098   -4.614  -5.148  1.00 0.00 ? 16 TYR A C    11 
ATOM 11385 O O    . TYR A 1 16 ? -0.141  -4.159  -6.276  1.00 0.00 ? 16 TYR A O    11 
ATOM 11386 C CB   . TYR A 1 16 ? 2.234   -5.979  -4.939  1.00 0.00 ? 16 TYR A CB   11 
ATOM 11387 C CG   . TYR A 1 16 ? 3.504   -6.215  -4.135  1.00 0.00 ? 16 TYR A CG   11 
ATOM 11388 C CD1  . TYR A 1 16 ? 4.367   -5.134  -3.840  1.00 0.00 ? 16 TYR A CD1  11 
ATOM 11389 C CD2  . TYR A 1 16 ? 3.828   -7.513  -3.673  1.00 0.00 ? 16 TYR A CD2  11 
ATOM 11390 C CE1  . TYR A 1 16 ? 5.544   -5.348  -3.092  1.00 0.00 ? 16 TYR A CE1  11 
ATOM 11391 C CE2  . TYR A 1 16 ? 5.006   -7.726  -2.926  1.00 0.00 ? 16 TYR A CE2  11 
ATOM 11392 C CZ   . TYR A 1 16 ? 5.866   -6.644  -2.635  1.00 0.00 ? 16 TYR A CZ   11 
ATOM 11393 O OH   . TYR A 1 16 ? 7.007   -6.846  -1.913  1.00 0.00 ? 16 TYR A OH   11 
ATOM 11394 H H    . TYR A 1 16 ? 1.939   -5.005  -2.600  1.00 0.00 ? 16 TYR A H    11 
ATOM 11395 H HA   . TYR A 1 16 ? 2.090   -3.840  -5.207  1.00 0.00 ? 16 TYR A HA   11 
ATOM 11396 H HB2  . TYR A 1 16 ? 1.522   -6.783  -4.739  1.00 0.00 ? 16 TYR A HB2  11 
ATOM 11397 H HB3  . TYR A 1 16 ? 2.494   -6.040  -5.997  1.00 0.00 ? 16 TYR A HB3  11 
ATOM 11398 H HD1  . TYR A 1 16 ? 4.127   -4.139  -4.186  1.00 0.00 ? 16 TYR A HD1  11 
ATOM 11399 H HD2  . TYR A 1 16 ? 3.176   -8.346  -3.889  1.00 0.00 ? 16 TYR A HD2  11 
ATOM 11400 H HE1  . TYR A 1 16 ? 6.198   -4.516  -2.873  1.00 0.00 ? 16 TYR A HE1  11 
ATOM 11401 H HE2  . TYR A 1 16 ? 5.246   -8.720  -2.577  1.00 0.00 ? 16 TYR A HE2  11 
ATOM 11402 H HH   . TYR A 1 16 ? 7.193   -6.145  -1.284  1.00 0.00 ? 16 TYR A HH   11 
ATOM 11403 N N    . HIS A 1 17 ? -0.823  -5.113  -4.306  1.00 0.00 ? 17 HIS A N    11 
ATOM 11404 C CA   . HIS A 1 17 ? -2.233  -5.166  -4.650  1.00 0.00 ? 17 HIS A CA   11 
ATOM 11405 C C    . HIS A 1 17 ? -2.782  -3.742  -4.758  1.00 0.00 ? 17 HIS A C    11 
ATOM 11406 O O    . HIS A 1 17 ? -3.670  -3.513  -5.592  1.00 0.00 ? 17 HIS A O    11 
ATOM 11407 C CB   . HIS A 1 17 ? -3.010  -6.027  -3.652  1.00 0.00 ? 17 HIS A CB   11 
ATOM 11408 C CG   . HIS A 1 17 ? -4.264  -5.373  -3.123  1.00 0.00 ? 17 HIS A CG   11 
ATOM 11409 N ND1  . HIS A 1 17 ? -5.480  -5.439  -3.782  1.00 0.00 ? 17 HIS A ND1  11 
ATOM 11410 C CD2  . HIS A 1 17 ? -4.479  -4.641  -1.992  1.00 0.00 ? 17 HIS A CD2  11 
ATOM 11411 C CE1  . HIS A 1 17 ? -6.378  -4.773  -3.071  1.00 0.00 ? 17 HIS A CE1  11 
ATOM 11412 N NE2  . HIS A 1 17 ? -5.756  -4.278  -1.963  1.00 0.00 ? 17 HIS A NE2  11 
ATOM 11413 H H    . HIS A 1 17 ? -0.540  -5.469  -3.392  1.00 0.00 ? 17 HIS A H    11 
ATOM 11414 H HA   . HIS A 1 17 ? -2.295  -5.645  -5.629  1.00 0.00 ? 17 HIS A HA   11 
ATOM 11415 H HB2  . HIS A 1 17 ? -3.280  -6.953  -4.159  1.00 0.00 ? 17 HIS A HB2  11 
ATOM 11416 H HB3  . HIS A 1 17 ? -2.335  -6.257  -2.828  1.00 0.00 ? 17 HIS A HB3  11 
ATOM 11417 H HD1  . HIS A 1 17 ? -5.752  -5.889  -4.656  1.00 0.00 ? 17 HIS A HD1  11 
ATOM 11418 H HD2  . HIS A 1 17 ? -3.815  -4.345  -1.194  1.00 0.00 ? 17 HIS A HD2  11 
ATOM 11419 H HE1  . HIS A 1 17 ? -7.398  -4.705  -3.418  1.00 0.00 ? 17 HIS A HE1  11 
ATOM 11420 N N    . LEU A 1 18 ? -2.251  -2.828  -3.926  1.00 0.00 ? 18 LEU A N    11 
ATOM 11421 C CA   . LEU A 1 18 ? -2.685  -1.441  -3.927  1.00 0.00 ? 18 LEU A CA   11 
ATOM 11422 C C    . LEU A 1 18 ? -2.064  -0.719  -5.125  1.00 0.00 ? 18 LEU A C    11 
ATOM 11423 O O    . LEU A 1 18 ? -2.806  -0.048  -5.858  1.00 0.00 ? 18 LEU A O    11 
ATOM 11424 C CB   . LEU A 1 18 ? -2.374  -0.781  -2.582  1.00 0.00 ? 18 LEU A CB   11 
ATOM 11425 C CG   . LEU A 1 18 ? -3.192  -1.275  -1.388  1.00 0.00 ? 18 LEU A CG   11 
ATOM 11426 C CD1  . LEU A 1 18 ? -2.454  -1.017  -0.073  1.00 0.00 ? 18 LEU A CD1  11 
ATOM 11427 C CD2  . LEU A 1 18 ? -4.592  -0.658  -1.390  1.00 0.00 ? 18 LEU A CD2  11 
ATOM 11428 H H    . LEU A 1 18 ? -1.522  -3.101  -3.267  1.00 0.00 ? 18 LEU A H    11 
ATOM 11429 H HA   . LEU A 1 18 ? -3.768  -1.456  -4.044  1.00 0.00 ? 18 LEU A HA   11 
ATOM 11430 H HB2  . LEU A 1 18 ? -1.318  -0.963  -2.388  1.00 0.00 ? 18 LEU A HB2  11 
ATOM 11431 H HB3  . LEU A 1 18 ? -2.531  0.288   -2.724  1.00 0.00 ? 18 LEU A HB3  11 
ATOM 11432 H HG   . LEU A 1 18 ? -3.280  -2.352  -1.529  1.00 0.00 ? 18 LEU A HG   11 
ATOM 11433 H HD11 . LEU A 1 18 ? -2.266  0.051   0.044   1.00 0.00 ? 18 LEU A HD11 11 
ATOM 11434 H HD12 . LEU A 1 18 ? -3.064  -1.380  0.754   1.00 0.00 ? 18 LEU A HD12 11 
ATOM 11435 H HD13 . LEU A 1 18 ? -1.502  -1.547  -0.071  1.00 0.00 ? 18 LEU A HD13 11 
ATOM 11436 H HD21 . LEU A 1 18 ? -5.114  -0.923  -2.309  1.00 0.00 ? 18 LEU A HD21 11 
ATOM 11437 H HD22 . LEU A 1 18 ? -5.145  -1.031  -0.528  1.00 0.00 ? 18 LEU A HD22 11 
ATOM 11438 H HD23 . LEU A 1 18 ? -4.520  0.428   -1.322  1.00 0.00 ? 18 LEU A HD23 11 
ATOM 11439 N N    . GLU A 1 19 ? -0.739  -0.867  -5.296  1.00 0.00 ? 19 GLU A N    11 
ATOM 11440 C CA   . GLU A 1 19 ? -0.028  -0.234  -6.394  1.00 0.00 ? 19 GLU A CA   11 
ATOM 11441 C C    . GLU A 1 19 ? -0.504  -0.835  -7.718  1.00 0.00 ? 19 GLU A C    11 
ATOM 11442 O O    . GLU A 1 19 ? -0.421  -0.144  -8.744  1.00 0.00 ? 19 GLU A O    11 
ATOM 11443 C CB   . GLU A 1 19 ? 1.487   -0.377  -6.240  1.00 0.00 ? 19 GLU A CB   11 
ATOM 11444 C CG   . GLU A 1 19 ? 2.157   0.993   -6.116  1.00 0.00 ? 19 GLU A CG   11 
ATOM 11445 C CD   . GLU A 1 19 ? 3.354   0.933   -5.165  1.00 0.00 ? 19 GLU A CD   11 
ATOM 11446 O OE1  . GLU A 1 19 ? 4.433   0.447   -5.677  1.00 0.00 ? 19 GLU A OE1  11 
ATOM 11447 O OE2  . GLU A 1 19 ? 3.239   1.336   -3.997  1.00 0.00 ? 19 GLU A OE2  11 
ATOM 11448 H H    . GLU A 1 19 ? -0.200  -1.438  -4.645  1.00 0.00 ? 19 GLU A H    11 
ATOM 11449 H HA   . GLU A 1 19 ? -0.288  0.824   -6.372  1.00 0.00 ? 19 GLU A HA   11 
ATOM 11450 H HB2  . GLU A 1 19 ? 1.698   -0.959  -5.343  1.00 0.00 ? 19 GLU A HB2  11 
ATOM 11451 H HB3  . GLU A 1 19 ? 1.882   -0.906  -7.108  1.00 0.00 ? 19 GLU A HB3  11 
ATOM 11452 H HG2  . GLU A 1 19 ? 2.501   1.310   -7.101  1.00 0.00 ? 19 GLU A HG2  11 
ATOM 11453 H HG3  . GLU A 1 19 ? 1.425   1.712   -5.747  1.00 0.00 ? 19 GLU A HG3  11 
ATOM 11454 N N    . ASN A 1 20 ? -0.986  -2.091  -7.671  1.00 0.00 ? 20 ASN A N    11 
ATOM 11455 C CA   . ASN A 1 20 ? -1.470  -2.775  -8.858  1.00 0.00 ? 20 ASN A CA   11 
ATOM 11456 C C    . ASN A 1 20 ? -2.823  -2.189  -9.264  1.00 0.00 ? 20 ASN A C    11 
ATOM 11457 O O    . ASN A 1 20 ? -3.131  -2.192  -10.465 1.00 0.00 ? 20 ASN A O    11 
ATOM 11458 C CB   . ASN A 1 20 ? -1.662  -4.269  -8.593  1.00 0.00 ? 20 ASN A CB   11 
ATOM 11459 C CG   . ASN A 1 20 ? -0.385  -5.051  -8.908  1.00 0.00 ? 20 ASN A CG   11 
ATOM 11460 O OD1  . ASN A 1 20 ? 0.450   -4.636  -9.695  1.00 0.00 ? 20 ASN A OD1  11 
ATOM 11461 N ND2  . ASN A 1 20 ? -0.281  -6.205  -8.253  1.00 0.00 ? 20 ASN A ND2  11 
ATOM 11462 H H    . ASN A 1 20 ? -1.020  -2.591  -6.783  1.00 0.00 ? 20 ASN A H    11 
ATOM 11463 H HA   . ASN A 1 20 ? -0.758  -2.621  -9.670  1.00 0.00 ? 20 ASN A HA   11 
ATOM 11464 H HB2  . ASN A 1 20 ? -1.915  -4.412  -7.541  1.00 0.00 ? 20 ASN A HB2  11 
ATOM 11465 H HB3  . ASN A 1 20 ? -2.484  -4.634  -9.208  1.00 0.00 ? 20 ASN A HB3  11 
ATOM 11466 H HD21 . ASN A 1 20 ? -1.016  -6.493  -7.609  1.00 0.00 ? 20 ASN A HD21 11 
ATOM 11467 H HD22 . ASN A 1 20 ? 0.534   -6.800  -8.395  1.00 0.00 ? 20 ASN A HD22 11 
ATOM 11468 N N    . GLU A 1 21 ? -3.591  -1.705  -8.272  1.00 0.00 ? 21 GLU A N    11 
ATOM 11469 C CA   . GLU A 1 21 ? -4.898  -1.122  -8.524  1.00 0.00 ? 21 GLU A CA   11 
ATOM 11470 C C    . GLU A 1 21 ? -4.730  0.351   -8.900  1.00 0.00 ? 21 GLU A C    11 
ATOM 11471 O O    . GLU A 1 21 ? -5.355  0.786   -9.879  1.00 0.00 ? 21 GLU A O    11 
ATOM 11472 C CB   . GLU A 1 21 ? -5.826  -1.279  -7.318  1.00 0.00 ? 21 GLU A CB   11 
ATOM 11473 C CG   . GLU A 1 21 ? -7.256  -1.591  -7.764  1.00 0.00 ? 21 GLU A CG   11 
ATOM 11474 C CD   . GLU A 1 21 ? -8.253  -1.322  -6.634  1.00 0.00 ? 21 GLU A CD   11 
ATOM 11475 O OE1  . GLU A 1 21 ? -7.740  -1.285  -5.451  1.00 0.00 ? 21 GLU A OE1  11 
ATOM 11476 O OE2  . GLU A 1 21 ? -9.455  -1.162  -6.893  1.00 0.00 ? 21 GLU A OE2  11 
ATOM 11477 H H    . GLU A 1 21 ? -3.262  -1.742  -7.308  1.00 0.00 ? 21 GLU A H    11 
ATOM 11478 H HA   . GLU A 1 21 ? -5.327  -1.658  -9.372  1.00 0.00 ? 21 GLU A HA   11 
ATOM 11479 H HB2  . GLU A 1 21 ? -5.462  -2.096  -6.696  1.00 0.00 ? 21 GLU A HB2  11 
ATOM 11480 H HB3  . GLU A 1 21 ? -5.810  -0.357  -6.738  1.00 0.00 ? 21 GLU A HB3  11 
ATOM 11481 H HG2  . GLU A 1 21 ? -7.507  -0.960  -8.615  1.00 0.00 ? 21 GLU A HG2  11 
ATOM 11482 H HG3  . GLU A 1 21 ? -7.312  -2.636  -8.067  1.00 0.00 ? 21 GLU A HG3  11 
ATOM 11483 N N    . VAL A 1 22 ? -3.905  1.079   -8.127  1.00 0.00 ? 22 VAL A N    11 
ATOM 11484 C CA   . VAL A 1 22 ? -3.659  2.489   -8.376  1.00 0.00 ? 22 VAL A CA   11 
ATOM 11485 C C    . VAL A 1 22 ? -3.004  2.654   -9.748  1.00 0.00 ? 22 VAL A C    11 
ATOM 11486 O O    . VAL A 1 22 ? -3.223  3.693   -10.387 1.00 0.00 ? 22 VAL A O    11 
ATOM 11487 C CB   . VAL A 1 22 ? -2.826  3.086   -7.240  1.00 0.00 ? 22 VAL A CB   11 
ATOM 11488 C CG1  . VAL A 1 22 ? -2.362  4.502   -7.585  1.00 0.00 ? 22 VAL A CG1  11 
ATOM 11489 C CG2  . VAL A 1 22 ? -3.604  3.068   -5.922  1.00 0.00 ? 22 VAL A CG2  11 
ATOM 11490 H H    . VAL A 1 22 ? -3.429  0.644   -7.337  1.00 0.00 ? 22 VAL A H    11 
ATOM 11491 H HA   . VAL A 1 22 ? -4.627  2.993   -8.382  1.00 0.00 ? 22 VAL A HA   11 
ATOM 11492 H HB   . VAL A 1 22 ? -1.954  2.439   -7.144  1.00 0.00 ? 22 VAL A HB   11 
ATOM 11493 H HG11 . VAL A 1 22 ? -3.226  5.143   -7.762  1.00 0.00 ? 22 VAL A HG11 11 
ATOM 11494 H HG12 . VAL A 1 22 ? -1.773  4.894   -6.755  1.00 0.00 ? 22 VAL A HG12 11 
ATOM 11495 H HG13 . VAL A 1 22 ? -1.744  4.483   -8.481  1.00 0.00 ? 22 VAL A HG13 11 
ATOM 11496 H HG21 . VAL A 1 22 ? -3.874  2.044   -5.663  1.00 0.00 ? 22 VAL A HG21 11 
ATOM 11497 H HG22 . VAL A 1 22 ? -2.982  3.498   -5.138  1.00 0.00 ? 22 VAL A HG22 11 
ATOM 11498 H HG23 . VAL A 1 22 ? -4.513  3.661   -6.020  1.00 0.00 ? 22 VAL A HG23 11 
ATOM 11499 N N    . ALA A 1 23 ? -2.223  1.641   -10.167 1.00 0.00 ? 23 ALA A N    11 
ATOM 11500 C CA   . ALA A 1 23 ? -1.544  1.673   -11.451 1.00 0.00 ? 23 ALA A CA   11 
ATOM 11501 C C    . ALA A 1 23 ? -2.581  1.622   -12.575 1.00 0.00 ? 23 ALA A C    11 
ATOM 11502 O O    . ALA A 1 23 ? -2.244  2.000   -13.706 1.00 0.00 ? 23 ALA A O    11 
ATOM 11503 C CB   . ALA A 1 23 ? -0.679  0.421   -11.607 1.00 0.00 ? 23 ALA A CB   11 
ATOM 11504 H H    . ALA A 1 23 ? -2.095  0.818   -9.578  1.00 0.00 ? 23 ALA A H    11 
ATOM 11505 H HA   . ALA A 1 23 ? -0.948  2.580   -11.559 1.00 0.00 ? 23 ALA A HA   11 
ATOM 11506 H HB1  . ALA A 1 23 ? 0.051   0.390   -10.798 1.00 0.00 ? 23 ALA A HB1  11 
ATOM 11507 H HB2  . ALA A 1 23 ? -1.304  -0.470  -11.556 1.00 0.00 ? 23 ALA A HB2  11 
ATOM 11508 H HB3  . ALA A 1 23 ? -0.167  0.440   -12.569 1.00 0.00 ? 23 ALA A HB3  11 
ATOM 11509 N N    . ARG A 1 24 ? -3.802  1.162   -12.246 1.00 0.00 ? 24 ARG A N    11 
ATOM 11510 C CA   . ARG A 1 24 ? -4.875  1.063   -13.220 1.00 0.00 ? 24 ARG A CA   11 
ATOM 11511 C C    . ARG A 1 24 ? -5.704  2.350   -13.192 1.00 0.00 ? 24 ARG A C    11 
ATOM 11512 O O    . ARG A 1 24 ? -6.075  2.835   -14.270 1.00 0.00 ? 24 ARG A O    11 
ATOM 11513 C CB   . ARG A 1 24 ? -5.788  -0.130  -12.933 1.00 0.00 ? 24 ARG A CB   11 
ATOM 11514 C CG   . ARG A 1 24 ? -5.038  -1.224  -12.172 1.00 0.00 ? 24 ARG A CG   11 
ATOM 11515 C CD   . ARG A 1 24 ? -5.955  -2.410  -11.871 1.00 0.00 ? 24 ARG A CD   11 
ATOM 11516 N NE   . ARG A 1 24 ? -5.146  -3.618  -11.591 1.00 0.00 ? 24 ARG A NE   11 
ATOM 11517 C CZ   . ARG A 1 24 ? -4.576  -4.384  -12.544 1.00 0.00 ? 24 ARG A CZ   11 
ATOM 11518 N NH1  . ARG A 1 24 ? -4.740  -4.050  -13.831 1.00 0.00 ? 24 ARG A NH1  11 
ATOM 11519 N NH2  . ARG A 1 24 ? -3.857  -5.465  -12.209 1.00 0.00 ? 24 ARG A NH2  11 
ATOM 11520 H H    . ARG A 1 24 ? -3.996  0.871   -11.288 1.00 0.00 ? 24 ARG A H    11 
ATOM 11521 H HA   . ARG A 1 24 ? -4.422  0.955   -14.206 1.00 0.00 ? 24 ARG A HA   11 
ATOM 11522 H HB2  . ARG A 1 24 ? -6.632  0.207   -12.333 1.00 0.00 ? 24 ARG A HB2  11 
ATOM 11523 H HB3  . ARG A 1 24 ? -6.161  -0.525  -13.879 1.00 0.00 ? 24 ARG A HB3  11 
ATOM 11524 H HG2  . ARG A 1 24 ? -4.200  -1.568  -12.779 1.00 0.00 ? 24 ARG A HG2  11 
ATOM 11525 H HG3  . ARG A 1 24 ? -4.654  -0.806  -11.241 1.00 0.00 ? 24 ARG A HG3  11 
ATOM 11526 H HD2  . ARG A 1 24 ? -6.568  -2.183  -10.998 1.00 0.00 ? 24 ARG A HD2  11 
ATOM 11527 H HD3  . ARG A 1 24 ? -6.609  -2.590  -12.725 1.00 0.00 ? 24 ARG A HD3  11 
ATOM 11528 H HE   . ARG A 1 24 ? -5.032  -3.859  -10.606 1.00 0.00 ? 24 ARG A HE   11 
ATOM 11529 H HH11 . ARG A 1 24 ? -5.289  -3.226  -14.078 1.00 0.00 ? 24 ARG A HH11 11 
ATOM 11530 H HH12 . ARG A 1 24 ? -4.315  -4.618  -14.564 1.00 0.00 ? 24 ARG A HH12 11 
ATOM 11531 H HH21 . ARG A 1 24 ? -3.737  -5.712  -11.227 1.00 0.00 ? 24 ARG A HH21 11 
ATOM 11532 H HH22 . ARG A 1 24 ? -3.429  -6.038  -12.935 1.00 0.00 ? 24 ARG A HH22 11 
ATOM 11533 N N    . LEU A 1 25 ? -5.972  2.866   -11.979 1.00 0.00 ? 25 LEU A N    11 
ATOM 11534 C CA   . LEU A 1 25 ? -6.750  4.083   -11.815 1.00 0.00 ? 25 LEU A CA   11 
ATOM 11535 C C    . LEU A 1 25 ? -5.910  5.282   -12.259 1.00 0.00 ? 25 LEU A C    11 
ATOM 11536 O O    . LEU A 1 25 ? -6.462  6.177   -12.916 1.00 0.00 ? 25 LEU A O    11 
ATOM 11537 C CB   . LEU A 1 25 ? -7.273  4.195   -10.382 1.00 0.00 ? 25 LEU A CB   11 
ATOM 11538 C CG   . LEU A 1 25 ? -8.387  3.218   -9.996  1.00 0.00 ? 25 LEU A CG   11 
ATOM 11539 C CD1  . LEU A 1 25 ? -7.828  1.812   -9.768  1.00 0.00 ? 25 LEU A CD1  11 
ATOM 11540 C CD2  . LEU A 1 25 ? -9.168  3.728   -8.784  1.00 0.00 ? 25 LEU A CD2  11 
ATOM 11541 H H    . LEU A 1 25 ? -5.628  2.401   -11.139 1.00 0.00 ? 25 LEU A H    11 
ATOM 11542 H HA   . LEU A 1 25 ? -7.613  3.989   -12.475 1.00 0.00 ? 25 LEU A HA   11 
ATOM 11543 H HB2  . LEU A 1 25 ? -6.418  4.032   -9.728  1.00 0.00 ? 25 LEU A HB2  11 
ATOM 11544 H HB3  . LEU A 1 25 ? -7.622  5.221   -10.264 1.00 0.00 ? 25 LEU A HB3  11 
ATOM 11545 H HG   . LEU A 1 25 ? -9.052  3.189   -10.861 1.00 0.00 ? 25 LEU A HG   11 
ATOM 11546 H HD11 . LEU A 1 25 ? -7.084  1.832   -8.972  1.00 0.00 ? 25 LEU A HD11 11 
ATOM 11547 H HD12 . LEU A 1 25 ? -8.645  1.146   -9.496  1.00 0.00 ? 25 LEU A HD12 11 
ATOM 11548 H HD13 . LEU A 1 25 ? -7.360  1.446   -10.682 1.00 0.00 ? 25 LEU A HD13 11 
ATOM 11549 H HD21 . LEU A 1 25 ? -9.611  4.698   -9.009  1.00 0.00 ? 25 LEU A HD21 11 
ATOM 11550 H HD22 . LEU A 1 25 ? -9.950  3.010   -8.538  1.00 0.00 ? 25 LEU A HD22 11 
ATOM 11551 H HD23 . LEU A 1 25 ? -8.501  3.833   -7.929  1.00 0.00 ? 25 LEU A HD23 11 
ATOM 11552 N N    . LYS A 1 26 ? -4.614  5.277   -11.898 1.00 0.00 ? 26 LYS A N    11 
ATOM 11553 C CA   . LYS A 1 26 ? -3.711  6.357   -12.256 1.00 0.00 ? 26 LYS A CA   11 
ATOM 11554 C C    . LYS A 1 26 ? -3.667  6.496   -13.779 1.00 0.00 ? 26 LYS A C    11 
ATOM 11555 O O    . LYS A 1 26 ? -3.512  7.626   -14.263 1.00 0.00 ? 26 LYS A O    11 
ATOM 11556 C CB   . LYS A 1 26 ? -2.338  6.140   -11.619 1.00 0.00 ? 26 LYS A CB   11 
ATOM 11557 C CG   . LYS A 1 26 ? -2.333  6.592   -10.156 1.00 0.00 ? 26 LYS A CG   11 
ATOM 11558 C CD   . LYS A 1 26 ? -0.944  7.080   -9.738  1.00 0.00 ? 26 LYS A CD   11 
ATOM 11559 C CE   . LYS A 1 26 ? -0.591  8.394   -10.438 1.00 0.00 ? 26 LYS A CE   11 
ATOM 11560 N NZ   . LYS A 1 26 ? 0.676   8.932   -9.916  1.00 0.00 ? 26 LYS A NZ   11 
ATOM 11561 H H    . LYS A 1 26 ? -4.240  4.498   -11.356 1.00 0.00 ? 26 LYS A H    11 
ATOM 11562 H HA   . LYS A 1 26 ? -4.132  7.267   -11.828 1.00 0.00 ? 26 LYS A HA   11 
ATOM 11563 H HB2  . LYS A 1 26 ? -2.091  5.079   -11.662 1.00 0.00 ? 26 LYS A HB2  11 
ATOM 11564 H HB3  . LYS A 1 26 ? -1.593  6.701   -12.183 1.00 0.00 ? 26 LYS A HB3  11 
ATOM 11565 H HG2  . LYS A 1 26 ? -3.046  7.407   -10.036 1.00 0.00 ? 26 LYS A HG2  11 
ATOM 11566 H HG3  . LYS A 1 26 ? -2.639  5.756   -9.528  1.00 0.00 ? 26 LYS A HG3  11 
ATOM 11567 H HD2  . LYS A 1 26 ? -0.936  7.239   -8.659  1.00 0.00 ? 26 LYS A HD2  11 
ATOM 11568 H HD3  . LYS A 1 26 ? -0.210  6.316   -9.990  1.00 0.00 ? 26 LYS A HD3  11 
ATOM 11569 H HE2  . LYS A 1 26 ? -0.486  8.213   -11.507 1.00 0.00 ? 26 LYS A HE2  11 
ATOM 11570 H HE3  . LYS A 1 26 ? -1.394  9.113   -10.277 1.00 0.00 ? 26 LYS A HE3  11 
ATOM 11571 H HZ1  . LYS A 1 26 ? 1.428   8.259   -10.066 1.00 0.00 ? 26 LYS A HZ1  11 
ATOM 11572 H HZ2  . LYS A 1 26 ? 0.889   9.805   -10.396 1.00 0.00 ? 26 LYS A HZ2  11 
ATOM 11573 H HZ3  . LYS A 1 26 ? 0.590   9.115   -8.915  1.00 0.00 ? 26 LYS A HZ3  11 
ATOM 11574 N N    . LYS A 1 27 ? -3.802  5.363   -14.491 1.00 0.00 ? 27 LYS A N    11 
ATOM 11575 C CA   . LYS A 1 27 ? -3.778  5.359   -15.943 1.00 0.00 ? 27 LYS A CA   11 
ATOM 11576 C C    . LYS A 1 27 ? -5.024  6.073   -16.472 1.00 0.00 ? 27 LYS A C    11 
ATOM 11577 O O    . LYS A 1 27 ? -5.073  6.361   -17.677 1.00 0.00 ? 27 LYS A O    11 
ATOM 11578 C CB   . LYS A 1 27 ? -3.615  3.933   -16.473 1.00 0.00 ? 27 LYS A CB   11 
ATOM 11579 C CG   . LYS A 1 27 ? -2.683  3.901   -17.685 1.00 0.00 ? 27 LYS A CG   11 
ATOM 11580 C CD   . LYS A 1 27 ? -1.223  4.071   -17.259 1.00 0.00 ? 27 LYS A CD   11 
ATOM 11581 C CE   . LYS A 1 27 ? -0.894  3.173   -16.064 1.00 0.00 ? 27 LYS A CE   11 
ATOM 11582 N NZ   . LYS A 1 27 ? 0.528   2.794   -16.080 1.00 0.00 ? 27 LYS A NZ   11 
ATOM 11583 H H    . LYS A 1 27 ? -3.927  4.471   -14.012 1.00 0.00 ? 27 LYS A H    11 
ATOM 11584 H HA   . LYS A 1 27 ? -2.894  5.923   -16.240 1.00 0.00 ? 27 LYS A HA   11 
ATOM 11585 H HB2  . LYS A 1 27 ? -3.194  3.309   -15.685 1.00 0.00 ? 27 LYS A HB2  11 
ATOM 11586 H HB3  . LYS A 1 27 ? -4.595  3.544   -16.748 1.00 0.00 ? 27 LYS A HB3  11 
ATOM 11587 H HG2  . LYS A 1 27 ? -2.795  2.944   -18.194 1.00 0.00 ? 27 LYS A HG2  11 
ATOM 11588 H HG3  . LYS A 1 27 ? -2.965  4.701   -18.369 1.00 0.00 ? 27 LYS A HG3  11 
ATOM 11589 H HD2  . LYS A 1 27 ? -0.577  3.800   -18.094 1.00 0.00 ? 27 LYS A HD2  11 
ATOM 11590 H HD3  . LYS A 1 27 ? -1.049  5.114   -16.999 1.00 0.00 ? 27 LYS A HD3  11 
ATOM 11591 H HE2  . LYS A 1 27 ? -1.107  3.712   -15.142 1.00 0.00 ? 27 LYS A HE2  11 
ATOM 11592 H HE3  . LYS A 1 27 ? -1.516  2.279   -16.105 1.00 0.00 ? 27 LYS A HE3  11 
ATOM 11593 H HZ1  . LYS A 1 27 ? 1.112   3.631   -16.042 1.00 0.00 ? 27 LYS A HZ1  11 
ATOM 11594 H HZ2  . LYS A 1 27 ? 0.723   2.198   -15.276 1.00 0.00 ? 27 LYS A HZ2  11 
ATOM 11595 H HZ3  . LYS A 1 27 ? 0.742   2.280   -16.935 1.00 0.00 ? 27 LYS A HZ3  11 
ATOM 11596 N N    . LEU A 1 28 ? -5.991  6.339   -15.576 1.00 0.00 ? 28 LEU A N    11 
ATOM 11597 C CA   . LEU A 1 28 ? -7.223  7.012   -15.950 1.00 0.00 ? 28 LEU A CA   11 
ATOM 11598 C C    . LEU A 1 28 ? -7.237  8.418   -15.344 1.00 0.00 ? 28 LEU A C    11 
ATOM 11599 O O    . LEU A 1 28 ? -7.797  9.326   -15.974 1.00 0.00 ? 28 LEU A O    11 
ATOM 11600 C CB   . LEU A 1 28 ? -8.437  6.164   -15.562 1.00 0.00 ? 28 LEU A CB   11 
ATOM 11601 C CG   . LEU A 1 28 ? -9.487  5.957   -16.654 1.00 0.00 ? 28 LEU A CG   11 
ATOM 11602 C CD1  . LEU A 1 28 ? -9.065  4.845   -17.617 1.00 0.00 ? 28 LEU A CD1  11 
ATOM 11603 C CD2  . LEU A 1 28 ? -10.867 5.695   -16.046 1.00 0.00 ? 28 LEU A CD2  11 
ATOM 11604 H H    . LEU A 1 28 ? -5.872  6.067   -14.600 1.00 0.00 ? 28 LEU A H    11 
ATOM 11605 H HA   . LEU A 1 28 ? -7.213  7.094   -17.037 1.00 0.00 ? 28 LEU A HA   11 
ATOM 11606 H HB2  . LEU A 1 28 ? -8.047  5.193   -15.255 1.00 0.00 ? 28 LEU A HB2  11 
ATOM 11607 H HB3  . LEU A 1 28 ? -8.888  6.654   -14.699 1.00 0.00 ? 28 LEU A HB3  11 
ATOM 11608 H HG   . LEU A 1 28 ? -9.515  6.897   -17.205 1.00 0.00 ? 28 LEU A HG   11 
ATOM 11609 H HD11 . LEU A 1 28 ? -8.934  3.911   -17.071 1.00 0.00 ? 28 LEU A HD11 11 
ATOM 11610 H HD12 . LEU A 1 28 ? -9.834  4.725   -18.380 1.00 0.00 ? 28 LEU A HD12 11 
ATOM 11611 H HD13 . LEU A 1 28 ? -8.125  5.109   -18.100 1.00 0.00 ? 28 LEU A HD13 11 
ATOM 11612 H HD21 . LEU A 1 28 ? -11.165 6.539   -15.425 1.00 0.00 ? 28 LEU A HD21 11 
ATOM 11613 H HD22 . LEU A 1 28 ? -11.588 5.553   -16.851 1.00 0.00 ? 28 LEU A HD22 11 
ATOM 11614 H HD23 . LEU A 1 28 ? -10.837 4.795   -15.432 1.00 0.00 ? 28 LEU A HD23 11 
ATOM 11615 N N    . VAL A 1 29 ? -6.629  8.565   -14.153 1.00 0.00 ? 29 VAL A N    11 
ATOM 11616 C CA   . VAL A 1 29 ? -6.571  9.847   -13.472 1.00 0.00 ? 29 VAL A CA   11 
ATOM 11617 C C    . VAL A 1 29 ? -5.160  10.426  -13.603 1.00 0.00 ? 29 VAL A C    11 
ATOM 11618 O O    . VAL A 1 29 ? -5.003  11.451  -14.283 1.00 0.00 ? 29 VAL A O    11 
ATOM 11619 C CB   . VAL A 1 29 ? -7.020  9.689   -12.019 1.00 0.00 ? 29 VAL A CB   11 
ATOM 11620 C CG1  . VAL A 1 29 ? -7.334  11.047  -11.390 1.00 0.00 ? 29 VAL A CG1  11 
ATOM 11621 C CG2  . VAL A 1 29 ? -8.221  8.747   -11.917 1.00 0.00 ? 29 VAL A CG2  11 
ATOM 11622 H H    . VAL A 1 29 ? -6.189  7.763   -13.702 1.00 0.00 ? 29 VAL A H    11 
ATOM 11623 H HA   . VAL A 1 29 ? -7.274  10.514  -13.971 1.00 0.00 ? 29 VAL A HA   11 
ATOM 11624 H HB   . VAL A 1 29 ? -6.175  9.241   -11.496 1.00 0.00 ? 29 VAL A HB   11 
ATOM 11625 H HG11 . VAL A 1 29 ? -8.124  11.543  -11.952 1.00 0.00 ? 29 VAL A HG11 11 
ATOM 11626 H HG12 . VAL A 1 29 ? -7.649  10.897  -10.357 1.00 0.00 ? 29 VAL A HG12 11 
ATOM 11627 H HG13 . VAL A 1 29 ? -6.443  11.676  -11.400 1.00 0.00 ? 29 VAL A HG13 11 
ATOM 11628 H HG21 . VAL A 1 29 ? -7.960  7.766   -12.315 1.00 0.00 ? 29 VAL A HG21 11 
ATOM 11629 H HG22 . VAL A 1 29 ? -8.513  8.657   -10.870 1.00 0.00 ? 29 VAL A HG22 11 
ATOM 11630 H HG23 . VAL A 1 29 ? -9.059  9.149   -12.486 1.00 0.00 ? 29 VAL A HG23 11 
ATOM 11631 N N    . GLY A 1 30 ? -4.178  9.769   -12.959 1.00 0.00 ? 30 GLY A N    11 
ATOM 11632 C CA   . GLY A 1 30 ? -2.796  10.215  -13.003 1.00 0.00 ? 30 GLY A CA   11 
ATOM 11633 C C    . GLY A 1 30 ? -2.374  10.413  -14.461 1.00 0.00 ? 30 GLY A C    11 
ATOM 11634 O O    . GLY A 1 30 ? -1.308  11.001  -14.692 1.00 0.00 ? 30 GLY A O    11 
ATOM 11635 H H    . GLY A 1 30 ? -4.394  8.931   -12.420 1.00 0.00 ? 30 GLY A H    11 
ATOM 11636 H HA2  . GLY A 1 30 ? -2.697  11.162  -12.473 1.00 0.00 ? 30 GLY A HA2  11 
ATOM 11637 H HA3  . GLY A 1 30 ? -2.154  9.474   -12.528 1.00 0.00 ? 30 GLY A HA3  11 
ATOM 11638 N N    . GLU A 1 31 ? -3.205  9.926   -15.399 1.00 0.00 ? 31 GLU A N    11 
ATOM 11639 C CA   . GLU A 1 31 ? -2.921  10.048  -16.819 1.00 0.00 ? 31 GLU A CA   11 
ATOM 11640 C C    . GLU A 1 31 ? -2.692  11.521  -17.163 1.00 0.00 ? 31 GLU A C    11 
ATOM 11641 O O    . GLU A 1 31 ? -3.681  12.236  -17.384 1.00 0.00 ? 31 GLU A O    11 
ATOM 11642 C CB   . GLU A 1 31 ? -4.043  9.454   -17.671 1.00 0.00 ? 31 GLU A CB   11 
ATOM 11643 C CG   . GLU A 1 31 ? -3.477  8.567   -18.782 1.00 0.00 ? 31 GLU A CG   11 
ATOM 11644 C CD   . GLU A 1 31 ? -4.518  8.330   -19.878 1.00 0.00 ? 31 GLU A CD   11 
ATOM 11645 O OE1  . GLU A 1 31 ? -5.492  9.175   -19.898 1.00 0.00 ? 31 GLU A OE1  11 
ATOM 11646 O OE2  . GLU A 1 31 ? -4.387  7.379   -20.662 1.00 0.00 ? 31 GLU A OE2  11 
ATOM 11647 H H    . GLU A 1 31 ? -4.066  9.454   -15.123 1.00 0.00 ? 31 GLU A H    11 
ATOM 11648 H HA   . GLU A 1 31 ? -2.002  9.493   -17.007 1.00 0.00 ? 31 GLU A HA   11 
ATOM 11649 H HB2  . GLU A 1 31 ? -4.691  8.852   -17.033 1.00 0.00 ? 31 GLU A HB2  11 
ATOM 11650 H HB3  . GLU A 1 31 ? -4.626  10.265  -18.104 1.00 0.00 ? 31 GLU A HB3  11 
ATOM 11651 H HG2  . GLU A 1 31 ? -2.608  9.058   -19.219 1.00 0.00 ? 31 GLU A HG2  11 
ATOM 11652 H HG3  . GLU A 1 31 ? -3.168  7.615   -18.352 1.00 0.00 ? 31 GLU A HG3  11 
ATOM 11653 N N    . ARG A 1 32 ? -1.415  11.941  -17.202 1.00 0.00 ? 32 ARG A N    11 
ATOM 11654 C CA   . ARG A 1 32 ? -1.064  13.314  -17.517 1.00 0.00 ? 32 ARG A CA   11 
ATOM 11655 C C    . ARG A 1 32 ? -1.758  13.728  -18.816 1.00 0.00 ? 32 ARG A C    11 
ATOM 11656 O O    . ARG A 1 32 ? -2.805  14.370  -18.788 1.00 0.00 ? 32 ARG A O    11 
ATOM 11657 C CB   . ARG A 1 32 ? 0.448   13.489  -17.676 1.00 0.00 ? 32 ARG A CB   11 
ATOM 11658 C CG   . ARG A 1 32 ? 0.968   12.695  -18.877 1.00 0.00 ? 32 ARG A CG   11 
ATOM 11659 C CD   . ARG A 1 32 ? 2.216   11.892  -18.504 1.00 0.00 ? 32 ARG A CD   11 
ATOM 11660 N NE   . ARG A 1 32 ? 3.057   12.670  -17.567 1.00 0.00 ? 32 ARG A NE   11 
ATOM 11661 C CZ   . ARG A 1 32 ? 4.389   12.502  -17.426 1.00 0.00 ? 32 ARG A CZ   11 
ATOM 11662 N NH1  . ARG A 1 32 ? 5.009   11.577  -18.172 1.00 0.00 ? 32 ARG A NH1  11 
ATOM 11663 N NH2  . ARG A 1 32 ? 5.081   13.247  -16.554 1.00 0.00 ? 32 ARG A NH2  11 
ATOM 11664 H H    . ARG A 1 32 ? -0.657  11.286  -17.007 1.00 0.00 ? 32 ARG A H    11 
ATOM 11665 H HA   . ARG A 1 32 ? -1.425  13.946  -16.706 1.00 0.00 ? 32 ARG A HA   11 
ATOM 11666 H HB2  . ARG A 1 32 ? 0.669   14.545  -17.826 1.00 0.00 ? 32 ARG A HB2  11 
ATOM 11667 H HB3  . ARG A 1 32 ? 0.940   13.149  -16.765 1.00 0.00 ? 32 ARG A HB3  11 
ATOM 11668 H HG2  . ARG A 1 32 ? 0.191   12.007  -19.210 1.00 0.00 ? 32 ARG A HG2  11 
ATOM 11669 H HG3  . ARG A 1 32 ? 1.199   13.388  -19.685 1.00 0.00 ? 32 ARG A HG3  11 
ATOM 11670 H HD2  . ARG A 1 32 ? 1.918   10.960  -18.024 1.00 0.00 ? 32 ARG A HD2  11 
ATOM 11671 H HD3  . ARG A 1 32 ? 2.782   11.662  -19.407 1.00 0.00 ? 32 ARG A HD3  11 
ATOM 11672 H HE   . ARG A 1 32 ? 2.570   13.370  -17.007 1.00 0.00 ? 32 ARG A HE   11 
ATOM 11673 H HH11 . ARG A 1 32 ? 4.475   11.014  -18.834 1.00 0.00 ? 32 ARG A HH11 11 
ATOM 11674 H HH12 . ARG A 1 32 ? 6.015   11.436  -18.078 1.00 0.00 ? 32 ARG A HH12 11 
ATOM 11675 H HH21 . ARG A 1 32 ? 4.601   13.949  -15.990 1.00 0.00 ? 32 ARG A HH21 11 
ATOM 11676 H HH22 . ARG A 1 32 ? 6.087   13.113  -16.453 1.00 0.00 ? 32 ARG A HH22 11 
ATOM 11677 N N    . MET B 1 1  ? 16.153  -7.130  12.988  1.00 0.00 ? 1  MET B N    11 
ATOM 11678 C CA   . MET B 1 1  ? 14.959  -6.908  13.786  1.00 0.00 ? 1  MET B CA   11 
ATOM 11679 C C    . MET B 1 1  ? 14.770  -5.406  14.009  1.00 0.00 ? 1  MET B C    11 
ATOM 11680 O O    . MET B 1 1  ? 13.639  -4.925  13.850  1.00 0.00 ? 1  MET B O    11 
ATOM 11681 C CB   . MET B 1 1  ? 15.086  -7.612  15.139  1.00 0.00 ? 1  MET B CB   11 
ATOM 11682 C CG   . MET B 1 1  ? 13.762  -8.262  15.545  1.00 0.00 ? 1  MET B CG   11 
ATOM 11683 S SD   . MET B 1 1  ? 13.598  -8.261  17.354  1.00 0.00 ? 1  MET B SD   11 
ATOM 11684 C CE   . MET B 1 1  ? 14.876  -9.477  17.787  1.00 0.00 ? 1  MET B CE   11 
ATOM 11685 H H    . MET B 1 1  ? 16.843  -7.796  13.333  1.00 0.00 ? 1  MET B H    11 
ATOM 11686 H HA   . MET B 1 1  ? 14.096  -7.299  13.248  1.00 0.00 ? 1  MET B HA   11 
ATOM 11687 H HB2  . MET B 1 1  ? 15.851  -8.385  15.065  1.00 0.00 ? 1  MET B HB2  11 
ATOM 11688 H HB3  . MET B 1 1  ? 15.388  -6.884  15.890  1.00 0.00 ? 1  MET B HB3  11 
ATOM 11689 H HG2  . MET B 1 1  ? 12.934  -7.699  15.113  1.00 0.00 ? 1  MET B HG2  11 
ATOM 11690 H HG3  . MET B 1 1  ? 13.729  -9.285  15.169  1.00 0.00 ? 1  MET B HG3  11 
ATOM 11691 H HE1  . MET B 1 1  ? 15.847  -9.140  17.425  1.00 0.00 ? 1  MET B HE1  11 
ATOM 11692 H HE2  . MET B 1 1  ? 14.903  -9.593  18.871  1.00 0.00 ? 1  MET B HE2  11 
ATOM 11693 H HE3  . MET B 1 1  ? 14.642  -10.440 17.334  1.00 0.00 ? 1  MET B HE3  11 
ATOM 11694 N N    . ASP B 1 2  ? 15.863  -4.708  14.366  1.00 0.00 ? 2  ASP B N    11 
ATOM 11695 C CA   . ASP B 1 2  ? 15.817  -3.276  14.606  1.00 0.00 ? 2  ASP B CA   11 
ATOM 11696 C C    . ASP B 1 2  ? 15.190  -2.580  13.396  1.00 0.00 ? 2  ASP B C    11 
ATOM 11697 O O    . ASP B 1 2  ? 14.394  -1.651  13.597  1.00 0.00 ? 2  ASP B O    11 
ATOM 11698 C CB   . ASP B 1 2  ? 17.223  -2.706  14.803  1.00 0.00 ? 2  ASP B CB   11 
ATOM 11699 C CG   . ASP B 1 2  ? 17.793  -2.864  16.214  1.00 0.00 ? 2  ASP B CG   11 
ATOM 11700 O OD1  . ASP B 1 2  ? 17.147  -3.438  17.103  1.00 0.00 ? 2  ASP B OD1  11 
ATOM 11701 O OD2  . ASP B 1 2  ? 18.968  -2.360  16.388  1.00 0.00 ? 2  ASP B OD2  11 
ATOM 11702 H H    . ASP B 1 2  ? 16.759  -5.184  14.474  1.00 0.00 ? 2  ASP B H    11 
ATOM 11703 H HA   . ASP B 1 2  ? 15.202  -3.084  15.485  1.00 0.00 ? 2  ASP B HA   11 
ATOM 11704 H HB2  . ASP B 1 2  ? 17.876  -3.220  14.097  1.00 0.00 ? 2  ASP B HB2  11 
ATOM 11705 H HB3  . ASP B 1 2  ? 17.174  -1.649  14.538  1.00 0.00 ? 2  ASP B HB3  11 
ATOM 11706 N N    . ALA B 1 3  ? 15.555  -3.034  12.184  1.00 0.00 ? 3  ALA B N    11 
ATOM 11707 C CA   . ALA B 1 3  ? 15.032  -2.458  10.957  1.00 0.00 ? 3  ALA B CA   11 
ATOM 11708 C C    . ALA B 1 3  ? 13.668  -3.079  10.648  1.00 0.00 ? 3  ALA B C    11 
ATOM 11709 O O    . ALA B 1 3  ? 12.918  -2.493  9.855   1.00 0.00 ? 3  ALA B O    11 
ATOM 11710 C CB   . ALA B 1 3  ? 15.945  -2.826  9.785   1.00 0.00 ? 3  ALA B CB   11 
ATOM 11711 H H    . ALA B 1 3  ? 16.218  -3.805  12.107  1.00 0.00 ? 3  ALA B H    11 
ATOM 11712 H HA   . ALA B 1 3  ? 14.918  -1.378  11.045  1.00 0.00 ? 3  ALA B HA   11 
ATOM 11713 H HB1  . ALA B 1 3  ? 16.945  -2.441  9.982   1.00 0.00 ? 3  ALA B HB1  11 
ATOM 11714 H HB2  . ALA B 1 3  ? 15.995  -3.910  9.679   1.00 0.00 ? 3  ALA B HB2  11 
ATOM 11715 H HB3  . ALA B 1 3  ? 15.556  -2.396  8.861   1.00 0.00 ? 3  ALA B HB3  11 
ATOM 11716 N N    . ILE B 1 4  ? 13.378  -4.236  11.272  1.00 0.00 ? 4  ILE B N    11 
ATOM 11717 C CA   . ILE B 1 4  ? 12.117  -4.927  11.065  1.00 0.00 ? 4  ILE B CA   11 
ATOM 11718 C C    . ILE B 1 4  ? 10.998  -4.161  11.775  1.00 0.00 ? 4  ILE B C    11 
ATOM 11719 O O    . ILE B 1 4  ? 9.946   -3.946  11.156  1.00 0.00 ? 4  ILE B O    11 
ATOM 11720 C CB   . ILE B 1 4  ? 12.230  -6.390  11.497  1.00 0.00 ? 4  ILE B CB   11 
ATOM 11721 C CG1  . ILE B 1 4  ? 13.306  -7.118  10.689  1.00 0.00 ? 4  ILE B CG1  11 
ATOM 11722 C CG2  . ILE B 1 4  ? 10.874  -7.094  11.412  1.00 0.00 ? 4  ILE B CG2  11 
ATOM 11723 C CD1  . ILE B 1 4  ? 12.813  -8.493  10.232  1.00 0.00 ? 4  ILE B CD1  11 
ATOM 11724 H H    . ILE B 1 4  ? 14.054  -4.653  11.911  1.00 0.00 ? 4  ILE B H    11 
ATOM 11725 H HA   . ILE B 1 4  ? 11.929  -4.914  9.991   1.00 0.00 ? 4  ILE B HA   11 
ATOM 11726 H HB   . ILE B 1 4  ? 12.535  -6.355  12.543  1.00 0.00 ? 4  ILE B HB   11 
ATOM 11727 H HG12 . ILE B 1 4  ? 13.555  -6.521  9.812   1.00 0.00 ? 4  ILE B HG12 11 
ATOM 11728 H HG13 . ILE B 1 4  ? 14.197  -7.229  11.307  1.00 0.00 ? 4  ILE B HG13 11 
ATOM 11729 H HG21 . ILE B 1 4  ? 10.500  -7.056  10.389  1.00 0.00 ? 4  ILE B HG21 11 
ATOM 11730 H HG22 . ILE B 1 4  ? 10.992  -8.132  11.725  1.00 0.00 ? 4  ILE B HG22 11 
ATOM 11731 H HG23 . ILE B 1 4  ? 10.159  -6.603  12.071  1.00 0.00 ? 4  ILE B HG23 11 
ATOM 11732 H HD11 . ILE B 1 4  ? 11.922  -8.382  9.615   1.00 0.00 ? 4  ILE B HD11 11 
ATOM 11733 H HD12 . ILE B 1 4  ? 13.603  -8.982  9.661   1.00 0.00 ? 4  ILE B HD12 11 
ATOM 11734 H HD13 . ILE B 1 4  ? 12.569  -9.108  11.099  1.00 0.00 ? 4  ILE B HD13 11 
ATOM 11735 N N    . LYS B 1 5  ? 11.244  -3.772  13.039  1.00 0.00 ? 5  LYS B N    11 
ATOM 11736 C CA   . LYS B 1 5  ? 10.264  -3.039  13.822  1.00 0.00 ? 5  LYS B CA   11 
ATOM 11737 C C    . LYS B 1 5  ? 9.811   -1.805  13.039  1.00 0.00 ? 5  LYS B C    11 
ATOM 11738 O O    . LYS B 1 5  ? 8.635   -1.431  13.156  1.00 0.00 ? 5  LYS B O    11 
ATOM 11739 C CB   . LYS B 1 5  ? 10.821  -2.715  15.211  1.00 0.00 ? 5  LYS B CB   11 
ATOM 11740 C CG   . LYS B 1 5  ? 11.208  -3.992  15.957  1.00 0.00 ? 5  LYS B CG   11 
ATOM 11741 C CD   . LYS B 1 5  ? 12.720  -4.066  16.173  1.00 0.00 ? 5  LYS B CD   11 
ATOM 11742 C CE   . LYS B 1 5  ? 13.093  -3.644  17.595  1.00 0.00 ? 5  LYS B CE   11 
ATOM 11743 N NZ   . LYS B 1 5  ? 12.788  -4.723  18.550  1.00 0.00 ? 5  LYS B NZ   11 
ATOM 11744 H H    . LYS B 1 5  ? 12.139  -3.990  13.476  1.00 0.00 ? 5  LYS B H    11 
ATOM 11745 H HA   . LYS B 1 5  ? 9.413   -3.706  13.957  1.00 0.00 ? 5  LYS B HA   11 
ATOM 11746 H HB2  . LYS B 1 5  ? 11.705  -2.087  15.099  1.00 0.00 ? 5  LYS B HB2  11 
ATOM 11747 H HB3  . LYS B 1 5  ? 10.067  -2.167  15.775  1.00 0.00 ? 5  LYS B HB3  11 
ATOM 11748 H HG2  . LYS B 1 5  ? 10.711  -3.999  16.928  1.00 0.00 ? 5  LYS B HG2  11 
ATOM 11749 H HG3  . LYS B 1 5  ? 10.873  -4.855  15.381  1.00 0.00 ? 5  LYS B HG3  11 
ATOM 11750 H HD2  . LYS B 1 5  ? 13.053  -5.091  16.009  1.00 0.00 ? 5  LYS B HD2  11 
ATOM 11751 H HD3  . LYS B 1 5  ? 13.212  -3.414  15.451  1.00 0.00 ? 5  LYS B HD3  11 
ATOM 11752 H HE2  . LYS B 1 5  ? 14.160  -3.424  17.636  1.00 0.00 ? 5  LYS B HE2  11 
ATOM 11753 H HE3  . LYS B 1 5  ? 12.535  -2.745  17.860  1.00 0.00 ? 5  LYS B HE3  11 
ATOM 11754 H HZ1  . LYS B 1 5  ? 13.311  -5.563  18.302  1.00 0.00 ? 5  LYS B HZ1  11 
ATOM 11755 H HZ2  . LYS B 1 5  ? 13.046  -4.418  19.489  1.00 0.00 ? 5  LYS B HZ2  11 
ATOM 11756 H HZ3  . LYS B 1 5  ? 11.791  -4.934  18.530  1.00 0.00 ? 5  LYS B HZ3  11 
ATOM 11757 N N    . LYS B 1 6  ? 10.738  -1.206  12.269  1.00 0.00 ? 6  LYS B N    11 
ATOM 11758 C CA   . LYS B 1 6  ? 10.435  -0.027  11.476  1.00 0.00 ? 6  LYS B CA   11 
ATOM 11759 C C    . LYS B 1 6  ? 9.967   -0.459  10.085  1.00 0.00 ? 6  LYS B C    11 
ATOM 11760 O O    . LYS B 1 6  ? 9.219   0.299   9.452   1.00 0.00 ? 6  LYS B O    11 
ATOM 11761 C CB   . LYS B 1 6  ? 11.632  0.925   11.454  1.00 0.00 ? 6  LYS B CB   11 
ATOM 11762 C CG   . LYS B 1 6  ? 12.251  1.060   12.847  1.00 0.00 ? 6  LYS B CG   11 
ATOM 11763 C CD   . LYS B 1 6  ? 13.514  1.924   12.804  1.00 0.00 ? 6  LYS B CD   11 
ATOM 11764 C CE   . LYS B 1 6  ? 13.590  2.843   14.026  1.00 0.00 ? 6  LYS B CE   11 
ATOM 11765 N NZ   . LYS B 1 6  ? 14.361  4.057   13.711  1.00 0.00 ? 6  LYS B NZ   11 
ATOM 11766 H H    . LYS B 1 6  ? 11.686  -1.579  12.230  1.00 0.00 ? 6  LYS B H    11 
ATOM 11767 H HA   . LYS B 1 6  ? 9.617   0.485   11.983  1.00 0.00 ? 6  LYS B HA   11 
ATOM 11768 H HB2  . LYS B 1 6  ? 12.383  0.534   10.768  1.00 0.00 ? 6  LYS B HB2  11 
ATOM 11769 H HB3  . LYS B 1 6  ? 11.302  1.902   11.099  1.00 0.00 ? 6  LYS B HB3  11 
ATOM 11770 H HG2  . LYS B 1 6  ? 11.525  1.525   13.514  1.00 0.00 ? 6  LYS B HG2  11 
ATOM 11771 H HG3  . LYS B 1 6  ? 12.494  0.067   13.224  1.00 0.00 ? 6  LYS B HG3  11 
ATOM 11772 H HD2  . LYS B 1 6  ? 14.388  1.274   12.795  1.00 0.00 ? 6  LYS B HD2  11 
ATOM 11773 H HD3  . LYS B 1 6  ? 13.505  2.520   11.891  1.00 0.00 ? 6  LYS B HD3  11 
ATOM 11774 H HE2  . LYS B 1 6  ? 12.581  3.131   14.322  1.00 0.00 ? 6  LYS B HE2  11 
ATOM 11775 H HE3  . LYS B 1 6  ? 14.062  2.307   14.849  1.00 0.00 ? 6  LYS B HE3  11 
ATOM 11776 H HZ1  . LYS B 1 6  ? 13.919  4.559   12.940  1.00 0.00 ? 6  LYS B HZ1  11 
ATOM 11777 H HZ2  . LYS B 1 6  ? 14.397  4.651   14.538  1.00 0.00 ? 6  LYS B HZ2  11 
ATOM 11778 H HZ3  . LYS B 1 6  ? 15.312  3.805   13.440  1.00 0.00 ? 6  LYS B HZ3  11 
ATOM 11779 N N    . LYS B 1 7  ? 10.411  -1.650  9.644   1.00 0.00 ? 7  LYS B N    11 
ATOM 11780 C CA   . LYS B 1 7  ? 10.041  -2.175  8.340   1.00 0.00 ? 7  LYS B CA   11 
ATOM 11781 C C    . LYS B 1 7  ? 8.516   -2.244  8.237   1.00 0.00 ? 7  LYS B C    11 
ATOM 11782 O O    . LYS B 1 7  ? 7.969   -1.757  7.238   1.00 0.00 ? 7  LYS B O    11 
ATOM 11783 C CB   . LYS B 1 7  ? 10.736  -3.513  8.084   1.00 0.00 ? 7  LYS B CB   11 
ATOM 11784 C CG   . LYS B 1 7  ? 10.367  -4.069  6.708   1.00 0.00 ? 7  LYS B CG   11 
ATOM 11785 C CD   . LYS B 1 7  ? 10.535  -3.002  5.623   1.00 0.00 ? 7  LYS B CD   11 
ATOM 11786 C CE   . LYS B 1 7  ? 11.067  -3.617  4.327   1.00 0.00 ? 7  LYS B CE   11 
ATOM 11787 N NZ   . LYS B 1 7  ? 10.142  -4.648  3.828   1.00 0.00 ? 7  LYS B NZ   11 
ATOM 11788 H H    . LYS B 1 7  ? 11.027  -2.214  10.229  1.00 0.00 ? 7  LYS B H    11 
ATOM 11789 H HA   . LYS B 1 7  ? 10.414  -1.463  7.603   1.00 0.00 ? 7  LYS B HA   11 
ATOM 11790 H HB2  . LYS B 1 7  ? 11.816  -3.365  8.129   1.00 0.00 ? 7  LYS B HB2  11 
ATOM 11791 H HB3  . LYS B 1 7  ? 10.442  -4.219  8.861   1.00 0.00 ? 7  LYS B HB3  11 
ATOM 11792 H HG2  . LYS B 1 7  ? 11.019  -4.912  6.480   1.00 0.00 ? 7  LYS B HG2  11 
ATOM 11793 H HG3  . LYS B 1 7  ? 9.334   -4.415  6.732   1.00 0.00 ? 7  LYS B HG3  11 
ATOM 11794 H HD2  . LYS B 1 7  ? 9.567   -2.542  5.426   1.00 0.00 ? 7  LYS B HD2  11 
ATOM 11795 H HD3  . LYS B 1 7  ? 11.225  -2.238  5.982   1.00 0.00 ? 7  LYS B HD3  11 
ATOM 11796 H HE2  . LYS B 1 7  ? 11.166  -2.836  3.574   1.00 0.00 ? 7  LYS B HE2  11 
ATOM 11797 H HE3  . LYS B 1 7  ? 12.047  -4.055  4.514   1.00 0.00 ? 7  LYS B HE3  11 
ATOM 11798 H HZ1  . LYS B 1 7  ? 9.225   -4.237  3.653   1.00 0.00 ? 7  LYS B HZ1  11 
ATOM 11799 H HZ2  . LYS B 1 7  ? 10.518  -5.042  2.966   1.00 0.00 ? 7  LYS B HZ2  11 
ATOM 11800 H HZ3  . LYS B 1 7  ? 10.046  -5.393  4.519   1.00 0.00 ? 7  LYS B HZ3  11 
ATOM 11801 N N    . MET B 1 8  ? 7.871   -2.840  9.257   1.00 0.00 ? 8  MET B N    11 
ATOM 11802 C CA   . MET B 1 8  ? 6.424   -2.971  9.280   1.00 0.00 ? 8  MET B CA   11 
ATOM 11803 C C    . MET B 1 8  ? 5.792   -1.582  9.396   1.00 0.00 ? 8  MET B C    11 
ATOM 11804 O O    . MET B 1 8  ? 4.635   -1.424  8.978   1.00 0.00 ? 8  MET B O    11 
ATOM 11805 C CB   . MET B 1 8  ? 5.986   -3.832  10.467  1.00 0.00 ? 8  MET B CB   11 
ATOM 11806 C CG   . MET B 1 8  ? 6.570   -3.299  11.776  1.00 0.00 ? 8  MET B CG   11 
ATOM 11807 S SD   . MET B 1 8  ? 5.951   -4.275  13.177  1.00 0.00 ? 8  MET B SD   11 
ATOM 11808 C CE   . MET B 1 8  ? 5.699   -2.952  14.398  1.00 0.00 ? 8  MET B CE   11 
ATOM 11809 H H    . MET B 1 8  ? 8.399   -3.216  10.045  1.00 0.00 ? 8  MET B H    11 
ATOM 11810 H HA   . MET B 1 8  ? 6.095   -3.434  8.349   1.00 0.00 ? 8  MET B HA   11 
ATOM 11811 H HB2  . MET B 1 8  ? 4.898   -3.818  10.532  1.00 0.00 ? 8  MET B HB2  11 
ATOM 11812 H HB3  . MET B 1 8  ? 6.319   -4.857  10.302  1.00 0.00 ? 8  MET B HB3  11 
ATOM 11813 H HG2  . MET B 1 8  ? 7.658   -3.372  11.745  1.00 0.00 ? 8  MET B HG2  11 
ATOM 11814 H HG3  . MET B 1 8  ? 6.290   -2.252  11.899  1.00 0.00 ? 8  MET B HG3  11 
ATOM 11815 H HE1  . MET B 1 8  ? 4.989   -2.221  14.012  1.00 0.00 ? 8  MET B HE1  11 
ATOM 11816 H HE2  . MET B 1 8  ? 5.318   -3.389  15.321  1.00 0.00 ? 8  MET B HE2  11 
ATOM 11817 H HE3  . MET B 1 8  ? 6.645   -2.452  14.605  1.00 0.00 ? 8  MET B HE3  11 
ATOM 11818 N N    . GLN B 1 9  ? 6.551   -0.621  9.952   1.00 0.00 ? 9  GLN B N    11 
ATOM 11819 C CA   . GLN B 1 9  ? 6.067   0.740   10.120  1.00 0.00 ? 9  GLN B CA   11 
ATOM 11820 C C    . GLN B 1 9  ? 6.146   1.473   8.779   1.00 0.00 ? 9  GLN B C    11 
ATOM 11821 O O    . GLN B 1 9  ? 5.389   2.436   8.589   1.00 0.00 ? 9  GLN B O    11 
ATOM 11822 C CB   . GLN B 1 9  ? 6.854   1.486   11.199  1.00 0.00 ? 9  GLN B CB   11 
ATOM 11823 C CG   . GLN B 1 9  ? 6.482   0.981   12.595  1.00 0.00 ? 9  GLN B CG   11 
ATOM 11824 C CD   . GLN B 1 9  ? 6.823   2.023   13.663  1.00 0.00 ? 9  GLN B CD   11 
ATOM 11825 O OE1  . GLN B 1 9  ? 6.066   2.940   13.935  1.00 0.00 ? 9  GLN B OE1  11 
ATOM 11826 N NE2  . GLN B 1 9  ? 8.000   1.831   14.250  1.00 0.00 ? 9  GLN B NE2  11 
ATOM 11827 H H    . GLN B 1 9  ? 7.495   -0.836  10.271  1.00 0.00 ? 9  GLN B H    11 
ATOM 11828 H HA   . GLN B 1 9  ? 5.024   0.671   10.426  1.00 0.00 ? 9  GLN B HA   11 
ATOM 11829 H HB2  . GLN B 1 9  ? 7.919   1.326   11.035  1.00 0.00 ? 9  GLN B HB2  11 
ATOM 11830 H HB3  . GLN B 1 9  ? 6.639   2.552   11.120  1.00 0.00 ? 9  GLN B HB3  11 
ATOM 11831 H HG2  . GLN B 1 9  ? 5.413   0.778   12.626  1.00 0.00 ? 9  GLN B HG2  11 
ATOM 11832 H HG3  . GLN B 1 9  ? 7.025   0.056   12.792  1.00 0.00 ? 9  GLN B HG3  11 
ATOM 11833 H HE21 . GLN B 1 9  ? 8.585   1.042   13.975  1.00 0.00 ? 9  GLN B HE21 11 
ATOM 11834 H HE22 . GLN B 1 9  ? 8.318   2.473   14.977  1.00 0.00 ? 9  GLN B HE22 11 
ATOM 11835 N N    . MET B 1 10 ? 7.044   1.011   7.891   1.00 0.00 ? 10 MET B N    11 
ATOM 11836 C CA   . MET B 1 10 ? 7.217   1.618   6.583   1.00 0.00 ? 10 MET B CA   11 
ATOM 11837 C C    . MET B 1 10 ? 6.132   1.100   5.636   1.00 0.00 ? 10 MET B C    11 
ATOM 11838 O O    . MET B 1 10 ? 5.601   1.900   4.852   1.00 0.00 ? 10 MET B O    11 
ATOM 11839 C CB   . MET B 1 10 ? 8.595   1.276   6.013   1.00 0.00 ? 10 MET B CB   11 
ATOM 11840 C CG   . MET B 1 10 ? 9.688   1.478   7.066   1.00 0.00 ? 10 MET B CG   11 
ATOM 11841 S SD   . MET B 1 10 ? 10.993  2.557   6.406   1.00 0.00 ? 10 MET B SD   11 
ATOM 11842 C CE   . MET B 1 10 ? 11.690  1.466   5.131   1.00 0.00 ? 10 MET B CE   11 
ATOM 11843 H H    . MET B 1 10 ? 7.629   0.209   8.127   1.00 0.00 ? 10 MET B H    11 
ATOM 11844 H HA   . MET B 1 10 ? 7.117   2.699   6.679   1.00 0.00 ? 10 MET B HA   11 
ATOM 11845 H HB2  . MET B 1 10 ? 8.598   0.233   5.696   1.00 0.00 ? 10 MET B HB2  11 
ATOM 11846 H HB3  . MET B 1 10 ? 8.789   1.910   5.150   1.00 0.00 ? 10 MET B HB3  11 
ATOM 11847 H HG2  . MET B 1 10 ? 9.257   1.944   7.952   1.00 0.00 ? 10 MET B HG2  11 
ATOM 11848 H HG3  . MET B 1 10 ? 10.109  0.512   7.342   1.00 0.00 ? 10 MET B HG3  11 
ATOM 11849 H HE1  . MET B 1 10 ? 10.919  1.201   4.407   1.00 0.00 ? 10 MET B HE1  11 
ATOM 11850 H HE2  . MET B 1 10 ? 12.508  1.982   4.630   1.00 0.00 ? 10 MET B HE2  11 
ATOM 11851 H HE3  . MET B 1 10 ? 12.074  0.554   5.590   1.00 0.00 ? 10 MET B HE3  11 
ATOM 11852 N N    . LEU B 1 11 ? 5.827   -0.207  5.727   1.00 0.00 ? 11 LEU B N    11 
ATOM 11853 C CA   . LEU B 1 11 ? 4.815   -0.822  4.887   1.00 0.00 ? 11 LEU B CA   11 
ATOM 11854 C C    . LEU B 1 11 ? 3.426   -0.458  5.416   1.00 0.00 ? 11 LEU B C    11 
ATOM 11855 O O    . LEU B 1 11 ? 2.472   -0.464  4.624   1.00 0.00 ? 11 LEU B O    11 
ATOM 11856 C CB   . LEU B 1 11 ? 5.054   -2.330  4.775   1.00 0.00 ? 11 LEU B CB   11 
ATOM 11857 C CG   . LEU B 1 11 ? 6.393   -2.753  4.167   1.00 0.00 ? 11 LEU B CG   11 
ATOM 11858 C CD1  . LEU B 1 11 ? 6.636   -4.250  4.366   1.00 0.00 ? 11 LEU B CD1  11 
ATOM 11859 C CD2  . LEU B 1 11 ? 6.481   -2.348  2.695   1.00 0.00 ? 11 LEU B CD2  11 
ATOM 11860 H H    . LEU B 1 11 ? 6.313   -0.798  6.402   1.00 0.00 ? 11 LEU B H    11 
ATOM 11861 H HA   . LEU B 1 11 ? 4.938   -0.395  3.891   1.00 0.00 ? 11 LEU B HA   11 
ATOM 11862 H HB2  . LEU B 1 11 ? 4.982   -2.728  5.787   1.00 0.00 ? 11 LEU B HB2  11 
ATOM 11863 H HB3  . LEU B 1 11 ? 4.234   -2.726  4.177   1.00 0.00 ? 11 LEU B HB3  11 
ATOM 11864 H HG   . LEU B 1 11 ? 7.147   -2.204  4.732   1.00 0.00 ? 11 LEU B HG   11 
ATOM 11865 H HD11 . LEU B 1 11 ? 5.837   -4.822  3.893   1.00 0.00 ? 11 LEU B HD11 11 
ATOM 11866 H HD12 . LEU B 1 11 ? 7.596   -4.516  3.922   1.00 0.00 ? 11 LEU