data_1TW8
# 
_entry.id   1TW8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TW8         
NDB   PD0565       
RCSB  RCSB022961   
WWPDB D_1000022961 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1KC6 
_pdbx_database_related.details        'HincII bound to cognate DNA GTCGAC' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TW8 
_pdbx_database_status.recvd_initial_deposition_date   2004-06-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Etzkorn, C.'  1 
'Horton, N.C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Ca2+ binding in the active site of HincII: implications for the catalytic mechanism' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            43 
_citation.page_first                13256 
_citation.page_last                 13270 
_citation.year                      2004 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15491133 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Etzkorn, C.'  1 
primary 'Horton, N.C.' 2 
# 
_cell.entry_id           1TW8 
_cell.length_a           66.945 
_cell.length_b           177.18 
_cell.length_c           254.89 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              32 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1TW8 
_symmetry.space_group_name_H-M             'I 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                24 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*CP*CP*GP*GP*TP*CP*GP*AP*CP*CP*GP*G)-3'" 3993.586  4   ?        ? ? ? 
2 polymer     man 'Hinc II endonuclease'                            29820.066 4   3.1.21.4 ? ? ? 
3 non-polymer syn 'CALCIUM ION'                                     40.078    6   ?        ? ? ? 
4 non-polymer syn 'SODIUM ION'                                      22.990    4   ?        ? ? ? 
5 water       nat water                                             18.015    765 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)(DG)(DT)(DC)(DG)(DA)(DC)(DC)(DG)(DG)' GCCGGTCGACCGG E,F,G,H ? 
2 'polypeptide(L)'        no no 
;SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPAIIGHEARYKLFN
SPTLLFLLSRGKAATENWSIENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNKEF
DLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQR
AISMIDKFVKPFKKYIL
;
;SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPAIIGHEARYKLFN
SPTLLFLLSRGKAATENWSIENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNKEF
DLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQR
AISMIDKFVKPFKKYIL
;
A,B,C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DC  n 
1 4   DG  n 
1 5   DG  n 
1 6   DT  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DC  n 
1 12  DG  n 
1 13  DG  n 
2 1   SER n 
2 2   PHE n 
2 3   ILE n 
2 4   LYS n 
2 5   PRO n 
2 6   ILE n 
2 7   TYR n 
2 8   GLN n 
2 9   ASP n 
2 10  ILE n 
2 11  ASN n 
2 12  SER n 
2 13  ILE n 
2 14  LEU n 
2 15  ILE n 
2 16  GLY n 
2 17  GLN n 
2 18  LYS n 
2 19  VAL n 
2 20  LYS n 
2 21  ARG n 
2 22  PRO n 
2 23  LYS n 
2 24  SER n 
2 25  GLY n 
2 26  THR n 
2 27  LEU n 
2 28  SER n 
2 29  GLY n 
2 30  HIS n 
2 31  ALA n 
2 32  ALA n 
2 33  GLY n 
2 34  GLU n 
2 35  PRO n 
2 36  PHE n 
2 37  GLU n 
2 38  LYS n 
2 39  LEU n 
2 40  VAL n 
2 41  TYR n 
2 42  LYS n 
2 43  PHE n 
2 44  LEU n 
2 45  LYS n 
2 46  GLU n 
2 47  ASN n 
2 48  LEU n 
2 49  SER n 
2 50  ASP n 
2 51  LEU n 
2 52  THR n 
2 53  PHE n 
2 54  LYS n 
2 55  GLN n 
2 56  TYR n 
2 57  GLU n 
2 58  TYR n 
2 59  LEU n 
2 60  ASN n 
2 61  ASP n 
2 62  LEU n 
2 63  PHE n 
2 64  MET n 
2 65  LYS n 
2 66  ASN n 
2 67  PRO n 
2 68  ALA n 
2 69  ILE n 
2 70  ILE n 
2 71  GLY n 
2 72  HIS n 
2 73  GLU n 
2 74  ALA n 
2 75  ARG n 
2 76  TYR n 
2 77  LYS n 
2 78  LEU n 
2 79  PHE n 
2 80  ASN n 
2 81  SER n 
2 82  PRO n 
2 83  THR n 
2 84  LEU n 
2 85  LEU n 
2 86  PHE n 
2 87  LEU n 
2 88  LEU n 
2 89  SER n 
2 90  ARG n 
2 91  GLY n 
2 92  LYS n 
2 93  ALA n 
2 94  ALA n 
2 95  THR n 
2 96  GLU n 
2 97  ASN n 
2 98  TRP n 
2 99  SER n 
2 100 ILE n 
2 101 GLU n 
2 102 ASN n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 GLU n 
2 107 LYS n 
2 108 GLN n 
2 109 ASN n 
2 110 ASP n 
2 111 THR n 
2 112 ALA n 
2 113 ASP n 
2 114 ILE n 
2 115 LEU n 
2 116 LEU n 
2 117 VAL n 
2 118 LYS n 
2 119 ASP n 
2 120 GLN n 
2 121 PHE n 
2 122 TYR n 
2 123 GLU n 
2 124 LEU n 
2 125 LEU n 
2 126 ASP n 
2 127 VAL n 
2 128 LYS n 
2 129 THR n 
2 130 ARG n 
2 131 ASN n 
2 132 ILE n 
2 133 SER n 
2 134 LYS n 
2 135 SER n 
2 136 ALA n 
2 137 GLN n 
2 138 ALA n 
2 139 PRO n 
2 140 ASN n 
2 141 ILE n 
2 142 ILE n 
2 143 SER n 
2 144 ALA n 
2 145 TYR n 
2 146 LYS n 
2 147 LEU n 
2 148 ALA n 
2 149 GLN n 
2 150 THR n 
2 151 CYS n 
2 152 ALA n 
2 153 LYS n 
2 154 MET n 
2 155 ILE n 
2 156 ASP n 
2 157 ASN n 
2 158 LYS n 
2 159 GLU n 
2 160 PHE n 
2 161 ASP n 
2 162 LEU n 
2 163 PHE n 
2 164 ASP n 
2 165 ILE n 
2 166 ASN n 
2 167 TYR n 
2 168 LEU n 
2 169 GLU n 
2 170 VAL n 
2 171 ASP n 
2 172 TRP n 
2 173 GLU n 
2 174 LEU n 
2 175 ASN n 
2 176 GLY n 
2 177 GLU n 
2 178 ASP n 
2 179 LEU n 
2 180 VAL n 
2 181 CYS n 
2 182 VAL n 
2 183 SER n 
2 184 THR n 
2 185 SER n 
2 186 PHE n 
2 187 ALA n 
2 188 GLU n 
2 189 LEU n 
2 190 PHE n 
2 191 LYS n 
2 192 SER n 
2 193 GLU n 
2 194 PRO n 
2 195 SER n 
2 196 GLU n 
2 197 LEU n 
2 198 TYR n 
2 199 ILE n 
2 200 ASN n 
2 201 TRP n 
2 202 ALA n 
2 203 ALA n 
2 204 ALA n 
2 205 MET n 
2 206 GLN n 
2 207 ILE n 
2 208 GLN n 
2 209 PHE n 
2 210 HIS n 
2 211 VAL n 
2 212 ARG n 
2 213 ASP n 
2 214 LEU n 
2 215 ASP n 
2 216 GLN n 
2 217 GLY n 
2 218 PHE n 
2 219 ASN n 
2 220 GLY n 
2 221 THR n 
2 222 ARG n 
2 223 GLU n 
2 224 GLU n 
2 225 TRP n 
2 226 ALA n 
2 227 LYS n 
2 228 SER n 
2 229 TYR n 
2 230 LEU n 
2 231 LYS n 
2 232 HIS n 
2 233 PHE n 
2 234 VAL n 
2 235 THR n 
2 236 GLN n 
2 237 ALA n 
2 238 GLU n 
2 239 GLN n 
2 240 ARG n 
2 241 ALA n 
2 242 ILE n 
2 243 SER n 
2 244 MET n 
2 245 ILE n 
2 246 ASP n 
2 247 LYS n 
2 248 PHE n 
2 249 VAL n 
2 250 LYS n 
2 251 PRO n 
2 252 PHE n 
2 253 LYS n 
2 254 LYS n 
2 255 TYR n 
2 256 ILE n 
2 257 LEU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Hinc II' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Haemophilus influenzae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     727 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'commercial phosphoramidite chemistry' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP E1B6R0_HAEIF E1B6R0 2 
;SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPAIIGHEARYKLFN
SPTLLFLLSRGKAATENWSIENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNKEF
DLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQR
AISMIDKFVKPFKKYIL
;
2 ? 
2 PDB 1TW8         1TW8   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TW8 A 1 ? 257 ? E1B6R0 2 ? 258 ? 2 258 
2 1 1TW8 B 1 ? 257 ? E1B6R0 2 ? 258 ? 2 258 
3 1 1TW8 C 1 ? 257 ? E1B6R0 2 ? 258 ? 2 258 
4 1 1TW8 D 1 ? 257 ? E1B6R0 2 ? 258 ? 2 258 
5 2 1TW8 E 1 ? 13  ? 1TW8   1 ? 13  ? 1 13  
6 2 1TW8 F 1 ? 13  ? 1TW8   1 ? 13  ? 1 13  
7 2 1TW8 G 1 ? 13  ? 1TW8   1 ? 13  ? 1 13  
8 2 1TW8 H 1 ? 13  ? 1TW8   1 ? 13  ? 1 13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1TW8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.98 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'PEG 4000, 0.1M citrate, 0.15M NaCl, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     1TW8 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            2.8 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   36795 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.066 
_reflns.pdbx_Rsym_value              0.066 
_reflns.pdbx_netI_over_sigmaI        5.3 
_reflns.B_iso_Wilson_estimate        55.1 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1TW8 
_refine.ls_d_res_high                            2.8 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_ls_sigma_I                          2 
_refine.ls_number_reflns_all                     37972 
_refine.ls_number_reflns_obs                     36795 
_refine.ls_number_reflns_R_free                  1840 
_refine.ls_percent_reflns_obs                    96.9 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.18 
_refine.ls_R_factor_R_free                       0.286 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1KC6' 
_refine.pdbx_ls_cross_valid_method               Rfree 
_refine.pdbx_R_Free_selection_details            'random 5%' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       CNS 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8241 
_refine_hist.pdbx_number_atoms_nucleic_acid   1060 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             765 
_refine_hist.number_atoms_total               10076 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.14  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1TW8 
_struct.title                     'HincII bound to Ca2+ and cognate DNA GTCGAC' 
_struct.pdbx_descriptor           
;5'-D(*GP*CP*CP*GP*GP*TP*CP*GP*AP*CP*CP*GP*G)-3'/Type II restriction enzyme HindII
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TW8 
_struct_keywords.pdbx_keywords   hydrolase/DNA 
_struct_keywords.text            'restriction endonuclease, hydrolase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 3 ? 
N N N 4 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
W N N 5 ? 
X N N 5 ? 
Y N N 5 ? 
Z N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;The biological assembly is one half of the asymmetric unit including two protein subunits and two strands of DNA (ie.  chains A-B, E-F)
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE E 3   ? PRO E 5   ? ILE A 4   PRO A 6   5 ? 3  
HELX_P HELX_P2  2  ILE E 6   ? ILE E 15  ? ILE A 7   ILE A 16  1 ? 10 
HELX_P HELX_P3  3  SER E 28  ? ALA E 32  ? SER A 29  ALA A 33  5 ? 5  
HELX_P HELX_P4  4  GLY E 33  ? LEU E 48  ? GLY A 34  LEU A 49  1 ? 16 
HELX_P HELX_P5  5  GLN E 55  ? LYS E 65  ? GLN A 56  LYS A 66  1 ? 11 
HELX_P HELX_P6  6  ILE E 70  ? LYS E 77  ? ILE A 71  LYS A 78  1 ? 8  
HELX_P HELX_P7  7  LEU E 78  ? ASN E 80  ? LEU A 79  ASN A 81  5 ? 3  
HELX_P HELX_P8  8  SER E 81  ? SER E 89  ? SER A 82  SER A 90  1 ? 9  
HELX_P HELX_P9  9  GLY E 91  ? TRP E 98  ? GLY A 92  TRP A 99  1 ? 8  
HELX_P HELX_P10 10 ALA E 144 ? LYS E 158 ? ALA A 145 LYS A 159 1 ? 15 
HELX_P HELX_P11 11 PHE E 190 ? SER E 192 ? PHE A 191 SER A 193 5 ? 3  
HELX_P HELX_P12 12 GLU E 193 ? LEU E 197 ? GLU A 194 LEU A 198 5 ? 5  
HELX_P HELX_P13 13 HIS E 210 ? LEU E 214 ? HIS A 211 LEU A 215 5 ? 5  
HELX_P HELX_P14 14 THR E 221 ? VAL E 249 ? THR A 222 VAL A 250 1 ? 29 
HELX_P HELX_P15 15 LYS E 250 ? ILE E 256 ? LYS A 251 ILE A 257 5 ? 7  
HELX_P HELX_P16 16 ILE F 3   ? PRO F 5   ? ILE B 4   PRO B 6   5 ? 3  
HELX_P HELX_P17 17 ILE F 6   ? ILE F 15  ? ILE B 7   ILE B 16  1 ? 10 
HELX_P HELX_P18 18 SER F 28  ? ALA F 32  ? SER B 29  ALA B 33  5 ? 5  
HELX_P HELX_P19 19 GLY F 33  ? PRO F 35  ? GLY B 34  PRO B 36  5 ? 3  
HELX_P HELX_P20 20 PHE F 36  ? LEU F 48  ? PHE B 37  LEU B 49  1 ? 13 
HELX_P HELX_P21 21 LYS F 54  ? LYS F 65  ? LYS B 55  LYS B 66  1 ? 12 
HELX_P HELX_P22 22 GLY F 71  ? LEU F 78  ? GLY B 72  LEU B 79  1 ? 8  
HELX_P HELX_P23 23 SER F 81  ? SER F 89  ? SER B 82  SER B 90  1 ? 9  
HELX_P HELX_P24 24 GLY F 91  ? ASN F 97  ? GLY B 92  ASN B 98  1 ? 7  
HELX_P HELX_P25 25 ALA F 144 ? ASN F 157 ? ALA B 145 ASN B 158 1 ? 14 
HELX_P HELX_P26 26 PHE F 190 ? SER F 192 ? PHE B 191 SER B 193 5 ? 3  
HELX_P HELX_P27 27 HIS F 210 ? LEU F 214 ? HIS B 211 LEU B 215 5 ? 5  
HELX_P HELX_P28 28 THR F 221 ? VAL F 249 ? THR B 222 VAL B 250 1 ? 29 
HELX_P HELX_P29 29 LYS F 250 ? LYS F 253 ? LYS B 251 LYS B 254 5 ? 4  
HELX_P HELX_P30 30 ILE G 3   ? PRO G 5   ? ILE C 4   PRO C 6   5 ? 3  
HELX_P HELX_P31 31 ILE G 6   ? ILE G 15  ? ILE C 7   ILE C 16  1 ? 10 
HELX_P HELX_P32 32 GLY G 33  ? LEU G 48  ? GLY C 34  LEU C 49  1 ? 16 
HELX_P HELX_P33 33 GLN G 55  ? LYS G 65  ? GLN C 56  LYS C 66  1 ? 11 
HELX_P HELX_P34 34 GLU G 73  ? PHE G 79  ? GLU C 74  PHE C 80  5 ? 7  
HELX_P HELX_P35 35 SER G 81  ? SER G 89  ? SER C 82  SER C 90  1 ? 9  
HELX_P HELX_P36 36 ALA G 93  ? ASN G 97  ? ALA C 94  ASN C 98  5 ? 5  
HELX_P HELX_P37 37 ALA G 144 ? ASP G 156 ? ALA C 145 ASP C 157 1 ? 13 
HELX_P HELX_P38 38 PHE G 190 ? SER G 192 ? PHE C 191 SER C 193 5 ? 3  
HELX_P HELX_P39 39 THR G 221 ? VAL G 249 ? THR C 222 VAL C 250 1 ? 29 
HELX_P HELX_P40 40 ILE H 3   ? GLN H 8   ? ILE D 4   GLN D 9   5 ? 6  
HELX_P HELX_P41 41 ASP H 9   ? ILE H 15  ? ASP D 10  ILE D 16  1 ? 7  
HELX_P HELX_P42 42 GLY H 29  ? LEU H 48  ? GLY D 30  LEU D 49  1 ? 20 
HELX_P HELX_P43 43 LYS H 54  ? LYS H 65  ? LYS D 55  LYS D 66  1 ? 12 
HELX_P HELX_P44 44 GLY H 71  ? LEU H 78  ? GLY D 72  LEU D 79  1 ? 8  
HELX_P HELX_P45 45 SER H 81  ? SER H 89  ? SER D 82  SER D 90  1 ? 9  
HELX_P HELX_P46 46 GLY H 91  ? ASN H 97  ? GLY D 92  ASN D 98  1 ? 7  
HELX_P HELX_P47 47 ALA H 144 ? ASN H 157 ? ALA D 145 ASN D 158 1 ? 14 
HELX_P HELX_P48 48 PHE H 190 ? SER H 192 ? PHE D 191 SER D 193 5 ? 3  
HELX_P HELX_P49 49 THR H 221 ? ASP H 246 ? THR D 222 ASP D 247 1 ? 26 
HELX_P HELX_P50 50 PHE H 248 ? LYS H 253 ? PHE D 249 LYS D 254 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? K CA  .   CA  ? ? ? 1_555 E VAL 127 O   ? ? A CA  801 A VAL 128  1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc2  metalc ? ? K CA  .   CA  ? ? ? 1_555 E ASP 113 OD1 ? ? A CA  801 A ASP 114  1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc3  metalc ? ? K CA  .   CA  ? ? ? 1_555 E ASP 126 OD1 ? ? A CA  801 A ASP 127  1_555 ? ? ? ? ? ? ?            2.182 ? 
metalc4  metalc ? ? K CA  .   CA  ? ? ? 1_555 T HOH .   O   ? ? A CA  801 F HOH 806  1_555 ? ? ? ? ? ? ?            2.211 ? 
metalc5  metalc ? ? K CA  .   CA  ? ? ? 1_555 E ASP 113 OD2 ? ? A CA  801 A ASP 114  1_555 ? ? ? ? ? ? ?            3.107 ? 
metalc6  metalc ? ? K CA  .   CA  ? ? ? 1_555 W HOH .   O   ? ? A CA  801 A HOH 1058 1_555 ? ? ? ? ? ? ?            2.229 ? 
metalc7  metalc ? ? K CA  .   CA  ? ? ? 1_555 B DG  8   OP1 ? ? A CA  801 F DG  8    1_555 ? ? ? ? ? ? ?            2.235 ? 
metalc8  metalc ? ? L NA  .   NA  ? ? ? 1_555 E ASP 126 OD2 ? ? A NA  901 A ASP 127  1_555 ? ? ? ? ? ? ?            2.407 ? 
metalc9  metalc ? ? L NA  .   NA  ? ? ? 1_555 B DG  8   OP2 ? ? A NA  901 F DG  8    1_555 ? ? ? ? ? ? ?            2.438 ? 
metalc10 metalc ? ? L NA  .   NA  ? ? ? 1_555 W HOH .   O   ? ? A NA  901 A HOH 1060 1_555 ? ? ? ? ? ? ?            2.546 ? 
metalc11 metalc ? ? L NA  .   NA  ? ? ? 1_555 E ILE 141 O   ? ? A NA  901 A ILE 142  1_555 ? ? ? ? ? ? ?            2.238 ? 
metalc12 metalc ? ? L NA  .   NA  ? ? ? 1_555 W HOH .   O   ? ? A NA  901 A HOH 1066 1_555 ? ? ? ? ? ? ?            2.493 ? 
metalc13 metalc ? ? M CA  .   CA  ? ? ? 1_555 X HOH .   O   ? ? B CA  802 B HOH 1006 1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc14 metalc ? ? M CA  .   CA  ? ? ? 1_555 A DG  8   OP1 ? ? B CA  802 E DG  8    1_555 ? ? ? ? ? ? ?            2.184 ? 
metalc15 metalc ? ? M CA  .   CA  ? ? ? 1_555 S HOH .   O   ? ? B CA  802 E HOH 244  1_555 ? ? ? ? ? ? ?            2.557 ? 
metalc16 metalc ? ? M CA  .   CA  ? ? ? 1_555 F ASP 113 OD1 ? ? B CA  802 B ASP 114  1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc17 metalc ? ? M CA  .   CA  ? ? ? 1_555 F VAL 127 O   ? ? B CA  802 B VAL 128  1_555 ? ? ? ? ? ? ?            2.393 ? 
metalc18 metalc ? ? M CA  .   CA  ? ? ? 1_555 F ASP 126 OD2 ? ? B CA  802 B ASP 127  1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc19 metalc ? ? N NA  .   NA  ? ? ? 1_555 F ILE 141 O   ? ? B NA  902 B ILE 142  1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc20 metalc ? ? N NA  .   NA  ? ? ? 1_555 X HOH .   O   ? ? B NA  902 B HOH 998  1_555 ? ? ? ? ? ? ?            2.151 ? 
metalc21 metalc ? ? N NA  .   NA  ? ? ? 1_555 A DG  8   OP2 ? ? B NA  902 E DG  8    1_555 ? ? ? ? ? ? ?            2.468 ? 
metalc22 metalc ? ? N NA  .   NA  ? ? ? 1_555 F ASP 126 OD1 ? ? B NA  902 B ASP 127  1_555 ? ? ? ? ? ? ?            2.202 ? 
metalc23 metalc ? ? N NA  .   NA  ? ? ? 1_555 X HOH .   O   ? ? B NA  902 B HOH 976  1_555 ? ? ? ? ? ? ?            2.390 ? 
metalc24 metalc ? ? O CA  .   CA  ? ? ? 1_555 D DG  8   OP1 ? ? C CA  803 H DG  8    1_555 ? ? ? ? ? ? ?            2.292 ? 
metalc25 metalc ? ? O CA  .   CA  ? ? ? 1_555 Y HOH .   O   ? ? C CA  803 C HOH 971  1_555 ? ? ? ? ? ? ?            2.070 ? 
metalc26 metalc ? ? O CA  .   CA  ? ? ? 1_555 G ASP 113 OD2 ? ? C CA  803 C ASP 114  1_555 ? ? ? ? ? ? ?            2.369 ? 
metalc27 metalc ? ? O CA  .   CA  ? ? ? 1_555 G ASP 126 OD1 ? ? C CA  803 C ASP 127  1_555 ? ? ? ? ? ? ?            2.174 ? 
metalc28 metalc ? ? O CA  .   CA  ? ? ? 1_555 G VAL 127 O   ? ? C CA  803 C VAL 128  1_555 ? ? ? ? ? ? ?            2.434 ? 
metalc29 metalc ? ? P NA  .   NA  ? ? ? 1_555 G ILE 141 O   ? ? C NA  903 C ILE 142  1_555 ? ? ? ? ? ? ?            2.082 ? 
metalc30 metalc ? ? Q CA  .   CA  ? ? ? 1_555 H ASP 113 OD2 ? ? D CA  804 D ASP 114  1_555 ? ? ? ? ? ? ?            2.515 ? 
metalc31 metalc ? ? Q CA  .   CA  ? ? ? 1_555 H ASP 126 OD2 ? ? D CA  804 D ASP 127  1_555 ? ? ? ? ? ? ?            2.242 ? 
metalc32 metalc ? ? Q CA  .   CA  ? ? ? 1_555 H VAL 127 O   ? ? D CA  804 D VAL 128  1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc33 metalc ? ? Q CA  .   CA  ? ? ? 1_555 Z HOH .   O   ? ? D CA  804 D HOH 922  1_555 ? ? ? ? ? ? ?            2.347 ? 
metalc34 metalc ? ? Q CA  .   CA  ? ? ? 1_555 C DG  8   OP2 ? ? D CA  804 G DG  8    1_555 ? ? ? ? ? ? ?            3.341 ? 
metalc35 metalc ? ? Q CA  .   CA  ? ? ? 1_555 C DG  8   OP1 ? ? D CA  804 G DG  8    1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc36 metalc ? ? Q CA  .   CA  ? ? ? 1_555 H ASP 113 OD1 ? ? D CA  804 D ASP 114  1_555 ? ? ? ? ? ? ?            3.108 ? 
metalc37 metalc ? ? R NA  .   NA  ? ? ? 1_555 H LYS 128 NZ  ? ? D NA  904 D LYS 129  1_555 ? ? ? ? ? ? ?            2.597 ? 
metalc38 metalc ? ? R NA  .   NA  ? ? ? 1_555 H ILE 141 O   ? ? D NA  904 D ILE 142  1_555 ? ? ? ? ? ? ?            2.239 ? 
metalc39 metalc ? ? R NA  .   NA  ? ? ? 1_555 U HOH .   O   ? ? D NA  904 G HOH 551  1_555 ? ? ? ? ? ? ?            2.521 ? 
metalc40 metalc ? ? R NA  .   NA  ? ? ? 1_555 Z HOH .   O   ? ? D NA  904 D HOH 989  1_555 ? ? ? ? ? ? ?            2.428 ? 
metalc41 metalc ? ? R NA  .   NA  ? ? ? 1_555 C DG  8   OP2 ? ? D NA  904 G DG  8    1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc42 metalc ? ? R NA  .   NA  ? ? ? 1_555 H ASP 126 OD1 ? ? D NA  904 D ASP 127  1_555 ? ? ? ? ? ? ?            2.149 ? 
metalc43 metalc ? ? I CA  .   CA  ? ? ? 1_555 X HOH .   O   ? ? F CA  805 B HOH 1059 1_555 ? ? ? ? ? ? ?            2.948 ? 
metalc44 metalc ? ? I CA  .   CA  ? ? ? 1_555 T HOH .   O   ? ? F CA  805 F HOH 841  1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc45 metalc ? ? I CA  .   CA  ? ? ? 1_555 B DG  1   O6  ? ? F CA  805 F DG  1    1_555 ? ? ? ? ? ? ?            3.036 ? 
metalc46 metalc ? ? I CA  .   CA  ? ? ? 1_555 B DC  2   N4  ? ? F CA  805 F DC  2    1_555 ? ? ? ? ? ? ?            2.874 ? 
metalc47 metalc ? ? J CA  .   CA  ? ? ? 1_555 D DG  1   O6  ? ? H CA  806 H DG  1    1_555 ? ? ? ? ? ? ?            1.976 ? 
metalc48 metalc ? ? J CA  .   CA  ? ? ? 1_555 V HOH .   O   ? ? H CA  806 H HOH 43   1_555 ? ? ? ? ? ? ?            2.760 ? 
metalc49 metalc ? ? I CA  .   CA  ? ? ? 1_555 B DG  1   O6  ? ? F CA  805 F DG  1    6_655 ? ? ? ? ? ? ?            2.314 ? 
metalc50 metalc ? ? I CA  .   CA  ? ? ? 1_555 T HOH .   O   ? ? F CA  805 F HOH 841  6_655 ? ? ? ? ? ? ?            2.394 ? 
metalc51 metalc ? ? J CA  .   CA  ? ? ? 1_555 D DG  1   O6  ? ? H CA  806 H DG  1    7_557 ? ? ? ? ? ? ?            2.960 ? 
metalc52 metalc ? ? J CA  .   CA  ? ? ? 1_555 V HOH .   O   ? ? H CA  806 H HOH 43   7_557 ? ? ? ? ? ? ?            3.165 ? 
metalc53 metalc ? ? E LYS 128 NZ  ? ? ? 1_555 L NA  .   NA  ? ? A LYS 129 A NA  901  1_555 ? ? ? ? ? ? ?            2.667 ? 
metalc54 metalc ? ? P NA  .   NA  ? ? ? 1_555 Y HOH .   O   ? ? C NA  903 C HOH 967  1_555 ? ? ? ? ? ? ?            2.897 ? 
metalc55 metalc ? ? D DG  8   OP2 ? ? ? 1_555 P NA  .   NA  ? ? H DG  8   C NA  903  1_555 ? ? ? ? ? ? ?            3.086 ? 
metalc56 metalc ? ? N NA  .   NA  ? ? ? 1_555 X HOH .   O   ? ? B NA  902 B HOH 1054 1_555 ? ? ? ? ? ? ?            3.179 ? 
hydrog1  hydrog ? ? A DG  1   N1  ? ? ? 1_555 C DC  2   N3  ? ? E DG  1   G DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  1   N2  ? ? ? 1_555 C DC  2   O2  ? ? E DG  1   G DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  1   O6  ? ? ? 1_555 C DC  2   N4  ? ? E DG  1   G DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC  2   O2  ? ? ? 1_555 C DG  1   N2  ? ? E DC  2   G DG  1    1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog5  hydrog ? ? A DC  3   N3  ? ? ? 1_555 B DG  12  N1  ? ? E DC  3   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC  3   N4  ? ? ? 1_555 B DG  12  O6  ? ? E DC  3   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  3   O2  ? ? ? 1_555 B DG  12  N2  ? ? E DC  3   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG  4   N1  ? ? ? 1_555 B DC  11  N3  ? ? E DG  4   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG  4   N2  ? ? ? 1_555 B DC  11  O2  ? ? E DG  4   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG  4   O6  ? ? ? 1_555 B DC  11  N4  ? ? E DG  4   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  5   N1  ? ? ? 1_555 B DC  10  N3  ? ? E DG  5   F DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  5   N2  ? ? ? 1_555 B DC  10  O2  ? ? E DG  5   F DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  5   O6  ? ? ? 1_555 B DC  10  N4  ? ? E DG  5   F DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  6   N3  ? ? ? 1_555 B DA  9   N1  ? ? E DT  6   F DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT  6   O4  ? ? ? 1_555 B DA  9   N6  ? ? E DT  6   F DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  7   N3  ? ? ? 1_555 B DG  8   N1  ? ? E DC  7   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  7   N4  ? ? ? 1_555 B DG  8   O6  ? ? E DC  7   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  7   O2  ? ? ? 1_555 B DG  8   N2  ? ? E DC  7   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG  8   N1  ? ? ? 1_555 B DC  7   N3  ? ? E DG  8   F DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG  8   N2  ? ? ? 1_555 B DC  7   O2  ? ? E DG  8   F DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG  8   O6  ? ? ? 1_555 B DC  7   N4  ? ? E DG  8   F DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA  9   N1  ? ? ? 1_555 B DT  6   N3  ? ? E DA  9   F DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA  9   N6  ? ? ? 1_555 B DT  6   O4  ? ? E DA  9   F DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC  10  N3  ? ? ? 1_555 B DG  5   N1  ? ? E DC  10  F DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC  10  N4  ? ? ? 1_555 B DG  5   O6  ? ? E DC  10  F DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DC  10  O2  ? ? ? 1_555 B DG  5   N2  ? ? E DC  10  F DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DC  11  N3  ? ? ? 1_555 B DG  4   N1  ? ? E DC  11  F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DC  11  N4  ? ? ? 1_555 B DG  4   O6  ? ? E DC  11  F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC  11  O2  ? ? ? 1_555 B DG  4   N2  ? ? E DC  11  F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DG  12  N1  ? ? ? 1_555 B DC  3   N3  ? ? E DG  12  F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DG  12  N2  ? ? ? 1_555 B DC  3   O2  ? ? E DG  12  F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DG  12  O6  ? ? ? 1_555 B DC  3   N4  ? ? E DG  12  F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DC  3   N3  ? ? ? 1_555 D DG  12  N1  ? ? G DC  3   H DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DC  3   N4  ? ? ? 1_555 D DG  12  O6  ? ? G DC  3   H DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DC  3   O2  ? ? ? 1_555 D DG  12  N2  ? ? G DC  3   H DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC  11  N3  ? ? G DG  4   H DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC  11  O2  ? ? G DG  4   H DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC  11  N4  ? ? G DG  4   H DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG  5   N1  ? ? ? 1_555 D DC  10  N3  ? ? G DG  5   H DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DG  5   N2  ? ? ? 1_555 D DC  10  O2  ? ? G DG  5   H DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG  5   O6  ? ? ? 1_555 D DC  10  N4  ? ? G DG  5   H DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DT  6   N3  ? ? ? 1_555 D DA  9   N1  ? ? G DT  6   H DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DT  6   O4  ? ? ? 1_555 D DA  9   N6  ? ? G DT  6   H DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DC  7   N3  ? ? ? 1_555 D DG  8   N1  ? ? G DC  7   H DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DC  7   N4  ? ? ? 1_555 D DG  8   O6  ? ? G DC  7   H DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DC  7   O2  ? ? ? 1_555 D DG  8   N2  ? ? G DC  7   H DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DG  8   N1  ? ? ? 1_555 D DC  7   N3  ? ? G DG  8   H DC  7    1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog48 hydrog ? ? C DA  9   N1  ? ? ? 1_555 D DT  6   N3  ? ? G DA  9   H DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DA  9   N6  ? ? ? 1_555 D DT  6   O4  ? ? G DA  9   H DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C DC  10  N3  ? ? ? 1_555 D DG  5   N1  ? ? G DC  10  H DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C DC  10  N4  ? ? ? 1_555 D DG  5   O6  ? ? G DC  10  H DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C DC  10  O2  ? ? ? 1_555 D DG  5   N2  ? ? G DC  10  H DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? C DC  11  N3  ? ? ? 1_555 D DG  4   N1  ? ? G DC  11  H DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? C DC  11  N4  ? ? ? 1_555 D DG  4   O6  ? ? G DC  11  H DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? C DC  11  O2  ? ? ? 1_555 D DG  4   N2  ? ? G DC  11  H DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? C DG  12  N1  ? ? ? 1_555 D DC  3   N3  ? ? G DG  12  H DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? C DG  12  N2  ? ? ? 1_555 D DC  3   O2  ? ? G DG  12  H DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? C DG  12  O6  ? ? ? 1_555 D DC  3   N4  ? ? G DG  12  H DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 6 ? 
D ? 3 ? 
E ? 5 ? 
F ? 3 ? 
G ? 5 ? 
H ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL E 19  ? LYS E 20  ? VAL A 20  LYS A 21  
A 2 ASP E 178 ? GLU E 188 ? ASP A 179 GLU A 189 
A 3 PHE E 163 ? ASN E 175 ? PHE A 164 ASN A 176 
A 4 PHE E 121 ? ASN E 131 ? PHE A 122 ASN A 132 
A 5 ILE E 114 ? LYS E 118 ? ILE A 115 LYS A 119 
A 6 THR E 52  ? LYS E 54  ? THR A 53  LYS A 55  
B 1 ASN E 140 ? SER E 143 ? ASN A 141 SER A 144 
B 2 GLN E 206 ? GLN E 208 ? GLN A 207 GLN A 209 
B 3 ILE E 199 ? ASN E 200 ? ILE A 200 ASN A 201 
C 1 LYS F 18  ? VAL F 19  ? LYS B 19  VAL B 20  
C 2 LEU F 179 ? GLU F 188 ? LEU B 180 GLU B 189 
C 3 PHE F 163 ? LEU F 174 ? PHE B 164 LEU B 175 
C 4 TYR F 122 ? ASN F 131 ? TYR B 123 ASN B 132 
C 5 ILE F 114 ? LEU F 116 ? ILE B 115 LEU B 117 
C 6 THR F 52  ? PHE F 53  ? THR B 53  PHE B 54  
D 1 ASN F 140 ? SER F 143 ? ASN B 141 SER B 144 
D 2 GLN F 206 ? GLN F 208 ? GLN B 207 GLN B 209 
D 3 TYR F 198 ? ASN F 200 ? TYR B 199 ASN B 201 
E 1 THR G 52  ? PHE G 53  ? THR C 53  PHE C 54  
E 2 ILE G 114 ? VAL G 117 ? ILE C 115 VAL C 118 
E 3 TYR G 122 ? ASN G 131 ? TYR C 123 ASN C 132 
E 4 PHE G 163 ? ASN G 175 ? PHE C 164 ASN C 176 
E 5 ASP G 178 ? GLU G 188 ? ASP C 179 GLU C 189 
F 1 ASN G 140 ? SER G 143 ? ASN C 141 SER C 144 
F 2 GLN G 206 ? GLN G 208 ? GLN C 207 GLN C 209 
F 3 ILE G 199 ? ASN G 200 ? ILE C 200 ASN C 201 
G 1 LYS H 18  ? LYS H 20  ? LYS D 19  LYS D 21  
G 2 ASP H 178 ? GLU H 188 ? ASP D 179 GLU D 189 
G 3 PHE H 163 ? TRP H 172 ? PHE D 164 TRP D 173 
G 4 PHE H 121 ? ASN H 131 ? PHE D 122 ASN D 132 
G 5 ILE H 114 ? LYS H 118 ? ILE D 115 LYS D 119 
H 1 ASN H 140 ? SER H 143 ? ASN D 141 SER D 144 
H 2 GLN H 206 ? GLN H 208 ? GLN D 207 GLN D 209 
H 3 ILE H 199 ? ASN H 200 ? ILE D 200 ASN D 201 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL E 19  ? N VAL A 20  O LEU E 179 ? O LEU A 180 
A 2 3 O VAL E 182 ? O VAL A 183 N ASP E 171 ? N ASP A 172 
A 3 4 O ASP E 164 ? O ASP A 165 N LEU E 124 ? N LEU A 125 
A 4 5 O LEU E 125 ? O LEU A 126 N ILE E 114 ? N ILE A 115 
A 5 6 O LEU E 115 ? O LEU A 116 N PHE E 53  ? N PHE A 54  
B 1 2 N ILE E 141 ? N ILE A 142 O ILE E 207 ? O ILE A 208 
B 2 3 O GLN E 206 ? O GLN A 207 N ASN E 200 ? N ASN A 201 
C 1 2 N VAL F 19  ? N VAL B 20  O LEU F 179 ? O LEU B 180 
C 2 3 O ALA F 187 ? O ALA B 188 N TYR F 167 ? N TYR B 168 
C 3 4 O VAL F 170 ? O VAL B 171 N LYS F 128 ? N LYS B 129 
C 4 5 O LEU F 125 ? O LEU B 126 N ILE F 114 ? N ILE B 115 
C 5 6 O LEU F 115 ? O LEU B 116 N PHE F 53  ? N PHE B 54  
D 1 2 N ILE F 142 ? N ILE B 143 O ILE F 207 ? O ILE B 208 
D 2 3 O GLN F 206 ? O GLN B 207 N ASN F 200 ? N ASN B 201 
E 1 2 N PHE G 53  ? N PHE C 54  O LEU G 115 ? O LEU C 116 
E 2 3 N ILE G 114 ? N ILE C 115 O LEU G 125 ? O LEU C 126 
E 3 4 N LEU G 124 ? N LEU C 125 O ASP G 164 ? O ASP C 165 
E 4 5 N GLU G 169 ? N GLU C 170 O SER G 185 ? O SER C 186 
F 1 2 N ILE G 142 ? N ILE C 143 O ILE G 207 ? O ILE C 208 
F 2 3 O GLN G 206 ? O GLN C 207 N ASN G 200 ? N ASN C 201 
G 1 2 N VAL H 19  ? N VAL D 20  O LEU H 179 ? O LEU D 180 
G 2 3 O VAL H 182 ? O VAL D 183 N ASP H 171 ? N ASP D 172 
G 3 4 O ASP H 164 ? O ASP D 165 N LEU H 124 ? N LEU D 125 
G 4 5 O LEU H 125 ? O LEU D 126 N ILE H 114 ? N ILE D 115 
H 1 2 N ILE H 142 ? N ILE D 143 O ILE H 207 ? O ILE D 208 
H 2 3 O GLN H 206 ? O GLN D 207 N ASN H 200 ? N ASN D 201 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 801' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 802' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA C 803' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA D 804' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA F 805' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CA H 806' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 901' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA B 902' 
AC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA C 903' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA D 904' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP E 113 ? ASP A 114  . ? 1_555 ? 
2  AC1 6 ASP E 126 ? ASP A 127  . ? 1_555 ? 
3  AC1 6 VAL E 127 ? VAL A 128  . ? 1_555 ? 
4  AC1 6 HOH W .   ? HOH A 1058 . ? 1_555 ? 
5  AC1 6 DG  B 8   ? DG  F 8    . ? 1_555 ? 
6  AC1 6 HOH T .   ? HOH F 806  . ? 1_555 ? 
7  AC2 6 ASP F 113 ? ASP B 114  . ? 1_555 ? 
8  AC2 6 ASP F 126 ? ASP B 127  . ? 1_555 ? 
9  AC2 6 VAL F 127 ? VAL B 128  . ? 1_555 ? 
10 AC2 6 HOH X .   ? HOH B 1006 . ? 1_555 ? 
11 AC2 6 DG  A 8   ? DG  E 8    . ? 1_555 ? 
12 AC2 6 HOH S .   ? HOH E 244  . ? 1_555 ? 
13 AC3 5 ASP G 113 ? ASP C 114  . ? 1_555 ? 
14 AC3 5 ASP G 126 ? ASP C 127  . ? 1_555 ? 
15 AC3 5 VAL G 127 ? VAL C 128  . ? 1_555 ? 
16 AC3 5 HOH Y .   ? HOH C 971  . ? 1_555 ? 
17 AC3 5 DG  D 8   ? DG  H 8    . ? 1_555 ? 
18 AC4 5 ASP H 113 ? ASP D 114  . ? 1_555 ? 
19 AC4 5 ASP H 126 ? ASP D 127  . ? 1_555 ? 
20 AC4 5 VAL H 127 ? VAL D 128  . ? 1_555 ? 
21 AC4 5 HOH Z .   ? HOH D 922  . ? 1_555 ? 
22 AC4 5 DG  C 8   ? DG  G 8    . ? 1_555 ? 
23 AC5 7 HOH X .   ? HOH B 1059 . ? 1_555 ? 
24 AC5 7 DG  A 12  ? DG  E 12   . ? 1_555 ? 
25 AC5 7 DG  B 1   ? DG  F 1    . ? 6_655 ? 
26 AC5 7 DG  B 1   ? DG  F 1    . ? 1_555 ? 
27 AC5 7 DC  B 2   ? DC  F 2    . ? 1_555 ? 
28 AC5 7 HOH T .   ? HOH F 841  . ? 1_555 ? 
29 AC5 7 HOH T .   ? HOH F 841  . ? 6_655 ? 
30 AC6 3 DG  D 1   ? DG  H 1    . ? 1_555 ? 
31 AC6 3 DG  D 1   ? DG  H 1    . ? 7_557 ? 
32 AC6 3 HOH V .   ? HOH H 43   . ? 1_555 ? 
33 AC7 6 ASP E 126 ? ASP A 127  . ? 1_555 ? 
34 AC7 6 LYS E 128 ? LYS A 129  . ? 1_555 ? 
35 AC7 6 ILE E 141 ? ILE A 142  . ? 1_555 ? 
36 AC7 6 HOH W .   ? HOH A 1060 . ? 1_555 ? 
37 AC7 6 HOH W .   ? HOH A 1066 . ? 1_555 ? 
38 AC7 6 DG  B 8   ? DG  F 8    . ? 1_555 ? 
39 AC8 6 ASP F 126 ? ASP B 127  . ? 1_555 ? 
40 AC8 6 LYS F 128 ? LYS B 129  . ? 1_555 ? 
41 AC8 6 ILE F 141 ? ILE B 142  . ? 1_555 ? 
42 AC8 6 HOH X .   ? HOH B 976  . ? 1_555 ? 
43 AC8 6 HOH X .   ? HOH B 998  . ? 1_555 ? 
44 AC8 6 DG  A 8   ? DG  E 8    . ? 1_555 ? 
45 AC9 7 ASP G 126 ? ASP C 127  . ? 1_555 ? 
46 AC9 7 LYS G 128 ? LYS C 129  . ? 1_555 ? 
47 AC9 7 ILE G 141 ? ILE C 142  . ? 1_555 ? 
48 AC9 7 ILE G 142 ? ILE C 143  . ? 1_555 ? 
49 AC9 7 HOH Y .   ? HOH C 967  . ? 1_555 ? 
50 AC9 7 DC  D 7   ? DC  H 7    . ? 1_555 ? 
51 AC9 7 DG  D 8   ? DG  H 8    . ? 1_555 ? 
52 BC1 6 ASP H 126 ? ASP D 127  . ? 1_555 ? 
53 BC1 6 LYS H 128 ? LYS D 129  . ? 1_555 ? 
54 BC1 6 ILE H 141 ? ILE D 142  . ? 1_555 ? 
55 BC1 6 HOH Z .   ? HOH D 989  . ? 1_555 ? 
56 BC1 6 DG  C 8   ? DG  G 8    . ? 1_555 ? 
57 BC1 6 HOH U .   ? HOH G 551  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1TW8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TW8 
_atom_sites.fract_transf_matrix[1][1]   0.014938 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005644 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003923 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DG  A 1 1   ? 19.824  -0.934  220.004 1.00 55.31  ? 1    DG  E "O5'" 1 
ATOM   2     C  "C5'" . DG  A 1 1   ? 19.577  0.150   220.920 1.00 69.34  ? 1    DG  E "C5'" 1 
ATOM   3     C  "C4'" . DG  A 1 1   ? 19.303  1.425   220.154 1.00 68.97  ? 1    DG  E "C4'" 1 
ATOM   4     O  "O4'" . DG  A 1 1   ? 20.476  1.807   219.401 1.00 62.32  ? 1    DG  E "O4'" 1 
ATOM   5     C  "C3'" . DG  A 1 1   ? 18.167  1.313   219.135 1.00 70.22  ? 1    DG  E "C3'" 1 
ATOM   6     O  "O3'" . DG  A 1 1   ? 17.522  2.583   218.968 1.00 84.86  ? 1    DG  E "O3'" 1 
ATOM   7     C  "C2'" . DG  A 1 1   ? 18.908  0.987   217.851 1.00 62.57  ? 1    DG  E "C2'" 1 
ATOM   8     C  "C1'" . DG  A 1 1   ? 20.175  1.820   218.013 1.00 66.42  ? 1    DG  E "C1'" 1 
ATOM   9     N  N9    . DG  A 1 1   ? 21.353  1.321   217.314 1.00 65.68  ? 1    DG  E N9    1 
ATOM   10    C  C8    . DG  A 1 1   ? 21.396  0.431   216.268 1.00 75.74  ? 1    DG  E C8    1 
ATOM   11    N  N7    . DG  A 1 1   ? 22.610  0.175   215.862 1.00 82.26  ? 1    DG  E N7    1 
ATOM   12    C  C5    . DG  A 1 1   ? 23.416  0.942   216.691 1.00 79.57  ? 1    DG  E C5    1 
ATOM   13    C  C6    . DG  A 1 1   ? 24.831  1.075   216.733 1.00 86.23  ? 1    DG  E C6    1 
ATOM   14    O  O6    . DG  A 1 1   ? 25.688  0.531   216.008 1.00 83.36  ? 1    DG  E O6    1 
ATOM   15    N  N1    . DG  A 1 1   ? 25.228  1.946   217.744 1.00 85.19  ? 1    DG  E N1    1 
ATOM   16    C  C2    . DG  A 1 1   ? 24.379  2.608   218.599 1.00 76.12  ? 1    DG  E C2    1 
ATOM   17    N  N2    . DG  A 1 1   ? 24.963  3.393   219.522 1.00 63.94  ? 1    DG  E N2    1 
ATOM   18    N  N3    . DG  A 1 1   ? 23.061  2.504   218.558 1.00 70.15  ? 1    DG  E N3    1 
ATOM   19    C  C4    . DG  A 1 1   ? 22.653  1.657   217.591 1.00 66.99  ? 1    DG  E C4    1 
ATOM   20    P  P     . DC  A 1 2   ? 16.984  3.400   220.249 1.00 94.86  ? 2    DC  E P     1 
ATOM   21    O  OP1   . DC  A 1 2   ? 17.155  2.617   221.511 1.00 86.88  ? 2    DC  E OP1   1 
ATOM   22    O  OP2   . DC  A 1 2   ? 15.636  3.913   219.870 1.00 90.48  ? 2    DC  E OP2   1 
ATOM   23    O  "O5'" . DC  A 1 2   ? 17.986  4.636   220.337 1.00 89.70  ? 2    DC  E "O5'" 1 
ATOM   24    C  "C5'" . DC  A 1 2   ? 18.897  4.766   221.432 1.00 83.42  ? 2    DC  E "C5'" 1 
ATOM   25    C  "C4'" . DC  A 1 2   ? 19.866  5.900   221.178 1.00 75.58  ? 2    DC  E "C4'" 1 
ATOM   26    O  "O4'" . DC  A 1 2   ? 20.906  5.496   220.255 1.00 61.98  ? 2    DC  E "O4'" 1 
ATOM   27    C  "C3'" . DC  A 1 2   ? 19.232  7.157   220.581 1.00 76.47  ? 2    DC  E "C3'" 1 
ATOM   28    O  "O3'" . DC  A 1 2   ? 19.837  8.316   221.158 1.00 76.64  ? 2    DC  E "O3'" 1 
ATOM   29    C  "C2'" . DC  A 1 2   ? 19.601  7.064   219.114 1.00 72.31  ? 2    DC  E "C2'" 1 
ATOM   30    C  "C1'" . DC  A 1 2   ? 20.980  6.439   219.196 1.00 66.30  ? 2    DC  E "C1'" 1 
ATOM   31    N  N1    . DC  A 1 2   ? 21.408  5.737   217.975 1.00 63.33  ? 2    DC  E N1    1 
ATOM   32    C  C2    . DC  A 1 2   ? 22.773  5.569   217.749 1.00 59.38  ? 2    DC  E C2    1 
ATOM   33    O  O2    . DC  A 1 2   ? 23.575  5.987   218.599 1.00 71.93  ? 2    DC  E O2    1 
ATOM   34    N  N3    . DC  A 1 2   ? 23.185  4.959   216.620 1.00 46.78  ? 2    DC  E N3    1 
ATOM   35    C  C4    . DC  A 1 2   ? 22.290  4.513   215.741 1.00 45.77  ? 2    DC  E C4    1 
ATOM   36    N  N4    . DC  A 1 2   ? 22.743  3.930   214.635 1.00 61.08  ? 2    DC  E N4    1 
ATOM   37    C  C5    . DC  A 1 2   ? 20.890  4.651   215.953 1.00 45.88  ? 2    DC  E C5    1 
ATOM   38    C  C6    . DC  A 1 2   ? 20.495  5.265   217.070 1.00 56.12  ? 2    DC  E C6    1 
ATOM   39    P  P     . DC  A 1 3   ? 19.418  9.778   220.644 1.00 83.43  ? 3    DC  E P     1 
ATOM   40    O  OP1   . DC  A 1 3   ? 19.107  10.592  221.846 1.00 85.18  ? 3    DC  E OP1   1 
ATOM   41    O  OP2   . DC  A 1 3   ? 18.414  9.652   219.551 1.00 78.73  ? 3    DC  E OP2   1 
ATOM   42    O  "O5'" . DC  A 1 3   ? 20.758  10.334  219.998 1.00 71.08  ? 3    DC  E "O5'" 1 
ATOM   43    C  "C5'" . DC  A 1 3   ? 22.002  10.135  220.651 1.00 62.12  ? 3    DC  E "C5'" 1 
ATOM   44    C  "C4'" . DC  A 1 3   ? 23.131  10.588  219.758 1.00 55.48  ? 3    DC  E "C4'" 1 
ATOM   45    O  "O4'" . DC  A 1 3   ? 23.370  9.627   218.697 1.00 49.63  ? 3    DC  E "O4'" 1 
ATOM   46    C  "C3'" . DC  A 1 3   ? 22.868  11.931  219.069 1.00 44.88  ? 3    DC  E "C3'" 1 
ATOM   47    O  "O3'" . DC  A 1 3   ? 24.067  12.706  219.057 1.00 40.41  ? 3    DC  E "O3'" 1 
ATOM   48    C  "C2'" . DC  A 1 3   ? 22.559  11.524  217.639 1.00 50.54  ? 3    DC  E "C2'" 1 
ATOM   49    C  "C1'" . DC  A 1 3   ? 23.479  10.333  217.475 1.00 50.19  ? 3    DC  E "C1'" 1 
ATOM   50    N  N1    . DC  A 1 3   ? 23.151  9.415   216.376 1.00 48.17  ? 3    DC  E N1    1 
ATOM   51    C  C2    . DC  A 1 3   ? 24.187  8.909   215.592 1.00 52.49  ? 3    DC  E C2    1 
ATOM   52    O  O2    . DC  A 1 3   ? 25.344  9.262   215.834 1.00 59.85  ? 3    DC  E O2    1 
ATOM   53    N  N3    . DC  A 1 3   ? 23.900  8.049   214.589 1.00 59.18  ? 3    DC  E N3    1 
ATOM   54    C  C4    . DC  A 1 3   ? 22.634  7.696   214.359 1.00 53.64  ? 3    DC  E C4    1 
ATOM   55    N  N4    . DC  A 1 3   ? 22.396  6.829   213.375 1.00 48.10  ? 3    DC  E N4    1 
ATOM   56    C  C5    . DC  A 1 3   ? 21.558  8.212   215.132 1.00 49.33  ? 3    DC  E C5    1 
ATOM   57    C  C6    . DC  A 1 3   ? 21.859  9.056   216.124 1.00 53.24  ? 3    DC  E C6    1 
ATOM   58    P  P     . DG  A 1 4   ? 24.053  14.234  219.552 1.00 37.44  ? 4    DG  E P     1 
ATOM   59    O  OP1   . DG  A 1 4   ? 24.487  14.287  220.973 1.00 28.30  ? 4    DG  E OP1   1 
ATOM   60    O  OP2   . DG  A 1 4   ? 22.778  14.869  219.137 1.00 32.83  ? 4    DG  E OP2   1 
ATOM   61    O  "O5'" . DG  A 1 4   ? 25.210  14.895  218.685 1.00 49.29  ? 4    DG  E "O5'" 1 
ATOM   62    C  "C5'" . DG  A 1 4   ? 26.491  14.301  218.630 1.00 31.76  ? 4    DG  E "C5'" 1 
ATOM   63    C  "C4'" . DG  A 1 4   ? 26.995  14.286  217.208 1.00 29.18  ? 4    DG  E "C4'" 1 
ATOM   64    O  "O4'" . DG  A 1 4   ? 26.358  13.254  216.421 1.00 27.53  ? 4    DG  E "O4'" 1 
ATOM   65    C  "C3'" . DG  A 1 4   ? 26.773  15.593  216.450 1.00 31.18  ? 4    DG  E "C3'" 1 
ATOM   66    O  "O3'" . DG  A 1 4   ? 27.945  15.886  215.708 1.00 42.33  ? 4    DG  E "O3'" 1 
ATOM   67    C  "C2'" . DG  A 1 4   ? 25.692  15.233  215.448 1.00 32.53  ? 4    DG  E "C2'" 1 
ATOM   68    C  "C1'" . DG  A 1 4   ? 26.093  13.811  215.148 1.00 29.13  ? 4    DG  E "C1'" 1 
ATOM   69    N  N9    . DG  A 1 4   ? 25.108  12.985  214.462 1.00 34.07  ? 4    DG  E N9    1 
ATOM   70    C  C8    . DG  A 1 4   ? 23.743  13.015  214.607 1.00 40.00  ? 4    DG  E C8    1 
ATOM   71    N  N7    . DG  A 1 4   ? 23.128  12.155  213.844 1.00 39.35  ? 4    DG  E N7    1 
ATOM   72    C  C5    . DG  A 1 4   ? 24.150  11.511  213.162 1.00 37.52  ? 4    DG  E C5    1 
ATOM   73    C  C6    . DG  A 1 4   ? 24.106  10.455  212.216 1.00 40.65  ? 4    DG  E C6    1 
ATOM   74    O  O6    . DG  A 1 4   ? 23.127  9.851   211.780 1.00 43.20  ? 4    DG  E O6    1 
ATOM   75    N  N1    . DG  A 1 4   ? 25.378  10.109  211.776 1.00 46.89  ? 4    DG  E N1    1 
ATOM   76    C  C2    . DG  A 1 4   ? 26.544  10.696  212.192 1.00 42.79  ? 4    DG  E C2    1 
ATOM   77    N  N2    . DG  A 1 4   ? 27.668  10.238  211.630 1.00 47.92  ? 4    DG  E N2    1 
ATOM   78    N  N3    . DG  A 1 4   ? 26.601  11.664  213.088 1.00 45.05  ? 4    DG  E N3    1 
ATOM   79    C  C4    . DG  A 1 4   ? 25.377  12.020  213.527 1.00 36.74  ? 4    DG  E C4    1 
ATOM   80    P  P     . DG  A 1 5   ? 29.125  16.711  216.393 1.00 44.12  ? 5    DG  E P     1 
ATOM   81    O  OP1   . DG  A 1 5   ? 29.310  16.160  217.757 1.00 34.35  ? 5    DG  E OP1   1 
ATOM   82    O  OP2   . DG  A 1 5   ? 28.825  18.159  216.202 1.00 34.21  ? 5    DG  E OP2   1 
ATOM   83    O  "O5'" . DG  A 1 5   ? 30.395  16.323  215.521 1.00 37.29  ? 5    DG  E "O5'" 1 
ATOM   84    C  "C5'" . DG  A 1 5   ? 30.923  15.006  215.566 1.00 30.09  ? 5    DG  E "C5'" 1 
ATOM   85    C  "C4'" . DG  A 1 5   ? 31.453  14.617  214.205 1.00 31.57  ? 5    DG  E "C4'" 1 
ATOM   86    O  "O4'" . DG  A 1 5   ? 30.376  14.248  213.308 1.00 22.42  ? 5    DG  E "O4'" 1 
ATOM   87    C  "C3'" . DG  A 1 5   ? 32.212  15.744  213.508 1.00 25.51  ? 5    DG  E "C3'" 1 
ATOM   88    O  "O3'" . DG  A 1 5   ? 33.378  15.226  212.860 1.00 29.67  ? 5    DG  E "O3'" 1 
ATOM   89    C  "C2'" . DG  A 1 5   ? 31.212  16.276  212.501 1.00 17.29  ? 5    DG  E "C2'" 1 
ATOM   90    C  "C1'" . DG  A 1 5   ? 30.444  15.025  212.129 1.00 17.28  ? 5    DG  E "C1'" 1 
ATOM   91    N  N9    . DG  A 1 5   ? 29.082  15.292  211.694 1.00 17.13  ? 5    DG  E N9    1 
ATOM   92    C  C8    . DG  A 1 5   ? 28.057  15.790  212.463 1.00 18.84  ? 5    DG  E C8    1 
ATOM   93    N  N7    . DG  A 1 5   ? 26.952  15.968  211.788 1.00 26.66  ? 5    DG  E N7    1 
ATOM   94    C  C5    . DG  A 1 5   ? 27.270  15.564  210.495 1.00 19.74  ? 5    DG  E C5    1 
ATOM   95    C  C6    . DG  A 1 5   ? 26.479  15.545  209.313 1.00 29.19  ? 5    DG  E C6    1 
ATOM   96    O  O6    . DG  A 1 5   ? 25.311  15.928  209.161 1.00 34.74  ? 5    DG  E O6    1 
ATOM   97    N  N1    . DG  A 1 5   ? 27.187  15.026  208.234 1.00 18.20  ? 5    DG  E N1    1 
ATOM   98    C  C2    . DG  A 1 5   ? 28.494  14.601  208.278 1.00 23.16  ? 5    DG  E C2    1 
ATOM   99    N  N2    . DG  A 1 5   ? 29.003  14.126  207.126 1.00 21.77  ? 5    DG  E N2    1 
ATOM   100   N  N3    . DG  A 1 5   ? 29.245  14.636  209.366 1.00 17.12  ? 5    DG  E N3    1 
ATOM   101   C  C4    . DG  A 1 5   ? 28.575  15.122  210.428 1.00 8.13   ? 5    DG  E C4    1 
ATOM   102   P  P     . DT  A 1 6   ? 34.401  16.235  212.159 1.00 32.23  ? 6    DT  E P     1 
ATOM   103   O  OP1   . DT  A 1 6   ? 35.753  15.642  212.235 1.00 33.86  ? 6    DT  E OP1   1 
ATOM   104   O  OP2   . DT  A 1 6   ? 34.133  17.551  212.770 1.00 25.67  ? 6    DT  E OP2   1 
ATOM   105   O  "O5'" . DT  A 1 6   ? 33.949  16.240  210.635 1.00 19.34  ? 6    DT  E "O5'" 1 
ATOM   106   C  "C5'" . DT  A 1 6   ? 34.094  15.060  209.871 1.00 11.45  ? 6    DT  E "C5'" 1 
ATOM   107   C  "C4'" . DT  A 1 6   ? 33.999  15.362  208.398 1.00 17.51  ? 6    DT  E "C4'" 1 
ATOM   108   O  "O4'" . DT  A 1 6   ? 32.618  15.460  207.958 1.00 30.38  ? 6    DT  E "O4'" 1 
ATOM   109   C  "C3'" . DT  A 1 6   ? 34.691  16.659  207.976 1.00 24.80  ? 6    DT  E "C3'" 1 
ATOM   110   O  "O3'" . DT  A 1 6   ? 35.533  16.375  206.859 1.00 24.92  ? 6    DT  E "O3'" 1 
ATOM   111   C  "C2'" . DT  A 1 6   ? 33.543  17.569  207.562 1.00 29.63  ? 6    DT  E "C2'" 1 
ATOM   112   C  "C1'" . DT  A 1 6   ? 32.485  16.575  207.086 1.00 32.38  ? 6    DT  E "C1'" 1 
ATOM   113   N  N1    . DT  A 1 6   ? 31.086  17.078  207.173 1.00 28.42  ? 6    DT  E N1    1 
ATOM   114   C  C2    . DT  A 1 6   ? 30.287  17.076  206.039 1.00 28.35  ? 6    DT  E C2    1 
ATOM   115   O  O2    . DT  A 1 6   ? 30.626  16.594  204.972 1.00 27.15  ? 6    DT  E O2    1 
ATOM   116   N  N3    . DT  A 1 6   ? 29.057  17.657  206.210 1.00 30.16  ? 6    DT  E N3    1 
ATOM   117   C  C4    . DT  A 1 6   ? 28.544  18.203  207.370 1.00 24.07  ? 6    DT  E C4    1 
ATOM   118   O  O4    . DT  A 1 6   ? 27.440  18.729  207.351 1.00 21.46  ? 6    DT  E O4    1 
ATOM   119   C  C5    . DT  A 1 6   ? 29.407  18.110  208.530 1.00 14.61  ? 6    DT  E C5    1 
ATOM   120   C  C7    . DT  A 1 6   ? 28.918  18.619  209.849 1.00 26.97  ? 6    DT  E C7    1 
ATOM   121   C  C6    . DT  A 1 6   ? 30.615  17.567  208.371 1.00 19.07  ? 6    DT  E C6    1 
ATOM   122   P  P     . DC  A 1 7   ? 36.594  17.464  206.340 1.00 27.51  ? 7    DC  E P     1 
ATOM   123   O  OP1   . DC  A 1 7   ? 37.950  16.851  206.349 1.00 14.28  ? 7    DC  E OP1   1 
ATOM   124   O  OP2   . DC  A 1 7   ? 36.361  18.729  207.064 1.00 32.21  ? 7    DC  E OP2   1 
ATOM   125   O  "O5'" . DC  A 1 7   ? 36.150  17.645  204.826 1.00 23.62  ? 7    DC  E "O5'" 1 
ATOM   126   C  "C5'" . DC  A 1 7   ? 35.922  16.483  204.041 1.00 36.26  ? 7    DC  E "C5'" 1 
ATOM   127   C  "C4'" . DC  A 1 7   ? 35.116  16.819  202.813 1.00 41.89  ? 7    DC  E "C4'" 1 
ATOM   128   O  "O4'" . DC  A 1 7   ? 33.715  16.938  203.166 1.00 35.80  ? 7    DC  E "O4'" 1 
ATOM   129   C  "C3'" . DC  A 1 7   ? 35.543  18.157  202.218 1.00 43.96  ? 7    DC  E "C3'" 1 
ATOM   130   O  "O3'" . DC  A 1 7   ? 35.957  18.046  200.859 1.00 38.45  ? 7    DC  E "O3'" 1 
ATOM   131   C  "C2'" . DC  A 1 7   ? 34.305  19.035  202.304 1.00 55.19  ? 7    DC  E "C2'" 1 
ATOM   132   C  "C1'" . DC  A 1 7   ? 33.157  18.058  202.512 1.00 40.97  ? 7    DC  E "C1'" 1 
ATOM   133   N  N1    . DC  A 1 7   ? 32.139  18.653  203.389 1.00 39.26  ? 7    DC  E N1    1 
ATOM   134   C  C2    . DC  A 1 7   ? 30.806  18.628  202.988 1.00 33.67  ? 7    DC  E C2    1 
ATOM   135   O  O2    . DC  A 1 7   ? 30.481  17.908  202.038 1.00 28.73  ? 7    DC  E O2    1 
ATOM   136   N  N3    . DC  A 1 7   ? 29.908  19.379  203.661 1.00 27.28  ? 7    DC  E N3    1 
ATOM   137   C  C4    . DC  A 1 7   ? 30.305  20.114  204.702 1.00 32.80  ? 7    DC  E C4    1 
ATOM   138   N  N4    . DC  A 1 7   ? 29.434  20.937  205.261 1.00 15.92  ? 7    DC  E N4    1 
ATOM   139   C  C5    . DC  A 1 7   ? 31.632  20.054  205.201 1.00 33.71  ? 7    DC  E C5    1 
ATOM   140   C  C6    . DC  A 1 7   ? 32.507  19.309  204.527 1.00 20.32  ? 7    DC  E C6    1 
ATOM   141   P  P     . DG  A 1 8   ? 36.749  19.275  200.177 1.00 33.35  ? 8    DG  E P     1 
ATOM   142   O  OP1   . DG  A 1 8   ? 37.650  18.743  199.131 1.00 30.31  ? 8    DG  E OP1   1 
ATOM   143   O  OP2   . DG  A 1 8   ? 37.309  20.151  201.251 1.00 8.67   ? 8    DG  E OP2   1 
ATOM   144   O  "O5'" . DG  A 1 8   ? 35.568  20.067  199.470 1.00 36.90  ? 8    DG  E "O5'" 1 
ATOM   145   C  "C5'" . DG  A 1 8   ? 34.605  19.341  198.706 1.00 44.54  ? 8    DG  E "C5'" 1 
ATOM   146   C  "C4'" . DG  A 1 8   ? 33.680  20.296  198.001 1.00 37.78  ? 8    DG  E "C4'" 1 
ATOM   147   O  "O4'" . DG  A 1 8   ? 32.421  20.399  198.710 1.00 25.87  ? 8    DG  E "O4'" 1 
ATOM   148   C  "C3'" . DG  A 1 8   ? 34.288  21.694  197.987 1.00 41.70  ? 8    DG  E "C3'" 1 
ATOM   149   O  "O3'" . DG  A 1 8   ? 34.321  22.255  196.683 1.00 39.41  ? 8    DG  E "O3'" 1 
ATOM   150   C  "C2'" . DG  A 1 8   ? 33.376  22.513  198.879 1.00 35.02  ? 8    DG  E "C2'" 1 
ATOM   151   C  "C1'" . DG  A 1 8   ? 32.065  21.758  198.850 1.00 20.19  ? 8    DG  E "C1'" 1 
ATOM   152   N  N9    . DG  A 1 8   ? 31.373  21.931  200.122 1.00 21.29  ? 8    DG  E N9    1 
ATOM   153   C  C8    . DG  A 1 8   ? 31.905  21.732  201.369 1.00 13.35  ? 8    DG  E C8    1 
ATOM   154   N  N7    . DG  A 1 8   ? 31.130  22.161  202.327 1.00 33.35  ? 8    DG  E N7    1 
ATOM   155   C  C5    . DG  A 1 8   ? 29.997  22.627  201.673 1.00 21.51  ? 8    DG  E C5    1 
ATOM   156   C  C6    . DG  A 1 8   ? 28.817  23.223  202.187 1.00 22.39  ? 8    DG  E C6    1 
ATOM   157   O  O6    . DG  A 1 8   ? 28.547  23.535  203.358 1.00 9.46   ? 8    DG  E O6    1 
ATOM   158   N  N1    . DG  A 1 8   ? 27.898  23.478  201.180 1.00 8.92   ? 8    DG  E N1    1 
ATOM   159   C  C2    . DG  A 1 8   ? 28.090  23.230  199.846 1.00 22.96  ? 8    DG  E C2    1 
ATOM   160   N  N2    . DG  A 1 8   ? 27.060  23.551  199.039 1.00 30.44  ? 8    DG  E N2    1 
ATOM   161   N  N3    . DG  A 1 8   ? 29.200  22.710  199.344 1.00 16.34  ? 8    DG  E N3    1 
ATOM   162   C  C4    . DG  A 1 8   ? 30.106  22.433  200.313 1.00 20.39  ? 8    DG  E C4    1 
ATOM   163   P  P     . DA  A 1 9   ? 35.225  23.548  196.421 1.00 35.12  ? 9    DA  E P     1 
ATOM   164   O  OP1   . DA  A 1 9   ? 35.647  23.513  195.009 1.00 30.72  ? 9    DA  E OP1   1 
ATOM   165   O  OP2   . DA  A 1 9   ? 36.248  23.634  197.499 1.00 29.92  ? 9    DA  E OP2   1 
ATOM   166   O  "O5'" . DA  A 1 9   ? 34.180  24.726  196.624 1.00 43.64  ? 9    DA  E "O5'" 1 
ATOM   167   C  "C5'" . DA  A 1 9   ? 32.968  24.705  195.887 1.00 25.17  ? 9    DA  E "C5'" 1 
ATOM   168   C  "C4'" . DA  A 1 9   ? 32.077  25.836  196.324 1.00 19.59  ? 9    DA  E "C4'" 1 
ATOM   169   O  "O4'" . DA  A 1 9   ? 31.546  25.598  197.652 1.00 25.20  ? 9    DA  E "O4'" 1 
ATOM   170   C  "C3'" . DA  A 1 9   ? 32.803  27.174  196.394 1.00 20.58  ? 9    DA  E "C3'" 1 
ATOM   171   O  "O3'" . DA  A 1 9   ? 31.940  28.159  195.843 1.00 34.34  ? 9    DA  E "O3'" 1 
ATOM   172   C  "C2'" . DA  A 1 9   ? 32.926  27.412  197.887 1.00 19.00  ? 9    DA  E "C2'" 1 
ATOM   173   C  "C1'" . DA  A 1 9   ? 31.634  26.804  198.361 1.00 20.52  ? 9    DA  E "C1'" 1 
ATOM   174   N  N9    . DA  A 1 9   ? 31.565  26.539  199.798 1.00 21.01  ? 9    DA  E N9    1 
ATOM   175   C  C8    . DA  A 1 9   ? 32.609  26.277  200.644 1.00 26.27  ? 9    DA  E C8    1 
ATOM   176   N  N7    . DA  A 1 9   ? 32.274  26.253  201.913 1.00 21.49  ? 9    DA  E N7    1 
ATOM   177   C  C5    . DA  A 1 9   ? 30.911  26.489  201.903 1.00 6.84   ? 9    DA  E C5    1 
ATOM   178   C  C6    . DA  A 1 9   ? 29.970  26.610  202.940 1.00 16.74  ? 9    DA  E C6    1 
ATOM   179   N  N6    . DA  A 1 9   ? 30.309  26.613  204.232 1.00 14.42  ? 9    DA  E N6    1 
ATOM   180   N  N1    . DA  A 1 9   ? 28.658  26.759  202.601 1.00 3.42   ? 9    DA  E N1    1 
ATOM   181   C  C2    . DA  A 1 9   ? 28.344  26.827  201.297 1.00 17.33  ? 9    DA  E C2    1 
ATOM   182   N  N3    . DA  A 1 9   ? 29.160  26.777  200.219 1.00 11.48  ? 9    DA  E N3    1 
ATOM   183   C  C4    . DA  A 1 9   ? 30.447  26.605  200.601 1.00 21.84  ? 9    DA  E C4    1 
ATOM   184   P  P     . DC  A 1 10  ? 32.539  29.521  195.256 1.00 32.49  ? 10   DC  E P     1 
ATOM   185   O  OP1   . DC  A 1 10  ? 33.183  29.307  193.935 1.00 32.60  ? 10   DC  E OP1   1 
ATOM   186   O  OP2   . DC  A 1 10  ? 33.297  30.158  196.354 1.00 44.75  ? 10   DC  E OP2   1 
ATOM   187   O  "O5'" . DC  A 1 10  ? 31.223  30.370  195.022 1.00 30.45  ? 10   DC  E "O5'" 1 
ATOM   188   C  "C5'" . DC  A 1 10  ? 30.817  31.308  195.989 1.00 31.36  ? 10   DC  E "C5'" 1 
ATOM   189   C  "C4'" . DC  A 1 10  ? 29.428  31.008  196.498 1.00 22.23  ? 10   DC  E "C4'" 1 
ATOM   190   O  "O4'" . DC  A 1 10  ? 29.514  30.050  197.595 1.00 36.26  ? 10   DC  E "O4'" 1 
ATOM   191   C  "C3'" . DC  A 1 10  ? 28.813  32.270  197.095 1.00 34.32  ? 10   DC  E "C3'" 1 
ATOM   192   O  "O3'" . DC  A 1 10  ? 27.534  32.540  196.584 1.00 28.94  ? 10   DC  E "O3'" 1 
ATOM   193   C  "C2'" . DC  A 1 10  ? 28.684  32.005  198.580 1.00 34.04  ? 10   DC  E "C2'" 1 
ATOM   194   C  "C1'" . DC  A 1 10  ? 28.752  30.503  198.714 1.00 18.64  ? 10   DC  E "C1'" 1 
ATOM   195   N  N1    . DC  A 1 10  ? 29.515  30.247  199.931 1.00 18.36  ? 10   DC  E N1    1 
ATOM   196   C  C2    . DC  A 1 10  ? 28.832  30.053  201.120 1.00 17.33  ? 10   DC  E C2    1 
ATOM   197   O  O2    . DC  A 1 10  ? 27.626  29.912  201.089 1.00 26.10  ? 10   DC  E O2    1 
ATOM   198   N  N3    . DC  A 1 10  ? 29.519  30.005  202.278 1.00 34.74  ? 10   DC  E N3    1 
ATOM   199   C  C4    . DC  A 1 10  ? 30.849  30.113  202.266 1.00 29.79  ? 10   DC  E C4    1 
ATOM   200   N  N4    . DC  A 1 10  ? 31.479  30.124  203.433 1.00 9.43   ? 10   DC  E N4    1 
ATOM   201   C  C5    . DC  A 1 10  ? 31.583  30.228  201.052 1.00 6.62   ? 10   DC  E C5    1 
ATOM   202   C  C6    . DC  A 1 10  ? 30.880  30.280  199.916 1.00 16.74  ? 10   DC  E C6    1 
ATOM   203   P  P     . DC  A 1 11  ? 26.908  33.977  196.845 1.00 33.72  ? 11   DC  E P     1 
ATOM   204   O  OP1   . DC  A 1 11  ? 26.301  33.939  198.226 1.00 18.65  ? 11   DC  E OP1   1 
ATOM   205   O  OP2   . DC  A 1 11  ? 26.066  34.302  195.661 1.00 27.30  ? 11   DC  E OP2   1 
ATOM   206   O  "O5'" . DC  A 1 11  ? 28.186  34.935  196.891 1.00 41.89  ? 11   DC  E "O5'" 1 
ATOM   207   C  "C5'" . DC  A 1 11  ? 28.029  36.354  196.838 1.00 35.97  ? 11   DC  E "C5'" 1 
ATOM   208   C  "C4'" . DC  A 1 11  ? 27.349  36.833  198.097 1.00 29.97  ? 11   DC  E "C4'" 1 
ATOM   209   O  "O4'" . DC  A 1 11  ? 28.157  36.541  199.267 1.00 32.11  ? 11   DC  E "O4'" 1 
ATOM   210   C  "C3'" . DC  A 1 11  ? 27.045  38.329  198.151 1.00 27.60  ? 11   DC  E "C3'" 1 
ATOM   211   O  "O3'" . DC  A 1 11  ? 25.710  38.479  198.629 1.00 36.20  ? 11   DC  E "O3'" 1 
ATOM   212   C  "C2'" . DC  A 1 11  ? 28.016  38.856  199.191 1.00 29.56  ? 11   DC  E "C2'" 1 
ATOM   213   C  "C1'" . DC  A 1 11  ? 28.120  37.676  200.125 1.00 24.83  ? 11   DC  E "C1'" 1 
ATOM   214   N  N1    . DC  A 1 11  ? 29.324  37.666  200.985 1.00 32.49  ? 11   DC  E N1    1 
ATOM   215   C  C2    . DC  A 1 11  ? 29.194  37.294  202.341 1.00 31.96  ? 11   DC  E C2    1 
ATOM   216   O  O2    . DC  A 1 11  ? 28.082  36.948  202.770 1.00 34.81  ? 11   DC  E O2    1 
ATOM   217   N  N3    . DC  A 1 11  ? 30.290  37.315  203.142 1.00 22.78  ? 11   DC  E N3    1 
ATOM   218   C  C4    . DC  A 1 11  ? 31.478  37.679  202.642 1.00 36.85  ? 11   DC  E C4    1 
ATOM   219   N  N4    . DC  A 1 11  ? 32.528  37.713  203.483 1.00 16.21  ? 11   DC  E N4    1 
ATOM   220   C  C5    . DC  A 1 11  ? 31.641  38.036  201.264 1.00 28.04  ? 11   DC  E C5    1 
ATOM   221   C  C6    . DC  A 1 11  ? 30.548  38.016  200.482 1.00 22.43  ? 11   DC  E C6    1 
ATOM   222   P  P     . DG  A 1 12  ? 25.015  39.925  198.652 1.00 36.82  ? 12   DG  E P     1 
ATOM   223   O  OP1   . DG  A 1 12  ? 23.645  39.736  198.124 1.00 20.68  ? 12   DG  E OP1   1 
ATOM   224   O  OP2   . DG  A 1 12  ? 25.917  40.918  198.019 1.00 27.24  ? 12   DG  E OP2   1 
ATOM   225   O  "O5'" . DG  A 1 12  ? 24.879  40.210  200.208 1.00 21.74  ? 12   DG  E "O5'" 1 
ATOM   226   C  "C5'" . DG  A 1 12  ? 24.199  39.267  201.017 1.00 32.20  ? 12   DG  E "C5'" 1 
ATOM   227   C  "C4'" . DG  A 1 12  ? 24.199  39.706  202.458 1.00 31.15  ? 12   DG  E "C4'" 1 
ATOM   228   O  "O4'" . DG  A 1 12  ? 25.497  39.519  203.063 1.00 37.11  ? 12   DG  E "O4'" 1 
ATOM   229   C  "C3'" . DG  A 1 12  ? 23.861  41.176  202.643 1.00 25.24  ? 12   DG  E "C3'" 1 
ATOM   230   O  "O3'" . DG  A 1 12  ? 23.099  41.296  203.831 1.00 26.34  ? 12   DG  E "O3'" 1 
ATOM   231   C  "C2'" . DG  A 1 12  ? 25.220  41.832  202.795 1.00 18.74  ? 12   DG  E "C2'" 1 
ATOM   232   C  "C1'" . DG  A 1 12  ? 25.989  40.763  203.542 1.00 23.12  ? 12   DG  E "C1'" 1 
ATOM   233   N  N9    . DG  A 1 12  ? 27.434  40.768  203.343 1.00 30.13  ? 12   DG  E N9    1 
ATOM   234   C  C8    . DG  A 1 12  ? 28.134  41.074  202.194 1.00 17.49  ? 12   DG  E C8    1 
ATOM   235   N  N7    . DG  A 1 12  ? 29.427  40.975  202.348 1.00 26.29  ? 12   DG  E N7    1 
ATOM   236   C  C5    . DG  A 1 12  ? 29.587  40.582  203.675 1.00 23.26  ? 12   DG  E C5    1 
ATOM   237   C  C6    . DG  A 1 12  ? 30.765  40.321  204.428 1.00 35.23  ? 12   DG  E C6    1 
ATOM   238   O  O6    . DG  A 1 12  ? 31.955  40.396  204.067 1.00 36.92  ? 12   DG  E O6    1 
ATOM   239   N  N1    . DG  A 1 12  ? 30.459  39.940  205.727 1.00 19.08  ? 12   DG  E N1    1 
ATOM   240   C  C2    . DG  A 1 12  ? 29.195  39.824  206.236 1.00 10.58  ? 12   DG  E C2    1 
ATOM   241   N  N2    . DG  A 1 12  ? 29.103  39.417  207.510 1.00 21.80  ? 12   DG  E N2    1 
ATOM   242   N  N3    . DG  A 1 12  ? 28.102  40.075  205.557 1.00 14.31  ? 12   DG  E N3    1 
ATOM   243   C  C4    . DG  A 1 12  ? 28.368  40.446  204.295 1.00 16.43  ? 12   DG  E C4    1 
ATOM   244   P  P     . DG  A 1 13  ? 22.040  42.476  203.958 1.00 37.03  ? 13   DG  E P     1 
ATOM   245   O  OP1   . DG  A 1 13  ? 22.203  43.256  202.702 1.00 27.14  ? 13   DG  E OP1   1 
ATOM   246   O  OP2   . DG  A 1 13  ? 22.266  43.112  205.278 1.00 23.04  ? 13   DG  E OP2   1 
ATOM   247   O  "O5'" . DG  A 1 13  ? 20.605  41.774  203.965 1.00 49.35  ? 13   DG  E "O5'" 1 
ATOM   248   C  "C5'" . DG  A 1 13  ? 20.195  40.929  205.047 1.00 64.53  ? 13   DG  E "C5'" 1 
ATOM   249   C  "C4'" . DG  A 1 13  ? 18.690  40.758  205.051 1.00 77.60  ? 13   DG  E "C4'" 1 
ATOM   250   O  "O4'" . DG  A 1 13  ? 18.046  41.945  205.569 1.00 86.02  ? 13   DG  E "O4'" 1 
ATOM   251   C  "C3'" . DG  A 1 13  ? 18.046  40.488  203.689 1.00 84.15  ? 13   DG  E "C3'" 1 
ATOM   252   O  "O3'" . DG  A 1 13  ? 16.882  39.653  203.776 1.00 82.43  ? 13   DG  E "O3'" 1 
ATOM   253   C  "C2'" . DG  A 1 13  ? 17.506  41.849  203.293 1.00 82.48  ? 13   DG  E "C2'" 1 
ATOM   254   C  "C1'" . DG  A 1 13  ? 17.087  42.417  204.635 1.00 86.70  ? 13   DG  E "C1'" 1 
ATOM   255   N  N9    . DG  A 1 13  ? 17.071  43.877  204.693 1.00 101.34 ? 13   DG  E N9    1 
ATOM   256   C  C8    . DG  A 1 13  ? 18.023  44.738  204.198 1.00 101.18 ? 13   DG  E C8    1 
ATOM   257   N  N7    . DG  A 1 13  ? 17.712  45.997  204.360 1.00 104.34 ? 13   DG  E N7    1 
ATOM   258   C  C5    . DG  A 1 13  ? 16.485  45.967  205.011 1.00 109.51 ? 13   DG  E C5    1 
ATOM   259   C  C6    . DG  A 1 13  ? 15.644  47.030  205.445 1.00 110.80 ? 13   DG  E C6    1 
ATOM   260   O  O6    . DG  A 1 13  ? 15.814  48.250  205.320 1.00 113.23 ? 13   DG  E O6    1 
ATOM   261   N  N1    . DG  A 1 13  ? 14.499  46.550  206.078 1.00 108.85 ? 13   DG  E N1    1 
ATOM   262   C  C2    . DG  A 1 13  ? 14.196  45.225  206.264 1.00 106.49 ? 13   DG  E C2    1 
ATOM   263   N  N2    . DG  A 1 13  ? 13.047  44.967  206.904 1.00 104.65 ? 13   DG  E N2    1 
ATOM   264   N  N3    . DG  A 1 13  ? 14.963  44.225  205.853 1.00 108.63 ? 13   DG  E N3    1 
ATOM   265   C  C4    . DG  A 1 13  ? 16.083  44.665  205.239 1.00 108.25 ? 13   DG  E C4    1 
ATOM   266   O  "O5'" . DG  B 1 1   ? 41.842  43.820  203.705 1.00 58.13  ? 1    DG  F "O5'" 1 
ATOM   267   C  "C5'" . DG  B 1 1   ? 41.216  43.018  204.722 1.00 47.42  ? 1    DG  F "C5'" 1 
ATOM   268   C  "C4'" . DG  B 1 1   ? 41.647  43.487  206.091 1.00 38.74  ? 1    DG  F "C4'" 1 
ATOM   269   O  "O4'" . DG  B 1 1   ? 41.231  44.861  206.272 1.00 36.70  ? 1    DG  F "O4'" 1 
ATOM   270   C  "C3'" . DG  B 1 1   ? 40.989  42.688  207.211 1.00 51.25  ? 1    DG  F "C3'" 1 
ATOM   271   O  "O3'" . DG  B 1 1   ? 41.921  42.103  208.110 1.00 65.63  ? 1    DG  F "O3'" 1 
ATOM   272   C  "C2'" . DG  B 1 1   ? 40.024  43.639  207.902 1.00 40.97  ? 1    DG  F "C2'" 1 
ATOM   273   C  "C1'" . DG  B 1 1   ? 40.127  44.959  207.162 1.00 26.53  ? 1    DG  F "C1'" 1 
ATOM   274   N  N9    . DG  B 1 1   ? 38.931  45.117  206.339 1.00 32.81  ? 1    DG  F N9    1 
ATOM   275   C  C8    . DG  B 1 1   ? 38.852  44.970  204.976 1.00 27.21  ? 1    DG  F C8    1 
ATOM   276   N  N7    . DG  B 1 1   ? 37.632  45.060  204.521 1.00 35.31  ? 1    DG  F N7    1 
ATOM   277   C  C5    . DG  B 1 1   ? 36.859  45.306  205.647 1.00 21.28  ? 1    DG  F C5    1 
ATOM   278   C  C6    . DG  B 1 1   ? 35.463  45.475  205.773 1.00 24.00  ? 1    DG  F C6    1 
ATOM   279   O  O6    . DG  B 1 1   ? 34.605  45.417  204.891 1.00 28.17  ? 1    DG  F O6    1 
ATOM   280   N  N1    . DG  B 1 1   ? 35.091  45.723  207.090 1.00 14.94  ? 1    DG  F N1    1 
ATOM   281   C  C2    . DG  B 1 1   ? 35.956  45.789  208.151 1.00 34.64  ? 1    DG  F C2    1 
ATOM   282   N  N2    . DG  B 1 1   ? 35.409  46.065  209.345 1.00 43.18  ? 1    DG  F N2    1 
ATOM   283   N  N3    . DG  B 1 1   ? 37.266  45.606  208.050 1.00 31.47  ? 1    DG  F N3    1 
ATOM   284   C  C4    . DG  B 1 1   ? 37.645  45.372  206.775 1.00 31.64  ? 1    DG  F C4    1 
ATOM   285   P  P     . DC  B 1 2   ? 41.620  40.634  208.687 1.00 64.00  ? 2    DC  F P     1 
ATOM   286   O  OP1   . DC  B 1 2   ? 42.777  40.187  209.518 1.00 69.45  ? 2    DC  F OP1   1 
ATOM   287   O  OP2   . DC  B 1 2   ? 41.158  39.793  207.562 1.00 53.56  ? 2    DC  F OP2   1 
ATOM   288   O  "O5'" . DC  B 1 2   ? 40.355  40.888  209.619 1.00 56.68  ? 2    DC  F "O5'" 1 
ATOM   289   C  "C5'" . DC  B 1 2   ? 40.331  41.979  210.553 1.00 53.25  ? 2    DC  F "C5'" 1 
ATOM   290   C  "C4'" . DC  B 1 2   ? 39.023  41.979  211.304 1.00 47.70  ? 2    DC  F "C4'" 1 
ATOM   291   O  "O4'" . DC  B 1 2   ? 38.002  42.709  210.562 1.00 49.03  ? 2    DC  F "O4'" 1 
ATOM   292   C  "C3'" . DC  B 1 2   ? 38.511  40.553  211.472 1.00 46.76  ? 2    DC  F "C3'" 1 
ATOM   293   O  "O3'" . DC  B 1 2   ? 38.004  40.299  212.770 1.00 45.25  ? 2    DC  F "O3'" 1 
ATOM   294   C  "C2'" . DC  B 1 2   ? 37.404  40.433  210.445 1.00 56.39  ? 2    DC  F "C2'" 1 
ATOM   295   C  "C1'" . DC  B 1 2   ? 36.894  41.863  210.274 1.00 45.52  ? 2    DC  F "C1'" 1 
ATOM   296   N  N1    . DC  B 1 2   ? 36.463  42.102  208.885 1.00 26.56  ? 2    DC  F N1    1 
ATOM   297   C  C2    . DC  B 1 2   ? 35.115  42.395  208.625 1.00 24.28  ? 2    DC  F C2    1 
ATOM   298   O  O2    . DC  B 1 2   ? 34.362  42.641  209.569 1.00 32.90  ? 2    DC  F O2    1 
ATOM   299   N  N3    . DC  B 1 2   ? 34.680  42.424  207.344 1.00 17.68  ? 2    DC  F N3    1 
ATOM   300   C  C4    . DC  B 1 2   ? 35.544  42.207  206.345 1.00 24.66  ? 2    DC  F C4    1 
ATOM   301   N  N4    . DC  B 1 2   ? 35.078  42.171  205.105 1.00 18.55  ? 2    DC  F N4    1 
ATOM   302   C  C5    . DC  B 1 2   ? 36.935  42.004  206.580 1.00 25.50  ? 2    DC  F C5    1 
ATOM   303   C  C6    . DC  B 1 2   ? 37.347  41.962  207.855 1.00 20.70  ? 2    DC  F C6    1 
ATOM   304   P  P     . DC  B 1 3   ? 37.649  38.788  213.179 1.00 64.31  ? 3    DC  F P     1 
ATOM   305   O  OP1   . DC  B 1 3   ? 37.907  38.669  214.650 1.00 52.22  ? 3    DC  F OP1   1 
ATOM   306   O  OP2   . DC  B 1 3   ? 38.329  37.840  212.229 1.00 30.58  ? 3    DC  F OP2   1 
ATOM   307   O  "O5'" . DC  B 1 3   ? 36.081  38.683  212.888 1.00 51.05  ? 3    DC  F "O5'" 1 
ATOM   308   C  "C5'" . DC  B 1 3   ? 35.139  39.344  213.732 1.00 38.36  ? 3    DC  F "C5'" 1 
ATOM   309   C  "C4'" . DC  B 1 3   ? 33.729  38.923  213.390 1.00 32.52  ? 3    DC  F "C4'" 1 
ATOM   310   O  "O4'" . DC  B 1 3   ? 33.352  39.428  212.080 1.00 33.93  ? 3    DC  F "O4'" 1 
ATOM   311   C  "C3'" . DC  B 1 3   ? 33.486  37.415  213.353 1.00 30.79  ? 3    DC  F "C3'" 1 
ATOM   312   O  "O3'" . DC  B 1 3   ? 32.240  37.120  213.975 1.00 15.53  ? 3    DC  F "O3'" 1 
ATOM   313   C  "C2'" . DC  B 1 3   ? 33.404  37.096  211.868 1.00 21.82  ? 3    DC  F "C2'" 1 
ATOM   314   C  "C1'" . DC  B 1 3   ? 32.851  38.381  211.269 1.00 19.54  ? 3    DC  F "C1'" 1 
ATOM   315   N  N1    . DC  B 1 3   ? 33.277  38.646  209.894 1.00 16.03  ? 3    DC  F N1    1 
ATOM   316   C  C2    . DC  B 1 3   ? 32.305  38.874  208.915 1.00 31.38  ? 3    DC  F C2    1 
ATOM   317   O  O2    . DC  B 1 3   ? 31.107  38.841  209.236 1.00 27.26  ? 3    DC  F O2    1 
ATOM   318   N  N3    . DC  B 1 3   ? 32.697  39.122  207.638 1.00 38.13  ? 3    DC  F N3    1 
ATOM   319   C  C4    . DC  B 1 3   ? 33.999  39.140  207.329 1.00 36.74  ? 3    DC  F C4    1 
ATOM   320   N  N4    . DC  B 1 3   ? 34.339  39.397  206.069 1.00 39.60  ? 3    DC  F N4    1 
ATOM   321   C  C5    . DC  B 1 3   ? 35.008  38.902  208.305 1.00 27.92  ? 3    DC  F C5    1 
ATOM   322   C  C6    . DC  B 1 3   ? 34.605  38.669  209.567 1.00 32.57  ? 3    DC  F C6    1 
ATOM   323   P  P     . DG  B 1 4   ? 32.053  35.738  214.758 1.00 35.49  ? 4    DG  F P     1 
ATOM   324   O  OP1   . DG  B 1 4   ? 31.556  36.055  216.126 1.00 30.95  ? 4    DG  F OP1   1 
ATOM   325   O  OP2   . DG  B 1 4   ? 33.255  34.882  214.593 1.00 34.18  ? 4    DG  F OP2   1 
ATOM   326   O  "O5'" . DG  B 1 4   ? 30.897  35.027  213.936 1.00 37.20  ? 4    DG  F "O5'" 1 
ATOM   327   C  "C5'" . DG  B 1 4   ? 29.676  35.697  213.678 1.00 25.01  ? 4    DG  F "C5'" 1 
ATOM   328   C  "C4'" . DG  B 1 4   ? 29.006  35.105  212.460 1.00 35.15  ? 4    DG  F "C4'" 1 
ATOM   329   O  "O4'" . DG  B 1 4   ? 29.564  35.661  211.242 1.00 25.33  ? 4    DG  F "O4'" 1 
ATOM   330   C  "C3'" . DG  B 1 4   ? 29.125  33.580  212.343 1.00 36.28  ? 4    DG  F "C3'" 1 
ATOM   331   O  "O3'" . DG  B 1 4   ? 27.840  33.011  212.058 1.00 21.87  ? 4    DG  F "O3'" 1 
ATOM   332   C  "C2'" . DG  B 1 4   ? 30.067  33.387  211.165 1.00 28.98  ? 4    DG  F "C2'" 1 
ATOM   333   C  "C1'" . DG  B 1 4   ? 29.770  34.614  210.322 1.00 22.61  ? 4    DG  F "C1'" 1 
ATOM   334   N  N9    . DG  B 1 4   ? 30.837  35.006  209.416 1.00 22.97  ? 4    DG  F N9    1 
ATOM   335   C  C8    . DG  B 1 4   ? 32.188  34.899  209.622 1.00 27.01  ? 4    DG  F C8    1 
ATOM   336   N  N7    . DG  B 1 4   ? 32.894  35.273  208.589 1.00 29.80  ? 4    DG  F N7    1 
ATOM   337   C  C5    . DG  B 1 4   ? 31.951  35.665  207.650 1.00 20.17  ? 4    DG  F C5    1 
ATOM   338   C  C6    . DG  B 1 4   ? 32.113  36.160  206.334 1.00 32.34  ? 4    DG  F C6    1 
ATOM   339   O  O6    . DG  B 1 4   ? 33.160  36.338  205.701 1.00 43.11  ? 4    DG  F O6    1 
ATOM   340   N  N1    . DG  B 1 4   ? 30.885  36.453  205.743 1.00 30.21  ? 4    DG  F N1    1 
ATOM   341   C  C2    . DG  B 1 4   ? 29.661  36.282  206.341 1.00 22.57  ? 4    DG  F C2    1 
ATOM   342   N  N2    . DG  B 1 4   ? 28.594  36.623  205.611 1.00 38.18  ? 4    DG  F N2    1 
ATOM   343   N  N3    . DG  B 1 4   ? 29.497  35.812  207.562 1.00 18.17  ? 4    DG  F N3    1 
ATOM   344   C  C4    . DG  B 1 4   ? 30.676  35.527  208.155 1.00 26.88  ? 4    DG  F C4    1 
ATOM   345   P  P     . DG  B 1 5   ? 26.856  32.649  213.276 1.00 38.76  ? 5    DG  F P     1 
ATOM   346   O  OP1   . DG  B 1 5   ? 26.980  33.621  214.402 1.00 23.30  ? 5    DG  F OP1   1 
ATOM   347   O  OP2   . DG  B 1 5   ? 27.032  31.204  213.553 1.00 14.43  ? 5    DG  F OP2   1 
ATOM   348   O  "O5'" . DG  B 1 5   ? 25.436  32.934  212.639 1.00 40.27  ? 5    DG  F "O5'" 1 
ATOM   349   C  "C5'" . DG  B 1 5   ? 24.821  31.970  211.837 1.00 38.67  ? 5    DG  F "C5'" 1 
ATOM   350   C  "C4'" . DG  B 1 5   ? 24.331  32.580  210.549 1.00 30.62  ? 5    DG  F "C4'" 1 
ATOM   351   O  "O4'" . DG  B 1 5   ? 25.445  32.897  209.674 1.00 36.84  ? 5    DG  F "O4'" 1 
ATOM   352   C  "C3'" . DG  B 1 5   ? 23.508  31.540  209.813 1.00 27.24  ? 5    DG  F "C3'" 1 
ATOM   353   O  "O3'" . DG  B 1 5   ? 22.365  32.087  209.225 1.00 31.81  ? 5    DG  F "O3'" 1 
ATOM   354   C  "C2'" . DG  B 1 5   ? 24.436  30.996  208.759 1.00 35.49  ? 5    DG  F "C2'" 1 
ATOM   355   C  "C1'" . DG  B 1 5   ? 25.342  32.157  208.459 1.00 20.08  ? 5    DG  F "C1'" 1 
ATOM   356   N  N9    . DG  B 1 5   ? 26.663  31.652  208.126 1.00 13.25  ? 5    DG  F N9    1 
ATOM   357   C  C8    . DG  B 1 5   ? 27.715  31.490  208.995 1.00 19.88  ? 5    DG  F C8    1 
ATOM   358   N  N7    . DG  B 1 5   ? 28.785  31.009  208.422 1.00 19.86  ? 5    DG  F N7    1 
ATOM   359   C  C5    . DG  B 1 5   ? 28.419  30.855  207.088 1.00 15.06  ? 5    DG  F C5    1 
ATOM   360   C  C6    . DG  B 1 5   ? 29.171  30.392  205.978 1.00 17.19  ? 5    DG  F C6    1 
ATOM   361   O  O6    . DG  B 1 5   ? 30.358  30.050  205.940 1.00 17.87  ? 5    DG  F O6    1 
ATOM   362   N  N1    . DG  B 1 5   ? 28.403  30.360  204.818 1.00 17.53  ? 5    DG  F N1    1 
ATOM   363   C  C2    . DG  B 1 5   ? 27.083  30.740  204.732 1.00 27.69  ? 5    DG  F C2    1 
ATOM   364   N  N2    . DG  B 1 5   ? 26.509  30.619  203.513 1.00 16.50  ? 5    DG  F N2    1 
ATOM   365   N  N3    . DG  B 1 5   ? 26.378  31.200  205.756 1.00 9.11   ? 5    DG  F N3    1 
ATOM   366   C  C4    . DG  B 1 5   ? 27.104  31.229  206.894 1.00 13.12  ? 5    DG  F C4    1 
ATOM   367   P  P     . DT  B 1 6   ? 21.199  31.104  208.811 1.00 29.29  ? 6    DT  F P     1 
ATOM   368   O  OP1   . DT  B 1 6   ? 19.961  31.891  208.584 1.00 27.63  ? 6    DT  F OP1   1 
ATOM   369   O  OP2   . DT  B 1 6   ? 21.227  30.065  209.862 1.00 5.22   ? 6    DT  F OP2   1 
ATOM   370   O  "O5'" . DT  B 1 6   ? 21.736  30.498  207.442 1.00 6.46   ? 6    DT  F "O5'" 1 
ATOM   371   C  "C5'" . DT  B 1 6   ? 21.610  31.241  206.257 1.00 14.87  ? 6    DT  F "C5'" 1 
ATOM   372   C  "C4'" . DT  B 1 6   ? 21.600  30.309  205.077 1.00 27.98  ? 6    DT  F "C4'" 1 
ATOM   373   O  "O4'" . DT  B 1 6   ? 22.955  29.980  204.688 1.00 26.73  ? 6    DT  F "O4'" 1 
ATOM   374   C  "C3'" . DT  B 1 6   ? 20.893  28.987  205.381 1.00 32.96  ? 6    DT  F "C3'" 1 
ATOM   375   O  "O3'" . DT  B 1 6   ? 20.068  28.635  204.274 1.00 27.59  ? 6    DT  F "O3'" 1 
ATOM   376   C  "C2'" . DT  B 1 6   ? 22.044  28.007  205.518 1.00 30.33  ? 6    DT  F "C2'" 1 
ATOM   377   C  "C1'" . DT  B 1 6   ? 23.087  28.579  204.573 1.00 28.98  ? 6    DT  F "C1'" 1 
ATOM   378   N  N1    . DT  B 1 6   ? 24.481  28.213  204.924 1.00 34.45  ? 6    DT  F N1    1 
ATOM   379   C  C2    . DT  B 1 6   ? 25.336  27.779  203.927 1.00 33.32  ? 6    DT  F C2    1 
ATOM   380   O  O2    . DT  B 1 6   ? 25.031  27.766  202.747 1.00 19.32  ? 6    DT  F O2    1 
ATOM   381   N  N3    . DT  B 1 6   ? 26.578  27.372  204.368 1.00 24.60  ? 6    DT  F N3    1 
ATOM   382   C  C4    . DT  B 1 6   ? 27.041  27.373  205.672 1.00 27.65  ? 6    DT  F C4    1 
ATOM   383   O  O4    . DT  B 1 6   ? 28.171  26.948  205.927 1.00 23.28  ? 6    DT  F O4    1 
ATOM   384   C  C5    . DT  B 1 6   ? 26.108  27.884  206.657 1.00 32.30  ? 6    DT  F C5    1 
ATOM   385   C  C7    . DT  B 1 6   ? 26.524  27.940  208.094 1.00 28.63  ? 6    DT  F C7    1 
ATOM   386   C  C6    . DT  B 1 6   ? 24.897  28.277  206.236 1.00 36.07  ? 6    DT  F C6    1 
ATOM   387   P  P     . DC  B 1 7   ? 18.878  27.555  204.432 1.00 34.36  ? 7    DC  F P     1 
ATOM   388   O  OP1   . DC  B 1 7   ? 17.599  28.313  204.413 1.00 28.51  ? 7    DC  F OP1   1 
ATOM   389   O  OP2   . DC  B 1 7   ? 19.122  26.580  205.523 1.00 20.42  ? 7    DC  F OP2   1 
ATOM   390   O  "O5'" . DC  B 1 7   ? 19.014  26.794  203.041 1.00 24.02  ? 7    DC  F "O5'" 1 
ATOM   391   C  "C5'" . DC  B 1 7   ? 19.294  27.553  201.850 1.00 31.70  ? 7    DC  F "C5'" 1 
ATOM   392   C  "C4'" . DC  B 1 7   ? 20.062  26.721  200.850 1.00 31.03  ? 7    DC  F "C4'" 1 
ATOM   393   O  "O4'" . DC  B 1 7   ? 21.500  26.742  201.104 1.00 36.03  ? 7    DC  F "O4'" 1 
ATOM   394   C  "C3'" . DC  B 1 7   ? 19.633  25.266  200.933 1.00 40.31  ? 7    DC  F "C3'" 1 
ATOM   395   O  "O3'" . DC  B 1 7   ? 19.253  24.725  199.684 1.00 31.85  ? 7    DC  F "O3'" 1 
ATOM   396   C  "C2'" . DC  B 1 7   ? 20.852  24.528  201.451 1.00 42.98  ? 7    DC  F "C2'" 1 
ATOM   397   C  "C1'" . DC  B 1 7   ? 22.017  25.423  201.058 1.00 19.99  ? 7    DC  F "C1'" 1 
ATOM   398   N  N1    . DC  B 1 7   ? 23.076  25.264  202.070 1.00 22.95  ? 7    DC  F N1    1 
ATOM   399   C  C2    . DC  B 1 7   ? 24.413  25.145  201.665 1.00 8.37   ? 7    DC  F C2    1 
ATOM   400   O  O2    . DC  B 1 7   ? 24.726  25.455  200.509 1.00 10.45  ? 7    DC  F O2    1 
ATOM   401   N  N3    . DC  B 1 7   ? 25.325  24.709  202.554 1.00 1.00   ? 7    DC  F N3    1 
ATOM   402   C  C4    . DC  B 1 7   ? 24.965  24.460  203.812 1.00 5.41   ? 7    DC  F C4    1 
ATOM   403   N  N4    . DC  B 1 7   ? 25.872  23.929  204.629 1.00 4.96   ? 7    DC  F N4    1 
ATOM   404   C  C5    . DC  B 1 7   ? 23.650  24.716  204.282 1.00 3.51   ? 7    DC  F C5    1 
ATOM   405   C  C6    . DC  B 1 7   ? 22.745  25.122  203.389 1.00 13.85  ? 7    DC  F C6    1 
ATOM   406   P  P     . DG  B 1 8   ? 18.517  23.304  199.663 1.00 37.44  ? 8    DG  F P     1 
ATOM   407   O  OP1   . DG  B 1 8   ? 17.491  23.327  198.571 1.00 25.34  ? 8    DG  F OP1   1 
ATOM   408   O  OP2   . DG  B 1 8   ? 18.114  23.028  201.075 1.00 8.54   ? 8    DG  F OP2   1 
ATOM   409   O  "O5'" . DG  B 1 8   ? 19.685  22.283  199.304 1.00 35.74  ? 8    DG  F "O5'" 1 
ATOM   410   C  "C5'" . DG  B 1 8   ? 20.635  22.633  198.311 1.00 40.24  ? 8    DG  F "C5'" 1 
ATOM   411   C  "C4'" . DG  B 1 8   ? 21.570  21.478  198.064 1.00 37.14  ? 8    DG  F "C4'" 1 
ATOM   412   O  "O4'" . DG  B 1 8   ? 22.855  21.718  198.688 1.00 30.00  ? 8    DG  F "O4'" 1 
ATOM   413   C  "C3'" . DG  B 1 8   ? 21.031  20.187  198.667 1.00 34.70  ? 8    DG  F "C3'" 1 
ATOM   414   O  "O3'" . DG  B 1 8   ? 20.904  19.188  197.678 1.00 31.86  ? 8    DG  F "O3'" 1 
ATOM   415   C  "C2'" . DG  B 1 8   ? 22.071  19.759  199.685 1.00 27.67  ? 8    DG  F "C2'" 1 
ATOM   416   C  "C1'" . DG  B 1 8   ? 23.316  20.540  199.298 1.00 16.13  ? 8    DG  F "C1'" 1 
ATOM   417   N  N9    . DG  B 1 8   ? 24.025  20.912  200.510 1.00 18.10  ? 8    DG  F N9    1 
ATOM   418   C  C8    . DG  B 1 8   ? 23.479  21.526  201.603 1.00 21.47  ? 8    DG  F C8    1 
ATOM   419   N  N7    . DG  B 1 8   ? 24.271  21.524  202.636 1.00 22.67  ? 8    DG  F N7    1 
ATOM   420   C  C5    . DG  B 1 8   ? 25.433  20.928  202.174 1.00 25.06  ? 8    DG  F C5    1 
ATOM   421   C  C6    . DG  B 1 8   ? 26.642  20.644  202.843 1.00 33.77  ? 8    DG  F C6    1 
ATOM   422   O  O6    . DG  B 1 8   ? 26.924  20.827  204.025 1.00 27.29  ? 8    DG  F O6    1 
ATOM   423   N  N1    . DG  B 1 8   ? 27.583  20.078  201.987 1.00 33.27  ? 8    DG  F N1    1 
ATOM   424   C  C2    . DG  B 1 8   ? 27.382  19.810  200.658 1.00 36.81  ? 8    DG  F C2    1 
ATOM   425   N  N2    . DG  B 1 8   ? 28.427  19.299  199.991 1.00 45.31  ? 8    DG  F N2    1 
ATOM   426   N  N3    . DG  B 1 8   ? 26.242  20.040  200.027 1.00 36.18  ? 8    DG  F N3    1 
ATOM   427   C  C4    . DG  B 1 8   ? 25.316  20.599  200.844 1.00 24.72  ? 8    DG  F C4    1 
ATOM   428   P  P     . DA  B 1 9   ? 20.102  17.846  198.016 1.00 30.78  ? 9    DA  F P     1 
ATOM   429   O  OP1   . DA  B 1 9   ? 19.700  17.329  196.697 1.00 26.27  ? 9    DA  F OP1   1 
ATOM   430   O  OP2   . DA  B 1 9   ? 19.073  18.074  199.078 1.00 18.68  ? 9    DA  F OP2   1 
ATOM   431   O  "O5'" . DA  B 1 9   ? 21.234  16.905  198.617 1.00 42.59  ? 9    DA  F "O5'" 1 
ATOM   432   C  "C5'" . DA  B 1 9   ? 22.442  16.701  197.896 1.00 41.83  ? 9    DA  F "C5'" 1 
ATOM   433   C  "C4'" . DA  B 1 9   ? 23.351  15.788  198.676 1.00 33.72  ? 9    DA  F "C4'" 1 
ATOM   434   O  "O4'" . DA  B 1 9   ? 23.882  16.490  199.829 1.00 36.99  ? 9    DA  F "O4'" 1 
ATOM   435   C  "C3'" . DA  B 1 9   ? 22.593  14.578  199.227 1.00 32.15  ? 9    DA  F "C3'" 1 
ATOM   436   O  "O3'" . DA  B 1 9   ? 23.430  13.424  199.187 1.00 36.32  ? 9    DA  F "O3'" 1 
ATOM   437   C  "C2'" . DA  B 1 9   ? 22.362  14.956  200.676 1.00 32.44  ? 9    DA  F "C2'" 1 
ATOM   438   C  "C1'" . DA  B 1 9   ? 23.658  15.676  200.963 1.00 33.73  ? 9    DA  F "C1'" 1 
ATOM   439   N  N9    . DA  B 1 9   ? 23.650  16.495  202.172 1.00 22.64  ? 9    DA  F N9    1 
ATOM   440   C  C8    . DA  B 1 9   ? 22.570  17.032  202.814 1.00 32.99  ? 9    DA  F C8    1 
ATOM   441   N  N7    . DA  B 1 9   ? 22.860  17.571  203.974 1.00 29.75  ? 9    DA  F N7    1 
ATOM   442   C  C5    . DA  B 1 9   ? 24.229  17.408  204.084 1.00 13.00  ? 9    DA  F C5    1 
ATOM   443   C  C6    . DA  B 1 9   ? 25.137  17.733  205.093 1.00 14.44  ? 9    DA  F C6    1 
ATOM   444   N  N6    . DA  B 1 9   ? 24.793  18.275  206.252 1.00 21.60  ? 9    DA  F N6    1 
ATOM   445   N  N1    . DA  B 1 9   ? 26.436  17.458  204.877 1.00 20.05  ? 9    DA  F N1    1 
ATOM   446   C  C2    . DA  B 1 9   ? 26.785  16.866  203.732 1.00 15.12  ? 9    DA  F C2    1 
ATOM   447   N  N3    . DA  B 1 9   ? 26.023  16.486  202.724 1.00 19.33  ? 9    DA  F N3    1 
ATOM   448   C  C4    . DA  B 1 9   ? 24.735  16.792  202.961 1.00 13.95  ? 9    DA  F C4    1 
ATOM   449   P  P     . DC  B 1 10  ? 22.779  11.955  199.215 1.00 28.53  ? 10   DC  F P     1 
ATOM   450   O  OP1   . DC  B 1 10  ? 22.086  11.729  197.924 1.00 24.57  ? 10   DC  F OP1   1 
ATOM   451   O  OP2   . DC  B 1 10  ? 22.047  11.765  200.485 1.00 23.78  ? 10   DC  F OP2   1 
ATOM   452   O  "O5'" . DC  B 1 10  ? 24.058  11.019  199.290 1.00 31.08  ? 10   DC  F "O5'" 1 
ATOM   453   C  "C5'" . DC  B 1 10  ? 24.536  10.567  200.544 1.00 32.30  ? 10   DC  F "C5'" 1 
ATOM   454   C  "C4'" . DC  B 1 10  ? 25.938  11.063  200.819 1.00 31.82  ? 10   DC  F "C4'" 1 
ATOM   455   O  "O4'" . DC  B 1 10  ? 25.878  12.398  201.413 1.00 38.31  ? 10   DC  F "O4'" 1 
ATOM   456   C  "C3'" . DC  B 1 10  ? 26.617  10.176  201.860 1.00 30.15  ? 10   DC  F "C3'" 1 
ATOM   457   O  "O3'" . DC  B 1 10  ? 27.910  9.745   201.507 1.00 21.18  ? 10   DC  F "O3'" 1 
ATOM   458   C  "C2'" . DC  B 1 10  ? 26.723  11.027  203.106 1.00 38.53  ? 10   DC  F "C2'" 1 
ATOM   459   C  "C1'" . DC  B 1 10  ? 26.666  12.450  202.600 1.00 30.27  ? 10   DC  F "C1'" 1 
ATOM   460   N  N1    . DC  B 1 10  ? 25.958  13.244  203.611 1.00 32.64  ? 10   DC  F N1    1 
ATOM   461   C  C2    . DC  B 1 10  ? 26.691  13.809  204.657 1.00 18.43  ? 10   DC  F C2    1 
ATOM   462   O  O2    . DC  B 1 10  ? 27.915  13.752  204.628 1.00 34.75  ? 10   DC  F O2    1 
ATOM   463   N  N3    . DC  B 1 10  ? 26.039  14.409  205.672 1.00 37.06  ? 10   DC  F N3    1 
ATOM   464   C  C4    . DC  B 1 10  ? 24.708  14.473  205.661 1.00 40.00  ? 10   DC  F C4    1 
ATOM   465   N  N4    . DC  B 1 10  ? 24.108  15.025  206.710 1.00 48.94  ? 10   DC  F N4    1 
ATOM   466   C  C5    . DC  B 1 10  ? 23.938  13.964  204.579 1.00 30.79  ? 10   DC  F C5    1 
ATOM   467   C  C6    . DC  B 1 10  ? 24.601  13.372  203.576 1.00 32.53  ? 10   DC  F C6    1 
ATOM   468   P  P     . DC  B 1 11  ? 28.514  8.506   202.299 1.00 30.97  ? 11   DC  F P     1 
ATOM   469   O  OP1   . DC  B 1 11  ? 29.214  9.009   203.518 1.00 16.07  ? 11   DC  F OP1   1 
ATOM   470   O  OP2   . DC  B 1 11  ? 29.264  7.695   201.310 1.00 34.47  ? 11   DC  F OP2   1 
ATOM   471   O  "O5'" . DC  B 1 11  ? 27.176  7.756   202.766 1.00 25.87  ? 11   DC  F "O5'" 1 
ATOM   472   C  "C5'" . DC  B 1 11  ? 27.209  6.472   203.389 1.00 31.84  ? 11   DC  F "C5'" 1 
ATOM   473   C  "C4'" . DC  B 1 11  ? 27.915  6.565   204.720 1.00 40.28  ? 11   DC  F "C4'" 1 
ATOM   474   O  "O4'" . DC  B 1 11  ? 27.115  7.249   205.717 1.00 35.90  ? 11   DC  F "O4'" 1 
ATOM   475   C  "C3'" . DC  B 1 11  ? 28.256  5.204   205.328 1.00 44.24  ? 11   DC  F "C3'" 1 
ATOM   476   O  "O3'" . DC  B 1 11  ? 29.586  5.249   205.823 1.00 51.43  ? 11   DC  F "O3'" 1 
ATOM   477   C  "C2'" . DC  B 1 11  ? 27.308  5.075   206.504 1.00 48.48  ? 11   DC  F "C2'" 1 
ATOM   478   C  "C1'" . DC  B 1 11  ? 27.200  6.515   206.932 1.00 45.46  ? 11   DC  F "C1'" 1 
ATOM   479   N  N1    . DC  B 1 11  ? 26.019  6.821   207.748 1.00 46.84  ? 11   DC  F N1    1 
ATOM   480   C  C2    . DC  B 1 11  ? 26.167  7.707   208.796 1.00 48.67  ? 11   DC  F C2    1 
ATOM   481   O  O2    . DC  B 1 11  ? 27.289  8.172   209.018 1.00 49.81  ? 11   DC  F O2    1 
ATOM   482   N  N3    . DC  B 1 11  ? 25.091  8.030   209.545 1.00 50.44  ? 11   DC  F N3    1 
ATOM   483   C  C4    . DC  B 1 11  ? 23.905  7.486   209.275 1.00 44.48  ? 11   DC  F C4    1 
ATOM   484   N  N4    . DC  B 1 11  ? 22.870  7.850   210.025 1.00 42.65  ? 11   DC  F N4    1 
ATOM   485   C  C5    . DC  B 1 11  ? 23.730  6.552   208.220 1.00 31.32  ? 11   DC  F C5    1 
ATOM   486   C  C6    . DC  B 1 11  ? 24.801  6.255   207.485 1.00 45.42  ? 11   DC  F C6    1 
ATOM   487   P  P     . DG  B 1 12  ? 30.439  3.902   205.934 1.00 38.71  ? 12   DG  F P     1 
ATOM   488   O  OP1   . DG  B 1 12  ? 31.127  3.633   204.650 1.00 48.34  ? 12   DG  F OP1   1 
ATOM   489   O  OP2   . DG  B 1 12  ? 29.588  2.860   206.541 1.00 45.44  ? 12   DG  F OP2   1 
ATOM   490   O  "O5'" . DG  B 1 12  ? 31.576  4.331   206.938 1.00 38.69  ? 12   DG  F "O5'" 1 
ATOM   491   C  "C5'" . DG  B 1 12  ? 31.862  3.544   208.043 1.00 46.09  ? 12   DG  F "C5'" 1 
ATOM   492   C  "C4'" . DG  B 1 12  ? 31.973  4.415   209.263 1.00 37.49  ? 12   DG  F "C4'" 1 
ATOM   493   O  "O4'" . DG  B 1 12  ? 30.719  5.101   209.498 1.00 36.69  ? 12   DG  F "O4'" 1 
ATOM   494   C  "C3'" . DG  B 1 12  ? 32.246  3.592   210.508 1.00 33.08  ? 12   DG  F "C3'" 1 
ATOM   495   O  "O3'" . DG  B 1 12  ? 33.187  4.257   211.311 1.00 27.70  ? 12   DG  F "O3'" 1 
ATOM   496   C  "C2'" . DG  B 1 12  ? 30.896  3.493   211.179 1.00 31.55  ? 12   DG  F "C2'" 1 
ATOM   497   C  "C1'" . DG  B 1 12  ? 30.272  4.817   210.814 1.00 33.52  ? 12   DG  F "C1'" 1 
ATOM   498   N  N9    . DG  B 1 12  ? 28.818  4.781   210.802 1.00 44.01  ? 12   DG  F N9    1 
ATOM   499   C  C8    . DG  B 1 12  ? 28.010  4.004   210.010 1.00 40.84  ? 12   DG  F C8    1 
ATOM   500   N  N7    . DG  B 1 12  ? 26.742  4.198   210.235 1.00 45.42  ? 12   DG  F N7    1 
ATOM   501   C  C5    . DG  B 1 12  ? 26.712  5.166   211.233 1.00 39.02  ? 12   DG  F C5    1 
ATOM   502   C  C6    . DG  B 1 12  ? 25.620  5.791   211.876 1.00 40.77  ? 12   DG  F C6    1 
ATOM   503   O  O6    . DG  B 1 12  ? 24.418  5.623   211.685 1.00 53.18  ? 12   DG  F O6    1 
ATOM   504   N  N1    . DG  B 1 12  ? 26.041  6.704   212.829 1.00 47.92  ? 12   DG  F N1    1 
ATOM   505   C  C2    . DG  B 1 12  ? 27.346  6.990   213.124 1.00 55.22  ? 12   DG  F C2    1 
ATOM   506   N  N2    . DG  B 1 12  ? 27.553  7.898   214.096 1.00 63.95  ? 12   DG  F N2    1 
ATOM   507   N  N3    . DG  B 1 12  ? 28.374  6.428   212.521 1.00 51.21  ? 12   DG  F N3    1 
ATOM   508   C  C4    . DG  B 1 12  ? 27.985  5.530   211.595 1.00 42.22  ? 12   DG  F C4    1 
ATOM   509   P  P     . DG  B 1 13  ? 34.053  3.405   212.329 1.00 53.55  ? 13   DG  F P     1 
ATOM   510   O  OP1   . DG  B 1 13  ? 34.027  2.026   211.800 1.00 41.19  ? 13   DG  F OP1   1 
ATOM   511   O  OP2   . DG  B 1 13  ? 33.495  3.683   213.686 1.00 52.22  ? 13   DG  F OP2   1 
ATOM   512   O  "O5'" . DG  B 1 13  ? 35.521  4.018   212.192 1.00 66.18  ? 13   DG  F "O5'" 1 
ATOM   513   C  "C5'" . DG  B 1 13  ? 35.784  5.377   212.538 1.00 87.13  ? 13   DG  F "C5'" 1 
ATOM   514   C  "C4'" . DG  B 1 13  ? 37.255  5.688   212.377 1.00 101.21 ? 13   DG  F "C4'" 1 
ATOM   515   O  "O4'" . DG  B 1 13  ? 38.016  4.824   213.257 1.00 108.72 ? 13   DG  F "O4'" 1 
ATOM   516   C  "C3'" . DG  B 1 13  ? 37.819  5.450   210.977 1.00 104.70 ? 13   DG  F "C3'" 1 
ATOM   517   O  "O3'" . DG  B 1 13  ? 38.948  6.302   210.726 1.00 94.46  ? 13   DG  F "O3'" 1 
ATOM   518   C  "C2'" . DG  B 1 13  ? 38.324  4.022   211.059 1.00 109.27 ? 13   DG  F "C2'" 1 
ATOM   519   C  "C1'" . DG  B 1 13  ? 38.817  3.922   212.499 1.00 115.77 ? 13   DG  F "C1'" 1 
ATOM   520   N  N9    . DG  B 1 13  ? 38.671  2.589   213.085 1.00 123.48 ? 13   DG  F N9    1 
ATOM   521   C  C8    . DG  B 1 13  ? 37.591  1.748   212.951 1.00 125.57 ? 13   DG  F C8    1 
ATOM   522   N  N7    . DG  B 1 13  ? 37.746  0.607   213.567 1.00 125.82 ? 13   DG  F N7    1 
ATOM   523   C  C5    . DG  B 1 13  ? 39.002  0.697   214.152 1.00 127.17 ? 13   DG  F C5    1 
ATOM   524   C  C6    . DG  B 1 13  ? 39.718  -0.243  214.942 1.00 129.15 ? 13   DG  F C6    1 
ATOM   525   O  O6    . DG  B 1 13  ? 39.374  -1.382  215.288 1.00 128.12 ? 13   DG  F O6    1 
ATOM   526   N  N1    . DG  B 1 13  ? 40.956  0.255   215.331 1.00 129.56 ? 13   DG  F N1    1 
ATOM   527   C  C2    . DG  B 1 13  ? 41.448  1.493   215.004 1.00 130.00 ? 13   DG  F C2    1 
ATOM   528   N  N2    . DG  B 1 13  ? 42.667  1.788   215.486 1.00 130.96 ? 13   DG  F N2    1 
ATOM   529   N  N3    . DG  B 1 13  ? 40.796  2.378   214.263 1.00 130.19 ? 13   DG  F N3    1 
ATOM   530   C  C4    . DG  B 1 13  ? 39.587  1.917   213.872 1.00 126.61 ? 13   DG  F C4    1 
ATOM   531   O  "O5'" . DG  C 1 1   ? 32.370  6.131   212.930 1.00 136.23 ? 1    DG  G "O5'" 1 
ATOM   532   C  "C5'" . DG  C 1 1   ? 33.096  7.279   213.404 1.00 129.70 ? 1    DG  G "C5'" 1 
ATOM   533   C  "C4'" . DG  C 1 1   ? 33.040  7.343   214.913 1.00 123.92 ? 1    DG  G "C4'" 1 
ATOM   534   O  "O4'" . DG  C 1 1   ? 31.677  7.101   215.339 1.00 115.28 ? 1    DG  G "O4'" 1 
ATOM   535   C  "C3'" . DG  C 1 1   ? 33.902  6.304   215.631 1.00 123.13 ? 1    DG  G "C3'" 1 
ATOM   536   O  "O3'" . DG  C 1 1   ? 34.658  6.907   216.701 1.00 133.72 ? 1    DG  G "O3'" 1 
ATOM   537   C  "C2'" . DG  C 1 1   ? 32.927  5.212   216.039 1.00 114.04 ? 1    DG  G "C2'" 1 
ATOM   538   C  "C1'" . DG  C 1 1   ? 31.575  5.905   216.105 1.00 106.33 ? 1    DG  G "C1'" 1 
ATOM   539   N  N9    . DG  C 1 1   ? 30.489  5.112   215.534 1.00 92.03  ? 1    DG  G N9    1 
ATOM   540   C  C8    . DG  C 1 1   ? 30.598  4.059   214.654 1.00 80.32  ? 1    DG  G C8    1 
ATOM   541   N  N7    . DG  C 1 1   ? 29.442  3.553   214.317 1.00 72.22  ? 1    DG  G N7    1 
ATOM   542   C  C5    . DG  C 1 1   ? 28.515  4.318   215.013 1.00 74.06  ? 1    DG  G C5    1 
ATOM   543   C  C6    . DG  C 1 1   ? 27.097  4.244   215.046 1.00 67.52  ? 1    DG  G C6    1 
ATOM   544   O  O6    . DG  C 1 1   ? 26.352  3.472   214.436 1.00 58.11  ? 1    DG  G O6    1 
ATOM   545   N  N1    . DG  C 1 1   ? 26.555  5.205   215.894 1.00 68.76  ? 1    DG  G N1    1 
ATOM   546   C  C2    . DG  C 1 1   ? 27.281  6.123   216.617 1.00 71.72  ? 1    DG  G C2    1 
ATOM   547   N  N2    . DG  C 1 1   ? 26.574  6.961   217.393 1.00 55.27  ? 1    DG  G N2    1 
ATOM   548   N  N3    . DG  C 1 1   ? 28.599  6.211   216.586 1.00 74.07  ? 1    DG  G N3    1 
ATOM   549   C  C4    . DG  C 1 1   ? 29.147  5.283   215.772 1.00 80.56  ? 1    DG  G C4    1 
ATOM   550   P  P     . DC  C 1 2   ? 34.124  6.859   218.221 1.00 141.90 ? 2    DC  G P     1 
ATOM   551   O  OP1   . DC  C 1 2   ? 32.758  7.444   218.252 1.00 142.42 ? 2    DC  G OP1   1 
ATOM   552   O  OP2   . DC  C 1 2   ? 35.200  7.459   219.060 1.00 145.37 ? 2    DC  G OP2   1 
ATOM   553   O  "O5'" . DC  C 1 2   ? 34.020  5.312   218.593 1.00 138.26 ? 2    DC  G "O5'" 1 
ATOM   554   C  "C5'" . DC  C 1 2   ? 33.807  4.902   219.949 1.00 124.46 ? 2    DC  G "C5'" 1 
ATOM   555   C  "C4'" . DC  C 1 2   ? 32.567  5.569   220.496 1.00 115.51 ? 2    DC  G "C4'" 1 
ATOM   556   O  "O4'" . DC  C 1 2   ? 31.454  5.346   219.602 1.00 109.93 ? 2    DC  G "O4'" 1 
ATOM   557   C  "C3'" . DC  C 1 2   ? 32.100  5.102   221.872 1.00 110.89 ? 2    DC  G "C3'" 1 
ATOM   558   O  "O3'" . DC  C 1 2   ? 31.563  6.237   222.566 1.00 113.75 ? 2    DC  G "O3'" 1 
ATOM   559   C  "C2'" . DC  C 1 2   ? 31.025  4.083   221.540 1.00 106.56 ? 2    DC  G "C2'" 1 
ATOM   560   C  "C1'" . DC  C 1 2   ? 30.405  4.665   220.274 1.00 100.58 ? 2    DC  G "C1'" 1 
ATOM   561   N  N1    . DC  C 1 2   ? 29.840  3.683   219.325 1.00 88.72  ? 2    DC  G N1    1 
ATOM   562   C  C2    . DC  C 1 2   ? 28.454  3.686   219.082 1.00 78.46  ? 2    DC  G C2    1 
ATOM   563   O  O2    . DC  C 1 2   ? 27.736  4.484   219.702 1.00 76.59  ? 2    DC  G O2    1 
ATOM   564   N  N3    . DC  C 1 2   ? 27.939  2.816   218.182 1.00 66.94  ? 2    DC  G N3    1 
ATOM   565   C  C4    . DC  C 1 2   ? 28.742  1.962   217.544 1.00 69.73  ? 2    DC  G C4    1 
ATOM   566   N  N4    . DC  C 1 2   ? 28.187  1.133   216.648 1.00 66.16  ? 2    DC  G N4    1 
ATOM   567   C  C5    . DC  C 1 2   ? 30.150  1.921   217.789 1.00 63.45  ? 2    DC  G C5    1 
ATOM   568   C  C6    . DC  C 1 2   ? 30.650  2.790   218.676 1.00 74.95  ? 2    DC  G C6    1 
ATOM   569   P  P     . DC  C 1 3   ? 31.176  6.128   224.120 1.00 109.18 ? 3    DC  G P     1 
ATOM   570   O  OP1   . DC  C 1 3   ? 30.951  7.517   224.622 1.00 111.43 ? 3    DC  G OP1   1 
ATOM   571   O  OP2   . DC  C 1 3   ? 32.169  5.258   224.791 1.00 107.96 ? 3    DC  G OP2   1 
ATOM   572   O  "O5'" . DC  C 1 3   ? 29.771  5.379   224.091 1.00 100.54 ? 3    DC  G "O5'" 1 
ATOM   573   C  "C5'" . DC  C 1 3   ? 28.614  6.030   223.563 1.00 86.52  ? 3    DC  G "C5'" 1 
ATOM   574   C  "C4'" . DC  C 1 3   ? 27.379  5.196   223.816 1.00 80.70  ? 3    DC  G "C4'" 1 
ATOM   575   O  "O4'" . DC  C 1 3   ? 27.156  4.232   222.753 1.00 72.46  ? 3    DC  G "O4'" 1 
ATOM   576   C  "C3'" . DC  C 1 3   ? 27.383  4.403   225.126 1.00 76.78  ? 3    DC  G "C3'" 1 
ATOM   577   O  "O3'" . DC  C 1 3   ? 26.148  4.596   225.815 1.00 64.47  ? 3    DC  G "O3'" 1 
ATOM   578   C  "C2'" . DC  C 1 3   ? 27.520  2.958   224.670 1.00 75.50  ? 3    DC  G "C2'" 1 
ATOM   579   C  "C1'" . DC  C 1 3   ? 26.822  2.977   223.323 1.00 71.63  ? 3    DC  G "C1'" 1 
ATOM   580   N  N1    . DC  C 1 3   ? 27.222  1.918   222.377 1.00 71.01  ? 3    DC  G N1    1 
ATOM   581   C  C2    . DC  C 1 3   ? 26.233  1.294   221.605 1.00 71.17  ? 3    DC  G C2    1 
ATOM   582   O  O2    . DC  C 1 3   ? 25.054  1.636   221.756 1.00 81.93  ? 3    DC  G O2    1 
ATOM   583   N  N3    . DC  C 1 3   ? 26.587  0.333   220.717 1.00 61.80  ? 3    DC  G N3    1 
ATOM   584   C  C4    . DC  C 1 3   ? 27.868  -0.015  220.589 1.00 64.61  ? 3    DC  G C4    1 
ATOM   585   N  N4    . DC  C 1 3   ? 28.174  -0.953  219.691 1.00 52.59  ? 3    DC  G N4    1 
ATOM   586   C  C5    . DC  C 1 3   ? 28.895  0.591   221.373 1.00 70.19  ? 3    DC  G C5    1 
ATOM   587   C  C6    . DC  C 1 3   ? 28.530  1.547   222.245 1.00 71.95  ? 3    DC  G C6    1 
ATOM   588   P  P     . DG  C 1 4   ? 25.991  4.092   227.331 1.00 64.58  ? 4    DG  G P     1 
ATOM   589   O  OP1   . DG  C 1 4   ? 25.182  5.112   228.047 1.00 62.42  ? 4    DG  G OP1   1 
ATOM   590   O  OP2   . DG  C 1 4   ? 27.312  3.689   227.876 1.00 42.10  ? 4    DG  G OP2   1 
ATOM   591   O  "O5'" . DG  C 1 4   ? 25.091  2.789   227.186 1.00 62.64  ? 4    DG  G "O5'" 1 
ATOM   592   C  "C5'" . DG  C 1 4   ? 23.723  2.913   226.815 1.00 67.48  ? 4    DG  G "C5'" 1 
ATOM   593   C  "C4'" . DG  C 1 4   ? 23.075  1.554   226.714 1.00 68.20  ? 4    DG  G "C4'" 1 
ATOM   594   O  "O4'" . DG  C 1 4   ? 23.638  0.819   225.603 1.00 66.92  ? 4    DG  G "O4'" 1 
ATOM   595   C  "C3'" . DG  C 1 4   ? 23.233  0.656   227.944 1.00 67.43  ? 4    DG  G "C3'" 1 
ATOM   596   O  "O3'" . DG  C 1 4   ? 22.009  -0.053  228.153 1.00 61.83  ? 4    DG  G "O3'" 1 
ATOM   597   C  "C2'" . DG  C 1 4   ? 24.309  -0.327  227.515 1.00 62.41  ? 4    DG  G "C2'" 1 
ATOM   598   C  "C1'" . DG  C 1 4   ? 23.967  -0.485  226.048 1.00 61.54  ? 4    DG  G "C1'" 1 
ATOM   599   N  N9    . DG  C 1 4   ? 25.025  -1.001  225.191 1.00 50.94  ? 4    DG  G N9    1 
ATOM   600   C  C8    . DG  C 1 4   ? 26.380  -0.850  225.343 1.00 51.12  ? 4    DG  G C8    1 
ATOM   601   N  N7    . DG  C 1 4   ? 27.066  -1.441  224.406 1.00 49.10  ? 4    DG  G N7    1 
ATOM   602   C  C5    . DG  C 1 4   ? 26.103  -2.009  223.584 1.00 48.39  ? 4    DG  G C5    1 
ATOM   603   C  C6    . DG  C 1 4   ? 26.240  -2.770  222.401 1.00 56.93  ? 4    DG  G C6    1 
ATOM   604   O  O6    . DG  C 1 4   ? 27.277  -3.110  221.815 1.00 63.06  ? 4    DG  G O6    1 
ATOM   605   N  N1    . DG  C 1 4   ? 25.004  -3.146  221.892 1.00 59.24  ? 4    DG  G N1    1 
ATOM   606   C  C2    . DG  C 1 4   ? 23.789  -2.832  222.446 1.00 58.42  ? 4    DG  G C2    1 
ATOM   607   N  N2    . DG  C 1 4   ? 22.702  -3.294  221.802 1.00 64.11  ? 4    DG  G N2    1 
ATOM   608   N  N3    . DG  C 1 4   ? 23.648  -2.122  223.547 1.00 52.72  ? 4    DG  G N3    1 
ATOM   609   C  C4    . DG  C 1 4   ? 24.840  -1.746  224.058 1.00 49.19  ? 4    DG  G C4    1 
ATOM   610   P  P     . DG  C 1 5   ? 20.822  0.642   228.972 1.00 56.09  ? 5    DG  G P     1 
ATOM   611   O  OP1   . DG  C 1 5   ? 20.692  2.032   228.474 1.00 48.81  ? 5    DG  G OP1   1 
ATOM   612   O  OP2   . DG  C 1 5   ? 21.076  0.401   230.411 1.00 54.27  ? 5    DG  G OP2   1 
ATOM   613   O  "O5'" . DG  C 1 5   ? 19.534  -0.202  228.564 1.00 56.61  ? 5    DG  G "O5'" 1 
ATOM   614   C  "C5'" . DG  C 1 5   ? 18.970  -0.105  227.261 1.00 46.97  ? 5    DG  G "C5'" 1 
ATOM   615   C  "C4'" . DG  C 1 5   ? 18.612  -1.481  226.743 1.00 44.58  ? 5    DG  G "C4'" 1 
ATOM   616   O  "O4'" . DG  C 1 5   ? 19.795  -2.196  226.314 1.00 50.16  ? 5    DG  G "O4'" 1 
ATOM   617   C  "C3'" . DG  C 1 5   ? 17.903  -2.401  227.738 1.00 40.21  ? 5    DG  G "C3'" 1 
ATOM   618   O  "O3'" . DG  C 1 5   ? 16.868  -3.114  227.081 1.00 36.25  ? 5    DG  G "O3'" 1 
ATOM   619   C  "C2'" . DG  C 1 5   ? 18.969  -3.407  228.121 1.00 42.68  ? 5    DG  G "C2'" 1 
ATOM   620   C  "C1'" . DG  C 1 5   ? 19.747  -3.518  226.828 1.00 43.52  ? 5    DG  G "C1'" 1 
ATOM   621   N  N9    . DG  C 1 5   ? 21.115  -3.968  227.032 1.00 36.09  ? 5    DG  G N9    1 
ATOM   622   C  C8    . DG  C 1 5   ? 22.136  -3.240  227.591 1.00 47.12  ? 5    DG  G C8    1 
ATOM   623   N  N7    . DG  C 1 5   ? 23.248  -3.912  227.696 1.00 46.65  ? 5    DG  G N7    1 
ATOM   624   C  C5    . DG  C 1 5   ? 22.945  -5.153  227.164 1.00 37.74  ? 5    DG  G C5    1 
ATOM   625   C  C6    . DG  C 1 5   ? 23.751  -6.294  227.020 1.00 45.66  ? 5    DG  G C6    1 
ATOM   626   O  O6    . DG  C 1 5   ? 24.942  -6.443  227.344 1.00 51.42  ? 5    DG  G O6    1 
ATOM   627   N  N1    . DG  C 1 5   ? 23.050  -7.344  226.434 1.00 38.94  ? 5    DG  G N1    1 
ATOM   628   C  C2    . DG  C 1 5   ? 21.738  -7.295  226.042 1.00 35.75  ? 5    DG  G C2    1 
ATOM   629   N  N2    . DG  C 1 5   ? 21.237  -8.423  225.514 1.00 37.76  ? 5    DG  G N2    1 
ATOM   630   N  N3    . DG  C 1 5   ? 20.971  -6.221  226.166 1.00 28.30  ? 5    DG  G N3    1 
ATOM   631   C  C4    . DG  C 1 5   ? 21.634  -5.197  226.734 1.00 24.44  ? 5    DG  G C4    1 
ATOM   632   P  P     . DT  C 1 6   ? 15.659  -3.723  227.939 1.00 46.49  ? 6    DT  G P     1 
ATOM   633   O  OP1   . DT  C 1 6   ? 14.401  -3.004  227.581 1.00 44.26  ? 6    DT  G OP1   1 
ATOM   634   O  OP2   . DT  C 1 6   ? 16.096  -3.784  229.345 1.00 35.59  ? 6    DT  G OP2   1 
ATOM   635   O  "O5'" . DT  C 1 6   ? 15.551  -5.209  227.405 1.00 41.51  ? 6    DT  G "O5'" 1 
ATOM   636   C  "C5'" . DT  C 1 6   ? 16.720  -5.942  227.108 1.00 30.38  ? 6    DT  G "C5'" 1 
ATOM   637   C  "C4'" . DT  C 1 6   ? 16.347  -7.343  226.706 1.00 32.47  ? 6    DT  G "C4'" 1 
ATOM   638   O  "O4'" . DT  C 1 6   ? 17.583  -8.053  226.498 1.00 31.07  ? 6    DT  G "O4'" 1 
ATOM   639   C  "C3'" . DT  C 1 6   ? 15.589  -8.092  227.802 1.00 39.94  ? 6    DT  G "C3'" 1 
ATOM   640   O  "O3'" . DT  C 1 6   ? 14.552  -8.915  227.240 1.00 39.71  ? 6    DT  G "O3'" 1 
ATOM   641   C  "C2'" . DT  C 1 6   ? 16.665  -8.892  228.515 1.00 39.91  ? 6    DT  G "C2'" 1 
ATOM   642   C  "C1'" . DT  C 1 6   ? 17.796  -9.024  227.501 1.00 37.80  ? 6    DT  G "C1'" 1 
ATOM   643   N  N1    . DT  C 1 6   ? 19.125  -8.762  228.092 1.00 33.35  ? 6    DT  G N1    1 
ATOM   644   C  C2    . DT  C 1 6   ? 20.035  -9.794  228.132 1.00 32.78  ? 6    DT  G C2    1 
ATOM   645   O  O2    . DT  C 1 6   ? 19.823  -10.893 227.649 1.00 37.34  ? 6    DT  G O2    1 
ATOM   646   N  N3    . DT  C 1 6   ? 21.216  -9.491  228.763 1.00 34.12  ? 6    DT  G N3    1 
ATOM   647   C  C4    . DT  C 1 6   ? 21.575  -8.284  229.331 1.00 28.99  ? 6    DT  G C4    1 
ATOM   648   O  O4    . DT  C 1 6   ? 22.658  -8.172  229.882 1.00 34.22  ? 6    DT  G O4    1 
ATOM   649   C  C5    . DT  C 1 6   ? 20.591  -7.232  229.219 1.00 31.01  ? 6    DT  G C5    1 
ATOM   650   C  C7    . DT  C 1 6   ? 20.903  -5.879  229.780 1.00 31.48  ? 6    DT  G C7    1 
ATOM   651   C  C6    . DT  C 1 6   ? 19.430  -7.520  228.612 1.00 25.60  ? 6    DT  G C6    1 
ATOM   652   P  P     . DC  C 1 7   ? 13.532  -9.711  228.201 1.00 45.66  ? 7    DC  G P     1 
ATOM   653   O  OP1   . DC  C 1 7   ? 12.226  -9.775  227.515 1.00 42.06  ? 7    DC  G OP1   1 
ATOM   654   O  OP2   . DC  C 1 7   ? 13.602  -9.204  229.599 1.00 30.80  ? 7    DC  G OP2   1 
ATOM   655   O  "O5'" . DC  C 1 7   ? 14.148  -11.173 228.194 1.00 28.59  ? 7    DC  G "O5'" 1 
ATOM   656   C  "C5'" . DC  C 1 7   ? 14.471  -11.793 226.958 1.00 41.57  ? 7    DC  G "C5'" 1 
ATOM   657   C  "C4'" . DC  C 1 7   ? 15.137  -13.127 227.191 1.00 43.10  ? 7    DC  G "C4'" 1 
ATOM   658   O  "O4'" . DC  C 1 7   ? 16.561  -12.953 227.409 1.00 39.34  ? 7    DC  G "O4'" 1 
ATOM   659   C  "C3'" . DC  C 1 7   ? 14.586  -13.857 228.408 1.00 46.16  ? 7    DC  G "C3'" 1 
ATOM   660   O  "O3'" . DC  C 1 7   ? 14.261  -15.202 228.092 1.00 57.19  ? 7    DC  G "O3'" 1 
ATOM   661   C  "C2'" . DC  C 1 7   ? 15.712  -13.793 229.425 1.00 56.47  ? 7    DC  G "C2'" 1 
ATOM   662   C  "C1'" . DC  C 1 7   ? 16.967  -13.647 228.569 1.00 48.69  ? 7    DC  G "C1'" 1 
ATOM   663   N  N1    . DC  C 1 7   ? 18.026  -12.859 229.231 1.00 49.26  ? 7    DC  G N1    1 
ATOM   664   C  C2    . DC  C 1 7   ? 19.380  -13.174 229.001 1.00 45.67  ? 7    DC  G C2    1 
ATOM   665   O  O2    . DC  C 1 7   ? 19.670  -14.007 228.135 1.00 41.14  ? 7    DC  G O2    1 
ATOM   666   N  N3    . DC  C 1 7   ? 20.335  -12.542 229.729 1.00 44.95  ? 7    DC  G N3    1 
ATOM   667   C  C4    . DC  C 1 7   ? 19.982  -11.622 230.638 1.00 55.49  ? 7    DC  G C4    1 
ATOM   668   N  N4    . DC  C 1 7   ? 20.939  -11.064 231.377 1.00 56.87  ? 7    DC  G N4    1 
ATOM   669   C  C5    . DC  C 1 7   ? 18.624  -11.237 230.834 1.00 48.20  ? 7    DC  G C5    1 
ATOM   670   C  C6    . DC  C 1 7   ? 17.690  -11.869 230.112 1.00 40.98  ? 7    DC  G C6    1 
ATOM   671   P  P     . DG  C 1 8   ? 13.630  -16.152 229.226 1.00 68.69  ? 8    DG  G P     1 
ATOM   672   O  OP1   . DG  C 1 8   ? 12.975  -17.300 228.538 1.00 71.72  ? 8    DG  G OP1   1 
ATOM   673   O  OP2   . DG  C 1 8   ? 12.845  -15.323 230.173 1.00 61.22  ? 8    DG  G OP2   1 
ATOM   674   O  "O5'" . DG  C 1 8   ? 14.916  -16.685 229.997 1.00 67.41  ? 8    DG  G "O5'" 1 
ATOM   675   C  "C5'" . DG  C 1 8   ? 15.929  -17.406 229.286 1.00 72.02  ? 8    DG  G "C5'" 1 
ATOM   676   C  "C4'" . DG  C 1 8   ? 16.746  -18.237 230.244 1.00 65.05  ? 8    DG  G "C4'" 1 
ATOM   677   O  "O4'" . DG  C 1 8   ? 18.013  -17.586 230.524 1.00 53.55  ? 8    DG  G "O4'" 1 
ATOM   678   C  "C3'" . DG  C 1 8   ? 16.039  -18.427 231.586 1.00 64.18  ? 8    DG  G "C3'" 1 
ATOM   679   O  "O3'" . DG  C 1 8   ? 16.065  -19.785 232.016 1.00 68.46  ? 8    DG  G "O3'" 1 
ATOM   680   C  "C2'" . DG  C 1 8   ? 16.820  -17.552 232.548 1.00 64.16  ? 8    DG  G "C2'" 1 
ATOM   681   C  "C1'" . DG  C 1 8   ? 18.208  -17.481 231.922 1.00 55.91  ? 8    DG  G "C1'" 1 
ATOM   682   N  N9    . DG  C 1 8   ? 18.857  -16.203 232.203 1.00 51.00  ? 8    DG  G N9    1 
ATOM   683   C  C8    . DG  C 1 8   ? 18.282  -14.953 232.138 1.00 46.52  ? 8    DG  G C8    1 
ATOM   684   N  N7    . DG  C 1 8   ? 19.056  -14.012 232.601 1.00 46.54  ? 8    DG  G N7    1 
ATOM   685   C  C5    . DG  C 1 8   ? 20.226  -14.673 232.955 1.00 41.60  ? 8    DG  G C5    1 
ATOM   686   C  C6    . DG  C 1 8   ? 21.426  -14.177 233.534 1.00 41.28  ? 8    DG  G C6    1 
ATOM   687   O  O6    . DG  C 1 8   ? 21.696  -13.020 233.876 1.00 32.23  ? 8    DG  G O6    1 
ATOM   688   N  N1    . DG  C 1 8   ? 22.362  -15.187 233.712 1.00 30.61  ? 8    DG  G N1    1 
ATOM   689   C  C2    . DG  C 1 8   ? 22.171  -16.502 233.379 1.00 37.03  ? 8    DG  G C2    1 
ATOM   690   N  N2    . DG  C 1 8   ? 23.197  -17.328 233.616 1.00 58.27  ? 8    DG  G N2    1 
ATOM   691   N  N3    . DG  C 1 8   ? 21.058  -16.979 232.852 1.00 32.36  ? 8    DG  G N3    1 
ATOM   692   C  C4    . DG  C 1 8   ? 20.133  -16.018 232.673 1.00 39.38  ? 8    DG  G C4    1 
ATOM   693   P  P     . DA  C 1 9   ? 15.173  -20.226 233.274 1.00 61.25  ? 9    DA  G P     1 
ATOM   694   O  OP1   . DA  C 1 9   ? 14.672  -21.590 233.013 1.00 60.26  ? 9    DA  G OP1   1 
ATOM   695   O  OP2   . DA  C 1 9   ? 14.213  -19.129 233.553 1.00 56.00  ? 9    DA  G OP2   1 
ATOM   696   O  "O5'" . DA  C 1 9   ? 16.236  -20.280 234.456 1.00 66.51  ? 9    DA  G "O5'" 1 
ATOM   697   C  "C5'" . DA  C 1 9   ? 17.532  -20.820 234.215 1.00 70.98  ? 9    DA  G "C5'" 1 
ATOM   698   C  "C4'" . DA  C 1 9   ? 18.416  -20.651 235.428 1.00 63.96  ? 9    DA  G "C4'" 1 
ATOM   699   O  "O4'" . DA  C 1 9   ? 18.991  -19.320 235.505 1.00 63.12  ? 9    DA  G "O4'" 1 
ATOM   700   C  "C3'" . DA  C 1 9   ? 17.720  -20.895 236.762 1.00 59.45  ? 9    DA  G "C3'" 1 
ATOM   701   O  "O3'" . DA  C 1 9   ? 18.584  -21.669 237.588 1.00 63.67  ? 9    DA  G "O3'" 1 
ATOM   702   C  "C2'" . DA  C 1 9   ? 17.570  -19.495 237.333 1.00 59.98  ? 9    DA  G "C2'" 1 
ATOM   703   C  "C1'" . DA  C 1 9   ? 18.828  -18.822 236.817 1.00 53.05  ? 9    DA  G "C1'" 1 
ATOM   704   N  N9    . DA  C 1 9   ? 18.783  -17.357 236.762 1.00 50.33  ? 9    DA  G N9    1 
ATOM   705   C  C8    . DA  C 1 9   ? 17.690  -16.546 236.571 1.00 48.54  ? 9    DA  G C8    1 
ATOM   706   N  N7    . DA  C 1 9   ? 17.962  -15.261 236.633 1.00 41.08  ? 9    DA  G N7    1 
ATOM   707   C  C5    . DA  C 1 9   ? 19.326  -15.223 236.869 1.00 33.35  ? 9    DA  G C5    1 
ATOM   708   C  C6    . DA  C 1 9   ? 20.226  -14.158 237.053 1.00 41.40  ? 9    DA  G C6    1 
ATOM   709   N  N6    . DA  C 1 9   ? 19.863  -12.868 237.051 1.00 30.19  ? 9    DA  G N6    1 
ATOM   710   N  N1    . DA  C 1 9   ? 21.532  -14.465 237.253 1.00 38.89  ? 9    DA  G N1    1 
ATOM   711   C  C2    . DA  C 1 9   ? 21.891  -15.753 237.281 1.00 49.16  ? 9    DA  G C2    1 
ATOM   712   N  N3    . DA  C 1 9   ? 21.132  -16.846 237.138 1.00 48.98  ? 9    DA  G N3    1 
ATOM   713   C  C4    . DA  C 1 9   ? 19.849  -16.507 236.930 1.00 43.41  ? 9    DA  G C4    1 
ATOM   714   P  P     . DC  C 1 10  ? 17.993  -22.438 238.860 1.00 61.67  ? 10   DC  G P     1 
ATOM   715   O  OP1   . DC  C 1 10  ? 17.510  -23.785 238.459 1.00 71.47  ? 10   DC  G OP1   1 
ATOM   716   O  OP2   . DC  C 1 10  ? 17.087  -21.517 239.575 1.00 64.77  ? 10   DC  G OP2   1 
ATOM   717   O  "O5'" . DC  C 1 10  ? 19.273  -22.617 239.769 1.00 65.36  ? 10   DC  G "O5'" 1 
ATOM   718   C  "C5'" . DC  C 1 10  ? 19.526  -21.699 240.804 1.00 65.97  ? 10   DC  G "C5'" 1 
ATOM   719   C  "C4'" . DC  C 1 10  ? 20.915  -21.128 240.672 1.00 57.89  ? 10   DC  G "C4'" 1 
ATOM   720   O  "O4'" . DC  C 1 10  ? 20.865  -19.902 239.883 1.00 44.84  ? 10   DC  G "O4'" 1 
ATOM   721   C  "C3'" . DC  C 1 10  ? 21.466  -20.735 242.040 1.00 60.95  ? 10   DC  G "C3'" 1 
ATOM   722   O  "O3'" . DC  C 1 10  ? 22.796  -21.192 242.231 1.00 57.20  ? 10   DC  G "O3'" 1 
ATOM   723   C  "C2'" . DC  C 1 10  ? 21.418  -19.221 242.051 1.00 52.34  ? 10   DC  G "C2'" 1 
ATOM   724   C  "C1'" . DC  C 1 10  ? 21.530  -18.860 240.585 1.00 44.70  ? 10   DC  G "C1'" 1 
ATOM   725   N  N1    . DC  C 1 10  ? 20.840  -17.595 240.331 1.00 38.87  ? 10   DC  G N1    1 
ATOM   726   C  C2    . DC  C 1 10  ? 21.547  -16.415 240.516 1.00 36.49  ? 10   DC  G C2    1 
ATOM   727   O  O2    . DC  C 1 10  ? 22.737  -16.481 240.782 1.00 39.45  ? 10   DC  G O2    1 
ATOM   728   N  N3    . DC  C 1 10  ? 20.917  -15.229 240.395 1.00 33.92  ? 10   DC  G N3    1 
ATOM   729   C  C4    . DC  C 1 10  ? 19.621  -15.199 240.089 1.00 36.03  ? 10   DC  G C4    1 
ATOM   730   N  N4    . DC  C 1 10  ? 19.030  -14.010 240.000 1.00 29.84  ? 10   DC  G N4    1 
ATOM   731   C  C5    . DC  C 1 10  ? 18.875  -16.392 239.859 1.00 36.06  ? 10   DC  G C5    1 
ATOM   732   C  C6    . DC  C 1 10  ? 19.523  -17.561 239.978 1.00 36.91  ? 10   DC  G C6    1 
ATOM   733   P  P     . DC  C 1 11  ? 23.424  -21.104 243.690 1.00 58.04  ? 11   DC  G P     1 
ATOM   734   O  OP1   . DC  C 1 11  ? 23.981  -19.730 243.830 1.00 45.65  ? 11   DC  G OP1   1 
ATOM   735   O  OP2   . DC  C 1 11  ? 24.313  -22.280 243.843 1.00 56.34  ? 11   DC  G OP2   1 
ATOM   736   O  "O5'" . DC  C 1 11  ? 22.137  -21.235 244.637 1.00 56.14  ? 11   DC  G "O5'" 1 
ATOM   737   C  "C5'" . DC  C 1 11  ? 22.265  -21.357 246.060 1.00 53.21  ? 11   DC  G "C5'" 1 
ATOM   738   C  "C4'" . DC  C 1 11  ? 22.932  -20.125 246.625 1.00 62.30  ? 11   DC  G "C4'" 1 
ATOM   739   O  "O4'" . DC  C 1 11  ? 22.100  -18.951 246.421 1.00 64.51  ? 11   DC  G "O4'" 1 
ATOM   740   C  "C3'" . DC  C 1 11  ? 23.243  -20.172 248.126 1.00 62.11  ? 11   DC  G "C3'" 1 
ATOM   741   O  "O3'" . DC  C 1 11  ? 24.585  -19.715 248.327 1.00 66.56  ? 11   DC  G "O3'" 1 
ATOM   742   C  "C2'" . DC  C 1 11  ? 22.276  -19.166 248.732 1.00 66.30  ? 11   DC  G "C2'" 1 
ATOM   743   C  "C1'" . DC  C 1 11  ? 22.122  -18.163 247.606 1.00 62.35  ? 11   DC  G "C1'" 1 
ATOM   744   N  N1    . DC  C 1 11  ? 20.888  -17.360 247.655 1.00 54.27  ? 11   DC  G N1    1 
ATOM   745   C  C2    . DC  C 1 11  ? 20.950  -15.979 247.381 1.00 50.87  ? 11   DC  G C2    1 
ATOM   746   O  O2    . DC  C 1 11  ? 22.039  -15.471 247.089 1.00 54.21  ? 11   DC  G O2    1 
ATOM   747   N  N3    . DC  C 1 11  ? 19.814  -15.239 247.440 1.00 38.54  ? 11   DC  G N3    1 
ATOM   748   C  C4    . DC  C 1 11  ? 18.650  -15.827 247.752 1.00 56.80  ? 11   DC  G C4    1 
ATOM   749   N  N4    . DC  C 1 11  ? 17.549  -15.067 247.793 1.00 45.74  ? 11   DC  G N4    1 
ATOM   750   C  C5    . DC  C 1 11  ? 18.562  -17.225 248.033 1.00 57.36  ? 11   DC  G C5    1 
ATOM   751   C  C6    . DC  C 1 11  ? 19.695  -17.945 247.969 1.00 62.77  ? 11   DC  G C6    1 
ATOM   752   P  P     . DG  C 1 12  ? 25.410  -20.165 249.632 1.00 57.97  ? 12   DG  G P     1 
ATOM   753   O  OP1   . DG  C 1 12  ? 26.628  -20.881 249.170 1.00 47.94  ? 12   DG  G OP1   1 
ATOM   754   O  OP2   . DG  C 1 12  ? 24.462  -20.831 250.567 1.00 56.10  ? 12   DG  G OP2   1 
ATOM   755   O  "O5'" . DG  C 1 12  ? 25.847  -18.774 250.264 1.00 46.79  ? 12   DG  G "O5'" 1 
ATOM   756   C  "C5'" . DG  C 1 12  ? 24.998  -17.647 250.116 1.00 45.11  ? 12   DG  G "C5'" 1 
ATOM   757   C  "C4'" . DG  C 1 12  ? 25.763  -16.360 250.320 1.00 44.76  ? 12   DG  G "C4'" 1 
ATOM   758   O  "O4'" . DG  C 1 12  ? 24.855  -15.281 250.023 1.00 56.52  ? 12   DG  G "O4'" 1 
ATOM   759   C  "C3'" . DG  C 1 12  ? 26.212  -16.103 251.752 1.00 53.86  ? 12   DG  G "C3'" 1 
ATOM   760   O  "O3'" . DG  C 1 12  ? 27.320  -15.201 251.720 1.00 66.52  ? 12   DG  G "O3'" 1 
ATOM   761   C  "C2'" . DG  C 1 12  ? 24.972  -15.494 252.386 1.00 49.09  ? 12   DG  G "C2'" 1 
ATOM   762   C  "C1'" . DG  C 1 12  ? 24.289  -14.762 251.228 1.00 54.37  ? 12   DG  G "C1'" 1 
ATOM   763   N  N9    . DG  C 1 12  ? 22.842  -14.963 251.136 1.00 44.69  ? 12   DG  G N9    1 
ATOM   764   C  C8    . DG  C 1 12  ? 22.170  -16.156 251.273 1.00 39.06  ? 12   DG  G C8    1 
ATOM   765   N  N7    . DG  C 1 12  ? 20.886  -16.050 251.064 1.00 42.29  ? 12   DG  G N7    1 
ATOM   766   C  C5    . DG  C 1 12  ? 20.691  -14.703 250.788 1.00 41.80  ? 12   DG  G C5    1 
ATOM   767   C  C6    . DG  C 1 12  ? 19.494  -13.991 250.466 1.00 48.45  ? 12   DG  G C6    1 
ATOM   768   O  O6    . DG  C 1 12  ? 18.336  -14.427 250.361 1.00 55.37  ? 12   DG  G O6    1 
ATOM   769   N  N1    . DG  C 1 12  ? 19.745  -12.639 250.255 1.00 44.69  ? 12   DG  G N1    1 
ATOM   770   C  C2    . DG  C 1 12  ? 20.984  -12.045 250.334 1.00 45.74  ? 12   DG  G C2    1 
ATOM   771   N  N2    . DG  C 1 12  ? 21.013  -10.729 250.083 1.00 31.43  ? 12   DG  G N2    1 
ATOM   772   N  N3    . DG  C 1 12  ? 22.107  -12.695 250.633 1.00 34.54  ? 12   DG  G N3    1 
ATOM   773   C  C4    . DG  C 1 12  ? 21.886  -14.012 250.845 1.00 35.19  ? 12   DG  G C4    1 
ATOM   774   P  P     . DG  C 1 13  ? 27.969  -14.655 253.087 1.00 75.79  ? 13   DG  G P     1 
ATOM   775   O  OP1   . DG  C 1 13  ? 27.803  -15.693 254.131 1.00 76.46  ? 13   DG  G OP1   1 
ATOM   776   O  OP2   . DG  C 1 13  ? 27.448  -13.286 253.326 1.00 60.97  ? 13   DG  G OP2   1 
ATOM   777   O  "O5'" . DG  C 1 13  ? 29.511  -14.500 252.717 1.00 92.30  ? 13   DG  G "O5'" 1 
ATOM   778   C  "C5'" . DG  C 1 13  ? 29.895  -13.893 251.481 1.00 112.54 ? 13   DG  G "C5'" 1 
ATOM   779   C  "C4'" . DG  C 1 13  ? 31.305  -13.356 251.566 1.00 127.46 ? 13   DG  G "C4'" 1 
ATOM   780   O  "O4'" . DG  C 1 13  ? 31.364  -12.375 252.627 1.00 133.94 ? 13   DG  G "O4'" 1 
ATOM   781   C  "C3'" . DG  C 1 13  ? 32.367  -14.395 251.914 1.00 133.80 ? 13   DG  G "C3'" 1 
ATOM   782   O  "O3'" . DG  C 1 13  ? 33.652  -13.938 251.488 1.00 138.41 ? 13   DG  G "O3'" 1 
ATOM   783   C  "C2'" . DG  C 1 13  ? 32.373  -14.355 253.429 1.00 140.55 ? 13   DG  G "C2'" 1 
ATOM   784   C  "C1'" . DG  C 1 13  ? 32.119  -12.881 253.721 1.00 144.92 ? 13   DG  G "C1'" 1 
ATOM   785   N  N9    . DG  C 1 13  ? 31.343  -12.653 254.936 1.00 156.03 ? 13   DG  G N9    1 
ATOM   786   C  C8    . DG  C 1 13  ? 30.053  -12.182 255.023 1.00 160.20 ? 13   DG  G C8    1 
ATOM   787   N  N7    . DG  C 1 13  ? 29.622  -12.094 256.253 1.00 162.73 ? 13   DG  G N7    1 
ATOM   788   C  C5    . DG  C 1 13  ? 30.691  -12.531 257.023 1.00 165.72 ? 13   DG  G C5    1 
ATOM   789   C  C6    . DG  C 1 13  ? 30.817  -12.660 258.432 1.00 169.41 ? 13   DG  G C6    1 
ATOM   790   O  O6    . DG  C 1 13  ? 29.979  -12.408 259.310 1.00 169.47 ? 13   DG  G O6    1 
ATOM   791   N  N1    . DG  C 1 13  ? 32.076  -13.137 258.788 1.00 171.65 ? 13   DG  G N1    1 
ATOM   792   C  C2    . DG  C 1 13  ? 33.083  -13.453 257.906 1.00 169.72 ? 13   DG  G C2    1 
ATOM   793   N  N2    . DG  C 1 13  ? 34.228  -13.896 258.448 1.00 170.16 ? 13   DG  G N2    1 
ATOM   794   N  N3    . DG  C 1 13  ? 32.975  -13.341 256.592 1.00 165.32 ? 13   DG  G N3    1 
ATOM   795   C  C4    . DG  C 1 13  ? 31.762  -12.877 256.224 1.00 162.40 ? 13   DG  G C4    1 
ATOM   796   O  "O5'" . DG  D 1 1   ? 9.400   -14.357 253.190 1.00 98.02  ? 1    DG  H "O5'" 1 
ATOM   797   C  "C5'" . DG  D 1 1   ? 8.129   -13.970 253.757 1.00 100.65 ? 1    DG  H "C5'" 1 
ATOM   798   C  "C4'" . DG  D 1 1   ? 8.229   -12.591 254.369 1.00 101.64 ? 1    DG  H "C4'" 1 
ATOM   799   O  "O4'" . DG  D 1 1   ? 9.106   -12.640 255.523 1.00 95.08  ? 1    DG  H "O4'" 1 
ATOM   800   C  "C3'" . DG  D 1 1   ? 8.804   -11.530 253.430 1.00 106.12 ? 1    DG  H "C3'" 1 
ATOM   801   O  "O3'" . DG  D 1 1   ? 8.113   -10.274 253.551 1.00 109.74 ? 1    DG  H "O3'" 1 
ATOM   802   C  "C2'" . DG  D 1 1   ? 10.259  -11.417 253.856 1.00 96.12  ? 1    DG  H "C2'" 1 
ATOM   803   C  "C1'" . DG  D 1 1   ? 10.273  -11.857 255.318 1.00 78.93  ? 1    DG  H "C1'" 1 
ATOM   804   N  N9    . DG  D 1 1   ? 11.421  -12.710 255.605 1.00 59.89  ? 1    DG  H N9    1 
ATOM   805   C  C8    . DG  D 1 1   ? 11.467  -14.086 255.546 1.00 47.84  ? 1    DG  H C8    1 
ATOM   806   N  N7    . DG  D 1 1   ? 12.660  -14.567 255.767 1.00 39.14  ? 1    DG  H N7    1 
ATOM   807   C  C5    . DG  D 1 1   ? 13.446  -13.444 256.004 1.00 29.44  ? 1    DG  H C5    1 
ATOM   808   C  C6    . DG  D 1 1   ? 14.837  -13.334 256.263 1.00 31.22  ? 1    DG  H C6    1 
ATOM   809   O  O6    . DG  D 1 1   ? 15.692  -14.238 256.316 1.00 43.62  ? 1    DG  H O6    1 
ATOM   810   N  N1    . DG  D 1 1   ? 15.216  -12.011 256.453 1.00 24.54  ? 1    DG  H N1    1 
ATOM   811   C  C2    . DG  D 1 1   ? 14.373  -10.927 256.389 1.00 39.89  ? 1    DG  H C2    1 
ATOM   812   N  N2    . DG  D 1 1   ? 14.937  -9.722  256.633 1.00 36.75  ? 1    DG  H N2    1 
ATOM   813   N  N3    . DG  D 1 1   ? 13.080  -11.012 256.117 1.00 31.53  ? 1    DG  H N3    1 
ATOM   814   C  C4    . DG  D 1 1   ? 12.688  -12.293 255.937 1.00 39.55  ? 1    DG  H C4    1 
ATOM   815   P  P     . DC  D 1 2   ? 8.140   -9.233  252.322 1.00 108.33 ? 2    DC  H P     1 
ATOM   816   O  OP1   . DC  D 1 2   ? 7.106   -8.200  252.578 1.00 104.10 ? 2    DC  H OP1   1 
ATOM   817   O  OP2   . DC  D 1 2   ? 8.121   -9.989  251.036 1.00 101.40 ? 2    DC  H OP2   1 
ATOM   818   O  "O5'" . DC  D 1 2   ? 9.570   -8.551  252.460 1.00 103.43 ? 2    DC  H "O5'" 1 
ATOM   819   C  "C5'" . DC  D 1 2   ? 9.784   -7.519  253.412 1.00 100.37 ? 2    DC  H "C5'" 1 
ATOM   820   C  "C4'" . DC  D 1 2   ? 11.088  -6.815  253.131 1.00 96.66  ? 2    DC  H "C4'" 1 
ATOM   821   O  "O4'" . DC  D 1 2   ? 12.200  -7.623  253.585 1.00 93.92  ? 2    DC  H "O4'" 1 
ATOM   822   C  "C3'" . DC  D 1 2   ? 11.335  -6.548  251.646 1.00 98.44  ? 2    DC  H "C3'" 1 
ATOM   823   O  "O3'" . DC  D 1 2   ? 11.898  -5.248  251.481 1.00 105.06 ? 2    DC  H "O3'" 1 
ATOM   824   C  "C2'" . DC  D 1 2   ? 12.339  -7.618  251.251 1.00 89.93  ? 2    DC  H "C2'" 1 
ATOM   825   C  "C1'" . DC  D 1 2   ? 13.136  -7.790  252.532 1.00 86.91  ? 2    DC  H "C1'" 1 
ATOM   826   N  N1    . DC  D 1 2   ? 13.765  -9.109  252.693 1.00 79.48  ? 2    DC  H N1    1 
ATOM   827   C  C2    . DC  D 1 2   ? 15.103  -9.181  253.135 1.00 77.53  ? 2    DC  H C2    1 
ATOM   828   O  O2    . DC  D 1 2   ? 15.723  -8.126  253.373 1.00 77.60  ? 2    DC  H O2    1 
ATOM   829   N  N3    . DC  D 1 2   ? 15.682  -10.398 253.290 1.00 63.33  ? 2    DC  H N3    1 
ATOM   830   C  C4    . DC  D 1 2   ? 14.983  -11.508 253.022 1.00 66.81  ? 2    DC  H C4    1 
ATOM   831   N  N4    . DC  D 1 2   ? 15.589  -12.689 253.193 1.00 58.29  ? 2    DC  H N4    1 
ATOM   832   C  C5    . DC  D 1 2   ? 13.629  -11.458 252.568 1.00 67.93  ? 2    DC  H C5    1 
ATOM   833   C  C6    . DC  D 1 2   ? 13.066  -10.251 252.421 1.00 73.19  ? 2    DC  H C6    1 
ATOM   834   P  P     . DC  D 1 3   ? 12.333  -4.752  250.021 1.00 109.20 ? 3    DC  H P     1 
ATOM   835   O  OP1   . DC  D 1 3   ? 12.242  -3.267  250.007 1.00 107.22 ? 3    DC  H OP1   1 
ATOM   836   O  OP2   . DC  D 1 3   ? 11.565  -5.552  249.023 1.00 107.76 ? 3    DC  H OP2   1 
ATOM   837   O  "O5'" . DC  D 1 3   ? 13.866  -5.177  249.927 1.00 105.16 ? 3    DC  H "O5'" 1 
ATOM   838   C  "C5'" . DC  D 1 3   ? 14.830  -4.615  250.817 1.00 88.44  ? 3    DC  H "C5'" 1 
ATOM   839   C  "C4'" . DC  D 1 3   ? 16.235  -4.926  250.349 1.00 76.47  ? 3    DC  H "C4'" 1 
ATOM   840   O  "O4'" . DC  D 1 3   ? 16.606  -6.287  250.682 1.00 72.58  ? 3    DC  H "O4'" 1 
ATOM   841   C  "C3'" . DC  D 1 3   ? 16.486  -4.763  248.850 1.00 74.00  ? 3    DC  H "C3'" 1 
ATOM   842   O  "O3'" . DC  D 1 3   ? 17.704  -4.046  248.643 1.00 76.73  ? 3    DC  H "O3'" 1 
ATOM   843   C  "C2'" . DC  D 1 3   ? 16.626  -6.192  248.347 1.00 70.40  ? 3    DC  H "C2'" 1 
ATOM   844   C  "C1'" . DC  D 1 3   ? 17.190  -6.919  249.553 1.00 57.54  ? 3    DC  H "C1'" 1 
ATOM   845   N  N1    . DC  D 1 3   ? 16.877  -8.359  249.624 1.00 47.88  ? 3    DC  H N1    1 
ATOM   846   C  C2    . DC  D 1 3   ? 17.923  -9.265  249.816 1.00 53.14  ? 3    DC  H C2    1 
ATOM   847   O  O2    . DC  D 1 3   ? 19.075  -8.827  249.926 1.00 70.94  ? 3    DC  H O2    1 
ATOM   848   N  N3    . DC  D 1 3   ? 17.655  -10.593 249.879 1.00 47.57  ? 3    DC  H N3    1 
ATOM   849   C  C4    . DC  D 1 3   ? 16.395  -11.026 249.767 1.00 47.42  ? 3    DC  H C4    1 
ATOM   850   N  N4    . DC  D 1 3   ? 16.178  -12.346 249.836 1.00 36.74  ? 3    DC  H N4    1 
ATOM   851   C  C5    . DC  D 1 3   ? 15.305  -10.126 249.577 1.00 37.85  ? 3    DC  H C5    1 
ATOM   852   C  C6    . DC  D 1 3   ? 15.590  -8.810  249.513 1.00 46.54  ? 3    DC  H C6    1 
ATOM   853   P  P     . DG  D 1 4   ? 18.008  -3.381  247.214 1.00 76.06  ? 4    DG  H P     1 
ATOM   854   O  OP1   . DG  D 1 4   ? 18.677  -2.076  247.458 1.00 70.59  ? 4    DG  H OP1   1 
ATOM   855   O  OP2   . DG  D 1 4   ? 16.780  -3.433  246.376 1.00 77.02  ? 4    DG  H OP2   1 
ATOM   856   O  "O5'" . DG  D 1 4   ? 19.058  -4.392  246.578 1.00 81.38  ? 4    DG  H "O5'" 1 
ATOM   857   C  "C5'" . DG  D 1 4   ? 20.302  -4.638  247.228 1.00 69.00  ? 4    DG  H "C5'" 1 
ATOM   858   C  "C4'" . DG  D 1 4   ? 21.069  -5.723  246.507 1.00 61.53  ? 4    DG  H "C4'" 1 
ATOM   859   O  "O4'" . DG  D 1 4   ? 20.624  -7.038  246.915 1.00 55.47  ? 4    DG  H "O4'" 1 
ATOM   860   C  "C3'" . DG  D 1 4   ? 20.979  -5.680  244.980 1.00 61.34  ? 4    DG  H "C3'" 1 
ATOM   861   O  "O3'" . DG  D 1 4   ? 22.292  -5.828  244.425 1.00 65.35  ? 4    DG  H "O3'" 1 
ATOM   862   C  "C2'" . DG  D 1 4   ? 20.138  -6.901  244.643 1.00 55.86  ? 4    DG  H "C2'" 1 
ATOM   863   C  "C1'" . DG  D 1 4   ? 20.485  -7.858  245.773 1.00 48.55  ? 4    DG  H "C1'" 1 
ATOM   864   N  N9    . DG  D 1 4   ? 19.444  -8.842  246.052 1.00 35.68  ? 4    DG  H N9    1 
ATOM   865   C  C8    . DG  D 1 4   ? 18.089  -8.635  245.978 1.00 42.32  ? 4    DG  H C8    1 
ATOM   866   N  N7    . DG  D 1 4   ? 17.389  -9.708  246.229 1.00 35.08  ? 4    DG  H N7    1 
ATOM   867   C  C5    . DG  D 1 4   ? 18.335  -10.680 246.495 1.00 17.76  ? 4    DG  H C5    1 
ATOM   868   C  C6    . DG  D 1 4   ? 18.169  -12.037 246.824 1.00 33.35  ? 4    DG  H C6    1 
ATOM   869   O  O6    . DG  D 1 4   ? 17.113  -12.681 246.930 1.00 43.23  ? 4    DG  H O6    1 
ATOM   870   N  N1    . DG  D 1 4   ? 19.395  -12.667 247.034 1.00 35.37  ? 4    DG  H N1    1 
ATOM   871   C  C2    . DG  D 1 4   ? 20.623  -12.062 246.934 1.00 34.19  ? 4    DG  H C2    1 
ATOM   872   N  N2    . DG  D 1 4   ? 21.681  -12.848 247.171 1.00 24.98  ? 4    DG  H N2    1 
ATOM   873   N  N3    . DG  D 1 4   ? 20.794  -10.781 246.621 1.00 27.77  ? 4    DG  H N3    1 
ATOM   874   C  C4    . DG  D 1 4   ? 19.614  -10.157 246.411 1.00 25.31  ? 4    DG  H C4    1 
ATOM   875   P  P     . DG  D 1 5   ? 23.232  -4.534  244.253 1.00 62.09  ? 5    DG  H P     1 
ATOM   876   O  OP1   . DG  D 1 5   ? 22.960  -3.558  245.348 1.00 68.04  ? 5    DG  H OP1   1 
ATOM   877   O  OP2   . DG  D 1 5   ? 23.137  -4.094  242.842 1.00 56.88  ? 5    DG  H OP2   1 
ATOM   878   O  "O5'" . DG  D 1 5   ? 24.679  -5.125  244.504 1.00 54.61  ? 5    DG  H "O5'" 1 
ATOM   879   C  "C5'" . DG  D 1 5   ? 25.368  -5.763  243.460 1.00 57.82  ? 5    DG  H "C5'" 1 
ATOM   880   C  "C4'" . DG  D 1 5   ? 25.809  -7.141  243.884 1.00 48.83  ? 5    DG  H "C4'" 1 
ATOM   881   O  "O4'" . DG  D 1 5   ? 24.657  -8.014  244.023 1.00 51.01  ? 5    DG  H "O4'" 1 
ATOM   882   C  "C3'" . DG  D 1 5   ? 26.706  -7.785  242.837 1.00 50.20  ? 5    DG  H "C3'" 1 
ATOM   883   O  "O3'" . DG  D 1 5   ? 27.843  -8.368  243.428 1.00 53.55  ? 5    DG  H "O3'" 1 
ATOM   884   C  "C2'" . DG  D 1 5   ? 25.839  -8.828  242.166 1.00 51.02  ? 5    DG  H "C2'" 1 
ATOM   885   C  "C1'" . DG  D 1 5   ? 24.826  -9.187  243.231 1.00 47.35  ? 5    DG  H "C1'" 1 
ATOM   886   N  N9    . DG  D 1 5   ? 23.538  -9.503  242.628 1.00 49.41  ? 5    DG  H N9    1 
ATOM   887   C  C8    . DG  D 1 5   ? 22.481  -8.640  242.475 1.00 48.90  ? 5    DG  H C8    1 
ATOM   888   N  N7    . DG  D 1 5   ? 21.462  -9.181  241.868 1.00 50.42  ? 5    DG  H N7    1 
ATOM   889   C  C5    . DG  D 1 5   ? 21.864  -10.487 241.614 1.00 36.17  ? 5    DG  H C5    1 
ATOM   890   C  C6    . DG  D 1 5   ? 21.167  -11.553 240.985 1.00 41.00  ? 5    DG  H C6    1 
ATOM   891   O  O6    . DG  D 1 5   ? 20.017  -11.555 240.515 1.00 38.94  ? 5    DG  H O6    1 
ATOM   892   N  N1    . DG  D 1 5   ? 21.938  -12.707 240.934 1.00 25.17  ? 5    DG  H N1    1 
ATOM   893   C  C2    . DG  D 1 5   ? 23.210  -12.826 241.430 1.00 32.00  ? 5    DG  H C2    1 
ATOM   894   N  N2    . DG  D 1 5   ? 23.779  -14.036 241.295 1.00 14.35  ? 5    DG  H N2    1 
ATOM   895   N  N3    . DG  D 1 5   ? 23.874  -11.837 242.020 1.00 33.53  ? 5    DG  H N3    1 
ATOM   896   C  C4    . DG  D 1 5   ? 23.143  -10.705 242.078 1.00 36.83  ? 5    DG  H C4    1 
ATOM   897   P  P     . DT  D 1 6   ? 29.152  -8.538  242.541 1.00 55.75  ? 6    DT  H P     1 
ATOM   898   O  OP1   . DT  D 1 6   ? 30.307  -8.897  243.407 1.00 64.86  ? 6    DT  H OP1   1 
ATOM   899   O  OP2   . DT  D 1 6   ? 29.203  -7.306  241.712 1.00 51.69  ? 6    DT  H OP2   1 
ATOM   900   O  "O5'" . DT  D 1 6   ? 28.793  -9.794  241.638 1.00 34.54  ? 6    DT  H "O5'" 1 
ATOM   901   C  "C5'" . DT  D 1 6   ? 28.667  -11.079 242.226 1.00 35.15  ? 6    DT  H "C5'" 1 
ATOM   902   C  "C4'" . DT  D 1 6   ? 28.520  -12.118 241.145 1.00 47.34  ? 6    DT  H "C4'" 1 
ATOM   903   O  "O4'" . DT  D 1 6   ? 27.132  -12.320 240.783 1.00 49.02  ? 6    DT  H "O4'" 1 
ATOM   904   C  "C3'" . DT  D 1 6   ? 29.252  -11.733 239.859 1.00 59.78  ? 6    DT  H "C3'" 1 
ATOM   905   O  "O3'" . DT  D 1 6   ? 30.007  -12.850 239.386 1.00 66.70  ? 6    DT  H "O3'" 1 
ATOM   906   C  "C2'" . DT  D 1 6   ? 28.128  -11.385 238.893 1.00 45.88  ? 6    DT  H "C2'" 1 
ATOM   907   C  "C1'" . DT  D 1 6   ? 27.025  -12.319 239.367 1.00 43.91  ? 6    DT  H "C1'" 1 
ATOM   908   N  N1    . DT  D 1 6   ? 25.630  -11.936 238.978 1.00 30.98  ? 6    DT  H N1    1 
ATOM   909   C  C2    . DT  D 1 6   ? 24.797  -12.913 238.460 1.00 21.07  ? 6    DT  H C2    1 
ATOM   910   O  O2    . DT  D 1 6   ? 25.107  -14.097 238.397 1.00 26.22  ? 6    DT  H O2    1 
ATOM   911   N  N3    . DT  D 1 6   ? 23.581  -12.453 238.026 1.00 6.73   ? 6    DT  H N3    1 
ATOM   912   C  C4    . DT  D 1 6   ? 23.110  -11.155 238.072 1.00 22.83  ? 6    DT  H C4    1 
ATOM   913   O  O4    . DT  D 1 6   ? 22.011  -10.880 237.566 1.00 28.90  ? 6    DT  H O4    1 
ATOM   914   C  C5    . DT  D 1 6   ? 23.991  -10.206 238.704 1.00 16.97  ? 6    DT  H C5    1 
ATOM   915   C  C7    . DT  D 1 6   ? 23.521  -8.798  238.890 1.00 24.90  ? 6    DT  H C7    1 
ATOM   916   C  C6    . DT  D 1 6   ? 25.195  -10.633 239.107 1.00 25.61  ? 6    DT  H C6    1 
ATOM   917   P  P     . DC  D 1 7   ? 31.273  -12.616 238.423 1.00 61.63  ? 7    DC  H P     1 
ATOM   918   O  OP1   . DC  D 1 7   ? 32.518  -12.692 239.217 1.00 58.16  ? 7    DC  H OP1   1 
ATOM   919   O  OP2   . DC  D 1 7   ? 31.016  -11.423 237.574 1.00 56.51  ? 7    DC  H OP2   1 
ATOM   920   O  "O5'" . DC  D 1 7   ? 31.213  -13.910 237.510 1.00 55.00  ? 7    DC  H "O5'" 1 
ATOM   921   C  "C5'" . DC  D 1 7   ? 30.956  -15.177 238.099 1.00 47.48  ? 7    DC  H "C5'" 1 
ATOM   922   C  "C4'" . DC  D 1 7   ? 30.272  -16.077 237.101 1.00 51.42  ? 7    DC  H "C4'" 1 
ATOM   923   O  "O4'" . DC  D 1 7   ? 28.854  -15.783 237.016 1.00 59.36  ? 7    DC  H "O4'" 1 
ATOM   924   C  "C3'" . DC  D 1 7   ? 30.835  -15.881 235.699 1.00 57.14  ? 7    DC  H "C3'" 1 
ATOM   925   O  "O3'" . DC  D 1 7   ? 31.044  -17.128 235.056 1.00 64.63  ? 7    DC  H "O3'" 1 
ATOM   926   C  "C2'" . DC  D 1 7   ? 29.751  -15.101 234.983 1.00 65.28  ? 7    DC  H "C2'" 1 
ATOM   927   C  "C1'" . DC  D 1 7   ? 28.501  -15.636 235.657 1.00 57.24  ? 7    DC  H "C1'" 1 
ATOM   928   N  N1    . DC  D 1 7   ? 27.330  -14.745 235.553 1.00 51.26  ? 7    DC  H N1    1 
ATOM   929   C  C2    . DC  D 1 7   ? 26.053  -15.310 235.488 1.00 44.75  ? 7    DC  H C2    1 
ATOM   930   O  O2    . DC  D 1 7   ? 25.924  -16.520 235.701 1.00 40.72  ? 7    DC  H O2    1 
ATOM   931   N  N3    . DC  D 1 7   ? 24.994  -14.517 235.205 1.00 36.45  ? 7    DC  H N3    1 
ATOM   932   C  C4    . DC  D 1 7   ? 25.174  -13.204 235.033 1.00 36.83  ? 7    DC  H C4    1 
ATOM   933   N  N4    . DC  D 1 7   ? 24.119  -12.465 234.687 1.00 37.97  ? 7    DC  H N4    1 
ATOM   934   C  C5    . DC  D 1 7   ? 26.450  -12.592 235.190 1.00 32.04  ? 7    DC  H C5    1 
ATOM   935   C  C6    . DC  D 1 7   ? 27.490  -13.391 235.452 1.00 42.95  ? 7    DC  H C6    1 
ATOM   936   P  P     . DG  D 1 8   ? 31.792  -17.163 233.639 1.00 62.02  ? 8    DG  H P     1 
ATOM   937   O  OP1   . DG  D 1 8   ? 33.024  -17.994 233.771 1.00 64.83  ? 8    DG  H OP1   1 
ATOM   938   O  OP2   . DG  D 1 8   ? 31.896  -15.741 233.225 1.00 34.45  ? 8    DG  H OP2   1 
ATOM   939   O  "O5'" . DG  D 1 8   ? 30.760  -17.929 232.698 1.00 56.13  ? 8    DG  H "O5'" 1 
ATOM   940   C  "C5'" . DG  D 1 8   ? 29.362  -17.715 232.855 1.00 62.96  ? 8    DG  H "C5'" 1 
ATOM   941   C  "C4'" . DG  D 1 8   ? 28.630  -18.081 231.590 1.00 60.30  ? 8    DG  H "C4'" 1 
ATOM   942   O  "O4'" . DG  D 1 8   ? 27.285  -17.549 231.730 1.00 50.95  ? 8    DG  H "O4'" 1 
ATOM   943   C  "C3'" . DG  D 1 8   ? 29.247  -17.398 230.367 1.00 60.94  ? 8    DG  H "C3'" 1 
ATOM   944   O  "O3'" . DG  D 1 8   ? 29.313  -18.260 229.226 1.00 59.74  ? 8    DG  H "O3'" 1 
ATOM   945   C  "C2'" . DG  D 1 8   ? 28.321  -16.234 230.088 1.00 63.96  ? 8    DG  H "C2'" 1 
ATOM   946   C  "C1'" . DG  D 1 8   ? 26.987  -16.673 230.668 1.00 49.21  ? 8    DG  H "C1'" 1 
ATOM   947   N  N9    . DG  D 1 8   ? 26.274  -15.507 231.184 1.00 43.84  ? 8    DG  H N9    1 
ATOM   948   C  C8    . DG  D 1 8   ? 26.828  -14.448 231.864 1.00 37.07  ? 8    DG  H C8    1 
ATOM   949   N  N7    . DG  D 1 8   ? 26.018  -13.431 231.971 1.00 40.82  ? 8    DG  H N7    1 
ATOM   950   C  C5    . DG  D 1 8   ? 24.836  -13.868 231.379 1.00 43.61  ? 8    DG  H C5    1 
ATOM   951   C  C6    . DG  D 1 8   ? 23.608  -13.187 231.152 1.00 32.45  ? 8    DG  H C6    1 
ATOM   952   O  O6    . DG  D 1 8   ? 23.318  -12.021 231.408 1.00 44.94  ? 8    DG  H O6    1 
ATOM   953   N  N1    . DG  D 1 8   ? 22.675  -14.007 230.534 1.00 31.21  ? 8    DG  H N1    1 
ATOM   954   C  C2    . DG  D 1 8   ? 22.890  -15.308 230.164 1.00 35.28  ? 8    DG  H C2    1 
ATOM   955   N  N2    . DG  D 1 8   ? 21.865  -15.929 229.555 1.00 35.98  ? 8    DG  H N2    1 
ATOM   956   N  N3    . DG  D 1 8   ? 24.028  -15.952 230.361 1.00 38.27  ? 8    DG  H N3    1 
ATOM   957   C  C4    . DG  D 1 8   ? 24.955  -15.173 230.957 1.00 42.65  ? 8    DG  H C4    1 
ATOM   958   P  P     . DA  D 1 9   ? 30.208  -17.829 227.952 1.00 58.48  ? 9    DA  H P     1 
ATOM   959   O  OP1   . DA  D 1 9   ? 30.601  -19.071 227.240 1.00 37.68  ? 9    DA  H OP1   1 
ATOM   960   O  OP2   . DA  D 1 9   ? 31.257  -16.850 228.367 1.00 37.75  ? 9    DA  H OP2   1 
ATOM   961   O  "O5'" . DA  D 1 9   ? 29.154  -17.069 227.039 1.00 51.25  ? 9    DA  H "O5'" 1 
ATOM   962   C  "C5'" . DA  D 1 9   ? 27.947  -17.728 226.672 1.00 53.00  ? 9    DA  H "C5'" 1 
ATOM   963   C  "C4'" . DA  D 1 9   ? 27.102  -16.829 225.805 1.00 46.62  ? 9    DA  H "C4'" 1 
ATOM   964   O  "O4'" . DA  D 1 9   ? 26.473  -15.791 226.590 1.00 53.54  ? 9    DA  H "O4'" 1 
ATOM   965   C  "C3'" . DA  D 1 9   ? 27.893  -16.107 224.718 1.00 43.86  ? 9    DA  H "C3'" 1 
ATOM   966   O  "O3'" . DA  D 1 9   ? 27.076  -16.028 223.563 1.00 51.77  ? 9    DA  H "O3'" 1 
ATOM   967   C  "C2'" . DA  D 1 9   ? 28.046  -14.710 225.283 1.00 39.04  ? 9    DA  H "C2'" 1 
ATOM   968   C  "C1'" . DA  D 1 9   ? 26.699  -14.562 225.936 1.00 41.04  ? 9    DA  H "C1'" 1 
ATOM   969   N  N9    . DA  D 1 9   ? 26.573  -13.480 226.902 1.00 32.50  ? 9    DA  H N9    1 
ATOM   970   C  C8    . DA  D 1 9   ? 27.557  -12.807 227.581 1.00 46.89  ? 9    DA  H C8    1 
ATOM   971   N  N7    . DA  D 1 9   ? 27.111  -11.799 228.292 1.00 43.61  ? 9    DA  H N7    1 
ATOM   972   C  C5    . DA  D 1 9   ? 25.739  -11.825 228.081 1.00 41.76  ? 9    DA  H C5    1 
ATOM   973   C  C6    . DA  D 1 9   ? 24.699  -11.002 228.528 1.00 37.47  ? 9    DA  H C6    1 
ATOM   974   N  N6    . DA  D 1 9   ? 24.888  -9.922  229.284 1.00 53.90  ? 9    DA  H N6    1 
ATOM   975   N  N1    . DA  D 1 9   ? 23.440  -11.320 228.156 1.00 38.01  ? 9    DA  H N1    1 
ATOM   976   C  C2    . DA  D 1 9   ? 23.253  -12.384 227.365 1.00 43.12  ? 9    DA  H C2    1 
ATOM   977   N  N3    . DA  D 1 9   ? 24.153  -13.218 226.854 1.00 43.57  ? 9    DA  H N3    1 
ATOM   978   C  C4    . DA  D 1 9   ? 25.393  -12.879 227.257 1.00 43.43  ? 9    DA  H C4    1 
ATOM   979   P  P     . DC  D 1 10  ? 27.742  -16.092 222.110 1.00 52.25  ? 10   DC  H P     1 
ATOM   980   O  OP1   . DC  D 1 10  ? 28.111  -17.508 221.826 1.00 49.67  ? 10   DC  H OP1   1 
ATOM   981   O  OP2   . DC  D 1 10  ? 28.776  -15.050 222.056 1.00 37.92  ? 10   DC  H OP2   1 
ATOM   982   O  "O5'" . DC  D 1 10  ? 26.535  -15.663 221.168 1.00 51.53  ? 10   DC  H "O5'" 1 
ATOM   983   C  "C5'" . DC  D 1 10  ? 26.189  -14.288 221.018 1.00 52.77  ? 10   DC  H "C5'" 1 
ATOM   984   C  "C4'" . DC  D 1 10  ? 24.739  -14.051 221.374 1.00 47.44  ? 10   DC  H "C4'" 1 
ATOM   985   O  "O4'" . DC  D 1 10  ? 24.687  -13.567 222.743 1.00 39.43  ? 10   DC  H "O4'" 1 
ATOM   986   C  "C3'" . DC  D 1 10  ? 24.111  -12.948 220.516 1.00 53.84  ? 10   DC  H "C3'" 1 
ATOM   987   O  "O3'" . DC  D 1 10  ? 22.753  -13.210 220.147 1.00 53.06  ? 10   DC  H "O3'" 1 
ATOM   988   C  "C2'" . DC  D 1 10  ? 24.146  -11.728 221.409 1.00 58.71  ? 10   DC  H "C2'" 1 
ATOM   989   C  "C1'" . DC  D 1 10  ? 23.992  -12.331 222.788 1.00 54.68  ? 10   DC  H "C1'" 1 
ATOM   990   N  N1    . DC  D 1 10  ? 24.621  -11.470 223.794 1.00 58.34  ? 10   DC  H N1    1 
ATOM   991   C  C2    . DC  D 1 10  ? 23.803  -10.638 224.565 1.00 60.45  ? 10   DC  H C2    1 
ATOM   992   O  O2    . DC  D 1 10  ? 22.568  -10.736 224.451 1.00 61.42  ? 10   DC  H O2    1 
ATOM   993   N  N3    . DC  D 1 10  ? 24.374  -9.756  225.416 1.00 55.09  ? 10   DC  H N3    1 
ATOM   994   C  C4    . DC  D 1 10  ? 25.703  -9.698  225.521 1.00 53.40  ? 10   DC  H C4    1 
ATOM   995   N  N4    . DC  D 1 10  ? 26.229  -8.778  226.332 1.00 57.65  ? 10   DC  H N4    1 
ATOM   996   C  C5    . DC  D 1 10  ? 26.553  -10.572 224.789 1.00 59.33  ? 10   DC  H C5    1 
ATOM   997   C  C6    . DC  D 1 10  ? 25.976  -11.436 223.944 1.00 58.66  ? 10   DC  H C6    1 
ATOM   998   P  P     . DC  D 1 11  ? 22.024  -12.210 219.112 1.00 52.22  ? 11   DC  H P     1 
ATOM   999   O  OP1   . DC  D 1 11  ? 21.106  -11.299 219.861 1.00 41.49  ? 11   DC  H OP1   1 
ATOM   1000  O  OP2   . DC  D 1 11  ? 21.493  -13.004 217.982 1.00 52.42  ? 11   DC  H OP2   1 
ATOM   1001  O  "O5'" . DC  D 1 11  ? 23.228  -11.323 218.556 1.00 41.19  ? 11   DC  H "O5'" 1 
ATOM   1002  C  "C5'" . DC  D 1 11  ? 23.120  -10.646 217.310 1.00 38.00  ? 11   DC  H "C5'" 1 
ATOM   1003  C  "C4'" . DC  D 1 11  ? 22.375  -9.349  217.499 1.00 37.23  ? 11   DC  H "C4'" 1 
ATOM   1004  O  "O4'" . DC  D 1 11  ? 23.151  -8.454  218.333 1.00 34.31  ? 11   DC  H "O4'" 1 
ATOM   1005  C  "C3'" . DC  D 1 11  ? 22.064  -8.569  216.222 1.00 44.15  ? 11   DC  H "C3'" 1 
ATOM   1006  O  "O3'" . DC  D 1 11  ? 20.716  -8.120  216.299 1.00 41.91  ? 11   DC  H "O3'" 1 
ATOM   1007  C  "C2'" . DC  D 1 11  ? 23.005  -7.373  216.280 1.00 47.80  ? 11   DC  H "C2'" 1 
ATOM   1008  C  "C1'" . DC  D 1 11  ? 23.154  -7.151  217.767 1.00 35.60  ? 11   DC  H "C1'" 1 
ATOM   1009  N  N1    . DC  D 1 11  ? 24.402  -6.493  218.173 1.00 37.89  ? 11   DC  H N1    1 
ATOM   1010  C  C2    . DC  D 1 11  ? 24.351  -5.489  219.135 1.00 42.18  ? 11   DC  H C2    1 
ATOM   1011  O  O2    . DC  D 1 11  ? 23.251  -5.133  219.573 1.00 42.22  ? 11   DC  H O2    1 
ATOM   1012  N  N3    . DC  D 1 11  ? 25.506  -4.929  219.564 1.00 47.63  ? 11   DC  H N3    1 
ATOM   1013  C  C4    . DC  D 1 11  ? 26.674  -5.337  219.063 1.00 37.73  ? 11   DC  H C4    1 
ATOM   1014  N  N4    . DC  D 1 11  ? 27.784  -4.792  219.544 1.00 29.79  ? 11   DC  H N4    1 
ATOM   1015  C  C5    . DC  D 1 11  ? 26.752  -6.330  218.056 1.00 36.76  ? 11   DC  H C5    1 
ATOM   1016  C  C6    . DC  D 1 11  ? 25.601  -6.877  217.641 1.00 50.12  ? 11   DC  H C6    1 
ATOM   1017  P  P     . DG  D 1 12  ? 19.939  -7.697  214.973 1.00 48.73  ? 12   DG  H P     1 
ATOM   1018  O  OP1   . DG  D 1 12  ? 18.752  -8.581  214.886 1.00 38.43  ? 12   DG  H OP1   1 
ATOM   1019  O  OP2   . DG  D 1 12  ? 20.908  -7.627  213.846 1.00 43.52  ? 12   DG  H OP2   1 
ATOM   1020  O  "O5'" . DG  D 1 12  ? 19.455  -6.223  215.309 1.00 49.26  ? 12   DG  H "O5'" 1 
ATOM   1021  C  "C5'" . DG  D 1 12  ? 18.727  -5.974  216.499 1.00 50.67  ? 12   DG  H "C5'" 1 
ATOM   1022  C  "C4'" . DG  D 1 12  ? 18.847  -4.524  216.896 1.00 47.93  ? 12   DG  H "C4'" 1 
ATOM   1023  O  "O4'" . DG  D 1 12  ? 20.155  -4.220  217.432 1.00 39.42  ? 12   DG  H "O4'" 1 
ATOM   1024  C  "C3'" . DG  D 1 12  ? 18.634  -3.540  215.750 1.00 46.04  ? 12   DG  H "C3'" 1 
ATOM   1025  O  "O3'" . DG  D 1 12  ? 17.918  -2.438  216.266 1.00 55.79  ? 12   DG  H "O3'" 1 
ATOM   1026  C  "C2'" . DG  D 1 12  ? 20.034  -3.050  215.443 1.00 52.00  ? 12   DG  H "C2'" 1 
ATOM   1027  C  "C1'" . DG  D 1 12  ? 20.585  -2.998  216.844 1.00 41.76  ? 12   DG  H "C1'" 1 
ATOM   1028  N  N9    . DG  D 1 12  ? 22.034  -2.921  216.955 1.00 40.46  ? 12   DG  H N9    1 
ATOM   1029  C  C8    . DG  D 1 12  ? 22.963  -3.568  216.183 1.00 43.53  ? 12   DG  H C8    1 
ATOM   1030  N  N7    . DG  D 1 12  ? 24.188  -3.358  216.573 1.00 44.59  ? 12   DG  H N7    1 
ATOM   1031  C  C5    . DG  D 1 12  ? 24.058  -2.513  217.663 1.00 34.44  ? 12   DG  H C5    1 
ATOM   1032  C  C6    . DG  D 1 12  ? 25.043  -1.969  218.521 1.00 42.24  ? 12   DG  H C6    1 
ATOM   1033  O  O6    . DG  D 1 12  ? 26.272  -2.138  218.495 1.00 30.25  ? 12   DG  H O6    1 
ATOM   1034  N  N1    . DG  D 1 12  ? 24.476  -1.161  219.500 1.00 40.09  ? 12   DG  H N1    1 
ATOM   1035  C  C2    . DG  D 1 12  ? 23.134  -0.918  219.646 1.00 49.14  ? 12   DG  H C2    1 
ATOM   1036  N  N2    . DG  D 1 12  ? 22.779  -0.115  220.663 1.00 48.24  ? 12   DG  H N2    1 
ATOM   1037  N  N3    . DG  D 1 12  ? 22.204  -1.427  218.854 1.00 52.42  ? 12   DG  H N3    1 
ATOM   1038  C  C4    . DG  D 1 12  ? 22.736  -2.211  217.892 1.00 37.29  ? 12   DG  H C4    1 
ATOM   1039  P  P     . DG  D 1 13  ? 16.625  -1.922  215.502 1.00 60.68  ? 13   DG  H P     1 
ATOM   1040  O  OP1   . DG  D 1 13  ? 16.283  -2.964  214.509 1.00 67.13  ? 13   DG  H OP1   1 
ATOM   1041  O  OP2   . DG  D 1 13  ? 16.934  -0.552  215.041 1.00 63.75  ? 13   DG  H OP2   1 
ATOM   1042  O  "O5'" . DG  D 1 13  ? 15.521  -1.872  216.650 1.00 73.92  ? 13   DG  H "O5'" 1 
ATOM   1043  C  "C5'" . DG  D 1 13  ? 14.834  -3.055  217.066 1.00 93.75  ? 13   DG  H "C5'" 1 
ATOM   1044  C  "C4'" . DG  D 1 13  ? 13.743  -2.704  218.053 1.00 108.12 ? 13   DG  H "C4'" 1 
ATOM   1045  O  "O4'" . DG  D 1 13  ? 13.129  -1.464  217.647 1.00 116.30 ? 13   DG  H "O4'" 1 
ATOM   1046  C  "C3'" . DG  D 1 13  ? 12.596  -3.705  218.109 1.00 112.51 ? 13   DG  H "C3'" 1 
ATOM   1047  O  "O3'" . DG  D 1 13  ? 11.821  -3.520  219.299 1.00 109.81 ? 13   DG  H "O3'" 1 
ATOM   1048  C  "C2'" . DG  D 1 13  ? 11.732  -3.248  216.947 1.00 118.42 ? 13   DG  H "C2'" 1 
ATOM   1049  C  "C1'" . DG  D 1 13  ? 11.911  -1.728  216.959 1.00 125.28 ? 13   DG  H "C1'" 1 
ATOM   1050  N  N9    . DG  D 1 13  ? 12.038  -1.128  215.633 1.00 137.41 ? 13   DG  H N9    1 
ATOM   1051  C  C8    . DG  D 1 13  ? 12.874  -1.544  214.625 1.00 141.02 ? 13   DG  H C8    1 
ATOM   1052  N  N7    . DG  D 1 13  ? 12.805  -0.795  213.557 1.00 144.05 ? 13   DG  H N7    1 
ATOM   1053  C  C5    . DG  D 1 13  ? 11.862  0.171   213.874 1.00 150.33 ? 13   DG  H C5    1 
ATOM   1054  C  C6    . DG  D 1 13  ? 11.371  1.261   213.108 1.00 155.28 ? 13   DG  H C6    1 
ATOM   1055  O  O6    . DG  D 1 13  ? 11.682  1.598   211.956 1.00 157.51 ? 13   DG  H O6    1 
ATOM   1056  N  N1    . DG  D 1 13  ? 10.423  1.996   213.814 1.00 159.49 ? 13   DG  H N1    1 
ATOM   1057  C  C2    . DG  D 1 13  ? 10.000  1.722   215.091 1.00 159.43 ? 13   DG  H C2    1 
ATOM   1058  N  N2    . DG  D 1 13  ? 9.081   2.560   215.600 1.00 160.24 ? 13   DG  H N2    1 
ATOM   1059  N  N3    . DG  D 1 13  ? 10.446  0.705   215.816 1.00 155.82 ? 13   DG  H N3    1 
ATOM   1060  C  C4    . DG  D 1 13  ? 11.370  -0.023  215.150 1.00 148.13 ? 13   DG  H C4    1 
ATOM   1061  N  N     . SER E 2 1   ? -1.358  22.781  201.088 1.00 42.63  ? 2    SER A N     1 
ATOM   1062  C  CA    . SER E 2 1   ? -0.387  22.625  199.963 1.00 48.12  ? 2    SER A CA    1 
ATOM   1063  C  C     . SER E 2 1   ? -1.052  22.692  198.597 1.00 47.96  ? 2    SER A C     1 
ATOM   1064  O  O     . SER E 2 1   ? -2.203  22.286  198.433 1.00 48.81  ? 2    SER A O     1 
ATOM   1065  C  CB    . SER E 2 1   ? 0.340   21.289  200.083 1.00 48.88  ? 2    SER A CB    1 
ATOM   1066  O  OG    . SER E 2 1   ? 0.784   20.864  198.803 1.00 52.26  ? 2    SER A OG    1 
ATOM   1067  N  N     . PHE E 2 2   ? -0.318  23.187  197.608 1.00 46.93  ? 3    PHE A N     1 
ATOM   1068  C  CA    . PHE E 2 2   ? -0.854  23.272  196.252 1.00 51.46  ? 3    PHE A CA    1 
ATOM   1069  C  C     . PHE E 2 2   ? -0.328  22.119  195.395 1.00 47.75  ? 3    PHE A C     1 
ATOM   1070  O  O     . PHE E 2 2   ? -0.593  22.053  194.202 1.00 48.16  ? 3    PHE A O     1 
ATOM   1071  C  CB    . PHE E 2 2   ? -0.480  24.611  195.603 1.00 51.38  ? 3    PHE A CB    1 
ATOM   1072  C  CG    . PHE E 2 2   ? -1.039  25.813  196.317 1.00 56.92  ? 3    PHE A CG    1 
ATOM   1073  C  CD1   . PHE E 2 2   ? -2.412  25.981  196.461 1.00 57.49  ? 3    PHE A CD1   1 
ATOM   1074  C  CD2   . PHE E 2 2   ? -0.191  26.784  196.841 1.00 54.23  ? 3    PHE A CD2   1 
ATOM   1075  C  CE1   . PHE E 2 2   ? -2.927  27.099  197.117 1.00 58.40  ? 3    PHE A CE1   1 
ATOM   1076  C  CE2   . PHE E 2 2   ? -0.697  27.902  197.495 1.00 44.13  ? 3    PHE A CE2   1 
ATOM   1077  C  CZ    . PHE E 2 2   ? -2.066  28.060  197.634 1.00 55.25  ? 3    PHE A CZ    1 
ATOM   1078  N  N     . ILE E 2 3   ? 0.417   21.213  196.013 1.00 43.86  ? 4    ILE A N     1 
ATOM   1079  C  CA    . ILE E 2 3   ? 0.967   20.075  195.307 1.00 40.28  ? 4    ILE A CA    1 
ATOM   1080  C  C     . ILE E 2 3   ? 0.323   18.794  195.822 1.00 43.84  ? 4    ILE A C     1 
ATOM   1081  O  O     . ILE E 2 3   ? 0.069   17.860  195.058 1.00 42.98  ? 4    ILE A O     1 
ATOM   1082  C  CB    . ILE E 2 3   ? 2.506   20.022  195.494 1.00 48.81  ? 4    ILE A CB    1 
ATOM   1083  C  CG1   . ILE E 2 3   ? 3.178   20.855  194.409 1.00 51.33  ? 4    ILE A CG1   1 
ATOM   1084  C  CG2   . ILE E 2 3   ? 3.021   18.600  195.430 1.00 49.36  ? 4    ILE A CG2   1 
ATOM   1085  C  CD1   . ILE E 2 3   ? 4.680   20.769  194.429 1.00 47.77  ? 4    ILE A CD1   1 
ATOM   1086  N  N     . LYS E 2 4   ? 0.041   18.769  197.120 1.00 40.78  ? 5    LYS A N     1 
ATOM   1087  C  CA    . LYS E 2 4   ? -0.571  17.611  197.771 1.00 45.78  ? 5    LYS A CA    1 
ATOM   1088  C  C     . LYS E 2 4   ? -1.664  16.960  196.930 1.00 55.15  ? 5    LYS A C     1 
ATOM   1089  O  O     . LYS E 2 4   ? -1.664  15.743  196.745 1.00 50.33  ? 5    LYS A O     1 
ATOM   1090  C  CB    . LYS E 2 4   ? -1.143  18.030  199.121 1.00 48.84  ? 5    LYS A CB    1 
ATOM   1091  C  CG    . LYS E 2 4   ? -0.772  17.115  200.254 1.00 45.74  ? 5    LYS A CG    1 
ATOM   1092  C  CD    . LYS E 2 4   ? -1.547  15.823  200.238 1.00 33.81  ? 5    LYS A CD    1 
ATOM   1093  C  CE    . LYS E 2 4   ? -1.026  14.923  201.335 1.00 46.11  ? 5    LYS A CE    1 
ATOM   1094  N  NZ    . LYS E 2 4   ? -0.927  15.667  202.620 1.00 49.63  ? 5    LYS A NZ    1 
ATOM   1095  N  N     . PRO E 2 5   ? -2.614  17.767  196.410 1.00 66.67  ? 6    PRO A N     1 
ATOM   1096  C  CA    . PRO E 2 5   ? -3.718  17.263  195.580 1.00 70.93  ? 6    PRO A CA    1 
ATOM   1097  C  C     . PRO E 2 5   ? -3.307  16.601  194.255 1.00 66.61  ? 6    PRO A C     1 
ATOM   1098  O  O     . PRO E 2 5   ? -4.118  15.926  193.622 1.00 64.21  ? 6    PRO A O     1 
ATOM   1099  C  CB    . PRO E 2 5   ? -4.582  18.508  195.366 1.00 67.01  ? 6    PRO A CB    1 
ATOM   1100  C  CG    . PRO E 2 5   ? -3.579  19.608  195.392 1.00 69.08  ? 6    PRO A CG    1 
ATOM   1101  C  CD    . PRO E 2 5   ? -2.738  19.227  196.582 1.00 66.72  ? 6    PRO A CD    1 
ATOM   1102  N  N     . ILE E 2 6   ? -2.062  16.802  193.831 1.00 64.46  ? 7    ILE A N     1 
ATOM   1103  C  CA    . ILE E 2 6   ? -1.590  16.182  192.591 1.00 60.34  ? 7    ILE A CA    1 
ATOM   1104  C  C     . ILE E 2 6   ? -0.291  15.402  192.803 1.00 51.88  ? 7    ILE A C     1 
ATOM   1105  O  O     . ILE E 2 6   ? 0.474   15.201  191.861 1.00 40.35  ? 7    ILE A O     1 
ATOM   1106  C  CB    . ILE E 2 6   ? -1.338  17.212  191.447 1.00 58.26  ? 7    ILE A CB    1 
ATOM   1107  C  CG1   . ILE E 2 6   ? -0.202  18.169  191.825 1.00 51.43  ? 7    ILE A CG1   1 
ATOM   1108  C  CG2   . ILE E 2 6   ? -2.615  17.972  191.139 1.00 60.64  ? 7    ILE A CG2   1 
ATOM   1109  C  CD1   . ILE E 2 6   ? 0.486   18.772  190.623 1.00 39.66  ? 7    ILE A CD1   1 
ATOM   1110  N  N     . TYR E 2 7   ? -0.053  14.957  194.035 1.00 41.47  ? 8    TYR A N     1 
ATOM   1111  C  CA    . TYR E 2 7   ? 1.156   14.213  194.347 1.00 42.91  ? 8    TYR A CA    1 
ATOM   1112  C  C     . TYR E 2 7   ? 1.294   12.956  193.505 1.00 43.55  ? 8    TYR A C     1 
ATOM   1113  O  O     . TYR E 2 7   ? 2.403   12.544  193.153 1.00 40.91  ? 8    TYR A O     1 
ATOM   1114  C  CB    . TYR E 2 7   ? 1.180   13.825  195.816 1.00 40.83  ? 8    TYR A CB    1 
ATOM   1115  C  CG    . TYR E 2 7   ? 2.426   13.071  196.194 1.00 42.35  ? 8    TYR A CG    1 
ATOM   1116  C  CD1   . TYR E 2 7   ? 3.669   13.699  196.202 1.00 39.92  ? 8    TYR A CD1   1 
ATOM   1117  C  CD2   . TYR E 2 7   ? 2.365   11.724  196.527 1.00 46.78  ? 8    TYR A CD2   1 
ATOM   1118  C  CE1   . TYR E 2 7   ? 4.826   13.000  196.538 1.00 44.22  ? 8    TYR A CE1   1 
ATOM   1119  C  CE2   . TYR E 2 7   ? 3.508   11.016  196.861 1.00 55.19  ? 8    TYR A CE2   1 
ATOM   1120  C  CZ    . TYR E 2 7   ? 4.734   11.657  196.869 1.00 53.61  ? 8    TYR A CZ    1 
ATOM   1121  O  OH    . TYR E 2 7   ? 5.851   10.945  197.231 1.00 55.75  ? 8    TYR A OH    1 
ATOM   1122  N  N     . GLN E 2 8   ? 0.159   12.340  193.201 1.00 44.87  ? 9    GLN A N     1 
ATOM   1123  C  CA    . GLN E 2 8   ? 0.129   11.134  192.389 1.00 46.81  ? 9    GLN A CA    1 
ATOM   1124  C  C     . GLN E 2 8   ? 0.492   11.469  190.946 1.00 42.96  ? 9    GLN A C     1 
ATOM   1125  O  O     . GLN E 2 8   ? 1.154   10.689  190.273 1.00 45.64  ? 9    GLN A O     1 
ATOM   1126  C  CB    . GLN E 2 8   ? -1.267  10.492  192.420 1.00 60.93  ? 9    GLN A CB    1 
ATOM   1127  C  CG    . GLN E 2 8   ? -1.833  10.240  193.810 1.00 75.63  ? 9    GLN A CG    1 
ATOM   1128  C  CD    . GLN E 2 8   ? -0.814  9.636   194.755 1.00 80.06  ? 9    GLN A CD    1 
ATOM   1129  O  OE1   . GLN E 2 8   ? -0.199  8.608   194.459 1.00 80.08  ? 9    GLN A OE1   1 
ATOM   1130  N  NE2   . GLN E 2 8   ? -0.630  10.274  195.903 1.00 84.21  ? 9    GLN A NE2   1 
ATOM   1131  N  N     . ASP E 2 9   ? 0.048   12.621  190.461 1.00 45.00  ? 10   ASP A N     1 
ATOM   1132  C  CA    . ASP E 2 9   ? 0.354   13.012  189.089 1.00 61.22  ? 10   ASP A CA    1 
ATOM   1133  C  C     . ASP E 2 9   ? 1.869   13.221  188.992 1.00 63.31  ? 10   ASP A C     1 
ATOM   1134  O  O     . ASP E 2 9   ? 2.499   12.897  187.981 1.00 66.29  ? 10   ASP A O     1 
ATOM   1135  C  CB    . ASP E 2 9   ? -0.394  14.310  188.715 1.00 73.49  ? 10   ASP A CB    1 
ATOM   1136  C  CG    . ASP E 2 9   ? -1.924  14.126  188.625 1.00 89.34  ? 10   ASP A CG    1 
ATOM   1137  O  OD1   . ASP E 2 9   ? -2.534  13.610  189.592 1.00 94.89  ? 10   ASP A OD1   1 
ATOM   1138  O  OD2   . ASP E 2 9   ? -2.520  14.516  187.593 1.00 87.68  ? 10   ASP A OD2   1 
ATOM   1139  N  N     . ILE E 2 10  ? 2.443   13.758  190.066 1.00 65.14  ? 11   ILE A N     1 
ATOM   1140  C  CA    . ILE E 2 10  ? 3.875   14.032  190.142 1.00 58.09  ? 11   ILE A CA    1 
ATOM   1141  C  C     . ILE E 2 10  ? 4.640   12.737  190.377 1.00 55.80  ? 11   ILE A C     1 
ATOM   1142  O  O     . ILE E 2 10  ? 5.431   12.307  189.537 1.00 55.30  ? 11   ILE A O     1 
ATOM   1143  C  CB    . ILE E 2 10  ? 4.173   15.025  191.287 1.00 52.29  ? 11   ILE A CB    1 
ATOM   1144  C  CG1   . ILE E 2 10  ? 3.442   16.334  191.024 1.00 55.90  ? 11   ILE A CG1   1 
ATOM   1145  C  CG2   . ILE E 2 10  ? 5.641   15.319  191.375 1.00 43.29  ? 11   ILE A CG2   1 
ATOM   1146  C  CD1   . ILE E 2 10  ? 3.567   17.313  192.145 1.00 60.89  ? 11   ILE A CD1   1 
ATOM   1147  N  N     . ASN E 2 11  ? 4.388   12.107  191.516 1.00 54.90  ? 12   ASN A N     1 
ATOM   1148  C  CA    . ASN E 2 11  ? 5.064   10.866  191.847 1.00 55.24  ? 12   ASN A CA    1 
ATOM   1149  C  C     . ASN E 2 11  ? 5.152   9.922   190.654 1.00 54.07  ? 12   ASN A C     1 
ATOM   1150  O  O     . ASN E 2 11  ? 6.170   9.266   190.439 1.00 69.01  ? 12   ASN A O     1 
ATOM   1151  C  CB    . ASN E 2 11  ? 4.355   10.165  193.004 1.00 43.34  ? 12   ASN A CB    1 
ATOM   1152  C  CG    . ASN E 2 11  ? 4.794   8.727   193.161 1.00 45.40  ? 12   ASN A CG    1 
ATOM   1153  O  OD1   . ASN E 2 11  ? 4.480   7.881   192.331 1.00 40.31  ? 12   ASN A OD1   1 
ATOM   1154  N  ND2   . ASN E 2 11  ? 5.533   8.444   194.224 1.00 45.06  ? 12   ASN A ND2   1 
ATOM   1155  N  N     . SER E 2 12  ? 4.098   9.869   189.861 1.00 49.16  ? 13   SER A N     1 
ATOM   1156  C  CA    . SER E 2 12  ? 4.093   8.973   188.731 1.00 46.13  ? 13   SER A CA    1 
ATOM   1157  C  C     . SER E 2 12  ? 5.069   9.360   187.619 1.00 45.40  ? 13   SER A C     1 
ATOM   1158  O  O     . SER E 2 12  ? 5.946   8.568   187.265 1.00 47.62  ? 13   SER A O     1 
ATOM   1159  C  CB    . SER E 2 12  ? 2.664   8.838   188.221 1.00 55.30  ? 13   SER A CB    1 
ATOM   1160  O  OG    . SER E 2 12  ? 1.857   8.315   189.275 1.00 46.36  ? 13   SER A OG    1 
ATOM   1161  N  N     . ILE E 2 13  ? 4.946   10.568  187.081 1.00 40.55  ? 14   ILE A N     1 
ATOM   1162  C  CA    . ILE E 2 13  ? 5.847   11.008  186.023 1.00 40.62  ? 14   ILE A CA    1 
ATOM   1163  C  C     . ILE E 2 13  ? 7.324   10.969  186.436 1.00 49.31  ? 14   ILE A C     1 
ATOM   1164  O  O     . ILE E 2 13  ? 8.221   11.063  185.590 1.00 48.14  ? 14   ILE A O     1 
ATOM   1165  C  CB    . ILE E 2 13  ? 5.530   12.434  185.604 1.00 44.01  ? 14   ILE A CB    1 
ATOM   1166  C  CG1   . ILE E 2 13  ? 6.362   12.814  184.376 1.00 49.92  ? 14   ILE A CG1   1 
ATOM   1167  C  CG2   . ILE E 2 13  ? 5.825   13.368  186.736 1.00 30.60  ? 14   ILE A CG2   1 
ATOM   1168  C  CD1   . ILE E 2 13  ? 6.055   14.188  183.840 1.00 66.73  ? 14   ILE A CD1   1 
ATOM   1169  N  N     . LEU E 2 14  ? 7.577   10.835  187.735 1.00 49.38  ? 15   LEU A N     1 
ATOM   1170  C  CA    . LEU E 2 14  ? 8.942   10.802  188.252 1.00 44.03  ? 15   LEU A CA    1 
ATOM   1171  C  C     . LEU E 2 14  ? 9.594   9.434   188.169 1.00 53.33  ? 15   LEU A C     1 
ATOM   1172  O  O     . LEU E 2 14  ? 10.610  9.265   187.485 1.00 61.31  ? 15   LEU A O     1 
ATOM   1173  C  CB    . LEU E 2 14  ? 8.963   11.278  189.698 1.00 37.62  ? 15   LEU A CB    1 
ATOM   1174  C  CG    . LEU E 2 14  ? 8.571   12.744  189.920 1.00 46.13  ? 15   LEU A CG    1 
ATOM   1175  C  CD1   . LEU E 2 14  ? 8.527   13.013  191.419 1.00 52.65  ? 15   LEU A CD1   1 
ATOM   1176  C  CD2   . LEU E 2 14  ? 9.561   13.683  189.234 1.00 28.15  ? 15   LEU A CD2   1 
ATOM   1177  N  N     . ILE E 2 15  ? 9.013   8.461   188.866 1.00 49.59  ? 16   ILE A N     1 
ATOM   1178  C  CA    . ILE E 2 15  ? 9.558   7.107   188.873 1.00 45.00  ? 16   ILE A CA    1 
ATOM   1179  C  C     . ILE E 2 15  ? 9.829   6.544   187.486 1.00 49.60  ? 16   ILE A C     1 
ATOM   1180  O  O     . ILE E 2 15  ? 8.907   6.347   186.693 1.00 49.13  ? 16   ILE A O     1 
ATOM   1181  C  CB    . ILE E 2 15  ? 8.631   6.121   189.596 1.00 36.83  ? 16   ILE A CB    1 
ATOM   1182  C  CG1   . ILE E 2 15  ? 8.789   6.261   191.107 1.00 41.15  ? 16   ILE A CG1   1 
ATOM   1183  C  CG2   . ILE E 2 15  ? 8.968   4.703   189.192 1.00 46.13  ? 16   ILE A CG2   1 
ATOM   1184  C  CD1   . ILE E 2 15  ? 8.010   7.400   191.696 1.00 37.12  ? 16   ILE A CD1   1 
ATOM   1185  N  N     . GLY E 2 16  ? 11.100  6.274   187.207 1.00 48.99  ? 17   GLY A N     1 
ATOM   1186  C  CA    . GLY E 2 16  ? 11.471  5.713   185.925 1.00 46.41  ? 17   GLY A CA    1 
ATOM   1187  C  C     . GLY E 2 16  ? 11.945  6.715   184.903 1.00 52.76  ? 17   GLY A C     1 
ATOM   1188  O  O     . GLY E 2 16  ? 12.231  6.337   183.769 1.00 57.50  ? 17   GLY A O     1 
ATOM   1189  N  N     . GLN E 2 17  ? 12.046  7.981   185.287 1.00 54.87  ? 18   GLN A N     1 
ATOM   1190  C  CA    . GLN E 2 17  ? 12.487  9.002   184.347 1.00 69.87  ? 18   GLN A CA    1 
ATOM   1191  C  C     . GLN E 2 17  ? 14.023  9.063   184.196 1.00 75.52  ? 18   GLN A C     1 
ATOM   1192  O  O     . GLN E 2 17  ? 14.666  9.945   184.765 1.00 84.75  ? 18   GLN A O     1 
ATOM   1193  C  CB    . GLN E 2 17  ? 11.940  10.364  184.796 1.00 71.25  ? 18   GLN A CB    1 
ATOM   1194  C  CG    . GLN E 2 17  ? 11.912  11.411  183.694 1.00 75.51  ? 18   GLN A CG    1 
ATOM   1195  C  CD    . GLN E 2 17  ? 10.930  11.066  182.594 1.00 78.38  ? 18   GLN A CD    1 
ATOM   1196  O  OE1   . GLN E 2 17  ? 9.721   11.248  182.746 1.00 84.22  ? 18   GLN A OE1   1 
ATOM   1197  N  NE2   . GLN E 2 17  ? 11.444  10.550  181.480 1.00 71.76  ? 18   GLN A NE2   1 
ATOM   1198  N  N     . LYS E 2 18  ? 14.608  8.142   183.426 1.00 69.47  ? 19   LYS A N     1 
ATOM   1199  C  CA    . LYS E 2 18  ? 16.066  8.111   183.223 1.00 61.68  ? 19   LYS A CA    1 
ATOM   1200  C  C     . LYS E 2 18  ? 16.668  9.457   182.809 1.00 61.82  ? 19   LYS A C     1 
ATOM   1201  O  O     . LYS E 2 18  ? 16.447  9.933   181.698 1.00 58.79  ? 19   LYS A O     1 
ATOM   1202  C  CB    . LYS E 2 18  ? 16.453  7.055   182.166 1.00 58.36  ? 19   LYS A CB    1 
ATOM   1203  C  CG    . LYS E 2 18  ? 16.177  5.593   182.555 1.00 53.78  ? 19   LYS A CG    1 
ATOM   1204  C  CD    . LYS E 2 18  ? 16.618  4.639   181.448 1.00 49.11  ? 19   LYS A CD    1 
ATOM   1205  C  CE    . LYS E 2 18  ? 16.368  3.184   181.810 1.00 51.23  ? 19   LYS A CE    1 
ATOM   1206  N  NZ    . LYS E 2 18  ? 17.116  2.778   183.026 1.00 58.10  ? 19   LYS A NZ    1 
ATOM   1207  N  N     . VAL E 2 19  ? 17.444  10.054  183.708 1.00 71.95  ? 20   VAL A N     1 
ATOM   1208  C  CA    . VAL E 2 19  ? 18.093  11.339  183.453 1.00 80.06  ? 20   VAL A CA    1 
ATOM   1209  C  C     . VAL E 2 19  ? 19.619  11.200  183.420 1.00 88.33  ? 20   VAL A C     1 
ATOM   1210  O  O     . VAL E 2 19  ? 20.208  10.582  184.307 1.00 96.53  ? 20   VAL A O     1 
ATOM   1211  C  CB    . VAL E 2 19  ? 17.727  12.369  184.546 1.00 72.53  ? 20   VAL A CB    1 
ATOM   1212  C  CG1   . VAL E 2 19  ? 16.258  12.720  184.458 1.00 76.79  ? 20   VAL A CG1   1 
ATOM   1213  C  CG2   . VAL E 2 19  ? 18.053  11.804  185.922 1.00 71.81  ? 20   VAL A CG2   1 
ATOM   1214  N  N     . LYS E 2 20  ? 20.253  11.782  182.403 1.00 91.14  ? 21   LYS A N     1 
ATOM   1215  C  CA    . LYS E 2 20  ? 21.709  11.725  182.265 1.00 87.93  ? 21   LYS A CA    1 
ATOM   1216  C  C     . LYS E 2 20  ? 22.407  12.183  183.542 1.00 87.51  ? 21   LYS A C     1 
ATOM   1217  O  O     . LYS E 2 20  ? 21.963  13.124  184.198 1.00 87.69  ? 21   LYS A O     1 
ATOM   1218  C  CB    . LYS E 2 20  ? 22.156  12.601  181.095 1.00 86.41  ? 21   LYS A CB    1 
ATOM   1219  N  N     . ARG E 2 21  ? 23.500  11.513  183.892 1.00 90.50  ? 22   ARG A N     1 
ATOM   1220  C  CA    . ARG E 2 21  ? 24.254  11.853  185.098 1.00 96.00  ? 22   ARG A CA    1 
ATOM   1221  C  C     . ARG E 2 21  ? 25.178  13.038  184.852 1.00 98.04  ? 22   ARG A C     1 
ATOM   1222  O  O     . ARG E 2 21  ? 25.537  13.324  183.716 1.00 102.48 ? 22   ARG A O     1 
ATOM   1223  C  CB    . ARG E 2 21  ? 25.090  10.656  185.559 1.00 96.85  ? 22   ARG A CB    1 
ATOM   1224  C  CG    . ARG E 2 21  ? 26.165  10.230  184.574 1.00 97.90  ? 22   ARG A CG    1 
ATOM   1225  C  CD    . ARG E 2 21  ? 27.043  9.127   185.146 1.00 96.93  ? 22   ARG A CD    1 
ATOM   1226  N  NE    . ARG E 2 21  ? 27.756  9.556   186.348 1.00 90.83  ? 22   ARG A NE    1 
ATOM   1227  C  CZ    . ARG E 2 21  ? 28.530  8.761   187.081 1.00 90.32  ? 22   ARG A CZ    1 
ATOM   1228  N  NH1   . ARG E 2 21  ? 28.698  7.490   186.739 1.00 90.30  ? 22   ARG A NH1   1 
ATOM   1229  N  NH2   . ARG E 2 21  ? 29.134  9.235   188.161 1.00 87.79  ? 22   ARG A NH2   1 
ATOM   1230  N  N     . PRO E 2 22  ? 25.579  13.743  185.921 1.00 99.96  ? 23   PRO A N     1 
ATOM   1231  C  CA    . PRO E 2 22  ? 26.472  14.900  185.786 1.00 99.18  ? 23   PRO A CA    1 
ATOM   1232  C  C     . PRO E 2 22  ? 27.752  14.546  185.024 1.00 96.64  ? 23   PRO A C     1 
ATOM   1233  O  O     . PRO E 2 22  ? 28.357  13.501  185.264 1.00 90.99  ? 23   PRO A O     1 
ATOM   1234  C  CB    . PRO E 2 22  ? 26.746  15.291  187.236 1.00 102.17 ? 23   PRO A CB    1 
ATOM   1235  C  CG    . PRO E 2 22  ? 25.465  14.925  187.919 1.00 105.14 ? 23   PRO A CG    1 
ATOM   1236  C  CD    . PRO E 2 22  ? 25.160  13.566  187.322 1.00 102.14 ? 23   PRO A CD    1 
ATOM   1237  N  N     . LYS E 2 23  ? 28.154  15.420  184.105 1.00 98.14  ? 24   LYS A N     1 
ATOM   1238  C  CA    . LYS E 2 23  ? 29.357  15.202  183.304 1.00 98.46  ? 24   LYS A CA    1 
ATOM   1239  C  C     . LYS E 2 23  ? 30.602  15.248  184.177 1.00 98.64  ? 24   LYS A C     1 
ATOM   1240  O  O     . LYS E 2 23  ? 31.655  14.730  183.801 1.00 99.38  ? 24   LYS A O     1 
ATOM   1241  C  CB    . LYS E 2 23  ? 29.460  16.266  182.210 1.00 99.46  ? 24   LYS A CB    1 
ATOM   1242  N  N     . SER E 2 24  ? 30.469  15.872  185.346 1.00 98.95  ? 25   SER A N     1 
ATOM   1243  C  CA    . SER E 2 24  ? 31.573  15.999  186.292 1.00 95.83  ? 25   SER A CA    1 
ATOM   1244  C  C     . SER E 2 24  ? 32.015  14.639  186.840 1.00 97.00  ? 25   SER A C     1 
ATOM   1245  O  O     . SER E 2 24  ? 33.184  14.269  186.722 1.00 98.30  ? 25   SER A O     1 
ATOM   1246  C  CB    . SER E 2 24  ? 31.182  16.945  187.442 1.00 94.36  ? 25   SER A CB    1 
ATOM   1247  O  OG    . SER E 2 24  ? 29.952  16.580  188.050 1.00 89.79  ? 25   SER A OG    1 
ATOM   1248  N  N     . GLY E 2 25  ? 31.082  13.895  187.428 1.00 96.78  ? 26   GLY A N     1 
ATOM   1249  C  CA    . GLY E 2 25  ? 31.414  12.589  187.972 1.00 91.03  ? 26   GLY A CA    1 
ATOM   1250  C  C     . GLY E 2 25  ? 31.711  12.624  189.457 1.00 89.18  ? 26   GLY A C     1 
ATOM   1251  O  O     . GLY E 2 25  ? 32.713  12.076  189.914 1.00 89.42  ? 26   GLY A O     1 
ATOM   1252  N  N     . THR E 2 26  ? 30.836  13.270  190.216 1.00 89.65  ? 27   THR A N     1 
ATOM   1253  C  CA    . THR E 2 26  ? 31.018  13.369  191.657 1.00 92.41  ? 27   THR A CA    1 
ATOM   1254  C  C     . THR E 2 26  ? 29.710  12.990  192.349 1.00 87.48  ? 27   THR A C     1 
ATOM   1255  O  O     . THR E 2 26  ? 29.713  12.379  193.417 1.00 88.19  ? 27   THR A O     1 
ATOM   1256  C  CB    . THR E 2 26  ? 31.407  14.807  192.067 1.00 98.71  ? 27   THR A CB    1 
ATOM   1257  O  OG1   . THR E 2 26  ? 32.297  15.363  191.088 1.00 100.38 ? 27   THR A OG1   1 
ATOM   1258  C  CG2   . THR E 2 26  ? 32.108  14.799  193.420 1.00 104.07 ? 27   THR A CG2   1 
ATOM   1259  N  N     . LEU E 2 27  ? 28.600  13.367  191.718 1.00 79.40  ? 28   LEU A N     1 
ATOM   1260  C  CA    . LEU E 2 27  ? 27.249  13.101  192.207 1.00 70.21  ? 28   LEU A CA    1 
ATOM   1261  C  C     . LEU E 2 27  ? 26.974  13.476  193.667 1.00 68.05  ? 28   LEU A C     1 
ATOM   1262  O  O     . LEU E 2 27  ? 25.967  13.053  194.236 1.00 71.65  ? 28   LEU A O     1 
ATOM   1263  C  CB    . LEU E 2 27  ? 26.884  11.630  191.958 1.00 57.28  ? 28   LEU A CB    1 
ATOM   1264  C  CG    . LEU E 2 27  ? 27.728  10.535  192.607 1.00 47.42  ? 28   LEU A CG    1 
ATOM   1265  C  CD1   . LEU E 2 27  ? 27.314  10.332  194.070 1.00 49.72  ? 28   LEU A CD1   1 
ATOM   1266  C  CD2   . LEU E 2 27  ? 27.534  9.263   191.834 1.00 34.89  ? 28   LEU A CD2   1 
ATOM   1267  N  N     . SER E 2 28  ? 27.856  14.280  194.259 1.00 66.30  ? 29   SER A N     1 
ATOM   1268  C  CA    . SER E 2 28  ? 27.714  14.735  195.644 1.00 64.75  ? 29   SER A CA    1 
ATOM   1269  C  C     . SER E 2 28  ? 27.201  16.180  195.676 1.00 72.49  ? 29   SER A C     1 
ATOM   1270  O  O     . SER E 2 28  ? 27.183  16.866  194.650 1.00 75.11  ? 29   SER A O     1 
ATOM   1271  C  CB    . SER E 2 28  ? 29.066  14.675  196.371 1.00 68.45  ? 29   SER A CB    1 
ATOM   1272  O  OG    . SER E 2 28  ? 29.591  13.359  196.436 1.00 56.42  ? 29   SER A OG    1 
ATOM   1273  N  N     . GLY E 2 29  ? 26.795  16.641  196.858 1.00 77.76  ? 30   GLY A N     1 
ATOM   1274  C  CA    . GLY E 2 29  ? 26.296  18.002  197.000 1.00 81.50  ? 30   GLY A CA    1 
ATOM   1275  C  C     . GLY E 2 29  ? 25.199  18.373  196.014 1.00 85.61  ? 30   GLY A C     1 
ATOM   1276  O  O     . GLY E 2 29  ? 24.312  17.572  195.730 1.00 90.58  ? 30   GLY A O     1 
ATOM   1277  N  N     . HIS E 2 30  ? 25.258  19.594  195.491 1.00 86.92  ? 31   HIS A N     1 
ATOM   1278  C  CA    . HIS E 2 30  ? 24.263  20.076  194.534 1.00 84.70  ? 31   HIS A CA    1 
ATOM   1279  C  C     . HIS E 2 30  ? 24.218  19.193  193.285 1.00 81.83  ? 31   HIS A C     1 
ATOM   1280  O  O     . HIS E 2 30  ? 23.147  18.822  192.814 1.00 82.49  ? 31   HIS A O     1 
ATOM   1281  C  CB    . HIS E 2 30  ? 24.588  21.520  194.120 1.00 84.36  ? 31   HIS A CB    1 
ATOM   1282  C  CG    . HIS E 2 30  ? 24.547  22.508  195.247 1.00 71.60  ? 31   HIS A CG    1 
ATOM   1283  N  ND1   . HIS E 2 30  ? 23.371  22.930  195.827 1.00 71.59  ? 31   HIS A ND1   1 
ATOM   1284  C  CD2   . HIS E 2 30  ? 25.539  23.175  195.883 1.00 71.42  ? 31   HIS A CD2   1 
ATOM   1285  C  CE1   . HIS E 2 30  ? 23.638  23.817  196.770 1.00 68.97  ? 31   HIS A CE1   1 
ATOM   1286  N  NE2   . HIS E 2 30  ? 24.947  23.982  196.825 1.00 70.04  ? 31   HIS A NE2   1 
ATOM   1287  N  N     . ALA E 2 31  ? 25.394  18.865  192.758 1.00 83.88  ? 32   ALA A N     1 
ATOM   1288  C  CA    . ALA E 2 31  ? 25.517  18.040  191.562 1.00 83.91  ? 32   ALA A CA    1 
ATOM   1289  C  C     . ALA E 2 31  ? 24.762  16.727  191.689 1.00 84.68  ? 32   ALA A C     1 
ATOM   1290  O  O     . ALA E 2 31  ? 24.330  16.154  190.688 1.00 82.08  ? 32   ALA A O     1 
ATOM   1291  C  CB    . ALA E 2 31  ? 26.993  17.759  191.279 1.00 76.75  ? 32   ALA A CB    1 
ATOM   1292  N  N     . ALA E 2 32  ? 24.616  16.254  192.924 1.00 86.63  ? 33   ALA A N     1 
ATOM   1293  C  CA    . ALA E 2 32  ? 23.933  14.992  193.202 1.00 81.50  ? 33   ALA A CA    1 
ATOM   1294  C  C     . ALA E 2 32  ? 22.690  14.828  192.352 1.00 77.24  ? 33   ALA A C     1 
ATOM   1295  O  O     . ALA E 2 32  ? 22.704  14.104  191.359 1.00 70.26  ? 33   ALA A O     1 
ATOM   1296  C  CB    . ALA E 2 32  ? 23.573  14.905  194.678 1.00 84.74  ? 33   ALA A CB    1 
ATOM   1297  N  N     . GLY E 2 33  ? 21.617  15.506  192.739 1.00 79.45  ? 34   GLY A N     1 
ATOM   1298  C  CA    . GLY E 2 33  ? 20.381  15.402  191.986 1.00 89.07  ? 34   GLY A CA    1 
ATOM   1299  C  C     . GLY E 2 33  ? 19.892  16.731  191.448 1.00 93.81  ? 34   GLY A C     1 
ATOM   1300  O  O     . GLY E 2 33  ? 18.705  16.881  191.160 1.00 97.04  ? 34   GLY A O     1 
ATOM   1301  N  N     . GLU E 2 34  ? 20.801  17.696  191.320 1.00 95.35  ? 35   GLU A N     1 
ATOM   1302  C  CA    . GLU E 2 34  ? 20.465  19.026  190.809 1.00 93.63  ? 35   GLU A CA    1 
ATOM   1303  C  C     . GLU E 2 34  ? 19.529  18.931  189.610 1.00 85.77  ? 35   GLU A C     1 
ATOM   1304  O  O     . GLU E 2 34  ? 18.531  19.646  189.533 1.00 86.74  ? 35   GLU A O     1 
ATOM   1305  C  CB    . GLU E 2 34  ? 21.740  19.776  190.403 1.00 103.03 ? 35   GLU A CB    1 
ATOM   1306  N  N     . PRO E 2 35  ? 19.845  18.046  188.652 1.00 78.57  ? 36   PRO A N     1 
ATOM   1307  C  CA    . PRO E 2 35  ? 18.996  17.892  187.467 1.00 69.71  ? 36   PRO A CA    1 
ATOM   1308  C  C     . PRO E 2 35  ? 17.587  17.416  187.809 1.00 59.69  ? 36   PRO A C     1 
ATOM   1309  O  O     . PRO E 2 35  ? 16.651  17.648  187.051 1.00 49.23  ? 36   PRO A O     1 
ATOM   1310  C  CB    . PRO E 2 35  ? 19.760  16.868  186.633 1.00 75.93  ? 36   PRO A CB    1 
ATOM   1311  C  CG    . PRO E 2 35  ? 21.190  17.133  187.006 1.00 81.04  ? 36   PRO A CG    1 
ATOM   1312  C  CD    . PRO E 2 35  ? 21.090  17.273  188.499 1.00 73.53  ? 36   PRO A CD    1 
ATOM   1313  N  N     . PHE E 2 36  ? 17.454  16.746  188.953 1.00 55.16  ? 37   PHE A N     1 
ATOM   1314  C  CA    . PHE E 2 36  ? 16.167  16.226  189.408 1.00 56.11  ? 37   PHE A CA    1 
ATOM   1315  C  C     . PHE E 2 36  ? 15.232  17.342  189.854 1.00 55.39  ? 37   PHE A C     1 
ATOM   1316  O  O     . PHE E 2 36  ? 14.038  17.349  189.517 1.00 42.58  ? 37   PHE A O     1 
ATOM   1317  C  CB    . PHE E 2 36  ? 16.367  15.239  190.560 1.00 55.36  ? 37   PHE A CB    1 
ATOM   1318  C  CG    . PHE E 2 36  ? 16.568  13.818  190.113 1.00 59.92  ? 37   PHE A CG    1 
ATOM   1319  C  CD1   . PHE E 2 36  ? 17.778  13.170  190.325 1.00 52.35  ? 37   PHE A CD1   1 
ATOM   1320  C  CD2   . PHE E 2 36  ? 15.544  13.130  189.469 1.00 56.75  ? 37   PHE A CD2   1 
ATOM   1321  C  CE1   . PHE E 2 36  ? 17.960  11.858  189.900 1.00 50.21  ? 37   PHE A CE1   1 
ATOM   1322  C  CE2   . PHE E 2 36  ? 15.723  11.817  189.041 1.00 53.70  ? 37   PHE A CE2   1 
ATOM   1323  C  CZ    . PHE E 2 36  ? 16.931  11.181  189.256 1.00 43.52  ? 37   PHE A CZ    1 
ATOM   1324  N  N     . GLU E 2 37  ? 15.782  18.271  190.631 1.00 48.71  ? 38   GLU A N     1 
ATOM   1325  C  CA    . GLU E 2 37  ? 15.024  19.413  191.124 1.00 44.88  ? 38   GLU A CA    1 
ATOM   1326  C  C     . GLU E 2 37  ? 14.426  20.099  189.904 1.00 44.81  ? 38   GLU A C     1 
ATOM   1327  O  O     . GLU E 2 37  ? 13.227  20.383  189.870 1.00 47.96  ? 38   GLU A O     1 
ATOM   1328  C  CB    . GLU E 2 37  ? 15.956  20.362  191.894 1.00 41.78  ? 38   GLU A CB    1 
ATOM   1329  C  CG    . GLU E 2 37  ? 15.301  21.535  192.609 1.00 40.30  ? 38   GLU A CG    1 
ATOM   1330  C  CD    . GLU E 2 37  ? 15.117  22.753  191.714 1.00 58.68  ? 38   GLU A CD    1 
ATOM   1331  O  OE1   . GLU E 2 37  ? 14.851  23.859  192.244 1.00 56.75  ? 38   GLU A OE1   1 
ATOM   1332  O  OE2   . GLU E 2 37  ? 15.241  22.610  190.477 1.00 69.99  ? 38   GLU A OE2   1 
ATOM   1333  N  N     . LYS E 2 38  ? 15.264  20.341  188.896 1.00 37.39  ? 39   LYS A N     1 
ATOM   1334  C  CA    . LYS E 2 38  ? 14.821  20.983  187.658 1.00 41.39  ? 39   LYS A CA    1 
ATOM   1335  C  C     . LYS E 2 38  ? 13.660  20.204  187.077 1.00 36.20  ? 39   LYS A C     1 
ATOM   1336  O  O     . LYS E 2 38  ? 12.648  20.771  186.659 1.00 47.23  ? 39   LYS A O     1 
ATOM   1337  C  CB    . LYS E 2 38  ? 15.958  21.024  186.639 1.00 38.59  ? 39   LYS A CB    1 
ATOM   1338  N  N     . LEU E 2 39  ? 13.818  18.891  187.062 1.00 42.26  ? 40   LEU A N     1 
ATOM   1339  C  CA    . LEU E 2 39  ? 12.803  17.989  186.536 1.00 44.14  ? 40   LEU A CA    1 
ATOM   1340  C  C     . LEU E 2 39  ? 11.449  18.181  187.212 1.00 44.70  ? 40   LEU A C     1 
ATOM   1341  O  O     . LEU E 2 39  ? 10.421  18.268  186.544 1.00 48.79  ? 40   LEU A O     1 
ATOM   1342  C  CB    . LEU E 2 39  ? 13.278  16.552  186.719 1.00 40.13  ? 40   LEU A CB    1 
ATOM   1343  C  CG    . LEU E 2 39  ? 12.259  15.459  186.455 1.00 42.57  ? 40   LEU A CG    1 
ATOM   1344  C  CD1   . LEU E 2 39  ? 11.555  15.662  185.119 1.00 37.73  ? 40   LEU A CD1   1 
ATOM   1345  C  CD2   . LEU E 2 39  ? 12.998  14.142  186.498 1.00 46.36  ? 40   LEU A CD2   1 
ATOM   1346  N  N     . VAL E 2 40  ? 11.462  18.242  188.540 1.00 42.71  ? 41   VAL A N     1 
ATOM   1347  C  CA    . VAL E 2 40  ? 10.249  18.422  189.325 1.00 33.53  ? 41   VAL A CA    1 
ATOM   1348  C  C     . VAL E 2 40  ? 9.564   19.734  188.979 1.00 44.00  ? 41   VAL A C     1 
ATOM   1349  O  O     . VAL E 2 40  ? 8.375   19.766  188.631 1.00 44.11  ? 41   VAL A O     1 
ATOM   1350  C  CB    . VAL E 2 40  ? 10.583  18.404  190.828 1.00 27.89  ? 41   VAL A CB    1 
ATOM   1351  C  CG1   . VAL E 2 40  ? 9.481   19.081  191.640 1.00 2.95   ? 41   VAL A CG1   1 
ATOM   1352  C  CG2   . VAL E 2 40  ? 10.773  16.976  191.281 1.00 16.02  ? 41   VAL A CG2   1 
ATOM   1353  N  N     . TYR E 2 41  ? 10.325  20.820  189.082 1.00 47.04  ? 42   TYR A N     1 
ATOM   1354  C  CA    . TYR E 2 41  ? 9.811   22.155  188.791 1.00 44.40  ? 42   TYR A CA    1 
ATOM   1355  C  C     . TYR E 2 41  ? 9.182   22.213  187.414 1.00 43.37  ? 42   TYR A C     1 
ATOM   1356  O  O     . TYR E 2 41  ? 8.028   22.614  187.275 1.00 43.74  ? 42   TYR A O     1 
ATOM   1357  C  CB    . TYR E 2 41  ? 10.938  23.189  188.894 1.00 42.18  ? 42   TYR A CB    1 
ATOM   1358  C  CG    . TYR E 2 41  ? 10.627  24.504  188.214 1.00 36.50  ? 42   TYR A CG    1 
ATOM   1359  C  CD1   . TYR E 2 41  ? 11.159  24.804  186.966 1.00 30.94  ? 42   TYR A CD1   1 
ATOM   1360  C  CD2   . TYR E 2 41  ? 9.773   25.438  188.803 1.00 37.95  ? 42   TYR A CD2   1 
ATOM   1361  C  CE1   . TYR E 2 41  ? 10.852  26.000  186.317 1.00 27.23  ? 42   TYR A CE1   1 
ATOM   1362  C  CE2   . TYR E 2 41  ? 9.456   26.639  188.159 1.00 27.72  ? 42   TYR A CE2   1 
ATOM   1363  C  CZ    . TYR E 2 41  ? 10.000  26.908  186.915 1.00 31.30  ? 42   TYR A CZ    1 
ATOM   1364  O  OH    . TYR E 2 41  ? 9.677   28.074  186.258 1.00 37.12  ? 42   TYR A OH    1 
ATOM   1365  N  N     . LYS E 2 42  ? 9.943   21.811  186.402 1.00 39.46  ? 43   LYS A N     1 
ATOM   1366  C  CA    . LYS E 2 42  ? 9.446   21.820  185.035 1.00 40.91  ? 43   LYS A CA    1 
ATOM   1367  C  C     . LYS E 2 42  ? 8.020   21.272  184.925 1.00 39.26  ? 43   LYS A C     1 
ATOM   1368  O  O     . LYS E 2 42  ? 7.201   21.823  184.191 1.00 33.90  ? 43   LYS A O     1 
ATOM   1369  C  CB    . LYS E 2 42  ? 10.384  21.013  184.130 1.00 49.68  ? 43   LYS A CB    1 
ATOM   1370  C  CG    . LYS E 2 42  ? 9.946   20.953  182.665 1.00 59.86  ? 43   LYS A CG    1 
ATOM   1371  C  CD    . LYS E 2 42  ? 9.986   22.327  182.020 1.00 66.54  ? 43   LYS A CD    1 
ATOM   1372  C  CE    . LYS E 2 42  ? 9.605   22.276  180.554 1.00 69.67  ? 43   LYS A CE    1 
ATOM   1373  N  NZ    . LYS E 2 42  ? 9.865   23.594  179.899 1.00 73.84  ? 43   LYS A NZ    1 
ATOM   1374  N  N     . PHE E 2 43  ? 7.724   20.199  185.658 1.00 41.93  ? 44   PHE A N     1 
ATOM   1375  C  CA    . PHE E 2 43  ? 6.390   19.597  185.616 1.00 44.31  ? 44   PHE A CA    1 
ATOM   1376  C  C     . PHE E 2 43  ? 5.342   20.527  186.183 1.00 40.71  ? 44   PHE A C     1 
ATOM   1377  O  O     . PHE E 2 43  ? 4.305   20.746  185.567 1.00 36.80  ? 44   PHE A O     1 
ATOM   1378  C  CB    . PHE E 2 43  ? 6.338   18.293  186.407 1.00 53.70  ? 44   PHE A CB    1 
ATOM   1379  C  CG    . PHE E 2 43  ? 4.950   17.709  186.502 1.00 60.44  ? 44   PHE A CG    1 
ATOM   1380  C  CD1   . PHE E 2 43  ? 4.462   16.875  185.504 1.00 66.13  ? 44   PHE A CD1   1 
ATOM   1381  C  CD2   . PHE E 2 43  ? 4.114   18.029  187.574 1.00 62.00  ? 44   PHE A CD2   1 
ATOM   1382  C  CE1   . PHE E 2 43  ? 3.160   16.366  185.569 1.00 66.36  ? 44   PHE A CE1   1 
ATOM   1383  C  CE2   . PHE E 2 43  ? 2.812   17.525  187.646 1.00 57.52  ? 44   PHE A CE2   1 
ATOM   1384  C  CZ    . PHE E 2 43  ? 2.336   16.693  186.644 1.00 55.22  ? 44   PHE A CZ    1 
ATOM   1385  N  N     . LEU E 2 44  ? 5.602   21.041  187.381 1.00 39.19  ? 45   LEU A N     1 
ATOM   1386  C  CA    . LEU E 2 44  ? 4.678   21.970  188.018 1.00 39.79  ? 45   LEU A CA    1 
ATOM   1387  C  C     . LEU E 2 44  ? 4.378   23.129  187.083 1.00 39.24  ? 45   LEU A C     1 
ATOM   1388  O  O     . LEU E 2 44  ? 3.225   23.512  186.906 1.00 45.51  ? 45   LEU A O     1 
ATOM   1389  C  CB    . LEU E 2 44  ? 5.280   22.519  189.311 1.00 27.80  ? 45   LEU A CB    1 
ATOM   1390  C  CG    . LEU E 2 44  ? 4.987   21.766  190.607 1.00 39.90  ? 45   LEU A CG    1 
ATOM   1391  C  CD1   . LEU E 2 44  ? 4.433   20.382  190.317 1.00 35.81  ? 45   LEU A CD1   1 
ATOM   1392  C  CD2   . LEU E 2 44  ? 6.256   21.695  191.436 1.00 26.82  ? 45   LEU A CD2   1 
ATOM   1393  N  N     . LYS E 2 45  ? 5.427   23.673  186.476 1.00 37.68  ? 46   LYS A N     1 
ATOM   1394  C  CA    . LYS E 2 45  ? 5.291   24.822  185.589 1.00 44.52  ? 46   LYS A CA    1 
ATOM   1395  C  C     . LYS E 2 45  ? 4.322   24.570  184.452 1.00 55.01  ? 46   LYS A C     1 
ATOM   1396  O  O     . LYS E 2 45  ? 3.769   25.509  183.871 1.00 59.80  ? 46   LYS A O     1 
ATOM   1397  C  CB    . LYS E 2 45  ? 6.659   25.221  185.023 1.00 30.91  ? 46   LYS A CB    1 
ATOM   1398  C  CG    . LYS E 2 45  ? 6.733   26.649  184.511 1.00 16.48  ? 46   LYS A CG    1 
ATOM   1399  C  CD    . LYS E 2 45  ? 6.620   27.677  185.629 1.00 31.28  ? 46   LYS A CD    1 
ATOM   1400  C  CE    . LYS E 2 45  ? 6.482   29.089  185.048 1.00 40.81  ? 46   LYS A CE    1 
ATOM   1401  N  NZ    . LYS E 2 45  ? 5.917   30.084  186.018 1.00 43.13  ? 46   LYS A NZ    1 
ATOM   1402  N  N     . GLU E 2 46  ? 4.112   23.298  184.136 1.00 61.78  ? 47   GLU A N     1 
ATOM   1403  C  CA    . GLU E 2 46  ? 3.208   22.932  183.056 1.00 62.46  ? 47   GLU A CA    1 
ATOM   1404  C  C     . GLU E 2 46  ? 1.841   22.525  183.598 1.00 63.89  ? 47   GLU A C     1 
ATOM   1405  O  O     . GLU E 2 46  ? 0.824   22.664  182.913 1.00 69.07  ? 47   GLU A O     1 
ATOM   1406  C  CB    . GLU E 2 46  ? 3.834   21.816  182.215 1.00 65.83  ? 47   GLU A CB    1 
ATOM   1407  C  CG    . GLU E 2 46  ? 5.147   22.242  181.565 1.00 71.81  ? 47   GLU A CG    1 
ATOM   1408  C  CD    . GLU E 2 46  ? 5.631   21.267  180.513 1.00 78.72  ? 47   GLU A CD    1 
ATOM   1409  O  OE1   . GLU E 2 46  ? 4.848   20.973  179.583 1.00 83.93  ? 47   GLU A OE1   1 
ATOM   1410  O  OE2   . GLU E 2 46  ? 6.791   20.804  180.608 1.00 70.61  ? 47   GLU A OE2   1 
ATOM   1411  N  N     . ASN E 2 47  ? 1.816   22.044  184.839 1.00 59.94  ? 48   ASN A N     1 
ATOM   1412  C  CA    . ASN E 2 47  ? 0.561   21.653  185.464 1.00 54.50  ? 48   ASN A CA    1 
ATOM   1413  C  C     . ASN E 2 47  ? -0.049  22.815  186.221 1.00 43.90  ? 48   ASN A C     1 
ATOM   1414  O  O     . ASN E 2 47  ? -1.115  23.299  185.865 1.00 46.26  ? 48   ASN A O     1 
ATOM   1415  C  CB    . ASN E 2 47  ? 0.770   20.463  186.391 1.00 65.31  ? 48   ASN A CB    1 
ATOM   1416  C  CG    . ASN E 2 47  ? 0.809   19.152  185.634 1.00 77.53  ? 48   ASN A CG    1 
ATOM   1417  O  OD1   . ASN E 2 47  ? 1.676   18.935  184.784 1.00 82.25  ? 48   ASN A OD1   1 
ATOM   1418  N  ND2   . ASN E 2 47  ? -0.144  18.272  185.929 1.00 84.40  ? 48   ASN A ND2   1 
ATOM   1419  N  N     . LEU E 2 48  ? 0.619   23.266  187.268 1.00 34.58  ? 49   LEU A N     1 
ATOM   1420  C  CA    . LEU E 2 48  ? 0.111   24.401  188.019 1.00 29.51  ? 49   LEU A CA    1 
ATOM   1421  C  C     . LEU E 2 48  ? 0.812   25.679  187.524 1.00 36.12  ? 49   LEU A C     1 
ATOM   1422  O  O     . LEU E 2 48  ? 1.292   26.471  188.328 1.00 48.72  ? 49   LEU A O     1 
ATOM   1423  C  CB    . LEU E 2 48  ? 0.386   24.193  189.502 1.00 17.56  ? 49   LEU A CB    1 
ATOM   1424  C  CG    . LEU E 2 48  ? -0.078  22.830  190.025 1.00 34.90  ? 49   LEU A CG    1 
ATOM   1425  C  CD1   . LEU E 2 48  ? 0.373   22.623  191.454 1.00 17.51  ? 49   LEU A CD1   1 
ATOM   1426  C  CD2   . LEU E 2 48  ? -1.589  22.733  189.924 1.00 31.09  ? 49   LEU A CD2   1 
ATOM   1427  N  N     . SER E 2 49  ? 0.857   25.885  186.209 1.00 24.15  ? 50   SER A N     1 
ATOM   1428  C  CA    . SER E 2 49  ? 1.529   27.050  185.636 1.00 38.26  ? 50   SER A CA    1 
ATOM   1429  C  C     . SER E 2 49  ? 1.283   28.389  186.329 1.00 38.78  ? 50   SER A C     1 
ATOM   1430  O  O     . SER E 2 49  ? 2.204   29.201  186.465 1.00 41.75  ? 50   SER A O     1 
ATOM   1431  C  CB    . SER E 2 49  ? 1.184   27.190  184.150 1.00 42.04  ? 50   SER A CB    1 
ATOM   1432  N  N     . ASP E 2 50  ? 0.048   28.615  186.763 1.00 43.56  ? 51   ASP A N     1 
ATOM   1433  C  CA    . ASP E 2 50  ? -0.343  29.860  187.427 1.00 44.52  ? 51   ASP A CA    1 
ATOM   1434  C  C     . ASP E 2 50  ? 0.171   30.028  188.858 1.00 45.30  ? 51   ASP A C     1 
ATOM   1435  O  O     . ASP E 2 50  ? 0.210   31.142  189.369 1.00 42.27  ? 51   ASP A O     1 
ATOM   1436  C  CB    . ASP E 2 50  ? -1.874  29.983  187.444 1.00 58.42  ? 51   ASP A CB    1 
ATOM   1437  C  CG    . ASP E 2 50  ? -2.481  30.025  186.050 1.00 65.07  ? 51   ASP A CG    1 
ATOM   1438  O  OD1   . ASP E 2 50  ? -2.080  30.892  185.242 1.00 64.56  ? 51   ASP A OD1   1 
ATOM   1439  O  OD2   . ASP E 2 50  ? -3.371  29.193  185.767 1.00 73.54  ? 51   ASP A OD2   1 
ATOM   1440  N  N     . LEU E 2 51  ? 0.556   28.935  189.507 1.00 42.60  ? 52   LEU A N     1 
ATOM   1441  C  CA    . LEU E 2 51  ? 1.042   29.012  190.882 1.00 38.73  ? 52   LEU A CA    1 
ATOM   1442  C  C     . LEU E 2 51  ? 2.539   28.744  191.030 1.00 39.72  ? 52   LEU A C     1 
ATOM   1443  O  O     . LEU E 2 51  ? 3.142   29.054  192.058 1.00 40.34  ? 52   LEU A O     1 
ATOM   1444  C  CB    . LEU E 2 51  ? 0.279   28.020  191.750 1.00 38.99  ? 52   LEU A CB    1 
ATOM   1445  C  CG    . LEU E 2 51  ? -1.164  28.368  192.114 1.00 54.92  ? 52   LEU A CG    1 
ATOM   1446  C  CD1   . LEU E 2 51  ? -1.997  28.670  190.869 1.00 58.14  ? 52   LEU A CD1   1 
ATOM   1447  C  CD2   . LEU E 2 51  ? -1.748  27.190  192.884 1.00 51.72  ? 52   LEU A CD2   1 
ATOM   1448  N  N     . THR E 2 52  ? 3.137   28.175  189.997 1.00 29.37  ? 53   THR A N     1 
ATOM   1449  C  CA    . THR E 2 52  ? 4.532   27.837  190.066 1.00 27.18  ? 53   THR A CA    1 
ATOM   1450  C  C     . THR E 2 52  ? 5.499   28.963  189.740 1.00 31.84  ? 53   THR A C     1 
ATOM   1451  O  O     . THR E 2 52  ? 5.344   29.686  188.760 1.00 37.77  ? 53   THR A O     1 
ATOM   1452  C  CB    . THR E 2 52  ? 4.810   26.622  189.203 1.00 26.13  ? 53   THR A CB    1 
ATOM   1453  O  OG1   . THR E 2 52  ? 4.073   25.519  189.734 1.00 30.70  ? 53   THR A OG1   1 
ATOM   1454  C  CG2   . THR E 2 52  ? 6.286   26.289  189.206 1.00 32.27  ? 53   THR A CG2   1 
ATOM   1455  N  N     . PHE E 2 53  ? 6.508   29.085  190.594 1.00 33.66  ? 54   PHE A N     1 
ATOM   1456  C  CA    . PHE E 2 53  ? 7.513   30.117  190.490 1.00 27.31  ? 54   PHE A CA    1 
ATOM   1457  C  C     . PHE E 2 53  ? 8.808   29.716  191.177 1.00 34.57  ? 54   PHE A C     1 
ATOM   1458  O  O     . PHE E 2 53  ? 8.799   29.125  192.261 1.00 27.41  ? 54   PHE A O     1 
ATOM   1459  C  CB    . PHE E 2 53  ? 7.006   31.389  191.171 1.00 30.88  ? 54   PHE A CB    1 
ATOM   1460  C  CG    . PHE E 2 53  ? 5.996   32.147  190.385 1.00 26.81  ? 54   PHE A CG    1 
ATOM   1461  C  CD1   . PHE E 2 53  ? 6.376   32.827  189.233 1.00 24.75  ? 54   PHE A CD1   1 
ATOM   1462  C  CD2   . PHE E 2 53  ? 4.662   32.181  190.791 1.00 17.75  ? 54   PHE A CD2   1 
ATOM   1463  C  CE1   . PHE E 2 53  ? 5.444   33.539  188.481 1.00 36.64  ? 54   PHE A CE1   1 
ATOM   1464  C  CE2   . PHE E 2 53  ? 3.724   32.887  190.048 1.00 26.41  ? 54   PHE A CE2   1 
ATOM   1465  C  CZ    . PHE E 2 53  ? 4.110   33.573  188.885 1.00 21.75  ? 54   PHE A CZ    1 
ATOM   1466  N  N     . LYS E 2 54  ? 9.924   30.060  190.551 1.00 36.92  ? 55   LYS A N     1 
ATOM   1467  C  CA    . LYS E 2 54  ? 11.232  29.790  191.139 1.00 38.78  ? 55   LYS A CA    1 
ATOM   1468  C  C     . LYS E 2 54  ? 11.399  30.976  192.104 1.00 34.24  ? 55   LYS A C     1 
ATOM   1469  O  O     . LYS E 2 54  ? 10.984  32.085  191.777 1.00 37.12  ? 55   LYS A O     1 
ATOM   1470  C  CB    . LYS E 2 54  ? 12.292  29.850  190.047 1.00 38.36  ? 55   LYS A CB    1 
ATOM   1471  C  CG    . LYS E 2 54  ? 13.361  28.819  190.172 1.00 39.77  ? 55   LYS A CG    1 
ATOM   1472  C  CD    . LYS E 2 54  ? 13.030  27.581  189.378 1.00 44.32  ? 55   LYS A CD    1 
ATOM   1473  C  CE    . LYS E 2 54  ? 14.205  26.613  189.429 1.00 59.21  ? 55   LYS A CE    1 
ATOM   1474  N  NZ    . LYS E 2 54  ? 14.590  26.303  190.847 1.00 63.77  ? 55   LYS A NZ    1 
ATOM   1475  N  N     . GLN E 2 55  ? 11.996  30.776  193.274 1.00 15.02  ? 56   GLN A N     1 
ATOM   1476  C  CA    . GLN E 2 55  ? 12.126  31.896  194.200 1.00 9.97   ? 56   GLN A CA    1 
ATOM   1477  C  C     . GLN E 2 55  ? 12.575  33.208  193.538 1.00 21.32  ? 56   GLN A C     1 
ATOM   1478  O  O     . GLN E 2 55  ? 11.962  34.244  193.752 1.00 18.70  ? 56   GLN A O     1 
ATOM   1479  C  CB    . GLN E 2 55  ? 13.069  31.565  195.355 1.00 19.96  ? 56   GLN A CB    1 
ATOM   1480  C  CG    . GLN E 2 55  ? 13.195  32.721  196.342 1.00 31.34  ? 56   GLN A CG    1 
ATOM   1481  C  CD    . GLN E 2 55  ? 13.640  32.286  197.721 1.00 34.80  ? 56   GLN A CD    1 
ATOM   1482  O  OE1   . GLN E 2 55  ? 13.241  31.227  198.202 1.00 47.57  ? 56   GLN A OE1   1 
ATOM   1483  N  NE2   . GLN E 2 55  ? 14.449  33.111  198.375 1.00 35.84  ? 56   GLN A NE2   1 
ATOM   1484  N  N     . TYR E 2 56  ? 13.634  33.182  192.733 1.00 28.60  ? 57   TYR A N     1 
ATOM   1485  C  CA    . TYR E 2 56  ? 14.074  34.418  192.103 1.00 32.31  ? 57   TYR A CA    1 
ATOM   1486  C  C     . TYR E 2 56  ? 13.061  34.826  191.042 1.00 33.82  ? 57   TYR A C     1 
ATOM   1487  O  O     . TYR E 2 56  ? 12.782  36.005  190.835 1.00 42.72  ? 57   TYR A O     1 
ATOM   1488  C  CB    . TYR E 2 56  ? 15.487  34.282  191.496 1.00 24.26  ? 57   TYR A CB    1 
ATOM   1489  C  CG    . TYR E 2 56  ? 15.616  33.329  190.327 1.00 23.20  ? 57   TYR A CG    1 
ATOM   1490  C  CD1   . TYR E 2 56  ? 15.759  31.957  190.528 1.00 25.46  ? 57   TYR A CD1   1 
ATOM   1491  C  CD2   . TYR E 2 56  ? 15.563  33.796  189.017 1.00 21.52  ? 57   TYR A CD2   1 
ATOM   1492  C  CE1   . TYR E 2 56  ? 15.842  31.078  189.453 1.00 13.38  ? 57   TYR A CE1   1 
ATOM   1493  C  CE2   . TYR E 2 56  ? 15.639  32.927  187.933 1.00 2.38   ? 57   TYR A CE2   1 
ATOM   1494  C  CZ    . TYR E 2 56  ? 15.777  31.579  188.155 1.00 25.48  ? 57   TYR A CZ    1 
ATOM   1495  O  OH    . TYR E 2 56  ? 15.838  30.721  187.079 1.00 35.64  ? 57   TYR A OH    1 
ATOM   1496  N  N     . GLU E 2 57  ? 12.494  33.836  190.381 1.00 35.95  ? 58   GLU A N     1 
ATOM   1497  C  CA    . GLU E 2 57  ? 11.494  34.091  189.359 1.00 35.15  ? 58   GLU A CA    1 
ATOM   1498  C  C     . GLU E 2 57  ? 10.381  34.974  189.936 1.00 33.98  ? 58   GLU A C     1 
ATOM   1499  O  O     . GLU E 2 57  ? 9.960   35.947  189.319 1.00 33.50  ? 58   GLU A O     1 
ATOM   1500  C  CB    . GLU E 2 57  ? 10.904  32.765  188.920 1.00 29.68  ? 58   GLU A CB    1 
ATOM   1501  C  CG    . GLU E 2 57  ? 10.188  32.807  187.626 1.00 36.66  ? 58   GLU A CG    1 
ATOM   1502  C  CD    . GLU E 2 57  ? 9.363   31.581  187.448 1.00 47.63  ? 58   GLU A CD    1 
ATOM   1503  O  OE1   . GLU E 2 57  ? 9.800   30.514  187.930 1.00 54.76  ? 58   GLU A OE1   1 
ATOM   1504  O  OE2   . GLU E 2 57  ? 8.284   31.680  186.830 1.00 61.27  ? 58   GLU A OE2   1 
ATOM   1505  N  N     . TYR E 2 58  ? 9.912   34.611  191.127 1.00 35.52  ? 59   TYR A N     1 
ATOM   1506  C  CA    . TYR E 2 58  ? 8.850   35.340  191.804 1.00 34.43  ? 59   TYR A CA    1 
ATOM   1507  C  C     . TYR E 2 58  ? 9.257   36.796  192.001 1.00 41.54  ? 59   TYR A C     1 
ATOM   1508  O  O     . TYR E 2 58  ? 8.533   37.741  191.657 1.00 33.79  ? 59   TYR A O     1 
ATOM   1509  C  CB    . TYR E 2 58  ? 8.579   34.715  193.167 1.00 23.74  ? 59   TYR A CB    1 
ATOM   1510  C  CG    . TYR E 2 58  ? 7.422   35.380  193.848 1.00 50.52  ? 59   TYR A CG    1 
ATOM   1511  C  CD1   . TYR E 2 58  ? 6.125   35.205  193.371 1.00 58.91  ? 59   TYR A CD1   1 
ATOM   1512  C  CD2   . TYR E 2 58  ? 7.622   36.253  194.914 1.00 57.54  ? 59   TYR A CD2   1 
ATOM   1513  C  CE1   . TYR E 2 58  ? 5.053   35.886  193.933 1.00 58.90  ? 59   TYR A CE1   1 
ATOM   1514  C  CE2   . TYR E 2 58  ? 6.556   36.942  195.482 1.00 62.50  ? 59   TYR A CE2   1 
ATOM   1515  C  CZ    . TYR E 2 58  ? 5.275   36.753  194.981 1.00 61.64  ? 59   TYR A CZ    1 
ATOM   1516  O  OH    . TYR E 2 58  ? 4.215   37.440  195.519 1.00 67.75  ? 59   TYR A OH    1 
ATOM   1517  N  N     . LEU E 2 59  ? 10.439  36.942  192.582 1.00 44.41  ? 60   LEU A N     1 
ATOM   1518  C  CA    . LEU E 2 59  ? 11.043  38.230  192.869 1.00 34.93  ? 60   LEU A CA    1 
ATOM   1519  C  C     . LEU E 2 59  ? 11.096  39.111  191.624 1.00 36.61  ? 60   LEU A C     1 
ATOM   1520  O  O     . LEU E 2 59  ? 10.584  40.226  191.633 1.00 34.59  ? 60   LEU A O     1 
ATOM   1521  C  CB    . LEU E 2 59  ? 12.454  38.006  193.410 1.00 25.88  ? 60   LEU A CB    1 
ATOM   1522  C  CG    . LEU E 2 59  ? 12.550  37.159  194.672 1.00 9.08   ? 60   LEU A CG    1 
ATOM   1523  C  CD1   . LEU E 2 59  ? 14.000  36.839  194.946 1.00 42.81  ? 60   LEU A CD1   1 
ATOM   1524  C  CD2   . LEU E 2 59  ? 11.956  37.887  195.819 1.00 17.44  ? 60   LEU A CD2   1 
ATOM   1525  N  N     . ASN E 2 60  ? 11.708  38.610  190.554 1.00 32.04  ? 61   ASN A N     1 
ATOM   1526  C  CA    . ASN E 2 60  ? 11.814  39.398  189.336 1.00 40.58  ? 61   ASN A CA    1 
ATOM   1527  C  C     . ASN E 2 60  ? 10.461  39.897  188.871 1.00 46.19  ? 61   ASN A C     1 
ATOM   1528  O  O     . ASN E 2 60  ? 10.329  41.036  188.410 1.00 46.54  ? 61   ASN A O     1 
ATOM   1529  C  CB    . ASN E 2 60  ? 12.482  38.604  188.215 1.00 38.04  ? 61   ASN A CB    1 
ATOM   1530  C  CG    . ASN E 2 60  ? 13.980  38.471  188.412 1.00 47.97  ? 61   ASN A CG    1 
ATOM   1531  O  OD1   . ASN E 2 60  ? 14.689  39.459  188.630 1.00 39.89  ? 61   ASN A OD1   1 
ATOM   1532  N  ND2   . ASN E 2 60  ? 14.473  37.245  188.325 1.00 53.90  ? 61   ASN A ND2   1 
ATOM   1533  N  N     . ASP E 2 61  ? 9.446   39.050  188.989 1.00 47.66  ? 62   ASP A N     1 
ATOM   1534  C  CA    . ASP E 2 61  ? 8.115   39.460  188.579 1.00 37.85  ? 62   ASP A CA    1 
ATOM   1535  C  C     . ASP E 2 61  ? 7.615   40.515  189.556 1.00 35.96  ? 62   ASP A C     1 
ATOM   1536  O  O     . ASP E 2 61  ? 7.196   41.591  189.144 1.00 38.92  ? 62   ASP A O     1 
ATOM   1537  C  CB    . ASP E 2 61  ? 7.174   38.255  188.538 1.00 32.39  ? 62   ASP A CB    1 
ATOM   1538  C  CG    . ASP E 2 61  ? 7.510   37.303  187.408 1.00 40.67  ? 62   ASP A CG    1 
ATOM   1539  O  OD1   . ASP E 2 61  ? 8.178   37.746  186.439 1.00 23.23  ? 62   ASP A OD1   1 
ATOM   1540  O  OD2   . ASP E 2 61  ? 7.097   36.122  187.479 1.00 37.70  ? 62   ASP A OD2   1 
ATOM   1541  N  N     . LEU E 2 62  ? 7.690   40.214  190.849 1.00 25.35  ? 63   LEU A N     1 
ATOM   1542  C  CA    . LEU E 2 62  ? 7.243   41.153  191.863 1.00 27.90  ? 63   LEU A CA    1 
ATOM   1543  C  C     . LEU E 2 62  ? 7.741   42.557  191.561 1.00 37.34  ? 63   LEU A C     1 
ATOM   1544  O  O     . LEU E 2 62  ? 6.976   43.518  191.542 1.00 47.25  ? 63   LEU A O     1 
ATOM   1545  C  CB    . LEU E 2 62  ? 7.741   40.731  193.237 1.00 13.19  ? 63   LEU A CB    1 
ATOM   1546  C  CG    . LEU E 2 62  ? 7.307   41.653  194.371 1.00 20.46  ? 63   LEU A CG    1 
ATOM   1547  C  CD1   . LEU E 2 62  ? 5.798   41.798  194.331 1.00 25.00  ? 63   LEU A CD1   1 
ATOM   1548  C  CD2   . LEU E 2 62  ? 7.759   41.102  195.722 1.00 9.52   ? 63   LEU A CD2   1 
ATOM   1549  N  N     . PHE E 2 63  ? 9.037   42.671  191.315 1.00 42.57  ? 64   PHE A N     1 
ATOM   1550  C  CA    . PHE E 2 63  ? 9.636   43.956  191.028 1.00 37.51  ? 64   PHE A CA    1 
ATOM   1551  C  C     . PHE E 2 63  ? 9.221   44.520  189.693 1.00 45.25  ? 64   PHE A C     1 
ATOM   1552  O  O     . PHE E 2 63  ? 8.991   45.725  189.558 1.00 52.58  ? 64   PHE A O     1 
ATOM   1553  C  CB    . PHE E 2 63  ? 11.144  43.832  191.106 1.00 31.10  ? 64   PHE A CB    1 
ATOM   1554  C  CG    . PHE E 2 63  ? 11.659  43.806  192.509 1.00 34.08  ? 64   PHE A CG    1 
ATOM   1555  C  CD1   . PHE E 2 63  ? 10.810  43.512  193.566 1.00 23.85  ? 64   PHE A CD1   1 
ATOM   1556  C  CD2   . PHE E 2 63  ? 12.987  44.098  192.780 1.00 31.46  ? 64   PHE A CD2   1 
ATOM   1557  C  CE1   . PHE E 2 63  ? 11.282  43.514  194.880 1.00 40.89  ? 64   PHE A CE1   1 
ATOM   1558  C  CE2   . PHE E 2 63  ? 13.464  44.104  194.086 1.00 25.63  ? 64   PHE A CE2   1 
ATOM   1559  C  CZ    . PHE E 2 63  ? 12.613  43.813  195.136 1.00 27.32  ? 64   PHE A CZ    1 
ATOM   1560  N  N     . MET E 2 64  ? 9.103   43.653  188.703 1.00 46.23  ? 65   MET A N     1 
ATOM   1561  C  CA    . MET E 2 64  ? 8.735   44.110  187.373 1.00 51.63  ? 65   MET A CA    1 
ATOM   1562  C  C     . MET E 2 64  ? 7.265   44.527  187.243 1.00 48.35  ? 65   MET A C     1 
ATOM   1563  O  O     . MET E 2 64  ? 6.914   45.275  186.329 1.00 54.07  ? 65   MET A O     1 
ATOM   1564  C  CB    . MET E 2 64  ? 9.083   43.023  186.357 1.00 56.18  ? 65   MET A CB    1 
ATOM   1565  C  CG    . MET E 2 64  ? 9.214   43.511  184.930 1.00 62.75  ? 65   MET A CG    1 
ATOM   1566  S  SD    . MET E 2 64  ? 9.871   42.193  183.888 1.00 70.91  ? 65   MET A SD    1 
ATOM   1567  C  CE    . MET E 2 64  ? 8.465   41.860  182.779 1.00 64.85  ? 65   MET A CE    1 
ATOM   1568  N  N     . LYS E 2 65  ? 6.409   44.054  188.147 1.00 42.44  ? 66   LYS A N     1 
ATOM   1569  C  CA    . LYS E 2 65  ? 4.989   44.418  188.106 1.00 41.47  ? 66   LYS A CA    1 
ATOM   1570  C  C     . LYS E 2 65  ? 4.784   45.789  188.761 1.00 47.13  ? 66   LYS A C     1 
ATOM   1571  O  O     . LYS E 2 65  ? 3.679   46.333  188.757 1.00 48.60  ? 66   LYS A O     1 
ATOM   1572  C  CB    . LYS E 2 65  ? 4.129   43.353  188.813 1.00 26.36  ? 66   LYS A CB    1 
ATOM   1573  C  CG    . LYS E 2 65  ? 3.819   42.128  187.943 1.00 43.88  ? 66   LYS A CG    1 
ATOM   1574  C  CD    . LYS E 2 65  ? 3.493   40.847  188.734 1.00 50.58  ? 66   LYS A CD    1 
ATOM   1575  C  CE    . LYS E 2 65  ? 2.162   40.906  189.485 1.00 58.20  ? 66   LYS A CE    1 
ATOM   1576  N  NZ    . LYS E 2 65  ? 1.842   39.598  190.145 1.00 61.55  ? 66   LYS A NZ    1 
ATOM   1577  N  N     . ASN E 2 66  ? 5.856   46.349  189.314 1.00 45.28  ? 67   ASN A N     1 
ATOM   1578  C  CA    . ASN E 2 66  ? 5.782   47.655  189.952 1.00 44.31  ? 67   ASN A CA    1 
ATOM   1579  C  C     . ASN E 2 66  ? 6.999   48.497  189.524 1.00 46.95  ? 67   ASN A C     1 
ATOM   1580  O  O     . ASN E 2 66  ? 7.764   48.968  190.361 1.00 56.90  ? 67   ASN A O     1 
ATOM   1581  C  CB    . ASN E 2 66  ? 5.761   47.508  191.488 1.00 47.17  ? 67   ASN A CB    1 
ATOM   1582  C  CG    . ASN E 2 66  ? 4.693   46.534  191.989 1.00 45.61  ? 67   ASN A CG    1 
ATOM   1583  O  OD1   . ASN E 2 66  ? 3.513   46.696  191.732 1.00 43.89  ? 67   ASN A OD1   1 
ATOM   1584  N  ND2   . ASN E 2 66  ? 5.121   45.523  192.722 1.00 49.44  ? 67   ASN A ND2   1 
ATOM   1585  N  N     . PRO E 2 67  ? 7.176   48.715  188.210 1.00 39.21  ? 68   PRO A N     1 
ATOM   1586  C  CA    . PRO E 2 67  ? 8.291   49.492  187.651 1.00 37.67  ? 68   PRO A CA    1 
ATOM   1587  C  C     . PRO E 2 67  ? 8.442   50.911  188.183 1.00 42.54  ? 68   PRO A C     1 
ATOM   1588  O  O     . PRO E 2 67  ? 9.530   51.482  188.154 1.00 46.11  ? 68   PRO A O     1 
ATOM   1589  C  CB    . PRO E 2 67  ? 7.999   49.493  186.155 1.00 19.38  ? 68   PRO A CB    1 
ATOM   1590  C  CG    . PRO E 2 67  ? 6.507   49.541  186.143 1.00 45.00  ? 68   PRO A CG    1 
ATOM   1591  C  CD    . PRO E 2 67  ? 6.165   48.467  187.172 1.00 40.01  ? 68   PRO A CD    1 
ATOM   1592  N  N     . ALA E 2 68  ? 7.350   51.492  188.651 1.00 52.30  ? 69   ALA A N     1 
ATOM   1593  C  CA    . ALA E 2 68  ? 7.406   52.850  189.173 1.00 56.57  ? 69   ALA A CA    1 
ATOM   1594  C  C     . ALA E 2 68  ? 7.943   52.857  190.608 1.00 54.43  ? 69   ALA A C     1 
ATOM   1595  O  O     . ALA E 2 68  ? 7.777   53.832  191.349 1.00 53.27  ? 69   ALA A O     1 
ATOM   1596  C  CB    . ALA E 2 68  ? 6.008   53.500  189.121 1.00 60.21  ? 69   ALA A CB    1 
ATOM   1597  N  N     . ILE E 2 69  ? 8.577   51.761  191.002 1.00 45.17  ? 70   ILE A N     1 
ATOM   1598  C  CA    . ILE E 2 69  ? 9.137   51.665  192.339 1.00 44.09  ? 70   ILE A CA    1 
ATOM   1599  C  C     . ILE E 2 69  ? 10.650  51.602  192.308 1.00 47.45  ? 70   ILE A C     1 
ATOM   1600  O  O     . ILE E 2 69  ? 11.242  50.958  191.451 1.00 54.38  ? 70   ILE A O     1 
ATOM   1601  C  CB    . ILE E 2 69  ? 8.627   50.436  193.056 1.00 33.38  ? 70   ILE A CB    1 
ATOM   1602  C  CG1   . ILE E 2 69  ? 7.125   50.342  192.863 1.00 32.19  ? 70   ILE A CG1   1 
ATOM   1603  C  CG2   . ILE E 2 69  ? 8.958   50.526  194.532 1.00 41.83  ? 70   ILE A CG2   1 
ATOM   1604  C  CD1   . ILE E 2 69  ? 6.400   51.572  193.305 1.00 38.65  ? 70   ILE A CD1   1 
ATOM   1605  N  N     . ILE E 2 70  ? 11.288  52.268  193.252 1.00 48.85  ? 71   ILE A N     1 
ATOM   1606  C  CA    . ILE E 2 70  ? 12.735  52.253  193.272 1.00 47.02  ? 71   ILE A CA    1 
ATOM   1607  C  C     . ILE E 2 70  ? 13.283  52.355  194.683 1.00 49.11  ? 71   ILE A C     1 
ATOM   1608  O  O     . ILE E 2 70  ? 12.576  52.764  195.611 1.00 45.54  ? 71   ILE A O     1 
ATOM   1609  C  CB    . ILE E 2 70  ? 13.293  53.397  192.399 1.00 51.40  ? 71   ILE A CB    1 
ATOM   1610  C  CG1   . ILE E 2 70  ? 12.620  54.727  192.765 1.00 62.73  ? 71   ILE A CG1   1 
ATOM   1611  C  CG2   . ILE E 2 70  ? 13.068  53.075  190.935 1.00 40.82  ? 71   ILE A CG2   1 
ATOM   1612  C  CD1   . ILE E 2 70  ? 13.181  55.417  194.013 1.00 73.36  ? 71   ILE A CD1   1 
ATOM   1613  N  N     . GLY E 2 71  ? 14.550  51.980  194.833 1.00 47.09  ? 72   GLY A N     1 
ATOM   1614  C  CA    . GLY E 2 71  ? 15.191  52.027  196.132 1.00 40.44  ? 72   GLY A CA    1 
ATOM   1615  C  C     . GLY E 2 71  ? 14.838  50.796  196.940 1.00 44.42  ? 72   GLY A C     1 
ATOM   1616  O  O     . GLY E 2 71  ? 13.875  50.101  196.626 1.00 45.70  ? 72   GLY A O     1 
ATOM   1617  N  N     . HIS E 2 72  ? 15.598  50.510  197.987 1.00 41.27  ? 73   HIS A N     1 
ATOM   1618  C  CA    . HIS E 2 72  ? 15.296  49.333  198.774 1.00 45.55  ? 73   HIS A CA    1 
ATOM   1619  C  C     . HIS E 2 72  ? 14.040  49.503  199.618 1.00 44.72  ? 73   HIS A C     1 
ATOM   1620  O  O     . HIS E 2 72  ? 13.183  48.623  199.635 1.00 54.04  ? 73   HIS A O     1 
ATOM   1621  C  CB    . HIS E 2 72  ? 16.484  48.977  199.661 1.00 47.29  ? 73   HIS A CB    1 
ATOM   1622  C  CG    . HIS E 2 72  ? 16.991  50.124  200.466 1.00 40.57  ? 73   HIS A CG    1 
ATOM   1623  N  ND1   . HIS E 2 72  ? 17.381  51.312  199.891 1.00 33.57  ? 73   HIS A ND1   1 
ATOM   1624  C  CD2   . HIS E 2 72  ? 17.161  50.273  201.803 1.00 44.03  ? 73   HIS A CD2   1 
ATOM   1625  C  CE1   . HIS E 2 72  ? 17.771  52.146  200.840 1.00 51.75  ? 73   HIS A CE1   1 
ATOM   1626  N  NE2   . HIS E 2 72  ? 17.646  51.539  202.009 1.00 46.14  ? 73   HIS A NE2   1 
ATOM   1627  N  N     . GLU E 2 73  ? 13.931  50.636  200.306 1.00 48.10  ? 74   GLU A N     1 
ATOM   1628  C  CA    . GLU E 2 73  ? 12.782  50.935  201.160 1.00 45.09  ? 74   GLU A CA    1 
ATOM   1629  C  C     . GLU E 2 73  ? 11.453  50.644  200.453 1.00 44.22  ? 74   GLU A C     1 
ATOM   1630  O  O     . GLU E 2 73  ? 10.637  49.864  200.938 1.00 38.35  ? 74   GLU A O     1 
ATOM   1631  C  CB    . GLU E 2 73  ? 12.827  52.408  201.589 1.00 54.67  ? 74   GLU A CB    1 
ATOM   1632  C  CG    . GLU E 2 73  ? 13.850  52.758  202.688 1.00 61.35  ? 74   GLU A CG    1 
ATOM   1633  C  CD    . GLU E 2 73  ? 13.368  52.380  204.081 1.00 63.25  ? 74   GLU A CD    1 
ATOM   1634  O  OE1   . GLU E 2 73  ? 13.924  52.883  205.084 1.00 53.10  ? 74   GLU A OE1   1 
ATOM   1635  O  OE2   . GLU E 2 73  ? 12.424  51.571  204.171 1.00 73.09  ? 74   GLU A OE2   1 
ATOM   1636  N  N     . ALA E 2 74  ? 11.253  51.272  199.301 1.00 44.14  ? 75   ALA A N     1 
ATOM   1637  C  CA    . ALA E 2 74  ? 10.039  51.101  198.514 1.00 40.15  ? 75   ALA A CA    1 
ATOM   1638  C  C     . ALA E 2 74  ? 9.823   49.688  197.992 1.00 39.40  ? 75   ALA A C     1 
ATOM   1639  O  O     . ALA E 2 74  ? 8.711   49.174  198.039 1.00 47.81  ? 75   ALA A O     1 
ATOM   1640  C  CB    . ALA E 2 74  ? 10.049  52.076  197.347 1.00 51.00  ? 75   ALA A CB    1 
ATOM   1641  N  N     . ARG E 2 75  ? 10.872  49.060  197.473 1.00 44.60  ? 76   ARG A N     1 
ATOM   1642  C  CA    . ARG E 2 75  ? 10.739  47.703  196.947 1.00 34.94  ? 76   ARG A CA    1 
ATOM   1643  C  C     . ARG E 2 75  ? 10.496  46.660  198.036 1.00 33.07  ? 76   ARG A C     1 
ATOM   1644  O  O     . ARG E 2 75  ? 9.921   45.620  197.752 1.00 39.99  ? 76   ARG A O     1 
ATOM   1645  C  CB    . ARG E 2 75  ? 11.963  47.337  196.101 1.00 31.48  ? 76   ARG A CB    1 
ATOM   1646  C  CG    . ARG E 2 75  ? 11.887  47.857  194.663 1.00 20.91  ? 76   ARG A CG    1 
ATOM   1647  C  CD    . ARG E 2 75  ? 13.249  47.906  193.966 1.00 22.48  ? 76   ARG A CD    1 
ATOM   1648  N  NE    . ARG E 2 75  ? 13.115  48.369  192.586 1.00 35.35  ? 76   ARG A NE    1 
ATOM   1649  C  CZ    . ARG E 2 75  ? 14.120  48.520  191.725 1.00 42.96  ? 76   ARG A CZ    1 
ATOM   1650  N  NH1   . ARG E 2 75  ? 15.366  48.246  192.089 1.00 48.32  ? 76   ARG A NH1   1 
ATOM   1651  N  NH2   . ARG E 2 75  ? 13.877  48.945  190.486 1.00 35.37  ? 76   ARG A NH2   1 
ATOM   1652  N  N     . TYR E 2 76  ? 10.905  46.930  199.275 1.00 24.25  ? 77   TYR A N     1 
ATOM   1653  C  CA    . TYR E 2 76  ? 10.662  45.971  200.342 1.00 33.13  ? 77   TYR A CA    1 
ATOM   1654  C  C     . TYR E 2 76  ? 9.204   46.003  200.768 1.00 42.03  ? 77   TYR A C     1 
ATOM   1655  O  O     . TYR E 2 76  ? 8.626   44.970  201.102 1.00 47.25  ? 77   TYR A O     1 
ATOM   1656  C  CB    . TYR E 2 76  ? 11.546  46.246  201.564 1.00 40.05  ? 77   TYR A CB    1 
ATOM   1657  C  CG    . TYR E 2 76  ? 12.974  45.792  201.387 1.00 53.08  ? 77   TYR A CG    1 
ATOM   1658  C  CD1   . TYR E 2 76  ? 13.259  44.565  200.791 1.00 59.44  ? 77   TYR A CD1   1 
ATOM   1659  C  CD2   . TYR E 2 76  ? 14.041  46.600  201.773 1.00 55.89  ? 77   TYR A CD2   1 
ATOM   1660  C  CE1   . TYR E 2 76  ? 14.569  44.158  200.572 1.00 63.69  ? 77   TYR A CE1   1 
ATOM   1661  C  CE2   . TYR E 2 76  ? 15.362  46.197  201.559 1.00 61.40  ? 77   TYR A CE2   1 
ATOM   1662  C  CZ    . TYR E 2 76  ? 15.612  44.975  200.952 1.00 59.94  ? 77   TYR A CZ    1 
ATOM   1663  O  OH    . TYR E 2 76  ? 16.898  44.579  200.680 1.00 52.92  ? 77   TYR A OH    1 
ATOM   1664  N  N     . LYS E 2 77  ? 8.612   47.197  200.747 1.00 49.46  ? 78   LYS A N     1 
ATOM   1665  C  CA    . LYS E 2 77  ? 7.213   47.394  201.139 1.00 46.84  ? 78   LYS A CA    1 
ATOM   1666  C  C     . LYS E 2 77  ? 6.258   46.597  200.249 1.00 46.97  ? 78   LYS A C     1 
ATOM   1667  O  O     . LYS E 2 77  ? 5.094   46.382  200.603 1.00 47.74  ? 78   LYS A O     1 
ATOM   1668  C  CB    . LYS E 2 77  ? 6.863   48.894  201.106 1.00 39.49  ? 78   LYS A CB    1 
ATOM   1669  C  CG    . LYS E 2 77  ? 7.561   49.715  202.220 1.00 40.79  ? 78   LYS A CG    1 
ATOM   1670  C  CD    . LYS E 2 77  ? 7.126   51.187  202.240 1.00 53.33  ? 78   LYS A CD    1 
ATOM   1671  C  CE    . LYS E 2 77  ? 5.644   51.340  202.612 1.00 55.70  ? 78   LYS A CE    1 
ATOM   1672  N  NZ    . LYS E 2 77  ? 5.126   52.744  202.549 1.00 46.17  ? 78   LYS A NZ    1 
ATOM   1673  N  N     . LEU E 2 78  ? 6.775   46.152  199.105 1.00 40.62  ? 79   LEU A N     1 
ATOM   1674  C  CA    . LEU E 2 78  ? 6.010   45.366  198.151 1.00 48.01  ? 79   LEU A CA    1 
ATOM   1675  C  C     . LEU E 2 78  ? 5.718   43.943  198.668 1.00 52.93  ? 79   LEU A C     1 
ATOM   1676  O  O     . LEU E 2 78  ? 4.913   43.217  198.079 1.00 61.87  ? 79   LEU A O     1 
ATOM   1677  C  CB    . LEU E 2 78  ? 6.748   45.298  196.796 1.00 43.10  ? 79   LEU A CB    1 
ATOM   1678  C  CG    . LEU E 2 78  ? 6.801   46.546  195.906 1.00 39.26  ? 79   LEU A CG    1 
ATOM   1679  C  CD1   . LEU E 2 78  ? 7.549   46.255  194.612 1.00 32.15  ? 79   LEU A CD1   1 
ATOM   1680  C  CD2   . LEU E 2 78  ? 5.386   46.994  195.580 1.00 47.57  ? 79   LEU A CD2   1 
ATOM   1681  N  N     . PHE E 2 79  ? 6.357   43.544  199.764 1.00 44.51  ? 80   PHE A N     1 
ATOM   1682  C  CA    . PHE E 2 79  ? 6.115   42.215  200.314 1.00 47.74  ? 80   PHE A CA    1 
ATOM   1683  C  C     . PHE E 2 79  ? 4.893   42.185  201.225 1.00 49.83  ? 80   PHE A C     1 
ATOM   1684  O  O     . PHE E 2 79  ? 4.312   41.129  201.464 1.00 53.03  ? 80   PHE A O     1 
ATOM   1685  C  CB    . PHE E 2 79  ? 7.333   41.705  201.093 1.00 41.52  ? 80   PHE A CB    1 
ATOM   1686  C  CG    . PHE E 2 79  ? 8.475   41.285  200.221 1.00 44.52  ? 80   PHE A CG    1 
ATOM   1687  C  CD1   . PHE E 2 79  ? 9.288   42.234  199.615 1.00 47.68  ? 80   PHE A CD1   1 
ATOM   1688  C  CD2   . PHE E 2 79  ? 8.710   39.943  199.961 1.00 45.74  ? 80   PHE A CD2   1 
ATOM   1689  C  CE1   . PHE E 2 79  ? 10.311  41.853  198.759 1.00 41.69  ? 80   PHE A CE1   1 
ATOM   1690  C  CE2   . PHE E 2 79  ? 9.735   39.550  199.103 1.00 44.91  ? 80   PHE A CE2   1 
ATOM   1691  C  CZ    . PHE E 2 79  ? 10.533  40.508  198.502 1.00 44.75  ? 80   PHE A CZ    1 
ATOM   1692  N  N     . ASN E 2 80  ? 4.513   43.347  201.732 1.00 51.84  ? 81   ASN A N     1 
ATOM   1693  C  CA    . ASN E 2 80  ? 3.368   43.466  202.622 1.00 57.91  ? 81   ASN A CA    1 
ATOM   1694  C  C     . ASN E 2 80  ? 3.427   42.454  203.747 1.00 56.80  ? 81   ASN A C     1 
ATOM   1695  O  O     . ASN E 2 80  ? 2.399   42.050  204.281 1.00 64.75  ? 81   ASN A O     1 
ATOM   1696  C  CB    . ASN E 2 80  ? 2.061   43.302  201.850 1.00 59.51  ? 81   ASN A CB    1 
ATOM   1697  C  CG    . ASN E 2 80  ? 1.849   44.410  200.838 1.00 82.18  ? 81   ASN A CG    1 
ATOM   1698  O  OD1   . ASN E 2 80  ? 1.898   45.598  201.180 1.00 87.85  ? 81   ASN A OD1   1 
ATOM   1699  N  ND2   . ASN E 2 80  ? 1.613   44.033  199.584 1.00 85.37  ? 81   ASN A ND2   1 
ATOM   1700  N  N     . SER E 2 81  ? 4.638   42.066  204.129 1.00 53.40  ? 82   SER A N     1 
ATOM   1701  C  CA    . SER E 2 81  ? 4.804   41.088  205.191 1.00 49.76  ? 82   SER A CA    1 
ATOM   1702  C  C     . SER E 2 81  ? 6.273   40.950  205.632 1.00 47.47  ? 82   SER A C     1 
ATOM   1703  O  O     . SER E 2 81  ? 7.145   40.621  204.836 1.00 45.31  ? 82   SER A O     1 
ATOM   1704  C  CB    . SER E 2 81  ? 4.253   39.734  204.701 1.00 52.51  ? 82   SER A CB    1 
ATOM   1705  O  OG    . SER E 2 81  ? 4.440   38.707  205.654 1.00 52.85  ? 82   SER A OG    1 
ATOM   1706  N  N     . PRO E 2 82  ? 6.561   41.211  206.915 1.00 46.57  ? 83   PRO A N     1 
ATOM   1707  C  CA    . PRO E 2 82  ? 7.926   41.108  207.458 1.00 39.35  ? 83   PRO A CA    1 
ATOM   1708  C  C     . PRO E 2 82  ? 8.513   39.705  207.312 1.00 39.26  ? 83   PRO A C     1 
ATOM   1709  O  O     . PRO E 2 82  ? 9.611   39.522  206.791 1.00 44.78  ? 83   PRO A O     1 
ATOM   1710  C  CB    . PRO E 2 82  ? 7.743   41.461  208.936 1.00 30.19  ? 83   PRO A CB    1 
ATOM   1711  C  CG    . PRO E 2 82  ? 6.582   42.360  208.937 1.00 35.61  ? 83   PRO A CG    1 
ATOM   1712  C  CD    . PRO E 2 82  ? 5.632   41.737  207.930 1.00 41.43  ? 83   PRO A CD    1 
ATOM   1713  N  N     . THR E 2 83  ? 7.759   38.724  207.802 1.00 40.73  ? 84   THR A N     1 
ATOM   1714  C  CA    . THR E 2 83  ? 8.155   37.320  207.790 1.00 31.35  ? 84   THR A CA    1 
ATOM   1715  C  C     . THR E 2 83  ? 8.443   36.866  206.376 1.00 32.13  ? 84   THR A C     1 
ATOM   1716  O  O     . THR E 2 83  ? 9.557   36.475  206.037 1.00 21.87  ? 84   THR A O     1 
ATOM   1717  C  CB    . THR E 2 83  ? 7.032   36.442  208.356 1.00 24.33  ? 84   THR A CB    1 
ATOM   1718  O  OG1   . THR E 2 83  ? 6.514   37.049  209.540 1.00 34.45  ? 84   THR A OG1   1 
ATOM   1719  C  CG2   . THR E 2 83  ? 7.550   35.074  208.704 1.00 32.55  ? 84   THR A CG2   1 
ATOM   1720  N  N     . LEU E 2 84  ? 7.417   36.935  205.547 1.00 33.51  ? 85   LEU A N     1 
ATOM   1721  C  CA    . LEU E 2 84  ? 7.556   36.520  204.173 1.00 36.05  ? 85   LEU A CA    1 
ATOM   1722  C  C     . LEU E 2 84  ? 8.695   37.259  203.456 1.00 36.51  ? 85   LEU A C     1 
ATOM   1723  O  O     . LEU E 2 84  ? 9.175   36.821  202.413 1.00 33.08  ? 85   LEU A O     1 
ATOM   1724  C  CB    . LEU E 2 84  ? 6.248   36.753  203.447 1.00 36.98  ? 85   LEU A CB    1 
ATOM   1725  C  CG    . LEU E 2 84  ? 6.271   36.206  202.034 1.00 34.80  ? 85   LEU A CG    1 
ATOM   1726  C  CD1   . LEU E 2 84  ? 6.592   34.726  202.060 1.00 24.39  ? 85   LEU A CD1   1 
ATOM   1727  C  CD2   . LEU E 2 84  ? 4.919   36.464  201.406 1.00 52.21  ? 85   LEU A CD2   1 
ATOM   1728  N  N     . LEU E 2 85  ? 9.122   38.387  204.013 1.00 34.23  ? 86   LEU A N     1 
ATOM   1729  C  CA    . LEU E 2 85  ? 10.197  39.159  203.410 1.00 28.26  ? 86   LEU A CA    1 
ATOM   1730  C  C     . LEU E 2 85  ? 11.521  38.602  203.907 1.00 33.42  ? 86   LEU A C     1 
ATOM   1731  O  O     . LEU E 2 85  ? 12.470  38.426  203.130 1.00 33.34  ? 86   LEU A O     1 
ATOM   1732  C  CB    . LEU E 2 85  ? 10.042  40.641  203.758 1.00 20.93  ? 86   LEU A CB    1 
ATOM   1733  C  CG    . LEU E 2 85  ? 11.187  41.606  203.455 1.00 39.16  ? 86   LEU A CG    1 
ATOM   1734  C  CD1   . LEU E 2 85  ? 10.656  42.952  203.037 1.00 26.09  ? 86   LEU A CD1   1 
ATOM   1735  C  CD2   . LEU E 2 85  ? 12.076  41.733  204.707 1.00 34.23  ? 86   LEU A CD2   1 
ATOM   1736  N  N     . PHE E 2 86  ? 11.579  38.313  205.203 1.00 29.50  ? 87   PHE A N     1 
ATOM   1737  C  CA    . PHE E 2 86  ? 12.779  37.739  205.799 1.00 30.22  ? 87   PHE A CA    1 
ATOM   1738  C  C     . PHE E 2 86  ? 13.101  36.387  205.174 1.00 32.91  ? 87   PHE A C     1 
ATOM   1739  O  O     . PHE E 2 86  ? 14.234  35.924  205.256 1.00 40.64  ? 87   PHE A O     1 
ATOM   1740  C  CB    . PHE E 2 86  ? 12.605  37.537  207.305 1.00 26.50  ? 87   PHE A CB    1 
ATOM   1741  C  CG    . PHE E 2 86  ? 13.627  36.614  207.904 1.00 24.78  ? 87   PHE A CG    1 
ATOM   1742  C  CD1   . PHE E 2 86  ? 14.943  37.018  208.050 1.00 24.47  ? 87   PHE A CD1   1 
ATOM   1743  C  CD2   . PHE E 2 86  ? 13.267  35.341  208.338 1.00 28.58  ? 87   PHE A CD2   1 
ATOM   1744  C  CE1   . PHE E 2 86  ? 15.894  36.174  208.630 1.00 35.46  ? 87   PHE A CE1   1 
ATOM   1745  C  CE2   . PHE E 2 86  ? 14.206  34.483  208.922 1.00 29.66  ? 87   PHE A CE2   1 
ATOM   1746  C  CZ    . PHE E 2 86  ? 15.522  34.901  209.071 1.00 40.08  ? 87   PHE A CZ    1 
ATOM   1747  N  N     . LEU E 2 87  ? 12.108  35.752  204.554 1.00 34.49  ? 88   LEU A N     1 
ATOM   1748  C  CA    . LEU E 2 87  ? 12.330  34.443  203.949 1.00 32.62  ? 88   LEU A CA    1 
ATOM   1749  C  C     . LEU E 2 87  ? 12.624  34.503  202.473 1.00 35.36  ? 88   LEU A C     1 
ATOM   1750  O  O     . LEU E 2 87  ? 13.241  33.579  201.939 1.00 35.56  ? 88   LEU A O     1 
ATOM   1751  C  CB    . LEU E 2 87  ? 11.120  33.533  204.175 1.00 27.23  ? 88   LEU A CB    1 
ATOM   1752  C  CG    . LEU E 2 87  ? 10.903  32.983  205.588 1.00 32.93  ? 88   LEU A CG    1 
ATOM   1753  C  CD1   . LEU E 2 87  ? 9.480   32.476  205.725 1.00 35.25  ? 88   LEU A CD1   1 
ATOM   1754  C  CD2   . LEU E 2 87  ? 11.903  31.873  205.862 1.00 29.61  ? 88   LEU A CD2   1 
ATOM   1755  N  N     . LEU E 2 88  ? 12.221  35.594  201.818 1.00 28.83  ? 89   LEU A N     1 
ATOM   1756  C  CA    . LEU E 2 88  ? 12.407  35.711  200.366 1.00 35.14  ? 89   LEU A CA    1 
ATOM   1757  C  C     . LEU E 2 88  ? 13.254  36.865  199.816 1.00 35.62  ? 89   LEU A C     1 
ATOM   1758  O  O     . LEU E 2 88  ? 13.641  36.836  198.643 1.00 39.90  ? 89   LEU A O     1 
ATOM   1759  C  CB    . LEU E 2 88  ? 11.022  35.727  199.691 1.00 43.47  ? 89   LEU A CB    1 
ATOM   1760  C  CG    . LEU E 2 88  ? 10.036  34.603  200.085 1.00 49.76  ? 89   LEU A CG    1 
ATOM   1761  C  CD1   . LEU E 2 88  ? 8.681   34.850  199.442 1.00 43.90  ? 89   LEU A CD1   1 
ATOM   1762  C  CD2   . LEU E 2 88  ? 10.586  33.244  199.661 1.00 46.07  ? 89   LEU A CD2   1 
ATOM   1763  N  N     . SER E 2 89  ? 13.540  37.862  200.654 1.00 35.24  ? 90   SER A N     1 
ATOM   1764  C  CA    . SER E 2 89  ? 14.340  39.043  200.270 1.00 37.36  ? 90   SER A CA    1 
ATOM   1765  C  C     . SER E 2 89  ? 15.734  38.750  199.676 1.00 37.93  ? 90   SER A C     1 
ATOM   1766  O  O     . SER E 2 89  ? 16.144  37.607  199.585 1.00 44.58  ? 90   SER A O     1 
ATOM   1767  C  CB    . SER E 2 89  ? 14.522  39.959  201.488 1.00 40.19  ? 90   SER A CB    1 
ATOM   1768  O  OG    . SER E 2 89  ? 13.464  40.885  201.604 1.00 45.73  ? 90   SER A OG    1 
ATOM   1769  N  N     . ARG E 2 90  ? 16.464  39.793  199.288 1.00 33.76  ? 91   ARG A N     1 
ATOM   1770  C  CA    . ARG E 2 90  ? 17.790  39.603  198.733 1.00 29.40  ? 91   ARG A CA    1 
ATOM   1771  C  C     . ARG E 2 90  ? 18.891  40.426  199.399 1.00 33.87  ? 91   ARG A C     1 
ATOM   1772  O  O     . ARG E 2 90  ? 20.054  40.018  199.429 1.00 37.01  ? 91   ARG A O     1 
ATOM   1773  C  CB    . ARG E 2 90  ? 17.800  39.870  197.219 1.00 24.08  ? 91   ARG A CB    1 
ATOM   1774  C  CG    . ARG E 2 90  ? 17.458  38.639  196.368 1.00 21.79  ? 91   ARG A CG    1 
ATOM   1775  C  CD    . ARG E 2 90  ? 18.231  37.398  196.860 1.00 26.30  ? 91   ARG A CD    1 
ATOM   1776  N  NE    . ARG E 2 90  ? 17.921  36.163  196.136 1.00 20.45  ? 91   ARG A NE    1 
ATOM   1777  C  CZ    . ARG E 2 90  ? 18.280  35.911  194.879 1.00 29.11  ? 91   ARG A CZ    1 
ATOM   1778  N  NH1   . ARG E 2 90  ? 17.953  34.756  194.319 1.00 14.98  ? 91   ARG A NH1   1 
ATOM   1779  N  NH2   . ARG E 2 90  ? 18.962  36.811  194.180 1.00 28.11  ? 91   ARG A NH2   1 
ATOM   1780  N  N     . GLY E 2 91  ? 18.550  41.583  199.940 1.00 31.46  ? 92   GLY A N     1 
ATOM   1781  C  CA    . GLY E 2 91  ? 19.581  42.389  200.575 1.00 35.67  ? 92   GLY A CA    1 
ATOM   1782  C  C     . GLY E 2 91  ? 19.726  43.757  199.940 1.00 35.63  ? 92   GLY A C     1 
ATOM   1783  O  O     . GLY E 2 91  ? 19.806  43.867  198.718 1.00 42.61  ? 92   GLY A O     1 
ATOM   1784  N  N     . LYS E 2 92  ? 19.752  44.789  200.788 1.00 28.54  ? 93   LYS A N     1 
ATOM   1785  C  CA    . LYS E 2 92  ? 19.879  46.189  200.381 1.00 27.93  ? 93   LYS A CA    1 
ATOM   1786  C  C     . LYS E 2 92  ? 20.462  46.371  198.992 1.00 30.41  ? 93   LYS A C     1 
ATOM   1787  O  O     . LYS E 2 92  ? 19.787  46.831  198.075 1.00 36.23  ? 93   LYS A O     1 
ATOM   1788  C  CB    . LYS E 2 92  ? 20.747  46.964  201.379 1.00 24.79  ? 93   LYS A CB    1 
ATOM   1789  C  CG    . LYS E 2 92  ? 19.977  47.746  202.429 1.00 33.10  ? 93   LYS A CG    1 
ATOM   1790  C  CD    . LYS E 2 92  ? 20.859  48.771  203.153 1.00 35.83  ? 93   LYS A CD    1 
ATOM   1791  C  CE    . LYS E 2 92  ? 20.093  49.505  204.263 1.00 33.18  ? 93   LYS A CE    1 
ATOM   1792  N  NZ    . LYS E 2 92  ? 19.559  48.570  205.294 1.00 32.22  ? 93   LYS A NZ    1 
ATOM   1793  N  N     . ALA E 2 93  ? 21.728  46.001  198.854 1.00 31.63  ? 94   ALA A N     1 
ATOM   1794  C  CA    . ALA E 2 93  ? 22.456  46.115  197.600 1.00 33.98  ? 94   ALA A CA    1 
ATOM   1795  C  C     . ALA E 2 93  ? 21.787  45.411  196.431 1.00 36.96  ? 94   ALA A C     1 
ATOM   1796  O  O     . ALA E 2 93  ? 21.517  46.029  195.400 1.00 36.81  ? 94   ALA A O     1 
ATOM   1797  C  CB    . ALA E 2 93  ? 23.867  45.576  197.782 1.00 25.25  ? 94   ALA A CB    1 
ATOM   1798  N  N     . ALA E 2 94  ? 21.536  44.114  196.588 1.00 38.53  ? 95   ALA A N     1 
ATOM   1799  C  CA    . ALA E 2 94  ? 20.923  43.340  195.520 1.00 41.01  ? 95   ALA A CA    1 
ATOM   1800  C  C     . ALA E 2 94  ? 19.566  43.908  195.141 1.00 45.44  ? 95   ALA A C     1 
ATOM   1801  O  O     . ALA E 2 94  ? 19.241  44.015  193.952 1.00 41.80  ? 95   ALA A O     1 
ATOM   1802  C  CB    . ALA E 2 94  ? 20.792  41.893  195.936 1.00 36.75  ? 95   ALA A CB    1 
ATOM   1803  N  N     . THR E 2 95  ? 18.793  44.292  196.156 1.00 44.99  ? 96   THR A N     1 
ATOM   1804  C  CA    . THR E 2 95  ? 17.456  44.850  195.955 1.00 49.52  ? 96   THR A CA    1 
ATOM   1805  C  C     . THR E 2 95  ? 17.512  46.197  195.251 1.00 55.22  ? 96   THR A C     1 
ATOM   1806  O  O     . THR E 2 95  ? 16.804  46.427  194.267 1.00 60.40  ? 96   THR A O     1 
ATOM   1807  C  CB    . THR E 2 95  ? 16.724  45.041  197.294 1.00 50.92  ? 96   THR A CB    1 
ATOM   1808  O  OG1   . THR E 2 95  ? 16.642  43.786  197.990 1.00 54.98  ? 96   THR A OG1   1 
ATOM   1809  C  CG2   . THR E 2 95  ? 15.323  45.569  197.052 1.00 56.17  ? 96   THR A CG2   1 
ATOM   1810  N  N     . GLU E 2 96  ? 18.365  47.077  195.769 1.00 54.75  ? 97   GLU A N     1 
ATOM   1811  C  CA    . GLU E 2 96  ? 18.563  48.428  195.235 1.00 42.73  ? 97   GLU A CA    1 
ATOM   1812  C  C     . GLU E 2 96  ? 19.052  48.431  193.791 1.00 32.88  ? 97   GLU A C     1 
ATOM   1813  O  O     . GLU E 2 96  ? 18.740  49.344  193.030 1.00 38.19  ? 97   GLU A O     1 
ATOM   1814  C  CB    . GLU E 2 96  ? 19.577  49.182  196.102 1.00 46.81  ? 97   GLU A CB    1 
ATOM   1815  C  CG    . GLU E 2 96  ? 19.786  50.640  195.723 1.00 41.96  ? 97   GLU A CG    1 
ATOM   1816  C  CD    . GLU E 2 96  ? 18.816  51.563  196.425 1.00 37.04  ? 97   GLU A CD    1 
ATOM   1817  O  OE1   . GLU E 2 96  ? 18.716  52.744  196.014 1.00 42.27  ? 97   GLU A OE1   1 
ATOM   1818  O  OE2   . GLU E 2 96  ? 18.164  51.111  197.392 1.00 30.65  ? 97   GLU A OE2   1 
ATOM   1819  N  N     . ASN E 2 97  ? 19.823  47.421  193.412 1.00 29.33  ? 98   ASN A N     1 
ATOM   1820  C  CA    . ASN E 2 97  ? 20.335  47.376  192.053 1.00 35.24  ? 98   ASN A CA    1 
ATOM   1821  C  C     . ASN E 2 97  ? 19.461  46.639  191.064 1.00 37.15  ? 98   ASN A C     1 
ATOM   1822  O  O     . ASN E 2 97  ? 19.756  46.634  189.866 1.00 39.84  ? 98   ASN A O     1 
ATOM   1823  C  CB    . ASN E 2 97  ? 21.736  46.767  192.025 1.00 38.28  ? 98   ASN A CB    1 
ATOM   1824  C  CG    . ASN E 2 97  ? 22.803  47.751  192.448 1.00 47.16  ? 98   ASN A CG    1 
ATOM   1825  O  OD1   . ASN E 2 97  ? 22.898  48.108  193.617 1.00 40.87  ? 98   ASN A OD1   1 
ATOM   1826  N  ND2   . ASN E 2 97  ? 23.605  48.215  191.484 1.00 48.61  ? 98   ASN A ND2   1 
ATOM   1827  N  N     . TRP E 2 98  ? 18.389  46.021  191.550 1.00 31.73  ? 99   TRP A N     1 
ATOM   1828  C  CA    . TRP E 2 98  ? 17.506  45.286  190.656 1.00 34.08  ? 99   TRP A CA    1 
ATOM   1829  C  C     . TRP E 2 98  ? 17.079  46.153  189.483 1.00 37.65  ? 99   TRP A C     1 
ATOM   1830  O  O     . TRP E 2 98  ? 16.954  47.366  189.610 1.00 42.42  ? 99   TRP A O     1 
ATOM   1831  C  CB    . TRP E 2 98  ? 16.257  44.793  191.378 1.00 39.45  ? 99   TRP A CB    1 
ATOM   1832  C  CG    . TRP E 2 98  ? 15.455  43.851  190.531 1.00 44.94  ? 99   TRP A CG    1 
ATOM   1833  C  CD1   . TRP E 2 98  ? 15.647  42.509  190.396 1.00 48.39  ? 99   TRP A CD1   1 
ATOM   1834  C  CD2   . TRP E 2 98  ? 14.376  44.195  189.654 1.00 55.56  ? 99   TRP A CD2   1 
ATOM   1835  N  NE1   . TRP E 2 98  ? 14.758  41.991  189.485 1.00 63.06  ? 99   TRP A NE1   1 
ATOM   1836  C  CE2   . TRP E 2 98  ? 13.966  43.005  189.011 1.00 63.38  ? 99   TRP A CE2   1 
ATOM   1837  C  CE3   . TRP E 2 98  ? 13.721  45.395  189.341 1.00 54.51  ? 99   TRP A CE3   1 
ATOM   1838  C  CZ2   . TRP E 2 98  ? 12.921  42.975  188.076 1.00 63.12  ? 99   TRP A CZ2   1 
ATOM   1839  C  CZ3   . TRP E 2 98  ? 12.683  45.366  188.412 1.00 64.62  ? 99   TRP A CZ3   1 
ATOM   1840  C  CH2   . TRP E 2 98  ? 12.296  44.160  187.789 1.00 64.83  ? 99   TRP A CH2   1 
ATOM   1841  N  N     . SER E 2 99  ? 16.836  45.516  188.346 1.00 41.25  ? 100  SER A N     1 
ATOM   1842  C  CA    . SER E 2 99  ? 16.439  46.224  187.148 1.00 44.12  ? 100  SER A CA    1 
ATOM   1843  C  C     . SER E 2 99  ? 15.990  45.262  186.053 1.00 52.36  ? 100  SER A C     1 
ATOM   1844  O  O     . SER E 2 99  ? 16.199  44.055  186.148 1.00 57.83  ? 100  SER A O     1 
ATOM   1845  C  CB    . SER E 2 99  ? 17.604  47.056  186.636 1.00 32.95  ? 100  SER A CB    1 
ATOM   1846  O  OG    . SER E 2 99  ? 17.635  47.028  185.220 1.00 32.68  ? 100  SER A OG    1 
ATOM   1847  N  N     . ILE E 2 100 ? 15.377  45.799  185.006 1.00 52.05  ? 101  ILE A N     1 
ATOM   1848  C  CA    . ILE E 2 100 ? 14.916  44.959  183.921 1.00 56.03  ? 101  ILE A CA    1 
ATOM   1849  C  C     . ILE E 2 100 ? 16.122  44.513  183.114 1.00 61.07  ? 101  ILE A C     1 
ATOM   1850  O  O     . ILE E 2 100 ? 16.034  43.622  182.262 1.00 64.37  ? 101  ILE A O     1 
ATOM   1851  C  CB    . ILE E 2 100 ? 13.934  45.703  183.003 1.00 60.11  ? 101  ILE A CB    1 
ATOM   1852  C  CG1   . ILE E 2 100 ? 12.943  46.517  183.836 1.00 69.10  ? 101  ILE A CG1   1 
ATOM   1853  C  CG2   . ILE E 2 100 ? 13.179  44.698  182.151 1.00 62.12  ? 101  ILE A CG2   1 
ATOM   1854  C  CD1   . ILE E 2 100 ? 13.529  47.794  184.443 1.00 72.07  ? 101  ILE A CD1   1 
ATOM   1855  N  N     . GLU E 2 101 ? 17.255  45.147  183.401 1.00 64.28  ? 102  GLU A N     1 
ATOM   1856  C  CA    . GLU E 2 101 ? 18.517  44.848  182.729 1.00 62.24  ? 102  GLU A CA    1 
ATOM   1857  C  C     . GLU E 2 101 ? 19.429  44.005  183.636 1.00 59.86  ? 102  GLU A C     1 
ATOM   1858  O  O     . GLU E 2 101 ? 20.280  43.257  183.153 1.00 65.29  ? 102  GLU A O     1 
ATOM   1859  C  CB    . GLU E 2 101 ? 19.218  46.152  182.342 1.00 49.99  ? 102  GLU A CB    1 
ATOM   1860  N  N     . ASN E 2 102 ? 19.249  44.130  184.948 1.00 45.09  ? 103  ASN A N     1 
ATOM   1861  C  CA    . ASN E 2 102 ? 20.045  43.364  185.889 1.00 32.52  ? 103  ASN A CA    1 
ATOM   1862  C  C     . ASN E 2 102 ? 19.140  42.583  186.844 1.00 31.57  ? 103  ASN A C     1 
ATOM   1863  O  O     . ASN E 2 102 ? 19.084  42.861  188.047 1.00 17.56  ? 103  ASN A O     1 
ATOM   1864  C  CB    . ASN E 2 102 ? 20.979  44.284  186.670 1.00 33.35  ? 103  ASN A CB    1 
ATOM   1865  C  CG    . ASN E 2 102 ? 21.934  43.516  187.564 1.00 43.19  ? 103  ASN A CG    1 
ATOM   1866  O  OD1   . ASN E 2 102 ? 22.658  42.628  187.103 1.00 49.42  ? 103  ASN A OD1   1 
ATOM   1867  N  ND2   . ASN E 2 102 ? 21.952  43.861  188.850 1.00 39.42  ? 103  ASN A ND2   1 
ATOM   1868  N  N     . LEU E 2 103 ? 18.444  41.593  186.286 1.00 22.37  ? 104  LEU A N     1 
ATOM   1869  C  CA    . LEU E 2 103 ? 17.519  40.751  187.035 1.00 22.40  ? 104  LEU A CA    1 
ATOM   1870  C  C     . LEU E 2 103 ? 18.141  39.945  188.146 1.00 31.80  ? 104  LEU A C     1 
ATOM   1871  O  O     . LEU E 2 103 ? 19.345  40.023  188.414 1.00 42.05  ? 104  LEU A O     1 
ATOM   1872  C  CB    . LEU E 2 103 ? 16.800  39.798  186.092 1.00 21.92  ? 104  LEU A CB    1 
ATOM   1873  C  CG    . LEU E 2 103 ? 15.867  40.447  185.046 1.00 31.74  ? 104  LEU A CG    1 
ATOM   1874  C  CD1   . LEU E 2 103 ? 15.369  39.373  184.097 1.00 13.34  ? 104  LEU A CD1   1 
ATOM   1875  C  CD2   . LEU E 2 103 ? 14.699  41.154  185.729 1.00 19.38  ? 104  LEU A CD2   1 
ATOM   1876  N  N     . PHE E 2 104 ? 17.301  39.164  188.808 1.00 31.92  ? 105  PHE A N     1 
ATOM   1877  C  CA    . PHE E 2 104 ? 17.756  38.315  189.897 1.00 38.31  ? 105  PHE A CA    1 
ATOM   1878  C  C     . PHE E 2 104 ? 18.028  36.919  189.360 1.00 41.66  ? 105  PHE A C     1 
ATOM   1879  O  O     . PHE E 2 104 ? 17.274  36.405  188.534 1.00 42.40  ? 105  PHE A O     1 
ATOM   1880  C  CB    . PHE E 2 104 ? 16.690  38.257  190.992 1.00 41.90  ? 105  PHE A CB    1 
ATOM   1881  C  CG    . PHE E 2 104 ? 16.803  39.352  192.010 1.00 47.79  ? 105  PHE A CG    1 
ATOM   1882  C  CD1   . PHE E 2 104 ? 15.664  39.911  192.574 1.00 46.33  ? 105  PHE A CD1   1 
ATOM   1883  C  CD2   . PHE E 2 104 ? 18.049  39.790  192.443 1.00 49.30  ? 105  PHE A CD2   1 
ATOM   1884  C  CE1   . PHE E 2 104 ? 15.758  40.889  193.557 1.00 38.69  ? 105  PHE A CE1   1 
ATOM   1885  C  CE2   . PHE E 2 104 ? 18.155  40.762  193.423 1.00 47.29  ? 105  PHE A CE2   1 
ATOM   1886  C  CZ    . PHE E 2 104 ? 17.006  41.314  193.983 1.00 49.18  ? 105  PHE A CZ    1 
ATOM   1887  N  N     . GLU E 2 105 ? 19.114  36.314  189.823 1.00 36.86  ? 106  GLU A N     1 
ATOM   1888  C  CA    . GLU E 2 105 ? 19.475  34.973  189.387 1.00 35.91  ? 106  GLU A CA    1 
ATOM   1889  C  C     . GLU E 2 105 ? 19.344  34.032  190.558 1.00 36.88  ? 106  GLU A C     1 
ATOM   1890  O  O     . GLU E 2 105 ? 19.189  34.478  191.695 1.00 35.95  ? 106  GLU A O     1 
ATOM   1891  C  CB    . GLU E 2 105 ? 20.904  34.963  188.861 1.00 46.01  ? 106  GLU A CB    1 
ATOM   1892  C  CG    . GLU E 2 105 ? 21.086  35.814  187.616 1.00 54.02  ? 106  GLU A CG    1 
ATOM   1893  C  CD    . GLU E 2 105 ? 22.539  36.106  187.327 1.00 55.61  ? 106  GLU A CD    1 
ATOM   1894  O  OE1   . GLU E 2 105 ? 22.812  36.770  186.302 1.00 55.26  ? 106  GLU A OE1   1 
ATOM   1895  O  OE2   . GLU E 2 105 ? 23.400  35.675  188.130 1.00 55.06  ? 106  GLU A OE2   1 
ATOM   1896  N  N     . GLU E 2 106 ? 19.381  32.732  190.291 1.00 33.45  ? 107  GLU A N     1 
ATOM   1897  C  CA    . GLU E 2 106 ? 19.263  31.758  191.368 1.00 33.89  ? 107  GLU A CA    1 
ATOM   1898  C  C     . GLU E 2 106 ? 20.433  31.969  192.322 1.00 30.47  ? 107  GLU A C     1 
ATOM   1899  O  O     . GLU E 2 106 ? 21.574  32.094  191.884 1.00 32.59  ? 107  GLU A O     1 
ATOM   1900  C  CB    . GLU E 2 106 ? 19.280  30.340  190.801 1.00 46.05  ? 107  GLU A CB    1 
ATOM   1901  C  CG    . GLU E 2 106 ? 18.872  29.256  191.794 1.00 50.38  ? 107  GLU A CG    1 
ATOM   1902  C  CD    . GLU E 2 106 ? 18.455  27.971  191.095 1.00 60.86  ? 107  GLU A CD    1 
ATOM   1903  O  OE1   . GLU E 2 106 ? 18.102  26.994  191.795 1.00 66.01  ? 107  GLU A OE1   1 
ATOM   1904  O  OE2   . GLU E 2 106 ? 18.478  27.947  189.839 1.00 65.68  ? 107  GLU A OE2   1 
ATOM   1905  N  N     . LYS E 2 107 ? 20.131  32.023  193.618 1.00 27.05  ? 108  LYS A N     1 
ATOM   1906  C  CA    . LYS E 2 107 ? 21.129  32.249  194.665 1.00 26.87  ? 108  LYS A CA    1 
ATOM   1907  C  C     . LYS E 2 107 ? 21.180  31.054  195.621 1.00 27.52  ? 108  LYS A C     1 
ATOM   1908  O  O     . LYS E 2 107 ? 20.198  30.746  196.279 1.00 28.64  ? 108  LYS A O     1 
ATOM   1909  C  CB    . LYS E 2 107 ? 20.797  33.535  195.449 1.00 19.49  ? 108  LYS A CB    1 
ATOM   1910  C  CG    . LYS E 2 107 ? 21.803  33.935  196.531 1.00 34.85  ? 108  LYS A CG    1 
ATOM   1911  C  CD    . LYS E 2 107 ? 21.311  35.133  197.338 1.00 37.73  ? 108  LYS A CD    1 
ATOM   1912  C  CE    . LYS E 2 107 ? 22.250  35.510  198.485 1.00 27.87  ? 108  LYS A CE    1 
ATOM   1913  N  NZ    . LYS E 2 107 ? 23.481  36.149  198.013 1.00 16.26  ? 108  LYS A NZ    1 
ATOM   1914  N  N     . GLN E 2 108 ? 22.337  30.393  195.685 1.00 32.17  ? 109  GLN A N     1 
ATOM   1915  C  CA    . GLN E 2 108 ? 22.557  29.215  196.528 1.00 29.86  ? 109  GLN A CA    1 
ATOM   1916  C  C     . GLN E 2 108 ? 21.977  29.319  197.937 1.00 31.18  ? 109  GLN A C     1 
ATOM   1917  O  O     . GLN E 2 108 ? 21.671  28.313  198.584 1.00 40.63  ? 109  GLN A O     1 
ATOM   1918  C  CB    . GLN E 2 108 ? 24.058  28.941  196.619 1.00 26.57  ? 109  GLN A CB    1 
ATOM   1919  C  CG    . GLN E 2 108 ? 24.425  27.641  197.326 1.00 46.47  ? 109  GLN A CG    1 
ATOM   1920  C  CD    . GLN E 2 108 ? 25.929  27.479  197.556 1.00 47.33  ? 109  GLN A CD    1 
ATOM   1921  O  OE1   . GLN E 2 108 ? 26.364  26.580  198.276 1.00 58.33  ? 109  GLN A OE1   1 
ATOM   1922  N  NE2   . GLN E 2 108 ? 26.721  28.345  196.945 1.00 45.81  ? 109  GLN A NE2   1 
ATOM   1923  N  N     . ASN E 2 109 ? 21.819  30.550  198.393 1.00 28.71  ? 110  ASN A N     1 
ATOM   1924  C  CA    . ASN E 2 109 ? 21.330  30.873  199.725 1.00 24.23  ? 110  ASN A CA    1 
ATOM   1925  C  C     . ASN E 2 109 ? 19.796  30.850  199.863 1.00 26.63  ? 110  ASN A C     1 
ATOM   1926  O  O     . ASN E 2 109 ? 19.253  30.738  200.959 1.00 22.52  ? 110  ASN A O     1 
ATOM   1927  C  CB    . ASN E 2 109 ? 21.854  32.269  200.057 1.00 25.51  ? 110  ASN A CB    1 
ATOM   1928  C  CG    . ASN E 2 109 ? 22.165  32.438  201.503 1.00 37.01  ? 110  ASN A CG    1 
ATOM   1929  O  OD1   . ASN E 2 109 ? 22.337  31.456  202.224 1.00 59.92  ? 110  ASN A OD1   1 
ATOM   1930  N  ND2   . ASN E 2 109 ? 22.270  33.683  201.944 1.00 34.61  ? 110  ASN A ND2   1 
ATOM   1931  N  N     . ASP E 2 110 ? 19.112  30.982  198.736 1.00 15.31  ? 111  ASP A N     1 
ATOM   1932  C  CA    . ASP E 2 110 ? 17.669  31.008  198.690 1.00 6.52   ? 111  ASP A CA    1 
ATOM   1933  C  C     . ASP E 2 110 ? 16.967  29.980  199.561 1.00 29.92  ? 111  ASP A C     1 
ATOM   1934  O  O     . ASP E 2 110 ? 17.264  28.779  199.509 1.00 35.80  ? 111  ASP A O     1 
ATOM   1935  C  CB    . ASP E 2 110 ? 17.221  30.875  197.246 1.00 10.28  ? 111  ASP A CB    1 
ATOM   1936  C  CG    . ASP E 2 110 ? 17.432  32.160  196.465 1.00 25.28  ? 111  ASP A CG    1 
ATOM   1937  O  OD1   . ASP E 2 110 ? 17.489  33.228  197.127 1.00 17.96  ? 111  ASP A OD1   1 
ATOM   1938  O  OD2   . ASP E 2 110 ? 17.521  32.106  195.211 1.00 26.03  ? 111  ASP A OD2   1 
ATOM   1939  N  N     . THR E 2 111 ? 16.015  30.461  200.355 1.00 29.32  ? 112  THR A N     1 
ATOM   1940  C  CA    . THR E 2 111 ? 15.270  29.595  201.257 1.00 28.73  ? 112  THR A CA    1 
ATOM   1941  C  C     . THR E 2 111 ? 14.529  28.429  200.605 1.00 27.79  ? 112  THR A C     1 
ATOM   1942  O  O     . THR E 2 111 ? 14.682  27.272  201.012 1.00 20.72  ? 112  THR A O     1 
ATOM   1943  C  CB    . THR E 2 111 ? 14.252  30.399  202.074 1.00 30.96  ? 112  THR A CB    1 
ATOM   1944  O  OG1   . THR E 2 111 ? 14.940  31.380  202.859 1.00 38.37  ? 112  THR A OG1   1 
ATOM   1945  C  CG2   . THR E 2 111 ? 13.469  29.469  203.001 1.00 15.82  ? 112  THR A CG2   1 
ATOM   1946  N  N     . ALA E 2 112 ? 13.722  28.741  199.599 1.00 27.55  ? 113  ALA A N     1 
ATOM   1947  C  CA    . ALA E 2 112 ? 12.925  27.735  198.909 1.00 33.94  ? 113  ALA A CA    1 
ATOM   1948  C  C     . ALA E 2 112 ? 13.416  27.410  197.504 1.00 39.56  ? 113  ALA A C     1 
ATOM   1949  O  O     . ALA E 2 112 ? 13.973  28.267  196.821 1.00 45.19  ? 113  ALA A O     1 
ATOM   1950  C  CB    . ALA E 2 112 ? 11.477  28.208  198.845 1.00 38.41  ? 113  ALA A CB    1 
ATOM   1951  N  N     . ASP E 2 113 ? 13.209  26.164  197.081 1.00 35.68  ? 114  ASP A N     1 
ATOM   1952  C  CA    . ASP E 2 113 ? 13.589  25.726  195.740 1.00 31.56  ? 114  ASP A CA    1 
ATOM   1953  C  C     . ASP E 2 113 ? 12.528  26.253  194.798 1.00 27.93  ? 114  ASP A C     1 
ATOM   1954  O  O     . ASP E 2 113 ? 12.833  26.906  193.807 1.00 37.21  ? 114  ASP A O     1 
ATOM   1955  C  CB    . ASP E 2 113 ? 13.594  24.198  195.630 1.00 33.11  ? 114  ASP A CB    1 
ATOM   1956  C  CG    . ASP E 2 113 ? 14.728  23.553  196.390 1.00 44.15  ? 114  ASP A CG    1 
ATOM   1957  O  OD1   . ASP E 2 113 ? 14.608  22.331  196.682 1.00 30.30  ? 114  ASP A OD1   1 
ATOM   1958  O  OD2   . ASP E 2 113 ? 15.729  24.260  196.680 1.00 38.93  ? 114  ASP A OD2   1 
ATOM   1959  N  N     . ILE E 2 114 ? 11.275  25.938  195.109 1.00 31.62  ? 115  ILE A N     1 
ATOM   1960  C  CA    . ILE E 2 114 ? 10.155  26.389  194.295 1.00 26.68  ? 115  ILE A CA    1 
ATOM   1961  C  C     . ILE E 2 114 ? 9.066   27.029  195.133 1.00 24.99  ? 115  ILE A C     1 
ATOM   1962  O  O     . ILE E 2 114 ? 8.754   26.575  196.234 1.00 19.87  ? 115  ILE A O     1 
ATOM   1963  C  CB    . ILE E 2 114 ? 9.483   25.249  193.538 1.00 23.42  ? 115  ILE A CB    1 
ATOM   1964  C  CG1   . ILE E 2 114 ? 10.524  24.295  192.956 1.00 22.10  ? 115  ILE A CG1   1 
ATOM   1965  C  CG2   . ILE E 2 114 ? 8.622   25.841  192.432 1.00 27.47  ? 115  ILE A CG2   1 
ATOM   1966  C  CD1   . ILE E 2 114 ? 9.907   23.012  192.400 1.00 16.29  ? 115  ILE A CD1   1 
ATOM   1967  N  N     . LEU E 2 115 ? 8.480   28.084  194.586 1.00 32.88  ? 116  LEU A N     1 
ATOM   1968  C  CA    . LEU E 2 115 ? 7.395   28.800  195.243 1.00 32.39  ? 116  LEU A CA    1 
ATOM   1969  C  C     . LEU E 2 115 ? 6.045   28.495  194.593 1.00 34.80  ? 116  LEU A C     1 
ATOM   1970  O  O     . LEU E 2 115 ? 5.922   28.478  193.368 1.00 30.04  ? 116  LEU A O     1 
ATOM   1971  C  CB    . LEU E 2 115 ? 7.644   30.311  195.176 1.00 30.36  ? 116  LEU A CB    1 
ATOM   1972  C  CG    . LEU E 2 115 ? 8.369   31.032  196.321 1.00 33.37  ? 116  LEU A CG    1 
ATOM   1973  C  CD1   . LEU E 2 115 ? 8.166   32.559  196.174 1.00 17.77  ? 116  LEU A CD1   1 
ATOM   1974  C  CD2   . LEU E 2 115 ? 7.802   30.580  197.653 1.00 31.07  ? 116  LEU A CD2   1 
ATOM   1975  N  N     . LEU E 2 116 ? 5.035   28.237  195.415 1.00 34.18  ? 117  LEU A N     1 
ATOM   1976  C  CA    . LEU E 2 116 ? 3.683   27.992  194.906 1.00 33.67  ? 117  LEU A CA    1 
ATOM   1977  C  C     . LEU E 2 116 ? 2.779   28.995  195.637 1.00 38.28  ? 117  LEU A C     1 
ATOM   1978  O  O     . LEU E 2 116 ? 2.576   28.895  196.858 1.00 35.13  ? 117  LEU A O     1 
ATOM   1979  C  CB    . LEU E 2 116 ? 3.253   26.534  195.167 1.00 31.58  ? 117  LEU A CB    1 
ATOM   1980  C  CG    . LEU E 2 116 ? 3.973   25.413  194.381 1.00 30.54  ? 117  LEU A CG    1 
ATOM   1981  C  CD1   . LEU E 2 116 ? 3.340   24.069  194.701 1.00 10.52  ? 117  LEU A CD1   1 
ATOM   1982  C  CD2   . LEU E 2 116 ? 3.872   25.667  192.870 1.00 18.49  ? 117  LEU A CD2   1 
ATOM   1983  N  N     . VAL E 2 117 ? 2.275   29.977  194.887 1.00 30.34  ? 118  VAL A N     1 
ATOM   1984  C  CA    . VAL E 2 117 ? 1.425   31.038  195.440 1.00 38.37  ? 118  VAL A CA    1 
ATOM   1985  C  C     . VAL E 2 117 ? 0.015   31.102  194.843 1.00 38.55  ? 118  VAL A C     1 
ATOM   1986  O  O     . VAL E 2 117 ? -0.191  30.858  193.651 1.00 33.35  ? 118  VAL A O     1 
ATOM   1987  C  CB    . VAL E 2 117 ? 2.092   32.432  195.264 1.00 41.14  ? 118  VAL A CB    1 
ATOM   1988  C  CG1   . VAL E 2 117 ? 3.576   32.342  195.613 1.00 50.83  ? 118  VAL A CG1   1 
ATOM   1989  C  CG2   . VAL E 2 117 ? 1.917   32.945  193.843 1.00 43.02  ? 118  VAL A CG2   1 
ATOM   1990  N  N     . LYS E 2 118 ? -0.953  31.439  195.685 1.00 38.73  ? 119  LYS A N     1 
ATOM   1991  C  CA    . LYS E 2 118 ? -2.334  31.526  195.253 1.00 44.12  ? 119  LYS A CA    1 
ATOM   1992  C  C     . LYS E 2 118 ? -3.207  31.995  196.393 1.00 52.25  ? 119  LYS A C     1 
ATOM   1993  O  O     . LYS E 2 118 ? -3.074  31.522  197.524 1.00 48.61  ? 119  LYS A O     1 
ATOM   1994  C  CB    . LYS E 2 118 ? -2.829  30.162  194.787 1.00 50.13  ? 119  LYS A CB    1 
ATOM   1995  C  CG    . LYS E 2 118 ? -4.158  30.183  194.071 1.00 57.23  ? 119  LYS A CG    1 
ATOM   1996  C  CD    . LYS E 2 118 ? -4.621  28.764  193.817 1.00 66.23  ? 119  LYS A CD    1 
ATOM   1997  C  CE    . LYS E 2 118 ? -5.799  28.683  192.866 1.00 61.28  ? 119  LYS A CE    1 
ATOM   1998  N  NZ    . LYS E 2 118 ? -6.063  27.244  192.574 1.00 48.49  ? 119  LYS A NZ    1 
ATOM   1999  N  N     . ASP E 2 119 ? -4.103  32.925  196.081 1.00 58.54  ? 120  ASP A N     1 
ATOM   2000  C  CA    . ASP E 2 119 ? -5.027  33.472  197.059 1.00 59.11  ? 120  ASP A CA    1 
ATOM   2001  C  C     . ASP E 2 119 ? -4.302  34.083  198.262 1.00 61.54  ? 120  ASP A C     1 
ATOM   2002  O  O     . ASP E 2 119 ? -4.782  33.989  199.395 1.00 71.97  ? 120  ASP A O     1 
ATOM   2003  C  CB    . ASP E 2 119 ? -6.002  32.377  197.515 1.00 69.65  ? 120  ASP A CB    1 
ATOM   2004  C  CG    . ASP E 2 119 ? -6.901  31.873  196.376 1.00 84.72  ? 120  ASP A CG    1 
ATOM   2005  O  OD1   . ASP E 2 119 ? -7.604  30.852  196.571 1.00 84.93  ? 120  ASP A OD1   1 
ATOM   2006  O  OD2   . ASP E 2 119 ? -6.908  32.502  195.290 1.00 79.17  ? 120  ASP A OD2   1 
ATOM   2007  N  N     . GLN E 2 120 ? -3.152  34.710  198.008 1.00 52.44  ? 121  GLN A N     1 
ATOM   2008  C  CA    . GLN E 2 120 ? -2.358  35.361  199.054 1.00 54.53  ? 121  GLN A CA    1 
ATOM   2009  C  C     . GLN E 2 120 ? -1.804  34.329  200.028 1.00 51.81  ? 121  GLN A C     1 
ATOM   2010  O  O     . GLN E 2 120 ? -1.677  34.578  201.231 1.00 55.34  ? 121  GLN A O     1 
ATOM   2011  C  CB    . GLN E 2 120 ? -3.217  36.377  199.820 1.00 60.28  ? 121  GLN A CB    1 
ATOM   2012  C  CG    . GLN E 2 120 ? -2.442  37.419  200.642 1.00 60.81  ? 121  GLN A CG    1 
ATOM   2013  C  CD    . GLN E 2 120 ? -2.428  38.792  199.977 1.00 62.44  ? 121  GLN A CD    1 
ATOM   2014  O  OE1   . GLN E 2 120 ? -2.070  39.797  200.600 1.00 64.53  ? 121  GLN A OE1   1 
ATOM   2015  N  NE2   . GLN E 2 120 ? -2.821  38.838  198.704 1.00 54.98  ? 121  GLN A NE2   1 
ATOM   2016  N  N     . PHE E 2 121 ? -1.493  33.154  199.505 1.00 48.88  ? 122  PHE A N     1 
ATOM   2017  C  CA    . PHE E 2 121 ? -0.944  32.091  200.327 1.00 48.67  ? 122  PHE A CA    1 
ATOM   2018  C  C     . PHE E 2 121 ? 0.269   31.497  199.622 1.00 46.50  ? 122  PHE A C     1 
ATOM   2019  O  O     . PHE E 2 121 ? 0.198   31.125  198.447 1.00 42.87  ? 122  PHE A O     1 
ATOM   2020  C  CB    . PHE E 2 121 ? -1.987  31.013  200.555 1.00 44.77  ? 122  PHE A CB    1 
ATOM   2021  C  CG    . PHE E 2 121 ? -1.691  30.156  201.728 1.00 48.89  ? 122  PHE A CG    1 
ATOM   2022  C  CD1   . PHE E 2 121 ? -1.939  30.623  203.012 1.00 33.69  ? 122  PHE A CD1   1 
ATOM   2023  C  CD2   . PHE E 2 121 ? -1.107  28.905  201.561 1.00 50.59  ? 122  PHE A CD2   1 
ATOM   2024  C  CE1   . PHE E 2 121 ? -1.608  29.862  204.111 1.00 42.18  ? 122  PHE A CE1   1 
ATOM   2025  C  CE2   . PHE E 2 121 ? -0.768  28.128  202.659 1.00 45.20  ? 122  PHE A CE2   1 
ATOM   2026  C  CZ    . PHE E 2 121 ? -1.018  28.605  203.937 1.00 47.46  ? 122  PHE A CZ    1 
ATOM   2027  N  N     . TYR E 2 122 ? 1.378   31.388  200.340 1.00 45.06  ? 123  TYR A N     1 
ATOM   2028  C  CA    . TYR E 2 122 ? 2.595   30.872  199.728 1.00 46.77  ? 123  TYR A CA    1 
ATOM   2029  C  C     . TYR E 2 122 ? 3.016   29.509  200.239 1.00 45.88  ? 123  TYR A C     1 
ATOM   2030  O  O     . TYR E 2 122 ? 2.897   29.213  201.425 1.00 51.62  ? 123  TYR A O     1 
ATOM   2031  C  CB    . TYR E 2 122 ? 3.743   31.860  199.945 1.00 45.37  ? 123  TYR A CB    1 
ATOM   2032  C  CG    . TYR E 2 122 ? 3.425   33.286  199.528 1.00 51.17  ? 123  TYR A CG    1 
ATOM   2033  C  CD1   . TYR E 2 122 ? 2.418   34.012  200.159 1.00 56.57  ? 123  TYR A CD1   1 
ATOM   2034  C  CD2   . TYR E 2 122 ? 4.141   33.916  198.519 1.00 48.97  ? 123  TYR A CD2   1 
ATOM   2035  C  CE1   . TYR E 2 122 ? 2.134   35.330  199.796 1.00 58.41  ? 123  TYR A CE1   1 
ATOM   2036  C  CE2   . TYR E 2 122 ? 3.862   35.237  198.150 1.00 53.98  ? 123  TYR A CE2   1 
ATOM   2037  C  CZ    . TYR E 2 122 ? 2.859   35.932  198.794 1.00 47.54  ? 123  TYR A CZ    1 
ATOM   2038  O  OH    . TYR E 2 122 ? 2.577   37.223  198.443 1.00 45.07  ? 123  TYR A OH    1 
ATOM   2039  N  N     . GLU E 2 123 ? 3.502   28.672  199.331 1.00 42.34  ? 124  GLU A N     1 
ATOM   2040  C  CA    . GLU E 2 123 ? 3.983   27.354  199.723 1.00 42.92  ? 124  GLU A CA    1 
ATOM   2041  C  C     . GLU E 2 123 ? 5.458   27.221  199.382 1.00 39.28  ? 124  GLU A C     1 
ATOM   2042  O  O     . GLU E 2 123 ? 5.811   27.075  198.209 1.00 43.62  ? 124  GLU A O     1 
ATOM   2043  C  CB    . GLU E 2 123 ? 3.232   26.246  199.000 1.00 42.30  ? 124  GLU A CB    1 
ATOM   2044  C  CG    . GLU E 2 123 ? 3.716   24.862  199.418 1.00 26.99  ? 124  GLU A CG    1 
ATOM   2045  C  CD    . GLU E 2 123 ? 3.133   23.740  198.573 1.00 28.18  ? 124  GLU A CD    1 
ATOM   2046  O  OE1   . GLU E 2 123 ? 3.228   22.572  198.999 1.00 4.37   ? 124  GLU A OE1   1 
ATOM   2047  O  OE2   . GLU E 2 123 ? 2.587   24.024  197.481 1.00 32.21  ? 124  GLU A OE2   1 
ATOM   2048  N  N     . LEU E 2 124 ? 6.316   27.282  200.397 1.00 22.62  ? 125  LEU A N     1 
ATOM   2049  C  CA    . LEU E 2 124 ? 7.755   27.131  200.179 1.00 23.46  ? 125  LEU A CA    1 
ATOM   2050  C  C     . LEU E 2 124 ? 8.130   25.663  199.998 1.00 26.04  ? 125  LEU A C     1 
ATOM   2051  O  O     . LEU E 2 124 ? 8.226   24.921  200.974 1.00 22.91  ? 125  LEU A O     1 
ATOM   2052  C  CB    . LEU E 2 124 ? 8.540   27.681  201.360 1.00 27.08  ? 125  LEU A CB    1 
ATOM   2053  C  CG    . LEU E 2 124 ? 8.914   29.156  201.352 1.00 32.62  ? 125  LEU A CG    1 
ATOM   2054  C  CD1   . LEU E 2 124 ? 7.701   30.042  201.012 1.00 23.89  ? 125  LEU A CD1   1 
ATOM   2055  C  CD2   . LEU E 2 124 ? 9.461   29.467  202.741 1.00 24.22  ? 125  LEU A CD2   1 
ATOM   2056  N  N     . LEU E 2 125 ? 8.357   25.253  198.754 1.00 24.36  ? 126  LEU A N     1 
ATOM   2057  C  CA    . LEU E 2 125 ? 8.714   23.868  198.461 1.00 25.14  ? 126  LEU A CA    1 
ATOM   2058  C  C     . LEU E 2 125 ? 10.206  23.658  198.320 1.00 29.35  ? 126  LEU A C     1 
ATOM   2059  O  O     . LEU E 2 125 ? 10.852  24.291  197.487 1.00 41.63  ? 126  LEU A O     1 
ATOM   2060  C  CB    . LEU E 2 125 ? 8.043   23.410  197.173 1.00 18.72  ? 126  LEU A CB    1 
ATOM   2061  C  CG    . LEU E 2 125 ? 8.270   21.937  196.824 1.00 16.14  ? 126  LEU A CG    1 
ATOM   2062  C  CD1   . LEU E 2 125 ? 7.725   21.052  197.908 1.00 3.49   ? 126  LEU A CD1   1 
ATOM   2063  C  CD2   . LEU E 2 125 ? 7.582   21.624  195.492 1.00 28.41  ? 126  LEU A CD2   1 
ATOM   2064  N  N     . ASP E 2 126 ? 10.750  22.762  199.134 1.00 23.90  ? 127  ASP A N     1 
ATOM   2065  C  CA    . ASP E 2 126 ? 12.175  22.448  199.088 1.00 27.30  ? 127  ASP A CA    1 
ATOM   2066  C  C     . ASP E 2 126 ? 12.323  20.960  198.793 1.00 28.96  ? 127  ASP A C     1 
ATOM   2067  O  O     . ASP E 2 126 ? 11.952  20.136  199.628 1.00 17.35  ? 127  ASP A O     1 
ATOM   2068  C  CB    . ASP E 2 126 ? 12.825  22.751  200.439 1.00 29.89  ? 127  ASP A CB    1 
ATOM   2069  C  CG    . ASP E 2 126 ? 14.334  22.608  200.409 1.00 23.62  ? 127  ASP A CG    1 
ATOM   2070  O  OD1   . ASP E 2 126 ? 14.856  21.876  199.546 1.00 12.86  ? 127  ASP A OD1   1 
ATOM   2071  O  OD2   . ASP E 2 126 ? 15.002  23.216  201.260 1.00 24.90  ? 127  ASP A OD2   1 
ATOM   2072  N  N     . VAL E 2 127 ? 12.855  20.611  197.621 1.00 24.88  ? 128  VAL A N     1 
ATOM   2073  C  CA    . VAL E 2 127 ? 13.050  19.196  197.282 1.00 27.25  ? 128  VAL A CA    1 
ATOM   2074  C  C     . VAL E 2 127 ? 14.417  18.672  197.738 1.00 24.94  ? 128  VAL A C     1 
ATOM   2075  O  O     . VAL E 2 127 ? 15.418  19.367  197.613 1.00 29.21  ? 128  VAL A O     1 
ATOM   2076  C  CB    . VAL E 2 127 ? 12.856  18.937  195.739 1.00 31.31  ? 128  VAL A CB    1 
ATOM   2077  C  CG1   . VAL E 2 127 ? 12.906  20.235  194.964 1.00 25.01  ? 128  VAL A CG1   1 
ATOM   2078  C  CG2   . VAL E 2 127 ? 13.897  17.966  195.234 1.00 9.01   ? 128  VAL A CG2   1 
ATOM   2079  N  N     . LYS E 2 128 ? 14.440  17.465  198.304 1.00 25.63  ? 129  LYS A N     1 
ATOM   2080  C  CA    . LYS E 2 128 ? 15.685  16.840  198.771 1.00 19.14  ? 129  LYS A CA    1 
ATOM   2081  C  C     . LYS E 2 128 ? 15.882  15.550  197.965 1.00 27.10  ? 129  LYS A C     1 
ATOM   2082  O  O     . LYS E 2 128 ? 15.011  14.689  197.979 1.00 43.43  ? 129  LYS A O     1 
ATOM   2083  C  CB    . LYS E 2 128 ? 15.604  16.480  200.264 1.00 15.24  ? 129  LYS A CB    1 
ATOM   2084  C  CG    . LYS E 2 128 ? 15.128  17.591  201.206 1.00 24.87  ? 129  LYS A CG    1 
ATOM   2085  C  CD    . LYS E 2 128 ? 16.033  18.825  201.182 1.00 40.39  ? 129  LYS A CD    1 
ATOM   2086  C  CE    . LYS E 2 128 ? 15.455  19.964  202.044 1.00 46.98  ? 129  LYS A CE    1 
ATOM   2087  N  NZ    . LYS E 2 128 ? 16.314  21.189  202.176 1.00 32.28  ? 129  LYS A NZ    1 
ATOM   2088  N  N     . THR E 2 129 ? 16.987  15.417  197.231 1.00 24.80  ? 130  THR A N     1 
ATOM   2089  C  CA    . THR E 2 129 ? 17.211  14.181  196.479 1.00 22.18  ? 130  THR A CA    1 
ATOM   2090  C  C     . THR E 2 129 ? 17.998  13.281  197.411 1.00 24.17  ? 130  THR A C     1 
ATOM   2091  O  O     . THR E 2 129 ? 18.783  13.771  198.209 1.00 26.19  ? 130  THR A O     1 
ATOM   2092  C  CB    . THR E 2 129 ? 18.023  14.378  195.149 1.00 25.17  ? 130  THR A CB    1 
ATOM   2093  O  OG1   . THR E 2 129 ? 19.398  14.659  195.445 1.00 12.31  ? 130  THR A OG1   1 
ATOM   2094  C  CG2   . THR E 2 129 ? 17.427  15.504  194.307 1.00 1.00   ? 130  THR A CG2   1 
ATOM   2095  N  N     . ARG E 2 130 ? 17.773  11.972  197.310 1.00 31.03  ? 131  ARG A N     1 
ATOM   2096  C  CA    . ARG E 2 130 ? 18.437  10.981  198.157 1.00 28.83  ? 131  ARG A CA    1 
ATOM   2097  C  C     . ARG E 2 130 ? 18.848  9.783   197.324 1.00 40.51  ? 131  ARG A C     1 
ATOM   2098  O  O     . ARG E 2 130 ? 18.019  9.139   196.666 1.00 45.98  ? 131  ARG A O     1 
ATOM   2099  C  CB    . ARG E 2 130 ? 17.492  10.516  199.281 1.00 21.55  ? 131  ARG A CB    1 
ATOM   2100  C  CG    . ARG E 2 130 ? 17.972  9.322   200.127 1.00 24.90  ? 131  ARG A CG    1 
ATOM   2101  C  CD    . ARG E 2 130 ? 16.912  8.869   201.156 1.00 33.03  ? 131  ARG A CD    1 
ATOM   2102  N  NE    . ARG E 2 130 ? 17.368  7.785   202.047 1.00 33.38  ? 131  ARG A NE    1 
ATOM   2103  C  CZ    . ARG E 2 130 ? 16.674  7.316   203.092 1.00 33.60  ? 131  ARG A CZ    1 
ATOM   2104  N  NH1   . ARG E 2 130 ? 15.487  7.819   203.401 1.00 34.31  ? 131  ARG A NH1   1 
ATOM   2105  N  NH2   . ARG E 2 130 ? 17.167  6.344   203.844 1.00 35.27  ? 131  ARG A NH2   1 
ATOM   2106  N  N     . ASN E 2 131 ? 20.140  9.488   197.363 1.00 45.14  ? 132  ASN A N     1 
ATOM   2107  C  CA    . ASN E 2 131 ? 20.692  8.358   196.644 1.00 45.72  ? 132  ASN A CA    1 
ATOM   2108  C  C     . ASN E 2 131 ? 20.310  7.077   197.385 1.00 49.58  ? 132  ASN A C     1 
ATOM   2109  O  O     . ASN E 2 131 ? 20.949  6.721   198.370 1.00 48.96  ? 132  ASN A O     1 
ATOM   2110  C  CB    . ASN E 2 131 ? 22.200  8.475   196.594 1.00 44.67  ? 132  ASN A CB    1 
ATOM   2111  C  CG    . ASN E 2 131 ? 22.827  7.329   195.863 1.00 52.29  ? 132  ASN A CG    1 
ATOM   2112  O  OD1   . ASN E 2 131 ? 22.493  6.168   196.112 1.00 49.94  ? 132  ASN A OD1   1 
ATOM   2113  N  ND2   . ASN E 2 131 ? 23.740  7.638   194.950 1.00 39.43  ? 132  ASN A ND2   1 
ATOM   2114  N  N     . ILE E 2 132 ? 19.282  6.388   196.893 1.00 47.35  ? 133  ILE A N     1 
ATOM   2115  C  CA    . ILE E 2 132 ? 18.781  5.161   197.504 1.00 46.40  ? 133  ILE A CA    1 
ATOM   2116  C  C     . ILE E 2 132 ? 19.764  3.991   197.452 1.00 41.11  ? 133  ILE A C     1 
ATOM   2117  O  O     . ILE E 2 132 ? 19.572  2.988   198.134 1.00 32.61  ? 133  ILE A O     1 
ATOM   2118  C  CB    . ILE E 2 132 ? 17.473  4.717   196.820 1.00 59.21  ? 133  ILE A CB    1 
ATOM   2119  C  CG1   . ILE E 2 132 ? 16.873  3.515   197.557 1.00 69.95  ? 133  ILE A CG1   1 
ATOM   2120  C  CG2   . ILE E 2 132 ? 17.751  4.337   195.363 1.00 62.99  ? 133  ILE A CG2   1 
ATOM   2121  C  CD1   . ILE E 2 132 ? 15.590  2.968   196.935 1.00 77.49  ? 133  ILE A CD1   1 
ATOM   2122  N  N     . SER E 2 133 ? 20.808  4.116   196.639 1.00 42.63  ? 134  SER A N     1 
ATOM   2123  C  CA    . SER E 2 133 ? 21.803  3.051   196.506 1.00 40.44  ? 134  SER A CA    1 
ATOM   2124  C  C     . SER E 2 133 ? 22.572  2.805   197.796 1.00 44.95  ? 134  SER A C     1 
ATOM   2125  O  O     . SER E 2 133 ? 23.288  1.813   197.926 1.00 52.36  ? 134  SER A O     1 
ATOM   2126  C  CB    . SER E 2 133 ? 22.787  3.383   195.383 1.00 39.31  ? 134  SER A CB    1 
ATOM   2127  O  OG    . SER E 2 133 ? 24.057  2.801   195.630 1.00 37.96  ? 134  SER A OG    1 
ATOM   2128  N  N     . LYS E 2 134 ? 22.427  3.708   198.754 1.00 46.26  ? 135  LYS A N     1 
ATOM   2129  C  CA    . LYS E 2 134 ? 23.130  3.561   200.017 1.00 43.18  ? 135  LYS A CA    1 
ATOM   2130  C  C     . LYS E 2 134 ? 22.294  4.055   201.174 1.00 40.93  ? 135  LYS A C     1 
ATOM   2131  O  O     . LYS E 2 134 ? 21.149  4.465   201.006 1.00 45.21  ? 135  LYS A O     1 
ATOM   2132  C  CB    . LYS E 2 134 ? 24.455  4.326   199.984 1.00 30.08  ? 135  LYS A CB    1 
ATOM   2133  C  CG    . LYS E 2 134 ? 24.325  5.777   199.558 1.00 41.60  ? 135  LYS A CG    1 
ATOM   2134  C  CD    . LYS E 2 134 ? 25.679  6.489   199.535 1.00 53.38  ? 135  LYS A CD    1 
ATOM   2135  C  CE    . LYS E 2 134 ? 26.624  5.935   198.475 1.00 43.62  ? 135  LYS A CE    1 
ATOM   2136  N  NZ    . LYS E 2 134 ? 27.918  6.649   198.504 1.00 47.34  ? 135  LYS A NZ    1 
ATOM   2137  N  N     . SER E 2 135 ? 22.871  4.001   202.362 1.00 32.96  ? 136  SER A N     1 
ATOM   2138  C  CA    . SER E 2 135 ? 22.161  4.467   203.526 1.00 43.44  ? 136  SER A CA    1 
ATOM   2139  C  C     . SER E 2 135 ? 23.041  5.494   204.196 1.00 50.98  ? 136  SER A C     1 
ATOM   2140  O  O     . SER E 2 135 ? 24.165  5.189   204.602 1.00 58.49  ? 136  SER A O     1 
ATOM   2141  C  CB    . SER E 2 135 ? 21.869  3.323   204.487 1.00 35.48  ? 136  SER A CB    1 
ATOM   2142  O  OG    . SER E 2 135 ? 21.434  3.854   205.725 1.00 35.70  ? 136  SER A OG    1 
ATOM   2143  N  N     . ALA E 2 136 ? 22.537  6.719   204.297 1.00 47.53  ? 137  ALA A N     1 
ATOM   2144  C  CA    . ALA E 2 136 ? 23.304  7.790   204.912 1.00 41.63  ? 137  ALA A CA    1 
ATOM   2145  C  C     . ALA E 2 136 ? 22.489  8.568   205.921 1.00 37.19  ? 137  ALA A C     1 
ATOM   2146  O  O     . ALA E 2 136 ? 21.286  8.361   206.055 1.00 33.46  ? 137  ALA A O     1 
ATOM   2147  C  CB    . ALA E 2 136 ? 23.839  8.725   203.847 1.00 41.19  ? 137  ALA A CB    1 
ATOM   2148  N  N     . GLN E 2 137 ? 23.169  9.467   206.626 1.00 35.51  ? 138  GLN A N     1 
ATOM   2149  C  CA    . GLN E 2 137 ? 22.547  10.302  207.636 1.00 33.49  ? 138  GLN A CA    1 
ATOM   2150  C  C     . GLN E 2 137 ? 21.475  11.189  207.015 1.00 33.87  ? 138  GLN A C     1 
ATOM   2151  O  O     . GLN E 2 137 ? 21.480  11.444  205.804 1.00 29.87  ? 138  GLN A O     1 
ATOM   2152  C  CB    . GLN E 2 137 ? 23.604  11.168  208.328 1.00 42.59  ? 138  GLN A CB    1 
ATOM   2153  C  CG    . GLN E 2 137 ? 23.051  12.071  209.426 1.00 54.56  ? 138  GLN A CG    1 
ATOM   2154  C  CD    . GLN E 2 137 ? 24.138  12.839  210.170 1.00 59.70  ? 138  GLN A CD    1 
ATOM   2155  O  OE1   . GLN E 2 137 ? 23.871  13.466  211.210 1.00 45.56  ? 138  GLN A OE1   1 
ATOM   2156  N  NE2   . GLN E 2 137 ? 25.372  12.794  209.642 1.00 49.74  ? 138  GLN A NE2   1 
ATOM   2157  N  N     . ALA E 2 138 ? 20.553  11.646  207.857 1.00 32.79  ? 139  ALA A N     1 
ATOM   2158  C  CA    . ALA E 2 138 ? 19.471  12.515  207.420 1.00 38.85  ? 139  ALA A CA    1 
ATOM   2159  C  C     . ALA E 2 138 ? 19.980  13.793  206.731 1.00 38.19  ? 139  ALA A C     1 
ATOM   2160  O  O     . ALA E 2 138 ? 20.882  14.468  207.233 1.00 46.03  ? 139  ALA A O     1 
ATOM   2161  C  CB    . ALA E 2 138 ? 18.607  12.886  208.608 1.00 38.22  ? 139  ALA A CB    1 
ATOM   2162  N  N     . PRO E 2 139 ? 19.393  14.139  205.575 1.00 25.26  ? 140  PRO A N     1 
ATOM   2163  C  CA    . PRO E 2 139 ? 19.718  15.315  204.758 1.00 13.92  ? 140  PRO A CA    1 
ATOM   2164  C  C     . PRO E 2 139 ? 19.482  16.591  205.534 1.00 21.67  ? 140  PRO A C     1 
ATOM   2165  O  O     . PRO E 2 139 ? 18.803  16.588  206.563 1.00 22.96  ? 140  PRO A O     1 
ATOM   2166  C  CB    . PRO E 2 139 ? 18.727  15.235  203.604 1.00 8.58   ? 140  PRO A CB    1 
ATOM   2167  C  CG    . PRO E 2 139 ? 18.353  13.788  203.556 1.00 29.15  ? 140  PRO A CG    1 
ATOM   2168  C  CD    . PRO E 2 139 ? 18.266  13.395  204.995 1.00 25.30  ? 140  PRO A CD    1 
ATOM   2169  N  N     . ASN E 2 140 ? 20.031  17.687  205.019 1.00 27.33  ? 141  ASN A N     1 
ATOM   2170  C  CA    . ASN E 2 140 ? 19.837  19.001  205.620 1.00 21.63  ? 141  ASN A CA    1 
ATOM   2171  C  C     . ASN E 2 140 ? 18.476  19.447  205.156 1.00 21.87  ? 141  ASN A C     1 
ATOM   2172  O  O     . ASN E 2 140 ? 18.200  19.448  203.953 1.00 29.00  ? 141  ASN A O     1 
ATOM   2173  C  CB    . ASN E 2 140 ? 20.857  20.014  205.110 1.00 24.05  ? 141  ASN A CB    1 
ATOM   2174  C  CG    . ASN E 2 140 ? 22.124  20.015  205.914 1.00 35.48  ? 141  ASN A CG    1 
ATOM   2175  O  OD1   . ASN E 2 140 ? 22.247  19.256  206.872 1.00 37.67  ? 141  ASN A OD1   1 
ATOM   2176  N  ND2   . ASN E 2 140 ? 23.085  20.877  205.535 1.00 15.40  ? 141  ASN A ND2   1 
ATOM   2177  N  N     . ILE E 2 141 ? 17.631  19.832  206.102 1.00 15.73  ? 142  ILE A N     1 
ATOM   2178  C  CA    . ILE E 2 141 ? 16.295  20.301  205.769 1.00 19.15  ? 142  ILE A CA    1 
ATOM   2179  C  C     . ILE E 2 141 ? 16.283  21.812  205.696 1.00 24.03  ? 142  ILE A C     1 
ATOM   2180  O  O     . ILE E 2 141 ? 16.120  22.391  204.623 1.00 32.64  ? 142  ILE A O     1 
ATOM   2181  C  CB    . ILE E 2 141 ? 15.279  19.881  206.814 1.00 22.92  ? 142  ILE A CB    1 
ATOM   2182  C  CG1   . ILE E 2 141 ? 15.196  18.350  206.866 1.00 25.11  ? 142  ILE A CG1   1 
ATOM   2183  C  CG2   . ILE E 2 141 ? 13.961  20.532  206.509 1.00 14.51  ? 142  ILE A CG2   1 
ATOM   2184  C  CD1   . ILE E 2 141 ? 14.965  17.695  205.516 1.00 37.48  ? 142  ILE A CD1   1 
ATOM   2185  N  N     . ILE E 2 142 ? 16.436  22.445  206.853 1.00 25.06  ? 143  ILE A N     1 
ATOM   2186  C  CA    . ILE E 2 142 ? 16.467  23.896  206.925 1.00 32.76  ? 143  ILE A CA    1 
ATOM   2187  C  C     . ILE E 2 142 ? 17.205  24.385  208.194 1.00 35.18  ? 143  ILE A C     1 
ATOM   2188  O  O     . ILE E 2 142 ? 17.306  23.663  209.196 1.00 32.01  ? 143  ILE A O     1 
ATOM   2189  C  CB    . ILE E 2 142 ? 15.029  24.476  206.866 1.00 33.07  ? 143  ILE A CB    1 
ATOM   2190  C  CG1   . ILE E 2 142 ? 15.096  25.963  206.507 1.00 28.41  ? 143  ILE A CG1   1 
ATOM   2191  C  CG2   . ILE E 2 142 ? 14.312  24.277  208.216 1.00 31.72  ? 143  ILE A CG2   1 
ATOM   2192  C  CD1   . ILE E 2 142 ? 13.745  26.626  206.414 1.00 24.34  ? 143  ILE A CD1   1 
ATOM   2193  N  N     . SER E 2 143 ? 17.735  25.606  208.144 1.00 30.41  ? 144  SER A N     1 
ATOM   2194  C  CA    . SER E 2 143 ? 18.472  26.159  209.285 1.00 31.54  ? 144  SER A CA    1 
ATOM   2195  C  C     . SER E 2 143 ? 17.579  26.355  210.498 1.00 26.56  ? 144  SER A C     1 
ATOM   2196  O  O     . SER E 2 143 ? 16.598  27.084  210.422 1.00 27.75  ? 144  SER A O     1 
ATOM   2197  C  CB    . SER E 2 143 ? 19.102  27.504  208.910 1.00 36.28  ? 144  SER A CB    1 
ATOM   2198  O  OG    . SER E 2 143 ? 19.362  28.274  210.072 1.00 24.72  ? 144  SER A OG    1 
ATOM   2199  N  N     . ALA E 2 144 ? 17.909  25.710  211.612 1.00 13.14  ? 145  ALA A N     1 
ATOM   2200  C  CA    . ALA E 2 144 ? 17.096  25.863  212.810 1.00 22.36  ? 145  ALA A CA    1 
ATOM   2201  C  C     . ALA E 2 144 ? 17.034  27.332  213.190 1.00 23.83  ? 145  ALA A C     1 
ATOM   2202  O  O     . ALA E 2 144 ? 15.998  27.843  213.624 1.00 25.47  ? 145  ALA A O     1 
ATOM   2203  C  CB    . ALA E 2 144 ? 17.675  25.061  213.962 1.00 20.68  ? 145  ALA A CB    1 
ATOM   2204  N  N     . TYR E 2 145 ? 18.156  28.009  213.010 1.00 24.83  ? 146  TYR A N     1 
ATOM   2205  C  CA    . TYR E 2 145 ? 18.255  29.422  213.324 1.00 31.93  ? 146  TYR A CA    1 
ATOM   2206  C  C     . TYR E 2 145 ? 17.292  30.218  212.442 1.00 29.18  ? 146  TYR A C     1 
ATOM   2207  O  O     . TYR E 2 145 ? 16.497  31.000  212.951 1.00 25.60  ? 146  TYR A O     1 
ATOM   2208  C  CB    . TYR E 2 145 ? 19.707  29.876  213.130 1.00 40.86  ? 146  TYR A CB    1 
ATOM   2209  C  CG    . TYR E 2 145 ? 19.958  31.319  213.449 1.00 36.35  ? 146  TYR A CG    1 
ATOM   2210  C  CD1   . TYR E 2 145 ? 19.525  31.872  214.654 1.00 43.65  ? 146  TYR A CD1   1 
ATOM   2211  C  CD2   . TYR E 2 145 ? 20.616  32.142  212.541 1.00 39.15  ? 146  TYR A CD2   1 
ATOM   2212  C  CE1   . TYR E 2 145 ? 19.735  33.214  214.946 1.00 42.60  ? 146  TYR A CE1   1 
ATOM   2213  C  CE2   . TYR E 2 145 ? 20.834  33.487  212.820 1.00 47.04  ? 146  TYR A CE2   1 
ATOM   2214  C  CZ    . TYR E 2 145 ? 20.388  34.017  214.027 1.00 42.02  ? 146  TYR A CZ    1 
ATOM   2215  O  OH    . TYR E 2 145 ? 20.593  35.348  214.310 1.00 40.83  ? 146  TYR A OH    1 
ATOM   2216  N  N     . LYS E 2 146 ? 17.346  30.011  211.128 1.00 27.41  ? 147  LYS A N     1 
ATOM   2217  C  CA    . LYS E 2 146 ? 16.428  30.719  210.244 1.00 27.27  ? 147  LYS A CA    1 
ATOM   2218  C  C     . LYS E 2 146 ? 14.975  30.346  210.549 1.00 27.53  ? 147  LYS A C     1 
ATOM   2219  O  O     . LYS E 2 146 ? 14.062  31.089  210.204 1.00 29.07  ? 147  LYS A O     1 
ATOM   2220  C  CB    . LYS E 2 146 ? 16.726  30.411  208.782 1.00 20.33  ? 147  LYS A CB    1 
ATOM   2221  C  CG    . LYS E 2 146 ? 15.634  30.898  207.851 1.00 12.03  ? 147  LYS A CG    1 
ATOM   2222  C  CD    . LYS E 2 146 ? 15.836  30.388  206.449 1.00 14.18  ? 147  LYS A CD    1 
ATOM   2223  C  CE    . LYS E 2 146 ? 17.128  30.923  205.864 1.00 10.92  ? 147  LYS A CE    1 
ATOM   2224  N  NZ    . LYS E 2 146 ? 17.050  30.848  204.397 1.00 18.68  ? 147  LYS A NZ    1 
ATOM   2225  N  N     . LEU E 2 147 ? 14.766  29.195  211.188 1.00 40.54  ? 148  LEU A N     1 
ATOM   2226  C  CA    . LEU E 2 147 ? 13.418  28.737  211.538 1.00 37.36  ? 148  LEU A CA    1 
ATOM   2227  C  C     . LEU E 2 147 ? 12.992  29.445  212.808 1.00 35.66  ? 148  LEU A C     1 
ATOM   2228  O  O     . LEU E 2 147 ? 11.835  29.822  212.958 1.00 36.58  ? 148  LEU A O     1 
ATOM   2229  C  CB    . LEU E 2 147 ? 13.384  27.222  211.790 1.00 33.08  ? 148  LEU A CB    1 
ATOM   2230  C  CG    . LEU E 2 147 ? 12.187  26.419  211.242 1.00 33.74  ? 148  LEU A CG    1 
ATOM   2231  C  CD1   . LEU E 2 147 ? 11.968  25.170  212.089 1.00 23.74  ? 148  LEU A CD1   1 
ATOM   2232  C  CD2   . LEU E 2 147 ? 10.935  27.255  211.239 1.00 26.98  ? 148  LEU A CD2   1 
ATOM   2233  N  N     . ALA E 2 148 ? 13.938  29.618  213.723 1.00 32.40  ? 149  ALA A N     1 
ATOM   2234  C  CA    . ALA E 2 148 ? 13.646  30.281  214.985 1.00 41.16  ? 149  ALA A CA    1 
ATOM   2235  C  C     . ALA E 2 148 ? 13.268  31.734  214.724 1.00 46.28  ? 149  ALA A C     1 
ATOM   2236  O  O     . ALA E 2 148 ? 12.344  32.270  215.342 1.00 40.46  ? 149  ALA A O     1 
ATOM   2237  C  CB    . ALA E 2 148 ? 14.849  30.213  215.909 1.00 39.98  ? 149  ALA A CB    1 
ATOM   2238  N  N     . GLN E 2 149 ? 13.988  32.373  213.808 1.00 39.89  ? 150  GLN A N     1 
ATOM   2239  C  CA    . GLN E 2 149 ? 13.689  33.749  213.493 1.00 37.29  ? 150  GLN A CA    1 
ATOM   2240  C  C     . GLN E 2 149 ? 12.322  33.827  212.823 1.00 36.43  ? 150  GLN A C     1 
ATOM   2241  O  O     . GLN E 2 149 ? 11.505  34.681  213.175 1.00 32.11  ? 150  GLN A O     1 
ATOM   2242  C  CB    . GLN E 2 149 ? 14.743  34.349  212.557 1.00 34.63  ? 150  GLN A CB    1 
ATOM   2243  C  CG    . GLN E 2 149 ? 16.134  34.485  213.158 1.00 45.26  ? 150  GLN A CG    1 
ATOM   2244  C  CD    . GLN E 2 149 ? 17.167  34.946  212.134 1.00 48.94  ? 150  GLN A CD    1 
ATOM   2245  O  OE1   . GLN E 2 149 ? 17.181  36.111  211.716 1.00 42.20  ? 150  GLN A OE1   1 
ATOM   2246  N  NE2   . GLN E 2 149 ? 18.025  34.021  211.708 1.00 38.36  ? 150  GLN A NE2   1 
ATOM   2247  N  N     . THR E 2 150 ? 12.065  32.927  211.875 1.00 31.63  ? 151  THR A N     1 
ATOM   2248  C  CA    . THR E 2 150 ? 10.801  32.953  211.152 1.00 37.43  ? 151  THR A CA    1 
ATOM   2249  C  C     . THR E 2 150 ? 9.613   32.818  212.094 1.00 40.22  ? 151  THR A C     1 
ATOM   2250  O  O     . THR E 2 150 ? 8.546   33.378  211.840 1.00 44.33  ? 151  THR A O     1 
ATOM   2251  C  CB    . THR E 2 150 ? 10.741  31.867  210.053 1.00 34.74  ? 151  THR A CB    1 
ATOM   2252  O  OG1   . THR E 2 150 ? 11.905  31.965  209.232 1.00 36.95  ? 151  THR A OG1   1 
ATOM   2253  C  CG2   . THR E 2 150 ? 9.532   32.087  209.155 1.00 26.60  ? 151  THR A CG2   1 
ATOM   2254  N  N     . CYS E 2 151 ? 9.810   32.086  213.185 1.00 37.92  ? 152  CYS A N     1 
ATOM   2255  C  CA    . CYS E 2 151 ? 8.770   31.917  214.186 1.00 39.82  ? 152  CYS A CA    1 
ATOM   2256  C  C     . CYS E 2 151 ? 8.588   33.229  214.952 1.00 43.91  ? 152  CYS A C     1 
ATOM   2257  O  O     . CYS E 2 151 ? 7.464   33.654  215.221 1.00 50.70  ? 152  CYS A O     1 
ATOM   2258  C  CB    . CYS E 2 151 ? 9.133   30.789  215.157 1.00 42.63  ? 152  CYS A CB    1 
ATOM   2259  S  SG    . CYS E 2 151 ? 8.897   29.142  214.472 1.00 32.91  ? 152  CYS A SG    1 
ATOM   2260  N  N     . ALA E 2 152 ? 9.695   33.874  215.306 1.00 48.30  ? 153  ALA A N     1 
ATOM   2261  C  CA    . ALA E 2 152 ? 9.628   35.145  216.021 1.00 36.69  ? 153  ALA A CA    1 
ATOM   2262  C  C     . ALA E 2 152 ? 8.847   36.136  215.161 1.00 36.23  ? 153  ALA A C     1 
ATOM   2263  O  O     . ALA E 2 152 ? 7.932   36.793  215.657 1.00 27.84  ? 153  ALA A O     1 
ATOM   2264  C  CB    . ALA E 2 152 ? 11.035  35.671  216.297 1.00 35.67  ? 153  ALA A CB    1 
ATOM   2265  N  N     . LYS E 2 153 ? 9.213   36.230  213.878 1.00 28.45  ? 154  LYS A N     1 
ATOM   2266  C  CA    . LYS E 2 153 ? 8.542   37.124  212.928 1.00 36.78  ? 154  LYS A CA    1 
ATOM   2267  C  C     . LYS E 2 153 ? 7.073   36.753  212.722 1.00 38.74  ? 154  LYS A C     1 
ATOM   2268  O  O     . LYS E 2 153 ? 6.265   37.588  212.308 1.00 34.45  ? 154  LYS A O     1 
ATOM   2269  C  CB    . LYS E 2 153 ? 9.234   37.101  211.564 1.00 39.14  ? 154  LYS A CB    1 
ATOM   2270  C  CG    . LYS E 2 153 ? 10.334  38.116  211.373 1.00 40.71  ? 154  LYS A CG    1 
ATOM   2271  C  CD    . LYS E 2 153 ? 11.501  37.868  212.284 1.00 41.93  ? 154  LYS A CD    1 
ATOM   2272  C  CE    . LYS E 2 153 ? 12.613  38.870  212.009 1.00 53.83  ? 154  LYS A CE    1 
ATOM   2273  N  NZ    . LYS E 2 153 ? 13.046  38.791  210.594 1.00 61.28  ? 154  LYS A NZ    1 
ATOM   2274  N  N     . MET E 2 154 ? 6.737   35.492  212.978 1.00 43.38  ? 155  MET A N     1 
ATOM   2275  C  CA    . MET E 2 154 ? 5.357   35.026  212.842 1.00 45.64  ? 155  MET A CA    1 
ATOM   2276  C  C     . MET E 2 154 ? 4.568   35.484  214.066 1.00 43.75  ? 155  MET A C     1 
ATOM   2277  O  O     . MET E 2 154 ? 3.490   36.074  213.946 1.00 36.49  ? 155  MET A O     1 
ATOM   2278  C  CB    . MET E 2 154 ? 5.302   33.496  212.756 1.00 48.15  ? 155  MET A CB    1 
ATOM   2279  C  CG    . MET E 2 154 ? 5.518   32.904  211.366 1.00 48.59  ? 155  MET A CG    1 
ATOM   2280  S  SD    . MET E 2 154 ? 5.570   31.084  211.444 1.00 56.55  ? 155  MET A SD    1 
ATOM   2281  C  CE    . MET E 2 154 ? 3.814   30.676  211.600 1.00 55.91  ? 155  MET A CE    1 
ATOM   2282  N  N     . ILE E 2 155 ? 5.125   35.197  215.240 1.00 39.70  ? 156  ILE A N     1 
ATOM   2283  C  CA    . ILE E 2 155 ? 4.525   35.562  216.513 1.00 38.53  ? 156  ILE A CA    1 
ATOM   2284  C  C     . ILE E 2 155 ? 4.366   37.066  216.660 1.00 42.05  ? 156  ILE A C     1 
ATOM   2285  O  O     . ILE E 2 155 ? 3.278   37.552  216.950 1.00 53.89  ? 156  ILE A O     1 
ATOM   2286  C  CB    . ILE E 2 155 ? 5.376   35.033  217.678 1.00 40.76  ? 156  ILE A CB    1 
ATOM   2287  C  CG1   . ILE E 2 155 ? 5.470   33.511  217.568 1.00 33.44  ? 156  ILE A CG1   1 
ATOM   2288  C  CG2   . ILE E 2 155 ? 4.788   35.477  219.023 1.00 24.30  ? 156  ILE A CG2   1 
ATOM   2289  C  CD1   . ILE E 2 155 ? 6.399   32.874  218.568 1.00 41.40  ? 156  ILE A CD1   1 
ATOM   2290  N  N     . ASP E 2 156 ? 5.448   37.804  216.454 1.00 45.92  ? 157  ASP A N     1 
ATOM   2291  C  CA    . ASP E 2 156 ? 5.412   39.256  216.580 1.00 43.47  ? 157  ASP A CA    1 
ATOM   2292  C  C     . ASP E 2 156 ? 4.462   39.941  215.593 1.00 49.41  ? 157  ASP A C     1 
ATOM   2293  O  O     . ASP E 2 156 ? 3.704   40.831  215.978 1.00 58.84  ? 157  ASP A O     1 
ATOM   2294  C  CB    . ASP E 2 156 ? 6.823   39.828  216.418 1.00 37.29  ? 157  ASP A CB    1 
ATOM   2295  C  CG    . ASP E 2 156 ? 7.707   39.546  217.616 1.00 47.58  ? 157  ASP A CG    1 
ATOM   2296  O  OD1   . ASP E 2 156 ? 8.941   39.698  217.495 1.00 54.55  ? 157  ASP A OD1   1 
ATOM   2297  O  OD2   . ASP E 2 156 ? 7.171   39.181  218.685 1.00 53.02  ? 157  ASP A OD2   1 
ATOM   2298  N  N     . ASN E 2 157 ? 4.507   39.534  214.327 1.00 50.34  ? 158  ASN A N     1 
ATOM   2299  C  CA    . ASN E 2 157 ? 3.667   40.125  213.288 1.00 39.43  ? 158  ASN A CA    1 
ATOM   2300  C  C     . ASN E 2 157 ? 2.293   39.472  213.195 1.00 44.10  ? 158  ASN A C     1 
ATOM   2301  O  O     . ASN E 2 157 ? 1.391   39.979  212.520 1.00 35.83  ? 158  ASN A O     1 
ATOM   2302  C  CB    . ASN E 2 157 ? 4.379   40.034  211.945 1.00 43.05  ? 158  ASN A CB    1 
ATOM   2303  C  CG    . ASN E 2 157 ? 5.391   41.133  211.758 1.00 51.88  ? 158  ASN A CG    1 
ATOM   2304  O  OD1   . ASN E 2 157 ? 5.033   42.277  211.465 1.00 55.36  ? 158  ASN A OD1   1 
ATOM   2305  N  ND2   . ASN E 2 157 ? 6.665   40.801  211.935 1.00 51.21  ? 158  ASN A ND2   1 
ATOM   2306  N  N     . LYS E 2 158 ? 2.142   38.343  213.880 1.00 45.60  ? 159  LYS A N     1 
ATOM   2307  C  CA    . LYS E 2 158 ? 0.881   37.620  213.892 1.00 43.53  ? 159  LYS A CA    1 
ATOM   2308  C  C     . LYS E 2 158 ? 0.479   37.202  212.480 1.00 41.82  ? 159  LYS A C     1 
ATOM   2309  O  O     . LYS E 2 158 ? -0.527  37.656  211.942 1.00 39.77  ? 159  LYS A O     1 
ATOM   2310  C  CB    . LYS E 2 158 ? -0.205  38.504  214.507 1.00 35.34  ? 159  LYS A CB    1 
ATOM   2311  N  N     . GLU E 2 159 ? 1.282   36.347  211.871 1.00 43.41  ? 160  GLU A N     1 
ATOM   2312  C  CA    . GLU E 2 159 ? 0.981   35.878  210.531 1.00 47.06  ? 160  GLU A CA    1 
ATOM   2313  C  C     . GLU E 2 159 ? 1.014   34.365  210.610 1.00 51.38  ? 160  GLU A C     1 
ATOM   2314  O  O     . GLU E 2 159 ? 2.078   33.754  210.547 1.00 55.68  ? 160  GLU A O     1 
ATOM   2315  C  CB    . GLU E 2 159 ? 2.031   36.375  209.540 1.00 39.23  ? 160  GLU A CB    1 
ATOM   2316  C  CG    . GLU E 2 159 ? 2.483   37.789  209.803 1.00 46.30  ? 160  GLU A CG    1 
ATOM   2317  C  CD    . GLU E 2 159 ? 3.246   38.390  208.644 1.00 54.56  ? 160  GLU A CD    1 
ATOM   2318  O  OE1   . GLU E 2 159 ? 2.601   38.753  207.639 1.00 62.90  ? 160  GLU A OE1   1 
ATOM   2319  O  OE2   . GLU E 2 159 ? 4.489   38.496  208.732 1.00 46.88  ? 160  GLU A OE2   1 
ATOM   2320  N  N     . PHE E 2 160 ? -0.154  33.757  210.758 1.00 54.99  ? 161  PHE A N     1 
ATOM   2321  C  CA    . PHE E 2 160 ? -0.213  32.313  210.873 1.00 53.56  ? 161  PHE A CA    1 
ATOM   2322  C  C     . PHE E 2 160 ? -0.957  31.654  209.726 1.00 53.24  ? 161  PHE A C     1 
ATOM   2323  O  O     . PHE E 2 160 ? -1.130  30.443  209.726 1.00 58.66  ? 161  PHE A O     1 
ATOM   2324  C  CB    . PHE E 2 160 ? -0.862  31.938  212.198 1.00 59.09  ? 161  PHE A CB    1 
ATOM   2325  C  CG    . PHE E 2 160 ? -0.310  32.695  213.375 1.00 67.27  ? 161  PHE A CG    1 
ATOM   2326  C  CD1   . PHE E 2 160 ? 1.005   32.514  213.789 1.00 74.20  ? 161  PHE A CD1   1 
ATOM   2327  C  CD2   . PHE E 2 160 ? -1.113  33.587  214.078 1.00 68.84  ? 161  PHE A CD2   1 
ATOM   2328  C  CE1   . PHE E 2 160 ? 1.507   33.213  214.890 1.00 75.47  ? 161  PHE A CE1   1 
ATOM   2329  C  CE2   . PHE E 2 160 ? -0.621  34.288  215.174 1.00 67.00  ? 161  PHE A CE2   1 
ATOM   2330  C  CZ    . PHE E 2 160 ? 0.687   34.101  215.581 1.00 72.73  ? 161  PHE A CZ    1 
ATOM   2331  N  N     . ASP E 2 161 ? -1.387  32.439  208.746 1.00 56.73  ? 162  ASP A N     1 
ATOM   2332  C  CA    . ASP E 2 161 ? -2.115  31.887  207.604 1.00 65.15  ? 162  ASP A CA    1 
ATOM   2333  C  C     . ASP E 2 161 ? -1.588  32.474  206.304 1.00 67.24  ? 162  ASP A C     1 
ATOM   2334  O  O     . ASP E 2 161 ? -2.362  32.840  205.415 1.00 72.02  ? 162  ASP A O     1 
ATOM   2335  C  CB    . ASP E 2 161 ? -3.607  32.196  207.744 1.00 71.63  ? 162  ASP A CB    1 
ATOM   2336  C  CG    . ASP E 2 161 ? -4.232  31.506  208.943 1.00 84.15  ? 162  ASP A CG    1 
ATOM   2337  O  OD1   . ASP E 2 161 ? -4.407  30.269  208.889 1.00 90.92  ? 162  ASP A OD1   1 
ATOM   2338  O  OD2   . ASP E 2 161 ? -4.539  32.197  209.942 1.00 88.29  ? 162  ASP A OD2   1 
ATOM   2339  N  N     . LEU E 2 162 ? -0.265  32.537  206.187 1.00 61.90  ? 163  LEU A N     1 
ATOM   2340  C  CA    . LEU E 2 162 ? 0.358   33.124  205.011 1.00 53.68  ? 163  LEU A CA    1 
ATOM   2341  C  C     . LEU E 2 162 ? 1.120   32.130  204.143 1.00 47.23  ? 163  LEU A C     1 
ATOM   2342  O  O     . LEU E 2 162 ? 0.933   32.073  202.920 1.00 42.51  ? 163  LEU A O     1 
ATOM   2343  C  CB    . LEU E 2 162 ? 1.312   34.244  205.458 1.00 53.99  ? 163  LEU A CB    1 
ATOM   2344  C  CG    . LEU E 2 162 ? 1.442   35.551  204.664 1.00 52.45  ? 163  LEU A CG    1 
ATOM   2345  C  CD1   . LEU E 2 162 ? 2.460   36.449  205.349 1.00 44.43  ? 163  LEU A CD1   1 
ATOM   2346  C  CD2   . LEU E 2 162 ? 1.861   35.270  203.238 1.00 42.49  ? 163  LEU A CD2   1 
ATOM   2347  N  N     . PHE E 2 163 ? 1.967   31.335  204.782 1.00 36.92  ? 164  PHE A N     1 
ATOM   2348  C  CA    . PHE E 2 163 ? 2.800   30.392  204.057 1.00 38.96  ? 164  PHE A CA    1 
ATOM   2349  C  C     . PHE E 2 163 ? 2.916   29.031  204.718 1.00 38.59  ? 164  PHE A C     1 
ATOM   2350  O  O     . PHE E 2 163 ? 2.536   28.863  205.875 1.00 43.94  ? 164  PHE A O     1 
ATOM   2351  C  CB    . PHE E 2 163 ? 4.205   30.984  203.941 1.00 38.16  ? 164  PHE A CB    1 
ATOM   2352  C  CG    . PHE E 2 163 ? 4.964   31.028  205.261 1.00 35.87  ? 164  PHE A CG    1 
ATOM   2353  C  CD1   . PHE E 2 163 ? 5.834   29.993  205.619 1.00 39.92  ? 164  PHE A CD1   1 
ATOM   2354  C  CD2   . PHE E 2 163 ? 4.809   32.099  206.142 1.00 22.36  ? 164  PHE A CD2   1 
ATOM   2355  C  CE1   . PHE E 2 163 ? 6.537   30.024  206.828 1.00 32.54  ? 164  PHE A CE1   1 
ATOM   2356  C  CE2   . PHE E 2 163 ? 5.505   32.140  207.350 1.00 30.35  ? 164  PHE A CE2   1 
ATOM   2357  C  CZ    . PHE E 2 163 ? 6.371   31.099  207.692 1.00 41.65  ? 164  PHE A CZ    1 
ATOM   2358  N  N     . ASP E 2 164 ? 3.470   28.076  203.971 1.00 38.45  ? 165  ASP A N     1 
ATOM   2359  C  CA    . ASP E 2 164 ? 3.733   26.715  204.461 1.00 39.41  ? 165  ASP A CA    1 
ATOM   2360  C  C     . ASP E 2 164 ? 5.095   26.270  203.931 1.00 37.69  ? 165  ASP A C     1 
ATOM   2361  O  O     . ASP E 2 164 ? 5.515   26.690  202.853 1.00 42.95  ? 165  ASP A O     1 
ATOM   2362  C  CB    . ASP E 2 164 ? 2.681   25.705  203.982 1.00 41.32  ? 165  ASP A CB    1 
ATOM   2363  C  CG    . ASP E 2 164 ? 1.411   25.734  204.809 1.00 44.73  ? 165  ASP A CG    1 
ATOM   2364  O  OD1   . ASP E 2 164 ? 1.496   25.799  206.057 1.00 49.58  ? 165  ASP A OD1   1 
ATOM   2365  O  OD2   . ASP E 2 164 ? 0.321   25.673  204.204 1.00 44.50  ? 165  ASP A OD2   1 
ATOM   2366  N  N     . ILE E 2 165 ? 5.777   25.425  204.695 1.00 28.72  ? 166  ILE A N     1 
ATOM   2367  C  CA    . ILE E 2 165 ? 7.073   24.891  204.297 1.00 20.47  ? 166  ILE A CA    1 
ATOM   2368  C  C     . ILE E 2 165 ? 6.931   23.378  204.117 1.00 19.20  ? 166  ILE A C     1 
ATOM   2369  O  O     . ILE E 2 165 ? 6.798   22.635  205.090 1.00 26.87  ? 166  ILE A O     1 
ATOM   2370  C  CB    . ILE E 2 165 ? 8.158   25.199  205.380 1.00 32.13  ? 166  ILE A CB    1 
ATOM   2371  C  CG1   . ILE E 2 165 ? 8.237   26.708  205.618 1.00 33.64  ? 166  ILE A CG1   1 
ATOM   2372  C  CG2   . ILE E 2 165 ? 9.542   24.741  204.915 1.00 25.07  ? 166  ILE A CG2   1 
ATOM   2373  C  CD1   . ILE E 2 165 ? 9.127   27.099  206.783 1.00 32.63  ? 166  ILE A CD1   1 
ATOM   2374  N  N     . ASN E 2 166 ? 6.944   22.922  202.870 1.00 19.63  ? 167  ASN A N     1 
ATOM   2375  C  CA    . ASN E 2 166 ? 6.815   21.496  202.589 1.00 29.18  ? 167  ASN A CA    1 
ATOM   2376  C  C     . ASN E 2 166 ? 8.021   20.927  201.805 1.00 30.48  ? 167  ASN A C     1 
ATOM   2377  O  O     . ASN E 2 166 ? 8.639   21.619  200.996 1.00 22.55  ? 167  ASN A O     1 
ATOM   2378  C  CB    . ASN E 2 166 ? 5.521   21.225  201.799 1.00 32.22  ? 167  ASN A CB    1 
ATOM   2379  C  CG    . ASN E 2 166 ? 4.277   21.842  202.449 1.00 28.44  ? 167  ASN A CG    1 
ATOM   2380  O  OD1   . ASN E 2 166 ? 4.144   21.892  203.678 1.00 25.31  ? 167  ASN A OD1   1 
ATOM   2381  N  ND2   . ASN E 2 166 ? 3.351   22.284  201.618 1.00 8.57   ? 167  ASN A ND2   1 
ATOM   2382  N  N     . TYR E 2 167 ? 8.310   19.647  202.033 1.00 27.68  ? 168  TYR A N     1 
ATOM   2383  C  CA    . TYR E 2 167 ? 9.433   18.968  201.415 1.00 22.67  ? 168  TYR A CA    1 
ATOM   2384  C  C     . TYR E 2 167 ? 9.057   17.789  200.535 1.00 27.89  ? 168  TYR A C     1 
ATOM   2385  O  O     . TYR E 2 167 ? 8.114   17.060  200.826 1.00 42.92  ? 168  TYR A O     1 
ATOM   2386  C  CB    . TYR E 2 167 ? 10.392  18.513  202.521 1.00 21.84  ? 168  TYR A CB    1 
ATOM   2387  C  CG    . TYR E 2 167 ? 10.945  19.694  203.295 1.00 30.32  ? 168  TYR A CG    1 
ATOM   2388  C  CD1   . TYR E 2 167 ? 12.081  20.372  202.859 1.00 27.59  ? 168  TYR A CD1   1 
ATOM   2389  C  CD2   . TYR E 2 167 ? 10.287  20.184  204.416 1.00 21.97  ? 168  TYR A CD2   1 
ATOM   2390  C  CE1   . TYR E 2 167 ? 12.543  21.502  203.521 1.00 24.66  ? 168  TYR A CE1   1 
ATOM   2391  C  CE2   . TYR E 2 167 ? 10.741  21.313  205.078 1.00 21.42  ? 168  TYR A CE2   1 
ATOM   2392  C  CZ    . TYR E 2 167 ? 11.866  21.965  204.625 1.00 24.88  ? 168  TYR A CZ    1 
ATOM   2393  O  OH    . TYR E 2 167 ? 12.311  23.081  205.288 1.00 34.16  ? 168  TYR A OH    1 
ATOM   2394  N  N     . LEU E 2 168 ? 9.813   17.607  199.458 1.00 29.91  ? 169  LEU A N     1 
ATOM   2395  C  CA    . LEU E 2 168 ? 9.598   16.524  198.505 1.00 26.19  ? 169  LEU A CA    1 
ATOM   2396  C  C     . LEU E 2 168 ? 10.893  15.747  198.295 1.00 29.70  ? 169  LEU A C     1 
ATOM   2397  O  O     . LEU E 2 168 ? 11.794  16.205  197.586 1.00 34.21  ? 169  LEU A O     1 
ATOM   2398  C  CB    . LEU E 2 168 ? 9.131   17.093  197.161 1.00 24.85  ? 169  LEU A CB    1 
ATOM   2399  C  CG    . LEU E 2 168 ? 9.056   16.135  195.966 1.00 25.49  ? 169  LEU A CG    1 
ATOM   2400  C  CD1   . LEU E 2 168 ? 8.205   14.910  196.342 1.00 25.79  ? 169  LEU A CD1   1 
ATOM   2401  C  CD2   . LEU E 2 168 ? 8.455   16.851  194.766 1.00 23.60  ? 169  LEU A CD2   1 
ATOM   2402  N  N     . GLU E 2 169 ? 10.971  14.566  198.905 1.00 29.28  ? 170  GLU A N     1 
ATOM   2403  C  CA    . GLU E 2 169 ? 12.149  13.701  198.805 1.00 21.81  ? 170  GLU A CA    1 
ATOM   2404  C  C     . GLU E 2 169 ? 12.155  12.912  197.502 1.00 16.46  ? 170  GLU A C     1 
ATOM   2405  O  O     . GLU E 2 169 ? 11.200  12.212  197.202 1.00 24.08  ? 170  GLU A O     1 
ATOM   2406  C  CB    . GLU E 2 169 ? 12.180  12.715  199.982 1.00 13.60  ? 170  GLU A CB    1 
ATOM   2407  C  CG    . GLU E 2 169 ? 13.325  11.709  199.906 1.00 24.00  ? 170  GLU A CG    1 
ATOM   2408  C  CD    . GLU E 2 169 ? 13.369  10.762  201.103 1.00 39.35  ? 170  GLU A CD    1 
ATOM   2409  O  OE1   . GLU E 2 169 ? 13.021  11.195  202.229 1.00 54.10  ? 170  GLU A OE1   1 
ATOM   2410  O  OE2   . GLU E 2 169 ? 13.770  9.589   200.927 1.00 36.88  ? 170  GLU A OE2   1 
ATOM   2411  N  N     . VAL E 2 170 ? 13.218  13.031  196.721 1.00 15.80  ? 171  VAL A N     1 
ATOM   2412  C  CA    . VAL E 2 170 ? 13.292  12.265  195.483 1.00 21.38  ? 171  VAL A CA    1 
ATOM   2413  C  C     . VAL E 2 170 ? 14.416  11.235  195.510 1.00 24.94  ? 171  VAL A C     1 
ATOM   2414  O  O     . VAL E 2 170 ? 15.577  11.585  195.339 1.00 24.18  ? 171  VAL A O     1 
ATOM   2415  C  CB    . VAL E 2 170 ? 13.490  13.150  194.258 1.00 18.13  ? 171  VAL A CB    1 
ATOM   2416  C  CG1   . VAL E 2 170 ? 13.937  12.310  193.096 1.00 13.80  ? 171  VAL A CG1   1 
ATOM   2417  C  CG2   . VAL E 2 170 ? 12.198  13.857  193.906 1.00 16.81  ? 171  VAL A CG2   1 
ATOM   2418  N  N     . ASP E 2 171 ? 14.033  9.970   195.721 1.00 30.32  ? 172  ASP A N     1 
ATOM   2419  C  CA    . ASP E 2 171 ? 14.930  8.810   195.770 1.00 27.40  ? 172  ASP A CA    1 
ATOM   2420  C  C     . ASP E 2 171 ? 15.415  8.401   194.400 1.00 34.60  ? 172  ASP A C     1 
ATOM   2421  O  O     . ASP E 2 171 ? 14.613  8.135   193.506 1.00 37.56  ? 172  ASP A O     1 
ATOM   2422  C  CB    . ASP E 2 171 ? 14.218  7.619   196.370 1.00 21.20  ? 172  ASP A CB    1 
ATOM   2423  C  CG    . ASP E 2 171 ? 13.716  7.902   197.745 1.00 40.26  ? 172  ASP A CG    1 
ATOM   2424  O  OD1   . ASP E 2 171 ? 14.314  8.783   198.399 1.00 43.17  ? 172  ASP A OD1   1 
ATOM   2425  O  OD2   . ASP E 2 171 ? 12.744  7.245   198.176 1.00 48.37  ? 172  ASP A OD2   1 
ATOM   2426  N  N     . TRP E 2 172 ? 16.726  8.291   194.244 1.00 33.13  ? 173  TRP A N     1 
ATOM   2427  C  CA    . TRP E 2 172 ? 17.276  7.929   192.948 1.00 37.43  ? 173  TRP A CA    1 
ATOM   2428  C  C     . TRP E 2 172 ? 18.421  6.956   193.086 1.00 42.75  ? 173  TRP A C     1 
ATOM   2429  O  O     . TRP E 2 172 ? 19.008  6.822   194.156 1.00 55.23  ? 173  TRP A O     1 
ATOM   2430  C  CB    . TRP E 2 172 ? 17.803  9.169   192.266 1.00 36.85  ? 173  TRP A CB    1 
ATOM   2431  C  CG    . TRP E 2 172 ? 18.948  9.765   193.036 1.00 46.25  ? 173  TRP A CG    1 
ATOM   2432  C  CD1   . TRP E 2 172 ? 18.871  10.606  194.111 1.00 40.35  ? 173  TRP A CD1   1 
ATOM   2433  C  CD2   . TRP E 2 172 ? 20.346  9.544   192.802 1.00 43.00  ? 173  TRP A CD2   1 
ATOM   2434  N  NE1   . TRP E 2 172 ? 20.130  10.922  194.555 1.00 39.47  ? 173  TRP A NE1   1 
ATOM   2435  C  CE2   . TRP E 2 172 ? 21.052  10.282  193.769 1.00 44.95  ? 173  TRP A CE2   1 
ATOM   2436  C  CE3   . TRP E 2 172 ? 21.068  8.786   191.874 1.00 32.10  ? 173  TRP A CE3   1 
ATOM   2437  C  CZ2   . TRP E 2 172 ? 22.447  10.296  193.822 1.00 50.20  ? 173  TRP A CZ2   1 
ATOM   2438  C  CZ3   . TRP E 2 172 ? 22.454  8.799   191.929 1.00 25.39  ? 173  TRP A CZ3   1 
ATOM   2439  C  CH2   . TRP E 2 172 ? 23.126  9.544   192.893 1.00 37.92  ? 173  TRP A CH2   1 
ATOM   2440  N  N     . GLU E 2 173 ? 18.762  6.288   191.996 1.00 39.37  ? 174  GLU A N     1 
ATOM   2441  C  CA    . GLU E 2 173 ? 19.878  5.368   192.038 1.00 38.59  ? 174  GLU A CA    1 
ATOM   2442  C  C     . GLU E 2 173 ? 20.638  5.410   190.718 1.00 47.83  ? 174  GLU A C     1 
ATOM   2443  O  O     . GLU E 2 173 ? 20.145  5.956   189.725 1.00 45.20  ? 174  GLU A O     1 
ATOM   2444  C  CB    . GLU E 2 173 ? 19.387  3.958   192.326 1.00 31.99  ? 174  GLU A CB    1 
ATOM   2445  C  CG    . GLU E 2 173 ? 18.636  3.322   191.193 1.00 35.57  ? 174  GLU A CG    1 
ATOM   2446  C  CD    . GLU E 2 173 ? 18.238  1.898   191.512 1.00 54.48  ? 174  GLU A CD    1 
ATOM   2447  O  OE1   . GLU E 2 173 ? 17.546  1.276   190.675 1.00 72.71  ? 174  GLU A OE1   1 
ATOM   2448  O  OE2   . GLU E 2 173 ? 18.616  1.397   192.599 1.00 56.58  ? 174  GLU A OE2   1 
ATOM   2449  N  N     . LEU E 2 174 ? 21.847  4.851   190.714 1.00 52.80  ? 175  LEU A N     1 
ATOM   2450  C  CA    . LEU E 2 174 ? 22.671  4.819   189.510 1.00 54.11  ? 175  LEU A CA    1 
ATOM   2451  C  C     . LEU E 2 174 ? 22.344  3.548   188.725 1.00 59.63  ? 175  LEU A C     1 
ATOM   2452  O  O     . LEU E 2 174 ? 22.251  2.463   189.306 1.00 59.46  ? 175  LEU A O     1 
ATOM   2453  C  CB    . LEU E 2 174 ? 24.162  4.840   189.878 1.00 51.15  ? 175  LEU A CB    1 
ATOM   2454  C  CG    . LEU E 2 174 ? 25.116  5.167   188.716 1.00 58.84  ? 175  LEU A CG    1 
ATOM   2455  C  CD1   . LEU E 2 174 ? 24.921  6.620   188.313 1.00 50.90  ? 175  LEU A CD1   1 
ATOM   2456  C  CD2   . LEU E 2 174 ? 26.563  4.931   189.108 1.00 55.15  ? 175  LEU A CD2   1 
ATOM   2457  N  N     . ASN E 2 175 ? 22.164  3.687   187.413 1.00 60.15  ? 176  ASN A N     1 
ATOM   2458  C  CA    . ASN E 2 175 ? 21.840  2.551   186.547 1.00 63.78  ? 176  ASN A CA    1 
ATOM   2459  C  C     . ASN E 2 175 ? 22.339  2.853   185.140 1.00 70.03  ? 176  ASN A C     1 
ATOM   2460  O  O     . ASN E 2 175 ? 21.780  3.696   184.439 1.00 72.15  ? 176  ASN A O     1 
ATOM   2461  C  CB    . ASN E 2 175 ? 20.320  2.316   186.539 1.00 64.97  ? 176  ASN A CB    1 
ATOM   2462  C  CG    . ASN E 2 175 ? 19.923  0.933   186.016 1.00 65.08  ? 176  ASN A CG    1 
ATOM   2463  O  OD1   . ASN E 2 175 ? 19.999  0.657   184.823 1.00 58.20  ? 176  ASN A OD1   1 
ATOM   2464  N  ND2   . ASN E 2 175 ? 19.488  0.063   186.924 1.00 73.73  ? 176  ASN A ND2   1 
ATOM   2465  N  N     . GLY E 2 176 ? 23.407  2.169   184.737 1.00 72.74  ? 177  GLY A N     1 
ATOM   2466  C  CA    . GLY E 2 176 ? 23.970  2.385   183.416 1.00 71.21  ? 177  GLY A CA    1 
ATOM   2467  C  C     . GLY E 2 176 ? 24.847  3.621   183.393 1.00 70.71  ? 177  GLY A C     1 
ATOM   2468  O  O     . GLY E 2 176 ? 25.802  3.733   184.155 1.00 70.07  ? 177  GLY A O     1 
ATOM   2469  N  N     . GLU E 2 177 ? 24.522  4.559   182.516 1.00 75.69  ? 178  GLU A N     1 
ATOM   2470  C  CA    . GLU E 2 177 ? 25.297  5.781   182.416 1.00 79.60  ? 178  GLU A CA    1 
ATOM   2471  C  C     . GLU E 2 177 ? 24.396  6.972   182.694 1.00 80.43  ? 178  GLU A C     1 
ATOM   2472  O  O     . GLU E 2 177 ? 24.573  8.050   182.128 1.00 84.60  ? 178  GLU A O     1 
ATOM   2473  C  CB    . GLU E 2 177 ? 25.905  5.905   181.020 1.00 87.05  ? 178  GLU A CB    1 
ATOM   2474  C  CG    . GLU E 2 177 ? 27.402  6.137   181.035 1.00 105.93 ? 178  GLU A CG    1 
ATOM   2475  C  CD    . GLU E 2 177 ? 27.781  7.399   181.787 1.00 116.05 ? 178  GLU A CD    1 
ATOM   2476  O  OE1   . GLU E 2 177 ? 27.506  8.507   181.274 1.00 122.13 ? 178  GLU A OE1   1 
ATOM   2477  O  OE2   . GLU E 2 177 ? 28.346  7.281   182.896 1.00 121.74 ? 178  GLU A OE2   1 
ATOM   2478  N  N     . ASP E 2 178 ? 23.423  6.776   183.573 1.00 71.74  ? 179  ASP A N     1 
ATOM   2479  C  CA    . ASP E 2 178 ? 22.500  7.842   183.896 1.00 64.09  ? 179  ASP A CA    1 
ATOM   2480  C  C     . ASP E 2 178 ? 21.722  7.498   185.158 1.00 56.35  ? 179  ASP A C     1 
ATOM   2481  O  O     . ASP E 2 178 ? 21.594  6.328   185.511 1.00 51.85  ? 179  ASP A O     1 
ATOM   2482  C  CB    . ASP E 2 178 ? 21.548  8.066   182.716 1.00 68.07  ? 179  ASP A CB    1 
ATOM   2483  C  CG    . ASP E 2 178 ? 20.883  6.782   182.258 1.00 72.72  ? 179  ASP A CG    1 
ATOM   2484  O  OD1   . ASP E 2 178 ? 20.091  6.827   181.296 1.00 72.09  ? 179  ASP A OD1   1 
ATOM   2485  O  OD2   . ASP E 2 178 ? 21.157  5.724   182.864 1.00 73.00  ? 179  ASP A OD2   1 
ATOM   2486  N  N     . LEU E 2 179 ? 21.231  8.536   185.836 1.00 48.13  ? 180  LEU A N     1 
ATOM   2487  C  CA    . LEU E 2 179 ? 20.459  8.411   187.071 1.00 47.33  ? 180  LEU A CA    1 
ATOM   2488  C  C     . LEU E 2 179 ? 19.016  7.980   186.814 1.00 50.45  ? 180  LEU A C     1 
ATOM   2489  O  O     . LEU E 2 179 ? 18.559  7.948   185.673 1.00 57.49  ? 180  LEU A O     1 
ATOM   2490  C  CB    . LEU E 2 179 ? 20.456  9.743   187.816 1.00 36.34  ? 180  LEU A CB    1 
ATOM   2491  C  CG    . LEU E 2 179 ? 21.669  10.095  188.668 1.00 43.61  ? 180  LEU A CG    1 
ATOM   2492  C  CD1   . LEU E 2 179 ? 22.924  9.800   187.889 1.00 55.26  ? 180  LEU A CD1   1 
ATOM   2493  C  CD2   . LEU E 2 179 ? 21.621  11.568  189.077 1.00 45.04  ? 180  LEU A CD2   1 
ATOM   2494  N  N     . VAL E 2 180 ? 18.294  7.653   187.876 1.00 37.52  ? 181  VAL A N     1 
ATOM   2495  C  CA    . VAL E 2 180 ? 16.917  7.238   187.715 1.00 30.04  ? 181  VAL A CA    1 
ATOM   2496  C  C     . VAL E 2 180 ? 16.160  7.264   189.040 1.00 29.30  ? 181  VAL A C     1 
ATOM   2497  O  O     . VAL E 2 180 ? 16.552  6.621   190.012 1.00 36.23  ? 181  VAL A O     1 
ATOM   2498  C  CB    . VAL E 2 180 ? 16.848  5.833   187.085 1.00 24.54  ? 181  VAL A CB    1 
ATOM   2499  C  CG1   . VAL E 2 180 ? 17.548  4.826   187.966 1.00 34.43  ? 181  VAL A CG1   1 
ATOM   2500  C  CG2   . VAL E 2 180 ? 15.411  5.440   186.855 1.00 27.06  ? 181  VAL A CG2   1 
ATOM   2501  N  N     . CYS E 2 181 ? 15.092  8.048   189.080 1.00 27.69  ? 182  CYS A N     1 
ATOM   2502  C  CA    . CYS E 2 181 ? 14.266  8.166   190.276 1.00 37.16  ? 182  CYS A CA    1 
ATOM   2503  C  C     . CYS E 2 181 ? 13.621  6.805   190.545 1.00 40.70  ? 182  CYS A C     1 
ATOM   2504  O  O     . CYS E 2 181 ? 13.208  6.114   189.610 1.00 49.00  ? 182  CYS A O     1 
ATOM   2505  C  CB    . CYS E 2 181 ? 13.195  9.246   190.052 1.00 38.15  ? 182  CYS A CB    1 
ATOM   2506  S  SG    . CYS E 2 181 ? 11.842  9.304   191.252 1.00 32.44  ? 182  CYS A SG    1 
ATOM   2507  N  N     . VAL E 2 182 ? 13.545  6.409   191.811 1.00 35.31  ? 183  VAL A N     1 
ATOM   2508  C  CA    . VAL E 2 182 ? 12.951  5.119   192.146 1.00 33.53  ? 183  VAL A CA    1 
ATOM   2509  C  C     . VAL E 2 182 ? 11.775  5.266   193.091 1.00 33.98  ? 183  VAL A C     1 
ATOM   2510  O  O     . VAL E 2 182 ? 11.065  4.303   193.333 1.00 38.61  ? 183  VAL A O     1 
ATOM   2511  C  CB    . VAL E 2 182 ? 13.975  4.155   192.784 1.00 36.29  ? 183  VAL A CB    1 
ATOM   2512  C  CG1   . VAL E 2 182 ? 15.079  3.840   191.798 1.00 39.94  ? 183  VAL A CG1   1 
ATOM   2513  C  CG2   . VAL E 2 182 ? 14.548  4.762   194.054 1.00 47.83  ? 183  VAL A CG2   1 
ATOM   2514  N  N     . SER E 2 183 ? 11.582  6.465   193.635 1.00 35.65  ? 184  SER A N     1 
ATOM   2515  C  CA    . SER E 2 183 ? 10.465  6.730   194.541 1.00 35.32  ? 184  SER A CA    1 
ATOM   2516  C  C     . SER E 2 183 ? 10.461  8.166   195.038 1.00 39.98  ? 184  SER A C     1 
ATOM   2517  O  O     . SER E 2 183 ? 11.382  8.932   194.748 1.00 40.28  ? 184  SER A O     1 
ATOM   2518  C  CB    . SER E 2 183 ? 10.449  5.745   195.725 1.00 19.15  ? 184  SER A CB    1 
ATOM   2519  O  OG    . SER E 2 183 ? 11.697  5.622   196.369 1.00 29.17  ? 184  SER A OG    1 
ATOM   2520  N  N     . THR E 2 184 ? 9.400   8.539   195.751 1.00 38.51  ? 185  THR A N     1 
ATOM   2521  C  CA    . THR E 2 184 ? 9.271   9.899   196.267 1.00 31.81  ? 185  THR A CA    1 
ATOM   2522  C  C     . THR E 2 184 ? 8.603   9.950   197.623 1.00 30.31  ? 185  THR A C     1 
ATOM   2523  O  O     . THR E 2 184 ? 8.004   8.986   198.064 1.00 44.04  ? 185  THR A O     1 
ATOM   2524  C  CB    . THR E 2 184 ? 8.459   10.786  195.327 1.00 30.82  ? 185  THR A CB    1 
ATOM   2525  O  OG1   . THR E 2 184 ? 7.149   10.234  195.164 1.00 44.49  ? 185  THR A OG1   1 
ATOM   2526  C  CG2   . THR E 2 184 ? 9.127   10.881  193.968 1.00 36.45  ? 185  THR A CG2   1 
ATOM   2527  N  N     . SER E 2 185 ? 8.726   11.086  198.289 1.00 35.07  ? 186  SER A N     1 
ATOM   2528  C  CA    . SER E 2 185 ? 8.129   11.270  199.593 1.00 32.25  ? 186  SER A CA    1 
ATOM   2529  C  C     . SER E 2 185 ? 7.792   12.744  199.801 1.00 43.97  ? 186  SER A C     1 
ATOM   2530  O  O     . SER E 2 185 ? 8.553   13.633  199.390 1.00 47.28  ? 186  SER A O     1 
ATOM   2531  C  CB    . SER E 2 185 ? 9.081   10.797  200.681 1.00 29.06  ? 186  SER A CB    1 
ATOM   2532  O  OG    . SER E 2 185 ? 9.188   9.392   200.678 1.00 38.83  ? 186  SER A OG    1 
ATOM   2533  N  N     . PHE E 2 186 ? 6.651   12.994  200.443 1.00 30.71  ? 187  PHE A N     1 
ATOM   2534  C  CA    . PHE E 2 186 ? 6.196   14.352  200.712 1.00 34.28  ? 187  PHE A CA    1 
ATOM   2535  C  C     . PHE E 2 186 ? 5.829   14.502  202.184 1.00 45.11  ? 187  PHE A C     1 
ATOM   2536  O  O     . PHE E 2 186 ? 5.368   13.550  202.818 1.00 54.40  ? 187  PHE A O     1 
ATOM   2537  C  CB    . PHE E 2 186 ? 4.973   14.661  199.858 1.00 36.25  ? 187  PHE A CB    1 
ATOM   2538  C  CG    . PHE E 2 186 ? 4.538   16.097  199.900 1.00 30.70  ? 187  PHE A CG    1 
ATOM   2539  C  CD1   . PHE E 2 186 ? 5.114   17.032  199.058 1.00 36.82  ? 187  PHE A CD1   1 
ATOM   2540  C  CD2   . PHE E 2 186 ? 3.511   16.505  200.744 1.00 33.38  ? 187  PHE A CD2   1 
ATOM   2541  C  CE1   . PHE E 2 186 ? 4.669   18.361  199.049 1.00 44.44  ? 187  PHE A CE1   1 
ATOM   2542  C  CE2   . PHE E 2 186 ? 3.064   17.830  200.742 1.00 35.60  ? 187  PHE A CE2   1 
ATOM   2543  C  CZ    . PHE E 2 186 ? 3.644   18.756  199.890 1.00 35.65  ? 187  PHE A CZ    1 
ATOM   2544  N  N     . ALA E 2 187 ? 6.030   15.700  202.725 1.00 43.58  ? 188  ALA A N     1 
ATOM   2545  C  CA    . ALA E 2 187 ? 5.703   15.973  204.117 1.00 39.29  ? 188  ALA A CA    1 
ATOM   2546  C  C     . ALA E 2 187 ? 5.611   17.474  204.333 1.00 46.53  ? 188  ALA A C     1 
ATOM   2547  O  O     . ALA E 2 187 ? 6.165   18.256  203.558 1.00 54.34  ? 188  ALA A O     1 
ATOM   2548  C  CB    . ALA E 2 187 ? 6.749   15.370  205.022 1.00 37.87  ? 188  ALA A CB    1 
ATOM   2549  N  N     . GLU E 2 188 ? 4.909   17.872  205.387 1.00 42.67  ? 189  GLU A N     1 
ATOM   2550  C  CA    . GLU E 2 188 ? 4.730   19.289  205.691 1.00 44.33  ? 189  GLU A CA    1 
ATOM   2551  C  C     . GLU E 2 188 ? 5.351   19.655  207.042 1.00 42.98  ? 189  GLU A C     1 
ATOM   2552  O  O     . GLU E 2 188 ? 4.876   19.205  208.074 1.00 45.13  ? 189  GLU A O     1 
ATOM   2553  C  CB    . GLU E 2 188 ? 3.239   19.617  205.690 1.00 46.50  ? 189  GLU A CB    1 
ATOM   2554  C  CG    . GLU E 2 188 ? 2.554   19.340  204.365 1.00 41.31  ? 189  GLU A CG    1 
ATOM   2555  C  CD    . GLU E 2 188 ? 1.066   19.585  204.435 1.00 40.13  ? 189  GLU A CD    1 
ATOM   2556  O  OE1   . GLU E 2 188 ? 0.371   19.397  203.416 1.00 39.22  ? 189  GLU A OE1   1 
ATOM   2557  O  OE2   . GLU E 2 188 ? 0.591   19.966  205.517 1.00 41.55  ? 189  GLU A OE2   1 
ATOM   2558  N  N     . LEU E 2 189 ? 6.394   20.486  207.036 1.00 37.04  ? 190  LEU A N     1 
ATOM   2559  C  CA    . LEU E 2 189 ? 7.083   20.858  208.276 1.00 35.32  ? 190  LEU A CA    1 
ATOM   2560  C  C     . LEU E 2 189 ? 6.182   21.216  209.459 1.00 42.11  ? 190  LEU A C     1 
ATOM   2561  O  O     . LEU E 2 189 ? 6.405   20.759  210.589 1.00 31.06  ? 190  LEU A O     1 
ATOM   2562  C  CB    . LEU E 2 189 ? 8.051   22.021  208.035 1.00 30.97  ? 190  LEU A CB    1 
ATOM   2563  C  CG    . LEU E 2 189 ? 8.838   22.425  209.292 1.00 23.24  ? 190  LEU A CG    1 
ATOM   2564  C  CD1   . LEU E 2 189 ? 9.713   21.278  209.759 1.00 14.60  ? 190  LEU A CD1   1 
ATOM   2565  C  CD2   . LEU E 2 189 ? 9.676   23.647  208.992 1.00 29.94  ? 190  LEU A CD2   1 
ATOM   2566  N  N     . PHE E 2 190 ? 5.175   22.040  209.173 1.00 36.78  ? 191  PHE A N     1 
ATOM   2567  C  CA    . PHE E 2 190 ? 4.211   22.523  210.152 1.00 41.71  ? 191  PHE A CA    1 
ATOM   2568  C  C     . PHE E 2 190 ? 3.190   21.467  210.585 1.00 52.27  ? 191  PHE A C     1 
ATOM   2569  O  O     . PHE E 2 190 ? 2.245   21.750  211.334 1.00 54.82  ? 191  PHE A O     1 
ATOM   2570  C  CB    . PHE E 2 190 ? 3.499   23.733  209.568 1.00 37.53  ? 191  PHE A CB    1 
ATOM   2571  C  CG    . PHE E 2 190 ? 4.396   24.914  209.373 1.00 27.29  ? 191  PHE A CG    1 
ATOM   2572  C  CD1   . PHE E 2 190 ? 4.268   25.731  208.255 1.00 17.53  ? 191  PHE A CD1   1 
ATOM   2573  C  CD2   . PHE E 2 190 ? 5.360   25.225  210.328 1.00 30.87  ? 191  PHE A CD2   1 
ATOM   2574  C  CE1   . PHE E 2 190 ? 5.081   26.839  208.093 1.00 22.76  ? 191  PHE A CE1   1 
ATOM   2575  C  CE2   . PHE E 2 190 ? 6.178   26.329  210.178 1.00 20.15  ? 191  PHE A CE2   1 
ATOM   2576  C  CZ    . PHE E 2 190 ? 6.039   27.141  209.058 1.00 29.86  ? 191  PHE A CZ    1 
ATOM   2577  N  N     . LYS E 2 191 ? 3.393   20.249  210.102 1.00 49.49  ? 192  LYS A N     1 
ATOM   2578  C  CA    . LYS E 2 191 ? 2.533   19.132  210.428 1.00 43.70  ? 192  LYS A CA    1 
ATOM   2579  C  C     . LYS E 2 191 ? 3.306   18.166  211.299 1.00 41.89  ? 192  LYS A C     1 
ATOM   2580  O  O     . LYS E 2 191 ? 2.783   17.131  211.681 1.00 49.63  ? 192  LYS A O     1 
ATOM   2581  C  CB    . LYS E 2 191 ? 2.080   18.406  209.151 1.00 52.31  ? 192  LYS A CB    1 
ATOM   2582  C  CG    . LYS E 2 191 ? 1.085   19.174  208.296 1.00 50.77  ? 192  LYS A CG    1 
ATOM   2583  C  CD    . LYS E 2 191 ? -0.347  18.809  208.647 1.00 61.32  ? 192  LYS A CD    1 
ATOM   2584  C  CE    . LYS E 2 191 ? -0.837  17.653  207.801 1.00 60.87  ? 192  LYS A CE    1 
ATOM   2585  N  NZ    . LYS E 2 191 ? -0.965  18.065  206.375 1.00 65.46  ? 192  LYS A NZ    1 
ATOM   2586  N  N     . SER E 2 192 ? 4.559   18.480  211.605 1.00 40.51  ? 193  SER A N     1 
ATOM   2587  C  CA    . SER E 2 192 ? 5.346   17.573  212.438 1.00 39.86  ? 193  SER A CA    1 
ATOM   2588  C  C     . SER E 2 192 ? 5.502   18.100  213.861 1.00 35.47  ? 193  SER A C     1 
ATOM   2589  O  O     . SER E 2 192 ? 5.354   19.298  214.126 1.00 33.36  ? 193  SER A O     1 
ATOM   2590  C  CB    . SER E 2 192 ? 6.725   17.348  211.822 1.00 41.67  ? 193  SER A CB    1 
ATOM   2591  O  OG    . SER E 2 192 ? 7.461   18.551  211.801 1.00 48.27  ? 193  SER A OG    1 
ATOM   2592  N  N     . GLU E 2 193 ? 5.800   17.196  214.780 1.00 23.11  ? 194  GLU A N     1 
ATOM   2593  C  CA    . GLU E 2 193 ? 5.977   17.581  216.169 1.00 36.35  ? 194  GLU A CA    1 
ATOM   2594  C  C     . GLU E 2 193 ? 7.269   18.387  216.319 1.00 42.95  ? 194  GLU A C     1 
ATOM   2595  O  O     . GLU E 2 193 ? 8.365   17.835  216.256 1.00 45.59  ? 194  GLU A O     1 
ATOM   2596  C  CB    . GLU E 2 193 ? 6.014   16.335  217.057 1.00 31.92  ? 194  GLU A CB    1 
ATOM   2597  C  CG    . GLU E 2 193 ? 6.079   16.654  218.540 1.00 59.70  ? 194  GLU A CG    1 
ATOM   2598  C  CD    . GLU E 2 193 ? 5.112   17.756  218.926 1.00 67.96  ? 194  GLU A CD    1 
ATOM   2599  O  OE1   . GLU E 2 193 ? 3.940   17.692  218.485 1.00 63.63  ? 194  GLU A OE1   1 
ATOM   2600  O  OE2   . GLU E 2 193 ? 5.526   18.677  219.673 1.00 74.41  ? 194  GLU A OE2   1 
ATOM   2601  N  N     . PRO E 2 194 ? 7.151   19.708  216.536 1.00 47.02  ? 195  PRO A N     1 
ATOM   2602  C  CA    . PRO E 2 194 ? 8.305   20.605  216.690 1.00 42.41  ? 195  PRO A CA    1 
ATOM   2603  C  C     . PRO E 2 194 ? 9.321   20.190  217.730 1.00 40.90  ? 195  PRO A C     1 
ATOM   2604  O  O     . PRO E 2 194 ? 10.522  20.159  217.459 1.00 48.04  ? 195  PRO A O     1 
ATOM   2605  C  CB    . PRO E 2 194 ? 7.661   21.951  217.005 1.00 42.01  ? 195  PRO A CB    1 
ATOM   2606  C  CG    . PRO E 2 194 ? 6.382   21.561  217.680 1.00 45.61  ? 195  PRO A CG    1 
ATOM   2607  C  CD    . PRO E 2 194 ? 5.896   20.423  216.818 1.00 42.24  ? 195  PRO A CD    1 
ATOM   2608  N  N     . SER E 2 195 ? 8.839   19.867  218.919 1.00 43.58  ? 196  SER A N     1 
ATOM   2609  C  CA    . SER E 2 195 ? 9.717   19.457  220.011 1.00 49.59  ? 196  SER A CA    1 
ATOM   2610  C  C     . SER E 2 195 ? 10.647  18.304  219.620 1.00 53.66  ? 196  SER A C     1 
ATOM   2611  O  O     . SER E 2 195 ? 11.749  18.185  220.147 1.00 48.40  ? 196  SER A O     1 
ATOM   2612  C  CB    . SER E 2 195 ? 8.874   19.016  221.195 1.00 51.63  ? 196  SER A CB    1 
ATOM   2613  O  OG    . SER E 2 195 ? 8.115   17.876  220.830 1.00 61.96  ? 196  SER A OG    1 
ATOM   2614  N  N     . GLU E 2 196 ? 10.188  17.449  218.711 1.00 53.66  ? 197  GLU A N     1 
ATOM   2615  C  CA    . GLU E 2 196 ? 10.975  16.306  218.274 1.00 56.73  ? 197  GLU A CA    1 
ATOM   2616  C  C     . GLU E 2 196 ? 11.926  16.618  217.131 1.00 54.78  ? 197  GLU A C     1 
ATOM   2617  O  O     . GLU E 2 196 ? 12.821  15.832  216.824 1.00 59.97  ? 197  GLU A O     1 
ATOM   2618  C  CB    . GLU E 2 196 ? 10.046  15.165  217.857 1.00 67.33  ? 197  GLU A CB    1 
ATOM   2619  C  CG    . GLU E 2 196 ? 9.475   14.411  219.028 1.00 76.11  ? 197  GLU A CG    1 
ATOM   2620  C  CD    . GLU E 2 196 ? 10.567  13.771  219.862 1.00 86.50  ? 197  GLU A CD    1 
ATOM   2621  O  OE1   . GLU E 2 196 ? 11.167  12.777  219.393 1.00 85.28  ? 197  GLU A OE1   1 
ATOM   2622  O  OE2   . GLU E 2 196 ? 10.837  14.275  220.977 1.00 90.76  ? 197  GLU A OE2   1 
ATOM   2623  N  N     . LEU E 2 197 ? 11.730  17.766  216.501 1.00 47.52  ? 198  LEU A N     1 
ATOM   2624  C  CA    . LEU E 2 197 ? 12.560  18.171  215.377 1.00 44.67  ? 198  LEU A CA    1 
ATOM   2625  C  C     . LEU E 2 197 ? 14.053  18.231  215.762 1.00 44.08  ? 198  LEU A C     1 
ATOM   2626  O  O     . LEU E 2 197 ? 14.447  18.956  216.681 1.00 42.29  ? 198  LEU A O     1 
ATOM   2627  C  CB    . LEU E 2 197 ? 12.045  19.518  214.854 1.00 31.65  ? 198  LEU A CB    1 
ATOM   2628  C  CG    . LEU E 2 197 ? 11.726  19.646  213.362 1.00 28.44  ? 198  LEU A CG    1 
ATOM   2629  C  CD1   . LEU E 2 197 ? 11.051  18.402  212.824 1.00 31.55  ? 198  LEU A CD1   1 
ATOM   2630  C  CD2   . LEU E 2 197 ? 10.859  20.861  213.170 1.00 22.43  ? 198  LEU A CD2   1 
ATOM   2631  N  N     . TYR E 2 198 ? 14.877  17.452  215.064 1.00 33.75  ? 199  TYR A N     1 
ATOM   2632  C  CA    . TYR E 2 198 ? 16.314  17.412  215.347 1.00 40.08  ? 199  TYR A CA    1 
ATOM   2633  C  C     . TYR E 2 198 ? 17.146  18.559  214.755 1.00 36.15  ? 199  TYR A C     1 
ATOM   2634  O  O     . TYR E 2 198 ? 17.040  18.871  213.569 1.00 32.71  ? 199  TYR A O     1 
ATOM   2635  C  CB    . TYR E 2 198 ? 16.930  16.097  214.845 1.00 39.69  ? 199  TYR A CB    1 
ATOM   2636  C  CG    . TYR E 2 198 ? 18.382  15.925  215.255 1.00 40.27  ? 199  TYR A CG    1 
ATOM   2637  C  CD1   . TYR E 2 198 ? 18.719  15.643  216.576 1.00 35.25  ? 199  TYR A CD1   1 
ATOM   2638  C  CD2   . TYR E 2 198 ? 19.411  16.063  214.335 1.00 33.11  ? 199  TYR A CD2   1 
ATOM   2639  C  CE1   . TYR E 2 198 ? 20.039  15.496  216.973 1.00 34.50  ? 199  TYR A CE1   1 
ATOM   2640  C  CE2   . TYR E 2 198 ? 20.742  15.920  214.721 1.00 38.43  ? 199  TYR A CE2   1 
ATOM   2641  C  CZ    . TYR E 2 198 ? 21.050  15.633  216.042 1.00 45.59  ? 199  TYR A CZ    1 
ATOM   2642  O  OH    . TYR E 2 198 ? 22.363  15.455  216.433 1.00 44.23  ? 199  TYR A OH    1 
ATOM   2643  N  N     . ILE E 2 199 ? 17.999  19.161  215.577 1.00 29.13  ? 200  ILE A N     1 
ATOM   2644  C  CA    . ILE E 2 199 ? 18.862  20.242  215.108 1.00 27.01  ? 200  ILE A CA    1 
ATOM   2645  C  C     . ILE E 2 199 ? 20.336  19.849  215.176 1.00 27.96  ? 200  ILE A C     1 
ATOM   2646  O  O     . ILE E 2 199 ? 20.868  19.608  216.259 1.00 26.87  ? 200  ILE A O     1 
ATOM   2647  C  CB    . ILE E 2 199 ? 18.698  21.500  215.950 1.00 26.88  ? 200  ILE A CB    1 
ATOM   2648  C  CG1   . ILE E 2 199 ? 17.235  21.839  216.113 1.00 16.95  ? 200  ILE A CG1   1 
ATOM   2649  C  CG2   . ILE E 2 199 ? 19.398  22.662  215.291 1.00 27.46  ? 200  ILE A CG2   1 
ATOM   2650  C  CD1   . ILE E 2 199 ? 17.021  22.807  217.234 1.00 30.30  ? 200  ILE A CD1   1 
ATOM   2651  N  N     . ASN E 2 200 ? 20.988  19.791  214.015 1.00 32.54  ? 201  ASN A N     1 
ATOM   2652  C  CA    . ASN E 2 200 ? 22.407  19.440  213.942 1.00 38.55  ? 201  ASN A CA    1 
ATOM   2653  C  C     . ASN E 2 200 ? 23.228  20.731  213.902 1.00 40.54  ? 201  ASN A C     1 
ATOM   2654  O  O     . ASN E 2 200 ? 23.444  21.311  212.830 1.00 43.55  ? 201  ASN A O     1 
ATOM   2655  C  CB    . ASN E 2 200 ? 22.693  18.613  212.680 1.00 31.12  ? 201  ASN A CB    1 
ATOM   2656  C  CG    . ASN E 2 200 ? 24.065  17.956  212.710 1.00 39.02  ? 201  ASN A CG    1 
ATOM   2657  O  OD1   . ASN E 2 200 ? 24.917  18.312  213.525 1.00 44.86  ? 201  ASN A OD1   1 
ATOM   2658  N  ND2   . ASN E 2 200 ? 24.288  16.997  211.813 1.00 42.94  ? 201  ASN A ND2   1 
ATOM   2659  N  N     . TRP E 2 201 ? 23.687  21.180  215.066 1.00 26.59  ? 202  TRP A N     1 
ATOM   2660  C  CA    . TRP E 2 201 ? 24.462  22.418  215.136 1.00 31.93  ? 202  TRP A CA    1 
ATOM   2661  C  C     . TRP E 2 201 ? 25.676  22.515  214.213 1.00 26.50  ? 202  TRP A C     1 
ATOM   2662  O  O     . TRP E 2 201 ? 25.814  23.489  213.479 1.00 25.44  ? 202  TRP A O     1 
ATOM   2663  C  CB    . TRP E 2 201 ? 24.878  22.685  216.581 1.00 27.70  ? 202  TRP A CB    1 
ATOM   2664  C  CG    . TRP E 2 201 ? 23.681  22.800  217.462 1.00 34.90  ? 202  TRP A CG    1 
ATOM   2665  C  CD1   . TRP E 2 201 ? 23.134  21.818  218.233 1.00 46.00  ? 202  TRP A CD1   1 
ATOM   2666  C  CD2   . TRP E 2 201 ? 22.845  23.952  217.628 1.00 34.91  ? 202  TRP A CD2   1 
ATOM   2667  N  NE1   . TRP E 2 201 ? 22.008  22.284  218.871 1.00 46.26  ? 202  TRP A NE1   1 
ATOM   2668  C  CE2   . TRP E 2 201 ? 21.807  23.591  218.519 1.00 37.39  ? 202  TRP A CE2   1 
ATOM   2669  C  CE3   . TRP E 2 201 ? 22.870  25.251  217.110 1.00 24.15  ? 202  TRP A CE3   1 
ATOM   2670  C  CZ2   . TRP E 2 201 ? 20.804  24.486  218.907 1.00 36.24  ? 202  TRP A CZ2   1 
ATOM   2671  C  CZ3   . TRP E 2 201 ? 21.870  26.141  217.495 1.00 36.28  ? 202  TRP A CZ3   1 
ATOM   2672  C  CH2   . TRP E 2 201 ? 20.852  25.754  218.386 1.00 22.92  ? 202  TRP A CH2   1 
ATOM   2673  N  N     . ALA E 2 202 ? 26.545  21.511  214.245 1.00 20.65  ? 203  ALA A N     1 
ATOM   2674  C  CA    . ALA E 2 202 ? 27.730  21.515  213.405 1.00 16.32  ? 203  ALA A CA    1 
ATOM   2675  C  C     . ALA E 2 202 ? 27.342  21.528  211.946 1.00 24.42  ? 203  ALA A C     1 
ATOM   2676  O  O     . ALA E 2 202 ? 27.960  22.219  211.134 1.00 36.55  ? 203  ALA A O     1 
ATOM   2677  C  CB    . ALA E 2 202 ? 28.581  20.301  213.691 1.00 28.76  ? 203  ALA A CB    1 
ATOM   2678  N  N     . ALA E 2 203 ? 26.312  20.768  211.602 1.00 21.62  ? 204  ALA A N     1 
ATOM   2679  C  CA    . ALA E 2 203 ? 25.880  20.703  210.214 1.00 18.58  ? 204  ALA A CA    1 
ATOM   2680  C  C     . ALA E 2 203 ? 25.150  21.969  209.770 1.00 18.34  ? 204  ALA A C     1 
ATOM   2681  O  O     . ALA E 2 203 ? 24.105  21.910  209.131 1.00 31.05  ? 204  ALA A O     1 
ATOM   2682  C  CB    . ALA E 2 203 ? 25.009  19.468  210.002 1.00 11.09  ? 204  ALA A CB    1 
ATOM   2683  N  N     . ALA E 2 204 ? 25.718  23.118  210.112 1.00 24.77  ? 205  ALA A N     1 
ATOM   2684  C  CA    . ALA E 2 204 ? 25.156  24.416  209.745 1.00 20.90  ? 205  ALA A CA    1 
ATOM   2685  C  C     . ALA E 2 204 ? 23.894  24.701  210.497 1.00 14.43  ? 205  ALA A C     1 
ATOM   2686  O  O     . ALA E 2 204 ? 23.008  25.394  210.003 1.00 10.19  ? 205  ALA A O     1 
ATOM   2687  C  CB    . ALA E 2 204 ? 24.904  24.487  208.248 1.00 15.31  ? 205  ALA A CB    1 
ATOM   2688  N  N     . MET E 2 205 ? 23.837  24.177  211.716 1.00 20.75  ? 206  MET A N     1 
ATOM   2689  C  CA    . MET E 2 205 ? 22.675  24.362  212.579 1.00 23.10  ? 206  MET A CA    1 
ATOM   2690  C  C     . MET E 2 205 ? 21.404  23.911  211.881 1.00 22.87  ? 206  MET A C     1 
ATOM   2691  O  O     . MET E 2 205 ? 20.325  24.385  212.203 1.00 20.90  ? 206  MET A O     1 
ATOM   2692  C  CB    . MET E 2 205 ? 22.527  25.832  212.921 1.00 21.18  ? 206  MET A CB    1 
ATOM   2693  C  CG    . MET E 2 205 ? 23.829  26.520  213.133 1.00 30.45  ? 206  MET A CG    1 
ATOM   2694  S  SD    . MET E 2 205 ? 23.618  28.146  213.742 1.00 28.19  ? 206  MET A SD    1 
ATOM   2695  C  CE    . MET E 2 205 ? 24.119  27.909  215.369 1.00 32.32  ? 206  MET A CE    1 
ATOM   2696  N  N     . GLN E 2 206 ? 21.533  23.007  210.922 1.00 24.32  ? 207  GLN A N     1 
ATOM   2697  C  CA    . GLN E 2 206 ? 20.374  22.556  210.165 1.00 37.22  ? 207  GLN A CA    1 
ATOM   2698  C  C     . GLN E 2 206 ? 19.512  21.512  210.874 1.00 40.01  ? 207  GLN A C     1 
ATOM   2699  O  O     . GLN E 2 206 ? 19.979  20.783  211.757 1.00 36.21  ? 207  GLN A O     1 
ATOM   2700  C  CB    . GLN E 2 206 ? 20.836  21.985  208.830 1.00 33.54  ? 207  GLN A CB    1 
ATOM   2701  C  CG    . GLN E 2 206 ? 21.511  22.980  207.947 1.00 32.44  ? 207  GLN A CG    1 
ATOM   2702  C  CD    . GLN E 2 206 ? 20.538  23.838  207.200 1.00 27.31  ? 207  GLN A CD    1 
ATOM   2703  O  OE1   . GLN E 2 206 ? 19.717  23.338  206.440 1.00 23.98  ? 207  GLN A OE1   1 
ATOM   2704  N  NE2   . GLN E 2 206 ? 20.627  25.148  207.403 1.00 39.92  ? 207  GLN A NE2   1 
ATOM   2705  N  N     . ILE E 2 207 ? 18.243  21.472  210.484 1.00 28.12  ? 208  ILE A N     1 
ATOM   2706  C  CA    . ILE E 2 207 ? 17.308  20.497  211.003 1.00 28.76  ? 208  ILE A CA    1 
ATOM   2707  C  C     . ILE E 2 207 ? 17.517  19.321  210.056 1.00 33.86  ? 208  ILE A C     1 
ATOM   2708  O  O     . ILE E 2 207 ? 17.656  19.516  208.849 1.00 36.27  ? 208  ILE A O     1 
ATOM   2709  C  CB    . ILE E 2 207 ? 15.862  21.021  210.915 1.00 28.68  ? 208  ILE A CB    1 
ATOM   2710  C  CG1   . ILE E 2 207 ? 15.746  22.262  211.799 1.00 35.68  ? 208  ILE A CG1   1 
ATOM   2711  C  CG2   . ILE E 2 207 ? 14.867  19.957  211.365 1.00 19.52  ? 208  ILE A CG2   1 
ATOM   2712  C  CD1   . ILE E 2 207 ? 14.368  22.833  211.887 1.00 23.10  ? 208  ILE A CD1   1 
ATOM   2713  N  N     . GLN E 2 208 ? 17.576  18.107  210.594 1.00 36.88  ? 209  GLN A N     1 
ATOM   2714  C  CA    . GLN E 2 208 ? 17.812  16.933  209.758 1.00 37.95  ? 209  GLN A CA    1 
ATOM   2715  C  C     . GLN E 2 208 ? 16.801  15.823  209.966 1.00 37.88  ? 209  GLN A C     1 
ATOM   2716  O  O     . GLN E 2 208 ? 16.562  15.393  211.096 1.00 34.55  ? 209  GLN A O     1 
ATOM   2717  C  CB    . GLN E 2 208 ? 19.213  16.364  210.010 1.00 31.55  ? 209  GLN A CB    1 
ATOM   2718  C  CG    . GLN E 2 208 ? 20.349  17.373  209.917 1.00 36.60  ? 209  GLN A CG    1 
ATOM   2719  C  CD    . GLN E 2 208 ? 21.708  16.727  210.116 1.00 40.46  ? 209  GLN A CD    1 
ATOM   2720  O  OE1   . GLN E 2 208 ? 21.895  15.930  211.033 1.00 48.68  ? 209  GLN A OE1   1 
ATOM   2721  N  NE2   . GLN E 2 208 ? 22.665  17.075  209.267 1.00 32.66  ? 209  GLN A NE2   1 
ATOM   2722  N  N     . PHE E 2 209 ? 16.220  15.358  208.861 1.00 43.57  ? 210  PHE A N     1 
ATOM   2723  C  CA    . PHE E 2 209 ? 15.246  14.272  208.886 1.00 33.19  ? 210  PHE A CA    1 
ATOM   2724  C  C     . PHE E 2 209 ? 14.858  13.842  207.482 1.00 35.73  ? 210  PHE A C     1 
ATOM   2725  O  O     . PHE E 2 209 ? 14.679  14.678  206.599 1.00 27.76  ? 210  PHE A O     1 
ATOM   2726  C  CB    . PHE E 2 209 ? 13.993  14.693  209.661 1.00 30.16  ? 210  PHE A CB    1 
ATOM   2727  C  CG    . PHE E 2 209 ? 13.186  15.786  208.992 1.00 33.38  ? 210  PHE A CG    1 
ATOM   2728  C  CD1   . PHE E 2 209 ? 12.593  15.587  207.742 1.00 19.14  ? 210  PHE A CD1   1 
ATOM   2729  C  CD2   . PHE E 2 209 ? 13.019  17.021  209.618 1.00 25.49  ? 210  PHE A CD2   1 
ATOM   2730  C  CE1   . PHE E 2 209 ? 11.859  16.595  207.129 1.00 30.19  ? 210  PHE A CE1   1 
ATOM   2731  C  CE2   . PHE E 2 209 ? 12.285  18.033  209.014 1.00 23.38  ? 210  PHE A CE2   1 
ATOM   2732  C  CZ    . PHE E 2 209 ? 11.702  17.824  207.764 1.00 23.17  ? 210  PHE A CZ    1 
ATOM   2733  N  N     . HIS E 2 210 ? 14.743  12.534  207.271 1.00 37.44  ? 211  HIS A N     1 
ATOM   2734  C  CA    . HIS E 2 210 ? 14.320  12.026  205.971 1.00 31.59  ? 211  HIS A CA    1 
ATOM   2735  C  C     . HIS E 2 210 ? 12.820  12.288  205.896 1.00 37.47  ? 211  HIS A C     1 
ATOM   2736  O  O     . HIS E 2 210 ? 12.070  11.961  206.832 1.00 19.89  ? 211  HIS A O     1 
ATOM   2737  C  CB    . HIS E 2 210 ? 14.598  10.531  205.847 1.00 28.72  ? 211  HIS A CB    1 
ATOM   2738  C  CG    . HIS E 2 210 ? 16.013  10.207  205.479 1.00 35.31  ? 211  HIS A CG    1 
ATOM   2739  N  ND1   . HIS E 2 210 ? 16.893  9.603   206.352 1.00 39.69  ? 211  HIS A ND1   1 
ATOM   2740  C  CD2   . HIS E 2 210 ? 16.703  10.403  204.328 1.00 33.84  ? 211  HIS A CD2   1 
ATOM   2741  C  CE1   . HIS E 2 210 ? 18.061  9.439   205.756 1.00 36.50  ? 211  HIS A CE1   1 
ATOM   2742  N  NE2   . HIS E 2 210 ? 17.972  9.916   204.527 1.00 33.12  ? 211  HIS A NE2   1 
ATOM   2743  N  N     . VAL E 2 211 ? 12.391  12.891  204.788 1.00 38.95  ? 212  VAL A N     1 
ATOM   2744  C  CA    . VAL E 2 211 ? 10.984  13.226  204.589 1.00 35.78  ? 212  VAL A CA    1 
ATOM   2745  C  C     . VAL E 2 211 ? 10.149  11.979  204.780 1.00 29.55  ? 212  VAL A C     1 
ATOM   2746  O  O     . VAL E 2 211 ? 9.119   11.990  205.450 1.00 38.70  ? 212  VAL A O     1 
ATOM   2747  C  CB    . VAL E 2 211 ? 10.759  13.832  203.188 1.00 33.89  ? 212  VAL A CB    1 
ATOM   2748  C  CG1   . VAL E 2 211 ? 9.282   14.107  202.954 1.00 32.84  ? 212  VAL A CG1   1 
ATOM   2749  C  CG2   . VAL E 2 211 ? 11.536  15.119  203.075 1.00 37.34  ? 212  VAL A CG2   1 
ATOM   2750  N  N     . ARG E 2 212 ? 10.632  10.889  204.217 1.00 28.69  ? 213  ARG A N     1 
ATOM   2751  C  CA    . ARG E 2 212 ? 9.949   9.620   204.326 1.00 33.37  ? 213  ARG A CA    1 
ATOM   2752  C  C     . ARG E 2 212 ? 9.569   9.248   205.773 1.00 33.96  ? 213  ARG A C     1 
ATOM   2753  O  O     . ARG E 2 212 ? 8.510   8.676   206.005 1.00 47.42  ? 213  ARG A O     1 
ATOM   2754  C  CB    . ARG E 2 212 ? 10.841  8.544   203.722 1.00 30.97  ? 213  ARG A CB    1 
ATOM   2755  C  CG    . ARG E 2 212 ? 10.295  7.156   203.820 1.00 31.41  ? 213  ARG A CG    1 
ATOM   2756  C  CD    . ARG E 2 212 ? 11.379  6.146   203.536 1.00 40.46  ? 213  ARG A CD    1 
ATOM   2757  N  NE    . ARG E 2 212 ? 12.041  6.391   202.260 1.00 39.16  ? 213  ARG A NE    1 
ATOM   2758  C  CZ    . ARG E 2 212 ? 12.971  5.595   201.744 1.00 41.00  ? 213  ARG A CZ    1 
ATOM   2759  N  NH1   . ARG E 2 212 ? 13.347  4.500   202.394 1.00 50.00  ? 213  ARG A NH1   1 
ATOM   2760  N  NH2   . ARG E 2 212 ? 13.527  5.896   200.581 1.00 42.03  ? 213  ARG A NH2   1 
ATOM   2761  N  N     . ASP E 2 213 ? 10.415  9.584   206.745 1.00 34.85  ? 214  ASP A N     1 
ATOM   2762  C  CA    . ASP E 2 213 ? 10.146  9.242   208.150 1.00 38.34  ? 214  ASP A CA    1 
ATOM   2763  C  C     . ASP E 2 213 ? 9.535   10.375  208.993 1.00 41.07  ? 214  ASP A C     1 
ATOM   2764  O  O     . ASP E 2 213 ? 9.254   10.191  210.182 1.00 34.87  ? 214  ASP A O     1 
ATOM   2765  C  CB    . ASP E 2 213 ? 11.439  8.800   208.843 1.00 41.51  ? 214  ASP A CB    1 
ATOM   2766  C  CG    . ASP E 2 213 ? 12.270  7.883   207.995 1.00 54.76  ? 214  ASP A CG    1 
ATOM   2767  O  OD1   . ASP E 2 213 ? 13.430  7.595   208.383 1.00 58.18  ? 214  ASP A OD1   1 
ATOM   2768  O  OD2   . ASP E 2 213 ? 11.765  7.449   206.940 1.00 66.40  ? 214  ASP A OD2   1 
ATOM   2769  N  N     . LEU E 2 214 ? 9.349   11.552  208.410 1.00 38.83  ? 215  LEU A N     1 
ATOM   2770  C  CA    . LEU E 2 214 ? 8.800   12.642  209.197 1.00 38.50  ? 215  LEU A CA    1 
ATOM   2771  C  C     . LEU E 2 214 ? 7.362   12.368  209.590 1.00 44.02  ? 215  LEU A C     1 
ATOM   2772  O  O     . LEU E 2 214 ? 6.514   12.046  208.745 1.00 46.66  ? 215  LEU A O     1 
ATOM   2773  C  CB    . LEU E 2 214 ? 8.887   13.973  208.434 1.00 35.37  ? 215  LEU A CB    1 
ATOM   2774  C  CG    . LEU E 2 214 ? 8.429   15.250  209.170 1.00 21.02  ? 215  LEU A CG    1 
ATOM   2775  C  CD1   . LEU E 2 214 ? 9.284   15.520  210.382 1.00 18.60  ? 215  LEU A CD1   1 
ATOM   2776  C  CD2   . LEU E 2 214 ? 8.500   16.417  208.213 1.00 16.20  ? 215  LEU A CD2   1 
ATOM   2777  N  N     . ASP E 2 215 ? 7.102   12.476  210.888 1.00 44.00  ? 216  ASP A N     1 
ATOM   2778  C  CA    . ASP E 2 215 ? 5.764   12.277  211.418 1.00 42.31  ? 216  ASP A CA    1 
ATOM   2779  C  C     . ASP E 2 215 ? 4.922   13.489  211.044 1.00 43.36  ? 216  ASP A C     1 
ATOM   2780  O  O     . ASP E 2 215 ? 5.450   14.575  210.788 1.00 46.09  ? 216  ASP A O     1 
ATOM   2781  C  CB    . ASP E 2 215 ? 5.817   12.091  212.939 1.00 50.70  ? 216  ASP A CB    1 
ATOM   2782  C  CG    . ASP E 2 215 ? 6.845   12.987  213.608 1.00 61.27  ? 216  ASP A CG    1 
ATOM   2783  O  OD1   . ASP E 2 215 ? 6.634   14.215  213.631 1.00 68.84  ? 216  ASP A OD1   1 
ATOM   2784  O  OD2   . ASP E 2 215 ? 7.864   12.458  214.111 1.00 57.86  ? 216  ASP A OD2   1 
ATOM   2785  N  N     . GLN E 2 216 ? 3.610   13.299  211.000 1.00 44.74  ? 217  GLN A N     1 
ATOM   2786  C  CA    . GLN E 2 216 ? 2.700   14.369  210.614 1.00 43.48  ? 217  GLN A CA    1 
ATOM   2787  C  C     . GLN E 2 216 ? 1.422   14.370  211.453 1.00 46.51  ? 217  GLN A C     1 
ATOM   2788  O  O     . GLN E 2 216 ? 0.325   14.506  210.910 1.00 51.69  ? 217  GLN A O     1 
ATOM   2789  C  CB    . GLN E 2 216 ? 2.342   14.206  209.134 1.00 31.51  ? 217  GLN A CB    1 
ATOM   2790  C  CG    . GLN E 2 216 ? 3.544   14.129  208.207 1.00 36.64  ? 217  GLN A CG    1 
ATOM   2791  C  CD    . GLN E 2 216 ? 3.769   15.410  207.420 1.00 39.48  ? 217  GLN A CD    1 
ATOM   2792  O  OE1   . GLN E 2 216 ? 3.008   15.740  206.512 1.00 32.42  ? 217  GLN A OE1   1 
ATOM   2793  N  NE2   . GLN E 2 216 ? 4.821   16.136  207.766 1.00 39.33  ? 217  GLN A NE2   1 
ATOM   2794  N  N     . GLY E 2 217 ? 1.556   14.241  212.770 1.00 47.91  ? 218  GLY A N     1 
ATOM   2795  C  CA    . GLY E 2 217 ? 0.373   14.201  213.612 1.00 50.06  ? 218  GLY A CA    1 
ATOM   2796  C  C     . GLY E 2 217 ? 0.187   15.360  214.559 1.00 49.02  ? 218  GLY A C     1 
ATOM   2797  O  O     . GLY E 2 217 ? -0.237  15.164  215.698 1.00 55.96  ? 218  GLY A O     1 
ATOM   2798  N  N     . PHE E 2 218 ? 0.494   16.565  214.092 1.00 47.40  ? 219  PHE A N     1 
ATOM   2799  C  CA    . PHE E 2 218 ? 0.360   17.752  214.919 1.00 49.43  ? 219  PHE A CA    1 
ATOM   2800  C  C     . PHE E 2 218 ? -1.058  18.300  214.787 1.00 52.00  ? 219  PHE A C     1 
ATOM   2801  O  O     . PHE E 2 218 ? -1.461  18.749  213.718 1.00 58.70  ? 219  PHE A O     1 
ATOM   2802  C  CB    . PHE E 2 218 ? 1.395   18.807  214.499 1.00 38.00  ? 219  PHE A CB    1 
ATOM   2803  C  CG    . PHE E 2 218 ? 1.465   19.981  215.435 1.00 23.22  ? 219  PHE A CG    1 
ATOM   2804  C  CD1   . PHE E 2 218 ? 1.974   19.835  216.709 1.00 16.46  ? 219  PHE A CD1   1 
ATOM   2805  C  CD2   . PHE E 2 218 ? 0.951   21.213  215.062 1.00 27.07  ? 219  PHE A CD2   1 
ATOM   2806  C  CE1   . PHE E 2 218 ? 1.945   20.895  217.613 1.00 31.29  ? 219  PHE A CE1   1 
ATOM   2807  C  CE2   . PHE E 2 218 ? 0.919   22.275  215.963 1.00 28.00  ? 219  PHE A CE2   1 
ATOM   2808  C  CZ    . PHE E 2 218 ? 1.420   22.116  217.235 1.00 20.33  ? 219  PHE A CZ    1 
ATOM   2809  N  N     . ASN E 2 219 ? -1.809  18.259  215.887 1.00 65.26  ? 220  ASN A N     1 
ATOM   2810  C  CA    . ASN E 2 219 ? -3.197  18.725  215.913 1.00 65.51  ? 220  ASN A CA    1 
ATOM   2811  C  C     . ASN E 2 219 ? -3.335  20.170  216.386 1.00 65.15  ? 220  ASN A C     1 
ATOM   2812  O  O     . ASN E 2 219 ? -4.391  20.777  216.203 1.00 69.60  ? 220  ASN A O     1 
ATOM   2813  C  CB    . ASN E 2 219 ? -4.037  17.827  216.830 1.00 67.54  ? 220  ASN A CB    1 
ATOM   2814  C  CG    . ASN E 2 219 ? -3.697  18.019  218.305 1.00 72.61  ? 220  ASN A CG    1 
ATOM   2815  O  OD1   . ASN E 2 219 ? -2.572  17.761  218.732 1.00 64.42  ? 220  ASN A OD1   1 
ATOM   2816  N  ND2   . ASN E 2 219 ? -4.672  18.486  219.087 1.00 78.31  ? 220  ASN A ND2   1 
ATOM   2817  N  N     . GLY E 2 220 ? -2.285  20.710  217.007 1.00 60.72  ? 221  GLY A N     1 
ATOM   2818  C  CA    . GLY E 2 220 ? -2.331  22.082  217.499 1.00 51.17  ? 221  GLY A CA    1 
ATOM   2819  C  C     . GLY E 2 220 ? -2.442  23.123  216.397 1.00 41.75  ? 221  GLY A C     1 
ATOM   2820  O  O     . GLY E 2 220 ? -2.420  22.790  215.215 1.00 47.07  ? 221  GLY A O     1 
ATOM   2821  N  N     . THR E 2 221 ? -2.561  24.390  216.770 1.00 34.47  ? 222  THR A N     1 
ATOM   2822  C  CA    . THR E 2 221 ? -2.666  25.444  215.766 1.00 39.87  ? 222  THR A CA    1 
ATOM   2823  C  C     . THR E 2 221 ? -1.287  25.891  215.273 1.00 45.42  ? 222  THR A C     1 
ATOM   2824  O  O     . THR E 2 221 ? -0.262  25.452  215.796 1.00 45.83  ? 222  THR A O     1 
ATOM   2825  C  CB    . THR E 2 221 ? -3.401  26.657  216.323 1.00 42.43  ? 222  THR A CB    1 
ATOM   2826  O  OG1   . THR E 2 221 ? -3.511  27.651  215.301 1.00 53.46  ? 222  THR A OG1   1 
ATOM   2827  C  CG2   . THR E 2 221 ? -2.644  27.235  217.496 1.00 41.51  ? 222  THR A CG2   1 
ATOM   2828  N  N     . ARG E 2 222 ? -1.255  26.761  214.266 1.00 47.36  ? 223  ARG A N     1 
ATOM   2829  C  CA    . ARG E 2 222 ? 0.018   27.239  213.727 1.00 47.50  ? 223  ARG A CA    1 
ATOM   2830  C  C     . ARG E 2 222 ? 0.774   28.062  214.754 1.00 49.42  ? 223  ARG A C     1 
ATOM   2831  O  O     . ARG E 2 222 ? 1.980   27.890  214.930 1.00 41.56  ? 223  ARG A O     1 
ATOM   2832  C  CB    . ARG E 2 222 ? -0.203  28.070  212.457 1.00 43.04  ? 223  ARG A CB    1 
ATOM   2833  C  CG    . ARG E 2 222 ? 1.080   28.643  211.836 1.00 49.83  ? 223  ARG A CG    1 
ATOM   2834  C  CD    . ARG E 2 222 ? 2.203   27.602  211.749 1.00 47.50  ? 223  ARG A CD    1 
ATOM   2835  N  NE    . ARG E 2 222 ? 1.706   26.323  211.263 1.00 47.05  ? 223  ARG A NE    1 
ATOM   2836  C  CZ    . ARG E 2 222 ? 1.312   26.095  210.016 1.00 56.99  ? 223  ARG A CZ    1 
ATOM   2837  N  NH1   . ARG E 2 222 ? 1.367   27.065  209.109 1.00 40.63  ? 223  ARG A NH1   1 
ATOM   2838  N  NH2   . ARG E 2 222 ? 0.837   24.897  209.685 1.00 65.65  ? 223  ARG A NH2   1 
ATOM   2839  N  N     . GLU E 2 223 ? 0.059   28.959  215.427 1.00 55.78  ? 224  GLU A N     1 
ATOM   2840  C  CA    . GLU E 2 223 ? 0.663   29.806  216.449 1.00 56.62  ? 224  GLU A CA    1 
ATOM   2841  C  C     . GLU E 2 223 ? 1.269   28.920  217.520 1.00 48.87  ? 224  GLU A C     1 
ATOM   2842  O  O     . GLU E 2 223 ? 2.304   29.251  218.088 1.00 50.34  ? 224  GLU A O     1 
ATOM   2843  C  CB    . GLU E 2 223 ? -0.393  30.721  217.071 1.00 68.29  ? 224  GLU A CB    1 
ATOM   2844  C  CG    . GLU E 2 223 ? 0.164   31.713  218.077 1.00 75.97  ? 224  GLU A CG    1 
ATOM   2845  C  CD    . GLU E 2 223 ? -0.902  32.636  218.638 1.00 86.97  ? 224  GLU A CD    1 
ATOM   2846  O  OE1   . GLU E 2 223 ? -0.553  33.523  219.447 1.00 94.68  ? 224  GLU A OE1   1 
ATOM   2847  O  OE2   . GLU E 2 223 ? -2.088  32.476  218.273 1.00 91.19  ? 224  GLU A OE2   1 
ATOM   2848  N  N     . GLU E 2 224 ? 0.612   27.795  217.787 1.00 45.80  ? 225  GLU A N     1 
ATOM   2849  C  CA    . GLU E 2 224 ? 1.080   26.837  218.783 1.00 49.19  ? 225  GLU A CA    1 
ATOM   2850  C  C     . GLU E 2 224 ? 2.346   26.136  218.320 1.00 44.80  ? 225  GLU A C     1 
ATOM   2851  O  O     . GLU E 2 224 ? 3.121   25.648  219.134 1.00 51.11  ? 225  GLU A O     1 
ATOM   2852  C  CB    . GLU E 2 224 ? -0.001  25.792  219.061 1.00 50.88  ? 225  GLU A CB    1 
ATOM   2853  C  CG    . GLU E 2 224 ? -1.026  26.226  220.090 1.00 67.39  ? 225  GLU A CG    1 
ATOM   2854  C  CD    . GLU E 2 224 ? -2.263  25.337  220.111 1.00 72.91  ? 225  GLU A CD    1 
ATOM   2855  O  OE1   . GLU E 2 224 ? -2.122  24.101  220.239 1.00 68.19  ? 225  GLU A OE1   1 
ATOM   2856  O  OE2   . GLU E 2 224 ? -3.383  25.885  220.007 1.00 83.34  ? 225  GLU A OE2   1 
ATOM   2857  N  N     . TRP E 2 225 ? 2.551   26.085  217.009 1.00 47.49  ? 226  TRP A N     1 
ATOM   2858  C  CA    . TRP E 2 225 ? 3.730   25.439  216.454 1.00 46.06  ? 226  TRP A CA    1 
ATOM   2859  C  C     . TRP E 2 225 ? 4.938   26.335  216.736 1.00 47.40  ? 226  TRP A C     1 
ATOM   2860  O  O     . TRP E 2 225 ? 5.859   25.948  217.449 1.00 46.29  ? 226  TRP A O     1 
ATOM   2861  C  CB    . TRP E 2 225 ? 3.557   25.239  214.943 1.00 52.35  ? 226  TRP A CB    1 
ATOM   2862  C  CG    . TRP E 2 225 ? 4.430   24.153  214.351 1.00 59.95  ? 226  TRP A CG    1 
ATOM   2863  C  CD1   . TRP E 2 225 ? 4.080   22.853  214.112 1.00 60.01  ? 226  TRP A CD1   1 
ATOM   2864  C  CD2   . TRP E 2 225 ? 5.802   24.276  213.959 1.00 64.80  ? 226  TRP A CD2   1 
ATOM   2865  N  NE1   . TRP E 2 225 ? 5.147   22.159  213.594 1.00 56.12  ? 226  TRP A NE1   1 
ATOM   2866  C  CE2   . TRP E 2 225 ? 6.218   23.010  213.486 1.00 66.43  ? 226  TRP A CE2   1 
ATOM   2867  C  CE3   . TRP E 2 225 ? 6.721   25.336  213.952 1.00 60.47  ? 226  TRP A CE3   1 
ATOM   2868  C  CZ2   . TRP E 2 225 ? 7.520   22.772  213.023 1.00 68.60  ? 226  TRP A CZ2   1 
ATOM   2869  C  CZ3   . TRP E 2 225 ? 8.012   25.098  213.493 1.00 63.75  ? 226  TRP A CZ3   1 
ATOM   2870  C  CH2   . TRP E 2 225 ? 8.396   23.827  213.031 1.00 63.63  ? 226  TRP A CH2   1 
ATOM   2871  N  N     . ALA E 2 226 ? 4.911   27.545  216.190 1.00 48.90  ? 227  ALA A N     1 
ATOM   2872  C  CA    . ALA E 2 226 ? 5.996   28.504  216.366 1.00 54.18  ? 227  ALA A CA    1 
ATOM   2873  C  C     . ALA E 2 226 ? 6.488   28.552  217.799 1.00 53.95  ? 227  ALA A C     1 
ATOM   2874  O  O     . ALA E 2 226 ? 7.639   28.208  218.094 1.00 65.08  ? 227  ALA A O     1 
ATOM   2875  C  CB    . ALA E 2 226 ? 5.542   29.890  215.932 1.00 47.24  ? 227  ALA A CB    1 
ATOM   2876  N  N     . LYS E 2 227 ? 5.605   28.988  218.686 1.00 53.16  ? 228  LYS A N     1 
ATOM   2877  C  CA    . LYS E 2 227 ? 5.924   29.104  220.098 1.00 48.97  ? 228  LYS A CA    1 
ATOM   2878  C  C     . LYS E 2 227 ? 6.502   27.805  220.643 1.00 50.27  ? 228  LYS A C     1 
ATOM   2879  O  O     . LYS E 2 227 ? 7.372   27.817  221.511 1.00 56.54  ? 228  LYS A O     1 
ATOM   2880  C  CB    . LYS E 2 227 ? 4.668   29.482  220.893 1.00 46.68  ? 228  LYS A CB    1 
ATOM   2881  N  N     . SER E 2 228 ? 6.032   26.675  220.136 1.00 42.13  ? 229  SER A N     1 
ATOM   2882  C  CA    . SER E 2 228 ? 6.536   25.415  220.644 1.00 37.12  ? 229  SER A CA    1 
ATOM   2883  C  C     . SER E 2 228 ? 7.950   25.131  220.152 1.00 37.40  ? 229  SER A C     1 
ATOM   2884  O  O     . SER E 2 228 ? 8.789   24.653  220.909 1.00 42.27  ? 229  SER A O     1 
ATOM   2885  C  CB    . SER E 2 228 ? 5.595   24.281  220.251 1.00 33.43  ? 229  SER A CB    1 
ATOM   2886  O  OG    . SER E 2 228 ? 6.051   23.044  220.779 1.00 52.16  ? 229  SER A OG    1 
ATOM   2887  N  N     . TYR E 2 229 ? 8.210   25.440  218.888 1.00 34.45  ? 230  TYR A N     1 
ATOM   2888  C  CA    . TYR E 2 229 ? 9.518   25.199  218.292 1.00 46.14  ? 230  TYR A CA    1 
ATOM   2889  C  C     . TYR E 2 229 ? 10.585  26.095  218.894 1.00 53.64  ? 230  TYR A C     1 
ATOM   2890  O  O     . TYR E 2 229 ? 11.705  25.663  219.194 1.00 47.45  ? 230  TYR A O     1 
ATOM   2891  C  CB    . TYR E 2 229 ? 9.458   25.450  216.789 1.00 47.07  ? 230  TYR A CB    1 
ATOM   2892  C  CG    . TYR E 2 229 ? 10.820  25.491  216.150 1.00 38.11  ? 230  TYR A CG    1 
ATOM   2893  C  CD1   . TYR E 2 229 ? 11.573  24.334  215.993 1.00 38.47  ? 230  TYR A CD1   1 
ATOM   2894  C  CD2   . TYR E 2 229 ? 11.375  26.696  215.744 1.00 48.16  ? 230  TYR A CD2   1 
ATOM   2895  C  CE1   . TYR E 2 229 ? 12.853  24.380  215.449 1.00 45.23  ? 230  TYR A CE1   1 
ATOM   2896  C  CE2   . TYR E 2 229 ? 12.648  26.752  215.203 1.00 52.17  ? 230  TYR A CE2   1 
ATOM   2897  C  CZ    . TYR E 2 229 ? 13.382  25.596  215.061 1.00 43.19  ? 230  TYR A CZ    1 
ATOM   2898  O  OH    . TYR E 2 229 ? 14.651  25.678  214.564 1.00 36.81  ? 230  TYR A OH    1 
ATOM   2899  N  N     . LEU E 2 230 ? 10.223  27.361  219.049 1.00 51.31  ? 231  LEU A N     1 
ATOM   2900  C  CA    . LEU E 2 230 ? 11.131  28.340  219.605 1.00 44.65  ? 231  LEU A CA    1 
ATOM   2901  C  C     . LEU E 2 230 ? 11.601  27.856  220.977 1.00 44.89  ? 231  LEU A C     1 
ATOM   2902  O  O     . LEU E 2 230 ? 12.743  28.081  221.361 1.00 48.90  ? 231  LEU A O     1 
ATOM   2903  C  CB    . LEU E 2 230 ? 10.425  29.695  219.679 1.00 29.59  ? 231  LEU A CB    1 
ATOM   2904  C  CG    . LEU E 2 230 ? 11.200  30.963  219.275 1.00 39.31  ? 231  LEU A CG    1 
ATOM   2905  C  CD1   . LEU E 2 230 ? 12.193  30.692  218.169 1.00 22.74  ? 231  LEU A CD1   1 
ATOM   2906  C  CD2   . LEU E 2 230 ? 10.185  32.025  218.831 1.00 40.29  ? 231  LEU A CD2   1 
ATOM   2907  N  N     . LYS E 2 231 ? 10.736  27.160  221.708 1.00 49.21  ? 232  LYS A N     1 
ATOM   2908  C  CA    . LYS E 2 231 ? 11.126  26.658  223.019 1.00 49.16  ? 232  LYS A CA    1 
ATOM   2909  C  C     . LYS E 2 231 ? 12.118  25.514  222.830 1.00 50.74  ? 232  LYS A C     1 
ATOM   2910  O  O     . LYS E 2 231 ? 13.121  25.410  223.539 1.00 48.02  ? 232  LYS A O     1 
ATOM   2911  C  CB    . LYS E 2 231 ? 9.904   26.166  223.800 1.00 52.59  ? 232  LYS A CB    1 
ATOM   2912  C  CG    . LYS E 2 231 ? 10.233  25.602  225.187 1.00 64.58  ? 232  LYS A CG    1 
ATOM   2913  C  CD    . LYS E 2 231 ? 8.989   25.069  225.899 1.00 75.44  ? 232  LYS A CD    1 
ATOM   2914  C  CE    . LYS E 2 231 ? 7.977   26.183  226.186 1.00 88.70  ? 232  LYS A CE    1 
ATOM   2915  N  NZ    . LYS E 2 231 ? 6.846   25.749  227.074 1.00 86.38  ? 232  LYS A NZ    1 
ATOM   2916  N  N     . HIS E 2 232 ? 11.843  24.660  221.855 1.00 47.45  ? 233  HIS A N     1 
ATOM   2917  C  CA    . HIS E 2 232 ? 12.720  23.536  221.597 1.00 52.72  ? 233  HIS A CA    1 
ATOM   2918  C  C     . HIS E 2 232 ? 14.124  24.025  221.205 1.00 53.62  ? 233  HIS A C     1 
ATOM   2919  O  O     . HIS E 2 232 ? 15.132  23.500  221.671 1.00 62.40  ? 233  HIS A O     1 
ATOM   2920  C  CB    . HIS E 2 232 ? 12.130  22.664  220.487 1.00 40.96  ? 233  HIS A CB    1 
ATOM   2921  C  CG    . HIS E 2 232 ? 13.021  21.533  220.086 1.00 40.53  ? 233  HIS A CG    1 
ATOM   2922  N  ND1   . HIS E 2 232 ? 13.422  20.558  220.969 1.00 34.62  ? 233  HIS A ND1   1 
ATOM   2923  C  CD2   . HIS E 2 232 ? 13.626  21.246  218.908 1.00 46.18  ? 233  HIS A CD2   1 
ATOM   2924  C  CE1   . HIS E 2 232 ? 14.235  19.715  220.357 1.00 43.33  ? 233  HIS A CE1   1 
ATOM   2925  N  NE2   . HIS E 2 232 ? 14.375  20.110  219.105 1.00 45.47  ? 233  HIS A NE2   1 
ATOM   2926  N  N     . PHE E 2 233 ? 14.169  25.038  220.351 1.00 46.39  ? 234  PHE A N     1 
ATOM   2927  C  CA    . PHE E 2 233 ? 15.416  25.617  219.879 1.00 35.55  ? 234  PHE A CA    1 
ATOM   2928  C  C     . PHE E 2 233 ? 16.293  26.076  221.038 1.00 44.69  ? 234  PHE A C     1 
ATOM   2929  O  O     . PHE E 2 233 ? 17.430  25.623  221.196 1.00 39.97  ? 234  PHE A O     1 
ATOM   2930  C  CB    . PHE E 2 233 ? 15.081  26.789  218.965 1.00 39.53  ? 234  PHE A CB    1 
ATOM   2931  C  CG    . PHE E 2 233 ? 16.257  27.386  218.282 1.00 35.80  ? 234  PHE A CG    1 
ATOM   2932  C  CD1   . PHE E 2 233 ? 17.161  28.165  218.979 1.00 47.61  ? 234  PHE A CD1   1 
ATOM   2933  C  CD2   . PHE E 2 233 ? 16.450  27.189  216.923 1.00 44.44  ? 234  PHE A CD2   1 
ATOM   2934  C  CE1   . PHE E 2 233 ? 18.246  28.741  218.330 1.00 47.30  ? 234  PHE A CE1   1 
ATOM   2935  C  CE2   . PHE E 2 233 ? 17.530  27.757  216.265 1.00 34.45  ? 234  PHE A CE2   1 
ATOM   2936  C  CZ    . PHE E 2 233 ? 18.426  28.535  216.969 1.00 44.35  ? 234  PHE A CZ    1 
ATOM   2937  N  N     . VAL E 2 234 ? 15.760  26.977  221.856 1.00 50.62  ? 235  VAL A N     1 
ATOM   2938  C  CA    . VAL E 2 234 ? 16.491  27.506  223.008 1.00 43.09  ? 235  VAL A CA    1 
ATOM   2939  C  C     . VAL E 2 234 ? 17.031  26.369  223.856 1.00 35.82  ? 235  VAL A C     1 
ATOM   2940  O  O     . VAL E 2 234 ? 18.207  26.320  224.159 1.00 25.54  ? 235  VAL A O     1 
ATOM   2941  C  CB    . VAL E 2 234 ? 15.577  28.374  223.905 1.00 44.02  ? 235  VAL A CB    1 
ATOM   2942  C  CG1   . VAL E 2 234 ? 16.355  28.855  225.124 1.00 46.13  ? 235  VAL A CG1   1 
ATOM   2943  C  CG2   . VAL E 2 234 ? 15.020  29.549  223.118 1.00 33.55  ? 235  VAL A CG2   1 
ATOM   2944  N  N     . THR E 2 235 ? 16.162  25.453  224.246 1.00 38.76  ? 236  THR A N     1 
ATOM   2945  C  CA    . THR E 2 235 ? 16.606  24.353  225.072 1.00 41.50  ? 236  THR A CA    1 
ATOM   2946  C  C     . THR E 2 235 ? 17.790  23.668  224.423 1.00 42.32  ? 236  THR A C     1 
ATOM   2947  O  O     . THR E 2 235 ? 18.838  23.504  225.045 1.00 43.42  ? 236  THR A O     1 
ATOM   2948  C  CB    . THR E 2 235 ? 15.482  23.360  225.281 1.00 44.53  ? 236  THR A CB    1 
ATOM   2949  O  OG1   . THR E 2 235 ? 14.372  24.040  225.876 1.00 52.57  ? 236  THR A OG1   1 
ATOM   2950  C  CG2   . THR E 2 235 ? 15.927  22.231  226.184 1.00 43.52  ? 236  THR A CG2   1 
ATOM   2951  N  N     . GLN E 2 236 ? 17.637  23.280  223.164 1.00 47.42  ? 237  GLN A N     1 
ATOM   2952  C  CA    . GLN E 2 236 ? 18.729  22.618  222.463 1.00 54.73  ? 237  GLN A CA    1 
ATOM   2953  C  C     . GLN E 2 236 ? 19.968  23.507  222.395 1.00 51.88  ? 237  GLN A C     1 
ATOM   2954  O  O     . GLN E 2 236 ? 21.089  23.010  222.475 1.00 55.49  ? 237  GLN A O     1 
ATOM   2955  C  CB    . GLN E 2 236 ? 18.297  22.216  221.054 1.00 60.04  ? 237  GLN A CB    1 
ATOM   2956  C  CG    . GLN E 2 236 ? 17.177  21.187  221.029 1.00 58.55  ? 237  GLN A CG    1 
ATOM   2957  C  CD    . GLN E 2 236 ? 17.374  20.091  222.061 1.00 52.38  ? 237  GLN A CD    1 
ATOM   2958  O  OE1   . GLN E 2 236 ? 17.034  20.263  223.233 1.00 38.54  ? 237  GLN A OE1   1 
ATOM   2959  N  NE2   . GLN E 2 236 ? 17.936  18.963  221.632 1.00 49.16  ? 237  GLN A NE2   1 
ATOM   2960  N  N     . ALA E 2 237 ? 19.772  24.814  222.242 1.00 42.11  ? 238  ALA A N     1 
ATOM   2961  C  CA    . ALA E 2 237 ? 20.908  25.722  222.190 1.00 39.13  ? 238  ALA A CA    1 
ATOM   2962  C  C     . ALA E 2 237 ? 21.661  25.684  223.513 1.00 41.05  ? 238  ALA A C     1 
ATOM   2963  O  O     . ALA E 2 237 ? 22.889  25.656  223.527 1.00 49.14  ? 238  ALA A O     1 
ATOM   2964  C  CB    . ALA E 2 237 ? 20.456  27.139  221.894 1.00 32.29  ? 238  ALA A CB    1 
ATOM   2965  N  N     . GLU E 2 238 ? 20.931  25.675  224.623 1.00 39.01  ? 239  GLU A N     1 
ATOM   2966  C  CA    . GLU E 2 238 ? 21.571  25.637  225.928 1.00 44.32  ? 239  GLU A CA    1 
ATOM   2967  C  C     . GLU E 2 238 ? 22.322  24.310  226.051 1.00 47.70  ? 239  GLU A C     1 
ATOM   2968  O  O     . GLU E 2 238 ? 23.540  24.289  226.278 1.00 40.31  ? 239  GLU A O     1 
ATOM   2969  C  CB    . GLU E 2 238 ? 20.526  25.771  227.044 1.00 56.50  ? 239  GLU A CB    1 
ATOM   2970  C  CG    . GLU E 2 238 ? 19.715  27.079  227.008 1.00 66.38  ? 239  GLU A CG    1 
ATOM   2971  C  CD    . GLU E 2 238 ? 18.510  27.070  227.959 1.00 72.21  ? 239  GLU A CD    1 
ATOM   2972  O  OE1   . GLU E 2 238 ? 17.600  26.232  227.772 1.00 71.28  ? 239  GLU A OE1   1 
ATOM   2973  O  OE2   . GLU E 2 238 ? 18.470  27.903  228.892 1.00 75.98  ? 239  GLU A OE2   1 
ATOM   2974  N  N     . GLN E 2 239 ? 21.595  23.208  225.877 1.00 40.73  ? 240  GLN A N     1 
ATOM   2975  C  CA    . GLN E 2 239 ? 22.186  21.879  225.962 1.00 41.09  ? 240  GLN A CA    1 
ATOM   2976  C  C     . GLN E 2 239 ? 23.451  21.785  225.108 1.00 41.01  ? 240  GLN A C     1 
ATOM   2977  O  O     . GLN E 2 239 ? 24.456  21.220  225.531 1.00 42.20  ? 240  GLN A O     1 
ATOM   2978  C  CB    . GLN E 2 239 ? 21.179  20.819  225.505 1.00 45.43  ? 240  GLN A CB    1 
ATOM   2979  C  CG    . GLN E 2 239 ? 21.734  19.401  225.508 1.00 69.31  ? 240  GLN A CG    1 
ATOM   2980  C  CD    . GLN E 2 239 ? 22.097  18.914  226.903 1.00 85.42  ? 240  GLN A CD    1 
ATOM   2981  O  OE1   . GLN E 2 239 ? 22.823  17.926  227.061 1.00 93.90  ? 240  GLN A OE1   1 
ATOM   2982  N  NE2   . GLN E 2 239 ? 21.585  19.600  227.924 1.00 83.06  ? 240  GLN A NE2   1 
ATOM   2983  N  N     . ARG E 2 240 ? 23.395  22.340  223.904 1.00 36.99  ? 241  ARG A N     1 
ATOM   2984  C  CA    . ARG E 2 240 ? 24.534  22.312  223.010 1.00 42.11  ? 241  ARG A CA    1 
ATOM   2985  C  C     . ARG E 2 240 ? 25.695  23.109  223.582 1.00 43.75  ? 241  ARG A C     1 
ATOM   2986  O  O     . ARG E 2 240 ? 26.851  22.749  223.397 1.00 41.61  ? 241  ARG A O     1 
ATOM   2987  C  CB    . ARG E 2 240 ? 24.152  22.888  221.648 1.00 51.35  ? 241  ARG A CB    1 
ATOM   2988  C  CG    . ARG E 2 240 ? 25.336  23.089  220.708 1.00 46.29  ? 241  ARG A CG    1 
ATOM   2989  C  CD    . ARG E 2 240 ? 25.946  21.778  220.257 1.00 36.51  ? 241  ARG A CD    1 
ATOM   2990  N  NE    . ARG E 2 240 ? 27.070  22.017  219.352 1.00 49.04  ? 241  ARG A NE    1 
ATOM   2991  C  CZ    . ARG E 2 240 ? 27.721  21.068  218.686 1.00 45.00  ? 241  ARG A CZ    1 
ATOM   2992  N  NH1   . ARG E 2 240 ? 27.370  19.792  218.808 1.00 41.04  ? 241  ARG A NH1   1 
ATOM   2993  N  NH2   . ARG E 2 240 ? 28.725  21.400  217.894 1.00 39.66  ? 241  ARG A NH2   1 
ATOM   2994  N  N     . ALA E 2 241 ? 25.381  24.203  224.268 1.00 52.39  ? 242  ALA A N     1 
ATOM   2995  C  CA    . ALA E 2 241 ? 26.408  25.053  224.868 1.00 51.25  ? 242  ALA A CA    1 
ATOM   2996  C  C     . ALA E 2 241 ? 27.267  24.227  225.804 1.00 47.95  ? 242  ALA A C     1 
ATOM   2997  O  O     . ALA E 2 241 ? 28.493  24.285  225.754 1.00 44.64  ? 242  ALA A O     1 
ATOM   2998  C  CB    . ALA E 2 241 ? 25.761  26.189  225.631 1.00 53.44  ? 242  ALA A CB    1 
ATOM   2999  N  N     . ILE E 2 242 ? 26.607  23.458  226.658 1.00 48.47  ? 243  ILE A N     1 
ATOM   3000  C  CA    . ILE E 2 242 ? 27.305  22.611  227.603 1.00 54.71  ? 243  ILE A CA    1 
ATOM   3001  C  C     . ILE E 2 242 ? 28.087  21.528  226.866 1.00 51.93  ? 243  ILE A C     1 
ATOM   3002  O  O     . ILE E 2 242 ? 29.314  21.483  226.940 1.00 56.40  ? 243  ILE A O     1 
ATOM   3003  C  CB    . ILE E 2 242 ? 26.319  21.935  228.578 1.00 58.52  ? 243  ILE A CB    1 
ATOM   3004  C  CG1   . ILE E 2 242 ? 25.606  22.990  229.436 1.00 52.61  ? 243  ILE A CG1   1 
ATOM   3005  C  CG2   . ILE E 2 242 ? 27.061  20.929  229.444 1.00 62.95  ? 243  ILE A CG2   1 
ATOM   3006  C  CD1   . ILE E 2 242 ? 26.496  23.696  230.444 1.00 54.68  ? 243  ILE A CD1   1 
ATOM   3007  N  N     . SER E 2 243 ? 27.377  20.663  226.149 1.00 52.44  ? 244  SER A N     1 
ATOM   3008  C  CA    . SER E 2 243 ? 28.024  19.580  225.419 1.00 55.34  ? 244  SER A CA    1 
ATOM   3009  C  C     . SER E 2 243 ? 29.223  20.059  224.605 1.00 54.73  ? 244  SER A C     1 
ATOM   3010  O  O     . SER E 2 243 ? 30.227  19.356  224.514 1.00 64.24  ? 244  SER A O     1 
ATOM   3011  C  CB    . SER E 2 243 ? 27.016  18.859  224.512 1.00 48.13  ? 244  SER A CB    1 
ATOM   3012  O  OG    . SER E 2 243 ? 26.466  19.725  223.538 1.00 57.94  ? 244  SER A OG    1 
ATOM   3013  N  N     . MET E 2 244 ? 29.129  21.252  224.026 1.00 52.29  ? 245  MET A N     1 
ATOM   3014  C  CA    . MET E 2 244 ? 30.230  21.797  223.231 1.00 51.96  ? 245  MET A CA    1 
ATOM   3015  C  C     . MET E 2 244 ? 31.521  21.887  224.029 1.00 45.77  ? 245  MET A C     1 
ATOM   3016  O  O     . MET E 2 244 ? 32.600  21.626  223.504 1.00 33.24  ? 245  MET A O     1 
ATOM   3017  C  CB    . MET E 2 244 ? 29.891  23.197  222.704 1.00 55.55  ? 245  MET A CB    1 
ATOM   3018  C  CG    . MET E 2 244 ? 29.431  23.224  221.255 1.00 55.31  ? 245  MET A CG    1 
ATOM   3019  S  SD    . MET E 2 244 ? 29.661  24.839  220.493 1.00 54.13  ? 245  MET A SD    1 
ATOM   3020  C  CE    . MET E 2 244 ? 31.452  24.821  220.183 1.00 47.35  ? 245  MET A CE    1 
ATOM   3021  N  N     . ILE E 2 245 ? 31.395  22.268  225.295 1.00 44.33  ? 246  ILE A N     1 
ATOM   3022  C  CA    . ILE E 2 245 ? 32.541  22.407  226.169 1.00 49.19  ? 246  ILE A CA    1 
ATOM   3023  C  C     . ILE E 2 245 ? 32.979  21.038  226.651 1.00 51.55  ? 246  ILE A C     1 
ATOM   3024  O  O     . ILE E 2 245 ? 34.171  20.769  226.820 1.00 53.93  ? 246  ILE A O     1 
ATOM   3025  C  CB    . ILE E 2 245 ? 32.203  23.278  227.395 1.00 56.51  ? 246  ILE A CB    1 
ATOM   3026  C  CG1   . ILE E 2 245 ? 31.705  24.649  226.941 1.00 65.15  ? 246  ILE A CG1   1 
ATOM   3027  C  CG2   . ILE E 2 245 ? 33.432  23.466  228.263 1.00 51.95  ? 246  ILE A CG2   1 
ATOM   3028  C  CD1   . ILE E 2 245 ? 31.210  25.523  228.078 1.00 76.83  ? 246  ILE A CD1   1 
ATOM   3029  N  N     . ASP E 2 246 ? 32.010  20.159  226.853 1.00 48.57  ? 247  ASP A N     1 
ATOM   3030  C  CA    . ASP E 2 246 ? 32.322  18.824  227.332 1.00 53.91  ? 247  ASP A CA    1 
ATOM   3031  C  C     . ASP E 2 246 ? 32.952  17.942  226.258 1.00 49.58  ? 247  ASP A C     1 
ATOM   3032  O  O     . ASP E 2 246 ? 33.504  16.891  226.562 1.00 54.47  ? 247  ASP A O     1 
ATOM   3033  C  CB    . ASP E 2 246 ? 31.057  18.156  227.865 1.00 62.68  ? 247  ASP A CB    1 
ATOM   3034  C  CG    . ASP E 2 246 ? 31.364  17.001  228.781 1.00 69.16  ? 247  ASP A CG    1 
ATOM   3035  O  OD1   . ASP E 2 246 ? 31.986  17.244  229.833 1.00 71.12  ? 247  ASP A OD1   1 
ATOM   3036  O  OD2   . ASP E 2 246 ? 30.994  15.856  228.451 1.00 79.29  ? 247  ASP A OD2   1 
ATOM   3037  N  N     . LYS E 2 247 ? 32.889  18.378  225.006 1.00 49.13  ? 248  LYS A N     1 
ATOM   3038  C  CA    . LYS E 2 247 ? 33.436  17.585  223.917 1.00 43.50  ? 248  LYS A CA    1 
ATOM   3039  C  C     . LYS E 2 247 ? 34.613  18.210  223.171 1.00 49.53  ? 248  LYS A C     1 
ATOM   3040  O  O     . LYS E 2 247 ? 35.532  17.503  222.744 1.00 47.10  ? 248  LYS A O     1 
ATOM   3041  C  CB    . LYS E 2 247 ? 32.323  17.259  222.916 1.00 32.12  ? 248  LYS A CB    1 
ATOM   3042  C  CG    . LYS E 2 247 ? 32.763  16.345  221.791 1.00 34.08  ? 248  LYS A CG    1 
ATOM   3043  C  CD    . LYS E 2 247 ? 31.604  15.849  220.950 1.00 39.79  ? 248  LYS A CD    1 
ATOM   3044  C  CE    . LYS E 2 247 ? 32.103  14.865  219.900 1.00 40.91  ? 248  LYS A CE    1 
ATOM   3045  N  NZ    . LYS E 2 247 ? 31.041  14.361  218.994 1.00 54.11  ? 248  LYS A NZ    1 
ATOM   3046  N  N     . PHE E 2 248 ? 34.589  19.530  223.007 1.00 44.63  ? 249  PHE A N     1 
ATOM   3047  C  CA    . PHE E 2 248 ? 35.651  20.210  222.278 1.00 44.50  ? 249  PHE A CA    1 
ATOM   3048  C  C     . PHE E 2 248 ? 36.617  20.982  223.158 1.00 51.21  ? 249  PHE A C     1 
ATOM   3049  O  O     . PHE E 2 248 ? 37.536  21.640  222.655 1.00 49.80  ? 249  PHE A O     1 
ATOM   3050  C  CB    . PHE E 2 248 ? 35.046  21.159  221.254 1.00 51.59  ? 249  PHE A CB    1 
ATOM   3051  C  CG    . PHE E 2 248 ? 34.035  20.511  220.347 1.00 51.66  ? 249  PHE A CG    1 
ATOM   3052  C  CD1   . PHE E 2 248 ? 34.361  19.386  219.609 1.00 47.30  ? 249  PHE A CD1   1 
ATOM   3053  C  CD2   . PHE E 2 248 ? 32.775  21.072  220.183 1.00 54.83  ? 249  PHE A CD2   1 
ATOM   3054  C  CE1   . PHE E 2 248 ? 33.450  18.828  218.729 1.00 51.70  ? 249  PHE A CE1   1 
ATOM   3055  C  CE2   . PHE E 2 248 ? 31.861  20.517  219.301 1.00 52.71  ? 249  PHE A CE2   1 
ATOM   3056  C  CZ    . PHE E 2 248 ? 32.203  19.399  218.572 1.00 52.41  ? 249  PHE A CZ    1 
ATOM   3057  N  N     . VAL E 2 249 ? 36.409  20.901  224.469 1.00 53.82  ? 250  VAL A N     1 
ATOM   3058  C  CA    . VAL E 2 249 ? 37.256  21.600  225.422 1.00 53.68  ? 250  VAL A CA    1 
ATOM   3059  C  C     . VAL E 2 249 ? 37.940  20.681  226.425 1.00 59.37  ? 250  VAL A C     1 
ATOM   3060  O  O     . VAL E 2 249 ? 39.164  20.589  226.439 1.00 73.34  ? 250  VAL A O     1 
ATOM   3061  C  CB    . VAL E 2 249 ? 36.457  22.645  226.227 1.00 56.78  ? 250  VAL A CB    1 
ATOM   3062  C  CG1   . VAL E 2 249 ? 37.400  23.408  227.149 1.00 57.16  ? 250  VAL A CG1   1 
ATOM   3063  C  CG2   . VAL E 2 249 ? 35.733  23.591  225.289 1.00 57.55  ? 250  VAL A CG2   1 
ATOM   3064  N  N     . LYS E 2 250 ? 37.158  20.009  227.268 1.00 57.04  ? 251  LYS A N     1 
ATOM   3065  C  CA    . LYS E 2 250 ? 37.728  19.130  228.290 1.00 58.56  ? 251  LYS A CA    1 
ATOM   3066  C  C     . LYS E 2 250 ? 38.788  18.167  227.776 1.00 60.35  ? 251  LYS A C     1 
ATOM   3067  O  O     . LYS E 2 250 ? 39.933  18.190  228.227 1.00 62.40  ? 251  LYS A O     1 
ATOM   3068  C  CB    . LYS E 2 250 ? 36.628  18.333  228.995 1.00 60.88  ? 251  LYS A CB    1 
ATOM   3069  C  CG    . LYS E 2 250 ? 35.778  19.163  229.930 1.00 67.87  ? 251  LYS A CG    1 
ATOM   3070  C  CD    . LYS E 2 250 ? 34.773  18.314  230.692 1.00 68.01  ? 251  LYS A CD    1 
ATOM   3071  C  CE    . LYS E 2 250 ? 33.988  19.172  231.682 1.00 74.86  ? 251  LYS A CE    1 
ATOM   3072  N  NZ    . LYS E 2 250 ? 33.033  18.385  232.513 1.00 73.79  ? 251  LYS A NZ    1 
ATOM   3073  N  N     . PRO E 2 251 ? 38.421  17.306  226.819 1.00 62.58  ? 252  PRO A N     1 
ATOM   3074  C  CA    . PRO E 2 251 ? 39.379  16.343  226.272 1.00 63.01  ? 252  PRO A CA    1 
ATOM   3075  C  C     . PRO E 2 251 ? 40.624  16.926  225.607 1.00 64.67  ? 252  PRO A C     1 
ATOM   3076  O  O     . PRO E 2 251 ? 41.433  16.181  225.058 1.00 72.51  ? 252  PRO A O     1 
ATOM   3077  C  CB    . PRO E 2 251 ? 38.528  15.532  225.299 1.00 60.41  ? 252  PRO A CB    1 
ATOM   3078  C  CG    . PRO E 2 251 ? 37.513  16.526  224.838 1.00 65.45  ? 252  PRO A CG    1 
ATOM   3079  C  CD    . PRO E 2 251 ? 37.126  17.209  226.122 1.00 63.15  ? 252  PRO A CD    1 
ATOM   3080  N  N     . PHE E 2 252 ? 40.789  18.243  225.651 1.00 58.25  ? 253  PHE A N     1 
ATOM   3081  C  CA    . PHE E 2 252 ? 41.960  18.855  225.034 1.00 59.60  ? 253  PHE A CA    1 
ATOM   3082  C  C     . PHE E 2 252 ? 42.747  19.730  225.986 1.00 62.00  ? 253  PHE A C     1 
ATOM   3083  O  O     . PHE E 2 252 ? 43.886  20.103  225.700 1.00 52.92  ? 253  PHE A O     1 
ATOM   3084  C  CB    . PHE E 2 252 ? 41.553  19.685  223.820 1.00 57.21  ? 253  PHE A CB    1 
ATOM   3085  C  CG    . PHE E 2 252 ? 41.164  18.861  222.640 1.00 56.46  ? 253  PHE A CG    1 
ATOM   3086  C  CD1   . PHE E 2 252 ? 39.966  18.163  222.628 1.00 57.30  ? 253  PHE A CD1   1 
ATOM   3087  C  CD2   . PHE E 2 252 ? 42.015  18.754  221.549 1.00 51.15  ? 253  PHE A CD2   1 
ATOM   3088  C  CE1   . PHE E 2 252 ? 39.624  17.364  221.546 1.00 55.24  ? 253  PHE A CE1   1 
ATOM   3089  C  CE2   . PHE E 2 252 ? 41.683  17.957  220.463 1.00 50.91  ? 253  PHE A CE2   1 
ATOM   3090  C  CZ    . PHE E 2 252 ? 40.486  17.261  220.459 1.00 43.88  ? 253  PHE A CZ    1 
ATOM   3091  N  N     . LYS E 2 253 ? 42.138  20.043  227.125 1.00 61.79  ? 254  LYS A N     1 
ATOM   3092  C  CA    . LYS E 2 253 ? 42.769  20.902  228.121 1.00 60.02  ? 254  LYS A CA    1 
ATOM   3093  C  C     . LYS E 2 253 ? 44.122  20.371  228.576 1.00 53.52  ? 254  LYS A C     1 
ATOM   3094  O  O     . LYS E 2 253 ? 44.926  21.125  229.108 1.00 54.17  ? 254  LYS A O     1 
ATOM   3095  C  CB    . LYS E 2 253 ? 41.831  21.078  229.322 1.00 60.52  ? 254  LYS A CB    1 
ATOM   3096  C  CG    . LYS E 2 253 ? 41.745  22.516  229.819 1.00 73.34  ? 254  LYS A CG    1 
ATOM   3097  C  CD    . LYS E 2 253 ? 40.607  22.714  230.819 1.00 83.99  ? 254  LYS A CD    1 
ATOM   3098  C  CE    . LYS E 2 253 ? 40.409  24.192  231.175 1.00 90.78  ? 254  LYS A CE    1 
ATOM   3099  N  NZ    . LYS E 2 253 ? 40.091  25.038  229.985 1.00 88.31  ? 254  LYS A NZ    1 
ATOM   3100  N  N     . LYS E 2 254 ? 44.372  19.080  228.347 1.00 52.54  ? 255  LYS A N     1 
ATOM   3101  C  CA    . LYS E 2 254 ? 45.630  18.421  228.736 1.00 46.87  ? 255  LYS A CA    1 
ATOM   3102  C  C     . LYS E 2 254 ? 46.732  18.620  227.701 1.00 45.04  ? 255  LYS A C     1 
ATOM   3103  O  O     . LYS E 2 254 ? 47.642  17.801  227.581 1.00 48.27  ? 255  LYS A O     1 
ATOM   3104  C  CB    . LYS E 2 254 ? 45.389  16.916  228.928 1.00 36.80  ? 255  LYS A CB    1 
ATOM   3105  C  CG    . LYS E 2 254 ? 44.661  16.254  227.766 1.00 50.55  ? 255  LYS A CG    1 
ATOM   3106  C  CD    . LYS E 2 254 ? 44.605  14.739  227.909 1.00 52.39  ? 255  LYS A CD    1 
ATOM   3107  C  CE    . LYS E 2 254 ? 45.995  14.150  228.066 1.00 57.74  ? 255  LYS A CE    1 
ATOM   3108  N  NZ    . LYS E 2 254 ? 46.929  14.601  226.996 1.00 62.85  ? 255  LYS A NZ    1 
ATOM   3109  N  N     . TYR E 2 255 ? 46.636  19.703  226.944 1.00 49.85  ? 256  TYR A N     1 
ATOM   3110  C  CA    . TYR E 2 255 ? 47.612  20.003  225.903 1.00 53.67  ? 256  TYR A CA    1 
ATOM   3111  C  C     . TYR E 2 255 ? 47.985  21.482  225.948 1.00 60.21  ? 256  TYR A C     1 
ATOM   3112  O  O     . TYR E 2 255 ? 48.774  21.964  225.132 1.00 59.71  ? 256  TYR A O     1 
ATOM   3113  C  CB    . TYR E 2 255 ? 47.027  19.659  224.537 1.00 36.23  ? 256  TYR A CB    1 
ATOM   3114  C  CG    . TYR E 2 255 ? 46.871  18.184  224.291 1.00 38.11  ? 256  TYR A CG    1 
ATOM   3115  C  CD1   . TYR E 2 255 ? 47.987  17.376  224.097 1.00 45.79  ? 256  TYR A CD1   1 
ATOM   3116  C  CD2   . TYR E 2 255 ? 45.607  17.596  224.214 1.00 51.38  ? 256  TYR A CD2   1 
ATOM   3117  C  CE1   . TYR E 2 255 ? 47.860  16.019  223.823 1.00 43.27  ? 256  TYR A CE1   1 
ATOM   3118  C  CE2   . TYR E 2 255 ? 45.463  16.231  223.941 1.00 46.90  ? 256  TYR A CE2   1 
ATOM   3119  C  CZ    . TYR E 2 255 ? 46.600  15.452  223.744 1.00 47.98  ? 256  TYR A CZ    1 
ATOM   3120  O  OH    . TYR E 2 255 ? 46.486  14.112  223.454 1.00 48.66  ? 256  TYR A OH    1 
ATOM   3121  N  N     . ILE E 2 256 ? 47.406  22.196  226.908 1.00 64.45  ? 257  ILE A N     1 
ATOM   3122  C  CA    . ILE E 2 256 ? 47.671  23.619  227.071 1.00 72.88  ? 257  ILE A CA    1 
ATOM   3123  C  C     . ILE E 2 256 ? 47.857  23.986  228.539 1.00 80.69  ? 257  ILE A C     1 
ATOM   3124  O  O     . ILE E 2 256 ? 48.605  24.910  228.860 1.00 85.90  ? 257  ILE A O     1 
ATOM   3125  C  CB    . ILE E 2 256 ? 46.523  24.471  226.487 1.00 66.64  ? 257  ILE A CB    1 
ATOM   3126  C  CG1   . ILE E 2 256 ? 45.191  24.047  227.114 1.00 63.45  ? 257  ILE A CG1   1 
ATOM   3127  C  CG2   . ILE E 2 256 ? 46.491  24.321  224.967 1.00 69.27  ? 257  ILE A CG2   1 
ATOM   3128  C  CD1   . ILE E 2 256 ? 44.006  24.888  226.692 1.00 55.19  ? 257  ILE A CD1   1 
ATOM   3129  N  N     . LEU E 2 257 ? 47.181  23.251  229.424 1.00 88.51  ? 258  LEU A N     1 
ATOM   3130  C  CA    . LEU E 2 257 ? 47.245  23.483  230.872 1.00 93.58  ? 258  LEU A CA    1 
ATOM   3131  C  C     . LEU E 2 257 ? 46.818  24.907  231.247 1.00 98.20  ? 258  LEU A C     1 
ATOM   3132  O  O     . LEU E 2 257 ? 47.698  25.723  231.619 1.00 95.74  ? 258  LEU A O     1 
ATOM   3133  C  CB    . LEU E 2 257 ? 48.657  23.204  231.400 1.00 94.02  ? 258  LEU A CB    1 
ATOM   3134  O  OXT   . LEU E 2 257 ? 45.598  25.185  231.151 1.00 98.21  ? 258  LEU A OXT   1 
ATOM   3135  N  N     . SER F 2 1   ? 56.603  19.936  200.762 1.00 55.66  ? 2    SER B N     1 
ATOM   3136  C  CA    . SER F 2 1   ? 55.644  19.836  199.622 1.00 50.19  ? 2    SER B CA    1 
ATOM   3137  C  C     . SER F 2 1   ? 56.304  19.383  198.334 1.00 49.68  ? 2    SER B C     1 
ATOM   3138  O  O     . SER F 2 1   ? 57.341  19.909  197.930 1.00 54.37  ? 2    SER B O     1 
ATOM   3139  C  CB    . SER F 2 1   ? 54.970  21.183  199.361 1.00 43.57  ? 2    SER B CB    1 
ATOM   3140  O  OG    . SER F 2 1   ? 54.292  21.157  198.111 1.00 43.49  ? 2    SER B OG    1 
ATOM   3141  N  N     . PHE F 2 2   ? 55.682  18.417  197.678 1.00 43.43  ? 3    PHE B N     1 
ATOM   3142  C  CA    . PHE F 2 2   ? 56.201  17.916  196.419 1.00 44.65  ? 3    PHE B CA    1 
ATOM   3143  C  C     . PHE F 2 2   ? 55.586  18.707  195.269 1.00 43.61  ? 3    PHE B C     1 
ATOM   3144  O  O     . PHE F 2 2   ? 55.896  18.472  194.110 1.00 46.36  ? 3    PHE B O     1 
ATOM   3145  C  CB    . PHE F 2 2   ? 55.857  16.437  196.270 1.00 41.60  ? 3    PHE B CB    1 
ATOM   3146  C  CG    . PHE F 2 2   ? 56.261  15.611  197.441 1.00 39.54  ? 3    PHE B CG    1 
ATOM   3147  C  CD1   . PHE F 2 2   ? 57.601  15.472  197.775 1.00 37.98  ? 3    PHE B CD1   1 
ATOM   3148  C  CD2   . PHE F 2 2   ? 55.306  14.967  198.214 1.00 42.93  ? 3    PHE B CD2   1 
ATOM   3149  C  CE1   . PHE F 2 2   ? 57.984  14.700  198.863 1.00 47.24  ? 3    PHE B CE1   1 
ATOM   3150  C  CE2   . PHE F 2 2   ? 55.679  14.194  199.303 1.00 49.26  ? 3    PHE B CE2   1 
ATOM   3151  C  CZ    . PHE F 2 2   ? 57.020  14.058  199.630 1.00 46.24  ? 3    PHE B CZ    1 
ATOM   3152  N  N     . ILE F 2 3   ? 54.705  19.644  195.594 1.00 46.49  ? 4    ILE B N     1 
ATOM   3153  C  CA    . ILE F 2 3   ? 54.060  20.443  194.569 1.00 43.11  ? 4    ILE B CA    1 
ATOM   3154  C  C     . ILE F 2 3   ? 54.795  21.765  194.411 1.00 43.79  ? 4    ILE B C     1 
ATOM   3155  O  O     . ILE F 2 3   ? 55.122  22.180  193.294 1.00 37.08  ? 4    ILE B O     1 
ATOM   3156  C  CB    . ILE F 2 3   ? 52.601  20.733  194.941 1.00 46.20  ? 4    ILE B CB    1 
ATOM   3157  C  CG1   . ILE F 2 3   ? 51.932  19.446  195.419 1.00 58.25  ? 4    ILE B CG1   1 
ATOM   3158  C  CG2   . ILE F 2 3   ? 51.853  21.272  193.739 1.00 28.46  ? 4    ILE B CG2   1 
ATOM   3159  C  CD1   . ILE F 2 3   ? 50.562  19.659  196.006 1.00 65.59  ? 4    ILE B CD1   1 
ATOM   3160  N  N     . LYS F 2 4   ? 55.073  22.407  195.542 1.00 37.21  ? 5    LYS B N     1 
ATOM   3161  C  CA    . LYS F 2 4   ? 55.746  23.697  195.543 1.00 38.87  ? 5    LYS B CA    1 
ATOM   3162  C  C     . LYS F 2 4   ? 56.852  23.821  194.503 1.00 35.79  ? 5    LYS B C     1 
ATOM   3163  O  O     . LYS F 2 4   ? 56.790  24.690  193.649 1.00 43.92  ? 5    LYS B O     1 
ATOM   3164  C  CB    . LYS F 2 4   ? 56.300  24.013  196.936 1.00 32.16  ? 5    LYS B CB    1 
ATOM   3165  C  CG    . LYS F 2 4   ? 56.789  25.440  197.081 1.00 39.33  ? 5    LYS B CG    1 
ATOM   3166  C  CD    . LYS F 2 4   ? 55.672  26.451  196.863 1.00 44.87  ? 5    LYS B CD    1 
ATOM   3167  C  CE    . LYS F 2 4   ? 56.220  27.878  196.732 1.00 54.69  ? 5    LYS B CE    1 
ATOM   3168  N  NZ    . LYS F 2 4   ? 57.122  28.254  197.865 1.00 58.73  ? 5    LYS B NZ    1 
ATOM   3169  N  N     . PRO F 2 5   ? 57.867  22.941  194.545 1.00 38.66  ? 6    PRO B N     1 
ATOM   3170  C  CA    . PRO F 2 5   ? 58.987  22.977  193.592 1.00 39.83  ? 6    PRO B CA    1 
ATOM   3171  C  C     . PRO F 2 5   ? 58.610  23.221  192.131 1.00 47.08  ? 6    PRO B C     1 
ATOM   3172  O  O     . PRO F 2 5   ? 59.421  23.730  191.355 1.00 49.44  ? 6    PRO B O     1 
ATOM   3173  C  CB    . PRO F 2 5   ? 59.641  21.613  193.781 1.00 35.65  ? 6    PRO B CB    1 
ATOM   3174  C  CG    . PRO F 2 5   ? 59.430  21.353  195.223 1.00 43.14  ? 6    PRO B CG    1 
ATOM   3175  C  CD    . PRO F 2 5   ? 57.977  21.757  195.416 1.00 37.79  ? 6    PRO B CD    1 
ATOM   3176  N  N     . ILE F 2 6   ? 57.388  22.848  191.757 1.00 44.14  ? 7    ILE B N     1 
ATOM   3177  C  CA    . ILE F 2 6   ? 56.927  23.029  190.388 1.00 32.44  ? 7    ILE B CA    1 
ATOM   3178  C  C     . ILE F 2 6   ? 55.640  23.831  190.332 1.00 32.42  ? 7    ILE B C     1 
ATOM   3179  O  O     . ILE F 2 6   ? 54.924  23.781  189.331 1.00 18.87  ? 7    ILE B O     1 
ATOM   3180  C  CB    . ILE F 2 6   ? 56.665  21.679  189.697 1.00 37.82  ? 7    ILE B CB    1 
ATOM   3181  C  CG1   . ILE F 2 6   ? 55.598  20.900  190.474 1.00 40.35  ? 7    ILE B CG1   1 
ATOM   3182  C  CG2   . ILE F 2 6   ? 57.959  20.888  189.593 1.00 39.52  ? 7    ILE B CG2   1 
ATOM   3183  C  CD1   . ILE F 2 6   ? 55.105  19.645  189.763 1.00 36.99  ? 7    ILE B CD1   1 
ATOM   3184  N  N     . TYR F 2 7   ? 55.348  24.573  191.399 1.00 31.85  ? 8    TYR B N     1 
ATOM   3185  C  CA    . TYR F 2 7   ? 54.132  25.385  191.455 1.00 31.03  ? 8    TYR B CA    1 
ATOM   3186  C  C     . TYR F 2 7   ? 53.963  26.196  190.196 1.00 30.03  ? 8    TYR B C     1 
ATOM   3187  O  O     . TYR F 2 7   ? 52.934  26.102  189.536 1.00 41.80  ? 8    TYR B O     1 
ATOM   3188  C  CB    . TYR F 2 7   ? 54.152  26.337  192.655 1.00 32.76  ? 8    TYR B CB    1 
ATOM   3189  C  CG    . TYR F 2 7   ? 52.957  27.274  192.700 1.00 47.23  ? 8    TYR B CG    1 
ATOM   3190  C  CD1   . TYR F 2 7   ? 51.660  26.785  192.869 1.00 40.72  ? 8    TYR B CD1   1 
ATOM   3191  C  CD2   . TYR F 2 7   ? 53.119  28.648  192.547 1.00 55.99  ? 8    TYR B CD2   1 
ATOM   3192  C  CE1   . TYR F 2 7   ? 50.556  27.642  192.885 1.00 41.44  ? 8    TYR B CE1   1 
ATOM   3193  C  CE2   . TYR F 2 7   ? 52.021  29.513  192.561 1.00 59.48  ? 8    TYR B CE2   1 
ATOM   3194  C  CZ    . TYR F 2 7   ? 50.745  29.007  192.730 1.00 55.80  ? 8    TYR B CZ    1 
ATOM   3195  O  OH    . TYR F 2 7   ? 49.676  29.880  192.749 1.00 60.34  ? 8    TYR B OH    1 
ATOM   3196  N  N     . GLN F 2 8   ? 54.971  26.998  189.867 1.00 33.86  ? 9    GLN B N     1 
ATOM   3197  C  CA    . GLN F 2 8   ? 54.923  27.831  188.665 1.00 43.43  ? 9    GLN B CA    1 
ATOM   3198  C  C     . GLN F 2 8   ? 54.519  27.034  187.417 1.00 39.69  ? 9    GLN B C     1 
ATOM   3199  O  O     . GLN F 2 8   ? 53.814  27.551  186.554 1.00 41.06  ? 9    GLN B O     1 
ATOM   3200  C  CB    . GLN F 2 8   ? 56.283  28.506  188.430 1.00 37.16  ? 9    GLN B CB    1 
ATOM   3201  N  N     . ASP F 2 9   ? 54.958  25.781  187.333 1.00 35.88  ? 10   ASP B N     1 
ATOM   3202  C  CA    . ASP F 2 9   ? 54.648  24.927  186.189 1.00 45.08  ? 10   ASP B CA    1 
ATOM   3203  C  C     . ASP F 2 9   ? 53.197  24.484  186.129 1.00 42.45  ? 10   ASP B C     1 
ATOM   3204  O  O     . ASP F 2 9   ? 52.650  24.305  185.045 1.00 45.18  ? 10   ASP B O     1 
ATOM   3205  C  CB    . ASP F 2 9   ? 55.546  23.691  186.195 1.00 60.18  ? 10   ASP B CB    1 
ATOM   3206  C  CG    . ASP F 2 9   ? 56.999  24.020  185.887 1.00 79.50  ? 10   ASP B CG    1 
ATOM   3207  O  OD1   . ASP F 2 9   ? 57.266  24.570  184.795 1.00 88.47  ? 10   ASP B OD1   1 
ATOM   3208  O  OD2   . ASP F 2 9   ? 57.875  23.723  186.732 1.00 89.69  ? 10   ASP B OD2   1 
ATOM   3209  N  N     . ILE F 2 10  ? 52.589  24.283  187.295 1.00 36.72  ? 11   ILE B N     1 
ATOM   3210  C  CA    . ILE F 2 10  ? 51.198  23.863  187.381 1.00 27.07  ? 11   ILE B CA    1 
ATOM   3211  C  C     . ILE F 2 10  ? 50.341  25.094  187.180 1.00 39.06  ? 11   ILE B C     1 
ATOM   3212  O  O     . ILE F 2 10  ? 49.344  25.083  186.452 1.00 39.49  ? 11   ILE B O     1 
ATOM   3213  C  CB    . ILE F 2 10  ? 50.898  23.262  188.750 1.00 27.15  ? 11   ILE B CB    1 
ATOM   3214  C  CG1   . ILE F 2 10  ? 51.794  22.052  188.983 1.00 39.83  ? 11   ILE B CG1   1 
ATOM   3215  C  CG2   . ILE F 2 10  ? 49.457  22.809  188.819 1.00 39.74  ? 11   ILE B CG2   1 
ATOM   3216  C  CD1   . ILE F 2 10  ? 51.820  21.604  190.410 1.00 54.05  ? 11   ILE B CD1   1 
ATOM   3217  N  N     . ASN F 2 11  ? 50.764  26.172  187.824 1.00 41.93  ? 12   ASN B N     1 
ATOM   3218  C  CA    . ASN F 2 11  ? 50.070  27.435  187.737 1.00 35.99  ? 12   ASN B CA    1 
ATOM   3219  C  C     . ASN F 2 11  ? 49.930  27.905  186.296 1.00 38.98  ? 12   ASN B C     1 
ATOM   3220  O  O     . ASN F 2 11  ? 48.992  28.627  185.968 1.00 50.56  ? 12   ASN B O     1 
ATOM   3221  C  CB    . ASN F 2 11  ? 50.814  28.477  188.549 1.00 35.90  ? 12   ASN B CB    1 
ATOM   3222  C  CG    . ASN F 2 11  ? 50.599  29.869  188.024 1.00 51.02  ? 12   ASN B CG    1 
ATOM   3223  O  OD1   . ASN F 2 11  ? 49.467  30.358  187.953 1.00 36.77  ? 12   ASN B OD1   1 
ATOM   3224  N  ND2   . ASN F 2 11  ? 51.692  30.522  187.639 1.00 59.97  ? 12   ASN B ND2   1 
ATOM   3225  N  N     . SER F 2 12  ? 50.856  27.499  185.432 1.00 36.35  ? 13   SER B N     1 
ATOM   3226  C  CA    . SER F 2 12  ? 50.805  27.913  184.029 1.00 40.42  ? 13   SER B CA    1 
ATOM   3227  C  C     . SER F 2 12  ? 49.884  27.039  183.189 1.00 39.78  ? 13   SER B C     1 
ATOM   3228  O  O     . SER F 2 12  ? 49.230  27.520  182.264 1.00 37.39  ? 13   SER B O     1 
ATOM   3229  C  CB    . SER F 2 12  ? 52.210  27.914  183.422 1.00 19.06  ? 13   SER B CB    1 
ATOM   3230  O  OG    . SER F 2 12  ? 52.995  28.931  184.019 1.00 50.47  ? 13   SER B OG    1 
ATOM   3231  N  N     . ILE F 2 13  ? 49.836  25.753  183.510 1.00 38.99  ? 14   ILE B N     1 
ATOM   3232  C  CA    . ILE F 2 13  ? 48.979  24.839  182.778 1.00 45.78  ? 14   ILE B CA    1 
ATOM   3233  C  C     . ILE F 2 13  ? 47.508  25.077  183.113 1.00 49.70  ? 14   ILE B C     1 
ATOM   3234  O  O     . ILE F 2 13  ? 46.657  25.092  182.222 1.00 44.44  ? 14   ILE B O     1 
ATOM   3235  C  CB    . ILE F 2 13  ? 49.354  23.379  183.072 1.00 45.82  ? 14   ILE B CB    1 
ATOM   3236  C  CG1   . ILE F 2 13  ? 50.605  23.019  182.279 1.00 60.83  ? 14   ILE B CG1   1 
ATOM   3237  C  CG2   . ILE F 2 13  ? 48.222  22.444  182.670 1.00 46.01  ? 14   ILE B CG2   1 
ATOM   3238  C  CD1   . ILE F 2 13  ? 50.391  23.038  180.779 1.00 62.78  ? 14   ILE B CD1   1 
ATOM   3239  N  N     . LEU F 2 14  ? 47.218  25.266  184.399 1.00 43.81  ? 15   LEU B N     1 
ATOM   3240  C  CA    . LEU F 2 14  ? 45.853  25.507  184.841 1.00 35.52  ? 15   LEU B CA    1 
ATOM   3241  C  C     . LEU F 2 14  ? 45.262  26.785  184.246 1.00 40.40  ? 15   LEU B C     1 
ATOM   3242  O  O     . LEU F 2 14  ? 44.126  26.780  183.777 1.00 53.74  ? 15   LEU B O     1 
ATOM   3243  C  CB    . LEU F 2 14  ? 45.779  25.573  186.366 1.00 30.67  ? 15   LEU B CB    1 
ATOM   3244  C  CG    . LEU F 2 14  ? 46.220  24.315  187.116 1.00 37.02  ? 15   LEU B CG    1 
ATOM   3245  C  CD1   . LEU F 2 14  ? 46.043  24.510  188.622 1.00 18.97  ? 15   LEU B CD1   1 
ATOM   3246  C  CD2   . LEU F 2 14  ? 45.408  23.135  186.622 1.00 26.22  ? 15   LEU B CD2   1 
ATOM   3247  N  N     . ILE F 2 15  ? 46.012  27.881  184.258 1.00 29.55  ? 16   ILE B N     1 
ATOM   3248  C  CA    . ILE F 2 15  ? 45.488  29.114  183.702 1.00 22.71  ? 16   ILE B CA    1 
ATOM   3249  C  C     . ILE F 2 15  ? 45.203  28.932  182.234 1.00 29.79  ? 16   ILE B C     1 
ATOM   3250  O  O     . ILE F 2 15  ? 46.090  28.600  181.451 1.00 32.85  ? 16   ILE B O     1 
ATOM   3251  C  CB    . ILE F 2 15  ? 46.456  30.284  183.875 1.00 25.51  ? 16   ILE B CB    1 
ATOM   3252  C  CG1   . ILE F 2 15  ? 46.624  30.580  185.369 1.00 27.62  ? 16   ILE B CG1   1 
ATOM   3253  C  CG2   . ILE F 2 15  ? 45.925  31.517  183.127 1.00 10.56  ? 16   ILE B CG2   1 
ATOM   3254  C  CD1   . ILE F 2 15  ? 47.781  31.481  185.698 1.00 21.96  ? 16   ILE B CD1   1 
ATOM   3255  N  N     . GLY F 2 16  ? 43.946  29.141  181.860 1.00 40.05  ? 17   GLY B N     1 
ATOM   3256  C  CA    . GLY F 2 16  ? 43.564  28.979  180.471 1.00 38.25  ? 17   GLY B CA    1 
ATOM   3257  C  C     . GLY F 2 16  ? 42.640  27.800  180.297 1.00 36.19  ? 17   GLY B C     1 
ATOM   3258  O  O     . GLY F 2 16  ? 41.748  27.842  179.459 1.00 46.37  ? 17   GLY B O     1 
ATOM   3259  N  N     . GLN F 2 17  ? 42.853  26.746  181.079 1.00 38.56  ? 18   GLN B N     1 
ATOM   3260  C  CA    . GLN F 2 17  ? 42.013  25.546  181.015 1.00 41.87  ? 18   GLN B CA    1 
ATOM   3261  C  C     . GLN F 2 17  ? 40.528  25.913  181.084 1.00 43.16  ? 18   GLN B C     1 
ATOM   3262  O  O     . GLN F 2 17  ? 40.170  27.015  181.490 1.00 40.55  ? 18   GLN B O     1 
ATOM   3263  C  CB    . GLN F 2 17  ? 42.350  24.625  182.185 1.00 41.28  ? 18   GLN B CB    1 
ATOM   3264  C  CG    . GLN F 2 17  ? 43.715  24.024  182.126 1.00 46.83  ? 18   GLN B CG    1 
ATOM   3265  C  CD    . GLN F 2 17  ? 43.757  22.810  181.245 1.00 57.88  ? 18   GLN B CD    1 
ATOM   3266  O  OE1   . GLN F 2 17  ? 43.494  22.889  180.047 1.00 61.25  ? 18   GLN B OE1   1 
ATOM   3267  N  NE2   . GLN F 2 17  ? 44.077  21.665  181.838 1.00 70.89  ? 18   GLN B NE2   1 
ATOM   3268  N  N     . LYS F 2 18  ? 39.662  24.987  180.697 1.00 50.53  ? 19   LYS B N     1 
ATOM   3269  C  CA    . LYS F 2 18  ? 38.234  25.251  180.746 1.00 55.74  ? 19   LYS B CA    1 
ATOM   3270  C  C     . LYS F 2 18  ? 37.454  24.012  181.167 1.00 55.71  ? 19   LYS B C     1 
ATOM   3271  O  O     . LYS F 2 18  ? 37.933  22.890  181.025 1.00 61.17  ? 19   LYS B O     1 
ATOM   3272  C  CB    . LYS F 2 18  ? 37.744  25.767  179.387 1.00 66.10  ? 19   LYS B CB    1 
ATOM   3273  C  CG    . LYS F 2 18  ? 38.181  24.938  178.184 1.00 74.06  ? 19   LYS B CG    1 
ATOM   3274  C  CD    . LYS F 2 18  ? 37.711  25.574  176.867 1.00 77.99  ? 19   LYS B CD    1 
ATOM   3275  C  CE    . LYS F 2 18  ? 38.037  24.681  175.665 1.00 77.90  ? 19   LYS B CE    1 
ATOM   3276  N  NZ    . LYS F 2 18  ? 37.460  25.199  174.391 1.00 68.44  ? 19   LYS B NZ    1 
ATOM   3277  N  N     . VAL F 2 19  ? 36.257  24.226  181.704 1.00 58.88  ? 20   VAL B N     1 
ATOM   3278  C  CA    . VAL F 2 19  ? 35.399  23.135  182.148 1.00 55.07  ? 20   VAL B CA    1 
ATOM   3279  C  C     . VAL F 2 19  ? 33.948  23.472  181.840 1.00 58.91  ? 20   VAL B C     1 
ATOM   3280  O  O     . VAL F 2 19  ? 33.417  24.459  182.344 1.00 64.29  ? 20   VAL B O     1 
ATOM   3281  C  CB    . VAL F 2 19  ? 35.533  22.887  183.667 1.00 47.39  ? 20   VAL B CB    1 
ATOM   3282  C  CG1   . VAL F 2 19  ? 36.958  22.525  184.017 1.00 44.14  ? 20   VAL B CG1   1 
ATOM   3283  C  CG2   . VAL F 2 19  ? 35.108  24.111  184.426 1.00 55.83  ? 20   VAL B CG2   1 
ATOM   3284  N  N     . LYS F 2 20  ? 33.314  22.649  181.007 1.00 67.39  ? 21   LYS B N     1 
ATOM   3285  C  CA    . LYS F 2 20  ? 31.913  22.840  180.618 1.00 66.02  ? 21   LYS B CA    1 
ATOM   3286  C  C     . LYS F 2 20  ? 30.993  22.776  181.832 1.00 64.82  ? 21   LYS B C     1 
ATOM   3287  O  O     . LYS F 2 20  ? 31.117  21.880  182.667 1.00 60.02  ? 21   LYS B O     1 
ATOM   3288  C  CB    . LYS F 2 20  ? 31.498  21.761  179.606 1.00 69.45  ? 21   LYS B CB    1 
ATOM   3289  C  CG    . LYS F 2 20  ? 32.222  21.820  178.261 1.00 71.52  ? 21   LYS B CG    1 
ATOM   3290  C  CD    . LYS F 2 20  ? 31.906  23.112  177.517 1.00 81.36  ? 21   LYS B CD    1 
ATOM   3291  C  CE    . LYS F 2 20  ? 32.706  23.242  176.214 1.00 91.21  ? 21   LYS B CE    1 
ATOM   3292  N  NZ    . LYS F 2 20  ? 32.381  22.200  175.189 1.00 93.68  ? 21   LYS B NZ    1 
ATOM   3293  N  N     . ARG F 2 21  ? 30.060  23.718  181.927 1.00 67.32  ? 22   ARG B N     1 
ATOM   3294  C  CA    . ARG F 2 21  ? 29.137  23.744  183.060 1.00 68.50  ? 22   ARG B CA    1 
ATOM   3295  C  C     . ARG F 2 21  ? 28.030  22.698  182.967 1.00 71.53  ? 22   ARG B C     1 
ATOM   3296  O  O     . ARG F 2 21  ? 27.507  22.431  181.891 1.00 74.85  ? 22   ARG B O     1 
ATOM   3297  C  CB    . ARG F 2 21  ? 28.519  25.124  183.193 1.00 64.77  ? 22   ARG B CB    1 
ATOM   3298  C  CG    . ARG F 2 21  ? 27.688  25.532  182.021 1.00 56.91  ? 22   ARG B CG    1 
ATOM   3299  C  CD    . ARG F 2 21  ? 27.135  26.918  182.253 1.00 68.32  ? 22   ARG B CD    1 
ATOM   3300  N  NE    . ARG F 2 21  ? 26.371  26.995  183.489 1.00 65.55  ? 22   ARG B NE    1 
ATOM   3301  C  CZ    . ARG F 2 21  ? 25.844  28.117  183.964 1.00 76.70  ? 22   ARG B CZ    1 
ATOM   3302  N  NH1   . ARG F 2 21  ? 26.008  29.252  183.294 1.00 74.70  ? 22   ARG B NH1   1 
ATOM   3303  N  NH2   . ARG F 2 21  ? 25.151  28.101  185.101 1.00 77.76  ? 22   ARG B NH2   1 
ATOM   3304  N  N     . PRO F 2 22  ? 27.652  22.106  184.114 1.00 78.92  ? 23   PRO B N     1 
ATOM   3305  C  CA    . PRO F 2 22  ? 26.615  21.075  184.247 1.00 81.26  ? 23   PRO B CA    1 
ATOM   3306  C  C     . PRO F 2 22  ? 25.261  21.374  183.596 1.00 86.43  ? 23   PRO B C     1 
ATOM   3307  O  O     . PRO F 2 22  ? 25.180  21.767  182.432 1.00 80.02  ? 23   PRO B O     1 
ATOM   3308  C  CB    . PRO F 2 22  ? 26.488  20.911  185.764 1.00 74.05  ? 23   PRO B CB    1 
ATOM   3309  C  CG    . PRO F 2 22  ? 27.852  21.195  186.249 1.00 71.97  ? 23   PRO B CG    1 
ATOM   3310  C  CD    . PRO F 2 22  ? 28.239  22.412  185.433 1.00 77.63  ? 23   PRO B CD    1 
ATOM   3311  N  N     . LYS F 2 23  ? 24.204  21.170  184.383 1.00 97.98  ? 24   LYS B N     1 
ATOM   3312  C  CA    . LYS F 2 23  ? 22.816  21.371  183.966 1.00 102.80 ? 24   LYS B CA    1 
ATOM   3313  C  C     . LYS F 2 23  ? 22.487  22.825  183.647 1.00 107.70 ? 24   LYS B C     1 
ATOM   3314  O  O     . LYS F 2 23  ? 21.317  23.179  183.502 1.00 113.03 ? 24   LYS B O     1 
ATOM   3315  C  CB    . LYS F 2 23  ? 21.877  20.885  185.076 1.00 99.47  ? 24   LYS B CB    1 
ATOM   3316  C  CG    . LYS F 2 23  ? 20.423  20.708  184.653 1.00 96.07  ? 24   LYS B CG    1 
ATOM   3317  C  CD    . LYS F 2 23  ? 20.279  19.515  183.718 1.00 93.13  ? 24   LYS B CD    1 
ATOM   3318  C  CE    . LYS F 2 23  ? 18.827  19.240  183.370 1.00 91.24  ? 24   LYS B CE    1 
ATOM   3319  N  NZ    . LYS F 2 23  ? 18.663  17.975  182.596 1.00 82.11  ? 24   LYS B NZ    1 
ATOM   3320  N  N     . SER F 2 24  ? 23.515  23.663  183.534 1.00 112.08 ? 25   SER B N     1 
ATOM   3321  C  CA    . SER F 2 24  ? 23.325  25.090  183.254 1.00 111.14 ? 25   SER B CA    1 
ATOM   3322  C  C     . SER F 2 24  ? 22.484  25.727  184.366 1.00 110.60 ? 25   SER B C     1 
ATOM   3323  O  O     . SER F 2 24  ? 21.576  26.523  184.102 1.00 108.05 ? 25   SER B O     1 
ATOM   3324  C  CB    . SER F 2 24  ? 22.636  25.292  181.897 1.00 106.06 ? 25   SER B CB    1 
ATOM   3325  O  OG    . SER F 2 24  ? 22.443  26.673  181.629 1.00 88.54  ? 25   SER B OG    1 
ATOM   3326  N  N     . GLY F 2 25  ? 22.800  25.364  185.609 1.00 106.93 ? 26   GLY B N     1 
ATOM   3327  C  CA    . GLY F 2 25  ? 22.074  25.887  186.751 1.00 98.15  ? 26   GLY B CA    1 
ATOM   3328  C  C     . GLY F 2 25  ? 22.874  25.936  188.042 1.00 89.86  ? 26   GLY B C     1 
ATOM   3329  O  O     . GLY F 2 25  ? 23.467  24.941  188.465 1.00 75.05  ? 26   GLY B O     1 
ATOM   3330  N  N     . THR F 2 26  ? 22.875  27.112  188.663 1.00 91.61  ? 27   THR B N     1 
ATOM   3331  C  CA    . THR F 2 26  ? 23.577  27.359  189.916 1.00 92.59  ? 27   THR B CA    1 
ATOM   3332  C  C     . THR F 2 26  ? 24.875  26.567  190.019 1.00 95.98  ? 27   THR B C     1 
ATOM   3333  O  O     . THR F 2 26  ? 24.896  25.436  190.509 1.00 94.73  ? 27   THR B O     1 
ATOM   3334  C  CB    . THR F 2 26  ? 22.676  27.031  191.125 1.00 88.22  ? 27   THR B CB    1 
ATOM   3335  O  OG1   . THR F 2 26  ? 21.473  27.801  191.038 1.00 87.28  ? 27   THR B OG1   1 
ATOM   3336  C  CG2   . THR F 2 26  ? 23.376  27.372  192.428 1.00 84.49  ? 27   THR B CG2   1 
ATOM   3337  N  N     . LEU F 2 27  ? 25.958  27.166  189.541 1.00 96.35  ? 28   LEU B N     1 
ATOM   3338  C  CA    . LEU F 2 27  ? 27.254  26.514  189.595 1.00 95.43  ? 28   LEU B CA    1 
ATOM   3339  C  C     . LEU F 2 27  ? 27.828  26.776  190.980 1.00 98.21  ? 28   LEU B C     1 
ATOM   3340  O  O     . LEU F 2 27  ? 28.727  27.603  191.142 1.00 106.16 ? 28   LEU B O     1 
ATOM   3341  C  CB    . LEU F 2 27  ? 28.187  27.087  188.525 1.00 88.23  ? 28   LEU B CB    1 
ATOM   3342  C  CG    . LEU F 2 27  ? 27.515  27.644  187.270 1.00 82.36  ? 28   LEU B CG    1 
ATOM   3343  C  CD1   . LEU F 2 27  ? 27.088  29.086  187.549 1.00 84.39  ? 28   LEU B CD1   1 
ATOM   3344  C  CD2   . LEU F 2 27  ? 28.480  27.604  186.094 1.00 74.65  ? 28   LEU B CD2   1 
ATOM   3345  N  N     . SER F 2 28  ? 27.298  26.082  191.983 1.00 92.37  ? 29   SER B N     1 
ATOM   3346  C  CA    . SER F 2 28  ? 27.761  26.267  193.354 1.00 88.91  ? 29   SER B CA    1 
ATOM   3347  C  C     . SER F 2 28  ? 27.959  24.946  194.083 1.00 86.16  ? 29   SER B C     1 
ATOM   3348  O  O     . SER F 2 28  ? 27.532  23.895  193.610 1.00 88.09  ? 29   SER B O     1 
ATOM   3349  C  CB    . SER F 2 28  ? 26.762  27.128  194.126 1.00 92.31  ? 29   SER B CB    1 
ATOM   3350  O  OG    . SER F 2 28  ? 25.503  26.486  194.196 1.00 95.35  ? 29   SER B OG    1 
ATOM   3351  N  N     . GLY F 2 29  ? 28.618  25.012  195.238 1.00 84.79  ? 30   GLY B N     1 
ATOM   3352  C  CA    . GLY F 2 29  ? 28.869  23.824  196.037 1.00 83.27  ? 30   GLY B CA    1 
ATOM   3353  C  C     . GLY F 2 29  ? 29.577  22.705  195.299 1.00 81.23  ? 30   GLY B C     1 
ATOM   3354  O  O     . GLY F 2 29  ? 30.372  22.943  194.392 1.00 75.61  ? 30   GLY B O     1 
ATOM   3355  N  N     . HIS F 2 30  ? 29.285  21.472  195.688 1.00 81.66  ? 31   HIS B N     1 
ATOM   3356  C  CA    . HIS F 2 30  ? 29.908  20.323  195.055 1.00 82.04  ? 31   HIS B CA    1 
ATOM   3357  C  C     . HIS F 2 30  ? 29.755  20.370  193.531 1.00 84.82  ? 31   HIS B C     1 
ATOM   3358  O  O     . HIS F 2 30  ? 30.459  19.657  192.813 1.00 84.55  ? 31   HIS B O     1 
ATOM   3359  C  CB    . HIS F 2 30  ? 29.303  19.032  195.624 1.00 77.65  ? 31   HIS B CB    1 
ATOM   3360  C  CG    . HIS F 2 30  ? 30.248  18.247  196.484 1.00 66.36  ? 31   HIS B CG    1 
ATOM   3361  N  ND1   . HIS F 2 30  ? 31.289  17.508  195.963 1.00 68.84  ? 31   HIS B ND1   1 
ATOM   3362  C  CD2   . HIS F 2 30  ? 30.323  18.105  197.827 1.00 66.16  ? 31   HIS B CD2   1 
ATOM   3363  C  CE1   . HIS F 2 30  ? 31.966  16.946  196.948 1.00 65.99  ? 31   HIS B CE1   1 
ATOM   3364  N  NE2   . HIS F 2 30  ? 31.402  17.292  198.090 1.00 66.30  ? 31   HIS B NE2   1 
ATOM   3365  N  N     . ALA F 2 31  ? 28.852  21.224  193.045 1.00 83.66  ? 32   ALA B N     1 
ATOM   3366  C  CA    . ALA F 2 31  ? 28.601  21.370  191.604 1.00 82.69  ? 32   ALA B CA    1 
ATOM   3367  C  C     . ALA F 2 31  ? 29.212  22.637  190.990 1.00 82.89  ? 32   ALA B C     1 
ATOM   3368  O  O     . ALA F 2 31  ? 28.835  23.044  189.888 1.00 78.06  ? 32   ALA B O     1 
ATOM   3369  C  CB    . ALA F 2 31  ? 27.099  21.345  191.335 1.00 75.83  ? 32   ALA B CB    1 
ATOM   3370  N  N     . ALA F 2 32  ? 30.150  23.258  191.699 1.00 82.68  ? 33   ALA B N     1 
ATOM   3371  C  CA    . ALA F 2 32  ? 30.797  24.470  191.205 1.00 79.32  ? 33   ALA B CA    1 
ATOM   3372  C  C     . ALA F 2 32  ? 32.080  24.127  190.461 1.00 76.53  ? 33   ALA B C     1 
ATOM   3373  O  O     . ALA F 2 32  ? 32.112  23.202  189.650 1.00 72.38  ? 33   ALA B O     1 
ATOM   3374  C  CB    . ALA F 2 32  ? 31.102  25.412  192.362 1.00 78.37  ? 33   ALA B CB    1 
ATOM   3375  N  N     . GLY F 2 33  ? 33.139  24.875  190.742 1.00 72.64  ? 34   GLY B N     1 
ATOM   3376  C  CA    . GLY F 2 33  ? 34.409  24.622  190.089 1.00 74.24  ? 34   GLY B CA    1 
ATOM   3377  C  C     . GLY F 2 33  ? 34.977  23.250  190.407 1.00 71.68  ? 34   GLY B C     1 
ATOM   3378  O  O     . GLY F 2 33  ? 36.091  22.930  189.996 1.00 65.54  ? 34   GLY B O     1 
ATOM   3379  N  N     . GLU F 2 34  ? 34.206  22.444  191.135 1.00 71.49  ? 35   GLU B N     1 
ATOM   3380  C  CA    . GLU F 2 34  ? 34.613  21.097  191.521 1.00 62.26  ? 35   GLU B CA    1 
ATOM   3381  C  C     . GLU F 2 34  ? 35.501  20.414  190.482 1.00 54.11  ? 35   GLU B C     1 
ATOM   3382  O  O     . GLU F 2 34  ? 36.633  20.053  190.776 1.00 58.48  ? 35   GLU B O     1 
ATOM   3383  C  CB    . GLU F 2 34  ? 33.376  20.234  191.777 1.00 72.57  ? 35   GLU B CB    1 
ATOM   3384  C  CG    . GLU F 2 34  ? 33.682  18.783  192.103 1.00 80.44  ? 35   GLU B CG    1 
ATOM   3385  C  CD    . GLU F 2 34  ? 34.012  18.578  193.566 1.00 82.73  ? 35   GLU B CD    1 
ATOM   3386  O  OE1   . GLU F 2 34  ? 34.669  19.465  194.153 1.00 81.24  ? 35   GLU B OE1   1 
ATOM   3387  O  OE2   . GLU F 2 34  ? 33.624  17.524  194.122 1.00 79.54  ? 35   GLU B OE2   1 
ATOM   3388  N  N     . PRO F 2 35  ? 35.005  20.247  189.246 1.00 47.74  ? 36   PRO B N     1 
ATOM   3389  C  CA    . PRO F 2 35  ? 35.765  19.600  188.165 1.00 44.76  ? 36   PRO B CA    1 
ATOM   3390  C  C     . PRO F 2 35  ? 37.232  20.039  187.997 1.00 39.76  ? 36   PRO B C     1 
ATOM   3391  O  O     . PRO F 2 35  ? 38.017  19.329  187.379 1.00 44.18  ? 36   PRO B O     1 
ATOM   3392  C  CB    . PRO F 2 35  ? 34.940  19.924  186.918 1.00 47.36  ? 36   PRO B CB    1 
ATOM   3393  C  CG    . PRO F 2 35  ? 33.551  20.024  187.445 1.00 48.17  ? 36   PRO B CG    1 
ATOM   3394  C  CD    . PRO F 2 35  ? 33.731  20.786  188.737 1.00 46.97  ? 36   PRO B CD    1 
ATOM   3395  N  N     . PHE F 2 36  ? 37.597  21.203  188.529 1.00 34.83  ? 37   PHE B N     1 
ATOM   3396  C  CA    . PHE F 2 36  ? 38.962  21.687  188.405 1.00 28.72  ? 37   PHE B CA    1 
ATOM   3397  C  C     . PHE F 2 36  ? 39.904  20.874  189.285 1.00 30.25  ? 37   PHE B C     1 
ATOM   3398  O  O     . PHE F 2 36  ? 41.118  20.886  189.091 1.00 24.75  ? 37   PHE B O     1 
ATOM   3399  C  CB    . PHE F 2 36  ? 39.064  23.179  188.769 1.00 37.84  ? 37   PHE B CB    1 
ATOM   3400  C  CG    . PHE F 2 36  ? 38.678  24.127  187.646 1.00 33.36  ? 37   PHE B CG    1 
ATOM   3401  C  CD1   . PHE F 2 36  ? 37.624  25.024  187.804 1.00 34.13  ? 37   PHE B CD1   1 
ATOM   3402  C  CD2   . PHE F 2 36  ? 39.374  24.131  186.441 1.00 29.37  ? 37   PHE B CD2   1 
ATOM   3403  C  CE1   . PHE F 2 36  ? 37.272  25.908  186.776 1.00 34.70  ? 37   PHE B CE1   1 
ATOM   3404  C  CE2   . PHE F 2 36  ? 39.028  25.012  185.408 1.00 26.73  ? 37   PHE B CE2   1 
ATOM   3405  C  CZ    . PHE F 2 36  ? 37.976  25.899  185.580 1.00 30.84  ? 37   PHE B CZ    1 
ATOM   3406  N  N     . GLU F 2 37  ? 39.360  20.168  190.265 1.00 27.36  ? 38   GLU B N     1 
ATOM   3407  C  CA    . GLU F 2 37  ? 40.223  19.353  191.089 1.00 33.57  ? 38   GLU B CA    1 
ATOM   3408  C  C     . GLU F 2 37  ? 40.653  18.184  190.209 1.00 34.06  ? 38   GLU B C     1 
ATOM   3409  O  O     . GLU F 2 37  ? 41.724  17.613  190.399 1.00 49.36  ? 38   GLU B O     1 
ATOM   3410  C  CB    . GLU F 2 37  ? 39.500  18.848  192.348 1.00 29.24  ? 38   GLU B CB    1 
ATOM   3411  C  CG    . GLU F 2 37  ? 38.772  17.532  192.197 1.00 49.12  ? 38   GLU B CG    1 
ATOM   3412  C  CD    . GLU F 2 37  ? 39.359  16.451  193.090 1.00 62.66  ? 38   GLU B CD    1 
ATOM   3413  O  OE1   . GLU F 2 37  ? 40.563  16.145  192.944 1.00 61.64  ? 38   GLU B OE1   1 
ATOM   3414  O  OE2   . GLU F 2 37  ? 38.618  15.909  193.942 1.00 67.67  ? 38   GLU B OE2   1 
ATOM   3415  N  N     . LYS F 2 38  ? 39.843  17.832  189.220 1.00 32.17  ? 39   LYS B N     1 
ATOM   3416  C  CA    . LYS F 2 38  ? 40.216  16.710  188.359 1.00 44.39  ? 39   LYS B CA    1 
ATOM   3417  C  C     . LYS F 2 38  ? 41.338  17.074  187.396 1.00 36.46  ? 39   LYS B C     1 
ATOM   3418  O  O     . LYS F 2 38  ? 41.988  16.200  186.849 1.00 30.29  ? 39   LYS B O     1 
ATOM   3419  C  CB    . LYS F 2 38  ? 38.988  16.187  187.587 1.00 38.70  ? 39   LYS B CB    1 
ATOM   3420  C  CG    . LYS F 2 38  ? 38.013  15.432  188.474 1.00 31.59  ? 39   LYS B CG    1 
ATOM   3421  C  CD    . LYS F 2 38  ? 36.698  15.122  187.782 1.00 44.26  ? 39   LYS B CD    1 
ATOM   3422  C  CE    . LYS F 2 38  ? 35.740  14.265  188.662 1.00 52.97  ? 39   LYS B CE    1 
ATOM   3423  N  NZ    . LYS F 2 38  ? 35.393  14.804  190.033 1.00 32.98  ? 39   LYS B NZ    1 
ATOM   3424  N  N     . LEU F 2 39  ? 41.566  18.366  187.192 1.00 40.04  ? 40   LEU B N     1 
ATOM   3425  C  CA    . LEU F 2 39  ? 42.629  18.797  186.293 1.00 37.93  ? 40   LEU B CA    1 
ATOM   3426  C  C     . LEU F 2 39  ? 43.948  18.940  187.059 1.00 39.50  ? 40   LEU B C     1 
ATOM   3427  O  O     . LEU F 2 39  ? 45.025  18.747  186.500 1.00 33.64  ? 40   LEU B O     1 
ATOM   3428  C  CB    . LEU F 2 39  ? 42.227  20.100  185.602 1.00 39.32  ? 40   LEU B CB    1 
ATOM   3429  C  CG    . LEU F 2 39  ? 41.726  19.927  184.152 1.00 43.95  ? 40   LEU B CG    1 
ATOM   3430  C  CD1   . LEU F 2 39  ? 40.785  18.732  184.031 1.00 41.68  ? 40   LEU B CD1   1 
ATOM   3431  C  CD2   . LEU F 2 39  ? 41.027  21.199  183.694 1.00 42.80  ? 40   LEU B CD2   1 
ATOM   3432  N  N     . VAL F 2 40  ? 43.853  19.259  188.345 1.00 34.01  ? 41   VAL B N     1 
ATOM   3433  C  CA    . VAL F 2 40  ? 45.029  19.380  189.185 1.00 30.16  ? 41   VAL B CA    1 
ATOM   3434  C  C     . VAL F 2 40  ? 45.634  17.975  189.318 1.00 40.53  ? 41   VAL B C     1 
ATOM   3435  O  O     . VAL F 2 40  ? 46.837  17.791  189.139 1.00 40.31  ? 41   VAL B O     1 
ATOM   3436  C  CB    . VAL F 2 40  ? 44.651  19.916  190.590 1.00 30.39  ? 41   VAL B CB    1 
ATOM   3437  C  CG1   . VAL F 2 40  ? 45.838  19.829  191.539 1.00 13.93  ? 41   VAL B CG1   1 
ATOM   3438  C  CG2   . VAL F 2 40  ? 44.171  21.341  190.477 1.00 23.93  ? 41   VAL B CG2   1 
ATOM   3439  N  N     . TYR F 2 41  ? 44.788  16.987  189.622 1.00 32.12  ? 42   TYR B N     1 
ATOM   3440  C  CA    . TYR F 2 41  ? 45.234  15.600  189.767 1.00 25.39  ? 42   TYR B CA    1 
ATOM   3441  C  C     . TYR F 2 41  ? 45.866  15.063  188.487 1.00 29.92  ? 42   TYR B C     1 
ATOM   3442  O  O     . TYR F 2 41  ? 46.852  14.330  188.533 1.00 28.53  ? 42   TYR B O     1 
ATOM   3443  C  CB    . TYR F 2 41  ? 44.061  14.684  190.142 1.00 36.79  ? 42   TYR B CB    1 
ATOM   3444  C  CG    . TYR F 2 41  ? 44.396  13.203  190.100 1.00 34.81  ? 42   TYR B CG    1 
ATOM   3445  C  CD1   . TYR F 2 41  ? 44.921  12.547  191.216 1.00 30.16  ? 42   TYR B CD1   1 
ATOM   3446  C  CD2   . TYR F 2 41  ? 44.255  12.477  188.917 1.00 36.79  ? 42   TYR B CD2   1 
ATOM   3447  C  CE1   . TYR F 2 41  ? 45.307  11.198  191.149 1.00 29.69  ? 42   TYR B CE1   1 
ATOM   3448  C  CE2   . TYR F 2 41  ? 44.638  11.140  188.837 1.00 35.00  ? 42   TYR B CE2   1 
ATOM   3449  C  CZ    . TYR F 2 41  ? 45.161  10.507  189.949 1.00 37.27  ? 42   TYR B CZ    1 
ATOM   3450  O  OH    . TYR F 2 41  ? 45.537  9.186   189.848 1.00 42.13  ? 42   TYR B OH    1 
ATOM   3451  N  N     . LYS F 2 42  ? 45.275  15.412  187.349 1.00 27.06  ? 43   LYS B N     1 
ATOM   3452  C  CA    . LYS F 2 42  ? 45.748  14.955  186.043 1.00 27.73  ? 43   LYS B CA    1 
ATOM   3453  C  C     . LYS F 2 42  ? 47.178  15.390  185.745 1.00 34.03  ? 43   LYS B C     1 
ATOM   3454  O  O     . LYS F 2 42  ? 48.056  14.563  185.478 1.00 31.70  ? 43   LYS B O     1 
ATOM   3455  C  CB    . LYS F 2 42  ? 44.801  15.470  184.956 1.00 17.00  ? 43   LYS B CB    1 
ATOM   3456  C  CG    . LYS F 2 42  ? 45.212  15.142  183.532 1.00 33.94  ? 43   LYS B CG    1 
ATOM   3457  C  CD    . LYS F 2 42  ? 44.170  15.662  182.541 1.00 39.69  ? 43   LYS B CD    1 
ATOM   3458  C  CE    . LYS F 2 42  ? 44.417  15.128  181.138 1.00 42.03  ? 43   LYS B CE    1 
ATOM   3459  N  NZ    . LYS F 2 42  ? 45.824  15.378  180.705 1.00 55.70  ? 43   LYS B NZ    1 
ATOM   3460  N  N     . PHE F 2 43  ? 47.400  16.697  185.795 1.00 41.14  ? 44   PHE B N     1 
ATOM   3461  C  CA    . PHE F 2 43  ? 48.703  17.270  185.527 1.00 41.99  ? 44   PHE B CA    1 
ATOM   3462  C  C     . PHE F 2 43  ? 49.701  16.800  186.579 1.00 47.05  ? 44   PHE B C     1 
ATOM   3463  O  O     . PHE F 2 43  ? 50.865  16.546  186.281 1.00 54.19  ? 44   PHE B O     1 
ATOM   3464  C  CB    . PHE F 2 43  ? 48.613  18.791  185.544 1.00 43.54  ? 44   PHE B CB    1 
ATOM   3465  C  CG    . PHE F 2 43  ? 49.921  19.465  185.299 1.00 70.16  ? 44   PHE B CG    1 
ATOM   3466  C  CD1   . PHE F 2 43  ? 50.495  19.441  184.032 1.00 80.76  ? 44   PHE B CD1   1 
ATOM   3467  C  CD2   . PHE F 2 43  ? 50.605  20.091  186.342 1.00 74.62  ? 44   PHE B CD2   1 
ATOM   3468  C  CE1   . PHE F 2 43  ? 51.736  20.032  183.803 1.00 87.85  ? 44   PHE B CE1   1 
ATOM   3469  C  CE2   . PHE F 2 43  ? 51.846  20.686  186.127 1.00 75.87  ? 44   PHE B CE2   1 
ATOM   3470  C  CZ    . PHE F 2 43  ? 52.415  20.658  184.856 1.00 83.22  ? 44   PHE B CZ    1 
ATOM   3471  N  N     . LEU F 2 44  ? 49.239  16.688  187.815 1.00 41.53  ? 45   LEU B N     1 
ATOM   3472  C  CA    . LEU F 2 44  ? 50.094  16.241  188.899 1.00 36.32  ? 45   LEU B CA    1 
ATOM   3473  C  C     . LEU F 2 44  ? 50.528  14.801  188.631 1.00 44.64  ? 45   LEU B C     1 
ATOM   3474  O  O     . LEU F 2 44  ? 51.607  14.385  189.041 1.00 51.74  ? 45   LEU B O     1 
ATOM   3475  C  CB    . LEU F 2 44  ? 49.328  16.298  190.219 1.00 32.41  ? 45   LEU B CB    1 
ATOM   3476  C  CG    . LEU F 2 44  ? 49.874  17.143  191.348 1.00 29.88  ? 45   LEU B CG    1 
ATOM   3477  C  CD1   . LEU F 2 44  ? 50.314  18.492  190.831 1.00 23.38  ? 45   LEU B CD1   1 
ATOM   3478  C  CD2   . LEU F 2 44  ? 48.798  17.296  192.393 1.00 31.69  ? 45   LEU B CD2   1 
ATOM   3479  N  N     . LYS F 2 45  ? 49.674  14.049  187.941 1.00 43.27  ? 46   LYS B N     1 
ATOM   3480  C  CA    . LYS F 2 45  ? 49.931  12.649  187.629 1.00 40.12  ? 46   LYS B CA    1 
ATOM   3481  C  C     . LYS F 2 45  ? 50.976  12.566  186.530 1.00 40.80  ? 46   LYS B C     1 
ATOM   3482  O  O     . LYS F 2 45  ? 51.886  11.730  186.565 1.00 40.15  ? 46   LYS B O     1 
ATOM   3483  C  CB    . LYS F 2 45  ? 48.631  11.970  187.166 1.00 46.38  ? 46   LYS B CB    1 
ATOM   3484  C  CG    . LYS F 2 45  ? 48.529  10.454  187.418 1.00 43.90  ? 46   LYS B CG    1 
ATOM   3485  C  CD    . LYS F 2 45  ? 48.509  10.117  188.914 1.00 51.67  ? 46   LYS B CD    1 
ATOM   3486  C  CE    . LYS F 2 45  ? 48.235  8.625   189.193 1.00 49.61  ? 46   LYS B CE    1 
ATOM   3487  N  NZ    . LYS F 2 45  ? 49.143  7.679   188.479 1.00 48.02  ? 46   LYS B NZ    1 
ATOM   3488  N  N     . GLU F 2 46  ? 50.841  13.453  185.554 1.00 40.98  ? 47   GLU B N     1 
ATOM   3489  C  CA    . GLU F 2 46  ? 51.755  13.508  184.422 1.00 42.34  ? 47   GLU B CA    1 
ATOM   3490  C  C     . GLU F 2 46  ? 53.172  13.923  184.788 1.00 41.94  ? 47   GLU B C     1 
ATOM   3491  O  O     . GLU F 2 46  ? 54.129  13.477  184.158 1.00 54.56  ? 47   GLU B O     1 
ATOM   3492  C  CB    . GLU F 2 46  ? 51.206  14.465  183.366 1.00 37.92  ? 47   GLU B CB    1 
ATOM   3493  C  CG    . GLU F 2 46  ? 49.908  13.997  182.761 1.00 40.94  ? 47   GLU B CG    1 
ATOM   3494  C  CD    . GLU F 2 46  ? 49.389  14.934  181.702 1.00 47.43  ? 47   GLU B CD    1 
ATOM   3495  O  OE1   . GLU F 2 46  ? 48.380  14.587  181.048 1.00 46.08  ? 47   GLU B OE1   1 
ATOM   3496  O  OE2   . GLU F 2 46  ? 49.987  16.020  181.523 1.00 59.44  ? 47   GLU B OE2   1 
ATOM   3497  N  N     . ASN F 2 47  ? 53.312  14.764  185.807 1.00 43.51  ? 48   ASN B N     1 
ATOM   3498  C  CA    . ASN F 2 47  ? 54.630  15.249  186.211 1.00 43.94  ? 48   ASN B CA    1 
ATOM   3499  C  C     . ASN F 2 47  ? 55.176  14.603  187.477 1.00 47.03  ? 48   ASN B C     1 
ATOM   3500  O  O     . ASN F 2 47  ? 56.347  14.774  187.808 1.00 47.99  ? 48   ASN B O     1 
ATOM   3501  C  CB    . ASN F 2 47  ? 54.592  16.772  186.386 1.00 40.58  ? 48   ASN B CB    1 
ATOM   3502  C  CG    . ASN F 2 47  ? 54.250  17.500  185.097 1.00 42.99  ? 48   ASN B CG    1 
ATOM   3503  O  OD1   . ASN F 2 47  ? 53.181  17.309  184.524 1.00 52.84  ? 48   ASN B OD1   1 
ATOM   3504  N  ND2   . ASN F 2 47  ? 55.164  18.336  184.634 1.00 58.26  ? 48   ASN B ND2   1 
ATOM   3505  N  N     . LEU F 2 48  ? 54.328  13.864  188.182 1.00 47.18  ? 49   LEU B N     1 
ATOM   3506  C  CA    . LEU F 2 48  ? 54.733  13.188  189.409 1.00 42.45  ? 49   LEU B CA    1 
ATOM   3507  C  C     . LEU F 2 48  ? 53.935  11.895  189.518 1.00 48.04  ? 49   LEU B C     1 
ATOM   3508  O  O     . LEU F 2 48  ? 53.310  11.626  190.542 1.00 62.08  ? 49   LEU B O     1 
ATOM   3509  C  CB    . LEU F 2 48  ? 54.447  14.082  190.614 1.00 32.99  ? 49   LEU B CB    1 
ATOM   3510  C  CG    . LEU F 2 48  ? 55.153  15.431  190.619 1.00 33.21  ? 49   LEU B CG    1 
ATOM   3511  C  CD1   . LEU F 2 48  ? 54.697  16.296  191.777 1.00 21.77  ? 49   LEU B CD1   1 
ATOM   3512  C  CD2   . LEU F 2 48  ? 56.636  15.177  190.699 1.00 45.43  ? 49   LEU B CD2   1 
ATOM   3513  N  N     . SER F 2 49  ? 53.962  11.093  188.459 1.00 52.98  ? 50   SER B N     1 
ATOM   3514  C  CA    . SER F 2 49  ? 53.211  9.845   188.433 1.00 54.49  ? 50   SER B CA    1 
ATOM   3515  C  C     . SER F 2 49  ? 53.572  8.872   189.557 1.00 50.55  ? 50   SER B C     1 
ATOM   3516  O  O     . SER F 2 49  ? 52.755  8.048   189.964 1.00 51.96  ? 50   SER B O     1 
ATOM   3517  C  CB    . SER F 2 49  ? 53.376  9.160   187.072 1.00 44.35  ? 50   SER B CB    1 
ATOM   3518  O  OG    . SER F 2 49  ? 52.533  8.026   186.977 1.00 53.52  ? 50   SER B OG    1 
ATOM   3519  N  N     . ASP F 2 50  ? 54.786  8.966   190.075 1.00 49.59  ? 51   ASP B N     1 
ATOM   3520  C  CA    . ASP F 2 50  ? 55.180  8.053   191.131 1.00 47.73  ? 51   ASP B CA    1 
ATOM   3521  C  C     . ASP F 2 50  ? 54.717  8.504   192.506 1.00 41.52  ? 51   ASP B C     1 
ATOM   3522  O  O     . ASP F 2 50  ? 54.802  7.744   193.458 1.00 40.10  ? 51   ASP B O     1 
ATOM   3523  C  CB    . ASP F 2 50  ? 56.702  7.867   191.113 1.00 64.35  ? 51   ASP B CB    1 
ATOM   3524  C  CG    . ASP F 2 50  ? 57.210  7.322   189.780 1.00 77.02  ? 51   ASP B CG    1 
ATOM   3525  O  OD1   . ASP F 2 50  ? 56.942  6.138   189.469 1.00 75.64  ? 51   ASP B OD1   1 
ATOM   3526  O  OD2   . ASP F 2 50  ? 57.871  8.087   189.037 1.00 86.50  ? 51   ASP B OD2   1 
ATOM   3527  N  N     . LEU F 2 51  ? 54.195  9.719   192.619 1.00 37.24  ? 52   LEU B N     1 
ATOM   3528  C  CA    . LEU F 2 51  ? 53.763  10.189  193.930 1.00 36.54  ? 52   LEU B CA    1 
ATOM   3529  C  C     . LEU F 2 51  ? 52.316  10.655  194.061 1.00 36.22  ? 52   LEU B C     1 
ATOM   3530  O  O     . LEU F 2 51  ? 51.842  10.877  195.174 1.00 38.77  ? 52   LEU B O     1 
ATOM   3531  C  CB    . LEU F 2 51  ? 54.665  11.325  194.392 1.00 35.62  ? 52   LEU B CB    1 
ATOM   3532  C  CG    . LEU F 2 51  ? 56.163  11.220  194.162 1.00 43.21  ? 52   LEU B CG    1 
ATOM   3533  C  CD1   . LEU F 2 51  ? 56.479  11.332  192.666 1.00 51.20  ? 52   LEU B CD1   1 
ATOM   3534  C  CD2   . LEU F 2 51  ? 56.846  12.344  194.910 1.00 35.03  ? 52   LEU B CD2   1 
ATOM   3535  N  N     . THR F 2 52  ? 51.618  10.810  192.941 1.00 31.48  ? 53   THR B N     1 
ATOM   3536  C  CA    . THR F 2 52  ? 50.240  11.305  192.972 1.00 32.58  ? 53   THR B CA    1 
ATOM   3537  C  C     . THR F 2 52  ? 49.182  10.212  193.154 1.00 27.40  ? 53   THR B C     1 
ATOM   3538  O  O     . THR F 2 52  ? 49.107  9.261   192.384 1.00 14.44  ? 53   THR B O     1 
ATOM   3539  C  CB    . THR F 2 52  ? 49.950  12.108  191.694 1.00 38.70  ? 53   THR B CB    1 
ATOM   3540  O  OG1   . THR F 2 52  ? 51.006  13.063  191.486 1.00 28.49  ? 53   THR B OG1   1 
ATOM   3541  C  CG2   . THR F 2 52  ? 48.627  12.841  191.820 1.00 42.19  ? 53   THR B CG2   1 
ATOM   3542  N  N     . PHE F 2 53  ? 48.359  10.356  194.179 1.00 32.12  ? 54   PHE B N     1 
ATOM   3543  C  CA    . PHE F 2 53  ? 47.350  9.351   194.440 1.00 38.30  ? 54   PHE B CA    1 
ATOM   3544  C  C     . PHE F 2 53  ? 46.053  9.930   194.973 1.00 38.34  ? 54   PHE B C     1 
ATOM   3545  O  O     . PHE F 2 53  ? 46.069  10.819  195.834 1.00 41.73  ? 54   PHE B O     1 
ATOM   3546  C  CB    . PHE F 2 53  ? 47.878  8.346   195.465 1.00 33.33  ? 54   PHE B CB    1 
ATOM   3547  C  CG    . PHE F 2 53  ? 49.095  7.612   195.023 1.00 38.46  ? 54   PHE B CG    1 
ATOM   3548  C  CD1   . PHE F 2 53  ? 49.037  6.746   193.947 1.00 47.84  ? 54   PHE B CD1   1 
ATOM   3549  C  CD2   . PHE F 2 53  ? 50.299  7.769   195.693 1.00 42.70  ? 54   PHE B CD2   1 
ATOM   3550  C  CE1   . PHE F 2 53  ? 50.168  6.037   193.539 1.00 66.76  ? 54   PHE B CE1   1 
ATOM   3551  C  CE2   . PHE F 2 53  ? 51.436  7.067   195.297 1.00 46.21  ? 54   PHE B CE2   1 
ATOM   3552  C  CZ    . PHE F 2 53  ? 51.372  6.197   194.218 1.00 61.64  ? 54   PHE B CZ    1 
ATOM   3553  N  N     . LYS F 2 54  ? 44.923  9.454   194.459 1.00 32.03  ? 55   LYS B N     1 
ATOM   3554  C  CA    . LYS F 2 54  ? 43.647  9.914   195.009 1.00 30.85  ? 55   LYS B CA    1 
ATOM   3555  C  C     . LYS F 2 54  ? 43.693  9.226   196.363 1.00 23.52  ? 55   LYS B C     1 
ATOM   3556  O  O     . LYS F 2 54  ? 44.202  8.112   196.461 1.00 25.52  ? 55   LYS B O     1 
ATOM   3557  C  CB    . LYS F 2 54  ? 42.453  9.364   194.222 1.00 26.03  ? 55   LYS B CB    1 
ATOM   3558  C  CG    . LYS F 2 54  ? 42.366  9.819   192.786 1.00 24.86  ? 55   LYS B CG    1 
ATOM   3559  C  CD    . LYS F 2 54  ? 42.013  11.293  192.681 1.00 44.46  ? 55   LYS B CD    1 
ATOM   3560  C  CE    . LYS F 2 54  ? 40.633  11.588  193.250 1.00 52.68  ? 55   LYS B CE    1 
ATOM   3561  N  NZ    . LYS F 2 54  ? 40.295  13.047  193.191 1.00 61.87  ? 55   LYS B NZ    1 
ATOM   3562  N  N     . GLN F 2 55  ? 43.181  9.854   197.408 1.00 16.96  ? 56   GLN B N     1 
ATOM   3563  C  CA    . GLN F 2 55  ? 43.237  9.190   198.702 1.00 18.33  ? 56   GLN B CA    1 
ATOM   3564  C  C     . GLN F 2 55  ? 42.715  7.754   198.613 1.00 17.37  ? 56   GLN B C     1 
ATOM   3565  O  O     . GLN F 2 55  ? 43.198  6.883   199.315 1.00 17.80  ? 56   GLN B O     1 
ATOM   3566  C  CB    . GLN F 2 55  ? 42.435  9.957   199.748 1.00 15.70  ? 56   GLN B CB    1 
ATOM   3567  C  CG    . GLN F 2 55  ? 42.517  9.354   201.126 1.00 24.70  ? 56   GLN B CG    1 
ATOM   3568  C  CD    . GLN F 2 55  ? 41.701  10.126  202.147 1.00 41.29  ? 56   GLN B CD    1 
ATOM   3569  O  OE1   . GLN F 2 55  ? 41.629  11.356  202.099 1.00 31.81  ? 56   GLN B OE1   1 
ATOM   3570  N  NE2   . GLN F 2 55  ? 41.104  9.408   203.095 1.00 40.59  ? 56   GLN B NE2   1 
ATOM   3571  N  N     . TYR F 2 56  ? 41.735  7.485   197.757 1.00 27.70  ? 57   TYR B N     1 
ATOM   3572  C  CA    . TYR F 2 56  ? 41.232  6.113   197.692 1.00 29.92  ? 57   TYR B CA    1 
ATOM   3573  C  C     . TYR F 2 56  ? 42.167  5.251   196.848 1.00 25.33  ? 57   TYR B C     1 
ATOM   3574  O  O     . TYR F 2 56  ? 42.481  4.119   197.205 1.00 29.21  ? 57   TYR B O     1 
ATOM   3575  C  CB    . TYR F 2 56  ? 39.772  6.089   197.185 1.00 20.91  ? 57   TYR B CB    1 
ATOM   3576  C  CG    . TYR F 2 56  ? 39.555  6.709   195.827 1.00 16.31  ? 57   TYR B CG    1 
ATOM   3577  C  CD1   . TYR F 2 56  ? 39.728  5.952   194.673 1.00 20.07  ? 57   TYR B CD1   1 
ATOM   3578  C  CD2   . TYR F 2 56  ? 39.228  8.064   195.693 1.00 28.11  ? 57   TYR B CD2   1 
ATOM   3579  C  CE1   . TYR F 2 56  ? 39.593  6.512   193.416 1.00 11.31  ? 57   TYR B CE1   1 
ATOM   3580  C  CE2   . TYR F 2 56  ? 39.084  8.649   194.428 1.00 17.48  ? 57   TYR B CE2   1 
ATOM   3581  C  CZ    . TYR F 2 56  ? 39.276  7.859   193.297 1.00 19.99  ? 57   TYR B CZ    1 
ATOM   3582  O  OH    . TYR F 2 56  ? 39.182  8.396   192.037 1.00 26.54  ? 57   TYR B OH    1 
ATOM   3583  N  N     . GLU F 2 57  ? 42.634  5.802   195.740 1.00 27.89  ? 58   GLU B N     1 
ATOM   3584  C  CA    . GLU F 2 57  ? 43.567  5.092   194.879 1.00 30.80  ? 58   GLU B CA    1 
ATOM   3585  C  C     . GLU F 2 57  ? 44.744  4.610   195.712 1.00 27.00  ? 58   GLU B C     1 
ATOM   3586  O  O     . GLU F 2 57  ? 45.247  3.517   195.506 1.00 27.24  ? 58   GLU B O     1 
ATOM   3587  C  CB    . GLU F 2 57  ? 44.078  6.025   193.794 1.00 34.70  ? 58   GLU B CB    1 
ATOM   3588  C  CG    . GLU F 2 57  ? 45.232  5.483   193.012 1.00 30.25  ? 58   GLU B CG    1 
ATOM   3589  C  CD    . GLU F 2 57  ? 45.717  6.473   191.978 1.00 46.12  ? 58   GLU B CD    1 
ATOM   3590  O  OE1   . GLU F 2 57  ? 46.630  6.117   191.194 1.00 43.88  ? 58   GLU B OE1   1 
ATOM   3591  O  OE2   . GLU F 2 57  ? 45.185  7.606   191.955 1.00 35.04  ? 58   GLU B OE2   1 
ATOM   3592  N  N     . TYR F 2 58  ? 45.182  5.438   196.656 1.00 31.58  ? 59   TYR B N     1 
ATOM   3593  C  CA    . TYR F 2 58  ? 46.310  5.083   197.506 1.00 29.35  ? 59   TYR B CA    1 
ATOM   3594  C  C     . TYR F 2 58  ? 45.967  3.905   198.387 1.00 28.61  ? 59   TYR B C     1 
ATOM   3595  O  O     . TYR F 2 58  ? 46.685  2.902   198.402 1.00 39.42  ? 59   TYR B O     1 
ATOM   3596  C  CB    . TYR F 2 58  ? 46.733  6.271   198.366 1.00 33.43  ? 59   TYR B CB    1 
ATOM   3597  C  CG    . TYR F 2 58  ? 47.798  5.944   199.389 1.00 35.39  ? 59   TYR B CG    1 
ATOM   3598  C  CD1   . TYR F 2 58  ? 47.449  5.548   200.692 1.00 36.22  ? 59   TYR B CD1   1 
ATOM   3599  C  CD2   . TYR F 2 58  ? 49.153  6.024   199.066 1.00 23.33  ? 59   TYR B CD2   1 
ATOM   3600  C  CE1   . TYR F 2 58  ? 48.421  5.244   201.649 1.00 26.28  ? 59   TYR B CE1   1 
ATOM   3601  C  CE2   . TYR F 2 58  ? 50.136  5.719   200.018 1.00 32.44  ? 59   TYR B CE2   1 
ATOM   3602  C  CZ    . TYR F 2 58  ? 49.761  5.333   201.302 1.00 33.88  ? 59   TYR B CZ    1 
ATOM   3603  O  OH    . TYR F 2 58  ? 50.727  5.050   202.238 1.00 35.99  ? 59   TYR B OH    1 
ATOM   3604  N  N     . LEU F 2 59  ? 44.871  4.018   199.122 1.00 19.86  ? 60   LEU B N     1 
ATOM   3605  C  CA    . LEU F 2 59  ? 44.458  2.931   199.994 1.00 27.82  ? 60   LEU B CA    1 
ATOM   3606  C  C     . LEU F 2 59  ? 44.291  1.618   199.230 1.00 35.03  ? 60   LEU B C     1 
ATOM   3607  O  O     . LEU F 2 59  ? 44.636  0.558   199.749 1.00 37.31  ? 60   LEU B O     1 
ATOM   3608  C  CB    . LEU F 2 59  ? 43.147  3.270   200.696 1.00 30.81  ? 60   LEU B CB    1 
ATOM   3609  C  CG    . LEU F 2 59  ? 43.182  4.455   201.640 1.00 28.32  ? 60   LEU B CG    1 
ATOM   3610  C  CD1   . LEU F 2 59  ? 41.780  4.714   202.132 1.00 13.31  ? 60   LEU B CD1   1 
ATOM   3611  C  CD2   . LEU F 2 59  ? 44.137  4.169   202.792 1.00 31.44  ? 60   LEU B CD2   1 
ATOM   3612  N  N     . ASN F 2 60  ? 43.769  1.671   198.006 1.00 28.87  ? 61   ASN B N     1 
ATOM   3613  C  CA    . ASN F 2 60  ? 43.594  0.430   197.264 1.00 30.28  ? 61   ASN B CA    1 
ATOM   3614  C  C     . ASN F 2 60  ? 44.930  -0.206  196.985 1.00 28.79  ? 61   ASN B C     1 
ATOM   3615  O  O     . ASN F 2 60  ? 45.040  -1.416  196.943 1.00 36.46  ? 61   ASN B O     1 
ATOM   3616  C  CB    . ASN F 2 60  ? 42.878  0.658   195.938 1.00 29.64  ? 61   ASN B CB    1 
ATOM   3617  C  CG    . ASN F 2 60  ? 41.421  0.937   196.116 1.00 32.67  ? 61   ASN B CG    1 
ATOM   3618  O  OD1   . ASN F 2 60  ? 40.788  0.410   197.028 1.00 34.66  ? 61   ASN B OD1   1 
ATOM   3619  N  ND2   . ASN F 2 60  ? 40.866  1.763   195.239 1.00 39.67  ? 61   ASN B ND2   1 
ATOM   3620  N  N     . ASP F 2 61  ? 45.946  0.620   196.794 1.00 32.92  ? 62   ASP B N     1 
ATOM   3621  C  CA    . ASP F 2 61  ? 47.276  0.119   196.509 1.00 44.30  ? 62   ASP B CA    1 
ATOM   3622  C  C     . ASP F 2 61  ? 47.894  -0.507  197.737 1.00 44.78  ? 62   ASP B C     1 
ATOM   3623  O  O     . ASP F 2 61  ? 48.423  -1.614  197.676 1.00 43.55  ? 62   ASP B O     1 
ATOM   3624  C  CB    . ASP F 2 61  ? 48.152  1.247   195.985 1.00 50.05  ? 62   ASP B CB    1 
ATOM   3625  C  CG    . ASP F 2 61  ? 47.868  1.555   194.536 1.00 55.13  ? 62   ASP B CG    1 
ATOM   3626  O  OD1   . ASP F 2 61  ? 48.180  2.674   194.085 1.00 64.13  ? 62   ASP B OD1   1 
ATOM   3627  O  OD2   . ASP F 2 61  ? 47.339  0.661   193.841 1.00 62.03  ? 62   ASP B OD2   1 
ATOM   3628  N  N     . LEU F 2 62  ? 47.813  0.198   198.857 1.00 43.88  ? 63   LEU B N     1 
ATOM   3629  C  CA    . LEU F 2 62  ? 48.365  -0.308  200.107 1.00 42.53  ? 63   LEU B CA    1 
ATOM   3630  C  C     . LEU F 2 62  ? 47.909  -1.742  200.357 1.00 44.34  ? 63   LEU B C     1 
ATOM   3631  O  O     . LEU F 2 62  ? 48.731  -2.641  200.545 1.00 48.24  ? 63   LEU B O     1 
ATOM   3632  C  CB    . LEU F 2 62  ? 47.922  0.569   201.276 1.00 26.33  ? 63   LEU B CB    1 
ATOM   3633  C  CG    . LEU F 2 62  ? 48.596  0.244   202.606 1.00 40.92  ? 63   LEU B CG    1 
ATOM   3634  C  CD1   . LEU F 2 62  ? 50.074  0.579   202.492 1.00 42.09  ? 63   LEU B CD1   1 
ATOM   3635  C  CD2   . LEU F 2 62  ? 47.955  1.023   203.750 1.00 28.49  ? 63   LEU B CD2   1 
ATOM   3636  N  N     . PHE F 2 63  ? 46.598  -1.957  200.352 1.00 40.80  ? 64   PHE B N     1 
ATOM   3637  C  CA    . PHE F 2 63  ? 46.052  -3.281  200.602 1.00 40.36  ? 64   PHE B CA    1 
ATOM   3638  C  C     . PHE F 2 63  ? 46.376  -4.309  199.519 1.00 46.13  ? 64   PHE B C     1 
ATOM   3639  O  O     . PHE F 2 63  ? 46.513  -5.494  199.815 1.00 35.77  ? 64   PHE B O     1 
ATOM   3640  C  CB    . PHE F 2 63  ? 44.530  -3.198  200.802 1.00 36.12  ? 64   PHE B CB    1 
ATOM   3641  C  CG    . PHE F 2 63  ? 44.116  -2.404  202.012 1.00 31.66  ? 64   PHE B CG    1 
ATOM   3642  C  CD1   . PHE F 2 63  ? 44.993  -2.227  203.077 1.00 39.42  ? 64   PHE B CD1   1 
ATOM   3643  C  CD2   . PHE F 2 63  ? 42.845  -1.849  202.100 1.00 38.62  ? 64   PHE B CD2   1 
ATOM   3644  C  CE1   . PHE F 2 63  ? 44.611  -1.509  204.215 1.00 40.88  ? 64   PHE B CE1   1 
ATOM   3645  C  CE2   . PHE F 2 63  ? 42.455  -1.129  203.236 1.00 37.74  ? 64   PHE B CE2   1 
ATOM   3646  C  CZ    . PHE F 2 63  ? 43.341  -0.960  204.292 1.00 32.44  ? 64   PHE B CZ    1 
ATOM   3647  N  N     . MET F 2 64  ? 46.508  -3.855  198.273 1.00 47.95  ? 65   MET B N     1 
ATOM   3648  C  CA    . MET F 2 64  ? 46.810  -4.750  197.153 1.00 47.96  ? 65   MET B CA    1 
ATOM   3649  C  C     . MET F 2 64  ? 48.182  -5.421  197.252 1.00 50.83  ? 65   MET B C     1 
ATOM   3650  O  O     . MET F 2 64  ? 48.369  -6.523  196.737 1.00 53.96  ? 65   MET B O     1 
ATOM   3651  C  CB    . MET F 2 64  ? 46.710  -4.004  195.813 1.00 45.68  ? 65   MET B CB    1 
ATOM   3652  C  CG    . MET F 2 64  ? 45.287  -3.706  195.333 1.00 37.84  ? 65   MET B CG    1 
ATOM   3653  S  SD    . MET F 2 64  ? 45.272  -2.767  193.765 1.00 39.95  ? 65   MET B SD    1 
ATOM   3654  C  CE    . MET F 2 64  ? 44.491  -3.925  192.594 1.00 26.14  ? 65   MET B CE    1 
ATOM   3655  N  N     . LYS F 2 65  ? 49.144  -4.766  197.896 1.00 52.74  ? 66   LYS B N     1 
ATOM   3656  C  CA    . LYS F 2 65  ? 50.474  -5.353  198.031 1.00 56.95  ? 66   LYS B CA    1 
ATOM   3657  C  C     . LYS F 2 65  ? 50.614  -5.987  199.413 1.00 59.82  ? 66   LYS B C     1 
ATOM   3658  O  O     . LYS F 2 65  ? 51.673  -5.924  200.040 1.00 65.08  ? 66   LYS B O     1 
ATOM   3659  C  CB    . LYS F 2 65  ? 51.559  -4.289  197.803 1.00 54.22  ? 66   LYS B CB    1 
ATOM   3660  C  CG    . LYS F 2 65  ? 51.641  -3.217  198.866 1.00 63.32  ? 66   LYS B CG    1 
ATOM   3661  C  CD    . LYS F 2 65  ? 51.949  -1.847  198.272 1.00 68.16  ? 66   LYS B CD    1 
ATOM   3662  C  CE    . LYS F 2 65  ? 53.264  -1.801  197.518 1.00 73.82  ? 66   LYS B CE    1 
ATOM   3663  N  NZ    . LYS F 2 65  ? 53.521  -0.440  196.952 1.00 69.38  ? 66   LYS B NZ    1 
ATOM   3664  N  N     . ASN F 2 66  ? 49.523  -6.599  199.869 1.00 53.62  ? 67   ASN B N     1 
ATOM   3665  C  CA    . ASN F 2 66  ? 49.454  -7.265  201.168 1.00 51.87  ? 67   ASN B CA    1 
ATOM   3666  C  C     . ASN F 2 66  ? 48.335  -8.318  201.167 1.00 51.15  ? 67   ASN B C     1 
ATOM   3667  O  O     . ASN F 2 66  ? 47.479  -8.334  202.049 1.00 50.67  ? 67   ASN B O     1 
ATOM   3668  C  CB    . ASN F 2 66  ? 49.202  -6.232  202.269 1.00 45.58  ? 67   ASN B CB    1 
ATOM   3669  C  CG    . ASN F 2 66  ? 50.459  -5.486  202.661 1.00 55.50  ? 67   ASN B CG    1 
ATOM   3670  O  OD1   . ASN F 2 66  ? 51.187  -5.913  203.553 1.00 64.98  ? 67   ASN B OD1   1 
ATOM   3671  N  ND2   . ASN F 2 66  ? 50.730  -4.372  201.987 1.00 54.02  ? 67   ASN B ND2   1 
ATOM   3672  N  N     . PRO F 2 67  ? 48.345  -9.223  200.178 1.00 47.65  ? 68   PRO B N     1 
ATOM   3673  C  CA    . PRO F 2 67  ? 47.339  -10.281 200.041 1.00 51.71  ? 68   PRO B CA    1 
ATOM   3674  C  C     . PRO F 2 67  ? 47.170  -11.122 201.296 1.00 51.83  ? 68   PRO B C     1 
ATOM   3675  O  O     . PRO F 2 67  ? 46.082  -11.620 201.580 1.00 50.95  ? 68   PRO B O     1 
ATOM   3676  C  CB    . PRO F 2 67  ? 47.873  -11.117 198.877 1.00 53.20  ? 68   PRO B CB    1 
ATOM   3677  C  CG    . PRO F 2 67  ? 48.670  -10.149 198.088 1.00 50.68  ? 68   PRO B CG    1 
ATOM   3678  C  CD    . PRO F 2 67  ? 49.398  -9.381  199.163 1.00 48.48  ? 68   PRO B CD    1 
ATOM   3679  N  N     . ALA F 2 68  ? 48.262  -11.284 202.031 1.00 49.80  ? 69   ALA B N     1 
ATOM   3680  C  CA    . ALA F 2 68  ? 48.264  -12.079 203.250 1.00 53.27  ? 69   ALA B CA    1 
ATOM   3681  C  C     . ALA F 2 68  ? 47.433  -11.434 204.348 1.00 54.68  ? 69   ALA B C     1 
ATOM   3682  O  O     . ALA F 2 68  ? 46.613  -12.084 204.985 1.00 55.47  ? 69   ALA B O     1 
ATOM   3683  C  CB    . ALA F 2 68  ? 49.689  -12.268 203.724 1.00 53.19  ? 69   ALA B CB    1 
ATOM   3684  N  N     . ILE F 2 69  ? 47.658  -10.146 204.558 1.00 58.91  ? 70   ILE B N     1 
ATOM   3685  C  CA    . ILE F 2 69  ? 46.955  -9.391  205.580 1.00 58.42  ? 70   ILE B CA    1 
ATOM   3686  C  C     . ILE F 2 69  ? 45.483  -9.183  205.242 1.00 62.01  ? 70   ILE B C     1 
ATOM   3687  O  O     . ILE F 2 69  ? 45.163  -8.572  204.225 1.00 67.96  ? 70   ILE B O     1 
ATOM   3688  C  CB    . ILE F 2 69  ? 47.604  -8.017  205.754 1.00 55.85  ? 70   ILE B CB    1 
ATOM   3689  C  CG1   . ILE F 2 69  ? 49.121  -8.149  205.624 1.00 62.60  ? 70   ILE B CG1   1 
ATOM   3690  C  CG2   . ILE F 2 69  ? 47.258  -7.440  207.113 1.00 58.75  ? 70   ILE B CG2   1 
ATOM   3691  C  CD1   . ILE F 2 69  ? 49.736  -9.101  206.620 1.00 66.24  ? 70   ILE B CD1   1 
ATOM   3692  N  N     . ILE F 2 70  ? 44.590  -9.693  206.090 1.00 65.73  ? 71   ILE B N     1 
ATOM   3693  C  CA    . ILE F 2 70  ? 43.147  -9.522  205.888 1.00 62.84  ? 71   ILE B CA    1 
ATOM   3694  C  C     . ILE F 2 70  ? 42.495  -9.226  207.235 1.00 61.23  ? 71   ILE B C     1 
ATOM   3695  O  O     . ILE F 2 70  ? 43.041  -9.582  208.275 1.00 58.93  ? 71   ILE B O     1 
ATOM   3696  C  CB    . ILE F 2 70  ? 42.474  -10.784 205.288 1.00 61.76  ? 71   ILE B CB    1 
ATOM   3697  C  CG1   . ILE F 2 70  ? 42.394  -11.889 206.342 1.00 66.28  ? 71   ILE B CG1   1 
ATOM   3698  C  CG2   . ILE F 2 70  ? 43.245  -11.260 204.075 1.00 50.67  ? 71   ILE B CG2   1 
ATOM   3699  C  CD1   . ILE F 2 70  ? 41.479  -13.029 205.967 1.00 64.19  ? 71   ILE B CD1   1 
ATOM   3700  N  N     . GLY F 2 71  ? 41.335  -8.572  207.214 1.00 65.87  ? 72   GLY B N     1 
ATOM   3701  C  CA    . GLY F 2 71  ? 40.646  -8.228  208.453 1.00 68.34  ? 72   GLY B CA    1 
ATOM   3702  C  C     . GLY F 2 71  ? 40.943  -6.806  208.927 1.00 69.16  ? 72   GLY B C     1 
ATOM   3703  O  O     . GLY F 2 71  ? 42.100  -6.381  208.938 1.00 63.99  ? 72   GLY B O     1 
ATOM   3704  N  N     . HIS F 2 72  ? 39.911  -6.065  209.326 1.00 69.97  ? 73   HIS B N     1 
ATOM   3705  C  CA    . HIS F 2 72  ? 40.109  -4.693  209.785 1.00 70.26  ? 73   HIS B CA    1 
ATOM   3706  C  C     . HIS F 2 72  ? 41.266  -4.610  210.776 1.00 64.44  ? 73   HIS B C     1 
ATOM   3707  O  O     . HIS F 2 72  ? 42.071  -3.693  210.713 1.00 64.58  ? 73   HIS B O     1 
ATOM   3708  C  CB    . HIS F 2 72  ? 38.836  -4.136  210.442 1.00 73.38  ? 73   HIS B CB    1 
ATOM   3709  C  CG    . HIS F 2 72  ? 38.546  -4.716  211.793 1.00 75.10  ? 73   HIS B CG    1 
ATOM   3710  N  ND1   . HIS F 2 72  ? 37.937  -5.941  211.965 1.00 79.61  ? 73   HIS B ND1   1 
ATOM   3711  C  CD2   . HIS F 2 72  ? 38.814  -4.252  213.035 1.00 78.22  ? 73   HIS B CD2   1 
ATOM   3712  C  CE1   . HIS F 2 72  ? 37.843  -6.206  213.256 1.00 85.76  ? 73   HIS B CE1   1 
ATOM   3713  N  NE2   . HIS F 2 72  ? 38.368  -5.197  213.928 1.00 85.85  ? 73   HIS B NE2   1 
ATOM   3714  N  N     . GLU F 2 73  ? 41.342  -5.580  211.680 1.00 65.25  ? 74   GLU B N     1 
ATOM   3715  C  CA    . GLU F 2 73  ? 42.389  -5.620  212.690 1.00 66.96  ? 74   GLU B CA    1 
ATOM   3716  C  C     . GLU F 2 73  ? 43.765  -5.302  212.107 1.00 67.25  ? 74   GLU B C     1 
ATOM   3717  O  O     . GLU F 2 73  ? 44.252  -4.173  212.211 1.00 66.40  ? 74   GLU B O     1 
ATOM   3718  C  CB    . GLU F 2 73  ? 42.446  -7.002  213.355 1.00 77.56  ? 74   GLU B CB    1 
ATOM   3719  C  CG    . GLU F 2 73  ? 41.159  -7.839  213.311 1.00 82.09  ? 74   GLU B CG    1 
ATOM   3720  C  CD    . GLU F 2 73  ? 41.012  -8.639  212.021 1.00 83.70  ? 74   GLU B CD    1 
ATOM   3721  O  OE1   . GLU F 2 73  ? 42.005  -9.266  211.587 1.00 79.54  ? 74   GLU B OE1   1 
ATOM   3722  O  OE2   . GLU F 2 73  ? 39.898  -8.653  211.451 1.00 87.09  ? 74   GLU B OE2   1 
ATOM   3723  N  N     . ALA F 2 74  ? 44.385  -6.307  211.491 1.00 66.33  ? 75   ALA B N     1 
ATOM   3724  C  CA    . ALA F 2 74  ? 45.710  -6.162  210.893 1.00 62.35  ? 75   ALA B CA    1 
ATOM   3725  C  C     . ALA F 2 74  ? 45.784  -5.115  209.784 1.00 60.16  ? 75   ALA B C     1 
ATOM   3726  O  O     . ALA F 2 74  ? 46.783  -4.401  209.668 1.00 51.63  ? 75   ALA B O     1 
ATOM   3727  C  CB    . ALA F 2 74  ? 46.184  -7.507  210.364 1.00 68.08  ? 75   ALA B CB    1 
ATOM   3728  N  N     . ARG F 2 75  ? 44.736  -5.023  208.970 1.00 49.68  ? 76   ARG B N     1 
ATOM   3729  C  CA    . ARG F 2 75  ? 44.731  -4.054  207.888 1.00 47.17  ? 76   ARG B CA    1 
ATOM   3730  C  C     . ARG F 2 75  ? 45.025  -2.633  208.339 1.00 48.72  ? 76   ARG B C     1 
ATOM   3731  O  O     . ARG F 2 75  ? 45.614  -1.867  207.583 1.00 51.79  ? 76   ARG B O     1 
ATOM   3732  C  CB    . ARG F 2 75  ? 43.408  -4.102  207.119 1.00 53.79  ? 76   ARG B CB    1 
ATOM   3733  C  CG    . ARG F 2 75  ? 43.537  -4.856  205.804 1.00 52.57  ? 76   ARG B CG    1 
ATOM   3734  C  CD    . ARG F 2 75  ? 42.226  -5.091  205.081 1.00 43.33  ? 76   ARG B CD    1 
ATOM   3735  N  NE    . ARG F 2 75  ? 42.450  -6.072  204.019 1.00 55.79  ? 76   ARG B NE    1 
ATOM   3736  C  CZ    . ARG F 2 75  ? 41.508  -6.614  203.250 1.00 57.30  ? 76   ARG B CZ    1 
ATOM   3737  N  NH1   . ARG F 2 75  ? 40.230  -6.286  203.393 1.00 48.79  ? 76   ARG B NH1   1 
ATOM   3738  N  NH2   . ARG F 2 75  ? 41.855  -7.508  202.335 1.00 55.68  ? 76   ARG B NH2   1 
ATOM   3739  N  N     . TYR F 2 76  ? 44.623  -2.277  209.559 1.00 49.53  ? 77   TYR B N     1 
ATOM   3740  C  CA    . TYR F 2 76  ? 44.885  -0.933  210.076 1.00 48.98  ? 77   TYR B CA    1 
ATOM   3741  C  C     . TYR F 2 76  ? 46.358  -0.804  210.409 1.00 51.74  ? 77   TYR B C     1 
ATOM   3742  O  O     . TYR F 2 76  ? 46.965  0.241   210.189 1.00 53.08  ? 77   TYR B O     1 
ATOM   3743  C  CB    . TYR F 2 76  ? 44.062  -0.643  211.340 1.00 49.31  ? 77   TYR B CB    1 
ATOM   3744  C  CG    . TYR F 2 76  ? 42.619  -0.258  211.078 1.00 50.14  ? 77   TYR B CG    1 
ATOM   3745  C  CD1   . TYR F 2 76  ? 42.298  0.821   210.263 1.00 48.81  ? 77   TYR B CD1   1 
ATOM   3746  C  CD2   . TYR F 2 76  ? 41.576  -1.001  211.611 1.00 52.71  ? 77   TYR B CD2   1 
ATOM   3747  C  CE1   . TYR F 2 76  ? 40.968  1.142   209.982 1.00 52.27  ? 77   TYR B CE1   1 
ATOM   3748  C  CE2   . TYR F 2 76  ? 40.248  -0.689  211.334 1.00 54.61  ? 77   TYR B CE2   1 
ATOM   3749  C  CZ    . TYR F 2 76  ? 39.950  0.378   210.518 1.00 49.97  ? 77   TYR B CZ    1 
ATOM   3750  O  OH    . TYR F 2 76  ? 38.635  0.655   210.211 1.00 48.96  ? 77   TYR B OH    1 
ATOM   3751  N  N     . LYS F 2 77  ? 46.929  -1.878  210.944 1.00 60.62  ? 78   LYS B N     1 
ATOM   3752  C  CA    . LYS F 2 77  ? 48.338  -1.891  211.319 1.00 61.48  ? 78   LYS B CA    1 
ATOM   3753  C  C     . LYS F 2 77  ? 49.208  -1.619  210.097 1.00 54.01  ? 78   LYS B C     1 
ATOM   3754  O  O     . LYS F 2 77  ? 50.400  -1.315  210.221 1.00 51.08  ? 78   LYS B O     1 
ATOM   3755  C  CB    . LYS F 2 77  ? 48.705  -3.247  211.937 1.00 62.46  ? 78   LYS B CB    1 
ATOM   3756  N  N     . LEU F 2 78  ? 48.604  -1.722  208.917 1.00 44.77  ? 79   LEU B N     1 
ATOM   3757  C  CA    . LEU F 2 78  ? 49.325  -1.489  207.670 1.00 43.64  ? 79   LEU B CA    1 
ATOM   3758  C  C     . LEU F 2 78  ? 49.695  -0.007  207.493 1.00 45.02  ? 79   LEU B C     1 
ATOM   3759  O  O     . LEU F 2 78  ? 50.615  0.317   206.744 1.00 49.95  ? 79   LEU B O     1 
ATOM   3760  C  CB    . LEU F 2 78  ? 48.490  -1.998  206.479 1.00 36.80  ? 79   LEU B CB    1 
ATOM   3761  C  CG    . LEU F 2 78  ? 48.265  -3.519  206.394 1.00 41.61  ? 79   LEU B CG    1 
ATOM   3762  C  CD1   . LEU F 2 78  ? 47.136  -3.829  205.443 1.00 40.66  ? 79   LEU B CD1   1 
ATOM   3763  C  CD2   . LEU F 2 78  ? 49.544  -4.210  205.942 1.00 39.36  ? 79   LEU B CD2   1 
ATOM   3764  N  N     . PHE F 2 79  ? 48.993  0.886   208.192 1.00 48.46  ? 80   PHE B N     1 
ATOM   3765  C  CA    . PHE F 2 79  ? 49.269  2.327   208.106 1.00 52.44  ? 80   PHE B CA    1 
ATOM   3766  C  C     . PHE F 2 79  ? 50.568  2.712   208.813 1.00 55.36  ? 80   PHE B C     1 
ATOM   3767  O  O     . PHE F 2 79  ? 51.249  3.663   208.419 1.00 55.70  ? 80   PHE B O     1 
ATOM   3768  C  CB    . PHE F 2 79  ? 48.100  3.137   208.689 1.00 48.86  ? 80   PHE B CB    1 
ATOM   3769  C  CG    . PHE F 2 79  ? 46.871  3.130   207.822 1.00 45.17  ? 80   PHE B CG    1 
ATOM   3770  C  CD1   . PHE F 2 79  ? 45.785  2.322   208.129 1.00 48.92  ? 80   PHE B CD1   1 
ATOM   3771  C  CD2   . PHE F 2 79  ? 46.829  3.888   206.657 1.00 41.14  ? 80   PHE B CD2   1 
ATOM   3772  C  CE1   . PHE F 2 79  ? 44.672  2.264   207.283 1.00 48.01  ? 80   PHE B CE1   1 
ATOM   3773  C  CE2   . PHE F 2 79  ? 45.725  3.837   205.807 1.00 44.58  ? 80   PHE B CE2   1 
ATOM   3774  C  CZ    . PHE F 2 79  ? 44.645  3.022   206.119 1.00 44.19  ? 80   PHE B CZ    1 
ATOM   3775  N  N     . ASN F 2 80  ? 50.902  1.959   209.855 1.00 55.59  ? 81   ASN B N     1 
ATOM   3776  C  CA    . ASN F 2 80  ? 52.113  2.188   210.628 1.00 62.30  ? 81   ASN B CA    1 
ATOM   3777  C  C     . ASN F 2 80  ? 52.127  3.603   211.184 1.00 61.32  ? 81   ASN B C     1 
ATOM   3778  O  O     . ASN F 2 80  ? 53.179  4.233   211.309 1.00 60.65  ? 81   ASN B O     1 
ATOM   3779  C  CB    . ASN F 2 80  ? 53.355  1.965   209.764 1.00 64.53  ? 81   ASN B CB    1 
ATOM   3780  C  CG    . ASN F 2 80  ? 54.633  1.938   210.583 1.00 70.87  ? 81   ASN B CG    1 
ATOM   3781  O  OD1   . ASN F 2 80  ? 55.733  2.052   210.035 1.00 75.37  ? 81   ASN B OD1   1 
ATOM   3782  N  ND2   . ASN F 2 80  ? 54.496  1.779   211.903 1.00 62.91  ? 81   ASN B ND2   1 
ATOM   3783  N  N     . SER F 2 81  ? 50.946  4.101   211.516 1.00 58.56  ? 82   SER B N     1 
ATOM   3784  C  CA    . SER F 2 81  ? 50.829  5.438   212.065 1.00 49.83  ? 82   SER B CA    1 
ATOM   3785  C  C     . SER F 2 81  ? 49.406  5.754   212.462 1.00 42.41  ? 82   SER B C     1 
ATOM   3786  O  O     . SER F 2 81  ? 48.511  5.805   211.623 1.00 53.58  ? 82   SER B O     1 
ATOM   3787  C  CB    . SER F 2 81  ? 51.307  6.472   211.049 1.00 54.16  ? 82   SER B CB    1 
ATOM   3788  O  OG    . SER F 2 81  ? 51.141  7.779   211.574 1.00 57.07  ? 82   SER B OG    1 
ATOM   3789  N  N     . PRO F 2 82  ? 49.176  5.980   213.753 1.00 33.92  ? 83   PRO B N     1 
ATOM   3790  C  CA    . PRO F 2 82  ? 47.833  6.298   214.247 1.00 40.99  ? 83   PRO B CA    1 
ATOM   3791  C  C     . PRO F 2 82  ? 47.239  7.498   213.515 1.00 38.21  ? 83   PRO B C     1 
ATOM   3792  O  O     . PRO F 2 82  ? 46.270  7.375   212.771 1.00 43.63  ? 83   PRO B O     1 
ATOM   3793  C  CB    . PRO F 2 82  ? 48.068  6.603   215.726 1.00 36.37  ? 83   PRO B CB    1 
ATOM   3794  C  CG    . PRO F 2 82  ? 49.263  5.775   216.062 1.00 36.28  ? 83   PRO B CG    1 
ATOM   3795  C  CD    . PRO F 2 82  ? 50.154  5.948   214.849 1.00 32.23  ? 83   PRO B CD    1 
ATOM   3796  N  N     . THR F 2 83  ? 47.841  8.657   213.744 1.00 37.04  ? 84   THR B N     1 
ATOM   3797  C  CA    . THR F 2 83  ? 47.409  9.900   213.138 1.00 39.29  ? 84   THR B CA    1 
ATOM   3798  C  C     . THR F 2 83  ? 46.988  9.727   211.685 1.00 41.13  ? 84   THR B C     1 
ATOM   3799  O  O     . THR F 2 83  ? 45.811  9.896   211.357 1.00 43.37  ? 84   THR B O     1 
ATOM   3800  C  CB    . THR F 2 83  ? 48.526  10.949  213.242 1.00 38.24  ? 84   THR B CB    1 
ATOM   3801  O  OG1   . THR F 2 83  ? 48.717  11.288  214.622 1.00 37.78  ? 84   THR B OG1   1 
ATOM   3802  C  CG2   . THR F 2 83  ? 48.172  12.190  212.464 1.00 31.11  ? 84   THR B CG2   1 
ATOM   3803  N  N     . LEU F 2 84  ? 47.936  9.386   210.817 1.00 39.13  ? 85   LEU B N     1 
ATOM   3804  C  CA    . LEU F 2 84  ? 47.618  9.187   209.403 1.00 41.97  ? 85   LEU B CA    1 
ATOM   3805  C  C     . LEU F 2 84  ? 46.391  8.306   209.201 1.00 37.58  ? 85   LEU B C     1 
ATOM   3806  O  O     . LEU F 2 84  ? 45.617  8.504   208.259 1.00 30.64  ? 85   LEU B O     1 
ATOM   3807  C  CB    . LEU F 2 84  ? 48.801  8.563   208.667 1.00 36.53  ? 85   LEU B CB    1 
ATOM   3808  C  CG    . LEU F 2 84  ? 49.870  9.573   208.266 1.00 48.74  ? 85   LEU B CG    1 
ATOM   3809  C  CD1   . LEU F 2 84  ? 51.029  8.855   207.588 1.00 55.89  ? 85   LEU B CD1   1 
ATOM   3810  C  CD2   . LEU F 2 84  ? 49.260  10.603  207.345 1.00 37.55  ? 85   LEU B CD2   1 
ATOM   3811  N  N     . LEU F 2 85  ? 46.234  7.323   210.081 1.00 32.47  ? 86   LEU B N     1 
ATOM   3812  C  CA    . LEU F 2 85  ? 45.115  6.409   210.012 1.00 33.86  ? 86   LEU B CA    1 
ATOM   3813  C  C     . LEU F 2 85  ? 43.836  7.194   210.283 1.00 35.04  ? 86   LEU B C     1 
ATOM   3814  O  O     . LEU F 2 85  ? 42.859  7.062   209.559 1.00 22.36  ? 86   LEU B O     1 
ATOM   3815  C  CB    . LEU F 2 85  ? 45.299  5.288   211.039 1.00 41.21  ? 86   LEU B CB    1 
ATOM   3816  C  CG    . LEU F 2 85  ? 44.296  4.126   210.973 1.00 54.97  ? 86   LEU B CG    1 
ATOM   3817  C  CD1   . LEU F 2 85  ? 44.970  2.842   211.430 1.00 51.55  ? 86   LEU B CD1   1 
ATOM   3818  C  CD2   . LEU F 2 85  ? 43.076  4.444   211.827 1.00 44.57  ? 86   LEU B CD2   1 
ATOM   3819  N  N     . PHE F 2 86  ? 43.858  8.019   211.324 1.00 30.34  ? 87   PHE B N     1 
ATOM   3820  C  CA    . PHE F 2 86  ? 42.716  8.842   211.671 1.00 19.66  ? 87   PHE B CA    1 
ATOM   3821  C  C     . PHE F 2 86  ? 42.355  9.762   210.520 1.00 24.93  ? 87   PHE B C     1 
ATOM   3822  O  O     . PHE F 2 86  ? 41.205  10.174  210.384 1.00 34.29  ? 87   PHE B O     1 
ATOM   3823  C  CB    . PHE F 2 86  ? 43.034  9.703   212.880 1.00 19.11  ? 87   PHE B CB    1 
ATOM   3824  C  CG    . PHE F 2 86  ? 42.060  10.813  213.088 1.00 23.56  ? 87   PHE B CG    1 
ATOM   3825  C  CD1   . PHE F 2 86  ? 40.792  10.557  213.570 1.00 25.42  ? 87   PHE B CD1   1 
ATOM   3826  C  CD2   . PHE F 2 86  ? 42.392  12.120  212.752 1.00 26.70  ? 87   PHE B CD2   1 
ATOM   3827  C  CE1   . PHE F 2 86  ? 39.865  11.592  213.713 1.00 32.11  ? 87   PHE B CE1   1 
ATOM   3828  C  CE2   . PHE F 2 86  ? 41.468  13.161  212.894 1.00 25.18  ? 87   PHE B CE2   1 
ATOM   3829  C  CZ    . PHE F 2 86  ? 40.208  12.898  213.372 1.00 13.72  ? 87   PHE B CZ    1 
ATOM   3830  N  N     . LEU F 2 87  ? 43.352  10.075  209.699 1.00 27.32  ? 88   LEU B N     1 
ATOM   3831  C  CA    . LEU F 2 87  ? 43.208  10.972  208.555 1.00 27.95  ? 88   LEU B CA    1 
ATOM   3832  C  C     . LEU F 2 87  ? 42.965  10.288  207.203 1.00 30.44  ? 88   LEU B C     1 
ATOM   3833  O  O     . LEU F 2 87  ? 42.413  10.898  206.285 1.00 31.40  ? 88   LEU B O     1 
ATOM   3834  C  CB    . LEU F 2 87  ? 44.469  11.857  208.442 1.00 34.53  ? 88   LEU B CB    1 
ATOM   3835  C  CG    . LEU F 2 87  ? 44.833  12.950  209.469 1.00 41.79  ? 88   LEU B CG    1 
ATOM   3836  C  CD1   . LEU F 2 87  ? 46.341  13.168  209.509 1.00 35.57  ? 88   LEU B CD1   1 
ATOM   3837  C  CD2   . LEU F 2 87  ? 44.128  14.244  209.122 1.00 32.54  ? 88   LEU B CD2   1 
ATOM   3838  N  N     . LEU F 2 88  ? 43.369  9.030   207.068 1.00 32.36  ? 89   LEU B N     1 
ATOM   3839  C  CA    . LEU F 2 88  ? 43.218  8.342   205.787 1.00 25.94  ? 89   LEU B CA    1 
ATOM   3840  C  C     . LEU F 2 88  ? 42.432  7.030   205.821 1.00 26.63  ? 89   LEU B C     1 
ATOM   3841  O  O     . LEU F 2 88  ? 41.852  6.632   204.820 1.00 32.14  ? 89   LEU B O     1 
ATOM   3842  C  CB    . LEU F 2 88  ? 44.606  8.075   205.203 1.00 19.07  ? 89   LEU B CB    1 
ATOM   3843  C  CG    . LEU F 2 88  ? 45.626  9.219   205.238 1.00 32.97  ? 89   LEU B CG    1 
ATOM   3844  C  CD1   . LEU F 2 88  ? 46.873  8.802   204.467 1.00 29.98  ? 89   LEU B CD1   1 
ATOM   3845  C  CD2   . LEU F 2 88  ? 45.033  10.479  204.609 1.00 23.30  ? 89   LEU B CD2   1 
ATOM   3846  N  N     . SER F 2 89  ? 42.421  6.357   206.966 1.00 26.63  ? 90   SER B N     1 
ATOM   3847  C  CA    . SER F 2 89  ? 41.728  5.083   207.091 1.00 21.83  ? 90   SER B CA    1 
ATOM   3848  C  C     . SER F 2 89  ? 40.233  5.185   206.797 1.00 27.22  ? 90   SER B C     1 
ATOM   3849  O  O     . SER F 2 89  ? 39.621  6.243   206.951 1.00 22.20  ? 90   SER B O     1 
ATOM   3850  C  CB    . SER F 2 89  ? 41.927  4.508   208.491 1.00 17.99  ? 90   SER B CB    1 
ATOM   3851  O  OG    . SER F 2 89  ? 41.017  5.094   209.405 1.00 47.69  ? 90   SER B OG    1 
ATOM   3852  N  N     . ARG F 2 90  ? 39.653  4.062   206.386 1.00 30.21  ? 91   ARG B N     1 
ATOM   3853  C  CA    . ARG F 2 90  ? 38.243  3.990   206.061 1.00 28.40  ? 91   ARG B CA    1 
ATOM   3854  C  C     . ARG F 2 90  ? 37.486  3.328   207.205 1.00 30.02  ? 91   ARG B C     1 
ATOM   3855  O  O     . ARG F 2 90  ? 38.087  2.931   208.195 1.00 40.07  ? 91   ARG B O     1 
ATOM   3856  C  CB    . ARG F 2 90  ? 38.068  3.180   204.792 1.00 35.18  ? 91   ARG B CB    1 
ATOM   3857  C  CG    . ARG F 2 90  ? 36.901  3.616   203.980 1.00 42.47  ? 91   ARG B CG    1 
ATOM   3858  C  CD    . ARG F 2 90  ? 37.206  4.950   203.361 1.00 38.53  ? 91   ARG B CD    1 
ATOM   3859  N  NE    . ARG F 2 90  ? 36.910  4.904   201.936 1.00 31.04  ? 91   ARG B NE    1 
ATOM   3860  C  CZ    . ARG F 2 90  ? 37.129  5.908   201.105 1.00 13.95  ? 91   ARG B CZ    1 
ATOM   3861  N  NH1   . ARG F 2 90  ? 37.646  7.038   201.557 1.00 19.31  ? 91   ARG B NH1   1 
ATOM   3862  N  NH2   . ARG F 2 90  ? 36.831  5.780   199.829 1.00 22.59  ? 91   ARG B NH2   1 
ATOM   3863  N  N     . GLY F 2 91  ? 36.171  3.200   207.077 1.00 37.98  ? 92   GLY B N     1 
ATOM   3864  C  CA    . GLY F 2 91  ? 35.397  2.571   208.139 1.00 47.09  ? 92   GLY B CA    1 
ATOM   3865  C  C     . GLY F 2 91  ? 35.856  1.162   208.479 1.00 50.16  ? 92   GLY B C     1 
ATOM   3866  O  O     . GLY F 2 91  ? 36.701  0.587   207.792 1.00 53.85  ? 92   GLY B O     1 
ATOM   3867  N  N     . LYS F 2 92  ? 35.291  0.600   209.542 1.00 53.99  ? 93   LYS B N     1 
ATOM   3868  C  CA    . LYS F 2 92  ? 35.638  -0.751  209.988 1.00 48.88  ? 93   LYS B CA    1 
ATOM   3869  C  C     . LYS F 2 92  ? 35.102  -1.785  208.989 1.00 42.08  ? 93   LYS B C     1 
ATOM   3870  O  O     . LYS F 2 92  ? 35.865  -2.543  208.381 1.00 31.07  ? 93   LYS B O     1 
ATOM   3871  C  CB    . LYS F 2 92  ? 35.052  -0.995  211.389 1.00 52.69  ? 93   LYS B CB    1 
ATOM   3872  C  CG    . LYS F 2 92  ? 35.505  -2.277  212.059 1.00 60.35  ? 93   LYS B CG    1 
ATOM   3873  C  CD    . LYS F 2 92  ? 34.953  -2.395  213.473 1.00 64.44  ? 93   LYS B CD    1 
ATOM   3874  C  CE    . LYS F 2 92  ? 35.465  -3.673  214.130 1.00 70.68  ? 93   LYS B CE    1 
ATOM   3875  N  NZ    . LYS F 2 92  ? 35.171  -3.757  215.580 1.00 64.42  ? 93   LYS B NZ    1 
ATOM   3876  N  N     . ALA F 2 93  ? 33.788  -1.811  208.815 1.00 37.04  ? 94   ALA B N     1 
ATOM   3877  C  CA    . ALA F 2 93  ? 33.191  -2.745  207.871 1.00 45.47  ? 94   ALA B CA    1 
ATOM   3878  C  C     . ALA F 2 93  ? 33.703  -2.473  206.457 1.00 43.81  ? 94   ALA B C     1 
ATOM   3879  O  O     . ALA F 2 93  ? 33.638  -3.339  205.583 1.00 49.67  ? 94   ALA B O     1 
ATOM   3880  C  CB    . ALA F 2 93  ? 31.668  -2.640  207.898 1.00 35.42  ? 94   ALA B CB    1 
ATOM   3881  N  N     . ALA F 2 94  ? 34.209  -1.267  206.230 1.00 42.28  ? 95   ALA B N     1 
ATOM   3882  C  CA    . ALA F 2 94  ? 34.712  -0.921  204.904 1.00 48.36  ? 95   ALA B CA    1 
ATOM   3883  C  C     . ALA F 2 94  ? 36.066  -1.584  204.606 1.00 51.49  ? 95   ALA B C     1 
ATOM   3884  O  O     . ALA F 2 94  ? 36.270  -2.144  203.518 1.00 36.90  ? 95   ALA B O     1 
ATOM   3885  C  CB    . ALA F 2 94  ? 34.817  0.595   204.761 1.00 42.60  ? 95   ALA B CB    1 
ATOM   3886  N  N     . THR F 2 95  ? 36.978  -1.519  205.578 1.00 41.73  ? 96   THR B N     1 
ATOM   3887  C  CA    . THR F 2 95  ? 38.303  -2.103  205.449 1.00 43.03  ? 96   THR B CA    1 
ATOM   3888  C  C     . THR F 2 95  ? 38.208  -3.628  205.528 1.00 50.77  ? 96   THR B C     1 
ATOM   3889  O  O     . THR F 2 95  ? 39.074  -4.351  205.037 1.00 52.10  ? 96   THR B O     1 
ATOM   3890  C  CB    . THR F 2 95  ? 39.211  -1.603  206.573 1.00 43.73  ? 96   THR B CB    1 
ATOM   3891  O  OG1   . THR F 2 95  ? 38.823  -0.276  206.916 1.00 46.00  ? 96   THR B OG1   1 
ATOM   3892  C  CG2   . THR F 2 95  ? 40.668  -1.592  206.138 1.00 35.60  ? 96   THR B CG2   1 
ATOM   3893  N  N     . GLU F 2 96  ? 37.134  -4.106  206.142 1.00 56.61  ? 97   GLU B N     1 
ATOM   3894  C  CA    . GLU F 2 96  ? 36.901  -5.535  206.298 1.00 59.13  ? 97   GLU B CA    1 
ATOM   3895  C  C     . GLU F 2 96  ? 36.475  -6.160  204.971 1.00 54.69  ? 97   GLU B C     1 
ATOM   3896  O  O     . GLU F 2 96  ? 37.061  -7.142  204.518 1.00 49.21  ? 97   GLU B O     1 
ATOM   3897  C  CB    . GLU F 2 96  ? 35.807  -5.762  207.350 1.00 67.61  ? 97   GLU B CB    1 
ATOM   3898  C  CG    . GLU F 2 96  ? 35.594  -7.208  207.776 1.00 65.03  ? 97   GLU B CG    1 
ATOM   3899  C  CD    . GLU F 2 96  ? 36.802  -7.793  208.481 1.00 69.48  ? 97   GLU B CD    1 
ATOM   3900  O  OE1   . GLU F 2 96  ? 37.431  -7.074  209.290 1.00 72.59  ? 97   GLU B OE1   1 
ATOM   3901  O  OE2   . GLU F 2 96  ? 37.117  -8.977  208.238 1.00 75.44  ? 97   GLU B OE2   1 
ATOM   3902  N  N     . ASN F 2 97  ? 35.459  -5.569  204.349 1.00 49.75  ? 98   ASN B N     1 
ATOM   3903  C  CA    . ASN F 2 97  ? 34.930  -6.063  203.083 1.00 48.34  ? 98   ASN B CA    1 
ATOM   3904  C  C     . ASN F 2 97  ? 35.745  -5.618  201.868 1.00 46.80  ? 98   ASN B C     1 
ATOM   3905  O  O     . ASN F 2 97  ? 35.239  -5.612  200.748 1.00 44.07  ? 98   ASN B O     1 
ATOM   3906  C  CB    . ASN F 2 97  ? 33.484  -5.589  202.905 1.00 46.39  ? 98   ASN B CB    1 
ATOM   3907  C  CG    . ASN F 2 97  ? 32.627  -5.854  204.126 1.00 50.61  ? 98   ASN B CG    1 
ATOM   3908  O  OD1   . ASN F 2 97  ? 31.518  -5.325  204.243 1.00 40.59  ? 98   ASN B OD1   1 
ATOM   3909  N  ND2   . ASN F 2 97  ? 33.132  -6.677  205.042 1.00 46.79  ? 98   ASN B ND2   1 
ATOM   3910  N  N     . TRP F 2 98  ? 37.000  -5.241  202.072 1.00 44.26  ? 99   TRP B N     1 
ATOM   3911  C  CA    . TRP F 2 98  ? 37.807  -4.805  200.942 1.00 38.50  ? 99   TRP B CA    1 
ATOM   3912  C  C     . TRP F 2 98  ? 38.408  -5.993  200.223 1.00 39.49  ? 99   TRP B C     1 
ATOM   3913  O  O     . TRP F 2 98  ? 38.963  -6.885  200.852 1.00 47.73  ? 99   TRP B O     1 
ATOM   3914  C  CB    . TRP F 2 98  ? 38.953  -3.902  201.396 1.00 45.44  ? 99   TRP B CB    1 
ATOM   3915  C  CG    . TRP F 2 98  ? 39.756  -3.376  200.243 1.00 39.47  ? 99   TRP B CG    1 
ATOM   3916  C  CD1   . TRP F 2 98  ? 39.526  -2.229  199.547 1.00 48.02  ? 99   TRP B CD1   1 
ATOM   3917  C  CD2   . TRP F 2 98  ? 40.886  -4.001  199.618 1.00 33.84  ? 99   TRP B CD2   1 
ATOM   3918  N  NE1   . TRP F 2 98  ? 40.442  -2.097  198.534 1.00 42.15  ? 99   TRP B NE1   1 
ATOM   3919  C  CE2   . TRP F 2 98  ? 41.289  -3.168  198.558 1.00 36.88  ? 99   TRP B CE2   1 
ATOM   3920  C  CE3   . TRP F 2 98  ? 41.598  -5.180  199.855 1.00 42.80  ? 99   TRP B CE3   1 
ATOM   3921  C  CZ2   . TRP F 2 98  ? 42.375  -3.479  197.730 1.00 52.02  ? 99   TRP B CZ2   1 
ATOM   3922  C  CZ3   . TRP F 2 98  ? 42.682  -5.490  199.030 1.00 47.68  ? 99   TRP B CZ3   1 
ATOM   3923  C  CH2   . TRP F 2 98  ? 43.061  -4.641  197.984 1.00 46.36  ? 99   TRP B CH2   1 
ATOM   3924  N  N     . SER F 2 99  ? 38.309  -6.002  198.902 1.00 33.17  ? 100  SER B N     1 
ATOM   3925  C  CA    . SER F 2 99  ? 38.883  -7.082  198.121 1.00 35.93  ? 100  SER B CA    1 
ATOM   3926  C  C     . SER F 2 99  ? 39.248  -6.520  196.754 1.00 39.99  ? 100  SER B C     1 
ATOM   3927  O  O     . SER F 2 99  ? 38.725  -5.485  196.352 1.00 47.97  ? 100  SER B O     1 
ATOM   3928  C  CB    . SER F 2 99  ? 37.876  -8.220  197.965 1.00 30.99  ? 100  SER B CB    1 
ATOM   3929  O  OG    . SER F 2 99  ? 36.761  -7.814  197.189 1.00 54.67  ? 100  SER B OG    1 
ATOM   3930  N  N     . ILE F 2 100 ? 40.131  -7.199  196.034 1.00 36.44  ? 101  ILE B N     1 
ATOM   3931  C  CA    . ILE F 2 100 ? 40.532  -6.714  194.731 1.00 35.52  ? 101  ILE B CA    1 
ATOM   3932  C  C     . ILE F 2 100 ? 39.345  -6.747  193.793 1.00 40.50  ? 101  ILE B C     1 
ATOM   3933  O  O     . ILE F 2 100 ? 39.482  -6.513  192.592 1.00 47.05  ? 101  ILE B O     1 
ATOM   3934  C  CB    . ILE F 2 100 ? 41.660  -7.554  194.114 1.00 36.21  ? 101  ILE B CB    1 
ATOM   3935  C  CG1   . ILE F 2 100 ? 42.692  -7.922  195.189 1.00 50.63  ? 101  ILE B CG1   1 
ATOM   3936  C  CG2   . ILE F 2 100 ? 42.342  -6.750  192.998 1.00 23.30  ? 101  ILE B CG2   1 
ATOM   3937  C  CD1   . ILE F 2 100 ? 42.238  -8.994  196.173 1.00 40.63  ? 101  ILE B CD1   1 
ATOM   3938  N  N     . GLU F 2 101 ? 38.169  -7.035  194.336 1.00 37.41  ? 102  GLU B N     1 
ATOM   3939  C  CA    . GLU F 2 101 ? 36.963  -7.087  193.513 1.00 44.70  ? 102  GLU B CA    1 
ATOM   3940  C  C     . GLU F 2 101 ? 35.957  -6.138  194.097 1.00 47.19  ? 102  GLU B C     1 
ATOM   3941  O  O     . GLU F 2 101 ? 34.821  -6.059  193.638 1.00 55.07  ? 102  GLU B O     1 
ATOM   3942  C  CB    . GLU F 2 101 ? 36.384  -8.492  193.504 1.00 38.16  ? 102  GLU B CB    1 
ATOM   3943  C  CG    . GLU F 2 101 ? 37.366  -9.537  193.945 1.00 55.66  ? 102  GLU B CG    1 
ATOM   3944  C  CD    . GLU F 2 101 ? 36.916  -10.920 193.596 1.00 62.66  ? 102  GLU B CD    1 
ATOM   3945  O  OE1   . GLU F 2 101 ? 37.647  -11.877 193.940 1.00 70.12  ? 102  GLU B OE1   1 
ATOM   3946  O  OE2   . GLU F 2 101 ? 35.836  -11.042 192.974 1.00 57.66  ? 102  GLU B OE2   1 
ATOM   3947  N  N     . ASN F 2 102 ? 36.398  -5.409  195.115 1.00 52.27  ? 103  ASN B N     1 
ATOM   3948  C  CA    . ASN F 2 102 ? 35.554  -4.448  195.802 1.00 48.55  ? 103  ASN B CA    1 
ATOM   3949  C  C     . ASN F 2 102 ? 36.450  -3.326  196.364 1.00 46.80  ? 103  ASN B C     1 
ATOM   3950  O  O     . ASN F 2 102 ? 36.520  -3.114  197.573 1.00 53.52  ? 103  ASN B O     1 
ATOM   3951  C  CB    . ASN F 2 102 ? 34.797  -5.185  196.911 1.00 34.13  ? 103  ASN B CB    1 
ATOM   3952  C  CG    . ASN F 2 102 ? 33.762  -4.320  197.595 1.00 40.47  ? 103  ASN B CG    1 
ATOM   3953  O  OD1   . ASN F 2 102 ? 33.009  -3.583  196.938 1.00 51.36  ? 103  ASN B OD1   1 
ATOM   3954  N  ND2   . ASN F 2 102 ? 33.698  -4.418  198.923 1.00 17.13  ? 103  ASN B ND2   1 
ATOM   3955  N  N     . LEU F 2 103 ? 37.130  -2.621  195.463 1.00 39.06  ? 104  LEU B N     1 
ATOM   3956  C  CA    . LEU F 2 103 ? 38.036  -1.532  195.821 1.00 42.31  ? 104  LEU B CA    1 
ATOM   3957  C  C     . LEU F 2 103 ? 37.322  -0.323  196.371 1.00 39.33  ? 104  LEU B C     1 
ATOM   3958  O  O     . LEU F 2 103 ? 36.107  -0.199  196.224 1.00 49.53  ? 104  LEU B O     1 
ATOM   3959  C  CB    . LEU F 2 103 ? 38.824  -1.071  194.599 1.00 39.29  ? 104  LEU B CB    1 
ATOM   3960  C  CG    . LEU F 2 103 ? 39.522  -2.194  193.851 1.00 44.81  ? 104  LEU B CG    1 
ATOM   3961  C  CD1   . LEU F 2 103 ? 40.154  -1.634  192.591 1.00 37.61  ? 104  LEU B CD1   1 
ATOM   3962  C  CD2   . LEU F 2 103 ? 40.550  -2.854  194.765 1.00 38.34  ? 104  LEU B CD2   1 
ATOM   3963  N  N     . PHE F 2 104 ? 38.094  0.575   196.986 1.00 32.36  ? 105  PHE B N     1 
ATOM   3964  C  CA    . PHE F 2 104 ? 37.559  1.817   197.545 1.00 26.96  ? 105  PHE B CA    1 
ATOM   3965  C  C     . PHE F 2 104 ? 37.252  2.785   196.406 1.00 34.29  ? 105  PHE B C     1 
ATOM   3966  O  O     . PHE F 2 104 ? 37.902  2.757   195.354 1.00 31.12  ? 105  PHE B O     1 
ATOM   3967  C  CB    . PHE F 2 104 ? 38.566  2.484   198.486 1.00 20.70  ? 105  PHE B CB    1 
ATOM   3968  C  CG    . PHE F 2 104 ? 38.803  1.743   199.777 1.00 31.14  ? 105  PHE B CG    1 
ATOM   3969  C  CD1   . PHE F 2 104 ? 40.067  1.242   200.082 1.00 26.57  ? 105  PHE B CD1   1 
ATOM   3970  C  CD2   . PHE F 2 104 ? 37.774  1.569   200.701 1.00 32.49  ? 105  PHE B CD2   1 
ATOM   3971  C  CE1   . PHE F 2 104 ? 40.299  0.577   201.294 1.00 30.07  ? 105  PHE B CE1   1 
ATOM   3972  C  CE2   . PHE F 2 104 ? 37.995  0.907   201.913 1.00 26.81  ? 105  PHE B CE2   1 
ATOM   3973  C  CZ    . PHE F 2 104 ? 39.259  0.409   202.210 1.00 25.98  ? 105  PHE B CZ    1 
ATOM   3974  N  N     . GLU F 2 105 ? 36.261  3.643   196.630 1.00 35.95  ? 106  GLU B N     1 
ATOM   3975  C  CA    . GLU F 2 105 ? 35.846  4.654   195.651 1.00 41.66  ? 106  GLU B CA    1 
ATOM   3976  C  C     . GLU F 2 105 ? 35.919  6.026   196.317 1.00 34.57  ? 106  GLU B C     1 
ATOM   3977  O  O     . GLU F 2 105 ? 36.439  6.142   197.420 1.00 22.99  ? 106  GLU B O     1 
ATOM   3978  C  CB    . GLU F 2 105 ? 34.411  4.398   195.194 1.00 50.68  ? 106  GLU B CB    1 
ATOM   3979  C  CG    . GLU F 2 105 ? 34.168  3.054   194.543 1.00 71.90  ? 106  GLU B CG    1 
ATOM   3980  C  CD    . GLU F 2 105 ? 32.686  2.734   194.447 1.00 84.71  ? 106  GLU B CD    1 
ATOM   3981  O  OE1   . GLU F 2 105 ? 31.908  3.660   194.122 1.00 83.77  ? 106  GLU B OE1   1 
ATOM   3982  O  OE2   . GLU F 2 105 ? 32.306  1.562   194.688 1.00 94.39  ? 106  GLU B OE2   1 
ATOM   3983  N  N     . GLU F 2 106 ? 35.403  7.055   195.649 1.00 32.86  ? 107  GLU B N     1 
ATOM   3984  C  CA    . GLU F 2 106 ? 35.420  8.399   196.216 1.00 35.16  ? 107  GLU B CA    1 
ATOM   3985  C  C     . GLU F 2 106 ? 34.451  8.495   197.387 1.00 26.35  ? 107  GLU B C     1 
ATOM   3986  O  O     . GLU F 2 106 ? 33.275  8.205   197.244 1.00 36.02  ? 107  GLU B O     1 
ATOM   3987  C  CB    . GLU F 2 106 ? 35.013  9.444   195.182 1.00 35.95  ? 107  GLU B CB    1 
ATOM   3988  C  CG    . GLU F 2 106 ? 35.297  10.861  195.645 1.00 68.61  ? 107  GLU B CG    1 
ATOM   3989  C  CD    . GLU F 2 106 ? 34.489  11.908  194.899 1.00 89.17  ? 107  GLU B CD    1 
ATOM   3990  O  OE1   . GLU F 2 106 ? 34.503  11.893  193.644 1.00 99.33  ? 107  GLU B OE1   1 
ATOM   3991  O  OE2   . GLU F 2 106 ? 33.846  12.752  195.573 1.00 95.69  ? 107  GLU B OE2   1 
ATOM   3992  N  N     . LYS F 2 107 ? 34.951  8.886   198.545 1.00 14.29  ? 108  LYS B N     1 
ATOM   3993  C  CA    . LYS F 2 107 ? 34.106  9.057   199.706 1.00 19.76  ? 108  LYS B CA    1 
ATOM   3994  C  C     . LYS F 2 107 ? 33.903  10.581  199.832 1.00 23.85  ? 108  LYS B C     1 
ATOM   3995  O  O     . LYS F 2 107 ? 34.824  11.356  199.573 1.00 13.98  ? 108  LYS B O     1 
ATOM   3996  C  CB    . LYS F 2 107 ? 34.814  8.510   200.934 1.00 26.33  ? 108  LYS B CB    1 
ATOM   3997  C  CG    . LYS F 2 107 ? 33.953  8.440   202.156 1.00 28.00  ? 108  LYS B CG    1 
ATOM   3998  C  CD    . LYS F 2 107 ? 33.047  7.249   202.125 1.00 22.13  ? 108  LYS B CD    1 
ATOM   3999  C  CE    . LYS F 2 107 ? 32.043  7.372   203.256 1.00 35.82  ? 108  LYS B CE    1 
ATOM   4000  N  NZ    . LYS F 2 107 ? 32.762  7.647   204.533 1.00 20.54  ? 108  LYS B NZ    1 
ATOM   4001  N  N     . GLN F 2 108 ? 32.720  11.022  200.247 1.00 14.51  ? 109  GLN B N     1 
ATOM   4002  C  CA    . GLN F 2 108 ? 32.487  12.452  200.307 1.00 13.43  ? 109  GLN B CA    1 
ATOM   4003  C  C     . GLN F 2 108 ? 33.250  13.195  201.393 1.00 18.07  ? 109  GLN B C     1 
ATOM   4004  O  O     . GLN F 2 108 ? 33.543  14.379  201.238 1.00 9.06   ? 109  GLN B O     1 
ATOM   4005  C  CB    . GLN F 2 108 ? 30.993  12.746  200.441 1.00 24.02  ? 109  GLN B CB    1 
ATOM   4006  C  CG    . GLN F 2 108 ? 30.648  14.219  200.225 1.00 21.59  ? 109  GLN B CG    1 
ATOM   4007  C  CD    . GLN F 2 108 ? 29.155  14.468  200.138 1.00 25.34  ? 109  GLN B CD    1 
ATOM   4008  O  OE1   . GLN F 2 108 ? 28.460  13.897  199.289 1.00 29.01  ? 109  GLN B OE1   1 
ATOM   4009  N  NE2   . GLN F 2 108 ? 28.653  15.330  201.010 1.00 28.36  ? 109  GLN B NE2   1 
ATOM   4010  N  N     . ASN F 2 109 ? 33.589  12.514  202.482 1.00 14.72  ? 110  ASN B N     1 
ATOM   4011  C  CA    . ASN F 2 109 ? 34.290  13.190  203.565 1.00 19.31  ? 110  ASN B CA    1 
ATOM   4012  C  C     . ASN F 2 109 ? 35.761  12.809  203.715 1.00 22.80  ? 110  ASN B C     1 
ATOM   4013  O  O     . ASN F 2 109 ? 36.299  12.793  204.831 1.00 28.41  ? 110  ASN B O     1 
ATOM   4014  C  CB    . ASN F 2 109 ? 33.553  12.994  204.905 1.00 7.23   ? 110  ASN B CB    1 
ATOM   4015  C  CG    . ASN F 2 109 ? 33.436  11.536  205.321 1.00 26.72  ? 110  ASN B CG    1 
ATOM   4016  O  OD1   . ASN F 2 109 ? 34.100  10.656  204.778 1.00 25.63  ? 110  ASN B OD1   1 
ATOM   4017  N  ND2   . ASN F 2 109 ? 32.592  11.280  206.310 1.00 29.66  ? 110  ASN B ND2   1 
ATOM   4018  N  N     . ASP F 2 110 ? 36.416  12.511  202.595 1.00 21.67  ? 111  ASP B N     1 
ATOM   4019  C  CA    . ASP F 2 110 ? 37.829  12.160  202.642 1.00 14.73  ? 111  ASP B CA    1 
ATOM   4020  C  C     . ASP F 2 110 ? 38.658  13.407  202.846 1.00 21.78  ? 111  ASP B C     1 
ATOM   4021  O  O     . ASP F 2 110 ? 38.554  14.369  202.080 1.00 24.35  ? 111  ASP B O     1 
ATOM   4022  C  CB    . ASP F 2 110 ? 38.280  11.435  201.362 1.00 13.11  ? 111  ASP B CB    1 
ATOM   4023  C  CG    . ASP F 2 110 ? 37.861  9.967   201.336 1.00 21.55  ? 111  ASP B CG    1 
ATOM   4024  O  OD1   . ASP F 2 110 ? 37.693  9.363   202.413 1.00 28.75  ? 111  ASP B OD1   1 
ATOM   4025  O  OD2   . ASP F 2 110 ? 37.704  9.409   200.236 1.00 26.16  ? 111  ASP B OD2   1 
ATOM   4026  N  N     . THR F 2 111 ? 39.464  13.381  203.904 1.00 24.45  ? 112  THR B N     1 
ATOM   4027  C  CA    . THR F 2 111 ? 40.350  14.479  204.271 1.00 18.61  ? 112  THR B CA    1 
ATOM   4028  C  C     . THR F 2 111 ? 40.988  15.176  203.074 1.00 22.61  ? 112  THR B C     1 
ATOM   4029  O  O     . THR F 2 111 ? 40.863  16.390  202.920 1.00 27.50  ? 112  THR B O     1 
ATOM   4030  C  CB    . THR F 2 111 ? 41.483  13.976  205.187 1.00 25.07  ? 112  THR B CB    1 
ATOM   4031  O  OG1   . THR F 2 111 ? 40.924  13.452  206.400 1.00 28.53  ? 112  THR B OG1   1 
ATOM   4032  C  CG2   . THR F 2 111 ? 42.448  15.107  205.523 1.00 13.25  ? 112  THR B CG2   1 
ATOM   4033  N  N     . ALA F 2 112 ? 41.653  14.414  202.211 1.00 23.01  ? 113  ALA B N     1 
ATOM   4034  C  CA    . ALA F 2 112 ? 42.332  15.025  201.071 1.00 34.22  ? 113  ALA B CA    1 
ATOM   4035  C  C     . ALA F 2 112 ? 41.783  14.756  199.684 1.00 35.25  ? 113  ALA B C     1 
ATOM   4036  O  O     . ALA F 2 112 ? 41.060  13.797  199.458 1.00 48.86  ? 113  ALA B O     1 
ATOM   4037  C  CB    . ALA F 2 112 ? 43.802  14.648  201.104 1.00 34.48  ? 113  ALA B CB    1 
ATOM   4038  N  N     . ASP F 2 113 ? 42.131  15.623  198.746 1.00 30.62  ? 114  ASP B N     1 
ATOM   4039  C  CA    . ASP F 2 113 ? 41.700  15.432  197.377 1.00 27.26  ? 114  ASP B CA    1 
ATOM   4040  C  C     . ASP F 2 113 ? 42.788  14.611  196.707 1.00 28.85  ? 114  ASP B C     1 
ATOM   4041  O  O     . ASP F 2 113 ? 42.504  13.711  195.929 1.00 43.93  ? 114  ASP B O     1 
ATOM   4042  C  CB    . ASP F 2 113 ? 41.549  16.775  196.659 1.00 18.09  ? 114  ASP B CB    1 
ATOM   4043  C  CG    . ASP F 2 113 ? 40.221  17.465  196.955 1.00 33.75  ? 114  ASP B CG    1 
ATOM   4044  O  OD1   . ASP F 2 113 ? 40.136  18.699  196.742 1.00 32.57  ? 114  ASP B OD1   1 
ATOM   4045  O  OD2   . ASP F 2 113 ? 39.257  16.786  197.387 1.00 35.45  ? 114  ASP B OD2   1 
ATOM   4046  N  N     . ILE F 2 114 ? 44.038  14.922  197.030 1.00 27.41  ? 115  ILE B N     1 
ATOM   4047  C  CA    . ILE F 2 114 ? 45.175  14.241  196.445 1.00 21.85  ? 115  ILE B CA    1 
ATOM   4048  C  C     . ILE F 2 114 ? 46.236  13.958  197.495 1.00 25.48  ? 115  ILE B C     1 
ATOM   4049  O  O     . ILE F 2 114 ? 46.501  14.780  198.358 1.00 19.91  ? 115  ILE B O     1 
ATOM   4050  C  CB    . ILE F 2 114 ? 45.796  15.102  195.330 1.00 22.76  ? 115  ILE B CB    1 
ATOM   4051  C  CG1   . ILE F 2 114 ? 44.742  15.365  194.261 1.00 11.40  ? 115  ILE B CG1   1 
ATOM   4052  C  CG2   . ILE F 2 114 ? 47.025  14.406  194.736 1.00 19.64  ? 115  ILE B CG2   1 
ATOM   4053  C  CD1   . ILE F 2 114 ? 45.229  16.171  193.113 1.00 29.35  ? 115  ILE B CD1   1 
ATOM   4054  N  N     . LEU F 2 115 ? 46.846  12.789  197.405 1.00 26.56  ? 116  LEU B N     1 
ATOM   4055  C  CA    . LEU F 2 115 ? 47.877  12.398  198.336 1.00 34.71  ? 116  LEU B CA    1 
ATOM   4056  C  C     . LEU F 2 115 ? 49.205  12.208  197.603 1.00 37.88  ? 116  LEU B C     1 
ATOM   4057  O  O     . LEU F 2 115 ? 49.327  11.301  196.779 1.00 44.47  ? 116  LEU B O     1 
ATOM   4058  C  CB    . LEU F 2 115 ? 47.474  11.088  199.009 1.00 34.97  ? 116  LEU B CB    1 
ATOM   4059  C  CG    . LEU F 2 115 ? 46.918  11.152  200.423 1.00 44.63  ? 116  LEU B CG    1 
ATOM   4060  C  CD1   . LEU F 2 115 ? 46.680  9.737   200.952 1.00 47.44  ? 116  LEU B CD1   1 
ATOM   4061  C  CD2   . LEU F 2 115 ? 47.914  11.882  201.322 1.00 49.32  ? 116  LEU B CD2   1 
ATOM   4062  N  N     . LEU F 2 116 ? 50.196  13.053  197.875 1.00 40.06  ? 117  LEU B N     1 
ATOM   4063  C  CA    . LEU F 2 116 ? 51.508  12.889  197.224 1.00 41.92  ? 117  LEU B CA    1 
ATOM   4064  C  C     . LEU F 2 116 ? 52.461  12.259  198.223 1.00 48.37  ? 117  LEU B C     1 
ATOM   4065  O  O     . LEU F 2 116 ? 52.947  12.936  199.130 1.00 52.08  ? 117  LEU B O     1 
ATOM   4066  C  CB    . LEU F 2 116 ? 52.082  14.227  196.772 1.00 33.34  ? 117  LEU B CB    1 
ATOM   4067  C  CG    . LEU F 2 116 ? 51.188  15.050  195.843 1.00 36.80  ? 117  LEU B CG    1 
ATOM   4068  C  CD1   . LEU F 2 116 ? 50.622  16.221  196.628 1.00 29.50  ? 117  LEU B CD1   1 
ATOM   4069  C  CD2   . LEU F 2 116 ? 51.978  15.552  194.648 1.00 43.22  ? 117  LEU B CD2   1 
ATOM   4070  N  N     . VAL F 2 117 ? 52.738  10.969  198.043 1.00 42.26  ? 118  VAL B N     1 
ATOM   4071  C  CA    . VAL F 2 117 ? 53.614  10.229  198.955 1.00 43.63  ? 118  VAL B CA    1 
ATOM   4072  C  C     . VAL F 2 117 ? 55.017  10.007  198.374 1.00 40.23  ? 118  VAL B C     1 
ATOM   4073  O  O     . VAL F 2 117 ? 55.178  9.828   197.170 1.00 47.36  ? 118  VAL B O     1 
ATOM   4074  C  CB    . VAL F 2 117 ? 52.976  8.852   199.314 1.00 46.79  ? 118  VAL B CB    1 
ATOM   4075  C  CG1   . VAL F 2 117 ? 53.615  8.290   200.566 1.00 45.24  ? 118  VAL B CG1   1 
ATOM   4076  C  CG2   . VAL F 2 117 ? 51.474  8.998   199.496 1.00 43.14  ? 118  VAL B CG2   1 
ATOM   4077  N  N     . LYS F 2 118 ? 56.028  10.010  199.232 1.00 33.67  ? 119  LYS B N     1 
ATOM   4078  C  CA    . LYS F 2 118 ? 57.404  9.834   198.774 1.00 40.75  ? 119  LYS B CA    1 
ATOM   4079  C  C     . LYS F 2 118 ? 58.339  9.693   199.965 1.00 35.21  ? 119  LYS B C     1 
ATOM   4080  O  O     . LYS F 2 118 ? 58.394  10.567  200.820 1.00 28.46  ? 119  LYS B O     1 
ATOM   4081  C  CB    . LYS F 2 118 ? 57.824  11.049  197.933 1.00 55.66  ? 119  LYS B CB    1 
ATOM   4082  C  CG    . LYS F 2 118 ? 59.326  11.202  197.651 1.00 61.04  ? 119  LYS B CG    1 
ATOM   4083  C  CD    . LYS F 2 118 ? 59.809  10.266  196.550 1.00 67.59  ? 119  LYS B CD    1 
ATOM   4084  C  CE    . LYS F 2 118 ? 61.202  10.647  196.055 1.00 63.96  ? 119  LYS B CE    1 
ATOM   4085  N  NZ    . LYS F 2 118 ? 61.708  9.703   195.011 1.00 54.20  ? 119  LYS B NZ    1 
ATOM   4086  N  N     . ASP F 2 119 ? 59.060  8.581   200.020 1.00 45.45  ? 120  ASP B N     1 
ATOM   4087  C  CA    . ASP F 2 119 ? 59.996  8.329   201.106 1.00 55.18  ? 120  ASP B CA    1 
ATOM   4088  C  C     . ASP F 2 119 ? 59.350  8.397   202.504 1.00 61.02  ? 120  ASP B C     1 
ATOM   4089  O  O     . ASP F 2 119 ? 59.829  9.107   203.395 1.00 67.98  ? 120  ASP B O     1 
ATOM   4090  C  CB    . ASP F 2 119 ? 61.176  9.310   201.000 1.00 55.88  ? 120  ASP B CB    1 
ATOM   4091  C  CG    . ASP F 2 119 ? 62.034  9.053   199.769 1.00 62.49  ? 120  ASP B CG    1 
ATOM   4092  O  OD1   . ASP F 2 119 ? 62.967  9.848   199.503 1.00 67.92  ? 120  ASP B OD1   1 
ATOM   4093  O  OD2   . ASP F 2 119 ? 61.772  8.046   199.069 1.00 53.57  ? 120  ASP B OD2   1 
ATOM   4094  N  N     . GLN F 2 120 ? 58.266  7.648   202.690 1.00 54.07  ? 121  GLN B N     1 
ATOM   4095  C  CA    . GLN F 2 120 ? 57.574  7.615   203.968 1.00 54.41  ? 121  GLN B CA    1 
ATOM   4096  C  C     . GLN F 2 120 ? 57.062  8.988   204.412 1.00 57.36  ? 121  GLN B C     1 
ATOM   4097  O  O     . GLN F 2 120 ? 56.949  9.254   205.610 1.00 62.01  ? 121  GLN B O     1 
ATOM   4098  C  CB    . GLN F 2 120 ? 58.497  7.038   205.046 1.00 50.98  ? 121  GLN B CB    1 
ATOM   4099  N  N     . PHE F 2 121 ? 56.772  9.864   203.451 1.00 58.00  ? 122  PHE B N     1 
ATOM   4100  C  CA    . PHE F 2 121 ? 56.239  11.197  203.754 1.00 59.02  ? 122  PHE B CA    1 
ATOM   4101  C  C     . PHE F 2 121 ? 54.995  11.496  202.904 1.00 54.24  ? 122  PHE B C     1 
ATOM   4102  O  O     . PHE F 2 121 ? 54.999  11.290  201.689 1.00 53.53  ? 122  PHE B O     1 
ATOM   4103  C  CB    . PHE F 2 121 ? 57.276  12.283  203.498 1.00 56.95  ? 122  PHE B CB    1 
ATOM   4104  C  CG    . PHE F 2 121 ? 56.866  13.622  204.026 1.00 61.77  ? 122  PHE B CG    1 
ATOM   4105  C  CD1   . PHE F 2 121 ? 57.031  13.923  205.374 1.00 61.66  ? 122  PHE B CD1   1 
ATOM   4106  C  CD2   . PHE F 2 121 ? 56.270  14.567  203.192 1.00 56.29  ? 122  PHE B CD2   1 
ATOM   4107  C  CE1   . PHE F 2 121 ? 56.609  15.145  205.895 1.00 62.82  ? 122  PHE B CE1   1 
ATOM   4108  C  CE2   . PHE F 2 121 ? 55.842  15.793  203.700 1.00 62.40  ? 122  PHE B CE2   1 
ATOM   4109  C  CZ    . PHE F 2 121 ? 56.012  16.084  205.057 1.00 60.24  ? 122  PHE B CZ    1 
ATOM   4110  N  N     . TYR F 2 122 ? 53.946  12.009  203.544 1.00 47.44  ? 123  TYR B N     1 
ATOM   4111  C  CA    . TYR F 2 122 ? 52.694  12.305  202.853 1.00 47.70  ? 123  TYR B CA    1 
ATOM   4112  C  C     . TYR F 2 122 ? 52.330  13.803  202.755 1.00 44.60  ? 123  TYR B C     1 
ATOM   4113  O  O     . TYR F 2 122 ? 52.703  14.608  203.608 1.00 43.85  ? 123  TYR B O     1 
ATOM   4114  C  CB    . TYR F 2 122 ? 51.548  11.555  203.547 1.00 56.31  ? 123  TYR B CB    1 
ATOM   4115  C  CG    . TYR F 2 122 ? 51.796  10.073  203.765 1.00 58.86  ? 123  TYR B CG    1 
ATOM   4116  C  CD1   . TYR F 2 122 ? 52.731  9.630   204.693 1.00 51.39  ? 123  TYR B CD1   1 
ATOM   4117  C  CD2   . TYR F 2 122 ? 51.117  9.115   203.012 1.00 62.83  ? 123  TYR B CD2   1 
ATOM   4118  C  CE1   . TYR F 2 122 ? 52.990  8.271   204.861 1.00 61.85  ? 123  TYR B CE1   1 
ATOM   4119  C  CE2   . TYR F 2 122 ? 51.368  7.750   203.170 1.00 60.52  ? 123  TYR B CE2   1 
ATOM   4120  C  CZ    . TYR F 2 122 ? 52.309  7.333   204.095 1.00 62.95  ? 123  TYR B CZ    1 
ATOM   4121  O  OH    . TYR F 2 122 ? 52.593  5.987   204.229 1.00 56.11  ? 123  TYR B OH    1 
ATOM   4122  N  N     . GLU F 2 123 ? 51.604  14.172  201.701 1.00 44.52  ? 124  GLU B N     1 
ATOM   4123  C  CA    . GLU F 2 123 ? 51.167  15.554  201.528 1.00 43.49  ? 124  GLU B CA    1 
ATOM   4124  C  C     . GLU F 2 123 ? 49.685  15.606  201.206 1.00 43.33  ? 124  GLU B C     1 
ATOM   4125  O  O     . GLU F 2 123 ? 49.308  15.542  200.035 1.00 50.56  ? 124  GLU B O     1 
ATOM   4126  C  CB    . GLU F 2 123 ? 51.920  16.244  200.397 1.00 39.90  ? 124  GLU B CB    1 
ATOM   4127  C  CG    . GLU F 2 123 ? 51.606  17.736  200.329 1.00 32.79  ? 124  GLU B CG    1 
ATOM   4128  C  CD    . GLU F 2 123 ? 52.351  18.439  199.214 1.00 42.74  ? 124  GLU B CD    1 
ATOM   4129  O  OE1   . GLU F 2 123 ? 52.306  19.692  199.150 1.00 35.70  ? 124  GLU B OE1   1 
ATOM   4130  O  OE2   . GLU F 2 123 ? 52.974  17.735  198.394 1.00 44.01  ? 124  GLU B OE2   1 
ATOM   4131  N  N     . LEU F 2 124 ? 48.839  15.724  202.226 1.00 34.32  ? 125  LEU B N     1 
ATOM   4132  C  CA    . LEU F 2 124 ? 47.395  15.781  201.985 1.00 31.35  ? 125  LEU B CA    1 
ATOM   4133  C  C     . LEU F 2 124 ? 46.998  17.104  201.329 1.00 26.13  ? 125  LEU B C     1 
ATOM   4134  O  O     . LEU F 2 124 ? 46.825  18.108  202.005 1.00 36.27  ? 125  LEU B O     1 
ATOM   4135  C  CB    . LEU F 2 124 ? 46.617  15.597  203.302 1.00 34.95  ? 125  LEU B CB    1 
ATOM   4136  C  CG    . LEU F 2 124 ? 46.585  14.208  203.961 1.00 31.85  ? 125  LEU B CG    1 
ATOM   4137  C  CD1   . LEU F 2 124 ? 47.991  13.806  204.372 1.00 34.91  ? 125  LEU B CD1   1 
ATOM   4138  C  CD2   . LEU F 2 124 ? 45.684  14.234  205.176 1.00 30.75  ? 125  LEU B CD2   1 
ATOM   4139  N  N     . LEU F 2 125 ? 46.847  17.097  200.013 1.00 20.61  ? 126  LEU B N     1 
ATOM   4140  C  CA    . LEU F 2 125 ? 46.477  18.298  199.265 1.00 20.79  ? 126  LEU B CA    1 
ATOM   4141  C  C     . LEU F 2 125 ? 44.963  18.445  199.072 1.00 24.85  ? 126  LEU B C     1 
ATOM   4142  O  O     . LEU F 2 125 ? 44.296  17.539  198.576 1.00 27.00  ? 126  LEU B O     1 
ATOM   4143  C  CB    . LEU F 2 125 ? 47.145  18.263  197.893 1.00 17.10  ? 126  LEU B CB    1 
ATOM   4144  C  CG    . LEU F 2 125 ? 46.857  19.426  196.954 1.00 18.40  ? 126  LEU B CG    1 
ATOM   4145  C  CD1   . LEU F 2 125 ? 47.593  20.680  197.413 1.00 9.91   ? 126  LEU B CD1   1 
ATOM   4146  C  CD2   . LEU F 2 125 ? 47.288  19.042  195.554 1.00 21.54  ? 126  LEU B CD2   1 
ATOM   4147  N  N     . ASP F 2 126 ? 44.421  19.592  199.454 1.00 25.69  ? 127  ASP B N     1 
ATOM   4148  C  CA    . ASP F 2 126 ? 42.994  19.834  199.294 1.00 13.17  ? 127  ASP B CA    1 
ATOM   4149  C  C     . ASP F 2 126 ? 42.820  21.006  198.357 1.00 21.88  ? 127  ASP B C     1 
ATOM   4150  O  O     . ASP F 2 126 ? 43.177  22.136  198.705 1.00 19.83  ? 127  ASP B O     1 
ATOM   4151  C  CB    . ASP F 2 126 ? 42.360  20.152  200.649 1.00 17.87  ? 127  ASP B CB    1 
ATOM   4152  C  CG    . ASP F 2 126 ? 40.861  20.448  200.559 1.00 28.52  ? 127  ASP B CG    1 
ATOM   4153  O  OD1   . ASP F 2 126 ? 40.227  20.558  201.628 1.00 25.02  ? 127  ASP B OD1   1 
ATOM   4154  O  OD2   . ASP F 2 126 ? 40.311  20.578  199.441 1.00 19.53  ? 127  ASP B OD2   1 
ATOM   4155  N  N     . VAL F 2 127 ? 42.262  20.743  197.175 1.00 16.81  ? 128  VAL B N     1 
ATOM   4156  C  CA    . VAL F 2 127 ? 42.051  21.798  196.189 1.00 20.58  ? 128  VAL B CA    1 
ATOM   4157  C  C     . VAL F 2 127 ? 40.776  22.602  196.428 1.00 23.14  ? 128  VAL B C     1 
ATOM   4158  O  O     . VAL F 2 127 ? 39.756  22.051  196.814 1.00 18.27  ? 128  VAL B O     1 
ATOM   4159  C  CB    . VAL F 2 127 ? 42.033  21.229  194.756 1.00 22.58  ? 128  VAL B CB    1 
ATOM   4160  C  CG1   . VAL F 2 127 ? 41.650  22.330  193.765 1.00 15.63  ? 128  VAL B CG1   1 
ATOM   4161  C  CG2   . VAL F 2 127 ? 43.408  20.663  194.411 1.00 13.18  ? 128  VAL B CG2   1 
ATOM   4162  N  N     . LYS F 2 128 ? 40.860  23.915  196.211 1.00 28.35  ? 129  LYS B N     1 
ATOM   4163  C  CA    . LYS F 2 128 ? 39.724  24.820  196.386 1.00 21.65  ? 129  LYS B CA    1 
ATOM   4164  C  C     . LYS F 2 128 ? 39.440  25.583  195.093 1.00 23.94  ? 129  LYS B C     1 
ATOM   4165  O  O     . LYS F 2 128 ? 40.354  26.143  194.489 1.00 36.03  ? 129  LYS B O     1 
ATOM   4166  C  CB    . LYS F 2 128 ? 40.026  25.831  197.482 1.00 9.22   ? 129  LYS B CB    1 
ATOM   4167  C  CG    . LYS F 2 128 ? 40.469  25.229  198.803 1.00 26.52  ? 129  LYS B CG    1 
ATOM   4168  C  CD    . LYS F 2 128 ? 39.373  24.428  199.489 1.00 19.68  ? 129  LYS B CD    1 
ATOM   4169  C  CE    . LYS F 2 128 ? 39.899  23.820  200.771 1.00 19.72  ? 129  LYS B CE    1 
ATOM   4170  N  NZ    . LYS F 2 128 ? 38.879  23.048  201.505 1.00 20.96  ? 129  LYS B NZ    1 
ATOM   4171  N  N     . THR F 2 129 ? 38.182  25.605  194.659 1.00 23.34  ? 130  THR B N     1 
ATOM   4172  C  CA    . THR F 2 129 ? 37.833  26.341  193.447 1.00 24.35  ? 130  THR B CA    1 
ATOM   4173  C  C     . THR F 2 129 ? 37.061  27.587  193.838 1.00 26.64  ? 130  THR B C     1 
ATOM   4174  O  O     . THR F 2 129 ? 36.476  27.659  194.920 1.00 29.99  ? 130  THR B O     1 
ATOM   4175  C  CB    . THR F 2 129 ? 36.981  25.524  192.486 1.00 31.63  ? 130  THR B CB    1 
ATOM   4176  O  OG1   . THR F 2 129 ? 35.718  25.256  193.084 1.00 36.17  ? 130  THR B OG1   1 
ATOM   4177  C  CG2   . THR F 2 129 ? 37.671  24.231  192.135 1.00 33.08  ? 130  THR B CG2   1 
ATOM   4178  N  N     . ARG F 2 130 ? 37.046  28.574  192.956 1.00 25.00  ? 131  ARG B N     1 
ATOM   4179  C  CA    . ARG F 2 130 ? 36.379  29.822  193.280 1.00 18.00  ? 131  ARG B CA    1 
ATOM   4180  C  C     . ARG F 2 130 ? 36.072  30.691  192.076 1.00 25.54  ? 131  ARG B C     1 
ATOM   4181  O  O     . ARG F 2 130 ? 36.913  30.898  191.189 1.00 24.91  ? 131  ARG B O     1 
ATOM   4182  C  CB    . ARG F 2 130 ? 37.247  30.610  194.255 1.00 5.77   ? 131  ARG B CB    1 
ATOM   4183  C  CG    . ARG F 2 130 ? 36.904  32.089  194.381 1.00 24.39  ? 131  ARG B CG    1 
ATOM   4184  C  CD    . ARG F 2 130 ? 38.173  32.915  194.563 1.00 30.15  ? 131  ARG B CD    1 
ATOM   4185  N  NE    . ARG F 2 130 ? 38.051  33.960  195.577 1.00 45.18  ? 131  ARG B NE    1 
ATOM   4186  C  CZ    . ARG F 2 130 ? 39.049  34.759  195.954 1.00 48.57  ? 131  ARG B CZ    1 
ATOM   4187  N  NH1   . ARG F 2 130 ? 40.245  34.638  195.400 1.00 55.97  ? 131  ARG B NH1   1 
ATOM   4188  N  NH2   . ARG F 2 130 ? 38.860  35.672  196.900 1.00 42.49  ? 131  ARG B NH2   1 
ATOM   4189  N  N     . ASN F 2 131 ? 34.853  31.213  192.066 1.00 30.83  ? 132  ASN B N     1 
ATOM   4190  C  CA    . ASN F 2 131 ? 34.409  32.104  191.009 1.00 39.98  ? 132  ASN B CA    1 
ATOM   4191  C  C     . ASN F 2 131 ? 34.826  33.517  191.438 1.00 42.69  ? 132  ASN B C     1 
ATOM   4192  O  O     . ASN F 2 131 ? 34.175  34.117  192.288 1.00 48.11  ? 132  ASN B O     1 
ATOM   4193  C  CB    . ASN F 2 131 ? 32.892  31.974  190.865 1.00 47.15  ? 132  ASN B CB    1 
ATOM   4194  C  CG    . ASN F 2 131 ? 32.263  33.143  190.162 1.00 49.23  ? 132  ASN B CG    1 
ATOM   4195  O  OD1   . ASN F 2 131 ? 32.648  33.508  189.055 1.00 61.56  ? 132  ASN B OD1   1 
ATOM   4196  N  ND2   . ASN F 2 131 ? 31.272  33.738  190.804 1.00 59.94  ? 132  ASN B ND2   1 
ATOM   4197  N  N     . ILE F 2 132 ? 35.923  34.031  190.873 1.00 43.21  ? 133  ILE B N     1 
ATOM   4198  C  CA    . ILE F 2 132 ? 36.408  35.361  191.238 1.00 42.60  ? 133  ILE B CA    1 
ATOM   4199  C  C     . ILE F 2 132 ? 35.541  36.475  190.687 1.00 43.15  ? 133  ILE B C     1 
ATOM   4200  O  O     . ILE F 2 132 ? 35.835  37.648  190.889 1.00 53.60  ? 133  ILE B O     1 
ATOM   4201  C  CB    . ILE F 2 132 ? 37.899  35.607  190.796 1.00 36.00  ? 133  ILE B CB    1 
ATOM   4202  C  CG1   . ILE F 2 132 ? 38.144  35.096  189.381 1.00 36.86  ? 133  ILE B CG1   1 
ATOM   4203  C  CG2   . ILE F 2 132 ? 38.845  34.931  191.764 1.00 32.20  ? 133  ILE B CG2   1 
ATOM   4204  C  CD1   . ILE F 2 132 ? 37.471  35.920  188.301 1.00 51.85  ? 133  ILE B CD1   1 
ATOM   4205  N  N     . SER F 2 133 ? 34.461  36.115  190.008 1.00 45.84  ? 134  SER B N     1 
ATOM   4206  C  CA    . SER F 2 133 ? 33.568  37.118  189.451 1.00 49.42  ? 134  SER B CA    1 
ATOM   4207  C  C     . SER F 2 133 ? 32.714  37.766  190.524 1.00 47.04  ? 134  SER B C     1 
ATOM   4208  O  O     . SER F 2 133 ? 31.842  38.580  190.225 1.00 49.36  ? 134  SER B O     1 
ATOM   4209  C  CB    . SER F 2 133 ? 32.667  36.503  188.382 1.00 50.60  ? 134  SER B CB    1 
ATOM   4210  O  OG    . SER F 2 133 ? 33.342  36.451  187.135 1.00 59.87  ? 134  SER B OG    1 
ATOM   4211  N  N     . LYS F 2 134 ? 32.975  37.418  191.778 1.00 47.58  ? 135  LYS B N     1 
ATOM   4212  C  CA    . LYS F 2 134 ? 32.210  37.983  192.883 1.00 53.38  ? 135  LYS B CA    1 
ATOM   4213  C  C     . LYS F 2 134 ? 32.968  37.905  194.200 1.00 43.82  ? 135  LYS B C     1 
ATOM   4214  O  O     . LYS F 2 134 ? 33.746  36.991  194.415 1.00 51.24  ? 135  LYS B O     1 
ATOM   4215  C  CB    . LYS F 2 134 ? 30.867  37.253  193.014 1.00 53.95  ? 135  LYS B CB    1 
ATOM   4216  C  CG    . LYS F 2 134 ? 30.990  35.745  193.067 1.00 48.39  ? 135  LYS B CG    1 
ATOM   4217  C  CD    . LYS F 2 134 ? 29.685  35.060  193.454 1.00 54.17  ? 135  LYS B CD    1 
ATOM   4218  C  CE    . LYS F 2 134 ? 28.662  35.035  192.334 1.00 44.71  ? 135  LYS B CE    1 
ATOM   4219  N  NZ    . LYS F 2 134 ? 27.469  34.260  192.792 1.00 53.77  ? 135  LYS B NZ    1 
ATOM   4220  N  N     . SER F 2 135 ? 32.755  38.887  195.065 1.00 40.50  ? 136  SER B N     1 
ATOM   4221  C  CA    . SER F 2 135 ? 33.406  38.903  196.363 1.00 40.24  ? 136  SER B CA    1 
ATOM   4222  C  C     . SER F 2 135 ? 32.632  37.962  197.276 1.00 41.93  ? 136  SER B C     1 
ATOM   4223  O  O     . SER F 2 135 ? 31.662  38.373  197.924 1.00 39.82  ? 136  SER B O     1 
ATOM   4224  C  CB    . SER F 2 135 ? 33.399  40.315  196.950 1.00 42.27  ? 136  SER B CB    1 
ATOM   4225  O  OG    . SER F 2 135 ? 33.728  40.305  198.334 1.00 39.09  ? 136  SER B OG    1 
ATOM   4226  N  N     . ALA F 2 136 ? 33.053  36.699  197.321 1.00 33.88  ? 137  ALA B N     1 
ATOM   4227  C  CA    . ALA F 2 136 ? 32.374  35.704  198.142 1.00 24.70  ? 137  ALA B CA    1 
ATOM   4228  C  C     . ALA F 2 136 ? 33.054  35.423  199.468 1.00 27.64  ? 137  ALA B C     1 
ATOM   4229  O  O     . ALA F 2 136 ? 34.185  35.838  199.705 1.00 36.90  ? 137  ALA B O     1 
ATOM   4230  C  CB    . ALA F 2 136 ? 32.216  34.423  197.370 1.00 23.86  ? 137  ALA B CB    1 
ATOM   4231  N  N     . GLN F 2 137 ? 32.340  34.740  200.352 1.00 26.45  ? 138  GLN B N     1 
ATOM   4232  C  CA    . GLN F 2 137 ? 32.874  34.399  201.664 1.00 29.07  ? 138  GLN B CA    1 
ATOM   4233  C  C     . GLN F 2 137 ? 33.995  33.361  201.502 1.00 36.01  ? 138  GLN B C     1 
ATOM   4234  O  O     . GLN F 2 137 ? 34.182  32.795  200.423 1.00 40.10  ? 138  GLN B O     1 
ATOM   4235  C  CB    . GLN F 2 137 ? 31.745  33.862  202.547 1.00 20.07  ? 138  GLN B CB    1 
ATOM   4236  C  CG    . GLN F 2 137 ? 32.167  33.474  203.948 1.00 9.56   ? 138  GLN B CG    1 
ATOM   4237  C  CD    . GLN F 2 137 ? 30.976  33.174  204.853 1.00 8.61   ? 138  GLN B CD    1 
ATOM   4238  O  OE1   . GLN F 2 137 ? 31.137  32.941  206.060 1.00 1.00   ? 138  GLN B OE1   1 
ATOM   4239  N  NE2   . GLN F 2 137 ? 29.772  33.181  204.273 1.00 1.00   ? 138  GLN B NE2   1 
ATOM   4240  N  N     . ALA F 2 138 ? 34.741  33.118  202.568 1.00 37.66  ? 139  ALA B N     1 
ATOM   4241  C  CA    . ALA F 2 138 ? 35.844  32.166  202.515 1.00 40.18  ? 139  ALA B CA    1 
ATOM   4242  C  C     . ALA F 2 138 ? 35.312  30.733  202.573 1.00 41.45  ? 139  ALA B C     1 
ATOM   4243  O  O     . ALA F 2 138 ? 34.387  30.432  203.332 1.00 37.97  ? 139  ALA B O     1 
ATOM   4244  C  CB    . ALA F 2 138 ? 36.829  32.418  203.677 1.00 39.72  ? 139  ALA B CB    1 
ATOM   4245  N  N     . PRO F 2 139 ? 35.897  29.827  201.773 1.00 38.26  ? 140  PRO B N     1 
ATOM   4246  C  CA    . PRO F 2 139 ? 35.479  28.427  201.738 1.00 29.61  ? 140  PRO B CA    1 
ATOM   4247  C  C     . PRO F 2 139 ? 35.955  27.603  202.917 1.00 31.42  ? 140  PRO B C     1 
ATOM   4248  O  O     . PRO F 2 139 ? 36.927  27.959  203.591 1.00 19.01  ? 140  PRO B O     1 
ATOM   4249  C  CB    . PRO F 2 139 ? 36.079  27.930  200.436 1.00 24.42  ? 140  PRO B CB    1 
ATOM   4250  C  CG    . PRO F 2 139 ? 37.345  28.703  200.368 1.00 22.98  ? 140  PRO B CG    1 
ATOM   4251  C  CD    . PRO F 2 139 ? 36.890  30.088  200.719 1.00 30.78  ? 140  PRO B CD    1 
ATOM   4252  N  N     . ASN F 2 140 ? 35.241  26.501  203.152 1.00 31.07  ? 141  ASN B N     1 
ATOM   4253  C  CA    . ASN F 2 140 ? 35.563  25.542  204.208 1.00 30.48  ? 141  ASN B CA    1 
ATOM   4254  C  C     . ASN F 2 140 ? 36.906  24.913  203.849 1.00 27.35  ? 141  ASN B C     1 
ATOM   4255  O  O     . ASN F 2 140 ? 37.040  24.266  202.817 1.00 25.53  ? 141  ASN B O     1 
ATOM   4256  C  CB    . ASN F 2 140 ? 34.506  24.432  204.281 1.00 25.45  ? 141  ASN B CB    1 
ATOM   4257  C  CG    . ASN F 2 140 ? 33.152  24.925  204.770 1.00 32.76  ? 141  ASN B CG    1 
ATOM   4258  O  OD1   . ASN F 2 140 ? 32.943  26.117  204.960 1.00 34.83  ? 141  ASN B OD1   1 
ATOM   4259  N  ND2   . ASN F 2 140 ? 32.220  23.993  204.968 1.00 9.18   ? 141  ASN B ND2   1 
ATOM   4260  N  N     . ILE F 2 141 ? 37.894  25.119  204.708 1.00 26.90  ? 142  ILE B N     1 
ATOM   4261  C  CA    . ILE F 2 141 ? 39.228  24.572  204.509 1.00 25.22  ? 142  ILE B CA    1 
ATOM   4262  C  C     . ILE F 2 141 ? 39.235  23.144  205.048 1.00 25.76  ? 142  ILE B C     1 
ATOM   4263  O  O     . ILE F 2 141 ? 39.454  22.186  204.311 1.00 12.65  ? 142  ILE B O     1 
ATOM   4264  C  CB    . ILE F 2 141 ? 40.268  25.399  205.284 1.00 29.65  ? 142  ILE B CB    1 
ATOM   4265  C  CG1   . ILE F 2 141 ? 40.151  26.866  204.887 1.00 37.21  ? 142  ILE B CG1   1 
ATOM   4266  C  CG2   . ILE F 2 141 ? 41.665  24.907  204.976 1.00 33.95  ? 142  ILE B CG2   1 
ATOM   4267  C  CD1   . ILE F 2 141 ? 40.388  27.092  203.411 1.00 39.93  ? 142  ILE B CD1   1 
ATOM   4268  N  N     . ILE F 2 142 ? 38.989  23.020  206.346 1.00 19.63  ? 143  ILE B N     1 
ATOM   4269  C  CA    . ILE F 2 142 ? 38.962  21.728  206.989 1.00 23.14  ? 143  ILE B CA    1 
ATOM   4270  C  C     . ILE F 2 142 ? 38.304  21.840  208.367 1.00 26.43  ? 143  ILE B C     1 
ATOM   4271  O  O     . ILE F 2 142 ? 38.223  22.924  208.943 1.00 21.34  ? 143  ILE B O     1 
ATOM   4272  C  CB    . ILE F 2 142 ? 40.390  21.160  207.145 1.00 27.37  ? 143  ILE B CB    1 
ATOM   4273  C  CG1   . ILE F 2 142 ? 40.346  19.674  207.469 1.00 25.00  ? 143  ILE B CG1   1 
ATOM   4274  C  CG2   . ILE F 2 142 ? 41.102  21.853  208.287 1.00 34.56  ? 143  ILE B CG2   1 
ATOM   4275  C  CD1   . ILE F 2 142 ? 41.718  19.063  207.506 1.00 20.48  ? 143  ILE B CD1   1 
ATOM   4276  N  N     . SER F 2 143 ? 37.822  20.710  208.879 1.00 28.38  ? 144  SER B N     1 
ATOM   4277  C  CA    . SER F 2 143 ? 37.166  20.683  210.175 1.00 26.82  ? 144  SER B CA    1 
ATOM   4278  C  C     . SER F 2 143 ? 38.140  21.064  211.277 1.00 30.36  ? 144  SER B C     1 
ATOM   4279  O  O     . SER F 2 143 ? 39.203  20.455  211.426 1.00 35.62  ? 144  SER B O     1 
ATOM   4280  C  CB    . SER F 2 143 ? 36.590  19.293  210.456 1.00 28.42  ? 144  SER B CB    1 
ATOM   4281  O  OG    . SER F 2 143 ? 36.230  19.148  211.821 1.00 22.11  ? 144  SER B OG    1 
ATOM   4282  N  N     . ALA F 2 144 ? 37.776  22.088  212.040 1.00 24.05  ? 145  ALA B N     1 
ATOM   4283  C  CA    . ALA F 2 144 ? 38.614  22.532  213.133 1.00 24.64  ? 145  ALA B CA    1 
ATOM   4284  C  C     . ALA F 2 144 ? 38.704  21.387  214.132 1.00 23.87  ? 145  ALA B C     1 
ATOM   4285  O  O     . ALA F 2 144 ? 39.746  21.158  214.736 1.00 24.53  ? 145  ALA B O     1 
ATOM   4286  C  CB    . ALA F 2 144 ? 38.018  23.765  213.785 1.00 27.46  ? 145  ALA B CB    1 
ATOM   4287  N  N     . TYR F 2 145 ? 37.605  20.660  214.290 1.00 27.40  ? 146  TYR B N     1 
ATOM   4288  C  CA    . TYR F 2 145 ? 37.562  19.535  215.214 1.00 28.87  ? 146  TYR B CA    1 
ATOM   4289  C  C     . TYR F 2 145 ? 38.527  18.462  214.714 1.00 30.00  ? 146  TYR B C     1 
ATOM   4290  O  O     . TYR F 2 145 ? 39.447  18.051  215.430 1.00 23.95  ? 146  TYR B O     1 
ATOM   4291  C  CB    . TYR F 2 145 ? 36.131  19.005  215.317 1.00 17.14  ? 146  TYR B CB    1 
ATOM   4292  C  CG    . TYR F 2 145 ? 35.952  17.832  216.250 1.00 34.81  ? 146  TYR B CG    1 
ATOM   4293  C  CD1   . TYR F 2 145 ? 36.570  17.799  217.507 1.00 28.59  ? 146  TYR B CD1   1 
ATOM   4294  C  CD2   . TYR F 2 145 ? 35.138  16.750  215.883 1.00 29.66  ? 146  TYR B CD2   1 
ATOM   4295  C  CE1   . TYR F 2 145 ? 36.380  16.710  218.370 1.00 28.54  ? 146  TYR B CE1   1 
ATOM   4296  C  CE2   . TYR F 2 145 ? 34.943  15.668  216.739 1.00 30.30  ? 146  TYR B CE2   1 
ATOM   4297  C  CZ    . TYR F 2 145 ? 35.566  15.655  217.979 1.00 26.64  ? 146  TYR B CZ    1 
ATOM   4298  O  OH    . TYR F 2 145 ? 35.366  14.585  218.819 1.00 29.11  ? 146  TYR B OH    1 
ATOM   4299  N  N     . LYS F 2 146 ? 38.338  18.018  213.479 1.00 26.09  ? 147  LYS B N     1 
ATOM   4300  C  CA    . LYS F 2 146 ? 39.240  17.020  212.918 1.00 26.56  ? 147  LYS B CA    1 
ATOM   4301  C  C     . LYS F 2 146 ? 40.706  17.438  213.085 1.00 21.58  ? 147  LYS B C     1 
ATOM   4302  O  O     . LYS F 2 146 ? 41.567  16.587  213.296 1.00 12.50  ? 147  LYS B O     1 
ATOM   4303  C  CB    . LYS F 2 146 ? 38.939  16.806  211.435 1.00 22.56  ? 147  LYS B CB    1 
ATOM   4304  C  CG    . LYS F 2 146 ? 39.965  15.953  210.744 1.00 12.53  ? 147  LYS B CG    1 
ATOM   4305  C  CD    . LYS F 2 146 ? 39.705  15.806  209.250 1.00 18.98  ? 147  LYS B CD    1 
ATOM   4306  C  CE    . LYS F 2 146 ? 38.500  14.927  208.966 1.00 6.79   ? 147  LYS B CE    1 
ATOM   4307  N  NZ    . LYS F 2 146 ? 38.481  14.444  207.548 1.00 23.37  ? 147  LYS B NZ    1 
ATOM   4308  N  N     . LEU F 2 147 ? 40.979  18.744  212.993 1.00 22.33  ? 148  LEU B N     1 
ATOM   4309  C  CA    . LEU F 2 147 ? 42.348  19.272  213.118 1.00 28.35  ? 148  LEU B CA    1 
ATOM   4310  C  C     . LEU F 2 147 ? 42.844  19.128  214.567 1.00 34.49  ? 148  LEU B C     1 
ATOM   4311  O  O     . LEU F 2 147 ? 43.966  18.666  214.814 1.00 31.83  ? 148  LEU B O     1 
ATOM   4312  C  CB    . LEU F 2 147 ? 42.395  20.756  212.676 1.00 26.98  ? 148  LEU B CB    1 
ATOM   4313  C  CG    . LEU F 2 147 ? 43.711  21.415  212.175 1.00 32.24  ? 148  LEU B CG    1 
ATOM   4314  C  CD1   . LEU F 2 147 ? 43.475  22.865  211.734 1.00 23.00  ? 148  LEU B CD1   1 
ATOM   4315  C  CD2   . LEU F 2 147 ? 44.749  21.393  213.270 1.00 38.83  ? 148  LEU B CD2   1 
ATOM   4316  N  N     . ALA F 2 148 ? 42.001  19.518  215.519 1.00 28.03  ? 149  ALA B N     1 
ATOM   4317  C  CA    . ALA F 2 148 ? 42.354  19.430  216.930 1.00 34.23  ? 149  ALA B CA    1 
ATOM   4318  C  C     . ALA F 2 148 ? 42.684  17.985  217.280 1.00 40.94  ? 149  ALA B C     1 
ATOM   4319  O  O     . ALA F 2 148 ? 43.585  17.717  218.082 1.00 43.01  ? 149  ALA B O     1 
ATOM   4320  C  CB    . ALA F 2 148 ? 41.202  19.925  217.792 1.00 22.66  ? 149  ALA B CB    1 
ATOM   4321  N  N     . GLN F 2 149 ? 41.943  17.059  216.674 1.00 37.12  ? 150  GLN B N     1 
ATOM   4322  C  CA    . GLN F 2 149 ? 42.153  15.638  216.909 1.00 43.63  ? 150  GLN B CA    1 
ATOM   4323  C  C     . GLN F 2 149 ? 43.486  15.223  216.313 1.00 39.73  ? 150  GLN B C     1 
ATOM   4324  O  O     . GLN F 2 149 ? 44.224  14.420  216.874 1.00 45.34  ? 150  GLN B O     1 
ATOM   4325  C  CB    . GLN F 2 149 ? 41.019  14.807  216.284 1.00 43.74  ? 150  GLN B CB    1 
ATOM   4326  C  CG    . GLN F 2 149 ? 39.824  14.621  217.212 1.00 49.33  ? 150  GLN B CG    1 
ATOM   4327  C  CD    . GLN F 2 149 ? 38.730  13.757  216.614 1.00 59.53  ? 150  GLN B CD    1 
ATOM   4328  O  OE1   . GLN F 2 149 ? 37.930  14.215  215.789 1.00 55.00  ? 150  GLN B OE1   1 
ATOM   4329  N  NE2   . GLN F 2 149 ? 38.695  12.487  217.024 1.00 63.87  ? 150  GLN B NE2   1 
ATOM   4330  N  N     . THR F 2 150 ? 43.799  15.800  215.172 1.00 33.66  ? 151  THR B N     1 
ATOM   4331  C  CA    . THR F 2 150 ? 45.037  15.488  214.503 1.00 34.89  ? 151  THR B CA    1 
ATOM   4332  C  C     . THR F 2 150 ? 46.243  15.927  215.321 1.00 35.42  ? 151  THR B C     1 
ATOM   4333  O  O     . THR F 2 150 ? 47.192  15.165  215.491 1.00 35.10  ? 151  THR B O     1 
ATOM   4334  C  CB    . THR F 2 150 ? 45.062  16.163  213.147 1.00 30.85  ? 151  THR B CB    1 
ATOM   4335  O  OG1   . THR F 2 150 ? 43.898  15.762  212.410 1.00 26.56  ? 151  THR B OG1   1 
ATOM   4336  C  CG2   . THR F 2 150 ? 46.304  15.776  212.391 1.00 18.66  ? 151  THR B CG2   1 
ATOM   4337  N  N     . CYS F 2 151 ? 46.203  17.155  215.830 1.00 37.35  ? 152  CYS B N     1 
ATOM   4338  C  CA    . CYS F 2 151 ? 47.304  17.680  216.632 1.00 34.08  ? 152  CYS B CA    1 
ATOM   4339  C  C     . CYS F 2 151 ? 47.456  16.863  217.890 1.00 38.82  ? 152  CYS B C     1 
ATOM   4340  O  O     . CYS F 2 151 ? 48.559  16.491  218.267 1.00 43.01  ? 152  CYS B O     1 
ATOM   4341  C  CB    . CYS F 2 151 ? 47.042  19.126  217.036 1.00 29.55  ? 152  CYS B CB    1 
ATOM   4342  S  SG    . CYS F 2 151 ? 46.933  20.285  215.678 1.00 33.00  ? 152  CYS B SG    1 
ATOM   4343  N  N     . ALA F 2 152 ? 46.337  16.592  218.548 1.00 38.22  ? 153  ALA B N     1 
ATOM   4344  C  CA    . ALA F 2 152 ? 46.380  15.829  219.777 1.00 36.46  ? 153  ALA B CA    1 
ATOM   4345  C  C     . ALA F 2 152 ? 47.059  14.488  219.536 1.00 37.03  ? 153  ALA B C     1 
ATOM   4346  O  O     . ALA F 2 152 ? 47.801  14.005  220.385 1.00 34.61  ? 153  ALA B O     1 
ATOM   4347  C  CB    . ALA F 2 152 ? 44.977  15.628  220.312 1.00 30.37  ? 153  ALA B CB    1 
ATOM   4348  N  N     . LYS F 2 153 ? 46.812  13.889  218.375 1.00 36.99  ? 154  LYS B N     1 
ATOM   4349  C  CA    . LYS F 2 153 ? 47.421  12.602  218.059 1.00 37.59  ? 154  LYS B CA    1 
ATOM   4350  C  C     . LYS F 2 153 ? 48.903  12.772  217.754 1.00 42.82  ? 154  LYS B C     1 
ATOM   4351  O  O     . LYS F 2 153 ? 49.725  11.924  218.111 1.00 40.16  ? 154  LYS B O     1 
ATOM   4352  C  CB    . LYS F 2 153 ? 46.706  11.937  216.873 1.00 30.61  ? 154  LYS B CB    1 
ATOM   4353  C  CG    . LYS F 2 153 ? 45.294  11.441  217.202 1.00 17.89  ? 154  LYS B CG    1 
ATOM   4354  C  CD    . LYS F 2 153 ? 44.614  10.851  215.973 1.00 33.81  ? 154  LYS B CD    1 
ATOM   4355  C  CE    . LYS F 2 153 ? 43.101  10.808  216.139 1.00 30.02  ? 154  LYS B CE    1 
ATOM   4356  N  NZ    . LYS F 2 153 ? 42.696  10.123  217.404 1.00 44.97  ? 154  LYS B NZ    1 
ATOM   4357  N  N     . MET F 2 154 ? 49.240  13.873  217.092 1.00 46.20  ? 155  MET B N     1 
ATOM   4358  C  CA    . MET F 2 154 ? 50.628  14.148  216.768 1.00 47.53  ? 155  MET B CA    1 
ATOM   4359  C  C     . MET F 2 154 ? 51.458  14.272  218.051 1.00 48.70  ? 155  MET B C     1 
ATOM   4360  O  O     . MET F 2 154 ? 52.634  13.925  218.063 1.00 51.48  ? 155  MET B O     1 
ATOM   4361  C  CB    . MET F 2 154 ? 50.750  15.440  215.963 1.00 49.55  ? 155  MET B CB    1 
ATOM   4362  C  CG    . MET F 2 154 ? 50.049  15.445  214.626 1.00 44.45  ? 155  MET B CG    1 
ATOM   4363  S  SD    . MET F 2 154 ? 50.592  16.879  213.660 1.00 49.96  ? 155  MET B SD    1 
ATOM   4364  C  CE    . MET F 2 154 ? 49.253  18.030  213.935 1.00 34.52  ? 155  MET B CE    1 
ATOM   4365  N  N     . ILE F 2 155 ? 50.853  14.754  219.134 1.00 44.75  ? 156  ILE B N     1 
ATOM   4366  C  CA    . ILE F 2 155 ? 51.601  14.904  220.375 1.00 52.40  ? 156  ILE B CA    1 
ATOM   4367  C  C     . ILE F 2 155 ? 51.641  13.612  221.180 1.00 54.62  ? 156  ILE B C     1 
ATOM   4368  O  O     . ILE F 2 155 ? 52.636  13.326  221.845 1.00 69.63  ? 156  ILE B O     1 
ATOM   4369  C  CB    . ILE F 2 155 ? 51.035  16.049  221.259 1.00 53.17  ? 156  ILE B CB    1 
ATOM   4370  C  CG1   . ILE F 2 155 ? 51.107  17.377  220.496 1.00 51.99  ? 156  ILE B CG1   1 
ATOM   4371  C  CG2   . ILE F 2 155 ? 51.865  16.191  222.531 1.00 46.74  ? 156  ILE B CG2   1 
ATOM   4372  C  CD1   . ILE F 2 155 ? 50.479  18.545  221.210 1.00 34.72  ? 156  ILE B CD1   1 
ATOM   4373  N  N     . ASP F 2 156 ? 50.576  12.821  221.120 1.00 50.60  ? 157  ASP B N     1 
ATOM   4374  C  CA    . ASP F 2 156 ? 50.553  11.555  221.849 1.00 46.38  ? 157  ASP B CA    1 
ATOM   4375  C  C     . ASP F 2 156 ? 51.532  10.562  221.228 1.00 42.92  ? 157  ASP B C     1 
ATOM   4376  O  O     . ASP F 2 156 ? 52.079  9.712   221.918 1.00 49.09  ? 157  ASP B O     1 
ATOM   4377  C  CB    . ASP F 2 156 ? 49.151  10.928  221.830 1.00 43.51  ? 157  ASP B CB    1 
ATOM   4378  C  CG    . ASP F 2 156 ? 48.168  11.659  222.709 1.00 38.52  ? 157  ASP B CG    1 
ATOM   4379  O  OD1   . ASP F 2 156 ? 48.609  12.445  223.569 1.00 57.35  ? 157  ASP B OD1   1 
ATOM   4380  O  OD2   . ASP F 2 156 ? 46.952  11.434  222.556 1.00 32.45  ? 157  ASP B OD2   1 
ATOM   4381  N  N     . ASN F 2 157 ? 51.757  10.682  219.927 1.00 42.18  ? 158  ASN B N     1 
ATOM   4382  C  CA    . ASN F 2 157 ? 52.638  9.764   219.228 1.00 48.04  ? 158  ASN B CA    1 
ATOM   4383  C  C     . ASN F 2 157 ? 53.958  10.369  218.772 1.00 51.16  ? 158  ASN B C     1 
ATOM   4384  O  O     . ASN F 2 157 ? 54.751  9.701   218.114 1.00 57.25  ? 158  ASN B O     1 
ATOM   4385  C  CB    . ASN F 2 157 ? 51.891  9.173   218.031 1.00 49.65  ? 158  ASN B CB    1 
ATOM   4386  C  CG    . ASN F 2 157 ? 50.633  8.423   218.447 1.00 56.33  ? 158  ASN B CG    1 
ATOM   4387  O  OD1   . ASN F 2 157 ? 50.692  7.272   218.886 1.00 52.56  ? 158  ASN B OD1   1 
ATOM   4388  N  ND2   . ASN F 2 157 ? 49.488  9.085   218.330 1.00 59.91  ? 158  ASN B ND2   1 
ATOM   4389  N  N     . LYS F 2 158 ? 54.192  11.629  219.115 1.00 49.99  ? 159  LYS B N     1 
ATOM   4390  C  CA    . LYS F 2 158 ? 55.428  12.294  218.735 1.00 53.79  ? 159  LYS B CA    1 
ATOM   4391  C  C     . LYS F 2 158 ? 55.631  12.362  217.212 1.00 53.31  ? 159  LYS B C     1 
ATOM   4392  O  O     . LYS F 2 158 ? 56.756  12.564  216.744 1.00 57.50  ? 159  LYS B O     1 
ATOM   4393  C  CB    . LYS F 2 158 ? 56.624  11.582  219.372 1.00 53.92  ? 159  LYS B CB    1 
ATOM   4394  C  CG    . LYS F 2 158 ? 56.567  11.454  220.893 1.00 67.46  ? 159  LYS B CG    1 
ATOM   4395  C  CD    . LYS F 2 158 ? 56.913  12.753  221.604 1.00 66.33  ? 159  LYS B CD    1 
ATOM   4396  C  CE    . LYS F 2 158 ? 56.934  12.551  223.111 1.00 69.80  ? 159  LYS B CE    1 
ATOM   4397  N  NZ    . LYS F 2 158 ? 57.318  13.788  223.844 1.00 74.08  ? 159  LYS B NZ    1 
ATOM   4398  N  N     . GLU F 2 159 ? 54.554  12.198  216.443 1.00 47.83  ? 160  GLU B N     1 
ATOM   4399  C  CA    . GLU F 2 159 ? 54.648  12.262  214.985 1.00 53.18  ? 160  GLU B CA    1 
ATOM   4400  C  C     . GLU F 2 159 ? 54.592  13.708  214.502 1.00 54.65  ? 160  GLU B C     1 
ATOM   4401  O  O     . GLU F 2 159 ? 53.529  14.200  214.104 1.00 52.91  ? 160  GLU B O     1 
ATOM   4402  C  CB    . GLU F 2 159 ? 53.519  11.465  214.315 1.00 50.28  ? 160  GLU B CB    1 
ATOM   4403  C  CG    . GLU F 2 159 ? 53.315  10.057  214.870 1.00 61.46  ? 160  GLU B CG    1 
ATOM   4404  C  CD    . GLU F 2 159 ? 52.578  9.145   213.906 1.00 63.53  ? 160  GLU B CD    1 
ATOM   4405  O  OE1   . GLU F 2 159 ? 53.213  8.683   212.935 1.00 69.04  ? 160  GLU B OE1   1 
ATOM   4406  O  OE2   . GLU F 2 159 ? 51.369  8.895   214.111 1.00 55.11  ? 160  GLU B OE2   1 
ATOM   4407  N  N     . PHE F 2 160 ? 55.743  14.378  214.533 1.00 52.47  ? 161  PHE B N     1 
ATOM   4408  C  CA    . PHE F 2 160 ? 55.839  15.775  214.113 1.00 50.17  ? 161  PHE B CA    1 
ATOM   4409  C  C     . PHE F 2 160 ? 56.554  15.907  212.787 1.00 52.35  ? 161  PHE B C     1 
ATOM   4410  O  O     . PHE F 2 160 ? 56.926  17.008  212.387 1.00 57.44  ? 161  PHE B O     1 
ATOM   4411  C  CB    . PHE F 2 160 ? 56.576  16.589  215.170 1.00 51.19  ? 161  PHE B CB    1 
ATOM   4412  C  CG    . PHE F 2 160 ? 55.996  16.447  216.547 1.00 55.34  ? 161  PHE B CG    1 
ATOM   4413  C  CD1   . PHE F 2 160 ? 54.664  16.771  216.791 1.00 54.42  ? 161  PHE B CD1   1 
ATOM   4414  C  CD2   . PHE F 2 160 ? 56.778  15.992  217.600 1.00 52.85  ? 161  PHE B CD2   1 
ATOM   4415  C  CE1   . PHE F 2 160 ? 54.120  16.644  218.059 1.00 59.47  ? 161  PHE B CE1   1 
ATOM   4416  C  CE2   . PHE F 2 160 ? 56.242  15.862  218.873 1.00 63.08  ? 161  PHE B CE2   1 
ATOM   4417  C  CZ    . PHE F 2 160 ? 54.909  16.190  219.102 1.00 63.01  ? 161  PHE B CZ    1 
ATOM   4418  N  N     . ASP F 2 161 ? 56.749  14.778  212.115 1.00 49.05  ? 162  ASP B N     1 
ATOM   4419  C  CA    . ASP F 2 161 ? 57.411  14.762  210.821 1.00 51.86  ? 162  ASP B CA    1 
ATOM   4420  C  C     . ASP F 2 161 ? 56.906  13.570  210.025 1.00 54.55  ? 162  ASP B C     1 
ATOM   4421  O  O     . ASP F 2 161 ? 57.578  12.541  209.944 1.00 60.35  ? 162  ASP B O     1 
ATOM   4422  C  CB    . ASP F 2 161 ? 58.927  14.661  210.997 1.00 55.29  ? 162  ASP B CB    1 
ATOM   4423  C  CG    . ASP F 2 161 ? 59.664  14.659  209.668 1.00 65.75  ? 162  ASP B CG    1 
ATOM   4424  O  OD1   . ASP F 2 161 ? 60.913  14.737  209.669 1.00 72.50  ? 162  ASP B OD1   1 
ATOM   4425  O  OD2   . ASP F 2 161 ? 58.991  14.577  208.617 1.00 66.26  ? 162  ASP B OD2   1 
ATOM   4426  N  N     . LEU F 2 162 ? 55.727  13.712  209.429 1.00 44.64  ? 163  LEU B N     1 
ATOM   4427  C  CA    . LEU F 2 162 ? 55.146  12.615  208.671 1.00 40.61  ? 163  LEU B CA    1 
ATOM   4428  C  C     . LEU F 2 162 ? 54.189  13.036  207.561 1.00 38.24  ? 163  LEU B C     1 
ATOM   4429  O  O     . LEU F 2 162 ? 54.103  12.380  206.519 1.00 37.65  ? 163  LEU B O     1 
ATOM   4430  C  CB    . LEU F 2 162 ? 54.430  11.661  209.625 1.00 32.67  ? 163  LEU B CB    1 
ATOM   4431  C  CG    . LEU F 2 162 ? 53.838  10.398  209.011 1.00 43.17  ? 163  LEU B CG    1 
ATOM   4432  C  CD1   . LEU F 2 162 ? 54.956  9.551   208.431 1.00 43.99  ? 163  LEU B CD1   1 
ATOM   4433  C  CD2   . LEU F 2 162 ? 53.069  9.621   210.065 1.00 45.97  ? 163  LEU B CD2   1 
ATOM   4434  N  N     . PHE F 2 163 ? 53.460  14.123  207.783 1.00 36.04  ? 164  PHE B N     1 
ATOM   4435  C  CA    . PHE F 2 163 ? 52.513  14.600  206.788 1.00 33.05  ? 164  PHE B CA    1 
ATOM   4436  C  C     . PHE F 2 163 ? 52.366  16.104  206.838 1.00 37.22  ? 164  PHE B C     1 
ATOM   4437  O  O     . PHE F 2 163 ? 52.661  16.752  207.849 1.00 31.56  ? 164  PHE B O     1 
ATOM   4438  C  CB    . PHE F 2 163 ? 51.137  13.959  207.017 1.00 42.10  ? 164  PHE B CB    1 
ATOM   4439  C  CG    . PHE F 2 163 ? 50.450  14.428  208.275 1.00 38.23  ? 164  PHE B CG    1 
ATOM   4440  C  CD1   . PHE F 2 163 ? 49.611  15.535  208.258 1.00 32.23  ? 164  PHE B CD1   1 
ATOM   4441  C  CD2   . PHE F 2 163 ? 50.677  13.781  209.486 1.00 34.75  ? 164  PHE B CD2   1 
ATOM   4442  C  CE1   . PHE F 2 163 ? 49.017  15.987  209.429 1.00 42.74  ? 164  PHE B CE1   1 
ATOM   4443  C  CE2   . PHE F 2 163 ? 50.083  14.227  210.662 1.00 28.82  ? 164  PHE B CE2   1 
ATOM   4444  C  CZ    . PHE F 2 163 ? 49.255  15.328  210.634 1.00 33.24  ? 164  PHE B CZ    1 
ATOM   4445  N  N     . ASP F 2 164 ? 51.886  16.649  205.730 1.00 37.19  ? 165  ASP B N     1 
ATOM   4446  C  CA    . ASP F 2 164 ? 51.654  18.077  205.609 1.00 40.79  ? 165  ASP B CA    1 
ATOM   4447  C  C     . ASP F 2 164 ? 50.323  18.259  204.921 1.00 41.28  ? 165  ASP B C     1 
ATOM   4448  O  O     . ASP F 2 164 ? 49.966  17.479  204.039 1.00 50.62  ? 165  ASP B O     1 
ATOM   4449  C  CB    . ASP F 2 164 ? 52.766  18.736  204.792 1.00 44.56  ? 165  ASP B CB    1 
ATOM   4450  C  CG    . ASP F 2 164 ? 53.942  19.170  205.655 1.00 47.36  ? 165  ASP B CG    1 
ATOM   4451  O  OD1   . ASP F 2 164 ? 54.980  19.555  205.086 1.00 32.73  ? 165  ASP B OD1   1 
ATOM   4452  O  OD2   . ASP F 2 164 ? 53.822  19.134  206.903 1.00 46.06  ? 165  ASP B OD2   1 
ATOM   4453  N  N     . ILE F 2 165 ? 49.577  19.270  205.355 1.00 36.39  ? 166  ILE B N     1 
ATOM   4454  C  CA    . ILE F 2 165 ? 48.273  19.575  204.779 1.00 20.53  ? 166  ILE B CA    1 
ATOM   4455  C  C     . ILE F 2 165 ? 48.421  20.887  204.036 1.00 19.32  ? 166  ILE B C     1 
ATOM   4456  O  O     . ILE F 2 165 ? 48.620  21.924  204.656 1.00 26.22  ? 166  ILE B O     1 
ATOM   4457  C  CB    . ILE F 2 165 ? 47.205  19.717  205.864 1.00 17.77  ? 166  ILE B CB    1 
ATOM   4458  C  CG1   . ILE F 2 165 ? 47.106  18.423  206.677 1.00 18.69  ? 166  ILE B CG1   1 
ATOM   4459  C  CG2   . ILE F 2 165 ? 45.848  19.996  205.226 1.00 24.84  ? 166  ILE B CG2   1 
ATOM   4460  C  CD1   . ILE F 2 165 ? 46.308  18.594  207.965 1.00 10.19  ? 166  ILE B CD1   1 
ATOM   4461  N  N     . ASN F 2 166 ? 48.353  20.830  202.705 1.00 17.93  ? 167  ASN B N     1 
ATOM   4462  C  CA    . ASN F 2 166 ? 48.489  22.020  201.874 1.00 18.81  ? 167  ASN B CA    1 
ATOM   4463  C  C     . ASN F 2 166 ? 47.294  22.271  200.967 1.00 27.64  ? 167  ASN B C     1 
ATOM   4464  O  O     . ASN F 2 166 ? 46.577  21.343  200.576 1.00 27.10  ? 167  ASN B O     1 
ATOM   4465  C  CB    . ASN F 2 166 ? 49.747  21.928  201.031 1.00 12.89  ? 167  ASN B CB    1 
ATOM   4466  C  CG    . ASN F 2 166 ? 51.004  21.738  201.881 1.00 36.33  ? 167  ASN B CG    1 
ATOM   4467  O  OD1   . ASN F 2 166 ? 51.123  22.298  202.997 1.00 12.99  ? 167  ASN B OD1   1 
ATOM   4468  N  ND2   . ASN F 2 166 ? 51.962  20.966  201.353 1.00 17.45  ? 167  ASN B ND2   1 
ATOM   4469  N  N     . TYR F 2 167 ? 47.101  23.535  200.609 1.00 22.54  ? 168  TYR B N     1 
ATOM   4470  C  CA    . TYR F 2 167 ? 45.984  23.903  199.766 1.00 22.32  ? 168  TYR B CA    1 
ATOM   4471  C  C     . TYR F 2 167 ? 46.328  24.579  198.457 1.00 22.64  ? 168  TYR B C     1 
ATOM   4472  O  O     . TYR F 2 167 ? 47.282  25.338  198.380 1.00 42.74  ? 168  TYR B O     1 
ATOM   4473  C  CB    . TYR F 2 167 ? 45.045  24.759  200.590 1.00 17.16  ? 168  TYR B CB    1 
ATOM   4474  C  CG    . TYR F 2 167 ? 44.554  23.985  201.779 1.00 19.29  ? 168  TYR B CG    1 
ATOM   4475  C  CD1   . TYR F 2 167 ? 43.382  23.232  201.715 1.00 9.09   ? 168  TYR B CD1   1 
ATOM   4476  C  CD2   . TYR F 2 167 ? 45.263  24.006  202.974 1.00 11.58  ? 168  TYR B CD2   1 
ATOM   4477  C  CE1   . TYR F 2 167 ? 42.926  22.540  202.828 1.00 13.05  ? 168  TYR B CE1   1 
ATOM   4478  C  CE2   . TYR F 2 167 ? 44.817  23.323  204.078 1.00 20.17  ? 168  TYR B CE2   1 
ATOM   4479  C  CZ    . TYR F 2 167 ? 43.651  22.601  204.007 1.00 18.34  ? 168  TYR B CZ    1 
ATOM   4480  O  OH    . TYR F 2 167 ? 43.181  22.021  205.158 1.00 35.58  ? 168  TYR B OH    1 
ATOM   4481  N  N     . LEU F 2 168 ? 45.545  24.286  197.424 1.00 20.72  ? 169  LEU B N     1 
ATOM   4482  C  CA    . LEU F 2 168 ? 45.750  24.859  196.098 1.00 26.29  ? 169  LEU B CA    1 
ATOM   4483  C  C     . LEU F 2 168 ? 44.470  25.517  195.588 1.00 37.00  ? 169  LEU B C     1 
ATOM   4484  O  O     . LEU F 2 168 ? 43.557  24.838  195.111 1.00 45.99  ? 169  LEU B O     1 
ATOM   4485  C  CB    . LEU F 2 168 ? 46.164  23.778  195.110 1.00 11.09  ? 169  LEU B CB    1 
ATOM   4486  C  CG    . LEU F 2 168 ? 46.203  24.237  193.647 1.00 26.81  ? 169  LEU B CG    1 
ATOM   4487  C  CD1   . LEU F 2 168 ? 47.439  25.102  193.390 1.00 22.21  ? 169  LEU B CD1   1 
ATOM   4488  C  CD2   . LEU F 2 168 ? 46.219  23.017  192.742 1.00 23.41  ? 169  LEU B CD2   1 
ATOM   4489  N  N     . GLU F 2 169 ? 44.406  26.837  195.679 1.00 30.01  ? 170  GLU B N     1 
ATOM   4490  C  CA    . GLU F 2 169 ? 43.230  27.549  195.219 1.00 29.01  ? 170  GLU B CA    1 
ATOM   4491  C  C     . GLU F 2 169 ? 43.259  27.780  193.715 1.00 34.68  ? 170  GLU B C     1 
ATOM   4492  O  O     . GLU F 2 169 ? 44.249  28.250  193.155 1.00 44.24  ? 170  GLU B O     1 
ATOM   4493  C  CB    . GLU F 2 169 ? 43.111  28.883  195.940 1.00 33.46  ? 170  GLU B CB    1 
ATOM   4494  C  CG    . GLU F 2 169 ? 42.217  29.877  195.229 1.00 30.07  ? 170  GLU B CG    1 
ATOM   4495  C  CD    . GLU F 2 169 ? 42.176  31.243  195.904 1.00 43.47  ? 170  GLU B CD    1 
ATOM   4496  O  OE1   . GLU F 2 169 ? 41.638  32.182  195.272 1.00 18.61  ? 170  GLU B OE1   1 
ATOM   4497  O  OE2   . GLU F 2 169 ? 42.670  31.371  197.060 1.00 41.05  ? 170  GLU B OE2   1 
ATOM   4498  N  N     . VAL F 2 170 ? 42.159  27.459  193.055 1.00 25.57  ? 171  VAL B N     1 
ATOM   4499  C  CA    . VAL F 2 170 ? 42.092  27.646  191.622 1.00 29.89  ? 171  VAL B CA    1 
ATOM   4500  C  C     . VAL F 2 170 ? 40.890  28.518  191.295 1.00 34.57  ? 171  VAL B C     1 
ATOM   4501  O  O     . VAL F 2 170 ? 39.748  28.097  191.449 1.00 43.05  ? 171  VAL B O     1 
ATOM   4502  C  CB    . VAL F 2 170 ? 42.006  26.291  190.910 1.00 23.58  ? 171  VAL B CB    1 
ATOM   4503  C  CG1   . VAL F 2 170 ? 40.976  25.421  191.597 1.00 39.13  ? 171  VAL B CG1   1 
ATOM   4504  C  CG2   . VAL F 2 170 ? 41.662  26.494  189.457 1.00 29.77  ? 171  VAL B CG2   1 
ATOM   4505  N  N     . ASP F 2 171 ? 41.164  29.743  190.852 1.00 29.13  ? 172  ASP B N     1 
ATOM   4506  C  CA    . ASP F 2 171 ? 40.124  30.700  190.520 1.00 22.41  ? 172  ASP B CA    1 
ATOM   4507  C  C     . ASP F 2 171 ? 39.693  30.587  189.062 1.00 29.40  ? 172  ASP B C     1 
ATOM   4508  O  O     . ASP F 2 171 ? 40.522  30.418  188.167 1.00 36.13  ? 172  ASP B O     1 
ATOM   4509  C  CB    . ASP F 2 171 ? 40.624  32.113  190.789 1.00 26.04  ? 172  ASP B CB    1 
ATOM   4510  C  CG    . ASP F 2 171 ? 41.438  32.209  192.053 1.00 30.09  ? 172  ASP B CG    1 
ATOM   4511  O  OD1   . ASP F 2 171 ? 42.681  32.173  191.979 1.00 44.54  ? 172  ASP B OD1   1 
ATOM   4512  O  OD2   . ASP F 2 171 ? 40.842  32.305  193.133 1.00 34.64  ? 172  ASP B OD2   1 
ATOM   4513  N  N     . TRP F 2 172 ? 38.393  30.697  188.822 1.00 24.00  ? 173  TRP B N     1 
ATOM   4514  C  CA    . TRP F 2 172 ? 37.859  30.599  187.464 1.00 30.44  ? 173  TRP B CA    1 
ATOM   4515  C  C     . TRP F 2 172 ? 36.802  31.666  187.281 1.00 35.04  ? 173  TRP B C     1 
ATOM   4516  O  O     . TRP F 2 172 ? 36.365  32.285  188.256 1.00 35.47  ? 173  TRP B O     1 
ATOM   4517  C  CB    . TRP F 2 172 ? 37.198  29.230  187.242 1.00 32.40  ? 173  TRP B CB    1 
ATOM   4518  C  CG    . TRP F 2 172 ? 36.160  28.928  188.290 1.00 28.09  ? 173  TRP B CG    1 
ATOM   4519  C  CD1   . TRP F 2 172 ? 36.391  28.536  189.578 1.00 34.15  ? 173  TRP B CD1   1 
ATOM   4520  C  CD2   . TRP F 2 172 ? 34.743  29.102  188.178 1.00 31.79  ? 173  TRP B CD2   1 
ATOM   4521  N  NE1   . TRP F 2 172 ? 35.213  28.458  190.274 1.00 31.37  ? 173  TRP B NE1   1 
ATOM   4522  C  CE2   . TRP F 2 172 ? 34.185  28.795  189.437 1.00 31.41  ? 173  TRP B CE2   1 
ATOM   4523  C  CE3   . TRP F 2 172 ? 33.889  29.484  187.137 1.00 32.96  ? 173  TRP B CE3   1 
ATOM   4524  C  CZ2   . TRP F 2 172 ? 32.810  28.864  189.683 1.00 33.79  ? 173  TRP B CZ2   1 
ATOM   4525  C  CZ3   . TRP F 2 172 ? 32.520  29.551  187.386 1.00 31.53  ? 173  TRP B CZ3   1 
ATOM   4526  C  CH2   . TRP F 2 172 ? 31.996  29.239  188.645 1.00 23.73  ? 173  TRP B CH2   1 
ATOM   4527  N  N     . GLU F 2 173 ? 36.392  31.866  186.031 1.00 35.72  ? 174  GLU B N     1 
ATOM   4528  C  CA    . GLU F 2 173 ? 35.345  32.833  185.687 1.00 39.35  ? 174  GLU B CA    1 
ATOM   4529  C  C     . GLU F 2 173 ? 34.554  32.310  184.489 1.00 43.50  ? 174  GLU B C     1 
ATOM   4530  O  O     . GLU F 2 173 ? 35.135  31.796  183.535 1.00 41.90  ? 174  GLU B O     1 
ATOM   4531  C  CB    . GLU F 2 173 ? 35.942  34.200  185.346 1.00 47.46  ? 174  GLU B CB    1 
ATOM   4532  C  CG    . GLU F 2 173 ? 36.544  34.303  183.957 1.00 49.35  ? 174  GLU B CG    1 
ATOM   4533  C  CD    . GLU F 2 173 ? 37.115  35.678  183.664 1.00 51.01  ? 174  GLU B CD    1 
ATOM   4534  O  OE1   . GLU F 2 173 ? 37.490  35.922  182.495 1.00 59.83  ? 174  GLU B OE1   1 
ATOM   4535  O  OE2   . GLU F 2 173 ? 37.195  36.508  184.596 1.00 36.15  ? 174  GLU B OE2   1 
ATOM   4536  N  N     . LEU F 2 174 ? 33.230  32.427  184.554 1.00 48.55  ? 175  LEU B N     1 
ATOM   4537  C  CA    . LEU F 2 174 ? 32.361  31.961  183.485 1.00 44.53  ? 175  LEU B CA    1 
ATOM   4538  C  C     . LEU F 2 174 ? 32.704  32.672  182.193 1.00 47.53  ? 175  LEU B C     1 
ATOM   4539  O  O     . LEU F 2 174 ? 33.108  33.836  182.194 1.00 48.23  ? 175  LEU B O     1 
ATOM   4540  C  CB    . LEU F 2 174 ? 30.886  32.214  183.837 1.00 52.99  ? 175  LEU B CB    1 
ATOM   4541  C  CG    . LEU F 2 174 ? 29.817  31.850  182.784 1.00 53.66  ? 175  LEU B CG    1 
ATOM   4542  C  CD1   . LEU F 2 174 ? 29.865  30.359  182.476 1.00 55.79  ? 175  LEU B CD1   1 
ATOM   4543  C  CD2   . LEU F 2 174 ? 28.435  32.229  183.303 1.00 62.68  ? 175  LEU B CD2   1 
ATOM   4544  N  N     . ASN F 2 175 ? 32.547  31.962  181.087 1.00 53.56  ? 176  ASN B N     1 
ATOM   4545  C  CA    . ASN F 2 175 ? 32.828  32.527  179.782 1.00 60.41  ? 176  ASN B CA    1 
ATOM   4546  C  C     . ASN F 2 175 ? 31.952  31.819  178.765 1.00 68.63  ? 176  ASN B C     1 
ATOM   4547  O  O     . ASN F 2 175 ? 32.408  30.912  178.065 1.00 71.80  ? 176  ASN B O     1 
ATOM   4548  C  CB    . ASN F 2 175 ? 34.286  32.323  179.423 1.00 62.12  ? 176  ASN B CB    1 
ATOM   4549  C  CG    . ASN F 2 175 ? 34.933  33.585  178.936 1.00 74.87  ? 176  ASN B CG    1 
ATOM   4550  O  OD1   . ASN F 2 175 ? 34.996  34.578  179.666 1.00 75.34  ? 176  ASN B OD1   1 
ATOM   4551  N  ND2   . ASN F 2 175 ? 35.424  33.565  177.695 1.00 73.48  ? 176  ASN B ND2   1 
ATOM   4552  N  N     . GLY F 2 176 ? 30.693  32.237  178.691 1.00 63.89  ? 177  GLY B N     1 
ATOM   4553  C  CA    . GLY F 2 176 ? 29.775  31.619  177.764 1.00 58.76  ? 177  GLY B CA    1 
ATOM   4554  C  C     . GLY F 2 176 ? 29.185  30.376  178.383 1.00 66.20  ? 177  GLY B C     1 
ATOM   4555  O  O     . GLY F 2 176 ? 28.114  30.428  178.988 1.00 68.40  ? 177  GLY B O     1 
ATOM   4556  N  N     . GLU F 2 177 ? 29.885  29.255  178.241 1.00 68.69  ? 178  GLU B N     1 
ATOM   4557  C  CA    . GLU F 2 177 ? 29.421  27.991  178.799 1.00 72.59  ? 178  GLU B CA    1 
ATOM   4558  C  C     . GLU F 2 177 ? 30.415  27.467  179.815 1.00 70.26  ? 178  GLU B C     1 
ATOM   4559  O  O     . GLU F 2 177 ? 30.115  27.360  181.006 1.00 68.40  ? 178  GLU B O     1 
ATOM   4560  C  CB    . GLU F 2 177 ? 29.247  26.955  177.693 1.00 73.62  ? 178  GLU B CB    1 
ATOM   4561  N  N     . ASP F 2 178 ? 31.605  27.146  179.325 1.00 67.78  ? 179  ASP B N     1 
ATOM   4562  C  CA    . ASP F 2 178 ? 32.676  26.612  180.159 1.00 66.71  ? 179  ASP B CA    1 
ATOM   4563  C  C     . ASP F 2 178 ? 33.305  27.645  181.101 1.00 55.81  ? 179  ASP B C     1 
ATOM   4564  O  O     . ASP F 2 178 ? 33.234  28.843  180.854 1.00 55.05  ? 179  ASP B O     1 
ATOM   4565  C  CB    . ASP F 2 178 ? 33.755  25.981  179.264 1.00 69.54  ? 179  ASP B CB    1 
ATOM   4566  C  CG    . ASP F 2 178 ? 33.781  26.578  177.857 1.00 69.84  ? 179  ASP B CG    1 
ATOM   4567  O  OD1   . ASP F 2 178 ? 33.674  27.819  177.730 1.00 61.29  ? 179  ASP B OD1   1 
ATOM   4568  O  OD2   . ASP F 2 178 ? 33.924  25.806  176.880 1.00 66.81  ? 179  ASP B OD2   1 
ATOM   4569  N  N     . LEU F 2 179 ? 33.909  27.166  182.185 1.00 49.44  ? 180  LEU B N     1 
ATOM   4570  C  CA    . LEU F 2 179 ? 34.558  28.032  183.170 1.00 47.99  ? 180  LEU B CA    1 
ATOM   4571  C  C     . LEU F 2 179 ? 36.063  27.997  182.923 1.00 46.05  ? 180  LEU B C     1 
ATOM   4572  O  O     . LEU F 2 179 ? 36.635  26.915  182.846 1.00 53.23  ? 180  LEU B O     1 
ATOM   4573  C  CB    . LEU F 2 179 ? 34.285  27.514  184.570 1.00 45.46  ? 180  LEU B CB    1 
ATOM   4574  C  CG    . LEU F 2 179 ? 32.992  26.737  184.768 1.00 43.59  ? 180  LEU B CG    1 
ATOM   4575  C  CD1   . LEU F 2 179 ? 32.907  26.360  186.230 1.00 52.31  ? 180  LEU B CD1   1 
ATOM   4576  C  CD2   . LEU F 2 179 ? 31.785  27.561  184.357 1.00 57.13  ? 180  LEU B CD2   1 
ATOM   4577  N  N     . VAL F 2 180 ? 36.714  29.154  182.822 1.00 38.61  ? 181  VAL B N     1 
ATOM   4578  C  CA    . VAL F 2 180 ? 38.155  29.157  182.555 1.00 41.01  ? 181  VAL B CA    1 
ATOM   4579  C  C     . VAL F 2 180 ? 39.052  29.634  183.683 1.00 35.62  ? 181  VAL B C     1 
ATOM   4580  O  O     . VAL F 2 180 ? 38.955  30.774  184.122 1.00 38.18  ? 181  VAL B O     1 
ATOM   4581  C  CB    . VAL F 2 180 ? 38.498  29.986  181.293 1.00 39.29  ? 181  VAL B CB    1 
ATOM   4582  C  CG1   . VAL F 2 180 ? 37.930  31.377  181.417 1.00 43.82  ? 181  VAL B CG1   1 
ATOM   4583  C  CG2   . VAL F 2 180 ? 40.012  30.043  181.105 1.00 41.00  ? 181  VAL B CG2   1 
ATOM   4584  N  N     . CYS F 2 181 ? 39.942  28.760  184.142 1.00 35.63  ? 182  CYS B N     1 
ATOM   4585  C  CA    . CYS F 2 181 ? 40.861  29.131  185.212 1.00 41.19  ? 182  CYS B CA    1 
ATOM   4586  C  C     . CYS F 2 181 ? 41.619  30.414  184.861 1.00 44.55  ? 182  CYS B C     1 
ATOM   4587  O  O     . CYS F 2 181 ? 42.276  30.486  183.817 1.00 51.71  ? 182  CYS B O     1 
ATOM   4588  C  CB    . CYS F 2 181 ? 41.862  28.007  185.469 1.00 32.19  ? 182  CYS B CB    1 
ATOM   4589  S  SG    . CYS F 2 181 ? 43.213  28.510  186.560 1.00 30.58  ? 182  CYS B SG    1 
ATOM   4590  N  N     . VAL F 2 182 ? 41.523  31.421  185.729 1.00 39.26  ? 183  VAL B N     1 
ATOM   4591  C  CA    . VAL F 2 182 ? 42.205  32.698  185.504 1.00 34.69  ? 183  VAL B CA    1 
ATOM   4592  C  C     . VAL F 2 182 ? 43.389  32.908  186.446 1.00 35.67  ? 183  VAL B C     1 
ATOM   4593  O  O     . VAL F 2 182 ? 44.291  33.671  186.133 1.00 43.16  ? 183  VAL B O     1 
ATOM   4594  C  CB    . VAL F 2 182 ? 41.244  33.895  185.659 1.00 25.23  ? 183  VAL B CB    1 
ATOM   4595  C  CG1   . VAL F 2 182 ? 40.041  33.710  184.736 1.00 28.35  ? 183  VAL B CG1   1 
ATOM   4596  C  CG2   . VAL F 2 182 ? 40.799  34.039  187.107 1.00 18.76  ? 183  VAL B CG2   1 
ATOM   4597  N  N     . SER F 2 183 ? 43.384  32.242  187.597 1.00 35.36  ? 184  SER B N     1 
ATOM   4598  C  CA    . SER F 2 183 ? 44.493  32.362  188.535 1.00 28.63  ? 184  SER B CA    1 
ATOM   4599  C  C     . SER F 2 183 ? 44.694  31.100  189.386 1.00 23.83  ? 184  SER B C     1 
ATOM   4600  O  O     . SER F 2 183 ? 44.057  30.069  189.153 1.00 31.77  ? 184  SER B O     1 
ATOM   4601  C  CB    . SER F 2 183 ? 44.306  33.591  189.420 1.00 16.68  ? 184  SER B CB    1 
ATOM   4602  O  OG    . SER F 2 183 ? 43.021  33.613  190.003 1.00 43.81  ? 184  SER B OG    1 
ATOM   4603  N  N     . THR F 2 184 ? 45.566  31.199  190.384 1.00 23.62  ? 185  THR B N     1 
ATOM   4604  C  CA    . THR F 2 184 ? 45.905  30.071  191.246 1.00 20.16  ? 185  THR B CA    1 
ATOM   4605  C  C     . THR F 2 184 ? 46.656  30.564  192.476 1.00 22.70  ? 185  THR B C     1 
ATOM   4606  O  O     . THR F 2 184 ? 47.270  31.625  192.451 1.00 19.24  ? 185  THR B O     1 
ATOM   4607  C  CB    . THR F 2 184 ? 46.816  29.086  190.481 1.00 17.56  ? 185  THR B CB    1 
ATOM   4608  O  OG1   . THR F 2 184 ? 46.025  28.318  189.566 1.00 35.07  ? 185  THR B OG1   1 
ATOM   4609  C  CG2   . THR F 2 184 ? 47.546  28.163  191.426 1.00 20.79  ? 185  THR B CG2   1 
ATOM   4610  N  N     . SER F 2 185 ? 46.609  29.788  193.550 1.00 30.55  ? 186  SER B N     1 
ATOM   4611  C  CA    . SER F 2 185 ? 47.289  30.144  194.783 1.00 34.70  ? 186  SER B CA    1 
ATOM   4612  C  C     . SER F 2 185 ? 47.594  28.879  195.561 1.00 38.51  ? 186  SER B C     1 
ATOM   4613  O  O     . SER F 2 185 ? 46.798  27.941  195.566 1.00 49.30  ? 186  SER B O     1 
ATOM   4614  C  CB    . SER F 2 185 ? 46.405  31.056  195.623 1.00 41.73  ? 186  SER B CB    1 
ATOM   4615  O  OG    . SER F 2 185 ? 46.294  32.336  195.031 1.00 64.63  ? 186  SER B OG    1 
ATOM   4616  N  N     . PHE F 2 186 ? 48.740  28.858  196.229 1.00 36.22  ? 187  PHE B N     1 
ATOM   4617  C  CA    . PHE F 2 186 ? 49.158  27.693  197.008 1.00 36.14  ? 187  PHE B CA    1 
ATOM   4618  C  C     . PHE F 2 186 ? 49.524  28.143  198.404 1.00 39.72  ? 187  PHE B C     1 
ATOM   4619  O  O     . PHE F 2 186 ? 50.028  29.248  198.579 1.00 55.56  ? 187  PHE B O     1 
ATOM   4620  C  CB    . PHE F 2 186 ? 50.380  27.041  196.365 1.00 29.71  ? 187  PHE B CB    1 
ATOM   4621  C  CG    . PHE F 2 186 ? 50.870  25.816  197.088 1.00 30.17  ? 187  PHE B CG    1 
ATOM   4622  C  CD1   . PHE F 2 186 ? 50.355  24.562  196.778 1.00 28.68  ? 187  PHE B CD1   1 
ATOM   4623  C  CD2   . PHE F 2 186 ? 51.863  25.913  198.066 1.00 35.67  ? 187  PHE B CD2   1 
ATOM   4624  C  CE1   . PHE F 2 186 ? 50.816  23.428  197.417 1.00 21.48  ? 187  PHE B CE1   1 
ATOM   4625  C  CE2   . PHE F 2 186 ? 52.335  24.782  198.717 1.00 25.88  ? 187  PHE B CE2   1 
ATOM   4626  C  CZ    . PHE F 2 186 ? 51.810  23.536  198.389 1.00 32.27  ? 187  PHE B CZ    1 
ATOM   4627  N  N     . ALA F 2 187 ? 49.285  27.294  199.397 1.00 36.83  ? 188  ALA B N     1 
ATOM   4628  C  CA    . ALA F 2 187 ? 49.620  27.643  200.774 1.00 34.75  ? 188  ALA B CA    1 
ATOM   4629  C  C     . ALA F 2 187 ? 49.651  26.421  201.678 1.00 28.90  ? 188  ALA B C     1 
ATOM   4630  O  O     . ALA F 2 187 ? 48.893  25.477  201.484 1.00 32.43  ? 188  ALA B O     1 
ATOM   4631  C  CB    . ALA F 2 187 ? 48.648  28.685  201.318 1.00 28.04  ? 188  ALA B CB    1 
ATOM   4632  N  N     . GLU F 2 188 ? 50.541  26.456  202.664 1.00 22.65  ? 189  GLU B N     1 
ATOM   4633  C  CA    . GLU F 2 188 ? 50.726  25.352  203.594 1.00 35.42  ? 189  GLU B CA    1 
ATOM   4634  C  C     . GLU F 2 188 ? 50.087  25.631  204.961 1.00 34.86  ? 189  GLU B C     1 
ATOM   4635  O  O     . GLU F 2 188 ? 50.463  26.574  205.646 1.00 39.65  ? 189  GLU B O     1 
ATOM   4636  C  CB    . GLU F 2 188 ? 52.227  25.090  203.745 1.00 35.47  ? 189  GLU B CB    1 
ATOM   4637  C  CG    . GLU F 2 188 ? 52.921  24.767  202.441 1.00 30.70  ? 189  GLU B CG    1 
ATOM   4638  C  CD    . GLU F 2 188 ? 54.435  24.682  202.599 1.00 46.15  ? 189  GLU B CD    1 
ATOM   4639  O  OE1   . GLU F 2 188 ? 54.885  23.987  203.533 1.00 37.48  ? 189  GLU B OE1   1 
ATOM   4640  O  OE2   . GLU F 2 188 ? 55.172  25.297  201.787 1.00 44.01  ? 189  GLU B OE2   1 
ATOM   4641  N  N     . LEU F 2 189 ? 49.125  24.809  205.362 1.00 33.54  ? 190  LEU B N     1 
ATOM   4642  C  CA    . LEU F 2 189 ? 48.461  25.037  206.634 1.00 38.79  ? 190  LEU B CA    1 
ATOM   4643  C  C     . LEU F 2 189 ? 49.440  25.171  207.780 1.00 38.41  ? 190  LEU B C     1 
ATOM   4644  O  O     . LEU F 2 189 ? 49.380  26.128  208.544 1.00 40.85  ? 190  LEU B O     1 
ATOM   4645  C  CB    . LEU F 2 189 ? 47.458  23.909  206.954 1.00 35.57  ? 190  LEU B CB    1 
ATOM   4646  C  CG    . LEU F 2 189 ? 46.740  23.984  208.325 1.00 28.44  ? 190  LEU B CG    1 
ATOM   4647  C  CD1   . LEU F 2 189 ? 46.081  25.336  208.516 1.00 27.03  ? 190  LEU B CD1   1 
ATOM   4648  C  CD2   . LEU F 2 189 ? 45.720  22.883  208.443 1.00 37.12  ? 190  LEU B CD2   1 
ATOM   4649  N  N     . PHE F 2 190 ? 50.357  24.219  207.890 1.00 46.80  ? 191  PHE B N     1 
ATOM   4650  C  CA    . PHE F 2 190 ? 51.318  24.215  208.991 1.00 51.18  ? 191  PHE B CA    1 
ATOM   4651  C  C     . PHE F 2 190 ? 52.358  25.335  209.021 1.00 53.25  ? 191  PHE B C     1 
ATOM   4652  O  O     . PHE F 2 190 ? 53.260  25.322  209.859 1.00 54.84  ? 191  PHE B O     1 
ATOM   4653  C  CB    . PHE F 2 190 ? 51.978  22.839  209.063 1.00 38.25  ? 191  PHE B CB    1 
ATOM   4654  C  CG    . PHE F 2 190 ? 51.056  21.767  209.581 1.00 37.63  ? 191  PHE B CG    1 
ATOM   4655  C  CD1   . PHE F 2 190 ? 50.979  20.529  208.954 1.00 38.57  ? 191  PHE B CD1   1 
ATOM   4656  C  CD2   . PHE F 2 190 ? 50.278  21.991  210.717 1.00 42.18  ? 191  PHE B CD2   1 
ATOM   4657  C  CE1   . PHE F 2 190 ? 50.147  19.523  209.446 1.00 32.48  ? 191  PHE B CE1   1 
ATOM   4658  C  CE2   . PHE F 2 190 ? 49.439  20.991  211.222 1.00 39.74  ? 191  PHE B CE2   1 
ATOM   4659  C  CZ    . PHE F 2 190 ? 49.376  19.754  210.584 1.00 40.20  ? 191  PHE B CZ    1 
ATOM   4660  N  N     . LYS F 2 191 ? 52.217  26.305  208.118 1.00 56.60  ? 192  LYS B N     1 
ATOM   4661  C  CA    . LYS F 2 191 ? 53.115  27.460  208.065 1.00 53.46  ? 192  LYS B CA    1 
ATOM   4662  C  C     . LYS F 2 191 ? 52.384  28.730  208.526 1.00 49.46  ? 192  LYS B C     1 
ATOM   4663  O  O     . LYS F 2 191 ? 53.009  29.702  208.935 1.00 43.19  ? 192  LYS B O     1 
ATOM   4664  C  CB    . LYS F 2 191 ? 53.659  27.680  206.650 1.00 50.36  ? 192  LYS B CB    1 
ATOM   4665  C  CG    . LYS F 2 191 ? 54.933  26.918  206.366 1.00 63.77  ? 192  LYS B CG    1 
ATOM   4666  C  CD    . LYS F 2 191 ? 55.656  27.458  205.147 1.00 62.35  ? 192  LYS B CD    1 
ATOM   4667  C  CE    . LYS F 2 191 ? 57.061  26.874  205.046 1.00 61.11  ? 192  LYS B CE    1 
ATOM   4668  N  NZ    . LYS F 2 191 ? 57.825  27.485  203.914 1.00 73.40  ? 192  LYS B NZ    1 
ATOM   4669  N  N     . SER F 2 192 ? 51.059  28.723  208.458 1.00 44.23  ? 193  SER B N     1 
ATOM   4670  C  CA    . SER F 2 192 ? 50.305  29.883  208.881 1.00 35.57  ? 193  SER B CA    1 
ATOM   4671  C  C     . SER F 2 192 ? 50.288  29.979  210.401 1.00 33.78  ? 193  SER B C     1 
ATOM   4672  O  O     . SER F 2 192 ? 50.594  29.010  211.099 1.00 21.23  ? 193  SER B O     1 
ATOM   4673  C  CB    . SER F 2 192 ? 48.873  29.828  208.331 1.00 38.62  ? 193  SER B CB    1 
ATOM   4674  O  OG    . SER F 2 192 ? 48.194  28.658  208.751 1.00 35.63  ? 193  SER B OG    1 
ATOM   4675  N  N     . GLU F 2 193 ? 49.956  31.162  210.910 1.00 36.03  ? 194  GLU B N     1 
ATOM   4676  C  CA    . GLU F 2 193 ? 49.887  31.367  212.346 1.00 36.43  ? 194  GLU B CA    1 
ATOM   4677  C  C     . GLU F 2 193 ? 48.679  30.586  212.858 1.00 35.32  ? 194  GLU B C     1 
ATOM   4678  O  O     . GLU F 2 193 ? 47.533  30.953  212.613 1.00 31.47  ? 194  GLU B O     1 
ATOM   4679  C  CB    . GLU F 2 193 ? 49.755  32.864  212.659 1.00 34.79  ? 194  GLU B CB    1 
ATOM   4680  C  CG    . GLU F 2 193 ? 49.511  33.182  214.134 1.00 55.30  ? 194  GLU B CG    1 
ATOM   4681  C  CD    . GLU F 2 193 ? 50.432  32.409  215.064 1.00 70.18  ? 194  GLU B CD    1 
ATOM   4682  O  OE1   . GLU F 2 193 ? 51.668  32.440  214.850 1.00 73.53  ? 194  GLU B OE1   1 
ATOM   4683  O  OE2   . GLU F 2 193 ? 49.917  31.772  216.012 1.00 68.98  ? 194  GLU B OE2   1 
ATOM   4684  N  N     . PRO F 2 194 ? 48.931  29.478  213.563 1.00 39.47  ? 195  PRO B N     1 
ATOM   4685  C  CA    . PRO F 2 194 ? 47.887  28.616  214.122 1.00 46.37  ? 195  PRO B CA    1 
ATOM   4686  C  C     . PRO F 2 194 ? 46.943  29.332  215.067 1.00 46.04  ? 195  PRO B C     1 
ATOM   4687  O  O     . PRO F 2 194 ? 45.943  28.760  215.495 1.00 55.44  ? 195  PRO B O     1 
ATOM   4688  C  CB    . PRO F 2 194 ? 48.682  27.527  214.840 1.00 46.96  ? 195  PRO B CB    1 
ATOM   4689  C  CG    . PRO F 2 194 ? 49.904  28.264  215.286 1.00 40.04  ? 195  PRO B CG    1 
ATOM   4690  C  CD    . PRO F 2 194 ? 50.257  29.041  214.026 1.00 32.72  ? 195  PRO B CD    1 
ATOM   4691  N  N     . SER F 2 195 ? 47.245  30.579  215.396 1.00 33.59  ? 196  SER B N     1 
ATOM   4692  C  CA    . SER F 2 195 ? 46.366  31.287  216.303 1.00 48.09  ? 196  SER B CA    1 
ATOM   4693  C  C     . SER F 2 195 ? 45.420  32.245  215.571 1.00 45.35  ? 196  SER B C     1 
ATOM   4694  O  O     . SER F 2 195 ? 44.359  32.583  216.089 1.00 50.45  ? 196  SER B O     1 
ATOM   4695  C  CB    . SER F 2 195 ? 47.185  32.033  217.363 1.00 53.17  ? 196  SER B CB    1 
ATOM   4696  O  OG    . SER F 2 195 ? 46.391  32.321  218.507 1.00 57.11  ? 196  SER B OG    1 
ATOM   4697  N  N     . GLU F 2 196 ? 45.799  32.659  214.363 1.00 41.77  ? 197  GLU B N     1 
ATOM   4698  C  CA    . GLU F 2 196 ? 44.987  33.575  213.562 1.00 40.96  ? 197  GLU B CA    1 
ATOM   4699  C  C     . GLU F 2 196 ? 44.024  32.847  212.604 1.00 39.10  ? 197  GLU B C     1 
ATOM   4700  O  O     . GLU F 2 196 ? 43.390  33.466  211.740 1.00 30.80  ? 197  GLU B O     1 
ATOM   4701  C  CB    . GLU F 2 196 ? 45.893  34.509  212.761 1.00 36.80  ? 197  GLU B CB    1 
ATOM   4702  C  CG    . GLU F 2 196 ? 46.840  35.338  213.603 1.00 48.79  ? 197  GLU B CG    1 
ATOM   4703  C  CD    . GLU F 2 196 ? 47.844  36.107  212.749 1.00 66.77  ? 197  GLU B CD    1 
ATOM   4704  O  OE1   . GLU F 2 196 ? 48.771  36.735  213.315 1.00 59.23  ? 197  GLU B OE1   1 
ATOM   4705  O  OE2   . GLU F 2 196 ? 47.699  36.082  211.504 1.00 76.59  ? 197  GLU B OE2   1 
ATOM   4706  N  N     . LEU F 2 197 ? 43.928  31.532  212.765 1.00 35.16  ? 198  LEU B N     1 
ATOM   4707  C  CA    . LEU F 2 197 ? 43.043  30.704  211.952 1.00 29.96  ? 198  LEU B CA    1 
ATOM   4708  C  C     . LEU F 2 197 ? 41.613  30.937  212.425 1.00 30.37  ? 198  LEU B C     1 
ATOM   4709  O  O     . LEU F 2 197 ? 41.344  30.866  213.629 1.00 28.73  ? 198  LEU B O     1 
ATOM   4710  C  CB    . LEU F 2 197 ? 43.410  29.237  212.140 1.00 23.60  ? 198  LEU B CB    1 
ATOM   4711  C  CG    . LEU F 2 197 ? 44.071  28.531  210.973 1.00 17.37  ? 198  LEU B CG    1 
ATOM   4712  C  CD1   . LEU F 2 197 ? 44.897  29.496  210.151 1.00 31.24  ? 198  LEU B CD1   1 
ATOM   4713  C  CD2   . LEU F 2 197 ? 44.883  27.411  211.522 1.00 5.13   ? 198  LEU B CD2   1 
ATOM   4714  N  N     . TYR F 2 198 ? 40.699  31.212  211.495 1.00 17.83  ? 199  TYR B N     1 
ATOM   4715  C  CA    . TYR F 2 198 ? 39.301  31.471  211.859 1.00 25.96  ? 199  TYR B CA    1 
ATOM   4716  C  C     . TYR F 2 198 ? 38.381  30.244  211.869 1.00 30.64  ? 199  TYR B C     1 
ATOM   4717  O  O     . TYR F 2 198 ? 38.098  29.659  210.827 1.00 31.66  ? 199  TYR B O     1 
ATOM   4718  C  CB    . TYR F 2 198 ? 38.690  32.527  210.925 1.00 31.58  ? 199  TYR B CB    1 
ATOM   4719  C  CG    . TYR F 2 198 ? 37.264  32.865  211.297 1.00 32.08  ? 199  TYR B CG    1 
ATOM   4720  C  CD1   . TYR F 2 198 ? 36.938  33.201  212.606 1.00 34.44  ? 199  TYR B CD1   1 
ATOM   4721  C  CD2   . TYR F 2 198 ? 36.242  32.809  210.362 1.00 36.24  ? 199  TYR B CD2   1 
ATOM   4722  C  CE1   . TYR F 2 198 ? 35.629  33.468  212.981 1.00 42.96  ? 199  TYR B CE1   1 
ATOM   4723  C  CE2   . TYR F 2 198 ? 34.921  33.075  210.720 1.00 42.91  ? 199  TYR B CE2   1 
ATOM   4724  C  CZ    . TYR F 2 198 ? 34.621  33.402  212.037 1.00 50.08  ? 199  TYR B CZ    1 
ATOM   4725  O  OH    . TYR F 2 198 ? 33.319  33.645  212.424 1.00 50.75  ? 199  TYR B OH    1 
ATOM   4726  N  N     . ILE F 2 199 ? 37.891  29.877  213.044 1.00 20.28  ? 200  ILE B N     1 
ATOM   4727  C  CA    . ILE F 2 199 ? 37.002  28.733  213.156 1.00 26.45  ? 200  ILE B CA    1 
ATOM   4728  C  C     . ILE F 2 199 ? 35.520  29.105  213.031 1.00 23.83  ? 200  ILE B C     1 
ATOM   4729  O  O     . ILE F 2 199 ? 34.983  29.779  213.906 1.00 30.31  ? 200  ILE B O     1 
ATOM   4730  C  CB    . ILE F 2 199 ? 37.210  28.032  214.501 1.00 32.92  ? 200  ILE B CB    1 
ATOM   4731  C  CG1   . ILE F 2 199 ? 38.644  27.524  214.575 1.00 25.99  ? 200  ILE B CG1   1 
ATOM   4732  C  CG2   . ILE F 2 199 ? 36.169  26.915  214.689 1.00 25.64  ? 200  ILE B CG2   1 
ATOM   4733  C  CD1   . ILE F 2 199 ? 38.974  26.833  215.844 1.00 30.72  ? 200  ILE B CD1   1 
ATOM   4734  N  N     . ASN F 2 200 ? 34.862  28.682  211.952 1.00 23.72  ? 201  ASN B N     1 
ATOM   4735  C  CA    . ASN F 2 200 ? 33.435  28.981  211.778 1.00 31.19  ? 201  ASN B CA    1 
ATOM   4736  C  C     . ASN F 2 200 ? 32.638  27.806  212.326 1.00 32.69  ? 201  ASN B C     1 
ATOM   4737  O  O     . ASN F 2 200 ? 32.462  26.796  211.636 1.00 41.74  ? 201  ASN B O     1 
ATOM   4738  C  CB    . ASN F 2 200 ? 33.079  29.155  210.301 1.00 24.16  ? 201  ASN B CB    1 
ATOM   4739  C  CG    . ASN F 2 200 ? 31.655  29.654  210.103 1.00 39.93  ? 201  ASN B CG    1 
ATOM   4740  O  OD1   . ASN F 2 200 ? 30.760  29.358  210.909 1.00 41.03  ? 201  ASN B OD1   1 
ATOM   4741  N  ND2   . ASN F 2 200 ? 31.431  30.406  209.026 1.00 31.61  ? 201  ASN B ND2   1 
ATOM   4742  N  N     . TRP F 2 201 ? 32.152  27.925  213.557 1.00 27.79  ? 202  TRP B N     1 
ATOM   4743  C  CA    . TRP F 2 201 ? 31.401  26.828  214.170 1.00 33.70  ? 202  TRP B CA    1 
ATOM   4744  C  C     . TRP F 2 201 ? 30.114  26.420  213.458 1.00 34.30  ? 202  TRP B C     1 
ATOM   4745  O  O     . TRP F 2 201 ? 29.824  25.227  213.336 1.00 37.88  ? 202  TRP B O     1 
ATOM   4746  C  CB    . TRP F 2 201 ? 31.099  27.141  215.638 1.00 35.75  ? 202  TRP B CB    1 
ATOM   4747  C  CG    . TRP F 2 201 ? 32.341  27.346  216.429 1.00 33.42  ? 202  TRP B CG    1 
ATOM   4748  C  CD1   . TRP F 2 201 ? 32.963  28.532  216.681 1.00 35.35  ? 202  TRP B CD1   1 
ATOM   4749  C  CD2   . TRP F 2 201 ? 33.175  26.327  216.992 1.00 28.57  ? 202  TRP B CD2   1 
ATOM   4750  N  NE1   . TRP F 2 201 ? 34.138  28.316  217.367 1.00 35.35  ? 202  TRP B NE1   1 
ATOM   4751  C  CE2   . TRP F 2 201 ? 34.287  26.972  217.575 1.00 27.09  ? 202  TRP B CE2   1 
ATOM   4752  C  CE3   . TRP F 2 201 ? 33.086  24.935  217.069 1.00 23.71  ? 202  TRP B CE3   1 
ATOM   4753  C  CZ2   . TRP F 2 201 ? 35.307  26.273  218.207 1.00 28.67  ? 202  TRP B CZ2   1 
ATOM   4754  C  CZ3   . TRP F 2 201 ? 34.104  24.236  217.700 1.00 20.78  ? 202  TRP B CZ3   1 
ATOM   4755  C  CH2   . TRP F 2 201 ? 35.196  24.907  218.267 1.00 30.92  ? 202  TRP B CH2   1 
ATOM   4756  N  N     . ALA F 2 202 ? 29.342  27.390  212.983 1.00 25.04  ? 203  ALA B N     1 
ATOM   4757  C  CA    . ALA F 2 202 ? 28.110  27.042  212.299 1.00 27.40  ? 203  ALA B CA    1 
ATOM   4758  C  C     . ALA F 2 202 ? 28.390  26.365  210.966 1.00 34.55  ? 203  ALA B C     1 
ATOM   4759  O  O     . ALA F 2 202 ? 27.580  25.577  210.487 1.00 43.08  ? 203  ALA B O     1 
ATOM   4760  C  CB    . ALA F 2 202 ? 27.247  28.267  212.099 1.00 26.05  ? 203  ALA B CB    1 
ATOM   4761  N  N     . ALA F 2 203 ? 29.536  26.657  210.363 1.00 29.09  ? 204  ALA B N     1 
ATOM   4762  C  CA    . ALA F 2 203 ? 29.861  26.038  209.082 1.00 29.19  ? 204  ALA B CA    1 
ATOM   4763  C  C     . ALA F 2 203 ? 30.655  24.750  209.266 1.00 32.90  ? 204  ALA B C     1 
ATOM   4764  O  O     . ALA F 2 203 ? 31.825  24.673  208.886 1.00 28.03  ? 204  ALA B O     1 
ATOM   4765  C  CB    . ALA F 2 203 ? 30.630  27.004  208.203 1.00 20.00  ? 204  ALA B CB    1 
ATOM   4766  N  N     . ALA F 2 204 ? 30.013  23.743  209.856 1.00 24.52  ? 205  ALA B N     1 
ATOM   4767  C  CA    . ALA F 2 204 ? 30.659  22.450  210.072 1.00 27.99  ? 205  ALA B CA    1 
ATOM   4768  C  C     . ALA F 2 204 ? 31.945  22.587  210.865 1.00 24.41  ? 205  ALA B C     1 
ATOM   4769  O  O     . ALA F 2 204 ? 32.884  21.816  210.670 1.00 18.56  ? 205  ALA B O     1 
ATOM   4770  C  CB    . ALA F 2 204 ? 30.952  21.776  208.730 1.00 26.38  ? 205  ALA B CB    1 
ATOM   4771  N  N     . MET F 2 205 ? 31.986  23.578  211.747 1.00 22.85  ? 206  MET B N     1 
ATOM   4772  C  CA    . MET F 2 205 ? 33.158  23.808  212.578 1.00 27.72  ? 206  MET B CA    1 
ATOM   4773  C  C     . MET F 2 205 ? 34.425  23.824  211.718 1.00 23.59  ? 206  MET B C     1 
ATOM   4774  O  O     . MET F 2 205 ? 35.507  23.458  212.179 1.00 25.86  ? 206  MET B O     1 
ATOM   4775  C  CB    . MET F 2 205 ? 33.264  22.709  213.643 1.00 22.01  ? 206  MET B CB    1 
ATOM   4776  C  CG    . MET F 2 205 ? 31.951  22.366  214.295 1.00 24.71  ? 206  MET B CG    1 
ATOM   4777  S  SD    . MET F 2 205 ? 32.100  21.065  215.556 1.00 32.60  ? 206  MET B SD    1 
ATOM   4778  C  CE    . MET F 2 205 ? 32.621  19.736  214.547 1.00 23.45  ? 206  MET B CE    1 
ATOM   4779  N  N     . GLN F 2 206 ? 34.280  24.259  210.474 1.00 13.27  ? 207  GLN B N     1 
ATOM   4780  C  CA    . GLN F 2 206 ? 35.404  24.323  209.537 1.00 22.86  ? 207  GLN B CA    1 
ATOM   4781  C  C     . GLN F 2 206 ? 36.290  25.556  209.727 1.00 29.01  ? 207  GLN B C     1 
ATOM   4782  O  O     . GLN F 2 206 ? 35.822  26.607  210.174 1.00 30.29  ? 207  GLN B O     1 
ATOM   4783  C  CB    . GLN F 2 206 ? 34.894  24.353  208.086 1.00 11.34  ? 207  GLN B CB    1 
ATOM   4784  C  CG    . GLN F 2 206 ? 34.003  23.181  207.704 1.00 24.20  ? 207  GLN B CG    1 
ATOM   4785  C  CD    . GLN F 2 206 ? 34.785  21.915  207.409 1.00 14.62  ? 207  GLN B CD    1 
ATOM   4786  O  OE1   . GLN F 2 206 ? 35.586  21.875  206.478 1.00 19.26  ? 207  GLN B OE1   1 
ATOM   4787  N  NE2   . GLN F 2 206 ? 34.553  20.874  208.197 1.00 27.91  ? 207  GLN B NE2   1 
ATOM   4788  N  N     . ILE F 2 207 ? 37.570  25.404  209.382 1.00 22.07  ? 208  ILE B N     1 
ATOM   4789  C  CA    . ILE F 2 207 ? 38.544  26.488  209.411 1.00 10.47  ? 208  ILE B CA    1 
ATOM   4790  C  C     . ILE F 2 207 ? 38.282  27.186  208.076 1.00 23.99  ? 208  ILE B C     1 
ATOM   4791  O  O     . ILE F 2 207 ? 38.172  26.507  207.059 1.00 20.04  ? 208  ILE B O     1 
ATOM   4792  C  CB    . ILE F 2 207 ? 40.001  25.974  209.356 1.00 22.46  ? 208  ILE B CB    1 
ATOM   4793  C  CG1   . ILE F 2 207 ? 40.491  25.581  210.746 1.00 20.54  ? 208  ILE B CG1   1 
ATOM   4794  C  CG2   . ILE F 2 207 ? 40.895  27.024  208.726 1.00 2.53   ? 208  ILE B CG2   1 
ATOM   4795  C  CD1   . ILE F 2 207 ? 40.418  26.704  211.738 1.00 42.91  ? 208  ILE B CD1   1 
ATOM   4796  N  N     . GLN F 2 208 ? 38.190  28.518  208.068 1.00 23.83  ? 209  GLN B N     1 
ATOM   4797  C  CA    . GLN F 2 208 ? 37.924  29.260  206.830 1.00 26.82  ? 209  GLN B CA    1 
ATOM   4798  C  C     . GLN F 2 208 ? 38.899  30.393  206.479 1.00 32.59  ? 209  GLN B C     1 
ATOM   4799  O  O     . GLN F 2 208 ? 39.249  31.211  207.330 1.00 38.93  ? 209  GLN B O     1 
ATOM   4800  C  CB    . GLN F 2 208 ? 36.515  29.856  206.861 1.00 25.56  ? 209  GLN B CB    1 
ATOM   4801  C  CG    . GLN F 2 208 ? 35.383  28.857  206.720 1.00 35.73  ? 209  GLN B CG    1 
ATOM   4802  C  CD    . GLN F 2 208 ? 34.004  29.516  206.790 1.00 36.22  ? 209  GLN B CD    1 
ATOM   4803  O  OE1   . GLN F 2 208 ? 33.629  30.090  207.803 1.00 41.39  ? 209  GLN B OE1   1 
ATOM   4804  N  NE2   . GLN F 2 208 ? 33.252  29.428  205.711 1.00 38.48  ? 209  GLN B NE2   1 
ATOM   4805  N  N     . PHE F 2 209 ? 39.321  30.436  205.214 1.00 30.98  ? 210  PHE B N     1 
ATOM   4806  C  CA    . PHE F 2 209 ? 40.205  31.483  204.699 1.00 23.01  ? 210  PHE B CA    1 
ATOM   4807  C  C     . PHE F 2 209 ? 40.388  31.322  203.189 1.00 24.75  ? 210  PHE B C     1 
ATOM   4808  O  O     . PHE F 2 209 ? 40.088  30.274  202.634 1.00 17.23  ? 210  PHE B O     1 
ATOM   4809  C  CB    . PHE F 2 209 ? 41.573  31.484  205.422 1.00 19.74  ? 210  PHE B CB    1 
ATOM   4810  C  CG    . PHE F 2 209 ? 42.364  30.196  205.297 1.00 17.28  ? 210  PHE B CG    1 
ATOM   4811  C  CD1   . PHE F 2 209 ? 42.831  29.758  204.064 1.00 17.97  ? 210  PHE B CD1   1 
ATOM   4812  C  CD2   . PHE F 2 209 ? 42.635  29.415  206.424 1.00 21.98  ? 210  PHE B CD2   1 
ATOM   4813  C  CE1   . PHE F 2 209 ? 43.550  28.558  203.949 1.00 12.52  ? 210  PHE B CE1   1 
ATOM   4814  C  CE2   . PHE F 2 209 ? 43.353  28.217  206.320 1.00 10.05  ? 210  PHE B CE2   1 
ATOM   4815  C  CZ    . PHE F 2 209 ? 43.807  27.785  205.079 1.00 1.00   ? 210  PHE B CZ    1 
ATOM   4816  N  N     . HIS F 2 210 ? 40.826  32.371  202.509 1.00 28.55  ? 211  HIS B N     1 
ATOM   4817  C  CA    . HIS F 2 210 ? 41.072  32.258  201.083 1.00 29.36  ? 211  HIS B CA    1 
ATOM   4818  C  C     . HIS F 2 210 ? 42.560  32.013  200.968 1.00 37.63  ? 211  HIS B C     1 
ATOM   4819  O  O     . HIS F 2 210 ? 43.353  32.787  201.509 1.00 36.40  ? 211  HIS B O     1 
ATOM   4820  C  CB    . HIS F 2 210 ? 40.720  33.543  200.358 1.00 34.27  ? 211  HIS B CB    1 
ATOM   4821  C  CG    . HIS F 2 210 ? 39.299  33.609  199.916 1.00 47.91  ? 211  HIS B CG    1 
ATOM   4822  N  ND1   . HIS F 2 210 ? 38.278  34.014  200.745 1.00 53.88  ? 211  HIS B ND1   1 
ATOM   4823  C  CD2   . HIS F 2 210 ? 38.718  33.282  198.734 1.00 49.56  ? 211  HIS B CD2   1 
ATOM   4824  C  CE1   . HIS F 2 210 ? 37.129  33.935  200.098 1.00 57.46  ? 211  HIS B CE1   1 
ATOM   4825  N  NE2   . HIS F 2 210 ? 37.371  33.493  198.875 1.00 51.58  ? 211  HIS B NE2   1 
ATOM   4826  N  N     . VAL F 2 211 ? 42.945  30.948  200.273 1.00 40.95  ? 212  VAL B N     1 
ATOM   4827  C  CA    . VAL F 2 211 ? 44.362  30.628  200.131 1.00 42.36  ? 212  VAL B CA    1 
ATOM   4828  C  C     . VAL F 2 211 ? 45.238  31.818  199.754 1.00 45.30  ? 212  VAL B C     1 
ATOM   4829  O  O     . VAL F 2 211 ? 46.292  32.037  200.354 1.00 48.07  ? 212  VAL B O     1 
ATOM   4830  C  CB    . VAL F 2 211 ? 44.600  29.554  199.092 1.00 35.01  ? 212  VAL B CB    1 
ATOM   4831  C  CG1   . VAL F 2 211 ? 46.041  29.082  199.197 1.00 31.41  ? 212  VAL B CG1   1 
ATOM   4832  C  CG2   . VAL F 2 211 ? 43.634  28.418  199.292 1.00 48.03  ? 212  VAL B CG2   1 
ATOM   4833  N  N     . ARG F 2 212 ? 44.798  32.578  198.756 1.00 46.07  ? 213  ARG B N     1 
ATOM   4834  C  CA    . ARG F 2 212 ? 45.540  33.744  198.297 1.00 40.54  ? 213  ARG B CA    1 
ATOM   4835  C  C     . ARG F 2 212 ? 45.744  34.773  199.405 1.00 42.15  ? 213  ARG B C     1 
ATOM   4836  O  O     . ARG F 2 212 ? 46.493  35.722  199.222 1.00 57.01  ? 213  ARG B O     1 
ATOM   4837  C  CB    . ARG F 2 212 ? 44.816  34.424  197.129 1.00 37.73  ? 213  ARG B CB    1 
ATOM   4838  C  CG    . ARG F 2 212 ? 43.469  35.024  197.526 1.00 53.35  ? 213  ARG B CG    1 
ATOM   4839  C  CD    . ARG F 2 212 ? 42.924  36.021  196.496 1.00 55.31  ? 213  ARG B CD    1 
ATOM   4840  N  NE    . ARG F 2 212 ? 42.832  35.475  195.145 1.00 55.47  ? 213  ARG B NE    1 
ATOM   4841  C  CZ    . ARG F 2 212 ? 42.362  36.148  194.099 1.00 52.44  ? 213  ARG B CZ    1 
ATOM   4842  N  NH1   . ARG F 2 212 ? 41.940  37.396  194.253 1.00 57.57  ? 213  ARG B NH1   1 
ATOM   4843  N  NH2   . ARG F 2 212 ? 42.317  35.576  192.901 1.00 43.94  ? 213  ARG B NH2   1 
ATOM   4844  N  N     . ASP F 2 213 ? 45.089  34.597  200.549 1.00 36.35  ? 214  ASP B N     1 
ATOM   4845  C  CA    . ASP F 2 213 ? 45.226  35.554  201.640 1.00 29.61  ? 214  ASP B CA    1 
ATOM   4846  C  C     . ASP F 2 213 ? 45.865  34.946  202.882 1.00 27.38  ? 214  ASP B C     1 
ATOM   4847  O  O     . ASP F 2 213 ? 46.127  35.645  203.855 1.00 38.60  ? 214  ASP B O     1 
ATOM   4848  C  CB    . ASP F 2 213 ? 43.848  36.138  202.014 1.00 26.21  ? 214  ASP B CB    1 
ATOM   4849  C  CG    . ASP F 2 213 ? 43.130  36.795  200.827 1.00 45.77  ? 214  ASP B CG    1 
ATOM   4850  O  OD1   . ASP F 2 213 ? 43.768  37.560  200.058 1.00 45.97  ? 214  ASP B OD1   1 
ATOM   4851  O  OD2   . ASP F 2 213 ? 41.910  36.569  200.671 1.00 45.68  ? 214  ASP B OD2   1 
ATOM   4852  N  N     . LEU F 2 214 ? 46.125  33.649  202.862 1.00 24.89  ? 215  LEU B N     1 
ATOM   4853  C  CA    . LEU F 2 214 ? 46.706  32.997  204.024 1.00 20.85  ? 215  LEU B CA    1 
ATOM   4854  C  C     . LEU F 2 214 ? 48.162  33.414  204.246 1.00 32.90  ? 215  LEU B C     1 
ATOM   4855  O  O     . LEU F 2 214 ? 48.970  33.468  203.309 1.00 32.33  ? 215  LEU B O     1 
ATOM   4856  C  CB    . LEU F 2 214 ? 46.609  31.473  203.852 1.00 5.78   ? 215  LEU B CB    1 
ATOM   4857  C  CG    . LEU F 2 214 ? 46.898  30.616  205.083 1.00 24.01  ? 215  LEU B CG    1 
ATOM   4858  C  CD1   . LEU F 2 214 ? 45.808  30.788  206.146 1.00 15.47  ? 215  LEU B CD1   1 
ATOM   4859  C  CD2   . LEU F 2 214 ? 46.994  29.181  204.654 1.00 23.56  ? 215  LEU B CD2   1 
ATOM   4860  N  N     . ASP F 2 215 ? 48.488  33.707  205.499 1.00 39.49  ? 216  ASP B N     1 
ATOM   4861  C  CA    . ASP F 2 215 ? 49.837  34.117  205.873 1.00 41.26  ? 216  ASP B CA    1 
ATOM   4862  C  C     . ASP F 2 215 ? 50.726  32.890  206.008 1.00 43.43  ? 216  ASP B C     1 
ATOM   4863  O  O     . ASP F 2 215 ? 50.286  31.851  206.497 1.00 53.83  ? 216  ASP B O     1 
ATOM   4864  C  CB    . ASP F 2 215 ? 49.786  34.893  207.190 1.00 40.95  ? 216  ASP B CB    1 
ATOM   4865  C  CG    . ASP F 2 215 ? 49.053  34.136  208.288 1.00 54.41  ? 216  ASP B CG    1 
ATOM   4866  O  OD1   . ASP F 2 215 ? 49.717  33.418  209.071 1.00 57.71  ? 216  ASP B OD1   1 
ATOM   4867  O  OD2   . ASP F 2 215 ? 47.808  34.256  208.364 1.00 54.23  ? 216  ASP B OD2   1 
ATOM   4868  N  N     . GLN F 2 216 ? 51.976  33.008  205.571 1.00 49.70  ? 217  GLN B N     1 
ATOM   4869  C  CA    . GLN F 2 216 ? 52.925  31.892  205.617 1.00 47.65  ? 217  GLN B CA    1 
ATOM   4870  C  C     . GLN F 2 216 ? 54.194  32.233  206.377 1.00 45.90  ? 217  GLN B C     1 
ATOM   4871  O  O     . GLN F 2 216 ? 55.278  32.065  205.839 1.00 49.94  ? 217  GLN B O     1 
ATOM   4872  C  CB    . GLN F 2 216 ? 53.322  31.491  204.191 1.00 42.98  ? 217  GLN B CB    1 
ATOM   4873  C  CG    . GLN F 2 216 ? 52.190  30.990  203.336 1.00 35.34  ? 217  GLN B CG    1 
ATOM   4874  C  CD    . GLN F 2 216 ? 51.983  29.505  203.473 1.00 38.86  ? 217  GLN B CD    1 
ATOM   4875  O  OE1   . GLN F 2 216 ? 52.669  28.710  202.827 1.00 31.92  ? 217  GLN B OE1   1 
ATOM   4876  N  NE2   . GLN F 2 216 ? 51.048  29.115  204.335 1.00 43.74  ? 217  GLN B NE2   1 
ATOM   4877  N  N     . GLY F 2 217 ? 54.089  32.685  207.621 1.00 53.61  ? 218  GLY B N     1 
ATOM   4878  C  CA    . GLY F 2 217 ? 55.311  33.039  208.320 1.00 52.98  ? 218  GLY B CA    1 
ATOM   4879  C  C     . GLY F 2 217 ? 55.564  32.477  209.700 1.00 54.20  ? 218  GLY B C     1 
ATOM   4880  O  O     . GLY F 2 217 ? 56.254  33.118  210.493 1.00 59.25  ? 218  GLY B O     1 
ATOM   4881  N  N     . PHE F 2 218 ? 55.024  31.296  209.993 1.00 49.19  ? 219  PHE B N     1 
ATOM   4882  C  CA    . PHE F 2 218 ? 55.225  30.677  211.296 1.00 48.73  ? 219  PHE B CA    1 
ATOM   4883  C  C     . PHE F 2 218 ? 56.688  30.265  211.389 1.00 55.36  ? 219  PHE B C     1 
ATOM   4884  O  O     . PHE F 2 218 ? 57.249  29.731  210.435 1.00 53.37  ? 219  PHE B O     1 
ATOM   4885  C  CB    . PHE F 2 218 ? 54.322  29.452  211.460 1.00 40.96  ? 219  PHE B CB    1 
ATOM   4886  C  CG    . PHE F 2 218 ? 54.360  28.850  212.841 1.00 30.08  ? 219  PHE B CG    1 
ATOM   4887  C  CD1   . PHE F 2 218 ? 53.833  29.540  213.934 1.00 25.12  ? 219  PHE B CD1   1 
ATOM   4888  C  CD2   . PHE F 2 218 ? 54.929  27.595  213.050 1.00 29.83  ? 219  PHE B CD2   1 
ATOM   4889  C  CE1   . PHE F 2 218 ? 53.869  28.991  215.220 1.00 21.27  ? 219  PHE B CE1   1 
ATOM   4890  C  CE2   . PHE F 2 218 ? 54.975  27.030  214.332 1.00 40.19  ? 219  PHE B CE2   1 
ATOM   4891  C  CZ    . PHE F 2 218 ? 54.442  27.731  215.421 1.00 35.93  ? 219  PHE B CZ    1 
ATOM   4892  N  N     . ASN F 2 219 ? 57.304  30.523  212.536 1.00 62.55  ? 220  ASN B N     1 
ATOM   4893  C  CA    . ASN F 2 219 ? 58.710  30.195  212.731 1.00 68.07  ? 220  ASN B CA    1 
ATOM   4894  C  C     . ASN F 2 219 ? 58.932  29.367  213.986 1.00 65.38  ? 220  ASN B C     1 
ATOM   4895  O  O     . ASN F 2 219 ? 59.812  29.670  214.795 1.00 69.22  ? 220  ASN B O     1 
ATOM   4896  C  CB    . ASN F 2 219 ? 59.541  31.479  212.813 1.00 74.06  ? 220  ASN B CB    1 
ATOM   4897  C  CG    . ASN F 2 219 ? 58.994  32.464  213.836 1.00 84.10  ? 220  ASN B CG    1 
ATOM   4898  O  OD1   . ASN F 2 219 ? 57.965  33.104  213.613 1.00 92.42  ? 220  ASN B OD1   1 
ATOM   4899  N  ND2   . ASN F 2 219 ? 59.676  32.581  214.969 1.00 89.79  ? 220  ASN B ND2   1 
ATOM   4900  N  N     . GLY F 2 220 ? 58.136  28.316  214.148 1.00 56.76  ? 221  GLY B N     1 
ATOM   4901  C  CA    . GLY F 2 220 ? 58.278  27.466  215.319 1.00 44.70  ? 221  GLY B CA    1 
ATOM   4902  C  C     . GLY F 2 220 ? 58.383  26.003  214.946 1.00 39.78  ? 221  GLY B C     1 
ATOM   4903  O  O     . GLY F 2 220 ? 58.557  25.652  213.775 1.00 29.39  ? 221  GLY B O     1 
ATOM   4904  N  N     . THR F 2 221 ? 58.289  25.138  215.945 1.00 40.65  ? 222  THR B N     1 
ATOM   4905  C  CA    . THR F 2 221 ? 58.356  23.709  215.681 1.00 46.39  ? 222  THR B CA    1 
ATOM   4906  C  C     . THR F 2 221 ? 56.959  23.185  215.414 1.00 50.18  ? 222  THR B C     1 
ATOM   4907  O  O     . THR F 2 221 ? 55.965  23.774  215.859 1.00 46.96  ? 222  THR B O     1 
ATOM   4908  C  CB    . THR F 2 221 ? 58.953  22.932  216.866 1.00 41.82  ? 222  THR B CB    1 
ATOM   4909  O  OG1   . THR F 2 221 ? 58.247  23.262  218.067 1.00 52.41  ? 222  THR B OG1   1 
ATOM   4910  C  CG2   . THR F 2 221 ? 60.420  23.272  217.023 1.00 48.99  ? 222  THR B CG2   1 
ATOM   4911  N  N     . ARG F 2 222 ? 56.875  22.087  214.672 1.00 48.00  ? 223  ARG B N     1 
ATOM   4912  C  CA    . ARG F 2 222 ? 55.573  21.515  214.376 1.00 39.41  ? 223  ARG B CA    1 
ATOM   4913  C  C     . ARG F 2 222 ? 54.889  21.238  215.705 1.00 38.04  ? 223  ARG B C     1 
ATOM   4914  O  O     . ARG F 2 222 ? 53.692  21.481  215.855 1.00 44.10  ? 223  ARG B O     1 
ATOM   4915  C  CB    . ARG F 2 222 ? 55.715  20.233  213.561 1.00 30.58  ? 223  ARG B CB    1 
ATOM   4916  C  CG    . ARG F 2 222 ? 54.413  19.777  212.922 1.00 34.16  ? 223  ARG B CG    1 
ATOM   4917  C  CD    . ARG F 2 222 ? 53.764  20.873  212.087 1.00 36.98  ? 223  ARG B CD    1 
ATOM   4918  N  NE    . ARG F 2 222 ? 54.491  21.164  210.855 1.00 44.62  ? 223  ARG B NE    1 
ATOM   4919  C  CZ    . ARG F 2 222 ? 54.341  20.489  209.719 1.00 34.45  ? 223  ARG B CZ    1 
ATOM   4920  N  NH1   . ARG F 2 222 ? 53.492  19.480  209.650 1.00 46.79  ? 223  ARG B NH1   1 
ATOM   4921  N  NH2   . ARG F 2 222 ? 55.034  20.821  208.642 1.00 37.65  ? 223  ARG B NH2   1 
ATOM   4922  N  N     . GLU F 2 223 ? 55.659  20.762  216.679 1.00 34.49  ? 224  GLU B N     1 
ATOM   4923  C  CA    . GLU F 2 223 ? 55.117  20.469  218.002 1.00 41.95  ? 224  GLU B CA    1 
ATOM   4924  C  C     . GLU F 2 223 ? 54.474  21.727  218.583 1.00 44.35  ? 224  GLU B C     1 
ATOM   4925  O  O     . GLU F 2 223 ? 53.439  21.664  219.249 1.00 36.59  ? 224  GLU B O     1 
ATOM   4926  C  CB    . GLU F 2 223 ? 56.234  19.966  218.924 1.00 53.74  ? 224  GLU B CB    1 
ATOM   4927  C  CG    . GLU F 2 223 ? 55.798  19.635  220.348 1.00 60.26  ? 224  GLU B CG    1 
ATOM   4928  C  CD    . GLU F 2 223 ? 56.932  19.043  221.171 1.00 69.70  ? 224  GLU B CD    1 
ATOM   4929  O  OE1   . GLU F 2 223 ? 56.861  19.099  222.420 1.00 76.23  ? 224  GLU B OE1   1 
ATOM   4930  O  OE2   . GLU F 2 223 ? 57.894  18.517  220.567 1.00 74.28  ? 224  GLU B OE2   1 
ATOM   4931  N  N     . GLU F 2 224 ? 55.094  22.874  218.316 1.00 45.61  ? 225  GLU B N     1 
ATOM   4932  C  CA    . GLU F 2 224 ? 54.579  24.147  218.797 1.00 44.61  ? 225  GLU B CA    1 
ATOM   4933  C  C     . GLU F 2 224 ? 53.275  24.501  218.085 1.00 43.44  ? 225  GLU B C     1 
ATOM   4934  O  O     . GLU F 2 224 ? 52.303  24.901  218.718 1.00 45.69  ? 225  GLU B O     1 
ATOM   4935  C  CB    . GLU F 2 224 ? 55.623  25.250  218.590 1.00 50.88  ? 225  GLU B CB    1 
ATOM   4936  C  CG    . GLU F 2 224 ? 56.640  25.363  219.722 1.00 59.19  ? 225  GLU B CG    1 
ATOM   4937  C  CD    . GLU F 2 224 ? 57.841  26.216  219.355 1.00 69.81  ? 225  GLU B CD    1 
ATOM   4938  O  OE1   . GLU F 2 224 ? 57.655  27.264  218.702 1.00 81.46  ? 225  GLU B OE1   1 
ATOM   4939  O  OE2   . GLU F 2 224 ? 58.971  25.844  219.730 1.00 68.47  ? 225  GLU B OE2   1 
ATOM   4940  N  N     . TRP F 2 225 ? 53.249  24.348  216.768 1.00 43.48  ? 226  TRP B N     1 
ATOM   4941  C  CA    . TRP F 2 225 ? 52.045  24.655  216.013 1.00 36.23  ? 226  TRP B CA    1 
ATOM   4942  C  C     . TRP F 2 225 ? 50.853  23.937  216.623 1.00 36.89  ? 226  TRP B C     1 
ATOM   4943  O  O     . TRP F 2 225 ? 49.809  24.537  216.861 1.00 36.25  ? 226  TRP B O     1 
ATOM   4944  C  CB    . TRP F 2 225 ? 52.194  24.208  214.574 1.00 25.41  ? 226  TRP B CB    1 
ATOM   4945  C  CG    . TRP F 2 225 ? 51.186  24.811  213.667 1.00 32.63  ? 226  TRP B CG    1 
ATOM   4946  C  CD1   . TRP F 2 225 ? 51.394  25.827  212.786 1.00 40.12  ? 226  TRP B CD1   1 
ATOM   4947  C  CD2   . TRP F 2 225 ? 49.832  24.386  213.472 1.00 34.93  ? 226  TRP B CD2   1 
ATOM   4948  N  NE1   . TRP F 2 225 ? 50.263  26.056  212.044 1.00 35.77  ? 226  TRP B NE1   1 
ATOM   4949  C  CE2   . TRP F 2 225 ? 49.285  25.185  212.448 1.00 35.43  ? 226  TRP B CE2   1 
ATOM   4950  C  CE3   . TRP F 2 225 ? 49.026  23.407  214.063 1.00 37.99  ? 226  TRP B CE3   1 
ATOM   4951  C  CZ2   . TRP F 2 225 ? 47.974  25.035  211.994 1.00 40.52  ? 226  TRP B CZ2   1 
ATOM   4952  C  CZ3   . TRP F 2 225 ? 47.717  23.256  213.612 1.00 50.69  ? 226  TRP B CZ3   1 
ATOM   4953  C  CH2   . TRP F 2 225 ? 47.206  24.068  212.588 1.00 45.92  ? 226  TRP B CH2   1 
ATOM   4954  N  N     . ALA F 2 226 ? 51.005  22.644  216.875 1.00 35.44  ? 227  ALA B N     1 
ATOM   4955  C  CA    . ALA F 2 226 ? 49.913  21.879  217.450 1.00 33.02  ? 227  ALA B CA    1 
ATOM   4956  C  C     . ALA F 2 226 ? 49.494  22.465  218.790 1.00 34.06  ? 227  ALA B C     1 
ATOM   4957  O  O     . ALA F 2 226 ? 48.345  22.877  218.950 1.00 47.31  ? 227  ALA B O     1 
ATOM   4958  C  CB    . ALA F 2 226 ? 50.313  20.423  217.606 1.00 29.68  ? 227  ALA B CB    1 
ATOM   4959  N  N     . LYS F 2 227 ? 50.419  22.508  219.748 1.00 34.44  ? 228  LYS B N     1 
ATOM   4960  C  CA    . LYS F 2 227 ? 50.125  23.048  221.074 1.00 36.54  ? 228  LYS B CA    1 
ATOM   4961  C  C     . LYS F 2 227 ? 49.366  24.365  220.978 1.00 36.05  ? 228  LYS B C     1 
ATOM   4962  O  O     . LYS F 2 227 ? 48.393  24.598  221.700 1.00 39.46  ? 228  LYS B O     1 
ATOM   4963  C  CB    . LYS F 2 227 ? 51.413  23.284  221.864 1.00 39.53  ? 228  LYS B CB    1 
ATOM   4964  C  CG    . LYS F 2 227 ? 52.222  22.031  222.097 1.00 56.75  ? 228  LYS B CG    1 
ATOM   4965  C  CD    . LYS F 2 227 ? 53.354  22.253  223.095 1.00 57.85  ? 228  LYS B CD    1 
ATOM   4966  C  CE    . LYS F 2 227 ? 54.142  20.965  223.289 1.00 55.61  ? 228  LYS B CE    1 
ATOM   4967  N  NZ    . LYS F 2 227 ? 53.264  19.832  223.702 1.00 41.13  ? 228  LYS B NZ    1 
ATOM   4968  N  N     . SER F 2 228 ? 49.816  25.221  220.073 1.00 29.33  ? 229  SER B N     1 
ATOM   4969  C  CA    . SER F 2 228 ? 49.194  26.511  219.890 1.00 31.46  ? 229  SER B CA    1 
ATOM   4970  C  C     . SER F 2 228 ? 47.772  26.354  219.373 1.00 33.22  ? 229  SER B C     1 
ATOM   4971  O  O     . SER F 2 228 ? 46.832  26.905  219.941 1.00 37.64  ? 229  SER B O     1 
ATOM   4972  C  CB    . SER F 2 228 ? 50.016  27.347  218.915 1.00 30.56  ? 229  SER B CB    1 
ATOM   4973  O  OG    . SER F 2 228 ? 49.648  28.712  219.001 1.00 49.83  ? 229  SER B OG    1 
ATOM   4974  N  N     . TYR F 2 229 ? 47.615  25.593  218.297 1.00 36.27  ? 230  TYR B N     1 
ATOM   4975  C  CA    . TYR F 2 229 ? 46.300  25.392  217.713 1.00 36.96  ? 230  TYR B CA    1 
ATOM   4976  C  C     . TYR F 2 229 ? 45.282  24.867  218.719 1.00 40.91  ? 230  TYR B C     1 
ATOM   4977  O  O     . TYR F 2 229 ? 44.121  25.280  218.687 1.00 32.10  ? 230  TYR B O     1 
ATOM   4978  C  CB    . TYR F 2 229 ? 46.358  24.433  216.522 1.00 35.15  ? 230  TYR B CB    1 
ATOM   4979  C  CG    . TYR F 2 229 ? 44.995  24.212  215.909 1.00 37.61  ? 230  TYR B CG    1 
ATOM   4980  C  CD1   . TYR F 2 229 ? 44.427  25.158  215.058 1.00 38.90  ? 230  TYR B CD1   1 
ATOM   4981  C  CD2   . TYR F 2 229 ? 44.237  23.094  216.241 1.00 32.47  ? 230  TYR B CD2   1 
ATOM   4982  C  CE1   . TYR F 2 229 ? 43.135  24.994  214.560 1.00 33.70  ? 230  TYR B CE1   1 
ATOM   4983  C  CE2   . TYR F 2 229 ? 42.950  22.922  215.749 1.00 29.54  ? 230  TYR B CE2   1 
ATOM   4984  C  CZ    . TYR F 2 229 ? 42.402  23.870  214.913 1.00 36.21  ? 230  TYR B CZ    1 
ATOM   4985  O  OH    . TYR F 2 229 ? 41.122  23.691  214.435 1.00 40.65  ? 230  TYR B OH    1 
ATOM   4986  N  N     . LEU F 2 230 ? 45.703  23.954  219.596 1.00 38.80  ? 231  LEU B N     1 
ATOM   4987  C  CA    . LEU F 2 230 ? 44.789  23.407  220.593 1.00 38.32  ? 231  LEU B CA    1 
ATOM   4988  C  C     . LEU F 2 230 ? 44.429  24.499  221.613 1.00 44.28  ? 231  LEU B C     1 
ATOM   4989  O  O     . LEU F 2 230 ? 43.330  24.512  222.180 1.00 48.83  ? 231  LEU B O     1 
ATOM   4990  C  CB    . LEU F 2 230 ? 45.401  22.188  221.318 1.00 40.63  ? 231  LEU B CB    1 
ATOM   4991  C  CG    . LEU F 2 230 ? 45.393  20.737  220.789 1.00 34.36  ? 231  LEU B CG    1 
ATOM   4992  C  CD1   . LEU F 2 230 ? 44.178  20.494  219.935 1.00 32.30  ? 231  LEU B CD1   1 
ATOM   4993  C  CD2   . LEU F 2 230 ? 46.653  20.463  219.991 1.00 31.03  ? 231  LEU B CD2   1 
ATOM   4994  N  N     . LYS F 2 231 ? 45.353  25.424  221.841 1.00 44.35  ? 232  LYS B N     1 
ATOM   4995  C  CA    . LYS F 2 231 ? 45.097  26.507  222.780 1.00 45.43  ? 232  LYS B CA    1 
ATOM   4996  C  C     . LYS F 2 231 ? 44.109  27.468  222.122 1.00 40.68  ? 232  LYS B C     1 
ATOM   4997  O  O     . LYS F 2 231 ? 43.196  27.970  222.770 1.00 42.45  ? 232  LYS B O     1 
ATOM   4998  C  CB    . LYS F 2 231 ? 46.402  27.230  223.130 1.00 52.96  ? 232  LYS B CB    1 
ATOM   4999  C  CG    . LYS F 2 231 ? 46.284  28.153  224.317 1.00 58.73  ? 232  LYS B CG    1 
ATOM   5000  C  CD    . LYS F 2 231 ? 47.621  28.748  224.702 1.00 64.66  ? 232  LYS B CD    1 
ATOM   5001  C  CE    . LYS F 2 231 ? 47.472  29.590  225.967 1.00 70.62  ? 232  LYS B CE    1 
ATOM   5002  N  NZ    . LYS F 2 231 ? 48.774  30.089  226.482 1.00 79.82  ? 232  LYS B NZ    1 
ATOM   5003  N  N     . HIS F 2 232 ? 44.288  27.708  220.827 1.00 32.34  ? 233  HIS B N     1 
ATOM   5004  C  CA    . HIS F 2 232 ? 43.395  28.587  220.080 1.00 37.72  ? 233  HIS B CA    1 
ATOM   5005  C  C     . HIS F 2 232 ? 42.028  27.921  219.879 1.00 41.21  ? 233  HIS B C     1 
ATOM   5006  O  O     . HIS F 2 232 ? 40.996  28.585  219.920 1.00 45.05  ? 233  HIS B O     1 
ATOM   5007  C  CB    . HIS F 2 232 ? 44.018  28.941  218.721 1.00 29.74  ? 233  HIS B CB    1 
ATOM   5008  C  CG    . HIS F 2 232 ? 43.079  29.633  217.787 1.00 37.25  ? 233  HIS B CG    1 
ATOM   5009  N  ND1   . HIS F 2 232 ? 42.400  30.783  218.132 1.00 51.51  ? 233  HIS B ND1   1 
ATOM   5010  C  CD2   . HIS F 2 232 ? 42.688  29.331  216.528 1.00 46.05  ? 233  HIS B CD2   1 
ATOM   5011  C  CE1   . HIS F 2 232 ? 41.632  31.157  217.126 1.00 48.00  ? 233  HIS B CE1   1 
ATOM   5012  N  NE2   . HIS F 2 232 ? 41.787  30.294  216.139 1.00 42.67  ? 233  HIS B NE2   1 
ATOM   5013  N  N     . PHE F 2 233 ? 42.046  26.609  219.651 1.00 44.80  ? 234  PHE B N     1 
ATOM   5014  C  CA    . PHE F 2 233 ? 40.843  25.797  219.448 1.00 40.04  ? 234  PHE B CA    1 
ATOM   5015  C  C     . PHE F 2 233 ? 40.018  25.741  220.719 1.00 49.05  ? 234  PHE B C     1 
ATOM   5016  O  O     . PHE F 2 233 ? 38.824  26.061  220.714 1.00 49.35  ? 234  PHE B O     1 
ATOM   5017  C  CB    . PHE F 2 233 ? 41.237  24.364  219.037 1.00 40.26  ? 234  PHE B CB    1 
ATOM   5018  C  CG    . PHE F 2 233 ? 40.069  23.427  218.876 1.00 34.13  ? 234  PHE B CG    1 
ATOM   5019  C  CD1   . PHE F 2 233 ? 39.594  22.686  219.958 1.00 41.46  ? 234  PHE B CD1   1 
ATOM   5020  C  CD2   . PHE F 2 233 ? 39.392  23.343  217.658 1.00 36.17  ? 234  PHE B CD2   1 
ATOM   5021  C  CE1   . PHE F 2 233 ? 38.454  21.882  219.833 1.00 27.94  ? 234  PHE B CE1   1 
ATOM   5022  C  CE2   . PHE F 2 233 ? 38.252  22.544  217.519 1.00 19.91  ? 234  PHE B CE2   1 
ATOM   5023  C  CZ    . PHE F 2 233 ? 37.782  21.816  218.607 1.00 26.94  ? 234  PHE B CZ    1 
ATOM   5024  N  N     . VAL F 2 234 ? 40.657  25.333  221.812 1.00 45.81  ? 235  VAL B N     1 
ATOM   5025  C  CA    . VAL F 2 234 ? 39.961  25.245  223.081 1.00 37.30  ? 235  VAL B CA    1 
ATOM   5026  C  C     . VAL F 2 234 ? 39.365  26.591  223.482 1.00 39.23  ? 235  VAL B C     1 
ATOM   5027  O  O     . VAL F 2 234 ? 38.275  26.648  224.049 1.00 45.28  ? 235  VAL B O     1 
ATOM   5028  C  CB    . VAL F 2 234 ? 40.885  24.758  224.182 1.00 32.14  ? 235  VAL B CB    1 
ATOM   5029  C  CG1   . VAL F 2 234 ? 40.139  24.798  225.510 1.00 34.32  ? 235  VAL B CG1   1 
ATOM   5030  C  CG2   . VAL F 2 234 ? 41.339  23.345  223.877 1.00 26.25  ? 235  VAL B CG2   1 
ATOM   5031  N  N     . THR F 2 235 ? 40.067  27.676  223.173 1.00 30.18  ? 236  THR B N     1 
ATOM   5032  C  CA    . THR F 2 235 ? 39.571  29.000  223.526 1.00 35.86  ? 236  THR B CA    1 
ATOM   5033  C  C     . THR F 2 235 ? 38.297  29.325  222.764 1.00 38.40  ? 236  THR B C     1 
ATOM   5034  O  O     . THR F 2 235 ? 37.239  29.535  223.363 1.00 32.59  ? 236  THR B O     1 
ATOM   5035  C  CB    . THR F 2 235 ? 40.623  30.103  223.242 1.00 39.05  ? 236  THR B CB    1 
ATOM   5036  O  OG1   . THR F 2 235 ? 41.738  29.951  224.131 1.00 43.82  ? 236  THR B OG1   1 
ATOM   5037  C  CG2   . THR F 2 235 ? 40.017  31.474  223.442 1.00 28.37  ? 236  THR B CG2   1 
ATOM   5038  N  N     . GLN F 2 236 ? 38.410  29.366  221.439 1.00 36.62  ? 237  GLN B N     1 
ATOM   5039  C  CA    . GLN F 2 236 ? 37.275  29.652  220.566 1.00 38.78  ? 237  GLN B CA    1 
ATOM   5040  C  C     . GLN F 2 236 ? 36.051  28.822  220.946 1.00 45.43  ? 237  GLN B C     1 
ATOM   5041  O  O     . GLN F 2 236 ? 34.919  29.301  220.877 1.00 42.59  ? 237  GLN B O     1 
ATOM   5042  C  CB    . GLN F 2 236 ? 37.647  29.354  219.122 1.00 39.62  ? 237  GLN B CB    1 
ATOM   5043  C  CG    . GLN F 2 236 ? 38.876  30.078  218.672 1.00 43.21  ? 237  GLN B CG    1 
ATOM   5044  C  CD    . GLN F 2 236 ? 38.845  31.522  219.080 1.00 52.31  ? 237  GLN B CD    1 
ATOM   5045  O  OE1   . GLN F 2 236 ? 37.826  32.191  218.912 1.00 48.28  ? 237  GLN B OE1   1 
ATOM   5046  N  NE2   . GLN F 2 236 ? 39.962  32.021  219.618 1.00 52.05  ? 237  GLN B NE2   1 
ATOM   5047  N  N     . ALA F 2 237 ? 36.289  27.574  221.342 1.00 41.62  ? 238  ALA B N     1 
ATOM   5048  C  CA    . ALA F 2 237 ? 35.207  26.699  221.735 1.00 42.47  ? 238  ALA B CA    1 
ATOM   5049  C  C     . ALA F 2 237 ? 34.459  27.302  222.920 1.00 51.04  ? 238  ALA B C     1 
ATOM   5050  O  O     . ALA F 2 237 ? 33.225  27.362  222.921 1.00 54.42  ? 238  ALA B O     1 
ATOM   5051  C  CB    . ALA F 2 237 ? 35.737  25.330  222.088 1.00 27.70  ? 238  ALA B CB    1 
ATOM   5052  N  N     . GLU F 2 238 ? 35.197  27.762  223.928 1.00 52.98  ? 239  GLU B N     1 
ATOM   5053  C  CA    . GLU F 2 238 ? 34.556  28.358  225.097 1.00 53.06  ? 239  GLU B CA    1 
ATOM   5054  C  C     . GLU F 2 238 ? 33.787  29.608  224.668 1.00 53.13  ? 239  GLU B C     1 
ATOM   5055  O  O     . GLU F 2 238 ? 32.630  29.808  225.055 1.00 52.25  ? 239  GLU B O     1 
ATOM   5056  C  CB    . GLU F 2 238 ? 35.595  28.707  226.176 1.00 45.95  ? 239  GLU B CB    1 
ATOM   5057  C  CG    . GLU F 2 238 ? 36.364  27.498  226.718 1.00 52.50  ? 239  GLU B CG    1 
ATOM   5058  C  CD    . GLU F 2 238 ? 37.397  27.859  227.792 1.00 65.44  ? 239  GLU B CD    1 
ATOM   5059  O  OE1   . GLU F 2 238 ? 38.370  28.588  227.491 1.00 59.47  ? 239  GLU B OE1   1 
ATOM   5060  O  OE2   . GLU F 2 238 ? 37.236  27.411  228.948 1.00 74.15  ? 239  GLU B OE2   1 
ATOM   5061  N  N     . GLN F 2 239 ? 34.416  30.434  223.839 1.00 49.46  ? 240  GLN B N     1 
ATOM   5062  C  CA    . GLN F 2 239 ? 33.770  31.658  223.378 1.00 45.68  ? 240  GLN B CA    1 
ATOM   5063  C  C     . GLN F 2 239 ? 32.489  31.383  222.585 1.00 43.45  ? 240  GLN B C     1 
ATOM   5064  O  O     . GLN F 2 239 ? 31.546  32.166  222.631 1.00 46.34  ? 240  GLN B O     1 
ATOM   5065  C  CB    . GLN F 2 239 ? 34.747  32.483  222.538 1.00 44.87  ? 240  GLN B CB    1 
ATOM   5066  N  N     . ARG F 2 240 ? 32.453  30.268  221.866 1.00 40.82  ? 241  ARG B N     1 
ATOM   5067  C  CA    . ARG F 2 240 ? 31.277  29.914  221.085 1.00 41.17  ? 241  ARG B CA    1 
ATOM   5068  C  C     . ARG F 2 240 ? 30.108  29.539  222.019 1.00 40.95  ? 241  ARG B C     1 
ATOM   5069  O  O     . ARG F 2 240 ? 28.951  29.872  221.760 1.00 26.64  ? 241  ARG B O     1 
ATOM   5070  C  CB    . ARG F 2 240 ? 31.610  28.742  220.149 1.00 42.67  ? 241  ARG B CB    1 
ATOM   5071  C  CG    . ARG F 2 240 ? 30.457  28.280  219.274 1.00 34.51  ? 241  ARG B CG    1 
ATOM   5072  C  CD    . ARG F 2 240 ? 30.066  29.361  218.312 1.00 23.63  ? 241  ARG B CD    1 
ATOM   5073  N  NE    . ARG F 2 240 ? 28.848  29.031  217.589 1.00 30.69  ? 241  ARG B NE    1 
ATOM   5074  C  CZ    . ARG F 2 240 ? 28.373  29.758  216.585 1.00 39.01  ? 241  ARG B CZ    1 
ATOM   5075  N  NH1   . ARG F 2 240 ? 29.026  30.850  216.201 1.00 39.61  ? 241  ARG B NH1   1 
ATOM   5076  N  NH2   . ARG F 2 240 ? 27.254  29.398  215.966 1.00 25.50  ? 241  ARG B NH2   1 
ATOM   5077  N  N     . ALA F 2 241 ? 30.418  28.849  223.111 1.00 39.58  ? 242  ALA B N     1 
ATOM   5078  C  CA    . ALA F 2 241 ? 29.393  28.450  224.063 1.00 35.44  ? 242  ALA B CA    1 
ATOM   5079  C  C     . ALA F 2 241 ? 28.697  29.683  224.619 1.00 38.08  ? 242  ALA B C     1 
ATOM   5080  O  O     . ALA F 2 241 ? 27.490  29.669  224.856 1.00 43.81  ? 242  ALA B O     1 
ATOM   5081  C  CB    . ALA F 2 241 ? 30.010  27.648  225.190 1.00 38.70  ? 242  ALA B CB    1 
ATOM   5082  N  N     . ILE F 2 242 ? 29.461  30.750  224.831 1.00 39.42  ? 243  ILE B N     1 
ATOM   5083  C  CA    . ILE F 2 242 ? 28.892  31.985  225.353 1.00 38.93  ? 243  ILE B CA    1 
ATOM   5084  C  C     . ILE F 2 242 ? 28.159  32.761  224.269 1.00 42.12  ? 243  ILE B C     1 
ATOM   5085  O  O     . ILE F 2 242 ? 27.074  33.291  224.507 1.00 46.64  ? 243  ILE B O     1 
ATOM   5086  C  CB    . ILE F 2 242 ? 29.963  32.904  225.942 1.00 40.54  ? 243  ILE B CB    1 
ATOM   5087  C  CG1   . ILE F 2 242 ? 30.665  32.213  227.114 1.00 51.04  ? 243  ILE B CG1   1 
ATOM   5088  C  CG2   . ILE F 2 242 ? 29.315  34.199  226.401 1.00 43.78  ? 243  ILE B CG2   1 
ATOM   5089  C  CD1   . ILE F 2 242 ? 31.871  32.980  227.641 1.00 50.21  ? 243  ILE B CD1   1 
ATOM   5090  N  N     . SER F 2 243 ? 28.745  32.833  223.078 1.00 34.54  ? 244  SER B N     1 
ATOM   5091  C  CA    . SER F 2 243 ? 28.114  33.568  221.989 1.00 37.11  ? 244  SER B CA    1 
ATOM   5092  C  C     . SER F 2 243 ? 26.756  32.973  221.640 1.00 39.43  ? 244  SER B C     1 
ATOM   5093  O  O     . SER F 2 243 ? 25.822  33.699  221.305 1.00 43.10  ? 244  SER B O     1 
ATOM   5094  C  CB    . SER F 2 243 ? 28.999  33.560  220.744 1.00 37.69  ? 244  SER B CB    1 
ATOM   5095  O  OG    . SER F 2 243 ? 29.030  32.279  220.152 1.00 51.74  ? 244  SER B OG    1 
ATOM   5096  N  N     . MET F 2 244 ? 26.651  31.649  221.721 1.00 41.76  ? 245  MET B N     1 
ATOM   5097  C  CA    . MET F 2 244 ? 25.405  30.966  221.408 1.00 41.29  ? 245  MET B CA    1 
ATOM   5098  C  C     . MET F 2 244 ? 24.266  31.470  222.268 1.00 44.98  ? 245  MET B C     1 
ATOM   5099  O  O     . MET F 2 244 ? 23.216  31.868  221.764 1.00 49.35  ? 245  MET B O     1 
ATOM   5100  C  CB    . MET F 2 244 ? 25.545  29.463  221.615 1.00 38.15  ? 245  MET B CB    1 
ATOM   5101  C  CG    . MET F 2 244 ? 26.470  28.789  220.634 1.00 42.44  ? 245  MET B CG    1 
ATOM   5102  S  SD    . MET F 2 244 ? 26.253  27.010  220.658 1.00 47.07  ? 245  MET B SD    1 
ATOM   5103  C  CE    . MET F 2 244 ? 26.459  26.652  218.915 1.00 39.93  ? 245  MET B CE    1 
ATOM   5104  N  N     . ILE F 2 245 ? 24.473  31.435  223.574 1.00 37.18  ? 246  ILE B N     1 
ATOM   5105  C  CA    . ILE F 2 245 ? 23.459  31.891  224.496 1.00 40.84  ? 246  ILE B CA    1 
ATOM   5106  C  C     . ILE F 2 245 ? 22.962  33.295  224.161 1.00 44.56  ? 246  ILE B C     1 
ATOM   5107  O  O     . ILE F 2 245 ? 21.758  33.524  224.066 1.00 45.20  ? 246  ILE B O     1 
ATOM   5108  C  CB    . ILE F 2 245 ? 23.999  31.899  225.928 1.00 42.52  ? 246  ILE B CB    1 
ATOM   5109  C  CG1   . ILE F 2 245 ? 24.332  30.474  226.362 1.00 33.42  ? 246  ILE B CG1   1 
ATOM   5110  C  CG2   . ILE F 2 245 ? 22.983  32.531  226.852 1.00 38.86  ? 246  ILE B CG2   1 
ATOM   5111  C  CD1   . ILE F 2 245 ? 24.901  30.392  227.740 1.00 40.33  ? 246  ILE B CD1   1 
ATOM   5112  N  N     . ASP F 2 246 ? 23.894  34.229  223.984 1.00 43.63  ? 247  ASP B N     1 
ATOM   5113  C  CA    . ASP F 2 246 ? 23.554  35.617  223.683 1.00 50.83  ? 247  ASP B CA    1 
ATOM   5114  C  C     . ASP F 2 246 ? 23.047  35.821  222.259 1.00 52.51  ? 247  ASP B C     1 
ATOM   5115  O  O     . ASP F 2 246 ? 22.705  36.937  221.864 1.00 53.81  ? 247  ASP B O     1 
ATOM   5116  C  CB    . ASP F 2 246 ? 24.769  36.532  223.926 1.00 62.99  ? 247  ASP B CB    1 
ATOM   5117  C  CG    . ASP F 2 246 ? 25.190  36.592  225.399 1.00 74.49  ? 247  ASP B CG    1 
ATOM   5118  O  OD1   . ASP F 2 246 ? 24.365  36.993  226.257 1.00 66.18  ? 247  ASP B OD1   1 
ATOM   5119  O  OD2   . ASP F 2 246 ? 26.357  36.246  225.697 1.00 85.81  ? 247  ASP B OD2   1 
ATOM   5120  N  N     . LYS F 2 247 ? 22.994  34.755  221.474 1.00 53.33  ? 248  LYS B N     1 
ATOM   5121  C  CA    . LYS F 2 247 ? 22.516  34.910  220.112 1.00 53.60  ? 248  LYS B CA    1 
ATOM   5122  C  C     . LYS F 2 247 ? 21.396  33.941  219.740 1.00 57.97  ? 248  LYS B C     1 
ATOM   5123  O  O     . LYS F 2 247 ? 20.650  34.189  218.792 1.00 61.20  ? 248  LYS B O     1 
ATOM   5124  C  CB    . LYS F 2 247 ? 23.688  34.782  219.141 1.00 46.47  ? 248  LYS B CB    1 
ATOM   5125  C  CG    . LYS F 2 247 ? 23.344  35.083  217.699 1.00 32.51  ? 248  LYS B CG    1 
ATOM   5126  C  CD    . LYS F 2 247 ? 24.601  35.387  216.930 1.00 37.35  ? 248  LYS B CD    1 
ATOM   5127  C  CE    . LYS F 2 247 ? 24.319  35.569  215.456 1.00 45.71  ? 248  LYS B CE    1 
ATOM   5128  N  NZ    . LYS F 2 247 ? 25.559  35.957  214.713 1.00 55.52  ? 248  LYS B NZ    1 
ATOM   5129  N  N     . PHE F 2 248 ? 21.269  32.848  220.491 1.00 55.64  ? 249  PHE B N     1 
ATOM   5130  C  CA    . PHE F 2 248 ? 20.232  31.858  220.219 1.00 54.46  ? 249  PHE B CA    1 
ATOM   5131  C  C     . PHE F 2 248 ? 19.413  31.558  221.453 1.00 61.97  ? 249  PHE B C     1 
ATOM   5132  O  O     . PHE F 2 248 ? 18.669  30.578  221.483 1.00 66.51  ? 249  PHE B O     1 
ATOM   5133  C  CB    . PHE F 2 248 ? 20.850  30.552  219.736 1.00 45.36  ? 249  PHE B CB    1 
ATOM   5134  C  CG    . PHE F 2 248 ? 21.871  30.731  218.667 1.00 43.02  ? 249  PHE B CG    1 
ATOM   5135  C  CD1   . PHE F 2 248 ? 21.556  31.409  217.492 1.00 45.20  ? 249  PHE B CD1   1 
ATOM   5136  C  CD2   . PHE F 2 248 ? 23.145  30.219  218.824 1.00 38.84  ? 249  PHE B CD2   1 
ATOM   5137  C  CE1   . PHE F 2 248 ? 22.497  31.574  216.489 1.00 33.68  ? 249  PHE B CE1   1 
ATOM   5138  C  CE2   . PHE F 2 248 ? 24.091  30.379  217.827 1.00 51.78  ? 249  PHE B CE2   1 
ATOM   5139  C  CZ    . PHE F 2 248 ? 23.762  31.059  216.654 1.00 41.81  ? 249  PHE B CZ    1 
ATOM   5140  N  N     . VAL F 2 249 ? 19.553  32.390  222.477 1.00 69.02  ? 250  VAL B N     1 
ATOM   5141  C  CA    . VAL F 2 249 ? 18.811  32.174  223.710 1.00 69.19  ? 250  VAL B CA    1 
ATOM   5142  C  C     . VAL F 2 249 ? 18.127  33.435  224.243 1.00 68.34  ? 250  VAL B C     1 
ATOM   5143  O  O     . VAL F 2 249 ? 16.902  33.480  224.358 1.00 65.21  ? 250  VAL B O     1 
ATOM   5144  C  CB    . VAL F 2 249 ? 19.735  31.602  224.799 1.00 66.78  ? 250  VAL B CB    1 
ATOM   5145  C  CG1   . VAL F 2 249 ? 18.919  31.229  226.019 1.00 79.94  ? 250  VAL B CG1   1 
ATOM   5146  C  CG2   . VAL F 2 249 ? 20.482  30.389  224.265 1.00 68.78  ? 250  VAL B CG2   1 
ATOM   5147  N  N     . LYS F 2 250 ? 18.924  34.452  224.563 1.00 69.34  ? 251  LYS B N     1 
ATOM   5148  C  CA    . LYS F 2 250 ? 18.412  35.711  225.102 1.00 68.61  ? 251  LYS B CA    1 
ATOM   5149  C  C     . LYS F 2 250 ? 17.412  36.405  224.187 1.00 65.52  ? 251  LYS B C     1 
ATOM   5150  O  O     . LYS F 2 250 ? 16.344  36.837  224.619 1.00 70.51  ? 251  LYS B O     1 
ATOM   5151  C  CB    . LYS F 2 250 ? 19.568  36.677  225.380 1.00 68.80  ? 251  LYS B CB    1 
ATOM   5152  N  N     . PRO F 2 251 ? 17.753  36.537  222.907 1.00 57.64  ? 252  PRO B N     1 
ATOM   5153  C  CA    . PRO F 2 251 ? 16.839  37.198  221.980 1.00 57.74  ? 252  PRO B CA    1 
ATOM   5154  C  C     . PRO F 2 251 ? 15.588  36.388  221.660 1.00 55.29  ? 252  PRO B C     1 
ATOM   5155  O  O     . PRO F 2 251 ? 14.727  36.849  220.915 1.00 57.28  ? 252  PRO B O     1 
ATOM   5156  C  CB    . PRO F 2 251 ? 17.713  37.437  220.754 1.00 63.35  ? 252  PRO B CB    1 
ATOM   5157  C  CG    . PRO F 2 251 ? 18.626  36.247  220.775 1.00 65.90  ? 252  PRO B CG    1 
ATOM   5158  C  CD    . PRO F 2 251 ? 19.000  36.138  222.235 1.00 56.24  ? 252  PRO B CD    1 
ATOM   5159  N  N     . PHE F 2 252 ? 15.480  35.190  222.226 1.00 48.11  ? 253  PHE B N     1 
ATOM   5160  C  CA    . PHE F 2 252 ? 14.318  34.351  221.968 1.00 39.70  ? 253  PHE B CA    1 
ATOM   5161  C  C     . PHE F 2 252 ? 13.552  33.970  223.209 1.00 49.59  ? 253  PHE B C     1 
ATOM   5162  O  O     . PHE F 2 252 ? 12.456  33.418  223.111 1.00 58.34  ? 253  PHE B O     1 
ATOM   5163  C  CB    . PHE F 2 252 ? 14.730  33.075  221.241 1.00 31.60  ? 253  PHE B CB    1 
ATOM   5164  C  CG    . PHE F 2 252 ? 15.117  33.301  219.810 1.00 40.34  ? 253  PHE B CG    1 
ATOM   5165  C  CD1   . PHE F 2 252 ? 16.441  33.130  219.394 1.00 30.21  ? 253  PHE B CD1   1 
ATOM   5166  C  CD2   . PHE F 2 252 ? 14.154  33.699  218.872 1.00 34.28  ? 253  PHE B CD2   1 
ATOM   5167  C  CE1   . PHE F 2 252 ? 16.797  33.351  218.073 1.00 37.06  ? 253  PHE B CE1   1 
ATOM   5168  C  CE2   . PHE F 2 252 ? 14.496  33.924  217.547 1.00 26.41  ? 253  PHE B CE2   1 
ATOM   5169  C  CZ    . PHE F 2 252 ? 15.819  33.751  217.141 1.00 42.04  ? 253  PHE B CZ    1 
ATOM   5170  N  N     . LYS F 2 253 ? 14.120  34.265  224.376 1.00 51.62  ? 254  LYS B N     1 
ATOM   5171  C  CA    . LYS F 2 253 ? 13.477  33.913  225.639 1.00 47.19  ? 254  LYS B CA    1 
ATOM   5172  C  C     . LYS F 2 253 ? 12.134  34.598  225.929 1.00 44.07  ? 254  LYS B C     1 
ATOM   5173  O  O     . LYS F 2 253 ? 11.343  34.078  226.710 1.00 40.02  ? 254  LYS B O     1 
ATOM   5174  C  CB    . LYS F 2 253 ? 14.449  34.132  226.801 1.00 49.78  ? 254  LYS B CB    1 
ATOM   5175  C  CG    . LYS F 2 253 ? 15.250  32.895  227.169 1.00 48.88  ? 254  LYS B CG    1 
ATOM   5176  C  CD    . LYS F 2 253 ? 15.840  33.016  228.574 1.00 58.26  ? 254  LYS B CD    1 
ATOM   5177  C  CE    . LYS F 2 253 ? 16.497  31.713  229.020 1.00 64.91  ? 254  LYS B CE    1 
ATOM   5178  N  NZ    . LYS F 2 253 ? 15.567  30.554  228.890 1.00 59.10  ? 254  LYS B NZ    1 
ATOM   5179  N  N     . LYS F 2 254 ? 11.877  35.749  225.307 1.00 40.82  ? 255  LYS B N     1 
ATOM   5180  C  CA    . LYS F 2 254 ? 10.613  36.457  225.506 1.00 45.04  ? 255  LYS B CA    1 
ATOM   5181  C  C     . LYS F 2 254 ? 9.459   35.573  225.043 1.00 53.31  ? 255  LYS B C     1 
ATOM   5182  O  O     . LYS F 2 254 ? 8.296   35.835  225.343 1.00 61.91  ? 255  LYS B O     1 
ATOM   5183  C  CB    . LYS F 2 254 ? 10.593  37.774  224.721 1.00 34.25  ? 255  LYS B CB    1 
ATOM   5184  C  CG    . LYS F 2 254 ? 10.866  37.611  223.226 1.00 43.12  ? 255  LYS B CG    1 
ATOM   5185  C  CD    . LYS F 2 254 ? 10.542  38.866  222.435 1.00 24.05  ? 255  LYS B CD    1 
ATOM   5186  C  CE    . LYS F 2 254 ? 11.330  40.047  222.920 1.00 30.86  ? 255  LYS B CE    1 
ATOM   5187  N  NZ    . LYS F 2 254 ? 12.789  39.752  222.844 1.00 53.36  ? 255  LYS B NZ    1 
ATOM   5188  N  N     . TYR F 2 255 ? 9.789   34.528  224.297 1.00 61.41  ? 256  TYR B N     1 
ATOM   5189  C  CA    . TYR F 2 255 ? 8.788   33.594  223.793 1.00 64.66  ? 256  TYR B CA    1 
ATOM   5190  C  C     . TYR F 2 255 ? 8.889   32.302  224.618 1.00 68.72  ? 256  TYR B C     1 
ATOM   5191  O  O     . TYR F 2 255 ? 9.946   31.672  224.675 1.00 71.41  ? 256  TYR B O     1 
ATOM   5192  C  CB    . TYR F 2 255 ? 9.059   33.281  222.310 1.00 60.37  ? 256  TYR B CB    1 
ATOM   5193  C  CG    . TYR F 2 255 ? 9.271   34.486  221.400 1.00 56.06  ? 256  TYR B CG    1 
ATOM   5194  C  CD1   . TYR F 2 255 ? 8.189   35.156  220.820 1.00 48.33  ? 256  TYR B CD1   1 
ATOM   5195  C  CD2   . TYR F 2 255 ? 10.559  34.938  221.097 1.00 46.55  ? 256  TYR B CD2   1 
ATOM   5196  C  CE1   . TYR F 2 255 ? 8.386   36.241  219.957 1.00 37.41  ? 256  TYR B CE1   1 
ATOM   5197  C  CE2   . TYR F 2 255 ? 10.764  36.023  220.236 1.00 34.73  ? 256  TYR B CE2   1 
ATOM   5198  C  CZ    . TYR F 2 255 ? 9.675   36.666  219.672 1.00 36.10  ? 256  TYR B CZ    1 
ATOM   5199  O  OH    . TYR F 2 255 ? 9.874   37.735  218.830 1.00 38.25  ? 256  TYR B OH    1 
ATOM   5200  N  N     . ILE F 2 256 ? 7.800   31.913  225.267 1.00 72.68  ? 257  ILE B N     1 
ATOM   5201  C  CA    . ILE F 2 256 ? 7.796   30.691  226.066 1.00 75.44  ? 257  ILE B CA    1 
ATOM   5202  C  C     . ILE F 2 256 ? 6.392   30.106  226.181 1.00 80.60  ? 257  ILE B C     1 
ATOM   5203  O  O     . ILE F 2 256 ? 6.180   29.038  225.570 1.00 83.75  ? 257  ILE B O     1 
ATOM   5204  C  CB    . ILE F 2 256 ? 8.343   30.931  227.499 1.00 71.36  ? 257  ILE B CB    1 
ATOM   5205  C  CG1   . ILE F 2 256 ? 7.686   32.173  228.103 1.00 67.70  ? 257  ILE B CG1   1 
ATOM   5206  C  CG2   . ILE F 2 256 ? 9.862   31.034  227.466 1.00 60.62  ? 257  ILE B CG2   1 
ATOM   5207  C  CD1   . ILE F 2 256 ? 7.909   32.329  229.592 1.00 71.15  ? 257  ILE B CD1   1 
ATOM   5208  N  N     . SER G 2 1   ? 51.618  -15.451 233.658 1.00 82.15  ? 2    SER C N     1 
ATOM   5209  C  CA    . SER G 2 1   ? 50.736  -16.340 232.847 1.00 90.18  ? 2    SER C CA    1 
ATOM   5210  C  C     . SER G 2 1   ? 51.362  -17.710 232.584 1.00 95.74  ? 2    SER C C     1 
ATOM   5211  O  O     . SER G 2 1   ? 52.255  -17.837 231.748 1.00 98.29  ? 2    SER C O     1 
ATOM   5212  C  CB    . SER G 2 1   ? 50.414  -15.674 231.511 1.00 87.11  ? 2    SER C CB    1 
ATOM   5213  O  OG    . SER G 2 1   ? 49.724  -16.573 230.662 1.00 89.73  ? 2    SER C OG    1 
ATOM   5214  N  N     . PHE G 2 2   ? 50.881  -18.734 233.285 1.00 102.27 ? 3    PHE C N     1 
ATOM   5215  C  CA    . PHE G 2 2   ? 51.403  -20.091 233.127 1.00 111.48 ? 3    PHE C CA    1 
ATOM   5216  C  C     . PHE G 2 2   ? 50.979  -20.713 231.805 1.00 112.69 ? 3    PHE C C     1 
ATOM   5217  O  O     . PHE G 2 2   ? 51.501  -21.751 231.397 1.00 110.62 ? 3    PHE C O     1 
ATOM   5218  C  CB    . PHE G 2 2   ? 50.924  -20.989 234.272 1.00 122.76 ? 3    PHE C CB    1 
ATOM   5219  C  CG    . PHE G 2 2   ? 51.281  -20.477 235.637 1.00 134.68 ? 3    PHE C CG    1 
ATOM   5220  C  CD1   . PHE G 2 2   ? 50.659  -19.346 236.156 1.00 141.31 ? 3    PHE C CD1   1 
ATOM   5221  C  CD2   . PHE G 2 2   ? 52.248  -21.120 236.403 1.00 139.65 ? 3    PHE C CD2   1 
ATOM   5222  C  CE1   . PHE G 2 2   ? 50.993  -18.860 237.419 1.00 145.70 ? 3    PHE C CE1   1 
ATOM   5223  C  CE2   . PHE G 2 2   ? 52.590  -20.643 237.668 1.00 145.41 ? 3    PHE C CE2   1 
ATOM   5224  C  CZ    . PHE G 2 2   ? 51.961  -19.510 238.176 1.00 146.09 ? 3    PHE C CZ    1 
ATOM   5225  N  N     . ILE G 2 3   ? 50.025  -20.071 231.144 1.00 116.97 ? 4    ILE C N     1 
ATOM   5226  C  CA    . ILE G 2 3   ? 49.515  -20.552 229.870 1.00 120.30 ? 4    ILE C CA    1 
ATOM   5227  C  C     . ILE G 2 3   ? 50.271  -19.920 228.708 1.00 118.00 ? 4    ILE C C     1 
ATOM   5228  O  O     . ILE G 2 3   ? 50.531  -20.578 227.701 1.00 117.51 ? 4    ILE C O     1 
ATOM   5229  C  CB    . ILE G 2 3   ? 48.011  -20.235 229.737 1.00 124.30 ? 4    ILE C CB    1 
ATOM   5230  C  CG1   . ILE G 2 3   ? 47.232  -20.959 230.836 1.00 125.90 ? 4    ILE C CG1   1 
ATOM   5231  C  CG2   . ILE G 2 3   ? 47.503  -20.657 228.370 1.00 130.96 ? 4    ILE C CG2   1 
ATOM   5232  C  CD1   . ILE G 2 3   ? 47.362  -22.472 230.788 1.00 126.37 ? 4    ILE C CD1   1 
ATOM   5233  N  N     . LYS G 2 4   ? 50.624  -18.646 228.858 1.00 116.89 ? 5    LYS C N     1 
ATOM   5234  C  CA    . LYS G 2 4   ? 51.355  -17.919 227.824 1.00 115.78 ? 5    LYS C CA    1 
ATOM   5235  C  C     . LYS G 2 4   ? 52.375  -18.814 227.128 1.00 117.21 ? 5    LYS C C     1 
ATOM   5236  O  O     . LYS G 2 4   ? 52.419  -18.870 225.901 1.00 115.67 ? 5    LYS C O     1 
ATOM   5237  C  CB    . LYS G 2 4   ? 52.075  -16.709 228.428 1.00 113.83 ? 5    LYS C CB    1 
ATOM   5238  C  CG    . LYS G 2 4   ? 52.903  -15.921 227.425 1.00 108.02 ? 5    LYS C CG    1 
ATOM   5239  C  CD    . LYS G 2 4   ? 52.022  -15.113 226.489 1.00 98.74  ? 5    LYS C CD    1 
ATOM   5240  C  CE    . LYS G 2 4   ? 51.332  -14.000 227.248 1.00 93.66  ? 5    LYS C CE    1 
ATOM   5241  N  NZ    . LYS G 2 4   ? 52.329  -13.105 227.897 1.00 84.48  ? 5    LYS C NZ    1 
ATOM   5242  N  N     . PRO G 2 5   ? 53.209  -19.530 227.906 1.00 118.57 ? 6    PRO C N     1 
ATOM   5243  C  CA    . PRO G 2 5   ? 54.223  -20.417 227.335 1.00 119.99 ? 6    PRO C CA    1 
ATOM   5244  C  C     . PRO G 2 5   ? 53.688  -21.428 226.320 1.00 119.25 ? 6    PRO C C     1 
ATOM   5245  O  O     . PRO G 2 5   ? 54.192  -21.509 225.198 1.00 124.19 ? 6    PRO C O     1 
ATOM   5246  C  CB    . PRO G 2 5   ? 54.818  -21.087 228.568 1.00 120.78 ? 6    PRO C CB    1 
ATOM   5247  C  CG    . PRO G 2 5   ? 54.745  -20.003 229.586 1.00 118.92 ? 6    PRO C CG    1 
ATOM   5248  C  CD    . PRO G 2 5   ? 53.345  -19.480 229.373 1.00 119.72 ? 6    PRO C CD    1 
ATOM   5249  N  N     . ILE G 2 6   ? 52.676  -22.197 226.705 1.00 115.72 ? 7    ILE C N     1 
ATOM   5250  C  CA    . ILE G 2 6   ? 52.113  -23.192 225.800 1.00 117.36 ? 7    ILE C CA    1 
ATOM   5251  C  C     . ILE G 2 6   ? 50.946  -22.664 224.966 1.00 122.24 ? 7    ILE C C     1 
ATOM   5252  O  O     . ILE G 2 6   ? 50.147  -23.441 224.439 1.00 119.25 ? 7    ILE C O     1 
ATOM   5253  C  CB    . ILE G 2 6   ? 51.645  -24.452 226.562 1.00 111.97 ? 7    ILE C CB    1 
ATOM   5254  C  CG1   . ILE G 2 6   ? 50.721  -24.051 227.711 1.00 106.06 ? 7    ILE C CG1   1 
ATOM   5255  C  CG2   . ILE G 2 6   ? 52.847  -25.237 227.058 1.00 109.95 ? 7    ILE C CG2   1 
ATOM   5256  C  CD1   . ILE G 2 6   ? 50.072  -25.222 228.403 1.00 95.02  ? 7    ILE C CD1   1 
ATOM   5257  N  N     . TYR G 2 7   ? 50.849  -21.345 224.843 1.00 128.82 ? 8    TYR C N     1 
ATOM   5258  C  CA    . TYR G 2 7   ? 49.782  -20.740 224.054 1.00 134.75 ? 8    TYR C CA    1 
ATOM   5259  C  C     . TYR G 2 7   ? 50.030  -21.028 222.579 1.00 138.31 ? 8    TYR C C     1 
ATOM   5260  O  O     . TYR G 2 7   ? 49.092  -21.166 221.797 1.00 141.52 ? 8    TYR C O     1 
ATOM   5261  C  CB    . TYR G 2 7   ? 49.730  -19.226 224.297 1.00 134.69 ? 8    TYR C CB    1 
ATOM   5262  C  CG    . TYR G 2 7   ? 48.734  -18.491 223.426 1.00 135.15 ? 8    TYR C CG    1 
ATOM   5263  C  CD1   . TYR G 2 7   ? 47.419  -18.946 223.295 1.00 134.43 ? 8    TYR C CD1   1 
ATOM   5264  C  CD2   . TYR G 2 7   ? 49.104  -17.338 222.733 1.00 137.32 ? 8    TYR C CD2   1 
ATOM   5265  C  CE1   . TYR G 2 7   ? 46.496  -18.273 222.494 1.00 135.99 ? 8    TYR C CE1   1 
ATOM   5266  C  CE2   . TYR G 2 7   ? 48.189  -16.655 221.930 1.00 139.44 ? 8    TYR C CE2   1 
ATOM   5267  C  CZ    . TYR G 2 7   ? 46.887  -17.128 221.814 1.00 138.00 ? 8    TYR C CZ    1 
ATOM   5268  O  OH    . TYR G 2 7   ? 45.985  -16.460 221.015 1.00 135.52 ? 8    TYR C OH    1 
ATOM   5269  N  N     . GLN G 2 8   ? 51.304  -21.129 222.214 1.00 141.48 ? 9    GLN C N     1 
ATOM   5270  C  CA    . GLN G 2 8   ? 51.701  -21.403 220.837 1.00 143.02 ? 9    GLN C CA    1 
ATOM   5271  C  C     . GLN G 2 8   ? 51.425  -22.852 220.451 1.00 142.75 ? 9    GLN C C     1 
ATOM   5272  O  O     . GLN G 2 8   ? 51.962  -23.346 219.460 1.00 143.21 ? 9    GLN C O     1 
ATOM   5273  C  CB    . GLN G 2 8   ? 53.192  -21.103 220.657 1.00 148.26 ? 9    GLN C CB    1 
ATOM   5274  C  CG    . GLN G 2 8   ? 54.099  -21.878 221.610 1.00 153.48 ? 9    GLN C CG    1 
ATOM   5275  C  CD    . GLN G 2 8   ? 55.577  -21.614 221.373 1.00 155.77 ? 9    GLN C CD    1 
ATOM   5276  O  OE1   . GLN G 2 8   ? 56.044  -20.480 221.476 1.00 155.64 ? 9    GLN C OE1   1 
ATOM   5277  N  NE2   . GLN G 2 8   ? 56.321  -22.669 221.057 1.00 156.66 ? 9    GLN C NE2   1 
ATOM   5278  N  N     . ASP G 2 9   ? 50.591  -23.531 221.234 1.00 142.15 ? 10   ASP C N     1 
ATOM   5279  C  CA    . ASP G 2 9   ? 50.258  -24.927 220.964 1.00 142.23 ? 10   ASP C CA    1 
ATOM   5280  C  C     . ASP G 2 9   ? 48.759  -25.199 221.067 1.00 140.02 ? 10   ASP C C     1 
ATOM   5281  O  O     . ASP G 2 9   ? 48.094  -25.467 220.065 1.00 138.22 ? 10   ASP C O     1 
ATOM   5282  C  CB    . ASP G 2 9   ? 51.005  -25.859 221.935 1.00 144.05 ? 10   ASP C CB    1 
ATOM   5283  C  CG    . ASP G 2 9   ? 52.492  -25.989 221.615 1.00 146.48 ? 10   ASP C CG    1 
ATOM   5284  O  OD1   . ASP G 2 9   ? 52.833  -26.479 220.515 1.00 149.59 ? 10   ASP C OD1   1 
ATOM   5285  O  OD2   . ASP G 2 9   ? 53.321  -25.608 222.470 1.00 145.52 ? 10   ASP C OD2   1 
ATOM   5286  N  N     . ILE G 2 10  ? 48.238  -25.126 222.287 1.00 138.98 ? 11   ILE C N     1 
ATOM   5287  C  CA    . ILE G 2 10  ? 46.825  -25.382 222.546 1.00 138.43 ? 11   ILE C CA    1 
ATOM   5288  C  C     . ILE G 2 10  ? 45.855  -24.831 221.503 1.00 135.67 ? 11   ILE C C     1 
ATOM   5289  O  O     . ILE G 2 10  ? 44.853  -25.471 221.182 1.00 135.07 ? 11   ILE C O     1 
ATOM   5290  C  CB    . ILE G 2 10  ? 46.411  -24.854 223.949 1.00 139.36 ? 11   ILE C CB    1 
ATOM   5291  C  CG1   . ILE G 2 10  ? 47.180  -23.574 224.287 1.00 138.20 ? 11   ILE C CG1   1 
ATOM   5292  C  CG2   . ILE G 2 10  ? 46.660  -25.924 225.003 1.00 140.77 ? 11   ILE C CG2   1 
ATOM   5293  C  CD1   . ILE G 2 10  ? 46.784  -22.372 223.468 1.00 137.15 ? 11   ILE C CD1   1 
ATOM   5294  N  N     . ASN G 2 11  ? 46.152  -23.655 220.964 1.00 130.93 ? 12   ASN C N     1 
ATOM   5295  C  CA    . ASN G 2 11  ? 45.275  -23.047 219.972 1.00 123.88 ? 12   ASN C CA    1 
ATOM   5296  C  C     . ASN G 2 11  ? 45.006  -24.015 218.825 1.00 119.09 ? 12   ASN C C     1 
ATOM   5297  O  O     . ASN G 2 11  ? 43.968  -23.940 218.165 1.00 119.77 ? 12   ASN C O     1 
ATOM   5298  C  CB    . ASN G 2 11  ? 45.903  -21.766 219.424 1.00 124.25 ? 12   ASN C CB    1 
ATOM   5299  C  CG    . ASN G 2 11  ? 44.876  -20.835 218.808 1.00 128.85 ? 12   ASN C CG    1 
ATOM   5300  O  OD1   . ASN G 2 11  ? 44.085  -21.240 217.954 1.00 128.42 ? 12   ASN C OD1   1 
ATOM   5301  N  ND2   . ASN G 2 11  ? 44.884  -19.577 219.241 1.00 132.34 ? 12   ASN C ND2   1 
ATOM   5302  N  N     . SER G 2 12  ? 45.942  -24.931 218.603 1.00 111.16 ? 13   SER C N     1 
ATOM   5303  C  CA    . SER G 2 12  ? 45.819  -25.903 217.527 1.00 105.09 ? 13   SER C CA    1 
ATOM   5304  C  C     . SER G 2 12  ? 45.116  -27.187 217.952 1.00 101.24 ? 13   SER C C     1 
ATOM   5305  O  O     . SER G 2 12  ? 44.585  -27.923 217.118 1.00 103.30 ? 13   SER C O     1 
ATOM   5306  C  CB    . SER G 2 12  ? 47.206  -26.227 216.972 1.00 104.66 ? 13   SER C CB    1 
ATOM   5307  O  OG    . SER G 2 12  ? 47.853  -25.048 216.526 1.00 97.13  ? 13   SER C OG    1 
ATOM   5308  N  N     . ILE G 2 13  ? 45.111  -27.457 219.251 1.00 94.51  ? 14   ILE C N     1 
ATOM   5309  C  CA    . ILE G 2 13  ? 44.468  -28.660 219.764 1.00 88.25  ? 14   ILE C CA    1 
ATOM   5310  C  C     . ILE G 2 13  ? 42.965  -28.421 219.884 1.00 85.69  ? 14   ILE C C     1 
ATOM   5311  O  O     . ILE G 2 13  ? 42.177  -29.359 220.009 1.00 82.09  ? 14   ILE C O     1 
ATOM   5312  C  CB    . ILE G 2 13  ? 45.043  -29.044 221.147 1.00 86.60  ? 14   ILE C CB    1 
ATOM   5313  C  CG1   . ILE G 2 13  ? 45.181  -30.566 221.250 1.00 86.27  ? 14   ILE C CG1   1 
ATOM   5314  C  CG2   . ILE G 2 13  ? 44.145  -28.511 222.261 1.00 82.25  ? 14   ILE C CG2   1 
ATOM   5315  C  CD1   . ILE G 2 13  ? 43.880  -31.325 221.152 1.00 80.66  ? 14   ILE C CD1   1 
ATOM   5316  N  N     . LEU G 2 14  ? 42.582  -27.150 219.850 1.00 81.57  ? 15   LEU C N     1 
ATOM   5317  C  CA    . LEU G 2 14  ? 41.182  -26.762 219.955 1.00 72.90  ? 15   LEU C CA    1 
ATOM   5318  C  C     . LEU G 2 14  ? 40.541  -26.757 218.575 1.00 69.31  ? 15   LEU C C     1 
ATOM   5319  O  O     . LEU G 2 14  ? 39.564  -27.462 218.331 1.00 63.32  ? 15   LEU C O     1 
ATOM   5320  C  CB    . LEU G 2 14  ? 41.076  -25.371 220.587 1.00 73.48  ? 15   LEU C CB    1 
ATOM   5321  C  CG    . LEU G 2 14  ? 41.570  -25.221 222.034 1.00 71.72  ? 15   LEU C CG    1 
ATOM   5322  C  CD1   . LEU G 2 14  ? 41.455  -23.769 222.484 1.00 67.48  ? 15   LEU C CD1   1 
ATOM   5323  C  CD2   . LEU G 2 14  ? 40.755  -26.122 222.943 1.00 69.39  ? 15   LEU C CD2   1 
ATOM   5324  N  N     . ILE G 2 15  ? 41.102  -25.954 217.677 1.00 64.21  ? 16   ILE C N     1 
ATOM   5325  C  CA    . ILE G 2 15  ? 40.598  -25.860 216.319 1.00 58.62  ? 16   ILE C CA    1 
ATOM   5326  C  C     . ILE G 2 15  ? 40.341  -27.255 215.773 1.00 68.00  ? 16   ILE C C     1 
ATOM   5327  O  O     . ILE G 2 15  ? 41.218  -28.122 215.815 1.00 72.77  ? 16   ILE C O     1 
ATOM   5328  C  CB    . ILE G 2 15  ? 41.606  -25.148 215.406 1.00 52.31  ? 16   ILE C CB    1 
ATOM   5329  C  CG1   . ILE G 2 15  ? 41.818  -23.710 215.894 1.00 54.10  ? 16   ILE C CG1   1 
ATOM   5330  C  CG2   . ILE G 2 15  ? 41.118  -25.181 213.966 1.00 54.73  ? 16   ILE C CG2   1 
ATOM   5331  C  CD1   . ILE G 2 15  ? 42.894  -22.942 215.150 1.00 19.18  ? 16   ILE C CD1   1 
ATOM   5332  N  N     . GLY G 2 16  ? 39.132  -27.474 215.269 1.00 71.37  ? 17   GLY C N     1 
ATOM   5333  C  CA    . GLY G 2 16  ? 38.787  -28.772 214.720 1.00 71.79  ? 17   GLY C CA    1 
ATOM   5334  C  C     . GLY G 2 16  ? 38.012  -29.612 215.710 1.00 73.75  ? 17   GLY C C     1 
ATOM   5335  O  O     . GLY G 2 16  ? 37.430  -30.633 215.341 1.00 68.70  ? 17   GLY C O     1 
ATOM   5336  N  N     . GLN G 2 17  ? 38.011  -29.174 216.968 1.00 78.84  ? 18   GLN C N     1 
ATOM   5337  C  CA    . GLN G 2 17  ? 37.308  -29.872 218.045 1.00 85.06  ? 18   GLN C CA    1 
ATOM   5338  C  C     . GLN G 2 17  ? 35.805  -29.671 217.873 1.00 85.88  ? 18   GLN C C     1 
ATOM   5339  O  O     . GLN G 2 17  ? 35.298  -28.556 218.014 1.00 86.10  ? 18   GLN C O     1 
ATOM   5340  C  CB    . GLN G 2 17  ? 37.741  -29.316 219.402 1.00 86.42  ? 18   GLN C CB    1 
ATOM   5341  C  CG    . GLN G 2 17  ? 37.751  -30.325 220.539 1.00 86.65  ? 18   GLN C CG    1 
ATOM   5342  C  CD    . GLN G 2 17  ? 38.957  -31.239 220.489 1.00 83.93  ? 18   GLN C CD    1 
ATOM   5343  O  OE1   . GLN G 2 17  ? 40.093  -30.772 220.378 1.00 79.73  ? 18   GLN C OE1   1 
ATOM   5344  N  NE2   . GLN G 2 17  ? 38.721  -32.547 220.585 1.00 80.85  ? 18   GLN C NE2   1 
ATOM   5345  N  N     . LYS G 2 18  ? 35.098  -30.758 217.577 1.00 87.27  ? 19   LYS C N     1 
ATOM   5346  C  CA    . LYS G 2 18  ? 33.658  -30.703 217.368 1.00 91.46  ? 19   LYS C CA    1 
ATOM   5347  C  C     . LYS G 2 18  ? 32.884  -31.064 218.628 1.00 90.62  ? 19   LYS C C     1 
ATOM   5348  O  O     . LYS G 2 18  ? 33.299  -31.927 219.398 1.00 86.05  ? 19   LYS C O     1 
ATOM   5349  C  CB    . LYS G 2 18  ? 33.257  -31.644 216.229 1.00 94.72  ? 19   LYS C CB    1 
ATOM   5350  C  CG    . LYS G 2 18  ? 33.965  -31.363 214.911 1.00 100.99 ? 19   LYS C CG    1 
ATOM   5351  C  CD    . LYS G 2 18  ? 33.567  -32.377 213.848 1.00 111.43 ? 19   LYS C CD    1 
ATOM   5352  C  CE    . LYS G 2 18  ? 34.304  -32.141 212.533 1.00 113.55 ? 19   LYS C CE    1 
ATOM   5353  N  NZ    . LYS G 2 18  ? 33.919  -30.854 211.891 1.00 111.28 ? 19   LYS C NZ    1 
ATOM   5354  N  N     . VAL G 2 19  ? 31.758  -30.391 218.835 1.00 91.44  ? 20   VAL C N     1 
ATOM   5355  C  CA    . VAL G 2 19  ? 30.923  -30.642 219.999 1.00 93.97  ? 20   VAL C CA    1 
ATOM   5356  C  C     . VAL G 2 19  ? 29.449  -30.484 219.636 1.00 101.08 ? 20   VAL C C     1 
ATOM   5357  O  O     . VAL G 2 19  ? 28.928  -29.370 219.607 1.00 107.08 ? 20   VAL C O     1 
ATOM   5358  C  CB    . VAL G 2 19  ? 31.255  -29.669 221.144 1.00 87.81  ? 20   VAL C CB    1 
ATOM   5359  C  CG1   . VAL G 2 19  ? 30.414  -30.001 222.362 1.00 88.31  ? 20   VAL C CG1   1 
ATOM   5360  C  CG2   . VAL G 2 19  ? 32.729  -29.743 221.482 1.00 83.23  ? 20   VAL C CG2   1 
ATOM   5361  N  N     . LYS G 2 20  ? 28.784  -31.603 219.360 1.00 104.09 ? 21   LYS C N     1 
ATOM   5362  C  CA    . LYS G 2 20  ? 27.367  -31.593 218.996 1.00 104.47 ? 21   LYS C CA    1 
ATOM   5363  C  C     . LYS G 2 20  ? 26.573  -30.625 219.875 1.00 105.75 ? 21   LYS C C     1 
ATOM   5364  O  O     . LYS G 2 20  ? 26.867  -30.467 221.059 1.00 102.69 ? 21   LYS C O     1 
ATOM   5365  C  CB    . LYS G 2 20  ? 26.786  -33.005 219.121 1.00 102.06 ? 21   LYS C CB    1 
ATOM   5366  N  N     . ARG G 2 21  ? 25.570  -29.977 219.292 1.00 108.86 ? 22   ARG C N     1 
ATOM   5367  C  CA    . ARG G 2 21  ? 24.752  -29.024 220.033 1.00 112.62 ? 22   ARG C CA    1 
ATOM   5368  C  C     . ARG G 2 21  ? 23.880  -29.737 221.067 1.00 112.44 ? 22   ARG C C     1 
ATOM   5369  O  O     . ARG G 2 21  ? 23.478  -30.883 220.866 1.00 110.32 ? 22   ARG C O     1 
ATOM   5370  C  CB    . ARG G 2 21  ? 23.871  -28.218 219.066 1.00 117.42 ? 22   ARG C CB    1 
ATOM   5371  C  CG    . ARG G 2 21  ? 22.469  -28.780 218.822 1.00 124.80 ? 22   ARG C CG    1 
ATOM   5372  C  CD    . ARG G 2 21  ? 22.474  -30.182 218.213 1.00 130.56 ? 22   ARG C CD    1 
ATOM   5373  N  NE    . ARG G 2 21  ? 21.120  -30.733 218.114 1.00 132.03 ? 22   ARG C NE    1 
ATOM   5374  C  CZ    . ARG G 2 21  ? 20.831  -31.959 217.688 1.00 131.68 ? 22   ARG C CZ    1 
ATOM   5375  N  NH1   . ARG G 2 21  ? 21.803  -32.782 217.316 1.00 132.47 ? 22   ARG C NH1   1 
ATOM   5376  N  NH2   . ARG G 2 21  ? 19.569  -32.364 217.637 1.00 129.56 ? 22   ARG C NH2   1 
ATOM   5377  N  N     . PRO G 2 22  ? 23.586  -29.067 222.195 1.00 113.35 ? 23   PRO C N     1 
ATOM   5378  C  CA    . PRO G 2 22  ? 22.756  -29.664 223.247 1.00 113.88 ? 23   PRO C CA    1 
ATOM   5379  C  C     . PRO G 2 22  ? 21.427  -30.181 222.692 1.00 115.66 ? 23   PRO C C     1 
ATOM   5380  O  O     . PRO G 2 22  ? 20.557  -29.392 222.320 1.00 117.65 ? 23   PRO C O     1 
ATOM   5381  C  CB    . PRO G 2 22  ? 22.569  -28.508 224.226 1.00 111.60 ? 23   PRO C CB    1 
ATOM   5382  C  CG    . PRO G 2 22  ? 23.862  -27.765 224.100 1.00 109.71 ? 23   PRO C CG    1 
ATOM   5383  C  CD    . PRO G 2 22  ? 24.064  -27.734 222.604 1.00 111.02 ? 23   PRO C CD    1 
ATOM   5384  N  N     . LYS G 2 23  ? 21.280  -31.503 222.634 1.00 115.67 ? 24   LYS C N     1 
ATOM   5385  C  CA    . LYS G 2 23  ? 20.061  -32.129 222.122 1.00 115.73 ? 24   LYS C CA    1 
ATOM   5386  C  C     . LYS G 2 23  ? 18.827  -31.388 222.615 1.00 117.99 ? 24   LYS C C     1 
ATOM   5387  O  O     . LYS G 2 23  ? 18.573  -31.324 223.818 1.00 123.43 ? 24   LYS C O     1 
ATOM   5388  C  CB    . LYS G 2 23  ? 19.987  -33.591 222.567 1.00 113.95 ? 24   LYS C CB    1 
ATOM   5389  N  N     . SER G 2 24  ? 18.066  -30.827 221.680 1.00 115.00 ? 25   SER C N     1 
ATOM   5390  C  CA    . SER G 2 24  ? 16.858  -30.078 222.013 1.00 108.07 ? 25   SER C CA    1 
ATOM   5391  C  C     . SER G 2 24  ? 17.202  -28.806 222.788 1.00 103.00 ? 25   SER C C     1 
ATOM   5392  O  O     . SER G 2 24  ? 17.796  -28.852 223.869 1.00 91.41  ? 25   SER C O     1 
ATOM   5393  C  CB    . SER G 2 24  ? 15.899  -30.953 222.832 1.00 111.12 ? 25   SER C CB    1 
ATOM   5394  O  OG    . SER G 2 24  ? 14.679  -30.281 223.097 1.00 107.79 ? 25   SER C OG    1 
ATOM   5395  N  N     . GLY G 2 25  ? 16.821  -27.667 222.220 1.00 103.05 ? 26   GLY C N     1 
ATOM   5396  C  CA    . GLY G 2 25  ? 17.096  -26.393 222.853 1.00 100.21 ? 26   GLY C CA    1 
ATOM   5397  C  C     . GLY G 2 25  ? 17.881  -25.482 221.932 1.00 95.87  ? 26   GLY C C     1 
ATOM   5398  O  O     . GLY G 2 25  ? 18.347  -25.906 220.871 1.00 93.25  ? 26   GLY C O     1 
ATOM   5399  N  N     . THR G 2 26  ? 18.030  -24.226 222.336 1.00 92.80  ? 27   THR C N     1 
ATOM   5400  C  CA    . THR G 2 26  ? 18.764  -23.256 221.537 1.00 88.46  ? 27   THR C CA    1 
ATOM   5401  C  C     . THR G 2 26  ? 20.216  -23.166 221.997 1.00 81.34  ? 27   THR C C     1 
ATOM   5402  O  O     . THR G 2 26  ? 20.579  -23.696 223.047 1.00 77.09  ? 27   THR C O     1 
ATOM   5403  C  CB    . THR G 2 26  ? 18.099  -21.852 221.606 1.00 87.71  ? 27   THR C CB    1 
ATOM   5404  O  OG1   . THR G 2 26  ? 18.806  -20.946 220.753 1.00 93.47  ? 27   THR C OG1   1 
ATOM   5405  C  CG2   . THR G 2 26  ? 18.109  -21.315 223.029 1.00 88.61  ? 27   THR C CG2   1 
ATOM   5406  N  N     . LEU G 2 27  ? 21.040  -22.503 221.193 1.00 79.32  ? 28   LEU C N     1 
ATOM   5407  C  CA    . LEU G 2 27  ? 22.460  -22.334 221.490 1.00 77.28  ? 28   LEU C CA    1 
ATOM   5408  C  C     . LEU G 2 27  ? 22.713  -20.912 221.986 1.00 80.62  ? 28   LEU C C     1 
ATOM   5409  O  O     . LEU G 2 27  ? 22.857  -19.981 221.187 1.00 88.38  ? 28   LEU C O     1 
ATOM   5410  C  CB    . LEU G 2 27  ? 23.286  -22.595 220.224 1.00 62.57  ? 28   LEU C CB    1 
ATOM   5411  C  CG    . LEU G 2 27  ? 23.036  -23.929 219.511 1.00 52.12  ? 28   LEU C CG    1 
ATOM   5412  C  CD1   . LEU G 2 27  ? 23.750  -23.932 218.179 1.00 42.49  ? 28   LEU C CD1   1 
ATOM   5413  C  CD2   . LEU G 2 27  ? 23.499  -25.084 220.385 1.00 43.56  ? 28   LEU C CD2   1 
ATOM   5414  N  N     . SER G 2 28  ? 22.764  -20.745 223.304 1.00 72.74  ? 29   SER C N     1 
ATOM   5415  C  CA    . SER G 2 28  ? 22.985  -19.428 223.888 1.00 63.84  ? 29   SER C CA    1 
ATOM   5416  C  C     . SER G 2 28  ? 23.169  -19.493 225.397 1.00 64.84  ? 29   SER C C     1 
ATOM   5417  O  O     . SER G 2 28  ? 22.511  -20.278 226.079 1.00 57.93  ? 29   SER C O     1 
ATOM   5418  C  CB    . SER G 2 28  ? 21.809  -18.512 223.548 1.00 58.08  ? 29   SER C CB    1 
ATOM   5419  O  OG    . SER G 2 28  ? 20.578  -19.137 223.857 1.00 49.59  ? 29   SER C OG    1 
ATOM   5420  N  N     . GLY G 2 29  ? 24.064  -18.656 225.915 1.00 67.22  ? 30   GLY C N     1 
ATOM   5421  C  CA    . GLY G 2 29  ? 24.321  -18.641 227.344 1.00 65.72  ? 30   GLY C CA    1 
ATOM   5422  C  C     . GLY G 2 29  ? 25.158  -19.839 227.738 1.00 69.52  ? 30   GLY C C     1 
ATOM   5423  O  O     . GLY G 2 29  ? 26.028  -20.262 226.978 1.00 66.34  ? 30   GLY C O     1 
ATOM   5424  N  N     . HIS G 2 30  ? 24.897  -20.395 228.917 1.00 73.31  ? 31   HIS C N     1 
ATOM   5425  C  CA    . HIS G 2 30  ? 25.649  -21.556 229.385 1.00 80.73  ? 31   HIS C CA    1 
ATOM   5426  C  C     . HIS G 2 30  ? 25.498  -22.740 228.442 1.00 88.89  ? 31   HIS C C     1 
ATOM   5427  O  O     . HIS G 2 30  ? 26.306  -23.671 228.471 1.00 87.37  ? 31   HIS C O     1 
ATOM   5428  C  CB    . HIS G 2 30  ? 25.185  -21.984 230.780 1.00 76.71  ? 31   HIS C CB    1 
ATOM   5429  C  CG    . HIS G 2 30  ? 25.677  -21.103 231.886 1.00 76.80  ? 31   HIS C CG    1 
ATOM   5430  N  ND1   . HIS G 2 30  ? 24.966  -20.019 232.353 1.00 71.48  ? 31   HIS C ND1   1 
ATOM   5431  C  CD2   . HIS G 2 30  ? 26.813  -21.153 232.624 1.00 73.29  ? 31   HIS C CD2   1 
ATOM   5432  C  CE1   . HIS G 2 30  ? 25.639  -19.441 233.332 1.00 68.96  ? 31   HIS C CE1   1 
ATOM   5433  N  NE2   . HIS G 2 30  ? 26.764  -20.110 233.516 1.00 71.16  ? 31   HIS C NE2   1 
ATOM   5434  N  N     . ALA G 2 31  ? 24.458  -22.699 227.612 1.00 98.49  ? 32   ALA C N     1 
ATOM   5435  C  CA    . ALA G 2 31  ? 24.171  -23.772 226.661 1.00 108.51 ? 32   ALA C CA    1 
ATOM   5436  C  C     . ALA G 2 31  ? 25.236  -23.945 225.578 1.00 113.29 ? 32   ALA C C     1 
ATOM   5437  O  O     . ALA G 2 31  ? 25.861  -25.004 225.477 1.00 117.46 ? 32   ALA C O     1 
ATOM   5438  C  CB    . ALA G 2 31  ? 22.810  -23.537 226.015 1.00 108.51 ? 32   ALA C CB    1 
ATOM   5439  N  N     . ALA G 2 32  ? 25.435  -22.910 224.768 1.00 114.31 ? 33   ALA C N     1 
ATOM   5440  C  CA    . ALA G 2 32  ? 26.417  -22.961 223.692 1.00 113.19 ? 33   ALA C CA    1 
ATOM   5441  C  C     . ALA G 2 32  ? 27.733  -22.299 224.091 1.00 113.50 ? 33   ALA C C     1 
ATOM   5442  O  O     . ALA G 2 32  ? 28.147  -21.307 223.485 1.00 114.23 ? 33   ALA C O     1 
ATOM   5443  C  CB    . ALA G 2 32  ? 25.851  -22.292 222.444 1.00 114.60 ? 33   ALA C CB    1 
ATOM   5444  N  N     . GLY G 2 33  ? 28.390  -22.856 225.105 1.00 111.73 ? 34   GLY C N     1 
ATOM   5445  C  CA    . GLY G 2 33  ? 29.651  -22.299 225.562 1.00 111.55 ? 34   GLY C CA    1 
ATOM   5446  C  C     . GLY G 2 33  ? 30.319  -23.102 226.659 1.00 110.08 ? 34   GLY C C     1 
ATOM   5447  O  O     . GLY G 2 33  ? 31.517  -23.385 226.588 1.00 110.89 ? 34   GLY C O     1 
ATOM   5448  N  N     . GLU G 2 34  ? 29.550  -23.467 227.679 1.00 111.02 ? 35   GLU C N     1 
ATOM   5449  C  CA    . GLU G 2 34  ? 30.077  -24.243 228.797 1.00 113.31 ? 35   GLU C CA    1 
ATOM   5450  C  C     . GLU G 2 34  ? 30.812  -25.500 228.315 1.00 111.06 ? 35   GLU C C     1 
ATOM   5451  O  O     . GLU G 2 34  ? 31.925  -25.784 228.759 1.00 111.25 ? 35   GLU C O     1 
ATOM   5452  C  CB    . GLU G 2 34  ? 28.938  -24.637 229.751 1.00 114.52 ? 35   GLU C CB    1 
ATOM   5453  C  CG    . GLU G 2 34  ? 29.398  -25.311 231.041 1.00 114.25 ? 35   GLU C CG    1 
ATOM   5454  C  CD    . GLU G 2 34  ? 30.106  -24.357 231.985 1.00 115.05 ? 35   GLU C CD    1 
ATOM   5455  O  OE1   . GLU G 2 34  ? 30.717  -24.833 232.966 1.00 119.97 ? 35   GLU C OE1   1 
ATOM   5456  O  OE2   . GLU G 2 34  ? 30.047  -23.131 231.754 1.00 110.83 ? 35   GLU C OE2   1 
ATOM   5457  N  N     . PRO G 2 35  ? 30.199  -26.264 227.394 1.00 108.13 ? 36   PRO C N     1 
ATOM   5458  C  CA    . PRO G 2 35  ? 30.802  -27.489 226.860 1.00 105.42 ? 36   PRO C CA    1 
ATOM   5459  C  C     . PRO G 2 35  ? 32.225  -27.326 226.340 1.00 103.16 ? 36   PRO C C     1 
ATOM   5460  O  O     . PRO G 2 35  ? 32.958  -28.305 226.218 1.00 102.34 ? 36   PRO C O     1 
ATOM   5461  C  CB    . PRO G 2 35  ? 29.831  -27.891 225.756 1.00 107.51 ? 36   PRO C CB    1 
ATOM   5462  C  CG    . PRO G 2 35  ? 28.521  -27.450 226.303 1.00 108.32 ? 36   PRO C CG    1 
ATOM   5463  C  CD    . PRO G 2 35  ? 28.853  -26.069 226.825 1.00 110.86 ? 36   PRO C CD    1 
ATOM   5464  N  N     . PHE G 2 36  ? 32.614  -26.098 226.022 1.00 102.23 ? 37   PHE C N     1 
ATOM   5465  C  CA    . PHE G 2 36  ? 33.959  -25.861 225.529 1.00 102.95 ? 37   PHE C CA    1 
ATOM   5466  C  C     . PHE G 2 36  ? 34.956  -25.707 226.671 1.00 102.00 ? 37   PHE C C     1 
ATOM   5467  O  O     . PHE G 2 36  ? 36.057  -26.255 226.612 1.00 103.59 ? 37   PHE C O     1 
ATOM   5468  C  CB    . PHE G 2 36  ? 34.000  -24.625 224.626 1.00 109.09 ? 37   PHE C CB    1 
ATOM   5469  C  CG    . PHE G 2 36  ? 33.631  -24.908 223.194 1.00 115.27 ? 37   PHE C CG    1 
ATOM   5470  C  CD1   . PHE G 2 36  ? 32.301  -25.031 222.809 1.00 115.38 ? 37   PHE C CD1   1 
ATOM   5471  C  CD2   . PHE G 2 36  ? 34.621  -25.064 222.228 1.00 113.67 ? 37   PHE C CD2   1 
ATOM   5472  C  CE1   . PHE G 2 36  ? 31.965  -25.306 221.483 1.00 115.16 ? 37   PHE C CE1   1 
ATOM   5473  C  CE2   . PHE G 2 36  ? 34.294  -25.340 220.902 1.00 111.95 ? 37   PHE C CE2   1 
ATOM   5474  C  CZ    . PHE G 2 36  ? 32.965  -25.460 220.529 1.00 111.88 ? 37   PHE C CZ    1 
ATOM   5475  N  N     . GLU G 2 37  ? 34.573  -24.970 227.711 1.00 100.07 ? 38   GLU C N     1 
ATOM   5476  C  CA    . GLU G 2 37  ? 35.457  -24.769 228.857 1.00 96.84  ? 38   GLU C CA    1 
ATOM   5477  C  C     . GLU G 2 37  ? 35.981  -26.107 229.351 1.00 95.49  ? 38   GLU C C     1 
ATOM   5478  O  O     . GLU G 2 37  ? 37.139  -26.223 229.747 1.00 96.51  ? 38   GLU C O     1 
ATOM   5479  C  CB    . GLU G 2 37  ? 34.718  -24.077 230.004 1.00 95.91  ? 38   GLU C CB    1 
ATOM   5480  C  CG    . GLU G 2 37  ? 35.520  -24.043 231.300 1.00 98.97  ? 38   GLU C CG    1 
ATOM   5481  C  CD    . GLU G 2 37  ? 34.686  -23.640 232.501 1.00 100.70 ? 38   GLU C CD    1 
ATOM   5482  O  OE1   . GLU G 2 37  ? 35.164  -23.809 233.644 1.00 98.04  ? 38   GLU C OE1   1 
ATOM   5483  O  OE2   . GLU G 2 37  ? 33.554  -23.153 232.302 1.00 103.94 ? 38   GLU C OE2   1 
ATOM   5484  N  N     . LYS G 2 38  ? 35.115  -27.113 229.329 1.00 93.84  ? 39   LYS C N     1 
ATOM   5485  C  CA    . LYS G 2 38  ? 35.474  -28.451 229.782 1.00 96.12  ? 39   LYS C CA    1 
ATOM   5486  C  C     . LYS G 2 38  ? 36.629  -29.031 228.976 1.00 98.71  ? 39   LYS C C     1 
ATOM   5487  O  O     . LYS G 2 38  ? 37.614  -29.508 229.545 1.00 101.85 ? 39   LYS C O     1 
ATOM   5488  C  CB    . LYS G 2 38  ? 34.262  -29.382 229.686 1.00 93.14  ? 39   LYS C CB    1 
ATOM   5489  N  N     . LEU G 2 39  ? 36.506  -28.992 227.653 1.00 98.62  ? 40   LEU C N     1 
ATOM   5490  C  CA    . LEU G 2 39  ? 37.548  -29.518 226.778 1.00 93.13  ? 40   LEU C CA    1 
ATOM   5491  C  C     . LEU G 2 39  ? 38.862  -28.772 226.967 1.00 92.88  ? 40   LEU C C     1 
ATOM   5492  O  O     . LEU G 2 39  ? 39.935  -29.331 226.752 1.00 95.76  ? 40   LEU C O     1 
ATOM   5493  C  CB    . LEU G 2 39  ? 37.108  -29.436 225.313 1.00 89.77  ? 40   LEU C CB    1 
ATOM   5494  C  CG    . LEU G 2 39  ? 36.159  -30.530 224.812 1.00 85.77  ? 40   LEU C CG    1 
ATOM   5495  C  CD1   . LEU G 2 39  ? 34.896  -30.565 225.659 1.00 82.42  ? 40   LEU C CD1   1 
ATOM   5496  C  CD2   . LEU G 2 39  ? 35.822  -30.270 223.350 1.00 75.84  ? 40   LEU C CD2   1 
ATOM   5497  N  N     . VAL G 2 40  ? 38.778  -27.512 227.376 1.00 91.99  ? 41   VAL C N     1 
ATOM   5498  C  CA    . VAL G 2 40  ? 39.976  -26.714 227.598 1.00 95.39  ? 41   VAL C CA    1 
ATOM   5499  C  C     . VAL G 2 40  ? 40.677  -27.140 228.883 1.00 100.88 ? 41   VAL C C     1 
ATOM   5500  O  O     . VAL G 2 40  ? 41.903  -27.177 228.945 1.00 104.23 ? 41   VAL C O     1 
ATOM   5501  C  CB    . VAL G 2 40  ? 39.640  -25.216 227.703 1.00 91.76  ? 41   VAL C CB    1 
ATOM   5502  C  CG1   . VAL G 2 40  ? 40.908  -24.412 227.970 1.00 81.65  ? 41   VAL C CG1   1 
ATOM   5503  C  CG2   . VAL G 2 40  ? 38.964  -24.750 226.426 1.00 81.67  ? 41   VAL C CG2   1 
ATOM   5504  N  N     . TYR G 2 41  ? 39.891  -27.458 229.906 1.00 105.24 ? 42   TYR C N     1 
ATOM   5505  C  CA    . TYR G 2 41  ? 40.434  -27.872 231.192 1.00 108.06 ? 42   TYR C CA    1 
ATOM   5506  C  C     . TYR G 2 41  ? 41.216  -29.175 231.100 1.00 109.34 ? 42   TYR C C     1 
ATOM   5507  O  O     . TYR G 2 41  ? 42.272  -29.312 231.716 1.00 110.57 ? 42   TYR C O     1 
ATOM   5508  C  CB    . TYR G 2 41  ? 39.307  -28.027 232.215 1.00 112.24 ? 42   TYR C CB    1 
ATOM   5509  C  CG    . TYR G 2 41  ? 39.780  -28.444 233.592 1.00 114.64 ? 42   TYR C CG    1 
ATOM   5510  C  CD1   . TYR G 2 41  ? 40.705  -27.672 234.297 1.00 112.84 ? 42   TYR C CD1   1 
ATOM   5511  C  CD2   . TYR G 2 41  ? 39.299  -29.609 234.192 1.00 113.22 ? 42   TYR C CD2   1 
ATOM   5512  C  CE1   . TYR G 2 41  ? 41.139  -28.048 235.565 1.00 110.33 ? 42   TYR C CE1   1 
ATOM   5513  C  CE2   . TYR G 2 41  ? 39.728  -29.994 235.461 1.00 110.69 ? 42   TYR C CE2   1 
ATOM   5514  C  CZ    . TYR G 2 41  ? 40.647  -29.209 236.139 1.00 110.89 ? 42   TYR C CZ    1 
ATOM   5515  O  OH    . TYR G 2 41  ? 41.080  -29.586 237.388 1.00 111.70 ? 42   TYR C OH    1 
ATOM   5516  N  N     . LYS G 2 42  ? 40.696  -30.133 230.337 1.00 109.99 ? 43   LYS C N     1 
ATOM   5517  C  CA    . LYS G 2 42  ? 41.368  -31.419 230.186 1.00 110.27 ? 43   LYS C CA    1 
ATOM   5518  C  C     . LYS G 2 42  ? 42.663  -31.276 229.392 1.00 112.83 ? 43   LYS C C     1 
ATOM   5519  O  O     . LYS G 2 42  ? 43.589  -32.069 229.557 1.00 114.27 ? 43   LYS C O     1 
ATOM   5520  C  CB    . LYS G 2 42  ? 40.453  -32.431 229.491 1.00 104.85 ? 43   LYS C CB    1 
ATOM   5521  C  CG    . LYS G 2 42  ? 40.145  -32.103 228.041 1.00 104.48 ? 43   LYS C CG    1 
ATOM   5522  C  CD    . LYS G 2 42  ? 40.168  -33.356 227.175 1.00 105.60 ? 43   LYS C CD    1 
ATOM   5523  C  CE    . LYS G 2 42  ? 41.560  -33.978 227.150 1.00 110.30 ? 43   LYS C CE    1 
ATOM   5524  N  NZ    . LYS G 2 42  ? 41.634  -35.215 226.326 1.00 109.93 ? 43   LYS C NZ    1 
ATOM   5525  N  N     . PHE G 2 43  ? 42.724  -30.261 228.534 1.00 116.47 ? 44   PHE C N     1 
ATOM   5526  C  CA    . PHE G 2 43  ? 43.907  -30.020 227.711 1.00 119.27 ? 44   PHE C CA    1 
ATOM   5527  C  C     . PHE G 2 43  ? 45.003  -29.318 228.503 1.00 123.13 ? 44   PHE C C     1 
ATOM   5528  O  O     . PHE G 2 43  ? 46.168  -29.718 228.457 1.00 122.62 ? 44   PHE C O     1 
ATOM   5529  C  CB    . PHE G 2 43  ? 43.537  -29.178 226.489 1.00 116.06 ? 44   PHE C CB    1 
ATOM   5530  N  N     . LEU G 2 44  ? 44.620  -28.266 229.221 1.00 129.09 ? 45   LEU C N     1 
ATOM   5531  C  CA    . LEU G 2 44  ? 45.556  -27.497 230.034 1.00 133.47 ? 45   LEU C CA    1 
ATOM   5532  C  C     . LEU G 2 44  ? 46.062  -28.334 231.207 1.00 136.07 ? 45   LEU C C     1 
ATOM   5533  O  O     . LEU G 2 44  ? 47.066  -27.999 231.838 1.00 138.20 ? 45   LEU C O     1 
ATOM   5534  C  CB    . LEU G 2 44  ? 44.879  -26.214 230.533 1.00 131.99 ? 45   LEU C CB    1 
ATOM   5535  C  CG    . LEU G 2 44  ? 43.549  -26.354 231.283 1.00 135.96 ? 45   LEU C CG    1 
ATOM   5536  C  CD1   . LEU G 2 44  ? 43.820  -26.658 232.746 1.00 138.94 ? 45   LEU C CD1   1 
ATOM   5537  C  CD2   . LEU G 2 44  ? 42.742  -25.067 231.160 1.00 135.88 ? 45   LEU C CD2   1 
ATOM   5538  N  N     . LYS G 2 45  ? 45.360  -29.429 231.488 1.00 135.94 ? 46   LYS C N     1 
ATOM   5539  C  CA    . LYS G 2 45  ? 45.740  -30.328 232.568 1.00 135.96 ? 46   LYS C CA    1 
ATOM   5540  C  C     . LYS G 2 45  ? 46.687  -31.391 232.025 1.00 137.78 ? 46   LYS C C     1 
ATOM   5541  O  O     . LYS G 2 45  ? 46.987  -32.373 232.701 1.00 138.38 ? 46   LYS C O     1 
ATOM   5542  C  CB    . LYS G 2 45  ? 44.502  -30.997 233.166 1.00 134.37 ? 46   LYS C CB    1 
ATOM   5543  N  N     . GLU G 2 46  ? 47.151  -31.189 230.796 1.00 139.55 ? 47   GLU C N     1 
ATOM   5544  C  CA    . GLU G 2 46  ? 48.068  -32.126 230.161 1.00 141.05 ? 47   GLU C CA    1 
ATOM   5545  C  C     . GLU G 2 46  ? 49.468  -31.531 230.084 1.00 142.48 ? 47   GLU C C     1 
ATOM   5546  O  O     . GLU G 2 46  ? 50.453  -32.258 229.969 1.00 144.44 ? 47   GLU C O     1 
ATOM   5547  C  CB    . GLU G 2 46  ? 47.580  -32.476 228.754 1.00 137.75 ? 47   GLU C CB    1 
ATOM   5548  N  N     . ASN G 2 47  ? 49.547  -30.206 230.148 1.00 143.89 ? 48   ASN C N     1 
ATOM   5549  C  CA    . ASN G 2 47  ? 50.828  -29.510 230.092 1.00 146.78 ? 48   ASN C CA    1 
ATOM   5550  C  C     . ASN G 2 47  ? 51.085  -28.703 231.361 1.00 144.96 ? 48   ASN C C     1 
ATOM   5551  O  O     . ASN G 2 47  ? 52.121  -28.052 231.493 1.00 146.62 ? 48   ASN C O     1 
ATOM   5552  C  CB    . ASN G 2 47  ? 50.879  -28.583 228.872 1.00 150.92 ? 48   ASN C CB    1 
ATOM   5553  C  CG    . ASN G 2 47  ? 51.093  -29.338 227.571 1.00 151.93 ? 48   ASN C CG    1 
ATOM   5554  O  OD1   . ASN G 2 47  ? 50.337  -30.251 227.237 1.00 152.65 ? 48   ASN C OD1   1 
ATOM   5555  N  ND2   . ASN G 2 47  ? 52.129  -28.956 226.829 1.00 151.15 ? 48   ASN C ND2   1 
ATOM   5556  N  N     . LEU G 2 48  ? 50.138  -28.747 232.291 1.00 140.31 ? 49   LEU C N     1 
ATOM   5557  C  CA    . LEU G 2 48  ? 50.272  -28.028 233.552 1.00 136.89 ? 49   LEU C CA    1 
ATOM   5558  C  C     . LEU G 2 48  ? 49.539  -28.765 234.663 1.00 132.53 ? 49   LEU C C     1 
ATOM   5559  O  O     . LEU G 2 48  ? 49.053  -28.155 235.614 1.00 131.71 ? 49   LEU C O     1 
ATOM   5560  C  CB    . LEU G 2 48  ? 49.719  -26.608 233.417 1.00 139.86 ? 49   LEU C CB    1 
ATOM   5561  C  CG    . LEU G 2 48  ? 50.598  -25.602 232.670 1.00 142.34 ? 49   LEU C CG    1 
ATOM   5562  C  CD1   . LEU G 2 48  ? 49.822  -24.317 232.441 1.00 144.44 ? 49   LEU C CD1   1 
ATOM   5563  C  CD2   . LEU G 2 48  ? 51.864  -25.328 233.473 1.00 144.17 ? 49   LEU C CD2   1 
ATOM   5564  N  N     . SER G 2 49  ? 49.473  -30.085 234.534 1.00 127.03 ? 50   SER C N     1 
ATOM   5565  C  CA    . SER G 2 49  ? 48.800  -30.932 235.509 1.00 120.23 ? 50   SER C CA    1 
ATOM   5566  C  C     . SER G 2 49  ? 49.290  -30.709 236.937 1.00 117.68 ? 50   SER C C     1 
ATOM   5567  O  O     . SER G 2 49  ? 48.651  -31.152 237.893 1.00 117.16 ? 50   SER C O     1 
ATOM   5568  C  CB    . SER G 2 49  ? 48.986  -32.401 235.129 1.00 116.30 ? 50   SER C CB    1 
ATOM   5569  O  OG    . SER G 2 49  ? 48.392  -33.252 236.089 1.00 110.67 ? 50   SER C OG    1 
ATOM   5570  N  N     . ASP G 2 50  ? 50.417  -30.018 237.080 1.00 115.15 ? 51   ASP C N     1 
ATOM   5571  C  CA    . ASP G 2 50  ? 50.994  -29.748 238.394 1.00 113.21 ? 51   ASP C CA    1 
ATOM   5572  C  C     . ASP G 2 50  ? 50.343  -28.583 239.136 1.00 108.59 ? 51   ASP C C     1 
ATOM   5573  O  O     . ASP G 2 50  ? 50.684  -28.308 240.286 1.00 106.31 ? 51   ASP C O     1 
ATOM   5574  C  CB    . ASP G 2 50  ? 52.497  -29.490 238.258 1.00 115.10 ? 51   ASP C CB    1 
ATOM   5575  C  CG    . ASP G 2 50  ? 53.260  -30.724 237.824 1.00 117.01 ? 51   ASP C CG    1 
ATOM   5576  O  OD1   . ASP G 2 50  ? 52.950  -31.266 236.743 1.00 115.07 ? 51   ASP C OD1   1 
ATOM   5577  O  OD2   . ASP G 2 50  ? 54.167  -31.153 238.569 1.00 120.10 ? 51   ASP C OD2   1 
ATOM   5578  N  N     . LEU G 2 51  ? 49.409  -27.902 238.481 1.00 107.90 ? 52   LEU C N     1 
ATOM   5579  C  CA    . LEU G 2 51  ? 48.723  -26.773 239.101 1.00 105.42 ? 52   LEU C CA    1 
ATOM   5580  C  C     . LEU G 2 51  ? 47.419  -26.393 238.390 1.00 104.62 ? 52   LEU C C     1 
ATOM   5581  O  O     . LEU G 2 51  ? 47.023  -25.226 238.399 1.00 98.79  ? 52   LEU C O     1 
ATOM   5582  C  CB    . LEU G 2 51  ? 49.651  -25.555 239.150 1.00 101.34 ? 52   LEU C CB    1 
ATOM   5583  C  CG    . LEU G 2 51  ? 49.996  -24.887 237.818 1.00 99.75  ? 52   LEU C CG    1 
ATOM   5584  C  CD1   . LEU G 2 51  ? 50.776  -23.618 238.090 1.00 95.89  ? 52   LEU C CD1   1 
ATOM   5585  C  CD2   . LEU G 2 51  ? 50.792  -25.831 236.937 1.00 95.22  ? 52   LEU C CD2   1 
ATOM   5586  N  N     . THR G 2 52  ? 46.758  -27.380 237.779 1.00 107.79 ? 53   THR C N     1 
ATOM   5587  C  CA    . THR G 2 52  ? 45.494  -27.153 237.072 1.00 107.97 ? 53   THR C CA    1 
ATOM   5588  C  C     . THR G 2 52  ? 44.282  -27.339 237.981 1.00 108.88 ? 53   THR C C     1 
ATOM   5589  O  O     . THR G 2 52  ? 43.616  -28.376 237.942 1.00 108.54 ? 53   THR C O     1 
ATOM   5590  C  CB    . THR G 2 52  ? 45.317  -28.104 235.853 1.00 106.90 ? 53   THR C CB    1 
ATOM   5591  O  OG1   . THR G 2 52  ? 45.533  -29.463 236.259 1.00 108.60 ? 53   THR C OG1   1 
ATOM   5592  C  CG2   . THR G 2 52  ? 46.278  -27.735 234.739 1.00 102.90 ? 53   THR C CG2   1 
ATOM   5593  N  N     . PHE G 2 53  ? 44.008  -26.329 238.801 1.00 112.10 ? 54   PHE C N     1 
ATOM   5594  C  CA    . PHE G 2 53  ? 42.869  -26.362 239.712 1.00 111.82 ? 54   PHE C CA    1 
ATOM   5595  C  C     . PHE G 2 53  ? 41.730  -25.558 239.094 1.00 106.06 ? 54   PHE C C     1 
ATOM   5596  O  O     . PHE G 2 53  ? 41.877  -24.991 238.012 1.00 102.07 ? 54   PHE C O     1 
ATOM   5597  C  CB    . PHE G 2 53  ? 43.235  -25.755 241.073 1.00 120.51 ? 54   PHE C CB    1 
ATOM   5598  C  CG    . PHE G 2 53  ? 44.408  -26.419 241.749 1.00 129.75 ? 54   PHE C CG    1 
ATOM   5599  C  CD1   . PHE G 2 53  ? 45.714  -26.070 241.415 1.00 132.67 ? 54   PHE C CD1   1 
ATOM   5600  C  CD2   . PHE G 2 53  ? 44.206  -27.395 242.723 1.00 133.66 ? 54   PHE C CD2   1 
ATOM   5601  C  CE1   . PHE G 2 53  ? 46.801  -26.682 242.040 1.00 133.04 ? 54   PHE C CE1   1 
ATOM   5602  C  CE2   . PHE G 2 53  ? 45.286  -28.014 243.353 1.00 135.70 ? 54   PHE C CE2   1 
ATOM   5603  C  CZ    . PHE G 2 53  ? 46.585  -27.656 243.010 1.00 134.25 ? 54   PHE C CZ    1 
ATOM   5604  N  N     . LYS G 2 54  ? 40.598  -25.505 239.784 1.00 102.56 ? 55   LYS C N     1 
ATOM   5605  C  CA    . LYS G 2 54  ? 39.457  -24.761 239.282 1.00 99.12  ? 55   LYS C CA    1 
ATOM   5606  C  C     . LYS G 2 54  ? 38.528  -24.252 240.377 1.00 97.88  ? 55   LYS C C     1 
ATOM   5607  O  O     . LYS G 2 54  ? 37.524  -24.886 240.701 1.00 99.47  ? 55   LYS C O     1 
ATOM   5608  C  CB    . LYS G 2 54  ? 38.662  -25.612 238.289 1.00 95.90  ? 55   LYS C CB    1 
ATOM   5609  C  CG    . LYS G 2 54  ? 38.394  -27.033 238.745 1.00 89.92  ? 55   LYS C CG    1 
ATOM   5610  C  CD    . LYS G 2 54  ? 37.249  -27.658 237.953 1.00 91.63  ? 55   LYS C CD    1 
ATOM   5611  C  CE    . LYS G 2 54  ? 37.483  -27.591 236.451 1.00 95.84  ? 55   LYS C CE    1 
ATOM   5612  N  NZ    . LYS G 2 54  ? 36.299  -28.069 235.690 1.00 92.85  ? 55   LYS C NZ    1 
ATOM   5613  N  N     . GLN G 2 55  ? 38.876  -23.099 240.940 1.00 93.47  ? 56   GLN C N     1 
ATOM   5614  C  CA    . GLN G 2 55  ? 38.077  -22.470 241.981 1.00 88.36  ? 56   GLN C CA    1 
ATOM   5615  C  C     . GLN G 2 55  ? 37.725  -23.413 243.128 1.00 90.72  ? 56   GLN C C     1 
ATOM   5616  O  O     . GLN G 2 55  ? 38.434  -23.480 244.132 1.00 92.96  ? 56   GLN C O     1 
ATOM   5617  C  CB    . GLN G 2 55  ? 36.789  -21.913 241.376 1.00 81.77  ? 56   GLN C CB    1 
ATOM   5618  C  CG    . GLN G 2 55  ? 35.895  -21.201 242.369 1.00 67.40  ? 56   GLN C CG    1 
ATOM   5619  C  CD    . GLN G 2 55  ? 36.426  -19.847 242.762 1.00 62.05  ? 56   GLN C CD    1 
ATOM   5620  O  OE1   . GLN G 2 55  ? 36.552  -18.956 241.928 1.00 64.37  ? 56   GLN C OE1   1 
ATOM   5621  N  NE2   . GLN G 2 55  ? 36.739  -19.680 244.039 1.00 65.95  ? 56   GLN C NE2   1 
ATOM   5622  N  N     . TYR G 2 56  ? 36.626  -24.141 242.974 1.00 89.42  ? 57   TYR C N     1 
ATOM   5623  C  CA    . TYR G 2 56  ? 36.169  -25.054 244.011 1.00 88.53  ? 57   TYR C CA    1 
ATOM   5624  C  C     . TYR G 2 56  ? 37.143  -26.182 244.292 1.00 89.69  ? 57   TYR C C     1 
ATOM   5625  O  O     . TYR G 2 56  ? 37.237  -26.663 245.422 1.00 85.67  ? 57   TYR C O     1 
ATOM   5626  C  CB    . TYR G 2 56  ? 34.812  -25.657 243.640 1.00 88.22  ? 57   TYR C CB    1 
ATOM   5627  C  CG    . TYR G 2 56  ? 34.878  -26.743 242.591 1.00 81.68  ? 57   TYR C CG    1 
ATOM   5628  C  CD1   . TYR G 2 56  ? 34.911  -26.435 241.235 1.00 84.38  ? 57   TYR C CD1   1 
ATOM   5629  C  CD2   . TYR G 2 56  ? 34.910  -28.085 242.961 1.00 80.18  ? 57   TYR C CD2   1 
ATOM   5630  C  CE1   . TYR G 2 56  ? 34.970  -27.442 240.276 1.00 87.67  ? 57   TYR C CE1   1 
ATOM   5631  C  CE2   . TYR G 2 56  ? 34.971  -29.095 242.015 1.00 78.85  ? 57   TYR C CE2   1 
ATOM   5632  C  CZ    . TYR G 2 56  ? 35.000  -28.772 240.677 1.00 84.20  ? 57   TYR C CZ    1 
ATOM   5633  O  OH    . TYR G 2 56  ? 35.055  -29.779 239.742 1.00 90.11  ? 57   TYR C OH    1 
ATOM   5634  N  N     . GLU G 2 57  ? 37.863  -26.617 243.266 1.00 90.67  ? 58   GLU C N     1 
ATOM   5635  C  CA    . GLU G 2 57  ? 38.806  -27.706 243.455 1.00 92.30  ? 58   GLU C CA    1 
ATOM   5636  C  C     . GLU G 2 57  ? 39.925  -27.301 244.403 1.00 91.42  ? 58   GLU C C     1 
ATOM   5637  O  O     . GLU G 2 57  ? 40.317  -28.080 245.272 1.00 89.80  ? 58   GLU C O     1 
ATOM   5638  C  CB    . GLU G 2 57  ? 39.394  -28.149 242.118 1.00 97.51  ? 58   GLU C CB    1 
ATOM   5639  C  CG    . GLU G 2 57  ? 40.039  -29.523 242.167 1.00 95.53  ? 58   GLU C CG    1 
ATOM   5640  C  CD    . GLU G 2 57  ? 40.703  -29.896 240.858 1.00 96.21  ? 58   GLU C CD    1 
ATOM   5641  O  OE1   . GLU G 2 57  ? 41.111  -31.069 240.712 1.00 91.03  ? 58   GLU C OE1   1 
ATOM   5642  O  OE2   . GLU G 2 57  ? 40.821  -29.012 239.980 1.00 96.33  ? 58   GLU C OE2   1 
ATOM   5643  N  N     . TYR G 2 58  ? 40.435  -26.082 244.245 1.00 87.32  ? 59   TYR C N     1 
ATOM   5644  C  CA    . TYR G 2 58  ? 41.510  -25.622 245.113 1.00 86.21  ? 59   TYR C CA    1 
ATOM   5645  C  C     . TYR G 2 58  ? 41.016  -25.365 246.526 1.00 85.02  ? 59   TYR C C     1 
ATOM   5646  O  O     . TYR G 2 58  ? 41.805  -25.356 247.471 1.00 90.94  ? 59   TYR C O     1 
ATOM   5647  C  CB    . TYR G 2 58  ? 42.159  -24.347 244.577 1.00 85.26  ? 59   TYR C CB    1 
ATOM   5648  C  CG    . TYR G 2 58  ? 43.467  -24.022 245.267 1.00 89.11  ? 59   TYR C CG    1 
ATOM   5649  C  CD1   . TYR G 2 58  ? 44.561  -24.884 245.162 1.00 85.98  ? 59   TYR C CD1   1 
ATOM   5650  C  CD2   . TYR G 2 58  ? 43.613  -22.860 246.026 1.00 88.76  ? 59   TYR C CD2   1 
ATOM   5651  C  CE1   . TYR G 2 58  ? 45.768  -24.599 245.792 1.00 93.47  ? 59   TYR C CE1   1 
ATOM   5652  C  CE2   . TYR G 2 58  ? 44.819  -22.563 246.664 1.00 95.20  ? 59   TYR C CE2   1 
ATOM   5653  C  CZ    . TYR G 2 58  ? 45.895  -23.438 246.542 1.00 97.16  ? 59   TYR C CZ    1 
ATOM   5654  O  OH    . TYR G 2 58  ? 47.098  -23.154 247.158 1.00 100.58 ? 59   TYR C OH    1 
ATOM   5655  N  N     . LEU G 2 59  ? 39.715  -25.146 246.676 1.00 81.67  ? 60   LEU C N     1 
ATOM   5656  C  CA    . LEU G 2 59  ? 39.158  -24.909 248.000 1.00 78.69  ? 60   LEU C CA    1 
ATOM   5657  C  C     . LEU G 2 59  ? 39.157  -26.204 248.806 1.00 82.87  ? 60   LEU C C     1 
ATOM   5658  O  O     . LEU G 2 59  ? 39.534  -26.214 249.978 1.00 83.95  ? 60   LEU C O     1 
ATOM   5659  C  CB    . LEU G 2 59  ? 37.736  -24.353 247.900 1.00 64.58  ? 60   LEU C CB    1 
ATOM   5660  C  CG    . LEU G 2 59  ? 37.584  -22.980 247.248 1.00 54.31  ? 60   LEU C CG    1 
ATOM   5661  C  CD1   . LEU G 2 59  ? 36.166  -22.478 247.480 1.00 56.78  ? 60   LEU C CD1   1 
ATOM   5662  C  CD2   . LEU G 2 59  ? 38.576  -22.002 247.832 1.00 38.36  ? 60   LEU C CD2   1 
ATOM   5663  N  N     . ASN G 2 60  ? 38.746  -27.295 248.165 1.00 87.55  ? 61   ASN C N     1 
ATOM   5664  C  CA    . ASN G 2 60  ? 38.703  -28.601 248.816 1.00 89.22  ? 61   ASN C CA    1 
ATOM   5665  C  C     . ASN G 2 60  ? 40.093  -29.025 249.298 1.00 89.13  ? 61   ASN C C     1 
ATOM   5666  O  O     . ASN G 2 60  ? 40.240  -29.538 250.403 1.00 84.77  ? 61   ASN C O     1 
ATOM   5667  C  CB    . ASN G 2 60  ? 38.146  -29.658 247.851 1.00 93.88  ? 61   ASN C CB    1 
ATOM   5668  C  CG    . ASN G 2 60  ? 36.692  -29.404 247.469 1.00 94.03  ? 61   ASN C CG    1 
ATOM   5669  O  OD1   . ASN G 2 60  ? 36.127  -30.103 246.625 1.00 94.15  ? 61   ASN C OD1   1 
ATOM   5670  N  ND2   . ASN G 2 60  ? 36.080  -28.404 248.092 1.00 87.36  ? 61   ASN C ND2   1 
ATOM   5671  N  N     . ASP G 2 61  ? 41.108  -28.810 248.464 1.00 88.99  ? 62   ASP C N     1 
ATOM   5672  C  CA    . ASP G 2 61  ? 42.470  -29.171 248.824 1.00 90.54  ? 62   ASP C CA    1 
ATOM   5673  C  C     . ASP G 2 61  ? 43.012  -28.234 249.897 1.00 94.76  ? 62   ASP C C     1 
ATOM   5674  O  O     . ASP G 2 61  ? 43.727  -28.660 250.807 1.00 97.34  ? 62   ASP C O     1 
ATOM   5675  C  CB    . ASP G 2 61  ? 43.384  -29.131 247.596 1.00 87.32  ? 62   ASP C CB    1 
ATOM   5676  C  CG    . ASP G 2 61  ? 43.015  -30.175 246.564 1.00 86.09  ? 62   ASP C CG    1 
ATOM   5677  O  OD1   . ASP G 2 61  ? 42.700  -31.317 246.963 1.00 81.57  ? 62   ASP C OD1   1 
ATOM   5678  O  OD2   . ASP G 2 61  ? 43.050  -29.862 245.356 1.00 86.73  ? 62   ASP C OD2   1 
ATOM   5679  N  N     . LEU G 2 62  ? 42.664  -26.955 249.788 1.00 96.07  ? 63   LEU C N     1 
ATOM   5680  C  CA    . LEU G 2 62  ? 43.115  -25.952 250.749 1.00 97.87  ? 63   LEU C CA    1 
ATOM   5681  C  C     . LEU G 2 62  ? 42.696  -26.359 252.156 1.00 100.23 ? 63   LEU C C     1 
ATOM   5682  O  O     . LEU G 2 62  ? 43.459  -26.206 253.109 1.00 100.13 ? 63   LEU C O     1 
ATOM   5683  C  CB    . LEU G 2 62  ? 42.526  -24.579 250.400 1.00 91.19  ? 63   LEU C CB    1 
ATOM   5684  C  CG    . LEU G 2 62  ? 43.053  -23.333 251.126 1.00 83.34  ? 63   LEU C CG    1 
ATOM   5685  C  CD1   . LEU G 2 62  ? 42.550  -23.285 252.545 1.00 79.87  ? 63   LEU C CD1   1 
ATOM   5686  C  CD2   . LEU G 2 62  ? 44.572  -23.327 251.084 1.00 84.32  ? 63   LEU C CD2   1 
ATOM   5687  N  N     . PHE G 2 63  ? 41.478  -26.879 252.280 1.00 104.58 ? 64   PHE C N     1 
ATOM   5688  C  CA    . PHE G 2 63  ? 40.968  -27.318 253.572 1.00 106.81 ? 64   PHE C CA    1 
ATOM   5689  C  C     . PHE G 2 63  ? 41.438  -28.742 253.886 1.00 109.10 ? 64   PHE C C     1 
ATOM   5690  O  O     . PHE G 2 63  ? 41.681  -29.080 255.045 1.00 112.13 ? 64   PHE C O     1 
ATOM   5691  C  CB    . PHE G 2 63  ? 39.430  -27.260 253.597 1.00 102.67 ? 64   PHE C CB    1 
ATOM   5692  C  CG    . PHE G 2 63  ? 38.862  -25.862 253.709 1.00 98.60  ? 64   PHE C CG    1 
ATOM   5693  C  CD1   . PHE G 2 63  ? 39.295  -24.994 254.709 1.00 100.55 ? 64   PHE C CD1   1 
ATOM   5694  C  CD2   . PHE G 2 63  ? 37.868  -25.430 252.837 1.00 97.54  ? 64   PHE C CD2   1 
ATOM   5695  C  CE1   . PHE G 2 63  ? 38.746  -23.720 254.840 1.00 96.92  ? 64   PHE C CE1   1 
ATOM   5696  C  CE2   . PHE G 2 63  ? 37.314  -24.160 252.960 1.00 95.97  ? 64   PHE C CE2   1 
ATOM   5697  C  CZ    . PHE G 2 63  ? 37.755  -23.304 253.964 1.00 99.78  ? 64   PHE C CZ    1 
ATOM   5698  N  N     . MET G 2 64  ? 41.571  -29.571 252.854 1.00 110.14 ? 65   MET C N     1 
ATOM   5699  C  CA    . MET G 2 64  ? 42.010  -30.951 253.034 1.00 111.76 ? 65   MET C CA    1 
ATOM   5700  C  C     . MET G 2 64  ? 43.486  -31.070 253.404 1.00 114.33 ? 65   MET C C     1 
ATOM   5701  O  O     . MET G 2 64  ? 43.962  -32.160 253.725 1.00 117.47 ? 65   MET C O     1 
ATOM   5702  C  CB    . MET G 2 64  ? 41.740  -31.771 251.768 1.00 111.49 ? 65   MET C CB    1 
ATOM   5703  C  CG    . MET G 2 64  ? 40.317  -32.303 251.654 1.00 106.70 ? 65   MET C CG    1 
ATOM   5704  S  SD    . MET G 2 64  ? 40.047  -33.243 250.134 1.00 106.90 ? 65   MET C SD    1 
ATOM   5705  C  CE    . MET G 2 64  ? 40.896  -34.779 250.518 1.00 97.18  ? 65   MET C CE    1 
ATOM   5706  N  N     . LYS G 2 65  ? 44.206  -29.953 253.357 1.00 114.90 ? 66   LYS C N     1 
ATOM   5707  C  CA    . LYS G 2 65  ? 45.626  -29.949 253.697 1.00 113.08 ? 66   LYS C CA    1 
ATOM   5708  C  C     . LYS G 2 65  ? 45.846  -29.543 255.154 1.00 111.74 ? 66   LYS C C     1 
ATOM   5709  O  O     . LYS G 2 65  ? 46.975  -29.289 255.576 1.00 114.34 ? 66   LYS C O     1 
ATOM   5710  C  CB    . LYS G 2 65  ? 46.393  -28.999 252.771 1.00 109.20 ? 66   LYS C CB    1 
ATOM   5711  N  N     . ASN G 2 66  ? 44.758  -29.481 255.918 1.00 110.26 ? 67   ASN C N     1 
ATOM   5712  C  CA    . ASN G 2 66  ? 44.820  -29.118 257.332 1.00 108.91 ? 67   ASN C CA    1 
ATOM   5713  C  C     . ASN G 2 66  ? 43.446  -29.184 258.008 1.00 104.02 ? 67   ASN C C     1 
ATOM   5714  O  O     . ASN G 2 66  ? 42.904  -28.167 258.445 1.00 98.81  ? 67   ASN C O     1 
ATOM   5715  C  CB    . ASN G 2 66  ? 45.435  -27.719 257.499 1.00 110.86 ? 67   ASN C CB    1 
ATOM   5716  C  CG    . ASN G 2 66  ? 44.856  -26.705 256.538 1.00 108.27 ? 67   ASN C CG    1 
ATOM   5717  O  OD1   . ASN G 2 66  ? 43.663  -26.418 256.568 1.00 110.92 ? 67   ASN C OD1   1 
ATOM   5718  N  ND2   . ASN G 2 66  ? 45.703  -26.157 255.676 1.00 106.73 ? 67   ASN C ND2   1 
ATOM   5719  N  N     . PRO G 2 67  ? 42.873  -30.399 258.112 1.00 100.51 ? 68   PRO C N     1 
ATOM   5720  C  CA    . PRO G 2 67  ? 41.566  -30.648 258.726 1.00 97.99  ? 68   PRO C CA    1 
ATOM   5721  C  C     . PRO G 2 67  ? 41.544  -30.406 260.230 1.00 93.32  ? 68   PRO C C     1 
ATOM   5722  O  O     . PRO G 2 67  ? 40.512  -30.574 260.881 1.00 84.00  ? 68   PRO C O     1 
ATOM   5723  C  CB    . PRO G 2 67  ? 41.300  -32.108 258.376 1.00 97.12  ? 68   PRO C CB    1 
ATOM   5724  C  CG    . PRO G 2 67  ? 42.663  -32.696 258.410 1.00 95.78  ? 68   PRO C CG    1 
ATOM   5725  C  CD    . PRO G 2 67  ? 43.466  -31.666 257.646 1.00 99.40  ? 68   PRO C CD    1 
ATOM   5726  N  N     . ALA G 2 68  ? 42.689  -30.017 260.777 1.00 92.15  ? 69   ALA C N     1 
ATOM   5727  C  CA    . ALA G 2 68  ? 42.786  -29.747 262.203 1.00 93.89  ? 69   ALA C CA    1 
ATOM   5728  C  C     . ALA G 2 68  ? 42.029  -28.463 262.529 1.00 96.12  ? 69   ALA C C     1 
ATOM   5729  O  O     . ALA G 2 68  ? 41.703  -28.204 263.686 1.00 92.84  ? 69   ALA C O     1 
ATOM   5730  C  CB    . ALA G 2 68  ? 44.247  -29.618 262.612 1.00 98.09  ? 69   ALA C CB    1 
ATOM   5731  N  N     . ILE G 2 69  ? 41.758  -27.660 261.501 1.00 97.52  ? 70   ILE C N     1 
ATOM   5732  C  CA    . ILE G 2 69  ? 41.025  -26.406 261.670 1.00 97.52  ? 70   ILE C CA    1 
ATOM   5733  C  C     . ILE G 2 69  ? 39.649  -26.510 261.013 1.00 103.90 ? 70   ILE C C     1 
ATOM   5734  O  O     . ILE G 2 69  ? 39.505  -26.294 259.807 1.00 102.39 ? 70   ILE C O     1 
ATOM   5735  C  CB    . ILE G 2 69  ? 41.794  -25.211 261.058 1.00 87.92  ? 70   ILE C CB    1 
ATOM   5736  C  CG1   . ILE G 2 69  ? 40.913  -23.961 261.069 1.00 75.43  ? 70   ILE C CG1   1 
ATOM   5737  C  CG2   . ILE G 2 69  ? 42.242  -25.545 259.652 1.00 87.22  ? 70   ILE C CG2   1 
ATOM   5738  C  CD1   . ILE G 2 69  ? 41.624  -22.718 260.619 1.00 64.49  ? 70   ILE C CD1   1 
ATOM   5739  N  N     . ILE G 2 70  ? 38.645  -26.840 261.825 1.00 109.33 ? 71   ILE C N     1 
ATOM   5740  C  CA    . ILE G 2 70  ? 37.271  -27.000 261.357 1.00 117.96 ? 71   ILE C CA    1 
ATOM   5741  C  C     . ILE G 2 70  ? 36.393  -25.785 261.656 1.00 121.73 ? 71   ILE C C     1 
ATOM   5742  O  O     . ILE G 2 70  ? 36.885  -24.715 262.021 1.00 120.65 ? 71   ILE C O     1 
ATOM   5743  C  CB    . ILE G 2 70  ? 36.588  -28.240 262.002 1.00 121.00 ? 71   ILE C CB    1 
ATOM   5744  C  CG1   . ILE G 2 70  ? 36.382  -28.006 263.501 1.00 120.78 ? 71   ILE C CG1   1 
ATOM   5745  C  CG2   . ILE G 2 70  ? 37.432  -29.489 261.768 1.00 120.91 ? 71   ILE C CG2   1 
ATOM   5746  C  CD1   . ILE G 2 70  ? 35.455  -29.011 264.162 1.00 122.65 ? 71   ILE C CD1   1 
ATOM   5747  N  N     . GLY G 2 71  ? 35.084  -25.973 261.498 1.00 123.10 ? 72   GLY C N     1 
ATOM   5748  C  CA    . GLY G 2 71  ? 34.136  -24.906 261.749 1.00 124.57 ? 72   GLY C CA    1 
ATOM   5749  C  C     . GLY G 2 71  ? 34.162  -23.855 260.662 1.00 127.76 ? 72   GLY C C     1 
ATOM   5750  O  O     . GLY G 2 71  ? 33.774  -24.113 259.523 1.00 131.84 ? 72   GLY C O     1 
ATOM   5751  N  N     . HIS G 2 72  ? 34.628  -22.664 261.017 1.00 125.96 ? 73   HIS C N     1 
ATOM   5752  C  CA    . HIS G 2 72  ? 34.710  -21.554 260.079 1.00 122.87 ? 73   HIS C CA    1 
ATOM   5753  C  C     . HIS G 2 72  ? 35.436  -20.413 260.766 1.00 121.77 ? 73   HIS C C     1 
ATOM   5754  O  O     . HIS G 2 72  ? 36.098  -20.627 261.778 1.00 121.73 ? 73   HIS C O     1 
ATOM   5755  C  CB    . HIS G 2 72  ? 33.305  -21.119 259.659 1.00 123.03 ? 73   HIS C CB    1 
ATOM   5756  C  CG    . HIS G 2 72  ? 32.410  -20.782 260.809 1.00 125.13 ? 73   HIS C CG    1 
ATOM   5757  N  ND1   . HIS G 2 72  ? 32.465  -19.572 261.466 1.00 122.89 ? 73   HIS C ND1   1 
ATOM   5758  C  CD2   . HIS G 2 72  ? 31.453  -21.508 261.437 1.00 122.63 ? 73   HIS C CD2   1 
ATOM   5759  C  CE1   . HIS G 2 72  ? 31.582  -19.566 262.448 1.00 125.54 ? 73   HIS C CE1   1 
ATOM   5760  N  NE2   . HIS G 2 72  ? 30.955  -20.729 262.452 1.00 127.69 ? 73   HIS C NE2   1 
ATOM   5761  N  N     . GLU G 2 73  ? 35.306  -19.208 260.221 1.00 121.03 ? 74   GLU C N     1 
ATOM   5762  C  CA    . GLU G 2 73  ? 35.962  -18.035 260.790 1.00 122.41 ? 74   GLU C CA    1 
ATOM   5763  C  C     . GLU G 2 73  ? 37.472  -18.263 260.759 1.00 121.21 ? 74   GLU C C     1 
ATOM   5764  O  O     . GLU G 2 73  ? 38.184  -17.649 259.966 1.00 120.13 ? 74   GLU C O     1 
ATOM   5765  C  CB    . GLU G 2 73  ? 35.488  -17.813 262.230 1.00 126.19 ? 74   GLU C CB    1 
ATOM   5766  C  CG    . GLU G 2 73  ? 35.162  -16.362 262.586 1.00 135.33 ? 74   GLU C CG    1 
ATOM   5767  C  CD    . GLU G 2 73  ? 36.388  -15.468 262.658 1.00 141.22 ? 74   GLU C CD    1 
ATOM   5768  O  OE1   . GLU G 2 73  ? 37.260  -15.715 263.520 1.00 143.79 ? 74   GLU C OE1   1 
ATOM   5769  O  OE2   . GLU G 2 73  ? 36.478  -14.515 261.855 1.00 144.23 ? 74   GLU C OE2   1 
ATOM   5770  N  N     . ALA G 2 74  ? 37.954  -19.153 261.622 1.00 120.20 ? 75   ALA C N     1 
ATOM   5771  C  CA    . ALA G 2 74  ? 39.375  -19.470 261.678 1.00 115.36 ? 75   ALA C CA    1 
ATOM   5772  C  C     . ALA G 2 74  ? 39.793  -20.075 260.345 1.00 111.78 ? 75   ALA C C     1 
ATOM   5773  O  O     . ALA G 2 74  ? 40.945  -19.959 259.931 1.00 110.82 ? 75   ALA C O     1 
ATOM   5774  C  CB    . ALA G 2 74  ? 39.651  -20.452 262.810 1.00 114.75 ? 75   ALA C CB    1 
ATOM   5775  N  N     . ARG G 2 75  ? 38.847  -20.725 259.675 1.00 107.76 ? 76   ARG C N     1 
ATOM   5776  C  CA    . ARG G 2 75  ? 39.125  -21.337 258.384 1.00 106.07 ? 76   ARG C CA    1 
ATOM   5777  C  C     . ARG G 2 75  ? 39.441  -20.283 257.330 1.00 104.83 ? 76   ARG C C     1 
ATOM   5778  O  O     . ARG G 2 75  ? 40.115  -20.569 256.338 1.00 101.01 ? 76   ARG C O     1 
ATOM   5779  C  CB    . ARG G 2 75  ? 37.943  -22.194 257.933 1.00 105.42 ? 76   ARG C CB    1 
ATOM   5780  C  CG    . ARG G 2 75  ? 37.993  -23.614 258.467 1.00 104.99 ? 76   ARG C CG    1 
ATOM   5781  C  CD    . ARG G 2 75  ? 36.760  -24.400 258.064 1.00 100.29 ? 76   ARG C CD    1 
ATOM   5782  N  NE    . ARG G 2 75  ? 36.910  -25.827 258.336 1.00 96.32  ? 76   ARG C NE    1 
ATOM   5783  C  CZ    . ARG G 2 75  ? 35.946  -26.726 258.163 1.00 91.61  ? 76   ARG C CZ    1 
ATOM   5784  N  NH1   . ARG G 2 75  ? 34.756  -26.345 257.719 1.00 92.52  ? 76   ARG C NH1   1 
ATOM   5785  N  NH2   . ARG G 2 75  ? 36.174  -28.006 258.421 1.00 89.29  ? 76   ARG C NH2   1 
ATOM   5786  N  N     . TYR G 2 76  ? 38.954  -19.065 257.548 1.00 102.77 ? 77   TYR C N     1 
ATOM   5787  C  CA    . TYR G 2 76  ? 39.212  -17.974 256.618 1.00 99.08  ? 77   TYR C CA    1 
ATOM   5788  C  C     . TYR G 2 76  ? 40.654  -17.513 256.758 1.00 100.01 ? 77   TYR C C     1 
ATOM   5789  O  O     . TYR G 2 76  ? 41.146  -16.718 255.957 1.00 97.73  ? 77   TYR C O     1 
ATOM   5790  C  CB    . TYR G 2 76  ? 38.271  -16.793 256.874 1.00 97.38  ? 77   TYR C CB    1 
ATOM   5791  C  CG    . TYR G 2 76  ? 36.872  -16.972 256.318 1.00 94.87  ? 77   TYR C CG    1 
ATOM   5792  C  CD1   . TYR G 2 76  ? 36.642  -17.778 255.204 1.00 93.74  ? 77   TYR C CD1   1 
ATOM   5793  C  CD2   . TYR G 2 76  ? 35.787  -16.289 256.869 1.00 92.49  ? 77   TYR C CD2   1 
ATOM   5794  C  CE1   . TYR G 2 76  ? 35.371  -17.901 254.652 1.00 94.89  ? 77   TYR C CE1   1 
ATOM   5795  C  CE2   . TYR G 2 76  ? 34.508  -16.403 256.320 1.00 88.42  ? 77   TYR C CE2   1 
ATOM   5796  C  CZ    . TYR G 2 76  ? 34.310  -17.210 255.211 1.00 89.70  ? 77   TYR C CZ    1 
ATOM   5797  O  OH    . TYR G 2 76  ? 33.060  -17.331 254.652 1.00 85.07  ? 77   TYR C OH    1 
ATOM   5798  N  N     . LYS G 2 77  ? 41.324  -18.004 257.794 1.00 103.61 ? 78   LYS C N     1 
ATOM   5799  C  CA    . LYS G 2 77  ? 42.717  -17.654 258.021 1.00 105.81 ? 78   LYS C CA    1 
ATOM   5800  C  C     . LYS G 2 77  ? 43.545  -18.499 257.062 1.00 108.05 ? 78   LYS C C     1 
ATOM   5801  O  O     . LYS G 2 77  ? 44.676  -18.156 256.726 1.00 110.31 ? 78   LYS C O     1 
ATOM   5802  C  CB    . LYS G 2 77  ? 43.116  -17.952 259.468 1.00 105.12 ? 78   LYS C CB    1 
ATOM   5803  N  N     . LEU G 2 78  ? 42.962  -19.608 256.619 1.00 108.39 ? 79   LEU C N     1 
ATOM   5804  C  CA    . LEU G 2 78  ? 43.627  -20.503 255.683 1.00 108.26 ? 79   LEU C CA    1 
ATOM   5805  C  C     . LEU G 2 78  ? 43.740  -19.820 254.325 1.00 110.98 ? 79   LEU C C     1 
ATOM   5806  O  O     . LEU G 2 78  ? 44.479  -20.270 253.448 1.00 109.14 ? 79   LEU C O     1 
ATOM   5807  C  CB    . LEU G 2 78  ? 42.833  -21.800 255.556 1.00 105.40 ? 79   LEU C CB    1 
ATOM   5808  C  CG    . LEU G 2 78  ? 42.768  -22.652 256.824 1.00 106.42 ? 79   LEU C CG    1 
ATOM   5809  C  CD1   . LEU G 2 78  ? 41.626  -23.643 256.720 1.00 109.22 ? 79   LEU C CD1   1 
ATOM   5810  C  CD2   . LEU G 2 78  ? 44.094  -23.369 257.031 1.00 106.98 ? 79   LEU C CD2   1 
ATOM   5811  N  N     . PHE G 2 79  ? 42.993  -18.729 254.165 1.00 114.88 ? 80   PHE C N     1 
ATOM   5812  C  CA    . PHE G 2 79  ? 42.990  -17.946 252.930 1.00 114.28 ? 80   PHE C CA    1 
ATOM   5813  C  C     . PHE G 2 79  ? 43.954  -16.773 253.034 1.00 113.76 ? 80   PHE C C     1 
ATOM   5814  O  O     . PHE G 2 79  ? 43.604  -15.701 253.531 1.00 117.68 ? 80   PHE C O     1 
ATOM   5815  C  CB    . PHE G 2 79  ? 41.581  -17.417 252.627 1.00 112.03 ? 80   PHE C CB    1 
ATOM   5816  C  CG    . PHE G 2 79  ? 40.696  -18.409 251.922 1.00 108.23 ? 80   PHE C CG    1 
ATOM   5817  C  CD1   . PHE G 2 79  ? 40.911  -18.725 250.585 1.00 103.21 ? 80   PHE C CD1   1 
ATOM   5818  C  CD2   . PHE G 2 79  ? 39.657  -19.036 252.597 1.00 104.84 ? 80   PHE C CD2   1 
ATOM   5819  C  CE1   . PHE G 2 79  ? 40.106  -19.654 249.935 1.00 95.07  ? 80   PHE C CE1   1 
ATOM   5820  C  CE2   . PHE G 2 79  ? 38.848  -19.967 251.954 1.00 100.60 ? 80   PHE C CE2   1 
ATOM   5821  C  CZ    . PHE G 2 79  ? 39.073  -20.273 250.622 1.00 98.38  ? 80   PHE C CZ    1 
ATOM   5822  N  N     . ASN G 2 80  ? 45.173  -16.991 252.560 1.00 109.50 ? 81   ASN C N     1 
ATOM   5823  C  CA    . ASN G 2 80  ? 46.209  -15.972 252.572 1.00 106.14 ? 81   ASN C CA    1 
ATOM   5824  C  C     . ASN G 2 80  ? 45.747  -14.724 251.814 1.00 107.69 ? 81   ASN C C     1 
ATOM   5825  O  O     . ASN G 2 80  ? 45.119  -14.831 250.761 1.00 113.42 ? 81   ASN C O     1 
ATOM   5826  C  CB    . ASN G 2 80  ? 47.476  -16.548 251.931 1.00 105.50 ? 81   ASN C CB    1 
ATOM   5827  C  CG    . ASN G 2 80  ? 47.218  -17.142 250.551 1.00 97.07  ? 81   ASN C CG    1 
ATOM   5828  O  OD1   . ASN G 2 80  ? 46.297  -17.937 250.363 1.00 89.18  ? 81   ASN C OD1   1 
ATOM   5829  N  ND2   . ASN G 2 80  ? 48.041  -16.763 249.584 1.00 96.40  ? 81   ASN C ND2   1 
ATOM   5830  N  N     . SER G 2 81  ? 46.052  -13.546 252.355 1.00 100.82 ? 82   SER C N     1 
ATOM   5831  C  CA    . SER G 2 81  ? 45.669  -12.279 251.723 1.00 94.12  ? 82   SER C CA    1 
ATOM   5832  C  C     . SER G 2 81  ? 44.155  -12.100 251.617 1.00 90.19  ? 82   SER C C     1 
ATOM   5833  O  O     . SER G 2 81  ? 43.449  -12.956 251.084 1.00 90.81  ? 82   SER C O     1 
ATOM   5834  C  CB    . SER G 2 81  ? 46.289  -12.165 250.325 1.00 91.84  ? 82   SER C CB    1 
ATOM   5835  O  OG    . SER G 2 81  ? 45.889  -10.964 249.688 1.00 89.80  ? 82   SER C OG    1 
ATOM   5836  N  N     . PRO G 2 82  ? 43.639  -10.971 252.123 1.00 85.82  ? 83   PRO C N     1 
ATOM   5837  C  CA    . PRO G 2 82  ? 42.208  -10.655 252.097 1.00 86.41  ? 83   PRO C CA    1 
ATOM   5838  C  C     . PRO G 2 82  ? 41.662  -10.653 250.680 1.00 89.64  ? 83   PRO C C     1 
ATOM   5839  O  O     . PRO G 2 82  ? 40.490  -10.953 250.444 1.00 91.89  ? 83   PRO C O     1 
ATOM   5840  C  CB    . PRO G 2 82  ? 42.154  -9.264  252.717 1.00 85.28  ? 83   PRO C CB    1 
ATOM   5841  C  CG    . PRO G 2 82  ? 43.315  -9.267  253.650 1.00 88.59  ? 83   PRO C CG    1 
ATOM   5842  C  CD    . PRO G 2 82  ? 44.386  -9.906  252.810 1.00 84.98  ? 83   PRO C CD    1 
ATOM   5843  N  N     . THR G 2 83  ? 42.533  -10.302 249.742 1.00 87.80  ? 84   THR C N     1 
ATOM   5844  C  CA    . THR G 2 83  ? 42.173  -10.231 248.340 1.00 84.58  ? 84   THR C CA    1 
ATOM   5845  C  C     . THR G 2 83  ? 41.728  -11.580 247.796 1.00 77.70  ? 84   THR C C     1 
ATOM   5846  O  O     . THR G 2 83  ? 40.566  -11.762 247.430 1.00 68.38  ? 84   THR C O     1 
ATOM   5847  C  CB    . THR G 2 83  ? 43.357  -9.727  247.519 1.00 92.57  ? 84   THR C CB    1 
ATOM   5848  O  OG1   . THR G 2 83  ? 43.878  -8.540  248.133 1.00 93.87  ? 84   THR C OG1   1 
ATOM   5849  C  CG2   . THR G 2 83  ? 42.917  -9.404  246.098 1.00 101.21 ? 84   THR C CG2   1 
ATOM   5850  N  N     . LEU G 2 84  ? 42.656  -12.525 247.745 1.00 76.33  ? 85   LEU C N     1 
ATOM   5851  C  CA    . LEU G 2 84  ? 42.344  -13.852 247.243 1.00 78.32  ? 85   LEU C CA    1 
ATOM   5852  C  C     . LEU G 2 84  ? 41.066  -14.405 247.862 1.00 78.49  ? 85   LEU C C     1 
ATOM   5853  O  O     . LEU G 2 84  ? 40.213  -14.956 247.162 1.00 77.52  ? 85   LEU C O     1 
ATOM   5854  C  CB    . LEU G 2 84  ? 43.508  -14.800 247.519 1.00 79.44  ? 85   LEU C CB    1 
ATOM   5855  C  CG    . LEU G 2 84  ? 44.817  -14.469 246.802 1.00 85.02  ? 85   LEU C CG    1 
ATOM   5856  C  CD1   . LEU G 2 84  ? 45.893  -15.430 247.261 1.00 90.74  ? 85   LEU C CD1   1 
ATOM   5857  C  CD2   . LEU G 2 84  ? 44.633  -14.558 245.297 1.00 87.55  ? 85   LEU C CD2   1 
ATOM   5858  N  N     . LEU G 2 85  ? 40.939  -14.259 249.177 1.00 76.58  ? 86   LEU C N     1 
ATOM   5859  C  CA    . LEU G 2 85  ? 39.760  -14.736 249.894 1.00 74.57  ? 86   LEU C CA    1 
ATOM   5860  C  C     . LEU G 2 85  ? 38.491  -14.198 249.245 1.00 74.77  ? 86   LEU C C     1 
ATOM   5861  O  O     . LEU G 2 85  ? 37.624  -14.958 248.815 1.00 74.77  ? 86   LEU C O     1 
ATOM   5862  C  CB    . LEU G 2 85  ? 39.828  -14.293 251.359 1.00 75.37  ? 86   LEU C CB    1 
ATOM   5863  C  CG    . LEU G 2 85  ? 38.570  -14.474 252.212 1.00 76.50  ? 86   LEU C CG    1 
ATOM   5864  C  CD1   . LEU G 2 85  ? 38.965  -14.751 253.648 1.00 67.24  ? 86   LEU C CD1   1 
ATOM   5865  C  CD2   . LEU G 2 85  ? 37.695  -13.231 252.111 1.00 70.91  ? 86   LEU C CD2   1 
ATOM   5866  N  N     . PHE G 2 86  ? 38.395  -12.876 249.185 1.00 71.49  ? 87   PHE C N     1 
ATOM   5867  C  CA    . PHE G 2 86  ? 37.254  -12.215 248.582 1.00 70.21  ? 87   PHE C CA    1 
ATOM   5868  C  C     . PHE G 2 86  ? 36.985  -12.746 247.185 1.00 73.39  ? 87   PHE C C     1 
ATOM   5869  O  O     . PHE G 2 86  ? 35.835  -12.882 246.778 1.00 82.65  ? 87   PHE C O     1 
ATOM   5870  C  CB    . PHE G 2 86  ? 37.505  -10.716 248.496 1.00 68.89  ? 87   PHE C CB    1 
ATOM   5871  C  CG    . PHE G 2 86  ? 36.557  -9.999  247.585 1.00 76.08  ? 87   PHE C CG    1 
ATOM   5872  C  CD1   . PHE G 2 86  ? 35.223  -9.846  247.928 1.00 86.50  ? 87   PHE C CD1   1 
ATOM   5873  C  CD2   . PHE G 2 86  ? 36.998  -9.476  246.377 1.00 83.05  ? 87   PHE C CD2   1 
ATOM   5874  C  CE1   . PHE G 2 86  ? 34.337  -9.178  247.079 1.00 86.60  ? 87   PHE C CE1   1 
ATOM   5875  C  CE2   . PHE G 2 86  ? 36.119  -8.808  245.522 1.00 84.85  ? 87   PHE C CE2   1 
ATOM   5876  C  CZ    . PHE G 2 86  ? 34.790  -8.659  245.875 1.00 83.08  ? 87   PHE C CZ    1 
ATOM   5877  N  N     . LEU G 2 87  ? 38.043  -13.049 246.447 1.00 71.08  ? 88   LEU C N     1 
ATOM   5878  C  CA    . LEU G 2 87  ? 37.879  -13.537 245.088 1.00 69.03  ? 88   LEU C CA    1 
ATOM   5879  C  C     . LEU G 2 87  ? 37.755  -15.047 244.962 1.00 70.24  ? 88   LEU C C     1 
ATOM   5880  O  O     . LEU G 2 87  ? 37.660  -15.563 243.853 1.00 77.31  ? 88   LEU C O     1 
ATOM   5881  C  CB    . LEU G 2 87  ? 39.043  -13.052 244.215 1.00 62.61  ? 88   LEU C CB    1 
ATOM   5882  C  CG    . LEU G 2 87  ? 39.139  -11.543 243.970 1.00 60.18  ? 88   LEU C CG    1 
ATOM   5883  C  CD1   . LEU G 2 87  ? 40.442  -11.204 243.266 1.00 68.92  ? 88   LEU C CD1   1 
ATOM   5884  C  CD2   . LEU G 2 87  ? 37.959  -11.082 243.152 1.00 51.89  ? 88   LEU C CD2   1 
ATOM   5885  N  N     . LEU G 2 88  ? 37.735  -15.766 246.076 1.00 68.96  ? 89   LEU C N     1 
ATOM   5886  C  CA    . LEU G 2 88  ? 37.655  -17.217 245.971 1.00 70.36  ? 89   LEU C CA    1 
ATOM   5887  C  C     . LEU G 2 88  ? 36.777  -17.893 247.010 1.00 70.78  ? 89   LEU C C     1 
ATOM   5888  O  O     . LEU G 2 88  ? 35.940  -18.726 246.667 1.00 71.14  ? 89   LEU C O     1 
ATOM   5889  C  CB    . LEU G 2 88  ? 39.070  -17.812 246.035 1.00 78.54  ? 89   LEU C CB    1 
ATOM   5890  C  CG    . LEU G 2 88  ? 40.080  -17.466 244.930 1.00 79.43  ? 89   LEU C CG    1 
ATOM   5891  C  CD1   . LEU G 2 88  ? 41.484  -17.878 245.348 1.00 76.75  ? 89   LEU C CD1   1 
ATOM   5892  C  CD2   . LEU G 2 88  ? 39.682  -18.167 243.644 1.00 79.00  ? 89   LEU C CD2   1 
ATOM   5893  N  N     . SER G 2 89  ? 36.977  -17.539 248.278 1.00 72.73  ? 90   SER C N     1 
ATOM   5894  C  CA    . SER G 2 89  ? 36.212  -18.138 249.368 1.00 67.63  ? 90   SER C CA    1 
ATOM   5895  C  C     . SER G 2 89  ? 34.715  -18.088 249.104 1.00 70.12  ? 90   SER C C     1 
ATOM   5896  O  O     . SER G 2 89  ? 34.204  -17.151 248.487 1.00 71.35  ? 90   SER C O     1 
ATOM   5897  C  CB    . SER G 2 89  ? 36.527  -17.442 250.695 1.00 58.98  ? 90   SER C CB    1 
ATOM   5898  O  OG    . SER G 2 89  ? 36.121  -16.085 250.678 1.00 59.62  ? 90   SER C OG    1 
ATOM   5899  N  N     . ARG G 2 90  ? 34.020  -19.116 249.574 1.00 70.14  ? 91   ARG C N     1 
ATOM   5900  C  CA    . ARG G 2 90  ? 32.583  -19.208 249.400 1.00 66.22  ? 91   ARG C CA    1 
ATOM   5901  C  C     . ARG G 2 90  ? 31.848  -18.308 250.388 1.00 70.64  ? 91   ARG C C     1 
ATOM   5902  O  O     . ARG G 2 90  ? 32.267  -17.177 250.641 1.00 67.50  ? 91   ARG C O     1 
ATOM   5903  C  CB    . ARG G 2 90  ? 32.138  -20.665 249.555 1.00 59.81  ? 91   ARG C CB    1 
ATOM   5904  C  CG    . ARG G 2 90  ? 32.398  -21.508 248.316 1.00 56.93  ? 91   ARG C CG    1 
ATOM   5905  C  CD    . ARG G 2 90  ? 31.561  -20.998 247.150 1.00 74.30  ? 91   ARG C CD    1 
ATOM   5906  N  NE    . ARG G 2 90  ? 31.974  -21.535 245.854 1.00 81.42  ? 91   ARG C NE    1 
ATOM   5907  C  CZ    . ARG G 2 90  ? 31.848  -22.807 245.484 1.00 85.42  ? 91   ARG C CZ    1 
ATOM   5908  N  NH1   . ARG G 2 90  ? 31.319  -23.697 246.312 1.00 79.04  ? 91   ARG C NH1   1 
ATOM   5909  N  NH2   . ARG G 2 90  ? 32.248  -23.188 244.275 1.00 88.00  ? 91   ARG C NH2   1 
ATOM   5910  N  N     . GLY G 2 91  ? 30.745  -18.809 250.935 1.00 75.11  ? 92   GLY C N     1 
ATOM   5911  C  CA    . GLY G 2 91  ? 29.971  -18.030 251.886 1.00 81.59  ? 92   GLY C CA    1 
ATOM   5912  C  C     . GLY G 2 91  ? 30.287  -18.396 253.323 1.00 82.73  ? 92   GLY C C     1 
ATOM   5913  O  O     . GLY G 2 91  ? 30.873  -19.445 253.585 1.00 91.27  ? 92   GLY C O     1 
ATOM   5914  N  N     . LYS G 2 92  ? 29.906  -17.535 254.260 1.00 77.03  ? 93   LYS C N     1 
ATOM   5915  C  CA    . LYS G 2 92  ? 30.165  -17.798 255.670 1.00 75.93  ? 93   LYS C CA    1 
ATOM   5916  C  C     . LYS G 2 92  ? 29.587  -19.146 256.094 1.00 72.94  ? 93   LYS C C     1 
ATOM   5917  O  O     . LYS G 2 92  ? 30.189  -19.867 256.890 1.00 70.18  ? 93   LYS C O     1 
ATOM   5918  C  CB    . LYS G 2 92  ? 29.565  -16.686 256.537 1.00 76.08  ? 93   LYS C CB    1 
ATOM   5919  N  N     . ALA G 2 93  ? 28.421  -19.476 255.549 1.00 67.29  ? 94   ALA C N     1 
ATOM   5920  C  CA    . ALA G 2 93  ? 27.733  -20.724 255.858 1.00 64.84  ? 94   ALA C CA    1 
ATOM   5921  C  C     . ALA G 2 93  ? 28.378  -21.897 255.140 1.00 70.61  ? 94   ALA C C     1 
ATOM   5922  O  O     . ALA G 2 93  ? 28.367  -23.028 255.631 1.00 70.39  ? 94   ALA C O     1 
ATOM   5923  C  CB    . ALA G 2 93  ? 26.266  -20.617 255.460 1.00 50.91  ? 94   ALA C CB    1 
ATOM   5924  N  N     . ALA G 2 94  ? 28.928  -21.614 253.965 1.00 81.95  ? 95   ALA C N     1 
ATOM   5925  C  CA    . ALA G 2 94  ? 29.581  -22.623 253.142 1.00 87.90  ? 95   ALA C CA    1 
ATOM   5926  C  C     . ALA G 2 94  ? 30.887  -23.075 253.782 1.00 90.94  ? 95   ALA C C     1 
ATOM   5927  O  O     . ALA G 2 94  ? 31.115  -24.271 253.977 1.00 90.97  ? 95   ALA C O     1 
ATOM   5928  C  CB    . ALA G 2 94  ? 29.848  -22.055 251.755 1.00 90.51  ? 95   ALA C CB    1 
ATOM   5929  N  N     . THR G 2 95  ? 31.739  -22.108 254.104 1.00 91.57  ? 96   THR C N     1 
ATOM   5930  C  CA    . THR G 2 95  ? 33.026  -22.392 254.721 1.00 94.64  ? 96   THR C CA    1 
ATOM   5931  C  C     . THR G 2 95  ? 32.853  -22.692 256.211 1.00 98.54  ? 96   THR C C     1 
ATOM   5932  O  O     . THR G 2 95  ? 33.789  -22.543 256.998 1.00 100.97 ? 96   THR C O     1 
ATOM   5933  C  CB    . THR G 2 95  ? 33.995  -21.201 254.554 1.00 91.20  ? 96   THR C CB    1 
ATOM   5934  O  OG1   . THR G 2 95  ? 33.511  -20.080 255.302 1.00 88.52  ? 96   THR C OG1   1 
ATOM   5935  C  CG2   . THR G 2 95  ? 34.110  -20.808 253.087 1.00 89.17  ? 96   THR C CG2   1 
ATOM   5936  N  N     . GLU G 2 96  ? 31.653  -23.120 256.592 1.00 101.05 ? 97   GLU C N     1 
ATOM   5937  C  CA    . GLU G 2 96  ? 31.359  -23.437 257.987 1.00 103.60 ? 97   GLU C CA    1 
ATOM   5938  C  C     . GLU G 2 96  ? 30.952  -24.892 258.141 1.00 104.47 ? 97   GLU C C     1 
ATOM   5939  O  O     . GLU G 2 96  ? 31.281  -25.540 259.136 1.00 102.82 ? 97   GLU C O     1 
ATOM   5940  C  CB    . GLU G 2 96  ? 30.233  -22.544 258.514 1.00 105.48 ? 97   GLU C CB    1 
ATOM   5941  N  N     . ASN G 2 97  ? 30.232  -25.398 257.147 1.00 103.25 ? 98   ASN C N     1 
ATOM   5942  C  CA    . ASN G 2 97  ? 29.769  -26.773 257.168 1.00 102.41 ? 98   ASN C CA    1 
ATOM   5943  C  C     . ASN G 2 97  ? 30.597  -27.655 256.231 1.00 101.49 ? 98   ASN C C     1 
ATOM   5944  O  O     . ASN G 2 97  ? 30.196  -28.768 255.898 1.00 104.60 ? 98   ASN C O     1 
ATOM   5945  C  CB    . ASN G 2 97  ? 28.283  -26.831 256.782 1.00 104.98 ? 98   ASN C CB    1 
ATOM   5946  C  CG    . ASN G 2 97  ? 27.387  -26.039 257.740 1.00 102.54 ? 98   ASN C CG    1 
ATOM   5947  O  OD1   . ASN G 2 97  ? 26.166  -26.023 257.591 1.00 102.81 ? 98   ASN C OD1   1 
ATOM   5948  N  ND2   . ASN G 2 97  ? 27.993  -25.382 258.720 1.00 102.93 ? 98   ASN C ND2   1 
ATOM   5949  N  N     . TRP G 2 98  ? 31.754  -27.155 255.809 1.00 101.26 ? 99   TRP C N     1 
ATOM   5950  C  CA    . TRP G 2 98  ? 32.633  -27.914 254.926 1.00 107.47 ? 99   TRP C CA    1 
ATOM   5951  C  C     . TRP G 2 98  ? 33.096  -29.190 255.630 1.00 111.26 ? 99   TRP C C     1 
ATOM   5952  O  O     . TRP G 2 98  ? 33.284  -29.195 256.845 1.00 114.76 ? 99   TRP C O     1 
ATOM   5953  C  CB    . TRP G 2 98  ? 33.861  -27.079 254.554 1.00 112.86 ? 99   TRP C CB    1 
ATOM   5954  C  CG    . TRP G 2 98  ? 34.837  -27.813 253.674 1.00 120.18 ? 99   TRP C CG    1 
ATOM   5955  C  CD1   . TRP G 2 98  ? 34.827  -27.873 252.308 1.00 121.03 ? 99   TRP C CD1   1 
ATOM   5956  C  CD2   . TRP G 2 98  ? 35.927  -28.641 254.103 1.00 122.36 ? 99   TRP C CD2   1 
ATOM   5957  N  NE1   . TRP G 2 98  ? 35.839  -28.689 251.860 1.00 119.72 ? 99   TRP C NE1   1 
ATOM   5958  C  CE2   . TRP G 2 98  ? 36.528  -29.175 252.940 1.00 122.63 ? 99   TRP C CE2   1 
ATOM   5959  C  CE3   . TRP G 2 98  ? 36.449  -28.989 255.357 1.00 122.09 ? 99   TRP C CE3   1 
ATOM   5960  C  CZ2   . TRP G 2 98  ? 37.630  -30.036 252.994 1.00 123.92 ? 99   TRP C CZ2   1 
ATOM   5961  C  CZ3   . TRP G 2 98  ? 37.545  -29.847 255.410 1.00 123.85 ? 99   TRP C CZ3   1 
ATOM   5962  C  CH2   . TRP G 2 98  ? 38.122  -30.361 254.233 1.00 124.83 ? 99   TRP C CH2   1 
ATOM   5963  N  N     . SER G 2 99  ? 33.282  -30.267 254.870 1.00 112.66 ? 100  SER C N     1 
ATOM   5964  C  CA    . SER G 2 99  ? 33.744  -31.537 255.433 1.00 114.84 ? 100  SER C CA    1 
ATOM   5965  C  C     . SER G 2 99  ? 34.033  -32.556 254.336 1.00 113.61 ? 100  SER C C     1 
ATOM   5966  O  O     . SER G 2 99  ? 33.751  -32.319 253.164 1.00 109.03 ? 100  SER C O     1 
ATOM   5967  C  CB    . SER G 2 99  ? 32.700  -32.116 256.393 1.00 118.76 ? 100  SER C CB    1 
ATOM   5968  O  OG    . SER G 2 99  ? 31.532  -32.517 255.698 1.00 128.46 ? 100  SER C OG    1 
ATOM   5969  N  N     . ILE G 2 100 ? 34.597  -33.694 254.721 1.00 115.68 ? 101  ILE C N     1 
ATOM   5970  C  CA    . ILE G 2 100 ? 34.910  -34.736 253.755 1.00 118.53 ? 101  ILE C CA    1 
ATOM   5971  C  C     . ILE G 2 100 ? 33.624  -35.237 253.110 1.00 117.14 ? 101  ILE C C     1 
ATOM   5972  O  O     . ILE G 2 100 ? 33.568  -35.452 251.900 1.00 115.15 ? 101  ILE C O     1 
ATOM   5973  C  CB    . ILE G 2 100 ? 35.633  -35.932 254.417 1.00 120.03 ? 101  ILE C CB    1 
ATOM   5974  C  CG1   . ILE G 2 100 ? 36.999  -35.492 254.953 1.00 118.22 ? 101  ILE C CG1   1 
ATOM   5975  C  CG2   . ILE G 2 100 ? 35.796  -37.063 253.412 1.00 121.11 ? 101  ILE C CG2   1 
ATOM   5976  C  CD1   . ILE G 2 100 ? 36.931  -34.557 256.147 1.00 115.60 ? 101  ILE C CD1   1 
ATOM   5977  N  N     . GLU G 2 101 ? 32.592  -35.421 253.927 1.00 118.82 ? 102  GLU C N     1 
ATOM   5978  C  CA    . GLU G 2 101 ? 31.304  -35.896 253.440 1.00 121.66 ? 102  GLU C CA    1 
ATOM   5979  C  C     . GLU G 2 101 ? 30.467  -34.740 252.902 1.00 122.43 ? 102  GLU C C     1 
ATOM   5980  O  O     . GLU G 2 101 ? 29.297  -34.912 252.560 1.00 122.89 ? 102  GLU C O     1 
ATOM   5981  C  CB    . GLU G 2 101 ? 30.545  -36.604 254.565 1.00 121.05 ? 102  GLU C CB    1 
ATOM   5982  N  N     . ASN G 2 102 ? 31.077  -33.561 252.828 1.00 122.04 ? 103  ASN C N     1 
ATOM   5983  C  CA    . ASN G 2 102 ? 30.396  -32.369 252.336 1.00 121.86 ? 103  ASN C CA    1 
ATOM   5984  C  C     . ASN G 2 102 ? 31.427  -31.375 251.805 1.00 120.25 ? 103  ASN C C     1 
ATOM   5985  O  O     . ASN G 2 102 ? 31.786  -30.414 252.489 1.00 122.29 ? 103  ASN C O     1 
ATOM   5986  C  CB    . ASN G 2 102 ? 29.582  -31.731 253.467 1.00 125.63 ? 103  ASN C CB    1 
ATOM   5987  C  CG    . ASN G 2 102 ? 28.773  -30.532 253.006 1.00 130.99 ? 103  ASN C CG    1 
ATOM   5988  O  OD1   . ASN G 2 102 ? 28.077  -29.894 253.801 1.00 130.55 ? 103  ASN C OD1   1 
ATOM   5989  N  ND2   . ASN G 2 102 ? 28.857  -30.219 251.717 1.00 134.65 ? 103  ASN C ND2   1 
ATOM   5990  N  N     . LEU G 2 103 ? 31.898  -31.616 250.583 1.00 114.26 ? 104  LEU C N     1 
ATOM   5991  C  CA    . LEU G 2 103 ? 32.896  -30.759 249.942 1.00 104.19 ? 104  LEU C CA    1 
ATOM   5992  C  C     . LEU G 2 103 ? 32.245  -29.572 249.237 1.00 101.42 ? 104  LEU C C     1 
ATOM   5993  O  O     . LEU G 2 103 ? 31.085  -29.240 249.493 1.00 101.07 ? 104  LEU C O     1 
ATOM   5994  C  CB    . LEU G 2 103 ? 33.694  -31.570 248.922 1.00 97.60  ? 104  LEU C CB    1 
ATOM   5995  C  CG    . LEU G 2 103 ? 34.347  -32.846 249.440 1.00 96.05  ? 104  LEU C CG    1 
ATOM   5996  C  CD1   . LEU G 2 103 ? 34.930  -33.621 248.277 1.00 96.04  ? 104  LEU C CD1   1 
ATOM   5997  C  CD2   . LEU G 2 103 ? 35.419  -32.495 250.453 1.00 96.45  ? 104  LEU C CD2   1 
ATOM   5998  N  N     . PHE G 2 104 ? 33.008  -28.934 248.352 1.00 95.03  ? 105  PHE C N     1 
ATOM   5999  C  CA    . PHE G 2 104 ? 32.525  -27.793 247.577 1.00 84.76  ? 105  PHE C CA    1 
ATOM   6000  C  C     . PHE G 2 104 ? 32.146  -28.255 246.169 1.00 80.86  ? 105  PHE C C     1 
ATOM   6001  O  O     . PHE G 2 104 ? 32.346  -29.417 245.808 1.00 71.72  ? 105  PHE C O     1 
ATOM   6002  C  CB    . PHE G 2 104 ? 33.607  -26.708 247.463 1.00 84.05  ? 105  PHE C CB    1 
ATOM   6003  C  CG    . PHE G 2 104 ? 33.797  -25.888 248.712 1.00 86.36  ? 105  PHE C CG    1 
ATOM   6004  C  CD1   . PHE G 2 104 ? 32.744  -25.151 249.245 1.00 88.68  ? 105  PHE C CD1   1 
ATOM   6005  C  CD2   . PHE G 2 104 ? 35.039  -25.831 249.342 1.00 84.06  ? 105  PHE C CD2   1 
ATOM   6006  C  CE1   . PHE G 2 104 ? 32.925  -24.368 250.387 1.00 85.50  ? 105  PHE C CE1   1 
ATOM   6007  C  CE2   . PHE G 2 104 ? 35.231  -25.053 250.484 1.00 77.92  ? 105  PHE C CE2   1 
ATOM   6008  C  CZ    . PHE G 2 104 ? 34.174  -24.320 251.007 1.00 85.96  ? 105  PHE C CZ    1 
ATOM   6009  N  N     . GLU G 2 105 ? 31.597  -27.331 245.384 1.00 82.68  ? 106  GLU C N     1 
ATOM   6010  C  CA    . GLU G 2 105 ? 31.203  -27.598 244.003 1.00 83.88  ? 106  GLU C CA    1 
ATOM   6011  C  C     . GLU G 2 105 ? 31.129  -26.308 243.196 1.00 84.62  ? 106  GLU C C     1 
ATOM   6012  O  O     . GLU G 2 105 ? 30.805  -25.251 243.734 1.00 85.72  ? 106  GLU C O     1 
ATOM   6013  C  CB    . GLU G 2 105 ? 29.854  -28.315 243.945 1.00 87.65  ? 106  GLU C CB    1 
ATOM   6014  C  CG    . GLU G 2 105 ? 29.972  -29.828 243.823 1.00 89.34  ? 106  GLU C CG    1 
ATOM   6015  C  CD    . GLU G 2 105 ? 28.647  -30.498 243.507 1.00 85.88  ? 106  GLU C CD    1 
ATOM   6016  O  OE1   . GLU G 2 105 ? 27.760  -30.522 244.387 1.00 78.05  ? 106  GLU C OE1   1 
ATOM   6017  O  OE2   . GLU G 2 105 ? 28.493  -30.995 242.370 1.00 90.15  ? 106  GLU C OE2   1 
ATOM   6018  N  N     . GLU G 2 106 ? 31.438  -26.402 241.906 1.00 86.40  ? 107  GLU C N     1 
ATOM   6019  C  CA    . GLU G 2 106 ? 31.409  -25.242 241.029 1.00 88.70  ? 107  GLU C CA    1 
ATOM   6020  C  C     . GLU G 2 106 ? 30.100  -24.489 241.217 1.00 84.26  ? 107  GLU C C     1 
ATOM   6021  O  O     . GLU G 2 106 ? 29.028  -24.997 240.892 1.00 87.58  ? 107  GLU C O     1 
ATOM   6022  C  CB    . GLU G 2 106 ? 31.557  -25.676 239.564 1.00 96.54  ? 107  GLU C CB    1 
ATOM   6023  C  CG    . GLU G 2 106 ? 31.523  -24.526 238.560 1.00 106.61 ? 107  GLU C CG    1 
ATOM   6024  C  CD    . GLU G 2 106 ? 31.816  -24.972 237.136 1.00 114.91 ? 107  GLU C CD    1 
ATOM   6025  O  OE1   . GLU G 2 106 ? 31.110  -25.873 236.635 1.00 119.71 ? 107  GLU C OE1   1 
ATOM   6026  O  OE2   . GLU G 2 106 ? 32.750  -24.415 236.514 1.00 118.02 ? 107  GLU C OE2   1 
ATOM   6027  N  N     . LYS G 2 107 ? 30.195  -23.284 241.763 1.00 75.24  ? 108  LYS C N     1 
ATOM   6028  C  CA    . LYS G 2 107 ? 29.024  -22.451 241.990 1.00 71.81  ? 108  LYS C CA    1 
ATOM   6029  C  C     . LYS G 2 107 ? 28.887  -21.528 240.779 1.00 76.21  ? 108  LYS C C     1 
ATOM   6030  O  O     . LYS G 2 107 ? 29.886  -21.019 240.264 1.00 77.95  ? 108  LYS C O     1 
ATOM   6031  C  CB    . LYS G 2 107 ? 29.210  -21.641 243.274 1.00 69.91  ? 108  LYS C CB    1 
ATOM   6032  C  CG    . LYS G 2 107 ? 27.938  -21.030 243.834 1.00 72.02  ? 108  LYS C CG    1 
ATOM   6033  C  CD    . LYS G 2 107 ? 28.231  -20.232 245.102 1.00 67.71  ? 108  LYS C CD    1 
ATOM   6034  C  CE    . LYS G 2 107 ? 26.999  -19.486 245.594 1.00 58.67  ? 108  LYS C CE    1 
ATOM   6035  N  NZ    . LYS G 2 107 ? 27.356  -18.432 246.583 1.00 45.30  ? 108  LYS C NZ    1 
ATOM   6036  N  N     . GLN G 2 108 ? 27.653  -21.317 240.327 1.00 74.29  ? 109  GLN C N     1 
ATOM   6037  C  CA    . GLN G 2 108 ? 27.383  -20.484 239.153 1.00 70.73  ? 109  GLN C CA    1 
ATOM   6038  C  C     . GLN G 2 108 ? 28.027  -19.104 239.188 1.00 65.76  ? 109  GLN C C     1 
ATOM   6039  O  O     . GLN G 2 108 ? 28.157  -18.461 238.146 1.00 69.54  ? 109  GLN C O     1 
ATOM   6040  C  CB    . GLN G 2 108 ? 25.872  -20.310 238.954 1.00 73.62  ? 109  GLN C CB    1 
ATOM   6041  C  CG    . GLN G 2 108 ? 25.473  -19.927 237.534 1.00 72.98  ? 109  GLN C CG    1 
ATOM   6042  C  CD    . GLN G 2 108 ? 24.043  -19.417 237.434 1.00 79.20  ? 109  GLN C CD    1 
ATOM   6043  O  OE1   . GLN G 2 108 ? 23.119  -20.008 237.988 1.00 86.43  ? 109  GLN C OE1   1 
ATOM   6044  N  NE2   . GLN G 2 108 ? 23.857  -18.318 236.712 1.00 75.51  ? 109  GLN C NE2   1 
ATOM   6045  N  N     . ASN G 2 109 ? 28.432  -18.645 240.371 1.00 57.88  ? 110  ASN C N     1 
ATOM   6046  C  CA    . ASN G 2 109 ? 29.033  -17.318 240.488 1.00 56.07  ? 110  ASN C CA    1 
ATOM   6047  C  C     . ASN G 2 109 ? 30.497  -17.278 240.918 1.00 60.38  ? 110  ASN C C     1 
ATOM   6048  O  O     . ASN G 2 109 ? 30.964  -16.270 241.456 1.00 62.10  ? 110  ASN C O     1 
ATOM   6049  C  CB    . ASN G 2 109 ? 28.186  -16.437 241.422 1.00 53.98  ? 110  ASN C CB    1 
ATOM   6050  C  CG    . ASN G 2 109 ? 28.232  -16.892 242.869 1.00 44.36  ? 110  ASN C CG    1 
ATOM   6051  O  OD1   . ASN G 2 109 ? 28.362  -18.075 243.153 1.00 47.49  ? 110  ASN C OD1   1 
ATOM   6052  N  ND2   . ASN G 2 109 ? 28.104  -15.949 243.790 1.00 38.30  ? 110  ASN C ND2   1 
ATOM   6053  N  N     . ASP G 2 110 ? 31.224  -18.369 240.680 1.00 62.34  ? 111  ASP C N     1 
ATOM   6054  C  CA    . ASP G 2 110 ? 32.641  -18.419 241.024 1.00 55.33  ? 111  ASP C CA    1 
ATOM   6055  C  C     . ASP G 2 110 ? 33.405  -17.447 240.160 1.00 56.93  ? 111  ASP C C     1 
ATOM   6056  O  O     . ASP G 2 110 ? 33.180  -17.362 238.953 1.00 59.38  ? 111  ASP C O     1 
ATOM   6057  C  CB    . ASP G 2 110 ? 33.213  -19.814 240.812 1.00 55.12  ? 111  ASP C CB    1 
ATOM   6058  C  CG    . ASP G 2 110 ? 32.886  -20.739 241.944 1.00 60.46  ? 111  ASP C CG    1 
ATOM   6059  O  OD1   . ASP G 2 110 ? 32.723  -20.232 243.077 1.00 57.93  ? 111  ASP C OD1   1 
ATOM   6060  O  OD2   . ASP G 2 110 ? 32.810  -21.968 241.711 1.00 60.58  ? 111  ASP C OD2   1 
ATOM   6061  N  N     . THR G 2 111 ? 34.328  -16.733 240.784 1.00 58.19  ? 112  THR C N     1 
ATOM   6062  C  CA    . THR G 2 111 ? 35.133  -15.748 240.085 1.00 61.43  ? 112  THR C CA    1 
ATOM   6063  C  C     . THR G 2 111 ? 35.984  -16.305 238.934 1.00 60.94  ? 112  THR C C     1 
ATOM   6064  O  O     . THR G 2 111 ? 36.331  -15.568 238.014 1.00 59.23  ? 112  THR C O     1 
ATOM   6065  C  CB    . THR G 2 111 ? 36.032  -15.001 241.084 1.00 59.57  ? 112  THR C CB    1 
ATOM   6066  O  OG1   . THR G 2 111 ? 35.214  -14.449 242.121 1.00 59.42  ? 112  THR C OG1   1 
ATOM   6067  C  CG2   . THR G 2 111 ? 36.766  -13.870 240.400 1.00 60.60  ? 112  THR C CG2   1 
ATOM   6068  N  N     . ALA G 2 112 ? 36.310  -17.594 238.958 1.00 59.04  ? 113  ALA C N     1 
ATOM   6069  C  CA    . ALA G 2 112 ? 37.123  -18.145 237.877 1.00 62.21  ? 113  ALA C CA    1 
ATOM   6070  C  C     . ALA G 2 112 ? 36.728  -19.545 237.436 1.00 63.88  ? 113  ALA C C     1 
ATOM   6071  O  O     . ALA G 2 112 ? 36.153  -20.308 238.206 1.00 67.16  ? 113  ALA C O     1 
ATOM   6072  C  CB    . ALA G 2 112 ? 38.595  -18.128 238.268 1.00 67.19  ? 113  ALA C CB    1 
ATOM   6073  N  N     . ASP G 2 113 ? 37.042  -19.860 236.180 1.00 69.31  ? 114  ASP C N     1 
ATOM   6074  C  CA    . ASP G 2 113 ? 36.754  -21.159 235.581 1.00 71.12  ? 114  ASP C CA    1 
ATOM   6075  C  C     . ASP G 2 113 ? 37.855  -22.135 235.951 1.00 74.75  ? 114  ASP C C     1 
ATOM   6076  O  O     . ASP G 2 113 ? 37.600  -23.187 236.537 1.00 76.22  ? 114  ASP C O     1 
ATOM   6077  C  CB    . ASP G 2 113 ? 36.706  -21.061 234.053 1.00 72.46  ? 114  ASP C CB    1 
ATOM   6078  C  CG    . ASP G 2 113 ? 35.434  -20.417 233.536 1.00 76.33  ? 114  ASP C CG    1 
ATOM   6079  O  OD1   . ASP G 2 113 ? 34.347  -21.003 233.736 1.00 79.08  ? 114  ASP C OD1   1 
ATOM   6080  O  OD2   . ASP G 2 113 ? 35.527  -19.330 232.917 1.00 68.30  ? 114  ASP C OD2   1 
ATOM   6081  N  N     . ILE G 2 114 ? 39.083  -21.788 235.580 1.00 77.61  ? 115  ILE C N     1 
ATOM   6082  C  CA    . ILE G 2 114 ? 40.235  -22.635 235.868 1.00 85.96  ? 115  ILE C CA    1 
ATOM   6083  C  C     . ILE G 2 114 ? 41.314  -21.818 236.567 1.00 88.68  ? 115  ILE C C     1 
ATOM   6084  O  O     . ILE G 2 114 ? 41.429  -20.614 236.343 1.00 87.14  ? 115  ILE C O     1 
ATOM   6085  C  CB    . ILE G 2 114 ? 40.830  -23.248 234.568 1.00 83.83  ? 115  ILE C CB    1 
ATOM   6086  C  CG1   . ILE G 2 114 ? 39.723  -23.896 233.736 1.00 85.46  ? 115  ILE C CG1   1 
ATOM   6087  C  CG2   . ILE G 2 114 ? 41.855  -24.312 234.912 1.00 81.00  ? 115  ILE C CG2   1 
ATOM   6088  C  CD1   . ILE G 2 114 ? 38.933  -24.949 234.479 1.00 85.01  ? 115  ILE C CD1   1 
ATOM   6089  N  N     . LEU G 2 115 ? 42.088  -22.471 237.429 1.00 91.35  ? 116  LEU C N     1 
ATOM   6090  C  CA    . LEU G 2 115 ? 43.166  -21.800 238.147 1.00 93.60  ? 116  LEU C CA    1 
ATOM   6091  C  C     . LEU G 2 115 ? 44.487  -22.558 238.059 1.00 92.98  ? 116  LEU C C     1 
ATOM   6092  O  O     . LEU G 2 115 ? 44.511  -23.783 237.942 1.00 87.93  ? 116  LEU C O     1 
ATOM   6093  C  CB    . LEU G 2 115 ? 42.796  -21.596 239.621 1.00 98.27  ? 116  LEU C CB    1 
ATOM   6094  C  CG    . LEU G 2 115 ? 41.923  -20.392 240.002 1.00 98.40  ? 116  LEU C CG    1 
ATOM   6095  C  CD1   . LEU G 2 115 ? 40.529  -20.551 239.427 1.00 101.31 ? 116  LEU C CD1   1 
ATOM   6096  C  CD2   . LEU G 2 115 ? 41.859  -20.279 241.519 1.00 97.39  ? 116  LEU C CD2   1 
ATOM   6097  N  N     . LEU G 2 116 ? 45.583  -21.806 238.108 1.00 97.37  ? 117  LEU C N     1 
ATOM   6098  C  CA    . LEU G 2 116 ? 46.930  -22.361 238.047 1.00 99.07  ? 117  LEU C CA    1 
ATOM   6099  C  C     . LEU G 2 116 ? 47.784  -21.618 239.067 1.00 102.53 ? 117  LEU C C     1 
ATOM   6100  O  O     . LEU G 2 116 ? 47.852  -20.386 239.049 1.00 94.17  ? 117  LEU C O     1 
ATOM   6101  C  CB    . LEU G 2 116 ? 47.512  -22.171 236.649 1.00 99.91  ? 117  LEU C CB    1 
ATOM   6102  C  CG    . LEU G 2 116 ? 46.658  -22.695 235.492 1.00 98.17  ? 117  LEU C CG    1 
ATOM   6103  C  CD1   . LEU G 2 116 ? 47.262  -22.238 234.179 1.00 97.07  ? 117  LEU C CD1   1 
ATOM   6104  C  CD2   . LEU G 2 116 ? 46.562  -24.208 235.550 1.00 94.21  ? 117  LEU C CD2   1 
ATOM   6105  N  N     . VAL G 2 117 ? 48.441  -22.369 239.948 1.00 110.81 ? 118  VAL C N     1 
ATOM   6106  C  CA    . VAL G 2 117 ? 49.263  -21.770 240.995 1.00 118.41 ? 118  VAL C CA    1 
ATOM   6107  C  C     . VAL G 2 117 ? 50.631  -22.432 241.202 1.00 122.52 ? 118  VAL C C     1 
ATOM   6108  O  O     . VAL G 2 117 ? 50.763  -23.654 241.141 1.00 121.92 ? 118  VAL C O     1 
ATOM   6109  C  CB    . VAL G 2 117 ? 48.494  -21.773 242.333 1.00 117.55 ? 118  VAL C CB    1 
ATOM   6110  C  CG1   . VAL G 2 117 ? 48.111  -23.197 242.705 1.00 118.32 ? 118  VAL C CG1   1 
ATOM   6111  C  CG2   . VAL G 2 117 ? 49.337  -21.135 243.423 1.00 122.32 ? 118  VAL C CG2   1 
ATOM   6112  N  N     . LYS G 2 118 ? 51.638  -21.599 241.458 1.00 126.81 ? 119  LYS C N     1 
ATOM   6113  C  CA    . LYS G 2 118 ? 53.011  -22.048 241.683 1.00 129.97 ? 119  LYS C CA    1 
ATOM   6114  C  C     . LYS G 2 118 ? 53.855  -20.838 242.100 1.00 134.65 ? 119  LYS C C     1 
ATOM   6115  O  O     . LYS G 2 118 ? 53.730  -19.759 241.518 1.00 137.50 ? 119  LYS C O     1 
ATOM   6116  C  CB    . LYS G 2 118 ? 53.565  -22.682 240.399 1.00 124.81 ? 119  LYS C CB    1 
ATOM   6117  C  CG    . LYS G 2 118 ? 54.968  -23.272 240.503 1.00 120.80 ? 119  LYS C CG    1 
ATOM   6118  C  CD    . LYS G 2 118 ? 56.053  -22.213 240.337 1.00 117.19 ? 119  LYS C CD    1 
ATOM   6119  C  CE    . LYS G 2 118 ? 57.445  -22.833 240.383 1.00 113.27 ? 119  LYS C CE    1 
ATOM   6120  N  NZ    . LYS G 2 118 ? 58.525  -21.849 240.087 1.00 101.67 ? 119  LYS C NZ    1 
ATOM   6121  N  N     . ASP G 2 119 ? 54.704  -21.023 243.110 1.00 137.82 ? 120  ASP C N     1 
ATOM   6122  C  CA    . ASP G 2 119 ? 55.566  -19.957 243.630 1.00 139.65 ? 120  ASP C CA    1 
ATOM   6123  C  C     . ASP G 2 119 ? 54.734  -18.837 244.261 1.00 137.70 ? 120  ASP C C     1 
ATOM   6124  O  O     . ASP G 2 119 ? 54.997  -17.650 244.051 1.00 137.92 ? 120  ASP C O     1 
ATOM   6125  C  CB    . ASP G 2 119 ? 56.455  -19.386 242.515 1.00 146.42 ? 120  ASP C CB    1 
ATOM   6126  C  CG    . ASP G 2 119 ? 57.489  -18.394 243.035 1.00 150.90 ? 120  ASP C CG    1 
ATOM   6127  O  OD1   . ASP G 2 119 ? 58.302  -18.776 243.906 1.00 151.47 ? 120  ASP C OD1   1 
ATOM   6128  O  OD2   . ASP G 2 119 ? 57.490  -17.233 242.570 1.00 154.25 ? 120  ASP C OD2   1 
ATOM   6129  N  N     . GLN G 2 120 ? 53.732  -19.236 245.040 1.00 132.99 ? 121  GLN C N     1 
ATOM   6130  C  CA    . GLN G 2 120 ? 52.840  -18.302 245.720 1.00 127.84 ? 121  GLN C CA    1 
ATOM   6131  C  C     . GLN G 2 120 ? 52.301  -17.241 244.762 1.00 124.23 ? 121  GLN C C     1 
ATOM   6132  O  O     . GLN G 2 120 ? 52.388  -16.041 245.027 1.00 120.00 ? 121  GLN C O     1 
ATOM   6133  C  CB    . GLN G 2 120 ? 53.569  -17.628 246.882 1.00 127.00 ? 121  GLN C CB    1 
ATOM   6134  C  CG    . GLN G 2 120 ? 52.637  -17.046 247.929 1.00 129.91 ? 121  GLN C CG    1 
ATOM   6135  C  CD    . GLN G 2 120 ? 51.818  -18.114 248.632 1.00 130.42 ? 121  GLN C CD    1 
ATOM   6136  O  OE1   . GLN G 2 120 ? 52.369  -19.030 249.238 1.00 131.81 ? 121  GLN C OE1   1 
ATOM   6137  N  NE2   . GLN G 2 120 ? 50.498  -18.000 248.557 1.00 129.44 ? 121  GLN C NE2   1 
ATOM   6138  N  N     . PHE G 2 121 ? 51.746  -17.701 243.645 1.00 121.73 ? 122  PHE C N     1 
ATOM   6139  C  CA    . PHE G 2 121 ? 51.181  -16.822 242.628 1.00 118.08 ? 122  PHE C CA    1 
ATOM   6140  C  C     . PHE G 2 121 ? 50.000  -17.525 241.969 1.00 113.78 ? 122  PHE C C     1 
ATOM   6141  O  O     . PHE G 2 121 ? 50.090  -18.704 241.615 1.00 111.62 ? 122  PHE C O     1 
ATOM   6142  C  CB    . PHE G 2 121 ? 52.229  -16.504 241.567 1.00 125.72 ? 122  PHE C CB    1 
ATOM   6143  C  CG    . PHE G 2 121 ? 51.795  -15.458 240.587 1.00 132.04 ? 122  PHE C CG    1 
ATOM   6144  C  CD1   . PHE G 2 121 ? 51.673  -14.131 240.984 1.00 134.46 ? 122  PHE C CD1   1 
ATOM   6145  C  CD2   . PHE G 2 121 ? 51.518  -15.793 239.264 1.00 132.92 ? 122  PHE C CD2   1 
ATOM   6146  C  CE1   . PHE G 2 121 ? 51.285  -13.150 240.079 1.00 136.74 ? 122  PHE C CE1   1 
ATOM   6147  C  CE2   . PHE G 2 121 ? 51.128  -14.818 238.349 1.00 135.15 ? 122  PHE C CE2   1 
ATOM   6148  C  CZ    . PHE G 2 121 ? 51.012  -13.493 238.758 1.00 137.20 ? 122  PHE C CZ    1 
ATOM   6149  N  N     . TYR G 2 122 ? 48.899  -16.800 241.786 1.00 107.68 ? 123  TYR C N     1 
ATOM   6150  C  CA    . TYR G 2 122 ? 47.709  -17.392 241.181 1.00 98.72  ? 123  TYR C CA    1 
ATOM   6151  C  C     . TYR G 2 122 ? 47.297  -16.779 239.844 1.00 86.17  ? 123  TYR C C     1 
ATOM   6152  O  O     . TYR G 2 122 ? 47.364  -15.566 239.648 1.00 67.47  ? 123  TYR C O     1 
ATOM   6153  C  CB    . TYR G 2 122 ? 46.524  -17.310 242.154 1.00 105.05 ? 123  TYR C CB    1 
ATOM   6154  C  CG    . TYR G 2 122 ? 46.787  -17.907 243.519 1.00 105.57 ? 123  TYR C CG    1 
ATOM   6155  C  CD1   . TYR G 2 122 ? 47.498  -17.197 244.486 1.00 106.02 ? 123  TYR C CD1   1 
ATOM   6156  C  CD2   . TYR G 2 122 ? 46.339  -19.191 243.839 1.00 105.76 ? 123  TYR C CD2   1 
ATOM   6157  C  CE1   . TYR G 2 122 ? 47.757  -17.748 245.737 1.00 112.98 ? 123  TYR C CE1   1 
ATOM   6158  C  CE2   . TYR G 2 122 ? 46.593  -19.754 245.087 1.00 110.52 ? 123  TYR C CE2   1 
ATOM   6159  C  CZ    . TYR G 2 122 ? 47.304  -19.028 246.033 1.00 114.80 ? 123  TYR C CZ    1 
ATOM   6160  O  OH    . TYR G 2 122 ? 47.572  -19.579 247.271 1.00 119.21 ? 123  TYR C OH    1 
ATOM   6161  N  N     . GLU G 2 123 ? 46.867  -17.644 238.931 1.00 81.63  ? 124  GLU C N     1 
ATOM   6162  C  CA    . GLU G 2 123 ? 46.409  -17.223 237.615 1.00 79.17  ? 124  GLU C CA    1 
ATOM   6163  C  C     . GLU G 2 123 ? 44.972  -17.703 237.427 1.00 71.32  ? 124  GLU C C     1 
ATOM   6164  O  O     . GLU G 2 123 ? 44.726  -18.883 237.172 1.00 60.56  ? 124  GLU C O     1 
ATOM   6165  C  CB    . GLU G 2 123 ? 47.291  -17.818 236.523 1.00 87.71  ? 124  GLU C CB    1 
ATOM   6166  C  CG    . GLU G 2 123 ? 47.082  -17.169 235.169 1.00 98.67  ? 124  GLU C CG    1 
ATOM   6167  C  CD    . GLU G 2 123 ? 47.711  -17.956 234.038 1.00 108.12 ? 124  GLU C CD    1 
ATOM   6168  O  OE1   . GLU G 2 123 ? 47.755  -17.430 232.904 1.00 110.42 ? 124  GLU C OE1   1 
ATOM   6169  O  OE2   . GLU G 2 123 ? 48.151  -19.102 234.283 1.00 112.16 ? 124  GLU C OE2   1 
ATOM   6170  N  N     . LEU G 2 124 ? 44.033  -16.774 237.567 1.00 67.20  ? 125  LEU C N     1 
ATOM   6171  C  CA    . LEU G 2 124 ? 42.609  -17.057 237.434 1.00 65.90  ? 125  LEU C CA    1 
ATOM   6172  C  C     . LEU G 2 124 ? 42.196  -17.035 235.965 1.00 67.02  ? 125  LEU C C     1 
ATOM   6173  O  O     . LEU G 2 124 ? 42.179  -15.974 235.335 1.00 71.03  ? 125  LEU C O     1 
ATOM   6174  C  CB    . LEU G 2 124 ? 41.807  -16.006 238.210 1.00 64.67  ? 125  LEU C CB    1 
ATOM   6175  C  CG    . LEU G 2 124 ? 42.235  -15.760 239.660 1.00 54.91  ? 125  LEU C CG    1 
ATOM   6176  C  CD1   . LEU G 2 124 ? 41.517  -14.551 240.240 1.00 54.25  ? 125  LEU C CD1   1 
ATOM   6177  C  CD2   . LEU G 2 124 ? 41.954  -17.002 240.469 1.00 50.75  ? 125  LEU C CD2   1 
ATOM   6178  N  N     . LEU G 2 125 ? 41.862  -18.205 235.427 1.00 65.01  ? 126  LEU C N     1 
ATOM   6179  C  CA    . LEU G 2 125 ? 41.454  -18.323 234.028 1.00 66.32  ? 126  LEU C CA    1 
ATOM   6180  C  C     . LEU G 2 125 ? 39.934  -18.236 233.863 1.00 68.13  ? 126  LEU C C     1 
ATOM   6181  O  O     . LEU G 2 125 ? 39.181  -18.844 234.628 1.00 67.70  ? 126  LEU C O     1 
ATOM   6182  C  CB    . LEU G 2 125 ? 41.957  -19.648 233.431 1.00 58.79  ? 126  LEU C CB    1 
ATOM   6183  C  CG    . LEU G 2 125 ? 41.717  -19.800 231.921 1.00 51.14  ? 126  LEU C CG    1 
ATOM   6184  C  CD1   . LEU G 2 125 ? 42.521  -18.731 231.209 1.00 42.06  ? 126  LEU C CD1   1 
ATOM   6185  C  CD2   . LEU G 2 125 ? 42.110  -21.184 231.426 1.00 37.99  ? 126  LEU C CD2   1 
ATOM   6186  N  N     . ASP G 2 126 ? 39.498  -17.484 232.853 1.00 65.36  ? 127  ASP C N     1 
ATOM   6187  C  CA    . ASP G 2 126 ? 38.078  -17.295 232.564 1.00 64.65  ? 127  ASP C CA    1 
ATOM   6188  C  C     . ASP G 2 126 ? 37.857  -17.525 231.072 1.00 61.25  ? 127  ASP C C     1 
ATOM   6189  O  O     . ASP G 2 126 ? 38.229  -16.694 230.248 1.00 63.38  ? 127  ASP C O     1 
ATOM   6190  C  CB    . ASP G 2 126 ? 37.661  -15.867 232.931 1.00 63.16  ? 127  ASP C CB    1 
ATOM   6191  C  CG    . ASP G 2 126 ? 36.149  -15.680 232.983 1.00 62.43  ? 127  ASP C CG    1 
ATOM   6192  O  OD1   . ASP G 2 126 ? 35.433  -16.298 232.165 1.00 53.26  ? 127  ASP C OD1   1 
ATOM   6193  O  OD2   . ASP G 2 126 ? 35.683  -14.890 233.838 1.00 55.88  ? 127  ASP C OD2   1 
ATOM   6194  N  N     . VAL G 2 127 ? 37.252  -18.652 230.721 1.00 54.35  ? 128  VAL C N     1 
ATOM   6195  C  CA    . VAL G 2 127 ? 37.009  -18.964 229.317 1.00 53.35  ? 128  VAL C CA    1 
ATOM   6196  C  C     . VAL G 2 127 ? 35.781  -18.231 228.774 1.00 54.44  ? 128  VAL C C     1 
ATOM   6197  O  O     . VAL G 2 127 ? 34.727  -18.226 229.406 1.00 62.90  ? 128  VAL C O     1 
ATOM   6198  C  CB    . VAL G 2 127 ? 36.790  -20.476 229.131 1.00 48.52  ? 128  VAL C CB    1 
ATOM   6199  C  CG1   . VAL G 2 127 ? 36.796  -20.822 227.661 1.00 41.20  ? 128  VAL C CG1   1 
ATOM   6200  C  CG2   . VAL G 2 127 ? 37.851  -21.250 229.881 1.00 51.86  ? 128  VAL C CG2   1 
ATOM   6201  N  N     . LYS G 2 128 ? 35.909  -17.614 227.605 1.00 53.30  ? 129  LYS C N     1 
ATOM   6202  C  CA    . LYS G 2 128 ? 34.777  -16.908 227.006 1.00 55.66  ? 129  LYS C CA    1 
ATOM   6203  C  C     . LYS G 2 128 ? 34.576  -17.421 225.586 1.00 56.09  ? 129  LYS C C     1 
ATOM   6204  O  O     . LYS G 2 128 ? 35.345  -17.075 224.697 1.00 57.04  ? 129  LYS C O     1 
ATOM   6205  C  CB    . LYS G 2 128 ? 35.036  -15.404 226.942 1.00 47.14  ? 129  LYS C CB    1 
ATOM   6206  C  CG    . LYS G 2 128 ? 35.918  -14.882 228.040 1.00 46.84  ? 129  LYS C CG    1 
ATOM   6207  C  CD    . LYS G 2 128 ? 35.230  -14.894 229.370 1.00 45.52  ? 129  LYS C CD    1 
ATOM   6208  C  CE    . LYS G 2 128 ? 34.798  -13.487 229.744 1.00 56.74  ? 129  LYS C CE    1 
ATOM   6209  N  NZ    . LYS G 2 128 ? 34.216  -13.423 231.123 1.00 50.87  ? 129  LYS C NZ    1 
ATOM   6210  N  N     . THR G 2 129 ? 33.545  -18.238 225.378 1.00 56.33  ? 130  THR C N     1 
ATOM   6211  C  CA    . THR G 2 129 ? 33.250  -18.794 224.057 1.00 53.19  ? 130  THR C CA    1 
ATOM   6212  C  C     . THR G 2 129 ? 32.387  -17.831 223.237 1.00 59.44  ? 130  THR C C     1 
ATOM   6213  O  O     . THR G 2 129 ? 31.612  -17.059 223.801 1.00 55.25  ? 130  THR C O     1 
ATOM   6214  C  CB    . THR G 2 129 ? 32.493  -20.107 224.169 1.00 48.40  ? 130  THR C CB    1 
ATOM   6215  O  OG1   . THR G 2 129 ? 31.187  -19.851 224.697 1.00 50.82  ? 130  THR C OG1   1 
ATOM   6216  C  CG2   . THR G 2 129 ? 33.233  -21.064 225.077 1.00 34.66  ? 130  THR C CG2   1 
ATOM   6217  N  N     . ARG G 2 130 ? 32.514  -17.887 221.910 1.00 61.74  ? 131  ARG C N     1 
ATOM   6218  C  CA    . ARG G 2 130 ? 31.751  -16.994 221.035 1.00 62.69  ? 131  ARG C CA    1 
ATOM   6219  C  C     . ARG G 2 130 ? 31.307  -17.613 219.724 1.00 62.80  ? 131  ARG C C     1 
ATOM   6220  O  O     . ARG G 2 130 ? 32.019  -18.416 219.137 1.00 68.60  ? 131  ARG C O     1 
ATOM   6221  C  CB    . ARG G 2 130 ? 32.567  -15.739 220.739 1.00 59.25  ? 131  ARG C CB    1 
ATOM   6222  C  CG    . ARG G 2 130 ? 31.893  -14.751 219.803 1.00 64.38  ? 131  ARG C CG    1 
ATOM   6223  C  CD    . ARG G 2 130 ? 32.324  -13.321 220.146 1.00 70.48  ? 131  ARG C CD    1 
ATOM   6224  N  NE    . ARG G 2 130 ? 33.761  -13.134 219.993 1.00 65.14  ? 131  ARG C NE    1 
ATOM   6225  C  CZ    . ARG G 2 130 ? 34.321  -12.462 218.994 1.00 59.26  ? 131  ARG C CZ    1 
ATOM   6226  N  NH1   . ARG G 2 130 ? 33.558  -11.905 218.063 1.00 33.74  ? 131  ARG C NH1   1 
ATOM   6227  N  NH2   . ARG G 2 130 ? 35.644  -12.358 218.919 1.00 63.15  ? 131  ARG C NH2   1 
ATOM   6228  N  N     . ASN G 2 131 ? 30.115  -17.233 219.279 1.00 63.85  ? 132  ASN C N     1 
ATOM   6229  C  CA    . ASN G 2 131 ? 29.562  -17.725 218.025 1.00 66.05  ? 132  ASN C CA    1 
ATOM   6230  C  C     . ASN G 2 131 ? 30.016  -16.770 216.928 1.00 68.04  ? 132  ASN C C     1 
ATOM   6231  O  O     . ASN G 2 131 ? 29.538  -15.640 216.849 1.00 75.09  ? 132  ASN C O     1 
ATOM   6232  C  CB    . ASN G 2 131 ? 28.034  -17.741 218.098 1.00 60.67  ? 132  ASN C CB    1 
ATOM   6233  C  CG    . ASN G 2 131 ? 27.387  -18.064 216.765 1.00 60.42  ? 132  ASN C CG    1 
ATOM   6234  O  OD1   . ASN G 2 131 ? 27.129  -19.222 216.450 1.00 54.75  ? 132  ASN C OD1   1 
ATOM   6235  N  ND2   . ASN G 2 131 ? 27.133  -17.033 215.967 1.00 59.22  ? 132  ASN C ND2   1 
ATOM   6236  N  N     . ILE G 2 132 ? 30.937  -17.217 216.084 1.00 67.97  ? 133  ILE C N     1 
ATOM   6237  C  CA    . ILE G 2 132 ? 31.443  -16.362 215.014 1.00 70.86  ? 133  ILE C CA    1 
ATOM   6238  C  C     . ILE G 2 132 ? 30.463  -16.304 213.831 1.00 67.75  ? 133  ILE C C     1 
ATOM   6239  O  O     . ILE G 2 132 ? 30.672  -15.566 212.865 1.00 53.59  ? 133  ILE C O     1 
ATOM   6240  C  CB    . ILE G 2 132 ? 32.836  -16.859 214.544 1.00 79.04  ? 133  ILE C CB    1 
ATOM   6241  C  CG1   . ILE G 2 132 ? 33.505  -15.799 213.662 1.00 84.51  ? 133  ILE C CG1   1 
ATOM   6242  C  CG2   . ILE G 2 132 ? 32.694  -18.197 213.816 1.00 72.25  ? 133  ILE C CG2   1 
ATOM   6243  C  CD1   . ILE G 2 132 ? 34.966  -16.085 213.350 1.00 92.09  ? 133  ILE C CD1   1 
ATOM   6244  N  N     . SER G 2 133 ? 29.378  -17.070 213.928 1.00 64.91  ? 134  SER C N     1 
ATOM   6245  C  CA    . SER G 2 133 ? 28.368  -17.110 212.871 1.00 67.51  ? 134  SER C CA    1 
ATOM   6246  C  C     . SER G 2 133 ? 27.627  -15.783 212.718 1.00 63.63  ? 134  SER C C     1 
ATOM   6247  O  O     . SER G 2 133 ? 26.905  -15.585 211.745 1.00 53.22  ? 134  SER C O     1 
ATOM   6248  C  CB    . SER G 2 133 ? 27.342  -18.210 213.157 1.00 78.07  ? 134  SER C CB    1 
ATOM   6249  O  OG    . SER G 2 133 ? 27.968  -19.458 213.384 1.00 80.90  ? 134  SER C OG    1 
ATOM   6250  N  N     . LYS G 2 134 ? 27.798  -14.886 213.685 1.00 66.01  ? 135  LYS C N     1 
ATOM   6251  C  CA    . LYS G 2 134 ? 27.128  -13.588 213.650 1.00 68.17  ? 135  LYS C CA    1 
ATOM   6252  C  C     . LYS G 2 134 ? 27.845  -12.546 214.516 1.00 66.20  ? 135  LYS C C     1 
ATOM   6253  O  O     . LYS G 2 134 ? 28.351  -12.864 215.594 1.00 63.44  ? 135  LYS C O     1 
ATOM   6254  C  CB    . LYS G 2 134 ? 25.679  -13.726 214.141 1.00 68.76  ? 135  LYS C CB    1 
ATOM   6255  C  CG    . LYS G 2 134 ? 25.548  -14.005 215.641 1.00 61.51  ? 135  LYS C CG    1 
ATOM   6256  C  CD    . LYS G 2 134 ? 24.083  -14.057 216.113 1.00 59.05  ? 135  LYS C CD    1 
ATOM   6257  C  CE    . LYS G 2 134 ? 23.382  -15.336 215.679 1.00 60.17  ? 135  LYS C CE    1 
ATOM   6258  N  NZ    . LYS G 2 134 ? 21.963  -15.394 216.112 1.00 49.97  ? 135  LYS C NZ    1 
ATOM   6259  N  N     . SER G 2 135 ? 27.884  -11.304 214.041 1.00 58.61  ? 136  SER C N     1 
ATOM   6260  C  CA    . SER G 2 135 ? 28.520  -10.225 214.786 1.00 53.84  ? 136  SER C CA    1 
ATOM   6261  C  C     . SER G 2 135 ? 27.641  -9.876  215.970 1.00 55.21  ? 136  SER C C     1 
ATOM   6262  O  O     . SER G 2 135 ? 26.515  -9.408  215.796 1.00 63.91  ? 136  SER C O     1 
ATOM   6263  C  CB    . SER G 2 135 ? 28.690  -8.989  213.911 1.00 50.09  ? 136  SER C CB    1 
ATOM   6264  O  OG    . SER G 2 135 ? 28.956  -7.851  214.714 1.00 50.63  ? 136  SER C OG    1 
ATOM   6265  N  N     . ALA G 2 136 ? 28.155  -10.099 217.175 1.00 53.43  ? 137  ALA C N     1 
ATOM   6266  C  CA    . ALA G 2 136 ? 27.395  -9.820  218.395 1.00 45.85  ? 137  ALA C CA    1 
ATOM   6267  C  C     . ALA G 2 136 ? 28.103  -8.843  219.318 1.00 37.86  ? 137  ALA C C     1 
ATOM   6268  O  O     . ALA G 2 136 ? 29.217  -8.408  219.042 1.00 50.17  ? 137  ALA C O     1 
ATOM   6269  C  CB    . ALA G 2 136 ? 27.120  -11.121 219.129 1.00 36.99  ? 137  ALA C CB    1 
ATOM   6270  N  N     . GLN G 2 137 ? 27.443  -8.508  220.418 1.00 42.04  ? 138  GLN C N     1 
ATOM   6271  C  CA    . GLN G 2 137 ? 27.989  -7.588  221.411 1.00 45.90  ? 138  GLN C CA    1 
ATOM   6272  C  C     . GLN G 2 137 ? 29.060  -8.299  222.230 1.00 50.21  ? 138  GLN C C     1 
ATOM   6273  O  O     . GLN G 2 137 ? 29.245  -9.514  222.102 1.00 49.42  ? 138  GLN C O     1 
ATOM   6274  C  CB    . GLN G 2 137 ? 26.872  -7.105  222.330 1.00 45.71  ? 138  GLN C CB    1 
ATOM   6275  C  CG    . GLN G 2 137 ? 27.192  -5.866  223.125 1.00 59.40  ? 138  GLN C CG    1 
ATOM   6276  C  CD    . GLN G 2 137 ? 26.125  -5.572  224.174 1.00 66.47  ? 138  GLN C CD    1 
ATOM   6277  O  OE1   . GLN G 2 137 ? 24.927  -5.596  223.885 1.00 55.54  ? 138  GLN C OE1   1 
ATOM   6278  N  NE2   . GLN G 2 137 ? 26.560  -5.291  225.399 1.00 69.94  ? 138  GLN C NE2   1 
ATOM   6279  N  N     . ALA G 2 138 ? 29.765  -7.537  223.064 1.00 52.19  ? 139  ALA C N     1 
ATOM   6280  C  CA    . ALA G 2 138 ? 30.827  -8.086  223.911 1.00 52.46  ? 139  ALA C CA    1 
ATOM   6281  C  C     . ALA G 2 138 ? 30.252  -8.853  225.099 1.00 45.68  ? 139  ALA C C     1 
ATOM   6282  O  O     . ALA G 2 138 ? 29.360  -8.373  225.784 1.00 46.66  ? 139  ALA C O     1 
ATOM   6283  C  CB    . ALA G 2 138 ? 31.732  -6.961  224.403 1.00 50.55  ? 139  ALA C CB    1 
ATOM   6284  N  N     . PRO G 2 139 ? 30.769  -10.056 225.364 1.00 47.11  ? 140  PRO C N     1 
ATOM   6285  C  CA    . PRO G 2 139 ? 30.300  -10.894 226.477 1.00 47.03  ? 140  PRO C CA    1 
ATOM   6286  C  C     . PRO G 2 139 ? 30.665  -10.347 227.857 1.00 47.18  ? 140  PRO C C     1 
ATOM   6287  O  O     . PRO G 2 139 ? 31.393  -9.357  227.972 1.00 47.57  ? 140  PRO C O     1 
ATOM   6288  C  CB    . PRO G 2 139 ? 30.970  -12.233 226.196 1.00 46.39  ? 140  PRO C CB    1 
ATOM   6289  C  CG    . PRO G 2 139 ? 32.283  -11.812 225.625 1.00 48.21  ? 140  PRO C CG    1 
ATOM   6290  C  CD    . PRO G 2 139 ? 31.894  -10.697 224.660 1.00 47.37  ? 140  PRO C CD    1 
ATOM   6291  N  N     . ASN G 2 140 ? 30.147  -10.977 228.907 1.00 41.54  ? 141  ASN C N     1 
ATOM   6292  C  CA    . ASN G 2 140 ? 30.468  -10.515 230.251 1.00 45.42  ? 141  ASN C CA    1 
ATOM   6293  C  C     . ASN G 2 140 ? 31.863  -10.997 230.634 1.00 43.86  ? 141  ASN C C     1 
ATOM   6294  O  O     . ASN G 2 140 ? 32.179  -12.178 230.536 1.00 34.92  ? 141  ASN C O     1 
ATOM   6295  C  CB    . ASN G 2 140 ? 29.442  -11.022 231.283 1.00 45.84  ? 141  ASN C CB    1 
ATOM   6296  C  CG    . ASN G 2 140 ? 28.115  -10.253 231.239 1.00 51.34  ? 141  ASN C CG    1 
ATOM   6297  O  OD1   . ASN G 2 140 ? 28.077  -9.074  230.881 1.00 45.37  ? 141  ASN C OD1   1 
ATOM   6298  N  ND2   . ASN G 2 140 ? 27.024  -10.920 231.630 1.00 38.63  ? 141  ASN C ND2   1 
ATOM   6299  N  N     . ILE G 2 141 ? 32.709  -10.079 231.066 1.00 48.59  ? 142  ILE C N     1 
ATOM   6300  C  CA    . ILE G 2 141 ? 34.051  -10.467 231.457 1.00 56.63  ? 142  ILE C CA    1 
ATOM   6301  C  C     . ILE G 2 141 ? 34.053  -10.812 232.947 1.00 54.69  ? 142  ILE C C     1 
ATOM   6302  O  O     . ILE G 2 141 ? 34.339  -11.945 233.324 1.00 52.72  ? 142  ILE C O     1 
ATOM   6303  C  CB    . ILE G 2 141 ? 35.048  -9.325  231.143 1.00 59.95  ? 142  ILE C CB    1 
ATOM   6304  C  CG1   . ILE G 2 141 ? 35.024  -9.035  229.639 1.00 61.11  ? 142  ILE C CG1   1 
ATOM   6305  C  CG2   . ILE G 2 141 ? 36.452  -9.705  231.566 1.00 61.13  ? 142  ILE C CG2   1 
ATOM   6306  C  CD1   . ILE G 2 141 ? 35.306  -10.261 228.775 1.00 55.87  ? 142  ILE C CD1   1 
ATOM   6307  N  N     . ILE G 2 142 ? 33.713  -9.827  233.775 1.00 57.87  ? 143  ILE C N     1 
ATOM   6308  C  CA    . ILE G 2 142 ? 33.639  -9.962  235.233 1.00 58.14  ? 143  ILE C CA    1 
ATOM   6309  C  C     . ILE G 2 142 ? 32.877  -8.767  235.790 1.00 54.96  ? 143  ILE C C     1 
ATOM   6310  O  O     . ILE G 2 142 ? 32.618  -7.801  235.078 1.00 62.40  ? 143  ILE C O     1 
ATOM   6311  C  CB    . ILE G 2 142 ? 35.025  -9.952  235.877 1.00 66.74  ? 143  ILE C CB    1 
ATOM   6312  C  CG1   . ILE G 2 142 ? 35.915  -8.961  235.125 1.00 68.80  ? 143  ILE C CG1   1 
ATOM   6313  C  CG2   . ILE G 2 142 ? 35.597  -11.363 235.919 1.00 69.78  ? 143  ILE C CG2   1 
ATOM   6314  C  CD1   . ILE G 2 142 ? 37.255  -8.732  235.768 1.00 81.73  ? 143  ILE C CD1   1 
ATOM   6315  N  N     . SER G 2 143 ? 32.534  -8.822  237.068 1.00 49.82  ? 144  SER C N     1 
ATOM   6316  C  CA    . SER G 2 143 ? 31.797  -7.734  237.688 1.00 48.36  ? 144  SER C CA    1 
ATOM   6317  C  C     . SER G 2 143 ? 32.641  -6.473  237.825 1.00 50.81  ? 144  SER C C     1 
ATOM   6318  O  O     . SER G 2 143 ? 33.720  -6.485  238.433 1.00 43.23  ? 144  SER C O     1 
ATOM   6319  C  CB    . SER G 2 143 ? 31.282  -8.179  239.062 1.00 53.86  ? 144  SER C CB    1 
ATOM   6320  O  OG    . SER G 2 143 ? 30.871  -7.070  239.848 1.00 53.87  ? 144  SER C OG    1 
ATOM   6321  N  N     . ALA G 2 144 ? 32.147  -5.382  237.249 1.00 48.50  ? 145  ALA C N     1 
ATOM   6322  C  CA    . ALA G 2 144 ? 32.852  -4.110  237.329 1.00 57.36  ? 145  ALA C CA    1 
ATOM   6323  C  C     . ALA G 2 144 ? 32.953  -3.735  238.798 1.00 57.21  ? 145  ALA C C     1 
ATOM   6324  O  O     . ALA G 2 144 ? 33.921  -3.116  239.235 1.00 63.45  ? 145  ALA C O     1 
ATOM   6325  C  CB    . ALA G 2 144 ? 32.092  -3.033  236.571 1.00 46.69  ? 145  ALA C CB    1 
ATOM   6326  N  N     . TYR G 2 145 ? 31.936  -4.125  239.556 1.00 61.29  ? 146  TYR C N     1 
ATOM   6327  C  CA    . TYR G 2 145 ? 31.887  -3.838  240.976 1.00 58.52  ? 146  TYR C CA    1 
ATOM   6328  C  C     . TYR G 2 145 ? 32.857  -4.733  241.724 1.00 57.94  ? 146  TYR C C     1 
ATOM   6329  O  O     . TYR G 2 145 ? 33.533  -4.282  242.646 1.00 63.77  ? 146  TYR C O     1 
ATOM   6330  C  CB    . TYR G 2 145 ? 30.465  -4.045  241.503 1.00 62.87  ? 146  TYR C CB    1 
ATOM   6331  C  CG    . TYR G 2 145 ? 30.311  -3.835  242.992 1.00 66.34  ? 146  TYR C CG    1 
ATOM   6332  C  CD1   . TYR G 2 145 ? 30.691  -2.636  243.592 1.00 66.17  ? 146  TYR C CD1   1 
ATOM   6333  C  CD2   . TYR G 2 145 ? 29.772  -4.834  243.799 1.00 70.27  ? 146  TYR C CD2   1 
ATOM   6334  C  CE1   . TYR G 2 145 ? 30.537  -2.432  244.963 1.00 70.02  ? 146  TYR C CE1   1 
ATOM   6335  C  CE2   . TYR G 2 145 ? 29.613  -4.645  245.169 1.00 77.41  ? 146  TYR C CE2   1 
ATOM   6336  C  CZ    . TYR G 2 145 ? 29.998  -3.442  245.749 1.00 77.45  ? 146  TYR C CZ    1 
ATOM   6337  O  OH    . TYR G 2 145 ? 29.845  -3.258  247.110 1.00 65.60  ? 146  TYR C OH    1 
ATOM   6338  N  N     . LYS G 2 146 ? 32.935  -5.999  241.328 1.00 50.53  ? 147  LYS C N     1 
ATOM   6339  C  CA    . LYS G 2 146 ? 33.842  -6.917  241.996 1.00 53.32  ? 147  LYS C CA    1 
ATOM   6340  C  C     . LYS G 2 146 ? 35.289  -6.466  241.870 1.00 57.91  ? 147  LYS C C     1 
ATOM   6341  O  O     . LYS G 2 146 ? 36.041  -6.492  242.845 1.00 64.47  ? 147  LYS C O     1 
ATOM   6342  C  CB    . LYS G 2 146 ? 33.708  -8.332  241.441 1.00 45.12  ? 147  LYS C CB    1 
ATOM   6343  C  CG    . LYS G 2 146 ? 34.765  -9.261  241.995 1.00 33.43  ? 147  LYS C CG    1 
ATOM   6344  C  CD    . LYS G 2 146 ? 34.607  -10.684 241.505 1.00 36.79  ? 147  LYS C CD    1 
ATOM   6345  C  CE    . LYS G 2 146 ? 33.328  -11.317 241.993 1.00 32.12  ? 147  LYS C CE    1 
ATOM   6346  N  NZ    . LYS G 2 146 ? 33.362  -12.781 241.725 1.00 35.07  ? 147  LYS C NZ    1 
ATOM   6347  N  N     . LEU G 2 147 ? 35.684  -6.061  240.668 1.00 69.16  ? 148  LEU C N     1 
ATOM   6348  C  CA    . LEU G 2 147 ? 37.055  -5.605  240.434 1.00 73.53  ? 148  LEU C CA    1 
ATOM   6349  C  C     . LEU G 2 147 ? 37.288  -4.351  241.266 1.00 73.71  ? 148  LEU C C     1 
ATOM   6350  O  O     . LEU G 2 147 ? 38.388  -4.121  241.764 1.00 74.68  ? 148  LEU C O     1 
ATOM   6351  C  CB    . LEU G 2 147 ? 37.270  -5.289  238.947 1.00 80.14  ? 148  LEU C CB    1 
ATOM   6352  C  CG    . LEU G 2 147 ? 38.711  -5.240  238.422 1.00 80.57  ? 148  LEU C CG    1 
ATOM   6353  C  CD1   . LEU G 2 147 ? 39.310  -6.640  238.514 1.00 86.34  ? 148  LEU C CD1   1 
ATOM   6354  C  CD2   . LEU G 2 147 ? 38.744  -4.755  236.976 1.00 76.16  ? 148  LEU C CD2   1 
ATOM   6355  N  N     . ALA G 2 148 ? 36.236  -3.549  241.414 1.00 69.26  ? 149  ALA C N     1 
ATOM   6356  C  CA    . ALA G 2 148 ? 36.310  -2.319  242.186 1.00 69.90  ? 149  ALA C CA    1 
ATOM   6357  C  C     . ALA G 2 148 ? 36.718  -2.642  243.614 1.00 75.02  ? 149  ALA C C     1 
ATOM   6358  O  O     . ALA G 2 148 ? 37.667  -2.071  244.146 1.00 76.11  ? 149  ALA C O     1 
ATOM   6359  C  CB    . ALA G 2 148 ? 34.967  -1.616  242.179 1.00 64.41  ? 149  ALA C CB    1 
ATOM   6360  N  N     . GLN G 2 149 ? 35.988  -3.560  244.233 1.00 76.89  ? 150  GLN C N     1 
ATOM   6361  C  CA    . GLN G 2 149 ? 36.294  -3.951  245.594 1.00 78.60  ? 150  GLN C CA    1 
ATOM   6362  C  C     . GLN G 2 149 ? 37.659  -4.629  245.603 1.00 76.48  ? 150  GLN C C     1 
ATOM   6363  O  O     . GLN G 2 149 ? 38.456  -4.417  246.511 1.00 82.95  ? 150  GLN C O     1 
ATOM   6364  C  CB    . GLN G 2 149 ? 35.234  -4.916  246.134 1.00 84.02  ? 150  GLN C CB    1 
ATOM   6365  C  CG    . GLN G 2 149 ? 33.796  -4.411  246.017 1.00 89.60  ? 150  GLN C CG    1 
ATOM   6366  C  CD    . GLN G 2 149 ? 32.797  -5.311  246.733 1.00 93.65  ? 150  GLN C CD    1 
ATOM   6367  O  OE1   . GLN G 2 149 ? 32.679  -5.279  247.960 1.00 90.71  ? 150  GLN C OE1   1 
ATOM   6368  N  NE2   . GLN G 2 149 ? 32.081  -6.130  245.967 1.00 98.71  ? 150  GLN C NE2   1 
ATOM   6369  N  N     . THR G 2 150 ? 37.938  -5.432  244.585 1.00 69.38  ? 151  THR C N     1 
ATOM   6370  C  CA    . THR G 2 150 ? 39.218  -6.116  244.534 1.00 71.61  ? 151  THR C CA    1 
ATOM   6371  C  C     . THR G 2 150 ? 40.412  -5.157  244.466 1.00 73.46  ? 151  THR C C     1 
ATOM   6372  O  O     . THR G 2 150 ? 41.475  -5.437  245.023 1.00 73.75  ? 151  THR C O     1 
ATOM   6373  C  CB    . THR G 2 150 ? 39.273  -7.096  243.361 1.00 64.41  ? 151  THR C CB    1 
ATOM   6374  O  OG1   . THR G 2 150 ? 38.236  -8.065  243.522 1.00 51.81  ? 151  THR C OG1   1 
ATOM   6375  C  CG2   . THR G 2 150 ? 40.615  -7.816  243.332 1.00 63.75  ? 151  THR C CG2   1 
ATOM   6376  N  N     . CYS G 2 151 ? 40.235  -4.024  243.799 1.00 71.48  ? 152  CYS C N     1 
ATOM   6377  C  CA    . CYS G 2 151 ? 41.302  -3.043  243.695 1.00 69.91  ? 152  CYS C CA    1 
ATOM   6378  C  C     . CYS G 2 151 ? 41.447  -2.284  245.004 1.00 71.30  ? 152  CYS C C     1 
ATOM   6379  O  O     . CYS G 2 151 ? 42.540  -1.849  245.363 1.00 76.03  ? 152  CYS C O     1 
ATOM   6380  C  CB    . CYS G 2 151 ? 41.021  -2.072  242.547 1.00 72.85  ? 152  CYS C CB    1 
ATOM   6381  S  SG    . CYS G 2 151 ? 41.331  -2.805  240.913 1.00 71.87  ? 152  CYS C SG    1 
ATOM   6382  N  N     . ALA G 2 152 ? 40.334  -2.129  245.713 1.00 72.57  ? 153  ALA C N     1 
ATOM   6383  C  CA    . ALA G 2 152 ? 40.328  -1.443  246.998 1.00 69.07  ? 153  ALA C CA    1 
ATOM   6384  C  C     . ALA G 2 152 ? 40.934  -2.377  248.046 1.00 72.20  ? 153  ALA C C     1 
ATOM   6385  O  O     . ALA G 2 152 ? 41.553  -1.925  249.007 1.00 70.86  ? 153  ALA C O     1 
ATOM   6386  C  CB    . ALA G 2 152 ? 38.905  -1.075  247.383 1.00 60.71  ? 153  ALA C CB    1 
ATOM   6387  N  N     . LYS G 2 153 ? 40.752  -3.680  247.842 1.00 74.72  ? 154  LYS C N     1 
ATOM   6388  C  CA    . LYS G 2 153 ? 41.274  -4.699  248.748 1.00 75.30  ? 154  LYS C CA    1 
ATOM   6389  C  C     . LYS G 2 153 ? 42.675  -5.119  248.319 1.00 79.30  ? 154  LYS C C     1 
ATOM   6390  O  O     . LYS G 2 153 ? 43.173  -6.161  248.738 1.00 80.68  ? 154  LYS C O     1 
ATOM   6391  C  CB    . LYS G 2 153 ? 40.357  -5.928  248.757 1.00 63.22  ? 154  LYS C CB    1 
ATOM   6392  N  N     . MET G 2 154 ? 43.298  -4.310  247.467 1.00 86.92  ? 155  MET C N     1 
ATOM   6393  C  CA    . MET G 2 154 ? 44.647  -4.593  246.987 1.00 93.10  ? 155  MET C CA    1 
ATOM   6394  C  C     . MET G 2 154 ? 45.664  -3.631  247.588 1.00 93.51  ? 155  MET C C     1 
ATOM   6395  O  O     . MET G 2 154 ? 46.780  -4.032  247.921 1.00 91.99  ? 155  MET C O     1 
ATOM   6396  C  CB    . MET G 2 154 ? 44.721  -4.503  245.457 1.00 95.15  ? 155  MET C CB    1 
ATOM   6397  C  CG    . MET G 2 154 ? 44.384  -5.798  244.725 1.00 103.22 ? 155  MET C CG    1 
ATOM   6398  S  SD    . MET G 2 154 ? 44.781  -5.739  242.952 1.00 101.33 ? 155  MET C SD    1 
ATOM   6399  C  CE    . MET G 2 154 ? 46.378  -6.559  242.922 1.00 97.99  ? 155  MET C CE    1 
ATOM   6400  N  N     . ILE G 2 155 ? 45.284  -2.364  247.724 1.00 92.12  ? 156  ILE C N     1 
ATOM   6401  C  CA    . ILE G 2 155 ? 46.197  -1.379  248.285 1.00 92.02  ? 156  ILE C CA    1 
ATOM   6402  C  C     . ILE G 2 155 ? 45.946  -1.197  249.774 1.00 97.19  ? 156  ILE C C     1 
ATOM   6403  O  O     . ILE G 2 155 ? 46.719  -0.534  250.461 1.00 102.65 ? 156  ILE C O     1 
ATOM   6404  C  CB    . ILE G 2 155 ? 46.074  0.000   247.585 1.00 86.00  ? 156  ILE C CB    1 
ATOM   6405  C  CG1   . ILE G 2 155 ? 44.893  0.787   248.141 1.00 83.42  ? 156  ILE C CG1   1 
ATOM   6406  C  CG2   . ILE G 2 155 ? 45.873  -0.189  246.095 1.00 90.72  ? 156  ILE C CG2   1 
ATOM   6407  C  CD1   . ILE G 2 155 ? 44.863  2.218   247.653 1.00 81.01  ? 156  ILE C CD1   1 
ATOM   6408  N  N     . ASP G 2 156 ? 44.863  -1.785  250.271 1.00 101.39 ? 157  ASP C N     1 
ATOM   6409  C  CA    . ASP G 2 156 ? 44.525  -1.687  251.689 1.00 104.78 ? 157  ASP C CA    1 
ATOM   6410  C  C     . ASP G 2 156 ? 45.256  -2.750  252.489 1.00 108.28 ? 157  ASP C C     1 
ATOM   6411  O  O     . ASP G 2 156 ? 45.300  -2.698  253.719 1.00 110.88 ? 157  ASP C O     1 
ATOM   6412  C  CB    . ASP G 2 156 ? 43.020  -1.841  251.890 1.00 105.14 ? 157  ASP C CB    1 
ATOM   6413  C  CG    . ASP G 2 156 ? 42.251  -0.620  251.447 1.00 103.22 ? 157  ASP C CG    1 
ATOM   6414  O  OD1   . ASP G 2 156 ? 41.007  -0.681  251.422 1.00 105.83 ? 157  ASP C OD1   1 
ATOM   6415  O  OD2   . ASP G 2 156 ? 42.892  0.402   251.129 1.00 102.62 ? 157  ASP C OD2   1 
ATOM   6416  N  N     . ASN G 2 157 ? 45.820  -3.720  251.778 1.00 108.40 ? 158  ASN C N     1 
ATOM   6417  C  CA    . ASN G 2 157 ? 46.574  -4.797  252.399 1.00 108.40 ? 158  ASN C CA    1 
ATOM   6418  C  C     . ASN G 2 157 ? 47.805  -5.129  251.553 1.00 105.28 ? 158  ASN C C     1 
ATOM   6419  O  O     . ASN G 2 157 ? 48.376  -6.211  251.661 1.00 107.11 ? 158  ASN C O     1 
ATOM   6420  C  CB    . ASN G 2 157 ? 45.682  -6.033  252.593 1.00 112.62 ? 158  ASN C CB    1 
ATOM   6421  C  CG    . ASN G 2 157 ? 44.835  -6.348  251.374 1.00 120.49 ? 158  ASN C CG    1 
ATOM   6422  O  OD1   . ASN G 2 157 ? 45.352  -6.710  250.315 1.00 126.25 ? 158  ASN C OD1   1 
ATOM   6423  N  ND2   . ASN G 2 157 ? 43.520  -6.212  251.521 1.00 121.64 ? 158  ASN C ND2   1 
ATOM   6424  N  N     . LYS G 2 158 ? 48.204  -4.173  250.718 1.00 101.16 ? 159  LYS C N     1 
ATOM   6425  C  CA    . LYS G 2 158 ? 49.369  -4.301  249.848 1.00 99.67  ? 159  LYS C CA    1 
ATOM   6426  C  C     . LYS G 2 158 ? 49.571  -5.685  249.230 1.00 100.40 ? 159  LYS C C     1 
ATOM   6427  O  O     . LYS G 2 158 ? 50.330  -6.502  249.748 1.00 99.96  ? 159  LYS C O     1 
ATOM   6428  C  CB    . LYS G 2 158 ? 50.628  -3.895  250.617 1.00 99.85  ? 159  LYS C CB    1 
ATOM   6429  C  CG    . LYS G 2 158 ? 50.504  -2.549  251.321 1.00 106.48 ? 159  LYS C CG    1 
ATOM   6430  C  CD    . LYS G 2 158 ? 51.807  -2.133  251.987 1.00 108.52 ? 159  LYS C CD    1 
ATOM   6431  C  CE    . LYS G 2 158 ? 52.837  -1.691  250.960 1.00 111.05 ? 159  LYS C CE    1 
ATOM   6432  N  NZ    . LYS G 2 158 ? 52.408  -0.452  250.256 1.00 107.20 ? 159  LYS C NZ    1 
ATOM   6433  N  N     . GLU G 2 159 ? 48.894  -5.937  248.115 1.00 101.45 ? 160  GLU C N     1 
ATOM   6434  C  CA    . GLU G 2 159 ? 49.007  -7.210  247.410 1.00 105.21 ? 160  GLU C CA    1 
ATOM   6435  C  C     . GLU G 2 159 ? 49.170  -6.931  245.914 1.00 108.44 ? 160  GLU C C     1 
ATOM   6436  O  O     . GLU G 2 159 ? 48.536  -7.570  245.072 1.00 110.16 ? 160  GLU C O     1 
ATOM   6437  C  CB    . GLU G 2 159 ? 47.758  -8.064  247.652 1.00 106.20 ? 160  GLU C CB    1 
ATOM   6438  C  CG    . GLU G 2 159 ? 47.541  -8.461  249.105 1.00 104.75 ? 160  GLU C CG    1 
ATOM   6439  N  N     . PHE G 2 160 ? 50.036  -5.972  245.598 1.00 107.17 ? 161  PHE C N     1 
ATOM   6440  C  CA    . PHE G 2 160 ? 50.292  -5.567  244.219 1.00 102.61 ? 161  PHE C CA    1 
ATOM   6441  C  C     . PHE G 2 160 ? 50.962  -6.667  243.408 1.00 97.32  ? 161  PHE C C     1 
ATOM   6442  O  O     . PHE G 2 160 ? 51.347  -6.460  242.257 1.00 96.68  ? 161  PHE C O     1 
ATOM   6443  C  CB    . PHE G 2 160 ? 51.165  -4.310  244.204 1.00 108.53 ? 161  PHE C CB    1 
ATOM   6444  C  CG    . PHE G 2 160 ? 50.678  -3.223  245.124 1.00 113.88 ? 161  PHE C CG    1 
ATOM   6445  C  CD1   . PHE G 2 160 ? 49.440  -2.620  244.921 1.00 112.75 ? 161  PHE C CD1   1 
ATOM   6446  C  CD2   . PHE G 2 160 ? 51.453  -2.814  246.206 1.00 114.75 ? 161  PHE C CD2   1 
ATOM   6447  C  CE1   . PHE G 2 160 ? 48.979  -1.626  245.783 1.00 113.00 ? 161  PHE C CE1   1 
ATOM   6448  C  CE2   . PHE G 2 160 ? 51.001  -1.821  247.073 1.00 117.49 ? 161  PHE C CE2   1 
ATOM   6449  C  CZ    . PHE G 2 160 ? 49.761  -1.226  246.862 1.00 114.58 ? 161  PHE C CZ    1 
ATOM   6450  N  N     . ASP G 2 161 ? 51.097  -7.840  244.012 1.00 91.10  ? 162  ASP C N     1 
ATOM   6451  C  CA    . ASP G 2 161 ? 51.719  -8.964  243.338 1.00 85.73  ? 162  ASP C CA    1 
ATOM   6452  C  C     . ASP G 2 161 ? 51.385  -10.257 244.058 1.00 84.79  ? 162  ASP C C     1 
ATOM   6453  O  O     . ASP G 2 161 ? 51.818  -10.477 245.186 1.00 87.24  ? 162  ASP C O     1 
ATOM   6454  C  CB    . ASP G 2 161 ? 53.231  -8.760  243.285 1.00 85.42  ? 162  ASP C CB    1 
ATOM   6455  C  CG    . ASP G 2 161 ? 53.968  -10.014 242.898 1.00 88.39  ? 162  ASP C CG    1 
ATOM   6456  O  OD1   . ASP G 2 161 ? 53.574  -10.650 241.900 1.00 93.56  ? 162  ASP C OD1   1 
ATOM   6457  O  OD2   . ASP G 2 161 ? 54.943  -10.364 243.591 1.00 90.38  ? 162  ASP C OD2   1 
ATOM   6458  N  N     . LEU G 2 162 ? 50.600  -11.107 243.402 1.00 87.11  ? 163  LEU C N     1 
ATOM   6459  C  CA    . LEU G 2 162 ? 50.197  -12.390 243.976 1.00 83.17  ? 163  LEU C CA    1 
ATOM   6460  C  C     . LEU G 2 162 ? 49.280  -13.193 243.051 1.00 77.95  ? 163  LEU C C     1 
ATOM   6461  O  O     . LEU G 2 162 ? 49.400  -14.414 242.951 1.00 72.41  ? 163  LEU C O     1 
ATOM   6462  C  CB    . LEU G 2 162 ? 49.484  -12.172 245.317 1.00 86.33  ? 163  LEU C CB    1 
ATOM   6463  C  CG    . LEU G 2 162 ? 48.869  -13.412 245.982 1.00 89.38  ? 163  LEU C CG    1 
ATOM   6464  C  CD1   . LEU G 2 162 ? 49.940  -14.471 246.185 1.00 91.63  ? 163  LEU C CD1   1 
ATOM   6465  C  CD2   . LEU G 2 162 ? 48.242  -13.020 247.314 1.00 94.14  ? 163  LEU C CD2   1 
ATOM   6466  N  N     . PHE G 2 163 ? 48.367  -12.501 242.376 1.00 72.50  ? 164  PHE C N     1 
ATOM   6467  C  CA    . PHE G 2 163 ? 47.418  -13.156 241.483 1.00 68.27  ? 164  PHE C CA    1 
ATOM   6468  C  C     . PHE G 2 163 ? 47.263  -12.394 240.164 1.00 66.67  ? 164  PHE C C     1 
ATOM   6469  O  O     . PHE G 2 163 ? 47.494  -11.186 240.103 1.00 59.93  ? 164  PHE C O     1 
ATOM   6470  C  CB    . PHE G 2 163 ? 46.046  -13.241 242.170 1.00 61.12  ? 164  PHE C CB    1 
ATOM   6471  C  CG    . PHE G 2 163 ? 45.288  -11.931 242.172 1.00 55.14  ? 164  PHE C CG    1 
ATOM   6472  C  CD1   . PHE G 2 163 ? 44.271  -11.696 241.247 1.00 54.96  ? 164  PHE C CD1   1 
ATOM   6473  C  CD2   . PHE G 2 163 ? 45.616  -10.919 243.071 1.00 51.02  ? 164  PHE C CD2   1 
ATOM   6474  C  CE1   . PHE G 2 163 ? 43.594  -10.473 241.218 1.00 40.38  ? 164  PHE C CE1   1 
ATOM   6475  C  CE2   . PHE G 2 163 ? 44.947  -9.696  243.050 1.00 43.57  ? 164  PHE C CE2   1 
ATOM   6476  C  CZ    . PHE G 2 163 ? 43.936  -9.475  242.122 1.00 46.36  ? 164  PHE C CZ    1 
ATOM   6477  N  N     . ASP G 2 164 ? 46.870  -13.114 239.117 1.00 68.61  ? 165  ASP C N     1 
ATOM   6478  C  CA    . ASP G 2 164 ? 46.628  -12.520 237.805 1.00 69.93  ? 165  ASP C CA    1 
ATOM   6479  C  C     . ASP G 2 164 ? 45.322  -13.094 237.274 1.00 69.74  ? 165  ASP C C     1 
ATOM   6480  O  O     . ASP G 2 164 ? 45.031  -14.276 237.468 1.00 70.21  ? 165  ASP C O     1 
ATOM   6481  C  CB    . ASP G 2 164 ? 47.758  -12.841 236.812 1.00 71.02  ? 165  ASP C CB    1 
ATOM   6482  C  CG    . ASP G 2 164 ? 48.783  -11.712 236.682 1.00 73.00  ? 165  ASP C CG    1 
ATOM   6483  O  OD1   . ASP G 2 164 ? 48.435  -10.534 236.922 1.00 69.86  ? 165  ASP C OD1   1 
ATOM   6484  O  OD2   . ASP G 2 164 ? 49.941  -12.005 236.315 1.00 77.65  ? 165  ASP C OD2   1 
ATOM   6485  N  N     . ILE G 2 165 ? 44.533  -12.252 236.618 1.00 69.00  ? 166  ILE C N     1 
ATOM   6486  C  CA    . ILE G 2 165 ? 43.265  -12.687 236.048 1.00 68.04  ? 166  ILE C CA    1 
ATOM   6487  C  C     . ILE G 2 165 ? 43.321  -12.539 234.534 1.00 69.83  ? 166  ILE C C     1 
ATOM   6488  O  O     . ILE G 2 165 ? 43.457  -11.426 234.020 1.00 74.34  ? 166  ILE C O     1 
ATOM   6489  C  CB    . ILE G 2 165 ? 42.103  -11.855 236.590 1.00 64.41  ? 166  ILE C CB    1 
ATOM   6490  C  CG1   . ILE G 2 165 ? 40.812  -12.312 235.927 1.00 68.00  ? 166  ILE C CG1   1 
ATOM   6491  C  CG2   . ILE G 2 165 ? 42.363  -10.382 236.357 1.00 56.38  ? 166  ILE C CG2   1 
ATOM   6492  C  CD1   . ILE G 2 165 ? 40.565  -13.798 236.066 1.00 62.38  ? 166  ILE C CD1   1 
ATOM   6493  N  N     . ASN G 2 166 ? 43.218  -13.662 233.824 1.00 68.12  ? 167  ASN C N     1 
ATOM   6494  C  CA    . ASN G 2 166 ? 43.291  -13.657 232.359 1.00 71.39  ? 167  ASN C CA    1 
ATOM   6495  C  C     . ASN G 2 166 ? 42.026  -14.191 231.686 1.00 70.00  ? 167  ASN C C     1 
ATOM   6496  O  O     . ASN G 2 166 ? 41.168  -14.774 232.346 1.00 77.01  ? 167  ASN C O     1 
ATOM   6497  C  CB    . ASN G 2 166 ? 44.494  -14.484 231.883 1.00 70.51  ? 167  ASN C CB    1 
ATOM   6498  C  CG    . ASN G 2 166 ? 45.811  -14.053 232.536 1.00 68.44  ? 167  ASN C CG    1 
ATOM   6499  O  OD1   . ASN G 2 166 ? 46.080  -12.856 232.698 1.00 61.84  ? 167  ASN C OD1   1 
ATOM   6500  N  ND2   . ASN G 2 166 ? 46.645  -15.035 232.895 1.00 50.50  ? 167  ASN C ND2   1 
ATOM   6501  N  N     . TYR G 2 167 ? 41.922  -13.999 230.370 1.00 62.53  ? 168  TYR C N     1 
ATOM   6502  C  CA    . TYR G 2 167 ? 40.751  -14.455 229.622 1.00 55.75  ? 168  TYR C CA    1 
ATOM   6503  C  C     . TYR G 2 167 ? 41.055  -15.178 228.303 1.00 54.66  ? 168  TYR C C     1 
ATOM   6504  O  O     . TYR G 2 167 ? 41.677  -14.625 227.401 1.00 50.35  ? 168  TYR C O     1 
ATOM   6505  C  CB    . TYR G 2 167 ? 39.825  -13.264 229.380 1.00 54.29  ? 168  TYR C CB    1 
ATOM   6506  C  CG    . TYR G 2 167 ? 39.296  -12.691 230.672 1.00 66.82  ? 168  TYR C CG    1 
ATOM   6507  C  CD1   . TYR G 2 167 ? 38.125  -13.182 231.247 1.00 67.46  ? 168  TYR C CD1   1 
ATOM   6508  C  CD2   . TYR G 2 167 ? 39.997  -11.705 231.356 1.00 70.76  ? 168  TYR C CD2   1 
ATOM   6509  C  CE1   . TYR G 2 167 ? 37.661  -12.708 232.473 1.00 68.96  ? 168  TYR C CE1   1 
ATOM   6510  C  CE2   . TYR G 2 167 ? 39.545  -11.224 232.584 1.00 79.68  ? 168  TYR C CE2   1 
ATOM   6511  C  CZ    . TYR G 2 167 ? 38.374  -11.732 233.137 1.00 77.56  ? 168  TYR C CZ    1 
ATOM   6512  O  OH    . TYR G 2 167 ? 37.917  -11.264 234.352 1.00 80.32  ? 168  TYR C OH    1 
ATOM   6513  N  N     . LEU G 2 168 ? 40.611  -16.428 228.209 1.00 53.77  ? 169  LEU C N     1 
ATOM   6514  C  CA    . LEU G 2 168 ? 40.819  -17.243 227.022 1.00 57.08  ? 169  LEU C CA    1 
ATOM   6515  C  C     . LEU G 2 168 ? 39.518  -17.365 226.235 1.00 62.41  ? 169  LEU C C     1 
ATOM   6516  O  O     . LEU G 2 168 ? 38.550  -17.968 226.705 1.00 70.19  ? 169  LEU C O     1 
ATOM   6517  C  CB    . LEU G 2 168 ? 41.302  -18.637 227.422 1.00 61.15  ? 169  LEU C CB    1 
ATOM   6518  C  CG    . LEU G 2 168 ? 41.446  -19.657 226.285 1.00 68.19  ? 169  LEU C CG    1 
ATOM   6519  C  CD1   . LEU G 2 168 ? 42.552  -19.217 225.347 1.00 68.17  ? 169  LEU C CD1   1 
ATOM   6520  C  CD2   . LEU G 2 168 ? 41.743  -21.035 226.852 1.00 63.16  ? 169  LEU C CD2   1 
ATOM   6521  N  N     . GLU G 2 169 ? 39.504  -16.800 225.033 1.00 59.84  ? 170  GLU C N     1 
ATOM   6522  C  CA    . GLU G 2 169 ? 38.322  -16.832 224.176 1.00 58.73  ? 170  GLU C CA    1 
ATOM   6523  C  C     . GLU G 2 169 ? 38.300  -18.110 223.324 1.00 56.61  ? 170  GLU C C     1 
ATOM   6524  O  O     . GLU G 2 169 ? 39.342  -18.707 223.068 1.00 63.63  ? 170  GLU C O     1 
ATOM   6525  C  CB    . GLU G 2 169 ? 38.321  -15.585 223.279 1.00 57.18  ? 170  GLU C CB    1 
ATOM   6526  C  CG    . GLU G 2 169 ? 37.027  -15.328 222.517 1.00 67.12  ? 170  GLU C CG    1 
ATOM   6527  C  CD    . GLU G 2 169 ? 37.098  -14.091 221.628 1.00 72.62  ? 170  GLU C CD    1 
ATOM   6528  O  OE1   . GLU G 2 169 ? 37.451  -13.000 222.139 1.00 69.92  ? 170  GLU C OE1   1 
ATOM   6529  O  OE2   . GLU G 2 169 ? 36.794  -14.212 220.417 1.00 70.88  ? 170  GLU C OE2   1 
ATOM   6530  N  N     . VAL G 2 170 ? 37.112  -18.532 222.897 1.00 50.52  ? 171  VAL C N     1 
ATOM   6531  C  CA    . VAL G 2 170 ? 36.973  -19.732 222.071 1.00 48.67  ? 171  VAL C CA    1 
ATOM   6532  C  C     . VAL G 2 170 ? 35.875  -19.563 221.021 1.00 51.59  ? 171  VAL C C     1 
ATOM   6533  O  O     . VAL G 2 170 ? 34.692  -19.795 221.286 1.00 42.32  ? 171  VAL C O     1 
ATOM   6534  C  CB    . VAL G 2 170 ? 36.670  -20.979 222.935 1.00 49.95  ? 171  VAL C CB    1 
ATOM   6535  C  CG1   . VAL G 2 170 ? 36.392  -22.186 222.059 1.00 46.00  ? 171  VAL C CG1   1 
ATOM   6536  C  CG2   . VAL G 2 170 ? 37.844  -21.268 223.852 1.00 55.76  ? 171  VAL C CG2   1 
ATOM   6537  N  N     . ASP G 2 171 ? 36.298  -19.155 219.824 1.00 55.61  ? 172  ASP C N     1 
ATOM   6538  C  CA    . ASP G 2 171 ? 35.415  -18.926 218.681 1.00 50.84  ? 172  ASP C CA    1 
ATOM   6539  C  C     . ASP G 2 171 ? 34.962  -20.252 218.060 1.00 54.44  ? 172  ASP C C     1 
ATOM   6540  O  O     . ASP G 2 171 ? 35.784  -21.109 217.741 1.00 59.16  ? 172  ASP C O     1 
ATOM   6541  C  CB    . ASP G 2 171 ? 36.153  -18.083 217.636 1.00 46.91  ? 172  ASP C CB    1 
ATOM   6542  C  CG    . ASP G 2 171 ? 36.525  -16.695 218.152 1.00 61.27  ? 172  ASP C CG    1 
ATOM   6543  O  OD1   . ASP G 2 171 ? 37.447  -16.060 217.589 1.00 60.40  ? 172  ASP C OD1   1 
ATOM   6544  O  OD2   . ASP G 2 171 ? 35.892  -16.222 219.114 1.00 64.67  ? 172  ASP C OD2   1 
ATOM   6545  N  N     . TRP G 2 172 ? 33.654  -20.424 217.892 1.00 54.52  ? 173  TRP C N     1 
ATOM   6546  C  CA    . TRP G 2 172 ? 33.129  -21.646 217.288 1.00 59.80  ? 173  TRP C CA    1 
ATOM   6547  C  C     . TRP G 2 172 ? 32.011  -21.328 216.301 1.00 64.01  ? 173  TRP C C     1 
ATOM   6548  O  O     . TRP G 2 172 ? 31.497  -20.206 216.266 1.00 64.49  ? 173  TRP C O     1 
ATOM   6549  C  CB    . TRP G 2 172 ? 32.592  -22.616 218.353 1.00 55.78  ? 173  TRP C CB    1 
ATOM   6550  C  CG    . TRP G 2 172 ? 31.452  -22.055 219.150 1.00 66.13  ? 173  TRP C CG    1 
ATOM   6551  C  CD1   . TRP G 2 172 ? 31.538  -21.260 220.260 1.00 69.95  ? 173  TRP C CD1   1 
ATOM   6552  C  CD2   . TRP G 2 172 ? 30.056  -22.168 218.848 1.00 71.03  ? 173  TRP C CD2   1 
ATOM   6553  N  NE1   . TRP G 2 172 ? 30.286  -20.871 220.664 1.00 69.48  ? 173  TRP C NE1   1 
ATOM   6554  C  CE2   . TRP G 2 172 ? 29.356  -21.413 219.815 1.00 71.99  ? 173  TRP C CE2   1 
ATOM   6555  C  CE3   . TRP G 2 172 ? 29.325  -22.832 217.852 1.00 76.50  ? 173  TRP C CE3   1 
ATOM   6556  C  CZ2   . TRP G 2 172 ? 27.960  -21.298 219.814 1.00 71.91  ? 173  TRP C CZ2   1 
ATOM   6557  C  CZ3   . TRP G 2 172 ? 27.932  -22.716 217.852 1.00 72.53  ? 173  TRP C CZ3   1 
ATOM   6558  C  CH2   . TRP G 2 172 ? 27.269  -21.955 218.828 1.00 68.62  ? 173  TRP C CH2   1 
ATOM   6559  N  N     . GLU G 2 173 ? 31.653  -22.328 215.500 1.00 64.23  ? 174  GLU C N     1 
ATOM   6560  C  CA    . GLU G 2 173 ? 30.587  -22.209 214.518 1.00 70.30  ? 174  GLU C CA    1 
ATOM   6561  C  C     . GLU G 2 173 ? 29.858  -23.546 214.424 1.00 74.78  ? 174  GLU C C     1 
ATOM   6562  O  O     . GLU G 2 173 ? 30.473  -24.600 214.561 1.00 74.82  ? 174  GLU C O     1 
ATOM   6563  C  CB    . GLU G 2 173 ? 31.139  -21.796 213.141 1.00 72.93  ? 174  GLU C CB    1 
ATOM   6564  C  CG    . GLU G 2 173 ? 32.223  -22.695 212.556 1.00 81.81  ? 174  GLU C CG    1 
ATOM   6565  C  CD    . GLU G 2 173 ? 32.536  -22.376 211.089 1.00 83.52  ? 174  GLU C CD    1 
ATOM   6566  O  OE1   . GLU G 2 173 ? 33.470  -22.995 210.526 1.00 81.96  ? 174  GLU C OE1   1 
ATOM   6567  O  OE2   . GLU G 2 173 ? 31.846  -21.513 210.499 1.00 70.21  ? 174  GLU C OE2   1 
ATOM   6568  N  N     . LEU G 2 174 ? 28.545  -23.502 214.214 1.00 84.52  ? 175  LEU C N     1 
ATOM   6569  C  CA    . LEU G 2 174 ? 27.748  -24.720 214.116 1.00 89.15  ? 175  LEU C CA    1 
ATOM   6570  C  C     . LEU G 2 174 ? 27.976  -25.415 212.777 1.00 94.76  ? 175  LEU C C     1 
ATOM   6571  O  O     . LEU G 2 174 ? 27.370  -25.053 211.768 1.00 94.66  ? 175  LEU C O     1 
ATOM   6572  C  CB    . LEU G 2 174 ? 26.260  -24.402 214.283 1.00 87.38  ? 175  LEU C CB    1 
ATOM   6573  C  CG    . LEU G 2 174 ? 25.300  -25.597 214.324 1.00 87.89  ? 175  LEU C CG    1 
ATOM   6574  C  CD1   . LEU G 2 174 ? 25.563  -26.426 215.572 1.00 91.46  ? 175  LEU C CD1   1 
ATOM   6575  C  CD2   . LEU G 2 174 ? 23.858  -25.108 214.319 1.00 87.07  ? 175  LEU C CD2   1 
ATOM   6576  N  N     . ASN G 2 175 ? 28.860  -26.409 212.776 1.00 99.29  ? 176  ASN C N     1 
ATOM   6577  C  CA    . ASN G 2 175 ? 29.164  -27.165 211.568 1.00 98.93  ? 176  ASN C CA    1 
ATOM   6578  C  C     . ASN G 2 175 ? 28.288  -28.408 211.543 1.00 97.94  ? 176  ASN C C     1 
ATOM   6579  O  O     . ASN G 2 175 ? 28.572  -29.397 212.221 1.00 98.12  ? 176  ASN C O     1 
ATOM   6580  C  CB    . ASN G 2 175 ? 30.635  -27.584 211.549 1.00 101.36 ? 176  ASN C CB    1 
ATOM   6581  C  CG    . ASN G 2 175 ? 31.047  -28.206 210.224 1.00 107.67 ? 176  ASN C CG    1 
ATOM   6582  O  OD1   . ASN G 2 175 ? 32.136  -28.774 210.099 1.00 108.68 ? 176  ASN C OD1   1 
ATOM   6583  N  ND2   . ASN G 2 175 ? 30.180  -28.093 209.222 1.00 111.36 ? 176  ASN C ND2   1 
ATOM   6584  N  N     . GLY G 2 176 ? 27.218  -28.348 210.759 1.00 95.48  ? 177  GLY C N     1 
ATOM   6585  C  CA    . GLY G 2 176 ? 26.315  -29.477 210.659 1.00 96.02  ? 177  GLY C CA    1 
ATOM   6586  C  C     . GLY G 2 176 ? 25.514  -29.722 211.922 1.00 92.74  ? 177  GLY C C     1 
ATOM   6587  O  O     . GLY G 2 176 ? 24.544  -29.016 212.203 1.00 87.86  ? 177  GLY C O     1 
ATOM   6588  N  N     . GLU G 2 177 ? 25.923  -30.727 212.687 1.00 92.20  ? 178  GLU C N     1 
ATOM   6589  C  CA    . GLU G 2 177 ? 25.237  -31.078 213.919 1.00 94.05  ? 178  GLU C CA    1 
ATOM   6590  C  C     . GLU G 2 177 ? 26.129  -30.847 215.136 1.00 100.97 ? 178  GLU C C     1 
ATOM   6591  O  O     . GLU G 2 177 ? 25.667  -30.928 216.276 1.00 106.45 ? 178  GLU C O     1 
ATOM   6592  C  CB    . GLU G 2 177 ? 24.801  -32.545 213.862 1.00 91.45  ? 178  GLU C CB    1 
ATOM   6593  C  CG    . GLU G 2 177 ? 23.983  -33.015 215.055 1.00 97.00  ? 178  GLU C CG    1 
ATOM   6594  C  CD    . GLU G 2 177 ? 23.626  -34.494 214.975 1.00 100.30 ? 178  GLU C CD    1 
ATOM   6595  O  OE1   . GLU G 2 177 ? 24.552  -35.337 214.967 1.00 101.01 ? 178  GLU C OE1   1 
ATOM   6596  O  OE2   . GLU G 2 177 ? 22.418  -34.811 214.919 1.00 97.28  ? 178  GLU C OE2   1 
ATOM   6597  N  N     . ASP G 2 178 ? 27.402  -30.545 214.896 1.00 99.74  ? 179  ASP C N     1 
ATOM   6598  C  CA    . ASP G 2 178 ? 28.346  -30.322 215.989 1.00 98.00  ? 179  ASP C CA    1 
ATOM   6599  C  C     . ASP G 2 178 ? 28.907  -28.903 215.989 1.00 92.02  ? 179  ASP C C     1 
ATOM   6600  O  O     . ASP G 2 178 ? 28.889  -28.226 214.962 1.00 90.78  ? 179  ASP C O     1 
ATOM   6601  C  CB    . ASP G 2 178 ? 29.506  -31.320 215.888 1.00 106.33 ? 179  ASP C CB    1 
ATOM   6602  C  CG    . ASP G 2 178 ? 29.048  -32.715 215.490 1.00 108.60 ? 179  ASP C CG    1 
ATOM   6603  O  OD1   . ASP G 2 178 ? 28.122  -33.252 216.135 1.00 114.23 ? 179  ASP C OD1   1 
ATOM   6604  O  OD2   . ASP G 2 178 ? 29.621  -33.279 214.533 1.00 107.84 ? 179  ASP C OD2   1 
ATOM   6605  N  N     . LEU G 2 179 ? 29.402  -28.461 217.144 1.00 86.22  ? 180  LEU C N     1 
ATOM   6606  C  CA    . LEU G 2 179 ? 29.989  -27.125 217.281 1.00 81.41  ? 180  LEU C CA    1 
ATOM   6607  C  C     . LEU G 2 179 ? 31.510  -27.210 217.196 1.00 82.04  ? 180  LEU C C     1 
ATOM   6608  O  O     . LEU G 2 179 ? 32.178  -27.662 218.131 1.00 83.07  ? 180  LEU C O     1 
ATOM   6609  C  CB    . LEU G 2 179 ? 29.604  -26.479 218.619 1.00 74.75  ? 180  LEU C CB    1 
ATOM   6610  C  CG    . LEU G 2 179 ? 28.208  -25.891 218.824 1.00 62.61  ? 180  LEU C CG    1 
ATOM   6611  C  CD1   . LEU G 2 179 ? 27.153  -26.986 218.788 1.00 64.66  ? 180  LEU C CD1   1 
ATOM   6612  C  CD2   . LEU G 2 179 ? 28.177  -25.173 220.150 1.00 47.82  ? 180  LEU C CD2   1 
ATOM   6613  N  N     . VAL G 2 180 ? 32.050  -26.756 216.072 1.00 76.56  ? 181  VAL C N     1 
ATOM   6614  C  CA    . VAL G 2 180 ? 33.484  -26.796 215.844 1.00 74.66  ? 181  VAL C CA    1 
ATOM   6615  C  C     . VAL G 2 180 ? 34.152  -25.476 216.185 1.00 73.32  ? 181  VAL C C     1 
ATOM   6616  O  O     . VAL G 2 180 ? 33.548  -24.411 216.059 1.00 69.80  ? 181  VAL C O     1 
ATOM   6617  C  CB    . VAL G 2 180 ? 33.781  -27.142 214.376 1.00 73.76  ? 181  VAL C CB    1 
ATOM   6618  C  CG1   . VAL G 2 180 ? 35.268  -27.376 214.175 1.00 69.67  ? 181  VAL C CG1   1 
ATOM   6619  C  CG2   . VAL G 2 180 ? 32.974  -28.362 213.973 1.00 74.42  ? 181  VAL C CG2   1 
ATOM   6620  N  N     . CYS G 2 181 ? 35.403  -25.559 216.628 1.00 70.32  ? 182  CYS C N     1 
ATOM   6621  C  CA    . CYS G 2 181 ? 36.173  -24.375 216.981 1.00 67.59  ? 182  CYS C CA    1 
ATOM   6622  C  C     . CYS G 2 181 ? 37.006  -23.934 215.783 1.00 65.35  ? 182  CYS C C     1 
ATOM   6623  O  O     . CYS G 2 181 ? 37.511  -24.770 215.037 1.00 68.43  ? 182  CYS C O     1 
ATOM   6624  C  CB    . CYS G 2 181 ? 37.089  -24.683 218.159 1.00 64.35  ? 182  CYS C CB    1 
ATOM   6625  S  SG    . CYS G 2 181 ? 38.307  -23.385 218.470 1.00 79.64  ? 182  CYS C SG    1 
ATOM   6626  N  N     . VAL G 2 182 ? 37.147  -22.626 215.591 1.00 61.19  ? 183  VAL C N     1 
ATOM   6627  C  CA    . VAL G 2 182 ? 37.932  -22.121 214.467 1.00 63.33  ? 183  VAL C CA    1 
ATOM   6628  C  C     . VAL G 2 182 ? 38.940  -21.061 214.887 1.00 63.06  ? 183  VAL C C     1 
ATOM   6629  O  O     . VAL G 2 182 ? 39.852  -20.739 214.135 1.00 63.51  ? 183  VAL C O     1 
ATOM   6630  C  CB    . VAL G 2 182 ? 37.034  -21.509 213.357 1.00 60.56  ? 183  VAL C CB    1 
ATOM   6631  C  CG1   . VAL G 2 182 ? 35.831  -22.402 213.108 1.00 57.75  ? 183  VAL C CG1   1 
ATOM   6632  C  CG2   . VAL G 2 182 ? 36.607  -20.097 213.737 1.00 57.87  ? 183  VAL C CG2   1 
ATOM   6633  N  N     . SER G 2 183 ? 38.774  -20.510 216.082 1.00 69.67  ? 184  SER C N     1 
ATOM   6634  C  CA    . SER G 2 183 ? 39.697  -19.489 216.554 1.00 72.76  ? 184  SER C CA    1 
ATOM   6635  C  C     . SER G 2 183 ? 39.885  -19.511 218.069 1.00 74.00  ? 184  SER C C     1 
ATOM   6636  O  O     . SER G 2 183 ? 39.210  -20.256 218.787 1.00 67.59  ? 184  SER C O     1 
ATOM   6637  C  CB    . SER G 2 183 ? 39.222  -18.107 216.100 1.00 72.09  ? 184  SER C CB    1 
ATOM   6638  O  OG    . SER G 2 183 ? 39.158  -18.041 214.688 1.00 74.56  ? 184  SER C OG    1 
ATOM   6639  N  N     . THR G 2 184 ? 40.814  -18.685 218.540 1.00 73.19  ? 185  THR C N     1 
ATOM   6640  C  CA    . THR G 2 184 ? 41.131  -18.584 219.958 1.00 70.81  ? 185  THR C CA    1 
ATOM   6641  C  C     . THR G 2 184 ? 41.817  -17.245 220.209 1.00 74.17  ? 185  THR C C     1 
ATOM   6642  O  O     . THR G 2 184 ? 42.631  -16.796 219.407 1.00 77.14  ? 185  THR C O     1 
ATOM   6643  C  CB    . THR G 2 184 ? 42.083  -19.722 220.393 1.00 68.91  ? 185  THR C CB    1 
ATOM   6644  O  OG1   . THR G 2 184 ? 41.443  -20.988 220.186 1.00 65.34  ? 185  THR C OG1   1 
ATOM   6645  C  CG2   . THR G 2 184 ? 42.458  -19.580 221.855 1.00 76.63  ? 185  THR C CG2   1 
ATOM   6646  N  N     . SER G 2 185 ? 41.483  -16.607 221.323 1.00 76.41  ? 186  SER C N     1 
ATOM   6647  C  CA    . SER G 2 185 ? 42.079  -15.326 221.657 1.00 77.48  ? 186  SER C CA    1 
ATOM   6648  C  C     . SER G 2 185 ? 42.470  -15.277 223.130 1.00 80.54  ? 186  SER C C     1 
ATOM   6649  O  O     . SER G 2 185 ? 41.671  -15.598 224.014 1.00 83.42  ? 186  SER C O     1 
ATOM   6650  C  CB    . SER G 2 185 ? 41.102  -14.195 221.332 1.00 78.86  ? 186  SER C CB    1 
ATOM   6651  O  OG    . SER G 2 185 ? 40.736  -14.222 219.961 1.00 80.26  ? 186  SER C OG    1 
ATOM   6652  N  N     . PHE G 2 186 ? 43.710  -14.878 223.384 1.00 80.69  ? 187  PHE C N     1 
ATOM   6653  C  CA    . PHE G 2 186 ? 44.226  -14.787 224.738 1.00 78.13  ? 187  PHE C CA    1 
ATOM   6654  C  C     . PHE G 2 186 ? 44.452  -13.330 225.097 1.00 74.57  ? 187  PHE C C     1 
ATOM   6655  O  O     . PHE G 2 186 ? 44.721  -12.508 224.225 1.00 71.90  ? 187  PHE C O     1 
ATOM   6656  C  CB    . PHE G 2 186 ? 45.538  -15.562 224.854 1.00 82.62  ? 187  PHE C CB    1 
ATOM   6657  C  CG    . PHE G 2 186 ? 46.144  -15.521 226.222 1.00 88.18  ? 187  PHE C CG    1 
ATOM   6658  C  CD1   . PHE G 2 186 ? 45.444  -16.006 227.320 1.00 89.38  ? 187  PHE C CD1   1 
ATOM   6659  C  CD2   . PHE G 2 186 ? 47.416  -14.997 226.414 1.00 90.05  ? 187  PHE C CD2   1 
ATOM   6660  C  CE1   . PHE G 2 186 ? 46.002  -15.968 228.591 1.00 91.36  ? 187  PHE C CE1   1 
ATOM   6661  C  CE2   . PHE G 2 186 ? 47.984  -14.955 227.683 1.00 93.05  ? 187  PHE C CE2   1 
ATOM   6662  C  CZ    . PHE G 2 186 ? 47.275  -15.442 228.774 1.00 89.75  ? 187  PHE C CZ    1 
ATOM   6663  N  N     . ALA G 2 187 ? 44.333  -13.018 226.384 1.00 77.35  ? 188  ALA C N     1 
ATOM   6664  C  CA    . ALA G 2 187 ? 44.509  -11.654 226.869 1.00 74.21  ? 188  ALA C CA    1 
ATOM   6665  C  C     . ALA G 2 187 ? 44.591  -11.639 228.387 1.00 74.43  ? 188  ALA C C     1 
ATOM   6666  O  O     . ALA G 2 187 ? 44.108  -12.557 229.052 1.00 68.68  ? 188  ALA C O     1 
ATOM   6667  C  CB    . ALA G 2 187 ? 43.352  -10.781 226.398 1.00 62.97  ? 188  ALA C CB    1 
ATOM   6668  N  N     . GLU G 2 188 ? 45.208  -10.584 228.920 1.00 78.10  ? 189  GLU C N     1 
ATOM   6669  C  CA    . GLU G 2 188 ? 45.389  -10.404 230.361 1.00 82.32  ? 189  GLU C CA    1 
ATOM   6670  C  C     . GLU G 2 188 ? 44.757  -9.093  230.829 1.00 79.24  ? 189  GLU C C     1 
ATOM   6671  O  O     . GLU G 2 188 ? 45.198  -8.009  230.446 1.00 74.04  ? 189  GLU C O     1 
ATOM   6672  C  CB    . GLU G 2 188 ? 46.881  -10.400 230.694 1.00 87.27  ? 189  GLU C CB    1 
ATOM   6673  C  CG    . GLU G 2 188 ? 47.600  -11.676 230.300 1.00 89.58  ? 189  GLU C CG    1 
ATOM   6674  C  CD    . GLU G 2 188 ? 49.105  -11.524 230.325 1.00 96.02  ? 189  GLU C CD    1 
ATOM   6675  O  OE1   . GLU G 2 188 ? 49.809  -12.534 230.102 1.00 96.56  ? 189  GLU C OE1   1 
ATOM   6676  O  OE2   . GLU G 2 188 ? 49.582  -10.392 230.562 1.00 98.77  ? 189  GLU C OE2   1 
ATOM   6677  N  N     . LEU G 2 189 ? 43.735  -9.203  231.670 1.00 72.95  ? 190  LEU C N     1 
ATOM   6678  C  CA    . LEU G 2 189 ? 43.026  -8.035  232.176 1.00 72.40  ? 190  LEU C CA    1 
ATOM   6679  C  C     . LEU G 2 189 ? 43.949  -6.888  232.546 1.00 74.29  ? 190  LEU C C     1 
ATOM   6680  O  O     . LEU G 2 189 ? 44.005  -5.863  231.867 1.00 74.55  ? 190  LEU C O     1 
ATOM   6681  C  CB    . LEU G 2 189 ? 42.194  -8.405  233.403 1.00 62.04  ? 190  LEU C CB    1 
ATOM   6682  C  CG    . LEU G 2 189 ? 41.296  -7.269  233.891 1.00 59.33  ? 190  LEU C CG    1 
ATOM   6683  C  CD1   . LEU G 2 189 ? 40.152  -7.091  232.923 1.00 40.24  ? 190  LEU C CD1   1 
ATOM   6684  C  CD2   . LEU G 2 189 ? 40.771  -7.577  235.282 1.00 65.31  ? 190  LEU C CD2   1 
ATOM   6685  N  N     . PHE G 2 190 ? 44.672  -7.075  233.638 1.00 79.06  ? 191  PHE C N     1 
ATOM   6686  C  CA    . PHE G 2 190 ? 45.586  -6.069  234.147 1.00 82.10  ? 191  PHE C CA    1 
ATOM   6687  C  C     . PHE G 2 190 ? 46.487  -5.451  233.086 1.00 85.63  ? 191  PHE C C     1 
ATOM   6688  O  O     . PHE G 2 190 ? 46.890  -4.289  233.202 1.00 84.58  ? 191  PHE C O     1 
ATOM   6689  C  CB    . PHE G 2 190 ? 46.428  -6.686  235.256 1.00 81.56  ? 191  PHE C CB    1 
ATOM   6690  C  CG    . PHE G 2 190 ? 45.621  -7.157  236.427 1.00 79.33  ? 191  PHE C CG    1 
ATOM   6691  C  CD1   . PHE G 2 190 ? 45.738  -8.465  236.888 1.00 75.18  ? 191  PHE C CD1   1 
ATOM   6692  C  CD2   . PHE G 2 190 ? 44.752  -6.283  237.082 1.00 78.22  ? 191  PHE C CD2   1 
ATOM   6693  C  CE1   . PHE G 2 190 ? 45.006  -8.896  237.985 1.00 79.60  ? 191  PHE C CE1   1 
ATOM   6694  C  CE2   . PHE G 2 190 ? 44.014  -6.700  238.178 1.00 74.12  ? 191  PHE C CE2   1 
ATOM   6695  C  CZ    . PHE G 2 190 ? 44.139  -8.009  238.635 1.00 79.66  ? 191  PHE C CZ    1 
ATOM   6696  N  N     . LYS G 2 191 ? 46.800  -6.223  232.050 1.00 83.70  ? 192  LYS C N     1 
ATOM   6697  C  CA    . LYS G 2 191 ? 47.664  -5.732  230.981 1.00 83.43  ? 192  LYS C CA    1 
ATOM   6698  C  C     . LYS G 2 191 ? 46.881  -4.860  229.999 1.00 78.47  ? 192  LYS C C     1 
ATOM   6699  O  O     . LYS G 2 191 ? 47.307  -4.651  228.865 1.00 71.71  ? 192  LYS C O     1 
ATOM   6700  C  CB    . LYS G 2 191 ? 48.308  -6.907  230.237 1.00 83.85  ? 192  LYS C CB    1 
ATOM   6701  C  CG    . LYS G 2 191 ? 49.826  -6.817  230.150 1.00 89.32  ? 192  LYS C CG    1 
ATOM   6702  C  CD    . LYS G 2 191 ? 50.467  -6.934  231.532 1.00 93.67  ? 192  LYS C CD    1 
ATOM   6703  C  CE    . LYS G 2 191 ? 51.972  -6.695  231.491 1.00 89.91  ? 192  LYS C CE    1 
ATOM   6704  N  NZ    . LYS G 2 191 ? 52.307  -5.301  231.094 1.00 85.35  ? 192  LYS C NZ    1 
ATOM   6705  N  N     . SER G 2 192 ? 45.740  -4.352  230.458 1.00 75.33  ? 193  SER C N     1 
ATOM   6706  C  CA    . SER G 2 192 ? 44.869  -3.508  229.650 1.00 71.48  ? 193  SER C CA    1 
ATOM   6707  C  C     . SER G 2 192 ? 44.835  -2.088  230.186 1.00 68.04  ? 193  SER C C     1 
ATOM   6708  O  O     . SER G 2 192 ? 45.549  -1.750  231.124 1.00 68.13  ? 193  SER C O     1 
ATOM   6709  C  CB    . SER G 2 192 ? 43.446  -4.061  229.658 1.00 69.41  ? 193  SER C CB    1 
ATOM   6710  O  OG    . SER G 2 192 ? 43.420  -5.394  229.196 1.00 74.84  ? 193  SER C OG    1 
ATOM   6711  N  N     . GLU G 2 193 ? 43.993  -1.259  229.584 1.00 68.15  ? 194  GLU C N     1 
ATOM   6712  C  CA    . GLU G 2 193 ? 43.857  0.115   230.026 1.00 77.71  ? 194  GLU C CA    1 
ATOM   6713  C  C     . GLU G 2 193 ? 42.535  0.242   230.779 1.00 84.40  ? 194  GLU C C     1 
ATOM   6714  O  O     . GLU G 2 193 ? 41.463  0.259   230.170 1.00 85.90  ? 194  GLU C O     1 
ATOM   6715  C  CB    . GLU G 2 193 ? 43.868  1.063   228.831 1.00 79.86  ? 194  GLU C CB    1 
ATOM   6716  C  CG    . GLU G 2 193 ? 44.619  2.361   229.084 1.00 87.29  ? 194  GLU C CG    1 
ATOM   6717  C  CD    . GLU G 2 193 ? 44.215  3.034   230.384 1.00 93.38  ? 194  GLU C CD    1 
ATOM   6718  O  OE1   . GLU G 2 193 ? 43.014  3.320   230.561 1.00 100.18 ? 194  GLU C OE1   1 
ATOM   6719  O  OE2   . GLU G 2 193 ? 45.102  3.282   231.230 1.00 92.88  ? 194  GLU C OE2   1 
ATOM   6720  N  N     . PRO G 2 194 ? 42.597  0.339   232.119 1.00 87.75  ? 195  PRO C N     1 
ATOM   6721  C  CA    . PRO G 2 194 ? 41.411  0.462   232.972 1.00 89.08  ? 195  PRO C CA    1 
ATOM   6722  C  C     . PRO G 2 194 ? 40.457  1.599   232.609 1.00 87.21  ? 195  PRO C C     1 
ATOM   6723  O  O     . PRO G 2 194 ? 39.240  1.404   232.565 1.00 90.44  ? 195  PRO C O     1 
ATOM   6724  C  CB    . PRO G 2 194 ? 42.011  0.616   234.369 1.00 92.53  ? 195  PRO C CB    1 
ATOM   6725  C  CG    . PRO G 2 194 ? 43.319  1.289   234.097 1.00 96.10  ? 195  PRO C CG    1 
ATOM   6726  C  CD    . PRO G 2 194 ? 43.823  0.506   232.916 1.00 92.56  ? 195  PRO C CD    1 
ATOM   6727  N  N     . SER G 2 195 ? 41.004  2.780   232.349 1.00 81.42  ? 196  SER C N     1 
ATOM   6728  C  CA    . SER G 2 195 ? 40.183  3.935   231.992 1.00 83.10  ? 196  SER C CA    1 
ATOM   6729  C  C     . SER G 2 195 ? 39.331  3.652   230.750 1.00 80.68  ? 196  SER C C     1 
ATOM   6730  O  O     . SER G 2 195 ? 38.261  4.237   230.562 1.00 72.14  ? 196  SER C O     1 
ATOM   6731  C  CB    . SER G 2 195 ? 41.077  5.150   231.733 1.00 84.72  ? 196  SER C CB    1 
ATOM   6732  O  OG    . SER G 2 195 ? 42.006  5.320   232.788 1.00 92.19  ? 196  SER C OG    1 
ATOM   6733  N  N     . GLU G 2 196 ? 39.817  2.750   229.906 1.00 78.24  ? 197  GLU C N     1 
ATOM   6734  C  CA    . GLU G 2 196 ? 39.116  2.389   228.684 1.00 79.28  ? 197  GLU C CA    1 
ATOM   6735  C  C     . GLU G 2 196 ? 38.028  1.355   228.925 1.00 75.93  ? 197  GLU C C     1 
ATOM   6736  O  O     . GLU G 2 196 ? 37.020  1.329   228.218 1.00 75.11  ? 197  GLU C O     1 
ATOM   6737  C  CB    . GLU G 2 196 ? 40.112  1.865   227.646 1.00 88.01  ? 197  GLU C CB    1 
ATOM   6738  C  CG    . GLU G 2 196 ? 40.988  2.953   227.021 1.00 94.05  ? 197  GLU C CG    1 
ATOM   6739  C  CD    . GLU G 2 196 ? 40.238  3.807   226.010 1.00 89.08  ? 197  GLU C CD    1 
ATOM   6740  O  OE1   . GLU G 2 196 ? 39.210  4.419   226.374 1.00 84.10  ? 197  GLU C OE1   1 
ATOM   6741  O  OE2   . GLU G 2 196 ? 40.683  3.858   224.845 1.00 92.35  ? 197  GLU C OE2   1 
ATOM   6742  N  N     . LEU G 2 197 ? 38.234  0.502   229.923 1.00 72.75  ? 198  LEU C N     1 
ATOM   6743  C  CA    . LEU G 2 197 ? 37.257  -0.528  230.247 1.00 68.77  ? 198  LEU C CA    1 
ATOM   6744  C  C     . LEU G 2 197 ? 35.860  0.074   230.396 1.00 67.39  ? 198  LEU C C     1 
ATOM   6745  O  O     . LEU G 2 197 ? 35.636  0.993   231.194 1.00 59.63  ? 198  LEU C O     1 
ATOM   6746  C  CB    . LEU G 2 197 ? 37.663  -1.262  231.530 1.00 60.63  ? 198  LEU C CB    1 
ATOM   6747  C  CG    . LEU G 2 197 ? 38.949  -2.081  231.434 1.00 59.65  ? 198  LEU C CG    1 
ATOM   6748  C  CD1   . LEU G 2 197 ? 39.317  -2.618  232.794 1.00 58.86  ? 198  LEU C CD1   1 
ATOM   6749  C  CD2   . LEU G 2 197 ? 38.763  -3.225  230.444 1.00 68.85  ? 198  LEU C CD2   1 
ATOM   6750  N  N     . TYR G 2 198 ? 34.931  -0.450  229.602 1.00 64.55  ? 199  TYR C N     1 
ATOM   6751  C  CA    . TYR G 2 198 ? 33.546  0.002   229.609 1.00 61.66  ? 199  TYR C CA    1 
ATOM   6752  C  C     . TYR G 2 198 ? 32.746  -0.740  230.667 1.00 57.68  ? 199  TYR C C     1 
ATOM   6753  O  O     . TYR G 2 198 ? 32.920  -1.941  230.865 1.00 60.24  ? 199  TYR C O     1 
ATOM   6754  C  CB    . TYR G 2 198 ? 32.905  -0.233  228.236 1.00 56.50  ? 199  TYR C CB    1 
ATOM   6755  C  CG    . TYR G 2 198 ? 31.445  0.151   228.176 1.00 48.77  ? 199  TYR C CG    1 
ATOM   6756  C  CD1   . TYR G 2 198 ? 30.449  -0.818  228.058 1.00 44.97  ? 199  TYR C CD1   1 
ATOM   6757  C  CD2   . TYR G 2 198 ? 31.057  1.489   228.254 1.00 46.85  ? 199  TYR C CD2   1 
ATOM   6758  C  CE1   . TYR G 2 198 ? 29.100  -0.463  228.018 1.00 36.31  ? 199  TYR C CE1   1 
ATOM   6759  C  CE2   . TYR G 2 198 ? 29.719  1.853   228.219 1.00 34.10  ? 199  TYR C CE2   1 
ATOM   6760  C  CZ    . TYR G 2 198 ? 28.747  0.874   228.101 1.00 37.92  ? 199  TYR C CZ    1 
ATOM   6761  O  OH    . TYR G 2 198 ? 27.420  1.244   228.077 1.00 49.03  ? 199  TYR C OH    1 
ATOM   6762  N  N     . ILE G 2 199 ? 31.858  -0.021  231.339 1.00 47.81  ? 200  ILE C N     1 
ATOM   6763  C  CA    . ILE G 2 199 ? 31.040  -0.626  232.369 1.00 49.32  ? 200  ILE C CA    1 
ATOM   6764  C  C     . ILE G 2 199 ? 29.578  -0.639  231.944 1.00 48.36  ? 200  ILE C C     1 
ATOM   6765  O  O     . ILE G 2 199 ? 29.019  0.399   231.577 1.00 51.15  ? 200  ILE C O     1 
ATOM   6766  C  CB    . ILE G 2 199 ? 31.151  0.160   233.698 1.00 57.54  ? 200  ILE C CB    1 
ATOM   6767  C  CG1   . ILE G 2 199 ? 32.616  0.430   234.038 1.00 51.62  ? 200  ILE C CG1   1 
ATOM   6768  C  CG2   . ILE G 2 199 ? 30.505  -0.637  234.822 1.00 60.94  ? 200  ILE C CG2   1 
ATOM   6769  C  CD1   . ILE G 2 199 ? 33.442  -0.833  234.215 1.00 57.96  ? 200  ILE C CD1   1 
ATOM   6770  N  N     . ASN G 2 200 ? 28.957  -1.813  231.986 1.00 48.03  ? 201  ASN C N     1 
ATOM   6771  C  CA    . ASN G 2 200 ? 27.541  -1.929  231.636 1.00 44.27  ? 201  ASN C CA    1 
ATOM   6772  C  C     . ASN G 2 200 ? 26.777  -2.186  232.916 1.00 45.53  ? 201  ASN C C     1 
ATOM   6773  O  O     . ASN G 2 200 ? 26.539  -3.337  233.284 1.00 47.69  ? 201  ASN C O     1 
ATOM   6774  C  CB    . ASN G 2 200 ? 27.298  -3.099  230.694 1.00 35.26  ? 201  ASN C CB    1 
ATOM   6775  C  CG    . ASN G 2 200 ? 26.007  -2.953  229.927 1.00 38.04  ? 201  ASN C CG    1 
ATOM   6776  O  OD1   . ASN G 2 200 ? 24.947  -2.694  230.512 1.00 30.23  ? 201  ASN C OD1   1 
ATOM   6777  N  ND2   . ASN G 2 200 ? 26.082  -3.108  228.610 1.00 34.03  ? 201  ASN C ND2   1 
ATOM   6778  N  N     . TRP G 2 201 ? 26.383  -1.121  233.594 1.00 48.58  ? 202  TRP C N     1 
ATOM   6779  C  CA    . TRP G 2 201 ? 25.667  -1.270  234.854 1.00 57.14  ? 202  TRP C CA    1 
ATOM   6780  C  C     . TRP G 2 201 ? 24.377  -2.072  234.751 1.00 52.60  ? 202  TRP C C     1 
ATOM   6781  O  O     . TRP G 2 201 ? 23.926  -2.656  235.733 1.00 62.13  ? 202  TRP C O     1 
ATOM   6782  C  CB    . TRP G 2 201 ? 25.372  0.108   235.436 1.00 68.48  ? 202  TRP C CB    1 
ATOM   6783  C  CG    . TRP G 2 201 ? 26.546  1.019   235.330 1.00 75.94  ? 202  TRP C CG    1 
ATOM   6784  C  CD1   . TRP G 2 201 ? 26.854  1.830   234.283 1.00 78.56  ? 202  TRP C CD1   1 
ATOM   6785  C  CD2   . TRP G 2 201 ? 27.600  1.179   236.287 1.00 80.13  ? 202  TRP C CD2   1 
ATOM   6786  N  NE1   . TRP G 2 201 ? 28.035  2.491   234.524 1.00 82.69  ? 202  TRP C NE1   1 
ATOM   6787  C  CE2   . TRP G 2 201 ? 28.514  2.109   235.747 1.00 81.78  ? 202  TRP C CE2   1 
ATOM   6788  C  CE3   . TRP G 2 201 ? 27.860  0.625   237.547 1.00 77.62  ? 202  TRP C CE3   1 
ATOM   6789  C  CZ2   . TRP G 2 201 ? 29.671  2.502   236.425 1.00 83.88  ? 202  TRP C CZ2   1 
ATOM   6790  C  CZ3   . TRP G 2 201 ? 29.010  1.014   238.220 1.00 75.74  ? 202  TRP C CZ3   1 
ATOM   6791  C  CH2   . TRP G 2 201 ? 29.901  1.945   237.656 1.00 86.10  ? 202  TRP C CH2   1 
ATOM   6792  N  N     . ALA G 2 202 ? 23.788  -2.101  233.564 1.00 51.48  ? 203  ALA C N     1 
ATOM   6793  C  CA    . ALA G 2 202 ? 22.545  -2.828  233.346 1.00 51.63  ? 203  ALA C CA    1 
ATOM   6794  C  C     . ALA G 2 202 ? 22.776  -4.332  233.260 1.00 47.80  ? 203  ALA C C     1 
ATOM   6795  O  O     . ALA G 2 202 ? 21.912  -5.118  233.611 1.00 52.09  ? 203  ALA C O     1 
ATOM   6796  C  CB    . ALA G 2 202 ? 21.878  -2.338  232.071 1.00 60.29  ? 203  ALA C CB    1 
ATOM   6797  N  N     . ALA G 2 203 ? 23.934  -4.738  232.770 1.00 41.45  ? 204  ALA C N     1 
ATOM   6798  C  CA    . ALA G 2 203 ? 24.210  -6.153  232.668 1.00 47.67  ? 204  ALA C CA    1 
ATOM   6799  C  C     . ALA G 2 203 ? 25.123  -6.602  233.807 1.00 56.65  ? 204  ALA C C     1 
ATOM   6800  O  O     . ALA G 2 203 ? 26.334  -6.771  233.617 1.00 57.06  ? 204  ALA C O     1 
ATOM   6801  C  CB    . ALA G 2 203 ? 24.852  -6.464  231.327 1.00 53.49  ? 204  ALA C CB    1 
ATOM   6802  N  N     . ALA G 2 204 ? 24.542  -6.784  234.991 1.00 49.59  ? 205  ALA C N     1 
ATOM   6803  C  CA    . ALA G 2 204 ? 25.294  -7.227  236.152 1.00 45.15  ? 205  ALA C CA    1 
ATOM   6804  C  C     . ALA G 2 204 ? 26.504  -6.338  236.393 1.00 51.43  ? 205  ALA C C     1 
ATOM   6805  O  O     . ALA G 2 204 ? 27.486  -6.769  236.999 1.00 46.57  ? 205  ALA C O     1 
ATOM   6806  C  CB    . ALA G 2 204 ? 25.735  -8.660  235.957 1.00 41.18  ? 205  ALA C CB    1 
ATOM   6807  N  N     . MET G 2 205 ? 26.424  -5.098  235.917 1.00 55.63  ? 206  MET C N     1 
ATOM   6808  C  CA    . MET G 2 205 ? 27.514  -4.147  236.075 1.00 56.32  ? 206  MET C CA    1 
ATOM   6809  C  C     . MET G 2 205 ? 28.798  -4.822  235.604 1.00 55.34  ? 206  MET C C     1 
ATOM   6810  O  O     . MET G 2 205 ? 29.845  -4.700  236.237 1.00 62.76  ? 206  MET C O     1 
ATOM   6811  C  CB    . MET G 2 205 ? 27.656  -3.749  237.547 1.00 56.67  ? 206  MET C CB    1 
ATOM   6812  C  CG    . MET G 2 205 ? 26.360  -3.337  238.211 1.00 58.57  ? 206  MET C CG    1 
ATOM   6813  S  SD    . MET G 2 205 ? 26.514  -3.081  239.994 1.00 59.33  ? 206  MET C SD    1 
ATOM   6814  C  CE    . MET G 2 205 ? 26.680  -4.768  240.541 1.00 69.77  ? 206  MET C CE    1 
ATOM   6815  N  N     . GLN G 2 206 ? 28.718  -5.546  234.496 1.00 50.31  ? 207  GLN C N     1 
ATOM   6816  C  CA    . GLN G 2 206 ? 29.892  -6.243  233.988 1.00 55.92  ? 207  GLN C CA    1 
ATOM   6817  C  C     . GLN G 2 206 ? 30.664  -5.411  232.976 1.00 57.14  ? 207  GLN C C     1 
ATOM   6818  O  O     . GLN G 2 206 ? 30.079  -4.644  232.215 1.00 60.45  ? 207  GLN C O     1 
ATOM   6819  C  CB    . GLN G 2 206 ? 29.475  -7.561  233.335 1.00 53.01  ? 207  GLN C CB    1 
ATOM   6820  C  CG    . GLN G 2 206 ? 28.651  -8.463  234.223 1.00 58.55  ? 207  GLN C CG    1 
ATOM   6821  C  CD    . GLN G 2 206 ? 29.494  -9.321  235.125 1.00 64.09  ? 207  GLN C CD    1 
ATOM   6822  O  OE1   . GLN G 2 206 ? 30.358  -10.061 234.658 1.00 73.48  ? 207  GLN C OE1   1 
ATOM   6823  N  NE2   . GLN G 2 206 ? 29.245  -9.240  236.428 1.00 77.21  ? 207  GLN C NE2   1 
ATOM   6824  N  N     . ILE G 2 207 ? 31.984  -5.547  232.985 1.00 59.38  ? 208  ILE C N     1 
ATOM   6825  C  CA    . ILE G 2 207 ? 32.813  -4.838  232.024 1.00 60.60  ? 208  ILE C CA    1 
ATOM   6826  C  C     . ILE G 2 207 ? 32.690  -5.702  230.780 1.00 58.97  ? 208  ILE C C     1 
ATOM   6827  O  O     . ILE G 2 207 ? 32.770  -6.928  230.869 1.00 61.97  ? 208  ILE C O     1 
ATOM   6828  C  CB    . ILE G 2 207 ? 34.287  -4.807  232.462 1.00 65.41  ? 208  ILE C CB    1 
ATOM   6829  C  CG1   . ILE G 2 207 ? 34.407  -4.157  233.843 1.00 70.32  ? 208  ILE C CG1   1 
ATOM   6830  C  CG2   . ILE G 2 207 ? 35.118  -4.058  231.430 1.00 74.48  ? 208  ILE C CG2   1 
ATOM   6831  C  CD1   . ILE G 2 207 ? 35.825  -4.105  234.372 1.00 61.89  ? 208  ILE C CD1   1 
ATOM   6832  N  N     . GLN G 2 208 ? 32.478  -5.094  229.623 1.00 53.24  ? 209  GLN C N     1 
ATOM   6833  C  CA    . GLN G 2 208 ? 32.342  -5.907  228.422 1.00 55.97  ? 209  GLN C CA    1 
ATOM   6834  C  C     . GLN G 2 208 ? 33.394  -5.607  227.360 1.00 56.34  ? 209  GLN C C     1 
ATOM   6835  O  O     . GLN G 2 208 ? 33.764  -4.453  227.130 1.00 55.13  ? 209  GLN C O     1 
ATOM   6836  C  CB    . GLN G 2 208 ? 30.941  -5.738  227.821 1.00 54.98  ? 209  GLN C CB    1 
ATOM   6837  C  CG    . GLN G 2 208 ? 29.796  -6.039  228.781 1.00 62.27  ? 209  GLN C CG    1 
ATOM   6838  C  CD    . GLN G 2 208 ? 28.422  -5.736  228.190 1.00 60.13  ? 209  GLN C CD    1 
ATOM   6839  O  OE1   . GLN G 2 208 ? 28.165  -4.619  227.745 1.00 63.04  ? 209  GLN C OE1   1 
ATOM   6840  N  NE2   . GLN G 2 208 ? 27.531  -6.730  228.196 1.00 53.41  ? 209  GLN C NE2   1 
ATOM   6841  N  N     . PHE G 2 209 ? 33.879  -6.667  226.726 1.00 54.39  ? 210  PHE C N     1 
ATOM   6842  C  CA    . PHE G 2 209 ? 34.860  -6.546  225.662 1.00 56.10  ? 210  PHE C CA    1 
ATOM   6843  C  C     . PHE G 2 209 ? 35.174  -7.911  225.054 1.00 57.65  ? 210  PHE C C     1 
ATOM   6844  O  O     . PHE G 2 209 ? 34.846  -8.953  225.624 1.00 55.69  ? 210  PHE C O     1 
ATOM   6845  C  CB    . PHE G 2 209 ? 36.143  -5.861  226.173 1.00 58.42  ? 210  PHE C CB    1 
ATOM   6846  C  CG    . PHE G 2 209 ? 36.933  -6.673  227.173 1.00 59.21  ? 210  PHE C CG    1 
ATOM   6847  C  CD1   . PHE G 2 209 ? 37.523  -7.879  226.806 1.00 58.15  ? 210  PHE C CD1   1 
ATOM   6848  C  CD2   . PHE G 2 209 ? 37.111  -6.215  228.476 1.00 62.50  ? 210  PHE C CD2   1 
ATOM   6849  C  CE1   . PHE G 2 209 ? 38.275  -8.613  227.719 1.00 58.27  ? 210  PHE C CE1   1 
ATOM   6850  C  CE2   . PHE G 2 209 ? 37.864  -6.943  229.395 1.00 46.98  ? 210  PHE C CE2   1 
ATOM   6851  C  CZ    . PHE G 2 209 ? 38.445  -8.143  229.015 1.00 44.16  ? 210  PHE C CZ    1 
ATOM   6852  N  N     . HIS G 2 210 ? 35.796  -7.902  223.884 1.00 56.58  ? 211  HIS C N     1 
ATOM   6853  C  CA    . HIS G 2 210 ? 36.148  -9.142  223.222 1.00 58.52  ? 211  HIS C CA    1 
ATOM   6854  C  C     . HIS G 2 210 ? 37.616  -9.427  223.502 1.00 64.34  ? 211  HIS C C     1 
ATOM   6855  O  O     . HIS G 2 210 ? 38.473  -8.567  223.307 1.00 68.62  ? 211  HIS C O     1 
ATOM   6856  C  CB    . HIS G 2 210 ? 35.903  -9.020  221.715 1.00 54.09  ? 211  HIS C CB    1 
ATOM   6857  C  CG    . HIS G 2 210 ? 34.455  -8.964  221.332 1.00 43.70  ? 211  HIS C CG    1 
ATOM   6858  N  ND1   . HIS G 2 210 ? 33.665  -10.091 221.235 1.00 44.25  ? 211  HIS C ND1   1 
ATOM   6859  C  CD2   . HIS G 2 210 ? 33.658  -7.919  221.004 1.00 42.81  ? 211  HIS C CD2   1 
ATOM   6860  C  CE1   . HIS G 2 210 ? 32.447  -9.742  220.859 1.00 39.43  ? 211  HIS C CE1   1 
ATOM   6861  N  NE2   . HIS G 2 210 ? 32.416  -8.431  220.712 1.00 42.25  ? 211  HIS C NE2   1 
ATOM   6862  N  N     . VAL G 2 211 ? 37.905  -10.631 223.976 1.00 71.30  ? 212  VAL C N     1 
ATOM   6863  C  CA    . VAL G 2 211 ? 39.279  -11.002 224.271 1.00 75.19  ? 212  VAL C CA    1 
ATOM   6864  C  C     . VAL G 2 211 ? 40.112  -10.763 223.018 1.00 68.94  ? 212  VAL C C     1 
ATOM   6865  O  O     . VAL G 2 211 ? 41.318  -10.563 223.092 1.00 70.62  ? 212  VAL C O     1 
ATOM   6866  C  CB    . VAL G 2 211 ? 39.367  -12.490 224.691 1.00 79.68  ? 212  VAL C CB    1 
ATOM   6867  C  CG1   . VAL G 2 211 ? 40.814  -12.890 224.940 1.00 76.56  ? 212  VAL C CG1   1 
ATOM   6868  C  CG2   . VAL G 2 211 ? 38.537  -12.715 225.954 1.00 88.09  ? 212  VAL C CG2   1 
ATOM   6869  N  N     . ARG G 2 212 ? 39.446  -10.767 221.870 1.00 66.28  ? 213  ARG C N     1 
ATOM   6870  C  CA    . ARG G 2 212 ? 40.109  -10.559 220.594 1.00 64.95  ? 213  ARG C CA    1 
ATOM   6871  C  C     . ARG G 2 212 ? 40.648  -9.148  220.425 1.00 61.61  ? 213  ARG C C     1 
ATOM   6872  O  O     . ARG G 2 212 ? 41.824  -8.957  220.117 1.00 62.42  ? 213  ARG C O     1 
ATOM   6873  C  CB    . ARG G 2 212 ? 39.141  -10.854 219.458 1.00 64.63  ? 213  ARG C CB    1 
ATOM   6874  C  CG    . ARG G 2 212 ? 39.711  -10.546 218.102 1.00 67.64  ? 213  ARG C CG    1 
ATOM   6875  C  CD    . ARG G 2 212 ? 38.697  -10.829 217.024 1.00 70.40  ? 213  ARG C CD    1 
ATOM   6876  N  NE    . ARG G 2 212 ? 38.255  -12.217 217.056 1.00 69.53  ? 213  ARG C NE    1 
ATOM   6877  C  CZ    . ARG G 2 212 ? 37.496  -12.774 216.119 1.00 74.82  ? 213  ARG C CZ    1 
ATOM   6878  N  NH1   . ARG G 2 212 ? 37.101  -12.051 215.078 1.00 76.98  ? 213  ARG C NH1   1 
ATOM   6879  N  NH2   . ARG G 2 212 ? 37.136  -14.050 216.220 1.00 70.05  ? 213  ARG C NH2   1 
ATOM   6880  N  N     . ASP G 2 213 ? 39.777  -8.164  220.621 1.00 62.20  ? 214  ASP C N     1 
ATOM   6881  C  CA    . ASP G 2 213 ? 40.141  -6.759  220.473 1.00 61.97  ? 214  ASP C CA    1 
ATOM   6882  C  C     . ASP G 2 213 ? 40.708  -6.140  221.749 1.00 56.92  ? 214  ASP C C     1 
ATOM   6883  O  O     . ASP G 2 213 ? 40.981  -4.941  221.787 1.00 57.76  ? 214  ASP C O     1 
ATOM   6884  C  CB    . ASP G 2 213 ? 38.918  -5.940  220.018 1.00 66.49  ? 214  ASP C CB    1 
ATOM   6885  C  CG    . ASP G 2 213 ? 38.052  -6.678  218.988 1.00 77.67  ? 214  ASP C CG    1 
ATOM   6886  O  OD1   . ASP G 2 213 ? 38.603  -7.425  218.144 1.00 90.86  ? 214  ASP C OD1   1 
ATOM   6887  O  OD2   . ASP G 2 213 ? 36.814  -6.495  219.014 1.00 64.43  ? 214  ASP C OD2   1 
ATOM   6888  N  N     . LEU G 2 214 ? 40.899  -6.946  222.790 1.00 59.97  ? 215  LEU C N     1 
ATOM   6889  C  CA    . LEU G 2 214 ? 41.416  -6.417  224.052 1.00 64.13  ? 215  LEU C CA    1 
ATOM   6890  C  C     . LEU G 2 214 ? 42.861  -5.933  223.962 1.00 63.90  ? 215  LEU C C     1 
ATOM   6891  O  O     . LEU G 2 214 ? 43.786  -6.728  223.762 1.00 54.52  ? 215  LEU C O     1 
ATOM   6892  C  CB    . LEU G 2 214 ? 41.296  -7.464  225.173 1.00 67.84  ? 215  LEU C CB    1 
ATOM   6893  C  CG    . LEU G 2 214 ? 41.795  -7.041  226.570 1.00 61.01  ? 215  LEU C CG    1 
ATOM   6894  C  CD1   . LEU G 2 214 ? 40.997  -5.850  227.088 1.00 44.72  ? 215  LEU C CD1   1 
ATOM   6895  C  CD2   . LEU G 2 214 ? 41.676  -8.207  227.526 1.00 58.10  ? 215  LEU C CD2   1 
ATOM   6896  N  N     . ASP G 2 215 ? 43.035  -4.622  224.124 1.00 64.08  ? 216  ASP C N     1 
ATOM   6897  C  CA    . ASP G 2 215 ? 44.349  -3.987  224.071 1.00 69.27  ? 216  ASP C CA    1 
ATOM   6898  C  C     . ASP G 2 215 ? 45.203  -4.331  225.289 1.00 68.15  ? 216  ASP C C     1 
ATOM   6899  O  O     . ASP G 2 215 ? 44.841  -4.027  226.424 1.00 66.66  ? 216  ASP C O     1 
ATOM   6900  C  CB    . ASP G 2 215 ? 44.202  -2.467  223.972 1.00 79.42  ? 216  ASP C CB    1 
ATOM   6901  C  CG    . ASP G 2 215 ? 43.413  -1.879  225.126 1.00 91.30  ? 216  ASP C CG    1 
ATOM   6902  O  OD1   . ASP G 2 215 ? 42.221  -2.224  225.266 1.00 94.71  ? 216  ASP C OD1   1 
ATOM   6903  O  OD2   . ASP G 2 215 ? 43.986  -1.072  225.893 1.00 94.61  ? 216  ASP C OD2   1 
ATOM   6904  N  N     . GLN G 2 216 ? 46.342  -4.961  225.032 1.00 66.58  ? 217  GLN C N     1 
ATOM   6905  C  CA    . GLN G 2 216 ? 47.265  -5.371  226.076 1.00 68.87  ? 217  GLN C CA    1 
ATOM   6906  C  C     . GLN G 2 216 ? 48.455  -4.415  226.188 1.00 72.06  ? 217  GLN C C     1 
ATOM   6907  O  O     . GLN G 2 216 ? 49.575  -4.834  226.491 1.00 70.31  ? 217  GLN C O     1 
ATOM   6908  C  CB    . GLN G 2 216 ? 47.768  -6.787  225.789 1.00 70.78  ? 217  GLN C CB    1 
ATOM   6909  C  CG    . GLN G 2 216 ? 46.678  -7.847  225.765 1.00 84.11  ? 217  GLN C CG    1 
ATOM   6910  C  CD    . GLN G 2 216 ? 46.087  -8.104  227.139 1.00 93.43  ? 217  GLN C CD    1 
ATOM   6911  O  OE1   . GLN G 2 216 ? 46.799  -8.488  228.068 1.00 98.60  ? 217  GLN C OE1   1 
ATOM   6912  N  NE2   . GLN G 2 216 ? 44.781  -7.892  227.275 1.00 93.74  ? 217  GLN C NE2   1 
ATOM   6913  N  N     . GLY G 2 217 ? 48.207  -3.128  225.951 1.00 71.52  ? 218  GLY C N     1 
ATOM   6914  C  CA    . GLY G 2 217 ? 49.273  -2.142  226.022 1.00 71.51  ? 218  GLY C CA    1 
ATOM   6915  C  C     . GLY G 2 217 ? 49.286  -1.317  227.296 1.00 74.74  ? 218  GLY C C     1 
ATOM   6916  O  O     . GLY G 2 217 ? 48.765  -0.196  227.328 1.00 73.80  ? 218  GLY C O     1 
ATOM   6917  N  N     . PHE G 2 218 ? 49.892  -1.878  228.345 1.00 79.17  ? 219  PHE C N     1 
ATOM   6918  C  CA    . PHE G 2 218 ? 50.002  -1.224  229.654 1.00 76.13  ? 219  PHE C CA    1 
ATOM   6919  C  C     . PHE G 2 218 ? 51.346  -1.568  230.326 1.00 76.86  ? 219  PHE C C     1 
ATOM   6920  O  O     . PHE G 2 218 ? 51.547  -2.688  230.797 1.00 75.05  ? 219  PHE C O     1 
ATOM   6921  C  CB    . PHE G 2 218 ? 48.842  -1.660  230.567 1.00 63.73  ? 219  PHE C CB    1 
ATOM   6922  C  CG    . PHE G 2 218 ? 48.657  -0.775  231.768 1.00 50.26  ? 219  PHE C CG    1 
ATOM   6923  C  CD1   . PHE G 2 218 ? 48.066  0.481   231.637 1.00 43.58  ? 219  PHE C CD1   1 
ATOM   6924  C  CD2   . PHE G 2 218 ? 49.142  -1.160  233.013 1.00 37.37  ? 219  PHE C CD2   1 
ATOM   6925  C  CE1   . PHE G 2 218 ? 47.967  1.346   232.727 1.00 29.16  ? 219  PHE C CE1   1 
ATOM   6926  C  CE2   . PHE G 2 218 ? 49.049  -0.302  234.112 1.00 38.40  ? 219  PHE C CE2   1 
ATOM   6927  C  CZ    . PHE G 2 218 ? 48.462  0.955   233.967 1.00 36.42  ? 219  PHE C CZ    1 
ATOM   6928  N  N     . ASN G 2 219 ? 52.262  -0.601  230.358 1.00 88.23  ? 220  ASN C N     1 
ATOM   6929  C  CA    . ASN G 2 219 ? 53.578  -0.788  230.970 1.00 93.50  ? 220  ASN C CA    1 
ATOM   6930  C  C     . ASN G 2 219 ? 53.656  -0.043  232.298 1.00 94.95  ? 220  ASN C C     1 
ATOM   6931  O  O     . ASN G 2 219 ? 54.021  1.134   232.338 1.00 98.50  ? 220  ASN C O     1 
ATOM   6932  C  CB    . ASN G 2 219 ? 54.692  -0.278  230.042 1.00 96.92  ? 220  ASN C CB    1 
ATOM   6933  C  CG    . ASN G 2 219 ? 54.806  -1.082  228.755 1.00 100.90 ? 220  ASN C CG    1 
ATOM   6934  O  OD1   . ASN G 2 219 ? 53.949  -0.997  227.874 1.00 102.66 ? 220  ASN C OD1   1 
ATOM   6935  N  ND2   . ASN G 2 219 ? 55.870  -1.872  228.644 1.00 101.40 ? 220  ASN C ND2   1 
ATOM   6936  N  N     . GLY G 2 220 ? 53.307  -0.733  233.380 1.00 93.94  ? 221  GLY C N     1 
ATOM   6937  C  CA    . GLY G 2 220 ? 53.343  -0.116  234.692 1.00 93.51  ? 221  GLY C CA    1 
ATOM   6938  C  C     . GLY G 2 220 ? 53.070  -1.109  235.802 1.00 96.10  ? 221  GLY C C     1 
ATOM   6939  O  O     . GLY G 2 220 ? 52.637  -2.235  235.537 1.00 97.68  ? 221  GLY C O     1 
ATOM   6940  N  N     . THR G 2 221 ? 53.329  -0.691  237.043 1.00 95.98  ? 222  THR C N     1 
ATOM   6941  C  CA    . THR G 2 221 ? 53.112  -1.530  238.223 1.00 91.91  ? 222  THR C CA    1 
ATOM   6942  C  C     . THR G 2 221 ? 51.629  -1.749  238.440 1.00 89.14  ? 222  THR C C     1 
ATOM   6943  O  O     . THR G 2 221 ? 50.829  -0.829  238.280 1.00 87.53  ? 222  THR C O     1 
ATOM   6944  C  CB    . THR G 2 221 ? 53.661  -0.881  239.501 1.00 91.16  ? 222  THR C CB    1 
ATOM   6945  O  OG1   . THR G 2 221 ? 53.081  0.421   239.655 1.00 89.73  ? 222  THR C OG1   1 
ATOM   6946  C  CG2   . THR G 2 221 ? 55.172  -0.772  239.446 1.00 85.71  ? 222  THR C CG2   1 
ATOM   6947  N  N     . ARG G 2 222 ? 51.272  -2.968  238.825 1.00 85.05  ? 223  ARG C N     1 
ATOM   6948  C  CA    . ARG G 2 222 ? 49.880  -3.313  239.060 1.00 84.88  ? 223  ARG C CA    1 
ATOM   6949  C  C     . ARG G 2 222 ? 49.192  -2.288  239.959 1.00 88.63  ? 223  ARG C C     1 
ATOM   6950  O  O     . ARG G 2 222 ? 47.990  -2.067  239.845 1.00 89.33  ? 223  ARG C O     1 
ATOM   6951  C  CB    . ARG G 2 222 ? 49.786  -4.702  239.692 1.00 79.92  ? 223  ARG C CB    1 
ATOM   6952  C  CG    . ARG G 2 222 ? 48.430  -5.371  239.531 1.00 71.85  ? 223  ARG C CG    1 
ATOM   6953  C  CD    . ARG G 2 222 ? 48.072  -5.540  238.060 1.00 73.30  ? 223  ARG C CD    1 
ATOM   6954  N  NE    . ARG G 2 222 ? 49.135  -6.184  237.280 1.00 74.69  ? 223  ARG C NE    1 
ATOM   6955  C  CZ    . ARG G 2 222 ? 49.442  -7.480  237.320 1.00 71.34  ? 223  ARG C CZ    1 
ATOM   6956  N  NH1   . ARG G 2 222 ? 48.770  -8.310  238.107 1.00 42.57  ? 223  ARG C NH1   1 
ATOM   6957  N  NH2   . ARG G 2 222 ? 50.427  -7.948  236.560 1.00 80.93  ? 223  ARG C NH2   1 
ATOM   6958  N  N     . GLU G 2 223 ? 49.954  -1.659  240.848 1.00 96.10  ? 224  GLU C N     1 
ATOM   6959  C  CA    . GLU G 2 223 ? 49.387  -0.665  241.749 1.00 102.38 ? 224  GLU C CA    1 
ATOM   6960  C  C     . GLU G 2 223 ? 48.783  0.486   240.956 1.00 103.24 ? 224  GLU C C     1 
ATOM   6961  O  O     . GLU G 2 223 ? 47.836  1.126   241.404 1.00 108.06 ? 224  GLU C O     1 
ATOM   6962  C  CB    . GLU G 2 223 ? 50.461  -0.124  242.697 1.00 104.98 ? 224  GLU C CB    1 
ATOM   6963  C  CG    . GLU G 2 223 ? 49.936  0.835   243.759 1.00 107.08 ? 224  GLU C CG    1 
ATOM   6964  C  CD    . GLU G 2 223 ? 51.035  1.344   244.667 1.00 109.55 ? 224  GLU C CD    1 
ATOM   6965  O  OE1   . GLU G 2 223 ? 51.801  0.509   245.188 1.00 114.24 ? 224  GLU C OE1   1 
ATOM   6966  O  OE2   . GLU G 2 223 ? 51.132  2.574   244.867 1.00 108.02 ? 224  GLU C OE2   1 
ATOM   6967  N  N     . GLU G 2 224 ? 49.331  0.750   239.778 1.00 104.58 ? 225  GLU C N     1 
ATOM   6968  C  CA    . GLU G 2 224 ? 48.819  1.831   238.952 1.00 111.59 ? 225  GLU C CA    1 
ATOM   6969  C  C     . GLU G 2 224 ? 47.455  1.466   238.365 1.00 115.82 ? 225  GLU C C     1 
ATOM   6970  O  O     . GLU G 2 224 ? 46.560  2.310   238.285 1.00 117.47 ? 225  GLU C O     1 
ATOM   6971  C  CB    . GLU G 2 224 ? 49.802  2.151   237.826 1.00 113.18 ? 225  GLU C CB    1 
ATOM   6972  C  CG    . GLU G 2 224 ? 51.225  2.407   238.295 1.00 108.47 ? 225  GLU C CG    1 
ATOM   6973  C  CD    . GLU G 2 224 ? 52.118  2.861   237.164 1.00 106.12 ? 225  GLU C CD    1 
ATOM   6974  O  OE1   . GLU G 2 224 ? 52.146  2.172   236.123 1.00 104.94 ? 225  GLU C OE1   1 
ATOM   6975  O  OE2   . GLU G 2 224 ? 52.794  3.900   237.311 1.00 102.44 ? 225  GLU C OE2   1 
ATOM   6976  N  N     . TRP G 2 225 ? 47.299  0.208   237.956 1.00 115.22 ? 226  TRP C N     1 
ATOM   6977  C  CA    . TRP G 2 225 ? 46.041  -0.265  237.383 1.00 112.06 ? 226  TRP C CA    1 
ATOM   6978  C  C     . TRP G 2 225 ? 44.886  -0.068  238.361 1.00 109.50 ? 226  TRP C C     1 
ATOM   6979  O  O     . TRP G 2 225 ? 43.802  0.372   237.977 1.00 108.45 ? 226  TRP C O     1 
ATOM   6980  C  CB    . TRP G 2 225 ? 46.159  -1.746  237.001 1.00 113.65 ? 226  TRP C CB    1 
ATOM   6981  C  CG    . TRP G 2 225 ? 44.844  -2.420  236.726 1.00 118.87 ? 226  TRP C CG    1 
ATOM   6982  C  CD1   . TRP G 2 225 ? 43.928  -2.846  237.649 1.00 119.76 ? 226  TRP C CD1   1 
ATOM   6983  C  CD2   . TRP G 2 225 ? 44.295  -2.740  235.443 1.00 118.94 ? 226  TRP C CD2   1 
ATOM   6984  N  NE1   . TRP G 2 225 ? 42.847  -3.411  237.020 1.00 121.43 ? 226  TRP C NE1   1 
ATOM   6985  C  CE2   . TRP G 2 225 ? 43.044  -3.360  235.666 1.00 120.22 ? 226  TRP C CE2   1 
ATOM   6986  C  CE3   . TRP G 2 225 ? 44.738  -2.563  234.126 1.00 112.96 ? 226  TRP C CE3   1 
ATOM   6987  C  CZ2   . TRP G 2 225 ? 42.231  -3.806  234.620 1.00 117.83 ? 226  TRP C CZ2   1 
ATOM   6988  C  CZ3   . TRP G 2 225 ? 43.927  -3.006  233.086 1.00 114.62 ? 226  TRP C CZ3   1 
ATOM   6989  C  CH2   . TRP G 2 225 ? 42.688  -3.621  233.341 1.00 115.70 ? 226  TRP C CH2   1 
ATOM   6990  N  N     . ALA G 2 226 ? 45.128  -0.398  239.624 1.00 103.24 ? 227  ALA C N     1 
ATOM   6991  C  CA    . ALA G 2 226 ? 44.122  -0.260  240.665 1.00 101.27 ? 227  ALA C CA    1 
ATOM   6992  C  C     . ALA G 2 226 ? 43.895  1.211   240.977 1.00 102.09 ? 227  ALA C C     1 
ATOM   6993  O  O     . ALA G 2 226 ? 42.765  1.699   240.940 1.00 104.86 ? 227  ALA C O     1 
ATOM   6994  C  CB    . ALA G 2 226 ? 44.574  -0.988  241.916 1.00 102.39 ? 227  ALA C CB    1 
ATOM   6995  N  N     . LYS G 2 227 ? 44.982  1.907   241.293 1.00 102.84 ? 228  LYS C N     1 
ATOM   6996  C  CA    . LYS G 2 227 ? 44.933  3.327   241.618 1.00 102.25 ? 228  LYS C CA    1 
ATOM   6997  C  C     . LYS G 2 227 ? 44.163  4.099   240.554 1.00 102.72 ? 228  LYS C C     1 
ATOM   6998  O  O     . LYS G 2 227 ? 43.505  5.095   240.852 1.00 101.61 ? 228  LYS C O     1 
ATOM   6999  C  CB    . LYS G 2 227 ? 46.358  3.889   241.738 1.00 103.62 ? 228  LYS C CB    1 
ATOM   7000  C  CG    . LYS G 2 227 ? 47.076  3.587   243.058 1.00 97.17  ? 228  LYS C CG    1 
ATOM   7001  C  CD    . LYS G 2 227 ? 46.524  4.430   244.205 1.00 94.71  ? 228  LYS C CD    1 
ATOM   7002  C  CE    . LYS G 2 227 ? 47.238  4.143   245.520 1.00 89.68  ? 228  LYS C CE    1 
ATOM   7003  N  NZ    . LYS G 2 227 ? 46.603  4.856   246.670 1.00 78.34  ? 228  LYS C NZ    1 
ATOM   7004  N  N     . SER G 2 228 ? 44.242  3.633   239.312 1.00 103.74 ? 229  SER C N     1 
ATOM   7005  C  CA    . SER G 2 228 ? 43.557  4.300   238.211 1.00 108.27 ? 229  SER C CA    1 
ATOM   7006  C  C     . SER G 2 228 ? 42.150  3.750   237.987 1.00 104.77 ? 229  SER C C     1 
ATOM   7007  O  O     . SER G 2 228 ? 41.212  4.512   237.747 1.00 107.56 ? 229  SER C O     1 
ATOM   7008  C  CB    . SER G 2 228 ? 44.383  4.162   236.926 1.00 117.06 ? 229  SER C CB    1 
ATOM   7009  O  OG    . SER G 2 228 ? 43.796  4.883   235.855 1.00 124.08 ? 229  SER C OG    1 
ATOM   7010  N  N     . TYR G 2 229 ? 42.013  2.429   238.066 1.00 100.69 ? 230  TYR C N     1 
ATOM   7011  C  CA    . TYR G 2 229 ? 40.722  1.768   237.872 1.00 93.71  ? 230  TYR C CA    1 
ATOM   7012  C  C     . TYR G 2 229 ? 39.649  2.330   238.810 1.00 90.04  ? 230  TYR C C     1 
ATOM   7013  O  O     . TYR G 2 229 ? 38.533  2.634   238.385 1.00 83.50  ? 230  TYR C O     1 
ATOM   7014  C  CB    . TYR G 2 229 ? 40.869  0.259   238.091 1.00 90.24  ? 230  TYR C CB    1 
ATOM   7015  C  CG    . TYR G 2 229 ? 39.571  -0.496  237.968 1.00 87.57  ? 230  TYR C CG    1 
ATOM   7016  C  CD1   . TYR G 2 229 ? 38.893  -0.564  236.755 1.00 88.16  ? 230  TYR C CD1   1 
ATOM   7017  C  CD2   . TYR G 2 229 ? 39.001  -1.113  239.075 1.00 87.92  ? 230  TYR C CD2   1 
ATOM   7018  C  CE1   . TYR G 2 229 ? 37.676  -1.228  236.649 1.00 86.25  ? 230  TYR C CE1   1 
ATOM   7019  C  CE2   . TYR G 2 229 ? 37.787  -1.779  238.982 1.00 86.84  ? 230  TYR C CE2   1 
ATOM   7020  C  CZ    . TYR G 2 229 ? 37.128  -1.831  237.770 1.00 85.89  ? 230  TYR C CZ    1 
ATOM   7021  O  OH    . TYR G 2 229 ? 35.913  -2.471  237.686 1.00 78.31  ? 230  TYR C OH    1 
ATOM   7022  N  N     . LEU G 2 230 ? 39.994  2.457   240.087 1.00 87.23  ? 231  LEU C N     1 
ATOM   7023  C  CA    . LEU G 2 230 ? 39.073  2.996   241.072 1.00 85.31  ? 231  LEU C CA    1 
ATOM   7024  C  C     . LEU G 2 230 ? 38.619  4.365   240.591 1.00 84.93  ? 231  LEU C C     1 
ATOM   7025  O  O     . LEU G 2 230 ? 37.442  4.706   240.672 1.00 87.55  ? 231  LEU C O     1 
ATOM   7026  C  CB    . LEU G 2 230 ? 39.768  3.126   242.428 1.00 86.33  ? 231  LEU C CB    1 
ATOM   7027  C  CG    . LEU G 2 230 ? 40.228  1.815   243.066 1.00 90.30  ? 231  LEU C CG    1 
ATOM   7028  C  CD1   . LEU G 2 230 ? 41.065  2.101   244.302 1.00 95.47  ? 231  LEU C CD1   1 
ATOM   7029  C  CD2   . LEU G 2 230 ? 39.012  0.973   243.421 1.00 88.37  ? 231  LEU C CD2   1 
ATOM   7030  N  N     . LYS G 2 231 ? 39.566  5.143   240.079 1.00 82.52  ? 232  LYS C N     1 
ATOM   7031  C  CA    . LYS G 2 231 ? 39.277  6.478   239.575 1.00 86.57  ? 232  LYS C CA    1 
ATOM   7032  C  C     . LYS G 2 231 ? 38.245  6.376   238.451 1.00 85.89  ? 232  LYS C C     1 
ATOM   7033  O  O     . LYS G 2 231 ? 37.375  7.237   238.308 1.00 87.02  ? 232  LYS C O     1 
ATOM   7034  C  CB    . LYS G 2 231 ? 40.571  7.120   239.060 1.00 92.61  ? 232  LYS C CB    1 
ATOM   7035  C  CG    . LYS G 2 231 ? 40.571  8.649   238.980 1.00 102.16 ? 232  LYS C CG    1 
ATOM   7036  C  CD    . LYS G 2 231 ? 39.705  9.190   237.852 1.00 104.83 ? 232  LYS C CD    1 
ATOM   7037  C  CE    . LYS G 2 231 ? 40.080  10.629  237.524 1.00 104.92 ? 232  LYS C CE    1 
ATOM   7038  N  NZ    . LYS G 2 231 ? 40.046  11.515  238.721 1.00 110.50 ? 232  LYS C NZ    1 
ATOM   7039  N  N     . HIS G 2 232 ? 38.340  5.307   237.667 1.00 83.41  ? 233  HIS C N     1 
ATOM   7040  C  CA    . HIS G 2 232 ? 37.426  5.078   236.554 1.00 82.39  ? 233  HIS C CA    1 
ATOM   7041  C  C     . HIS G 2 232 ? 36.057  4.562   237.014 1.00 85.07  ? 233  HIS C C     1 
ATOM   7042  O  O     . HIS G 2 232 ? 35.023  4.940   236.458 1.00 86.01  ? 233  HIS C O     1 
ATOM   7043  C  CB    . HIS G 2 232 ? 38.056  4.092   235.560 1.00 73.40  ? 233  HIS C CB    1 
ATOM   7044  C  CG    . HIS G 2 232 ? 37.200  3.800   234.367 1.00 70.21  ? 233  HIS C CG    1 
ATOM   7045  N  ND1   . HIS G 2 232 ? 36.594  4.792   233.625 1.00 70.52  ? 233  HIS C ND1   1 
ATOM   7046  C  CD2   . HIS G 2 232 ? 36.844  2.628   233.790 1.00 72.91  ? 233  HIS C CD2   1 
ATOM   7047  C  CE1   . HIS G 2 232 ? 35.899  4.242   232.646 1.00 76.50  ? 233  HIS C CE1   1 
ATOM   7048  N  NE2   . HIS G 2 232 ? 36.034  2.930   232.722 1.00 70.12  ? 233  HIS C NE2   1 
ATOM   7049  N  N     . PHE G 2 233 ? 36.050  3.702   238.028 1.00 81.08  ? 234  PHE C N     1 
ATOM   7050  C  CA    . PHE G 2 233 ? 34.803  3.152   238.543 1.00 76.84  ? 234  PHE C CA    1 
ATOM   7051  C  C     . PHE G 2 233 ? 33.917  4.251   239.119 1.00 75.18  ? 234  PHE C C     1 
ATOM   7052  O  O     . PHE G 2 233 ? 32.710  4.288   238.868 1.00 69.69  ? 234  PHE C O     1 
ATOM   7053  C  CB    . PHE G 2 233 ? 35.096  2.092   239.613 1.00 85.57  ? 234  PHE C CB    1 
ATOM   7054  C  CG    . PHE G 2 233 ? 33.865  1.572   240.319 1.00 93.34  ? 234  PHE C CG    1 
ATOM   7055  C  CD1   . PHE G 2 233 ? 33.310  2.272   241.390 1.00 94.55  ? 234  PHE C CD1   1 
ATOM   7056  C  CD2   . PHE G 2 233 ? 33.263  0.382   239.912 1.00 93.76  ? 234  PHE C CD2   1 
ATOM   7057  C  CE1   . PHE G 2 233 ? 32.177  1.794   242.044 1.00 95.37  ? 234  PHE C CE1   1 
ATOM   7058  C  CE2   . PHE G 2 233 ? 32.130  -0.105  240.560 1.00 89.64  ? 234  PHE C CE2   1 
ATOM   7059  C  CZ    . PHE G 2 233 ? 31.587  0.603   241.628 1.00 94.37  ? 234  PHE C CZ    1 
ATOM   7060  N  N     . VAL G 2 234 ? 34.523  5.149   239.889 1.00 70.94  ? 235  VAL C N     1 
ATOM   7061  C  CA    . VAL G 2 234 ? 33.786  6.243   240.506 1.00 72.08  ? 235  VAL C CA    1 
ATOM   7062  C  C     . VAL G 2 234 ? 33.081  7.092   239.463 1.00 69.62  ? 235  VAL C C     1 
ATOM   7063  O  O     . VAL G 2 234 ? 31.870  7.298   239.522 1.00 62.66  ? 235  VAL C O     1 
ATOM   7064  C  CB    . VAL G 2 234 ? 34.723  7.148   241.317 1.00 69.84  ? 235  VAL C CB    1 
ATOM   7065  C  CG1   . VAL G 2 234 ? 33.926  8.267   241.968 1.00 71.80  ? 235  VAL C CG1   1 
ATOM   7066  C  CG2   . VAL G 2 234 ? 35.445  6.326   242.364 1.00 69.57  ? 235  VAL C CG2   1 
ATOM   7067  N  N     . THR G 2 235 ? 33.854  7.580   238.505 1.00 72.52  ? 236  THR C N     1 
ATOM   7068  C  CA    . THR G 2 235 ? 33.309  8.413   237.447 1.00 79.12  ? 236  THR C CA    1 
ATOM   7069  C  C     . THR G 2 235 ? 32.066  7.796   236.797 1.00 77.53  ? 236  THR C C     1 
ATOM   7070  O  O     . THR G 2 235 ? 30.953  8.290   236.984 1.00 73.20  ? 236  THR C O     1 
ATOM   7071  C  CB    . THR G 2 235 ? 34.376  8.683   236.359 1.00 81.40  ? 236  THR C CB    1 
ATOM   7072  O  OG1   . THR G 2 235 ? 34.957  7.442   235.940 1.00 85.08  ? 236  THR C OG1   1 
ATOM   7073  C  CG2   . THR G 2 235 ? 35.472  9.595   236.897 1.00 76.49  ? 236  THR C CG2   1 
ATOM   7074  N  N     . GLN G 2 236 ? 32.257  6.715   236.046 1.00 71.50  ? 237  GLN C N     1 
ATOM   7075  C  CA    . GLN G 2 236 ? 31.153  6.059   235.360 1.00 72.81  ? 237  GLN C CA    1 
ATOM   7076  C  C     . GLN G 2 236 ? 29.962  5.760   236.260 1.00 73.99  ? 237  GLN C C     1 
ATOM   7077  O  O     . GLN G 2 236 ? 28.808  5.793   235.818 1.00 69.80  ? 237  GLN C O     1 
ATOM   7078  C  CB    . GLN G 2 236 ? 31.653  4.785   234.689 1.00 78.34  ? 237  GLN C CB    1 
ATOM   7079  C  CG    . GLN G 2 236 ? 32.670  5.095   233.614 1.00 82.52  ? 237  GLN C CG    1 
ATOM   7080  C  CD    . GLN G 2 236 ? 32.110  6.043   232.562 1.00 82.32  ? 237  GLN C CD    1 
ATOM   7081  O  OE1   . GLN G 2 236 ? 32.861  6.723   231.861 1.00 83.96  ? 237  GLN C OE1   1 
ATOM   7082  N  NE2   . GLN G 2 236 ? 30.782  6.082   232.440 1.00 72.84  ? 237  GLN C NE2   1 
ATOM   7083  N  N     . ALA G 2 237 ? 30.241  5.467   237.524 1.00 71.15  ? 238  ALA C N     1 
ATOM   7084  C  CA    . ALA G 2 237 ? 29.179  5.198   238.476 1.00 64.39  ? 238  ALA C CA    1 
ATOM   7085  C  C     . ALA G 2 237 ? 28.328  6.460   238.562 1.00 67.61  ? 238  ALA C C     1 
ATOM   7086  O  O     . ALA G 2 237 ? 27.114  6.414   238.367 1.00 66.12  ? 238  ALA C O     1 
ATOM   7087  C  CB    . ALA G 2 237 ? 29.767  4.868   239.825 1.00 55.57  ? 238  ALA C CB    1 
ATOM   7088  N  N     . GLU G 2 238 ? 28.977  7.590   238.834 1.00 74.23  ? 239  GLU C N     1 
ATOM   7089  C  CA    . GLU G 2 238 ? 28.285  8.875   238.938 1.00 81.93  ? 239  GLU C CA    1 
ATOM   7090  C  C     . GLU G 2 238 ? 27.496  9.130   237.661 1.00 80.83  ? 239  GLU C C     1 
ATOM   7091  O  O     . GLU G 2 238 ? 26.346  9.563   237.702 1.00 75.31  ? 239  GLU C O     1 
ATOM   7092  C  CB    . GLU G 2 238 ? 29.293  10.012  239.154 1.00 91.49  ? 239  GLU C CB    1 
ATOM   7093  C  CG    . GLU G 2 238 ? 30.185  9.841   240.385 1.00 101.51 ? 239  GLU C CG    1 
ATOM   7094  C  CD    . GLU G 2 238 ? 31.231  10.943  240.530 1.00 99.54  ? 239  GLU C CD    1 
ATOM   7095  O  OE1   . GLU G 2 238 ? 32.033  10.877  241.488 1.00 103.49 ? 239  GLU C OE1   1 
ATOM   7096  O  OE2   . GLU G 2 238 ? 31.254  11.871  239.693 1.00 98.18  ? 239  GLU C OE2   1 
ATOM   7097  N  N     . GLN G 2 239 ? 28.127  8.858   236.525 1.00 82.99  ? 240  GLN C N     1 
ATOM   7098  C  CA    . GLN G 2 239 ? 27.477  9.044   235.239 1.00 86.27  ? 240  GLN C CA    1 
ATOM   7099  C  C     . GLN G 2 239 ? 26.221  8.190   235.129 1.00 86.76  ? 240  GLN C C     1 
ATOM   7100  O  O     . GLN G 2 239 ? 25.197  8.650   234.625 1.00 90.88  ? 240  GLN C O     1 
ATOM   7101  C  CB    . GLN G 2 239 ? 28.436  8.695   234.101 1.00 90.92  ? 240  GLN C CB    1 
ATOM   7102  C  CG    . GLN G 2 239 ? 29.340  9.836   233.677 1.00 91.93  ? 240  GLN C CG    1 
ATOM   7103  C  CD    . GLN G 2 239 ? 28.554  11.032  233.176 1.00 94.79  ? 240  GLN C CD    1 
ATOM   7104  O  OE1   . GLN G 2 239 ? 27.640  10.890  232.357 1.00 94.71  ? 240  GLN C OE1   1 
ATOM   7105  N  NE2   . GLN G 2 239 ? 28.910  12.221  233.659 1.00 92.90  ? 240  GLN C NE2   1 
ATOM   7106  N  N     . ARG G 2 240 ? 26.294  6.947   235.595 1.00 81.46  ? 241  ARG C N     1 
ATOM   7107  C  CA    . ARG G 2 240 ? 25.132  6.072   235.532 1.00 82.98  ? 241  ARG C CA    1 
ATOM   7108  C  C     . ARG G 2 240 ? 24.039  6.626   236.436 1.00 80.54  ? 241  ARG C C     1 
ATOM   7109  O  O     . ARG G 2 240 ? 22.870  6.682   236.054 1.00 77.95  ? 241  ARG C O     1 
ATOM   7110  C  CB    . ARG G 2 240 ? 25.492  4.648   235.975 1.00 87.93  ? 241  ARG C CB    1 
ATOM   7111  C  CG    . ARG G 2 240 ? 24.314  3.658   235.931 1.00 86.34  ? 241  ARG C CG    1 
ATOM   7112  C  CD    . ARG G 2 240 ? 23.801  3.417   234.507 1.00 85.03  ? 241  ARG C CD    1 
ATOM   7113  N  NE    . ARG G 2 240 ? 22.603  2.573   234.480 1.00 77.92  ? 241  ARG C NE    1 
ATOM   7114  C  CZ    . ARG G 2 240 ? 21.957  2.214   233.371 1.00 68.61  ? 241  ARG C CZ    1 
ATOM   7115  N  NH1   . ARG G 2 240 ? 22.388  2.619   232.180 1.00 62.21  ? 241  ARG C NH1   1 
ATOM   7116  N  NH2   . ARG G 2 240 ? 20.871  1.459   233.458 1.00 44.19  ? 241  ARG C NH2   1 
ATOM   7117  N  N     . ALA G 2 241 ? 24.430  7.042   237.636 1.00 76.51  ? 242  ALA C N     1 
ATOM   7118  C  CA    . ALA G 2 241 ? 23.484  7.589   238.592 1.00 75.69  ? 242  ALA C CA    1 
ATOM   7119  C  C     . ALA G 2 241 ? 22.711  8.741   237.968 1.00 79.56  ? 242  ALA C C     1 
ATOM   7120  O  O     . ALA G 2 241 ? 21.543  8.956   238.287 1.00 89.88  ? 242  ALA C O     1 
ATOM   7121  C  CB    . ALA G 2 241 ? 24.213  8.058   239.826 1.00 73.27  ? 242  ALA C CB    1 
ATOM   7122  N  N     . ILE G 2 242 ? 23.365  9.476   237.072 1.00 77.18  ? 243  ILE C N     1 
ATOM   7123  C  CA    . ILE G 2 242 ? 22.744  10.611  236.389 1.00 76.22  ? 243  ILE C CA    1 
ATOM   7124  C  C     . ILE G 2 242 ? 21.929  10.128  235.200 1.00 78.82  ? 243  ILE C C     1 
ATOM   7125  O  O     . ILE G 2 242 ? 20.789  10.545  235.000 1.00 83.59  ? 243  ILE C O     1 
ATOM   7126  C  CB    . ILE G 2 242 ? 23.805  11.588  235.865 1.00 76.06  ? 243  ILE C CB    1 
ATOM   7127  C  CG1   . ILE G 2 242 ? 24.645  12.107  237.034 1.00 78.57  ? 243  ILE C CG1   1 
ATOM   7128  C  CG2   . ILE G 2 242 ? 23.135  12.717  235.099 1.00 66.51  ? 243  ILE C CG2   1 
ATOM   7129  C  CD1   . ILE G 2 242 ? 25.900  12.850  236.622 1.00 77.23  ? 243  ILE C CD1   1 
ATOM   7130  N  N     . SER G 2 243 ? 22.535  9.249   234.411 1.00 81.46  ? 244  SER C N     1 
ATOM   7131  C  CA    . SER G 2 243 ? 21.887  8.687   233.235 1.00 82.28  ? 244  SER C CA    1 
ATOM   7132  C  C     . SER G 2 243 ? 20.536  8.087   233.592 1.00 84.42  ? 244  SER C C     1 
ATOM   7133  O  O     . SER G 2 243 ? 19.537  8.361   232.932 1.00 87.43  ? 244  SER C O     1 
ATOM   7134  C  CB    . SER G 2 243 ? 22.763  7.595   232.619 1.00 80.26  ? 244  SER C CB    1 
ATOM   7135  O  OG    . SER G 2 243 ? 24.060  8.080   232.329 1.00 84.44  ? 244  SER C OG    1 
ATOM   7136  N  N     . MET G 2 244 ? 20.508  7.268   234.639 1.00 82.01  ? 245  MET C N     1 
ATOM   7137  C  CA    . MET G 2 244 ? 19.269  6.629   235.052 1.00 78.27  ? 245  MET C CA    1 
ATOM   7138  C  C     . MET G 2 244 ? 18.124  7.616   235.119 1.00 76.65  ? 245  MET C C     1 
ATOM   7139  O  O     . MET G 2 244 ? 17.024  7.336   234.641 1.00 76.67  ? 245  MET C O     1 
ATOM   7140  C  CB    . MET G 2 244 ? 19.436  5.943   236.410 1.00 75.84  ? 245  MET C CB    1 
ATOM   7141  C  CG    . MET G 2 244 ? 20.365  4.743   236.364 1.00 76.42  ? 245  MET C CG    1 
ATOM   7142  S  SD    . MET G 2 244 ? 20.347  3.722   237.840 1.00 65.55  ? 245  MET C SD    1 
ATOM   7143  C  CE    . MET G 2 244 ? 19.341  2.388   237.289 1.00 73.69  ? 245  MET C CE    1 
ATOM   7144  N  N     . ILE G 2 245 ? 18.393  8.777   235.703 1.00 73.00  ? 246  ILE C N     1 
ATOM   7145  C  CA    . ILE G 2 245 ? 17.375  9.809   235.853 1.00 80.25  ? 246  ILE C CA    1 
ATOM   7146  C  C     . ILE G 2 245 ? 16.863  10.328  234.522 1.00 76.28  ? 246  ILE C C     1 
ATOM   7147  O  O     . ILE G 2 245 ? 15.663  10.290  234.242 1.00 75.61  ? 246  ILE C O     1 
ATOM   7148  C  CB    . ILE G 2 245 ? 17.917  11.001  236.660 1.00 85.93  ? 246  ILE C CB    1 
ATOM   7149  C  CG1   . ILE G 2 245 ? 18.427  10.518  238.019 1.00 91.31  ? 246  ILE C CG1   1 
ATOM   7150  C  CG2   . ILE G 2 245 ? 16.830  12.040  236.844 1.00 87.97  ? 246  ILE C CG2   1 
ATOM   7151  C  CD1   . ILE G 2 245 ? 17.377  9.813   238.863 1.00 91.81  ? 246  ILE C CD1   1 
ATOM   7152  N  N     . ASP G 2 246 ? 17.782  10.821  233.704 1.00 77.33  ? 247  ASP C N     1 
ATOM   7153  C  CA    . ASP G 2 246 ? 17.429  11.362  232.403 1.00 77.59  ? 247  ASP C CA    1 
ATOM   7154  C  C     . ASP G 2 246 ? 17.051  10.291  231.395 1.00 68.57  ? 247  ASP C C     1 
ATOM   7155  O  O     . ASP G 2 246 ? 17.071  10.550  230.196 1.00 68.58  ? 247  ASP C O     1 
ATOM   7156  C  CB    . ASP G 2 246 ? 18.592  12.199  231.858 1.00 92.14  ? 247  ASP C CB    1 
ATOM   7157  C  CG    . ASP G 2 246 ? 18.894  13.417  232.726 1.00 105.40 ? 247  ASP C CG    1 
ATOM   7158  O  OD1   . ASP G 2 246 ? 18.003  14.286  232.871 1.00 111.20 ? 247  ASP C OD1   1 
ATOM   7159  O  OD2   . ASP G 2 246 ? 20.022  13.504  233.262 1.00 108.71 ? 247  ASP C OD2   1 
ATOM   7160  N  N     . LYS G 2 247 ? 16.705  9.094   231.869 1.00 66.85  ? 248  LYS C N     1 
ATOM   7161  C  CA    . LYS G 2 247 ? 16.326  8.005   230.964 1.00 61.79  ? 248  LYS C CA    1 
ATOM   7162  C  C     . LYS G 2 247 ? 15.194  7.117   231.466 1.00 62.02  ? 248  LYS C C     1 
ATOM   7163  O  O     . LYS G 2 247 ? 14.304  6.752   230.701 1.00 56.28  ? 248  LYS C O     1 
ATOM   7164  C  CB    . LYS G 2 247 ? 17.537  7.129   230.645 1.00 54.90  ? 248  LYS C CB    1 
ATOM   7165  C  CG    . LYS G 2 247 ? 17.196  5.945   229.767 1.00 57.87  ? 248  LYS C CG    1 
ATOM   7166  C  CD    . LYS G 2 247 ? 18.418  5.392   229.067 1.00 68.90  ? 248  LYS C CD    1 
ATOM   7167  C  CE    . LYS G 2 247 ? 18.034  4.314   228.067 1.00 63.70  ? 248  LYS C CE    1 
ATOM   7168  N  NZ    . LYS G 2 247 ? 19.196  3.921   227.223 1.00 71.58  ? 248  LYS C NZ    1 
ATOM   7169  N  N     . PHE G 2 248 ? 15.237  6.762   232.747 1.00 63.35  ? 249  PHE C N     1 
ATOM   7170  C  CA    . PHE G 2 248 ? 14.213  5.908   233.334 1.00 63.00  ? 249  PHE C CA    1 
ATOM   7171  C  C     . PHE G 2 248 ? 13.261  6.716   234.194 1.00 63.25  ? 249  PHE C C     1 
ATOM   7172  O  O     . PHE G 2 248 ? 12.306  6.180   234.746 1.00 65.44  ? 249  PHE C O     1 
ATOM   7173  C  CB    . PHE G 2 248 ? 14.865  4.830   234.196 1.00 73.29  ? 249  PHE C CB    1 
ATOM   7174  C  CG    . PHE G 2 248 ? 15.913  4.036   233.481 1.00 77.39  ? 249  PHE C CG    1 
ATOM   7175  C  CD1   . PHE G 2 248 ? 15.577  3.236   232.397 1.00 74.92  ? 249  PHE C CD1   1 
ATOM   7176  C  CD2   . PHE G 2 248 ? 17.242  4.097   233.885 1.00 77.35  ? 249  PHE C CD2   1 
ATOM   7177  C  CE1   . PHE G 2 248 ? 16.549  2.509   231.721 1.00 76.28  ? 249  PHE C CE1   1 
ATOM   7178  C  CE2   . PHE G 2 248 ? 18.221  3.372   233.214 1.00 79.58  ? 249  PHE C CE2   1 
ATOM   7179  C  CZ    . PHE G 2 248 ? 17.872  2.577   232.131 1.00 75.34  ? 249  PHE C CZ    1 
ATOM   7180  N  N     . VAL G 2 249 ? 13.525  8.009   234.313 1.00 68.75  ? 250  VAL C N     1 
ATOM   7181  C  CA    . VAL G 2 249 ? 12.685  8.860   235.135 1.00 73.97  ? 250  VAL C CA    1 
ATOM   7182  C  C     . VAL G 2 249 ? 12.000  9.963   234.347 1.00 80.92  ? 250  VAL C C     1 
ATOM   7183  O  O     . VAL G 2 249 ? 10.769  9.989   234.236 1.00 81.16  ? 250  VAL C O     1 
ATOM   7184  C  CB    . VAL G 2 249 ? 13.501  9.502   236.263 1.00 70.83  ? 250  VAL C CB    1 
ATOM   7185  C  CG1   . VAL G 2 249 ? 12.619  10.429  237.079 1.00 76.34  ? 250  VAL C CG1   1 
ATOM   7186  C  CG2   . VAL G 2 249 ? 14.090  8.421   237.146 1.00 69.36  ? 250  VAL C CG2   1 
ATOM   7187  N  N     . LYS G 2 250 ? 12.802  10.874  233.806 1.00 82.84  ? 251  LYS C N     1 
ATOM   7188  C  CA    . LYS G 2 250 ? 12.276  11.995  233.035 1.00 89.69  ? 251  LYS C CA    1 
ATOM   7189  C  C     . LYS G 2 250 ? 11.319  11.552  231.909 1.00 90.30  ? 251  LYS C C     1 
ATOM   7190  O  O     . LYS G 2 250 ? 10.226  12.104  231.767 1.00 88.27  ? 251  LYS C O     1 
ATOM   7191  C  CB    . LYS G 2 250 ? 13.444  12.829  232.475 1.00 91.04  ? 251  LYS C CB    1 
ATOM   7192  C  CG    . LYS G 2 250 ? 13.037  14.148  231.827 1.00 95.74  ? 251  LYS C CG    1 
ATOM   7193  C  CD    . LYS G 2 250 ? 14.250  15.003  231.448 1.00 97.57  ? 251  LYS C CD    1 
ATOM   7194  C  CE    . LYS G 2 250 ? 13.833  16.278  230.702 1.00 98.66  ? 251  LYS C CE    1 
ATOM   7195  N  NZ    . LYS G 2 250 ? 12.906  17.154  231.485 1.00 99.59  ? 251  LYS C NZ    1 
ATOM   7196  N  N     . PRO G 2 251 ? 11.707  10.541  231.106 1.00 91.84  ? 252  PRO C N     1 
ATOM   7197  C  CA    . PRO G 2 251 ? 10.844  10.070  230.015 1.00 89.65  ? 252  PRO C CA    1 
ATOM   7198  C  C     . PRO G 2 251 ? 9.449   9.631   230.461 1.00 88.15  ? 252  PRO C C     1 
ATOM   7199  O  O     . PRO G 2 251 ? 8.453   9.944   229.810 1.00 83.52  ? 252  PRO C O     1 
ATOM   7200  C  CB    . PRO G 2 251 ? 11.642  8.912   229.421 1.00 93.35  ? 252  PRO C CB    1 
ATOM   7201  C  CG    . PRO G 2 251 ? 13.054  9.332   229.653 1.00 94.60  ? 252  PRO C CG    1 
ATOM   7202  C  CD    . PRO G 2 251 ? 13.004  9.840   231.075 1.00 94.29  ? 252  PRO C CD    1 
ATOM   7203  N  N     . PHE G 2 252 ? 9.382   8.900   231.569 1.00 89.66  ? 253  PHE C N     1 
ATOM   7204  C  CA    . PHE G 2 252 ? 8.108   8.415   232.080 1.00 87.27  ? 253  PHE C CA    1 
ATOM   7205  C  C     . PHE G 2 252 ? 7.565   9.353   233.147 1.00 89.32  ? 253  PHE C C     1 
ATOM   7206  O  O     . PHE G 2 252 ? 6.480   9.140   233.686 1.00 86.69  ? 253  PHE C O     1 
ATOM   7207  C  CB    . PHE G 2 252 ? 8.271   7.013   232.671 1.00 80.40  ? 253  PHE C CB    1 
ATOM   7208  C  CG    . PHE G 2 252 ? 9.038   6.077   231.795 1.00 72.74  ? 253  PHE C CG    1 
ATOM   7209  C  CD1   . PHE G 2 252 ? 10.425  6.013   231.876 1.00 72.80  ? 253  PHE C CD1   1 
ATOM   7210  C  CD2   . PHE G 2 252 ? 8.378   5.277   230.871 1.00 69.17  ? 253  PHE C CD2   1 
ATOM   7211  C  CE1   . PHE G 2 252 ? 11.147  5.166   231.047 1.00 75.46  ? 253  PHE C CE1   1 
ATOM   7212  C  CE2   . PHE G 2 252 ? 9.087   4.427   230.037 1.00 75.05  ? 253  PHE C CE2   1 
ATOM   7213  C  CZ    . PHE G 2 252 ? 10.478  4.369   230.124 1.00 77.20  ? 253  PHE C CZ    1 
ATOM   7214  N  N     . LYS G 2 253 ? 8.325   10.396  233.448 1.00 92.34  ? 254  LYS C N     1 
ATOM   7215  C  CA    . LYS G 2 253 ? 7.915   11.359  234.457 1.00 100.11 ? 254  LYS C CA    1 
ATOM   7216  C  C     . LYS G 2 253 ? 6.559   11.959  234.082 1.00 101.72 ? 254  LYS C C     1 
ATOM   7217  O  O     . LYS G 2 253 ? 5.929   12.636  234.891 1.00 104.94 ? 254  LYS C O     1 
ATOM   7218  C  CB    . LYS G 2 253 ? 8.970   12.467  234.577 1.00 106.15 ? 254  LYS C CB    1 
ATOM   7219  C  CG    . LYS G 2 253 ? 8.839   13.368  235.806 1.00 107.62 ? 254  LYS C CG    1 
ATOM   7220  C  CD    . LYS G 2 253 ? 9.158   12.625  237.101 1.00 113.23 ? 254  LYS C CD    1 
ATOM   7221  C  CE    . LYS G 2 253 ? 9.087   13.554  238.315 1.00 115.75 ? 254  LYS C CE    1 
ATOM   7222  N  NZ    . LYS G 2 253 ? 9.360   12.848  239.605 1.00 111.96 ? 254  LYS C NZ    1 
ATOM   7223  N  N     . LYS G 2 254 ? 6.105   11.699  232.858 1.00 102.36 ? 255  LYS C N     1 
ATOM   7224  C  CA    . LYS G 2 254 ? 4.828   12.235  232.394 1.00 101.90 ? 255  LYS C CA    1 
ATOM   7225  C  C     . LYS G 2 254 ? 3.704   11.204  232.271 1.00 104.19 ? 255  LYS C C     1 
ATOM   7226  O  O     . LYS G 2 254 ? 3.000   11.149  231.263 1.00 106.59 ? 255  LYS C O     1 
ATOM   7227  C  CB    . LYS G 2 254 ? 5.034   12.974  231.061 1.00 97.29  ? 255  LYS C CB    1 
ATOM   7228  C  CG    . LYS G 2 254 ? 5.987   12.287  230.083 1.00 90.28  ? 255  LYS C CG    1 
ATOM   7229  C  CD    . LYS G 2 254 ? 5.261   11.363  229.109 1.00 93.03  ? 255  LYS C CD    1 
ATOM   7230  C  CE    . LYS G 2 254 ? 4.438   12.155  228.093 1.00 94.35  ? 255  LYS C CE    1 
ATOM   7231  N  NZ    . LYS G 2 254 ? 3.715   11.298  227.098 1.00 87.18  ? 255  LYS C NZ    1 
ATOM   7232  N  N     . TYR G 2 255 ? 3.537   10.393  233.312 1.00 104.89 ? 256  TYR C N     1 
ATOM   7233  C  CA    . TYR G 2 255 ? 2.493   9.373   233.339 1.00 107.02 ? 256  TYR C CA    1 
ATOM   7234  C  C     . TYR G 2 255 ? 1.907   9.255   234.742 1.00 110.84 ? 256  TYR C C     1 
ATOM   7235  O  O     . TYR G 2 255 ? 1.183   8.306   235.044 1.00 112.68 ? 256  TYR C O     1 
ATOM   7236  C  CB    . TYR G 2 255 ? 3.047   8.007   232.913 1.00 104.73 ? 256  TYR C CB    1 
ATOM   7237  C  CG    . TYR G 2 255 ? 3.432   7.895   231.449 1.00 100.30 ? 256  TYR C CG    1 
ATOM   7238  C  CD1   . TYR G 2 255 ? 4.750   8.099   231.030 1.00 98.80  ? 256  TYR C CD1   1 
ATOM   7239  C  CD2   . TYR G 2 255 ? 2.479   7.575   230.483 1.00 92.02  ? 256  TYR C CD2   1 
ATOM   7240  C  CE1   . TYR G 2 255 ? 5.105   7.983   229.684 1.00 91.06  ? 256  TYR C CE1   1 
ATOM   7241  C  CE2   . TYR G 2 255 ? 2.825   7.460   229.139 1.00 85.91  ? 256  TYR C CE2   1 
ATOM   7242  C  CZ    . TYR G 2 255 ? 4.136   7.664   228.749 1.00 88.56  ? 256  TYR C CZ    1 
ATOM   7243  O  OH    . TYR G 2 255 ? 4.475   7.552   227.426 1.00 86.18  ? 256  TYR C OH    1 
ATOM   7244  N  N     . ILE G 2 256 ? 2.228   10.223  235.597 1.00 112.33 ? 257  ILE C N     1 
ATOM   7245  C  CA    . ILE G 2 256 ? 1.738   10.234  236.971 1.00 113.64 ? 257  ILE C CA    1 
ATOM   7246  C  C     . ILE G 2 256 ? 0.672   11.314  237.174 1.00 117.25 ? 257  ILE C C     1 
ATOM   7247  O  O     . ILE G 2 256 ? 0.771   12.409  236.616 1.00 116.62 ? 257  ILE C O     1 
ATOM   7248  C  CB    . ILE G 2 256 ? 2.887   10.482  237.972 1.00 108.50 ? 257  ILE C CB    1 
ATOM   7249  C  CG1   . ILE G 2 256 ? 3.923   9.360   237.871 1.00 104.50 ? 257  ILE C CG1   1 
ATOM   7250  C  CG2   . ILE G 2 256 ? 2.338   10.574  239.388 1.00 110.28 ? 257  ILE C CG2   1 
ATOM   7251  C  CD1   . ILE G 2 256 ? 4.779   9.419   236.631 1.00 100.48 ? 257  ILE C CD1   1 
ATOM   7252  N  N     . LEU G 2 257 ? -0.337  10.997  237.982 1.00 119.44 ? 258  LEU C N     1 
ATOM   7253  C  CA    . LEU G 2 257 ? -1.436  11.918  238.265 1.00 120.91 ? 258  LEU C CA    1 
ATOM   7254  C  C     . LEU G 2 257 ? -0.909  13.248  238.787 1.00 121.25 ? 258  LEU C C     1 
ATOM   7255  O  O     . LEU G 2 257 ? -0.623  13.300  240.002 1.00 123.04 ? 258  LEU C O     1 
ATOM   7256  C  CB    . LEU G 2 257 ? -2.389  11.294  239.294 1.00 120.62 ? 258  LEU C CB    1 
ATOM   7257  C  CG    . LEU G 2 257 ? -3.793  11.888  239.483 1.00 120.42 ? 258  LEU C CG    1 
ATOM   7258  C  CD1   . LEU G 2 257 ? -4.599  10.962  240.380 1.00 116.53 ? 258  LEU C CD1   1 
ATOM   7259  C  CD2   . LEU G 2 257 ? -3.726  13.287  240.078 1.00 118.24 ? 258  LEU C CD2   1 
ATOM   7260  N  N     . SER H 2 1   ? -6.269  -15.661 229.392 1.00 56.96  ? 2    SER D N     1 
ATOM   7261  C  CA    . SER H 2 1   ? -5.385  -16.855 229.534 1.00 59.70  ? 2    SER D CA    1 
ATOM   7262  C  C     . SER H 2 1   ? -6.033  -18.136 229.029 1.00 62.61  ? 2    SER D C     1 
ATOM   7263  O  O     . SER H 2 1   ? -7.103  -18.536 229.493 1.00 66.56  ? 2    SER D O     1 
ATOM   7264  C  CB    . SER H 2 1   ? -4.976  -17.066 230.994 1.00 47.58  ? 2    SER D CB    1 
ATOM   7265  O  OG    . SER H 2 1   ? -4.260  -18.283 231.136 1.00 44.12  ? 2    SER D OG    1 
ATOM   7266  N  N     . PHE H 2 2   ? -5.368  -18.785 228.085 1.00 60.27  ? 3    PHE D N     1 
ATOM   7267  C  CA    . PHE H 2 2   ? -5.876  -20.025 227.536 1.00 61.85  ? 3    PHE D CA    1 
ATOM   7268  C  C     . PHE H 2 2   ? -5.134  -21.174 228.196 1.00 62.07  ? 3    PHE D C     1 
ATOM   7269  O  O     . PHE H 2 2   ? -5.232  -22.315 227.757 1.00 70.61  ? 3    PHE D O     1 
ATOM   7270  C  CB    . PHE H 2 2   ? -5.667  -20.056 226.019 1.00 65.78  ? 3    PHE D CB    1 
ATOM   7271  C  CG    . PHE H 2 2   ? -6.076  -18.785 225.330 1.00 68.67  ? 3    PHE D CG    1 
ATOM   7272  C  CD1   . PHE H 2 2   ? -7.314  -18.206 225.591 1.00 68.17  ? 3    PHE D CD1   1 
ATOM   7273  C  CD2   . PHE H 2 2   ? -5.216  -18.152 224.441 1.00 66.55  ? 3    PHE D CD2   1 
ATOM   7274  C  CE1   . PHE H 2 2   ? -7.689  -17.011 224.980 1.00 62.04  ? 3    PHE D CE1   1 
ATOM   7275  C  CE2   . PHE H 2 2   ? -5.582  -16.958 223.826 1.00 60.05  ? 3    PHE D CE2   1 
ATOM   7276  C  CZ    . PHE H 2 2   ? -6.821  -16.387 224.097 1.00 56.74  ? 3    PHE D CZ    1 
ATOM   7277  N  N     . ILE H 2 3   ? -4.397  -20.868 229.260 1.00 56.84  ? 4    ILE D N     1 
ATOM   7278  C  CA    . ILE H 2 3   ? -3.636  -21.892 229.972 1.00 56.87  ? 4    ILE D CA    1 
ATOM   7279  C  C     . ILE H 2 3   ? -4.391  -22.315 231.241 1.00 61.87  ? 4    ILE D C     1 
ATOM   7280  O  O     . ILE H 2 3   ? -4.678  -23.497 231.449 1.00 52.73  ? 4    ILE D O     1 
ATOM   7281  C  CB    . ILE H 2 3   ? -2.219  -21.363 230.360 1.00 58.77  ? 4    ILE D CB    1 
ATOM   7282  C  CG1   . ILE H 2 3   ? -1.686  -20.436 229.266 1.00 55.35  ? 4    ILE D CG1   1 
ATOM   7283  C  CG2   . ILE H 2 3   ? -1.234  -22.523 230.492 1.00 44.60  ? 4    ILE D CG2   1 
ATOM   7284  C  CD1   . ILE H 2 3   ? -1.510  -21.113 227.920 1.00 59.19  ? 4    ILE D CD1   1 
ATOM   7285  N  N     . LYS H 2 4   ? -4.726  -21.334 232.072 1.00 69.20  ? 5    LYS D N     1 
ATOM   7286  C  CA    . LYS H 2 4   ? -5.446  -21.574 233.320 1.00 77.61  ? 5    LYS D CA    1 
ATOM   7287  C  C     . LYS H 2 4   ? -6.622  -22.550 233.189 1.00 84.18  ? 5    LYS D C     1 
ATOM   7288  O  O     . LYS H 2 4   ? -6.811  -23.424 234.039 1.00 86.76  ? 5    LYS D O     1 
ATOM   7289  C  CB    . LYS H 2 4   ? -5.935  -20.239 233.892 1.00 79.58  ? 5    LYS D CB    1 
ATOM   7290  C  CG    . LYS H 2 4   ? -6.536  -20.347 235.277 1.00 79.87  ? 5    LYS D CG    1 
ATOM   7291  C  CD    . LYS H 2 4   ? -6.425  -19.031 236.024 1.00 83.81  ? 5    LYS D CD    1 
ATOM   7292  C  CE    . LYS H 2 4   ? -6.995  -19.156 237.430 1.00 94.22  ? 5    LYS D CE    1 
ATOM   7293  N  NZ    . LYS H 2 4   ? -6.378  -20.276 238.212 1.00 95.40  ? 5    LYS D NZ    1 
ATOM   7294  N  N     . PRO H 2 5   ? -7.437  -22.407 232.127 1.00 87.62  ? 6    PRO D N     1 
ATOM   7295  C  CA    . PRO H 2 5   ? -8.582  -23.303 231.930 1.00 88.75  ? 6    PRO D CA    1 
ATOM   7296  C  C     . PRO H 2 5   ? -8.223  -24.792 231.967 1.00 85.65  ? 6    PRO D C     1 
ATOM   7297  O  O     . PRO H 2 5   ? -8.847  -25.561 232.697 1.00 84.99  ? 6    PRO D O     1 
ATOM   7298  C  CB    . PRO H 2 5   ? -9.120  -22.863 230.572 1.00 90.33  ? 6    PRO D CB    1 
ATOM   7299  C  CG    . PRO H 2 5   ? -8.881  -21.386 230.608 1.00 90.76  ? 6    PRO D CG    1 
ATOM   7300  C  CD    . PRO H 2 5   ? -7.468  -21.306 231.144 1.00 87.99  ? 6    PRO D CD    1 
ATOM   7301  N  N     . ILE H 2 6   ? -7.219  -25.189 231.188 1.00 81.58  ? 7    ILE D N     1 
ATOM   7302  C  CA    . ILE H 2 6   ? -6.800  -26.586 231.146 1.00 82.61  ? 7    ILE D CA    1 
ATOM   7303  C  C     . ILE H 2 6   ? -5.444  -26.809 231.822 1.00 83.44  ? 7    ILE D C     1 
ATOM   7304  O  O     . ILE H 2 6   ? -4.706  -27.728 231.460 1.00 78.18  ? 7    ILE D O     1 
ATOM   7305  C  CB    . ILE H 2 6   ? -6.719  -27.110 229.685 1.00 84.29  ? 7    ILE D CB    1 
ATOM   7306  C  CG1   . ILE H 2 6   ? -5.460  -26.583 228.996 1.00 82.38  ? 7    ILE D CG1   1 
ATOM   7307  C  CG2   . ILE H 2 6   ? -7.948  -26.660 228.904 1.00 83.01  ? 7    ILE D CG2   1 
ATOM   7308  C  CD1   . ILE H 2 6   ? -5.422  -25.080 228.851 1.00 97.73  ? 7    ILE D CD1   1 
ATOM   7309  N  N     . TYR H 2 7   ? -5.121  -25.971 232.804 1.00 88.11  ? 8    TYR D N     1 
ATOM   7310  C  CA    . TYR H 2 7   ? -3.857  -26.088 233.530 1.00 96.91  ? 8    TYR D CA    1 
ATOM   7311  C  C     . TYR H 2 7   ? -3.834  -27.358 234.367 1.00 98.66  ? 8    TYR D C     1 
ATOM   7312  O  O     . TYR H 2 7   ? -2.785  -27.977 234.553 1.00 95.05  ? 8    TYR D O     1 
ATOM   7313  C  CB    . TYR H 2 7   ? -3.650  -24.878 234.444 1.00 101.52 ? 8    TYR D CB    1 
ATOM   7314  C  CG    . TYR H 2 7   ? -2.478  -25.011 235.399 1.00 108.28 ? 8    TYR D CG    1 
ATOM   7315  C  CD1   . TYR H 2 7   ? -1.182  -25.223 234.925 1.00 110.94 ? 8    TYR D CD1   1 
ATOM   7316  C  CD2   . TYR H 2 7   ? -2.665  -24.904 236.778 1.00 112.14 ? 8    TYR D CD2   1 
ATOM   7317  C  CE1   . TYR H 2 7   ? -0.098  -25.322 235.807 1.00 113.77 ? 8    TYR D CE1   1 
ATOM   7318  C  CE2   . TYR H 2 7   ? -1.591  -25.001 237.666 1.00 113.92 ? 8    TYR D CE2   1 
ATOM   7319  C  CZ    . TYR H 2 7   ? -0.313  -25.209 237.175 1.00 114.40 ? 8    TYR D CZ    1 
ATOM   7320  O  OH    . TYR H 2 7   ? 0.743   -25.291 238.055 1.00 107.33 ? 8    TYR D OH    1 
ATOM   7321  N  N     . GLN H 2 8   ? -5.001  -27.739 234.874 1.00 101.87 ? 9    GLN D N     1 
ATOM   7322  C  CA    . GLN H 2 8   ? -5.120  -28.937 235.685 1.00 103.37 ? 9    GLN D CA    1 
ATOM   7323  C  C     . GLN H 2 8   ? -4.796  -30.160 234.831 1.00 105.82 ? 9    GLN D C     1 
ATOM   7324  O  O     . GLN H 2 8   ? -4.796  -31.285 235.322 1.00 109.10 ? 9    GLN D O     1 
ATOM   7325  C  CB    . GLN H 2 8   ? -6.541  -29.047 236.249 1.00 103.02 ? 9    GLN D CB    1 
ATOM   7326  N  N     . ASP H 2 9   ? -4.522  -29.932 233.549 1.00 107.93 ? 10   ASP D N     1 
ATOM   7327  C  CA    . ASP H 2 9   ? -4.191  -31.010 232.619 1.00 106.66 ? 10   ASP D CA    1 
ATOM   7328  C  C     . ASP H 2 9   ? -2.723  -30.909 232.211 1.00 101.45 ? 10   ASP D C     1 
ATOM   7329  O  O     . ASP H 2 9   ? -2.175  -31.805 231.568 1.00 101.14 ? 10   ASP D O     1 
ATOM   7330  C  CB    . ASP H 2 9   ? -5.071  -30.923 231.366 1.00 113.09 ? 10   ASP D CB    1 
ATOM   7331  C  CG    . ASP H 2 9   ? -6.557  -30.963 231.686 1.00 118.17 ? 10   ASP D CG    1 
ATOM   7332  O  OD1   . ASP H 2 9   ? -7.017  -31.956 232.290 1.00 123.40 ? 10   ASP D OD1   1 
ATOM   7333  O  OD2   . ASP H 2 9   ? -7.268  -30.000 231.325 1.00 121.21 ? 10   ASP D OD2   1 
ATOM   7334  N  N     . ILE H 2 10  ? -2.099  -29.801 232.593 1.00 92.97  ? 11   ILE D N     1 
ATOM   7335  C  CA    . ILE H 2 10  ? -0.702  -29.544 232.281 1.00 82.64  ? 11   ILE D CA    1 
ATOM   7336  C  C     . ILE H 2 10  ? 0.179   -29.914 233.467 1.00 79.17  ? 11   ILE D C     1 
ATOM   7337  O  O     . ILE H 2 10  ? 1.189   -30.606 233.316 1.00 68.39  ? 11   ILE D O     1 
ATOM   7338  C  CB    . ILE H 2 10  ? -0.496  -28.051 231.945 1.00 76.21  ? 11   ILE D CB    1 
ATOM   7339  C  CG1   . ILE H 2 10  ? -1.428  -27.644 230.800 1.00 77.05  ? 11   ILE D CG1   1 
ATOM   7340  C  CG2   . ILE H 2 10  ? 0.952   -27.791 231.582 1.00 72.91  ? 11   ILE D CG2   1 
ATOM   7341  C  CD1   . ILE H 2 10  ? -1.202  -28.403 229.503 1.00 71.18  ? 11   ILE D CD1   1 
ATOM   7342  N  N     . ASN H 2 11  ? -0.217  -29.447 234.649 1.00 78.92  ? 12   ASN D N     1 
ATOM   7343  C  CA    . ASN H 2 11  ? 0.524   -29.717 235.877 1.00 75.78  ? 12   ASN D CA    1 
ATOM   7344  C  C     . ASN H 2 11  ? 0.780   -31.207 236.010 1.00 76.14  ? 12   ASN D C     1 
ATOM   7345  O  O     . ASN H 2 11  ? 1.796   -31.623 236.570 1.00 72.82  ? 12   ASN D O     1 
ATOM   7346  C  CB    . ASN H 2 11  ? -0.268  -29.240 237.095 1.00 75.78  ? 12   ASN D CB    1 
ATOM   7347  C  CG    . ASN H 2 11  ? 0.479   -29.463 238.406 1.00 79.18  ? 12   ASN D CG    1 
ATOM   7348  O  OD1   . ASN H 2 11  ? 1.265   -28.621 238.841 1.00 74.76  ? 12   ASN D OD1   1 
ATOM   7349  N  ND2   . ASN H 2 11  ? 0.245   -30.614 239.032 1.00 75.91  ? 12   ASN D ND2   1 
ATOM   7350  N  N     . SER H 2 12  ? -0.152  -31.999 235.485 1.00 80.39  ? 13   SER D N     1 
ATOM   7351  C  CA    . SER H 2 12  ? -0.070  -33.458 235.540 1.00 82.92  ? 13   SER D CA    1 
ATOM   7352  C  C     . SER H 2 12  ? 0.917   -34.032 234.528 1.00 78.64  ? 13   SER D C     1 
ATOM   7353  O  O     . SER H 2 12  ? 1.868   -34.723 234.894 1.00 79.31  ? 13   SER D O     1 
ATOM   7354  C  CB    . SER H 2 12  ? -1.456  -34.074 235.303 1.00 85.92  ? 13   SER D CB    1 
ATOM   7355  O  OG    . SER H 2 12  ? -1.912  -33.823 233.983 1.00 92.06  ? 13   SER D OG    1 
ATOM   7356  N  N     . ILE H 2 13  ? 0.683   -33.749 233.254 1.00 75.52  ? 14   ILE D N     1 
ATOM   7357  C  CA    . ILE H 2 13  ? 1.551   -34.245 232.199 1.00 77.98  ? 14   ILE D CA    1 
ATOM   7358  C  C     . ILE H 2 13  ? 2.994   -33.834 232.463 1.00 79.61  ? 14   ILE D C     1 
ATOM   7359  O  O     . ILE H 2 13  ? 3.933   -34.511 232.040 1.00 79.99  ? 14   ILE D O     1 
ATOM   7360  C  CB    . ILE H 2 13  ? 1.117   -33.696 230.822 1.00 77.81  ? 14   ILE D CB    1 
ATOM   7361  C  CG1   . ILE H 2 13  ? -0.374  -33.983 230.599 1.00 84.70  ? 14   ILE D CG1   1 
ATOM   7362  C  CG2   . ILE H 2 13  ? 1.960   -34.332 229.727 1.00 68.71  ? 14   ILE D CG2   1 
ATOM   7363  C  CD1   . ILE H 2 13  ? -0.943  -33.445 229.299 1.00 82.86  ? 14   ILE D CD1   1 
ATOM   7364  N  N     . LEU H 2 14  ? 3.164   -32.720 233.167 1.00 80.37  ? 15   LEU D N     1 
ATOM   7365  C  CA    . LEU H 2 14  ? 4.496   -32.222 233.479 1.00 84.42  ? 15   LEU D CA    1 
ATOM   7366  C  C     . LEU H 2 14  ? 5.148   -32.961 234.650 1.00 87.50  ? 15   LEU D C     1 
ATOM   7367  O  O     . LEU H 2 14  ? 6.243   -33.509 234.510 1.00 93.02  ? 15   LEU D O     1 
ATOM   7368  C  CB    . LEU H 2 14  ? 4.442   -30.714 233.755 1.00 79.34  ? 15   LEU D CB    1 
ATOM   7369  C  CG    . LEU H 2 14  ? 4.124   -29.832 232.538 1.00 73.80  ? 15   LEU D CG    1 
ATOM   7370  C  CD1   . LEU H 2 14  ? 4.093   -28.370 232.957 1.00 68.14  ? 15   LEU D CD1   1 
ATOM   7371  C  CD2   . LEU H 2 14  ? 5.170   -30.047 231.451 1.00 62.66  ? 15   LEU D CD2   1 
ATOM   7372  N  N     . ILE H 2 15  ? 4.485   -32.983 235.800 1.00 84.78  ? 16   ILE D N     1 
ATOM   7373  C  CA    . ILE H 2 15  ? 5.034   -33.673 236.962 1.00 82.24  ? 16   ILE D CA    1 
ATOM   7374  C  C     . ILE H 2 15  ? 5.374   -35.122 236.617 1.00 83.63  ? 16   ILE D C     1 
ATOM   7375  O  O     . ILE H 2 15  ? 4.514   -35.880 236.166 1.00 85.42  ? 16   ILE D O     1 
ATOM   7376  C  CB    . ILE H 2 15  ? 4.039   -33.653 238.135 1.00 81.18  ? 16   ILE D CB    1 
ATOM   7377  C  CG1   . ILE H 2 15  ? 3.842   -32.214 238.609 1.00 88.80  ? 16   ILE D CG1   1 
ATOM   7378  C  CG2   . ILE H 2 15  ? 4.545   -34.523 239.271 1.00 79.09  ? 16   ILE D CG2   1 
ATOM   7379  C  CD1   . ILE H 2 15  ? 2.842   -32.075 239.729 1.00 90.22  ? 16   ILE D CD1   1 
ATOM   7380  N  N     . GLY H 2 16  ? 6.634   -35.496 236.821 1.00 80.65  ? 17   GLY D N     1 
ATOM   7381  C  CA    . GLY H 2 16  ? 7.061   -36.851 236.525 1.00 74.80  ? 17   GLY D CA    1 
ATOM   7382  C  C     . GLY H 2 16  ? 7.912   -36.954 235.275 1.00 76.38  ? 17   GLY D C     1 
ATOM   7383  O  O     . GLY H 2 16  ? 8.495   -38.003 235.002 1.00 78.55  ? 17   GLY D O     1 
ATOM   7384  N  N     . GLN H 2 17  ? 7.980   -35.865 234.512 1.00 79.14  ? 18   GLN D N     1 
ATOM   7385  C  CA    . GLN H 2 17  ? 8.763   -35.816 233.276 1.00 74.82  ? 18   GLN D CA    1 
ATOM   7386  C  C     . GLN H 2 17  ? 10.255  -35.689 233.572 1.00 72.93  ? 18   GLN D C     1 
ATOM   7387  O  O     . GLN H 2 17  ? 10.681  -34.768 234.269 1.00 62.73  ? 18   GLN D O     1 
ATOM   7388  C  CB    . GLN H 2 17  ? 8.300   -34.639 232.412 1.00 71.40  ? 18   GLN D CB    1 
ATOM   7389  C  CG    . GLN H 2 17  ? 6.893   -34.791 231.855 1.00 59.89  ? 18   GLN D CG    1 
ATOM   7390  C  CD    . GLN H 2 17  ? 6.830   -35.782 230.715 1.00 75.40  ? 18   GLN D CD    1 
ATOM   7391  O  OE1   . GLN H 2 17  ? 7.285   -36.922 230.836 1.00 79.31  ? 18   GLN D OE1   1 
ATOM   7392  N  NE2   . GLN H 2 17  ? 6.261   -35.354 229.595 1.00 76.83  ? 18   GLN D NE2   1 
ATOM   7393  N  N     . LYS H 2 18  ? 11.038  -36.618 233.026 1.00 78.14  ? 19   LYS D N     1 
ATOM   7394  C  CA    . LYS H 2 18  ? 12.484  -36.647 233.231 1.00 82.32  ? 19   LYS D CA    1 
ATOM   7395  C  C     . LYS H 2 18  ? 13.260  -36.364 231.956 1.00 87.58  ? 19   LYS D C     1 
ATOM   7396  O  O     . LYS H 2 18  ? 13.095  -37.059 230.956 1.00 95.19  ? 19   LYS D O     1 
ATOM   7397  C  CB    . LYS H 2 18  ? 12.917  -38.012 233.773 1.00 75.20  ? 19   LYS D CB    1 
ATOM   7398  N  N     . VAL H 2 19  ? 14.113  -35.346 232.002 1.00 93.30  ? 20   VAL D N     1 
ATOM   7399  C  CA    . VAL H 2 19  ? 14.937  -34.974 230.858 1.00 98.73  ? 20   VAL D CA    1 
ATOM   7400  C  C     . VAL H 2 19  ? 16.396  -35.306 231.141 1.00 106.45 ? 20   VAL D C     1 
ATOM   7401  O  O     . VAL H 2 19  ? 16.946  -34.894 232.163 1.00 109.70 ? 20   VAL D O     1 
ATOM   7402  C  CB    . VAL H 2 19  ? 14.823  -33.477 230.561 1.00 97.65  ? 20   VAL D CB    1 
ATOM   7403  C  CG1   . VAL H 2 19  ? 13.488  -33.185 229.910 1.00 99.92  ? 20   VAL D CG1   1 
ATOM   7404  C  CG2   . VAL H 2 19  ? 14.964  -32.683 231.849 1.00 92.29  ? 20   VAL D CG2   1 
ATOM   7405  N  N     . LYS H 2 20  ? 17.018  -36.047 230.229 1.00 112.84 ? 21   LYS D N     1 
ATOM   7406  C  CA    . LYS H 2 20  ? 18.411  -36.462 230.380 1.00 120.35 ? 21   LYS D CA    1 
ATOM   7407  C  C     . LYS H 2 20  ? 19.346  -35.320 230.789 1.00 123.65 ? 21   LYS D C     1 
ATOM   7408  O  O     . LYS H 2 20  ? 19.072  -34.149 230.524 1.00 123.90 ? 21   LYS D O     1 
ATOM   7409  C  CB    . LYS H 2 20  ? 18.912  -37.095 229.077 1.00 120.58 ? 21   LYS D CB    1 
ATOM   7410  C  CG    . LYS H 2 20  ? 20.208  -37.883 229.225 1.00 121.58 ? 21   LYS D CG    1 
ATOM   7411  C  CD    . LYS H 2 20  ? 19.996  -39.140 230.060 1.00 121.52 ? 21   LYS D CD    1 
ATOM   7412  C  CE    . LYS H 2 20  ? 21.307  -39.862 230.329 1.00 116.89 ? 21   LYS D CE    1 
ATOM   7413  N  NZ    . LYS H 2 20  ? 22.212  -39.052 231.191 1.00 114.38 ? 21   LYS D NZ    1 
ATOM   7414  N  N     . ARG H 2 21  ? 20.450  -35.678 231.439 1.00 127.59 ? 22   ARG D N     1 
ATOM   7415  C  CA    . ARG H 2 21  ? 21.442  -34.709 231.895 1.00 130.55 ? 22   ARG D CA    1 
ATOM   7416  C  C     . ARG H 2 21  ? 21.875  -33.822 230.734 1.00 136.83 ? 22   ARG D C     1 
ATOM   7417  O  O     . ARG H 2 21  ? 22.257  -34.318 229.675 1.00 139.44 ? 22   ARG D O     1 
ATOM   7418  C  CB    . ARG H 2 21  ? 22.664  -35.437 232.459 1.00 127.28 ? 22   ARG D CB    1 
ATOM   7419  C  CG    . ARG H 2 21  ? 23.638  -34.551 233.221 1.00 120.46 ? 22   ARG D CG    1 
ATOM   7420  C  CD    . ARG H 2 21  ? 23.044  -34.101 234.544 1.00 117.62 ? 22   ARG D CD    1 
ATOM   7421  N  NE    . ARG H 2 21  ? 24.047  -33.521 235.433 1.00 116.20 ? 22   ARG D NE    1 
ATOM   7422  C  CZ    . ARG H 2 21  ? 24.702  -32.390 235.193 1.00 116.72 ? 22   ARG D CZ    1 
ATOM   7423  N  NH1   . ARG H 2 21  ? 24.463  -31.702 234.085 1.00 119.72 ? 22   ARG D NH1   1 
ATOM   7424  N  NH2   . ARG H 2 21  ? 25.603  -31.949 236.061 1.00 112.89 ? 22   ARG D NH2   1 
ATOM   7425  N  N     . PRO H 2 22  ? 21.818  -32.493 230.919 1.00 140.41 ? 23   PRO D N     1 
ATOM   7426  C  CA    . PRO H 2 22  ? 22.201  -31.518 229.893 1.00 142.42 ? 23   PRO D CA    1 
ATOM   7427  C  C     . PRO H 2 22  ? 23.593  -31.746 229.311 1.00 144.75 ? 23   PRO D C     1 
ATOM   7428  O  O     . PRO H 2 22  ? 24.544  -31.057 229.673 1.00 146.95 ? 23   PRO D O     1 
ATOM   7429  C  CB    . PRO H 2 22  ? 22.095  -30.188 230.630 1.00 141.51 ? 23   PRO D CB    1 
ATOM   7430  C  CG    . PRO H 2 22  ? 20.964  -30.430 231.568 1.00 142.84 ? 23   PRO D CG    1 
ATOM   7431  C  CD    . PRO H 2 22  ? 21.286  -31.807 232.110 1.00 142.61 ? 23   PRO D CD    1 
ATOM   7432  N  N     . LYS H 2 23  ? 23.694  -32.716 228.405 1.00 146.53 ? 24   LYS D N     1 
ATOM   7433  C  CA    . LYS H 2 23  ? 24.949  -33.059 227.739 1.00 147.81 ? 24   LYS D CA    1 
ATOM   7434  C  C     . LYS H 2 23  ? 26.191  -32.889 228.609 1.00 147.38 ? 24   LYS D C     1 
ATOM   7435  O  O     . LYS H 2 23  ? 27.242  -32.465 228.124 1.00 148.61 ? 24   LYS D O     1 
ATOM   7436  C  CB    . LYS H 2 23  ? 25.109  -32.220 226.467 1.00 149.02 ? 24   LYS D CB    1 
ATOM   7437  N  N     . SER H 2 24  ? 26.072  -33.220 229.889 1.00 144.35 ? 25   SER D N     1 
ATOM   7438  C  CA    . SER H 2 24  ? 27.199  -33.098 230.805 1.00 141.63 ? 25   SER D CA    1 
ATOM   7439  C  C     . SER H 2 24  ? 27.691  -31.648 230.866 1.00 137.54 ? 25   SER D C     1 
ATOM   7440  O  O     . SER H 2 24  ? 28.631  -31.272 230.166 1.00 136.53 ? 25   SER D O     1 
ATOM   7441  C  CB    . SER H 2 24  ? 28.339  -34.015 230.345 1.00 140.50 ? 25   SER D CB    1 
ATOM   7442  O  OG    . SER H 2 24  ? 27.878  -35.338 230.130 1.00 136.66 ? 25   SER D OG    1 
ATOM   7443  N  N     . GLY H 2 25  ? 27.050  -30.838 231.704 1.00 132.34 ? 26   GLY D N     1 
ATOM   7444  C  CA    . GLY H 2 25  ? 27.445  -29.446 231.828 1.00 129.08 ? 26   GLY D CA    1 
ATOM   7445  C  C     . GLY H 2 25  ? 26.886  -28.782 233.071 1.00 125.78 ? 26   GLY D C     1 
ATOM   7446  O  O     . GLY H 2 25  ? 25.968  -29.308 233.699 1.00 123.47 ? 26   GLY D O     1 
ATOM   7447  N  N     . THR H 2 26  ? 27.434  -27.622 233.426 1.00 124.14 ? 27   THR D N     1 
ATOM   7448  C  CA    . THR H 2 26  ? 26.978  -26.898 234.607 1.00 123.01 ? 27   THR D CA    1 
ATOM   7449  C  C     . THR H 2 26  ? 25.486  -26.607 234.500 1.00 120.41 ? 27   THR D C     1 
ATOM   7450  O  O     . THR H 2 26  ? 25.043  -25.870 233.617 1.00 121.55 ? 27   THR D O     1 
ATOM   7451  C  CB    . THR H 2 26  ? 27.746  -25.563 234.794 1.00 124.54 ? 27   THR D CB    1 
ATOM   7452  O  OG1   . THR H 2 26  ? 29.155  -25.822 234.855 1.00 123.87 ? 27   THR D OG1   1 
ATOM   7453  C  CG2   . THR H 2 26  ? 27.321  -24.877 236.088 1.00 119.58 ? 27   THR D CG2   1 
ATOM   7454  N  N     . LEU H 2 27  ? 24.719  -27.206 235.405 1.00 115.60 ? 28   LEU D N     1 
ATOM   7455  C  CA    . LEU H 2 27  ? 23.273  -27.034 235.443 1.00 107.70 ? 28   LEU D CA    1 
ATOM   7456  C  C     . LEU H 2 27  ? 22.917  -25.614 235.869 1.00 102.58 ? 28   LEU D C     1 
ATOM   7457  O  O     . LEU H 2 27  ? 22.668  -25.350 237.047 1.00 108.49 ? 28   LEU D O     1 
ATOM   7458  C  CB    . LEU H 2 27  ? 22.651  -28.043 236.420 1.00 102.66 ? 28   LEU D CB    1 
ATOM   7459  C  CG    . LEU H 2 27  ? 22.784  -29.537 236.100 1.00 99.58  ? 28   LEU D CG    1 
ATOM   7460  C  CD1   . LEU H 2 27  ? 22.368  -30.360 237.305 1.00 99.97  ? 28   LEU D CD1   1 
ATOM   7461  C  CD2   . LEU H 2 27  ? 21.933  -29.888 234.895 1.00 95.44  ? 28   LEU D CD2   1 
ATOM   7462  N  N     . SER H 2 28  ? 22.902  -24.699 234.909 1.00 88.26  ? 29   SER D N     1 
ATOM   7463  C  CA    . SER H 2 28  ? 22.573  -23.315 235.204 1.00 79.85  ? 29   SER D CA    1 
ATOM   7464  C  C     . SER H 2 28  ? 22.246  -22.548 233.935 1.00 79.37  ? 29   SER D C     1 
ATOM   7465  O  O     . SER H 2 28  ? 22.588  -22.977 232.832 1.00 82.23  ? 29   SER D O     1 
ATOM   7466  C  CB    . SER H 2 28  ? 23.733  -22.640 235.943 1.00 77.64  ? 29   SER D CB    1 
ATOM   7467  O  OG    . SER H 2 28  ? 24.955  -22.806 235.247 1.00 67.89  ? 29   SER D OG    1 
ATOM   7468  N  N     . GLY H 2 29  ? 21.571  -21.417 234.099 1.00 76.16  ? 30   GLY D N     1 
ATOM   7469  C  CA    . GLY H 2 29  ? 21.203  -20.600 232.959 1.00 76.31  ? 30   GLY D CA    1 
ATOM   7470  C  C     . GLY H 2 29  ? 20.414  -21.339 231.898 1.00 76.18  ? 30   GLY D C     1 
ATOM   7471  O  O     . GLY H 2 29  ? 19.447  -22.032 232.206 1.00 75.18  ? 30   GLY D O     1 
ATOM   7472  N  N     . HIS H 2 30  ? 20.825  -21.187 230.641 1.00 77.94  ? 31   HIS D N     1 
ATOM   7473  C  CA    . HIS H 2 30  ? 20.151  -21.837 229.520 1.00 76.24  ? 31   HIS D CA    1 
ATOM   7474  C  C     . HIS H 2 30  ? 20.431  -23.328 229.512 1.00 76.98  ? 31   HIS D C     1 
ATOM   7475  O  O     . HIS H 2 30  ? 19.667  -24.103 228.945 1.00 79.73  ? 31   HIS D O     1 
ATOM   7476  C  CB    . HIS H 2 30  ? 20.620  -21.225 228.203 1.00 70.02  ? 31   HIS D CB    1 
ATOM   7477  C  CG    . HIS H 2 30  ? 20.245  -19.786 228.039 1.00 61.41  ? 31   HIS D CG    1 
ATOM   7478  N  ND1   . HIS H 2 30  ? 19.036  -19.387 227.511 1.00 53.33  ? 31   HIS D ND1   1 
ATOM   7479  C  CD2   . HIS H 2 30  ? 20.915  -18.650 228.345 1.00 54.25  ? 31   HIS D CD2   1 
ATOM   7480  C  CE1   . HIS H 2 30  ? 18.978  -18.067 227.496 1.00 48.90  ? 31   HIS D CE1   1 
ATOM   7481  N  NE2   . HIS H 2 30  ? 20.106  -17.596 227.997 1.00 55.96  ? 31   HIS D NE2   1 
ATOM   7482  N  N     . ALA H 2 31  ? 21.527  -23.721 230.150 1.00 80.16  ? 32   ALA D N     1 
ATOM   7483  C  CA    . ALA H 2 31  ? 21.919  -25.121 230.208 1.00 84.60  ? 32   ALA D CA    1 
ATOM   7484  C  C     . ALA H 2 31  ? 21.101  -25.915 231.218 1.00 86.39  ? 32   ALA D C     1 
ATOM   7485  O  O     . ALA H 2 31  ? 21.645  -26.756 231.927 1.00 89.84  ? 32   ALA D O     1 
ATOM   7486  C  CB    . ALA H 2 31  ? 23.400  -25.220 230.548 1.00 87.28  ? 32   ALA D CB    1 
ATOM   7487  N  N     . ALA H 2 32  ? 19.797  -25.660 231.285 1.00 91.96  ? 33   ALA D N     1 
ATOM   7488  C  CA    . ALA H 2 32  ? 18.938  -26.371 232.233 1.00 96.97  ? 33   ALA D CA    1 
ATOM   7489  C  C     . ALA H 2 32  ? 17.475  -26.012 232.025 1.00 100.76 ? 33   ALA D C     1 
ATOM   7490  O  O     . ALA H 2 32  ? 16.601  -26.882 231.991 1.00 98.43  ? 33   ALA D O     1 
ATOM   7491  C  CB    . ALA H 2 32  ? 19.348  -26.032 233.661 1.00 93.71  ? 33   ALA D CB    1 
ATOM   7492  N  N     . GLY H 2 33  ? 17.221  -24.715 231.896 1.00 105.23 ? 34   GLY D N     1 
ATOM   7493  C  CA    . GLY H 2 33  ? 15.868  -24.242 231.699 1.00 108.06 ? 34   GLY D CA    1 
ATOM   7494  C  C     . GLY H 2 33  ? 15.341  -24.542 230.313 1.00 107.31 ? 34   GLY D C     1 
ATOM   7495  O  O     . GLY H 2 33  ? 14.230  -25.049 230.165 1.00 112.32 ? 34   GLY D O     1 
ATOM   7496  N  N     . GLU H 2 34  ? 16.145  -24.237 229.298 1.00 102.08 ? 35   GLU D N     1 
ATOM   7497  C  CA    . GLU H 2 34  ? 15.756  -24.458 227.909 1.00 99.23  ? 35   GLU D CA    1 
ATOM   7498  C  C     . GLU H 2 34  ? 15.068  -25.808 227.686 1.00 95.35  ? 35   GLU D C     1 
ATOM   7499  O  O     . GLU H 2 34  ? 14.045  -25.893 227.004 1.00 91.89  ? 35   GLU D O     1 
ATOM   7500  C  CB    . GLU H 2 34  ? 16.980  -24.348 226.997 1.00 98.29  ? 35   GLU D CB    1 
ATOM   7501  C  CG    . GLU H 2 34  ? 16.635  -24.206 225.527 1.00 95.56  ? 35   GLU D CG    1 
ATOM   7502  C  CD    . GLU H 2 34  ? 15.948  -22.886 225.212 1.00 94.73  ? 35   GLU D CD    1 
ATOM   7503  O  OE1   . GLU H 2 34  ? 15.505  -22.717 224.055 1.00 97.18  ? 35   GLU D OE1   1 
ATOM   7504  O  OE2   . GLU H 2 34  ? 15.855  -22.018 226.112 1.00 83.81  ? 35   GLU D OE2   1 
ATOM   7505  N  N     . PRO H 2 35  ? 15.628  -26.886 228.252 1.00 91.23  ? 36   PRO D N     1 
ATOM   7506  C  CA    . PRO H 2 35  ? 15.020  -28.205 228.079 1.00 85.30  ? 36   PRO D CA    1 
ATOM   7507  C  C     . PRO H 2 35  ? 13.540  -28.233 228.464 1.00 80.27  ? 36   PRO D C     1 
ATOM   7508  O  O     . PRO H 2 35  ? 12.683  -28.552 227.639 1.00 72.05  ? 36   PRO D O     1 
ATOM   7509  C  CB    . PRO H 2 35  ? 15.877  -29.091 228.975 1.00 88.58  ? 36   PRO D CB    1 
ATOM   7510  C  CG    . PRO H 2 35  ? 17.232  -28.468 228.844 1.00 92.60  ? 36   PRO D CG    1 
ATOM   7511  C  CD    . PRO H 2 35  ? 16.910  -26.993 228.974 1.00 92.06  ? 36   PRO D CD    1 
ATOM   7512  N  N     . PHE H 2 36  ? 13.240  -27.897 229.714 1.00 78.42  ? 37   PHE D N     1 
ATOM   7513  C  CA    . PHE H 2 36  ? 11.858  -27.899 230.174 1.00 82.58  ? 37   PHE D CA    1 
ATOM   7514  C  C     . PHE H 2 36  ? 10.968  -26.911 229.431 1.00 85.54  ? 37   PHE D C     1 
ATOM   7515  O  O     . PHE H 2 36  ? 9.748   -27.082 229.372 1.00 84.74  ? 37   PHE D O     1 
ATOM   7516  C  CB    . PHE H 2 36  ? 11.789  -27.616 231.674 1.00 83.47  ? 37   PHE D CB    1 
ATOM   7517  C  CG    . PHE H 2 36  ? 12.081  -28.814 232.524 1.00 83.82  ? 37   PHE D CG    1 
ATOM   7518  C  CD1   . PHE H 2 36  ? 13.347  -29.007 233.071 1.00 83.76  ? 37   PHE D CD1   1 
ATOM   7519  C  CD2   . PHE H 2 36  ? 11.093  -29.767 232.756 1.00 70.83  ? 37   PHE D CD2   1 
ATOM   7520  C  CE1   . PHE H 2 36  ? 13.624  -30.136 233.840 1.00 84.01  ? 37   PHE D CE1   1 
ATOM   7521  C  CE2   . PHE H 2 36  ? 11.358  -30.899 233.520 1.00 74.80  ? 37   PHE D CE2   1 
ATOM   7522  C  CZ    . PHE H 2 36  ? 12.626  -31.086 234.065 1.00 77.78  ? 37   PHE D CZ    1 
ATOM   7523  N  N     . GLU H 2 37  ? 11.582  -25.878 228.865 1.00 86.44  ? 38   GLU D N     1 
ATOM   7524  C  CA    . GLU H 2 37  ? 10.845  -24.863 228.123 1.00 83.43  ? 38   GLU D CA    1 
ATOM   7525  C  C     . GLU H 2 37  ? 10.304  -25.483 226.845 1.00 79.06  ? 38   GLU D C     1 
ATOM   7526  O  O     . GLU H 2 37  ? 9.385   -24.951 226.224 1.00 78.01  ? 38   GLU D O     1 
ATOM   7527  C  CB    . GLU H 2 37  ? 11.767  -23.684 227.793 1.00 88.54  ? 38   GLU D CB    1 
ATOM   7528  C  CG    . GLU H 2 37  ? 11.077  -22.481 227.161 1.00 90.73  ? 38   GLU D CG    1 
ATOM   7529  C  CD    . GLU H 2 37  ? 10.955  -22.582 225.651 1.00 91.39  ? 38   GLU D CD    1 
ATOM   7530  O  OE1   . GLU H 2 37  ? 10.364  -21.663 225.046 1.00 97.28  ? 38   GLU D OE1   1 
ATOM   7531  O  OE2   . GLU H 2 37  ? 11.453  -23.567 225.065 1.00 91.45  ? 38   GLU D OE2   1 
ATOM   7532  N  N     . LYS H 2 38  ? 10.880  -26.618 226.463 1.00 75.99  ? 39   LYS D N     1 
ATOM   7533  C  CA    . LYS H 2 38  ? 10.460  -27.323 225.263 1.00 76.50  ? 39   LYS D CA    1 
ATOM   7534  C  C     . LYS H 2 38  ? 9.346   -28.301 225.609 1.00 74.50  ? 39   LYS D C     1 
ATOM   7535  O  O     . LYS H 2 38  ? 8.399   -28.479 224.843 1.00 69.43  ? 39   LYS D O     1 
ATOM   7536  C  CB    . LYS H 2 38  ? 11.640  -28.084 224.649 1.00 79.35  ? 39   LYS D CB    1 
ATOM   7537  C  CG    . LYS H 2 38  ? 12.863  -27.223 224.363 1.00 79.45  ? 39   LYS D CG    1 
ATOM   7538  C  CD    . LYS H 2 38  ? 12.523  -26.038 223.473 1.00 87.07  ? 39   LYS D CD    1 
ATOM   7539  C  CE    . LYS H 2 38  ? 13.731  -25.130 223.271 1.00 93.94  ? 39   LYS D CE    1 
ATOM   7540  N  NZ    . LYS H 2 38  ? 13.389  -23.876 222.536 1.00 85.09  ? 39   LYS D NZ    1 
ATOM   7541  N  N     . LEU H 2 39  ? 9.458   -28.929 226.772 1.00 76.55  ? 40   LEU D N     1 
ATOM   7542  C  CA    . LEU H 2 39  ? 8.452   -29.889 227.200 1.00 79.80  ? 40   LEU D CA    1 
ATOM   7543  C  C     . LEU H 2 39  ? 7.097   -29.214 227.351 1.00 76.45  ? 40   LEU D C     1 
ATOM   7544  O  O     . LEU H 2 39  ? 6.057   -29.840 227.157 1.00 74.33  ? 40   LEU D O     1 
ATOM   7545  C  CB    . LEU H 2 39  ? 8.863   -30.535 228.522 1.00 83.84  ? 40   LEU D CB    1 
ATOM   7546  C  CG    . LEU H 2 39  ? 10.240  -31.209 228.549 1.00 90.40  ? 40   LEU D CG    1 
ATOM   7547  C  CD1   . LEU H 2 39  ? 10.373  -31.979 229.856 1.00 90.38  ? 40   LEU D CD1   1 
ATOM   7548  C  CD2   . LEU H 2 39  ? 10.413  -32.151 227.354 1.00 88.38  ? 40   LEU D CD2   1 
ATOM   7549  N  N     . VAL H 2 40  ? 7.118   -27.933 227.698 1.00 73.75  ? 41   VAL D N     1 
ATOM   7550  C  CA    . VAL H 2 40  ? 5.889   -27.176 227.860 1.00 72.76  ? 41   VAL D CA    1 
ATOM   7551  C  C     . VAL H 2 40  ? 5.267   -26.933 226.483 1.00 78.10  ? 41   VAL D C     1 
ATOM   7552  O  O     . VAL H 2 40  ? 4.083   -27.209 226.265 1.00 82.75  ? 41   VAL D O     1 
ATOM   7553  C  CB    . VAL H 2 40  ? 6.157   -25.829 228.573 1.00 72.61  ? 41   VAL D CB    1 
ATOM   7554  C  CG1   . VAL H 2 40  ? 4.877   -25.009 228.662 1.00 68.54  ? 41   VAL D CG1   1 
ATOM   7555  C  CG2   . VAL H 2 40  ? 6.709   -26.090 229.971 1.00 69.89  ? 41   VAL D CG2   1 
ATOM   7556  N  N     . TYR H 2 41  ? 6.068   -26.433 225.549 1.00 76.88  ? 42   TYR D N     1 
ATOM   7557  C  CA    . TYR H 2 41  ? 5.581   -26.172 224.198 1.00 78.73  ? 42   TYR D CA    1 
ATOM   7558  C  C     . TYR H 2 41  ? 5.072   -27.466 223.564 1.00 81.51  ? 42   TYR D C     1 
ATOM   7559  O  O     . TYR H 2 41  ? 4.082   -27.465 222.831 1.00 77.18  ? 42   TYR D O     1 
ATOM   7560  C  CB    . TYR H 2 41  ? 6.701   -25.577 223.339 1.00 78.86  ? 42   TYR D CB    1 
ATOM   7561  C  CG    . TYR H 2 41  ? 6.293   -25.259 221.918 1.00 79.42  ? 42   TYR D CG    1 
ATOM   7562  C  CD1   . TYR H 2 41  ? 5.304   -24.314 221.650 1.00 83.50  ? 42   TYR D CD1   1 
ATOM   7563  C  CD2   . TYR H 2 41  ? 6.888   -25.914 220.840 1.00 80.82  ? 42   TYR D CD2   1 
ATOM   7564  C  CE1   . TYR H 2 41  ? 4.913   -24.032 220.343 1.00 87.69  ? 42   TYR D CE1   1 
ATOM   7565  C  CE2   . TYR H 2 41  ? 6.506   -25.642 219.530 1.00 86.99  ? 42   TYR D CE2   1 
ATOM   7566  C  CZ    . TYR H 2 41  ? 5.515   -24.700 219.289 1.00 90.59  ? 42   TYR D CZ    1 
ATOM   7567  O  OH    . TYR H 2 41  ? 5.109   -24.442 217.998 1.00 93.67  ? 42   TYR D OH    1 
ATOM   7568  N  N     . LYS H 2 42  ? 5.753   -28.570 223.852 1.00 83.76  ? 43   LYS D N     1 
ATOM   7569  C  CA    . LYS H 2 42  ? 5.366   -29.864 223.309 1.00 81.79  ? 43   LYS D CA    1 
ATOM   7570  C  C     . LYS H 2 42  ? 3.891   -30.133 223.537 1.00 83.43  ? 43   LYS D C     1 
ATOM   7571  O  O     . LYS H 2 42  ? 3.093   -30.083 222.605 1.00 83.37  ? 43   LYS D O     1 
ATOM   7572  C  CB    . LYS H 2 42  ? 6.179   -30.980 223.960 1.00 84.70  ? 43   LYS D CB    1 
ATOM   7573  C  CG    . LYS H 2 42  ? 5.782   -32.378 223.506 1.00 82.96  ? 43   LYS D CG    1 
ATOM   7574  C  CD    . LYS H 2 42  ? 6.462   -33.443 224.355 1.00 86.47  ? 43   LYS D CD    1 
ATOM   7575  C  CE    . LYS H 2 42  ? 6.106   -34.851 223.900 1.00 83.48  ? 43   LYS D CE    1 
ATOM   7576  N  NZ    . LYS H 2 42  ? 4.641   -35.105 223.908 1.00 83.66  ? 43   LYS D NZ    1 
ATOM   7577  N  N     . PHE H 2 43  ? 3.535   -30.411 224.786 1.00 86.17  ? 44   PHE D N     1 
ATOM   7578  C  CA    . PHE H 2 43  ? 2.153   -30.707 225.133 1.00 91.85  ? 44   PHE D CA    1 
ATOM   7579  C  C     . PHE H 2 43  ? 1.200   -29.529 224.969 1.00 87.25  ? 44   PHE D C     1 
ATOM   7580  O  O     . PHE H 2 43  ? 0.009   -29.726 224.728 1.00 85.13  ? 44   PHE D O     1 
ATOM   7581  C  CB    . PHE H 2 43  ? 2.068   -31.253 226.563 1.00 103.42 ? 44   PHE D CB    1 
ATOM   7582  C  CG    . PHE H 2 43  ? 2.711   -32.604 226.736 1.00 118.36 ? 44   PHE D CG    1 
ATOM   7583  C  CD1   . PHE H 2 43  ? 3.979   -32.721 227.297 1.00 125.74 ? 44   PHE D CD1   1 
ATOM   7584  C  CD2   . PHE H 2 43  ? 2.051   -33.762 226.325 1.00 123.91 ? 44   PHE D CD2   1 
ATOM   7585  C  CE1   . PHE H 2 43  ? 4.582   -33.973 227.448 1.00 131.60 ? 44   PHE D CE1   1 
ATOM   7586  C  CE2   . PHE H 2 43  ? 2.645   -35.019 226.470 1.00 128.48 ? 44   PHE D CE2   1 
ATOM   7587  C  CZ    . PHE H 2 43  ? 3.913   -35.125 227.033 1.00 131.87 ? 44   PHE D CZ    1 
ATOM   7588  N  N     . LEU H 2 44  ? 1.701   -28.306 225.098 1.00 81.13  ? 45   LEU D N     1 
ATOM   7589  C  CA    . LEU H 2 44  ? 0.821   -27.156 224.930 1.00 79.48  ? 45   LEU D CA    1 
ATOM   7590  C  C     . LEU H 2 44  ? 0.333   -27.114 223.484 1.00 80.55  ? 45   LEU D C     1 
ATOM   7591  O  O     . LEU H 2 44  ? -0.796  -26.707 223.210 1.00 78.83  ? 45   LEU D O     1 
ATOM   7592  C  CB    . LEU H 2 44  ? 1.542   -25.845 225.282 1.00 69.87  ? 45   LEU D CB    1 
ATOM   7593  C  CG    . LEU H 2 44  ? 1.209   -25.205 226.641 1.00 59.27  ? 45   LEU D CG    1 
ATOM   7594  C  CD1   . LEU H 2 44  ? 1.922   -23.870 226.779 1.00 48.68  ? 45   LEU D CD1   1 
ATOM   7595  C  CD2   . LEU H 2 44  ? -0.291  -25.003 226.761 1.00 57.38  ? 45   LEU D CD2   1 
ATOM   7596  N  N     . LYS H 2 45  ? 1.187   -27.559 222.565 1.00 82.22  ? 46   LYS D N     1 
ATOM   7597  C  CA    . LYS H 2 45  ? 0.857   -27.575 221.144 1.00 80.96  ? 46   LYS D CA    1 
ATOM   7598  C  C     . LYS H 2 45  ? -0.150  -28.669 220.803 1.00 82.90  ? 46   LYS D C     1 
ATOM   7599  O  O     . LYS H 2 45  ? -0.849  -28.585 219.791 1.00 88.91  ? 46   LYS D O     1 
ATOM   7600  C  CB    . LYS H 2 45  ? 2.129   -27.767 220.310 1.00 76.20  ? 46   LYS D CB    1 
ATOM   7601  N  N     . GLU H 2 46  ? -0.224  -29.695 221.646 1.00 85.03  ? 47   GLU D N     1 
ATOM   7602  C  CA    . GLU H 2 46  ? -1.151  -30.804 221.423 1.00 84.77  ? 47   GLU D CA    1 
ATOM   7603  C  C     . GLU H 2 46  ? -2.593  -30.449 221.786 1.00 79.96  ? 47   GLU D C     1 
ATOM   7604  O  O     . GLU H 2 46  ? -3.497  -30.554 220.955 1.00 75.67  ? 47   GLU D O     1 
ATOM   7605  C  CB    . GLU H 2 46  ? -0.715  -32.038 222.224 1.00 88.40  ? 47   GLU D CB    1 
ATOM   7606  C  CG    . GLU H 2 46  ? 0.619   -32.624 221.788 1.00 95.93  ? 47   GLU D CG    1 
ATOM   7607  C  CD    . GLU H 2 46  ? 0.920   -33.949 222.461 1.00 101.66 ? 47   GLU D CD    1 
ATOM   7608  O  OE1   . GLU H 2 46  ? 0.102   -34.885 222.327 1.00 102.81 ? 47   GLU D OE1   1 
ATOM   7609  O  OE2   . GLU H 2 46  ? 1.976   -34.059 223.120 1.00 106.88 ? 47   GLU D OE2   1 
ATOM   7610  N  N     . ASN H 2 47  ? -2.803  -30.027 223.027 1.00 76.61  ? 48   ASN D N     1 
ATOM   7611  C  CA    . ASN H 2 47  ? -4.135  -29.667 223.486 1.00 76.34  ? 48   ASN D CA    1 
ATOM   7612  C  C     . ASN H 2 47  ? -4.639  -28.389 222.837 1.00 81.56  ? 48   ASN D C     1 
ATOM   7613  O  O     . ASN H 2 47  ? -5.836  -28.100 222.875 1.00 84.61  ? 48   ASN D O     1 
ATOM   7614  C  CB    . ASN H 2 47  ? -4.143  -29.511 225.005 1.00 74.77  ? 48   ASN D CB    1 
ATOM   7615  C  CG    . ASN H 2 47  ? -3.563  -30.722 225.716 1.00 74.17  ? 48   ASN D CG    1 
ATOM   7616  O  OD1   . ASN H 2 47  ? -3.622  -31.842 225.203 1.00 77.49  ? 48   ASN D OD1   1 
ATOM   7617  N  ND2   . ASN H 2 47  ? -3.012  -30.507 226.908 1.00 63.88  ? 48   ASN D ND2   1 
ATOM   7618  N  N     . LEU H 2 48  ? -3.724  -27.630 222.240 1.00 85.82  ? 49   LEU D N     1 
ATOM   7619  C  CA    . LEU H 2 48  ? -4.070  -26.375 221.577 1.00 89.71  ? 49   LEU D CA    1 
ATOM   7620  C  C     . LEU H 2 48  ? -3.219  -26.194 220.322 1.00 88.76  ? 49   LEU D C     1 
ATOM   7621  O  O     . LEU H 2 48  ? -2.293  -25.389 220.303 1.00 94.34  ? 49   LEU D O     1 
ATOM   7622  C  CB    . LEU H 2 48  ? -3.841  -25.202 222.536 1.00 92.59  ? 49   LEU D CB    1 
ATOM   7623  C  CG    . LEU H 2 48  ? -4.590  -25.252 223.873 1.00 97.09  ? 49   LEU D CG    1 
ATOM   7624  C  CD1   . LEU H 2 48  ? -4.088  -24.152 224.791 1.00 97.30  ? 49   LEU D CD1   1 
ATOM   7625  C  CD2   . LEU H 2 48  ? -6.083  -25.114 223.632 1.00 102.72 ? 49   LEU D CD2   1 
ATOM   7626  N  N     . SER H 2 49  ? -3.544  -26.936 219.271 1.00 88.82  ? 50   SER D N     1 
ATOM   7627  C  CA    . SER H 2 49  ? -2.788  -26.862 218.029 1.00 90.46  ? 50   SER D CA    1 
ATOM   7628  C  C     . SER H 2 49  ? -3.136  -25.660 217.154 1.00 91.98  ? 50   SER D C     1 
ATOM   7629  O  O     . SER H 2 49  ? -2.627  -25.530 216.040 1.00 90.62  ? 50   SER D O     1 
ATOM   7630  C  CB    . SER H 2 49  ? -2.981  -28.150 217.224 1.00 91.91  ? 50   SER D CB    1 
ATOM   7631  N  N     . ASP H 2 50  ? -3.995  -24.778 217.653 1.00 92.15  ? 51   ASP D N     1 
ATOM   7632  C  CA    . ASP H 2 50  ? -4.383  -23.607 216.878 1.00 95.66  ? 51   ASP D CA    1 
ATOM   7633  C  C     . ASP H 2 50  ? -4.144  -22.294 217.606 1.00 93.87  ? 51   ASP D C     1 
ATOM   7634  O  O     . ASP H 2 50  ? -4.359  -21.219 217.044 1.00 92.46  ? 51   ASP D O     1 
ATOM   7635  C  CB    . ASP H 2 50  ? -5.856  -23.701 216.481 1.00 105.64 ? 51   ASP D CB    1 
ATOM   7636  C  CG    . ASP H 2 50  ? -6.123  -24.815 215.492 1.00 113.69 ? 51   ASP D CG    1 
ATOM   7637  O  OD1   . ASP H 2 50  ? -5.914  -25.995 215.851 1.00 121.33 ? 51   ASP D OD1   1 
ATOM   7638  O  OD2   . ASP H 2 50  ? -6.539  -24.507 214.354 1.00 117.20 ? 51   ASP D OD2   1 
ATOM   7639  N  N     . LEU H 2 51  ? -3.706  -22.378 218.856 1.00 90.47  ? 52   LEU D N     1 
ATOM   7640  C  CA    . LEU H 2 51  ? -3.443  -21.182 219.645 1.00 83.72  ? 52   LEU D CA    1 
ATOM   7641  C  C     . LEU H 2 51  ? -1.982  -21.083 220.057 1.00 78.76  ? 52   LEU D C     1 
ATOM   7642  O  O     . LEU H 2 51  ? -1.457  -19.982 220.260 1.00 67.57  ? 52   LEU D O     1 
ATOM   7643  C  CB    . LEU H 2 51  ? -4.317  -21.165 220.903 1.00 85.14  ? 52   LEU D CB    1 
ATOM   7644  C  CG    . LEU H 2 51  ? -5.757  -20.661 220.815 1.00 84.66  ? 52   LEU D CG    1 
ATOM   7645  C  CD1   . LEU H 2 51  ? -6.577  -21.554 219.905 1.00 89.37  ? 52   LEU D CD1   1 
ATOM   7646  C  CD2   . LEU H 2 51  ? -6.357  -20.627 222.216 1.00 83.85  ? 52   LEU D CD2   1 
ATOM   7647  N  N     . THR H 2 52  ? -1.331  -22.236 220.174 1.00 71.21  ? 53   THR D N     1 
ATOM   7648  C  CA    . THR H 2 52  ? 0.063   -22.285 220.587 1.00 72.25  ? 53   THR D CA    1 
ATOM   7649  C  C     . THR H 2 52  ? 1.058   -22.058 219.453 1.00 67.42  ? 53   THR D C     1 
ATOM   7650  O  O     . THR H 2 52  ? 1.019   -22.734 218.431 1.00 61.98  ? 53   THR D O     1 
ATOM   7651  C  CB    . THR H 2 52  ? 0.386   -23.623 221.277 1.00 74.15  ? 53   THR D CB    1 
ATOM   7652  O  OG1   . THR H 2 52  ? -0.513  -23.821 222.375 1.00 76.09  ? 53   THR D OG1   1 
ATOM   7653  C  CG2   . THR H 2 52  ? 1.813   -23.616 221.809 1.00 79.10  ? 53   THR D CG2   1 
ATOM   7654  N  N     . PHE H 2 53  ? 1.949   -21.092 219.654 1.00 67.83  ? 54   PHE D N     1 
ATOM   7655  C  CA    . PHE H 2 53  ? 2.974   -20.754 218.675 1.00 71.04  ? 54   PHE D CA    1 
ATOM   7656  C  C     . PHE H 2 53  ? 4.242   -20.292 219.382 1.00 71.31  ? 54   PHE D C     1 
ATOM   7657  O  O     . PHE H 2 53  ? 4.195   -19.823 220.523 1.00 69.88  ? 54   PHE D O     1 
ATOM   7658  C  CB    . PHE H 2 53  ? 2.489   -19.627 217.749 1.00 73.64  ? 54   PHE D CB    1 
ATOM   7659  C  CG    . PHE H 2 53  ? 1.479   -20.064 216.729 1.00 79.41  ? 54   PHE D CG    1 
ATOM   7660  C  CD1   . PHE H 2 53  ? 1.772   -21.097 215.841 1.00 86.10  ? 54   PHE D CD1   1 
ATOM   7661  C  CD2   . PHE H 2 53  ? 0.237   -19.445 216.649 1.00 72.17  ? 54   PHE D CD2   1 
ATOM   7662  C  CE1   . PHE H 2 53  ? 0.843   -21.509 214.885 1.00 88.36  ? 54   PHE D CE1   1 
ATOM   7663  C  CE2   . PHE H 2 53  ? -0.697  -19.849 215.698 1.00 77.18  ? 54   PHE D CE2   1 
ATOM   7664  C  CZ    . PHE H 2 53  ? -0.394  -20.885 214.814 1.00 85.88  ? 54   PHE D CZ    1 
ATOM   7665  N  N     . LYS H 2 54  ? 5.376   -20.447 218.709 1.00 70.82  ? 55   LYS D N     1 
ATOM   7666  C  CA    . LYS H 2 54  ? 6.647   -19.988 219.255 1.00 69.36  ? 55   LYS D CA    1 
ATOM   7667  C  C     . LYS H 2 54  ? 6.786   -18.532 218.828 1.00 68.59  ? 55   LYS D C     1 
ATOM   7668  O  O     . LYS H 2 54  ? 6.153   -18.091 217.866 1.00 69.04  ? 55   LYS D O     1 
ATOM   7669  C  CB    . LYS H 2 54  ? 7.815   -20.804 218.697 1.00 64.38  ? 55   LYS D CB    1 
ATOM   7670  C  CG    . LYS H 2 54  ? 8.131   -22.053 219.489 1.00 70.17  ? 55   LYS D CG    1 
ATOM   7671  C  CD    . LYS H 2 54  ? 8.588   -21.717 220.911 1.00 77.76  ? 55   LYS D CD    1 
ATOM   7672  C  CE    . LYS H 2 54  ? 9.957   -21.043 220.919 1.00 80.02  ? 55   LYS D CE    1 
ATOM   7673  N  NZ    . LYS H 2 54  ? 10.454  -20.667 222.277 1.00 73.59  ? 55   LYS D NZ    1 
ATOM   7674  N  N     . GLN H 2 55  ? 7.605   -17.785 219.550 1.00 67.44  ? 56   GLN D N     1 
ATOM   7675  C  CA    . GLN H 2 55  ? 7.810   -16.381 219.241 1.00 61.65  ? 56   GLN D CA    1 
ATOM   7676  C  C     . GLN H 2 55  ? 8.063   -16.220 217.748 1.00 58.95  ? 56   GLN D C     1 
ATOM   7677  O  O     . GLN H 2 55  ? 7.212   -15.720 217.010 1.00 48.00  ? 56   GLN D O     1 
ATOM   7678  C  CB    . GLN H 2 55  ? 9.006   -15.846 220.036 1.00 67.78  ? 56   GLN D CB    1 
ATOM   7679  C  CG    . GLN H 2 55  ? 9.214   -14.333 219.954 1.00 69.26  ? 56   GLN D CG    1 
ATOM   7680  C  CD    . GLN H 2 55  ? 8.195   -13.547 220.755 1.00 64.36  ? 56   GLN D CD    1 
ATOM   7681  O  OE1   . GLN H 2 55  ? 6.993   -13.768 220.632 1.00 77.93  ? 56   GLN D OE1   1 
ATOM   7682  N  NE2   . GLN H 2 55  ? 8.672   -12.616 221.573 1.00 58.94  ? 56   GLN D NE2   1 
ATOM   7683  N  N     . TYR H 2 56  ? 9.232   -16.677 217.307 1.00 57.77  ? 57   TYR D N     1 
ATOM   7684  C  CA    . TYR H 2 56  ? 9.614   -16.558 215.910 1.00 57.57  ? 57   TYR D CA    1 
ATOM   7685  C  C     . TYR H 2 56  ? 8.629   -17.247 214.974 1.00 64.60  ? 57   TYR D C     1 
ATOM   7686  O  O     . TYR H 2 56  ? 8.258   -16.691 213.936 1.00 67.29  ? 57   TYR D O     1 
ATOM   7687  C  CB    . TYR H 2 56  ? 11.041  -17.094 215.701 1.00 48.24  ? 57   TYR D CB    1 
ATOM   7688  C  CG    . TYR H 2 56  ? 11.208  -18.561 215.981 1.00 50.22  ? 57   TYR D CG    1 
ATOM   7689  C  CD1   . TYR H 2 56  ? 10.949  -19.514 214.998 1.00 52.35  ? 57   TYR D CD1   1 
ATOM   7690  C  CD2   . TYR H 2 56  ? 11.569  -19.003 217.249 1.00 50.73  ? 57   TYR D CD2   1 
ATOM   7691  C  CE1   . TYR H 2 56  ? 11.038  -20.876 215.280 1.00 60.97  ? 57   TYR D CE1   1 
ATOM   7692  C  CE2   . TYR H 2 56  ? 11.662  -20.357 217.542 1.00 51.64  ? 57   TYR D CE2   1 
ATOM   7693  C  CZ    . TYR H 2 56  ? 11.391  -21.290 216.562 1.00 59.69  ? 57   TYR D CZ    1 
ATOM   7694  O  OH    . TYR H 2 56  ? 11.421  -22.631 216.882 1.00 68.39  ? 57   TYR D OH    1 
ATOM   7695  N  N     . GLU H 2 57  ? 8.192   -18.448 215.338 1.00 65.34  ? 58   GLU D N     1 
ATOM   7696  C  CA    . GLU H 2 57  ? 7.242   -19.173 214.502 1.00 62.09  ? 58   GLU D CA    1 
ATOM   7697  C  C     . GLU H 2 57  ? 6.044   -18.278 214.202 1.00 56.67  ? 58   GLU D C     1 
ATOM   7698  O  O     . GLU H 2 57  ? 5.566   -18.232 213.071 1.00 54.96  ? 58   GLU D O     1 
ATOM   7699  C  CB    . GLU H 2 57  ? 6.779   -20.455 215.202 1.00 67.17  ? 58   GLU D CB    1 
ATOM   7700  C  CG    . GLU H 2 57  ? 5.770   -21.266 214.405 1.00 81.15  ? 58   GLU D CG    1 
ATOM   7701  C  CD    . GLU H 2 57  ? 5.343   -22.541 215.116 1.00 91.20  ? 58   GLU D CD    1 
ATOM   7702  O  OE1   . GLU H 2 57  ? 4.975   -22.467 216.311 1.00 95.68  ? 58   GLU D OE1   1 
ATOM   7703  O  OE2   . GLU H 2 57  ? 5.365   -23.615 214.478 1.00 95.99  ? 58   GLU D OE2   1 
ATOM   7704  N  N     . TYR H 2 58  ? 5.566   -17.551 215.209 1.00 55.25  ? 59   TYR D N     1 
ATOM   7705  C  CA    . TYR H 2 58  ? 4.423   -16.675 214.998 1.00 49.17  ? 59   TYR D CA    1 
ATOM   7706  C  C     . TYR H 2 58  ? 4.765   -15.520 214.079 1.00 42.68  ? 59   TYR D C     1 
ATOM   7707  O  O     . TYR H 2 58  ? 3.880   -14.917 213.479 1.00 42.98  ? 59   TYR D O     1 
ATOM   7708  C  CB    . TYR H 2 58  ? 3.894   -16.118 216.312 1.00 55.26  ? 59   TYR D CB    1 
ATOM   7709  C  CG    . TYR H 2 58  ? 2.721   -15.191 216.099 1.00 61.92  ? 59   TYR D CG    1 
ATOM   7710  C  CD1   . TYR H 2 58  ? 1.479   -15.683 215.693 1.00 58.27  ? 59   TYR D CD1   1 
ATOM   7711  C  CD2   . TYR H 2 58  ? 2.869   -13.811 216.246 1.00 61.74  ? 59   TYR D CD2   1 
ATOM   7712  C  CE1   . TYR H 2 58  ? 0.414   -14.818 215.435 1.00 70.43  ? 59   TYR D CE1   1 
ATOM   7713  C  CE2   . TYR H 2 58  ? 1.815   -12.939 215.992 1.00 68.05  ? 59   TYR D CE2   1 
ATOM   7714  C  CZ    . TYR H 2 58  ? 0.590   -13.446 215.587 1.00 72.22  ? 59   TYR D CZ    1 
ATOM   7715  O  OH    . TYR H 2 58  ? -0.452  -12.576 215.345 1.00 68.79  ? 59   TYR D OH    1 
ATOM   7716  N  N     . LEU H 2 59  ? 6.046   -15.194 213.982 1.00 39.16  ? 60   LEU D N     1 
ATOM   7717  C  CA    . LEU H 2 59  ? 6.453   -14.116 213.103 1.00 41.03  ? 60   LEU D CA    1 
ATOM   7718  C  C     . LEU H 2 59  ? 6.510   -14.585 211.663 1.00 46.79  ? 60   LEU D C     1 
ATOM   7719  O  O     . LEU H 2 59  ? 6.066   -13.880 210.758 1.00 44.43  ? 60   LEU D O     1 
ATOM   7720  C  CB    . LEU H 2 59  ? 7.811   -13.569 213.508 1.00 38.08  ? 60   LEU D CB    1 
ATOM   7721  C  CG    . LEU H 2 59  ? 7.755   -12.737 214.775 1.00 33.88  ? 60   LEU D CG    1 
ATOM   7722  C  CD1   . LEU H 2 59  ? 9.115   -12.137 215.021 1.00 30.16  ? 60   LEU D CD1   1 
ATOM   7723  C  CD2   . LEU H 2 59  ? 6.697   -11.655 214.633 1.00 29.83  ? 60   LEU D CD2   1 
ATOM   7724  N  N     . ASN H 2 60  ? 7.054   -15.778 211.446 1.00 49.78  ? 61   ASN D N     1 
ATOM   7725  C  CA    . ASN H 2 60  ? 7.145   -16.293 210.095 1.00 52.72  ? 61   ASN D CA    1 
ATOM   7726  C  C     . ASN H 2 60  ? 5.759   -16.463 209.492 1.00 62.69  ? 61   ASN D C     1 
ATOM   7727  O  O     . ASN H 2 60  ? 5.552   -16.191 208.313 1.00 72.64  ? 61   ASN D O     1 
ATOM   7728  C  CB    . ASN H 2 60  ? 7.887   -17.623 210.065 1.00 45.90  ? 61   ASN D CB    1 
ATOM   7729  C  CG    . ASN H 2 60  ? 9.362   -17.470 210.374 1.00 57.83  ? 61   ASN D CG    1 
ATOM   7730  O  OD1   . ASN H 2 60  ? 9.961   -16.424 210.114 1.00 62.23  ? 61   ASN D OD1   1 
ATOM   7731  N  ND2   . ASN H 2 60  ? 9.961   -18.519 210.912 1.00 65.09  ? 61   ASN D ND2   1 
ATOM   7732  N  N     . ASP H 2 61  ? 4.806   -16.900 210.305 1.00 62.45  ? 62   ASP D N     1 
ATOM   7733  C  CA    . ASP H 2 61  ? 3.446   -17.104 209.837 1.00 62.65  ? 62   ASP D CA    1 
ATOM   7734  C  C     . ASP H 2 61  ? 2.830   -15.775 209.397 1.00 56.56  ? 62   ASP D C     1 
ATOM   7735  O  O     . ASP H 2 61  ? 2.353   -15.640 208.270 1.00 53.36  ? 62   ASP D O     1 
ATOM   7736  C  CB    . ASP H 2 61  ? 2.609   -17.712 210.960 1.00 75.85  ? 62   ASP D CB    1 
ATOM   7737  C  CG    . ASP H 2 61  ? 1.271   -18.218 210.476 1.00 90.27  ? 62   ASP D CG    1 
ATOM   7738  O  OD1   . ASP H 2 61  ? 0.411   -18.534 211.327 1.00 91.10  ? 62   ASP D OD1   1 
ATOM   7739  O  OD2   . ASP H 2 61  ? 1.085   -18.307 209.242 1.00 102.48 ? 62   ASP D OD2   1 
ATOM   7740  N  N     . LEU H 2 62  ? 2.852   -14.805 210.308 1.00 52.13  ? 63   LEU D N     1 
ATOM   7741  C  CA    . LEU H 2 62  ? 2.314   -13.466 210.082 1.00 49.90  ? 63   LEU D CA    1 
ATOM   7742  C  C     . LEU H 2 62  ? 2.781   -12.833 208.775 1.00 49.71  ? 63   LEU D C     1 
ATOM   7743  O  O     . LEU H 2 62  ? 1.977   -12.299 208.002 1.00 48.45  ? 63   LEU D O     1 
ATOM   7744  C  CB    . LEU H 2 62  ? 2.705   -12.551 211.244 1.00 39.76  ? 63   LEU D CB    1 
ATOM   7745  C  CG    . LEU H 2 62  ? 2.415   -11.060 211.071 1.00 42.66  ? 63   LEU D CG    1 
ATOM   7746  C  CD1   . LEU H 2 62  ? 0.912   -10.824 211.034 1.00 39.19  ? 63   LEU D CD1   1 
ATOM   7747  C  CD2   . LEU H 2 62  ? 3.055   -10.279 212.222 1.00 48.24  ? 63   LEU D CD2   1 
ATOM   7748  N  N     . PHE H 2 63  ? 4.084   -12.872 208.537 1.00 45.38  ? 64   PHE D N     1 
ATOM   7749  C  CA    . PHE H 2 63  ? 4.621   -12.298 207.313 1.00 51.98  ? 64   PHE D CA    1 
ATOM   7750  C  C     . PHE H 2 63  ? 4.359   -13.180 206.082 1.00 57.67  ? 64   PHE D C     1 
ATOM   7751  O  O     . PHE H 2 63  ? 4.221   -12.666 204.969 1.00 54.88  ? 64   PHE D O     1 
ATOM   7752  C  CB    . PHE H 2 63  ? 6.119   -12.028 207.467 1.00 44.21  ? 64   PHE D CB    1 
ATOM   7753  C  CG    . PHE H 2 63  ? 6.449   -10.986 208.504 1.00 43.83  ? 64   PHE D CG    1 
ATOM   7754  C  CD1   . PHE H 2 63  ? 5.750   -9.789  208.560 1.00 45.14  ? 64   PHE D CD1   1 
ATOM   7755  C  CD2   . PHE H 2 63  ? 7.501   -11.174 209.385 1.00 48.14  ? 64   PHE D CD2   1 
ATOM   7756  C  CE1   . PHE H 2 63  ? 6.099   -8.795  209.469 1.00 39.57  ? 64   PHE D CE1   1 
ATOM   7757  C  CE2   . PHE H 2 63  ? 7.853   -10.183 210.297 1.00 47.18  ? 64   PHE D CE2   1 
ATOM   7758  C  CZ    . PHE H 2 63  ? 7.149   -8.992  210.334 1.00 41.33  ? 64   PHE D CZ    1 
ATOM   7759  N  N     . MET H 2 64  ? 4.283   -14.497 206.282 1.00 61.93  ? 65   MET D N     1 
ATOM   7760  C  CA    . MET H 2 64  ? 4.025   -15.432 205.187 1.00 64.74  ? 65   MET D CA    1 
ATOM   7761  C  C     . MET H 2 64  ? 2.578   -15.341 204.706 1.00 67.07  ? 65   MET D C     1 
ATOM   7762  O  O     . MET H 2 64  ? 2.279   -15.683 203.559 1.00 72.56  ? 65   MET D O     1 
ATOM   7763  C  CB    . MET H 2 64  ? 4.348   -16.871 205.616 1.00 68.25  ? 65   MET D CB    1 
ATOM   7764  C  CG    . MET H 2 64  ? 5.833   -17.258 205.525 1.00 70.89  ? 65   MET D CG    1 
ATOM   7765  S  SD    . MET H 2 64  ? 6.294   -18.813 206.409 1.00 81.21  ? 65   MET D SD    1 
ATOM   7766  C  CE    . MET H 2 64  ? 6.462   -19.973 205.048 1.00 74.02  ? 65   MET D CE    1 
ATOM   7767  N  N     . LYS H 2 65  ? 1.691   -14.875 205.583 1.00 67.85  ? 66   LYS D N     1 
ATOM   7768  C  CA    . LYS H 2 65  ? 0.269   -14.717 205.257 1.00 74.90  ? 66   LYS D CA    1 
ATOM   7769  C  C     . LYS H 2 65  ? 0.060   -13.444 204.427 1.00 74.94  ? 66   LYS D C     1 
ATOM   7770  O  O     . LYS H 2 65  ? -0.959  -13.283 203.759 1.00 77.19  ? 66   LYS D O     1 
ATOM   7771  C  CB    . LYS H 2 65  ? -0.572  -14.632 206.547 1.00 76.15  ? 66   LYS D CB    1 
ATOM   7772  C  CG    . LYS H 2 65  ? -0.478  -15.865 207.462 1.00 78.27  ? 66   LYS D CG    1 
ATOM   7773  C  CD    . LYS H 2 65  ? -1.070  -15.628 208.866 1.00 67.49  ? 66   LYS D CD    1 
ATOM   7774  C  CE    . LYS H 2 65  ? -2.597  -15.582 208.884 1.00 62.12  ? 66   LYS D CE    1 
ATOM   7775  N  NZ    . LYS H 2 65  ? -3.133  -15.374 210.266 1.00 45.84  ? 66   LYS D NZ    1 
ATOM   7776  N  N     . ASN H 2 66  ? 1.035   -12.542 204.486 1.00 74.62  ? 67   ASN D N     1 
ATOM   7777  C  CA    . ASN H 2 66  ? 0.978   -11.290 203.746 1.00 72.24  ? 67   ASN D CA    1 
ATOM   7778  C  C     . ASN H 2 66  ? 2.249   -11.184 202.918 1.00 66.89  ? 67   ASN D C     1 
ATOM   7779  O  O     . ASN H 2 66  ? 3.107   -10.342 203.176 1.00 67.01  ? 67   ASN D O     1 
ATOM   7780  C  CB    . ASN H 2 66  ? 0.883   -10.118 204.716 1.00 77.70  ? 67   ASN D CB    1 
ATOM   7781  C  CG    . ASN H 2 66  ? -0.336  -10.202 205.602 1.00 79.51  ? 67   ASN D CG    1 
ATOM   7782  O  OD1   . ASN H 2 66  ? -1.466  -10.049 205.138 1.00 86.79  ? 67   ASN D OD1   1 
ATOM   7783  N  ND2   . ASN H 2 66  ? -0.117  -10.462 206.886 1.00 78.81  ? 67   ASN D ND2   1 
ATOM   7784  N  N     . PRO H 2 67  ? 2.374   -12.034 201.892 1.00 61.44  ? 68   PRO D N     1 
ATOM   7785  C  CA    . PRO H 2 67  ? 3.550   -12.042 201.026 1.00 56.68  ? 68   PRO D CA    1 
ATOM   7786  C  C     . PRO H 2 67  ? 3.784   -10.768 200.225 1.00 47.83  ? 68   PRO D C     1 
ATOM   7787  O  O     . PRO H 2 67  ? 4.922   -10.446 199.898 1.00 57.53  ? 68   PRO D O     1 
ATOM   7788  C  CB    . PRO H 2 67  ? 3.307   -13.261 200.149 1.00 46.75  ? 68   PRO D CB    1 
ATOM   7789  C  CG    . PRO H 2 67  ? 1.827   -13.227 199.983 1.00 58.20  ? 68   PRO D CG    1 
ATOM   7790  C  CD    . PRO H 2 67  ? 1.342   -12.951 201.379 1.00 57.47  ? 68   PRO D CD    1 
ATOM   7791  N  N     . ALA H 2 68  ? 2.723   -10.033 199.921 1.00 50.00  ? 69   ALA D N     1 
ATOM   7792  C  CA    . ALA H 2 68  ? 2.846   -8.800  199.139 1.00 46.53  ? 69   ALA D CA    1 
ATOM   7793  C  C     . ALA H 2 68  ? 3.412   -7.636  199.934 1.00 39.35  ? 69   ALA D C     1 
ATOM   7794  O  O     . ALA H 2 68  ? 3.490   -6.520  199.426 1.00 51.41  ? 69   ALA D O     1 
ATOM   7795  C  CB    . ALA H 2 68  ? 1.486   -8.409  198.572 1.00 48.41  ? 69   ALA D CB    1 
ATOM   7796  N  N     . ILE H 2 69  ? 3.802   -7.897  201.176 1.00 46.15  ? 70   ILE D N     1 
ATOM   7797  C  CA    . ILE H 2 69  ? 4.339   -6.855  202.055 1.00 48.90  ? 70   ILE D CA    1 
ATOM   7798  C  C     . ILE H 2 69  ? 5.863   -6.882  202.057 1.00 47.94  ? 70   ILE D C     1 
ATOM   7799  O  O     . ILE H 2 69  ? 6.485   -7.839  202.519 1.00 52.17  ? 70   ILE D O     1 
ATOM   7800  C  CB    . ILE H 2 69  ? 3.819   -7.041  203.508 1.00 51.82  ? 70   ILE D CB    1 
ATOM   7801  C  CG1   . ILE H 2 69  ? 2.303   -7.301  203.492 1.00 42.29  ? 70   ILE D CG1   1 
ATOM   7802  C  CG2   . ILE H 2 69  ? 4.151   -5.822  204.351 1.00 52.54  ? 70   ILE D CG2   1 
ATOM   7803  C  CD1   . ILE H 2 69  ? 1.503   -6.329  202.623 1.00 29.02  ? 70   ILE D CD1   1 
ATOM   7804  N  N     . ILE H 2 70  ? 6.458   -5.816  201.540 1.00 47.08  ? 71   ILE D N     1 
ATOM   7805  C  CA    . ILE H 2 70  ? 7.906   -5.715  201.459 1.00 46.28  ? 71   ILE D CA    1 
ATOM   7806  C  C     . ILE H 2 70  ? 8.454   -4.557  202.289 1.00 43.49  ? 71   ILE D C     1 
ATOM   7807  O  O     . ILE H 2 70  ? 7.830   -3.501  202.381 1.00 46.28  ? 71   ILE D O     1 
ATOM   7808  C  CB    . ILE H 2 70  ? 8.344   -5.557  199.983 1.00 40.36  ? 71   ILE D CB    1 
ATOM   7809  C  CG1   . ILE H 2 70  ? 8.472   -6.939  199.336 1.00 49.79  ? 71   ILE D CG1   1 
ATOM   7810  C  CG2   . ILE H 2 70  ? 9.644   -4.761  199.889 1.00 39.75  ? 71   ILE D CG2   1 
ATOM   7811  C  CD1   . ILE H 2 70  ? 7.188   -7.743  199.298 1.00 50.76  ? 71   ILE D CD1   1 
ATOM   7812  N  N     . GLY H 2 71  ? 9.624   -4.766  202.884 1.00 38.14  ? 72   GLY D N     1 
ATOM   7813  C  CA    . GLY H 2 71  ? 10.240  -3.735  203.694 1.00 39.90  ? 72   GLY D CA    1 
ATOM   7814  C  C     . GLY H 2 71  ? 9.855   -3.842  205.158 1.00 51.15  ? 72   GLY D C     1 
ATOM   7815  O  O     . GLY H 2 71  ? 8.850   -4.473  205.509 1.00 49.06  ? 72   GLY D O     1 
ATOM   7816  N  N     . HIS H 2 72  ? 10.657  -3.233  206.025 1.00 48.03  ? 73   HIS D N     1 
ATOM   7817  C  CA    . HIS H 2 72  ? 10.371  -3.273  207.449 1.00 47.69  ? 73   HIS D CA    1 
ATOM   7818  C  C     . HIS H 2 72  ? 9.187   -2.366  207.758 1.00 47.24  ? 73   HIS D C     1 
ATOM   7819  O  O     . HIS H 2 72  ? 8.249   -2.764  208.449 1.00 48.49  ? 73   HIS D O     1 
ATOM   7820  C  CB    . HIS H 2 72  ? 11.593  -2.839  208.250 1.00 49.14  ? 73   HIS D CB    1 
ATOM   7821  C  CG    . HIS H 2 72  ? 12.099  -1.481  207.890 1.00 64.62  ? 73   HIS D CG    1 
ATOM   7822  N  ND1   . HIS H 2 72  ? 12.557  -1.166  206.630 1.00 71.26  ? 73   HIS D ND1   1 
ATOM   7823  C  CD2   . HIS H 2 72  ? 12.233  -0.353  208.631 1.00 63.84  ? 73   HIS D CD2   1 
ATOM   7824  C  CE1   . HIS H 2 72  ? 12.953  0.095   206.609 1.00 74.19  ? 73   HIS D CE1   1 
ATOM   7825  N  NE2   . HIS H 2 72  ? 12.765  0.609   207.813 1.00 63.12  ? 73   HIS D NE2   1 
ATOM   7826  N  N     . GLU H 2 73  ? 9.222   -1.155  207.219 1.00 46.78  ? 74   GLU D N     1 
ATOM   7827  C  CA    . GLU H 2 73  ? 8.159   -0.179  207.435 1.00 47.96  ? 74   GLU D CA    1 
ATOM   7828  C  C     . GLU H 2 73  ? 6.764   -0.744  207.217 1.00 40.00  ? 74   GLU D C     1 
ATOM   7829  O  O     . GLU H 2 73  ? 5.882   -0.567  208.045 1.00 24.80  ? 74   GLU D O     1 
ATOM   7830  C  CB    . GLU H 2 73  ? 8.363   1.019   206.504 1.00 65.86  ? 74   GLU D CB    1 
ATOM   7831  N  N     . ALA H 2 74  ? 6.575   -1.420  206.089 1.00 45.52  ? 75   ALA D N     1 
ATOM   7832  C  CA    . ALA H 2 74  ? 5.285   -1.998  205.735 1.00 46.52  ? 75   ALA D CA    1 
ATOM   7833  C  C     . ALA H 2 74  ? 4.934   -3.214  206.570 1.00 50.44  ? 75   ALA D C     1 
ATOM   7834  O  O     . ALA H 2 74  ? 3.792   -3.369  207.001 1.00 53.47  ? 75   ALA D O     1 
ATOM   7835  C  CB    . ALA H 2 74  ? 5.279   -2.368  204.265 1.00 45.11  ? 75   ALA D CB    1 
ATOM   7836  N  N     . ARG H 2 75  ? 5.916   -4.087  206.777 1.00 56.02  ? 76   ARG D N     1 
ATOM   7837  C  CA    . ARG H 2 75  ? 5.707   -5.298  207.558 1.00 55.35  ? 76   ARG D CA    1 
ATOM   7838  C  C     . ARG H 2 75  ? 5.337   -4.957  208.993 1.00 53.04  ? 76   ARG D C     1 
ATOM   7839  O  O     . ARG H 2 75  ? 4.595   -5.696  209.639 1.00 48.68  ? 76   ARG D O     1 
ATOM   7840  C  CB    . ARG H 2 75  ? 6.961   -6.189  207.514 1.00 51.47  ? 76   ARG D CB    1 
ATOM   7841  C  CG    . ARG H 2 75  ? 6.970   -7.147  206.322 1.00 43.95  ? 76   ARG D CG    1 
ATOM   7842  C  CD    . ARG H 2 75  ? 8.331   -7.778  206.036 1.00 47.29  ? 76   ARG D CD    1 
ATOM   7843  N  NE    . ARG H 2 75  ? 8.288   -8.590  204.814 1.00 32.10  ? 76   ARG D NE    1 
ATOM   7844  C  CZ    . ARG H 2 75  ? 9.348   -8.949  204.094 1.00 24.41  ? 76   ARG D CZ    1 
ATOM   7845  N  NH1   . ARG H 2 75  ? 10.578  -8.583  204.448 1.00 22.57  ? 76   ARG D NH1   1 
ATOM   7846  N  NH2   . ARG H 2 75  ? 9.170   -9.672  203.003 1.00 32.23  ? 76   ARG D NH2   1 
ATOM   7847  N  N     . TYR H 2 76  ? 5.845   -3.833  209.489 1.00 49.31  ? 77   TYR D N     1 
ATOM   7848  C  CA    . TYR H 2 76  ? 5.531   -3.425  210.849 1.00 47.87  ? 77   TYR D CA    1 
ATOM   7849  C  C     . TYR H 2 76  ? 4.069   -3.076  210.960 1.00 47.09  ? 77   TYR D C     1 
ATOM   7850  O  O     . TYR H 2 76  ? 3.486   -3.192  212.035 1.00 50.31  ? 77   TYR D O     1 
ATOM   7851  C  CB    . TYR H 2 76  ? 6.359   -2.219  211.277 1.00 47.27  ? 77   TYR D CB    1 
ATOM   7852  C  CG    . TYR H 2 76  ? 7.785   -2.544  211.628 1.00 47.82  ? 77   TYR D CG    1 
ATOM   7853  C  CD1   . TYR H 2 76  ? 8.098   -3.697  212.351 1.00 45.19  ? 77   TYR D CD1   1 
ATOM   7854  C  CD2   . TYR H 2 76  ? 8.823   -1.690  211.253 1.00 51.73  ? 77   TYR D CD2   1 
ATOM   7855  C  CE1   . TYR H 2 76  ? 9.411   -3.994  212.690 1.00 50.30  ? 77   TYR D CE1   1 
ATOM   7856  C  CE2   . TYR H 2 76  ? 10.141  -1.974  211.588 1.00 52.41  ? 77   TYR D CE2   1 
ATOM   7857  C  CZ    . TYR H 2 76  ? 10.428  -3.128  212.304 1.00 55.14  ? 77   TYR D CZ    1 
ATOM   7858  O  OH    . TYR H 2 76  ? 11.732  -3.418  212.623 1.00 47.77  ? 77   TYR D OH    1 
ATOM   7859  N  N     . LYS H 2 77  ? 3.479   -2.636  209.851 1.00 47.62  ? 78   LYS D N     1 
ATOM   7860  C  CA    . LYS H 2 77  ? 2.062   -2.277  209.843 1.00 51.28  ? 78   LYS D CA    1 
ATOM   7861  C  C     . LYS H 2 77  ? 1.230   -3.505  210.176 1.00 55.56  ? 78   LYS D C     1 
ATOM   7862  O  O     . LYS H 2 77  ? 0.124   -3.390  210.697 1.00 63.19  ? 78   LYS D O     1 
ATOM   7863  C  CB    . LYS H 2 77  ? 1.641   -1.742  208.474 1.00 51.89  ? 78   LYS D CB    1 
ATOM   7864  C  CG    . LYS H 2 77  ? 2.353   -0.471  208.032 1.00 65.48  ? 78   LYS D CG    1 
ATOM   7865  C  CD    . LYS H 2 77  ? 1.591   0.806   208.376 1.00 63.21  ? 78   LYS D CD    1 
ATOM   7866  C  CE    . LYS H 2 77  ? 1.595   1.128   209.870 1.00 75.78  ? 78   LYS D CE    1 
ATOM   7867  N  NZ    . LYS H 2 77  ? 0.772   0.202   210.705 1.00 73.46  ? 78   LYS D NZ    1 
ATOM   7868  N  N     . LEU H 2 78  ? 1.769   -4.681  209.879 1.00 54.16  ? 79   LEU D N     1 
ATOM   7869  C  CA    . LEU H 2 78  ? 1.056   -5.918  210.142 1.00 56.30  ? 79   LEU D CA    1 
ATOM   7870  C  C     . LEU H 2 78  ? 0.654   -6.060  211.600 1.00 60.21  ? 79   LEU D C     1 
ATOM   7871  O  O     . LEU H 2 78  ? -0.271  -6.802  211.922 1.00 60.43  ? 79   LEU D O     1 
ATOM   7872  C  CB    . LEU H 2 78  ? 1.903   -7.109  209.713 1.00 51.21  ? 79   LEU D CB    1 
ATOM   7873  C  CG    . LEU H 2 78  ? 2.378   -7.089  208.254 1.00 49.44  ? 79   LEU D CG    1 
ATOM   7874  C  CD1   . LEU H 2 78  ? 2.836   -8.487  207.891 1.00 53.74  ? 79   LEU D CD1   1 
ATOM   7875  C  CD2   . LEU H 2 78  ? 1.267   -6.664  207.311 1.00 33.24  ? 79   LEU D CD2   1 
ATOM   7876  N  N     . PHE H 2 79  ? 1.352   -5.340  212.475 1.00 68.63  ? 80   PHE D N     1 
ATOM   7877  C  CA    . PHE H 2 79  ? 1.070   -5.355  213.912 1.00 72.58  ? 80   PHE D CA    1 
ATOM   7878  C  C     . PHE H 2 79  ? 0.140   -4.174  214.220 1.00 79.94  ? 80   PHE D C     1 
ATOM   7879  O  O     . PHE H 2 79  ? 0.611   -3.053  214.444 1.00 82.90  ? 80   PHE D O     1 
ATOM   7880  C  CB    . PHE H 2 79  ? 2.351   -5.162  214.738 1.00 69.42  ? 80   PHE D CB    1 
ATOM   7881  C  CG    . PHE H 2 79  ? 3.390   -6.241  214.561 1.00 62.81  ? 80   PHE D CG    1 
ATOM   7882  C  CD1   . PHE H 2 79  ? 4.077   -6.389  213.361 1.00 64.75  ? 80   PHE D CD1   1 
ATOM   7883  C  CD2   . PHE H 2 79  ? 3.731   -7.068  215.626 1.00 61.58  ? 80   PHE D CD2   1 
ATOM   7884  C  CE1   . PHE H 2 79  ? 5.087   -7.342  213.227 1.00 61.36  ? 80   PHE D CE1   1 
ATOM   7885  C  CE2   . PHE H 2 79  ? 4.737   -8.022  215.504 1.00 59.75  ? 80   PHE D CE2   1 
ATOM   7886  C  CZ    . PHE H 2 79  ? 5.417   -8.157  214.301 1.00 63.90  ? 80   PHE D CZ    1 
ATOM   7887  N  N     . ASN H 2 80  ? -1.169  -4.411  214.230 1.00 78.85  ? 81   ASN D N     1 
ATOM   7888  C  CA    . ASN H 2 80  ? -2.119  -3.343  214.523 1.00 80.45  ? 81   ASN D CA    1 
ATOM   7889  C  C     . ASN H 2 80  ? -2.072  -2.980  215.997 1.00 79.95  ? 81   ASN D C     1 
ATOM   7890  O  O     . ASN H 2 80  ? -3.106  -2.905  216.662 1.00 84.72  ? 81   ASN D O     1 
ATOM   7891  C  CB    . ASN H 2 80  ? -3.536  -3.765  214.151 1.00 84.44  ? 81   ASN D CB    1 
ATOM   7892  C  CG    . ASN H 2 80  ? -3.777  -3.724  212.665 1.00 85.80  ? 81   ASN D CG    1 
ATOM   7893  O  OD1   . ASN H 2 80  ? -3.191  -4.496  211.906 1.00 89.34  ? 81   ASN D OD1   1 
ATOM   7894  N  ND2   . ASN H 2 80  ? -4.641  -2.811  212.235 1.00 88.52  ? 81   ASN D ND2   1 
ATOM   7895  N  N     . SER H 2 81  ? -0.866  -2.747  216.499 1.00 76.23  ? 82   SER D N     1 
ATOM   7896  C  CA    . SER H 2 81  ? -0.676  -2.408  217.895 1.00 69.23  ? 82   SER D CA    1 
ATOM   7897  C  C     . SER H 2 81  ? 0.764   -2.084  218.213 1.00 68.13  ? 82   SER D C     1 
ATOM   7898  O  O     . SER H 2 81  ? 1.565   -2.984  218.472 1.00 71.10  ? 82   SER D O     1 
ATOM   7899  C  CB    . SER H 2 81  ? -1.103  -3.569  218.781 1.00 75.57  ? 82   SER D CB    1 
ATOM   7900  O  OG    . SER H 2 81  ? -0.626  -3.373  220.098 1.00 82.05  ? 82   SER D OG    1 
ATOM   7901  N  N     . PRO H 2 82  ? 1.115   -0.794  218.207 1.00 61.85  ? 83   PRO D N     1 
ATOM   7902  C  CA    . PRO H 2 82  ? 2.476   -0.352  218.506 1.00 63.90  ? 83   PRO D CA    1 
ATOM   7903  C  C     . PRO H 2 82  ? 3.022   -1.051  219.752 1.00 67.92  ? 83   PRO D C     1 
ATOM   7904  O  O     . PRO H 2 82  ? 4.205   -1.395  219.826 1.00 70.23  ? 83   PRO D O     1 
ATOM   7905  C  CB    . PRO H 2 82  ? 2.305   1.147   218.725 1.00 55.52  ? 83   PRO D CB    1 
ATOM   7906  C  CG    . PRO H 2 82  ? 1.225   1.492   217.770 1.00 57.54  ? 83   PRO D CG    1 
ATOM   7907  C  CD    . PRO H 2 82  ? 0.237   0.356   217.942 1.00 62.41  ? 83   PRO D CD    1 
ATOM   7908  N  N     . THR H 2 83  ? 2.146   -1.253  220.730 1.00 72.22  ? 84   THR D N     1 
ATOM   7909  C  CA    . THR H 2 83  ? 2.519   -1.904  221.982 1.00 74.56  ? 84   THR D CA    1 
ATOM   7910  C  C     . THR H 2 83  ? 2.920   -3.347  221.710 1.00 71.73  ? 84   THR D C     1 
ATOM   7911  O  O     . THR H 2 83  ? 3.992   -3.796  222.115 1.00 73.16  ? 84   THR D O     1 
ATOM   7912  C  CB    . THR H 2 83  ? 1.342   -1.885  222.995 1.00 77.11  ? 84   THR D CB    1 
ATOM   7913  O  OG1   . THR H 2 83  ? 0.955   -0.529  223.254 1.00 77.32  ? 84   THR D OG1   1 
ATOM   7914  C  CG2   . THR H 2 83  ? 1.748   -2.547  224.304 1.00 79.79  ? 84   THR D CG2   1 
ATOM   7915  N  N     . LEU H 2 84  ? 2.050   -4.068  221.015 1.00 65.69  ? 85   LEU D N     1 
ATOM   7916  C  CA    . LEU H 2 84  ? 2.314   -5.455  220.691 1.00 58.92  ? 85   LEU D CA    1 
ATOM   7917  C  C     . LEU H 2 84  ? 3.506   -5.561  219.754 1.00 57.53  ? 85   LEU D C     1 
ATOM   7918  O  O     . LEU H 2 84  ? 4.196   -6.578  219.737 1.00 61.71  ? 85   LEU D O     1 
ATOM   7919  C  CB    . LEU H 2 84  ? 1.087   -6.081  220.052 1.00 56.18  ? 85   LEU D CB    1 
ATOM   7920  C  CG    . LEU H 2 84  ? 1.039   -7.599  220.163 1.00 59.67  ? 85   LEU D CG    1 
ATOM   7921  C  CD1   . LEU H 2 84  ? 1.276   -8.021  221.593 1.00 58.22  ? 85   LEU D CD1   1 
ATOM   7922  C  CD2   . LEU H 2 84  ? -0.318  -8.092  219.683 1.00 68.50  ? 85   LEU D CD2   1 
ATOM   7923  N  N     . LEU H 2 85  ? 3.747   -4.506  218.978 1.00 51.77  ? 86   LEU D N     1 
ATOM   7924  C  CA    . LEU H 2 85  ? 4.875   -4.479  218.051 1.00 43.56  ? 86   LEU D CA    1 
ATOM   7925  C  C     . LEU H 2 85  ? 6.121   -4.424  218.905 1.00 38.18  ? 86   LEU D C     1 
ATOM   7926  O  O     . LEU H 2 85  ? 6.964   -5.307  218.854 1.00 44.61  ? 86   LEU D O     1 
ATOM   7927  C  CB    . LEU H 2 85  ? 4.825   -3.235  217.144 1.00 42.75  ? 86   LEU D CB    1 
ATOM   7928  C  CG    . LEU H 2 85  ? 5.952   -3.043  216.100 1.00 42.03  ? 86   LEU D CG    1 
ATOM   7929  C  CD1   . LEU H 2 85  ? 5.856   -4.138  215.058 1.00 40.27  ? 86   LEU D CD1   1 
ATOM   7930  C  CD2   . LEU H 2 85  ? 5.850   -1.682  215.411 1.00 15.71  ? 86   LEU D CD2   1 
ATOM   7931  N  N     . PHE H 2 86  ? 6.223   -3.378  219.707 1.00 39.23  ? 87   PHE D N     1 
ATOM   7932  C  CA    . PHE H 2 86  ? 7.371   -3.204  220.579 1.00 37.58  ? 87   PHE D CA    1 
ATOM   7933  C  C     . PHE H 2 86  ? 7.759   -4.481  221.301 1.00 31.30  ? 87   PHE D C     1 
ATOM   7934  O  O     . PHE H 2 86  ? 8.930   -4.719  221.556 1.00 43.98  ? 87   PHE D O     1 
ATOM   7935  C  CB    . PHE H 2 86  ? 7.068   -2.131  221.606 1.00 32.63  ? 87   PHE D CB    1 
ATOM   7936  C  CG    . PHE H 2 86  ? 8.082   -2.043  222.686 1.00 39.72  ? 87   PHE D CG    1 
ATOM   7937  C  CD1   . PHE H 2 86  ? 9.391   -1.693  222.400 1.00 41.26  ? 87   PHE D CD1   1 
ATOM   7938  C  CD2   . PHE H 2 86  ? 7.727   -2.295  224.003 1.00 44.47  ? 87   PHE D CD2   1 
ATOM   7939  C  CE1   . PHE H 2 86  ? 10.336  -1.594  223.416 1.00 50.43  ? 87   PHE D CE1   1 
ATOM   7940  C  CE2   . PHE H 2 86  ? 8.662   -2.198  225.026 1.00 47.74  ? 87   PHE D CE2   1 
ATOM   7941  C  CZ    . PHE H 2 86  ? 9.967   -1.845  224.736 1.00 50.19  ? 87   PHE D CZ    1 
ATOM   7942  N  N     . LEU H 2 87  ? 6.770   -5.306  221.613 1.00 39.91  ? 88   LEU D N     1 
ATOM   7943  C  CA    . LEU H 2 87  ? 6.987   -6.549  222.350 1.00 39.19  ? 88   LEU D CA    1 
ATOM   7944  C  C     . LEU H 2 87  ? 7.399   -7.755  221.516 1.00 46.40  ? 88   LEU D C     1 
ATOM   7945  O  O     . LEU H 2 87  ? 8.220   -8.568  221.951 1.00 39.72  ? 88   LEU D O     1 
ATOM   7946  C  CB    . LEU H 2 87  ? 5.705   -6.890  223.117 1.00 39.70  ? 88   LEU D CB    1 
ATOM   7947  C  CG    . LEU H 2 87  ? 5.658   -6.862  224.651 1.00 42.39  ? 88   LEU D CG    1 
ATOM   7948  C  CD1   . LEU H 2 87  ? 6.258   -5.581  225.229 1.00 40.44  ? 88   LEU D CD1   1 
ATOM   7949  C  CD2   . LEU H 2 87  ? 4.214   -6.990  225.062 1.00 49.91  ? 88   LEU D CD2   1 
ATOM   7950  N  N     . LEU H 2 88  ? 6.826   -7.863  220.319 1.00 47.32  ? 89   LEU D N     1 
ATOM   7951  C  CA    . LEU H 2 88  ? 7.081   -8.996  219.440 1.00 42.38  ? 89   LEU D CA    1 
ATOM   7952  C  C     . LEU H 2 88  ? 7.925   -8.680  218.197 1.00 48.87  ? 89   LEU D C     1 
ATOM   7953  O  O     . LEU H 2 88  ? 8.511   -9.582  217.591 1.00 50.39  ? 89   LEU D O     1 
ATOM   7954  C  CB    . LEU H 2 88  ? 5.731   -9.601  219.029 1.00 41.41  ? 89   LEU D CB    1 
ATOM   7955  C  CG    . LEU H 2 88  ? 4.748   -9.950  220.160 1.00 23.54  ? 89   LEU D CG    1 
ATOM   7956  C  CD1   . LEU H 2 88  ? 3.379   -10.265 219.571 1.00 28.78  ? 89   LEU D CD1   1 
ATOM   7957  C  CD2   . LEU H 2 88  ? 5.260   -11.137 220.950 1.00 22.77  ? 89   LEU D CD2   1 
ATOM   7958  N  N     . SER H 2 89  ? 7.988   -7.404  217.823 1.00 50.99  ? 90   SER D N     1 
ATOM   7959  C  CA    . SER H 2 89  ? 8.759   -6.969  216.657 1.00 46.15  ? 90   SER D CA    1 
ATOM   7960  C  C     . SER H 2 89  ? 10.133  -7.627  216.651 1.00 44.94  ? 90   SER D C     1 
ATOM   7961  O  O     . SER H 2 89  ? 10.618  -8.055  217.695 1.00 47.56  ? 90   SER D O     1 
ATOM   7962  C  CB    . SER H 2 89  ? 8.922   -5.450  216.679 1.00 52.59  ? 90   SER D CB    1 
ATOM   7963  O  OG    . SER H 2 89  ? 9.680   -5.004  215.570 1.00 80.80  ? 90   SER D OG    1 
ATOM   7964  N  N     . ARG H 2 90  ? 10.772  -7.694  215.486 1.00 51.18  ? 91   ARG D N     1 
ATOM   7965  C  CA    . ARG H 2 90  ? 12.083  -8.331  215.403 1.00 46.67  ? 91   ARG D CA    1 
ATOM   7966  C  C     . ARG H 2 90  ? 13.171  -7.493  214.772 1.00 41.46  ? 91   ARG D C     1 
ATOM   7967  O  O     . ARG H 2 90  ? 13.978  -8.017  214.016 1.00 53.06  ? 91   ARG D O     1 
ATOM   7968  C  CB    . ARG H 2 90  ? 11.984  -9.660  214.646 1.00 47.61  ? 91   ARG D CB    1 
ATOM   7969  C  CG    . ARG H 2 90  ? 13.068  -10.669 215.009 1.00 42.61  ? 91   ARG D CG    1 
ATOM   7970  C  CD    . ARG H 2 90  ? 12.987  -11.029 216.487 1.00 50.82  ? 91   ARG D CD    1 
ATOM   7971  N  NE    . ARG H 2 90  ? 13.783  -12.203 216.837 1.00 58.40  ? 91   ARG D NE    1 
ATOM   7972  C  CZ    . ARG H 2 90  ? 13.513  -13.437 216.427 1.00 54.87  ? 91   ARG D CZ    1 
ATOM   7973  N  NH1   . ARG H 2 90  ? 12.467  -13.662 215.649 1.00 65.50  ? 91   ARG D NH1   1 
ATOM   7974  N  NH2   . ARG H 2 90  ? 14.275  -14.453 216.805 1.00 63.04  ? 91   ARG D NH2   1 
ATOM   7975  N  N     . GLY H 2 91  ? 13.217  -6.201  215.072 1.00 31.66  ? 92   GLY D N     1 
ATOM   7976  C  CA    . GLY H 2 91  ? 14.274  -5.381  214.496 1.00 37.67  ? 92   GLY D CA    1 
ATOM   7977  C  C     . GLY H 2 91  ? 14.046  -4.961  213.055 1.00 45.95  ? 92   GLY D C     1 
ATOM   7978  O  O     . GLY H 2 91  ? 13.340  -5.627  212.298 1.00 51.22  ? 92   GLY D O     1 
ATOM   7979  N  N     . LYS H 2 92  ? 14.658  -3.844  212.675 1.00 47.89  ? 93   LYS D N     1 
ATOM   7980  C  CA    . LYS H 2 92  ? 14.517  -3.297  211.328 1.00 45.76  ? 93   LYS D CA    1 
ATOM   7981  C  C     . LYS H 2 92  ? 15.211  -4.143  210.267 1.00 44.56  ? 93   LYS D C     1 
ATOM   7982  O  O     . LYS H 2 92  ? 14.565  -4.674  209.355 1.00 40.91  ? 93   LYS D O     1 
ATOM   7983  C  CB    . LYS H 2 92  ? 15.058  -1.861  211.300 1.00 51.79  ? 93   LYS D CB    1 
ATOM   7984  C  CG    . LYS H 2 92  ? 15.217  -1.255  209.918 1.00 56.50  ? 93   LYS D CG    1 
ATOM   7985  C  CD    . LYS H 2 92  ? 15.516  0.236   210.009 1.00 61.82  ? 93   LYS D CD    1 
ATOM   7986  C  CE    . LYS H 2 92  ? 15.949  0.817   208.663 1.00 73.58  ? 93   LYS D CE    1 
ATOM   7987  N  NZ    . LYS H 2 92  ? 17.303  0.332   208.251 1.00 73.04  ? 93   LYS D NZ    1 
ATOM   7988  N  N     . ALA H 2 93  ? 16.526  -4.271  210.397 1.00 38.31  ? 94   ALA D N     1 
ATOM   7989  C  CA    . ALA H 2 93  ? 17.315  -5.053  209.457 1.00 40.12  ? 94   ALA D CA    1 
ATOM   7990  C  C     . ALA H 2 93  ? 16.749  -6.454  209.281 1.00 39.92  ? 94   ALA D C     1 
ATOM   7991  O  O     . ALA H 2 93  ? 16.560  -6.922  208.161 1.00 45.56  ? 94   ALA D O     1 
ATOM   7992  C  CB    . ALA H 2 93  ? 18.757  -5.135  209.928 1.00 36.13  ? 94   ALA D CB    1 
ATOM   7993  N  N     . ALA H 2 94  ? 16.481  -7.132  210.385 1.00 39.63  ? 95   ALA D N     1 
ATOM   7994  C  CA    . ALA H 2 94  ? 15.947  -8.477  210.296 1.00 43.68  ? 95   ALA D CA    1 
ATOM   7995  C  C     . ALA H 2 94  ? 14.641  -8.507  209.517 1.00 45.47  ? 95   ALA D C     1 
ATOM   7996  O  O     . ALA H 2 94  ? 14.536  -9.194  208.505 1.00 50.48  ? 95   ALA D O     1 
ATOM   7997  C  CB    . ALA H 2 94  ? 15.741  -9.052  211.692 1.00 49.88  ? 95   ALA D CB    1 
ATOM   7998  N  N     . THR H 2 95  ? 13.647  -7.763  209.991 1.00 50.89  ? 96   THR D N     1 
ATOM   7999  C  CA    . THR H 2 95  ? 12.341  -7.721  209.343 1.00 47.56  ? 96   THR D CA    1 
ATOM   8000  C  C     . THR H 2 95  ? 12.462  -7.373  207.872 1.00 46.67  ? 96   THR D C     1 
ATOM   8001  O  O     . THR H 2 95  ? 11.620  -7.753  207.060 1.00 40.36  ? 96   THR D O     1 
ATOM   8002  C  CB    . THR H 2 95  ? 11.434  -6.678  209.989 1.00 48.28  ? 96   THR D CB    1 
ATOM   8003  O  OG1   . THR H 2 95  ? 11.408  -6.874  211.410 1.00 61.56  ? 96   THR D OG1   1 
ATOM   8004  C  CG2   . THR H 2 95  ? 10.034  -6.808  209.440 1.00 36.29  ? 96   THR D CG2   1 
ATOM   8005  N  N     . GLU H 2 96  ? 13.515  -6.639  207.538 1.00 48.33  ? 97   GLU D N     1 
ATOM   8006  C  CA    . GLU H 2 96  ? 13.752  -6.221  206.165 1.00 51.57  ? 97   GLU D CA    1 
ATOM   8007  C  C     . GLU H 2 96  ? 14.175  -7.406  205.297 1.00 51.12  ? 97   GLU D C     1 
ATOM   8008  O  O     . GLU H 2 96  ? 13.573  -7.665  204.255 1.00 56.37  ? 97   GLU D O     1 
ATOM   8009  C  CB    . GLU H 2 96  ? 14.831  -5.135  206.145 1.00 48.07  ? 97   GLU D CB    1 
ATOM   8010  C  CG    . GLU H 2 96  ? 15.157  -4.576  204.770 1.00 58.93  ? 97   GLU D CG    1 
ATOM   8011  C  CD    . GLU H 2 96  ? 14.089  -3.644  204.233 1.00 60.82  ? 97   GLU D CD    1 
ATOM   8012  O  OE1   . GLU H 2 96  ? 14.314  -3.051  203.157 1.00 62.35  ? 97   GLU D OE1   1 
ATOM   8013  O  OE2   . GLU H 2 96  ? 13.030  -3.499  204.880 1.00 64.26  ? 97   GLU D OE2   1 
ATOM   8014  N  N     . ASN H 2 97  ? 15.194  -8.135  205.739 1.00 49.17  ? 98   ASN D N     1 
ATOM   8015  C  CA    . ASN H 2 97  ? 15.695  -9.269  204.983 1.00 54.42  ? 98   ASN D CA    1 
ATOM   8016  C  C     . ASN H 2 97  ? 14.933  -10.569 205.168 1.00 56.50  ? 98   ASN D C     1 
ATOM   8017  O  O     . ASN H 2 97  ? 15.486  -11.649 204.978 1.00 68.88  ? 98   ASN D O     1 
ATOM   8018  C  CB    . ASN H 2 97  ? 17.173  -9.504  205.301 1.00 59.54  ? 98   ASN D CB    1 
ATOM   8019  C  CG    . ASN H 2 97  ? 18.051  -8.381  204.820 1.00 63.33  ? 98   ASN D CG    1 
ATOM   8020  O  OD1   . ASN H 2 97  ? 18.323  -7.436  205.558 1.00 61.38  ? 98   ASN D OD1   1 
ATOM   8021  N  ND2   . ASN H 2 97  ? 18.485  -8.463  203.560 1.00 66.72  ? 98   ASN D ND2   1 
ATOM   8022  N  N     . TRP H 2 98  ? 13.665  -10.479 205.535 1.00 55.01  ? 99   TRP D N     1 
ATOM   8023  C  CA    . TRP H 2 98  ? 12.866  -11.679 205.711 1.00 51.40  ? 99   TRP D CA    1 
ATOM   8024  C  C     . TRP H 2 98  ? 12.330  -12.147 204.359 1.00 54.94  ? 99   TRP D C     1 
ATOM   8025  O  O     . TRP H 2 98  ? 11.812  -11.347 203.571 1.00 38.20  ? 99   TRP D O     1 
ATOM   8026  C  CB    . TRP H 2 98  ? 11.689  -11.407 206.644 1.00 52.42  ? 99   TRP D CB    1 
ATOM   8027  C  CG    . TRP H 2 98  ? 10.897  -12.627 206.932 1.00 47.32  ? 99   TRP D CG    1 
ATOM   8028  C  CD1   . TRP H 2 98  ? 11.204  -13.611 207.826 1.00 55.77  ? 99   TRP D CD1   1 
ATOM   8029  C  CD2   . TRP H 2 98  ? 9.686   -13.030 206.294 1.00 52.13  ? 99   TRP D CD2   1 
ATOM   8030  N  NE1   . TRP H 2 98  ? 10.256  -14.605 207.781 1.00 56.13  ? 99   TRP D NE1   1 
ATOM   8031  C  CE2   . TRP H 2 98  ? 9.311   -14.272 206.847 1.00 49.91  ? 99   TRP D CE2   1 
ATOM   8032  C  CE3   . TRP H 2 98  ? 8.876   -12.463 205.304 1.00 60.26  ? 99   TRP D CE3   1 
ATOM   8033  C  CZ2   . TRP H 2 98  ? 8.167   -14.956 206.449 1.00 51.91  ? 99   TRP D CZ2   1 
ATOM   8034  C  CZ3   . TRP H 2 98  ? 7.730   -13.147 204.905 1.00 59.42  ? 99   TRP D CZ3   1 
ATOM   8035  C  CH2   . TRP H 2 98  ? 7.389   -14.379 205.478 1.00 52.70  ? 99   TRP D CH2   1 
ATOM   8036  N  N     . SER H 2 99  ? 12.463  -13.446 204.098 1.00 62.25  ? 100  SER D N     1 
ATOM   8037  C  CA    . SER H 2 99  ? 11.983  -14.053 202.851 1.00 64.71  ? 100  SER D CA    1 
ATOM   8038  C  C     . SER H 2 99  ? 11.678  -15.527 203.085 1.00 61.99  ? 100  SER D C     1 
ATOM   8039  O  O     . SER H 2 99  ? 12.219  -16.140 204.001 1.00 60.82  ? 100  SER D O     1 
ATOM   8040  C  CB    . SER H 2 99  ? 13.029  -13.911 201.739 1.00 66.04  ? 100  SER D CB    1 
ATOM   8041  O  OG    . SER H 2 99  ? 14.280  -14.449 202.130 1.00 76.67  ? 100  SER D OG    1 
ATOM   8042  N  N     . ILE H 2 100 ? 10.805  -16.096 202.261 1.00 59.41  ? 101  ILE D N     1 
ATOM   8043  C  CA    . ILE H 2 100 ? 10.442  -17.501 202.406 1.00 55.37  ? 101  ILE D CA    1 
ATOM   8044  C  C     . ILE H 2 100 ? 11.662  -18.408 202.373 1.00 60.37  ? 101  ILE D C     1 
ATOM   8045  O  O     . ILE H 2 100 ? 11.569  -19.580 202.723 1.00 64.74  ? 101  ILE D O     1 
ATOM   8046  C  CB    . ILE H 2 100 ? 9.470   -17.938 201.308 1.00 58.14  ? 101  ILE D CB    1 
ATOM   8047  C  CG1   . ILE H 2 100 ? 9.900   -17.316 199.976 1.00 63.03  ? 101  ILE D CG1   1 
ATOM   8048  C  CG2   . ILE H 2 100 ? 8.043   -17.587 201.711 1.00 42.77  ? 101  ILE D CG2   1 
ATOM   8049  C  CD1   . ILE H 2 100 ? 8.933   -17.552 198.835 1.00 73.85  ? 101  ILE D CD1   1 
ATOM   8050  N  N     . GLU H 2 101 ? 12.798  -17.869 201.942 1.00 61.05  ? 102  GLU D N     1 
ATOM   8051  C  CA    . GLU H 2 101 ? 14.039  -18.630 201.891 1.00 69.82  ? 102  GLU D CA    1 
ATOM   8052  C  C     . GLU H 2 101 ? 14.952  -18.128 202.989 1.00 75.55  ? 102  GLU D C     1 
ATOM   8053  O  O     . GLU H 2 101 ? 16.165  -18.341 202.961 1.00 83.12  ? 102  GLU D O     1 
ATOM   8054  C  CB    . GLU H 2 101 ? 14.734  -18.463 200.540 1.00 75.81  ? 102  GLU D CB    1 
ATOM   8055  C  CG    . GLU H 2 101 ? 14.175  -19.351 199.449 1.00 89.17  ? 102  GLU D CG    1 
ATOM   8056  C  CD    . GLU H 2 101 ? 14.579  -20.805 199.603 1.00 93.63  ? 102  GLU D CD    1 
ATOM   8057  O  OE1   . GLU H 2 101 ? 14.403  -21.366 200.709 1.00 94.15  ? 102  GLU D OE1   1 
ATOM   8058  O  OE2   . GLU H 2 101 ? 15.065  -21.387 198.609 1.00 97.15  ? 102  GLU D OE2   1 
ATOM   8059  N  N     . ASN H 2 102 ? 14.357  -17.447 203.957 1.00 71.12  ? 103  ASN D N     1 
ATOM   8060  C  CA    . ASN H 2 102 ? 15.103  -16.912 205.084 1.00 67.56  ? 103  ASN D CA    1 
ATOM   8061  C  C     . ASN H 2 102 ? 14.123  -16.481 206.165 1.00 65.97  ? 103  ASN D C     1 
ATOM   8062  O  O     . ASN H 2 102 ? 13.777  -15.302 206.266 1.00 65.22  ? 103  ASN D O     1 
ATOM   8063  C  CB    . ASN H 2 102 ? 15.954  -15.730 204.631 1.00 57.84  ? 103  ASN D CB    1 
ATOM   8064  C  CG    . ASN H 2 102 ? 16.829  -15.191 205.736 1.00 56.26  ? 103  ASN D CG    1 
ATOM   8065  O  OD1   . ASN H 2 102 ? 17.600  -15.929 206.353 1.00 58.68  ? 103  ASN D OD1   1 
ATOM   8066  N  ND2   . ASN H 2 102 ? 16.725  -13.895 205.989 1.00 61.11  ? 103  ASN D ND2   1 
ATOM   8067  N  N     . LEU H 2 103 ? 13.672  -17.452 206.959 1.00 58.80  ? 104  LEU D N     1 
ATOM   8068  C  CA    . LEU H 2 103 ? 12.721  -17.191 208.031 1.00 55.85  ? 104  LEU D CA    1 
ATOM   8069  C  C     . LEU H 2 103 ? 13.409  -16.985 209.369 1.00 52.18  ? 104  LEU D C     1 
ATOM   8070  O  O     . LEU H 2 103 ? 14.571  -17.342 209.551 1.00 46.81  ? 104  LEU D O     1 
ATOM   8071  C  CB    . LEU H 2 103 ? 11.724  -18.340 208.171 1.00 58.46  ? 104  LEU D CB    1 
ATOM   8072  C  CG    . LEU H 2 103 ? 11.074  -18.888 206.907 1.00 58.06  ? 104  LEU D CG    1 
ATOM   8073  C  CD1   . LEU H 2 103 ? 12.063  -19.816 206.208 1.00 57.18  ? 104  LEU D CD1   1 
ATOM   8074  C  CD2   . LEU H 2 103 ? 9.800   -19.655 207.267 1.00 58.98  ? 104  LEU D CD2   1 
ATOM   8075  N  N     . PHE H 2 104 ? 12.660  -16.421 210.308 1.00 47.07  ? 105  PHE D N     1 
ATOM   8076  C  CA    . PHE H 2 104 ? 13.166  -16.143 211.643 1.00 46.93  ? 105  PHE D CA    1 
ATOM   8077  C  C     . PHE H 2 104 ? 13.469  -17.410 212.428 1.00 51.64  ? 105  PHE D C     1 
ATOM   8078  O  O     . PHE H 2 104 ? 12.905  -18.473 212.163 1.00 52.21  ? 105  PHE D O     1 
ATOM   8079  C  CB    . PHE H 2 104 ? 12.149  -15.310 212.419 1.00 34.39  ? 105  PHE D CB    1 
ATOM   8080  C  CG    . PHE H 2 104 ? 11.970  -13.917 211.893 1.00 35.34  ? 105  PHE D CG    1 
ATOM   8081  C  CD1   . PHE H 2 104 ? 10.700  -13.366 211.788 1.00 38.35  ? 105  PHE D CD1   1 
ATOM   8082  C  CD2   . PHE H 2 104 ? 13.067  -13.143 211.533 1.00 27.55  ? 105  PHE D CD2   1 
ATOM   8083  C  CE1   . PHE H 2 104 ? 10.525  -12.067 211.334 1.00 32.86  ? 105  PHE D CE1   1 
ATOM   8084  C  CE2   . PHE H 2 104 ? 12.899  -11.842 211.079 1.00 26.56  ? 105  PHE D CE2   1 
ATOM   8085  C  CZ    . PHE H 2 104 ? 11.628  -11.303 210.979 1.00 30.02  ? 105  PHE D CZ    1 
ATOM   8086  N  N     . GLU H 2 105 ? 14.353  -17.282 213.413 1.00 54.69  ? 106  GLU D N     1 
ATOM   8087  C  CA    . GLU H 2 105 ? 14.731  -18.408 214.256 1.00 55.54  ? 106  GLU D CA    1 
ATOM   8088  C  C     . GLU H 2 105 ? 14.710  -18.011 215.737 1.00 57.09  ? 106  GLU D C     1 
ATOM   8089  O  O     . GLU H 2 105 ? 14.154  -16.974 216.105 1.00 57.84  ? 106  GLU D O     1 
ATOM   8090  C  CB    . GLU H 2 105 ? 16.124  -18.903 213.857 1.00 57.94  ? 106  GLU D CB    1 
ATOM   8091  C  CG    . GLU H 2 105 ? 16.308  -19.073 212.351 1.00 65.45  ? 106  GLU D CG    1 
ATOM   8092  C  CD    . GLU H 2 105 ? 17.572  -19.833 211.986 1.00 76.60  ? 106  GLU D CD    1 
ATOM   8093  O  OE1   . GLU H 2 105 ? 18.644  -19.530 212.556 1.00 82.32  ? 106  GLU D OE1   1 
ATOM   8094  O  OE2   . GLU H 2 105 ? 17.495  -20.730 211.117 1.00 77.37  ? 106  GLU D OE2   1 
ATOM   8095  N  N     . GLU H 2 106 ? 15.310  -18.841 216.584 1.00 61.39  ? 107  GLU D N     1 
ATOM   8096  C  CA    . GLU H 2 106 ? 15.361  -18.566 218.020 1.00 58.31  ? 107  GLU D CA    1 
ATOM   8097  C  C     . GLU H 2 106 ? 16.353  -17.453 218.312 1.00 54.62  ? 107  GLU D C     1 
ATOM   8098  O  O     . GLU H 2 106 ? 17.497  -17.507 217.867 1.00 60.70  ? 107  GLU D O     1 
ATOM   8099  C  CB    . GLU H 2 106 ? 15.786  -19.823 218.801 1.00 65.15  ? 107  GLU D CB    1 
ATOM   8100  C  CG    . GLU H 2 106 ? 14.650  -20.595 219.486 1.00 65.46  ? 107  GLU D CG    1 
ATOM   8101  C  CD    . GLU H 2 106 ? 14.043  -19.842 220.669 1.00 77.01  ? 107  GLU D CD    1 
ATOM   8102  O  OE1   . GLU H 2 106 ? 13.674  -18.656 220.508 1.00 78.22  ? 107  GLU D OE1   1 
ATOM   8103  O  OE2   . GLU H 2 106 ? 13.927  -20.439 221.764 1.00 76.88  ? 107  GLU D OE2   1 
ATOM   8104  N  N     . LYS H 2 107 ? 15.914  -16.448 219.062 1.00 45.49  ? 108  LYS D N     1 
ATOM   8105  C  CA    . LYS H 2 107 ? 16.775  -15.331 219.444 1.00 37.48  ? 108  LYS D CA    1 
ATOM   8106  C  C     . LYS H 2 107 ? 16.570  -15.025 220.943 1.00 37.57  ? 108  LYS D C     1 
ATOM   8107  O  O     . LYS H 2 107 ? 15.448  -14.768 221.370 1.00 39.52  ? 108  LYS D O     1 
ATOM   8108  C  CB    . LYS H 2 107 ? 16.438  -14.101 218.596 1.00 23.63  ? 108  LYS D CB    1 
ATOM   8109  C  CG    . LYS H 2 107 ? 17.310  -12.899 218.897 1.00 32.30  ? 108  LYS D CG    1 
ATOM   8110  C  CD    . LYS H 2 107 ? 16.926  -11.668 218.104 1.00 25.79  ? 108  LYS D CD    1 
ATOM   8111  C  CE    . LYS H 2 107 ? 17.746  -10.473 218.575 1.00 37.70  ? 108  LYS D CE    1 
ATOM   8112  N  NZ    . LYS H 2 107 ? 17.182  -9.177  218.083 1.00 49.16  ? 108  LYS D NZ    1 
ATOM   8113  N  N     . GLN H 2 108 ? 17.645  -15.054 221.733 1.00 27.89  ? 109  GLN D N     1 
ATOM   8114  C  CA    . GLN H 2 108 ? 17.556  -14.797 223.172 1.00 35.59  ? 109  GLN D CA    1 
ATOM   8115  C  C     . GLN H 2 108 ? 16.560  -13.698 223.566 1.00 40.17  ? 109  GLN D C     1 
ATOM   8116  O  O     . GLN H 2 108 ? 15.682  -13.922 224.391 1.00 48.32  ? 109  GLN D O     1 
ATOM   8117  C  CB    . GLN H 2 108 ? 18.939  -14.453 223.738 1.00 42.66  ? 109  GLN D CB    1 
ATOM   8118  C  CG    . GLN H 2 108 ? 19.973  -15.557 223.595 1.00 49.48  ? 109  GLN D CG    1 
ATOM   8119  C  CD    . GLN H 2 108 ? 21.252  -15.284 224.382 1.00 47.88  ? 109  GLN D CD    1 
ATOM   8120  O  OE1   . GLN H 2 108 ? 21.239  -15.174 225.609 1.00 55.08  ? 109  GLN D OE1   1 
ATOM   8121  N  NE2   . GLN H 2 108 ? 22.363  -15.169 223.673 1.00 61.05  ? 109  GLN D NE2   1 
ATOM   8122  N  N     . ASN H 2 109 ? 16.710  -12.523 222.968 1.00 37.06  ? 110  ASN D N     1 
ATOM   8123  C  CA    . ASN H 2 109 ? 15.859  -11.365 223.212 1.00 39.77  ? 110  ASN D CA    1 
ATOM   8124  C  C     . ASN H 2 109 ? 14.375  -11.637 223.240 1.00 45.00  ? 110  ASN D C     1 
ATOM   8125  O  O     . ASN H 2 109 ? 13.643  -11.018 224.006 1.00 48.57  ? 110  ASN D O     1 
ATOM   8126  C  CB    . ASN H 2 109 ? 16.049  -10.332 222.112 1.00 46.34  ? 110  ASN D CB    1 
ATOM   8127  C  CG    . ASN H 2 109 ? 16.976  -9.240  222.496 1.00 32.88  ? 110  ASN D CG    1 
ATOM   8128  O  OD1   . ASN H 2 109 ? 16.802  -8.592  223.523 1.00 47.32  ? 110  ASN D OD1   1 
ATOM   8129  N  ND2   . ASN H 2 109 ? 17.968  -9.005  221.661 1.00 44.91  ? 110  ASN D ND2   1 
ATOM   8130  N  N     . ASP H 2 110 ? 13.925  -12.521 222.357 1.00 49.28  ? 111  ASP D N     1 
ATOM   8131  C  CA    . ASP H 2 110 ? 12.507  -12.821 222.254 1.00 50.70  ? 111  ASP D CA    1 
ATOM   8132  C  C     . ASP H 2 110 ? 11.806  -12.766 223.606 1.00 48.42  ? 111  ASP D C     1 
ATOM   8133  O  O     . ASP H 2 110 ? 12.084  -13.561 224.504 1.00 43.31  ? 111  ASP D O     1 
ATOM   8134  C  CB    . ASP H 2 110 ? 12.287  -14.181 221.578 1.00 54.88  ? 111  ASP D CB    1 
ATOM   8135  C  CG    . ASP H 2 110 ? 12.634  -14.161 220.094 1.00 53.52  ? 111  ASP D CG    1 
ATOM   8136  O  OD1   . ASP H 2 110 ? 12.456  -13.105 219.451 1.00 59.43  ? 111  ASP D OD1   1 
ATOM   8137  O  OD2   . ASP H 2 110 ? 13.070  -15.205 219.566 1.00 61.84  ? 111  ASP D OD2   1 
ATOM   8138  N  N     . THR H 2 111 ? 10.913  -11.789 223.730 1.00 40.72  ? 112  THR D N     1 
ATOM   8139  C  CA    . THR H 2 111 ? 10.139  -11.553 224.936 1.00 41.96  ? 112  THR D CA    1 
ATOM   8140  C  C     . THR H 2 111 ? 9.411   -12.779 225.483 1.00 48.21  ? 112  THR D C     1 
ATOM   8141  O  O     . THR H 2 111 ? 9.421   -13.014 226.696 1.00 44.62  ? 112  THR D O     1 
ATOM   8142  C  CB    . THR H 2 111 ? 9.089   -10.448 224.709 1.00 41.62  ? 112  THR D CB    1 
ATOM   8143  O  OG1   . THR H 2 111 ? 9.742   -9.217  224.370 1.00 42.39  ? 112  THR D OG1   1 
ATOM   8144  C  CG2   . THR H 2 111 ? 8.259   -10.254 225.961 1.00 42.99  ? 112  THR D CG2   1 
ATOM   8145  N  N     . ALA H 2 112 ? 8.777   -13.557 224.607 1.00 40.30  ? 113  ALA D N     1 
ATOM   8146  C  CA    . ALA H 2 112 ? 8.038   -14.731 225.071 1.00 45.85  ? 113  ALA D CA    1 
ATOM   8147  C  C     . ALA H 2 112 ? 8.617   -16.068 224.614 1.00 50.17  ? 113  ALA D C     1 
ATOM   8148  O  O     . ALA H 2 112 ? 9.325   -16.132 223.619 1.00 60.89  ? 113  ALA D O     1 
ATOM   8149  C  CB    . ALA H 2 112 ? 6.568   -14.614 224.657 1.00 39.43  ? 113  ALA D CB    1 
ATOM   8150  N  N     . ASP H 2 113 ? 8.334   -17.129 225.366 1.00 54.32  ? 114  ASP D N     1 
ATOM   8151  C  CA    . ASP H 2 113 ? 8.819   -18.470 225.036 1.00 56.07  ? 114  ASP D CA    1 
ATOM   8152  C  C     . ASP H 2 113 ? 7.782   -19.094 224.120 1.00 56.34  ? 114  ASP D C     1 
ATOM   8153  O  O     . ASP H 2 113 ? 8.112   -19.779 223.154 1.00 57.99  ? 114  ASP D O     1 
ATOM   8154  C  CB    . ASP H 2 113 ? 8.956   -19.316 226.307 1.00 56.79  ? 114  ASP D CB    1 
ATOM   8155  C  CG    . ASP H 2 113 ? 9.920   -18.709 227.316 1.00 63.05  ? 114  ASP D CG    1 
ATOM   8156  O  OD1   . ASP H 2 113 ? 9.813   -17.495 227.585 1.00 76.12  ? 114  ASP D OD1   1 
ATOM   8157  O  OD2   . ASP H 2 113 ? 10.776  -19.440 227.852 1.00 54.38  ? 114  ASP D OD2   1 
ATOM   8158  N  N     . ILE H 2 114 ? 6.521   -18.849 224.457 1.00 55.01  ? 115  ILE D N     1 
ATOM   8159  C  CA    . ILE H 2 114 ? 5.380   -19.334 223.698 1.00 51.56  ? 115  ILE D CA    1 
ATOM   8160  C  C     . ILE H 2 114 ? 4.366   -18.204 223.612 1.00 58.98  ? 115  ILE D C     1 
ATOM   8161  O  O     . ILE H 2 114 ? 4.026   -17.561 224.614 1.00 54.26  ? 115  ILE D O     1 
ATOM   8162  C  CB    . ILE H 2 114 ? 4.686   -20.532 224.362 1.00 46.36  ? 115  ILE D CB    1 
ATOM   8163  C  CG1   . ILE H 2 114 ? 5.648   -21.715 224.476 1.00 51.49  ? 115  ILE D CG1   1 
ATOM   8164  C  CG2   . ILE H 2 114 ? 3.484   -20.940 223.537 1.00 43.47  ? 115  ILE D CG2   1 
ATOM   8165  C  CD1   . ILE H 2 114 ? 6.481   -21.712 225.738 1.00 60.47  ? 115  ILE D CD1   1 
ATOM   8166  N  N     . LEU H 2 115 ? 3.872   -17.977 222.406 1.00 61.55  ? 116  LEU D N     1 
ATOM   8167  C  CA    . LEU H 2 115 ? 2.917   -16.913 222.173 1.00 63.49  ? 116  LEU D CA    1 
ATOM   8168  C  C     . LEU H 2 115 ? 1.536   -17.457 221.839 1.00 66.82  ? 116  LEU D C     1 
ATOM   8169  O  O     . LEU H 2 115 ? 1.164   -17.557 220.668 1.00 69.42  ? 116  LEU D O     1 
ATOM   8170  C  CB    . LEU H 2 115 ? 3.431   -16.032 221.040 1.00 55.24  ? 116  LEU D CB    1 
ATOM   8171  C  CG    . LEU H 2 115 ? 2.675   -14.743 220.787 1.00 53.13  ? 116  LEU D CG    1 
ATOM   8172  C  CD1   . LEU H 2 115 ? 2.385   -14.049 222.106 1.00 55.44  ? 116  LEU D CD1   1 
ATOM   8173  C  CD2   . LEU H 2 115 ? 3.512   -13.864 219.873 1.00 49.05  ? 116  LEU D CD2   1 
ATOM   8174  N  N     . LEU H 2 116 ? 0.777   -17.809 222.874 1.00 67.24  ? 117  LEU D N     1 
ATOM   8175  C  CA    . LEU H 2 116 ? -0.568  -18.347 222.685 1.00 69.63  ? 117  LEU D CA    1 
ATOM   8176  C  C     . LEU H 2 116 ? -1.556  -17.251 222.342 1.00 70.81  ? 117  LEU D C     1 
ATOM   8177  O  O     . LEU H 2 116 ? -1.993  -16.500 223.211 1.00 67.18  ? 117  LEU D O     1 
ATOM   8178  C  CB    . LEU H 2 116 ? -1.041  -19.066 223.942 1.00 67.33  ? 117  LEU D CB    1 
ATOM   8179  C  CG    . LEU H 2 116 ? -0.164  -20.237 224.359 1.00 73.67  ? 117  LEU D CG    1 
ATOM   8180  C  CD1   . LEU H 2 116 ? 0.676   -19.846 225.563 1.00 79.83  ? 117  LEU D CD1   1 
ATOM   8181  C  CD2   . LEU H 2 116 ? -1.041  -21.427 224.681 1.00 80.46  ? 117  LEU D CD2   1 
ATOM   8182  N  N     . VAL H 2 117 ? -1.916  -17.176 221.068 1.00 72.68  ? 118  VAL D N     1 
ATOM   8183  C  CA    . VAL H 2 117 ? -2.846  -16.164 220.600 1.00 73.84  ? 118  VAL D CA    1 
ATOM   8184  C  C     . VAL H 2 117 ? -4.075  -16.833 220.000 1.00 81.11  ? 118  VAL D C     1 
ATOM   8185  O  O     . VAL H 2 117 ? -3.974  -17.898 219.396 1.00 82.86  ? 118  VAL D O     1 
ATOM   8186  C  CB    . VAL H 2 117 ? -2.171  -15.274 219.546 1.00 67.95  ? 118  VAL D CB    1 
ATOM   8187  C  CG1   . VAL H 2 117 ? -1.601  -16.138 218.446 1.00 66.76  ? 118  VAL D CG1   1 
ATOM   8188  C  CG2   . VAL H 2 117 ? -3.156  -14.266 218.994 1.00 61.26  ? 118  VAL D CG2   1 
ATOM   8189  N  N     . LYS H 2 118 ? -5.238  -16.215 220.181 1.00 85.15  ? 119  LYS D N     1 
ATOM   8190  C  CA    . LYS H 2 118 ? -6.473  -16.772 219.645 1.00 90.59  ? 119  LYS D CA    1 
ATOM   8191  C  C     . LYS H 2 118 ? -7.435  -15.680 219.203 1.00 94.03  ? 119  LYS D C     1 
ATOM   8192  O  O     . LYS H 2 118 ? -8.316  -15.271 219.958 1.00 95.44  ? 119  LYS D O     1 
ATOM   8193  C  CB    . LYS H 2 118 ? -7.157  -17.665 220.682 1.00 92.07  ? 119  LYS D CB    1 
ATOM   8194  N  N     . ASP H 2 119 ? -7.254  -15.212 217.973 1.00 94.59  ? 120  ASP D N     1 
ATOM   8195  C  CA    . ASP H 2 119 ? -8.107  -14.178 217.415 1.00 92.22  ? 120  ASP D CA    1 
ATOM   8196  C  C     . ASP H 2 119 ? -8.125  -12.903 218.260 1.00 90.34  ? 120  ASP D C     1 
ATOM   8197  O  O     . ASP H 2 119 ? -8.828  -12.827 219.268 1.00 91.68  ? 120  ASP D O     1 
ATOM   8198  C  CB    . ASP H 2 119 ? -9.532  -14.719 217.258 1.00 91.80  ? 120  ASP D CB    1 
ATOM   8199  N  N     . GLN H 2 120 ? -7.341  -11.913 217.842 1.00 84.83  ? 121  GLN D N     1 
ATOM   8200  C  CA    . GLN H 2 120 ? -7.263  -10.623 218.524 1.00 85.10  ? 121  GLN D CA    1 
ATOM   8201  C  C     . GLN H 2 120 ? -6.537  -10.608 219.869 1.00 81.52  ? 121  GLN D C     1 
ATOM   8202  O  O     . GLN H 2 120 ? -5.662  -9.772  220.091 1.00 80.99  ? 121  GLN D O     1 
ATOM   8203  C  CB    . GLN H 2 120 ? -8.669  -10.038 218.711 1.00 89.47  ? 121  GLN D CB    1 
ATOM   8204  C  CG    . GLN H 2 120 ? -9.376  -9.686  217.408 1.00 99.21  ? 121  GLN D CG    1 
ATOM   8205  C  CD    . GLN H 2 120 ? -10.771 -9.109  217.617 1.00 100.94 ? 121  GLN D CD    1 
ATOM   8206  O  OE1   . GLN H 2 120 ? -11.432 -8.695  216.658 1.00 98.96  ? 121  GLN D OE1   1 
ATOM   8207  N  NE2   . GLN H 2 120 ? -11.226 -9.084  218.869 1.00 100.78 ? 121  GLN D NE2   1 
ATOM   8208  N  N     . PHE H 2 121 ? -6.896  -11.521 220.768 1.00 82.19  ? 122  PHE D N     1 
ATOM   8209  C  CA    . PHE H 2 121 ? -6.273  -11.562 222.091 1.00 78.99  ? 122  PHE D CA    1 
ATOM   8210  C  C     . PHE H 2 121 ? -4.968  -12.344 222.129 1.00 72.21  ? 122  PHE D C     1 
ATOM   8211  O  O     . PHE H 2 121 ? -4.847  -13.412 221.525 1.00 74.91  ? 122  PHE D O     1 
ATOM   8212  C  CB    . PHE H 2 121 ? -7.237  -12.156 223.118 1.00 84.19  ? 122  PHE D CB    1 
ATOM   8213  C  CG    . PHE H 2 121 ? -6.755  -12.033 224.540 1.00 90.97  ? 122  PHE D CG    1 
ATOM   8214  C  CD1   . PHE H 2 121 ? -6.649  -10.783 225.145 1.00 90.68  ? 122  PHE D CD1   1 
ATOM   8215  C  CD2   . PHE H 2 121 ? -6.420  -13.167 225.280 1.00 92.89  ? 122  PHE D CD2   1 
ATOM   8216  C  CE1   . PHE H 2 121 ? -6.219  -10.664 226.466 1.00 91.02  ? 122  PHE D CE1   1 
ATOM   8217  C  CE2   . PHE H 2 121 ? -5.988  -13.060 226.603 1.00 92.37  ? 122  PHE D CE2   1 
ATOM   8218  C  CZ    . PHE H 2 121 ? -5.889  -11.806 227.197 1.00 92.41  ? 122  PHE D CZ    1 
ATOM   8219  N  N     . TYR H 2 122 ? -3.997  -11.814 222.860 1.00 62.29  ? 123  TYR D N     1 
ATOM   8220  C  CA    . TYR H 2 122 ? -2.703  -12.469 222.969 1.00 64.62  ? 123  TYR D CA    1 
ATOM   8221  C  C     . TYR H 2 122 ? -2.304  -12.765 224.409 1.00 61.32  ? 123  TYR D C     1 
ATOM   8222  O  O     . TYR H 2 122 ? -2.570  -11.976 225.313 1.00 54.31  ? 123  TYR D O     1 
ATOM   8223  C  CB    . TYR H 2 122 ? -1.601  -11.609 222.339 1.00 64.08  ? 123  TYR D CB    1 
ATOM   8224  C  CG    . TYR H 2 122 ? -1.727  -11.389 220.856 1.00 64.71  ? 123  TYR D CG    1 
ATOM   8225  C  CD1   . TYR H 2 122 ? -2.753  -10.605 220.332 1.00 61.48  ? 123  TYR D CD1   1 
ATOM   8226  C  CD2   . TYR H 2 122 ? -0.814  -11.959 219.974 1.00 66.21  ? 123  TYR D CD2   1 
ATOM   8227  C  CE1   . TYR H 2 122 ? -2.866  -10.394 218.966 1.00 61.76  ? 123  TYR D CE1   1 
ATOM   8228  C  CE2   . TYR H 2 122 ? -0.916  -11.755 218.608 1.00 70.50  ? 123  TYR D CE2   1 
ATOM   8229  C  CZ    . TYR H 2 122 ? -1.944  -10.972 218.105 1.00 67.55  ? 123  TYR D CZ    1 
ATOM   8230  O  OH    . TYR H 2 122 ? -2.053  -10.773 216.743 1.00 70.85  ? 123  TYR D OH    1 
ATOM   8231  N  N     . GLU H 2 123 ? -1.650  -13.909 224.598 1.00 60.49  ? 124  GLU D N     1 
ATOM   8232  C  CA    . GLU H 2 123 ? -1.148  -14.336 225.901 1.00 63.51  ? 124  GLU D CA    1 
ATOM   8233  C  C     . GLU H 2 123 ? 0.345   -14.718 225.785 1.00 62.25  ? 124  GLU D C     1 
ATOM   8234  O  O     . GLU H 2 123 ? 0.687   -15.817 225.334 1.00 69.31  ? 124  GLU D O     1 
ATOM   8235  C  CB    . GLU H 2 123 ? -1.951  -15.536 226.420 1.00 61.26  ? 124  GLU D CB    1 
ATOM   8236  C  CG    . GLU H 2 123 ? -1.442  -16.089 227.753 1.00 66.59  ? 124  GLU D CG    1 
ATOM   8237  C  CD    . GLU H 2 123 ? -2.061  -17.430 228.127 1.00 71.75  ? 124  GLU D CD    1 
ATOM   8238  O  OE1   . GLU H 2 123 ? -2.169  -18.304 227.240 1.00 76.69  ? 124  GLU D OE1   1 
ATOM   8239  O  OE2   . GLU H 2 123 ? -2.421  -17.622 229.311 1.00 72.01  ? 124  GLU D OE2   1 
ATOM   8240  N  N     . LEU H 2 124 ? 1.227   -13.804 226.180 1.00 51.40  ? 125  LEU D N     1 
ATOM   8241  C  CA    . LEU H 2 124 ? 2.666   -14.047 226.134 1.00 45.90  ? 125  LEU D CA    1 
ATOM   8242  C  C     . LEU H 2 124 ? 3.083   -14.867 227.364 1.00 47.47  ? 125  LEU D C     1 
ATOM   8243  O  O     . LEU H 2 124 ? 3.247   -14.323 228.456 1.00 47.59  ? 125  LEU D O     1 
ATOM   8244  C  CB    . LEU H 2 124 ? 3.419   -12.706 226.100 1.00 33.11  ? 125  LEU D CB    1 
ATOM   8245  C  CG    . LEU H 2 124 ? 3.384   -11.884 224.802 1.00 26.86  ? 125  LEU D CG    1 
ATOM   8246  C  CD1   . LEU H 2 124 ? 1.961   -11.649 224.339 1.00 35.34  ? 125  LEU D CD1   1 
ATOM   8247  C  CD2   . LEU H 2 124 ? 4.070   -10.557 225.019 1.00 20.91  ? 125  LEU D CD2   1 
ATOM   8248  N  N     . LEU H 2 125 ? 3.246   -16.176 227.173 1.00 44.20  ? 126  LEU D N     1 
ATOM   8249  C  CA    . LEU H 2 125 ? 3.624   -17.094 228.248 1.00 43.47  ? 126  LEU D CA    1 
ATOM   8250  C  C     . LEU H 2 125 ? 5.121   -17.315 228.380 1.00 49.13  ? 126  LEU D C     1 
ATOM   8251  O  O     . LEU H 2 125 ? 5.778   -17.775 227.444 1.00 50.54  ? 126  LEU D O     1 
ATOM   8252  C  CB    . LEU H 2 125 ? 2.978   -18.465 228.035 1.00 46.30  ? 126  LEU D CB    1 
ATOM   8253  C  CG    . LEU H 2 125 ? 3.444   -19.542 229.024 1.00 44.89  ? 126  LEU D CG    1 
ATOM   8254  C  CD1   . LEU H 2 125 ? 2.899   -19.226 230.418 1.00 37.27  ? 126  LEU D CD1   1 
ATOM   8255  C  CD2   . LEU H 2 125 ? 2.985   -20.910 228.559 1.00 33.61  ? 126  LEU D CD2   1 
ATOM   8256  N  N     . ASP H 2 126 ? 5.656   -17.033 229.559 1.00 51.91  ? 127  ASP D N     1 
ATOM   8257  C  CA    . ASP H 2 126 ? 7.080   -17.218 229.783 1.00 50.07  ? 127  ASP D CA    1 
ATOM   8258  C  C     . ASP H 2 126 ? 7.320   -18.319 230.796 1.00 48.61  ? 127  ASP D C     1 
ATOM   8259  O  O     . ASP H 2 126 ? 6.958   -18.180 231.959 1.00 46.40  ? 127  ASP D O     1 
ATOM   8260  C  CB    . ASP H 2 126 ? 7.704   -15.913 230.269 1.00 45.56  ? 127  ASP D CB    1 
ATOM   8261  C  CG    . ASP H 2 126 ? 9.189   -16.038 230.542 1.00 42.13  ? 127  ASP D CG    1 
ATOM   8262  O  OD1   . ASP H 2 126 ? 9.815   -14.995 230.811 1.00 34.49  ? 127  ASP D OD1   1 
ATOM   8263  O  OD2   . ASP H 2 126 ? 9.730   -17.166 230.494 1.00 40.94  ? 127  ASP D OD2   1 
ATOM   8264  N  N     . VAL H 2 127 ? 7.939   -19.406 230.340 1.00 51.50  ? 128  VAL D N     1 
ATOM   8265  C  CA    . VAL H 2 127 ? 8.239   -20.552 231.189 1.00 57.65  ? 128  VAL D CA    1 
ATOM   8266  C  C     . VAL H 2 127 ? 9.549   -20.364 231.954 1.00 66.32  ? 128  VAL D C     1 
ATOM   8267  O  O     . VAL H 2 127 ? 10.562  -19.985 231.369 1.00 75.44  ? 128  VAL D O     1 
ATOM   8268  C  CB    . VAL H 2 127 ? 8.337   -21.837 230.353 1.00 53.70  ? 128  VAL D CB    1 
ATOM   8269  C  CG1   . VAL H 2 127 ? 8.526   -23.039 231.261 1.00 53.56  ? 128  VAL D CG1   1 
ATOM   8270  C  CG2   . VAL H 2 127 ? 7.085   -21.995 229.508 1.00 58.02  ? 128  VAL D CG2   1 
ATOM   8271  N  N     . LYS H 2 128 ? 9.515   -20.633 233.260 1.00 67.92  ? 129  LYS D N     1 
ATOM   8272  C  CA    . LYS H 2 128 ? 10.685  -20.506 234.134 1.00 64.06  ? 129  LYS D CA    1 
ATOM   8273  C  C     . LYS H 2 128 ? 10.937  -21.824 234.874 1.00 65.11  ? 129  LYS D C     1 
ATOM   8274  O  O     . LYS H 2 128 ? 9.996   -22.441 235.372 1.00 69.49  ? 129  LYS D O     1 
ATOM   8275  C  CB    . LYS H 2 128 ? 10.452  -19.407 235.175 1.00 63.37  ? 129  LYS D CB    1 
ATOM   8276  C  CG    . LYS H 2 128 ? 9.995   -18.069 234.626 1.00 62.22  ? 129  LYS D CG    1 
ATOM   8277  C  CD    . LYS H 2 128 ? 11.074  -17.373 233.826 1.00 63.63  ? 129  LYS D CD    1 
ATOM   8278  C  CE    . LYS H 2 128 ? 10.666  -15.942 233.543 1.00 68.27  ? 129  LYS D CE    1 
ATOM   8279  N  NZ    . LYS H 2 128 ? 11.678  -15.223 232.732 1.00 78.51  ? 129  LYS D NZ    1 
ATOM   8280  N  N     . THR H 2 129 ? 12.199  -22.250 234.952 1.00 65.11  ? 130  THR D N     1 
ATOM   8281  C  CA    . THR H 2 129 ? 12.545  -23.490 235.656 1.00 63.69  ? 130  THR D CA    1 
ATOM   8282  C  C     . THR H 2 129 ? 13.266  -23.173 236.968 1.00 66.66  ? 130  THR D C     1 
ATOM   8283  O  O     . THR H 2 129 ? 13.992  -22.188 237.072 1.00 67.12  ? 130  THR D O     1 
ATOM   8284  C  CB    . THR H 2 129 ? 13.451  -24.417 234.815 1.00 54.25  ? 130  THR D CB    1 
ATOM   8285  O  OG1   . THR H 2 129 ? 14.748  -23.829 234.670 1.00 50.36  ? 130  THR D OG1   1 
ATOM   8286  C  CG2   . THR H 2 129 ? 12.845  -24.653 233.445 1.00 56.13  ? 130  THR D CG2   1 
ATOM   8287  N  N     . ARG H 2 130 ? 13.068  -24.023 237.965 1.00 66.75  ? 131  ARG D N     1 
ATOM   8288  C  CA    . ARG H 2 130 ? 13.669  -23.811 239.265 1.00 67.53  ? 131  ARG D CA    1 
ATOM   8289  C  C     . ARG H 2 130 ? 14.301  -25.087 239.797 1.00 73.57  ? 131  ARG D C     1 
ATOM   8290  O  O     . ARG H 2 130 ? 13.926  -26.195 239.417 1.00 71.72  ? 131  ARG D O     1 
ATOM   8291  C  CB    . ARG H 2 130 ? 12.594  -23.316 240.236 1.00 67.04  ? 131  ARG D CB    1 
ATOM   8292  C  CG    . ARG H 2 130 ? 13.067  -23.076 241.654 1.00 75.35  ? 131  ARG D CG    1 
ATOM   8293  C  CD    . ARG H 2 130 ? 11.952  -22.507 242.515 1.00 73.93  ? 131  ARG D CD    1 
ATOM   8294  N  NE    . ARG H 2 130 ? 12.408  -22.226 243.868 1.00 80.08  ? 131  ARG D NE    1 
ATOM   8295  C  CZ    . ARG H 2 130 ? 11.674  -21.632 244.805 1.00 88.24  ? 131  ARG D CZ    1 
ATOM   8296  N  NH1   . ARG H 2 130 ? 10.430  -21.246 244.545 1.00 78.20  ? 131  ARG D NH1   1 
ATOM   8297  N  NH2   . ARG H 2 130 ? 12.191  -21.422 246.011 1.00 95.75  ? 131  ARG D NH2   1 
ATOM   8298  N  N     . ASN H 2 131 ? 15.268  -24.925 240.685 1.00 79.49  ? 132  ASN D N     1 
ATOM   8299  C  CA    . ASN H 2 131 ? 15.931  -26.069 241.275 1.00 86.17  ? 132  ASN D CA    1 
ATOM   8300  C  C     . ASN H 2 131 ? 15.587  -26.082 242.760 1.00 84.87  ? 132  ASN D C     1 
ATOM   8301  O  O     . ASN H 2 131 ? 16.330  -25.542 243.579 1.00 84.65  ? 132  ASN D O     1 
ATOM   8302  C  CB    . ASN H 2 131 ? 17.441  -25.948 241.080 1.00 96.97  ? 132  ASN D CB    1 
ATOM   8303  C  CG    . ASN H 2 131 ? 18.175  -27.215 241.448 1.00 100.55 ? 132  ASN D CG    1 
ATOM   8304  O  OD1   . ASN H 2 131 ? 19.404  -27.241 241.508 1.00 104.52 ? 132  ASN D OD1   1 
ATOM   8305  N  ND2   . ASN H 2 131 ? 17.422  -28.283 241.692 1.00 103.86 ? 132  ASN D ND2   1 
ATOM   8306  N  N     . ILE H 2 132 ? 14.454  -26.692 243.099 1.00 87.63  ? 133  ILE D N     1 
ATOM   8307  C  CA    . ILE H 2 132 ? 13.998  -26.767 244.486 1.00 87.55  ? 133  ILE D CA    1 
ATOM   8308  C  C     . ILE H 2 132 ? 15.028  -27.432 245.390 1.00 86.44  ? 133  ILE D C     1 
ATOM   8309  O  O     . ILE H 2 132 ? 14.973  -27.293 246.609 1.00 87.69  ? 133  ILE D O     1 
ATOM   8310  C  CB    . ILE H 2 132 ? 12.674  -27.554 244.609 1.00 86.80  ? 133  ILE D CB    1 
ATOM   8311  C  CG1   . ILE H 2 132 ? 12.863  -28.973 244.076 1.00 86.20  ? 133  ILE D CG1   1 
ATOM   8312  C  CG2   . ILE H 2 132 ? 11.571  -26.839 243.853 1.00 84.51  ? 133  ILE D CG2   1 
ATOM   8313  C  CD1   . ILE H 2 132 ? 11.752  -29.914 244.467 1.00 90.52  ? 133  ILE D CD1   1 
ATOM   8314  N  N     . SER H 2 133 ? 15.961  -28.157 244.782 1.00 85.68  ? 134  SER D N     1 
ATOM   8315  C  CA    . SER H 2 133 ? 17.013  -28.848 245.517 1.00 84.44  ? 134  SER D CA    1 
ATOM   8316  C  C     . SER H 2 133 ? 17.871  -27.861 246.299 1.00 84.16  ? 134  SER D C     1 
ATOM   8317  O  O     . SER H 2 133 ? 18.818  -28.255 246.976 1.00 84.17  ? 134  SER D O     1 
ATOM   8318  C  CB    . SER H 2 133 ? 17.902  -29.627 244.548 1.00 86.38  ? 134  SER D CB    1 
ATOM   8319  O  OG    . SER H 2 133 ? 17.132  -30.479 243.718 1.00 91.95  ? 134  SER D OG    1 
ATOM   8320  N  N     . LYS H 2 134 ? 17.543  -26.577 246.190 1.00 86.11  ? 135  LYS D N     1 
ATOM   8321  C  CA    . LYS H 2 134 ? 18.273  -25.516 246.886 1.00 85.81  ? 135  LYS D CA    1 
ATOM   8322  C  C     . LYS H 2 134 ? 17.474  -24.224 246.844 1.00 82.42  ? 135  LYS D C     1 
ATOM   8323  O  O     . LYS H 2 134 ? 16.782  -23.948 245.870 1.00 84.69  ? 135  LYS D O     1 
ATOM   8324  C  CB    . LYS H 2 134 ? 19.649  -25.298 246.245 1.00 81.38  ? 135  LYS D CB    1 
ATOM   8325  C  CG    . LYS H 2 134 ? 19.621  -25.080 244.736 1.00 74.60  ? 135  LYS D CG    1 
ATOM   8326  C  CD    . LYS H 2 134 ? 21.032  -25.027 244.150 1.00 72.64  ? 135  LYS D CD    1 
ATOM   8327  C  CE    . LYS H 2 134 ? 21.004  -24.969 242.628 1.00 70.71  ? 135  LYS D CE    1 
ATOM   8328  N  NZ    . LYS H 2 134 ? 22.362  -24.874 242.020 1.00 73.09  ? 135  LYS D NZ    1 
ATOM   8329  N  N     . SER H 2 135 ? 17.561  -23.439 247.909 1.00 84.44  ? 136  SER D N     1 
ATOM   8330  C  CA    . SER H 2 135 ? 16.839  -22.177 247.969 1.00 87.64  ? 136  SER D CA    1 
ATOM   8331  C  C     . SER H 2 135 ? 17.436  -21.213 246.949 1.00 86.17  ? 136  SER D C     1 
ATOM   8332  O  O     . SER H 2 135 ? 18.325  -20.424 247.266 1.00 87.05  ? 136  SER D O     1 
ATOM   8333  C  CB    . SER H 2 135 ? 16.939  -21.590 249.378 1.00 90.19  ? 136  SER D CB    1 
ATOM   8334  O  OG    . SER H 2 135 ? 16.569  -22.560 250.348 1.00 91.43  ? 136  SER D OG    1 
ATOM   8335  N  N     . ALA H 2 136 ? 16.943  -21.293 245.718 1.00 85.21  ? 137  ALA D N     1 
ATOM   8336  C  CA    . ALA H 2 136 ? 17.430  -20.449 244.635 1.00 82.18  ? 137  ALA D CA    1 
ATOM   8337  C  C     . ALA H 2 136 ? 16.760  -19.082 244.622 1.00 80.00  ? 137  ALA D C     1 
ATOM   8338  O  O     . ALA H 2 136 ? 15.536  -18.982 244.722 1.00 89.63  ? 137  ALA D O     1 
ATOM   8339  C  CB    . ALA H 2 136 ? 17.204  -21.149 243.296 1.00 83.42  ? 137  ALA D CB    1 
ATOM   8340  N  N     . GLN H 2 137 ? 17.569  -18.033 244.494 1.00 73.16  ? 138  GLN D N     1 
ATOM   8341  C  CA    . GLN H 2 137 ? 17.068  -16.657 244.446 1.00 64.66  ? 138  GLN D CA    1 
ATOM   8342  C  C     . GLN H 2 137 ? 16.014  -16.511 243.349 1.00 59.09  ? 138  GLN D C     1 
ATOM   8343  O  O     . GLN H 2 137 ? 15.940  -17.330 242.440 1.00 57.84  ? 138  GLN D O     1 
ATOM   8344  C  CB    . GLN H 2 137 ? 18.232  -15.691 244.183 1.00 57.86  ? 138  GLN D CB    1 
ATOM   8345  C  CG    . GLN H 2 137 ? 17.828  -14.247 243.914 1.00 54.25  ? 138  GLN D CG    1 
ATOM   8346  C  CD    . GLN H 2 137 ? 19.030  -13.308 243.757 1.00 59.75  ? 138  GLN D CD    1 
ATOM   8347  O  OE1   . GLN H 2 137 ? 18.865  -12.105 243.556 1.00 54.41  ? 138  GLN D OE1   1 
ATOM   8348  N  NE2   . GLN H 2 137 ? 20.239  -13.858 243.851 1.00 56.41  ? 138  GLN D NE2   1 
ATOM   8349  N  N     . ALA H 2 138 ? 15.186  -15.477 243.447 1.00 57.59  ? 139  ALA D N     1 
ATOM   8350  C  CA    . ALA H 2 138 ? 14.155  -15.240 242.442 1.00 56.25  ? 139  ALA D CA    1 
ATOM   8351  C  C     . ALA H 2 138 ? 14.825  -15.058 241.076 1.00 58.24  ? 139  ALA D C     1 
ATOM   8352  O  O     . ALA H 2 138 ? 15.762  -14.273 240.939 1.00 59.67  ? 139  ALA D O     1 
ATOM   8353  C  CB    . ALA H 2 138 ? 13.347  -13.997 242.808 1.00 42.97  ? 139  ALA D CB    1 
ATOM   8354  N  N     . PRO H 2 139 ? 14.360  -15.797 240.054 1.00 58.85  ? 140  PRO D N     1 
ATOM   8355  C  CA    . PRO H 2 139 ? 14.888  -15.744 238.687 1.00 55.08  ? 140  PRO D CA    1 
ATOM   8356  C  C     . PRO H 2 139 ? 14.418  -14.496 237.954 1.00 53.39  ? 140  PRO D C     1 
ATOM   8357  O  O     . PRO H 2 139 ? 13.521  -13.800 238.424 1.00 45.91  ? 140  PRO D O     1 
ATOM   8358  C  CB    . PRO H 2 139 ? 14.318  -17.003 238.062 1.00 58.48  ? 140  PRO D CB    1 
ATOM   8359  C  CG    . PRO H 2 139 ? 12.963  -17.056 238.682 1.00 63.07  ? 140  PRO D CG    1 
ATOM   8360  C  CD    . PRO H 2 139 ? 13.281  -16.796 240.144 1.00 64.37  ? 140  PRO D CD    1 
ATOM   8361  N  N     . ASN H 2 140 ? 15.021  -14.216 236.804 1.00 51.89  ? 141  ASN D N     1 
ATOM   8362  C  CA    . ASN H 2 140 ? 14.629  -13.050 236.029 1.00 51.81  ? 141  ASN D CA    1 
ATOM   8363  C  C     . ASN H 2 140 ? 13.262  -13.255 235.398 1.00 50.14  ? 141  ASN D C     1 
ATOM   8364  O  O     . ASN H 2 140 ? 12.940  -14.344 234.919 1.00 46.75  ? 141  ASN D O     1 
ATOM   8365  C  CB    . ASN H 2 140 ? 15.646  -12.747 234.927 1.00 54.79  ? 141  ASN D CB    1 
ATOM   8366  C  CG    . ASN H 2 140 ? 16.975  -12.290 235.477 1.00 54.62  ? 141  ASN D CG    1 
ATOM   8367  O  OD1   . ASN H 2 140 ? 17.030  -11.544 236.455 1.00 55.00  ? 141  ASN D OD1   1 
ATOM   8368  N  ND2   . ASN H 2 140 ? 18.055  -12.723 234.845 1.00 48.68  ? 141  ASN D ND2   1 
ATOM   8369  N  N     . ILE H 2 141 ? 12.459  -12.199 235.403 1.00 47.59  ? 142  ILE D N     1 
ATOM   8370  C  CA    . ILE H 2 141 ? 11.130  -12.260 234.820 1.00 50.36  ? 142  ILE D CA    1 
ATOM   8371  C  C     . ILE H 2 141 ? 11.149  -11.535 233.483 1.00 44.41  ? 142  ILE D C     1 
ATOM   8372  O  O     . ILE H 2 141 ? 11.121  -12.172 232.437 1.00 40.23  ? 142  ILE D O     1 
ATOM   8373  C  CB    . ILE H 2 141 ? 10.111  -11.613 235.739 1.00 51.79  ? 142  ILE D CB    1 
ATOM   8374  C  CG1   . ILE H 2 141 ? 10.288  -12.141 237.163 1.00 49.61  ? 142  ILE D CG1   1 
ATOM   8375  C  CG2   . ILE H 2 141 ? 8.724   -11.933 235.242 1.00 55.53  ? 142  ILE D CG2   1 
ATOM   8376  C  CD1   . ILE H 2 141 ? 10.197  -13.657 237.262 1.00 42.18  ? 142  ILE D CD1   1 
ATOM   8377  N  N     . ILE H 2 142 ? 11.181  -10.204 233.530 1.00 43.86  ? 143  ILE D N     1 
ATOM   8378  C  CA    . ILE H 2 142 ? 11.274  -9.372  232.324 1.00 52.21  ? 143  ILE D CA    1 
ATOM   8379  C  C     . ILE H 2 142 ? 11.938  -8.037  232.667 1.00 52.10  ? 143  ILE D C     1 
ATOM   8380  O  O     . ILE H 2 142 ? 12.041  -7.657  233.838 1.00 41.22  ? 143  ILE D O     1 
ATOM   8381  C  CB    . ILE H 2 142 ? 9.894   -9.060  231.638 1.00 52.77  ? 143  ILE D CB    1 
ATOM   8382  C  CG1   . ILE H 2 142 ? 8.995   -8.247  232.568 1.00 60.82  ? 143  ILE D CG1   1 
ATOM   8383  C  CG2   . ILE H 2 142 ? 9.227   -10.340 231.191 1.00 62.57  ? 143  ILE D CG2   1 
ATOM   8384  C  CD1   . ILE H 2 142 ? 8.541   -8.992  233.796 1.00 57.98  ? 143  ILE D CD1   1 
ATOM   8385  N  N     . SER H 2 143 ? 12.396  -7.336  231.632 1.00 54.23  ? 144  SER D N     1 
ATOM   8386  C  CA    . SER H 2 143 ? 13.050  -6.046  231.804 1.00 51.14  ? 144  SER D CA    1 
ATOM   8387  C  C     . SER H 2 143 ? 12.080  -5.020  232.357 1.00 49.42  ? 144  SER D C     1 
ATOM   8388  O  O     . SER H 2 143 ? 11.136  -4.624  231.677 1.00 50.95  ? 144  SER D O     1 
ATOM   8389  C  CB    . SER H 2 143 ? 13.593  -5.534  230.467 1.00 51.07  ? 144  SER D CB    1 
ATOM   8390  O  OG    . SER H 2 143 ? 13.923  -4.157  230.556 1.00 45.88  ? 144  SER D OG    1 
ATOM   8391  N  N     . ALA H 2 144 ? 12.315  -4.593  233.592 1.00 42.93  ? 145  ALA D N     1 
ATOM   8392  C  CA    . ALA H 2 144 ? 11.463  -3.599  234.205 1.00 39.36  ? 145  ALA D CA    1 
ATOM   8393  C  C     . ALA H 2 144 ? 11.354  -2.445  233.229 1.00 37.13  ? 145  ALA D C     1 
ATOM   8394  O  O     . ALA H 2 144 ? 10.316  -1.791  233.135 1.00 37.14  ? 145  ALA D O     1 
ATOM   8395  C  CB    . ALA H 2 144 ? 12.057  -3.129  235.514 1.00 39.27  ? 145  ALA D CB    1 
ATOM   8396  N  N     . TYR H 2 145 ? 12.425  -2.211  232.481 1.00 44.68  ? 146  TYR D N     1 
ATOM   8397  C  CA    . TYR H 2 145 ? 12.437  -1.131  231.497 1.00 45.90  ? 146  TYR D CA    1 
ATOM   8398  C  C     . TYR H 2 145 ? 11.522  -1.485  230.341 1.00 39.15  ? 146  TYR D C     1 
ATOM   8399  O  O     . TYR H 2 145 ? 10.806  -0.630  229.834 1.00 37.90  ? 146  TYR D O     1 
ATOM   8400  C  CB    . TYR H 2 145 ? 13.853  -0.902  230.978 1.00 48.82  ? 146  TYR D CB    1 
ATOM   8401  C  CG    . TYR H 2 145 ? 13.978  0.270   230.036 1.00 47.13  ? 146  TYR D CG    1 
ATOM   8402  C  CD1   . TYR H 2 145 ? 13.324  1.471   230.291 1.00 40.95  ? 146  TYR D CD1   1 
ATOM   8403  C  CD2   . TYR H 2 145 ? 14.820  0.207   228.931 1.00 47.96  ? 146  TYR D CD2   1 
ATOM   8404  C  CE1   . TYR H 2 145 ? 13.519  2.580   229.475 1.00 49.70  ? 146  TYR D CE1   1 
ATOM   8405  C  CE2   . TYR H 2 145 ? 15.019  1.311   228.112 1.00 47.40  ? 146  TYR D CE2   1 
ATOM   8406  C  CZ    . TYR H 2 145 ? 14.373  2.493   228.391 1.00 44.54  ? 146  TYR D CZ    1 
ATOM   8407  O  OH    . TYR H 2 145 ? 14.623  3.599   227.617 1.00 48.64  ? 146  TYR D OH    1 
ATOM   8408  N  N     . LYS H 2 146 ? 11.554  -2.747  229.922 1.00 34.56  ? 147  LYS D N     1 
ATOM   8409  C  CA    . LYS H 2 146 ? 10.696  -3.186  228.833 1.00 40.29  ? 147  LYS D CA    1 
ATOM   8410  C  C     . LYS H 2 146 ? 9.245   -3.032  229.278 1.00 44.20  ? 147  LYS D C     1 
ATOM   8411  O  O     . LYS H 2 146 ? 8.401   -2.557  228.524 1.00 47.89  ? 147  LYS D O     1 
ATOM   8412  C  CB    . LYS H 2 146 ? 10.976  -4.644  228.463 1.00 30.58  ? 147  LYS D CB    1 
ATOM   8413  C  CG    . LYS H 2 146 ? 9.933   -5.235  227.527 1.00 24.36  ? 147  LYS D CG    1 
ATOM   8414  C  CD    . LYS H 2 146 ? 10.262  -6.659  227.066 1.00 31.35  ? 147  LYS D CD    1 
ATOM   8415  C  CE    . LYS H 2 146 ? 11.452  -6.667  226.099 1.00 47.50  ? 147  LYS D CE    1 
ATOM   8416  N  NZ    . LYS H 2 146 ? 11.655  -7.957  225.378 1.00 34.85  ? 147  LYS D NZ    1 
ATOM   8417  N  N     . LEU H 2 147 ? 8.962   -3.429  230.512 1.00 49.04  ? 148  LEU D N     1 
ATOM   8418  C  CA    . LEU H 2 147 ? 7.611   -3.322  231.043 1.00 52.27  ? 148  LEU D CA    1 
ATOM   8419  C  C     . LEU H 2 147 ? 7.251   -1.837  231.159 1.00 53.53  ? 148  LEU D C     1 
ATOM   8420  O  O     . LEU H 2 147 ? 6.150   -1.417  230.789 1.00 45.91  ? 148  LEU D O     1 
ATOM   8421  C  CB    . LEU H 2 147 ? 7.539   -4.007  232.411 1.00 48.76  ? 148  LEU D CB    1 
ATOM   8422  C  CG    . LEU H 2 147 ? 6.196   -4.596  232.857 1.00 48.40  ? 148  LEU D CG    1 
ATOM   8423  C  CD1   . LEU H 2 147 ? 6.425   -5.556  234.003 1.00 31.40  ? 148  LEU D CD1   1 
ATOM   8424  C  CD2   . LEU H 2 147 ? 5.240   -3.487  233.252 1.00 51.23  ? 148  LEU D CD2   1 
ATOM   8425  N  N     . ALA H 2 148 ? 8.190   -1.039  231.658 1.00 48.32  ? 149  ALA D N     1 
ATOM   8426  C  CA    . ALA H 2 148 ? 7.951   0.392   231.794 1.00 50.54  ? 149  ALA D CA    1 
ATOM   8427  C  C     . ALA H 2 148 ? 7.513   0.975   230.459 1.00 53.65  ? 149  ALA D C     1 
ATOM   8428  O  O     . ALA H 2 148 ? 6.531   1.705   230.389 1.00 54.30  ? 149  ALA D O     1 
ATOM   8429  C  CB    . ALA H 2 148 ? 9.200   1.092   232.271 1.00 42.69  ? 149  ALA D CB    1 
ATOM   8430  N  N     . GLN H 2 149 ? 8.240   0.649   229.395 1.00 52.74  ? 150  GLN D N     1 
ATOM   8431  C  CA    . GLN H 2 149 ? 7.884   1.166   228.086 1.00 54.09  ? 150  GLN D CA    1 
ATOM   8432  C  C     . GLN H 2 149 ? 6.545   0.581   227.645 1.00 52.77  ? 150  GLN D C     1 
ATOM   8433  O  O     . GLN H 2 149 ? 5.724   1.292   227.074 1.00 55.49  ? 150  GLN D O     1 
ATOM   8434  C  CB    . GLN H 2 149 ? 8.964   0.835   227.048 1.00 54.03  ? 150  GLN D CB    1 
ATOM   8435  C  CG    . GLN H 2 149 ? 10.363  1.367   227.374 1.00 58.83  ? 150  GLN D CG    1 
ATOM   8436  C  CD    . GLN H 2 149 ? 11.317  1.289   226.186 1.00 60.98  ? 150  GLN D CD    1 
ATOM   8437  O  OE1   . GLN H 2 149 ? 11.150  2.003   225.190 1.00 55.57  ? 150  GLN D OE1   1 
ATOM   8438  N  NE2   . GLN H 2 149 ? 12.318  0.418   226.283 1.00 52.21  ? 150  GLN D NE2   1 
ATOM   8439  N  N     . THR H 2 150 ? 6.324   -0.704  227.919 1.00 44.88  ? 151  THR D N     1 
ATOM   8440  C  CA    . THR H 2 150 ? 5.077   -1.364  227.533 1.00 44.44  ? 151  THR D CA    1 
ATOM   8441  C  C     . THR H 2 150 ? 3.880   -0.598  228.068 1.00 48.77  ? 151  THR D C     1 
ATOM   8442  O  O     . THR H 2 150 ? 2.973   -0.228  227.317 1.00 52.96  ? 151  THR D O     1 
ATOM   8443  C  CB    . THR H 2 150 ? 4.995   -2.808  228.068 1.00 38.39  ? 151  THR D CB    1 
ATOM   8444  O  OG1   . THR H 2 150 ? 6.061   -3.582  227.512 1.00 43.31  ? 151  THR D OG1   1 
ATOM   8445  C  CG2   . THR H 2 150 ? 3.653   -3.450  227.691 1.00 19.71  ? 151  THR D CG2   1 
ATOM   8446  N  N     . CYS H 2 151 ? 3.881   -0.364  229.375 1.00 48.22  ? 152  CYS D N     1 
ATOM   8447  C  CA    . CYS H 2 151 ? 2.800   0.370   230.012 1.00 45.82  ? 152  CYS D CA    1 
ATOM   8448  C  C     . CYS H 2 151 ? 2.616   1.709   229.308 1.00 44.66  ? 152  CYS D C     1 
ATOM   8449  O  O     . CYS H 2 151 ? 1.494   2.097   228.979 1.00 53.60  ? 152  CYS D O     1 
ATOM   8450  C  CB    . CYS H 2 151 ? 3.109   0.590   231.499 1.00 40.55  ? 152  CYS D CB    1 
ATOM   8451  S  SG    . CYS H 2 151 ? 3.081   -0.924  232.481 1.00 49.75  ? 152  CYS D SG    1 
ATOM   8452  N  N     . ALA H 2 152 ? 3.722   2.405   229.065 1.00 44.58  ? 153  ALA D N     1 
ATOM   8453  C  CA    . ALA H 2 152 ? 3.676   3.697   228.387 1.00 50.65  ? 153  ALA D CA    1 
ATOM   8454  C  C     . ALA H 2 152 ? 2.951   3.549   227.046 1.00 54.49  ? 153  ALA D C     1 
ATOM   8455  O  O     . ALA H 2 152 ? 2.049   4.329   226.729 1.00 46.93  ? 153  ALA D O     1 
ATOM   8456  C  CB    . ALA H 2 152 ? 5.090   4.225   228.173 1.00 48.90  ? 153  ALA D CB    1 
ATOM   8457  N  N     . LYS H 2 153 ? 3.350   2.541   226.272 1.00 54.67  ? 154  LYS D N     1 
ATOM   8458  C  CA    . LYS H 2 153 ? 2.734   2.263   224.982 1.00 53.52  ? 154  LYS D CA    1 
ATOM   8459  C  C     . LYS H 2 153 ? 1.247   1.997   225.207 1.00 48.68  ? 154  LYS D C     1 
ATOM   8460  O  O     . LYS H 2 153 ? 0.411   2.390   224.396 1.00 48.11  ? 154  LYS D O     1 
ATOM   8461  C  CB    . LYS H 2 153 ? 3.360   1.021   224.329 1.00 57.68  ? 154  LYS D CB    1 
ATOM   8462  C  CG    . LYS H 2 153 ? 4.853   1.091   224.064 1.00 53.05  ? 154  LYS D CG    1 
ATOM   8463  C  CD    . LYS H 2 153 ? 5.206   2.109   223.009 1.00 48.77  ? 154  LYS D CD    1 
ATOM   8464  C  CE    . LYS H 2 153 ? 6.713   2.093   222.752 1.00 52.09  ? 154  LYS D CE    1 
ATOM   8465  N  NZ    . LYS H 2 153 ? 7.139   3.073   221.709 1.00 50.98  ? 154  LYS D NZ    1 
ATOM   8466  N  N     . MET H 2 154 ? 0.924   1.323   226.306 1.00 34.90  ? 155  MET D N     1 
ATOM   8467  C  CA    . MET H 2 154 ? -0.466  1.018   226.612 1.00 47.29  ? 155  MET D CA    1 
ATOM   8468  C  C     . MET H 2 154 ? -1.316  2.265   226.784 1.00 49.42  ? 155  MET D C     1 
ATOM   8469  O  O     . MET H 2 154 ? -2.452  2.318   226.318 1.00 53.60  ? 155  MET D O     1 
ATOM   8470  C  CB    . MET H 2 154 ? -0.574  0.151   227.871 1.00 48.49  ? 155  MET D CB    1 
ATOM   8471  C  CG    . MET H 2 154 ? -0.329  -1.332  227.613 1.00 57.82  ? 155  MET D CG    1 
ATOM   8472  S  SD    . MET H 2 154 ? -0.790  -2.408  228.996 1.00 74.08  ? 155  MET D SD    1 
ATOM   8473  C  CE    . MET H 2 154 ? 0.845   -2.882  229.639 1.00 75.24  ? 155  MET D CE    1 
ATOM   8474  N  N     . ILE H 2 155 ? -0.766  3.271   227.449 1.00 52.18  ? 156  ILE D N     1 
ATOM   8475  C  CA    . ILE H 2 155 ? -1.497  4.508   227.678 1.00 51.89  ? 156  ILE D CA    1 
ATOM   8476  C  C     . ILE H 2 155 ? -1.582  5.360   226.425 1.00 54.26  ? 156  ILE D C     1 
ATOM   8477  O  O     . ILE H 2 155 ? -2.674  5.656   225.947 1.00 62.28  ? 156  ILE D O     1 
ATOM   8478  C  CB    . ILE H 2 155 ? -0.840  5.328   228.784 1.00 51.68  ? 156  ILE D CB    1 
ATOM   8479  C  CG1   . ILE H 2 155 ? -0.773  4.492   230.056 1.00 52.67  ? 156  ILE D CG1   1 
ATOM   8480  C  CG2   . ILE H 2 155 ? -1.621  6.609   229.021 1.00 52.44  ? 156  ILE D CG2   1 
ATOM   8481  C  CD1   . ILE H 2 155 ? 0.053   5.117   231.146 1.00 72.50  ? 156  ILE D CD1   1 
ATOM   8482  N  N     . ASP H 2 156 ? -0.433  5.761   225.896 1.00 56.37  ? 157  ASP D N     1 
ATOM   8483  C  CA    . ASP H 2 156 ? -0.407  6.587   224.695 1.00 62.49  ? 157  ASP D CA    1 
ATOM   8484  C  C     . ASP H 2 156 ? -1.362  6.086   223.610 1.00 63.42  ? 157  ASP D C     1 
ATOM   8485  O  O     . ASP H 2 156 ? -2.095  6.875   223.015 1.00 64.81  ? 157  ASP D O     1 
ATOM   8486  C  CB    . ASP H 2 156 ? 1.014   6.663   224.140 1.00 70.39  ? 157  ASP D CB    1 
ATOM   8487  C  CG    . ASP H 2 156 ? 1.960   7.396   225.069 1.00 82.43  ? 157  ASP D CG    1 
ATOM   8488  O  OD1   . ASP H 2 156 ? 2.163   6.929   226.211 1.00 85.48  ? 157  ASP D OD1   1 
ATOM   8489  O  OD2   . ASP H 2 156 ? 2.500   8.444   224.655 1.00 90.94  ? 157  ASP D OD2   1 
ATOM   8490  N  N     . ASN H 2 157 ? -1.359  4.779   223.360 1.00 65.95  ? 158  ASN D N     1 
ATOM   8491  C  CA    . ASN H 2 157 ? -2.229  4.184   222.344 1.00 63.04  ? 158  ASN D CA    1 
ATOM   8492  C  C     . ASN H 2 157 ? -3.523  3.665   222.928 1.00 61.29  ? 158  ASN D C     1 
ATOM   8493  O  O     . ASN H 2 157 ? -4.328  3.055   222.225 1.00 63.07  ? 158  ASN D O     1 
ATOM   8494  C  CB    . ASN H 2 157 ? -1.524  3.033   221.629 1.00 64.08  ? 158  ASN D CB    1 
ATOM   8495  C  CG    . ASN H 2 157 ? -0.495  3.511   220.643 1.00 64.89  ? 158  ASN D CG    1 
ATOM   8496  O  OD1   . ASN H 2 157 ? -0.834  4.113   219.626 1.00 68.33  ? 158  ASN D OD1   1 
ATOM   8497  N  ND2   . ASN H 2 157 ? 0.777   3.252   220.936 1.00 69.62  ? 158  ASN D ND2   1 
ATOM   8498  N  N     . LYS H 2 158 ? -3.715  3.892   224.221 1.00 63.46  ? 159  LYS D N     1 
ATOM   8499  C  CA    . LYS H 2 158 ? -4.928  3.448   224.887 1.00 65.04  ? 159  LYS D CA    1 
ATOM   8500  C  C     . LYS H 2 158 ? -5.227  1.995   224.522 1.00 63.83  ? 159  LYS D C     1 
ATOM   8501  O  O     . LYS H 2 158 ? -6.306  1.675   224.023 1.00 64.59  ? 159  LYS D O     1 
ATOM   8502  C  CB    . LYS H 2 158 ? -6.094  4.351   224.472 1.00 61.77  ? 159  LYS D CB    1 
ATOM   8503  N  N     . GLU H 2 159 ? -4.262  1.119   224.775 1.00 65.16  ? 160  GLU D N     1 
ATOM   8504  C  CA    . GLU H 2 159 ? -4.408  -0.294  224.465 1.00 67.01  ? 160  GLU D CA    1 
ATOM   8505  C  C     . GLU H 2 159 ? -4.486  -1.157  225.722 1.00 72.76  ? 160  GLU D C     1 
ATOM   8506  O  O     . GLU H 2 159 ? -3.533  -1.223  226.495 1.00 77.16  ? 160  GLU D O     1 
ATOM   8507  C  CB    . GLU H 2 159 ? -3.233  -0.748  223.596 1.00 58.13  ? 160  GLU D CB    1 
ATOM   8508  C  CG    . GLU H 2 159 ? -3.074  0.065   222.325 1.00 56.69  ? 160  GLU D CG    1 
ATOM   8509  C  CD    . GLU H 2 159 ? -2.125  -0.582  221.334 1.00 65.98  ? 160  GLU D CD    1 
ATOM   8510  O  OE1   . GLU H 2 159 ? -1.053  0.007   221.052 1.00 58.04  ? 160  GLU D OE1   1 
ATOM   8511  O  OE2   . GLU H 2 159 ? -2.456  -1.683  220.835 1.00 62.32  ? 160  GLU D OE2   1 
ATOM   8512  N  N     . PHE H 2 160 ? -5.625  -1.812  225.929 1.00 78.86  ? 161  PHE D N     1 
ATOM   8513  C  CA    . PHE H 2 160 ? -5.809  -2.684  227.091 1.00 79.26  ? 161  PHE D CA    1 
ATOM   8514  C  C     . PHE H 2 160 ? -6.505  -3.964  226.631 1.00 81.60  ? 161  PHE D C     1 
ATOM   8515  O  O     . PHE H 2 160 ? -6.847  -4.097  225.453 1.00 82.70  ? 161  PHE D O     1 
ATOM   8516  C  CB    . PHE H 2 160 ? -6.649  -1.982  228.162 1.00 71.65  ? 161  PHE D CB    1 
ATOM   8517  C  CG    . PHE H 2 160 ? -6.155  -0.606  228.514 1.00 69.44  ? 161  PHE D CG    1 
ATOM   8518  C  CD1   . PHE H 2 160 ? -4.962  -0.430  229.207 1.00 71.36  ? 161  PHE D CD1   1 
ATOM   8519  C  CD2   . PHE H 2 160 ? -6.879  0.523   228.129 1.00 69.65  ? 161  PHE D CD2   1 
ATOM   8520  C  CE1   . PHE H 2 160 ? -4.494  0.853   229.510 1.00 67.48  ? 161  PHE D CE1   1 
ATOM   8521  C  CE2   . PHE H 2 160 ? -6.424  1.807   228.426 1.00 60.37  ? 161  PHE D CE2   1 
ATOM   8522  C  CZ    . PHE H 2 160 ? -5.230  1.973   229.117 1.00 70.42  ? 161  PHE D CZ    1 
ATOM   8523  N  N     . ASP H 2 161 ? -6.716  -4.898  227.555 1.00 84.15  ? 162  ASP D N     1 
ATOM   8524  C  CA    . ASP H 2 161 ? -7.356  -6.179  227.237 1.00 89.41  ? 162  ASP D CA    1 
ATOM   8525  C  C     . ASP H 2 161 ? -6.932  -6.704  225.862 1.00 83.02  ? 162  ASP D C     1 
ATOM   8526  O  O     . ASP H 2 161 ? -7.691  -7.388  225.170 1.00 77.29  ? 162  ASP D O     1 
ATOM   8527  C  CB    . ASP H 2 161 ? -8.886  -6.057  227.298 1.00 98.50  ? 162  ASP D CB    1 
ATOM   8528  C  CG    . ASP H 2 161 ? -9.422  -4.951  226.411 1.00 106.38 ? 162  ASP D CG    1 
ATOM   8529  O  OD1   . ASP H 2 161 ? -9.327  -3.768  226.800 1.00 112.79 ? 162  ASP D OD1   1 
ATOM   8530  O  OD2   . ASP H 2 161 ? -9.933  -5.264  225.317 1.00 115.86 ? 162  ASP D OD2   1 
ATOM   8531  N  N     . LEU H 2 162 ? -5.702  -6.375  225.481 1.00 77.22  ? 163  LEU D N     1 
ATOM   8532  C  CA    . LEU H 2 162 ? -5.142  -6.791  224.204 1.00 63.84  ? 163  LEU D CA    1 
ATOM   8533  C  C     . LEU H 2 162 ? -4.208  -7.981  224.392 1.00 56.03  ? 163  LEU D C     1 
ATOM   8534  O  O     . LEU H 2 162 ? -4.234  -8.926  223.608 1.00 49.13  ? 163  LEU D O     1 
ATOM   8535  C  CB    . LEU H 2 162 ? -4.386  -5.617  223.576 1.00 64.36  ? 163  LEU D CB    1 
ATOM   8536  C  CG    . LEU H 2 162 ? -3.769  -5.810  222.186 1.00 67.99  ? 163  LEU D CG    1 
ATOM   8537  C  CD1   . LEU H 2 162 ? -3.501  -4.445  221.547 1.00 69.25  ? 163  LEU D CD1   1 
ATOM   8538  C  CD2   . LEU H 2 162 ? -2.491  -6.616  222.286 1.00 75.22  ? 163  LEU D CD2   1 
ATOM   8539  N  N     . PHE H 2 163 ? -3.394  -7.936  225.446 1.00 48.54  ? 164  PHE D N     1 
ATOM   8540  C  CA    . PHE H 2 163 ? -2.442  -9.011  225.719 1.00 43.28  ? 164  PHE D CA    1 
ATOM   8541  C  C     . PHE H 2 163 ? -2.180  -9.195  227.217 1.00 45.75  ? 164  PHE D C     1 
ATOM   8542  O  O     . PHE H 2 163 ? -2.463  -8.316  228.037 1.00 38.50  ? 164  PHE D O     1 
ATOM   8543  C  CB    . PHE H 2 163 ? -1.115  -8.698  225.035 1.00 30.43  ? 164  PHE D CB    1 
ATOM   8544  C  CG    . PHE H 2 163 ? -0.352  -7.594  225.711 1.00 34.67  ? 164  PHE D CG    1 
ATOM   8545  C  CD1   . PHE H 2 163 ? 0.604   -7.882  226.691 1.00 24.32  ? 164  PHE D CD1   1 
ATOM   8546  C  CD2   . PHE H 2 163 ? -0.642  -6.264  225.429 1.00 24.16  ? 164  PHE D CD2   1 
ATOM   8547  C  CE1   . PHE H 2 163 ? 1.251   -6.865  227.375 1.00 18.77  ? 164  PHE D CE1   1 
ATOM   8548  C  CE2   . PHE H 2 163 ? 0.005   -5.239  226.112 1.00 39.73  ? 164  PHE D CE2   1 
ATOM   8549  C  CZ    . PHE H 2 163 ? 0.954   -5.540  227.090 1.00 29.63  ? 164  PHE D CZ    1 
ATOM   8550  N  N     . ASP H 2 164 ? -1.606  -10.345 227.549 1.00 50.87  ? 165  ASP D N     1 
ATOM   8551  C  CA    . ASP H 2 164 ? -1.255  -10.678 228.918 1.00 51.97  ? 165  ASP D CA    1 
ATOM   8552  C  C     . ASP H 2 164 ? 0.116   -11.357 228.958 1.00 57.04  ? 165  ASP D C     1 
ATOM   8553  O  O     . ASP H 2 164 ? 0.559   -11.967 227.977 1.00 58.74  ? 165  ASP D O     1 
ATOM   8554  C  CB    . ASP H 2 164 ? -2.303  -11.603 229.540 1.00 57.10  ? 165  ASP D CB    1 
ATOM   8555  C  CG    . ASP H 2 164 ? -3.584  -10.875 229.895 1.00 64.03  ? 165  ASP D CG    1 
ATOM   8556  O  OD1   . ASP H 2 164 ? -3.495  -9.670  230.237 1.00 62.72  ? 165  ASP D OD1   1 
ATOM   8557  O  OD2   . ASP H 2 164 ? -4.666  -11.510 229.851 1.00 60.04  ? 165  ASP D OD2   1 
ATOM   8558  N  N     . ILE H 2 165 ? 0.778   -11.247 230.104 1.00 47.18  ? 166  ILE D N     1 
ATOM   8559  C  CA    . ILE H 2 165 ? 2.088   -11.833 230.293 1.00 37.02  ? 166  ILE D CA    1 
ATOM   8560  C  C     . ILE H 2 165 ? 1.985   -12.772 231.473 1.00 39.21  ? 166  ILE D C     1 
ATOM   8561  O  O     . ILE H 2 165 ? 1.857   -12.327 232.607 1.00 49.45  ? 166  ILE D O     1 
ATOM   8562  C  CB    . ILE H 2 165 ? 3.124   -10.734 230.575 1.00 39.16  ? 166  ILE D CB    1 
ATOM   8563  C  CG1   . ILE H 2 165 ? 3.123   -9.733  229.410 1.00 37.61  ? 166  ILE D CG1   1 
ATOM   8564  C  CG2   . ILE H 2 165 ? 4.511   -11.352 230.766 1.00 42.37  ? 166  ILE D CG2   1 
ATOM   8565  C  CD1   . ILE H 2 165 ? 3.632   -8.347  229.770 1.00 18.86  ? 166  ILE D CD1   1 
ATOM   8566  N  N     . ASN H 2 166 ? 2.007   -14.073 231.205 1.00 35.39  ? 167  ASN D N     1 
ATOM   8567  C  CA    . ASN H 2 166 ? 1.911   -15.061 232.273 1.00 41.92  ? 167  ASN D CA    1 
ATOM   8568  C  C     . ASN H 2 166 ? 3.175   -15.901 232.345 1.00 46.11  ? 167  ASN D C     1 
ATOM   8569  O  O     . ASN H 2 166 ? 4.006   -15.858 231.445 1.00 59.01  ? 167  ASN D O     1 
ATOM   8570  C  CB    . ASN H 2 166 ? 0.709   -15.982 232.054 1.00 43.92  ? 167  ASN D CB    1 
ATOM   8571  C  CG    . ASN H 2 166 ? -0.600  -15.222 231.894 1.00 48.43  ? 167  ASN D CG    1 
ATOM   8572  O  OD1   . ASN H 2 166 ? -0.677  -14.007 232.141 1.00 38.79  ? 167  ASN D OD1   1 
ATOM   8573  N  ND2   . ASN H 2 166 ? -1.649  -15.944 231.490 1.00 39.67  ? 167  ASN D ND2   1 
ATOM   8574  N  N     . TYR H 2 167 ? 3.314   -16.670 233.418 1.00 47.95  ? 168  TYR D N     1 
ATOM   8575  C  CA    . TYR H 2 167 ? 4.488   -17.513 233.612 1.00 44.52  ? 168  TYR D CA    1 
ATOM   8576  C  C     . TYR H 2 167 ? 4.179   -18.922 234.124 1.00 46.66  ? 168  TYR D C     1 
ATOM   8577  O  O     . TYR H 2 167 ? 3.194   -19.143 234.832 1.00 51.39  ? 168  TYR D O     1 
ATOM   8578  C  CB    . TYR H 2 167 ? 5.433   -16.832 234.588 1.00 40.41  ? 168  TYR D CB    1 
ATOM   8579  C  CG    . TYR H 2 167 ? 5.824   -15.454 234.153 1.00 37.82  ? 168  TYR D CG    1 
ATOM   8580  C  CD1   . TYR H 2 167 ? 4.984   -14.364 234.375 1.00 29.44  ? 168  TYR D CD1   1 
ATOM   8581  C  CD2   . TYR H 2 167 ? 7.029   -15.240 233.484 1.00 39.20  ? 168  TYR D CD2   1 
ATOM   8582  C  CE1   . TYR H 2 167 ? 5.338   -13.094 233.941 1.00 25.46  ? 168  TYR D CE1   1 
ATOM   8583  C  CE2   . TYR H 2 167 ? 7.390   -13.979 233.048 1.00 35.95  ? 168  TYR D CE2   1 
ATOM   8584  C  CZ    . TYR H 2 167 ? 6.544   -12.915 233.278 1.00 33.00  ? 168  TYR D CZ    1 
ATOM   8585  O  OH    . TYR H 2 167 ? 6.937   -11.672 232.861 1.00 35.38  ? 168  TYR D OH    1 
ATOM   8586  N  N     . LEU H 2 168 ? 5.043   -19.870 233.778 1.00 43.80  ? 169  LEU D N     1 
ATOM   8587  C  CA    . LEU H 2 168 ? 4.878   -21.249 234.212 1.00 47.50  ? 169  LEU D CA    1 
ATOM   8588  C  C     . LEU H 2 168 ? 6.154   -21.731 234.903 1.00 53.71  ? 169  LEU D C     1 
ATOM   8589  O  O     . LEU H 2 168 ? 7.131   -22.096 234.252 1.00 51.41  ? 169  LEU D O     1 
ATOM   8590  C  CB    . LEU H 2 168 ? 4.556   -22.160 233.024 1.00 36.54  ? 169  LEU D CB    1 
ATOM   8591  C  CG    . LEU H 2 168 ? 4.431   -23.665 233.320 1.00 38.43  ? 169  LEU D CG    1 
ATOM   8592  C  CD1   . LEU H 2 168 ? 3.171   -23.917 234.120 1.00 36.98  ? 169  LEU D CD1   1 
ATOM   8593  C  CD2   . LEU H 2 168 ? 4.394   -24.469 232.016 1.00 37.54  ? 169  LEU D CD2   1 
ATOM   8594  N  N     . GLU H 2 169 ? 6.137   -21.713 236.231 1.00 61.46  ? 170  GLU D N     1 
ATOM   8595  C  CA    . GLU H 2 169 ? 7.273   -22.156 237.019 1.00 57.92  ? 170  GLU D CA    1 
ATOM   8596  C  C     . GLU H 2 169 ? 7.297   -23.678 236.969 1.00 59.32  ? 170  GLU D C     1 
ATOM   8597  O  O     . GLU H 2 169 ? 6.258   -24.323 237.113 1.00 56.70  ? 170  GLU D O     1 
ATOM   8598  C  CB    . GLU H 2 169 ? 7.118   -21.683 238.457 1.00 51.40  ? 170  GLU D CB    1 
ATOM   8599  C  CG    . GLU H 2 169 ? 8.259   -22.073 239.352 1.00 59.51  ? 170  GLU D CG    1 
ATOM   8600  C  CD    . GLU H 2 169 ? 7.960   -21.794 240.802 1.00 51.12  ? 170  GLU D CD    1 
ATOM   8601  O  OE1   . GLU H 2 169 ? 7.691   -20.627 241.134 1.00 46.98  ? 170  GLU D OE1   1 
ATOM   8602  O  OE2   . GLU H 2 169 ? 7.996   -22.746 241.602 1.00 51.66  ? 170  GLU D OE2   1 
ATOM   8603  N  N     . VAL H 2 170 ? 8.483   -24.242 236.764 1.00 61.72  ? 171  VAL D N     1 
ATOM   8604  C  CA    . VAL H 2 170 ? 8.650   -25.688 236.673 1.00 64.74  ? 171  VAL D CA    1 
ATOM   8605  C  C     . VAL H 2 170 ? 9.678   -26.180 237.683 1.00 72.08  ? 171  VAL D C     1 
ATOM   8606  O  O     . VAL H 2 170 ? 10.878  -26.075 237.448 1.00 84.16  ? 171  VAL D O     1 
ATOM   8607  C  CB    . VAL H 2 170 ? 9.114   -26.093 235.249 1.00 60.84  ? 171  VAL D CB    1 
ATOM   8608  C  CG1   . VAL H 2 170 ? 9.458   -27.573 235.199 1.00 52.93  ? 171  VAL D CG1   1 
ATOM   8609  C  CG2   . VAL H 2 170 ? 8.028   -25.763 234.243 1.00 56.07  ? 171  VAL D CG2   1 
ATOM   8610  N  N     . ASP H 2 171 ? 9.212   -26.721 238.802 1.00 73.67  ? 172  ASP D N     1 
ATOM   8611  C  CA    . ASP H 2 171 ? 10.113  -27.225 239.831 1.00 75.98  ? 172  ASP D CA    1 
ATOM   8612  C  C     . ASP H 2 171 ? 10.657  -28.607 239.444 1.00 78.99  ? 172  ASP D C     1 
ATOM   8613  O  O     . ASP H 2 171 ? 9.888   -29.521 239.150 1.00 81.39  ? 172  ASP D O     1 
ATOM   8614  C  CB    . ASP H 2 171 ? 9.379   -27.313 241.181 1.00 78.20  ? 172  ASP D CB    1 
ATOM   8615  C  CG    . ASP H 2 171 ? 8.829   -25.967 241.650 1.00 72.51  ? 172  ASP D CG    1 
ATOM   8616  O  OD1   . ASP H 2 171 ? 9.605   -24.995 241.750 1.00 75.85  ? 172  ASP D OD1   1 
ATOM   8617  O  OD2   . ASP H 2 171 ? 7.616   -25.885 241.929 1.00 71.35  ? 172  ASP D OD2   1 
ATOM   8618  N  N     . TRP H 2 172 ? 11.981  -28.755 239.441 1.00 80.12  ? 173  TRP D N     1 
ATOM   8619  C  CA    . TRP H 2 172 ? 12.616  -30.028 239.097 1.00 82.57  ? 173  TRP D CA    1 
ATOM   8620  C  C     . TRP H 2 172 ? 13.805  -30.324 240.002 1.00 85.35  ? 173  TRP D C     1 
ATOM   8621  O  O     . TRP H 2 172 ? 14.404  -29.413 240.575 1.00 86.78  ? 173  TRP D O     1 
ATOM   8622  C  CB    . TRP H 2 172 ? 13.107  -30.009 237.655 1.00 82.86  ? 173  TRP D CB    1 
ATOM   8623  C  CG    . TRP H 2 172 ? 14.026  -28.873 237.386 1.00 88.46  ? 173  TRP D CG    1 
ATOM   8624  C  CD1   . TRP H 2 172 ? 13.673  -27.606 237.044 1.00 91.26  ? 173  TRP D CD1   1 
ATOM   8625  C  CD2   . TRP H 2 172 ? 15.456  -28.883 237.471 1.00 93.36  ? 173  TRP D CD2   1 
ATOM   8626  N  NE1   . TRP H 2 172 ? 14.791  -26.820 236.907 1.00 93.77  ? 173  TRP D NE1   1 
ATOM   8627  C  CE2   . TRP H 2 172 ? 15.901  -27.581 237.162 1.00 91.29  ? 173  TRP D CE2   1 
ATOM   8628  C  CE3   . TRP H 2 172 ? 16.407  -29.867 237.776 1.00 96.17  ? 173  TRP D CE3   1 
ATOM   8629  C  CZ2   . TRP H 2 172 ? 17.252  -27.232 237.148 1.00 88.36  ? 173  TRP D CZ2   1 
ATOM   8630  C  CZ3   . TRP H 2 172 ? 17.753  -29.519 237.762 1.00 91.98  ? 173  TRP D CZ3   1 
ATOM   8631  C  CH2   . TRP H 2 172 ? 18.161  -28.211 237.449 1.00 90.13  ? 173  TRP D CH2   1 
ATOM   8632  N  N     . GLU H 2 173 ? 14.151  -31.601 240.118 1.00 87.17  ? 174  GLU D N     1 
ATOM   8633  C  CA    . GLU H 2 173 ? 15.275  -32.010 240.949 1.00 95.48  ? 174  GLU D CA    1 
ATOM   8634  C  C     . GLU H 2 173 ? 15.963  -33.243 240.371 1.00 99.22  ? 174  GLU D C     1 
ATOM   8635  O  O     . GLU H 2 173 ? 15.358  -34.302 240.257 1.00 106.34 ? 174  GLU D O     1 
ATOM   8636  C  CB    . GLU H 2 173 ? 14.802  -32.292 242.385 1.00 96.81  ? 174  GLU D CB    1 
ATOM   8637  C  CG    . GLU H 2 173 ? 13.737  -33.381 242.517 1.00 98.74  ? 174  GLU D CG    1 
ATOM   8638  C  CD    . GLU H 2 173 ? 13.368  -33.694 243.968 1.00 95.54  ? 174  GLU D CD    1 
ATOM   8639  O  OE1   . GLU H 2 173 ? 12.534  -34.597 244.192 1.00 91.60  ? 174  GLU D OE1   1 
ATOM   8640  O  OE2   . GLU H 2 173 ? 13.909  -33.043 244.885 1.00 97.25  ? 174  GLU D OE2   1 
ATOM   8641  N  N     . LEU H 2 174 ? 17.229  -33.098 239.999 1.00 100.88 ? 175  LEU D N     1 
ATOM   8642  C  CA    . LEU H 2 174 ? 17.984  -34.207 239.434 1.00 101.70 ? 175  LEU D CA    1 
ATOM   8643  C  C     . LEU H 2 174 ? 18.013  -35.386 240.395 1.00 103.14 ? 175  LEU D C     1 
ATOM   8644  O  O     . LEU H 2 174 ? 18.413  -35.244 241.549 1.00 99.54  ? 175  LEU D O     1 
ATOM   8645  C  CB    . LEU H 2 174 ? 19.413  -33.760 239.132 1.00 105.07 ? 175  LEU D CB    1 
ATOM   8646  C  CG    . LEU H 2 174 ? 20.368  -34.832 238.610 1.00 106.66 ? 175  LEU D CG    1 
ATOM   8647  C  CD1   . LEU H 2 174 ? 19.840  -35.418 237.312 1.00 110.21 ? 175  LEU D CD1   1 
ATOM   8648  C  CD2   . LEU H 2 174 ? 21.739  -34.221 238.401 1.00 109.21 ? 175  LEU D CD2   1 
ATOM   8649  N  N     . ASN H 2 175 ? 17.583  -36.550 239.922 1.00 107.73 ? 176  ASN D N     1 
ATOM   8650  C  CA    . ASN H 2 175 ? 17.582  -37.739 240.764 1.00 114.25 ? 176  ASN D CA    1 
ATOM   8651  C  C     . ASN H 2 175 ? 18.851  -38.544 240.507 1.00 117.17 ? 176  ASN D C     1 
ATOM   8652  O  O     . ASN H 2 175 ? 19.405  -39.164 241.419 1.00 117.18 ? 176  ASN D O     1 
ATOM   8653  C  CB    . ASN H 2 175 ? 16.347  -38.598 240.475 1.00 114.54 ? 176  ASN D CB    1 
ATOM   8654  C  CG    . ASN H 2 175 ? 16.196  -39.748 241.457 1.00 115.78 ? 176  ASN D CG    1 
ATOM   8655  O  OD1   . ASN H 2 175 ? 17.060  -40.620 241.548 1.00 117.27 ? 176  ASN D OD1   1 
ATOM   8656  N  ND2   . ASN H 2 175 ? 15.096  -39.752 242.200 1.00 115.50 ? 176  ASN D ND2   1 
ATOM   8657  N  N     . GLY H 2 176 ? 19.309  -38.523 239.259 1.00 117.35 ? 177  GLY D N     1 
ATOM   8658  C  CA    . GLY H 2 176 ? 20.513  -39.248 238.901 1.00 116.08 ? 177  GLY D CA    1 
ATOM   8659  C  C     . GLY H 2 176 ? 21.152  -38.741 237.623 1.00 114.26 ? 177  GLY D C     1 
ATOM   8660  O  O     . GLY H 2 176 ? 22.072  -37.925 237.659 1.00 114.44 ? 177  GLY D O     1 
ATOM   8661  N  N     . GLU H 2 177 ? 20.661  -39.226 236.487 1.00 114.68 ? 178  GLU D N     1 
ATOM   8662  C  CA    . GLU H 2 177 ? 21.186  -38.825 235.188 1.00 115.73 ? 178  GLU D CA    1 
ATOM   8663  C  C     . GLU H 2 177 ? 20.178  -38.011 234.391 1.00 113.77 ? 178  GLU D C     1 
ATOM   8664  O  O     . GLU H 2 177 ? 20.339  -37.822 233.187 1.00 111.77 ? 178  GLU D O     1 
ATOM   8665  C  CB    . GLU H 2 177 ? 21.587  -40.060 234.378 1.00 120.29 ? 178  GLU D CB    1 
ATOM   8666  C  CG    . GLU H 2 177 ? 22.902  -40.692 234.805 1.00 125.06 ? 178  GLU D CG    1 
ATOM   8667  C  CD    . GLU H 2 177 ? 24.109  -39.874 234.380 1.00 125.37 ? 178  GLU D CD    1 
ATOM   8668  O  OE1   . GLU H 2 177 ? 24.240  -38.714 234.828 1.00 122.57 ? 178  GLU D OE1   1 
ATOM   8669  O  OE2   . GLU H 2 177 ? 24.926  -40.395 233.591 1.00 125.93 ? 178  GLU D OE2   1 
ATOM   8670  N  N     . ASP H 2 178 ? 19.134  -37.537 235.059 1.00 113.96 ? 179  ASP D N     1 
ATOM   8671  C  CA    . ASP H 2 178 ? 18.119  -36.746 234.384 1.00 114.14 ? 179  ASP D CA    1 
ATOM   8672  C  C     . ASP H 2 178 ? 17.284  -35.929 235.356 1.00 113.02 ? 179  ASP D C     1 
ATOM   8673  O  O     . ASP H 2 178 ? 16.987  -36.368 236.469 1.00 114.11 ? 179  ASP D O     1 
ATOM   8674  C  CB    . ASP H 2 178 ? 17.213  -37.651 233.539 1.00 116.99 ? 179  ASP D CB    1 
ATOM   8675  C  CG    . ASP H 2 178 ? 16.620  -38.797 234.334 1.00 119.05 ? 179  ASP D CG    1 
ATOM   8676  O  OD1   . ASP H 2 178 ? 15.807  -39.555 233.759 1.00 116.00 ? 179  ASP D OD1   1 
ATOM   8677  O  OD2   . ASP H 2 178 ? 16.967  -38.941 235.528 1.00 120.89 ? 179  ASP D OD2   1 
ATOM   8678  N  N     . LEU H 2 179 ? 16.917  -34.728 234.923 1.00 110.90 ? 180  LEU D N     1 
ATOM   8679  C  CA    . LEU H 2 179 ? 16.120  -33.823 235.738 1.00 108.50 ? 180  LEU D CA    1 
ATOM   8680  C  C     . LEU H 2 179 ? 14.655  -34.253 235.670 1.00 104.12 ? 180  LEU D C     1 
ATOM   8681  O  O     . LEU H 2 179 ? 14.171  -34.650 234.610 1.00 101.98 ? 180  LEU D O     1 
ATOM   8682  C  CB    . LEU H 2 179 ? 16.270  -32.392 235.212 1.00 110.09 ? 180  LEU D CB    1 
ATOM   8683  C  CG    . LEU H 2 179 ? 17.660  -31.972 234.721 1.00 109.73 ? 180  LEU D CG    1 
ATOM   8684  C  CD1   . LEU H 2 179 ? 17.602  -30.532 234.252 1.00 110.52 ? 180  LEU D CD1   1 
ATOM   8685  C  CD2   . LEU H 2 179 ? 18.693  -32.131 235.827 1.00 110.04 ? 180  LEU D CD2   1 
ATOM   8686  N  N     . VAL H 2 180 ? 13.950  -34.174 236.797 1.00 98.83  ? 181  VAL D N     1 
ATOM   8687  C  CA    . VAL H 2 180 ? 12.543  -34.570 236.833 1.00 93.78  ? 181  VAL D CA    1 
ATOM   8688  C  C     . VAL H 2 180 ? 11.634  -33.516 237.469 1.00 87.04  ? 181  VAL D C     1 
ATOM   8689  O  O     . VAL H 2 180 ? 11.935  -32.978 238.533 1.00 81.09  ? 181  VAL D O     1 
ATOM   8690  C  CB    . VAL H 2 180 ? 12.354  -35.895 237.605 1.00 94.09  ? 181  VAL D CB    1 
ATOM   8691  C  CG1   . VAL H 2 180 ? 10.959  -36.441 237.353 1.00 95.15  ? 181  VAL D CG1   1 
ATOM   8692  C  CG2   . VAL H 2 180 ? 13.416  -36.904 237.194 1.00 91.31  ? 181  VAL D CG2   1 
ATOM   8693  N  N     . CYS H 2 181 ? 10.513  -33.237 236.809 1.00 82.18  ? 182  CYS D N     1 
ATOM   8694  C  CA    . CYS H 2 181 ? 9.552   -32.255 237.293 1.00 78.52  ? 182  CYS D CA    1 
ATOM   8695  C  C     . CYS H 2 181 ? 8.885   -32.767 238.563 1.00 81.28  ? 182  CYS D C     1 
ATOM   8696  O  O     . CYS H 2 181 ? 8.507   -33.938 238.645 1.00 85.43  ? 182  CYS D O     1 
ATOM   8697  C  CB    . CYS H 2 181 ? 8.486   -31.984 236.223 1.00 72.61  ? 182  CYS D CB    1 
ATOM   8698  S  SG    . CYS H 2 181 ? 7.225   -30.732 236.670 1.00 72.59  ? 182  CYS D SG    1 
ATOM   8699  N  N     . VAL H 2 182 ? 8.744   -31.888 239.550 1.00 77.26  ? 183  VAL D N     1 
ATOM   8700  C  CA    . VAL H 2 182 ? 8.119   -32.251 240.814 1.00 74.85  ? 183  VAL D CA    1 
ATOM   8701  C  C     . VAL H 2 182 ? 6.966   -31.317 241.155 1.00 74.84  ? 183  VAL D C     1 
ATOM   8702  O  O     . VAL H 2 182 ? 6.161   -31.613 242.031 1.00 75.35  ? 183  VAL D O     1 
ATOM   8703  C  CB    . VAL H 2 182 ? 9.129   -32.212 241.970 1.00 74.12  ? 183  VAL D CB    1 
ATOM   8704  C  CG1   . VAL H 2 182 ? 10.280  -33.156 241.681 1.00 84.99  ? 183  VAL D CG1   1 
ATOM   8705  C  CG2   . VAL H 2 182 ? 9.636   -30.801 242.163 1.00 82.77  ? 183  VAL D CG2   1 
ATOM   8706  N  N     . SER H 2 183 ? 6.888   -30.186 240.467 1.00 74.43  ? 184  SER D N     1 
ATOM   8707  C  CA    . SER H 2 183 ? 5.821   -29.235 240.721 1.00 72.11  ? 184  SER D CA    1 
ATOM   8708  C  C     . SER H 2 183 ? 5.831   -28.152 239.657 1.00 67.45  ? 184  SER D C     1 
ATOM   8709  O  O     . SER H 2 183 ? 6.800   -28.014 238.913 1.00 67.99  ? 184  SER D O     1 
ATOM   8710  C  CB    . SER H 2 183 ? 5.996   -28.610 242.105 1.00 78.50  ? 184  SER D CB    1 
ATOM   8711  O  OG    . SER H 2 183 ? 5.006   -27.621 242.347 1.00 96.62  ? 184  SER D OG    1 
ATOM   8712  N  N     . THR H 2 184 ? 4.746   -27.389 239.587 1.00 59.33  ? 185  THR D N     1 
ATOM   8713  C  CA    . THR H 2 184 ? 4.612   -26.318 238.607 1.00 54.58  ? 185  THR D CA    1 
ATOM   8714  C  C     . THR H 2 184 ? 3.622   -25.301 239.154 1.00 57.35  ? 185  THR D C     1 
ATOM   8715  O  O     . THR H 2 184 ? 2.643   -25.673 239.797 1.00 66.30  ? 185  THR D O     1 
ATOM   8716  C  CB    . THR H 2 184 ? 4.040   -26.837 237.286 1.00 48.34  ? 185  THR D CB    1 
ATOM   8717  O  OG1   . THR H 2 184 ? 2.637   -27.068 237.445 1.00 51.48  ? 185  THR D OG1   1 
ATOM   8718  C  CG2   . THR H 2 184 ? 4.704   -28.146 236.882 1.00 52.85  ? 185  THR D CG2   1 
ATOM   8719  N  N     . SER H 2 185 ? 3.861   -24.023 238.887 1.00 53.74  ? 186  SER D N     1 
ATOM   8720  C  CA    . SER H 2 185 ? 2.974   -22.971 239.373 1.00 54.83  ? 186  SER D CA    1 
ATOM   8721  C  C     . SER H 2 185 ? 2.638   -22.009 238.244 1.00 56.94  ? 186  SER D C     1 
ATOM   8722  O  O     . SER H 2 185 ? 3.385   -21.895 237.274 1.00 61.11  ? 186  SER D O     1 
ATOM   8723  C  CB    . SER H 2 185 ? 3.648   -22.204 240.512 1.00 54.90  ? 186  SER D CB    1 
ATOM   8724  O  OG    . SER H 2 185 ? 4.318   -23.098 241.388 1.00 58.37  ? 186  SER D OG    1 
ATOM   8725  N  N     . PHE H 2 186 ? 1.519   -21.307 238.369 1.00 55.37  ? 187  PHE D N     1 
ATOM   8726  C  CA    . PHE H 2 186 ? 1.109   -20.358 237.339 1.00 55.34  ? 187  PHE D CA    1 
ATOM   8727  C  C     . PHE H 2 186 ? 0.836   -18.993 237.966 1.00 54.38  ? 187  PHE D C     1 
ATOM   8728  O  O     . PHE H 2 186 ? 0.648   -18.891 239.174 1.00 61.82  ? 187  PHE D O     1 
ATOM   8729  C  CB    . PHE H 2 186 ? -0.156  -20.873 236.650 1.00 62.39  ? 187  PHE D CB    1 
ATOM   8730  C  CG    . PHE H 2 186 ? -0.509  -20.131 235.395 1.00 79.99  ? 187  PHE D CG    1 
ATOM   8731  C  CD1   . PHE H 2 186 ? 0.186   -20.370 234.213 1.00 84.23  ? 187  PHE D CD1   1 
ATOM   8732  C  CD2   . PHE H 2 186 ? -1.524  -19.176 235.396 1.00 86.73  ? 187  PHE D CD2   1 
ATOM   8733  C  CE1   . PHE H 2 186 ? -0.119  -19.670 233.052 1.00 85.16  ? 187  PHE D CE1   1 
ATOM   8734  C  CE2   . PHE H 2 186 ? -1.839  -18.468 234.240 1.00 87.75  ? 187  PHE D CE2   1 
ATOM   8735  C  CZ    . PHE H 2 186 ? -1.134  -18.716 233.065 1.00 93.22  ? 187  PHE D CZ    1 
ATOM   8736  N  N     . ALA H 2 187 ? 0.821   -17.940 237.157 1.00 50.80  ? 188  ALA D N     1 
ATOM   8737  C  CA    . ALA H 2 187 ? 0.520   -16.600 237.672 1.00 48.38  ? 188  ALA D CA    1 
ATOM   8738  C  C     . ALA H 2 187 ? 0.403   -15.599 236.530 1.00 46.48  ? 188  ALA D C     1 
ATOM   8739  O  O     . ALA H 2 187 ? 0.819   -15.873 235.408 1.00 52.71  ? 188  ALA D O     1 
ATOM   8740  C  CB    . ALA H 2 187 ? 1.586   -16.159 238.666 1.00 43.01  ? 188  ALA D CB    1 
ATOM   8741  N  N     . GLU H 2 188 ? -0.165  -14.437 236.810 1.00 45.97  ? 189  GLU D N     1 
ATOM   8742  C  CA    . GLU H 2 188 ? -0.326  -13.435 235.770 1.00 48.40  ? 189  GLU D CA    1 
ATOM   8743  C  C     . GLU H 2 188 ? 0.199   -12.079 236.216 1.00 49.17  ? 189  GLU D C     1 
ATOM   8744  O  O     . GLU H 2 188 ? -0.375  -11.423 237.082 1.00 47.03  ? 189  GLU D O     1 
ATOM   8745  C  CB    . GLU H 2 188 ? -1.799  -13.315 235.388 1.00 40.24  ? 189  GLU D CB    1 
ATOM   8746  C  CG    . GLU H 2 188 ? -2.500  -14.648 235.190 1.00 52.33  ? 189  GLU D CG    1 
ATOM   8747  C  CD    . GLU H 2 188 ? -3.969  -14.477 234.830 1.00 67.83  ? 189  GLU D CD    1 
ATOM   8748  O  OE1   . GLU H 2 188 ? -4.698  -15.495 234.764 1.00 73.44  ? 189  GLU D OE1   1 
ATOM   8749  O  OE2   . GLU H 2 188 ? -4.390  -13.319 234.609 1.00 69.50  ? 189  GLU D OE2   1 
ATOM   8750  N  N     . LEU H 2 189 ? 1.302   -11.666 235.614 1.00 53.26  ? 190  LEU D N     1 
ATOM   8751  C  CA    . LEU H 2 189 ? 1.908   -10.391 235.937 1.00 55.08  ? 190  LEU D CA    1 
ATOM   8752  C  C     . LEU H 2 189 ? 0.866   -9.289  236.147 1.00 53.65  ? 190  LEU D C     1 
ATOM   8753  O  O     . LEU H 2 189 ? 0.961   -8.499  237.083 1.00 47.27  ? 190  LEU D O     1 
ATOM   8754  C  CB    . LEU H 2 189 ? 2.858   -9.982  234.819 1.00 45.39  ? 190  LEU D CB    1 
ATOM   8755  C  CG    . LEU H 2 189 ? 3.507   -8.626  235.020 1.00 44.82  ? 190  LEU D CG    1 
ATOM   8756  C  CD1   . LEU H 2 189 ? 4.417   -8.676  236.235 1.00 62.23  ? 190  LEU D CD1   1 
ATOM   8757  C  CD2   . LEU H 2 189 ? 4.284   -8.250  233.785 1.00 64.62  ? 190  LEU D CD2   1 
ATOM   8758  N  N     . PHE H 2 190 ? -0.133  -9.239  235.278 1.00 60.76  ? 191  PHE D N     1 
ATOM   8759  C  CA    . PHE H 2 190 ? -1.150  -8.201  235.382 1.00 71.62  ? 191  PHE D CA    1 
ATOM   8760  C  C     . PHE H 2 190 ? -2.125  -8.381  236.536 1.00 73.68  ? 191  PHE D C     1 
ATOM   8761  O  O     . PHE H 2 190 ? -2.962  -7.511  236.774 1.00 79.60  ? 191  PHE D O     1 
ATOM   8762  C  CB    . PHE H 2 190 ? -1.918  -8.078  234.063 1.00 72.61  ? 191  PHE D CB    1 
ATOM   8763  C  CG    . PHE H 2 190 ? -1.112  -7.471  232.945 1.00 65.88  ? 191  PHE D CG    1 
ATOM   8764  C  CD1   . PHE H 2 190 ? -0.988  -8.128  231.726 1.00 63.48  ? 191  PHE D CD1   1 
ATOM   8765  C  CD2   . PHE H 2 190 ? -0.492  -6.235  233.103 1.00 66.21  ? 191  PHE D CD2   1 
ATOM   8766  C  CE1   . PHE H 2 190 ? -0.260  -7.567  230.683 1.00 58.38  ? 191  PHE D CE1   1 
ATOM   8767  C  CE2   . PHE H 2 190 ? 0.240   -5.665  232.060 1.00 67.64  ? 191  PHE D CE2   1 
ATOM   8768  C  CZ    . PHE H 2 190 ? 0.355   -6.333  230.850 1.00 54.94  ? 191  PHE D CZ    1 
ATOM   8769  N  N     . LYS H 2 191 ? -2.034  -9.503  237.245 1.00 72.61  ? 192  LYS D N     1 
ATOM   8770  C  CA    . LYS H 2 191 ? -2.918  -9.736  238.391 1.00 71.15  ? 192  LYS D CA    1 
ATOM   8771  C  C     . LYS H 2 191 ? -2.169  -9.620  239.717 1.00 68.91  ? 192  LYS D C     1 
ATOM   8772  O  O     . LYS H 2 191 ? -2.647  -10.093 240.748 1.00 73.43  ? 192  LYS D O     1 
ATOM   8773  C  CB    . LYS H 2 191 ? -3.601  -11.110 238.310 1.00 64.66  ? 192  LYS D CB    1 
ATOM   8774  C  CG    . LYS H 2 191 ? -4.823  -11.146 237.407 1.00 62.88  ? 192  LYS D CG    1 
ATOM   8775  C  CD    . LYS H 2 191 ? -5.924  -12.052 237.953 1.00 65.66  ? 192  LYS D CD    1 
ATOM   8776  C  CE    . LYS H 2 191 ? -5.498  -13.516 238.026 1.00 71.50  ? 192  LYS D CE    1 
ATOM   8777  N  NZ    . LYS H 2 191 ? -6.588  -14.405 238.547 1.00 69.87  ? 192  LYS D NZ    1 
ATOM   8778  N  N     . SER H 2 192 ? -0.996  -8.991  239.681 1.00 63.55  ? 193  SER D N     1 
ATOM   8779  C  CA    . SER H 2 192 ? -0.183  -8.798  240.879 1.00 61.56  ? 193  SER D CA    1 
ATOM   8780  C  C     . SER H 2 192 ? -0.145  -7.325  241.229 1.00 58.98  ? 193  SER D C     1 
ATOM   8781  O  O     . SER H 2 192 ? -0.595  -6.490  240.450 1.00 61.83  ? 193  SER D O     1 
ATOM   8782  C  CB    . SER H 2 192 ? 1.244   -9.289  240.654 1.00 66.83  ? 193  SER D CB    1 
ATOM   8783  O  OG    . SER H 2 192 ? 2.054   -8.960  241.771 1.00 78.04  ? 193  SER D OG    1 
ATOM   8784  N  N     . GLU H 2 193 ? 0.389   -6.996  242.397 1.00 58.80  ? 194  GLU D N     1 
ATOM   8785  C  CA    . GLU H 2 193 ? 0.463   -5.597  242.789 1.00 69.12  ? 194  GLU D CA    1 
ATOM   8786  C  C     . GLU H 2 193 ? 1.657   -4.912  242.124 1.00 70.35  ? 194  GLU D C     1 
ATOM   8787  O  O     . GLU H 2 193 ? 2.806   -5.087  242.546 1.00 66.17  ? 194  GLU D O     1 
ATOM   8788  C  CB    . GLU H 2 193 ? 0.557   -5.474  244.313 1.00 79.09  ? 194  GLU D CB    1 
ATOM   8789  C  CG    . GLU H 2 193 ? 0.635   -4.031  244.799 1.00 88.99  ? 194  GLU D CG    1 
ATOM   8790  C  CD    . GLU H 2 193 ? -0.587  -3.198  244.418 1.00 91.25  ? 194  GLU D CD    1 
ATOM   8791  O  OE1   . GLU H 2 193 ? -0.486  -1.957  244.476 1.00 94.47  ? 194  GLU D OE1   1 
ATOM   8792  O  OE2   . GLU H 2 193 ? -1.645  -3.771  244.072 1.00 86.69  ? 194  GLU D OE2   1 
ATOM   8793  N  N     . PRO H 2 194 ? 1.391   -4.109  241.082 1.00 72.31  ? 195  PRO D N     1 
ATOM   8794  C  CA    . PRO H 2 194 ? 2.428   -3.390  240.340 1.00 77.33  ? 195  PRO D CA    1 
ATOM   8795  C  C     . PRO H 2 194 ? 3.181   -2.371  241.183 1.00 79.23  ? 195  PRO D C     1 
ATOM   8796  O  O     . PRO H 2 194 ? 3.650   -1.355  240.670 1.00 81.65  ? 195  PRO D O     1 
ATOM   8797  C  CB    . PRO H 2 194 ? 1.642   -2.732  239.210 1.00 80.83  ? 195  PRO D CB    1 
ATOM   8798  C  CG    . PRO H 2 194 ? 0.352   -2.400  239.874 1.00 77.34  ? 195  PRO D CG    1 
ATOM   8799  C  CD    . PRO H 2 194 ? 0.053   -3.681  240.638 1.00 76.35  ? 195  PRO D CD    1 
ATOM   8800  N  N     . SER H 2 195 ? 3.292   -2.636  242.478 1.00 78.24  ? 196  SER D N     1 
ATOM   8801  C  CA    . SER H 2 195 ? 4.001   -1.727  243.366 1.00 81.09  ? 196  SER D CA    1 
ATOM   8802  C  C     . SER H 2 195 ? 4.951   -2.484  244.274 1.00 76.57  ? 196  SER D C     1 
ATOM   8803  O  O     . SER H 2 195 ? 5.699   -1.874  245.037 1.00 74.58  ? 196  SER D O     1 
ATOM   8804  C  CB    . SER H 2 195 ? 3.012   -0.922  244.218 1.00 86.67  ? 196  SER D CB    1 
ATOM   8805  O  OG    . SER H 2 195 ? 2.192   -0.090  243.413 1.00 93.18  ? 196  SER D OG    1 
ATOM   8806  N  N     . GLU H 2 196 ? 4.921   -3.812  244.185 1.00 69.77  ? 197  GLU D N     1 
ATOM   8807  C  CA    . GLU H 2 196 ? 5.779   -4.647  245.010 1.00 63.81  ? 197  GLU D CA    1 
ATOM   8808  C  C     . GLU H 2 196 ? 6.493   -5.701  244.189 1.00 57.15  ? 197  GLU D C     1 
ATOM   8809  O  O     . GLU H 2 196 ? 6.815   -6.781  244.681 1.00 56.29  ? 197  GLU D O     1 
ATOM   8810  C  CB    . GLU H 2 196 ? 4.954   -5.308  246.105 1.00 71.96  ? 197  GLU D CB    1 
ATOM   8811  C  CG    . GLU H 2 196 ? 4.233   -4.303  246.976 1.00 83.78  ? 197  GLU D CG    1 
ATOM   8812  C  CD    . GLU H 2 196 ? 3.651   -4.933  248.215 1.00 90.80  ? 197  GLU D CD    1 
ATOM   8813  O  OE1   . GLU H 2 196 ? 4.428   -5.546  248.983 1.00 94.17  ? 197  GLU D OE1   1 
ATOM   8814  O  OE2   . GLU H 2 196 ? 2.424   -4.813  248.421 1.00 91.33  ? 197  GLU D OE2   1 
ATOM   8815  N  N     . LEU H 2 197 ? 6.737   -5.379  242.928 1.00 48.18  ? 198  LEU D N     1 
ATOM   8816  C  CA    . LEU H 2 197 ? 7.425   -6.294  242.046 1.00 43.31  ? 198  LEU D CA    1 
ATOM   8817  C  C     . LEU H 2 197 ? 8.922   -6.325  242.351 1.00 42.76  ? 198  LEU D C     1 
ATOM   8818  O  O     . LEU H 2 197 ? 9.534   -7.388  242.327 1.00 39.91  ? 198  LEU D O     1 
ATOM   8819  C  CB    . LEU H 2 197 ? 7.166   -5.917  240.577 1.00 35.90  ? 198  LEU D CB    1 
ATOM   8820  C  CG    . LEU H 2 197 ? 5.812   -6.388  240.015 1.00 31.72  ? 198  LEU D CG    1 
ATOM   8821  C  CD1   . LEU H 2 197 ? 5.502   -5.745  238.678 1.00 20.90  ? 198  LEU D CD1   1 
ATOM   8822  C  CD2   . LEU H 2 197 ? 5.841   -7.910  239.871 1.00 24.90  ? 198  LEU D CD2   1 
ATOM   8823  N  N     . TYR H 2 198 ? 9.507   -5.171  242.657 1.00 41.66  ? 199  TYR D N     1 
ATOM   8824  C  CA    . TYR H 2 198 ? 10.938  -5.093  242.966 1.00 45.38  ? 199  TYR D CA    1 
ATOM   8825  C  C     . TYR H 2 198 ? 11.766  -5.142  241.698 1.00 46.45  ? 199  TYR D C     1 
ATOM   8826  O  O     . TYR H 2 198 ? 11.745  -6.124  240.953 1.00 38.24  ? 199  TYR D O     1 
ATOM   8827  C  CB    . TYR H 2 198 ? 11.380  -6.229  243.897 1.00 42.87  ? 199  TYR D CB    1 
ATOM   8828  C  CG    . TYR H 2 198 ? 12.879  -6.268  244.116 1.00 58.42  ? 199  TYR D CG    1 
ATOM   8829  C  CD1   . TYR H 2 198 ? 13.569  -5.120  244.516 1.00 69.42  ? 199  TYR D CD1   1 
ATOM   8830  C  CD2   . TYR H 2 198 ? 13.616  -7.443  243.909 1.00 59.49  ? 199  TYR D CD2   1 
ATOM   8831  C  CE1   . TYR H 2 198 ? 14.950  -5.132  244.704 1.00 76.45  ? 199  TYR D CE1   1 
ATOM   8832  C  CE2   . TYR H 2 198 ? 15.006  -7.470  244.095 1.00 60.44  ? 199  TYR D CE2   1 
ATOM   8833  C  CZ    . TYR H 2 198 ? 15.663  -6.305  244.492 1.00 77.20  ? 199  TYR D CZ    1 
ATOM   8834  O  OH    . TYR H 2 198 ? 17.031  -6.290  244.677 1.00 77.64  ? 199  TYR D OH    1 
ATOM   8835  N  N     . ILE H 2 199 ? 12.511  -4.071  241.474 1.00 54.68  ? 200  ILE D N     1 
ATOM   8836  C  CA    . ILE H 2 199 ? 13.349  -3.941  240.296 1.00 57.76  ? 200  ILE D CA    1 
ATOM   8837  C  C     . ILE H 2 199 ? 14.828  -4.091  240.633 1.00 59.47  ? 200  ILE D C     1 
ATOM   8838  O  O     . ILE H 2 199 ? 15.402  -3.287  241.369 1.00 56.96  ? 200  ILE D O     1 
ATOM   8839  C  CB    . ILE H 2 199 ? 13.118  -2.572  239.643 1.00 60.14  ? 200  ILE D CB    1 
ATOM   8840  C  CG1   . ILE H 2 199 ? 11.642  -2.435  239.276 1.00 53.08  ? 200  ILE D CG1   1 
ATOM   8841  C  CG2   . ILE H 2 199 ? 13.987  -2.416  238.405 1.00 59.71  ? 200  ILE D CG2   1 
ATOM   8842  C  CD1   . ILE H 2 199 ? 11.227  -1.016  238.994 1.00 65.89  ? 200  ILE D CD1   1 
ATOM   8843  N  N     . ASN H 2 200 ? 15.443  -5.129  240.085 1.00 57.20  ? 201  ASN D N     1 
ATOM   8844  C  CA    . ASN H 2 200 ? 16.856  -5.366  240.312 1.00 52.26  ? 201  ASN D CA    1 
ATOM   8845  C  C     . ASN H 2 200 ? 17.649  -4.721  239.173 1.00 54.45  ? 201  ASN D C     1 
ATOM   8846  O  O     . ASN H 2 200 ? 17.901  -5.361  238.156 1.00 58.16  ? 201  ASN D O     1 
ATOM   8847  C  CB    . ASN H 2 200 ? 17.130  -6.859  240.327 1.00 34.54  ? 201  ASN D CB    1 
ATOM   8848  C  CG    . ASN H 2 200 ? 18.438  -7.179  240.970 1.00 32.56  ? 201  ASN D CG    1 
ATOM   8849  O  OD1   . ASN H 2 200 ? 19.294  -6.307  241.101 1.00 45.42  ? 201  ASN D OD1   1 
ATOM   8850  N  ND2   . ASN H 2 200 ? 18.614  -8.429  241.381 1.00 34.84  ? 201  ASN D ND2   1 
ATOM   8851  N  N     . TRP H 2 201 ? 18.056  -3.467  239.340 1.00 48.72  ? 202  TRP D N     1 
ATOM   8852  C  CA    . TRP H 2 201 ? 18.781  -2.765  238.281 1.00 52.71  ? 202  TRP D CA    1 
ATOM   8853  C  C     . TRP H 2 201 ? 20.141  -3.351  237.894 1.00 57.42  ? 202  TRP D C     1 
ATOM   8854  O  O     . TRP H 2 201 ? 20.735  -2.969  236.884 1.00 57.36  ? 202  TRP D O     1 
ATOM   8855  C  CB    . TRP H 2 201 ? 18.945  -1.298  238.662 1.00 56.46  ? 202  TRP D CB    1 
ATOM   8856  C  CG    . TRP H 2 201 ? 17.696  -0.725  239.224 1.00 59.84  ? 202  TRP D CG    1 
ATOM   8857  C  CD1   . TRP H 2 201 ? 17.257  -0.834  240.504 1.00 61.66  ? 202  TRP D CD1   1 
ATOM   8858  C  CD2   . TRP H 2 201 ? 16.684  -0.004  238.512 1.00 64.68  ? 202  TRP D CD2   1 
ATOM   8859  N  NE1   . TRP H 2 201 ? 16.032  -0.228  240.641 1.00 65.33  ? 202  TRP D NE1   1 
ATOM   8860  C  CE2   . TRP H 2 201 ? 15.658  0.290   239.431 1.00 64.74  ? 202  TRP D CE2   1 
ATOM   8861  C  CE3   . TRP H 2 201 ? 16.544  0.419   237.187 1.00 65.78  ? 202  TRP D CE3   1 
ATOM   8862  C  CZ2   . TRP H 2 201 ? 14.507  0.989   239.070 1.00 68.26  ? 202  TRP D CZ2   1 
ATOM   8863  C  CZ3   . TRP H 2 201 ? 15.397  1.114   236.826 1.00 65.53  ? 202  TRP D CZ3   1 
ATOM   8864  C  CH2   . TRP H 2 201 ? 14.395  1.392   237.766 1.00 69.82  ? 202  TRP D CH2   1 
ATOM   8865  N  N     . ALA H 2 202 ? 20.636  -4.281  238.695 1.00 58.39  ? 203  ALA D N     1 
ATOM   8866  C  CA    . ALA H 2 202 ? 21.916  -4.898  238.399 1.00 55.88  ? 203  ALA D CA    1 
ATOM   8867  C  C     . ALA H 2 202 ? 21.706  -6.158  237.560 1.00 53.89  ? 203  ALA D C     1 
ATOM   8868  O  O     . ALA H 2 202 ? 22.570  -6.536  236.772 1.00 47.84  ? 203  ALA D O     1 
ATOM   8869  C  CB    . ALA H 2 202 ? 22.646  -5.234  239.696 1.00 53.46  ? 203  ALA D CB    1 
ATOM   8870  N  N     . ALA H 2 203 ? 20.562  -6.813  237.732 1.00 52.36  ? 204  ALA D N     1 
ATOM   8871  C  CA    . ALA H 2 203 ? 20.267  -8.029  236.976 1.00 53.32  ? 204  ALA D CA    1 
ATOM   8872  C  C     . ALA H 2 203 ? 19.446  -7.718  235.724 1.00 52.11  ? 204  ALA D C     1 
ATOM   8873  O  O     . ALA H 2 203 ? 18.299  -8.151  235.589 1.00 57.81  ? 204  ALA D O     1 
ATOM   8874  C  CB    . ALA H 2 203 ? 19.525  -9.032  237.860 1.00 43.02  ? 204  ALA D CB    1 
ATOM   8875  N  N     . ALA H 2 204 ? 20.045  -6.964  234.810 1.00 49.70  ? 205  ALA D N     1 
ATOM   8876  C  CA    . ALA H 2 204 ? 19.390  -6.582  233.567 1.00 45.48  ? 205  ALA D CA    1 
ATOM   8877  C  C     . ALA H 2 204 ? 18.078  -5.889  233.863 1.00 42.39  ? 205  ALA D C     1 
ATOM   8878  O  O     . ALA H 2 204 ? 17.085  -6.111  233.178 1.00 47.15  ? 205  ALA D O     1 
ATOM   8879  C  CB    . ALA H 2 204 ? 19.148  -7.806  232.698 1.00 46.11  ? 205  ALA D CB    1 
ATOM   8880  N  N     . MET H 2 205 ? 18.077  -5.051  234.893 1.00 41.99  ? 206  MET D N     1 
ATOM   8881  C  CA    . MET H 2 205 ? 16.875  -4.320  235.273 1.00 46.88  ? 206  MET D CA    1 
ATOM   8882  C  C     . MET H 2 205 ? 15.631  -5.212  235.222 1.00 44.82  ? 206  MET D C     1 
ATOM   8883  O  O     . MET H 2 205 ? 14.544  -4.745  234.904 1.00 37.19  ? 206  MET D O     1 
ATOM   8884  C  CB    . MET H 2 205 ? 16.696  -3.133  234.332 1.00 48.53  ? 206  MET D CB    1 
ATOM   8885  C  CG    . MET H 2 205 ? 17.960  -2.306  234.170 1.00 52.32  ? 206  MET D CG    1 
ATOM   8886  S  SD    . MET H 2 205 ? 17.683  -0.815  233.214 1.00 54.28  ? 206  MET D SD    1 
ATOM   8887  C  CE    . MET H 2 205 ? 17.329  -1.511  231.622 1.00 56.60  ? 206  MET D CE    1 
ATOM   8888  N  N     . GLN H 2 206 ? 15.812  -6.492  235.541 1.00 44.59  ? 207  GLN D N     1 
ATOM   8889  C  CA    . GLN H 2 206 ? 14.735  -7.486  235.524 1.00 54.31  ? 207  GLN D CA    1 
ATOM   8890  C  C     . GLN H 2 206 ? 13.932  -7.538  236.833 1.00 59.52  ? 207  GLN D C     1 
ATOM   8891  O  O     . GLN H 2 206 ? 14.521  -7.600  237.909 1.00 66.97  ? 207  GLN D O     1 
ATOM   8892  C  CB    . GLN H 2 206 ? 15.333  -8.874  235.291 1.00 48.85  ? 207  GLN D CB    1 
ATOM   8893  C  CG    . GLN H 2 206 ? 16.017  -9.071  233.958 1.00 44.44  ? 207  GLN D CG    1 
ATOM   8894  C  CD    . GLN H 2 206 ? 15.036  -9.439  232.884 1.00 45.75  ? 207  GLN D CD    1 
ATOM   8895  O  OE1   . GLN H 2 206 ? 14.192  -10.305 233.089 1.00 43.03  ? 207  GLN D OE1   1 
ATOM   8896  N  NE2   . GLN H 2 206 ? 15.143  -8.796  231.725 1.00 43.28  ? 207  GLN D NE2   1 
ATOM   8897  N  N     . ILE H 2 207 ? 12.602  -7.515  236.761 1.00 56.51  ? 208  ILE D N     1 
ATOM   8898  C  CA    . ILE H 2 207 ? 11.822  -7.620  237.988 1.00 58.79  ? 208  ILE D CA    1 
ATOM   8899  C  C     . ILE H 2 207 ? 11.972  -9.099  238.349 1.00 62.71  ? 208  ILE D C     1 
ATOM   8900  O  O     . ILE H 2 207 ? 12.074  -9.944  237.453 1.00 60.29  ? 208  ILE D O     1 
ATOM   8901  C  CB    . ILE H 2 207 ? 10.333  -7.312  237.781 1.00 57.39  ? 208  ILE D CB    1 
ATOM   8902  C  CG1   . ILE H 2 207 ? 9.699   -8.424  236.956 1.00 60.59  ? 208  ILE D CG1   1 
ATOM   8903  C  CG2   . ILE H 2 207 ? 10.163  -5.965  237.099 1.00 63.66  ? 208  ILE D CG2   1 
ATOM   8904  C  CD1   . ILE H 2 207 ? 8.209   -8.510  237.110 1.00 65.76  ? 208  ILE D CD1   1 
ATOM   8905  N  N     . GLN H 2 208 ? 11.975  -9.424  239.640 1.00 58.93  ? 209  GLN D N     1 
ATOM   8906  C  CA    . GLN H 2 208 ? 12.180  -10.814 240.042 1.00 59.21  ? 209  GLN D CA    1 
ATOM   8907  C  C     . GLN H 2 208 ? 11.201  -11.382 241.069 1.00 56.77  ? 209  GLN D C     1 
ATOM   8908  O  O     . GLN H 2 208 ? 10.776  -10.689 241.992 1.00 63.44  ? 209  GLN D O     1 
ATOM   8909  C  CB    . GLN H 2 208 ? 13.621  -10.981 240.564 1.00 52.85  ? 209  GLN D CB    1 
ATOM   8910  C  CG    . GLN H 2 208 ? 14.714  -10.643 239.540 1.00 51.83  ? 209  GLN D CG    1 
ATOM   8911  C  CD    . GLN H 2 208 ? 16.077  -10.412 240.167 1.00 38.63  ? 209  GLN D CD    1 
ATOM   8912  O  OE1   . GLN H 2 208 ? 16.262  -9.475  240.924 1.00 42.66  ? 209  GLN D OE1   1 
ATOM   8913  N  NE2   . GLN H 2 208 ? 17.035  -11.265 239.844 1.00 44.23  ? 209  GLN D NE2   1 
ATOM   8914  N  N     . PHE H 2 209 ? 10.854  -12.655 240.896 1.00 44.85  ? 210  PHE D N     1 
ATOM   8915  C  CA    . PHE H 2 209 ? 9.953   -13.340 241.807 1.00 38.17  ? 210  PHE D CA    1 
ATOM   8916  C  C     . PHE H 2 209 ? 9.757   -14.781 241.368 1.00 44.80  ? 210  PHE D C     1 
ATOM   8917  O  O     . PHE H 2 209 ? 10.092  -15.150 240.244 1.00 48.54  ? 210  PHE D O     1 
ATOM   8918  C  CB    . PHE H 2 209 ? 8.601   -12.620 241.873 1.00 29.81  ? 210  PHE D CB    1 
ATOM   8919  C  CG    . PHE H 2 209 ? 7.816   -12.655 240.580 1.00 39.81  ? 210  PHE D CG    1 
ATOM   8920  C  CD1   . PHE H 2 209 ? 7.266   -13.845 240.110 1.00 36.07  ? 210  PHE D CD1   1 
ATOM   8921  C  CD2   . PHE H 2 209 ? 7.613   -11.490 239.840 1.00 37.97  ? 210  PHE D CD2   1 
ATOM   8922  C  CE1   . PHE H 2 209 ? 6.530   -13.874 238.931 1.00 37.90  ? 210  PHE D CE1   1 
ATOM   8923  C  CE2   . PHE H 2 209 ? 6.880   -11.512 238.660 1.00 30.05  ? 210  PHE D CE2   1 
ATOM   8924  C  CZ    . PHE H 2 209 ? 6.337   -12.705 238.204 1.00 34.30  ? 210  PHE D CZ    1 
ATOM   8925  N  N     . HIS H 2 210 ? 9.213   -15.591 242.267 1.00 55.97  ? 211  HIS D N     1 
ATOM   8926  C  CA    . HIS H 2 210 ? 8.941   -16.991 241.983 1.00 63.30  ? 211  HIS D CA    1 
ATOM   8927  C  C     . HIS H 2 210 ? 7.460   -17.139 241.712 1.00 61.54  ? 211  HIS D C     1 
ATOM   8928  O  O     . HIS H 2 210 ? 6.642   -16.732 242.530 1.00 61.26  ? 211  HIS D O     1 
ATOM   8929  C  CB    . HIS H 2 210 ? 9.322   -17.859 243.179 1.00 75.96  ? 211  HIS D CB    1 
ATOM   8930  C  CG    . HIS H 2 210 ? 10.790  -18.113 243.295 1.00 87.03  ? 211  HIS D CG    1 
ATOM   8931  N  ND1   . HIS H 2 210 ? 11.467  -18.949 242.434 1.00 89.06  ? 211  HIS D ND1   1 
ATOM   8932  C  CD2   . HIS H 2 210 ? 11.715  -17.629 244.158 1.00 86.20  ? 211  HIS D CD2   1 
ATOM   8933  C  CE1   . HIS H 2 210 ? 12.747  -18.971 242.763 1.00 89.46  ? 211  HIS D CE1   1 
ATOM   8934  N  NE2   . HIS H 2 210 ? 12.923  -18.178 243.805 1.00 89.08  ? 211  HIS D NE2   1 
ATOM   8935  N  N     . VAL H 2 211 ? 7.119   -17.724 240.569 1.00 65.05  ? 212  VAL D N     1 
ATOM   8936  C  CA    . VAL H 2 211 ? 5.721   -17.922 240.194 1.00 70.57  ? 212  VAL D CA    1 
ATOM   8937  C  C     . VAL H 2 211 ? 4.891   -18.541 241.332 1.00 73.09  ? 212  VAL D C     1 
ATOM   8938  O  O     . VAL H 2 211 ? 3.689   -18.302 241.433 1.00 75.95  ? 212  VAL D O     1 
ATOM   8939  C  CB    . VAL H 2 211 ? 5.616   -18.813 238.934 1.00 69.19  ? 212  VAL D CB    1 
ATOM   8940  C  CG1   . VAL H 2 211 ? 4.172   -18.887 238.452 1.00 64.20  ? 212  VAL D CG1   1 
ATOM   8941  C  CG2   . VAL H 2 211 ? 6.513   -18.260 237.847 1.00 66.80  ? 212  VAL D CG2   1 
ATOM   8942  N  N     . ARG H 2 212 ? 5.541   -19.323 242.190 1.00 71.49  ? 213  ARG D N     1 
ATOM   8943  C  CA    . ARG H 2 212 ? 4.862   -19.957 243.313 1.00 65.06  ? 213  ARG D CA    1 
ATOM   8944  C  C     . ARG H 2 212 ? 4.708   -19.016 244.508 1.00 65.42  ? 213  ARG D C     1 
ATOM   8945  O  O     . ARG H 2 212 ? 4.447   -19.476 245.614 1.00 68.50  ? 213  ARG D O     1 
ATOM   8946  C  CB    . ARG H 2 212 ? 5.632   -21.192 243.771 1.00 64.59  ? 213  ARG D CB    1 
ATOM   8947  C  CG    . ARG H 2 212 ? 7.037   -20.869 244.270 1.00 78.19  ? 213  ARG D CG    1 
ATOM   8948  C  CD    . ARG H 2 212 ? 7.454   -21.745 245.457 1.00 83.05  ? 213  ARG D CD    1 
ATOM   8949  N  NE    . ARG H 2 212 ? 7.778   -23.122 245.090 1.00 69.99  ? 213  ARG D NE    1 
ATOM   8950  C  CZ    . ARG H 2 212 ? 8.012   -24.084 245.975 1.00 70.56  ? 213  ARG D CZ    1 
ATOM   8951  N  NH1   . ARG H 2 212 ? 7.951   -23.815 247.275 1.00 73.13  ? 213  ARG D NH1   1 
ATOM   8952  N  NH2   . ARG H 2 212 ? 8.311   -25.309 245.562 1.00 70.18  ? 213  ARG D NH2   1 
ATOM   8953  N  N     . ASP H 2 213 ? 4.870   -17.712 244.296 1.00 62.00  ? 214  ASP D N     1 
ATOM   8954  C  CA    . ASP H 2 213 ? 4.760   -16.749 245.387 1.00 60.41  ? 214  ASP D CA    1 
ATOM   8955  C  C     . ASP H 2 213 ? 4.125   -15.428 244.984 1.00 64.40  ? 214  ASP D C     1 
ATOM   8956  O  O     . ASP H 2 213 ? 3.736   -14.636 245.840 1.00 69.04  ? 214  ASP D O     1 
ATOM   8957  C  CB    . ASP H 2 213 ? 6.139   -16.458 245.983 1.00 68.88  ? 214  ASP D CB    1 
ATOM   8958  C  CG    . ASP H 2 213 ? 6.699   -17.624 246.765 1.00 77.45  ? 214  ASP D CG    1 
ATOM   8959  O  OD1   . ASP H 2 213 ? 6.067   -18.035 247.761 1.00 85.03  ? 214  ASP D OD1   1 
ATOM   8960  O  OD2   . ASP H 2 213 ? 7.778   -18.129 246.387 1.00 82.61  ? 214  ASP D OD2   1 
ATOM   8961  N  N     . LEU H 2 214 ? 4.030   -15.180 243.685 1.00 69.39  ? 215  LEU D N     1 
ATOM   8962  C  CA    . LEU H 2 214 ? 3.444   -13.939 243.205 1.00 67.53  ? 215  LEU D CA    1 
ATOM   8963  C  C     . LEU H 2 214 ? 2.015   -13.791 243.707 1.00 70.09  ? 215  LEU D C     1 
ATOM   8964  O  O     . LEU H 2 214 ? 1.198   -14.707 243.589 1.00 65.12  ? 215  LEU D O     1 
ATOM   8965  C  CB    . LEU H 2 214 ? 3.454   -13.897 241.675 1.00 71.53  ? 215  LEU D CB    1 
ATOM   8966  C  CG    . LEU H 2 214 ? 2.950   -12.593 241.047 1.00 75.55  ? 215  LEU D CG    1 
ATOM   8967  C  CD1   . LEU H 2 214 ? 3.972   -11.488 241.292 1.00 71.06  ? 215  LEU D CD1   1 
ATOM   8968  C  CD2   . LEU H 2 214 ? 2.724   -12.784 239.550 1.00 82.15  ? 215  LEU D CD2   1 
ATOM   8969  N  N     . ASP H 2 215 ? 1.727   -12.626 244.273 1.00 75.18  ? 216  ASP D N     1 
ATOM   8970  C  CA    . ASP H 2 215 ? 0.403   -12.333 244.790 1.00 74.44  ? 216  ASP D CA    1 
ATOM   8971  C  C     . ASP H 2 215 ? -0.571  -12.131 243.622 1.00 77.09  ? 216  ASP D C     1 
ATOM   8972  O  O     . ASP H 2 215 ? -0.203  -11.597 242.574 1.00 71.00  ? 216  ASP D O     1 
ATOM   8973  C  CB    . ASP H 2 215 ? 0.463   -11.085 245.683 1.00 73.04  ? 216  ASP D CB    1 
ATOM   8974  C  CG    . ASP H 2 215 ? 1.033   -9.871  244.965 1.00 80.19  ? 216  ASP D CG    1 
ATOM   8975  O  OD1   . ASP H 2 215 ? 0.311   -9.278  244.136 1.00 88.41  ? 216  ASP D OD1   1 
ATOM   8976  O  OD2   . ASP H 2 215 ? 2.204   -9.509  245.222 1.00 82.45  ? 216  ASP D OD2   1 
ATOM   8977  N  N     . GLN H 2 216 ? -1.806  -12.587 243.805 1.00 78.69  ? 217  GLN D N     1 
ATOM   8978  C  CA    . GLN H 2 216 ? -2.844  -12.467 242.790 1.00 72.67  ? 217  GLN D CA    1 
ATOM   8979  C  C     . GLN H 2 216 ? -4.047  -11.774 243.395 1.00 80.81  ? 217  GLN D C     1 
ATOM   8980  O  O     . GLN H 2 216 ? -5.169  -12.273 243.309 1.00 91.79  ? 217  GLN D O     1 
ATOM   8981  C  CB    . GLN H 2 216 ? -3.246  -13.850 242.287 1.00 62.06  ? 217  GLN D CB    1 
ATOM   8982  C  CG    . GLN H 2 216 ? -2.151  -14.512 241.500 1.00 59.58  ? 217  GLN D CG    1 
ATOM   8983  C  CD    . GLN H 2 216 ? -1.818  -13.726 240.251 1.00 62.09  ? 217  GLN D CD    1 
ATOM   8984  O  OE1   . GLN H 2 216 ? -2.499  -13.845 239.235 1.00 54.34  ? 217  GLN D OE1   1 
ATOM   8985  N  NE2   . GLN H 2 216 ? -0.781  -12.892 240.330 1.00 57.77  ? 217  GLN D NE2   1 
ATOM   8986  N  N     . GLY H 2 217 ? -3.805  -10.620 244.009 1.00 81.82  ? 218  GLY D N     1 
ATOM   8987  C  CA    . GLY H 2 217 ? -4.882  -9.887  244.646 1.00 79.73  ? 218  GLY D CA    1 
ATOM   8988  C  C     . GLY H 2 217 ? -5.039  -8.466  244.159 1.00 83.02  ? 218  GLY D C     1 
ATOM   8989  O  O     . GLY H 2 217 ? -4.980  -7.524  244.950 1.00 88.12  ? 218  GLY D O     1 
ATOM   8990  N  N     . PHE H 2 218 ? -5.249  -8.311  242.857 1.00 80.88  ? 219  PHE D N     1 
ATOM   8991  C  CA    . PHE H 2 218 ? -5.425  -6.995  242.263 1.00 78.33  ? 219  PHE D CA    1 
ATOM   8992  C  C     . PHE H 2 218 ? -6.858  -6.879  241.754 1.00 80.91  ? 219  PHE D C     1 
ATOM   8993  O  O     . PHE H 2 218 ? -7.277  -7.645  240.887 1.00 83.40  ? 219  PHE D O     1 
ATOM   8994  C  CB    . PHE H 2 218 ? -4.442  -6.815  241.113 1.00 70.47  ? 219  PHE D CB    1 
ATOM   8995  C  CG    . PHE H 2 218 ? -4.407  -5.427  240.566 1.00 67.72  ? 219  PHE D CG    1 
ATOM   8996  C  CD1   . PHE H 2 218 ? -3.805  -4.402  241.285 1.00 63.31  ? 219  PHE D CD1   1 
ATOM   8997  C  CD2   . PHE H 2 218 ? -4.979  -5.140  239.329 1.00 66.25  ? 219  PHE D CD2   1 
ATOM   8998  C  CE1   . PHE H 2 218 ? -3.769  -3.104  240.781 1.00 69.92  ? 219  PHE D CE1   1 
ATOM   8999  C  CE2   . PHE H 2 218 ? -4.951  -3.846  238.811 1.00 69.28  ? 219  PHE D CE2   1 
ATOM   9000  C  CZ    . PHE H 2 218 ? -4.345  -2.826  239.536 1.00 72.21  ? 219  PHE D CZ    1 
ATOM   9001  N  N     . ASN H 2 219 ? -7.606  -5.922  242.293 1.00 88.19  ? 220  ASN D N     1 
ATOM   9002  C  CA    . ASN H 2 219 ? -8.999  -5.732  241.900 1.00 93.62  ? 220  ASN D CA    1 
ATOM   9003  C  C     . ASN H 2 219 ? -9.203  -4.509  241.005 1.00 94.08  ? 220  ASN D C     1 
ATOM   9004  O  O     . ASN H 2 219 ? -10.268 -4.339  240.408 1.00 95.37  ? 220  ASN D O     1 
ATOM   9005  C  CB    . ASN H 2 219 ? -9.878  -5.607  243.150 1.00 96.47  ? 220  ASN D CB    1 
ATOM   9006  C  CG    . ASN H 2 219 ? -9.624  -6.719  244.163 1.00 96.52  ? 220  ASN D CG    1 
ATOM   9007  O  OD1   . ASN H 2 219 ? -9.707  -7.910  243.840 1.00 92.26  ? 220  ASN D OD1   1 
ATOM   9008  N  ND2   . ASN H 2 219 ? -9.319  -6.330  245.398 1.00 94.04  ? 220  ASN D ND2   1 
ATOM   9009  N  N     . GLY H 2 220 ? -8.181  -3.662  240.915 1.00 94.71  ? 221  GLY D N     1 
ATOM   9010  C  CA    . GLY H 2 220 ? -8.271  -2.463  240.096 1.00 92.19  ? 221  GLY D CA    1 
ATOM   9011  C  C     . GLY H 2 220 ? -8.419  -2.748  238.614 1.00 91.69  ? 221  GLY D C     1 
ATOM   9012  O  O     . GLY H 2 220 ? -8.729  -3.872  238.216 1.00 92.51  ? 221  GLY D O     1 
ATOM   9013  N  N     . THR H 2 221 ? -8.192  -1.731  237.790 1.00 88.40  ? 222  THR D N     1 
ATOM   9014  C  CA    . THR H 2 221 ? -8.314  -1.884  236.346 1.00 83.73  ? 222  THR D CA    1 
ATOM   9015  C  C     . THR H 2 221 ? -6.954  -2.106  235.708 1.00 84.07  ? 222  THR D C     1 
ATOM   9016  O  O     . THR H 2 221 ? -5.929  -2.106  236.391 1.00 88.74  ? 222  THR D O     1 
ATOM   9017  C  CB    . THR H 2 221 ? -8.926  -0.640  235.716 1.00 80.57  ? 222  THR D CB    1 
ATOM   9018  O  OG1   . THR H 2 221 ? -7.916  0.363   235.573 1.00 79.69  ? 222  THR D OG1   1 
ATOM   9019  C  CG2   . THR H 2 221 ? -10.035 -0.098  236.601 1.00 81.53  ? 222  THR D CG2   1 
ATOM   9020  N  N     . ARG H 2 222 ? -6.946  -2.289  234.391 1.00 81.96  ? 223  ARG D N     1 
ATOM   9021  C  CA    . ARG H 2 222 ? -5.700  -2.505  233.671 1.00 78.10  ? 223  ARG D CA    1 
ATOM   9022  C  C     . ARG H 2 222 ? -4.979  -1.184  233.452 1.00 76.48  ? 223  ARG D C     1 
ATOM   9023  O  O     . ARG H 2 222 ? -3.776  -1.080  233.679 1.00 76.47  ? 223  ARG D O     1 
ATOM   9024  C  CB    . ARG H 2 222 ? -5.965  -3.183  232.326 1.00 70.19  ? 223  ARG D CB    1 
ATOM   9025  C  CG    . ARG H 2 222 ? -4.701  -3.530  231.545 1.00 70.11  ? 223  ARG D CG    1 
ATOM   9026  C  CD    . ARG H 2 222 ? -3.692  -4.293  232.406 1.00 63.71  ? 223  ARG D CD    1 
ATOM   9027  N  NE    . ARG H 2 222 ? -4.244  -5.507  233.010 1.00 58.78  ? 223  ARG D NE    1 
ATOM   9028  C  CZ    . ARG H 2 222 ? -4.385  -6.671  232.380 1.00 61.28  ? 223  ARG D CZ    1 
ATOM   9029  N  NH1   . ARG H 2 222 ? -4.015  -6.803  231.114 1.00 44.85  ? 223  ARG D NH1   1 
ATOM   9030  N  NH2   . ARG H 2 222 ? -4.886  -7.715  233.025 1.00 69.34  ? 223  ARG D NH2   1 
ATOM   9031  N  N     . GLU H 2 223 ? -5.719  -0.171  233.014 1.00 80.63  ? 224  GLU D N     1 
ATOM   9032  C  CA    . GLU H 2 223 ? -5.135  1.143   232.770 1.00 80.24  ? 224  GLU D CA    1 
ATOM   9033  C  C     . GLU H 2 223 ? -4.428  1.648   234.025 1.00 81.98  ? 224  GLU D C     1 
ATOM   9034  O  O     . GLU H 2 223 ? -3.410  2.336   233.942 1.00 83.90  ? 224  GLU D O     1 
ATOM   9035  C  CB    . GLU H 2 223 ? -6.227  2.133   232.336 1.00 76.98  ? 224  GLU D CB    1 
ATOM   9036  C  CG    . GLU H 2 223 ? -5.760  3.574   232.098 1.00 74.22  ? 224  GLU D CG    1 
ATOM   9037  C  CD    . GLU H 2 223 ? -6.884  4.480   231.609 1.00 75.49  ? 224  GLU D CD    1 
ATOM   9038  O  OE1   . GLU H 2 223 ? -6.678  5.711   231.520 1.00 68.20  ? 224  GLU D OE1   1 
ATOM   9039  O  OE2   . GLU H 2 223 ? -7.978  3.954   231.308 1.00 76.98  ? 224  GLU D OE2   1 
ATOM   9040  N  N     . GLU H 2 224 ? -4.960  1.290   235.189 1.00 78.31  ? 225  GLU D N     1 
ATOM   9041  C  CA    . GLU H 2 224 ? -4.366  1.725   236.446 1.00 80.36  ? 225  GLU D CA    1 
ATOM   9042  C  C     . GLU H 2 224 ? -3.160  0.864   236.816 1.00 75.23  ? 225  GLU D C     1 
ATOM   9043  O  O     . GLU H 2 224 ? -2.212  1.340   237.445 1.00 66.56  ? 225  GLU D O     1 
ATOM   9044  C  CB    . GLU H 2 224 ? -5.424  1.704   237.558 1.00 87.58  ? 225  GLU D CB    1 
ATOM   9045  C  CG    . GLU H 2 224 ? -6.594  2.661   237.289 1.00 95.60  ? 225  GLU D CG    1 
ATOM   9046  C  CD    . GLU H 2 224 ? -7.679  2.606   238.351 1.00 99.30  ? 225  GLU D CD    1 
ATOM   9047  O  OE1   . GLU H 2 224 ? -8.213  1.502   238.601 1.00 104.16 ? 225  GLU D OE1   1 
ATOM   9048  O  OE2   . GLU H 2 224 ? -8.004  3.669   238.927 1.00 100.25 ? 225  GLU D OE2   1 
ATOM   9049  N  N     . TRP H 2 225 ? -3.192  -0.401  236.410 1.00 73.52  ? 226  TRP D N     1 
ATOM   9050  C  CA    . TRP H 2 225 ? -2.089  -1.310  236.688 1.00 71.02  ? 226  TRP D CA    1 
ATOM   9051  C  C     . TRP H 2 225 ? -0.805  -0.711  236.130 1.00 73.26  ? 226  TRP D C     1 
ATOM   9052  O  O     . TRP H 2 225 ? 0.225   -0.685  236.796 1.00 81.62  ? 226  TRP D O     1 
ATOM   9053  C  CB    . TRP H 2 225 ? -2.323  -2.658  236.020 1.00 61.15  ? 226  TRP D CB    1 
ATOM   9054  C  CG    . TRP H 2 225 ? -1.390  -3.704  236.508 1.00 65.18  ? 226  TRP D CG    1 
ATOM   9055  C  CD1   . TRP H 2 225 ? -1.651  -4.649  237.455 1.00 66.85  ? 226  TRP D CD1   1 
ATOM   9056  C  CD2   . TRP H 2 225 ? -0.026  -3.899  236.111 1.00 65.24  ? 226  TRP D CD2   1 
ATOM   9057  N  NE1   . TRP H 2 225 ? -0.538  -5.421  237.679 1.00 64.91  ? 226  TRP D NE1   1 
ATOM   9058  C  CE2   . TRP H 2 225 ? 0.477   -4.982  236.871 1.00 68.90  ? 226  TRP D CE2   1 
ATOM   9059  C  CE3   . TRP H 2 225 ? 0.823   -3.260  235.197 1.00 60.37  ? 226  TRP D CE3   1 
ATOM   9060  C  CZ2   . TRP H 2 225 ? 1.791   -5.449  236.736 1.00 64.43  ? 226  TRP D CZ2   1 
ATOM   9061  C  CZ3   . TRP H 2 225 ? 2.130   -3.721  235.062 1.00 61.32  ? 226  TRP D CZ3   1 
ATOM   9062  C  CH2   . TRP H 2 225 ? 2.602   -4.807  235.833 1.00 65.91  ? 226  TRP D CH2   1 
ATOM   9063  N  N     . ALA H 2 226 ? -0.881  -0.236  234.893 1.00 75.35  ? 227  ALA D N     1 
ATOM   9064  C  CA    . ALA H 2 226 ? 0.263   0.358   234.220 1.00 72.07  ? 227  ALA D CA    1 
ATOM   9065  C  C     . ALA H 2 226 ? 0.738   1.625   234.914 1.00 73.65  ? 227  ALA D C     1 
ATOM   9066  O  O     . ALA H 2 226 ? 1.889   1.701   235.339 1.00 75.78  ? 227  ALA D O     1 
ATOM   9067  C  CB    . ALA H 2 226 ? -0.093  0.659   232.781 1.00 76.33  ? 227  ALA D CB    1 
ATOM   9068  N  N     . LYS H 2 227 ? -0.144  2.618   235.020 1.00 75.26  ? 228  LYS D N     1 
ATOM   9069  C  CA    . LYS H 2 227 ? 0.196   3.886   235.665 1.00 77.28  ? 228  LYS D CA    1 
ATOM   9070  C  C     . LYS H 2 227 ? 0.791   3.650   237.042 1.00 79.13  ? 228  LYS D C     1 
ATOM   9071  O  O     . LYS H 2 227 ? 1.630   4.426   237.505 1.00 80.68  ? 228  LYS D O     1 
ATOM   9072  C  CB    . LYS H 2 227 ? -1.041  4.783   235.807 1.00 82.49  ? 228  LYS D CB    1 
ATOM   9073  C  CG    . LYS H 2 227 ? -1.515  5.454   234.521 1.00 83.70  ? 228  LYS D CG    1 
ATOM   9074  C  CD    . LYS H 2 227 ? -2.705  6.372   234.795 1.00 81.37  ? 228  LYS D CD    1 
ATOM   9075  C  CE    . LYS H 2 227 ? -3.210  7.041   233.530 1.00 77.41  ? 228  LYS D CE    1 
ATOM   9076  N  NZ    . LYS H 2 227 ? -4.357  7.943   233.808 1.00 74.03  ? 228  LYS D NZ    1 
ATOM   9077  N  N     . SER H 2 228 ? 0.348   2.581   237.701 1.00 75.18  ? 229  SER D N     1 
ATOM   9078  C  CA    . SER H 2 228 ? 0.854   2.251   239.032 1.00 72.66  ? 229  SER D CA    1 
ATOM   9079  C  C     . SER H 2 228 ? 2.310   1.830   238.933 1.00 68.81  ? 229  SER D C     1 
ATOM   9080  O  O     . SER H 2 228 ? 3.163   2.303   239.688 1.00 62.60  ? 229  SER D O     1 
ATOM   9081  C  CB    . SER H 2 228 ? 0.037   1.116   239.651 1.00 72.45  ? 229  SER D CB    1 
ATOM   9082  O  OG    . SER H 2 228 ? -1.298  1.524   239.891 1.00 81.24  ? 229  SER D OG    1 
ATOM   9083  N  N     . TYR H 2 229 ? 2.577   0.936   237.985 1.00 68.43  ? 230  TYR D N     1 
ATOM   9084  C  CA    . TYR H 2 229 ? 3.920   0.426   237.755 1.00 64.71  ? 230  TYR D CA    1 
ATOM   9085  C  C     . TYR H 2 229 ? 4.879   1.552   237.388 1.00 67.10  ? 230  TYR D C     1 
ATOM   9086  O  O     . TYR H 2 229 ? 5.979   1.655   237.939 1.00 58.70  ? 230  TYR D O     1 
ATOM   9087  C  CB    . TYR H 2 229 ? 3.914   -0.603  236.630 1.00 56.47  ? 230  TYR D CB    1 
ATOM   9088  C  CG    . TYR H 2 229 ? 5.293   -1.141  236.360 1.00 56.62  ? 230  TYR D CG    1 
ATOM   9089  C  CD1   . TYR H 2 229 ? 5.909   -2.000  237.267 1.00 51.26  ? 230  TYR D CD1   1 
ATOM   9090  C  CD2   . TYR H 2 229 ? 6.010   -0.747  235.230 1.00 51.89  ? 230  TYR D CD2   1 
ATOM   9091  C  CE1   . TYR H 2 229 ? 7.204   -2.452  237.063 1.00 56.20  ? 230  TYR D CE1   1 
ATOM   9092  C  CE2   . TYR H 2 229 ? 7.311   -1.194  235.015 1.00 58.36  ? 230  TYR D CE2   1 
ATOM   9093  C  CZ    . TYR H 2 229 ? 7.901   -2.045  235.939 1.00 56.11  ? 230  TYR D CZ    1 
ATOM   9094  O  OH    . TYR H 2 229 ? 9.188   -2.480  235.756 1.00 58.11  ? 230  TYR D OH    1 
ATOM   9095  N  N     . LEU H 2 230 ? 4.459   2.385   236.441 1.00 64.85  ? 231  LEU D N     1 
ATOM   9096  C  CA    . LEU H 2 230 ? 5.279   3.504   236.001 1.00 65.44  ? 231  LEU D CA    1 
ATOM   9097  C  C     . LEU H 2 230 ? 5.635   4.369   237.198 1.00 71.32  ? 231  LEU D C     1 
ATOM   9098  O  O     . LEU H 2 230 ? 6.709   4.975   237.250 1.00 73.32  ? 231  LEU D O     1 
ATOM   9099  C  CB    . LEU H 2 230 ? 4.535   4.329   234.953 1.00 57.29  ? 231  LEU D CB    1 
ATOM   9100  C  CG    . LEU H 2 230 ? 4.344   3.638   233.603 1.00 52.64  ? 231  LEU D CG    1 
ATOM   9101  C  CD1   . LEU H 2 230 ? 3.481   4.495   232.706 1.00 59.86  ? 231  LEU D CD1   1 
ATOM   9102  C  CD2   . LEU H 2 230 ? 5.691   3.393   232.962 1.00 56.41  ? 231  LEU D CD2   1 
ATOM   9103  N  N     . LYS H 2 231 ? 4.725   4.419   238.166 1.00 74.84  ? 232  LYS D N     1 
ATOM   9104  C  CA    . LYS H 2 231 ? 4.951   5.198   239.377 1.00 71.33  ? 232  LYS D CA    1 
ATOM   9105  C  C     . LYS H 2 231 ? 6.002   4.478   240.216 1.00 62.82  ? 232  LYS D C     1 
ATOM   9106  O  O     . LYS H 2 231 ? 6.911   5.103   240.761 1.00 63.98  ? 232  LYS D O     1 
ATOM   9107  C  CB    . LYS H 2 231 ? 3.649   5.340   240.167 1.00 71.75  ? 232  LYS D CB    1 
ATOM   9108  N  N     . HIS H 2 232 ? 5.871   3.158   240.306 1.00 51.92  ? 233  HIS D N     1 
ATOM   9109  C  CA    . HIS H 2 232 ? 6.813   2.343   241.065 1.00 57.13  ? 233  HIS D CA    1 
ATOM   9110  C  C     . HIS H 2 232 ? 8.162   2.359   240.365 1.00 59.44  ? 233  HIS D C     1 
ATOM   9111  O  O     . HIS H 2 232 ? 9.213   2.338   241.006 1.00 62.71  ? 233  HIS D O     1 
ATOM   9112  C  CB    . HIS H 2 232 ? 6.323   0.893   241.151 1.00 48.19  ? 233  HIS D CB    1 
ATOM   9113  C  CG    . HIS H 2 232 ? 7.222   -0.007  241.937 1.00 49.87  ? 233  HIS D CG    1 
ATOM   9114  N  ND1   . HIS H 2 232 ? 7.174   -1.379  241.844 1.00 56.77  ? 233  HIS D ND1   1 
ATOM   9115  C  CD2   . HIS H 2 232 ? 8.188   0.269   242.853 1.00 55.86  ? 233  HIS D CD2   1 
ATOM   9116  C  CE1   . HIS H 2 232 ? 8.069   -1.914  242.659 1.00 55.98  ? 233  HIS D CE1   1 
ATOM   9117  N  NE2   . HIS H 2 232 ? 8.695   -0.930  243.282 1.00 57.16  ? 233  HIS D NE2   1 
ATOM   9118  N  N     . PHE H 2 233 ? 8.113   2.396   239.039 1.00 55.11  ? 234  PHE D N     1 
ATOM   9119  C  CA    . PHE H 2 233 ? 9.308   2.391   238.218 1.00 57.49  ? 234  PHE D CA    1 
ATOM   9120  C  C     . PHE H 2 233 ? 10.105  3.683   238.314 1.00 57.71  ? 234  PHE D C     1 
ATOM   9121  O  O     . PHE H 2 233 ? 11.324  3.661   238.508 1.00 53.23  ? 234  PHE D O     1 
ATOM   9122  C  CB    . PHE H 2 233 ? 8.922   2.124   236.761 1.00 63.30  ? 234  PHE D CB    1 
ATOM   9123  C  CG    . PHE H 2 233 ? 10.091  2.059   235.826 1.00 57.94  ? 234  PHE D CG    1 
ATOM   9124  C  CD1   . PHE H 2 233 ? 10.567  3.208   235.202 1.00 57.32  ? 234  PHE D CD1   1 
ATOM   9125  C  CD2   . PHE H 2 233 ? 10.710  0.843   235.562 1.00 59.98  ? 234  PHE D CD2   1 
ATOM   9126  C  CE1   . PHE H 2 233 ? 11.645  3.148   234.321 1.00 61.48  ? 234  PHE D CE1   1 
ATOM   9127  C  CE2   . PHE H 2 233 ? 11.788  0.767   234.684 1.00 60.66  ? 234  PHE D CE2   1 
ATOM   9128  C  CZ    . PHE H 2 233 ? 12.256  1.923   234.061 1.00 64.10  ? 234  PHE D CZ    1 
ATOM   9129  N  N     . VAL H 2 234 ? 9.414   4.808   238.173 1.00 52.67  ? 235  VAL D N     1 
ATOM   9130  C  CA    . VAL H 2 234 ? 10.075  6.100   238.245 1.00 53.35  ? 235  VAL D CA    1 
ATOM   9131  C  C     . VAL H 2 234 ? 10.667  6.337   239.632 1.00 55.82  ? 235  VAL D C     1 
ATOM   9132  O  O     . VAL H 2 234 ? 11.752  6.898   239.759 1.00 59.27  ? 235  VAL D O     1 
ATOM   9133  C  CB    . VAL H 2 234 ? 9.096   7.239   237.898 1.00 48.83  ? 235  VAL D CB    1 
ATOM   9134  C  CG1   . VAL H 2 234 ? 9.742   8.585   238.164 1.00 45.61  ? 235  VAL D CG1   1 
ATOM   9135  C  CG2   . VAL H 2 234 ? 8.688   7.138   236.448 1.00 44.89  ? 235  VAL D CG2   1 
ATOM   9136  N  N     . THR H 2 235 ? 9.953   5.900   240.666 1.00 58.40  ? 236  THR D N     1 
ATOM   9137  C  CA    . THR H 2 235 ? 10.408  6.071   242.044 1.00 61.07  ? 236  THR D CA    1 
ATOM   9138  C  C     . THR H 2 235 ? 11.627  5.205   242.319 1.00 57.98  ? 236  THR D C     1 
ATOM   9139  O  O     . THR H 2 235 ? 12.657  5.687   242.793 1.00 51.09  ? 236  THR D O     1 
ATOM   9140  C  CB    . THR H 2 235 ? 9.298   5.696   243.043 1.00 66.42  ? 236  THR D CB    1 
ATOM   9141  O  OG1   . THR H 2 235 ? 8.187   6.580   242.866 1.00 78.62  ? 236  THR D OG1   1 
ATOM   9142  C  CG2   . THR H 2 235 ? 9.803   5.806   244.474 1.00 67.54  ? 236  THR D CG2   1 
ATOM   9143  N  N     . GLN H 2 236 ? 11.491  3.919   242.027 1.00 56.37  ? 237  GLN D N     1 
ATOM   9144  C  CA    . GLN H 2 236 ? 12.577  2.977   242.209 1.00 56.96  ? 237  GLN D CA    1 
ATOM   9145  C  C     . GLN H 2 236 ? 13.814  3.489   241.487 1.00 57.44  ? 237  GLN D C     1 
ATOM   9146  O  O     . GLN H 2 236 ? 14.920  3.418   242.009 1.00 54.37  ? 237  GLN D O     1 
ATOM   9147  C  CB    . GLN H 2 236 ? 12.175  1.618   241.652 1.00 56.48  ? 237  GLN D CB    1 
ATOM   9148  C  CG    . GLN H 2 236 ? 11.250  0.876   242.562 1.00 55.08  ? 237  GLN D CG    1 
ATOM   9149  C  CD    . GLN H 2 236 ? 11.868  0.663   243.922 1.00 61.83  ? 237  GLN D CD    1 
ATOM   9150  O  OE1   . GLN H 2 236 ? 12.104  1.616   244.665 1.00 54.58  ? 237  GLN D OE1   1 
ATOM   9151  N  NE2   . GLN H 2 236 ? 12.149  -0.596  244.253 1.00 70.09  ? 237  GLN D NE2   1 
ATOM   9152  N  N     . ALA H 2 237 ? 13.612  4.012   240.284 1.00 58.52  ? 238  ALA D N     1 
ATOM   9153  C  CA    . ALA H 2 237 ? 14.707  4.545   239.492 1.00 63.67  ? 238  ALA D CA    1 
ATOM   9154  C  C     . ALA H 2 237 ? 15.462  5.561   240.331 1.00 67.79  ? 238  ALA D C     1 
ATOM   9155  O  O     . ALA H 2 237 ? 16.686  5.490   240.472 1.00 66.27  ? 238  ALA D O     1 
ATOM   9156  C  CB    . ALA H 2 237 ? 14.167  5.205   238.228 1.00 61.17  ? 238  ALA D CB    1 
ATOM   9157  N  N     . GLU H 2 238 ? 14.717  6.512   240.884 1.00 73.91  ? 239  GLU D N     1 
ATOM   9158  C  CA    . GLU H 2 238 ? 15.290  7.552   241.726 1.00 80.20  ? 239  GLU D CA    1 
ATOM   9159  C  C     . GLU H 2 238 ? 16.007  6.904   242.911 1.00 81.13  ? 239  GLU D C     1 
ATOM   9160  O  O     . GLU H 2 238 ? 17.077  7.353   243.324 1.00 84.19  ? 239  GLU D O     1 
ATOM   9161  C  CB    . GLU H 2 238 ? 14.182  8.497   242.219 1.00 83.76  ? 239  GLU D CB    1 
ATOM   9162  C  CG    . GLU H 2 238 ? 13.559  9.378   241.130 1.00 79.71  ? 239  GLU D CG    1 
ATOM   9163  C  CD    . GLU H 2 238 ? 12.340  10.155  241.618 1.00 83.01  ? 239  GLU D CD    1 
ATOM   9164  O  OE1   . GLU H 2 238 ? 11.918  11.109  240.929 1.00 80.35  ? 239  GLU D OE1   1 
ATOM   9165  O  OE2   . GLU H 2 238 ? 11.796  9.803   242.689 1.00 81.44  ? 239  GLU D OE2   1 
ATOM   9166  N  N     . GLN H 2 239 ? 15.424  5.836   243.444 1.00 78.89  ? 240  GLN D N     1 
ATOM   9167  C  CA    . GLN H 2 239 ? 16.026  5.139   244.574 1.00 84.27  ? 240  GLN D CA    1 
ATOM   9168  C  C     . GLN H 2 239 ? 17.413  4.613   244.198 1.00 82.43  ? 240  GLN D C     1 
ATOM   9169  O  O     . GLN H 2 239 ? 18.409  4.946   244.844 1.00 79.59  ? 240  GLN D O     1 
ATOM   9170  C  CB    . GLN H 2 239 ? 15.126  3.983   245.016 1.00 87.89  ? 240  GLN D CB    1 
ATOM   9171  C  CG    . GLN H 2 239 ? 13.668  4.375   245.242 1.00 93.24  ? 240  GLN D CG    1 
ATOM   9172  C  CD    . GLN H 2 239 ? 13.507  5.516   246.231 1.00 93.37  ? 240  GLN D CD    1 
ATOM   9173  O  OE1   . GLN H 2 239 ? 14.087  5.494   247.314 1.00 94.29  ? 240  GLN D OE1   1 
ATOM   9174  N  NE2   . GLN H 2 239 ? 12.707  6.513   245.867 1.00 91.72  ? 240  GLN D NE2   1 
ATOM   9175  N  N     . ARG H 2 240 ? 17.465  3.798   243.147 1.00 82.22  ? 241  ARG D N     1 
ATOM   9176  C  CA    . ARG H 2 240 ? 18.715  3.214   242.653 1.00 80.37  ? 241  ARG D CA    1 
ATOM   9177  C  C     . ARG H 2 240 ? 19.796  4.272   242.467 1.00 78.40  ? 241  ARG D C     1 
ATOM   9178  O  O     . ARG H 2 240 ? 20.909  4.131   242.980 1.00 73.11  ? 241  ARG D O     1 
ATOM   9179  C  CB    . ARG H 2 240 ? 18.467  2.502   241.318 1.00 76.94  ? 241  ARG D CB    1 
ATOM   9180  C  CG    . ARG H 2 240 ? 19.709  1.905   240.663 1.00 70.87  ? 241  ARG D CG    1 
ATOM   9181  C  CD    . ARG H 2 240 ? 20.355  0.827   241.526 1.00 71.55  ? 241  ARG D CD    1 
ATOM   9182  N  NE    . ARG H 2 240 ? 21.391  0.097   240.796 1.00 62.91  ? 241  ARG D NE    1 
ATOM   9183  C  CZ    . ARG H 2 240 ? 22.138  -0.869  241.321 1.00 58.30  ? 241  ARG D CZ    1 
ATOM   9184  N  NH1   . ARG H 2 240 ? 21.972  -1.228  242.588 1.00 57.21  ? 241  ARG D NH1   1 
ATOM   9185  N  NH2   . ARG H 2 240 ? 23.046  -1.477  240.577 1.00 49.42  ? 241  ARG D NH2   1 
ATOM   9186  N  N     . ALA H 2 241 ? 19.455  5.325   241.726 1.00 77.66  ? 242  ALA D N     1 
ATOM   9187  C  CA    . ALA H 2 241 ? 20.381  6.418   241.458 1.00 77.37  ? 242  ALA D CA    1 
ATOM   9188  C  C     . ALA H 2 241 ? 21.053  6.844   242.754 1.00 75.87  ? 242  ALA D C     1 
ATOM   9189  O  O     . ALA H 2 241 ? 22.277  6.888   242.848 1.00 75.11  ? 242  ALA D O     1 
ATOM   9190  C  CB    . ALA H 2 241 ? 19.635  7.592   240.844 1.00 72.40  ? 242  ALA D CB    1 
ATOM   9191  N  N     . ILE H 2 242 ? 20.239  7.145   243.758 1.00 77.45  ? 243  ILE D N     1 
ATOM   9192  C  CA    . ILE H 2 242 ? 20.750  7.564   245.055 1.00 76.63  ? 243  ILE D CA    1 
ATOM   9193  C  C     . ILE H 2 242 ? 21.570  6.448   245.695 1.00 74.39  ? 243  ILE D C     1 
ATOM   9194  O  O     . ILE H 2 242 ? 22.659  6.688   246.207 1.00 77.03  ? 243  ILE D O     1 
ATOM   9195  C  CB    . ILE H 2 242 ? 19.591  7.951   246.007 1.00 75.93  ? 243  ILE D CB    1 
ATOM   9196  C  CG1   . ILE H 2 242 ? 18.856  9.180   245.455 1.00 76.84  ? 243  ILE D CG1   1 
ATOM   9197  C  CG2   . ILE H 2 242 ? 20.129  8.222   247.401 1.00 74.00  ? 243  ILE D CG2   1 
ATOM   9198  C  CD1   . ILE H 2 242 ? 17.607  9.565   246.226 1.00 73.82  ? 243  ILE D CD1   1 
ATOM   9199  N  N     . SER H 2 243 ? 21.047  5.227   245.652 1.00 72.03  ? 244  SER D N     1 
ATOM   9200  C  CA    . SER H 2 243 ? 21.727  4.089   246.248 1.00 75.58  ? 244  SER D CA    1 
ATOM   9201  C  C     . SER H 2 243 ? 22.986  3.680   245.486 1.00 79.19  ? 244  SER D C     1 
ATOM   9202  O  O     . SER H 2 243 ? 23.700  2.762   245.898 1.00 81.04  ? 244  SER D O     1 
ATOM   9203  C  CB    . SER H 2 243 ? 20.768  2.899   246.338 1.00 76.42  ? 244  SER D CB    1 
ATOM   9204  O  OG    . SER H 2 243 ? 21.356  1.809   247.032 1.00 79.83  ? 244  SER D OG    1 
ATOM   9205  N  N     . MET H 2 244 ? 23.265  4.351   244.376 1.00 77.53  ? 245  MET D N     1 
ATOM   9206  C  CA    . MET H 2 244 ? 24.450  4.013   243.598 1.00 79.96  ? 245  MET D CA    1 
ATOM   9207  C  C     . MET H 2 244 ? 25.680  4.790   244.036 1.00 80.26  ? 245  MET D C     1 
ATOM   9208  O  O     . MET H 2 244 ? 26.768  4.224   244.149 1.00 77.30  ? 245  MET D O     1 
ATOM   9209  C  CB    . MET H 2 244 ? 24.206  4.247   242.102 1.00 81.20  ? 245  MET D CB    1 
ATOM   9210  C  CG    . MET H 2 244 ? 23.630  3.048   241.360 1.00 72.56  ? 245  MET D CG    1 
ATOM   9211  S  SD    . MET H 2 244 ? 23.533  3.345   239.585 1.00 72.00  ? 245  MET D SD    1 
ATOM   9212  C  CE    . MET H 2 244 ? 25.191  2.950   239.106 1.00 66.10  ? 245  MET D CE    1 
ATOM   9213  N  N     . ILE H 2 245 ? 25.510  6.087   244.275 1.00 81.80  ? 246  ILE D N     1 
ATOM   9214  C  CA    . ILE H 2 245 ? 26.626  6.924   244.695 1.00 90.16  ? 246  ILE D CA    1 
ATOM   9215  C  C     . ILE H 2 245 ? 26.977  6.704   246.156 1.00 90.30  ? 246  ILE D C     1 
ATOM   9216  O  O     . ILE H 2 245 ? 28.062  7.071   246.604 1.00 89.39  ? 246  ILE D O     1 
ATOM   9217  C  CB    . ILE H 2 245 ? 26.332  8.429   244.488 1.00 94.45  ? 246  ILE D CB    1 
ATOM   9218  C  CG1   . ILE H 2 245 ? 25.077  8.839   245.262 1.00 95.65  ? 246  ILE D CG1   1 
ATOM   9219  C  CG2   . ILE H 2 245 ? 26.184  8.726   243.005 1.00 101.42 ? 246  ILE D CG2   1 
ATOM   9220  C  CD1   . ILE H 2 245 ? 24.778  10.326  245.195 1.00 93.20  ? 246  ILE D CD1   1 
ATOM   9221  N  N     . ASP H 2 246 ? 26.057  6.092   246.892 1.00 92.91  ? 247  ASP D N     1 
ATOM   9222  C  CA    . ASP H 2 246 ? 26.273  5.832   248.308 1.00 95.12  ? 247  ASP D CA    1 
ATOM   9223  C  C     . ASP H 2 246 ? 26.753  4.406   248.548 1.00 90.63  ? 247  ASP D C     1 
ATOM   9224  O  O     . ASP H 2 246 ? 27.114  4.043   249.666 1.00 95.57  ? 247  ASP D O     1 
ATOM   9225  C  CB    . ASP H 2 246 ? 24.979  6.095   249.089 1.00 104.80 ? 247  ASP D CB    1 
ATOM   9226  N  N     . LYS H 2 247 ? 26.773  3.598   247.497 1.00 82.45  ? 248  LYS D N     1 
ATOM   9227  C  CA    . LYS H 2 247 ? 27.209  2.218   247.636 1.00 76.00  ? 248  LYS D CA    1 
ATOM   9228  C  C     . LYS H 2 247 ? 28.350  1.915   246.667 1.00 77.78  ? 248  LYS D C     1 
ATOM   9229  O  O     . LYS H 2 247 ? 29.035  0.897   246.791 1.00 76.09  ? 248  LYS D O     1 
ATOM   9230  C  CB    . LYS H 2 247 ? 26.019  1.279   247.389 1.00 71.22  ? 248  LYS D CB    1 
ATOM   9231  C  CG    . LYS H 2 247 ? 26.135  -0.080  248.058 1.00 60.22  ? 248  LYS D CG    1 
ATOM   9232  C  CD    . LYS H 2 247 ? 26.615  -1.153  247.110 1.00 61.01  ? 248  LYS D CD    1 
ATOM   9233  C  CE    . LYS H 2 247 ? 27.125  -2.354  247.892 1.00 75.27  ? 248  LYS D CE    1 
ATOM   9234  N  NZ    . LYS H 2 247 ? 27.212  -3.607  247.083 1.00 73.38  ? 248  LYS D NZ    1 
ATOM   9235  N  N     . PHE H 2 248 ? 28.559  2.818   245.712 1.00 78.61  ? 249  PHE D N     1 
ATOM   9236  C  CA    . PHE H 2 248 ? 29.609  2.658   244.711 1.00 77.92  ? 249  PHE D CA    1 
ATOM   9237  C  C     . PHE H 2 248 ? 30.576  3.845   244.693 1.00 79.43  ? 249  PHE D C     1 
ATOM   9238  O  O     . PHE H 2 248 ? 31.792  3.667   244.642 1.00 78.40  ? 249  PHE D O     1 
ATOM   9239  C  CB    . PHE H 2 248 ? 28.981  2.486   243.321 1.00 74.15  ? 249  PHE D CB    1 
ATOM   9240  C  CG    . PHE H 2 248 ? 28.079  1.284   243.199 1.00 65.53  ? 249  PHE D CG    1 
ATOM   9241  C  CD1   . PHE H 2 248 ? 28.570  0.000   243.415 1.00 63.22  ? 249  PHE D CD1   1 
ATOM   9242  C  CD2   . PHE H 2 248 ? 26.745  1.432   242.851 1.00 64.91  ? 249  PHE D CD2   1 
ATOM   9243  C  CE1   . PHE H 2 248 ? 27.745  -1.120  243.283 1.00 54.83  ? 249  PHE D CE1   1 
ATOM   9244  C  CE2   . PHE H 2 248 ? 25.914  0.316   242.718 1.00 67.83  ? 249  PHE D CE2   1 
ATOM   9245  C  CZ    . PHE H 2 248 ? 26.420  -0.961  242.935 1.00 54.85  ? 249  PHE D CZ    1 
ATOM   9246  N  N     . VAL H 2 249 ? 30.026  5.054   244.734 1.00 79.52  ? 250  VAL D N     1 
ATOM   9247  C  CA    . VAL H 2 249 ? 30.835  6.266   244.715 1.00 81.55  ? 250  VAL D CA    1 
ATOM   9248  C  C     . VAL H 2 249 ? 31.491  6.546   246.066 1.00 88.62  ? 250  VAL D C     1 
ATOM   9249  O  O     . VAL H 2 249 ? 32.670  6.251   246.266 1.00 92.89  ? 250  VAL D O     1 
ATOM   9250  C  CB    . VAL H 2 249 ? 29.982  7.493   244.327 1.00 78.83  ? 250  VAL D CB    1 
ATOM   9251  C  CG1   . VAL H 2 249 ? 30.825  8.758   244.380 1.00 79.85  ? 250  VAL D CG1   1 
ATOM   9252  C  CG2   . VAL H 2 249 ? 29.402  7.298   242.941 1.00 80.78  ? 250  VAL D CG2   1 
ATOM   9253  N  N     . LYS H 2 250 ? 30.717  7.112   246.989 1.00 86.35  ? 251  LYS D N     1 
ATOM   9254  C  CA    . LYS H 2 250 ? 31.207  7.456   248.324 1.00 76.63  ? 251  LYS D CA    1 
ATOM   9255  C  C     . LYS H 2 250 ? 32.153  6.420   248.929 1.00 74.56  ? 251  LYS D C     1 
ATOM   9256  O  O     . LYS H 2 250 ? 33.214  6.767   249.445 1.00 72.32  ? 251  LYS D O     1 
ATOM   9257  C  CB    . LYS H 2 250 ? 30.026  7.683   249.273 1.00 61.72  ? 251  LYS D CB    1 
ATOM   9258  N  N     . PRO H 2 251 ? 31.783  5.132   248.869 1.00 74.92  ? 252  PRO D N     1 
ATOM   9259  C  CA    . PRO H 2 251 ? 32.631  4.074   249.431 1.00 74.58  ? 252  PRO D CA    1 
ATOM   9260  C  C     . PRO H 2 251 ? 34.097  4.107   248.991 1.00 74.42  ? 252  PRO D C     1 
ATOM   9261  O  O     . PRO H 2 251 ? 35.005  4.062   249.821 1.00 75.59  ? 252  PRO D O     1 
ATOM   9262  C  CB    . PRO H 2 251 ? 31.920  2.795   248.991 1.00 73.63  ? 252  PRO D CB    1 
ATOM   9263  C  CG    . PRO H 2 251 ? 30.476  3.208   248.981 1.00 75.92  ? 252  PRO D CG    1 
ATOM   9264  C  CD    . PRO H 2 251 ? 30.539  4.566   248.312 1.00 75.95  ? 252  PRO D CD    1 
ATOM   9265  N  N     . PHE H 2 252 ? 34.326  4.185   247.687 1.00 79.21  ? 253  PHE D N     1 
ATOM   9266  C  CA    . PHE H 2 252 ? 35.684  4.204   247.161 1.00 77.28  ? 253  PHE D CA    1 
ATOM   9267  C  C     . PHE H 2 252 ? 36.192  5.637   246.976 1.00 81.22  ? 253  PHE D C     1 
ATOM   9268  O  O     . PHE H 2 252 ? 37.322  5.855   246.541 1.00 75.84  ? 253  PHE D O     1 
ATOM   9269  C  CB    . PHE H 2 252 ? 35.738  3.443   245.826 1.00 68.96  ? 253  PHE D CB    1 
ATOM   9270  C  CG    . PHE H 2 252 ? 35.220  2.024   245.903 1.00 68.35  ? 253  PHE D CG    1 
ATOM   9271  C  CD1   . PHE H 2 252 ? 33.851  1.759   245.857 1.00 65.07  ? 253  PHE D CD1   1 
ATOM   9272  C  CD2   . PHE H 2 252 ? 36.101  0.952   246.030 1.00 71.07  ? 253  PHE D CD2   1 
ATOM   9273  C  CE1   . PHE H 2 252 ? 33.368  0.450   245.937 1.00 57.09  ? 253  PHE D CE1   1 
ATOM   9274  C  CE2   . PHE H 2 252 ? 35.629  -0.364  246.111 1.00 68.56  ? 253  PHE D CE2   1 
ATOM   9275  C  CZ    . PHE H 2 252 ? 34.258  -0.613  246.064 1.00 61.68  ? 253  PHE D CZ    1 
ATOM   9276  N  N     . LYS H 2 253 ? 35.359  6.613   247.328 1.00 86.89  ? 254  LYS D N     1 
ATOM   9277  C  CA    . LYS H 2 253 ? 35.721  8.022   247.188 1.00 93.85  ? 254  LYS D CA    1 
ATOM   9278  C  C     . LYS H 2 253 ? 36.967  8.373   248.010 1.00 100.10 ? 254  LYS D C     1 
ATOM   9279  O  O     . LYS H 2 253 ? 37.427  9.517   248.000 1.00 102.22 ? 254  LYS D O     1 
ATOM   9280  C  CB    . LYS H 2 253 ? 34.540  8.906   247.615 1.00 92.43  ? 254  LYS D CB    1 
ATOM   9281  C  CG    . LYS H 2 253 ? 34.552  10.330  247.053 1.00 86.26  ? 254  LYS D CG    1 
ATOM   9282  C  CD    . LYS H 2 253 ? 34.493  10.339  245.526 1.00 80.03  ? 254  LYS D CD    1 
ATOM   9283  C  CE    . LYS H 2 253 ? 33.749  11.560  245.007 1.00 75.33  ? 254  LYS D CE    1 
ATOM   9284  N  NZ    . LYS H 2 253 ? 34.268  12.829  245.583 1.00 73.74  ? 254  LYS D NZ    1 
ATOM   9285  N  N     . LYS H 2 254 ? 37.509  7.378   248.712 1.00 105.25 ? 255  LYS D N     1 
ATOM   9286  C  CA    . LYS H 2 254 ? 38.701  7.559   249.545 1.00 105.51 ? 255  LYS D CA    1 
ATOM   9287  C  C     . LYS H 2 254 ? 39.961  7.068   248.837 1.00 105.63 ? 255  LYS D C     1 
ATOM   9288  O  O     . LYS H 2 254 ? 40.855  6.504   249.469 1.00 105.29 ? 255  LYS D O     1 
ATOM   9289  C  CB    . LYS H 2 254 ? 38.539  6.805   250.870 1.00 103.48 ? 255  LYS D CB    1 
ATOM   9290  N  N     . TYR H 2 255 ? 40.026  7.288   247.526 1.00 105.20 ? 256  TYR D N     1 
ATOM   9291  C  CA    . TYR H 2 255 ? 41.174  6.869   246.724 1.00 106.27 ? 256  TYR D CA    1 
ATOM   9292  C  C     . TYR H 2 255 ? 41.486  7.904   245.647 1.00 106.96 ? 256  TYR D C     1 
ATOM   9293  O  O     . TYR H 2 255 ? 42.482  7.790   244.935 1.00 106.27 ? 256  TYR D O     1 
ATOM   9294  C  CB    . TYR H 2 255 ? 40.893  5.515   246.066 1.00 104.65 ? 256  TYR D CB    1 
ATOM   9295  C  CG    . TYR H 2 255 ? 40.723  4.372   247.043 1.00 102.60 ? 256  TYR D CG    1 
ATOM   9296  C  CD1   . TYR H 2 255 ? 41.827  3.671   247.530 1.00 98.51  ? 256  TYR D CD1   1 
ATOM   9297  C  CD2   . TYR H 2 255 ? 39.455  3.994   247.488 1.00 103.14 ? 256  TYR D CD2   1 
ATOM   9298  C  CE1   . TYR H 2 255 ? 41.672  2.619   248.433 1.00 93.35  ? 256  TYR D CE1   1 
ATOM   9299  C  CE2   . TYR H 2 255 ? 39.290  2.946   248.391 1.00 98.90  ? 256  TYR D CE2   1 
ATOM   9300  C  CZ    . TYR H 2 255 ? 40.401  2.264   248.857 1.00 95.57  ? 256  TYR D CZ    1 
ATOM   9301  O  OH    . TYR H 2 255 ? 40.235  1.223   249.737 1.00 90.51  ? 256  TYR D OH    1 
HETATM 9302  CA CA    . CA  I 3 .   ? 33.579  43.327  202.943 1.00 72.13  ? 805  CA  F CA    1 
HETATM 9303  CA CA    . CA  J 3 .   ? 16.262  -15.890 255.394 0.50 31.78  ? 806  CA  H CA    1 
HETATM 9304  CA CA    . CA  K 3 .   ? 16.335  21.506  197.985 1.00 19.42  ? 801  CA  A CA    1 
HETATM 9305  NA NA    . NA  L 4 .   ? 16.674  23.726  202.914 1.00 38.83  ? 901  NA  A NA    1 
HETATM 9306  CA CA    . CA  M 3 .   ? 38.714  20.172  197.868 1.00 37.14  ? 802  CA  B CA    1 
HETATM 9307  NA NA    . NA  N 4 .   ? 38.768  20.211  203.241 1.00 23.67  ? 902  NA  B NA    1 
HETATM 9308  CA CA    . CA  O 3 .   ? 34.049  -17.915 231.723 1.00 49.05  ? 803  CA  C CA    1 
HETATM 9309  NA NA    . NA  P 4 .   ? 32.993  -13.109 234.405 1.00 72.47  ? 903  NA  C NA    1 
HETATM 9310  CA CA    . CA  Q 3 .   ? 11.541  -18.394 230.007 1.00 43.44  ? 804  CA  D CA    1 
HETATM 9311  NA NA    . NA  R 4 .   ? 11.435  -13.586 230.730 1.00 62.39  ? 904  NA  D NA    1 
HETATM 9312  O  O     . HOH S 5 .   ? 24.125  41.702  193.554 1.00 43.92  ? 99   HOH E O     1 
HETATM 9313  O  O     . HOH S 5 .   ? 24.320  36.774  193.739 1.00 47.24  ? 100  HOH E O     1 
HETATM 9314  O  O     . HOH S 5 .   ? 15.222  48.518  214.434 1.00 42.47  ? 116  HOH E O     1 
HETATM 9315  O  O     . HOH S 5 .   ? 34.664  12.470  215.863 1.00 44.22  ? 148  HOH E O     1 
HETATM 9316  O  O     . HOH S 5 .   ? 27.202  14.813  222.137 1.00 45.35  ? 202  HOH E O     1 
HETATM 9317  O  O     . HOH S 5 .   ? 13.140  44.915  209.869 1.00 36.62  ? 224  HOH E O     1 
HETATM 9318  O  O     . HOH S 5 .   ? 13.857  41.349  207.173 1.00 42.92  ? 225  HOH E O     1 
HETATM 9319  O  O     . HOH S 5 .   ? 12.842  47.800  210.844 1.00 46.65  ? 226  HOH E O     1 
HETATM 9320  O  O     . HOH S 5 .   ? 16.874  37.559  205.214 1.00 41.90  ? 227  HOH E O     1 
HETATM 9321  O  O     . HOH S 5 .   ? 37.472  21.940  199.236 1.00 35.25  ? 244  HOH E O     1 
HETATM 9322  O  O     . HOH S 5 .   ? 29.286  23.865  205.807 1.00 10.95  ? 300  HOH E O     1 
HETATM 9323  O  O     . HOH S 5 .   ? 25.544  35.488  200.313 1.00 35.92  ? 323  HOH E O     1 
HETATM 9324  O  O     . HOH S 5 .   ? 27.624  17.153  219.577 1.00 50.62  ? 330  HOH E O     1 
HETATM 9325  O  O     . HOH S 5 .   ? 15.674  8.182   222.721 1.00 37.73  ? 397  HOH E O     1 
HETATM 9326  O  O     . HOH S 5 .   ? 15.731  7.449   217.216 1.00 41.97  ? 399  HOH E O     1 
HETATM 9327  O  O     . HOH S 5 .   ? 25.100  29.510  200.732 1.00 30.73  ? 406  HOH E O     1 
HETATM 9328  O  O     . HOH S 5 .   ? 23.808  39.456  195.616 1.00 33.06  ? 409  HOH E O     1 
HETATM 9329  O  O     . HOH S 5 .   ? 22.919  42.125  207.434 1.00 51.29  ? 410  HOH E O     1 
HETATM 9330  O  O     . HOH S 5 .   ? 30.514  0.160   213.827 1.00 35.11  ? 421  HOH E O     1 
HETATM 9331  O  O     . HOH S 5 .   ? 33.200  18.741  210.475 1.00 11.35  ? 492  HOH E O     1 
HETATM 9332  O  O     . HOH S 5 .   ? 36.146  13.132  213.386 1.00 32.68  ? 493  HOH E O     1 
HETATM 9333  O  O     . HOH S 5 .   ? 30.898  11.037  211.122 1.00 58.05  ? 571  HOH E O     1 
HETATM 9334  O  O     . HOH S 5 .   ? 26.421  18.879  215.573 1.00 47.65  ? 574  HOH E O     1 
HETATM 9335  O  O     . HOH S 5 .   ? 25.071  36.507  203.381 1.00 26.03  ? 575  HOH E O     1 
HETATM 9336  O  O     . HOH S 5 .   ? 25.571  0.451   213.530 1.00 30.73  ? 584  HOH E O     1 
HETATM 9337  O  O     . HOH S 5 .   ? 32.838  11.747  214.217 1.00 49.75  ? 590  HOH E O     1 
HETATM 9338  O  O     . HOH S 5 .   ? 29.376  12.432  216.676 1.00 29.65  ? 591  HOH E O     1 
HETATM 9339  O  O     . HOH S 5 .   ? 28.823  10.984  214.737 1.00 63.79  ? 592  HOH E O     1 
HETATM 9340  O  O     . HOH S 5 .   ? 25.200  -0.295  210.797 1.00 46.52  ? 593  HOH E O     1 
HETATM 9341  O  O     . HOH S 5 .   ? 28.324  0.546   212.033 1.00 46.05  ? 594  HOH E O     1 
HETATM 9342  O  O     . HOH S 5 .   ? 36.113  23.954  199.833 1.00 31.51  ? 615  HOH E O     1 
HETATM 9343  O  O     . HOH S 5 .   ? 22.136  3.245   222.179 1.00 44.60  ? 669  HOH E O     1 
HETATM 9344  O  O     . HOH T 5 .   ? 17.907  20.283  198.945 1.00 38.46  ? 806  HOH F O     1 
HETATM 9345  O  O     . HOH T 5 .   ? 33.586  42.946  212.121 1.00 34.74  ? 807  HOH F O     1 
HETATM 9346  O  O     . HOH T 5 .   ? 44.522  37.109  212.872 1.00 43.68  ? 808  HOH F O     1 
HETATM 9347  O  O     . HOH T 5 .   ? 36.440  36.005  216.375 1.00 56.44  ? 809  HOH F O     1 
HETATM 9348  O  O     . HOH T 5 .   ? 27.281  33.254  216.746 1.00 36.01  ? 810  HOH F O     1 
HETATM 9349  O  O     . HOH T 5 .   ? 40.969  4.329   216.307 1.00 43.22  ? 811  HOH F O     1 
HETATM 9350  O  O     . HOH T 5 .   ? 29.248  40.003  210.199 1.00 53.73  ? 812  HOH F O     1 
HETATM 9351  O  O     . HOH T 5 .   ? 31.568  0.957   206.856 1.00 62.63  ? 813  HOH F O     1 
HETATM 9352  O  O     . HOH T 5 .   ? 45.323  38.979  207.971 1.00 41.94  ? 814  HOH F O     1 
HETATM 9353  O  O     . HOH T 5 .   ? 42.010  37.441  213.931 1.00 46.16  ? 815  HOH F O     1 
HETATM 9354  O  O     . HOH T 5 .   ? 26.041  21.335  206.126 1.00 24.66  ? 816  HOH F O     1 
HETATM 9355  O  O     . HOH T 5 .   ? 19.193  35.097  205.980 1.00 44.27  ? 817  HOH F O     1 
HETATM 9356  O  O     . HOH T 5 .   ? 30.243  13.930  203.751 1.00 55.05  ? 818  HOH F O     1 
HETATM 9357  O  O     . HOH T 5 .   ? 28.792  2.888   202.208 1.00 49.22  ? 819  HOH F O     1 
HETATM 9358  O  O     . HOH T 5 .   ? 24.438  32.999  204.217 1.00 37.68  ? 820  HOH F O     1 
HETATM 9359  O  O     . HOH T 5 .   ? 46.556  44.264  207.610 1.00 33.24  ? 821  HOH F O     1 
HETATM 9360  O  O     . HOH T 5 .   ? 40.675  43.132  200.843 1.00 21.24  ? 822  HOH F O     1 
HETATM 9361  O  O     . HOH T 5 .   ? 37.439  42.193  201.327 1.00 26.44  ? 823  HOH F O     1 
HETATM 9362  O  O     . HOH T 5 .   ? 29.014  10.475  206.700 1.00 33.78  ? 824  HOH F O     1 
HETATM 9363  O  O     . HOH T 5 .   ? 38.018  2.766   218.089 1.00 35.23  ? 825  HOH F O     1 
HETATM 9364  O  O     . HOH T 5 .   ? 41.324  7.055   215.711 1.00 36.23  ? 826  HOH F O     1 
HETATM 9365  O  O     . HOH T 5 .   ? 31.610  3.907   202.207 1.00 49.93  ? 827  HOH F O     1 
HETATM 9366  O  O     . HOH T 5 .   ? 33.931  4.090   205.149 1.00 32.12  ? 828  HOH F O     1 
HETATM 9367  O  O     . HOH T 5 .   ? 30.345  9.549   199.594 1.00 23.17  ? 829  HOH F O     1 
HETATM 9368  O  O     . HOH T 5 .   ? 41.275  6.609   213.388 1.00 53.87  ? 830  HOH F O     1 
HETATM 9369  O  O     . HOH T 5 .   ? 30.212  8.927   208.144 1.00 38.58  ? 831  HOH F O     1 
HETATM 9370  O  O     . HOH T 5 .   ? 25.917  37.308  207.319 1.00 39.21  ? 832  HOH F O     1 
HETATM 9371  O  O     . HOH T 5 .   ? 22.782  29.793  211.766 1.00 68.36  ? 833  HOH F O     1 
HETATM 9372  O  O     . HOH T 5 .   ? 37.466  38.755  206.140 1.00 42.46  ? 834  HOH F O     1 
HETATM 9373  O  O     . HOH T 5 .   ? 42.296  38.128  211.226 1.00 32.60  ? 835  HOH F O     1 
HETATM 9374  O  O     . HOH T 5 .   ? 18.903  34.395  208.622 1.00 46.39  ? 836  HOH F O     1 
HETATM 9375  O  O     . HOH T 5 .   ? 26.528  34.975  207.951 1.00 37.95  ? 837  HOH F O     1 
HETATM 9376  O  O     . HOH T 5 .   ? 28.063  42.204  210.508 1.00 26.65  ? 838  HOH F O     1 
HETATM 9377  O  O     . HOH T 5 .   ? 30.240  42.372  212.041 1.00 31.20  ? 839  HOH F O     1 
HETATM 9378  O  O     . HOH T 5 .   ? 22.619  28.134  208.437 1.00 9.21   ? 840  HOH F O     1 
HETATM 9379  O  O     . HOH T 5 .   ? 35.592  44.389  202.842 1.00 41.97  ? 841  HOH F O     1 
HETATM 9380  O  O     . HOH T 5 .   ? 37.290  41.021  203.449 1.00 34.31  ? 842  HOH F O     1 
HETATM 9381  O  O     . HOH T 5 .   ? 46.096  41.821  207.307 1.00 43.01  ? 843  HOH F O     1 
HETATM 9382  O  O     . HOH T 5 .   ? 25.152  39.618  208.044 1.00 63.70  ? 844  HOH F O     1 
HETATM 9383  O  O     . HOH T 5 .   ? 25.756  35.159  205.473 1.00 60.94  ? 845  HOH F O     1 
HETATM 9384  O  O     . HOH T 5 .   ? 38.966  36.590  209.214 1.00 67.08  ? 846  HOH F O     1 
HETATM 9385  O  O     . HOH T 5 .   ? 38.387  -3.595  216.559 1.00 76.93  ? 847  HOH F O     1 
HETATM 9386  O  O     . HOH U 5 .   ? 25.526  -22.962 247.875 1.00 63.65  ? 41   HOH G O     1 
HETATM 9387  O  O     . HOH U 5 .   ? 21.029  -21.860 253.577 1.00 41.22  ? 42   HOH G O     1 
HETATM 9388  O  O     . HOH U 5 .   ? 28.102  7.348   220.106 1.00 55.31  ? 81   HOH G O     1 
HETATM 9389  O  O     . HOH U 5 .   ? 15.744  -19.580 240.256 1.00 67.33  ? 82   HOH G O     1 
HETATM 9390  O  O     . HOH U 5 .   ? 29.981  -4.491  221.976 1.00 43.05  ? 159  HOH G O     1 
HETATM 9391  O  O     . HOH U 5 .   ? 24.778  -16.506 246.212 1.00 46.92  ? 162  HOH G O     1 
HETATM 9392  O  O     . HOH U 5 .   ? 23.472  -0.059  230.957 1.00 36.06  ? 170  HOH G O     1 
HETATM 9393  O  O     . HOH U 5 .   ? 21.109  -21.410 237.185 1.00 27.36  ? 177  HOH G O     1 
HETATM 9394  O  O     . HOH U 5 .   ? 19.785  -24.787 238.020 1.00 38.81  ? 178  HOH G O     1 
HETATM 9395  O  O     . HOH U 5 .   ? 16.924  -6.209  229.834 1.00 26.24  ? 197  HOH G O     1 
HETATM 9396  O  O     . HOH U 5 .   ? 21.220  -10.767 234.837 1.00 43.65  ? 200  HOH G O     1 
HETATM 9397  O  O     . HOH U 5 .   ? 20.897  0.774   224.496 1.00 34.82  ? 265  HOH G O     1 
HETATM 9398  O  O     . HOH U 5 .   ? 22.535  -22.632 249.453 1.00 52.55  ? 273  HOH G O     1 
HETATM 9399  O  O     . HOH U 5 .   ? 36.114  2.248   219.709 1.00 51.71  ? 369  HOH G O     1 
HETATM 9400  O  O     . HOH U 5 .   ? 21.768  -17.494 244.190 1.00 62.79  ? 385  HOH G O     1 
HETATM 9401  O  O     . HOH U 5 .   ? 13.774  -2.409  224.733 1.00 40.35  ? 395  HOH G O     1 
HETATM 9402  O  O     . HOH U 5 .   ? 24.869  -12.233 249.649 1.00 45.41  ? 428  HOH G O     1 
HETATM 9403  O  O     . HOH U 5 .   ? 28.146  -10.645 253.157 1.00 59.91  ? 429  HOH G O     1 
HETATM 9404  O  O     . HOH U 5 .   ? 31.873  2.995   224.580 1.00 43.42  ? 525  HOH G O     1 
HETATM 9405  O  O     . HOH U 5 .   ? 30.599  0.051   224.707 1.00 41.39  ? 526  HOH G O     1 
HETATM 9406  O  O     . HOH U 5 .   ? 31.684  7.491   228.197 1.00 40.65  ? 531  HOH G O     1 
HETATM 9407  O  O     . HOH U 5 .   ? 10.898  -11.820 229.013 1.00 16.83  ? 551  HOH G O     1 
HETATM 9408  O  O     . HOH U 5 .   ? 16.700  -24.236 236.227 1.00 36.77  ? 552  HOH G O     1 
HETATM 9409  O  O     . HOH U 5 .   ? 27.875  9.706   217.577 1.00 30.78  ? 567  HOH G O     1 
HETATM 9410  O  O     . HOH U 5 .   ? 28.567  10.160  220.390 1.00 36.34  ? 569  HOH G O     1 
HETATM 9411  O  O     . HOH U 5 .   ? 30.449  9.407   215.706 1.00 74.02  ? 570  HOH G O     1 
HETATM 9412  O  O     . HOH U 5 .   ? 28.559  8.940   223.727 1.00 57.70  ? 585  HOH G O     1 
HETATM 9413  O  O     . HOH U 5 .   ? 34.709  8.739   226.733 1.00 38.37  ? 586  HOH G O     1 
HETATM 9414  O  O     . HOH U 5 .   ? 20.111  -3.217  223.102 1.00 54.74  ? 595  HOH G O     1 
HETATM 9415  O  O     . HOH U 5 .   ? 19.346  -6.434  223.715 1.00 34.72  ? 596  HOH G O     1 
HETATM 9416  O  O     . HOH U 5 .   ? 30.634  8.304   212.342 1.00 48.64  ? 755  HOH G O     1 
HETATM 9417  O  O     . HOH U 5 .   ? 32.173  10.925  227.118 1.00 45.41  ? 757  HOH G O     1 
HETATM 9418  O  O     . HOH U 5 .   ? 22.055  -24.070 251.365 1.00 48.43  ? 759  HOH G O     1 
HETATM 9419  O  O     . HOH V 5 .   ? 15.583  -18.535 254.996 1.00 44.48  ? 43   HOH H O     1 
HETATM 9420  O  O     . HOH V 5 .   ? 28.662  -12.861 222.211 1.00 31.28  ? 49   HOH H O     1 
HETATM 9421  O  O     . HOH V 5 .   ? 25.625  -5.178  213.862 1.00 25.49  ? 50   HOH H O     1 
HETATM 9422  O  O     . HOH V 5 .   ? 21.055  -8.395  210.909 1.00 47.56  ? 85   HOH H O     1 
HETATM 9423  O  O     . HOH V 5 .   ? 24.314  -1.800  213.500 1.00 34.10  ? 113  HOH H O     1 
HETATM 9424  O  O     . HOH V 5 .   ? 23.146  -11.145 212.847 1.00 43.42  ? 160  HOH H O     1 
HETATM 9425  O  O     . HOH V 5 .   ? 9.170   -12.385 250.562 1.00 60.86  ? 205  HOH H O     1 
HETATM 9426  O  O     . HOH V 5 .   ? 12.084  -13.877 252.251 1.00 35.58  ? 206  HOH H O     1 
HETATM 9427  O  O     . HOH V 5 .   ? 6.133   -11.100 248.579 1.00 37.77  ? 207  HOH H O     1 
HETATM 9428  O  O     . HOH V 5 .   ? 18.750  -11.402 215.164 1.00 36.64  ? 272  HOH H O     1 
HETATM 9429  O  O     . HOH V 5 .   ? 16.438  -8.103  215.454 1.00 48.76  ? 358  HOH H O     1 
HETATM 9430  O  O     . HOH V 5 .   ? 19.759  -3.457  219.726 1.00 56.27  ? 360  HOH H O     1 
HETATM 9431  O  O     . HOH V 5 .   ? 19.440  1.140   212.355 1.00 46.81  ? 398  HOH H O     1 
HETATM 9432  O  O     . HOH V 5 .   ? 24.939  -16.340 239.199 1.00 47.98  ? 424  HOH H O     1 
HETATM 9433  O  O     . HOH V 5 .   ? 25.528  -13.472 244.218 1.00 32.53  ? 425  HOH H O     1 
HETATM 9434  O  O     . HOH V 5 .   ? 24.122  -13.745 246.882 1.00 56.21  ? 427  HOH H O     1 
HETATM 9435  O  O     . HOH V 5 .   ? 16.371  -11.709 213.631 1.00 35.28  ? 549  HOH H O     1 
HETATM 9436  O  O     . HOH V 5 .   ? 11.225  -8.511  247.831 1.00 41.65  ? 556  HOH H O     1 
HETATM 9437  O  O     . HOH V 5 .   ? 5.886   -13.481 248.486 1.00 35.04  ? 599  HOH H O     1 
HETATM 9438  O  O     . HOH V 5 .   ? 11.144  5.577   214.991 1.00 55.27  ? 665  HOH H O     1 
HETATM 9439  O  O     . HOH V 5 .   ? 10.250  -15.314 250.432 1.00 55.86  ? 742  HOH H O     1 
HETATM 9440  O  O     . HOH V 5 .   ? 25.305  -11.211 245.544 1.00 52.53  ? 758  HOH H O     1 
HETATM 9441  O  O     . HOH W 5 .   ? 13.055  3.641   184.076 1.00 56.53  ? 902  HOH A O     1 
HETATM 9442  O  O     . HOH W 5 .   ? 31.106  10.090  193.208 1.00 47.36  ? 903  HOH A O     1 
HETATM 9443  O  O     . HOH W 5 .   ? -4.641  31.577  190.317 1.00 65.47  ? 904  HOH A O     1 
HETATM 9444  O  O     . HOH W 5 .   ? 2.068   43.423  193.073 1.00 26.38  ? 905  HOH A O     1 
HETATM 9445  O  O     . HOH W 5 .   ? 4.669   50.415  189.289 1.00 32.48  ? 906  HOH A O     1 
HETATM 9446  O  O     . HOH W 5 .   ? 17.306  54.077  198.180 1.00 44.45  ? 907  HOH A O     1 
HETATM 9447  O  O     . HOH W 5 .   ? 14.843  53.526  199.641 1.00 35.82  ? 908  HOH A O     1 
HETATM 9448  O  O     . HOH W 5 .   ? 8.121   54.317  203.070 1.00 34.89  ? 909  HOH A O     1 
HETATM 9449  O  O     . HOH W 5 .   ? 10.542  48.911  191.759 1.00 29.29  ? 910  HOH A O     1 
HETATM 9450  O  O     . HOH W 5 .   ? 20.360  48.677  187.817 1.00 25.35  ? 911  HOH A O     1 
HETATM 9451  O  O     . HOH W 5 .   ? -1.939  35.495  195.498 1.00 33.28  ? 912  HOH A O     1 
HETATM 9452  O  O     . HOH W 5 .   ? 18.348  13.426  200.881 1.00 24.73  ? 913  HOH A O     1 
HETATM 9453  O  O     . HOH W 5 .   ? 17.759  38.728  215.663 1.00 67.30  ? 914  HOH A O     1 
HETATM 9454  O  O     . HOH W 5 .   ? -0.940  4.128   197.744 1.00 36.72  ? 915  HOH A O     1 
HETATM 9455  O  O     . HOH W 5 .   ? 1.904   2.978   189.471 1.00 64.29  ? 916  HOH A O     1 
HETATM 9456  O  O     . HOH W 5 .   ? 5.263   4.055   197.687 1.00 40.91  ? 917  HOH A O     1 
HETATM 9457  O  O     . HOH W 5 .   ? 16.360  0.985   203.334 1.00 46.20  ? 918  HOH A O     1 
HETATM 9458  O  O     . HOH W 5 .   ? 25.641  21.039  197.659 1.00 57.56  ? 919  HOH A O     1 
HETATM 9459  O  O     . HOH W 5 .   ? 28.992  27.552  196.072 1.00 53.17  ? 920  HOH A O     1 
HETATM 9460  O  O     . HOH W 5 .   ? 30.383  10.618  196.495 1.00 30.45  ? 921  HOH A O     1 
HETATM 9461  O  O     . HOH W 5 .   ? -3.104  13.069  192.255 1.00 20.11  ? 922  HOH A O     1 
HETATM 9462  O  O     . HOH W 5 .   ? 14.515  8.675   186.628 1.00 27.27  ? 923  HOH A O     1 
HETATM 9463  O  O     . HOH W 5 .   ? -6.151  24.687  197.150 1.00 35.55  ? 924  HOH A O     1 
HETATM 9464  O  O     . HOH W 5 .   ? -6.303  28.377  197.441 1.00 63.86  ? 925  HOH A O     1 
HETATM 9465  O  O     . HOH W 5 .   ? -6.285  26.274  195.098 1.00 26.56  ? 926  HOH A O     1 
HETATM 9466  O  O     . HOH W 5 .   ? 1.327   22.627  206.118 1.00 28.76  ? 927  HOH A O     1 
HETATM 9467  O  O     . HOH W 5 .   ? 17.291  12.245  180.553 1.00 47.58  ? 928  HOH A O     1 
HETATM 9468  O  O     . HOH W 5 .   ? 0.705   24.333  180.785 1.00 42.35  ? 929  HOH A O     1 
HETATM 9469  O  O     . HOH W 5 .   ? 0.310   32.930  190.904 1.00 25.46  ? 930  HOH A O     1 
HETATM 9470  O  O     . HOH W 5 .   ? 2.498   40.509  183.250 1.00 42.68  ? 931  HOH A O     1 
HETATM 9471  O  O     . HOH W 5 .   ? -1.958  40.597  207.637 1.00 58.56  ? 932  HOH A O     1 
HETATM 9472  O  O     . HOH W 5 .   ? 7.160   45.110  205.691 1.00 51.97  ? 933  HOH A O     1 
HETATM 9473  O  O     . HOH W 5 .   ? 21.749  40.070  191.361 1.00 41.03  ? 934  HOH A O     1 
HETATM 9474  O  O     . HOH W 5 .   ? 22.277  51.240  190.258 1.00 32.09  ? 935  HOH A O     1 
HETATM 9475  O  O     . HOH W 5 .   ? 22.976  38.546  183.564 1.00 61.68  ? 936  HOH A O     1 
HETATM 9476  O  O     . HOH W 5 .   ? 22.664  41.307  181.308 1.00 50.25  ? 937  HOH A O     1 
HETATM 9477  O  O     . HOH W 5 .   ? 26.902  41.690  184.135 1.00 51.34  ? 938  HOH A O     1 
HETATM 9478  O  O     . HOH W 5 .   ? 25.394  35.919  184.225 1.00 51.57  ? 939  HOH A O     1 
HETATM 9479  O  O     . HOH W 5 .   ? 27.728  35.247  182.993 1.00 44.19  ? 940  HOH A O     1 
HETATM 9480  O  O     . HOH W 5 .   ? 28.577  34.832  185.836 1.00 50.13  ? 941  HOH A O     1 
HETATM 9481  O  O     . HOH W 5 .   ? 15.515  2.746   199.958 1.00 45.14  ? 942  HOH A O     1 
HETATM 9482  O  O     . HOH W 5 .   ? 10.901  1.879   200.133 1.00 67.99  ? 943  HOH A O     1 
HETATM 9483  O  O     . HOH W 5 .   ? 18.199  2.298   205.228 1.00 30.54  ? 944  HOH A O     1 
HETATM 9484  O  O     . HOH W 5 .   ? 9.466   41.371  213.209 1.00 33.67  ? 945  HOH A O     1 
HETATM 9485  O  O     . HOH W 5 .   ? 17.141  19.099  218.297 1.00 36.92  ? 946  HOH A O     1 
HETATM 9486  O  O     . HOH W 5 .   ? 23.967  18.916  217.525 1.00 45.93  ? 947  HOH A O     1 
HETATM 9487  O  O     . HOH W 5 .   ? 11.446  14.531  213.982 1.00 28.65  ? 948  HOH A O     1 
HETATM 9488  O  O     . HOH W 5 .   ? 18.156  22.996  228.034 1.00 59.12  ? 949  HOH A O     1 
HETATM 9489  O  O     . HOH W 5 .   ? 50.783  16.829  226.442 1.00 32.19  ? 950  HOH A O     1 
HETATM 9490  O  O     . HOH W 5 .   ? 29.507  24.704  217.667 1.00 30.88  ? 951  HOH A O     1 
HETATM 9491  O  O     . HOH W 5 .   ? -2.366  25.057  202.452 1.00 42.30  ? 952  HOH A O     1 
HETATM 9492  O  O     . HOH W 5 .   ? -2.304  25.417  200.078 1.00 25.94  ? 953  HOH A O     1 
HETATM 9493  O  O     . HOH W 5 .   ? -4.485  28.602  203.822 1.00 36.78  ? 954  HOH A O     1 
HETATM 9494  O  O     . HOH W 5 .   ? -4.500  28.514  206.740 1.00 30.74  ? 955  HOH A O     1 
HETATM 9495  O  O     . HOH W 5 .   ? -5.876  31.614  202.007 1.00 51.17  ? 956  HOH A O     1 
HETATM 9496  O  O     . HOH W 5 .   ? -5.122  12.973  190.256 1.00 46.60  ? 957  HOH A O     1 
HETATM 9497  O  O     . HOH W 5 .   ? 0.999   8.283   196.925 1.00 35.67  ? 958  HOH A O     1 
HETATM 9498  O  O     . HOH W 5 .   ? 1.575   8.649   192.387 1.00 24.83  ? 959  HOH A O     1 
HETATM 9499  O  O     . HOH W 5 .   ? 12.635  6.620   181.074 1.00 31.89  ? 960  HOH A O     1 
HETATM 9500  O  O     . HOH W 5 .   ? 12.979  35.385  186.577 1.00 36.28  ? 961  HOH A O     1 
HETATM 9501  O  O     . HOH W 5 .   ? 8.937   40.332  185.312 1.00 42.02  ? 962  HOH A O     1 
HETATM 9502  O  O     . HOH W 5 .   ? 19.465  53.831  193.504 1.00 44.86  ? 963  HOH A O     1 
HETATM 9503  O  O     . HOH W 5 .   ? 0.872   39.203  202.756 1.00 40.42  ? 964  HOH A O     1 
HETATM 9504  O  O     . HOH W 5 .   ? 16.453  33.941  201.474 1.00 23.28  ? 965  HOH A O     1 
HETATM 9505  O  O     . HOH W 5 .   ? 14.402  41.420  197.936 1.00 29.73  ? 966  HOH A O     1 
HETATM 9506  O  O     . HOH W 5 .   ? 19.182  48.379  208.175 1.00 41.99  ? 967  HOH A O     1 
HETATM 9507  O  O     . HOH W 5 .   ? 19.906  42.675  190.704 1.00 31.90  ? 968  HOH A O     1 
HETATM 9508  O  O     . HOH W 5 .   ? 20.269  50.941  188.656 1.00 20.60  ? 969  HOH A O     1 
HETATM 9509  O  O     . HOH W 5 .   ? 19.158  37.366  183.670 1.00 31.90  ? 970  HOH A O     1 
HETATM 9510  O  O     . HOH W 5 .   ? -2.431  39.380  195.972 1.00 33.71  ? 971  HOH A O     1 
HETATM 9511  O  O     . HOH W 5 .   ? 12.708  3.401   197.857 1.00 43.78  ? 972  HOH A O     1 
HETATM 9512  O  O     . HOH W 5 .   ? 17.728  2.916   202.282 1.00 31.83  ? 973  HOH A O     1 
HETATM 9513  O  O     . HOH W 5 .   ? 10.280  5.648   207.892 1.00 44.39  ? 974  HOH A O     1 
HETATM 9514  O  O     . HOH W 5 .   ? 1.842   26.611  222.089 1.00 40.59  ? 975  HOH A O     1 
HETATM 9515  O  O     . HOH W 5 .   ? 23.093  18.953  222.358 1.00 42.34  ? 976  HOH A O     1 
HETATM 9516  O  O     . HOH W 5 .   ? 19.004  52.898  190.471 1.00 52.35  ? 977  HOH A O     1 
HETATM 9517  O  O     . HOH W 5 .   ? 14.679  37.723  217.504 1.00 37.13  ? 978  HOH A O     1 
HETATM 9518  O  O     . HOH W 5 .   ? 17.236  26.516  197.310 1.00 52.74  ? 979  HOH A O     1 
HETATM 9519  O  O     . HOH W 5 .   ? 15.267  4.741   209.570 1.00 47.01  ? 980  HOH A O     1 
HETATM 9520  O  O     . HOH W 5 .   ? -3.204  12.841  194.905 1.00 21.80  ? 981  HOH A O     1 
HETATM 9521  O  O     . HOH W 5 .   ? 7.268   6.566   195.824 1.00 31.05  ? 982  HOH A O     1 
HETATM 9522  O  O     . HOH W 5 .   ? -2.992  31.314  181.862 1.00 41.42  ? 983  HOH A O     1 
HETATM 9523  O  O     . HOH W 5 .   ? -5.225  27.681  189.361 1.00 33.41  ? 984  HOH A O     1 
HETATM 9524  O  O     . HOH W 5 .   ? -0.196  41.765  191.695 1.00 29.31  ? 985  HOH A O     1 
HETATM 9525  O  O     . HOH W 5 .   ? 11.226  49.159  188.940 1.00 22.65  ? 986  HOH A O     1 
HETATM 9526  O  O     . HOH W 5 .   ? 17.423  51.444  204.921 1.00 35.95  ? 987  HOH A O     1 
HETATM 9527  O  O     . HOH W 5 .   ? 0.501   38.636  206.113 1.00 45.03  ? 988  HOH A O     1 
HETATM 9528  O  O     . HOH W 5 .   ? 7.641   45.011  203.391 1.00 53.09  ? 989  HOH A O     1 
HETATM 9529  O  O     . HOH W 5 .   ? 26.833  49.284  191.176 1.00 29.23  ? 990  HOH A O     1 
HETATM 9530  O  O     . HOH W 5 .   ? 25.352  35.516  190.678 1.00 50.14  ? 991  HOH A O     1 
HETATM 9531  O  O     . HOH W 5 .   ? 18.892  31.723  187.426 1.00 28.80  ? 992  HOH A O     1 
HETATM 9532  O  O     . HOH W 5 .   ? 18.437  32.227  185.014 1.00 28.54  ? 993  HOH A O     1 
HETATM 9533  O  O     . HOH W 5 .   ? 15.955  12.581  201.696 1.00 36.71  ? 994  HOH A O     1 
HETATM 9534  O  O     . HOH W 5 .   ? 11.244  7.716   200.146 1.00 35.04  ? 995  HOH A O     1 
HETATM 9535  O  O     . HOH W 5 .   ? 16.110  40.126  210.534 1.00 38.92  ? 996  HOH A O     1 
HETATM 9536  O  O     . HOH W 5 .   ? 11.170  41.059  208.347 1.00 32.68  ? 997  HOH A O     1 
HETATM 9537  O  O     . HOH W 5 .   ? 10.321  39.592  215.374 1.00 37.94  ? 998  HOH A O     1 
HETATM 9538  O  O     . HOH W 5 .   ? 13.254  38.795  215.092 1.00 33.49  ? 999  HOH A O     1 
HETATM 9539  O  O     . HOH W 5 .   ? 1.792   32.243  207.838 1.00 39.46  ? 1000 HOH A O     1 
HETATM 9540  O  O     . HOH W 5 .   ? 5.629   10.120  200.163 1.00 52.00  ? 1001 HOH A O     1 
HETATM 9541  O  O     . HOH W 5 .   ? 0.371   22.485  203.527 1.00 14.98  ? 1002 HOH A O     1 
HETATM 9542  O  O     . HOH W 5 .   ? 4.543   22.655  206.861 1.00 26.30  ? 1003 HOH A O     1 
HETATM 9543  O  O     . HOH W 5 .   ? 16.522  15.793  221.439 1.00 44.38  ? 1004 HOH A O     1 
HETATM 9544  O  O     . HOH W 5 .   ? 14.453  14.304  203.212 1.00 33.81  ? 1005 HOH A O     1 
HETATM 9545  O  O     . HOH W 5 .   ? 5.381   9.047   210.798 1.00 63.87  ? 1006 HOH A O     1 
HETATM 9546  O  O     . HOH W 5 .   ? 11.146  11.734  214.286 1.00 54.82  ? 1007 HOH A O     1 
HETATM 9547  O  O     . HOH W 5 .   ? -3.694  34.294  216.413 1.00 49.95  ? 1008 HOH A O     1 
HETATM 9548  O  O     . HOH W 5 .   ? -3.889  31.710  216.011 1.00 46.92  ? 1009 HOH A O     1 
HETATM 9549  O  O     . HOH W 5 .   ? -1.856  36.250  207.317 1.00 44.55  ? 1010 HOH A O     1 
HETATM 9550  O  O     . HOH W 5 .   ? -3.008  26.214  211.924 1.00 63.13  ? 1011 HOH A O     1 
HETATM 9551  O  O     . HOH W 5 .   ? 14.328  20.611  223.943 1.00 29.75  ? 1012 HOH A O     1 
HETATM 9552  O  O     . HOH W 5 .   ? 25.256  18.806  220.433 1.00 34.07  ? 1013 HOH A O     1 
HETATM 9553  O  O     . HOH W 5 .   ? 41.897  13.212  223.490 1.00 30.16  ? 1014 HOH A O     1 
HETATM 9554  O  O     . HOH W 5 .   ? 29.143  13.232  220.320 1.00 37.05  ? 1015 HOH A O     1 
HETATM 9555  O  O     . HOH W 5 .   ? 10.867  6.602   211.813 1.00 41.01  ? 1016 HOH A O     1 
HETATM 9556  O  O     . HOH W 5 .   ? 7.166   6.655   209.257 1.00 36.24  ? 1017 HOH A O     1 
HETATM 9557  O  O     . HOH W 5 .   ? 30.447  4.830   199.884 1.00 40.63  ? 1018 HOH A O     1 
HETATM 9558  O  O     . HOH W 5 .   ? 20.054  37.130  200.593 1.00 20.71  ? 1019 HOH A O     1 
HETATM 9559  O  O     . HOH W 5 .   ? 15.187  25.789  198.896 1.00 39.22  ? 1020 HOH A O     1 
HETATM 9560  O  O     . HOH W 5 .   ? 18.937  32.247  203.020 1.00 46.96  ? 1021 HOH A O     1 
HETATM 9561  O  O     . HOH W 5 .   ? 17.326  23.641  193.261 1.00 29.02  ? 1022 HOH A O     1 
HETATM 9562  O  O     . HOH W 5 .   ? 26.996  11.364  208.346 1.00 30.67  ? 1023 HOH A O     1 
HETATM 9563  O  O     . HOH W 5 .   ? 6.102   5.694   187.080 1.00 29.12  ? 1024 HOH A O     1 
HETATM 9564  O  O     . HOH W 5 .   ? 17.635  24.251  189.091 1.00 45.75  ? 1025 HOH A O     1 
HETATM 9565  O  O     . HOH W 5 .   ? 0.795   33.306  187.619 1.00 43.68  ? 1026 HOH A O     1 
HETATM 9566  O  O     . HOH W 5 .   ? 3.624   32.070  186.367 1.00 36.95  ? 1027 HOH A O     1 
HETATM 9567  O  O     . HOH W 5 .   ? 7.131   37.230  183.203 1.00 48.62  ? 1028 HOH A O     1 
HETATM 9568  O  O     . HOH W 5 .   ? 4.010   39.794  185.569 1.00 28.15  ? 1029 HOH A O     1 
HETATM 9569  O  O     . HOH W 5 .   ? 3.810   37.424  187.921 1.00 26.31  ? 1030 HOH A O     1 
HETATM 9570  O  O     . HOH W 5 .   ? 4.245   37.858  190.856 1.00 3.52   ? 1031 HOH A O     1 
HETATM 9571  O  O     . HOH W 5 .   ? 0.288   35.758  191.995 1.00 29.37  ? 1032 HOH A O     1 
HETATM 9572  O  O     . HOH W 5 .   ? 3.673   38.374  192.916 1.00 19.54  ? 1033 HOH A O     1 
HETATM 9573  O  O     . HOH W 5 .   ? 1.573   40.382  193.142 1.00 16.76  ? 1034 HOH A O     1 
HETATM 9574  O  O     . HOH W 5 .   ? 7.290   55.789  192.754 1.00 32.57  ? 1035 HOH A O     1 
HETATM 9575  O  O     . HOH W 5 .   ? 16.491  52.000  191.652 1.00 30.59  ? 1036 HOH A O     1 
HETATM 9576  O  O     . HOH W 5 .   ? 18.914  40.014  183.952 1.00 39.34  ? 1037 HOH A O     1 
HETATM 9577  O  O     . HOH W 5 .   ? 20.942  37.422  191.253 1.00 27.03  ? 1038 HOH A O     1 
HETATM 9578  O  O     . HOH W 5 .   ? 20.939  38.756  194.639 1.00 33.63  ? 1039 HOH A O     1 
HETATM 9579  O  O     . HOH W 5 .   ? 13.923  27.900  184.829 1.00 39.51  ? 1040 HOH A O     1 
HETATM 9580  O  O     . HOH W 5 .   ? 15.050  -0.008  187.393 1.00 13.89  ? 1041 HOH A O     1 
HETATM 9581  O  O     . HOH W 5 .   ? 13.648  0.146   189.633 1.00 35.42  ? 1042 HOH A O     1 
HETATM 9582  O  O     . HOH W 5 .   ? 17.015  1.578   187.433 1.00 52.14  ? 1043 HOH A O     1 
HETATM 9583  O  O     . HOH W 5 .   ? 6.418   6.578   198.720 1.00 28.80  ? 1044 HOH A O     1 
HETATM 9584  O  O     . HOH W 5 .   ? 15.727  16.389  219.169 1.00 42.55  ? 1045 HOH A O     1 
HETATM 9585  O  O     . HOH W 5 .   ? 14.101  13.833  220.064 1.00 59.71  ? 1046 HOH A O     1 
HETATM 9586  O  O     . HOH W 5 .   ? 14.184  11.652  209.700 1.00 44.69  ? 1047 HOH A O     1 
HETATM 9587  O  O     . HOH W 5 .   ? 11.372  12.073  211.043 1.00 31.94  ? 1048 HOH A O     1 
HETATM 9588  O  O     . HOH W 5 .   ? -1.015  23.457  211.928 1.00 33.28  ? 1049 HOH A O     1 
HETATM 9589  O  O     . HOH W 5 .   ? 28.284  10.907  197.842 1.00 33.22  ? 1050 HOH A O     1 
HETATM 9590  O  O     . HOH W 5 .   ? 41.987  26.791  229.290 1.00 54.76  ? 1051 HOH A O     1 
HETATM 9591  O  O     . HOH W 5 .   ? 42.529  25.916  232.676 1.00 52.51  ? 1052 HOH A O     1 
HETATM 9592  O  O     . HOH W 5 .   ? 45.620  24.665  235.808 1.00 50.60  ? 1053 HOH A O     1 
HETATM 9593  O  O     . HOH W 5 .   ? 8.638   5.647   198.827 1.00 31.66  ? 1054 HOH A O     1 
HETATM 9594  O  O     . HOH W 5 .   ? 8.046   3.522   203.510 1.00 33.97  ? 1055 HOH A O     1 
HETATM 9595  O  O     . HOH W 5 .   ? 7.592   2.514   199.020 1.00 44.88  ? 1056 HOH A O     1 
HETATM 9596  O  O     . HOH W 5 .   ? 31.735  11.537  217.258 1.00 48.16  ? 1057 HOH A O     1 
HETATM 9597  O  O     . HOH W 5 .   ? 17.400  21.430  196.028 1.00 24.41  ? 1058 HOH A O     1 
HETATM 9598  O  O     . HOH W 5 .   ? 21.210  13.069  196.014 1.00 34.81  ? 1059 HOH A O     1 
HETATM 9599  O  O     . HOH W 5 .   ? 15.908  26.154  202.936 1.00 27.31  ? 1060 HOH A O     1 
HETATM 9600  O  O     . HOH W 5 .   ? 18.104  24.767  195.950 1.00 42.61  ? 1061 HOH A O     1 
HETATM 9601  O  O     . HOH W 5 .   ? 19.464  34.323  199.956 1.00 34.99  ? 1062 HOH A O     1 
HETATM 9602  O  O     . HOH W 5 .   ? 22.490  36.364  202.183 1.00 22.31  ? 1063 HOH A O     1 
HETATM 9603  O  O     . HOH W 5 .   ? 22.145  35.637  205.057 1.00 18.67  ? 1064 HOH A O     1 
HETATM 9604  O  O     . HOH W 5 .   ? 16.817  34.141  204.470 1.00 24.53  ? 1065 HOH A O     1 
HETATM 9605  O  O     . HOH W 5 .   ? 18.930  24.072  203.917 1.00 29.06  ? 1066 HOH A O     1 
HETATM 9606  O  O     . HOH W 5 .   ? 13.463  24.283  203.635 1.00 18.65  ? 1067 HOH A O     1 
HETATM 9607  O  O     . HOH W 5 .   ? 15.354  9.637   208.470 1.00 66.92  ? 1068 HOH A O     1 
HETATM 9608  O  O     . HOH W 5 .   ? 17.254  0.657   199.182 1.00 59.15  ? 1069 HOH A O     1 
HETATM 9609  O  O     . HOH W 5 .   ? 19.421  -0.462  203.817 1.00 28.76  ? 1070 HOH A O     1 
HETATM 9610  O  O     . HOH W 5 .   ? 25.845  10.676  205.872 1.00 65.48  ? 1071 HOH A O     1 
HETATM 9611  O  O     . HOH W 5 .   ? -5.845  21.782  200.898 1.00 33.25  ? 1072 HOH A O     1 
HETATM 9612  O  O     . HOH W 5 .   ? -3.861  19.321  200.956 1.00 59.82  ? 1073 HOH A O     1 
HETATM 9613  O  O     . HOH W 5 .   ? -5.794  15.714  190.803 1.00 70.07  ? 1074 HOH A O     1 
HETATM 9614  O  O     . HOH W 5 .   ? -2.335  35.948  192.283 1.00 37.36  ? 1075 HOH A O     1 
HETATM 9615  O  O     . HOH W 5 .   ? -3.154  35.675  186.793 1.00 41.27  ? 1076 HOH A O     1 
HETATM 9616  O  O     . HOH W 5 .   ? 10.835  55.154  200.703 1.00 46.81  ? 1077 HOH A O     1 
HETATM 9617  O  O     . HOH W 5 .   ? 14.173  48.754  187.138 1.00 50.90  ? 1078 HOH A O     1 
HETATM 9618  O  O     . HOH W 5 .   ? 22.778  40.657  185.312 1.00 56.27  ? 1079 HOH A O     1 
HETATM 9619  O  O     . HOH W 5 .   ? 15.341  37.443  214.101 1.00 64.90  ? 1080 HOH A O     1 
HETATM 9620  O  O     . HOH W 5 .   ? 9.387   4.157   201.316 1.00 68.58  ? 1081 HOH A O     1 
HETATM 9621  O  O     . HOH W 5 .   ? -0.095  4.841   195.000 1.00 37.33  ? 1082 HOH A O     1 
HETATM 9622  O  O     . HOH W 5 .   ? 50.308  14.399  226.765 1.00 76.11  ? 1083 HOH A O     1 
HETATM 9623  O  O     . HOH W 5 .   ? 23.187  38.816  188.475 1.00 46.93  ? 1084 HOH A O     1 
HETATM 9624  O  O     . HOH W 5 .   ? 1.423   40.948  199.166 1.00 61.95  ? 1085 HOH A O     1 
HETATM 9625  O  O     . HOH W 5 .   ? 15.704  2.740   205.502 1.00 40.08  ? 1086 HOH A O     1 
HETATM 9626  O  O     . HOH W 5 .   ? 13.088  30.675  184.071 1.00 43.61  ? 1087 HOH A O     1 
HETATM 9627  O  O     . HOH W 5 .   ? 13.437  9.615   216.828 1.00 53.60  ? 1088 HOH A O     1 
HETATM 9628  O  O     . HOH W 5 .   ? 27.667  16.176  226.235 1.00 67.69  ? 1089 HOH A O     1 
HETATM 9629  O  O     . HOH W 5 .   ? -1.075  5.608   199.943 1.00 65.80  ? 1090 HOH A O     1 
HETATM 9630  O  O     . HOH W 5 .   ? 2.642   24.223  177.852 1.00 57.26  ? 1091 HOH A O     1 
HETATM 9631  O  O     . HOH W 5 .   ? 11.198  39.590  184.349 1.00 51.07  ? 1092 HOH A O     1 
HETATM 9632  O  O     . HOH W 5 .   ? 3.000   46.108  204.574 1.00 41.19  ? 1093 HOH A O     1 
HETATM 9633  O  O     . HOH W 5 .   ? 23.195  44.878  200.734 1.00 35.03  ? 1094 HOH A O     1 
HETATM 9634  O  O     . HOH W 5 .   ? 20.961  8.083   200.650 1.00 40.33  ? 1095 HOH A O     1 
HETATM 9635  O  O     . HOH W 5 .   ? 5.062   7.410   196.582 1.00 35.37  ? 1096 HOH A O     1 
HETATM 9636  O  O     . HOH W 5 .   ? -2.462  21.272  203.177 1.00 51.81  ? 1097 HOH A O     1 
HETATM 9637  O  O     . HOH W 5 .   ? -8.194  22.849  200.027 1.00 38.39  ? 1098 HOH A O     1 
HETATM 9638  O  O     . HOH W 5 .   ? -5.377  16.163  199.427 1.00 46.78  ? 1099 HOH A O     1 
HETATM 9639  O  O     . HOH W 5 .   ? 3.752   9.849   207.936 1.00 41.76  ? 1100 HOH A O     1 
HETATM 9640  O  O     . HOH W 5 .   ? 3.492   7.717   203.919 1.00 43.42  ? 1101 HOH A O     1 
HETATM 9641  O  O     . HOH W 5 .   ? 6.483   8.493   204.885 1.00 49.80  ? 1102 HOH A O     1 
HETATM 9642  O  O     . HOH W 5 .   ? 8.756   15.384  214.283 1.00 41.24  ? 1103 HOH A O     1 
HETATM 9643  O  O     . HOH W 5 .   ? 4.198   7.684   206.435 1.00 49.57  ? 1104 HOH A O     1 
HETATM 9644  O  O     . HOH W 5 .   ? 38.022  16.530  230.886 1.00 45.99  ? 1105 HOH A O     1 
HETATM 9645  O  O     . HOH W 5 .   ? 26.882  38.009  191.281 1.00 50.08  ? 1106 HOH A O     1 
HETATM 9646  O  O     . HOH X 5 .   ? 26.100  -1.112  194.280 1.00 40.28  ? 903  HOH B O     1 
HETATM 9647  O  O     . HOH X 5 .   ? 33.648  0.146   192.789 1.00 38.52  ? 904  HOH B O     1 
HETATM 9648  O  O     . HOH X 5 .   ? 33.007  -5.614  191.478 1.00 35.22  ? 905  HOH B O     1 
HETATM 9649  O  O     . HOH X 5 .   ? 60.748  16.892  201.947 1.00 44.74  ? 906  HOH B O     1 
HETATM 9650  O  O     . HOH X 5 .   ? 62.010  13.765  198.947 1.00 43.09  ? 907  HOH B O     1 
HETATM 9651  O  O     . HOH X 5 .   ? 57.750  16.105  221.858 1.00 53.59  ? 908  HOH B O     1 
HETATM 9652  O  O     . HOH X 5 .   ? 48.392  31.452  223.709 1.00 53.00  ? 909  HOH B O     1 
HETATM 9653  O  O     . HOH X 5 .   ? 27.820  36.982  229.256 1.00 43.20  ? 910  HOH B O     1 
HETATM 9654  O  O     . HOH X 5 .   ? 28.829  39.033  228.509 1.00 37.56  ? 911  HOH B O     1 
HETATM 9655  O  O     . HOH X 5 .   ? 32.911  36.642  227.888 1.00 34.37  ? 912  HOH B O     1 
HETATM 9656  O  O     . HOH X 5 .   ? 24.767  38.514  219.946 1.00 37.49  ? 913  HOH B O     1 
HETATM 9657  O  O     . HOH X 5 .   ? 22.655  40.417  220.860 1.00 41.05  ? 914  HOH B O     1 
HETATM 9658  O  O     . HOH X 5 .   ? 24.272  43.245  221.347 1.00 43.57  ? 915  HOH B O     1 
HETATM 9659  O  O     . HOH X 5 .   ? 19.518  43.219  217.632 1.00 40.43  ? 916  HOH B O     1 
HETATM 9660  O  O     . HOH X 5 .   ? 21.694  42.518  225.936 1.00 47.35  ? 917  HOH B O     1 
HETATM 9661  O  O     . HOH X 5 .   ? 5.397   38.237  222.877 1.00 38.62  ? 918  HOH B O     1 
HETATM 9662  O  O     . HOH X 5 .   ? 32.484  -5.731  210.078 1.00 47.32  ? 919  HOH B O     1 
HETATM 9663  O  O     . HOH X 5 .   ? 33.041  -9.259  202.133 1.00 33.20  ? 920  HOH B O     1 
HETATM 9664  O  O     . HOH X 5 .   ? 50.071  1.862   214.269 1.00 40.71  ? 921  HOH B O     1 
HETATM 9665  O  O     . HOH X 5 .   ? 35.033  6.795   205.627 1.00 48.13  ? 922  HOH B O     1 
HETATM 9666  O  O     . HOH X 5 .   ? 41.450  13.317  220.421 1.00 26.20  ? 923  HOH B O     1 
HETATM 9667  O  O     . HOH X 5 .   ? 55.307  17.349  222.746 1.00 42.56  ? 924  HOH B O     1 
HETATM 9668  O  O     . HOH X 5 .   ? 41.154  22.493  178.285 1.00 37.73  ? 925  HOH B O     1 
HETATM 9669  O  O     . HOH X 5 .   ? 46.008  19.164  178.667 1.00 42.60  ? 926  HOH B O     1 
HETATM 9670  O  O     . HOH X 5 .   ? 45.652  19.912  183.831 1.00 51.76  ? 927  HOH B O     1 
HETATM 9671  O  O     . HOH X 5 .   ? 46.805  18.456  182.184 1.00 54.89  ? 928  HOH B O     1 
HETATM 9672  O  O     . HOH X 5 .   ? 30.930  22.908  187.719 1.00 52.42  ? 929  HOH B O     1 
HETATM 9673  O  O     . HOH X 5 .   ? 36.918  13.769  198.175 1.00 57.25  ? 930  HOH B O     1 
HETATM 9674  O  O     . HOH X 5 .   ? 42.767  1.119   190.812 1.00 56.35  ? 931  HOH B O     1 
HETATM 9675  O  O     . HOH X 5 .   ? 40.614  -12.529 214.183 1.00 41.71  ? 932  HOH B O     1 
HETATM 9676  O  O     . HOH X 5 .   ? 55.031  6.306   208.700 1.00 42.39  ? 933  HOH B O     1 
HETATM 9677  O  O     . HOH X 5 .   ? 54.480  4.101   204.077 1.00 76.21  ? 934  HOH B O     1 
HETATM 9678  O  O     . HOH X 5 .   ? 57.019  4.434   206.003 1.00 83.58  ? 935  HOH B O     1 
HETATM 9679  O  O     . HOH X 5 .   ? 53.557  2.794   214.865 1.00 43.79  ? 936  HOH B O     1 
HETATM 9680  O  O     . HOH X 5 .   ? 60.581  3.978   215.874 1.00 65.40  ? 937  HOH B O     1 
HETATM 9681  O  O     . HOH X 5 .   ? 58.548  3.461   208.171 1.00 71.30  ? 938  HOH B O     1 
HETATM 9682  O  O     . HOH X 5 .   ? 44.860  7.820   214.621 1.00 67.64  ? 939  HOH B O     1 
HETATM 9683  O  O     . HOH X 5 .   ? 39.687  10.873  204.719 1.00 49.89  ? 940  HOH B O     1 
HETATM 9684  O  O     . HOH X 5 .   ? 35.259  3.504   199.146 1.00 46.57  ? 941  HOH B O     1 
HETATM 9685  O  O     . HOH X 5 .   ? 29.708  -1.831  206.011 1.00 71.55  ? 942  HOH B O     1 
HETATM 9686  O  O     . HOH X 5 .   ? 32.208  -2.600  203.386 1.00 50.50  ? 943  HOH B O     1 
HETATM 9687  O  O     . HOH X 5 .   ? 35.072  -10.741 197.345 1.00 58.43  ? 944  HOH B O     1 
HETATM 9688  O  O     . HOH X 5 .   ? 37.857  5.408   191.361 1.00 37.26  ? 945  HOH B O     1 
HETATM 9689  O  O     . HOH X 5 .   ? 43.496  18.036  202.640 1.00 36.53  ? 946  HOH B O     1 
HETATM 9690  O  O     . HOH X 5 .   ? 45.056  37.043  192.931 1.00 29.92  ? 947  HOH B O     1 
HETATM 9691  O  O     . HOH X 5 .   ? 27.694  41.006  192.644 1.00 39.94  ? 948  HOH B O     1 
HETATM 9692  O  O     . HOH X 5 .   ? 34.422  30.301  176.007 1.00 83.53  ? 949  HOH B O     1 
HETATM 9693  O  O     . HOH X 5 .   ? 51.020  32.653  195.539 1.00 51.77  ? 950  HOH B O     1 
HETATM 9694  O  O     . HOH X 5 .   ? 43.227  36.050  209.966 1.00 77.68  ? 951  HOH B O     1 
HETATM 9695  O  O     . HOH X 5 .   ? 56.763  30.445  218.066 1.00 38.06  ? 952  HOH B O     1 
HETATM 9696  O  O     . HOH X 5 .   ? 55.770  32.509  220.450 1.00 56.42  ? 953  HOH B O     1 
HETATM 9697  O  O     . HOH X 5 .   ? 60.723  24.904  221.581 1.00 56.46  ? 954  HOH B O     1 
HETATM 9698  O  O     . HOH X 5 .   ? 25.272  31.623  186.550 1.00 59.18  ? 955  HOH B O     1 
HETATM 9699  O  O     . HOH X 5 .   ? 57.195  14.293  184.090 1.00 62.57  ? 956  HOH B O     1 
HETATM 9700  O  O     . HOH X 5 .   ? 41.599  2.813   192.702 1.00 31.67  ? 957  HOH B O     1 
HETATM 9701  O  O     . HOH X 5 .   ? 36.057  28.219  176.107 1.00 37.61  ? 958  HOH B O     1 
HETATM 9702  O  O     . HOH X 5 .   ? 51.102  37.433  211.722 1.00 41.03  ? 959  HOH B O     1 
HETATM 9703  O  O     . HOH X 5 .   ? 60.267  31.193  217.013 1.00 50.83  ? 960  HOH B O     1 
HETATM 9704  O  O     . HOH X 5 .   ? 38.937  31.081  231.184 1.00 53.34  ? 961  HOH B O     1 
HETATM 9705  O  O     . HOH X 5 .   ? 45.204  36.277  208.342 1.00 49.23  ? 962  HOH B O     1 
HETATM 9706  O  O     . HOH X 5 .   ? 54.915  21.418  202.835 1.00 23.13  ? 963  HOH B O     1 
HETATM 9707  O  O     . HOH X 5 .   ? 59.648  26.031  185.211 1.00 52.79  ? 964  HOH B O     1 
HETATM 9708  O  O     . HOH X 5 .   ? 60.866  23.451  184.811 1.00 47.95  ? 965  HOH B O     1 
HETATM 9709  O  O     . HOH X 5 .   ? 26.004  28.316  179.324 1.00 56.50  ? 966  HOH B O     1 
HETATM 9710  O  O     . HOH X 5 .   ? 38.970  -11.096 211.595 1.00 57.03  ? 967  HOH B O     1 
HETATM 9711  O  O     . HOH X 5 .   ? 40.267  1.268   205.735 1.00 42.42  ? 968  HOH B O     1 
HETATM 9712  O  O     . HOH X 5 .   ? 34.955  -2.292  201.253 1.00 39.52  ? 969  HOH B O     1 
HETATM 9713  O  O     . HOH X 5 .   ? 34.197  2.767   201.819 1.00 20.66  ? 970  HOH B O     1 
HETATM 9714  O  O     . HOH X 5 .   ? 38.184  2.481   192.896 1.00 26.69  ? 971  HOH B O     1 
HETATM 9715  O  O     . HOH X 5 .   ? 30.447  0.953   191.079 1.00 32.62  ? 972  HOH B O     1 
HETATM 9716  O  O     . HOH X 5 .   ? 36.110  0.902   192.049 1.00 38.72  ? 973  HOH B O     1 
HETATM 9717  O  O     . HOH X 5 .   ? 33.940  14.924  197.993 1.00 54.38  ? 974  HOH B O     1 
HETATM 9718  O  O     . HOH X 5 .   ? 57.769  17.148  201.847 1.00 30.59  ? 975  HOH B O     1 
HETATM 9719  O  O     . HOH X 5 .   ? 36.958  20.801  204.686 1.00 27.81  ? 976  HOH B O     1 
HETATM 9720  O  O     . HOH X 5 .   ? 42.807  11.059  220.022 1.00 32.52  ? 977  HOH B O     1 
HETATM 9721  O  O     . HOH X 5 .   ? 40.250  8.824   217.799 1.00 55.18  ? 978  HOH B O     1 
HETATM 9722  O  O     . HOH X 5 .   ? 36.530  10.835  221.210 1.00 33.44  ? 979  HOH B O     1 
HETATM 9723  O  O     . HOH X 5 .   ? 35.972  14.162  221.980 1.00 24.35  ? 980  HOH B O     1 
HETATM 9724  O  O     . HOH X 5 .   ? 53.003  5.743   217.931 1.00 56.64  ? 981  HOH B O     1 
HETATM 9725  O  O     . HOH X 5 .   ? 58.096  19.794  215.924 1.00 42.90  ? 982  HOH B O     1 
HETATM 9726  O  O     . HOH X 5 .   ? 51.326  22.296  205.540 1.00 28.41  ? 983  HOH B O     1 
HETATM 9727  O  O     . HOH X 5 .   ? 50.515  32.665  192.695 1.00 33.14  ? 984  HOH B O     1 
HETATM 9728  O  O     . HOH X 5 .   ? 52.907  33.282  212.811 1.00 29.74  ? 985  HOH B O     1 
HETATM 9729  O  O     . HOH X 5 .   ? 54.299  31.406  216.705 1.00 47.56  ? 986  HOH B O     1 
HETATM 9730  O  O     . HOH X 5 .   ? 51.225  36.039  216.093 1.00 65.18  ? 987  HOH B O     1 
HETATM 9731  O  O     . HOH X 5 .   ? 41.513  34.724  208.536 1.00 37.23  ? 988  HOH B O     1 
HETATM 9732  O  O     . HOH X 5 .   ? 42.855  36.798  206.724 1.00 26.43  ? 989  HOH B O     1 
HETATM 9733  O  O     . HOH X 5 .   ? 47.512  37.505  208.026 1.00 58.62  ? 990  HOH B O     1 
HETATM 9734  O  O     . HOH X 5 .   ? 41.311  35.770  211.654 1.00 33.05  ? 991  HOH B O     1 
HETATM 9735  O  O     . HOH X 5 .   ? 44.863  34.227  206.863 1.00 33.44  ? 992  HOH B O     1 
HETATM 9736  O  O     . HOH X 5 .   ? 35.070  31.313  217.253 1.00 37.35  ? 993  HOH B O     1 
HETATM 9737  O  O     . HOH X 5 .   ? 54.612  14.415  223.622 1.00 33.78  ? 994  HOH B O     1 
HETATM 9738  O  O     . HOH X 5 .   ? 53.274  17.768  225.210 1.00 42.72  ? 995  HOH B O     1 
HETATM 9739  O  O     . HOH X 5 .   ? 32.633  8.560   206.933 1.00 31.23  ? 996  HOH B O     1 
HETATM 9740  O  O     . HOH X 5 .   ? 31.810  11.035  203.028 1.00 48.52  ? 997  HOH B O     1 
HETATM 9741  O  O     . HOH X 5 .   ? 39.229  18.341  204.199 1.00 11.65  ? 998  HOH B O     1 
HETATM 9742  O  O     . HOH X 5 .   ? 36.616  38.355  201.315 1.00 33.19  ? 999  HOH B O     1 
HETATM 9743  O  O     . HOH X 5 .   ? 36.721  38.941  194.758 1.00 43.79  ? 1000 HOH B O     1 
HETATM 9744  O  O     . HOH X 5 .   ? 24.158  19.812  188.164 1.00 41.52  ? 1001 HOH B O     1 
HETATM 9745  O  O     . HOH X 5 .   ? 19.149  25.982  185.952 1.00 33.23  ? 1002 HOH B O     1 
HETATM 9746  O  O     . HOH X 5 .   ? 45.949  28.326  178.345 1.00 41.10  ? 1003 HOH B O     1 
HETATM 9747  O  O     . HOH X 5 .   ? 40.866  25.144  173.815 1.00 73.72  ? 1004 HOH B O     1 
HETATM 9748  O  O     . HOH X 5 .   ? 40.508  11.866  196.909 1.00 29.55  ? 1005 HOH B O     1 
HETATM 9749  O  O     . HOH X 5 .   ? 37.684  19.934  196.026 1.00 5.27   ? 1006 HOH B O     1 
HETATM 9750  O  O     . HOH X 5 .   ? 54.519  3.978   193.225 1.00 20.58  ? 1007 HOH B O     1 
HETATM 9751  O  O     . HOH X 5 .   ? 58.554  4.635   186.668 1.00 74.64  ? 1008 HOH B O     1 
HETATM 9752  O  O     . HOH X 5 .   ? 51.215  19.413  179.658 1.00 59.52  ? 1009 HOH B O     1 
HETATM 9753  O  O     . HOH X 5 .   ? 37.955  10.415  197.867 1.00 22.09  ? 1010 HOH B O     1 
HETATM 9754  O  O     . HOH X 5 .   ? 53.593  -4.417  201.359 1.00 64.56  ? 1011 HOH B O     1 
HETATM 9755  O  O     . HOH X 5 .   ? 54.011  6.382   185.302 1.00 48.13  ? 1012 HOH B O     1 
HETATM 9756  O  O     . HOH X 5 .   ? 53.725  -1.979  203.281 1.00 45.52  ? 1013 HOH B O     1 
HETATM 9757  O  O     . HOH X 5 .   ? 52.949  5.125   214.163 1.00 70.42  ? 1014 HOH B O     1 
HETATM 9758  O  O     . HOH X 5 .   ? 54.912  5.510   215.784 1.00 25.16  ? 1015 HOH B O     1 
HETATM 9759  O  O     . HOH X 5 .   ? 54.781  6.591   211.763 1.00 36.17  ? 1016 HOH B O     1 
HETATM 9760  O  O     . HOH X 5 .   ? 53.803  5.173   207.099 1.00 23.03  ? 1017 HOH B O     1 
HETATM 9761  O  O     . HOH X 5 .   ? 53.245  3.869   201.565 1.00 51.45  ? 1018 HOH B O     1 
HETATM 9762  O  O     . HOH X 5 .   ? 52.884  1.145   199.199 1.00 41.24  ? 1019 HOH B O     1 
HETATM 9763  O  O     . HOH X 5 .   ? 37.919  16.087  199.460 1.00 19.55  ? 1020 HOH B O     1 
HETATM 9764  O  O     . HOH X 5 .   ? 31.762  0.428   209.628 1.00 31.20  ? 1021 HOH B O     1 
HETATM 9765  O  O     . HOH X 5 .   ? 29.588  -2.851  202.983 1.00 41.15  ? 1022 HOH B O     1 
HETATM 9766  O  O     . HOH X 5 .   ? 31.973  0.725   202.213 1.00 44.00  ? 1023 HOH B O     1 
HETATM 9767  O  O     . HOH X 5 .   ? 28.819  -0.184  193.682 1.00 44.30  ? 1024 HOH B O     1 
HETATM 9768  O  O     . HOH X 5 .   ? 32.167  -5.469  194.214 1.00 29.63  ? 1025 HOH B O     1 
HETATM 9769  O  O     . HOH X 5 .   ? 33.273  0.970   199.499 1.00 25.94  ? 1026 HOH B O     1 
HETATM 9770  O  O     . HOH X 5 .   ? 32.040  0.960   197.242 1.00 35.41  ? 1027 HOH B O     1 
HETATM 9771  O  O     . HOH X 5 .   ? 37.337  10.903  192.592 1.00 39.36  ? 1028 HOH B O     1 
HETATM 9772  O  O     . HOH X 5 .   ? 44.228  33.640  193.808 1.00 50.48  ? 1029 HOH B O     1 
HETATM 9773  O  O     . HOH X 5 .   ? 41.544  37.027  190.915 1.00 38.17  ? 1030 HOH B O     1 
HETATM 9774  O  O     . HOH X 5 .   ? 38.301  8.361   216.322 1.00 48.58  ? 1031 HOH B O     1 
HETATM 9775  O  O     . HOH X 5 .   ? 38.798  38.314  185.832 1.00 44.30  ? 1032 HOH B O     1 
HETATM 9776  O  O     . HOH X 5 .   ? 26.802  24.333  179.378 1.00 40.52  ? 1033 HOH B O     1 
HETATM 9777  O  O     . HOH X 5 .   ? 25.038  25.966  179.663 1.00 26.37  ? 1034 HOH B O     1 
HETATM 9778  O  O     . HOH X 5 .   ? 27.510  19.929  180.776 1.00 55.16  ? 1035 HOH B O     1 
HETATM 9779  O  O     . HOH X 5 .   ? 25.447  18.175  182.892 1.00 47.86  ? 1036 HOH B O     1 
HETATM 9780  O  O     . HOH X 5 .   ? 52.939  30.461  196.026 1.00 39.58  ? 1037 HOH B O     1 
HETATM 9781  O  O     . HOH X 5 .   ? 56.344  32.438  195.636 1.00 38.55  ? 1038 HOH B O     1 
HETATM 9782  O  O     . HOH X 5 .   ? 38.816  31.177  215.836 1.00 31.90  ? 1039 HOH B O     1 
HETATM 9783  O  O     . HOH X 5 .   ? 29.409  30.352  212.807 1.00 15.66  ? 1040 HOH B O     1 
HETATM 9784  O  O     . HOH X 5 .   ? 40.485  34.837  203.457 1.00 22.02  ? 1041 HOH B O     1 
HETATM 9785  O  O     . HOH X 5 .   ? 41.170  38.137  197.876 1.00 51.90  ? 1042 HOH B O     1 
HETATM 9786  O  O     . HOH X 5 .   ? 59.872  19.623  213.994 1.00 33.55  ? 1043 HOH B O     1 
HETATM 9787  O  O     . HOH X 5 .   ? 60.887  27.381  220.845 1.00 27.79  ? 1044 HOH B O     1 
HETATM 9788  O  O     . HOH X 5 .   ? 43.718  33.069  219.554 1.00 41.31  ? 1045 HOH B O     1 
HETATM 9789  O  O     . HOH X 5 .   ? 37.361  27.929  231.822 1.00 61.85  ? 1046 HOH B O     1 
HETATM 9790  O  O     . HOH X 5 .   ? 36.440  30.296  231.630 1.00 63.28  ? 1047 HOH B O     1 
HETATM 9791  O  O     . HOH X 5 .   ? 30.681  -9.180  209.908 1.00 61.53  ? 1048 HOH B O     1 
HETATM 9792  O  O     . HOH X 5 .   ? 34.222  -6.032  211.783 1.00 64.64  ? 1049 HOH B O     1 
HETATM 9793  O  O     . HOH X 5 .   ? 31.187  12.385  208.349 1.00 40.65  ? 1050 HOH B O     1 
HETATM 9794  O  O     . HOH X 5 .   ? 23.410  36.443  212.797 1.00 36.66  ? 1051 HOH B O     1 
HETATM 9795  O  O     . HOH X 5 .   ? 44.204  33.600  209.251 1.00 29.01  ? 1052 HOH B O     1 
HETATM 9796  O  O     . HOH X 5 .   ? 23.075  36.829  210.447 1.00 31.72  ? 1053 HOH B O     1 
HETATM 9797  O  O     . HOH X 5 .   ? 41.874  19.777  203.761 1.00 14.45  ? 1054 HOH B O     1 
HETATM 9798  O  O     . HOH X 5 .   ? 36.431  16.398  197.224 1.00 14.55  ? 1055 HOH B O     1 
HETATM 9799  O  O     . HOH X 5 .   ? 36.560  17.926  194.775 1.00 46.10  ? 1056 HOH B O     1 
HETATM 9800  O  O     . HOH X 5 .   ? 31.908  31.154  214.563 1.00 37.91  ? 1057 HOH B O     1 
HETATM 9801  O  O     . HOH X 5 .   ? 37.233  20.787  193.872 1.00 38.86  ? 1058 HOH B O     1 
HETATM 9802  O  O     . HOH X 5 .   ? 34.417  43.328  200.117 1.00 31.11  ? 1059 HOH B O     1 
HETATM 9803  O  O     . HOH X 5 .   ? 35.348  40.774  200.798 1.00 48.07  ? 1060 HOH B O     1 
HETATM 9804  O  O     . HOH X 5 .   ? 38.909  40.185  196.588 1.00 52.40  ? 1061 HOH B O     1 
HETATM 9805  O  O     . HOH X 5 .   ? 41.637  39.751  200.612 1.00 55.08  ? 1062 HOH B O     1 
HETATM 9806  O  O     . HOH X 5 .   ? 41.595  31.824  208.420 1.00 34.47  ? 1063 HOH B O     1 
HETATM 9807  O  O     . HOH X 5 .   ? 21.070  16.643  182.635 1.00 64.02  ? 1064 HOH B O     1 
HETATM 9808  O  O     . HOH X 5 .   ? 31.924  -1.218  195.670 1.00 72.05  ? 1065 HOH B O     1 
HETATM 9809  O  O     . HOH X 5 .   ? 9.171   35.034  230.046 1.00 45.24  ? 1066 HOH B O     1 
HETATM 9810  O  O     . HOH X 5 .   ? 30.212  -6.056  208.938 1.00 56.67  ? 1067 HOH B O     1 
HETATM 9811  O  O     . HOH X 5 .   ? 39.866  12.157  190.037 1.00 51.92  ? 1068 HOH B O     1 
HETATM 9812  O  O     . HOH X 5 .   ? 29.690  41.201  190.137 1.00 54.45  ? 1069 HOH B O     1 
HETATM 9813  O  O     . HOH X 5 .   ? 23.106  30.164  186.967 1.00 74.28  ? 1070 HOH B O     1 
HETATM 9814  O  O     . HOH X 5 .   ? 38.639  14.645  196.775 1.00 33.90  ? 1071 HOH B O     1 
HETATM 9815  O  O     . HOH X 5 .   ? 64.300  12.535  198.197 1.00 59.17  ? 1072 HOH B O     1 
HETATM 9816  O  O     . HOH X 5 .   ? 55.342  18.322  202.458 1.00 34.79  ? 1073 HOH B O     1 
HETATM 9817  O  O     . HOH X 5 .   ? 61.894  21.840  189.415 1.00 46.52  ? 1074 HOH B O     1 
HETATM 9818  O  O     . HOH X 5 .   ? 48.884  29.776  180.251 1.00 46.02  ? 1075 HOH B O     1 
HETATM 9819  O  O     . HOH X 5 .   ? 43.871  24.792  174.505 1.00 50.76  ? 1076 HOH B O     1 
HETATM 9820  O  O     . HOH X 5 .   ? 56.023  -3.327  213.219 1.00 43.87  ? 1077 HOH B O     1 
HETATM 9821  O  O     . HOH X 5 .   ? 54.876  2.967   206.443 1.00 60.55  ? 1078 HOH B O     1 
HETATM 9822  O  O     . HOH X 5 .   ? 56.603  -4.852  210.443 1.00 39.92  ? 1079 HOH B O     1 
HETATM 9823  O  O     . HOH X 5 .   ? 32.307  -2.105  193.085 1.00 45.15  ? 1080 HOH B O     1 
HETATM 9824  O  O     . HOH X 5 .   ? 33.055  3.121   191.938 1.00 32.32  ? 1081 HOH B O     1 
HETATM 9825  O  O     . HOH X 5 .   ? 30.102  39.925  195.267 1.00 55.08  ? 1082 HOH B O     1 
HETATM 9826  O  O     . HOH X 5 .   ? 59.767  13.963  217.452 1.00 52.74  ? 1083 HOH B O     1 
HETATM 9827  O  O     . HOH X 5 .   ? 61.338  10.473  217.406 1.00 53.36  ? 1084 HOH B O     1 
HETATM 9828  O  O     . HOH X 5 .   ? 36.343  37.809  180.266 1.00 53.29  ? 1085 HOH B O     1 
HETATM 9829  O  O     . HOH X 5 .   ? 54.071  23.181  205.609 1.00 26.41  ? 1086 HOH B O     1 
HETATM 9830  O  O     . HOH X 5 .   ? 55.677  34.845  213.439 1.00 46.59  ? 1087 HOH B O     1 
HETATM 9831  O  O     . HOH X 5 .   ? 56.596  32.342  215.428 1.00 57.28  ? 1088 HOH B O     1 
HETATM 9832  O  O     . HOH X 5 .   ? 42.269  34.767  205.454 1.00 46.66  ? 1089 HOH B O     1 
HETATM 9833  O  O     . HOH X 5 .   ? 50.134  30.179  222.384 1.00 81.19  ? 1090 HOH B O     1 
HETATM 9834  O  O     . HOH X 5 .   ? 51.369  31.222  225.793 1.00 75.76  ? 1091 HOH B O     1 
HETATM 9835  O  O     . HOH X 5 .   ? 14.486  39.021  224.643 1.00 51.42  ? 1092 HOH B O     1 
HETATM 9836  O  O     . HOH X 5 .   ? 15.996  41.199  224.097 1.00 43.76  ? 1093 HOH B O     1 
HETATM 9837  O  O     . HOH X 5 .   ? 14.075  37.129  230.038 1.00 60.89  ? 1094 HOH B O     1 
HETATM 9838  O  O     . HOH X 5 .   ? 15.876  37.305  233.980 1.00 59.04  ? 1095 HOH B O     1 
HETATM 9839  O  O     . HOH X 5 .   ? 13.089  35.130  233.604 1.00 40.44  ? 1096 HOH B O     1 
HETATM 9840  O  O     . HOH X 5 .   ? 12.182  33.999  235.886 1.00 54.53  ? 1097 HOH B O     1 
HETATM 9841  O  O     . HOH X 5 .   ? 10.318  36.685  232.944 1.00 67.55  ? 1098 HOH B O     1 
HETATM 9842  O  O     . HOH X 5 .   ? 23.728  44.363  224.526 1.00 48.31  ? 1099 HOH B O     1 
HETATM 9843  O  O     . HOH X 5 .   ? 26.883  44.422  219.689 1.00 63.82  ? 1100 HOH B O     1 
HETATM 9844  O  O     . HOH X 5 .   ? 36.810  9.360   204.862 1.00 30.92  ? 1101 HOH B O     1 
HETATM 9845  O  O     . HOH X 5 .   ? 50.187  -0.111  192.185 1.00 39.93  ? 1102 HOH B O     1 
HETATM 9846  O  O     . HOH X 5 .   ? 51.246  1.917   196.511 1.00 27.26  ? 1103 HOH B O     1 
HETATM 9847  O  O     . HOH X 5 .   ? 52.940  1.099   194.566 1.00 35.29  ? 1104 HOH B O     1 
HETATM 9848  O  O     . HOH Y 5 .   ? 54.730  -22.026 232.973 1.00 53.30  ? 904  HOH C O     1 
HETATM 9849  O  O     . HOH Y 5 .   ? 55.679  -28.763 221.401 1.00 40.47  ? 905  HOH C O     1 
HETATM 9850  O  O     . HOH Y 5 .   ? 39.928  -32.281 215.089 1.00 52.97  ? 906  HOH C O     1 
HETATM 9851  O  O     . HOH Y 5 .   ? 54.973  -27.827 227.809 1.00 74.47  ? 907  HOH C O     1 
HETATM 9852  O  O     . HOH Y 5 .   ? 56.028  -17.997 220.428 1.00 59.63  ? 908  HOH C O     1 
HETATM 9853  O  O     . HOH Y 5 .   ? 44.625  -31.486 238.024 1.00 63.08  ? 909  HOH C O     1 
HETATM 9854  O  O     . HOH Y 5 .   ? 35.282  -25.495 236.894 1.00 39.47  ? 910  HOH C O     1 
HETATM 9855  O  O     . HOH Y 5 .   ? 37.220  -29.985 243.863 1.00 56.72  ? 911  HOH C O     1 
HETATM 9856  O  O     . HOH Y 5 .   ? 50.013  -26.627 248.911 1.00 39.36  ? 912  HOH C O     1 
HETATM 9857  O  O     . HOH Y 5 .   ? 51.014  -29.292 249.726 1.00 42.06  ? 913  HOH C O     1 
HETATM 9858  O  O     . HOH Y 5 .   ? 24.011  -17.041 211.898 1.00 45.61  ? 914  HOH C O     1 
HETATM 9859  O  O     . HOH Y 5 .   ? 23.420  -19.124 214.935 1.00 65.71  ? 915  HOH C O     1 
HETATM 9860  O  O     . HOH Y 5 .   ? 41.685  -4.663  254.463 1.00 38.73  ? 916  HOH C O     1 
HETATM 9861  O  O     . HOH Y 5 .   ? 43.383  -1.187  255.759 1.00 76.25  ? 917  HOH C O     1 
HETATM 9862  O  O     . HOH Y 5 .   ? 42.714  2.121   256.548 1.00 41.35  ? 918  HOH C O     1 
HETATM 9863  O  O     . HOH Y 5 .   ? 47.484  -6.536  221.365 1.00 62.32  ? 919  HOH C O     1 
HETATM 9864  O  O     . HOH Y 5 .   ? 47.373  4.562   232.927 1.00 48.93  ? 920  HOH C O     1 
HETATM 9865  O  O     . HOH Y 5 .   ? 0.674   11.688  230.309 1.00 53.54  ? 921  HOH C O     1 
HETATM 9866  O  O     . HOH Y 5 .   ? -0.575  12.264  227.898 1.00 51.52  ? 922  HOH C O     1 
HETATM 9867  O  O     . HOH Y 5 .   ? 18.928  -14.461 215.823 1.00 34.58  ? 923  HOH C O     1 
HETATM 9868  O  O     . HOH Y 5 .   ? 29.028  -13.754 218.719 1.00 36.33  ? 924  HOH C O     1 
HETATM 9869  O  O     . HOH Y 5 .   ? 30.022  -11.123 219.413 1.00 58.73  ? 925  HOH C O     1 
HETATM 9870  O  O     . HOH Y 5 .   ? 35.246  -5.582  222.307 1.00 35.35  ? 926  HOH C O     1 
HETATM 9871  O  O     . HOH Y 5 .   ? 34.066  -7.461  233.088 1.00 47.65  ? 927  HOH C O     1 
HETATM 9872  O  O     . HOH Y 5 .   ? 27.056  -18.072 254.064 1.00 51.33  ? 928  HOH C O     1 
HETATM 9873  O  O     . HOH Y 5 .   ? 27.524  -8.528  239.001 1.00 42.54  ? 929  HOH C O     1 
HETATM 9874  O  O     . HOH Y 5 .   ? 47.311  -8.499  240.281 1.00 37.77  ? 930  HOH C O     1 
HETATM 9875  O  O     . HOH Y 5 .   ? 35.221  -19.388 208.983 1.00 55.63  ? 931  HOH C O     1 
HETATM 9876  O  O     . HOH Y 5 .   ? 49.806  -3.450  234.654 1.00 57.02  ? 932  HOH C O     1 
HETATM 9877  O  O     . HOH Y 5 .   ? 46.772  -0.854  225.757 1.00 48.80  ? 933  HOH C O     1 
HETATM 9878  O  O     . HOH Y 5 .   ? 32.609  2.368   231.330 1.00 42.18  ? 934  HOH C O     1 
HETATM 9879  O  O     . HOH Y 5 .   ? 34.828  -0.111  237.599 1.00 58.57  ? 935  HOH C O     1 
HETATM 9880  O  O     . HOH Y 5 .   ? 31.000  -22.174 235.042 1.00 49.79  ? 936  HOH C O     1 
HETATM 9881  O  O     . HOH Y 5 .   ? 13.900  -27.132 220.210 1.00 60.78  ? 937  HOH C O     1 
HETATM 9882  O  O     . HOH Y 5 .   ? 33.487  -17.189 244.229 1.00 55.00  ? 938  HOH C O     1 
HETATM 9883  O  O     . HOH Y 5 .   ? 27.878  12.011  229.943 1.00 65.64  ? 939  HOH C O     1 
HETATM 9884  O  O     . HOH Y 5 .   ? 55.400  -12.911 234.050 1.00 47.41  ? 940  HOH C O     1 
HETATM 9885  O  O     . HOH Y 5 .   ? 53.733  -9.908  238.995 1.00 31.68  ? 941  HOH C O     1 
HETATM 9886  O  O     . HOH Y 5 .   ? 42.947  -32.080 243.660 1.00 31.99  ? 942  HOH C O     1 
HETATM 9887  O  O     . HOH Y 5 .   ? 41.263  -16.006 217.312 1.00 72.04  ? 943  HOH C O     1 
HETATM 9888  O  O     . HOH Y 5 .   ? 45.470  -8.080  220.116 1.00 29.57  ? 944  HOH C O     1 
HETATM 9889  O  O     . HOH Y 5 .   ? 14.842  6.460   228.360 1.00 69.65  ? 945  HOH C O     1 
HETATM 9890  O  O     . HOH Y 5 .   ? 52.714  -10.693 234.572 1.00 44.16  ? 946  HOH C O     1 
HETATM 9891  O  O     . HOH Y 5 .   ? 52.092  -32.224 234.378 1.00 48.14  ? 947  HOH C O     1 
HETATM 9892  O  O     . HOH Y 5 .   ? 46.889  -26.299 248.169 1.00 25.97  ? 948  HOH C O     1 
HETATM 9893  O  O     . HOH Y 5 .   ? 47.674  -28.831 249.652 1.00 46.88  ? 949  HOH C O     1 
HETATM 9894  O  O     . HOH Y 5 .   ? 48.636  -24.997 250.194 1.00 40.57  ? 950  HOH C O     1 
HETATM 9895  O  O     . HOH Y 5 .   ? 50.458  -26.037 252.800 1.00 36.32  ? 951  HOH C O     1 
HETATM 9896  O  O     . HOH Y 5 .   ? 31.986  -16.703 261.450 1.00 27.67  ? 952  HOH C O     1 
HETATM 9897  O  O     . HOH Y 5 .   ? 30.663  -17.464 244.391 1.00 19.25  ? 953  HOH C O     1 
HETATM 9898  O  O     . HOH Y 5 .   ? 54.973  -14.140 242.956 1.00 42.80  ? 954  HOH C O     1 
HETATM 9899  O  O     . HOH Y 5 .   ? 35.372  -9.826  218.394 1.00 38.47  ? 955  HOH C O     1 
HETATM 9900  O  O     . HOH Y 5 .   ? 32.611  -10.843 213.612 1.00 57.22  ? 956  HOH C O     1 
HETATM 9901  O  O     . HOH Y 5 .   ? 54.274  -7.080  240.616 1.00 38.83  ? 957  HOH C O     1 
HETATM 9902  O  O     . HOH Y 5 .   ? 34.764  -21.163 206.902 1.00 42.36  ? 958  HOH C O     1 
HETATM 9903  O  O     . HOH Y 5 .   ? 43.708  -19.436 214.329 1.00 69.08  ? 959  HOH C O     1 
HETATM 9904  O  O     . HOH Y 5 .   ? 39.110  -18.242 211.242 1.00 42.42  ? 960  HOH C O     1 
HETATM 9905  O  O     . HOH Y 5 .   ? 44.162  -17.600 217.373 1.00 22.12  ? 961  HOH C O     1 
HETATM 9906  O  O     . HOH Y 5 .   ? 49.767  -9.356  233.841 1.00 37.64  ? 962  HOH C O     1 
HETATM 9907  O  O     . HOH Y 5 .   ? 52.082  -6.486  234.549 1.00 62.52  ? 963  HOH C O     1 
HETATM 9908  O  O     . HOH Y 5 .   ? 52.934  -12.016 236.803 1.00 54.86  ? 964  HOH C O     1 
HETATM 9909  O  O     . HOH Y 5 .   ? 18.278  2.448   224.711 1.00 49.34  ? 965  HOH C O     1 
HETATM 9910  O  O     . HOH Y 5 .   ? 18.350  7.806   226.160 1.00 48.08  ? 966  HOH C O     1 
HETATM 9911  O  O     . HOH Y 5 .   ? 34.465  -14.214 236.642 1.00 37.45  ? 967  HOH C O     1 
HETATM 9912  O  O     . HOH Y 5 .   ? 27.897  -15.897 246.593 1.00 36.11  ? 968  HOH C O     1 
HETATM 9913  O  O     . HOH Y 5 .   ? 25.027  -18.578 222.118 1.00 69.95  ? 969  HOH C O     1 
HETATM 9914  O  O     . HOH Y 5 .   ? 32.498  -15.008 230.274 1.00 26.15  ? 970  HOH C O     1 
HETATM 9915  O  O     . HOH Y 5 .   ? 33.067  -19.679 231.268 1.00 30.96  ? 971  HOH C O     1 
HETATM 9916  O  O     . HOH Y 5 .   ? 34.515  -17.479 236.486 1.00 57.92  ? 972  HOH C O     1 
HETATM 9917  O  O     . HOH Y 5 .   ? 34.289  -12.972 213.905 1.00 70.30  ? 973  HOH C O     1 
HETATM 9918  O  O     . HOH Y 5 .   ? 56.362  -10.009 241.294 1.00 49.95  ? 974  HOH C O     1 
HETATM 9919  O  O     . HOH Y 5 .   ? 38.858  -0.053  224.037 1.00 62.05  ? 975  HOH C O     1 
HETATM 9920  O  O     . HOH Y 5 .   ? 38.804  1.849   221.721 1.00 45.39  ? 976  HOH C O     1 
HETATM 9921  O  O     . HOH Y 5 .   ? 37.179  2.048   224.153 1.00 56.22  ? 977  HOH C O     1 
HETATM 9922  O  O     . HOH Y 5 .   ? 49.361  2.495   228.198 1.00 45.05  ? 978  HOH C O     1 
HETATM 9923  O  O     . HOH Y 5 .   ? 47.664  7.624   232.705 1.00 41.75  ? 979  HOH C O     1 
HETATM 9924  O  O     . HOH Y 5 .   ? 51.327  5.486   238.387 1.00 51.94  ? 980  HOH C O     1 
HETATM 9925  O  O     . HOH Y 5 .   ? 51.010  3.936   242.661 1.00 39.33  ? 981  HOH C O     1 
HETATM 9926  O  O     . HOH Y 5 .   ? 9.280   12.812  242.244 1.00 84.52  ? 982  HOH C O     1 
HETATM 9927  O  O     . HOH Y 5 .   ? 10.968  15.047  244.388 1.00 73.08  ? 983  HOH C O     1 
HETATM 9928  O  O     . HOH Y 5 .   ? 35.087  2.892   227.359 1.00 59.61  ? 984  HOH C O     1 
HETATM 9929  O  O     . HOH Y 5 .   ? 41.441  4.753   222.056 1.00 56.93  ? 985  HOH C O     1 
HETATM 9930  O  O     . HOH Y 5 .   ? 37.168  4.476   223.531 1.00 47.39  ? 986  HOH C O     1 
HETATM 9931  O  O     . HOH Y 5 .   ? 57.067  -7.840  231.407 1.00 43.53  ? 987  HOH C O     1 
HETATM 9932  O  O     . HOH Y 5 .   ? 56.225  -16.237 240.081 1.00 77.99  ? 988  HOH C O     1 
HETATM 9933  O  O     . HOH Y 5 .   ? 20.652  -26.401 221.930 1.00 71.43  ? 989  HOH C O     1 
HETATM 9934  O  O     . HOH Y 5 .   ? 19.249  -22.728 225.446 1.00 76.17  ? 990  HOH C O     1 
HETATM 9935  O  O     . HOH Y 5 .   ? 35.468  -21.953 204.538 1.00 70.28  ? 991  HOH C O     1 
HETATM 9936  O  O     . HOH Y 5 .   ? 54.833  -27.194 224.410 1.00 55.74  ? 992  HOH C O     1 
HETATM 9937  O  O     . HOH Y 5 .   ? 55.184  -31.803 224.668 1.00 77.42  ? 993  HOH C O     1 
HETATM 9938  O  O     . HOH Y 5 .   ? 57.309  -29.990 227.611 1.00 29.23  ? 994  HOH C O     1 
HETATM 9939  O  O     . HOH Y 5 .   ? 17.296  -33.297 219.203 1.00 63.38  ? 995  HOH C O     1 
HETATM 9940  O  O     . HOH Y 5 .   ? 19.635  -36.775 217.623 1.00 65.87  ? 996  HOH C O     1 
HETATM 9941  O  O     . HOH Y 5 .   ? 25.154  -38.797 215.879 1.00 61.37  ? 997  HOH C O     1 
HETATM 9942  O  O     . HOH Y 5 .   ? 21.203  -40.468 217.912 1.00 63.54  ? 998  HOH C O     1 
HETATM 9943  O  O     . HOH Y 5 .   ? 33.170  -19.992 235.655 1.00 58.05  ? 999  HOH C O     1 
HETATM 9944  O  O     . HOH Y 5 .   ? 56.549  -16.510 247.301 1.00 67.26  ? 1000 HOH C O     1 
HETATM 9945  O  O     . HOH Y 5 .   ? 35.620  -2.792  227.699 1.00 71.73  ? 1001 HOH C O     1 
HETATM 9946  O  O     . HOH Y 5 .   ? 8.966   6.877   226.946 1.00 61.44  ? 1002 HOH C O     1 
HETATM 9947  O  O     . HOH Y 5 .   ? 20.413  0.178   235.416 1.00 59.43  ? 1003 HOH C O     1 
HETATM 9948  O  O     . HOH Y 5 .   ? 26.689  -30.217 250.343 1.00 48.68  ? 1004 HOH C O     1 
HETATM 9949  O  O     . HOH Z 5 .   ? 12.586  -22.333 249.753 1.00 60.37  ? 905  HOH D O     1 
HETATM 9950  O  O     . HOH Z 5 .   ? 26.129  1.042   250.997 1.00 42.13  ? 906  HOH D O     1 
HETATM 9951  O  O     . HOH Z 5 .   ? 26.970  -1.317  250.748 1.00 34.04  ? 907  HOH D O     1 
HETATM 9952  O  O     . HOH Z 5 .   ? 24.611  -3.273  247.912 1.00 23.76  ? 908  HOH D O     1 
HETATM 9953  O  O     . HOH Z 5 .   ? -7.250  9.362   231.082 1.00 51.51  ? 909  HOH D O     1 
HETATM 9954  O  O     . HOH Z 5 .   ? -9.278  -22.008 227.712 1.00 39.18  ? 910  HOH D O     1 
HETATM 9955  O  O     . HOH Z 5 .   ? 8.823   -39.456 231.410 1.00 66.56  ? 911  HOH D O     1 
HETATM 9956  O  O     . HOH Z 5 .   ? 8.545   -39.863 228.619 1.00 51.25  ? 912  HOH D O     1 
HETATM 9957  O  O     . HOH Z 5 .   ? 9.293   -0.651  198.164 1.00 50.24  ? 913  HOH D O     1 
HETATM 9958  O  O     . HOH Z 5 .   ? 2.144   -0.088  214.729 1.00 38.72  ? 914  HOH D O     1 
HETATM 9959  O  O     . HOH Z 5 .   ? -3.080  -5.782  245.208 1.00 45.00  ? 915  HOH D O     1 
HETATM 9960  O  O     . HOH Z 5 .   ? 18.693  -12.018 222.126 1.00 39.48  ? 916  HOH D O     1 
HETATM 9961  O  O     . HOH Z 5 .   ? 18.789  -12.463 206.507 1.00 47.27  ? 917  HOH D O     1 
HETATM 9962  O  O     . HOH Z 5 .   ? -4.424  -14.384 231.265 1.00 37.23  ? 918  HOH D O     1 
HETATM 9963  O  O     . HOH Z 5 .   ? -2.992  -31.826 236.830 1.00 40.13  ? 919  HOH D O     1 
HETATM 9964  O  O     . HOH Z 5 .   ? 2.802   -37.018 233.967 1.00 48.03  ? 920  HOH D O     1 
HETATM 9965  O  O     . HOH Z 5 .   ? 9.653   -42.008 227.842 1.00 54.28  ? 921  HOH D O     1 
HETATM 9966  O  O     . HOH Z 5 .   ? 12.582  -20.368 229.281 1.00 22.25  ? 922  HOH D O     1 
HETATM 9967  O  O     . HOH Z 5 .   ? 3.492   -31.269 220.382 1.00 47.17  ? 923  HOH D O     1 
HETATM 9968  O  O     . HOH Z 5 .   ? -10.584 -24.930 222.799 1.00 78.68  ? 924  HOH D O     1 
HETATM 9969  O  O     . HOH Z 5 .   ? 3.664   -20.313 210.720 1.00 44.17  ? 925  HOH D O     1 
HETATM 9970  O  O     . HOH Z 5 .   ? -0.738  -16.051 211.921 1.00 38.30  ? 926  HOH D O     1 
HETATM 9971  O  O     . HOH Z 5 .   ? 3.387   -19.524 205.874 1.00 37.06  ? 927  HOH D O     1 
HETATM 9972  O  O     . HOH Z 5 .   ? -0.306  -10.155 201.120 1.00 36.34  ? 928  HOH D O     1 
HETATM 9973  O  O     . HOH Z 5 .   ? 13.032  -3.856  201.322 1.00 44.31  ? 929  HOH D O     1 
HETATM 9974  O  O     . HOH Z 5 .   ? -1.572  -5.916  216.304 1.00 70.34  ? 930  HOH D O     1 
HETATM 9975  O  O     . HOH Z 5 .   ? 9.224   -15.454 203.840 1.00 72.56  ? 931  HOH D O     1 
HETATM 9976  O  O     . HOH Z 5 .   ? 18.604  -20.368 217.239 1.00 48.25  ? 932  HOH D O     1 
HETATM 9977  O  O     . HOH Z 5 .   ? 14.004  -8.336  223.909 1.00 31.42  ? 933  HOH D O     1 
HETATM 9978  O  O     . HOH Z 5 .   ? 10.444  -24.853 247.622 1.00 44.05  ? 934  HOH D O     1 
HETATM 9979  O  O     . HOH Z 5 .   ? 9.758   -22.687 249.392 1.00 46.79  ? 935  HOH D O     1 
HETATM 9980  O  O     . HOH Z 5 .   ? 5.324   -26.296 247.639 1.00 54.11  ? 936  HOH D O     1 
HETATM 9981  O  O     . HOH Z 5 .   ? 9.970   -29.265 249.117 1.00 57.85  ? 937  HOH D O     1 
HETATM 9982  O  O     . HOH Z 5 .   ? 17.228  -21.322 253.801 1.00 75.73  ? 938  HOH D O     1 
HETATM 9983  O  O     . HOH Z 5 .   ? -8.949  -2.467  231.551 1.00 45.13  ? 939  HOH D O     1 
HETATM 9984  O  O     . HOH Z 5 .   ? -9.869  -4.651  222.042 1.00 57.03  ? 940  HOH D O     1 
HETATM 9985  O  O     . HOH Z 5 .   ? 32.381  13.883  247.600 1.00 57.99  ? 941  HOH D O     1 
HETATM 9986  O  O     . HOH Z 5 .   ? 7.846   -9.139  242.398 1.00 32.62  ? 942  HOH D O     1 
HETATM 9987  O  O     . HOH Z 5 .   ? 6.027   -3.712  241.025 1.00 55.24  ? 943  HOH D O     1 
HETATM 9988  O  O     . HOH Z 5 .   ? 22.171  -42.330 231.992 1.00 67.32  ? 944  HOH D O     1 
HETATM 9989  O  O     . HOH Z 5 .   ? 4.702   -33.962 221.292 1.00 51.77  ? 945  HOH D O     1 
HETATM 9990  O  O     . HOH Z 5 .   ? -8.434  -27.501 221.443 1.00 61.61  ? 946  HOH D O     1 
HETATM 9991  O  O     . HOH Z 5 .   ? 18.346  -15.499 209.879 1.00 42.11  ? 947  HOH D O     1 
HETATM 9992  O  O     . HOH Z 5 .   ? 18.555  -19.333 203.400 1.00 38.58  ? 948  HOH D O     1 
HETATM 9993  O  O     . HOH Z 5 .   ? -7.647  -0.005  220.640 1.00 49.37  ? 949  HOH D O     1 
HETATM 9994  O  O     . HOH Z 5 .   ? -7.047  -15.540 241.308 1.00 51.00  ? 950  HOH D O     1 
HETATM 9995  O  O     . HOH Z 5 .   ? 9.888   -18.911 240.171 1.00 44.65  ? 951  HOH D O     1 
HETATM 9996  O  O     . HOH Z 5 .   ? 29.089  13.149  243.380 1.00 32.77  ? 952  HOH D O     1 
HETATM 9997  O  O     . HOH Z 5 .   ? 16.770  -5.711  212.719 1.00 55.96  ? 953  HOH D O     1 
HETATM 9998  O  O     . HOH Z 5 .   ? -10.011 -23.958 235.939 1.00 60.75  ? 954  HOH D O     1 
HETATM 9999  O  O     . HOH Z 5 .   ? 28.722  -34.518 227.378 1.00 82.10  ? 955  HOH D O     1 
HETATM 10000 O  O     . HOH Z 5 .   ? 12.365  -19.561 225.724 1.00 38.00  ? 956  HOH D O     1 
HETATM 10001 O  O     . HOH Z 5 .   ? -8.225  -29.700 224.884 1.00 55.91  ? 957  HOH D O     1 
HETATM 10002 O  O     . HOH Z 5 .   ? 10.741  -24.075 214.455 1.00 46.03  ? 958  HOH D O     1 
HETATM 10003 O  O     . HOH Z 5 .   ? 12.042  -6.591  221.241 1.00 49.71  ? 959  HOH D O     1 
HETATM 10004 O  O     . HOH Z 5 .   ? 11.533  -9.505  221.219 1.00 29.54  ? 960  HOH D O     1 
HETATM 10005 O  O     . HOH Z 5 .   ? 16.395  -4.123  220.760 1.00 48.16  ? 961  HOH D O     1 
HETATM 10006 O  O     . HOH Z 5 .   ? 16.171  -14.999 213.397 1.00 26.67  ? 962  HOH D O     1 
HETATM 10007 O  O     . HOH Z 5 .   ? 17.148  -18.234 207.616 1.00 49.62  ? 963  HOH D O     1 
HETATM 10008 O  O     . HOH Z 5 .   ? 17.982  -13.764 211.823 1.00 56.32  ? 964  HOH D O     1 
HETATM 10009 O  O     . HOH Z 5 .   ? 8.284   -13.047 230.482 1.00 15.35  ? 965  HOH D O     1 
HETATM 10010 O  O     . HOH Z 5 .   ? 13.562  -19.907 238.721 1.00 30.71  ? 966  HOH D O     1 
HETATM 10011 O  O     . HOH Z 5 .   ? 4.031   -25.721 245.582 1.00 53.21  ? 967  HOH D O     1 
HETATM 10012 O  O     . HOH Z 5 .   ? 10.983  -27.501 247.749 1.00 36.99  ? 968  HOH D O     1 
HETATM 10013 O  O     . HOH Z 5 .   ? 12.958  -24.813 248.252 1.00 56.40  ? 969  HOH D O     1 
HETATM 10014 O  O     . HOH Z 5 .   ? 5.522   -24.109 243.931 1.00 59.47  ? 970  HOH D O     1 
HETATM 10015 O  O     . HOH Z 5 .   ? 7.591   -26.355 248.519 1.00 29.75  ? 971  HOH D O     1 
HETATM 10016 O  O     . HOH Z 5 .   ? 2.635   -28.732 241.803 1.00 73.86  ? 972  HOH D O     1 
HETATM 10017 O  O     . HOH Z 5 .   ? 22.311  -0.315  248.166 1.00 69.19  ? 973  HOH D O     1 
HETATM 10018 O  O     . HOH Z 5 .   ? 13.533  0.531   223.702 1.00 43.76  ? 974  HOH D O     1 
HETATM 10019 O  O     . HOH Z 5 .   ? 5.450   -38.807 228.326 1.00 40.05  ? 975  HOH D O     1 
HETATM 10020 O  O     . HOH Z 5 .   ? 7.646   -40.456 225.610 1.00 50.20  ? 976  HOH D O     1 
HETATM 10021 O  O     . HOH Z 5 .   ? 10.465  -38.656 226.540 1.00 47.60  ? 977  HOH D O     1 
HETATM 10022 O  O     . HOH Z 5 .   ? 8.706   -36.044 224.976 1.00 64.27  ? 978  HOH D O     1 
HETATM 10023 O  O     . HOH Z 5 .   ? 11.747  -16.490 226.483 1.00 39.09  ? 979  HOH D O     1 
HETATM 10024 O  O     . HOH Z 5 .   ? 1.422   -38.597 226.328 1.00 61.46  ? 980  HOH D O     1 
HETATM 10025 O  O     . HOH Z 5 .   ? -4.189  -34.384 224.652 1.00 55.37  ? 981  HOH D O     1 
HETATM 10026 O  O     . HOH Z 5 .   ? -8.215  -30.690 221.309 1.00 44.22  ? 982  HOH D O     1 
HETATM 10027 O  O     . HOH Z 5 .   ? 0.780   -36.439 224.488 1.00 83.07  ? 983  HOH D O     1 
HETATM 10028 O  O     . HOH Z 5 .   ? -8.441  -26.766 213.379 1.00 56.66  ? 984  HOH D O     1 
HETATM 10029 O  O     . HOH Z 5 .   ? 8.085   -23.383 215.309 1.00 57.68  ? 985  HOH D O     1 
HETATM 10030 O  O     . HOH Z 5 .   ? 0.607   -18.313 205.781 1.00 35.69  ? 986  HOH D O     1 
HETATM 10031 O  O     . HOH Z 5 .   ? 7.863   -1.234  203.499 1.00 46.93  ? 987  HOH D O     1 
HETATM 10032 O  O     . HOH Z 5 .   ? 2.874   0.613   204.620 1.00 40.33  ? 988  HOH D O     1 
HETATM 10033 O  O     . HOH Z 5 .   ? 13.279  -12.007 230.719 1.00 34.41  ? 989  HOH D O     1 
HETATM 10034 O  O     . HOH Z 5 .   ? -8.394  -0.459  223.542 1.00 46.04  ? 990  HOH D O     1 
HETATM 10035 O  O     . HOH Z 5 .   ? 8.960   -5.763  246.752 1.00 55.97  ? 991  HOH D O     1 
HETATM 10036 O  O     . HOH Z 5 .   ? 6.680   -5.332  250.408 1.00 50.90  ? 992  HOH D O     1 
HETATM 10037 O  O     . HOH Z 5 .   ? 11.294  -11.975 246.584 1.00 54.41  ? 993  HOH D O     1 
HETATM 10038 O  O     . HOH Z 5 .   ? 5.967   -9.027  245.261 1.00 50.63  ? 994  HOH D O     1 
HETATM 10039 O  O     . HOH Z 5 .   ? 22.211  -0.494  237.463 1.00 39.41  ? 995  HOH D O     1 
HETATM 10040 O  O     . HOH Z 5 .   ? -6.648  7.556   235.291 1.00 52.53  ? 996  HOH D O     1 
HETATM 10041 O  O     . HOH Z 5 .   ? -5.878  9.020   237.634 1.00 42.94  ? 997  HOH D O     1 
HETATM 10042 O  O     . HOH Z 5 .   ? 8.488   10.127  243.694 1.00 55.40  ? 998  HOH D O     1 
HETATM 10043 O  O     . HOH Z 5 .   ? 30.152  12.830  247.014 1.00 38.86  ? 999  HOH D O     1 
HETATM 10044 O  O     . HOH Z 5 .   ? 31.620  13.645  244.441 1.00 51.52  ? 1000 HOH D O     1 
HETATM 10045 O  O     . HOH Z 5 .   ? 20.513  -8.018  220.051 1.00 24.77  ? 1001 HOH D O     1 
HETATM 10046 O  O     . HOH Z 5 .   ? 17.249  -6.785  220.666 1.00 25.19  ? 1002 HOH D O     1 
HETATM 10047 O  O     . HOH Z 5 .   ? 1.240   -14.038 247.928 1.00 32.13  ? 1003 HOH D O     1 
HETATM 10048 O  O     . HOH Z 5 .   ? 10.035  -20.337 250.425 1.00 65.29  ? 1004 HOH D O     1 
HETATM 10049 O  O     . HOH Z 5 .   ? 19.065  -19.622 207.764 1.00 51.66  ? 1005 HOH D O     1 
HETATM 10050 O  O     . HOH Z 5 .   ? 9.909   -2.624  196.181 1.00 53.34  ? 1006 HOH D O     1 
HETATM 10051 O  O     . HOH Z 5 .   ? -5.040  -3.706  245.194 1.00 70.65  ? 1007 HOH D O     1 
HETATM 10052 O  O     . HOH Z 5 .   ? 18.062  -16.087 201.687 1.00 66.92  ? 1008 HOH D O     1 
HETATM 10053 O  O     . HOH Z 5 .   ? 16.502  -21.365 202.808 1.00 63.90  ? 1009 HOH D O     1 
HETATM 10054 O  O     . HOH Z 5 .   ? -6.249  3.481   242.471 1.00 63.55  ? 1010 HOH D O     1 
HETATM 10055 O  O     . HOH Z 5 .   ? 15.732  -38.682 229.159 1.00 73.76  ? 1011 HOH D O     1 
HETATM 10056 O  O     . HOH Z 5 .   ? -1.666  -19.760 211.994 1.00 51.39  ? 1012 HOH D O     1 
HETATM 10057 O  O     . HOH Z 5 .   ? -3.820  -22.107 212.427 1.00 51.20  ? 1013 HOH D O     1 
HETATM 10058 O  O     . HOH Z 5 .   ? 2.755   -22.093 212.520 1.00 58.06  ? 1014 HOH D O     1 
HETATM 10059 O  O     . HOH Z 5 .   ? -3.486  -12.793 210.887 1.00 60.04  ? 1015 HOH D O     1 
HETATM 10060 O  O     . HOH Z 5 .   ? 4.261   -16.935 201.123 1.00 49.87  ? 1016 HOH D O     1 
HETATM 10061 O  O     . HOH Z 5 .   ? 1.115   2.767   214.439 1.00 51.48  ? 1017 HOH D O     1 
HETATM 10062 O  O     . HOH Z 5 .   ? 9.280   -7.755  212.790 1.00 40.58  ? 1018 HOH D O     1 
HETATM 10063 O  O     . HOH Z 5 .   ? 10.459  2.116   208.692 1.00 69.03  ? 1019 HOH D O     1 
HETATM 10064 O  O     . HOH Z 5 .   ? 12.597  -22.298 203.336 1.00 42.43  ? 1020 HOH D O     1 
HETATM 10065 O  O     . HOH Z 5 .   ? 9.542   2.866   222.381 1.00 60.57  ? 1021 HOH D O     1 
HETATM 10066 O  O     . HOH Z 5 .   ? -8.509  2.377   222.182 1.00 60.60  ? 1022 HOH D O     1 
HETATM 10067 O  O     . HOH Z 5 .   ? -8.039  -8.906  229.386 1.00 43.44  ? 1023 HOH D O     1 
HETATM 10068 O  O     . HOH Z 5 .   ? -0.186  -22.280 241.444 1.00 35.44  ? 1024 HOH D O     1 
HETATM 10069 O  O     . HOH Z 5 .   ? -0.166  -25.950 241.092 1.00 60.24  ? 1025 HOH D O     1 
HETATM 10070 O  O     . HOH Z 5 .   ? -0.469  -12.046 248.366 1.00 45.77  ? 1026 HOH D O     1 
HETATM 10071 O  O     . HOH Z 5 .   ? -6.071  -14.941 244.307 1.00 42.02  ? 1027 HOH D O     1 
HETATM 10072 O  O     . HOH Z 5 .   ? -8.730  -2.182  244.848 1.00 63.86  ? 1028 HOH D O     1 
HETATM 10073 O  O     . HOH Z 5 .   ? 7.466   9.457   241.349 1.00 70.49  ? 1029 HOH D O     1 
HETATM 10074 O  O     . HOH Z 5 .   ? 26.321  -3.795  251.292 1.00 77.01  ? 1030 HOH D O     1 
HETATM 10075 O  O     . HOH Z 5 .   ? 11.987  -1.275  199.817 1.00 44.82  ? 1031 HOH D O     1 
HETATM 10076 O  O     . HOH Z 5 .   ? 17.546  -1.534  206.683 1.00 39.65  ? 1032 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  GUA E . n 
A 1 2   DC  2   2   2   DC  CYT E . n 
A 1 3   DC  3   3   3   DC  CYT E . n 
A 1 4   DG  4   4   4   DG  GUA E . n 
A 1 5   DG  5   5   5   DG  GUA E . n 
A 1 6   DT  6   6   6   DT  THY E . n 
A 1 7   DC  7   7   7   DC  CYT E . n 
A 1 8   DG  8   8   8   DG  GUA E . n 
A 1 9   DA  9   9   9   DA  ADE E . n 
A 1 10  DC  10  10  10  DC  CYT E . n 
A 1 11  DC  11  11  11  DC  CYT E . n 
A 1 12  DG  12  12  12  DG  GUA E . n 
A 1 13  DG  13  13  13  DG  GUA E . n 
B 1 1   DG  1   1   1   DG  GUA F . n 
B 1 2   DC  2   2   2   DC  CYT F . n 
B 1 3   DC  3   3   3   DC  CYT F . n 
B 1 4   DG  4   4   4   DG  GUA F . n 
B 1 5   DG  5   5   5   DG  GUA F . n 
B 1 6   DT  6   6   6   DT  THY F . n 
B 1 7   DC  7   7   7   DC  CYT F . n 
B 1 8   DG  8   8   8   DG  GUA F . n 
B 1 9   DA  9   9   9   DA  ADE F . n 
B 1 10  DC  10  10  10  DC  CYT F . n 
B 1 11  DC  11  11  11  DC  CYT F . n 
B 1 12  DG  12  12  12  DG  GUA F . n 
B 1 13  DG  13  13  13  DG  GUA F . n 
C 1 1   DG  1   1   1   DG  GUA G . n 
C 1 2   DC  2   2   2   DC  CYT G . n 
C 1 3   DC  3   3   3   DC  CYT G . n 
C 1 4   DG  4   4   4   DG  GUA G . n 
C 1 5   DG  5   5   5   DG  GUA G . n 
C 1 6   DT  6   6   6   DT  THY G . n 
C 1 7   DC  7   7   7   DC  CYT G . n 
C 1 8   DG  8   8   8   DG  GUA G . n 
C 1 9   DA  9   9   9   DA  ADE G . n 
C 1 10  DC  10  10  10  DC  CYT G . n 
C 1 11  DC  11  11  11  DC  CYT G . n 
C 1 12  DG  12  12  12  DG  GUA G . n 
C 1 13  DG  13  13  13  DG  GUA G . n 
D 1 1   DG  1   1   1   DG  GUA H . n 
D 1 2   DC  2   2   2   DC  CYT H . n 
D 1 3   DC  3   3   3   DC  CYT H . n 
D 1 4   DG  4   4   4   DG  GUA H . n 
D 1 5   DG  5   5   5   DG  GUA H . n 
D 1 6   DT  6   6   6   DT  THY H . n 
D 1 7   DC  7   7   7   DC  CYT H . n 
D 1 8   DG  8   8   8   DG  GUA H . n 
D 1 9   DA  9   9   9   DA  ADE H . n 
D 1 10  DC  10  10  10  DC  CYT H . n 
D 1 11  DC  11  11  11  DC  CYT H . n 
D 1 12  DG  12  12  12  DG  GUA H . n 
D 1 13  DG  13  13  13  DG  GUA H . n 
E 2 1   SER 1   2   2   SER SER A . n 
E 2 2   PHE 2   3   3   PHE PHE A . n 
E 2 3   ILE 3   4   4   ILE ILE A . n 
E 2 4   LYS 4   5   5   LYS LYS A . n 
E 2 5   PRO 5   6   6   PRO PRO A . n 
E 2 6   ILE 6   7   7   ILE ILE A . n 
E 2 7   TYR 7   8   8   TYR TYR A . n 
E 2 8   GLN 8   9   9   GLN GLN A . n 
E 2 9   ASP 9   10  10  ASP ASP A . n 
E 2 10  ILE 10  11  11  ILE ILE A . n 
E 2 11  ASN 11  12  12  ASN ASN A . n 
E 2 12  SER 12  13  13  SER SER A . n 
E 2 13  ILE 13  14  14  ILE ILE A . n 
E 2 14  LEU 14  15  15  LEU LEU A . n 
E 2 15  ILE 15  16  16  ILE ILE A . n 
E 2 16  GLY 16  17  17  GLY GLY A . n 
E 2 17  GLN 17  18  18  GLN GLN A . n 
E 2 18  LYS 18  19  19  LYS LYS A . n 
E 2 19  VAL 19  20  20  VAL VAL A . n 
E 2 20  LYS 20  21  21  LYS LYS A . n 
E 2 21  ARG 21  22  22  ARG ARG A . n 
E 2 22  PRO 22  23  23  PRO PRO A . n 
E 2 23  LYS 23  24  24  LYS LYS A . n 
E 2 24  SER 24  25  25  SER SER A . n 
E 2 25  GLY 25  26  26  GLY GLY A . n 
E 2 26  THR 26  27  27  THR THR A . n 
E 2 27  LEU 27  28  28  LEU LEU A . n 
E 2 28  SER 28  29  29  SER SER A . n 
E 2 29  GLY 29  30  30  GLY GLY A . n 
E 2 30  HIS 30  31  31  HIS HIS A . n 
E 2 31  ALA 31  32  32  ALA ALA A . n 
E 2 32  ALA 32  33  33  ALA ALA A . n 
E 2 33  GLY 33  34  34  GLY GLY A . n 
E 2 34  GLU 34  35  35  GLU GLU A . n 
E 2 35  PRO 35  36  36  PRO PRO A . n 
E 2 36  PHE 36  37  37  PHE PHE A . n 
E 2 37  GLU 37  38  38  GLU GLU A . n 
E 2 38  LYS 38  39  39  LYS LYS A . n 
E 2 39  LEU 39  40  40  LEU LEU A . n 
E 2 40  VAL 40  41  41  VAL VAL A . n 
E 2 41  TYR 41  42  42  TYR TYR A . n 
E 2 42  LYS 42  43  43  LYS LYS A . n 
E 2 43  PHE 43  44  44  PHE PHE A . n 
E 2 44  LEU 44  45  45  LEU LEU A . n 
E 2 45  LYS 45  46  46  LYS LYS A . n 
E 2 46  GLU 46  47  47  GLU GLU A . n 
E 2 47  ASN 47  48  48  ASN ASN A . n 
E 2 48  LEU 48  49  49  LEU LEU A . n 
E 2 49  SER 49  50  50  SER SER A . n 
E 2 50  ASP 50  51  51  ASP ASP A . n 
E 2 51  LEU 51  52  52  LEU LEU A . n 
E 2 52  THR 52  53  53  THR THR A . n 
E 2 53  PHE 53  54  54  PHE PHE A . n 
E 2 54  LYS 54  55  55  LYS LYS A . n 
E 2 55  GLN 55  56  56  GLN GLN A . n 
E 2 56  TYR 56  57  57  TYR TYR A . n 
E 2 57  GLU 57  58  58  GLU GLU A . n 
E 2 58  TYR 58  59  59  TYR TYR A . n 
E 2 59  LEU 59  60  60  LEU LEU A . n 
E 2 60  ASN 60  61  61  ASN ASN A . n 
E 2 61  ASP 61  62  62  ASP ASP A . n 
E 2 62  LEU 62  63  63  LEU LEU A . n 
E 2 63  PHE 63  64  64  PHE PHE A . n 
E 2 64  MET 64  65  65  MET MET A . n 
E 2 65  LYS 65  66  66  LYS LYS A . n 
E 2 66  ASN 66  67  67  ASN ASN A . n 
E 2 67  PRO 67  68  68  PRO PRO A . n 
E 2 68  ALA 68  69  69  ALA ALA A . n 
E 2 69  ILE 69  70  70  ILE ILE A . n 
E 2 70  ILE 70  71  71  ILE ILE A . n 
E 2 71  GLY 71  72  72  GLY GLY A . n 
E 2 72  HIS 72  73  73  HIS HIS A . n 
E 2 73  GLU 73  74  74  GLU GLU A . n 
E 2 74  ALA 74  75  75  ALA ALA A . n 
E 2 75  ARG 75  76  76  ARG ARG A . n 
E 2 76  TYR 76  77  77  TYR TYR A . n 
E 2 77  LYS 77  78  78  LYS LYS A . n 
E 2 78  LEU 78  79  79  LEU LEU A . n 
E 2 79  PHE 79  80  80  PHE PHE A . n 
E 2 80  ASN 80  81  81  ASN ASN A . n 
E 2 81  SER 81  82  82  SER SER A . n 
E 2 82  PRO 82  83  83  PRO PRO A . n 
E 2 83  THR 83  84  84  THR THR A . n 
E 2 84  LEU 84  85  85  LEU LEU A . n 
E 2 85  LEU 85  86  86  LEU LEU A . n 
E 2 86  PHE 86  87  87  PHE PHE A . n 
E 2 87  LEU 87  88  88  LEU LEU A . n 
E 2 88  LEU 88  89  89  LEU LEU A . n 
E 2 89  SER 89  90  90  SER SER A . n 
E 2 90  ARG 90  91  91  ARG ARG A . n 
E 2 91  GLY 91  92  92  GLY GLY A . n 
E 2 92  LYS 92  93  93  LYS LYS A . n 
E 2 93  ALA 93  94  94  ALA ALA A . n 
E 2 94  ALA 94  95  95  ALA ALA A . n 
E 2 95  THR 95  96  96  THR THR A . n 
E 2 96  GLU 96  97  97  GLU GLU A . n 
E 2 97  ASN 97  98  98  ASN ASN A . n 
E 2 98  TRP 98  99  99  TRP TRP A . n 
E 2 99  SER 99  100 100 SER SER A . n 
E 2 100 ILE 100 101 101 ILE ILE A . n 
E 2 101 GLU 101 102 102 GLU GLU A . n 
E 2 102 ASN 102 103 103 ASN ASN A . n 
E 2 103 LEU 103 104 104 LEU LEU A . n 
E 2 104 PHE 104 105 105 PHE PHE A . n 
E 2 105 GLU 105 106 106 GLU GLU A . n 
E 2 106 GLU 106 107 107 GLU GLU A . n 
E 2 107 LYS 107 108 108 LYS LYS A . n 
E 2 108 GLN 108 109 109 GLN GLN A . n 
E 2 109 ASN 109 110 110 ASN ASN A . n 
E 2 110 ASP 110 111 111 ASP ASP A . n 
E 2 111 THR 111 112 112 THR THR A . n 
E 2 112 ALA 112 113 113 ALA ALA A . n 
E 2 113 ASP 113 114 114 ASP ASP A . n 
E 2 114 ILE 114 115 115 ILE ILE A . n 
E 2 115 LEU 115 116 116 LEU LEU A . n 
E 2 116 LEU 116 117 117 LEU LEU A . n 
E 2 117 VAL 117 118 118 VAL VAL A . n 
E 2 118 LYS 118 119 119 LYS LYS A . n 
E 2 119 ASP 119 120 120 ASP ASP A . n 
E 2 120 GLN 120 121 121 GLN GLN A . n 
E 2 121 PHE 121 122 122 PHE PHE A . n 
E 2 122 TYR 122 123 123 TYR TYR A . n 
E 2 123 GLU 123 124 124 GLU GLU A . n 
E 2 124 LEU 124 125 125 LEU LEU A . n 
E 2 125 LEU 125 126 126 LEU LEU A . n 
E 2 126 ASP 126 127 127 ASP ASP A . n 
E 2 127 VAL 127 128 128 VAL VAL A . n 
E 2 128 LYS 128 129 129 LYS LYS A . n 
E 2 129 THR 129 130 130 THR THR A . n 
E 2 130 ARG 130 131 131 ARG ARG A . n 
E 2 131 ASN 131 132 132 ASN ASN A . n 
E 2 132 ILE 132 133 133 ILE ILE A . n 
E 2 133 SER 133 134 134 SER SER A . n 
E 2 134 LYS 134 135 135 LYS LYS A . n 
E 2 135 SER 135 136 136 SER SER A . n 
E 2 136 ALA 136 137 137 ALA ALA A . n 
E 2 137 GLN 137 138 138 GLN GLN A . n 
E 2 138 ALA 138 139 139 ALA ALA A . n 
E 2 139 PRO 139 140 140 PRO PRO A . n 
E 2 140 ASN 140 141 141 ASN ASN A . n 
E 2 141 ILE 141 142 142 ILE ILE A . n 
E 2 142 ILE 142 143 143 ILE ILE A . n 
E 2 143 SER 143 144 144 SER SER A . n 
E 2 144 ALA 144 145 145 ALA ALA A . n 
E 2 145 TYR 145 146 146 TYR TYR A . n 
E 2 146 LYS 146 147 147 LYS LYS A . n 
E 2 147 LEU 147 148 148 LEU LEU A . n 
E 2 148 ALA 148 149 149 ALA ALA A . n 
E 2 149 GLN 149 150 150 GLN GLN A . n 
E 2 150 THR 150 151 151 THR THR A . n 
E 2 151 CYS 151 152 152 CYS CYS A . n 
E 2 152 ALA 152 153 153 ALA ALA A . n 
E 2 153 LYS 153 154 154 LYS LYS A . n 
E 2 154 MET 154 155 155 MET MET A . n 
E 2 155 ILE 155 156 156 ILE ILE A . n 
E 2 156 ASP 156 157 157 ASP ASP A . n 
E 2 157 ASN 157 158 158 ASN ASN A . n 
E 2 158 LYS 158 159 159 LYS LYS A . n 
E 2 159 GLU 159 160 160 GLU GLU A . n 
E 2 160 PHE 160 161 161 PHE PHE A . n 
E 2 161 ASP 161 162 162 ASP ASP A . n 
E 2 162 LEU 162 163 163 LEU LEU A . n 
E 2 163 PHE 163 164 164 PHE PHE A . n 
E 2 164 ASP 164 165 165 ASP ASP A . n 
E 2 165 ILE 165 166 166 ILE ILE A . n 
E 2 166 ASN 166 167 167 ASN ASN A . n 
E 2 167 TYR 167 168 168 TYR TYR A . n 
E 2 168 LEU 168 169 169 LEU LEU A . n 
E 2 169 GLU 169 170 170 GLU GLU A . n 
E 2 170 VAL 170 171 171 VAL VAL A . n 
E 2 171 ASP 171 172 172 ASP ASP A . n 
E 2 172 TRP 172 173 173 TRP TRP A . n 
E 2 173 GLU 173 174 174 GLU GLU A . n 
E 2 174 LEU 174 175 175 LEU LEU A . n 
E 2 175 ASN 175 176 176 ASN ASN A . n 
E 2 176 GLY 176 177 177 GLY GLY A . n 
E 2 177 GLU 177 178 178 GLU GLU A . n 
E 2 178 ASP 178 179 179 ASP ASP A . n 
E 2 179 LEU 179 180 180 LEU LEU A . n 
E 2 180 VAL 180 181 181 VAL VAL A . n 
E 2 181 CYS 181 182 182 CYS CYS A . n 
E 2 182 VAL 182 183 183 VAL VAL A . n 
E 2 183 SER 183 184 184 SER SER A . n 
E 2 184 THR 184 185 185 THR THR A . n 
E 2 185 SER 185 186 186 SER SER A . n 
E 2 186 PHE 186 187 187 PHE PHE A . n 
E 2 187 ALA 187 188 188 ALA ALA A . n 
E 2 188 GLU 188 189 189 GLU GLU A . n 
E 2 189 LEU 189 190 190 LEU LEU A . n 
E 2 190 PHE 190 191 191 PHE PHE A . n 
E 2 191 LYS 191 192 192 LYS LYS A . n 
E 2 192 SER 192 193 193 SER SER A . n 
E 2 193 GLU 193 194 194 GLU GLU A . n 
E 2 194 PRO 194 195 195 PRO PRO A . n 
E 2 195 SER 195 196 196 SER SER A . n 
E 2 196 GLU 196 197 197 GLU GLU A . n 
E 2 197 LEU 197 198 198 LEU LEU A . n 
E 2 198 TYR 198 199 199 TYR TYR A . n 
E 2 199 ILE 199 200 200 ILE ILE A . n 
E 2 200 ASN 200 201 201 ASN ASN A . n 
E 2 201 TRP 201 202 202 TRP TRP A . n 
E 2 202 ALA 202 203 203 ALA ALA A . n 
E 2 203 ALA 203 204 204 ALA ALA A . n 
E 2 204 ALA 204 205 205 ALA ALA A . n 
E 2 205 MET 205 206 206 MET MET A . n 
E 2 206 GLN 206 207 207 GLN GLN A . n 
E 2 207 ILE 207 208 208 ILE ILE A . n 
E 2 208 GLN 208 209 209 GLN GLN A . n 
E 2 209 PHE 209 210 210 PHE PHE A . n 
E 2 210 HIS 210 211 211 HIS HIS A . n 
E 2 211 VAL 211 212 212 VAL VAL A . n 
E 2 212 ARG 212 213 213 ARG ARG A . n 
E 2 213 ASP 213 214 214 ASP ASP A . n 
E 2 214 LEU 214 215 215 LEU LEU A . n 
E 2 215 ASP 215 216 216 ASP ASP A . n 
E 2 216 GLN 216 217 217 GLN GLN A . n 
E 2 217 GLY 217 218 218 GLY GLY A . n 
E 2 218 PHE 218 219 219 PHE PHE A . n 
E 2 219 ASN 219 220 220 ASN ASN A . n 
E 2 220 GLY 220 221 221 GLY GLY A . n 
E 2 221 THR 221 222 222 THR THR A . n 
E 2 222 ARG 222 223 223 ARG ARG A . n 
E 2 223 GLU 223 224 224 GLU GLU A . n 
E 2 224 GLU 224 225 225 GLU GLU A . n 
E 2 225 TRP 225 226 226 TRP TRP A . n 
E 2 226 ALA 226 227 227 ALA ALA A . n 
E 2 227 LYS 227 228 228 LYS LYS A . n 
E 2 228 SER 228 229 229 SER SER A . n 
E 2 229 TYR 229 230 230 TYR TYR A . n 
E 2 230 LEU 230 231 231 LEU LEU A . n 
E 2 231 LYS 231 232 232 LYS LYS A . n 
E 2 232 HIS 232 233 233 HIS HIS A . n 
E 2 233 PHE 233 234 234 PHE PHE A . n 
E 2 234 VAL 234 235 235 VAL VAL A . n 
E 2 235 THR 235 236 236 THR THR A . n 
E 2 236 GLN 236 237 237 GLN GLN A . n 
E 2 237 ALA 237 238 238 ALA ALA A . n 
E 2 238 GLU 238 239 239 GLU GLU A . n 
E 2 239 GLN 239 240 240 GLN GLN A . n 
E 2 240 ARG 240 241 241 ARG ARG A . n 
E 2 241 ALA 241 242 242 ALA ALA A . n 
E 2 242 ILE 242 243 243 ILE ILE A . n 
E 2 243 SER 243 244 244 SER SER A . n 
E 2 244 MET 244 245 245 MET MET A . n 
E 2 245 ILE 245 246 246 ILE ILE A . n 
E 2 246 ASP 246 247 247 ASP ASP A . n 
E 2 247 LYS 247 248 248 LYS LYS A . n 
E 2 248 PHE 248 249 249 PHE PHE A . n 
E 2 249 VAL 249 250 250 VAL VAL A . n 
E 2 250 LYS 250 251 251 LYS LYS A . n 
E 2 251 PRO 251 252 252 PRO PRO A . n 
E 2 252 PHE 252 253 253 PHE PHE A . n 
E 2 253 LYS 253 254 254 LYS LYS A . n 
E 2 254 LYS 254 255 255 LYS LYS A . n 
E 2 255 TYR 255 256 256 TYR TYR A . n 
E 2 256 ILE 256 257 257 ILE ILE A . n 
E 2 257 LEU 257 258 258 LEU LEU A . n 
F 2 1   SER 1   2   2   SER SER B . n 
F 2 2   PHE 2   3   3   PHE PHE B . n 
F 2 3   ILE 3   4   4   ILE ILE B . n 
F 2 4   LYS 4   5   5   LYS LYS B . n 
F 2 5   PRO 5   6   6   PRO PRO B . n 
F 2 6   ILE 6   7   7   ILE ILE B . n 
F 2 7   TYR 7   8   8   TYR TYR B . n 
F 2 8   GLN 8   9   9   GLN GLN B . n 
F 2 9   ASP 9   10  10  ASP ASP B . n 
F 2 10  ILE 10  11  11  ILE ILE B . n 
F 2 11  ASN 11  12  12  ASN ASN B . n 
F 2 12  SER 12  13  13  SER SER B . n 
F 2 13  ILE 13  14  14  ILE ILE B . n 
F 2 14  LEU 14  15  15  LEU LEU B . n 
F 2 15  ILE 15  16  16  ILE ILE B . n 
F 2 16  GLY 16  17  17  GLY GLY B . n 
F 2 17  GLN 17  18  18  GLN GLN B . n 
F 2 18  LYS 18  19  19  LYS LYS B . n 
F 2 19  VAL 19  20  20  VAL VAL B . n 
F 2 20  LYS 20  21  21  LYS LYS B . n 
F 2 21  ARG 21  22  22  ARG ARG B . n 
F 2 22  PRO 22  23  23  PRO PRO B . n 
F 2 23  LYS 23  24  24  LYS LYS B . n 
F 2 24  SER 24  25  25  SER SER B . n 
F 2 25  GLY 25  26  26  GLY GLY B . n 
F 2 26  THR 26  27  27  THR THR B . n 
F 2 27  LEU 27  28  28  LEU LEU B . n 
F 2 28  SER 28  29  29  SER SER B . n 
F 2 29  GLY 29  30  30  GLY GLY B . n 
F 2 30  HIS 30  31  31  HIS HIS B . n 
F 2 31  ALA 31  32  32  ALA ALA B . n 
F 2 32  ALA 32  33  33  ALA ALA B . n 
F 2 33  GLY 33  34  34  GLY GLY B . n 
F 2 34  GLU 34  35  35  GLU GLU B . n 
F 2 35  PRO 35  36  36  PRO PRO B . n 
F 2 36  PHE 36  37  37  PHE PHE B . n 
F 2 37  GLU 37  38  38  GLU GLU B . n 
F 2 38  LYS 38  39  39  LYS LYS B . n 
F 2 39  LEU 39  40  40  LEU LEU B . n 
F 2 40  VAL 40  41  41  VAL VAL B . n 
F 2 41  TYR 41  42  42  TYR TYR B . n 
F 2 42  LYS 42  43  43  LYS LYS B . n 
F 2 43  PHE 43  44  44  PHE PHE B . n 
F 2 44  LEU 44  45  45  LEU LEU B . n 
F 2 45  LYS 45  46  46  LYS LYS B . n 
F 2 46  GLU 46  47  47  GLU GLU B . n 
F 2 47  ASN 47  48  48  ASN ASN B . n 
F 2 48  LEU 48  49  49  LEU LEU B . n 
F 2 49  SER 49  50  50  SER SER B . n 
F 2 50  ASP 50  51  51  ASP ASP B . n 
F 2 51  LEU 51  52  52  LEU LEU B . n 
F 2 52  THR 52  53  53  THR THR B . n 
F 2 53  PHE 53  54  54  PHE PHE B . n 
F 2 54  LYS 54  55  55  LYS LYS B . n 
F 2 55  GLN 55  56  56  GLN GLN B . n 
F 2 56  TYR 56  57  57  TYR TYR B . n 
F 2 57  GLU 57  58  58  GLU GLU B . n 
F 2 58  TYR 58  59  59  TYR TYR B . n 
F 2 59  LEU 59  60  60  LEU LEU B . n 
F 2 60  ASN 60  61  61  ASN ASN B . n 
F 2 61  ASP 61  62  62  ASP ASP B . n 
F 2 62  LEU 62  63  63  LEU LEU B . n 
F 2 63  PHE 63  64  64  PHE PHE B . n 
F 2 64  MET 64  65  65  MET MET B . n 
F 2 65  LYS 65  66  66  LYS LYS B . n 
F 2 66  ASN 66  67  67  ASN ASN B . n 
F 2 67  PRO 67  68  68  PRO PRO B . n 
F 2 68  ALA 68  69  69  ALA ALA B . n 
F 2 69  ILE 69  70  70  ILE ILE B . n 
F 2 70  ILE 70  71  71  ILE ILE B . n 
F 2 71  GLY 71  72  72  GLY GLY B . n 
F 2 72  HIS 72  73  73  HIS HIS B . n 
F 2 73  GLU 73  74  74  GLU GLU B . n 
F 2 74  ALA 74  75  75  ALA ALA B . n 
F 2 75  ARG 75  76  76  ARG ARG B . n 
F 2 76  TYR 76  77  77  TYR TYR B . n 
F 2 77  LYS 77  78  78  LYS LYS B . n 
F 2 78  LEU 78  79  79  LEU LEU B . n 
F 2 79  PHE 79  80  80  PHE PHE B . n 
F 2 80  ASN 80  81  81  ASN ASN B . n 
F 2 81  SER 81  82  82  SER SER B . n 
F 2 82  PRO 82  83  83  PRO PRO B . n 
F 2 83  THR 83  84  84  THR THR B . n 
F 2 84  LEU 84  85  85  LEU LEU B . n 
F 2 85  LEU 85  86  86  LEU LEU B . n 
F 2 86  PHE 86  87  87  PHE PHE B . n 
F 2 87  LEU 87  88  88  LEU LEU B . n 
F 2 88  LEU 88  89  89  LEU LEU B . n 
F 2 89  SER 89  90  90  SER SER B . n 
F 2 90  ARG 90  91  91  ARG ARG B . n 
F 2 91  GLY 91  92  92  GLY GLY B . n 
F 2 92  LYS 92  93  93  LYS LYS B . n 
F 2 93  ALA 93  94  94  ALA ALA B . n 
F 2 94  ALA 94  95  95  ALA ALA B . n 
F 2 95  THR 95  96  96  THR THR B . n 
F 2 96  GLU 96  97  97  GLU GLU B . n 
F 2 97  ASN 97  98  98  ASN ASN B . n 
F 2 98  TRP 98  99  99  TRP TRP B . n 
F 2 99  SER 99  100 100 SER SER B . n 
F 2 100 ILE 100 101 101 ILE ILE B . n 
F 2 101 GLU 101 102 102 GLU GLU B . n 
F 2 102 ASN 102 103 103 ASN ASN B . n 
F 2 103 LEU 103 104 104 LEU LEU B . n 
F 2 104 PHE 104 105 105 PHE PHE B . n 
F 2 105 GLU 105 106 106 GLU GLU B . n 
F 2 106 GLU 106 107 107 GLU GLU B . n 
F 2 107 LYS 107 108 108 LYS LYS B . n 
F 2 108 GLN 108 109 109 GLN GLN B . n 
F 2 109 ASN 109 110 110 ASN ASN B . n 
F 2 110 ASP 110 111 111 ASP ASP B . n 
F 2 111 THR 111 112 112 THR THR B . n 
F 2 112 ALA 112 113 113 ALA ALA B . n 
F 2 113 ASP 113 114 114 ASP ASP B . n 
F 2 114 ILE 114 115 115 ILE ILE B . n 
F 2 115 LEU 115 116 116 LEU LEU B . n 
F 2 116 LEU 116 117 117 LEU LEU B . n 
F 2 117 VAL 117 118 118 VAL VAL B . n 
F 2 118 LYS 118 119 119 LYS LYS B . n 
F 2 119 ASP 119 120 120 ASP ASP B . n 
F 2 120 GLN 120 121 121 GLN GLN B . n 
F 2 121 PHE 121 122 122 PHE PHE B . n 
F 2 122 TYR 122 123 123 TYR TYR B . n 
F 2 123 GLU 123 124 124 GLU GLU B . n 
F 2 124 LEU 124 125 125 LEU LEU B . n 
F 2 125 LEU 125 126 126 LEU LEU B . n 
F 2 126 ASP 126 127 127 ASP ASP B . n 
F 2 127 VAL 127 128 128 VAL VAL B . n 
F 2 128 LYS 128 129 129 LYS LYS B . n 
F 2 129 THR 129 130 130 THR THR B . n 
F 2 130 ARG 130 131 131 ARG ARG B . n 
F 2 131 ASN 131 132 132 ASN ASN B . n 
F 2 132 ILE 132 133 133 ILE ILE B . n 
F 2 133 SER 133 134 134 SER SER B . n 
F 2 134 LYS 134 135 135 LYS LYS B . n 
F 2 135 SER 135 136 136 SER SER B . n 
F 2 136 ALA 136 137 137 ALA ALA B . n 
F 2 137 GLN 137 138 138 GLN GLN B . n 
F 2 138 ALA 138 139 139 ALA ALA B . n 
F 2 139 PRO 139 140 140 PRO PRO B . n 
F 2 140 ASN 140 141 141 ASN ASN B . n 
F 2 141 ILE 141 142 142 ILE ILE B . n 
F 2 142 ILE 142 143 143 ILE ILE B . n 
F 2 143 SER 143 144 144 SER SER B . n 
F 2 144 ALA 144 145 145 ALA ALA B . n 
F 2 145 TYR 145 146 146 TYR TYR B . n 
F 2 146 LYS 146 147 147 LYS LYS B . n 
F 2 147 LEU 147 148 148 LEU LEU B . n 
F 2 148 ALA 148 149 149 ALA ALA B . n 
F 2 149 GLN 149 150 150 GLN GLN B . n 
F 2 150 THR 150 151 151 THR THR B . n 
F 2 151 CYS 151 152 152 CYS CYS B . n 
F 2 152 ALA 152 153 153 ALA ALA B . n 
F 2 153 LYS 153 154 154 LYS LYS B . n 
F 2 154 MET 154 155 155 MET MET B . n 
F 2 155 ILE 155 156 156 ILE ILE B . n 
F 2 156 ASP 156 157 157 ASP ASP B . n 
F 2 157 ASN 157 158 158 ASN ASN B . n 
F 2 158 LYS 158 159 159 LYS LYS B . n 
F 2 159 GLU 159 160 160 GLU GLU B . n 
F 2 160 PHE 160 161 161 PHE PHE B . n 
F 2 161 ASP 161 162 162 ASP ASP B . n 
F 2 162 LEU 162 163 163 LEU LEU B . n 
F 2 163 PHE 163 164 164 PHE PHE B . n 
F 2 164 ASP 164 165 165 ASP ASP B . n 
F 2 165 ILE 165 166 166 ILE ILE B . n 
F 2 166 ASN 166 167 167 ASN ASN B . n 
F 2 167 TYR 167 168 168 TYR TYR B . n 
F 2 168 LEU 168 169 169 LEU LEU B . n 
F 2 169 GLU 169 170 170 GLU GLU B . n 
F 2 170 VAL 170 171 171 VAL VAL B . n 
F 2 171 ASP 171 172 172 ASP ASP B . n 
F 2 172 TRP 172 173 173 TRP TRP B . n 
F 2 173 GLU 173 174 174 GLU GLU B . n 
F 2 174 LEU 174 175 175 LEU LEU B . n 
F 2 175 ASN 175 176 176 ASN ASN B . n 
F 2 176 GLY 176 177 177 GLY GLY B . n 
F 2 177 GLU 177 178 178 GLU GLU B . n 
F 2 178 ASP 178 179 179 ASP ASP B . n 
F 2 179 LEU 179 180 180 LEU LEU B . n 
F 2 180 VAL 180 181 181 VAL VAL B . n 
F 2 181 CYS 181 182 182 CYS CYS B . n 
F 2 182 VAL 182 183 183 VAL VAL B . n 
F 2 183 SER 183 184 184 SER SER B . n 
F 2 184 THR 184 185 185 THR THR B . n 
F 2 185 SER 185 186 186 SER SER B . n 
F 2 186 PHE 186 187 187 PHE PHE B . n 
F 2 187 ALA 187 188 188 ALA ALA B . n 
F 2 188 GLU 188 189 189 GLU GLU B . n 
F 2 189 LEU 189 190 190 LEU LEU B . n 
F 2 190 PHE 190 191 191 PHE PHE B . n 
F 2 191 LYS 191 192 192 LYS LYS B . n 
F 2 192 SER 192 193 193 SER SER B . n 
F 2 193 GLU 193 194 194 GLU GLU B . n 
F 2 194 PRO 194 195 195 PRO PRO B . n 
F 2 195 SER 195 196 196 SER SER B . n 
F 2 196 GLU 196 197 197 GLU GLU B . n 
F 2 197 LEU 197 198 198 LEU LEU B . n 
F 2 198 TYR 198 199 199 TYR TYR B . n 
F 2 199 ILE 199 200 200 ILE ILE B . n 
F 2 200 ASN 200 201 201 ASN ASN B . n 
F 2 201 TRP 201 202 202 TRP TRP B . n 
F 2 202 ALA 202 203 203 ALA ALA B . n 
F 2 203 ALA 203 204 204 ALA ALA B . n 
F 2 204 ALA 204 205 205 ALA ALA B . n 
F 2 205 MET 205 206 206 MET MET B . n 
F 2 206 GLN 206 207 207 GLN GLN B . n 
F 2 207 ILE 207 208 208 ILE ILE B . n 
F 2 208 GLN 208 209 209 GLN GLN B . n 
F 2 209 PHE 209 210 210 PHE PHE B . n 
F 2 210 HIS 210 211 211 HIS HIS B . n 
F 2 211 VAL 211 212 212 VAL VAL B . n 
F 2 212 ARG 212 213 213 ARG ARG B . n 
F 2 213 ASP 213 214 214 ASP ASP B . n 
F 2 214 LEU 214 215 215 LEU LEU B . n 
F 2 215 ASP 215 216 216 ASP ASP B . n 
F 2 216 GLN 216 217 217 GLN GLN B . n 
F 2 217 GLY 217 218 218 GLY GLY B . n 
F 2 218 PHE 218 219 219 PHE PHE B . n 
F 2 219 ASN 219 220 220 ASN ASN B . n 
F 2 220 GLY 220 221 221 GLY GLY B . n 
F 2 221 THR 221 222 222 THR THR B . n 
F 2 222 ARG 222 223 223 ARG ARG B . n 
F 2 223 GLU 223 224 224 GLU GLU B . n 
F 2 224 GLU 224 225 225 GLU GLU B . n 
F 2 225 TRP 225 226 226 TRP TRP B . n 
F 2 226 ALA 226 227 227 ALA ALA B . n 
F 2 227 LYS 227 228 228 LYS LYS B . n 
F 2 228 SER 228 229 229 SER SER B . n 
F 2 229 TYR 229 230 230 TYR TYR B . n 
F 2 230 LEU 230 231 231 LEU LEU B . n 
F 2 231 LYS 231 232 232 LYS LYS B . n 
F 2 232 HIS 232 233 233 HIS HIS B . n 
F 2 233 PHE 233 234 234 PHE PHE B . n 
F 2 234 VAL 234 235 235 VAL VAL B . n 
F 2 235 THR 235 236 236 THR THR B . n 
F 2 236 GLN 236 237 237 GLN GLN B . n 
F 2 237 ALA 237 238 238 ALA ALA B . n 
F 2 238 GLU 238 239 239 GLU GLU B . n 
F 2 239 GLN 239 240 240 GLN GLN B . n 
F 2 240 ARG 240 241 241 ARG ARG B . n 
F 2 241 ALA 241 242 242 ALA ALA B . n 
F 2 242 ILE 242 243 243 ILE ILE B . n 
F 2 243 SER 243 244 244 SER SER B . n 
F 2 244 MET 244 245 245 MET MET B . n 
F 2 245 ILE 245 246 246 ILE ILE B . n 
F 2 246 ASP 246 247 247 ASP ASP B . n 
F 2 247 LYS 247 248 248 LYS LYS B . n 
F 2 248 PHE 248 249 249 PHE PHE B . n 
F 2 249 VAL 249 250 250 VAL VAL B . n 
F 2 250 LYS 250 251 251 LYS LYS B . n 
F 2 251 PRO 251 252 252 PRO PRO B . n 
F 2 252 PHE 252 253 253 PHE PHE B . n 
F 2 253 LYS 253 254 254 LYS LYS B . n 
F 2 254 LYS 254 255 255 LYS LYS B . n 
F 2 255 TYR 255 256 256 TYR TYR B . n 
F 2 256 ILE 256 257 257 ILE ILE B . n 
F 2 257 LEU 257 258 ?   ?   ?   B . n 
G 2 1   SER 1   2   2   SER SER C . n 
G 2 2   PHE 2   3   3   PHE PHE C . n 
G 2 3   ILE 3   4   4   ILE ILE C . n 
G 2 4   LYS 4   5   5   LYS LYS C . n 
G 2 5   PRO 5   6   6   PRO PRO C . n 
G 2 6   ILE 6   7   7   ILE ILE C . n 
G 2 7   TYR 7   8   8   TYR TYR C . n 
G 2 8   GLN 8   9   9   GLN GLN C . n 
G 2 9   ASP 9   10  10  ASP ASP C . n 
G 2 10  ILE 10  11  11  ILE ILE C . n 
G 2 11  ASN 11  12  12  ASN ASN C . n 
G 2 12  SER 12  13  13  SER SER C . n 
G 2 13  ILE 13  14  14  ILE ILE C . n 
G 2 14  LEU 14  15  15  LEU LEU C . n 
G 2 15  ILE 15  16  16  ILE ILE C . n 
G 2 16  GLY 16  17  17  GLY GLY C . n 
G 2 17  GLN 17  18  18  GLN GLN C . n 
G 2 18  LYS 18  19  19  LYS LYS C . n 
G 2 19  VAL 19  20  20  VAL VAL C . n 
G 2 20  LYS 20  21  21  LYS LYS C . n 
G 2 21  ARG 21  22  22  ARG ARG C . n 
G 2 22  PRO 22  23  23  PRO PRO C . n 
G 2 23  LYS 23  24  24  LYS LYS C . n 
G 2 24  SER 24  25  25  SER SER C . n 
G 2 25  GLY 25  26  26  GLY GLY C . n 
G 2 26  THR 26  27  27  THR THR C . n 
G 2 27  LEU 27  28  28  LEU LEU C . n 
G 2 28  SER 28  29  29  SER SER C . n 
G 2 29  GLY 29  30  30  GLY GLY C . n 
G 2 30  HIS 30  31  31  HIS HIS C . n 
G 2 31  ALA 31  32  32  ALA ALA C . n 
G 2 32  ALA 32  33  33  ALA ALA C . n 
G 2 33  GLY 33  34  34  GLY GLY C . n 
G 2 34  GLU 34  35  35  GLU GLU C . n 
G 2 35  PRO 35  36  36  PRO PRO C . n 
G 2 36  PHE 36  37  37  PHE PHE C . n 
G 2 37  GLU 37  38  38  GLU GLU C . n 
G 2 38  LYS 38  39  39  LYS LYS C . n 
G 2 39  LEU 39  40  40  LEU LEU C . n 
G 2 40  VAL 40  41  41  VAL VAL C . n 
G 2 41  TYR 41  42  42  TYR TYR C . n 
G 2 42  LYS 42  43  43  LYS LYS C . n 
G 2 43  PHE 43  44  44  PHE PHE C . n 
G 2 44  LEU 44  45  45  LEU LEU C . n 
G 2 45  LYS 45  46  46  LYS LYS C . n 
G 2 46  GLU 46  47  47  GLU GLU C . n 
G 2 47  ASN 47  48  48  ASN ASN C . n 
G 2 48  LEU 48  49  49  LEU LEU C . n 
G 2 49  SER 49  50  50  SER SER C . n 
G 2 50  ASP 50  51  51  ASP ASP C . n 
G 2 51  LEU 51  52  52  LEU LEU C . n 
G 2 52  THR 52  53  53  THR THR C . n 
G 2 53  PHE 53  54  54  PHE PHE C . n 
G 2 54  LYS 54  55  55  LYS LYS C . n 
G 2 55  GLN 55  56  56  GLN GLN C . n 
G 2 56  TYR 56  57  57  TYR TYR C . n 
G 2 57  GLU 57  58  58  GLU GLU C . n 
G 2 58  TYR 58  59  59  TYR TYR C . n 
G 2 59  LEU 59  60  60  LEU LEU C . n 
G 2 60  ASN 60  61  61  ASN ASN C . n 
G 2 61  ASP 61  62  62  ASP ASP C . n 
G 2 62  LEU 62  63  63  LEU LEU C . n 
G 2 63  PHE 63  64  64  PHE PHE C . n 
G 2 64  MET 64  65  65  MET MET C . n 
G 2 65  LYS 65  66  66  LYS LYS C . n 
G 2 66  ASN 66  67  67  ASN ASN C . n 
G 2 67  PRO 67  68  68  PRO PRO C . n 
G 2 68  ALA 68  69  69  ALA ALA C . n 
G 2 69  ILE 69  70  70  ILE ILE C . n 
G 2 70  ILE 70  71  71  ILE ILE C . n 
G 2 71  GLY 71  72  72  GLY GLY C . n 
G 2 72  HIS 72  73  73  HIS HIS C . n 
G 2 73  GLU 73  74  74  GLU GLU C . n 
G 2 74  ALA 74  75  75  ALA ALA C . n 
G 2 75  ARG 75  76  76  ARG ARG C . n 
G 2 76  TYR 76  77  77  TYR TYR C . n 
G 2 77  LYS 77  78  78  LYS LYS C . n 
G 2 78  LEU 78  79  79  LEU LEU C . n 
G 2 79  PHE 79  80  80  PHE PHE C . n 
G 2 80  ASN 80  81  81  ASN ASN C . n 
G 2 81  SER 81  82  82  SER SER C . n 
G 2 82  PRO 82  83  83  PRO PRO C . n 
G 2 83  THR 83  84  84  THR THR C . n 
G 2 84  LEU 84  85  85  LEU LEU C . n 
G 2 85  LEU 85  86  86  LEU LEU C . n 
G 2 86  PHE 86  87  87  PHE PHE C . n 
G 2 87  LEU 87  88  88  LEU LEU C . n 
G 2 88  LEU 88  89  89  LEU LEU C . n 
G 2 89  SER 89  90  90  SER SER C . n 
G 2 90  ARG 90  91  91  ARG ARG C . n 
G 2 91  GLY 91  92  92  GLY GLY C . n 
G 2 92  LYS 92  93  93  LYS LYS C . n 
G 2 93  ALA 93  94  94  ALA ALA C . n 
G 2 94  ALA 94  95  95  ALA ALA C . n 
G 2 95  THR 95  96  96  THR THR C . n 
G 2 96  GLU 96  97  97  GLU GLU C . n 
G 2 97  ASN 97  98  98  ASN ASN C . n 
G 2 98  TRP 98  99  99  TRP TRP C . n 
G 2 99  SER 99  100 100 SER SER C . n 
G 2 100 ILE 100 101 101 ILE ILE C . n 
G 2 101 GLU 101 102 102 GLU GLU C . n 
G 2 102 ASN 102 103 103 ASN ASN C . n 
G 2 103 LEU 103 104 104 LEU LEU C