data_1TXD
# 
_entry.id   1TXD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TXD         
RCSB  RCSB022998   
WWPDB D_1000022998 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TXD 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kristelly, R.' 1 
'Gao, G.'       2 
'Tesmer, J.J.'  3 
# 
_citation.id                        primary 
_citation.title                     
'Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            279 
_citation.page_first                47352 
_citation.page_last                 47362 
_citation.year                      2004 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15331592 
_citation.pdbx_database_id_DOI      10.1074/jbc.M406056200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kristelly, R.' 1 
primary 'Gao, G.'       2 
primary 'Tesmer, J.J.'  3 
# 
_cell.entry_id           1TXD 
_cell.length_a           193.606 
_cell.length_b           45.859 
_cell.length_c           74.730 
_cell.angle_alpha        90.00 
_cell.angle_beta         107.49 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TXD 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Rho guanine nucleotide exchange factor 12' 44694.293 1  ? ? 'DH/PH domains' ? 
2 water   nat water                                       18.015    91 ? ? ?               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Leukemia-associated RhoGEF' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHI
GLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRR
LQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLKLSE
YPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLS
TVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSVDGGHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHI
GLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRR
LQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLKLSE
YPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLS
TVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSVDGGHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PRO n 
1 4   PRO n 
1 5   ASN n 
1 6   TRP n 
1 7   GLN n 
1 8   GLN n 
1 9   LEU n 
1 10  VAL n 
1 11  SER n 
1 12  ARG n 
1 13  GLU n 
1 14  VAL n 
1 15  LEU n 
1 16  LEU n 
1 17  GLY n 
1 18  LEU n 
1 19  LYS n 
1 20  PRO n 
1 21  CYS n 
1 22  GLU n 
1 23  ILE n 
1 24  LYS n 
1 25  ARG n 
1 26  GLN n 
1 27  GLU n 
1 28  VAL n 
1 29  ILE n 
1 30  ASN n 
1 31  GLU n 
1 32  LEU n 
1 33  PHE n 
1 34  TYR n 
1 35  THR n 
1 36  GLU n 
1 37  ARG n 
1 38  ALA n 
1 39  HIS n 
1 40  VAL n 
1 41  ARG n 
1 42  THR n 
1 43  LEU n 
1 44  LYS n 
1 45  VAL n 
1 46  LEU n 
1 47  ASP n 
1 48  GLN n 
1 49  VAL n 
1 50  PHE n 
1 51  TYR n 
1 52  GLN n 
1 53  ARG n 
1 54  VAL n 
1 55  SER n 
1 56  ARG n 
1 57  GLU n 
1 58  GLY n 
1 59  ILE n 
1 60  LEU n 
1 61  SER n 
1 62  PRO n 
1 63  SER n 
1 64  GLU n 
1 65  LEU n 
1 66  ARG n 
1 67  LYS n 
1 68  ILE n 
1 69  PHE n 
1 70  SER n 
1 71  ASN n 
1 72  LEU n 
1 73  GLU n 
1 74  ASP n 
1 75  ILE n 
1 76  LEU n 
1 77  GLN n 
1 78  LEU n 
1 79  HIS n 
1 80  ILE n 
1 81  GLY n 
1 82  LEU n 
1 83  ASN n 
1 84  GLU n 
1 85  GLN n 
1 86  MET n 
1 87  LYS n 
1 88  ALA n 
1 89  VAL n 
1 90  ARG n 
1 91  LYS n 
1 92  ARG n 
1 93  ASN n 
1 94  GLU n 
1 95  THR n 
1 96  SER n 
1 97  VAL n 
1 98  ILE n 
1 99  ASP n 
1 100 GLN n 
1 101 ILE n 
1 102 GLY n 
1 103 GLU n 
1 104 ASP n 
1 105 LEU n 
1 106 LEU n 
1 107 THR n 
1 108 TRP n 
1 109 PHE n 
1 110 SER n 
1 111 GLY n 
1 112 PRO n 
1 113 GLY n 
1 114 GLU n 
1 115 GLU n 
1 116 LYS n 
1 117 LEU n 
1 118 LYS n 
1 119 HIS n 
1 120 ALA n 
1 121 ALA n 
1 122 ALA n 
1 123 THR n 
1 124 PHE n 
1 125 CYS n 
1 126 SER n 
1 127 ASN n 
1 128 GLN n 
1 129 PRO n 
1 130 PHE n 
1 131 ALA n 
1 132 LEU n 
1 133 GLU n 
1 134 MET n 
1 135 ILE n 
1 136 LYS n 
1 137 SER n 
1 138 ARG n 
1 139 GLN n 
1 140 LYS n 
1 141 LYS n 
1 142 ASP n 
1 143 SER n 
1 144 ARG n 
1 145 PHE n 
1 146 GLN n 
1 147 THR n 
1 148 PHE n 
1 149 VAL n 
1 150 GLN n 
1 151 ASP n 
1 152 ALA n 
1 153 GLU n 
1 154 SER n 
1 155 ASN n 
1 156 PRO n 
1 157 LEU n 
1 158 CYS n 
1 159 ARG n 
1 160 ARG n 
1 161 LEU n 
1 162 GLN n 
1 163 LEU n 
1 164 LYS n 
1 165 ASP n 
1 166 ILE n 
1 167 ILE n 
1 168 PRO n 
1 169 THR n 
1 170 GLN n 
1 171 MET n 
1 172 GLN n 
1 173 ARG n 
1 174 LEU n 
1 175 THR n 
1 176 LYS n 
1 177 TYR n 
1 178 PRO n 
1 179 LEU n 
1 180 LEU n 
1 181 LEU n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 ALA n 
1 186 LYS n 
1 187 TYR n 
1 188 THR n 
1 189 GLU n 
1 190 TRP n 
1 191 PRO n 
1 192 THR n 
1 193 GLU n 
1 194 ARG n 
1 195 GLU n 
1 196 LYS n 
1 197 VAL n 
1 198 LYS n 
1 199 LYS n 
1 200 ALA n 
1 201 ALA n 
1 202 ASP n 
1 203 HIS n 
1 204 CYS n 
1 205 ARG n 
1 206 GLN n 
1 207 ILE n 
1 208 LEU n 
1 209 ASN n 
1 210 PHE n 
1 211 VAL n 
1 212 ASN n 
1 213 GLN n 
1 214 ALA n 
1 215 VAL n 
1 216 LYS n 
1 217 GLU n 
1 218 ALA n 
1 219 GLU n 
1 220 ASN n 
1 221 LYS n 
1 222 GLN n 
1 223 ARG n 
1 224 LEU n 
1 225 GLU n 
1 226 ASP n 
1 227 TYR n 
1 228 GLN n 
1 229 ARG n 
1 230 ARG n 
1 231 LEU n 
1 232 ASP n 
1 233 THR n 
1 234 SER n 
1 235 SER n 
1 236 LEU n 
1 237 LYS n 
1 238 LEU n 
1 239 SER n 
1 240 GLU n 
1 241 TYR n 
1 242 PRO n 
1 243 ASN n 
1 244 VAL n 
1 245 GLU n 
1 246 GLU n 
1 247 LEU n 
1 248 ARG n 
1 249 ASN n 
1 250 LEU n 
1 251 ASP n 
1 252 LEU n 
1 253 THR n 
1 254 LYS n 
1 255 ARG n 
1 256 LYS n 
1 257 MET n 
1 258 ILE n 
1 259 HIS n 
1 260 GLU n 
1 261 GLY n 
1 262 PRO n 
1 263 LEU n 
1 264 VAL n 
1 265 TRP n 
1 266 LYS n 
1 267 VAL n 
1 268 ASN n 
1 269 ARG n 
1 270 ASP n 
1 271 LYS n 
1 272 THR n 
1 273 ILE n 
1 274 ASP n 
1 275 LEU n 
1 276 TYR n 
1 277 THR n 
1 278 LEU n 
1 279 LEU n 
1 280 LEU n 
1 281 GLU n 
1 282 ASP n 
1 283 ILE n 
1 284 LEU n 
1 285 VAL n 
1 286 LEU n 
1 287 LEU n 
1 288 GLN n 
1 289 LYS n 
1 290 GLN n 
1 291 ASP n 
1 292 ASP n 
1 293 ARG n 
1 294 LEU n 
1 295 VAL n 
1 296 LEU n 
1 297 ARG n 
1 298 CYS n 
1 299 HIS n 
1 300 SER n 
1 301 LYS n 
1 302 ILE n 
1 303 LEU n 
1 304 ALA n 
1 305 SER n 
1 306 THR n 
1 307 ALA n 
1 308 ASP n 
1 309 SER n 
1 310 LYS n 
1 311 HIS n 
1 312 THR n 
1 313 PHE n 
1 314 SER n 
1 315 PRO n 
1 316 VAL n 
1 317 ILE n 
1 318 LYS n 
1 319 LEU n 
1 320 SER n 
1 321 THR n 
1 322 VAL n 
1 323 LEU n 
1 324 VAL n 
1 325 ARG n 
1 326 GLN n 
1 327 VAL n 
1 328 ALA n 
1 329 THR n 
1 330 ASP n 
1 331 ASN n 
1 332 LYS n 
1 333 ALA n 
1 334 LEU n 
1 335 PHE n 
1 336 VAL n 
1 337 ILE n 
1 338 SER n 
1 339 MET n 
1 340 SER n 
1 341 ASP n 
1 342 ASN n 
1 343 GLY n 
1 344 ALA n 
1 345 GLN n 
1 346 ILE n 
1 347 TYR n 
1 348 GLU n 
1 349 LEU n 
1 350 VAL n 
1 351 ALA n 
1 352 GLN n 
1 353 THR n 
1 354 VAL n 
1 355 SER n 
1 356 GLU n 
1 357 LYS n 
1 358 THR n 
1 359 VAL n 
1 360 TRP n 
1 361 GLN n 
1 362 ASP n 
1 363 LEU n 
1 364 ILE n 
1 365 CYS n 
1 366 ARG n 
1 367 MET n 
1 368 ALA n 
1 369 ALA n 
1 370 SER n 
1 371 VAL n 
1 372 LYS n 
1 373 GLU n 
1 374 GLN n 
1 375 SER n 
1 376 VAL n 
1 377 ASP n 
1 378 GLY n 
1 379 GLY n 
1 380 HIS n 
1 381 HIS n 
1 382 HIS n 
1 383 HIS n 
1 384 HIS n 
1 385 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ARHGEF12, LARG, KIAA0382' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta (DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMAL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARHGC_HUMAN 
_struct_ref.pdbx_db_accession          Q9NZN5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TDPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHI
GLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRR
LQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSE
YPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLS
TVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQS
;
_struct_ref.pdbx_align_begin           764 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1TXD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 375 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NZN5 
_struct_ref_seq.db_align_beg                  764 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1138 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       764 
_struct_ref_seq.pdbx_auth_seq_align_end       1138 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1TXD GLY A 1   ? UNP Q9NZN5 THR 764 'CLONING ARTIFACT' 764  1  
1 1TXD SER A 2   ? UNP Q9NZN5 ASP 765 'CLONING ARTIFACT' 765  2  
1 1TXD PHE A 210 ? UNP Q9NZN5 TYR 973 engineered         973  3  
1 1TXD VAL A 376 ? UNP Q9NZN5 ?   ?   'CLONING ARTIFACT' 1139 4  
1 1TXD ASP A 377 ? UNP Q9NZN5 ?   ?   'CLONING ARTIFACT' 1140 5  
1 1TXD GLY A 378 ? UNP Q9NZN5 ?   ?   'CLONING ARTIFACT' 1141 6  
1 1TXD GLY A 379 ? UNP Q9NZN5 ?   ?   'CLONING ARTIFACT' 1142 7  
1 1TXD HIS A 380 ? UNP Q9NZN5 ?   ?   'EXPRESSION TAG'   1143 8  
1 1TXD HIS A 381 ? UNP Q9NZN5 ?   ?   'EXPRESSION TAG'   1144 9  
1 1TXD HIS A 382 ? UNP Q9NZN5 ?   ?   'EXPRESSION TAG'   1145 10 
1 1TXD HIS A 383 ? UNP Q9NZN5 ?   ?   'EXPRESSION TAG'   1146 11 
1 1TXD HIS A 384 ? UNP Q9NZN5 ?   ?   'EXPRESSION TAG'   1147 12 
1 1TXD HIS A 385 ? UNP Q9NZN5 ?   ?   'EXPRESSION TAG'   1148 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1TXD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.5 
_exptl_crystal.density_percent_sol   65 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG3350, sodium chloride, sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-08-21 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)  double-crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1TXD 
_reflns.observed_criterion_sigma_F   -1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.13 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   36990 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.046 
_reflns.pdbx_netI_over_sigmaI        21 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.13 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   93.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.365 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1TXD 
_refine.ls_number_reflns_obs                     35784 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          -1 
_refine.pdbx_ls_sigma_F                          -1 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.85 
_refine.ls_d_res_high                            2.13 
_refine.ls_percent_reflns_obs                    97.48 
_refine.ls_R_factor_obs                          0.23676 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2348 
_refine.ls_R_factor_R_free                       0.27433 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1883 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.915 
_refine.B_iso_mean                               36.256 
_refine.aniso_B[1][1]                            0.28 
_refine.aniso_B[2][2]                            -0.08 
_refine.aniso_B[3][3]                            0.16 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.62 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.176 
_refine.pdbx_overall_ESU_R_Free                  0.168 
_refine.overall_SU_ML                            0.136 
_refine.overall_SU_B                             5.137 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2881 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             91 
_refine_hist.number_atoms_total               2972 
_refine_hist.d_res_high                       2.13 
_refine_hist.d_res_low                        24.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.017 0.022 ? 2922 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 2749 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.486 1.966 ? 3937 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.824 3.000 ? 6410 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.341 5.000 ? 348  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.084 0.200 ? 456  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.007 0.020 ? 3142 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.005 0.020 ? 559  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.222 0.200 ? 616  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.221 0.200 ? 3036 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.085 0.200 ? 1836 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.209 0.200 ? 93   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.161 0.200 ? 17   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.213 0.200 ? 77   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.219 0.200 ? 8    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.302 2.000 ? 1760 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.114 3.000 ? 2863 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.142 3.000 ? 1162 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.311 4.000 ? 1074 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.13 
_refine_ls_shell.d_res_low                        ? 
_refine_ls_shell.number_reflns_R_work             2315 
_refine_ls_shell.R_factor_R_work                  0.316 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.333 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             115 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1TXD 
_struct.title                     'Crystal Structure of the DH/PH domains of Leukemia-associated RhoGEF' 
_struct.pdbx_descriptor           'Rho guanine nucleotide exchange factor 12' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TXD 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'helical bundle (DH), beta sandwich (PH), SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 5   ? VAL A 10  ? ASN A 768  VAL A 773  1 ? 6  
HELX_P HELX_P2  2  SER A 11  ? LEU A 16  ? SER A 774  LEU A 779  1 ? 6  
HELX_P HELX_P3  3  LYS A 19  ? PHE A 50  ? LYS A 782  PHE A 813  1 ? 32 
HELX_P HELX_P4  4  PHE A 50  ? GLY A 58  ? PHE A 813  GLY A 821  1 ? 9  
HELX_P HELX_P5  5  SER A 61  ? SER A 70  ? SER A 824  SER A 833  1 ? 10 
HELX_P HELX_P6  6  ASN A 71  ? LYS A 91  ? ASN A 834  LYS A 854  1 ? 21 
HELX_P HELX_P7  7  ILE A 101 ? SER A 110 ? ILE A 864  SER A 873  1 ? 10 
HELX_P HELX_P8  8  GLY A 111 ? ASN A 127 ? GLY A 874  ASN A 890  1 ? 17 
HELX_P HELX_P9  9  ASN A 127 ? ASP A 142 ? ASN A 890  ASP A 905  1 ? 16 
HELX_P HELX_P10 10 ASP A 142 ? ASN A 155 ? ASP A 905  ASN A 918  1 ? 14 
HELX_P HELX_P11 11 PRO A 156 ? ARG A 159 ? PRO A 919  ARG A 922  5 ? 4  
HELX_P HELX_P12 12 GLN A 162 ? ILE A 167 ? GLN A 925  ILE A 930  1 ? 6  
HELX_P HELX_P13 13 PRO A 168 ? TYR A 187 ? PRO A 931  TYR A 950  1 ? 20 
HELX_P HELX_P14 14 TRP A 190 ? ARG A 230 ? TRP A 953  ARG A 993  1 ? 41 
HELX_P HELX_P15 15 VAL A 244 ? ASN A 249 ? VAL A 1007 ASN A 1012 1 ? 6  
HELX_P HELX_P16 16 ASP A 251 ? ARG A 255 ? ASP A 1014 ARG A 1018 5 ? 5  
HELX_P HELX_P17 17 THR A 353 ? SER A 375 ? THR A 1116 SER A 1138 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 231 ? ASP A 232 ? LEU A 994  ASP A 995  
A 2 ARG A 293 ? VAL A 295 ? ARG A 1056 VAL A 1058 
A 3 ILE A 283 ? GLN A 290 ? ILE A 1046 GLN A 1053 
A 4 VAL A 316 ? LYS A 318 ? VAL A 1079 LYS A 1081 
B 1 LEU A 231 ? ASP A 232 ? LEU A 994  ASP A 995  
B 2 ARG A 293 ? VAL A 295 ? ARG A 1056 VAL A 1058 
B 3 ILE A 283 ? GLN A 290 ? ILE A 1046 GLN A 1053 
B 4 LEU A 275 ? LEU A 280 ? LEU A 1038 LEU A 1043 
B 5 MET A 257 ? LYS A 266 ? MET A 1020 LYS A 1029 
B 6 ALA A 344 ? VAL A 350 ? ALA A 1107 VAL A 1113 
B 7 ALA A 333 ? MET A 339 ? ALA A 1096 MET A 1102 
B 8 VAL A 322 ? GLN A 326 ? VAL A 1085 GLN A 1089 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 232 ? N ASP A 995  O LEU A 294 ? O LEU A 1057 
A 2 3 O VAL A 295 ? O VAL A 1058 N GLN A 288 ? N GLN A 1051 
A 3 4 N LEU A 284 ? N LEU A 1047 O ILE A 317 ? O ILE A 1080 
B 1 2 N ASP A 232 ? N ASP A 995  O LEU A 294 ? O LEU A 1057 
B 2 3 O VAL A 295 ? O VAL A 1058 N GLN A 288 ? N GLN A 1051 
B 3 4 O ILE A 283 ? O ILE A 1046 N LEU A 280 ? N LEU A 1043 
B 4 5 O THR A 277 ? O THR A 1040 N GLY A 261 ? N GLY A 1024 
B 5 6 N LYS A 266 ? N LYS A 1029 O GLU A 348 ? O GLU A 1111 
B 6 7 O TYR A 347 ? O TYR A 1110 N VAL A 336 ? N VAL A 1099 
B 7 8 O PHE A 335 ? O PHE A 1098 N ARG A 325 ? N ARG A 1088 
# 
_database_PDB_matrix.entry_id          1TXD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TXD 
_atom_sites.fract_transf_matrix[1][1]   0.005165 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001627 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021806 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014030 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 3   ? 55.155  28.596 5.809   1.00 74.20 ? 766  PRO A N   1 
ATOM   2    C CA  . PRO A 1 3   ? 54.883  29.135 4.437   1.00 74.49 ? 766  PRO A CA  1 
ATOM   3    C C   . PRO A 1 3   ? 53.388  29.456 4.223   1.00 74.95 ? 766  PRO A C   1 
ATOM   4    O O   . PRO A 1 3   ? 52.582  28.960 5.021   1.00 75.12 ? 766  PRO A O   1 
ATOM   5    C CB  . PRO A 1 3   ? 55.353  28.001 3.518   1.00 74.22 ? 766  PRO A CB  1 
ATOM   6    C CG  . PRO A 1 3   ? 56.362  27.207 4.340   1.00 74.08 ? 766  PRO A CG  1 
ATOM   7    C CD  . PRO A 1 3   ? 56.232  27.594 5.800   1.00 74.09 ? 766  PRO A CD  1 
ATOM   8    N N   . PRO A 1 4   ? 53.027  30.273 3.218   1.00 75.42 ? 767  PRO A N   1 
ATOM   9    C CA  . PRO A 1 4   ? 51.626  30.695 3.002   1.00 75.51 ? 767  PRO A CA  1 
ATOM   10   C C   . PRO A 1 4   ? 50.783  29.957 1.920   1.00 75.07 ? 767  PRO A C   1 
ATOM   11   O O   . PRO A 1 4   ? 49.680  29.529 2.262   1.00 75.41 ? 767  PRO A O   1 
ATOM   12   C CB  . PRO A 1 4   ? 51.777  32.181 2.628   1.00 75.55 ? 767  PRO A CB  1 
ATOM   13   C CG  . PRO A 1 4   ? 53.217  32.311 2.106   1.00 75.66 ? 767  PRO A CG  1 
ATOM   14   C CD  . PRO A 1 4   ? 53.919  30.954 2.262   1.00 75.68 ? 767  PRO A CD  1 
ATOM   15   N N   . ASN A 1 5   ? 51.250  29.855 0.670   1.00 74.40 ? 768  ASN A N   1 
ATOM   16   C CA  . ASN A 1 5   ? 50.504  29.172 -0.408  1.00 73.66 ? 768  ASN A CA  1 
ATOM   17   C C   . ASN A 1 5   ? 50.796  27.683 -0.375  1.00 72.65 ? 768  ASN A C   1 
ATOM   18   O O   . ASN A 1 5   ? 51.875  27.276 0.073   1.00 73.14 ? 768  ASN A O   1 
ATOM   19   C CB  . ASN A 1 5   ? 50.899  29.732 -1.784  1.00 74.03 ? 768  ASN A CB  1 
ATOM   20   C CG  . ASN A 1 5   ? 49.899  29.396 -2.899  1.00 73.83 ? 768  ASN A CG  1 
ATOM   21   O OD1 . ASN A 1 5   ? 49.744  28.244 -3.293  1.00 73.88 ? 768  ASN A OD1 1 
ATOM   22   N ND2 . ASN A 1 5   ? 49.258  30.426 -3.443  1.00 73.80 ? 768  ASN A ND2 1 
ATOM   23   N N   . TRP A 1 6   ? 49.845  26.876 -0.849  1.00 70.99 ? 769  TRP A N   1 
ATOM   24   C CA  . TRP A 1 6   ? 50.009  25.423 -0.867  1.00 69.23 ? 769  TRP A CA  1 
ATOM   25   C C   . TRP A 1 6   ? 50.944  24.896 -1.965  1.00 68.97 ? 769  TRP A C   1 
ATOM   26   O O   . TRP A 1 6   ? 51.816  24.060 -1.694  1.00 68.76 ? 769  TRP A O   1 
ATOM   27   C CB  . TRP A 1 6   ? 48.669  24.715 -1.022  1.00 68.33 ? 769  TRP A CB  1 
ATOM   28   C CG  . TRP A 1 6   ? 48.915  23.257 -1.138  1.00 67.07 ? 769  TRP A CG  1 
ATOM   29   C CD1 . TRP A 1 6   ? 49.331  22.407 -0.142  1.00 67.04 ? 769  TRP A CD1 1 
ATOM   30   C CD2 . TRP A 1 6   ? 48.876  22.483 -2.326  1.00 65.11 ? 769  TRP A CD2 1 
ATOM   31   N NE1 . TRP A 1 6   ? 49.494  21.138 -0.637  1.00 66.02 ? 769  TRP A NE1 1 
ATOM   32   C CE2 . TRP A 1 6   ? 49.234  21.161 -1.983  1.00 65.35 ? 769  TRP A CE2 1 
ATOM   33   C CE3 . TRP A 1 6   ? 48.541  22.762 -3.651  1.00 64.12 ? 769  TRP A CE3 1 
ATOM   34   C CZ2 . TRP A 1 6   ? 49.267  20.132 -2.918  1.00 64.44 ? 769  TRP A CZ2 1 
ATOM   35   C CZ3 . TRP A 1 6   ? 48.576  21.751 -4.572  1.00 63.65 ? 769  TRP A CZ3 1 
ATOM   36   C CH2 . TRP A 1 6   ? 48.935  20.446 -4.205  1.00 64.19 ? 769  TRP A CH2 1 
ATOM   37   N N   . GLN A 1 7   ? 50.718  25.349 -3.202  1.00 68.53 ? 770  GLN A N   1 
ATOM   38   C CA  . GLN A 1 7   ? 51.469  24.881 -4.387  1.00 68.27 ? 770  GLN A CA  1 
ATOM   39   C C   . GLN A 1 7   ? 52.947  25.303 -4.332  1.00 67.63 ? 770  GLN A C   1 
ATOM   40   O O   . GLN A 1 7   ? 53.809  24.711 -5.010  1.00 66.97 ? 770  GLN A O   1 
ATOM   41   C CB  . GLN A 1 7   ? 50.813  25.396 -5.683  1.00 68.43 ? 770  GLN A CB  1 
ATOM   42   C CG  . GLN A 1 7   ? 49.331  25.015 -5.827  1.00 69.07 ? 770  GLN A CG  1 
ATOM   43   C CD  . GLN A 1 7   ? 48.563  25.867 -6.816  1.00 69.82 ? 770  GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 7   ? 48.564  27.100 -6.714  1.00 71.37 ? 770  GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 7   ? 47.876  25.216 -7.759  1.00 69.65 ? 770  GLN A NE2 1 
ATOM   46   N N   . GLN A 1 8   ? 53.207  26.340 -3.526  1.00 66.89 ? 771  GLN A N   1 
ATOM   47   C CA  . GLN A 1 8   ? 54.556  26.774 -3.159  1.00 66.03 ? 771  GLN A CA  1 
ATOM   48   C C   . GLN A 1 8   ? 55.338  25.687 -2.418  1.00 64.36 ? 771  GLN A C   1 
ATOM   49   O O   . GLN A 1 8   ? 56.521  25.485 -2.694  1.00 65.08 ? 771  GLN A O   1 
ATOM   50   C CB  . GLN A 1 8   ? 54.481  28.037 -2.288  1.00 66.46 ? 771  GLN A CB  1 
ATOM   51   C CG  . GLN A 1 8   ? 55.833  28.570 -1.787  1.00 66.99 ? 771  GLN A CG  1 
ATOM   52   C CD  . GLN A 1 8   ? 56.789  28.965 -2.913  1.00 67.20 ? 771  GLN A CD  1 
ATOM   53   O OE1 . GLN A 1 8   ? 57.899  28.441 -2.995  1.00 67.86 ? 771  GLN A OE1 1 
ATOM   54   N NE2 . GLN A 1 8   ? 56.359  29.882 -3.780  1.00 66.72 ? 771  GLN A NE2 1 
ATOM   55   N N   . LEU A 1 9   ? 54.695  25.014 -1.469  1.00 61.76 ? 772  LEU A N   1 
ATOM   56   C CA  . LEU A 1 9   ? 55.309  23.857 -0.828  1.00 60.04 ? 772  LEU A CA  1 
ATOM   57   C C   . LEU A 1 9   ? 55.738  22.852 -1.893  1.00 57.89 ? 772  LEU A C   1 
ATOM   58   O O   . LEU A 1 9   ? 56.933  22.719 -2.175  1.00 58.14 ? 772  LEU A O   1 
ATOM   59   C CB  . LEU A 1 9   ? 54.353  23.178 0.178   1.00 60.39 ? 772  LEU A CB  1 
ATOM   60   C CG  . LEU A 1 9   ? 54.237  23.754 1.603   1.00 60.81 ? 772  LEU A CG  1 
ATOM   61   C CD1 . LEU A 1 9   ? 53.046  23.145 2.377   1.00 60.92 ? 772  LEU A CD1 1 
ATOM   62   C CD2 . LEU A 1 9   ? 55.544  23.557 2.378   1.00 60.92 ? 772  LEU A CD2 1 
ATOM   63   N N   . VAL A 1 10  ? 54.755  22.194 -2.512  1.00 55.02 ? 773  VAL A N   1 
ATOM   64   C CA  . VAL A 1 10  ? 55.008  21.006 -3.345  1.00 53.03 ? 773  VAL A CA  1 
ATOM   65   C C   . VAL A 1 10  ? 55.856  21.312 -4.559  1.00 51.09 ? 773  VAL A C   1 
ATOM   66   O O   . VAL A 1 10  ? 55.665  22.347 -5.208  1.00 50.86 ? 773  VAL A O   1 
ATOM   67   C CB  . VAL A 1 10  ? 53.709  20.357 -3.902  1.00 52.74 ? 773  VAL A CB  1 
ATOM   68   C CG1 . VAL A 1 10  ? 54.013  18.954 -4.449  1.00 52.75 ? 773  VAL A CG1 1 
ATOM   69   C CG2 . VAL A 1 10  ? 52.609  20.296 -2.848  1.00 52.74 ? 773  VAL A CG2 1 
ATOM   70   N N   . SER A 1 11  ? 56.767  20.393 -4.876  1.00 48.79 ? 774  SER A N   1 
ATOM   71   C CA  . SER A 1 11  ? 57.494  20.461 -6.134  1.00 47.24 ? 774  SER A CA  1 
ATOM   72   C C   . SER A 1 11  ? 56.473  20.574 -7.283  1.00 45.87 ? 774  SER A C   1 
ATOM   73   O O   . SER A 1 11  ? 55.441  19.906 -7.257  1.00 46.89 ? 774  SER A O   1 
ATOM   74   C CB  . SER A 1 11  ? 58.434  19.249 -6.294  1.00 47.05 ? 774  SER A CB  1 
ATOM   75   O OG  . SER A 1 11  ? 57.795  18.115 -6.856  1.00 47.12 ? 774  SER A OG  1 
ATOM   76   N N   . ARG A 1 12  ? 56.737  21.447 -8.258  1.00 43.42 ? 775  ARG A N   1 
ATOM   77   C CA  . ARG A 1 12  ? 55.857  21.618 -9.431  1.00 41.07 ? 775  ARG A CA  1 
ATOM   78   C C   . ARG A 1 12  ? 55.745  20.344 -10.274 1.00 38.31 ? 775  ARG A C   1 
ATOM   79   O O   . ARG A 1 12  ? 54.770  20.158 -11.005 1.00 38.41 ? 775  ARG A O   1 
ATOM   80   C CB  . ARG A 1 12  ? 56.366  22.742 -10.343 1.00 40.97 ? 775  ARG A CB  1 
ATOM   81   C CG  . ARG A 1 12  ? 56.514  24.098 -9.678  1.00 42.24 ? 775  ARG A CG  1 
ATOM   82   C CD  . ARG A 1 12  ? 56.479  25.276 -10.636 1.00 42.55 ? 775  ARG A CD  1 
ATOM   83   N NE  . ARG A 1 12  ? 57.588  25.260 -11.592 1.00 43.87 ? 775  ARG A NE  1 
ATOM   84   C CZ  . ARG A 1 12  ? 57.941  26.291 -12.370 1.00 44.43 ? 775  ARG A CZ  1 
ATOM   85   N NH1 . ARG A 1 12  ? 57.287  27.449 -12.309 1.00 44.80 ? 775  ARG A NH1 1 
ATOM   86   N NH2 . ARG A 1 12  ? 58.959  26.162 -13.215 1.00 43.59 ? 775  ARG A NH2 1 
ATOM   87   N N   . GLU A 1 13  ? 56.753  19.482 -10.166 1.00 35.03 ? 776  GLU A N   1 
ATOM   88   C CA  . GLU A 1 13  ? 56.887  18.305 -11.018 1.00 32.05 ? 776  GLU A CA  1 
ATOM   89   C C   . GLU A 1 13  ? 56.166  17.082 -10.458 1.00 29.85 ? 776  GLU A C   1 
ATOM   90   O O   . GLU A 1 13  ? 56.179  16.009 -11.065 1.00 29.25 ? 776  GLU A O   1 
ATOM   91   C CB  . GLU A 1 13  ? 58.374  18.016 -11.211 1.00 32.03 ? 776  GLU A CB  1 
ATOM   92   C CG  . GLU A 1 13  ? 58.999  18.768 -12.390 1.00 32.55 ? 776  GLU A CG  1 
ATOM   93   C CD  . GLU A 1 13  ? 59.599  20.117 -12.027 1.00 32.49 ? 776  GLU A CD  1 
ATOM   94   O OE1 . GLU A 1 13  ? 59.353  20.601 -10.896 1.00 33.11 ? 776  GLU A OE1 1 
ATOM   95   O OE2 . GLU A 1 13  ? 60.326  20.697 -12.878 1.00 31.81 ? 776  GLU A OE2 1 
ATOM   96   N N   . VAL A 1 14  ? 55.581  17.230 -9.263  1.00 27.72 ? 777  VAL A N   1 
ATOM   97   C CA  . VAL A 1 14  ? 54.749  16.174 -8.648  1.00 25.01 ? 777  VAL A CA  1 
ATOM   98   C C   . VAL A 1 14  ? 53.279  16.605 -8.727  1.00 21.57 ? 777  VAL A C   1 
ATOM   99   O O   . VAL A 1 14  ? 52.363  15.771 -8.749  1.00 18.80 ? 777  VAL A O   1 
ATOM   100  C CB  . VAL A 1 14  ? 55.252  15.852 -7.187  1.00 25.73 ? 777  VAL A CB  1 
ATOM   101  C CG1 . VAL A 1 14  ? 54.137  15.315 -6.258  1.00 24.87 ? 777  VAL A CG1 1 
ATOM   102  C CG2 . VAL A 1 14  ? 56.459  14.884 -7.273  1.00 26.66 ? 777  VAL A CG2 1 
ATOM   103  N N   . LEU A 1 15  ? 53.096  17.922 -8.795  1.00 18.50 ? 778  LEU A N   1 
ATOM   104  C CA  . LEU A 1 15  ? 51.825  18.568 -9.072  1.00 17.47 ? 778  LEU A CA  1 
ATOM   105  C C   . LEU A 1 15  ? 51.274  18.202 -10.446 1.00 14.26 ? 778  LEU A C   1 
ATOM   106  O O   . LEU A 1 15  ? 50.063  18.251 -10.676 1.00 13.03 ? 778  LEU A O   1 
ATOM   107  C CB  . LEU A 1 15  ? 52.042  20.097 -9.047  1.00 19.16 ? 778  LEU A CB  1 
ATOM   108  C CG  . LEU A 1 15  ? 51.110  20.998 -8.254  1.00 21.53 ? 778  LEU A CG  1 
ATOM   109  C CD1 . LEU A 1 15  ? 50.678  20.423 -6.950  1.00 23.51 ? 778  LEU A CD1 1 
ATOM   110  C CD2 . LEU A 1 15  ? 51.770  22.355 -7.973  1.00 24.32 ? 778  LEU A CD2 1 
ATOM   111  N N   . LEU A 1 16  ? 52.171  17.886 -11.365 1.00 12.71 ? 779  LEU A N   1 
ATOM   112  C CA  . LEU A 1 16  ? 51.776  17.513 -12.735 1.00 12.94 ? 779  LEU A CA  1 
ATOM   113  C C   . LEU A 1 16  ? 50.969  16.250 -12.708 1.00 10.40 ? 779  LEU A C   1 
ATOM   114  O O   . LEU A 1 16  ? 50.071  16.070 -13.509 1.00 9.24  ? 779  LEU A O   1 
ATOM   115  C CB  . LEU A 1 16  ? 52.969  17.288 -13.626 1.00 13.03 ? 779  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 16  ? 53.438  18.481 -14.415 1.00 14.52 ? 779  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 16  ? 54.692  18.070 -15.139 1.00 15.08 ? 779  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 16  ? 52.370  18.991 -15.388 1.00 15.70 ? 779  LEU A CD2 1 
ATOM   119  N N   . GLY A 1 17  ? 51.311  15.393 -11.758 1.00 10.44 ? 780  GLY A N   1 
ATOM   120  C CA  . GLY A 1 17  ? 50.684  14.104 -11.605 1.00 10.47 ? 780  GLY A CA  1 
ATOM   121  C C   . GLY A 1 17  ? 49.373  14.090 -10.849 1.00 10.05 ? 780  GLY A C   1 
ATOM   122  O O   . GLY A 1 17  ? 48.694  13.098 -10.887 1.00 9.91  ? 780  GLY A O   1 
ATOM   123  N N   . LEU A 1 18  ? 49.004  15.173 -10.186 1.00 10.40 ? 781  LEU A N   1 
ATOM   124  C CA  . LEU A 1 18  ? 47.770  15.199 -9.428  1.00 11.89 ? 781  LEU A CA  1 
ATOM   125  C C   . LEU A 1 18  ? 46.585  15.564 -10.274 1.00 11.80 ? 781  LEU A C   1 
ATOM   126  O O   . LEU A 1 18  ? 46.668  16.430 -11.137 1.00 8.93  ? 781  LEU A O   1 
ATOM   127  C CB  . LEU A 1 18  ? 47.864  16.214 -8.290  1.00 13.31 ? 781  LEU A CB  1 
ATOM   128  C CG  . LEU A 1 18  ? 48.976  15.858 -7.338  1.00 15.79 ? 781  LEU A CG  1 
ATOM   129  C CD1 . LEU A 1 18  ? 49.020  16.873 -6.248  1.00 17.24 ? 781  LEU A CD1 1 
ATOM   130  C CD2 . LEU A 1 18  ? 48.764  14.456 -6.785  1.00 18.26 ? 781  LEU A CD2 1 
ATOM   131  N N   . LYS A 1 19  ? 45.462  14.924 -9.988  1.00 13.28 ? 782  LYS A N   1 
ATOM   132  C CA  . LYS A 1 19  ? 44.183  15.293 -10.599 1.00 15.55 ? 782  LYS A CA  1 
ATOM   133  C C   . LYS A 1 19  ? 43.840  16.744 -10.225 1.00 14.73 ? 782  LYS A C   1 
ATOM   134  O O   . LYS A 1 19  ? 44.191  17.198 -9.121  1.00 13.04 ? 782  LYS A O   1 
ATOM   135  C CB  . LYS A 1 19  ? 43.061  14.369 -10.085 1.00 17.35 ? 782  LYS A CB  1 
ATOM   136  C CG  . LYS A 1 19  ? 42.497  13.376 -11.066 1.00 20.11 ? 782  LYS A CG  1 
ATOM   137  C CD  . LYS A 1 19  ? 41.373  12.535 -10.399 1.00 22.65 ? 782  LYS A CD  1 
ATOM   138  C CE  . LYS A 1 19  ? 40.128  12.434 -11.314 1.00 24.90 ? 782  LYS A CE  1 
ATOM   139  N NZ  . LYS A 1 19  ? 39.194  11.305 -10.950 1.00 25.73 ? 782  LYS A NZ  1 
ATOM   140  N N   . PRO A 1 20  ? 43.155  17.460 -11.117 1.00 14.72 ? 783  PRO A N   1 
ATOM   141  C CA  . PRO A 1 20  ? 42.628  18.799 -10.790 1.00 16.45 ? 783  PRO A CA  1 
ATOM   142  C C   . PRO A 1 20  ? 41.801  18.825 -9.491  1.00 17.52 ? 783  PRO A C   1 
ATOM   143  O O   . PRO A 1 20  ? 42.065  19.615 -8.592  1.00 16.34 ? 783  PRO A O   1 
ATOM   144  C CB  . PRO A 1 20  ? 41.767  19.161 -12.018 1.00 16.50 ? 783  PRO A CB  1 
ATOM   145  C CG  . PRO A 1 20  ? 42.247  18.302 -13.122 1.00 15.76 ? 783  PRO A CG  1 
ATOM   146  C CD  . PRO A 1 20  ? 42.853  17.057 -12.507 1.00 15.31 ? 783  PRO A CD  1 
ATOM   147  N N   . CYS A 1 21  ? 40.843  17.918 -9.363  1.00 19.86 ? 784  CYS A N   1 
ATOM   148  C CA  . CYS A 1 21  ? 40.046  17.843 -8.146  1.00 21.84 ? 784  CYS A CA  1 
ATOM   149  C C   . CYS A 1 21  ? 40.911  17.595 -6.919  1.00 20.84 ? 784  CYS A C   1 
ATOM   150  O O   . CYS A 1 21  ? 40.595  18.046 -5.824  1.00 20.05 ? 784  CYS A O   1 
ATOM   151  C CB  . CYS A 1 21  ? 38.963  16.765 -8.264  1.00 24.48 ? 784  CYS A CB  1 
ATOM   152  S SG  . CYS A 1 21  ? 39.540  15.032 -8.162  1.00 31.62 ? 784  CYS A SG  1 
ATOM   153  N N   . GLU A 1 22  ? 42.009  16.884 -7.094  1.00 20.07 ? 785  GLU A N   1 
ATOM   154  C CA  . GLU A 1 22  ? 42.926  16.619 -5.988  1.00 20.36 ? 785  GLU A CA  1 
ATOM   155  C C   . GLU A 1 22  ? 43.731  17.865 -5.618  1.00 19.49 ? 785  GLU A C   1 
ATOM   156  O O   . GLU A 1 22  ? 44.092  18.073 -4.460  1.00 19.97 ? 785  GLU A O   1 
ATOM   157  C CB  . GLU A 1 22  ? 43.833  15.421 -6.335  1.00 20.91 ? 785  GLU A CB  1 
ATOM   158  C CG  . GLU A 1 22  ? 44.872  15.085 -5.281  1.00 22.74 ? 785  GLU A CG  1 
ATOM   159  C CD  . GLU A 1 22  ? 44.270  14.811 -3.897  1.00 22.99 ? 785  GLU A CD  1 
ATOM   160  O OE1 . GLU A 1 22  ? 43.073  14.440 -3.801  1.00 23.05 ? 785  GLU A OE1 1 
ATOM   161  O OE2 . GLU A 1 22  ? 45.004  14.975 -2.912  1.00 21.76 ? 785  GLU A OE2 1 
ATOM   162  N N   . ILE A 1 23  ? 43.985  18.732 -6.583  1.00 18.72 ? 786  ILE A N   1 
ATOM   163  C CA  . ILE A 1 23  ? 44.611  20.014 -6.278  1.00 18.66 ? 786  ILE A CA  1 
ATOM   164  C C   . ILE A 1 23  ? 43.661  20.902 -5.450  1.00 19.58 ? 786  ILE A C   1 
ATOM   165  O O   . ILE A 1 23  ? 44.109  21.568 -4.526  1.00 17.03 ? 786  ILE A O   1 
ATOM   166  C CB  . ILE A 1 23  ? 45.112  20.701 -7.558  1.00 17.73 ? 786  ILE A CB  1 
ATOM   167  C CG1 . ILE A 1 23  ? 46.551  20.248 -7.828  1.00 17.57 ? 786  ILE A CG1 1 
ATOM   168  C CG2 . ILE A 1 23  ? 45.104  22.182 -7.449  1.00 17.51 ? 786  ILE A CG2 1 
ATOM   169  C CD1 . ILE A 1 23  ? 46.986  20.464 -9.189  1.00 14.16 ? 786  ILE A CD1 1 
ATOM   170  N N   . LYS A 1 24  ? 42.364  20.878 -5.771  1.00 20.82 ? 787  LYS A N   1 
ATOM   171  C CA  . LYS A 1 24  ? 41.369  21.675 -5.054  1.00 21.77 ? 787  LYS A CA  1 
ATOM   172  C C   . LYS A 1 24  ? 41.237  21.178 -3.624  1.00 21.38 ? 787  LYS A C   1 
ATOM   173  O O   . LYS A 1 24  ? 41.178  21.990 -2.703  1.00 20.84 ? 787  LYS A O   1 
ATOM   174  C CB  . LYS A 1 24  ? 40.004  21.623 -5.740  1.00 23.32 ? 787  LYS A CB  1 
ATOM   175  C CG  . LYS A 1 24  ? 39.830  22.655 -6.831  1.00 26.37 ? 787  LYS A CG  1 
ATOM   176  C CD  . LYS A 1 24  ? 39.180  22.073 -8.078  1.00 29.04 ? 787  LYS A CD  1 
ATOM   177  C CE  . LYS A 1 24  ? 39.474  22.906 -9.326  1.00 30.52 ? 787  LYS A CE  1 
ATOM   178  N NZ  . LYS A 1 24  ? 39.468  22.057 -10.535 1.00 31.19 ? 787  LYS A NZ  1 
ATOM   179  N N   . ARG A 1 25  ? 41.196  19.856 -3.446  1.00 20.57 ? 788  ARG A N   1 
ATOM   180  C CA  . ARG A 1 25  ? 41.189  19.233 -2.122  1.00 21.49 ? 788  ARG A CA  1 
ATOM   181  C C   . ARG A 1 25  ? 42.351  19.767 -1.296  1.00 21.64 ? 788  ARG A C   1 
ATOM   182  O O   . ARG A 1 25  ? 42.167  20.089 -0.110  1.00 21.35 ? 788  ARG A O   1 
ATOM   183  C CB  . ARG A 1 25  ? 41.235  17.678 -2.181  1.00 22.85 ? 788  ARG A CB  1 
ATOM   184  C CG  . ARG A 1 25  ? 40.794  16.953 -0.854  1.00 24.21 ? 788  ARG A CG  1 
ATOM   185  C CD  . ARG A 1 25  ? 40.876  15.425 -0.884  1.00 26.00 ? 788  ARG A CD  1 
ATOM   186  N NE  . ARG A 1 25  ? 42.270  15.024 -0.816  1.00 27.53 ? 788  ARG A NE  1 
ATOM   187  C CZ  . ARG A 1 25  ? 42.910  14.561 0.246   1.00 28.93 ? 788  ARG A CZ  1 
ATOM   188  N NH1 . ARG A 1 25  ? 42.295  14.349 1.411   1.00 27.27 ? 788  ARG A NH1 1 
ATOM   189  N NH2 . ARG A 1 25  ? 44.203  14.275 0.116   1.00 30.77 ? 788  ARG A NH2 1 
ATOM   190  N N   . GLN A 1 26  ? 43.530  19.901 -1.905  1.00 20.04 ? 789  GLN A N   1 
ATOM   191  C CA  . GLN A 1 26  ? 44.697  20.268 -1.122  1.00 21.27 ? 789  GLN A CA  1 
ATOM   192  C C   . GLN A 1 26  ? 44.566  21.704 -0.708  1.00 22.59 ? 789  GLN A C   1 
ATOM   193  O O   . GLN A 1 26  ? 44.952  22.067 0.394   1.00 22.16 ? 789  GLN A O   1 
ATOM   194  C CB  . GLN A 1 26  ? 45.996  20.114 -1.886  1.00 20.40 ? 789  GLN A CB  1 
ATOM   195  C CG  . GLN A 1 26  ? 46.335  18.665 -2.254  1.00 21.10 ? 789  GLN A CG  1 
ATOM   196  C CD  . GLN A 1 26  ? 46.679  17.844 -1.048  1.00 19.34 ? 789  GLN A CD  1 
ATOM   197  O OE1 . GLN A 1 26  ? 47.443  18.294 -0.208  1.00 18.75 ? 789  GLN A OE1 1 
ATOM   198  N NE2 . GLN A 1 26  ? 46.081  16.666 -0.935  1.00 16.84 ? 789  GLN A NE2 1 
ATOM   199  N N   . GLU A 1 27  ? 44.049  22.509 -1.619  1.00 22.58 ? 790  GLU A N   1 
ATOM   200  C CA  . GLU A 1 27  ? 43.916  23.926 -1.390  1.00 24.76 ? 790  GLU A CA  1 
ATOM   201  C C   . GLU A 1 27  ? 42.967  24.196 -0.224  1.00 23.34 ? 790  GLU A C   1 
ATOM   202  O O   . GLU A 1 27  ? 43.247  25.047 0.586   1.00 24.30 ? 790  GLU A O   1 
ATOM   203  C CB  . GLU A 1 27  ? 43.435  24.645 -2.655  1.00 25.66 ? 790  GLU A CB  1 
ATOM   204  C CG  . GLU A 1 27  ? 44.558  25.072 -3.621  1.00 29.65 ? 790  GLU A CG  1 
ATOM   205  C CD  . GLU A 1 27  ? 44.032  25.427 -5.017  1.00 31.06 ? 790  GLU A CD  1 
ATOM   206  O OE1 . GLU A 1 27  ? 44.812  25.466 -6.007  1.00 32.94 ? 790  GLU A OE1 1 
ATOM   207  O OE2 . GLU A 1 27  ? 42.813  25.680 -5.124  1.00 33.18 ? 790  GLU A OE2 1 
ATOM   208  N N   . VAL A 1 28  ? 41.854  23.478 -0.159  1.00 23.24 ? 791  VAL A N   1 
ATOM   209  C CA  . VAL A 1 28  ? 40.891  23.650 0.905   1.00 23.22 ? 791  VAL A CA  1 
ATOM   210  C C   . VAL A 1 28  ? 41.334  23.023 2.239   1.00 24.61 ? 791  VAL A C   1 
ATOM   211  O O   . VAL A 1 28  ? 40.979  23.549 3.292   1.00 26.65 ? 791  VAL A O   1 
ATOM   212  C CB  . VAL A 1 28  ? 39.473  23.186 0.523   1.00 23.17 ? 791  VAL A CB  1 
ATOM   213  C CG1 . VAL A 1 28  ? 38.944  23.993 -0.638  1.00 23.28 ? 791  VAL A CG1 1 
ATOM   214  C CG2 . VAL A 1 28  ? 39.423  21.703 0.233   1.00 22.57 ? 791  VAL A CG2 1 
ATOM   215  N N   . ILE A 1 29  ? 42.115  21.942 2.226   1.00 23.89 ? 792  ILE A N   1 
ATOM   216  C CA  . ILE A 1 29  ? 42.706  21.469 3.467   1.00 24.87 ? 792  ILE A CA  1 
ATOM   217  C C   . ILE A 1 29  ? 43.685  22.530 3.969   1.00 26.34 ? 792  ILE A C   1 
ATOM   218  O O   . ILE A 1 29  ? 43.847  22.743 5.171   1.00 26.92 ? 792  ILE A O   1 
ATOM   219  C CB  . ILE A 1 29  ? 43.453  20.128 3.303   1.00 23.65 ? 792  ILE A CB  1 
ATOM   220  C CG1 . ILE A 1 29  ? 42.469  18.983 3.162   1.00 23.22 ? 792  ILE A CG1 1 
ATOM   221  C CG2 . ILE A 1 29  ? 44.316  19.839 4.528   1.00 23.57 ? 792  ILE A CG2 1 
ATOM   222  C CD1 . ILE A 1 29  ? 43.111  17.697 2.673   1.00 23.05 ? 792  ILE A CD1 1 
ATOM   223  N N   . ASN A 1 30  ? 44.360  23.178 3.042   1.00 26.88 ? 793  ASN A N   1 
ATOM   224  C CA  . ASN A 1 30  ? 45.349  24.169 3.410   1.00 27.61 ? 793  ASN A CA  1 
ATOM   225  C C   . ASN A 1 30  ? 44.751  25.461 3.938   1.00 26.10 ? 793  ASN A C   1 
ATOM   226  O O   . ASN A 1 30  ? 45.400  26.153 4.716   1.00 24.32 ? 793  ASN A O   1 
ATOM   227  C CB  . ASN A 1 30  ? 46.257  24.475 2.238   1.00 28.01 ? 793  ASN A CB  1 
ATOM   228  C CG  . ASN A 1 30  ? 47.455  23.633 2.260   1.00 32.01 ? 793  ASN A CG  1 
ATOM   229  O OD1 . ASN A 1 30  ? 48.456  23.991 2.875   1.00 34.34 ? 793  ASN A OD1 1 
ATOM   230  N ND2 . ASN A 1 30  ? 47.379  22.463 1.596   1.00 36.16 ? 793  ASN A ND2 1 
ATOM   231  N N   . GLU A 1 31  ? 43.531  25.763 3.488   1.00 24.34 ? 794  GLU A N   1 
ATOM   232  C CA  . GLU A 1 31  ? 42.767  26.866 3.992   1.00 24.60 ? 794  GLU A CA  1 
ATOM   233  C C   . GLU A 1 31  ? 42.418  26.636 5.475   1.00 23.76 ? 794  GLU A C   1 
ATOM   234  O O   . GLU A 1 31  ? 42.461  27.571 6.249   1.00 22.98 ? 794  GLU A O   1 
ATOM   235  C CB  . GLU A 1 31  ? 41.493  27.051 3.140   1.00 27.78 ? 794  GLU A CB  1 
ATOM   236  C CG  . GLU A 1 31  ? 40.606  28.256 3.455   1.00 30.42 ? 794  GLU A CG  1 
ATOM   237  C CD  . GLU A 1 31  ? 41.273  29.606 3.220   1.00 36.24 ? 794  GLU A CD  1 
ATOM   238  O OE1 . GLU A 1 31  ? 42.535  29.650 3.109   1.00 40.12 ? 794  GLU A OE1 1 
ATOM   239  O OE2 . GLU A 1 31  ? 40.536  30.638 3.175   1.00 37.09 ? 794  GLU A OE2 1 
ATOM   240  N N   . LEU A 1 32  ? 42.062  25.405 5.838   1.00 21.31 ? 795  LEU A N   1 
ATOM   241  C CA  . LEU A 1 32  ? 41.715  25.067 7.180   1.00 21.73 ? 795  LEU A CA  1 
ATOM   242  C C   . LEU A 1 32  ? 42.955  25.220 8.040   1.00 21.75 ? 795  LEU A C   1 
ATOM   243  O O   . LEU A 1 32  ? 42.905  25.925 9.062   1.00 19.66 ? 795  LEU A O   1 
ATOM   244  C CB  . LEU A 1 32  ? 41.166  23.647 7.287   1.00 22.19 ? 795  LEU A CB  1 
ATOM   245  C CG  . LEU A 1 32  ? 41.182  23.044 8.700   1.00 22.97 ? 795  LEU A CG  1 
ATOM   246  C CD1 . LEU A 1 32  ? 40.237  23.770 9.682   1.00 23.13 ? 795  LEU A CD1 1 
ATOM   247  C CD2 . LEU A 1 32  ? 40.843  21.615 8.609   1.00 22.95 ? 795  LEU A CD2 1 
ATOM   248  N N   . PHE A 1 33  ? 44.071  24.656 7.590   1.00 20.14 ? 796  PHE A N   1 
ATOM   249  C CA  . PHE A 1 33  ? 45.295  24.772 8.353   1.00 22.69 ? 796  PHE A CA  1 
ATOM   250  C C   . PHE A 1 33  ? 45.754  26.224 8.502   1.00 23.01 ? 796  PHE A C   1 
ATOM   251  O O   . PHE A 1 33  ? 46.007  26.644 9.604   1.00 23.61 ? 796  PHE A O   1 
ATOM   252  C CB  . PHE A 1 33  ? 46.425  23.916 7.782   1.00 23.60 ? 796  PHE A CB  1 
ATOM   253  C CG  . PHE A 1 33  ? 46.164  22.411 7.830   1.00 26.18 ? 796  PHE A CG  1 
ATOM   254  C CD1 . PHE A 1 33  ? 44.910  21.883 8.134   1.00 27.30 ? 796  PHE A CD1 1 
ATOM   255  C CD2 . PHE A 1 33  ? 47.189  21.525 7.525   1.00 28.31 ? 796  PHE A CD2 1 
ATOM   256  C CE1 . PHE A 1 33  ? 44.689  20.491 8.126   1.00 28.64 ? 796  PHE A CE1 1 
ATOM   257  C CE2 . PHE A 1 33  ? 46.966  20.153 7.533   1.00 29.86 ? 796  PHE A CE2 1 
ATOM   258  C CZ  . PHE A 1 33  ? 45.714  19.648 7.845   1.00 28.66 ? 796  PHE A CZ  1 
ATOM   259  N N   . TYR A 1 34  ? 45.806  26.978 7.403   1.00 23.06 ? 797  TYR A N   1 
ATOM   260  C CA  . TYR A 1 34  ? 46.328  28.323 7.385   1.00 24.40 ? 797  TYR A CA  1 
ATOM   261  C C   . TYR A 1 34  ? 45.524  29.298 8.272   1.00 22.45 ? 797  TYR A C   1 
ATOM   262  O O   . TYR A 1 34  ? 46.115  30.103 8.965   1.00 21.36 ? 797  TYR A O   1 
ATOM   263  C CB  . TYR A 1 34  ? 46.375  28.852 5.933   1.00 27.28 ? 797  TYR A CB  1 
ATOM   264  C CG  . TYR A 1 34  ? 46.920  30.268 5.800   1.00 34.45 ? 797  TYR A CG  1 
ATOM   265  C CD1 . TYR A 1 34  ? 48.260  30.485 5.435   1.00 39.24 ? 797  TYR A CD1 1 
ATOM   266  C CD2 . TYR A 1 34  ? 46.098  31.414 6.045   1.00 38.01 ? 797  TYR A CD2 1 
ATOM   267  C CE1 . TYR A 1 34  ? 48.783  31.792 5.317   1.00 41.22 ? 797  TYR A CE1 1 
ATOM   268  C CE2 . TYR A 1 34  ? 46.619  32.707 5.949   1.00 40.63 ? 797  TYR A CE2 1 
ATOM   269  C CZ  . TYR A 1 34  ? 47.967  32.885 5.576   1.00 42.19 ? 797  TYR A CZ  1 
ATOM   270  O OH  . TYR A 1 34  ? 48.514  34.137 5.453   1.00 43.49 ? 797  TYR A OH  1 
ATOM   271  N N   . THR A 1 35  ? 44.196  29.240 8.202   1.00 20.53 ? 798  THR A N   1 
ATOM   272  C CA  . THR A 1 35  ? 43.348  30.146 8.950   1.00 20.93 ? 798  THR A CA  1 
ATOM   273  C C   . THR A 1 35  ? 43.323  29.719 10.414  1.00 20.93 ? 798  THR A C   1 
ATOM   274  O O   . THR A 1 35  ? 43.001  30.521 11.249  1.00 19.35 ? 798  THR A O   1 
ATOM   275  C CB  . THR A 1 35  ? 41.919  30.162 8.417   1.00 20.15 ? 798  THR A CB  1 
ATOM   276  O OG1 . THR A 1 35  ? 41.409  28.819 8.365   1.00 21.82 ? 798  THR A OG1 1 
ATOM   277  C CG2 . THR A 1 35  ? 41.881  30.648 6.986   1.00 23.14 ? 798  THR A CG2 1 
ATOM   278  N N   . GLU A 1 36  ? 43.664  28.456 10.715  1.00 21.74 ? 799  GLU A N   1 
ATOM   279  C CA  . GLU A 1 36  ? 43.908  28.062 12.100  1.00 21.94 ? 799  GLU A CA  1 
ATOM   280  C C   . GLU A 1 36  ? 45.166  28.710 12.636  1.00 22.50 ? 799  GLU A C   1 
ATOM   281  O O   . GLU A 1 36  ? 45.196  29.104 13.814  1.00 19.44 ? 799  GLU A O   1 
ATOM   282  C CB  . GLU A 1 36  ? 44.043  26.536 12.305  1.00 22.46 ? 799  GLU A CB  1 
ATOM   283  C CG  . GLU A 1 36  ? 44.121  26.148 13.782  1.00 21.66 ? 799  GLU A CG  1 
ATOM   284  C CD  . GLU A 1 36  ? 42.791  26.269 14.459  1.00 23.34 ? 799  GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 36  ? 42.764  26.373 15.694  1.00 24.73 ? 799  GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 36  ? 41.764  26.299 13.760  1.00 21.79 ? 799  GLU A OE2 1 
ATOM   287  N N   . ARG A 1 37  ? 46.211  28.812 11.813  1.00 23.17 ? 800  ARG A N   1 
ATOM   288  C CA  . ARG A 1 37  ? 47.443  29.477 12.269  1.00 25.06 ? 800  ARG A CA  1 
ATOM   289  C C   . ARG A 1 37  ? 47.185  30.992 12.504  1.00 24.29 ? 800  ARG A C   1 
ATOM   290  O O   . ARG A 1 37  ? 47.617  31.571 13.487  1.00 21.57 ? 800  ARG A O   1 
ATOM   291  C CB  . ARG A 1 37  ? 48.557  29.279 11.254  1.00 27.75 ? 800  ARG A CB  1 
ATOM   292  C CG  . ARG A 1 37  ? 49.979  29.417 11.799  1.00 33.56 ? 800  ARG A CG  1 
ATOM   293  C CD  . ARG A 1 37  ? 51.083  29.033 10.774  1.00 38.00 ? 800  ARG A CD  1 
ATOM   294  N NE  . ARG A 1 37  ? 50.702  27.845 9.990   1.00 41.81 ? 800  ARG A NE  1 
ATOM   295  C CZ  . ARG A 1 37  ? 50.431  27.810 8.671   1.00 42.66 ? 800  ARG A CZ  1 
ATOM   296  N NH1 . ARG A 1 37  ? 50.500  28.910 7.909   1.00 44.68 ? 800  ARG A NH1 1 
ATOM   297  N NH2 . ARG A 1 37  ? 50.085  26.647 8.112   1.00 40.47 ? 800  ARG A NH2 1 
ATOM   298  N N   . ALA A 1 38  ? 46.436  31.600 11.591  1.00 24.67 ? 801  ALA A N   1 
ATOM   299  C CA  . ALA A 1 38  ? 46.035  32.996 11.708  1.00 24.15 ? 801  ALA A CA  1 
ATOM   300  C C   . ALA A 1 38  ? 45.268  33.198 13.024  1.00 23.91 ? 801  ALA A C   1 
ATOM   301  O O   . ALA A 1 38  ? 45.511  34.161 13.754  1.00 21.40 ? 801  ALA A O   1 
ATOM   302  C CB  . ALA A 1 38  ? 45.186  33.403 10.524  1.00 23.84 ? 801  ALA A CB  1 
ATOM   303  N N   . HIS A 1 39  ? 44.352  32.270 13.297  1.00 23.94 ? 802  HIS A N   1 
ATOM   304  C CA  . HIS A 1 39  ? 43.545  32.316 14.515  1.00 24.59 ? 802  HIS A CA  1 
ATOM   305  C C   . HIS A 1 39  ? 44.356  32.288 15.798  1.00 22.37 ? 802  HIS A C   1 
ATOM   306  O O   . HIS A 1 39  ? 44.128  33.078 16.713  1.00 22.06 ? 802  HIS A O   1 
ATOM   307  C CB  . HIS A 1 39  ? 42.551  31.170 14.594  1.00 23.28 ? 802  HIS A CB  1 
ATOM   308  C CG  . HIS A 1 39  ? 41.623  31.297 15.747  1.00 24.07 ? 802  HIS A CG  1 
ATOM   309  N ND1 . HIS A 1 39  ? 40.687  32.311 15.826  1.00 25.17 ? 802  HIS A ND1 1 
ATOM   310  C CD2 . HIS A 1 39  ? 41.559  30.624 16.922  1.00 22.93 ? 802  HIS A CD2 1 
ATOM   311  C CE1 . HIS A 1 39  ? 40.040  32.200 16.969  1.00 22.59 ? 802  HIS A CE1 1 
ATOM   312  N NE2 . HIS A 1 39  ? 40.528  31.165 17.632  1.00 22.83 ? 802  HIS A NE2 1 
ATOM   313  N N   . VAL A 1 40  ? 45.251  31.327 15.862  1.00 23.02 ? 803  VAL A N   1 
ATOM   314  C CA  . VAL A 1 40  ? 46.223  31.242 16.935  1.00 21.98 ? 803  VAL A CA  1 
ATOM   315  C C   . VAL A 1 40  ? 46.958  32.535 17.169  1.00 22.88 ? 803  VAL A C   1 
ATOM   316  O O   . VAL A 1 40  ? 47.175  32.934 18.323  1.00 22.92 ? 803  VAL A O   1 
ATOM   317  C CB  . VAL A 1 40  ? 47.215  30.094 16.705  1.00 22.31 ? 803  VAL A CB  1 
ATOM   318  C CG1 . VAL A 1 40  ? 48.426  30.147 17.686  1.00 21.32 ? 803  VAL A CG1 1 
ATOM   319  C CG2 . VAL A 1 40  ? 46.518  28.745 16.899  1.00 20.66 ? 803  VAL A CG2 1 
ATOM   320  N N   . ARG A 1 41  ? 47.390  33.162 16.087  1.00 22.83 ? 804  ARG A N   1 
ATOM   321  C CA  . ARG A 1 41  ? 48.170  34.401 16.138  1.00 22.63 ? 804  ARG A CA  1 
ATOM   322  C C   . ARG A 1 41  ? 47.390  35.560 16.748  1.00 20.26 ? 804  ARG A C   1 
ATOM   323  O O   . ARG A 1 41  ? 47.959  36.373 17.430  1.00 16.31 ? 804  ARG A O   1 
ATOM   324  C CB  . ARG A 1 41  ? 48.651  34.790 14.733  1.00 25.41 ? 804  ARG A CB  1 
ATOM   325  C CG  . ARG A 1 41  ? 50.066  35.328 14.720  1.00 30.78 ? 804  ARG A CG  1 
ATOM   326  C CD  . ARG A 1 41  ? 50.594  35.696 13.317  1.00 34.33 ? 804  ARG A CD  1 
ATOM   327  N NE  . ARG A 1 41  ? 51.353  34.573 12.770  1.00 37.35 ? 804  ARG A NE  1 
ATOM   328  C CZ  . ARG A 1 41  ? 50.942  33.713 11.827  1.00 38.20 ? 804  ARG A CZ  1 
ATOM   329  N NH1 . ARG A 1 41  ? 49.758  33.819 11.237  1.00 39.19 ? 804  ARG A NH1 1 
ATOM   330  N NH2 . ARG A 1 41  ? 51.759  32.745 11.448  1.00 38.25 ? 804  ARG A NH2 1 
ATOM   331  N N   . THR A 1 42  ? 46.099  35.626 16.422  1.00 18.17 ? 805  THR A N   1 
ATOM   332  C CA  . THR A 1 42  ? 45.143  36.562 16.939  1.00 19.92 ? 805  THR A CA  1 
ATOM   333  C C   . THR A 1 42  ? 44.974  36.379 18.446  1.00 20.87 ? 805  THR A C   1 
ATOM   334  O O   . THR A 1 42  ? 44.984  37.360 19.250  1.00 17.18 ? 805  THR A O   1 
ATOM   335  C CB  . THR A 1 42  ? 43.807  36.281 16.191  1.00 21.49 ? 805  THR A CB  1 
ATOM   336  O OG1 . THR A 1 42  ? 43.957  36.687 14.844  1.00 21.33 ? 805  THR A OG1 1 
ATOM   337  C CG2 . THR A 1 42  ? 42.732  37.150 16.579  1.00 21.21 ? 805  THR A CG2 1 
ATOM   338  N N   . LEU A 1 43  ? 44.878  35.108 18.844  1.00 19.43 ? 806  LEU A N   1 
ATOM   339  C CA  . LEU A 1 43  ? 44.674  34.805 20.235  1.00 19.15 ? 806  LEU A CA  1 
ATOM   340  C C   . LEU A 1 43  ? 45.956  35.175 21.018  1.00 16.78 ? 806  LEU A C   1 
ATOM   341  O O   . LEU A 1 43  ? 45.856  35.672 22.156  1.00 16.73 ? 806  LEU A O   1 
ATOM   342  C CB  . LEU A 1 43  ? 44.274  33.344 20.441  1.00 17.92 ? 806  LEU A CB  1 
ATOM   343  C CG  . LEU A 1 43  ? 42.845  32.950 20.037  1.00 20.24 ? 806  LEU A CG  1 
ATOM   344  C CD1 . LEU A 1 43  ? 42.577  31.482 20.390  1.00 22.38 ? 806  LEU A CD1 1 
ATOM   345  C CD2 . LEU A 1 43  ? 41.805  33.812 20.645  1.00 20.28 ? 806  LEU A CD2 1 
ATOM   346  N N   . LYS A 1 44  ? 47.112  34.970 20.443  1.00 17.82 ? 807  LYS A N   1 
ATOM   347  C CA  . LYS A 1 44  ? 48.365  35.436 21.098  1.00 19.16 ? 807  LYS A CA  1 
ATOM   348  C C   . LYS A 1 44  ? 48.443  36.978 21.211  1.00 19.69 ? 807  LYS A C   1 
ATOM   349  O O   . LYS A 1 44  ? 49.077  37.455 22.147  1.00 20.15 ? 807  LYS A O   1 
ATOM   350  C CB  . LYS A 1 44  ? 49.602  34.900 20.429  1.00 20.38 ? 807  LYS A CB  1 
ATOM   351  C CG  . LYS A 1 44  ? 49.732  33.387 20.388  1.00 23.95 ? 807  LYS A CG  1 
ATOM   352  C CD  . LYS A 1 44  ? 51.184  32.979 20.007  1.00 26.00 ? 807  LYS A CD  1 
ATOM   353  C CE  . LYS A 1 44  ? 51.488  31.529 20.341  1.00 26.38 ? 807  LYS A CE  1 
ATOM   354  N NZ  . LYS A 1 44  ? 52.463  30.930 19.413  1.00 27.73 ? 807  LYS A NZ  1 
ATOM   355  N N   . VAL A 1 45  ? 47.764  37.735 20.330  1.00 19.87 ? 808  VAL A N   1 
ATOM   356  C CA  . VAL A 1 45  ? 47.613  39.190 20.496  1.00 22.40 ? 808  VAL A CA  1 
ATOM   357  C C   . VAL A 1 45  ? 46.776  39.511 21.730  1.00 21.82 ? 808  VAL A C   1 
ATOM   358  O O   . VAL A 1 45  ? 47.255  40.264 22.542  1.00 23.28 ? 808  VAL A O   1 
ATOM   359  C CB  . VAL A 1 45  ? 47.017  39.954 19.251  1.00 22.49 ? 808  VAL A CB  1 
ATOM   360  C CG1 . VAL A 1 45  ? 46.783  41.482 19.554  1.00 23.99 ? 808  VAL A CG1 1 
ATOM   361  C CG2 . VAL A 1 45  ? 47.877  39.818 18.075  1.00 23.15 ? 808  VAL A CG2 1 
ATOM   362  N N   . LEU A 1 46  ? 45.524  39.011 21.860  1.00 21.72 ? 809  LEU A N   1 
ATOM   363  C CA  . LEU A 1 46  ? 44.779  39.176 23.105  1.00 18.69 ? 809  LEU A CA  1 
ATOM   364  C C   . LEU A 1 46  ? 45.679  38.891 24.282  1.00 18.73 ? 809  LEU A C   1 
ATOM   365  O O   . LEU A 1 46  ? 45.713  39.655 25.268  1.00 21.06 ? 809  LEU A O   1 
ATOM   366  C CB  . LEU A 1 46  ? 43.635  38.217 23.242  1.00 14.15 ? 809  LEU A CB  1 
ATOM   367  C CG  . LEU A 1 46  ? 42.411  38.730 22.463  1.00 15.34 ? 809  LEU A CG  1 
ATOM   368  C CD1 . LEU A 1 46  ? 41.370  37.743 22.618  1.00 17.01 ? 809  LEU A CD1 1 
ATOM   369  C CD2 . LEU A 1 46  ? 42.004  40.074 23.113  1.00 15.70 ? 809  LEU A CD2 1 
ATOM   370  N N   . ASP A 1 47  ? 46.232  37.717 24.248  1.00 14.42 ? 810  ASP A N   1 
ATOM   371  C CA  . ASP A 1 47  ? 47.074  37.250 25.392  1.00 19.83 ? 810  ASP A CA  1 
ATOM   372  C C   . ASP A 1 47  ? 48.231  38.154 25.637  1.00 18.91 ? 810  ASP A C   1 
ATOM   373  O O   . ASP A 1 47  ? 48.509  38.491 26.800  1.00 23.54 ? 810  ASP A O   1 
ATOM   374  C CB  . ASP A 1 47  ? 47.512  35.769 25.227  1.00 17.34 ? 810  ASP A CB  1 
ATOM   375  C CG  . ASP A 1 47  ? 48.340  35.278 26.358  1.00 22.48 ? 810  ASP A CG  1 
ATOM   376  O OD1 . ASP A 1 47  ? 49.527  35.002 26.096  1.00 22.49 ? 810  ASP A OD1 1 
ATOM   377  O OD2 . ASP A 1 47  ? 47.949  35.235 27.550  1.00 24.88 ? 810  ASP A OD2 1 
ATOM   378  N N   . GLN A 1 48  ? 48.974  38.511 24.618  1.00 21.01 ? 811  GLN A N   1 
ATOM   379  C CA  . GLN A 1 48  ? 50.314  39.096 24.908  1.00 23.30 ? 811  GLN A CA  1 
ATOM   380  C C   . GLN A 1 48  ? 50.211  40.617 25.077  1.00 24.24 ? 811  GLN A C   1 
ATOM   381  O O   . GLN A 1 48  ? 50.856  41.201 25.958  1.00 21.73 ? 811  GLN A O   1 
ATOM   382  C CB  . GLN A 1 48  ? 51.351  38.739 23.847  1.00 25.58 ? 811  GLN A CB  1 
ATOM   383  C CG  . GLN A 1 48  ? 51.931  37.294 23.955  1.00 29.17 ? 811  GLN A CG  1 
ATOM   384  C CD  . GLN A 1 48  ? 52.581  37.004 25.305  1.00 31.28 ? 811  GLN A CD  1 
ATOM   385  O OE1 . GLN A 1 48  ? 53.627  37.580 25.633  1.00 39.86 ? 811  GLN A OE1 1 
ATOM   386  N NE2 . GLN A 1 48  ? 51.987  36.097 26.081  1.00 31.63 ? 811  GLN A NE2 1 
ATOM   387  N N   . VAL A 1 49  ? 49.327  41.236 24.289  1.00 24.43 ? 812  VAL A N   1 
ATOM   388  C CA  . VAL A 1 49  ? 49.228  42.692 24.292  1.00 24.22 ? 812  VAL A CA  1 
ATOM   389  C C   . VAL A 1 49  ? 48.363  43.172 25.468  1.00 24.47 ? 812  VAL A C   1 
ATOM   390  O O   . VAL A 1 49  ? 48.728  44.169 26.085  1.00 21.68 ? 812  VAL A O   1 
ATOM   391  C CB  . VAL A 1 49  ? 48.730  43.255 22.945  1.00 23.73 ? 812  VAL A CB  1 
ATOM   392  C CG1 . VAL A 1 49  ? 48.527  44.761 23.026  1.00 24.87 ? 812  VAL A CG1 1 
ATOM   393  C CG2 . VAL A 1 49  ? 49.717  42.915 21.846  1.00 24.72 ? 812  VAL A CG2 1 
ATOM   394  N N   . PHE A 1 50  ? 47.283  42.414 25.785  1.00 23.03 ? 813  PHE A N   1 
ATOM   395  C CA  . PHE A 1 50  ? 46.306  42.762 26.769  1.00 21.36 ? 813  PHE A CA  1 
ATOM   396  C C   . PHE A 1 50  ? 46.439  42.007 28.070  1.00 20.18 ? 813  PHE A C   1 
ATOM   397  O O   . PHE A 1 50  ? 46.674  42.632 29.092  1.00 20.79 ? 813  PHE A O   1 
ATOM   398  C CB  . PHE A 1 50  ? 44.847  42.642 26.218  1.00 18.93 ? 813  PHE A CB  1 
ATOM   399  C CG  . PHE A 1 50  ? 44.582  43.586 25.117  1.00 18.99 ? 813  PHE A CG  1 
ATOM   400  C CD1 . PHE A 1 50  ? 44.235  44.910 25.376  1.00 16.22 ? 813  PHE A CD1 1 
ATOM   401  C CD2 . PHE A 1 50  ? 44.819  43.223 23.811  1.00 19.94 ? 813  PHE A CD2 1 
ATOM   402  C CE1 . PHE A 1 50  ? 44.099  45.816 24.358  1.00 18.05 ? 813  PHE A CE1 1 
ATOM   403  C CE2 . PHE A 1 50  ? 44.656  44.137 22.776  1.00 20.38 ? 813  PHE A CE2 1 
ATOM   404  C CZ  . PHE A 1 50  ? 44.293  45.437 23.055  1.00 20.41 ? 813  PHE A CZ  1 
ATOM   405  N N   . TYR A 1 51  ? 46.229  40.687 28.057  1.00 19.48 ? 814  TYR A N   1 
ATOM   406  C CA  . TYR A 1 51  ? 45.982  39.962 29.272  1.00 18.37 ? 814  TYR A CA  1 
ATOM   407  C C   . TYR A 1 51  ? 47.269  39.900 30.077  1.00 19.52 ? 814  TYR A C   1 
ATOM   408  O O   . TYR A 1 51  ? 47.291  40.273 31.253  1.00 20.33 ? 814  TYR A O   1 
ATOM   409  C CB  . TYR A 1 51  ? 45.498  38.536 29.012  1.00 21.47 ? 814  TYR A CB  1 
ATOM   410  C CG  . TYR A 1 51  ? 45.465  37.724 30.292  1.00 25.24 ? 814  TYR A CG  1 
ATOM   411  C CD1 . TYR A 1 51  ? 44.428  37.840 31.179  1.00 29.56 ? 814  TYR A CD1 1 
ATOM   412  C CD2 . TYR A 1 51  ? 46.564  36.955 30.667  1.00 31.37 ? 814  TYR A CD2 1 
ATOM   413  C CE1 . TYR A 1 51  ? 44.432  37.144 32.430  1.00 32.87 ? 814  TYR A CE1 1 
ATOM   414  C CE2 . TYR A 1 51  ? 46.586  36.234 31.890  1.00 35.60 ? 814  TYR A CE2 1 
ATOM   415  C CZ  . TYR A 1 51  ? 45.475  36.318 32.752  1.00 35.44 ? 814  TYR A CZ  1 
ATOM   416  O OH  . TYR A 1 51  ? 45.490  35.621 33.951  1.00 39.35 ? 814  TYR A OH  1 
ATOM   417  N N   . GLN A 1 52  ? 48.326  39.451 29.456  1.00 18.77 ? 815  GLN A N   1 
ATOM   418  C CA  . GLN A 1 52  ? 49.607  39.278 30.209  1.00 19.53 ? 815  GLN A CA  1 
ATOM   419  C C   . GLN A 1 52  ? 50.067  40.628 30.784  1.00 20.53 ? 815  GLN A C   1 
ATOM   420  O O   . GLN A 1 52  ? 50.321  40.733 31.965  1.00 24.59 ? 815  GLN A O   1 
ATOM   421  C CB  . GLN A 1 52  ? 50.679  38.683 29.343  1.00 19.94 ? 815  GLN A CB  1 
ATOM   422  C CG  . GLN A 1 52  ? 50.574  37.160 28.967  1.00 21.67 ? 815  GLN A CG  1 
ATOM   423  C CD  . GLN A 1 52  ? 50.331  36.189 30.134  1.00 28.34 ? 815  GLN A CD  1 
ATOM   424  O OE1 . GLN A 1 52  ? 51.075  36.226 31.163  1.00 32.65 ? 815  GLN A OE1 1 
ATOM   425  N NE2 . GLN A 1 52  ? 49.386  35.260 29.950  1.00 22.17 ? 815  GLN A NE2 1 
ATOM   426  N N   . ARG A 1 53  ? 50.137  41.668 29.965  1.00 22.18 ? 816  ARG A N   1 
ATOM   427  C CA  . ARG A 1 53  ? 50.512  43.022 30.426  1.00 24.51 ? 816  ARG A CA  1 
ATOM   428  C C   . ARG A 1 53  ? 49.666  43.593 31.587  1.00 23.09 ? 816  ARG A C   1 
ATOM   429  O O   . ARG A 1 53  ? 50.205  44.045 32.582  1.00 19.92 ? 816  ARG A O   1 
ATOM   430  C CB  . ARG A 1 53  ? 50.454  44.014 29.258  1.00 27.64 ? 816  ARG A CB  1 
ATOM   431  C CG  . ARG A 1 53  ? 51.511  43.785 28.183  1.00 35.66 ? 816  ARG A CG  1 
ATOM   432  C CD  . ARG A 1 53  ? 52.611  44.838 28.210  1.00 41.09 ? 816  ARG A CD  1 
ATOM   433  N NE  . ARG A 1 53  ? 53.561  44.688 27.121  1.00 46.39 ? 816  ARG A NE  1 
ATOM   434  C CZ  . ARG A 1 53  ? 54.607  45.497 26.924  1.00 50.78 ? 816  ARG A CZ  1 
ATOM   435  N NH1 . ARG A 1 53  ? 54.829  46.542 27.738  1.00 51.12 ? 816  ARG A NH1 1 
ATOM   436  N NH2 . ARG A 1 53  ? 55.427  45.272 25.890  1.00 53.03 ? 816  ARG A NH2 1 
ATOM   437  N N   . VAL A 1 54  ? 48.339  43.580 31.458  1.00 20.99 ? 817  VAL A N   1 
ATOM   438  C CA  . VAL A 1 54  ? 47.490  44.135 32.485  1.00 22.47 ? 817  VAL A CA  1 
ATOM   439  C C   . VAL A 1 54  ? 47.591  43.365 33.783  1.00 24.01 ? 817  VAL A C   1 
ATOM   440  O O   . VAL A 1 54  ? 47.484  43.920 34.857  1.00 23.43 ? 817  VAL A O   1 
ATOM   441  C CB  . VAL A 1 54  ? 45.999  44.161 32.028  1.00 21.77 ? 817  VAL A CB  1 
ATOM   442  C CG1 . VAL A 1 54  ? 45.315  42.845 32.270  1.00 23.61 ? 817  VAL A CG1 1 
ATOM   443  C CG2 . VAL A 1 54  ? 45.251  45.228 32.793  1.00 23.57 ? 817  VAL A CG2 1 
ATOM   444  N N   . SER A 1 55  ? 47.756  42.062 33.673  1.00 26.81 ? 818  SER A N   1 
ATOM   445  C CA  . SER A 1 55  ? 47.861  41.212 34.827  1.00 29.92 ? 818  SER A CA  1 
ATOM   446  C C   . SER A 1 55  ? 49.177  41.600 35.525  1.00 31.27 ? 818  SER A C   1 
ATOM   447  O O   . SER A 1 55  ? 49.206  41.799 36.731  1.00 31.56 ? 818  SER A O   1 
ATOM   448  C CB  . SER A 1 55  ? 47.804  39.737 34.367  1.00 31.57 ? 818  SER A CB  1 
ATOM   449  O OG  . SER A 1 55  ? 48.175  38.871 35.418  1.00 32.93 ? 818  SER A OG  1 
ATOM   450  N N   . ARG A 1 56  ? 50.230  41.808 34.764  1.00 32.05 ? 819  ARG A N   1 
ATOM   451  C CA  . ARG A 1 56  ? 51.507  42.224 35.375  1.00 35.40 ? 819  ARG A CA  1 
ATOM   452  C C   . ARG A 1 56  ? 51.406  43.607 36.020  1.00 35.90 ? 819  ARG A C   1 
ATOM   453  O O   . ARG A 1 56  ? 52.068  43.861 37.002  1.00 36.82 ? 819  ARG A O   1 
ATOM   454  C CB  . ARG A 1 56  ? 52.635  42.234 34.345  1.00 36.33 ? 819  ARG A CB  1 
ATOM   455  C CG  . ARG A 1 56  ? 53.227  40.850 34.040  1.00 40.09 ? 819  ARG A CG  1 
ATOM   456  C CD  . ARG A 1 56  ? 54.601  40.907 33.358  1.00 44.31 ? 819  ARG A CD  1 
ATOM   457  N NE  . ARG A 1 56  ? 54.669  41.897 32.267  1.00 47.39 ? 819  ARG A NE  1 
ATOM   458  C CZ  . ARG A 1 56  ? 54.396  41.662 30.970  1.00 49.79 ? 819  ARG A CZ  1 
ATOM   459  N NH1 . ARG A 1 56  ? 54.023  40.456 30.531  1.00 48.48 ? 819  ARG A NH1 1 
ATOM   460  N NH2 . ARG A 1 56  ? 54.500  42.668 30.101  1.00 52.01 ? 819  ARG A NH2 1 
ATOM   461  N N   . GLU A 1 57  ? 50.586  44.504 35.473  1.00 36.79 ? 820  GLU A N   1 
ATOM   462  C CA  . GLU A 1 57  ? 50.525  45.866 36.016  1.00 36.71 ? 820  GLU A CA  1 
ATOM   463  C C   . GLU A 1 57  ? 49.663  45.878 37.278  1.00 34.79 ? 820  GLU A C   1 
ATOM   464  O O   . GLU A 1 57  ? 49.766  46.765 38.094  1.00 31.77 ? 820  GLU A O   1 
ATOM   465  C CB  . GLU A 1 57  ? 50.071  46.886 34.941  1.00 38.05 ? 820  GLU A CB  1 
ATOM   466  C CG  . GLU A 1 57  ? 51.287  47.372 34.120  1.00 40.19 ? 820  GLU A CG  1 
ATOM   467  C CD  . GLU A 1 57  ? 50.978  48.120 32.819  1.00 42.38 ? 820  GLU A CD  1 
ATOM   468  O OE1 . GLU A 1 57  ? 51.824  48.043 31.904  1.00 43.56 ? 820  GLU A OE1 1 
ATOM   469  O OE2 . GLU A 1 57  ? 49.917  48.785 32.683  1.00 46.19 ? 820  GLU A OE2 1 
ATOM   470  N N   . GLY A 1 58  ? 48.822  44.864 37.442  1.00 34.39 ? 821  GLY A N   1 
ATOM   471  C CA  . GLY A 1 58  ? 48.008  44.748 38.649  1.00 33.63 ? 821  GLY A CA  1 
ATOM   472  C C   . GLY A 1 58  ? 46.873  45.738 38.751  1.00 31.62 ? 821  GLY A C   1 
ATOM   473  O O   . GLY A 1 58  ? 46.395  45.969 39.847  1.00 30.39 ? 821  GLY A O   1 
ATOM   474  N N   . ILE A 1 59  ? 46.447  46.280 37.607  1.00 31.64 ? 822  ILE A N   1 
ATOM   475  C CA  . ILE A 1 59  ? 45.386  47.276 37.494  1.00 31.63 ? 822  ILE A CA  1 
ATOM   476  C C   . ILE A 1 59  ? 44.006  46.700 37.814  1.00 29.72 ? 822  ILE A C   1 
ATOM   477  O O   . ILE A 1 59  ? 43.159  47.427 38.344  1.00 27.19 ? 822  ILE A O   1 
ATOM   478  C CB  . ILE A 1 59  ? 45.272  47.807 35.981  1.00 33.33 ? 822  ILE A CB  1 
ATOM   479  C CG1 . ILE A 1 59  ? 46.510  48.493 35.476  1.00 34.77 ? 822  ILE A CG1 1 
ATOM   480  C CG2 . ILE A 1 59  ? 44.031  48.669 35.782  1.00 34.29 ? 822  ILE A CG2 1 
ATOM   481  C CD1 . ILE A 1 59  ? 47.188  49.351 36.485  1.00 37.93 ? 822  ILE A CD1 1 
ATOM   482  N N   . LEU A 1 60  ? 43.762  45.461 37.361  1.00 28.08 ? 823  LEU A N   1 
ATOM   483  C CA  . LEU A 1 60  ? 42.525  44.755 37.616  1.00 26.90 ? 823  LEU A CA  1 
ATOM   484  C C   . LEU A 1 60  ? 42.603  43.797 38.794  1.00 25.01 ? 823  LEU A C   1 
ATOM   485  O O   . LEU A 1 60  ? 43.641  43.271 39.150  1.00 26.90 ? 823  LEU A O   1 
ATOM   486  C CB  . LEU A 1 60  ? 42.044  43.990 36.389  1.00 27.71 ? 823  LEU A CB  1 
ATOM   487  C CG  . LEU A 1 60  ? 41.904  44.849 35.100  1.00 25.00 ? 823  LEU A CG  1 
ATOM   488  C CD1 . LEU A 1 60  ? 41.688  43.941 33.964  1.00 23.91 ? 823  LEU A CD1 1 
ATOM   489  C CD2 . LEU A 1 60  ? 40.835  45.873 35.234  1.00 22.55 ? 823  LEU A CD2 1 
ATOM   490  N N   . SER A 1 61  ? 41.466  43.623 39.424  1.00 24.19 ? 824  SER A N   1 
ATOM   491  C CA  . SER A 1 61  ? 41.292  42.658 40.525  1.00 23.09 ? 824  SER A CA  1 
ATOM   492  C C   . SER A 1 61  ? 41.159  41.250 39.963  1.00 21.51 ? 824  SER A C   1 
ATOM   493  O O   . SER A 1 61  ? 40.883  41.107 38.764  1.00 23.90 ? 824  SER A O   1 
ATOM   494  C CB  . SER A 1 61  ? 40.058  43.034 41.303  1.00 21.36 ? 824  SER A CB  1 
ATOM   495  O OG  . SER A 1 61  ? 38.900  42.701 40.585  1.00 20.11 ? 824  SER A OG  1 
ATOM   496  N N   . PRO A 1 62  ? 41.250  40.221 40.814  1.00 20.44 ? 825  PRO A N   1 
ATOM   497  C CA  . PRO A 1 62  ? 41.023  38.851 40.364  1.00 21.46 ? 825  PRO A CA  1 
ATOM   498  C C   . PRO A 1 62  ? 39.663  38.730 39.674  1.00 19.76 ? 825  PRO A C   1 
ATOM   499  O O   . PRO A 1 62  ? 39.603  38.152 38.617  1.00 22.75 ? 825  PRO A O   1 
ATOM   500  C CB  . PRO A 1 62  ? 41.116  38.017 41.662  1.00 21.30 ? 825  PRO A CB  1 
ATOM   501  C CG  . PRO A 1 62  ? 42.118  38.769 42.488  1.00 24.94 ? 825  PRO A CG  1 
ATOM   502  C CD  . PRO A 1 62  ? 41.689  40.241 42.222  1.00 25.41 ? 825  PRO A CD  1 
ATOM   503  N N   . SER A 1 63  ? 38.629  39.397 40.170  1.00 19.76 ? 826  SER A N   1 
ATOM   504  C CA  . SER A 1 63  ? 37.292  39.228 39.590  1.00 18.69 ? 826  SER A CA  1 
ATOM   505  C C   . SER A 1 63  ? 37.074  39.978 38.254  1.00 19.41 ? 826  SER A C   1 
ATOM   506  O O   . SER A 1 63  ? 36.348  39.532 37.367  1.00 20.95 ? 826  SER A O   1 
ATOM   507  C CB  . SER A 1 63  ? 36.295  39.682 40.615  1.00 20.24 ? 826  SER A CB  1 
ATOM   508  O OG  . SER A 1 63  ? 35.035  39.607 40.021  1.00 25.00 ? 826  SER A OG  1 
ATOM   509  N N   . GLU A 1 64  ? 37.687  41.147 38.133  1.00 19.80 ? 827  GLU A N   1 
ATOM   510  C CA  . GLU A 1 64  ? 37.668  41.936 36.899  1.00 18.01 ? 827  GLU A CA  1 
ATOM   511  C C   . GLU A 1 64  ? 38.403  41.226 35.808  1.00 18.73 ? 827  GLU A C   1 
ATOM   512  O O   . GLU A 1 64  ? 37.912  41.200 34.727  1.00 16.29 ? 827  GLU A O   1 
ATOM   513  C CB  . GLU A 1 64  ? 38.277  43.336 37.119  1.00 18.27 ? 827  GLU A CB  1 
ATOM   514  C CG  . GLU A 1 64  ? 37.454  44.225 38.007  1.00 17.97 ? 827  GLU A CG  1 
ATOM   515  C CD  . GLU A 1 64  ? 38.187  45.360 38.634  1.00 12.79 ? 827  GLU A CD  1 
ATOM   516  O OE1 . GLU A 1 64  ? 39.479  45.394 38.738  1.00 26.89 ? 827  GLU A OE1 1 
ATOM   517  O OE2 . GLU A 1 64  ? 37.503  46.109 39.322  1.00 21.95 ? 827  GLU A OE2 1 
ATOM   518  N N   . LEU A 1 65  ? 39.666  40.779 36.057  1.00 20.81 ? 828  LEU A N   1 
ATOM   519  C CA  . LEU A 1 65  ? 40.334  39.853 35.169  1.00 22.15 ? 828  LEU A CA  1 
ATOM   520  C C   . LEU A 1 65  ? 39.452  38.710 34.621  1.00 23.12 ? 828  LEU A C   1 
ATOM   521  O O   . LEU A 1 65  ? 39.436  38.433 33.389  1.00 20.17 ? 828  LEU A O   1 
ATOM   522  C CB  . LEU A 1 65  ? 41.483  39.191 35.877  1.00 23.83 ? 828  LEU A CB  1 
ATOM   523  C CG  . LEU A 1 65  ? 42.685  40.087 36.016  1.00 22.30 ? 828  LEU A CG  1 
ATOM   524  C CD1 . LEU A 1 65  ? 43.710  39.416 36.866  1.00 28.31 ? 828  LEU A CD1 1 
ATOM   525  C CD2 . LEU A 1 65  ? 43.310  40.378 34.632  1.00 23.80 ? 828  LEU A CD2 1 
ATOM   526  N N   . ARG A 1 66  ? 38.803  38.016 35.541  1.00 22.08 ? 829  ARG A N   1 
ATOM   527  C CA  . ARG A 1 66  ? 37.921  36.915 35.205  1.00 22.49 ? 829  ARG A CA  1 
ATOM   528  C C   . ARG A 1 66  ? 36.747  37.342 34.406  1.00 22.08 ? 829  ARG A C   1 
ATOM   529  O O   . ARG A 1 66  ? 36.390  36.675 33.429  1.00 20.26 ? 829  ARG A O   1 
ATOM   530  C CB  . ARG A 1 66  ? 37.437  36.208 36.466  1.00 24.56 ? 829  ARG A CB  1 
ATOM   531  C CG  . ARG A 1 66  ? 36.458  35.128 36.229  1.00 27.80 ? 829  ARG A CG  1 
ATOM   532  C CD  . ARG A 1 66  ? 36.257  34.159 37.400  1.00 29.07 ? 829  ARG A CD  1 
ATOM   533  N NE  . ARG A 1 66  ? 36.315  34.747 38.740  1.00 32.45 ? 829  ARG A NE  1 
ATOM   534  C CZ  . ARG A 1 66  ? 35.361  35.443 39.308  1.00 34.37 ? 829  ARG A CZ  1 
ATOM   535  N NH1 . ARG A 1 66  ? 34.222  35.647 38.680  1.00 39.85 ? 829  ARG A NH1 1 
ATOM   536  N NH2 . ARG A 1 66  ? 35.526  35.918 40.523  1.00 34.63 ? 829  ARG A NH2 1 
ATOM   537  N N   . LYS A 1 67  ? 36.176  38.482 34.761  1.00 20.92 ? 830  LYS A N   1 
ATOM   538  C CA  . LYS A 1 67  ? 35.011  38.947 34.025  1.00 22.33 ? 830  LYS A CA  1 
ATOM   539  C C   . LYS A 1 67  ? 35.462  39.444 32.615  1.00 21.86 ? 830  LYS A C   1 
ATOM   540  O O   . LYS A 1 67  ? 34.695  39.343 31.696  1.00 15.11 ? 830  LYS A O   1 
ATOM   541  C CB  . LYS A 1 67  ? 34.313  40.069 34.768  1.00 24.55 ? 830  LYS A CB  1 
ATOM   542  C CG  . LYS A 1 67  ? 33.274  39.601 35.778  1.00 28.12 ? 830  LYS A CG  1 
ATOM   543  C CD  . LYS A 1 67  ? 31.946  39.192 35.035  1.00 28.65 ? 830  LYS A CD  1 
ATOM   544  C CE  . LYS A 1 67  ? 30.971  38.654 35.992  1.00 28.46 ? 830  LYS A CE  1 
ATOM   545  N NZ  . LYS A 1 67  ? 29.760  37.918 35.383  1.00 27.49 ? 830  LYS A NZ  1 
ATOM   546  N N   . ILE A 1 68  ? 36.721  39.899 32.434  1.00 19.79 ? 831  ILE A N   1 
ATOM   547  C CA  . ILE A 1 68  ? 37.094  40.452 31.091  1.00 21.09 ? 831  ILE A CA  1 
ATOM   548  C C   . ILE A 1 68  ? 37.617  39.341 30.118  1.00 21.17 ? 831  ILE A C   1 
ATOM   549  O O   . ILE A 1 68  ? 37.088  39.200 29.014  1.00 22.04 ? 831  ILE A O   1 
ATOM   550  C CB  . ILE A 1 68  ? 38.052  41.619 31.222  1.00 21.23 ? 831  ILE A CB  1 
ATOM   551  C CG1 . ILE A 1 68  ? 37.295  42.803 31.899  1.00 19.85 ? 831  ILE A CG1 1 
ATOM   552  C CG2 . ILE A 1 68  ? 38.575  42.025 29.856  1.00 21.24 ? 831  ILE A CG2 1 
ATOM   553  C CD1 . ILE A 1 68  ? 38.141  43.970 32.118  1.00 21.70 ? 831  ILE A CD1 1 
ATOM   554  N N   . PHE A 1 69  ? 38.497  38.499 30.639  1.00 18.17 ? 832  PHE A N   1 
ATOM   555  C CA  . PHE A 1 69  ? 39.263  37.495 29.892  1.00 20.45 ? 832  PHE A CA  1 
ATOM   556  C C   . PHE A 1 69  ? 38.916  36.041 30.111  1.00 20.20 ? 832  PHE A C   1 
ATOM   557  O O   . PHE A 1 69  ? 39.357  35.173 29.342  1.00 21.16 ? 832  PHE A O   1 
ATOM   558  C CB  . PHE A 1 69  ? 40.766  37.653 30.279  1.00 17.31 ? 832  PHE A CB  1 
ATOM   559  C CG  . PHE A 1 69  ? 41.337  38.980 29.911  1.00 22.56 ? 832  PHE A CG  1 
ATOM   560  C CD1 . PHE A 1 69  ? 41.490  39.334 28.548  1.00 20.98 ? 832  PHE A CD1 1 
ATOM   561  C CD2 . PHE A 1 69  ? 41.754  39.886 30.914  1.00 20.84 ? 832  PHE A CD2 1 
ATOM   562  C CE1 . PHE A 1 69  ? 42.000  40.613 28.192  1.00 23.60 ? 832  PHE A CE1 1 
ATOM   563  C CE2 . PHE A 1 69  ? 42.258  41.167 30.587  1.00 20.05 ? 832  PHE A CE2 1 
ATOM   564  C CZ  . PHE A 1 69  ? 42.426  41.524 29.225  1.00 19.14 ? 832  PHE A CZ  1 
ATOM   565  N N   . SER A 1 70  ? 38.212  35.751 31.209  1.00 20.20 ? 833  SER A N   1 
ATOM   566  C CA  . SER A 1 70  ? 37.719  34.408 31.536  1.00 15.82 ? 833  SER A CA  1 
ATOM   567  C C   . SER A 1 70  ? 38.735  33.360 31.211  1.00 15.15 ? 833  SER A C   1 
ATOM   568  O O   . SER A 1 70  ? 39.906  33.323 31.773  1.00 14.22 ? 833  SER A O   1 
ATOM   569  C CB  . SER A 1 70  ? 36.326  34.192 30.903  1.00 13.80 ? 833  SER A CB  1 
ATOM   570  O OG  . SER A 1 70  ? 36.364  34.198 29.440  1.00 21.37 ? 833  SER A OG  1 
ATOM   571  N N   . ASN A 1 71  ? 38.346  32.481 30.309  1.00 19.38 ? 834  ASN A N   1 
ATOM   572  C CA  . ASN A 1 71  ? 39.145  31.296 29.965  1.00 19.23 ? 834  ASN A CA  1 
ATOM   573  C C   . ASN A 1 71  ? 39.913  31.485 28.677  1.00 19.72 ? 834  ASN A C   1 
ATOM   574  O O   . ASN A 1 71  ? 40.148  30.535 27.999  1.00 19.07 ? 834  ASN A O   1 
ATOM   575  C CB  . ASN A 1 71  ? 38.288  30.046 29.887  1.00 20.77 ? 834  ASN A CB  1 
ATOM   576  C CG  . ASN A 1 71  ? 37.382  30.054 28.701  1.00 19.34 ? 834  ASN A CG  1 
ATOM   577  O OD1 . ASN A 1 71  ? 37.070  31.109 28.191  1.00 18.17 ? 834  ASN A OD1 1 
ATOM   578  N ND2 . ASN A 1 71  ? 37.070  28.878 28.165  1.00 19.83 ? 834  ASN A ND2 1 
ATOM   579  N N   . LEU A 1 72  ? 40.345  32.718 28.394  1.00 19.68 ? 835  LEU A N   1 
ATOM   580  C CA  . LEU A 1 72  ? 41.325  32.994 27.346  1.00 21.05 ? 835  LEU A CA  1 
ATOM   581  C C   . LEU A 1 72  ? 42.537  32.003 27.333  1.00 20.01 ? 835  LEU A C   1 
ATOM   582  O O   . LEU A 1 72  ? 42.920  31.492 26.282  1.00 15.55 ? 835  LEU A O   1 
ATOM   583  C CB  . LEU A 1 72  ? 41.947  34.425 27.456  1.00 20.11 ? 835  LEU A CB  1 
ATOM   584  C CG  . LEU A 1 72  ? 42.928  34.727 26.314  1.00 21.63 ? 835  LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 72  ? 42.238  34.608 24.919  1.00 22.14 ? 835  LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 72  ? 43.463  36.162 26.480  1.00 26.25 ? 835  LEU A CD2 1 
ATOM   587  N N   . GLU A 1 73  ? 43.074  31.721 28.484  1.00 20.85 ? 836  GLU A N   1 
ATOM   588  C CA  . GLU A 1 73  ? 44.235  30.794 28.612  1.00 24.57 ? 836  GLU A CA  1 
ATOM   589  C C   . GLU A 1 73  ? 43.890  29.395 27.962  1.00 25.78 ? 836  GLU A C   1 
ATOM   590  O O   . GLU A 1 73  ? 44.686  28.827 27.231  1.00 25.02 ? 836  GLU A O   1 
ATOM   591  C CB  . GLU A 1 73  ? 44.539  30.608 30.077  1.00 23.77 ? 836  GLU A CB  1 
ATOM   592  C CG  . GLU A 1 73  ? 45.832  29.906 30.494  1.00 30.04 ? 836  GLU A CG  1 
ATOM   593  C CD  . GLU A 1 73  ? 45.898  29.737 32.023  1.00 32.99 ? 836  GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 73  ? 46.109  28.618 32.545  1.00 39.71 ? 836  GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 73  ? 45.732  30.738 32.760  1.00 40.05 ? 836  GLU A OE2 1 
ATOM   596  N N   . ASP A 1 74  ? 42.672  28.899 28.178  1.00 23.64 ? 837  ASP A N   1 
ATOM   597  C CA  . ASP A 1 74  ? 42.332  27.567 27.655  1.00 22.75 ? 837  ASP A CA  1 
ATOM   598  C C   . ASP A 1 74  ? 41.956  27.616 26.195  1.00 19.75 ? 837  ASP A C   1 
ATOM   599  O O   . ASP A 1 74  ? 42.218  26.690 25.467  1.00 16.57 ? 837  ASP A O   1 
ATOM   600  C CB  . ASP A 1 74  ? 41.209  26.869 28.417  1.00 19.13 ? 837  ASP A CB  1 
ATOM   601  C CG  . ASP A 1 74  ? 41.336  26.946 29.895  1.00 18.53 ? 837  ASP A CG  1 
ATOM   602  O OD1 . ASP A 1 74  ? 42.478  26.841 30.568  1.00 19.30 ? 837  ASP A OD1 1 
ATOM   603  O OD2 . ASP A 1 74  ? 40.261  27.036 30.495  1.00 12.50 ? 837  ASP A OD2 1 
ATOM   604  N N   . ILE A 1 75  ? 41.333  28.666 25.722  1.00 22.77 ? 838  ILE A N   1 
ATOM   605  C CA  . ILE A 1 75  ? 41.019  28.667 24.278  1.00 23.99 ? 838  ILE A CA  1 
ATOM   606  C C   . ILE A 1 75  ? 42.331  28.862 23.532  1.00 21.82 ? 838  ILE A C   1 
ATOM   607  O O   . ILE A 1 75  ? 42.555  28.288 22.480  1.00 22.16 ? 838  ILE A O   1 
ATOM   608  C CB  . ILE A 1 75  ? 39.932  29.655 23.805  1.00 24.85 ? 838  ILE A CB  1 
ATOM   609  C CG1 . ILE A 1 75  ? 40.144  31.017 24.356  1.00 28.35 ? 838  ILE A CG1 1 
ATOM   610  C CG2 . ILE A 1 75  ? 38.444  29.163 24.167  1.00 24.65 ? 838  ILE A CG2 1 
ATOM   611  C CD1 . ILE A 1 75  ? 39.580  32.028 23.453  1.00 27.11 ? 838  ILE A CD1 1 
ATOM   612  N N   . LEU A 1 76  ? 43.217  29.643 24.101  1.00 21.79 ? 839  LEU A N   1 
ATOM   613  C CA  . LEU A 1 76  ? 44.564  29.717 23.584  1.00 21.89 ? 839  LEU A CA  1 
ATOM   614  C C   . LEU A 1 76  ? 45.264  28.369 23.454  1.00 20.75 ? 839  LEU A C   1 
ATOM   615  O O   . LEU A 1 76  ? 45.738  28.069 22.353  1.00 17.56 ? 839  LEU A O   1 
ATOM   616  C CB  . LEU A 1 76  ? 45.426  30.705 24.335  1.00 22.33 ? 839  LEU A CB  1 
ATOM   617  C CG  . LEU A 1 76  ? 46.892  30.848 23.937  1.00 22.79 ? 839  LEU A CG  1 
ATOM   618  C CD1 . LEU A 1 76  ? 47.081  31.346 22.503  1.00 21.55 ? 839  LEU A CD1 1 
ATOM   619  C CD2 . LEU A 1 76  ? 47.598  31.794 24.901  1.00 23.86 ? 839  LEU A CD2 1 
ATOM   620  N N   . GLN A 1 77  ? 45.427  27.625 24.561  1.00 21.48 ? 840  GLN A N   1 
ATOM   621  C CA  . GLN A 1 77  ? 46.145  26.318 24.558  1.00 21.60 ? 840  GLN A CA  1 
ATOM   622  C C   . GLN A 1 77  ? 45.412  25.320 23.621  1.00 19.29 ? 840  GLN A C   1 
ATOM   623  O O   . GLN A 1 77  ? 46.020  24.587 22.917  1.00 18.88 ? 840  GLN A O   1 
ATOM   624  C CB  . GLN A 1 77  ? 46.259  25.738 25.980  1.00 25.00 ? 840  GLN A CB  1 
ATOM   625  C CG  . GLN A 1 77  ? 47.610  25.970 26.748  1.00 31.39 ? 840  GLN A CG  1 
ATOM   626  C CD  . GLN A 1 77  ? 48.752  26.571 25.882  1.00 34.76 ? 840  GLN A CD  1 
ATOM   627  O OE1 . GLN A 1 77  ? 49.344  25.866 25.050  1.00 39.74 ? 840  GLN A OE1 1 
ATOM   628  N NE2 . GLN A 1 77  ? 49.032  27.863 26.067  1.00 32.18 ? 840  GLN A NE2 1 
ATOM   629  N N   . LEU A 1 78  ? 44.093  25.375 23.567  1.00 16.31 ? 841  LEU A N   1 
ATOM   630  C CA  . LEU A 1 78  ? 43.330  24.523 22.704  1.00 18.33 ? 841  LEU A CA  1 
ATOM   631  C C   . LEU A 1 78  ? 43.660  24.688 21.210  1.00 18.25 ? 841  LEU A C   1 
ATOM   632  O O   . LEU A 1 78  ? 43.989  23.702 20.506  1.00 16.89 ? 841  LEU A O   1 
ATOM   633  C CB  . LEU A 1 78  ? 41.845  24.749 22.957  1.00 20.17 ? 841  LEU A CB  1 
ATOM   634  C CG  . LEU A 1 78  ? 40.883  23.872 22.181  1.00 21.93 ? 841  LEU A CG  1 
ATOM   635  C CD1 . LEU A 1 78  ? 39.587  23.790 22.851  1.00 23.15 ? 841  LEU A CD1 1 
ATOM   636  C CD2 . LEU A 1 78  ? 40.712  24.345 20.760  1.00 24.88 ? 841  LEU A CD2 1 
ATOM   637  N N   . HIS A 1 79  ? 43.663  25.931 20.761  1.00 17.21 ? 842  HIS A N   1 
ATOM   638  C CA  . HIS A 1 79  ? 43.949  26.295 19.374  1.00 17.82 ? 842  HIS A CA  1 
ATOM   639  C C   . HIS A 1 79  ? 45.434  26.152 19.020  1.00 19.60 ? 842  HIS A C   1 
ATOM   640  O O   . HIS A 1 79  ? 45.750  25.707 17.889  1.00 21.73 ? 842  HIS A O   1 
ATOM   641  C CB  . HIS A 1 79  ? 43.398  27.671 19.072  1.00 19.37 ? 842  HIS A CB  1 
ATOM   642  C CG  . HIS A 1 79  ? 41.908  27.695 18.925  1.00 19.33 ? 842  HIS A CG  1 
ATOM   643  N ND1 . HIS A 1 79  ? 41.253  27.249 17.797  1.00 20.80 ? 842  HIS A ND1 1 
ATOM   644  C CD2 . HIS A 1 79  ? 40.940  28.136 19.764  1.00 22.42 ? 842  HIS A CD2 1 
ATOM   645  C CE1 . HIS A 1 79  ? 39.952  27.377 17.958  1.00 19.62 ? 842  HIS A CE1 1 
ATOM   646  N NE2 . HIS A 1 79  ? 39.734  27.937 19.138  1.00 18.97 ? 842  HIS A NE2 1 
ATOM   647  N N   . ILE A 1 80  ? 46.344  26.412 19.950  1.00 16.68 ? 843  ILE A N   1 
ATOM   648  C CA  . ILE A 1 80  ? 47.738  25.997 19.720  1.00 17.26 ? 843  ILE A CA  1 
ATOM   649  C C   . ILE A 1 80  ? 47.866  24.441 19.544  1.00 20.60 ? 843  ILE A C   1 
ATOM   650  O O   . ILE A 1 80  ? 48.546  23.986 18.619  1.00 19.85 ? 843  ILE A O   1 
ATOM   651  C CB  . ILE A 1 80  ? 48.642  26.454 20.846  1.00 16.14 ? 843  ILE A CB  1 
ATOM   652  C CG1 . ILE A 1 80  ? 48.864  27.957 20.797  1.00 19.61 ? 843  ILE A CG1 1 
ATOM   653  C CG2 . ILE A 1 80  ? 50.047  25.727 20.815  1.00 18.66 ? 843  ILE A CG2 1 
ATOM   654  C CD1 . ILE A 1 80  ? 49.421  28.529 22.089  1.00 21.46 ? 843  ILE A CD1 1 
ATOM   655  N N   . GLY A 1 81  ? 47.237  23.634 20.416  1.00 19.25 ? 844  GLY A N   1 
ATOM   656  C CA  . GLY A 1 81  ? 47.303  22.185 20.274  1.00 19.07 ? 844  GLY A CA  1 
ATOM   657  C C   . GLY A 1 81  ? 46.711  21.712 18.949  1.00 20.32 ? 844  GLY A C   1 
ATOM   658  O O   . GLY A 1 81  ? 47.231  20.850 18.315  1.00 19.31 ? 844  GLY A O   1 
ATOM   659  N N   . LEU A 1 82  ? 45.610  22.324 18.537  1.00 20.36 ? 845  LEU A N   1 
ATOM   660  C CA  . LEU A 1 82  ? 44.941  21.960 17.323  1.00 21.66 ? 845  LEU A CA  1 
ATOM   661  C C   . LEU A 1 82  ? 45.824  22.300 16.122  1.00 24.11 ? 845  LEU A C   1 
ATOM   662  O O   . LEU A 1 82  ? 45.968  21.489 15.182  1.00 22.74 ? 845  LEU A O   1 
ATOM   663  C CB  . LEU A 1 82  ? 43.601  22.717 17.237  1.00 19.89 ? 845  LEU A CB  1 
ATOM   664  C CG  . LEU A 1 82  ? 42.760  22.515 15.979  1.00 21.75 ? 845  LEU A CG  1 
ATOM   665  C CD1 . LEU A 1 82  ? 42.700  20.990 15.511  1.00 20.58 ? 845  LEU A CD1 1 
ATOM   666  C CD2 . LEU A 1 82  ? 41.361  23.094 16.237  1.00 21.04 ? 845  LEU A CD2 1 
ATOM   667  N N   . ASN A 1 83  ? 46.407  23.500 16.162  1.00 24.41 ? 846  ASN A N   1 
ATOM   668  C CA  . ASN A 1 83  ? 47.363  23.948 15.181  1.00 25.74 ? 846  ASN A CA  1 
ATOM   669  C C   . ASN A 1 83  ? 48.585  23.028 15.106  1.00 26.30 ? 846  ASN A C   1 
ATOM   670  O O   . ASN A 1 83  ? 49.072  22.781 14.046  1.00 24.84 ? 846  ASN A O   1 
ATOM   671  C CB  . ASN A 1 83  ? 47.818  25.368 15.493  1.00 27.07 ? 846  ASN A CB  1 
ATOM   672  C CG  . ASN A 1 83  ? 48.653  25.961 14.395  1.00 27.76 ? 846  ASN A CG  1 
ATOM   673  O OD1 . ASN A 1 83  ? 49.794  26.358 14.606  1.00 26.04 ? 846  ASN A OD1 1 
ATOM   674  N ND2 . ASN A 1 83  ? 48.098  25.997 13.207  1.00 21.73 ? 846  ASN A ND2 1 
ATOM   675  N N   . GLU A 1 84  ? 49.072  22.524 16.231  1.00 27.84 ? 847  GLU A N   1 
ATOM   676  C CA  . GLU A 1 84  ? 50.209  21.624 16.223  1.00 28.70 ? 847  GLU A CA  1 
ATOM   677  C C   . GLU A 1 84  ? 49.836  20.284 15.562  1.00 28.25 ? 847  GLU A C   1 
ATOM   678  O O   . GLU A 1 84  ? 50.656  19.695 14.867  1.00 26.85 ? 847  GLU A O   1 
ATOM   679  C CB  . GLU A 1 84  ? 50.734  21.394 17.642  1.00 31.21 ? 847  GLU A CB  1 
ATOM   680  C CG  . GLU A 1 84  ? 51.530  22.556 18.233  1.00 35.01 ? 847  GLU A CG  1 
ATOM   681  C CD  . GLU A 1 84  ? 52.641  23.060 17.302  1.00 38.80 ? 847  GLU A CD  1 
ATOM   682  O OE1 . GLU A 1 84  ? 53.330  22.218 16.672  1.00 40.56 ? 847  GLU A OE1 1 
ATOM   683  O OE2 . GLU A 1 84  ? 52.835  24.298 17.200  1.00 40.08 ? 847  GLU A OE2 1 
ATOM   684  N N   . GLN A 1 85  ? 48.595  19.831 15.744  1.00 27.94 ? 848  GLN A N   1 
ATOM   685  C CA  . GLN A 1 85  ? 48.156  18.564 15.185  1.00 27.82 ? 848  GLN A CA  1 
ATOM   686  C C   . GLN A 1 85  ? 47.999  18.733 13.670  1.00 27.25 ? 848  GLN A C   1 
ATOM   687  O O   . GLN A 1 85  ? 48.210  17.804 12.907  1.00 27.31 ? 848  GLN A O   1 
ATOM   688  C CB  . GLN A 1 85  ? 46.825  18.126 15.796  1.00 27.96 ? 848  GLN A CB  1 
ATOM   689  C CG  . GLN A 1 85  ? 46.894  17.765 17.272  1.00 29.40 ? 848  GLN A CG  1 
ATOM   690  C CD  . GLN A 1 85  ? 45.510  17.599 17.864  1.00 30.52 ? 848  GLN A CD  1 
ATOM   691  O OE1 . GLN A 1 85  ? 44.681  18.498 17.782  1.00 31.24 ? 848  GLN A OE1 1 
ATOM   692  N NE2 . GLN A 1 85  ? 45.259  16.446 18.460  1.00 29.64 ? 848  GLN A NE2 1 
ATOM   693  N N   . MET A 1 86  ? 47.638  19.925 13.242  1.00 25.89 ? 849  MET A N   1 
ATOM   694  C CA  . MET A 1 86  ? 47.510  20.204 11.817  1.00 25.87 ? 849  MET A CA  1 
ATOM   695  C C   . MET A 1 86  ? 48.903  20.220 11.200  1.00 27.03 ? 849  MET A C   1 
ATOM   696  O O   . MET A 1 86  ? 49.124  19.587 10.161  1.00 24.77 ? 849  MET A O   1 
ATOM   697  C CB  . MET A 1 86  ? 46.767  21.496 11.549  1.00 24.08 ? 849  MET A CB  1 
ATOM   698  C CG  . MET A 1 86  ? 45.262  21.392 11.686  1.00 23.16 ? 849  MET A CG  1 
ATOM   699  S SD  . MET A 1 86  ? 44.624  23.031 11.897  1.00 18.74 ? 849  MET A SD  1 
ATOM   700  C CE  . MET A 1 86  ? 42.820  22.842 11.859  1.00 18.42 ? 849  MET A CE  1 
ATOM   701  N N   . LYS A 1 87  ? 49.851  20.874 11.875  1.00 28.74 ? 850  LYS A N   1 
ATOM   702  C CA  . LYS A 1 87  ? 51.253  20.856 11.435  1.00 30.95 ? 850  LYS A CA  1 
ATOM   703  C C   . LYS A 1 87  ? 51.789  19.428 11.247  1.00 31.48 ? 850  LYS A C   1 
ATOM   704  O O   . LYS A 1 87  ? 52.503  19.162 10.282  1.00 32.41 ? 850  LYS A O   1 
ATOM   705  C CB  . LYS A 1 87  ? 52.174  21.647 12.381  1.00 31.86 ? 850  LYS A CB  1 
ATOM   706  C CG  . LYS A 1 87  ? 52.532  23.076 11.872  1.00 35.08 ? 850  LYS A CG  1 
ATOM   707  C CD  . LYS A 1 87  ? 52.458  24.182 12.971  1.00 37.07 ? 850  LYS A CD  1 
ATOM   708  C CE  . LYS A 1 87  ? 52.500  25.605 12.349  1.00 37.85 ? 850  LYS A CE  1 
ATOM   709  N NZ  . LYS A 1 87  ? 52.407  26.739 13.341  1.00 38.53 ? 850  LYS A NZ  1 
ATOM   710  N N   . ALA A 1 88  ? 51.433  18.533 12.171  1.00 31.80 ? 851  ALA A N   1 
ATOM   711  C CA  . ALA A 1 88  ? 51.933  17.166 12.203  1.00 31.52 ? 851  ALA A CA  1 
ATOM   712  C C   . ALA A 1 88  ? 51.329  16.353 11.087  1.00 31.95 ? 851  ALA A C   1 
ATOM   713  O O   . ALA A 1 88  ? 51.973  15.437 10.580  1.00 33.66 ? 851  ALA A O   1 
ATOM   714  C CB  . ALA A 1 88  ? 51.629  16.503 13.549  1.00 30.75 ? 851  ALA A CB  1 
ATOM   715  N N   . VAL A 1 89  ? 50.099  16.667 10.704  1.00 31.76 ? 852  VAL A N   1 
ATOM   716  C CA  . VAL A 1 89  ? 49.480  15.967 9.599   1.00 32.69 ? 852  VAL A CA  1 
ATOM   717  C C   . VAL A 1 89  ? 50.300  16.176 8.343   1.00 35.35 ? 852  VAL A C   1 
ATOM   718  O O   . VAL A 1 89  ? 50.423  15.256 7.555   1.00 35.12 ? 852  VAL A O   1 
ATOM   719  C CB  . VAL A 1 89  ? 47.998  16.354 9.368   1.00 31.19 ? 852  VAL A CB  1 
ATOM   720  C CG1 . VAL A 1 89  ? 47.509  15.875 8.017   1.00 31.17 ? 852  VAL A CG1 1 
ATOM   721  C CG2 . VAL A 1 89  ? 47.146  15.759 10.417  1.00 30.23 ? 852  VAL A CG2 1 
ATOM   722  N N   . ARG A 1 90  ? 50.850  17.381 8.162   1.00 38.73 ? 853  ARG A N   1 
ATOM   723  C CA  . ARG A 1 90  ? 51.691  17.716 6.998   1.00 40.85 ? 853  ARG A CA  1 
ATOM   724  C C   . ARG A 1 90  ? 53.062  17.071 7.028   1.00 40.78 ? 853  ARG A C   1 
ATOM   725  O O   . ARG A 1 90  ? 53.629  16.762 5.993   1.00 41.61 ? 853  ARG A O   1 
ATOM   726  C CB  . ARG A 1 90  ? 51.955  19.209 6.955   1.00 41.97 ? 853  ARG A CB  1 
ATOM   727  C CG  . ARG A 1 90  ? 50.786  20.049 6.637   1.00 45.29 ? 853  ARG A CG  1 
ATOM   728  C CD  . ARG A 1 90  ? 51.167  21.251 5.795   1.00 48.46 ? 853  ARG A CD  1 
ATOM   729  N NE  . ARG A 1 90  ? 49.981  22.001 5.413   1.00 49.95 ? 853  ARG A NE  1 
ATOM   730  C CZ  . ARG A 1 90  ? 49.758  23.270 5.716   1.00 52.22 ? 853  ARG A CZ  1 
ATOM   731  N NH1 . ARG A 1 90  ? 50.644  23.982 6.404   1.00 53.34 ? 853  ARG A NH1 1 
ATOM   732  N NH2 . ARG A 1 90  ? 48.631  23.836 5.325   1.00 52.92 ? 853  ARG A NH2 1 
ATOM   733  N N   . LYS A 1 91  ? 53.594  16.932 8.233   1.00 41.49 ? 854  LYS A N   1 
ATOM   734  C CA  . LYS A 1 91  ? 54.925  16.407 8.496   1.00 42.29 ? 854  LYS A CA  1 
ATOM   735  C C   . LYS A 1 91  ? 54.972  14.896 8.231   1.00 42.68 ? 854  LYS A C   1 
ATOM   736  O O   . LYS A 1 91  ? 56.032  14.280 8.328   1.00 42.88 ? 854  LYS A O   1 
ATOM   737  C CB  . LYS A 1 91  ? 55.250  16.733 9.969   1.00 43.20 ? 854  LYS A CB  1 
ATOM   738  C CG  . LYS A 1 91  ? 56.529  16.187 10.613  1.00 44.19 ? 854  LYS A CG  1 
ATOM   739  C CD  . LYS A 1 91  ? 56.442  16.308 12.160  1.00 44.77 ? 854  LYS A CD  1 
ATOM   740  C CE  . LYS A 1 91  ? 56.539  17.765 12.665  1.00 44.75 ? 854  LYS A CE  1 
ATOM   741  N NZ  . LYS A 1 91  ? 55.203  18.431 12.960  1.00 43.62 ? 854  LYS A NZ  1 
ATOM   742  N N   . ARG A 1 92  ? 53.823  14.299 7.907   1.00 43.09 ? 855  ARG A N   1 
ATOM   743  C CA  . ARG A 1 92  ? 53.724  12.849 7.690   1.00 43.71 ? 855  ARG A CA  1 
ATOM   744  C C   . ARG A 1 92  ? 54.427  12.371 6.415   1.00 44.85 ? 855  ARG A C   1 
ATOM   745  O O   . ARG A 1 92  ? 54.898  11.233 6.370   1.00 46.43 ? 855  ARG A O   1 
ATOM   746  C CB  . ARG A 1 92  ? 52.255  12.406 7.694   1.00 42.51 ? 855  ARG A CB  1 
ATOM   747  C CG  . ARG A 1 92  ? 51.614  12.545 9.045   1.00 41.10 ? 855  ARG A CG  1 
ATOM   748  C CD  . ARG A 1 92  ? 50.470  11.614 9.318   1.00 40.41 ? 855  ARG A CD  1 
ATOM   749  N NE  . ARG A 1 92  ? 49.261  12.003 8.598   1.00 38.97 ? 855  ARG A NE  1 
ATOM   750  C CZ  . ARG A 1 92  ? 48.034  12.079 9.119   1.00 38.42 ? 855  ARG A CZ  1 
ATOM   751  N NH1 . ARG A 1 92  ? 47.792  11.819 10.396  1.00 38.67 ? 855  ARG A NH1 1 
ATOM   752  N NH2 . ARG A 1 92  ? 47.026  12.416 8.339   1.00 38.21 ? 855  ARG A NH2 1 
ATOM   753  N N   . ASN A 1 93  ? 54.512  13.235 5.402   1.00 46.25 ? 856  ASN A N   1 
ATOM   754  C CA  . ASN A 1 93  ? 55.314  12.960 4.197   1.00 47.56 ? 856  ASN A CA  1 
ATOM   755  C C   . ASN A 1 93  ? 56.006  14.211 3.617   1.00 48.08 ? 856  ASN A C   1 
ATOM   756  O O   . ASN A 1 93  ? 55.464  15.326 3.681   1.00 48.38 ? 856  ASN A O   1 
ATOM   757  C CB  . ASN A 1 93  ? 54.457  12.267 3.125   1.00 48.05 ? 856  ASN A CB  1 
ATOM   758  C CG  . ASN A 1 93  ? 53.258  13.103 2.694   1.00 48.77 ? 856  ASN A CG  1 
ATOM   759  O OD1 . ASN A 1 93  ? 53.179  14.294 2.986   1.00 51.16 ? 856  ASN A OD1 1 
ATOM   760  N ND2 . ASN A 1 93  ? 52.325  12.478 1.982   1.00 49.22 ? 856  ASN A ND2 1 
ATOM   761  N N   . GLU A 1 94  ? 57.197  14.022 3.049   1.00 48.43 ? 857  GLU A N   1 
ATOM   762  C CA  . GLU A 1 94  ? 57.972  15.139 2.500   1.00 49.06 ? 857  GLU A CA  1 
ATOM   763  C C   . GLU A 1 94  ? 57.313  15.788 1.267   1.00 48.79 ? 857  GLU A C   1 
ATOM   764  O O   . GLU A 1 94  ? 57.663  16.927 0.911   1.00 49.48 ? 857  GLU A O   1 
ATOM   765  C CB  . GLU A 1 94  ? 59.418  14.710 2.156   1.00 49.93 ? 857  GLU A CB  1 
ATOM   766  C CG  . GLU A 1 94  ? 60.188  15.703 1.267   1.00 50.71 ? 857  GLU A CG  1 
ATOM   767  C CD  . GLU A 1 94  ? 61.700  15.535 1.306   1.00 51.27 ? 857  GLU A CD  1 
ATOM   768  O OE1 . GLU A 1 94  ? 62.214  14.578 0.682   1.00 50.85 ? 857  GLU A OE1 1 
ATOM   769  O OE2 . GLU A 1 94  ? 62.373  16.384 1.944   1.00 51.51 ? 857  GLU A OE2 1 
ATOM   770  N N   . THR A 1 95  ? 56.380  15.086 0.619   1.00 47.62 ? 858  THR A N   1 
ATOM   771  C CA  . THR A 1 95  ? 55.680  15.641 -0.559  1.00 46.87 ? 858  THR A CA  1 
ATOM   772  C C   . THR A 1 95  ? 54.926  16.964 -0.298  1.00 45.71 ? 858  THR A C   1 
ATOM   773  O O   . THR A 1 95  ? 54.662  17.716 -1.245  1.00 45.69 ? 858  THR A O   1 
ATOM   774  C CB  . THR A 1 95  ? 54.686  14.608 -1.166  1.00 47.27 ? 858  THR A CB  1 
ATOM   775  O OG1 . THR A 1 95  ? 54.102  13.801 -0.128  1.00 48.73 ? 858  THR A OG1 1 
ATOM   776  C CG2 . THR A 1 95  ? 55.413  13.606 -2.065  1.00 47.19 ? 858  THR A CG2 1 
ATOM   777  N N   . SER A 1 96  ? 54.586  17.231 0.969   1.00 42.98 ? 859  SER A N   1 
ATOM   778  C CA  . SER A 1 96  ? 53.705  18.338 1.367   1.00 41.71 ? 859  SER A CA  1 
ATOM   779  C C   . SER A 1 96  ? 52.284  18.137 0.848   1.00 39.06 ? 859  SER A C   1 
ATOM   780  O O   . SER A 1 96  ? 51.390  18.943 1.120   1.00 38.40 ? 859  SER A O   1 
ATOM   781  C CB  . SER A 1 96  ? 54.254  19.698 0.943   1.00 42.05 ? 859  SER A CB  1 
ATOM   782  O OG  . SER A 1 96  ? 55.665  19.703 0.988   1.00 43.99 ? 859  SER A OG  1 
ATOM   783  N N   . VAL A 1 97  ? 52.085  17.036 0.129   1.00 36.26 ? 860  VAL A N   1 
ATOM   784  C CA  . VAL A 1 97  ? 50.768  16.582 -0.265  1.00 34.29 ? 860  VAL A CA  1 
ATOM   785  C C   . VAL A 1 97  ? 50.206  15.800 0.907   1.00 33.35 ? 860  VAL A C   1 
ATOM   786  O O   . VAL A 1 97  ? 50.852  14.901 1.431   1.00 32.78 ? 860  VAL A O   1 
ATOM   787  C CB  . VAL A 1 97  ? 50.834  15.690 -1.496  1.00 33.00 ? 860  VAL A CB  1 
ATOM   788  C CG1 . VAL A 1 97  ? 49.454  15.149 -1.863  1.00 32.04 ? 860  VAL A CG1 1 
ATOM   789  C CG2 . VAL A 1 97  ? 51.433  16.458 -2.628  1.00 33.55 ? 860  VAL A CG2 1 
ATOM   790  N N   . ILE A 1 98  ? 49.001  16.170 1.313   1.00 32.66 ? 861  ILE A N   1 
ATOM   791  C CA  . ILE A 1 98  ? 48.334  15.553 2.435   1.00 32.71 ? 861  ILE A CA  1 
ATOM   792  C C   . ILE A 1 98  ? 47.477  14.463 1.848   1.00 31.86 ? 861  ILE A C   1 
ATOM   793  O O   . ILE A 1 98  ? 46.827  14.680 0.826   1.00 29.76 ? 861  ILE A O   1 
ATOM   794  C CB  . ILE A 1 98  ? 47.481  16.599 3.168   1.00 32.18 ? 861  ILE A CB  1 
ATOM   795  C CG1 . ILE A 1 98  ? 48.391  17.552 3.949   1.00 34.74 ? 861  ILE A CG1 1 
ATOM   796  C CG2 . ILE A 1 98  ? 46.488  15.959 4.088   1.00 32.05 ? 861  ILE A CG2 1 
ATOM   797  C CD1 . ILE A 1 98  ? 48.427  18.933 3.364   1.00 35.67 ? 861  ILE A CD1 1 
ATOM   798  N N   . ASP A 1 99  ? 47.452  13.312 2.506   1.00 31.19 ? 862  ASP A N   1 
ATOM   799  C CA  . ASP A 1 99  ? 46.612  12.217 2.044   1.00 32.59 ? 862  ASP A CA  1 
ATOM   800  C C   . ASP A 1 99  ? 45.290  12.275 2.791   1.00 30.73 ? 862  ASP A C   1 
ATOM   801  O O   . ASP A 1 99  ? 44.614  13.303 2.721   1.00 30.11 ? 862  ASP A O   1 
ATOM   802  C CB  . ASP A 1 99  ? 47.342  10.866 2.157   1.00 33.75 ? 862  ASP A CB  1 
ATOM   803  C CG  . ASP A 1 99  ? 48.514  10.753 1.179   1.00 37.53 ? 862  ASP A CG  1 
ATOM   804  O OD1 . ASP A 1 99  ? 48.347  11.102 -0.031  1.00 39.58 ? 862  ASP A OD1 1 
ATOM   805  O OD2 . ASP A 1 99  ? 49.643  10.332 1.537   1.00 40.34 ? 862  ASP A OD2 1 
ATOM   806  N N   . GLN A 1 100 ? 44.962  11.225 3.543   1.00 28.32 ? 863  GLN A N   1 
ATOM   807  C CA  . GLN A 1 100 ? 43.665  11.061 4.182   1.00 28.45 ? 863  GLN A CA  1 
ATOM   808  C C   . GLN A 1 100 ? 43.629  11.956 5.399   1.00 26.12 ? 863  GLN A C   1 
ATOM   809  O O   . GLN A 1 100 ? 44.640  12.085 6.065   1.00 25.71 ? 863  GLN A O   1 
ATOM   810  C CB  . GLN A 1 100 ? 43.465  9.617  4.665   1.00 30.57 ? 863  GLN A CB  1 
ATOM   811  C CG  . GLN A 1 100 ? 43.876  8.526  3.683   1.00 34.29 ? 863  GLN A CG  1 
ATOM   812  C CD  . GLN A 1 100 ? 43.119  8.647  2.368   1.00 38.31 ? 863  GLN A CD  1 
ATOM   813  O OE1 . GLN A 1 100 ? 41.893  8.753  2.376   1.00 42.30 ? 863  GLN A OE1 1 
ATOM   814  N NE2 . GLN A 1 100 ? 43.837  8.667  1.251   1.00 40.30 ? 863  GLN A NE2 1 
ATOM   815  N N   . ILE A 1 101 ? 42.474  12.548 5.682   1.00 23.84 ? 864  ILE A N   1 
ATOM   816  C CA  . ILE A 1 101 ? 42.320  13.487 6.805   1.00 25.01 ? 864  ILE A CA  1 
ATOM   817  C C   . ILE A 1 101 ? 41.024  13.338 7.622   1.00 24.44 ? 864  ILE A C   1 
ATOM   818  O O   . ILE A 1 101 ? 40.923  13.876 8.711   1.00 23.35 ? 864  ILE A O   1 
ATOM   819  C CB  . ILE A 1 101 ? 42.471  14.936 6.314   1.00 24.37 ? 864  ILE A CB  1 
ATOM   820  C CG1 . ILE A 1 101 ? 43.139  15.777 7.378   1.00 25.55 ? 864  ILE A CG1 1 
ATOM   821  C CG2 . ILE A 1 101 ? 41.106  15.553 5.912   1.00 25.26 ? 864  ILE A CG2 1 
ATOM   822  C CD1 . ILE A 1 101 ? 42.894  17.216 7.225   1.00 26.51 ? 864  ILE A CD1 1 
ATOM   823  N N   . GLY A 1 102 ? 40.048  12.596 7.110   1.00 25.87 ? 865  GLY A N   1 
ATOM   824  C CA  . GLY A 1 102 ? 38.775  12.430 7.785   1.00 26.45 ? 865  GLY A CA  1 
ATOM   825  C C   . GLY A 1 102 ? 38.970  12.041 9.237   1.00 27.61 ? 865  GLY A C   1 
ATOM   826  O O   . GLY A 1 102 ? 38.325  12.592 10.124  1.00 26.99 ? 865  GLY A O   1 
ATOM   827  N N   . GLU A 1 103 ? 39.884  11.109 9.483   1.00 27.46 ? 866  GLU A N   1 
ATOM   828  C CA  . GLU A 1 103 ? 40.046  10.544 10.802  1.00 27.69 ? 866  GLU A CA  1 
ATOM   829  C C   . GLU A 1 103 ? 40.605  11.589 11.760  1.00 26.24 ? 866  GLU A C   1 
ATOM   830  O O   . GLU A 1 103 ? 40.226  11.630 12.925  1.00 22.55 ? 866  GLU A O   1 
ATOM   831  C CB  . GLU A 1 103 ? 40.949  9.295  10.752  1.00 29.99 ? 866  GLU A CB  1 
ATOM   832  C CG  . GLU A 1 103 ? 40.738  8.333  11.911  1.00 33.64 ? 866  GLU A CG  1 
ATOM   833  C CD  . GLU A 1 103 ? 39.333  7.734  11.954  1.00 36.51 ? 866  GLU A CD  1 
ATOM   834  O OE1 . GLU A 1 103 ? 38.927  7.071  10.961  1.00 39.94 ? 866  GLU A OE1 1 
ATOM   835  O OE2 . GLU A 1 103 ? 38.639  7.913  12.981  1.00 38.64 ? 866  GLU A OE2 1 
ATOM   836  N N   . ASP A 1 104 ? 41.490  12.439 11.249  1.00 25.02 ? 867  ASP A N   1 
ATOM   837  C CA  . ASP A 1 104 ? 42.042  13.532 12.044  1.00 25.57 ? 867  ASP A CA  1 
ATOM   838  C C   . ASP A 1 104 ? 40.939  14.529 12.401  1.00 23.37 ? 867  ASP A C   1 
ATOM   839  O O   . ASP A 1 104 ? 40.814  14.926 13.520  1.00 21.78 ? 867  ASP A O   1 
ATOM   840  C CB  . ASP A 1 104 ? 43.174  14.230 11.307  1.00 24.60 ? 867  ASP A CB  1 
ATOM   841  C CG  . ASP A 1 104 ? 44.213  13.274 10.843  1.00 25.78 ? 867  ASP A CG  1 
ATOM   842  O OD1 . ASP A 1 104 ? 44.779  12.556 11.691  1.00 26.07 ? 867  ASP A OD1 1 
ATOM   843  O OD2 . ASP A 1 104 ? 44.498  13.149 9.636   1.00 27.51 ? 867  ASP A OD2 1 
ATOM   844  N N   . LEU A 1 105 ? 40.115  14.866 11.429  1.00 22.32 ? 868  LEU A N   1 
ATOM   845  C CA  . LEU A 1 105 ? 38.985  15.749 11.650  1.00 23.68 ? 868  LEU A CA  1 
ATOM   846  C C   . LEU A 1 105 ? 38.023  15.193 12.677  1.00 24.00 ? 868  LEU A C   1 
ATOM   847  O O   . LEU A 1 105 ? 37.452  15.940 13.469  1.00 25.52 ? 868  LEU A O   1 
ATOM   848  C CB  . LEU A 1 105 ? 38.259  15.997 10.339  1.00 23.63 ? 868  LEU A CB  1 
ATOM   849  C CG  . LEU A 1 105 ? 39.070  16.709 9.257   1.00 21.39 ? 868  LEU A CG  1 
ATOM   850  C CD1 . LEU A 1 105 ? 38.216  16.772 8.046   1.00 22.95 ? 868  LEU A CD1 1 
ATOM   851  C CD2 . LEU A 1 105 ? 39.474  18.098 9.667   1.00 22.67 ? 868  LEU A CD2 1 
ATOM   852  N N   . LEU A 1 106 ? 37.876  13.880 12.689  1.00 23.31 ? 869  LEU A N   1 
ATOM   853  C CA  . LEU A 1 106 ? 37.062  13.216 13.684  1.00 23.12 ? 869  LEU A CA  1 
ATOM   854  C C   . LEU A 1 106 ? 37.689  13.235 15.087  1.00 21.61 ? 869  LEU A C   1 
ATOM   855  O O   . LEU A 1 106 ? 36.975  13.354 16.068  1.00 21.25 ? 869  LEU A O   1 
ATOM   856  C CB  . LEU A 1 106 ? 36.734  11.775 13.244  1.00 23.45 ? 869  LEU A CB  1 
ATOM   857  C CG  . LEU A 1 106 ? 35.613  11.704 12.199  1.00 23.76 ? 869  LEU A CG  1 
ATOM   858  C CD1 . LEU A 1 106 ? 35.252  10.221 11.829  1.00 21.96 ? 869  LEU A CD1 1 
ATOM   859  C CD2 . LEU A 1 106 ? 34.354  12.473 12.637  1.00 22.34 ? 869  LEU A CD2 1 
ATOM   860  N N   . THR A 1 107 ? 39.006  13.119 15.176  1.00 21.16 ? 870  THR A N   1 
ATOM   861  C CA  . THR A 1 107 ? 39.731  13.321 16.439  1.00 21.91 ? 870  THR A CA  1 
ATOM   862  C C   . THR A 1 107 ? 39.642  14.766 16.985  1.00 21.52 ? 870  THR A C   1 
ATOM   863  O O   . THR A 1 107 ? 39.549  14.974 18.216  1.00 22.28 ? 870  THR A O   1 
ATOM   864  C CB  . THR A 1 107 ? 41.213  12.902 16.235  1.00 22.15 ? 870  THR A CB  1 
ATOM   865  O OG1 . THR A 1 107 ? 41.258  11.506 15.920  1.00 23.09 ? 870  THR A OG1 1 
ATOM   866  C CG2 . THR A 1 107 ? 41.992  12.974 17.529  1.00 23.69 ? 870  THR A CG2 1 
ATOM   867  N N   . TRP A 1 108 ? 39.675  15.757 16.079  1.00 20.15 ? 871  TRP A N   1 
ATOM   868  C CA  . TRP A 1 108 ? 39.682  17.156 16.444  1.00 19.72 ? 871  TRP A CA  1 
ATOM   869  C C   . TRP A 1 108 ? 38.296  17.643 16.873  1.00 20.20 ? 871  TRP A C   1 
ATOM   870  O O   . TRP A 1 108 ? 38.179  18.429 17.823  1.00 20.89 ? 871  TRP A O   1 
ATOM   871  C CB  . TRP A 1 108 ? 40.203  18.030 15.287  1.00 19.60 ? 871  TRP A CB  1 
ATOM   872  C CG  . TRP A 1 108 ? 41.562  17.678 14.866  1.00 20.94 ? 871  TRP A CG  1 
ATOM   873  C CD1 . TRP A 1 108 ? 42.489  17.030 15.610  1.00 21.16 ? 871  TRP A CD1 1 
ATOM   874  C CD2 . TRP A 1 108 ? 42.184  17.945 13.597  1.00 20.13 ? 871  TRP A CD2 1 
ATOM   875  N NE1 . TRP A 1 108 ? 43.642  16.855 14.886  1.00 19.40 ? 871  TRP A NE1 1 
ATOM   876  C CE2 . TRP A 1 108 ? 43.490  17.421 13.655  1.00 21.80 ? 871  TRP A CE2 1 
ATOM   877  C CE3 . TRP A 1 108 ? 41.778  18.583 12.428  1.00 20.31 ? 871  TRP A CE3 1 
ATOM   878  C CZ2 . TRP A 1 108 ? 44.390  17.497 12.581  1.00 22.73 ? 871  TRP A CZ2 1 
ATOM   879  C CZ3 . TRP A 1 108 ? 42.668  18.656 11.359  1.00 22.90 ? 871  TRP A CZ3 1 
ATOM   880  C CH2 . TRP A 1 108 ? 43.963  18.116 11.448  1.00 21.29 ? 871  TRP A CH2 1 
ATOM   881  N N   . PHE A 1 109 ? 37.260  17.127 16.212  1.00 20.57 ? 872  PHE A N   1 
ATOM   882  C CA  . PHE A 1 109 ? 35.925  17.713 16.271  1.00 20.85 ? 872  PHE A CA  1 
ATOM   883  C C   . PHE A 1 109 ? 34.796  16.776 16.662  1.00 20.10 ? 872  PHE A C   1 
ATOM   884  O O   . PHE A 1 109 ? 33.616  17.151 16.548  1.00 20.30 ? 872  PHE A O   1 
ATOM   885  C CB  . PHE A 1 109 ? 35.597  18.350 14.896  1.00 19.81 ? 872  PHE A CB  1 
ATOM   886  C CG  . PHE A 1 109 ? 36.541  19.445 14.500  1.00 22.56 ? 872  PHE A CG  1 
ATOM   887  C CD1 . PHE A 1 109 ? 36.736  20.542 15.333  1.00 23.36 ? 872  PHE A CD1 1 
ATOM   888  C CD2 . PHE A 1 109 ? 37.231  19.396 13.284  1.00 23.93 ? 872  PHE A CD2 1 
ATOM   889  C CE1 . PHE A 1 109 ? 37.600  21.544 14.978  1.00 23.39 ? 872  PHE A CE1 1 
ATOM   890  C CE2 . PHE A 1 109 ? 38.093  20.383 12.925  1.00 24.99 ? 872  PHE A CE2 1 
ATOM   891  C CZ  . PHE A 1 109 ? 38.278  21.483 13.764  1.00 24.86 ? 872  PHE A CZ  1 
ATOM   892  N N   . SER A 1 110 ? 35.129  15.567 17.116  1.00 20.40 ? 873  SER A N   1 
ATOM   893  C CA  . SER A 1 110 ? 34.150  14.661 17.734  1.00 19.39 ? 873  SER A CA  1 
ATOM   894  C C   . SER A 1 110 ? 34.724  14.029 19.002  1.00 18.32 ? 873  SER A C   1 
ATOM   895  O O   . SER A 1 110 ? 35.918  14.143 19.296  1.00 18.33 ? 873  SER A O   1 
ATOM   896  C CB  . SER A 1 110 ? 33.728  13.554 16.744  1.00 20.78 ? 873  SER A CB  1 
ATOM   897  O OG  . SER A 1 110 ? 34.844  12.760 16.420  1.00 20.09 ? 873  SER A OG  1 
ATOM   898  N N   . GLY A 1 111 ? 33.896  13.313 19.730  1.00 17.05 ? 874  GLY A N   1 
ATOM   899  C CA  . GLY A 1 111 ? 34.372  12.694 20.956  1.00 18.63 ? 874  GLY A CA  1 
ATOM   900  C C   . GLY A 1 111 ? 34.974  13.723 21.906  1.00 18.92 ? 874  GLY A C   1 
ATOM   901  O O   . GLY A 1 111 ? 34.430  14.826 22.034  1.00 18.24 ? 874  GLY A O   1 
ATOM   902  N N   . PRO A 1 112 ? 36.081  13.376 22.575  1.00 19.32 ? 875  PRO A N   1 
ATOM   903  C CA  . PRO A 1 112 ? 36.717  14.295 23.529  1.00 18.65 ? 875  PRO A CA  1 
ATOM   904  C C   . PRO A 1 112 ? 37.155  15.603 22.920  1.00 16.39 ? 875  PRO A C   1 
ATOM   905  O O   . PRO A 1 112 ? 37.163  16.588 23.639  1.00 15.24 ? 875  PRO A O   1 
ATOM   906  C CB  . PRO A 1 112 ? 37.917  13.503 24.043  1.00 19.03 ? 875  PRO A CB  1 
ATOM   907  C CG  . PRO A 1 112 ? 37.459  12.066 23.910  1.00 20.35 ? 875  PRO A CG  1 
ATOM   908  C CD  . PRO A 1 112 ? 36.761  12.059 22.557  1.00 19.63 ? 875  PRO A CD  1 
ATOM   909  N N   . GLY A 1 113 ? 37.485  15.617 21.632  1.00 15.45 ? 876  GLY A N   1 
ATOM   910  C CA  . GLY A 1 113 ? 37.860  16.822 20.929  1.00 13.97 ? 876  GLY A CA  1 
ATOM   911  C C   . GLY A 1 113 ? 36.699  17.782 20.804  1.00 14.44 ? 876  GLY A C   1 
ATOM   912  O O   . GLY A 1 113 ? 36.874  18.965 21.084  1.00 17.00 ? 876  GLY A O   1 
ATOM   913  N N   . GLU A 1 114 ? 35.522  17.275 20.430  1.00 14.33 ? 877  GLU A N   1 
ATOM   914  C CA  . GLU A 1 114 ? 34.272  18.046 20.467  1.00 14.12 ? 877  GLU A CA  1 
ATOM   915  C C   . GLU A 1 114 ? 33.943  18.590 21.868  1.00 16.54 ? 877  GLU A C   1 
ATOM   916  O O   . GLU A 1 114 ? 33.660  19.780 22.021  1.00 17.63 ? 877  GLU A O   1 
ATOM   917  C CB  . GLU A 1 114 ? 33.105  17.216 19.931  1.00 15.21 ? 877  GLU A CB  1 
ATOM   918  C CG  . GLU A 1 114 ? 31.768  17.862 20.210  1.00 19.28 ? 877  GLU A CG  1 
ATOM   919  C CD  . GLU A 1 114 ? 30.611  17.186 19.515  1.00 20.75 ? 877  GLU A CD  1 
ATOM   920  O OE1 . GLU A 1 114 ? 30.781  16.088 19.031  1.00 22.96 ? 877  GLU A OE1 1 
ATOM   921  O OE2 . GLU A 1 114 ? 29.518  17.771 19.460  1.00 25.05 ? 877  GLU A OE2 1 
ATOM   922  N N   . GLU A 1 115 ? 33.999  17.748 22.906  1.00 16.69 ? 878  GLU A N   1 
ATOM   923  C CA  . GLU A 1 115 ? 33.649  18.202 24.267  1.00 17.39 ? 878  GLU A CA  1 
ATOM   924  C C   . GLU A 1 115 ? 34.575  19.305 24.755  1.00 17.00 ? 878  GLU A C   1 
ATOM   925  O O   . GLU A 1 115 ? 34.140  20.252 25.368  1.00 18.46 ? 878  GLU A O   1 
ATOM   926  C CB  . GLU A 1 115 ? 33.677  17.043 25.282  1.00 17.38 ? 878  GLU A CB  1 
ATOM   927  C CG  . GLU A 1 115 ? 32.805  15.855 24.896  1.00 18.29 ? 878  GLU A CG  1 
ATOM   928  C CD  . GLU A 1 115 ? 31.334  16.090 25.190  1.00 20.96 ? 878  GLU A CD  1 
ATOM   929  O OE1 . GLU A 1 115 ? 30.993  17.055 25.917  1.00 21.08 ? 878  GLU A OE1 1 
ATOM   930  O OE2 . GLU A 1 115 ? 30.512  15.293 24.708  1.00 23.77 ? 878  GLU A OE2 1 
ATOM   931  N N   . LYS A 1 116 ? 35.860  19.160 24.523  1.00 17.86 ? 879  LYS A N   1 
ATOM   932  C CA  . LYS A 1 116 ? 36.794  20.142 24.964  1.00 20.03 ? 879  LYS A CA  1 
ATOM   933  C C   . LYS A 1 116 ? 36.543  21.499 24.228  1.00 18.55 ? 879  LYS A C   1 
ATOM   934  O O   . LYS A 1 116 ? 36.485  22.496 24.868  1.00 16.07 ? 879  LYS A O   1 
ATOM   935  C CB  . LYS A 1 116 ? 38.214  19.641 24.768  1.00 22.17 ? 879  LYS A CB  1 
ATOM   936  C CG  . LYS A 1 116 ? 39.252  20.691 25.110  1.00 25.93 ? 879  LYS A CG  1 
ATOM   937  C CD  . LYS A 1 116 ? 40.676  20.083 25.169  1.00 30.90 ? 879  LYS A CD  1 
ATOM   938  C CE  . LYS A 1 116 ? 41.691  21.021 25.863  1.00 29.90 ? 879  LYS A CE  1 
ATOM   939  N NZ  . LYS A 1 116 ? 41.938  20.624 27.336  1.00 34.64 ? 879  LYS A NZ  1 
ATOM   940  N N   . LEU A 1 117 ? 36.355  21.495 22.911  1.00 17.88 ? 880  LEU A N   1 
ATOM   941  C CA  . LEU A 1 117 ? 36.174  22.713 22.153  1.00 17.98 ? 880  LEU A CA  1 
ATOM   942  C C   . LEU A 1 117 ? 34.870  23.347 22.478  1.00 16.29 ? 880  LEU A C   1 
ATOM   943  O O   . LEU A 1 117 ? 34.867  24.516 22.743  1.00 16.75 ? 880  LEU A O   1 
ATOM   944  C CB  . LEU A 1 117 ? 36.299  22.478 20.622  1.00 17.12 ? 880  LEU A CB  1 
ATOM   945  C CG  . LEU A 1 117 ? 36.022  23.596 19.640  1.00 17.15 ? 880  LEU A CG  1 
ATOM   946  C CD1 . LEU A 1 117 ? 36.853  24.778 20.012  1.00 19.85 ? 880  LEU A CD1 1 
ATOM   947  C CD2 . LEU A 1 117 ? 36.300  23.168 18.163  1.00 19.61 ? 880  LEU A CD2 1 
ATOM   948  N N   . LYS A 1 118 ? 33.774  22.588 22.494  1.00 16.93 ? 881  LYS A N   1 
ATOM   949  C CA  . LYS A 1 118 ? 32.476  23.193 22.731  1.00 17.30 ? 881  LYS A CA  1 
ATOM   950  C C   . LYS A 1 118 ? 32.404  23.784 24.144  1.00 17.73 ? 881  LYS A C   1 
ATOM   951  O O   . LYS A 1 118 ? 31.989  24.901 24.292  1.00 15.46 ? 881  LYS A O   1 
ATOM   952  C CB  . LYS A 1 118 ? 31.306  22.249 22.402  1.00 17.89 ? 881  LYS A CB  1 
ATOM   953  C CG  . LYS A 1 118 ? 30.683  21.430 23.510  1.00 20.59 ? 881  LYS A CG  1 
ATOM   954  C CD  . LYS A 1 118 ? 29.861  20.263 22.901  1.00 24.44 ? 881  LYS A CD  1 
ATOM   955  C CE  . LYS A 1 118 ? 28.708  19.758 23.781  1.00 24.82 ? 881  LYS A CE  1 
ATOM   956  N NZ  . LYS A 1 118 ? 27.885  18.712 23.088  1.00 28.69 ? 881  LYS A NZ  1 
ATOM   957  N N   . HIS A 1 119 ? 32.903  23.092 25.170  1.00 18.33 ? 882  HIS A N   1 
ATOM   958  C CA  . HIS A 1 119 ? 32.884  23.705 26.523  1.00 18.20 ? 882  HIS A CA  1 
ATOM   959  C C   . HIS A 1 119 ? 33.782  24.889 26.703  1.00 17.42 ? 882  HIS A C   1 
ATOM   960  O O   . HIS A 1 119 ? 33.442  25.836 27.375  1.00 17.47 ? 882  HIS A O   1 
ATOM   961  C CB  . HIS A 1 119 ? 33.140  22.685 27.607  1.00 15.06 ? 882  HIS A CB  1 
ATOM   962  C CG  . HIS A 1 119 ? 31.983  21.770 27.811  1.00 13.52 ? 882  HIS A CG  1 
ATOM   963  N ND1 . HIS A 1 119 ? 31.135  21.877 28.872  1.00 14.96 ? 882  HIS A ND1 1 
ATOM   964  C CD2 . HIS A 1 119 ? 31.566  20.698 27.111  1.00 12.07 ? 882  HIS A CD2 1 
ATOM   965  C CE1 . HIS A 1 119 ? 30.225  20.917 28.815  1.00 11.05 ? 882  HIS A CE1 1 
ATOM   966  N NE2 . HIS A 1 119 ? 30.474  20.190 27.757  1.00 12.12 ? 882  HIS A NE2 1 
ATOM   967  N N   . ALA A 1 120 ? 34.914  24.889 26.036  1.00 20.52 ? 883  ALA A N   1 
ATOM   968  C CA  . ALA A 1 120 ? 35.836  25.990 26.245  1.00 19.83 ? 883  ALA A CA  1 
ATOM   969  C C   . ALA A 1 120 ? 35.322  27.198 25.481  1.00 19.17 ? 883  ALA A C   1 
ATOM   970  O O   . ALA A 1 120 ? 35.245  28.307 26.026  1.00 15.87 ? 883  ALA A O   1 
ATOM   971  C CB  . ALA A 1 120 ? 37.218  25.635 25.818  1.00 19.46 ? 883  ALA A CB  1 
ATOM   972  N N   . ALA A 1 121 ? 34.949  26.994 24.233  1.00 20.80 ? 884  ALA A N   1 
ATOM   973  C CA  . ALA A 1 121 ? 34.406  28.097 23.460  1.00 22.43 ? 884  ALA A CA  1 
ATOM   974  C C   . ALA A 1 121 ? 33.091  28.630 24.049  1.00 22.63 ? 884  ALA A C   1 
ATOM   975  O O   . ALA A 1 121 ? 32.734  29.824 23.858  1.00 20.06 ? 884  ALA A O   1 
ATOM   976  C CB  . ALA A 1 121 ? 34.169  27.689 22.003  1.00 23.39 ? 884  ALA A CB  1 
ATOM   977  N N   . ALA A 1 122 ? 32.332  27.760 24.691  1.00 22.42 ? 885  ALA A N   1 
ATOM   978  C CA  . ALA A 1 122 ? 30.995  28.173 25.233  1.00 22.88 ? 885  ALA A CA  1 
ATOM   979  C C   . ALA A 1 122 ? 31.212  29.115 26.403  1.00 23.52 ? 885  ALA A C   1 
ATOM   980  O O   . ALA A 1 122 ? 30.465  30.091 26.581  1.00 23.01 ? 885  ALA A O   1 
ATOM   981  C CB  . ALA A 1 122 ? 30.141  26.944 25.716  1.00 23.10 ? 885  ALA A CB  1 
ATOM   982  N N   . THR A 1 123 ? 32.245  28.815 27.181  1.00 21.55 ? 886  THR A N   1 
ATOM   983  C CA  . THR A 1 123 ? 32.619  29.636 28.338  1.00 24.72 ? 886  THR A CA  1 
ATOM   984  C C   . THR A 1 123 ? 33.189  31.003 27.874  1.00 26.44 ? 886  THR A C   1 
ATOM   985  O O   . THR A 1 123 ? 32.681  32.073 28.276  1.00 24.78 ? 886  THR A O   1 
ATOM   986  C CB  . THR A 1 123 ? 33.613  28.879 29.205  1.00 23.71 ? 886  THR A CB  1 
ATOM   987  O OG1 . THR A 1 123 ? 32.943  27.760 29.819  1.00 23.21 ? 886  THR A OG1 1 
ATOM   988  C CG2 . THR A 1 123 ? 34.117  29.706 30.347  1.00 23.72 ? 886  THR A CG2 1 
ATOM   989  N N   . PHE A 1 124 ? 34.246  30.976 27.046  1.00 26.95 ? 887  PHE A N   1 
ATOM   990  C CA  . PHE A 1 124 ? 34.744  32.224 26.460  1.00 25.15 ? 887  PHE A CA  1 
ATOM   991  C C   . PHE A 1 124 ? 33.644  33.034 25.773  1.00 22.19 ? 887  PHE A C   1 
ATOM   992  O O   . PHE A 1 124 ? 33.397  34.171 26.126  1.00 21.57 ? 887  PHE A O   1 
ATOM   993  C CB  . PHE A 1 124 ? 35.902  32.038 25.519  1.00 23.16 ? 887  PHE A CB  1 
ATOM   994  C CG  . PHE A 1 124 ? 36.556  33.324 25.150  1.00 22.44 ? 887  PHE A CG  1 
ATOM   995  C CD1 . PHE A 1 124 ? 37.372  33.955 26.025  1.00 23.19 ? 887  PHE A CD1 1 
ATOM   996  C CD2 . PHE A 1 124 ? 36.407  33.868 23.903  1.00 15.27 ? 887  PHE A CD2 1 
ATOM   997  C CE1 . PHE A 1 124 ? 37.984  35.145 25.706  1.00 24.14 ? 887  PHE A CE1 1 
ATOM   998  C CE2 . PHE A 1 124 ? 37.035  35.056 23.588  1.00 21.63 ? 887  PHE A CE2 1 
ATOM   999  C CZ  . PHE A 1 124 ? 37.824  35.672 24.477  1.00 22.29 ? 887  PHE A CZ  1 
ATOM   1000 N N   . CYS A 1 125 ? 32.947  32.452 24.835  1.00 23.77 ? 888  CYS A N   1 
ATOM   1001 C CA  . CYS A 1 125 ? 32.073  33.220 24.002  1.00 23.57 ? 888  CYS A CA  1 
ATOM   1002 C C   . CYS A 1 125 ? 30.783  33.720 24.693  1.00 23.76 ? 888  CYS A C   1 
ATOM   1003 O O   . CYS A 1 125 ? 30.252  34.750 24.330  1.00 22.94 ? 888  CYS A O   1 
ATOM   1004 C CB  . CYS A 1 125 ? 31.675  32.408 22.741  1.00 25.54 ? 888  CYS A CB  1 
ATOM   1005 S SG  . CYS A 1 125 ? 33.029  31.883 21.651  1.00 19.94 ? 888  CYS A SG  1 
ATOM   1006 N N   . SER A 1 126 ? 30.259  32.950 25.632  1.00 24.06 ? 889  SER A N   1 
ATOM   1007 C CA  . SER A 1 126 ? 29.003  33.291 26.331  1.00 23.26 ? 889  SER A CA  1 
ATOM   1008 C C   . SER A 1 126 ? 29.288  34.404 27.327  1.00 21.84 ? 889  SER A C   1 
ATOM   1009 O O   . SER A 1 126 ? 28.438  35.159 27.643  1.00 18.04 ? 889  SER A O   1 
ATOM   1010 C CB  . SER A 1 126 ? 28.401  32.064 27.054  1.00 23.93 ? 889  SER A CB  1 
ATOM   1011 O OG  . SER A 1 126 ? 29.238  31.648 28.132  1.00 25.13 ? 889  SER A OG  1 
ATOM   1012 N N   . ASN A 1 127 ? 30.536  34.503 27.751  1.00 16.92 ? 890  ASN A N   1 
ATOM   1013 C CA  . ASN A 1 127 ? 30.995  35.587 28.574  1.00 19.64 ? 890  ASN A CA  1 
ATOM   1014 C C   . ASN A 1 127 ? 31.223  36.949 27.928  1.00 20.11 ? 890  ASN A C   1 
ATOM   1015 O O   . ASN A 1 127 ? 31.385  37.972 28.663  1.00 17.16 ? 890  ASN A O   1 
ATOM   1016 C CB  . ASN A 1 127 ? 32.351  35.258 29.214  1.00 18.60 ? 890  ASN A CB  1 
ATOM   1017 C CG  . ASN A 1 127 ? 32.638  36.163 30.398  1.00 23.15 ? 890  ASN A CG  1 
ATOM   1018 O OD1 . ASN A 1 127 ? 31.769  36.385 31.174  1.00 23.31 ? 890  ASN A OD1 1 
ATOM   1019 N ND2 . ASN A 1 127 ? 33.808  36.762 30.461  1.00 20.54 ? 890  ASN A ND2 1 
ATOM   1020 N N   . GLN A 1 128 ? 31.251  36.951 26.600  1.00 17.84 ? 891  GLN A N   1 
ATOM   1021 C CA  . GLN A 1 128 ? 31.548  38.112 25.826  1.00 19.59 ? 891  GLN A CA  1 
ATOM   1022 C C   . GLN A 1 128 ? 30.749  39.355 26.206  1.00 20.19 ? 891  GLN A C   1 
ATOM   1023 O O   . GLN A 1 128 ? 31.367  40.388 26.332  1.00 24.13 ? 891  GLN A O   1 
ATOM   1024 C CB  . GLN A 1 128 ? 31.412  37.830 24.319  1.00 18.86 ? 891  GLN A CB  1 
ATOM   1025 C CG  . GLN A 1 128 ? 31.576  39.109 23.471  1.00 20.81 ? 891  GLN A CG  1 
ATOM   1026 C CD  . GLN A 1 128 ? 31.642  38.795 22.002  1.00 22.06 ? 891  GLN A CD  1 
ATOM   1027 O OE1 . GLN A 1 128 ? 32.441  37.975 21.582  1.00 24.72 ? 891  GLN A OE1 1 
ATOM   1028 N NE2 . GLN A 1 128 ? 30.772  39.403 21.231  1.00 18.34 ? 891  GLN A NE2 1 
ATOM   1029 N N   . PRO A 1 129 ? 29.427  39.301 26.356  1.00 20.45 ? 892  PRO A N   1 
ATOM   1030 C CA  . PRO A 1 129 ? 28.673  40.503 26.702  1.00 21.64 ? 892  PRO A CA  1 
ATOM   1031 C C   . PRO A 1 129 ? 29.066  40.979 28.121  1.00 21.12 ? 892  PRO A C   1 
ATOM   1032 O O   . PRO A 1 129 ? 29.114  42.193 28.397  1.00 20.37 ? 892  PRO A O   1 
ATOM   1033 C CB  . PRO A 1 129 ? 27.194  40.061 26.668  1.00 22.24 ? 892  PRO A CB  1 
ATOM   1034 C CG  . PRO A 1 129 ? 27.124  38.675 26.116  1.00 22.99 ? 892  PRO A CG  1 
ATOM   1035 C CD  . PRO A 1 129 ? 28.568  38.126 26.193  1.00 22.12 ? 892  PRO A CD  1 
ATOM   1036 N N   . PHE A 1 130 ? 29.315  40.040 29.027  1.00 18.59 ? 893  PHE A N   1 
ATOM   1037 C CA  . PHE A 1 130 ? 29.770  40.448 30.341  1.00 19.83 ? 893  PHE A CA  1 
ATOM   1038 C C   . PHE A 1 130 ? 31.139  41.111 30.164  1.00 19.66 ? 893  PHE A C   1 
ATOM   1039 O O   . PHE A 1 130 ? 31.430  42.086 30.848  1.00 18.66 ? 893  PHE A O   1 
ATOM   1040 C CB  . PHE A 1 130 ? 29.854  39.285 31.394  1.00 19.06 ? 893  PHE A CB  1 
ATOM   1041 C CG  . PHE A 1 130 ? 28.539  38.587 31.613  1.00 22.27 ? 893  PHE A CG  1 
ATOM   1042 C CD1 . PHE A 1 130 ? 27.599  39.090 32.500  1.00 21.53 ? 893  PHE A CD1 1 
ATOM   1043 C CD2 . PHE A 1 130 ? 28.243  37.415 30.930  1.00 22.72 ? 893  PHE A CD2 1 
ATOM   1044 C CE1 . PHE A 1 130 ? 26.381  38.478 32.672  1.00 23.93 ? 893  PHE A CE1 1 
ATOM   1045 C CE2 . PHE A 1 130 ? 27.007  36.784 31.126  1.00 23.83 ? 893  PHE A CE2 1 
ATOM   1046 C CZ  . PHE A 1 130 ? 26.092  37.300 32.000  1.00 22.92 ? 893  PHE A CZ  1 
ATOM   1047 N N   . ALA A 1 131 ? 31.980  40.593 29.285  1.00 18.20 ? 894  ALA A N   1 
ATOM   1048 C CA  . ALA A 1 131 ? 33.420  41.024 29.315  1.00 18.92 ? 894  ALA A CA  1 
ATOM   1049 C C   . ALA A 1 131 ? 33.481  42.417 28.657  1.00 20.62 ? 894  ALA A C   1 
ATOM   1050 O O   . ALA A 1 131 ? 34.151  43.303 29.132  1.00 17.80 ? 894  ALA A O   1 
ATOM   1051 C CB  . ALA A 1 131 ? 34.309  40.044 28.641  1.00 18.20 ? 894  ALA A CB  1 
ATOM   1052 N N   . LEU A 1 132 ? 32.596  42.668 27.696  1.00 22.15 ? 895  LEU A N   1 
ATOM   1053 C CA  . LEU A 1 132 ? 32.653  43.916 26.940  1.00 22.04 ? 895  LEU A CA  1 
ATOM   1054 C C   . LEU A 1 132 ? 32.102  45.022 27.824  1.00 22.14 ? 895  LEU A C   1 
ATOM   1055 O O   . LEU A 1 132 ? 32.428  46.171 27.657  1.00 20.06 ? 895  LEU A O   1 
ATOM   1056 C CB  . LEU A 1 132 ? 31.811  43.825 25.648  1.00 22.24 ? 895  LEU A CB  1 
ATOM   1057 C CG  . LEU A 1 132 ? 32.353  42.960 24.499  1.00 26.10 ? 895  LEU A CG  1 
ATOM   1058 C CD1 . LEU A 1 132 ? 31.705  43.286 23.239  1.00 25.12 ? 895  LEU A CD1 1 
ATOM   1059 C CD2 . LEU A 1 132 ? 33.871  43.029 24.291  1.00 26.80 ? 895  LEU A CD2 1 
ATOM   1060 N N   . GLU A 1 133 ? 31.205  44.675 28.732  1.00 24.90 ? 896  GLU A N   1 
ATOM   1061 C CA  . GLU A 1 133 ? 30.581  45.673 29.569  1.00 24.94 ? 896  GLU A CA  1 
ATOM   1062 C C   . GLU A 1 133 ? 31.492  45.989 30.711  1.00 21.35 ? 896  GLU A C   1 
ATOM   1063 O O   . GLU A 1 133 ? 31.519  47.120 31.153  1.00 19.68 ? 896  GLU A O   1 
ATOM   1064 C CB  . GLU A 1 133 ? 29.164  45.241 30.014  1.00 27.80 ? 896  GLU A CB  1 
ATOM   1065 C CG  . GLU A 1 133 ? 28.712  45.932 31.302  1.00 30.79 ? 896  GLU A CG  1 
ATOM   1066 C CD  . GLU A 1 133 ? 28.281  47.351 31.087  1.00 34.15 ? 896  GLU A CD  1 
ATOM   1067 O OE1 . GLU A 1 133 ? 27.662  47.616 29.992  1.00 33.99 ? 896  GLU A OE1 1 
ATOM   1068 O OE2 . GLU A 1 133 ? 28.516  48.177 32.035  1.00 30.50 ? 896  GLU A OE2 1 
ATOM   1069 N N   . MET A 1 134 ? 32.276  45.022 31.152  1.00 19.76 ? 897  MET A N   1 
ATOM   1070 C CA  . MET A 1 134 ? 33.237  45.254 32.207  1.00 21.66 ? 897  MET A CA  1 
ATOM   1071 C C   . MET A 1 134 ? 34.390  46.130 31.704  1.00 21.52 ? 897  MET A C   1 
ATOM   1072 O O   . MET A 1 134 ? 34.874  46.946 32.407  1.00 26.20 ? 897  MET A O   1 
ATOM   1073 C CB  . MET A 1 134 ? 33.790  43.934 32.723  1.00 21.64 ? 897  MET A CB  1 
ATOM   1074 C CG  . MET A 1 134 ? 34.719  44.032 33.814  1.00 19.60 ? 897  MET A CG  1 
ATOM   1075 S SD  . MET A 1 134 ? 34.160  45.062 35.181  1.00 25.64 ? 897  MET A SD  1 
ATOM   1076 C CE  . MET A 1 134 ? 33.461  43.786 36.361  1.00 27.55 ? 897  MET A CE  1 
ATOM   1077 N N   . ILE A 1 135 ? 34.872  45.888 30.496  1.00 20.84 ? 898  ILE A N   1 
ATOM   1078 C CA  . ILE A 1 135 ? 35.831  46.762 29.845  1.00 17.26 ? 898  ILE A CA  1 
ATOM   1079 C C   . ILE A 1 135 ? 35.330  48.206 29.824  1.00 16.57 ? 898  ILE A C   1 
ATOM   1080 O O   . ILE A 1 135 ? 36.058  49.043 30.280  1.00 17.17 ? 898  ILE A O   1 
ATOM   1081 C CB  . ILE A 1 135 ? 36.183  46.252 28.417  1.00 18.20 ? 898  ILE A CB  1 
ATOM   1082 C CG1 . ILE A 1 135 ? 36.891  44.895 28.460  1.00 20.55 ? 898  ILE A CG1 1 
ATOM   1083 C CG2 . ILE A 1 135 ? 36.957  47.285 27.598  1.00 14.20 ? 898  ILE A CG2 1 
ATOM   1084 C CD1 . ILE A 1 135 ? 36.715  44.173 27.099  1.00 21.10 ? 898  ILE A CD1 1 
ATOM   1085 N N   . LYS A 1 136 ? 34.098  48.494 29.337  1.00 17.23 ? 899  LYS A N   1 
ATOM   1086 C CA  . LYS A 1 136 ? 33.557  49.833 29.376  1.00 19.75 ? 899  LYS A CA  1 
ATOM   1087 C C   . LYS A 1 136 ? 33.465  50.417 30.766  1.00 20.40 ? 899  LYS A C   1 
ATOM   1088 O O   . LYS A 1 136 ? 33.733  51.601 30.941  1.00 17.76 ? 899  LYS A O   1 
ATOM   1089 C CB  . LYS A 1 136 ? 32.123  49.917 28.795  1.00 22.77 ? 899  LYS A CB  1 
ATOM   1090 C CG  . LYS A 1 136 ? 32.004  49.671 27.302  1.00 27.62 ? 899  LYS A CG  1 
ATOM   1091 C CD  . LYS A 1 136 ? 30.900  50.578 26.687  1.00 30.82 ? 899  LYS A CD  1 
ATOM   1092 C CE  . LYS A 1 136 ? 29.502  50.087 27.064  1.00 34.51 ? 899  LYS A CE  1 
ATOM   1093 N NZ  . LYS A 1 136 ? 28.372  51.073 26.715  1.00 36.82 ? 899  LYS A NZ  1 
ATOM   1094 N N   . SER A 1 137 ? 33.055  49.604 31.750  1.00 18.76 ? 900  SER A N   1 
ATOM   1095 C CA  . SER A 1 137 ? 32.853  50.130 33.081  1.00 20.03 ? 900  SER A CA  1 
ATOM   1096 C C   . SER A 1 137 ? 34.206  50.415 33.690  1.00 14.74 ? 900  SER A C   1 
ATOM   1097 O O   . SER A 1 137 ? 34.328  51.422 34.348  1.00 17.83 ? 900  SER A O   1 
ATOM   1098 C CB  . SER A 1 137 ? 31.953  49.255 33.989  1.00 22.83 ? 900  SER A CB  1 
ATOM   1099 O OG  . SER A 1 137 ? 32.587  48.072 34.402  1.00 27.89 ? 900  SER A OG  1 
ATOM   1100 N N   . ARG A 1 138 ? 35.226  49.616 33.454  1.00 12.29 ? 901  ARG A N   1 
ATOM   1101 C CA  . ARG A 1 138 ? 36.566  49.996 34.004  1.00 13.10 ? 901  ARG A CA  1 
ATOM   1102 C C   . ARG A 1 138 ? 37.136  51.194 33.242  1.00 13.41 ? 901  ARG A C   1 
ATOM   1103 O O   . ARG A 1 138 ? 37.804  52.013 33.820  1.00 16.62 ? 901  ARG A O   1 
ATOM   1104 C CB  . ARG A 1 138 ? 37.538  48.846 34.054  1.00 13.06 ? 901  ARG A CB  1 
ATOM   1105 C CG  . ARG A 1 138 ? 37.135  47.574 34.868  1.00 14.36 ? 901  ARG A CG  1 
ATOM   1106 C CD  . ARG A 1 138 ? 36.525  47.834 36.182  1.00 15.62 ? 901  ARG A CD  1 
ATOM   1107 N NE  . ARG A 1 138 ? 37.336  48.569 37.107  1.00 21.18 ? 901  ARG A NE  1 
ATOM   1108 C CZ  . ARG A 1 138 ? 36.849  49.078 38.221  1.00 20.42 ? 901  ARG A CZ  1 
ATOM   1109 N NH1 . ARG A 1 138 ? 35.582  48.929 38.484  1.00 23.12 ? 901  ARG A NH1 1 
ATOM   1110 N NH2 . ARG A 1 138 ? 37.632  49.717 39.082  1.00 20.97 ? 901  ARG A NH2 1 
ATOM   1111 N N   . GLN A 1 139 ? 36.838  51.347 31.948  1.00 15.41 ? 902  GLN A N   1 
ATOM   1112 C CA  . GLN A 1 139 ? 37.353  52.496 31.212  1.00 16.46 ? 902  GLN A CA  1 
ATOM   1113 C C   . GLN A 1 139 ? 36.766  53.787 31.840  1.00 18.77 ? 902  GLN A C   1 
ATOM   1114 O O   . GLN A 1 139 ? 37.466  54.840 31.984  1.00 15.03 ? 902  GLN A O   1 
ATOM   1115 C CB  . GLN A 1 139 ? 36.981  52.409 29.698  1.00 17.23 ? 902  GLN A CB  1 
ATOM   1116 C CG  . GLN A 1 139 ? 37.849  51.365 28.989  1.00 18.51 ? 902  GLN A CG  1 
ATOM   1117 C CD  . GLN A 1 139 ? 37.531  51.148 27.564  1.00 20.57 ? 902  GLN A CD  1 
ATOM   1118 O OE1 . GLN A 1 139 ? 36.357  50.921 27.170  1.00 18.55 ? 902  GLN A OE1 1 
ATOM   1119 N NE2 . GLN A 1 139 ? 38.550  51.237 26.761  1.00 20.37 ? 902  GLN A NE2 1 
ATOM   1120 N N   . LYS A 1 140 ? 35.487  53.675 32.223  1.00 19.48 ? 903  LYS A N   1 
ATOM   1121 C CA  . LYS A 1 140 ? 34.677  54.767 32.700  1.00 21.51 ? 903  LYS A CA  1 
ATOM   1122 C C   . LYS A 1 140 ? 35.023  55.195 34.150  1.00 21.53 ? 903  LYS A C   1 
ATOM   1123 O O   . LYS A 1 140 ? 34.892  56.367 34.497  1.00 19.33 ? 903  LYS A O   1 
ATOM   1124 C CB  . LYS A 1 140 ? 33.191  54.361 32.572  1.00 24.20 ? 903  LYS A CB  1 
ATOM   1125 C CG  . LYS A 1 140 ? 32.184  55.356 33.144  1.00 27.97 ? 903  LYS A CG  1 
ATOM   1126 C CD  . LYS A 1 140 ? 30.800  54.679 33.442  1.00 31.50 ? 903  LYS A CD  1 
ATOM   1127 C CE  . LYS A 1 140 ? 30.138  55.251 34.730  1.00 32.93 ? 903  LYS A CE  1 
ATOM   1128 N NZ  . LYS A 1 140 ? 28.935  56.116 34.445  1.00 33.78 ? 903  LYS A NZ  1 
ATOM   1129 N N   . LYS A 1 141 ? 35.505  54.257 34.959  1.00 19.36 ? 904  LYS A N   1 
ATOM   1130 C CA  . LYS A 1 141 ? 35.743  54.495 36.359  1.00 20.09 ? 904  LYS A CA  1 
ATOM   1131 C C   . LYS A 1 141 ? 37.191  54.519 36.729  1.00 19.97 ? 904  LYS A C   1 
ATOM   1132 O O   . LYS A 1 141 ? 37.518  55.071 37.755  1.00 19.49 ? 904  LYS A O   1 
ATOM   1133 C CB  . LYS A 1 141 ? 35.186  53.370 37.182  1.00 20.34 ? 904  LYS A CB  1 
ATOM   1134 C CG  . LYS A 1 141 ? 33.717  53.359 37.360  1.00 20.81 ? 904  LYS A CG  1 
ATOM   1135 C CD  . LYS A 1 141 ? 33.337  51.863 37.515  1.00 21.29 ? 904  LYS A CD  1 
ATOM   1136 C CE  . LYS A 1 141 ? 32.040  51.715 38.075  1.00 23.13 ? 904  LYS A CE  1 
ATOM   1137 N NZ  . LYS A 1 141 ? 31.498  50.406 37.956  1.00 20.46 ? 904  LYS A NZ  1 
ATOM   1138 N N   . ASP A 1 142 ? 38.063  53.887 35.940  1.00 19.04 ? 905  ASP A N   1 
ATOM   1139 C CA  . ASP A 1 142 ? 39.492  53.742 36.339  1.00 19.67 ? 905  ASP A CA  1 
ATOM   1140 C C   . ASP A 1 142 ? 40.499  54.276 35.300  1.00 20.63 ? 905  ASP A C   1 
ATOM   1141 O O   . ASP A 1 142 ? 40.885  53.545 34.353  1.00 20.65 ? 905  ASP A O   1 
ATOM   1142 C CB  . ASP A 1 142 ? 39.800  52.278 36.593  1.00 19.13 ? 905  ASP A CB  1 
ATOM   1143 C CG  . ASP A 1 142 ? 41.214  52.059 37.012  1.00 21.57 ? 905  ASP A CG  1 
ATOM   1144 O OD1 . ASP A 1 142 ? 42.026  53.013 37.223  1.00 22.96 ? 905  ASP A OD1 1 
ATOM   1145 O OD2 . ASP A 1 142 ? 41.606  50.937 37.189  1.00 24.39 ? 905  ASP A OD2 1 
ATOM   1146 N N   . SER A 1 143 ? 40.982  55.496 35.517  1.00 19.88 ? 906  SER A N   1 
ATOM   1147 C CA  . SER A 1 143 ? 41.986  56.092 34.666  1.00 21.51 ? 906  SER A CA  1 
ATOM   1148 C C   . SER A 1 143 ? 43.149  55.171 34.277  1.00 21.78 ? 906  SER A C   1 
ATOM   1149 O O   . SER A 1 143 ? 43.617  55.233 33.165  1.00 19.95 ? 906  SER A O   1 
ATOM   1150 C CB  . SER A 1 143 ? 42.594  57.335 35.335  1.00 19.89 ? 906  SER A CB  1 
ATOM   1151 O OG  . SER A 1 143 ? 41.662  58.344 35.154  1.00 24.23 ? 906  SER A OG  1 
ATOM   1152 N N   . ARG A 1 144 ? 43.618  54.364 35.209  1.00 22.50 ? 907  ARG A N   1 
ATOM   1153 C CA  . ARG A 1 144 ? 44.781  53.529 34.956  1.00 25.32 ? 907  ARG A CA  1 
ATOM   1154 C C   . ARG A 1 144 ? 44.483  52.460 33.920  1.00 25.22 ? 907  ARG A C   1 
ATOM   1155 O O   . ARG A 1 144 ? 45.371  52.087 33.150  1.00 23.72 ? 907  ARG A O   1 
ATOM   1156 C CB  . ARG A 1 144 ? 45.283  52.885 36.229  1.00 27.08 ? 907  ARG A CB  1 
ATOM   1157 C CG  . ARG A 1 144 ? 45.294  53.807 37.404  1.00 30.83 ? 907  ARG A CG  1 
ATOM   1158 C CD  . ARG A 1 144 ? 46.165  53.349 38.538  1.00 35.51 ? 907  ARG A CD  1 
ATOM   1159 N NE  . ARG A 1 144 ? 47.432  52.773 38.092  1.00 37.90 ? 907  ARG A NE  1 
ATOM   1160 C CZ  . ARG A 1 144 ? 47.905  51.575 38.473  1.00 41.46 ? 907  ARG A CZ  1 
ATOM   1161 N NH1 . ARG A 1 144 ? 47.201  50.782 39.302  1.00 42.64 ? 907  ARG A NH1 1 
ATOM   1162 N NH2 . ARG A 1 144 ? 49.086  51.157 38.011  1.00 41.08 ? 907  ARG A NH2 1 
ATOM   1163 N N   . PHE A 1 145 ? 43.221  52.001 33.865  1.00 25.76 ? 908  PHE A N   1 
ATOM   1164 C CA  . PHE A 1 145 ? 42.851  50.969 32.921  1.00 24.22 ? 908  PHE A CA  1 
ATOM   1165 C C   . PHE A 1 145 ? 42.491  51.612 31.575  1.00 23.53 ? 908  PHE A C   1 
ATOM   1166 O O   . PHE A 1 145 ? 42.754  51.045 30.508  1.00 20.73 ? 908  PHE A O   1 
ATOM   1167 C CB  . PHE A 1 145 ? 41.669  50.170 33.454  1.00 24.36 ? 908  PHE A CB  1 
ATOM   1168 C CG  . PHE A 1 145 ? 41.182  49.123 32.507  1.00 21.14 ? 908  PHE A CG  1 
ATOM   1169 C CD1 . PHE A 1 145 ? 41.878  47.939 32.358  1.00 21.38 ? 908  PHE A CD1 1 
ATOM   1170 C CD2 . PHE A 1 145 ? 40.051  49.325 31.752  1.00 21.06 ? 908  PHE A CD2 1 
ATOM   1171 C CE1 . PHE A 1 145 ? 41.458  46.961 31.493  1.00 22.48 ? 908  PHE A CE1 1 
ATOM   1172 C CE2 . PHE A 1 145 ? 39.611  48.353 30.897  1.00 22.48 ? 908  PHE A CE2 1 
ATOM   1173 C CZ  . PHE A 1 145 ? 40.314  47.156 30.764  1.00 15.83 ? 908  PHE A CZ  1 
ATOM   1174 N N   . GLN A 1 146 ? 41.853  52.778 31.614  1.00 21.08 ? 909  GLN A N   1 
ATOM   1175 C CA  . GLN A 1 146 ? 41.651  53.538 30.372  1.00 21.30 ? 909  GLN A CA  1 
ATOM   1176 C C   . GLN A 1 146 ? 43.019  53.776 29.692  1.00 20.92 ? 909  GLN A C   1 
ATOM   1177 O O   . GLN A 1 146 ? 43.184  53.571 28.471  1.00 20.34 ? 909  GLN A O   1 
ATOM   1178 C CB  . GLN A 1 146 ? 40.912  54.851 30.619  1.00 21.14 ? 909  GLN A CB  1 
ATOM   1179 C CG  . GLN A 1 146 ? 40.166  55.370 29.400  1.00 23.99 ? 909  GLN A CG  1 
ATOM   1180 C CD  . GLN A 1 146 ? 41.090  56.093 28.431  1.00 24.82 ? 909  GLN A CD  1 
ATOM   1181 O OE1 . GLN A 1 146 ? 42.124  56.583 28.848  1.00 23.84 ? 909  GLN A OE1 1 
ATOM   1182 N NE2 . GLN A 1 146 ? 40.769  56.058 27.136  1.00 27.15 ? 909  GLN A NE2 1 
ATOM   1183 N N   . THR A 1 147 ? 43.992  54.223 30.476  1.00 19.60 ? 910  THR A N   1 
ATOM   1184 C CA  . THR A 1 147 ? 45.320  54.467 29.932  1.00 20.37 ? 910  THR A CA  1 
ATOM   1185 C C   . THR A 1 147 ? 45.880  53.195 29.356  1.00 17.39 ? 910  THR A C   1 
ATOM   1186 O O   . THR A 1 147 ? 46.283  53.149 28.194  1.00 15.74 ? 910  THR A O   1 
ATOM   1187 C CB  . THR A 1 147 ? 46.286  55.028 31.009  1.00 19.64 ? 910  THR A CB  1 
ATOM   1188 O OG1 . THR A 1 147 ? 45.836  56.309 31.450  1.00 20.63 ? 910  THR A OG1 1 
ATOM   1189 C CG2 . THR A 1 147 ? 47.684  55.361 30.408  1.00 20.96 ? 910  THR A CG2 1 
ATOM   1190 N N   . PHE A 1 148 ? 45.888  52.149 30.165  1.00 18.80 ? 911  PHE A N   1 
ATOM   1191 C CA  . PHE A 1 148 ? 46.406  50.845 29.718  1.00 17.56 ? 911  PHE A CA  1 
ATOM   1192 C C   . PHE A 1 148 ? 45.815  50.407 28.394  1.00 15.22 ? 911  PHE A C   1 
ATOM   1193 O O   . PHE A 1 148 ? 46.546  50.076 27.515  1.00 16.20 ? 911  PHE A O   1 
ATOM   1194 C CB  . PHE A 1 148 ? 46.217  49.737 30.745  1.00 20.33 ? 911  PHE A CB  1 
ATOM   1195 C CG  . PHE A 1 148 ? 46.563  48.368 30.192  1.00 20.95 ? 911  PHE A CG  1 
ATOM   1196 C CD1 . PHE A 1 148 ? 47.861  47.902 30.238  1.00 24.12 ? 911  PHE A CD1 1 
ATOM   1197 C CD2 . PHE A 1 148 ? 45.636  47.640 29.527  1.00 23.46 ? 911  PHE A CD2 1 
ATOM   1198 C CE1 . PHE A 1 148 ? 48.211  46.684 29.697  1.00 22.81 ? 911  PHE A CE1 1 
ATOM   1199 C CE2 . PHE A 1 148 ? 45.970  46.415 28.973  1.00 24.00 ? 911  PHE A CE2 1 
ATOM   1200 C CZ  . PHE A 1 148 ? 47.275  45.948 29.064  1.00 26.36 ? 911  PHE A CZ  1 
ATOM   1201 N N   . VAL A 1 149 ? 44.495  50.445 28.262  1.00 16.97 ? 912  VAL A N   1 
ATOM   1202 C CA  . VAL A 1 149 ? 43.825  49.964 27.106  1.00 17.90 ? 912  VAL A CA  1 
ATOM   1203 C C   . VAL A 1 149 ? 44.167  50.814 25.904  1.00 19.01 ? 912  VAL A C   1 
ATOM   1204 O O   . VAL A 1 149 ? 44.481  50.265 24.858  1.00 19.05 ? 912  VAL A O   1 
ATOM   1205 C CB  . VAL A 1 149 ? 42.314  49.906 27.318  1.00 19.51 ? 912  VAL A CB  1 
ATOM   1206 C CG1 . VAL A 1 149 ? 41.549  49.818 25.968  1.00 21.54 ? 912  VAL A CG1 1 
ATOM   1207 C CG2 . VAL A 1 149 ? 41.983  48.727 28.180  1.00 22.48 ? 912  VAL A CG2 1 
ATOM   1208 N N   . GLN A 1 150 ? 44.154  52.148 26.058  1.00 19.90 ? 913  GLN A N   1 
ATOM   1209 C CA  . GLN A 1 150 ? 44.502  53.027 24.947  1.00 19.13 ? 913  GLN A CA  1 
ATOM   1210 C C   . GLN A 1 150 ? 45.931  52.810 24.510  1.00 17.83 ? 913  GLN A C   1 
ATOM   1211 O O   . GLN A 1 150 ? 46.215  52.766 23.326  1.00 16.80 ? 913  GLN A O   1 
ATOM   1212 C CB  . GLN A 1 150 ? 44.287  54.497 25.309  1.00 20.04 ? 913  GLN A CB  1 
ATOM   1213 C CG  . GLN A 1 150 ? 44.438  55.464 24.119  1.00 22.78 ? 913  GLN A CG  1 
ATOM   1214 C CD  . GLN A 1 150 ? 44.314  56.907 24.539  1.00 25.82 ? 913  GLN A CD  1 
ATOM   1215 O OE1 . GLN A 1 150 ? 43.771  57.204 25.616  1.00 27.07 ? 913  GLN A OE1 1 
ATOM   1216 N NE2 . GLN A 1 150 ? 44.828  57.825 23.700  1.00 27.32 ? 913  GLN A NE2 1 
ATOM   1217 N N   . ASP A 1 151 ? 46.862  52.718 25.443  1.00 18.40 ? 914  ASP A N   1 
ATOM   1218 C CA  . ASP A 1 151 ? 48.220  52.392 25.039  1.00 19.09 ? 914  ASP A CA  1 
ATOM   1219 C C   . ASP A 1 151 ? 48.263  51.057 24.261  1.00 20.91 ? 914  ASP A C   1 
ATOM   1220 O O   . ASP A 1 151 ? 48.802  50.990 23.125  1.00 21.07 ? 914  ASP A O   1 
ATOM   1221 C CB  . ASP A 1 151 ? 49.111  52.358 26.240  1.00 21.49 ? 914  ASP A CB  1 
ATOM   1222 C CG  . ASP A 1 151 ? 50.563  52.178 25.878  1.00 25.15 ? 914  ASP A CG  1 
ATOM   1223 O OD1 . ASP A 1 151 ? 51.094  51.082 26.141  1.00 30.67 ? 914  ASP A OD1 1 
ATOM   1224 O OD2 . ASP A 1 151 ? 51.262  53.062 25.331  1.00 29.99 ? 914  ASP A OD2 1 
ATOM   1225 N N   . ALA A 1 152 ? 47.614  50.014 24.799  1.00 20.88 ? 915  ALA A N   1 
ATOM   1226 C CA  . ALA A 1 152 ? 47.757  48.687 24.217  1.00 20.79 ? 915  ALA A CA  1 
ATOM   1227 C C   . ALA A 1 152 ? 47.219  48.655 22.800  1.00 22.19 ? 915  ALA A C   1 
ATOM   1228 O O   . ALA A 1 152 ? 47.847  48.017 21.933  1.00 22.26 ? 915  ALA A O   1 
ATOM   1229 C CB  . ALA A 1 152 ? 47.076  47.626 25.051  1.00 20.46 ? 915  ALA A CB  1 
ATOM   1230 N N   . GLU A 1 153 ? 46.079  49.313 22.580  1.00 20.52 ? 916  GLU A N   1 
ATOM   1231 C CA  . GLU A 1 153 ? 45.425  49.341 21.285  1.00 23.60 ? 916  GLU A CA  1 
ATOM   1232 C C   . GLU A 1 153 ? 46.207  50.173 20.231  1.00 22.74 ? 916  GLU A C   1 
ATOM   1233 O O   . GLU A 1 153 ? 45.939  50.092 19.047  1.00 20.32 ? 916  GLU A O   1 
ATOM   1234 C CB  . GLU A 1 153 ? 43.978  49.895 21.386  1.00 24.12 ? 916  GLU A CB  1 
ATOM   1235 C CG  . GLU A 1 153 ? 43.062  49.062 22.248  1.00 25.89 ? 916  GLU A CG  1 
ATOM   1236 C CD  . GLU A 1 153 ? 41.700  49.690 22.518  1.00 28.99 ? 916  GLU A CD  1 
ATOM   1237 O OE1 . GLU A 1 153 ? 41.567  50.920 22.421  1.00 31.64 ? 916  GLU A OE1 1 
ATOM   1238 O OE2 . GLU A 1 153 ? 40.759  48.935 22.855  1.00 29.89 ? 916  GLU A OE2 1 
ATOM   1239 N N   . SER A 1 154 ? 47.138  50.980 20.692  1.00 23.52 ? 917  SER A N   1 
ATOM   1240 C CA  . SER A 1 154 ? 48.068  51.647 19.810  1.00 23.74 ? 917  SER A CA  1 
ATOM   1241 C C   . SER A 1 154 ? 49.165  50.702 19.258  1.00 23.88 ? 917  SER A C   1 
ATOM   1242 O O   . SER A 1 154 ? 49.767  51.010 18.233  1.00 21.27 ? 917  SER A O   1 
ATOM   1243 C CB  . SER A 1 154 ? 48.674  52.870 20.506  1.00 24.21 ? 917  SER A CB  1 
ATOM   1244 O OG  . SER A 1 154 ? 49.815  52.532 21.261  1.00 25.36 ? 917  SER A OG  1 
ATOM   1245 N N   . ASN A 1 155 ? 49.407  49.560 19.925  1.00 22.84 ? 918  ASN A N   1 
ATOM   1246 C CA  . ASN A 1 155 ? 50.315  48.518 19.412  1.00 22.32 ? 918  ASN A CA  1 
ATOM   1247 C C   . ASN A 1 155 ? 49.941  48.149 17.985  1.00 20.00 ? 918  ASN A C   1 
ATOM   1248 O O   . ASN A 1 155 ? 48.788  47.860 17.752  1.00 21.82 ? 918  ASN A O   1 
ATOM   1249 C CB  . ASN A 1 155 ? 50.235  47.243 20.295  1.00 22.86 ? 918  ASN A CB  1 
ATOM   1250 C CG  . ASN A 1 155 ? 51.446  46.351 20.141  1.00 21.85 ? 918  ASN A CG  1 
ATOM   1251 O OD1 . ASN A 1 155 ? 51.800  45.982 19.048  1.00 24.02 ? 918  ASN A OD1 1 
ATOM   1252 N ND2 . ASN A 1 155 ? 52.090  46.026 21.235  1.00 22.38 ? 918  ASN A ND2 1 
ATOM   1253 N N   . PRO A 1 156 ? 50.866  48.181 17.033  1.00 19.98 ? 919  PRO A N   1 
ATOM   1254 C CA  . PRO A 1 156 ? 50.571  47.751 15.643  1.00 19.60 ? 919  PRO A CA  1 
ATOM   1255 C C   . PRO A 1 156 ? 49.947  46.369 15.491  1.00 19.25 ? 919  PRO A C   1 
ATOM   1256 O O   . PRO A 1 156 ? 49.201  46.153 14.529  1.00 17.95 ? 919  PRO A O   1 
ATOM   1257 C CB  . PRO A 1 156 ? 51.951  47.799 14.931  1.00 20.47 ? 919  PRO A CB  1 
ATOM   1258 C CG  . PRO A 1 156 ? 52.776  48.756 15.718  1.00 19.48 ? 919  PRO A CG  1 
ATOM   1259 C CD  . PRO A 1 156 ? 52.237  48.739 17.156  1.00 20.13 ? 919  PRO A CD  1 
ATOM   1260 N N   . LEU A 1 157 ? 50.197  45.456 16.437  1.00 20.00 ? 920  LEU A N   1 
ATOM   1261 C CA  . LEU A 1 157 ? 49.637  44.092 16.354  1.00 19.37 ? 920  LEU A CA  1 
ATOM   1262 C C   . LEU A 1 157 ? 48.112  44.102 16.395  1.00 19.62 ? 920  LEU A C   1 
ATOM   1263 O O   . LEU A 1 157 ? 47.457  43.168 15.944  1.00 19.76 ? 920  LEU A O   1 
ATOM   1264 C CB  . LEU A 1 157 ? 50.219  43.193 17.438  1.00 20.16 ? 920  LEU A CB  1 
ATOM   1265 C CG  . LEU A 1 157 ? 51.751  43.111 17.495  1.00 23.06 ? 920  LEU A CG  1 
ATOM   1266 C CD1 . LEU A 1 157 ? 52.168  42.360 18.747  1.00 23.71 ? 920  LEU A CD1 1 
ATOM   1267 C CD2 . LEU A 1 157 ? 52.292  42.408 16.278  1.00 25.33 ? 920  LEU A CD2 1 
ATOM   1268 N N   . CYS A 1 158 ? 47.552  45.193 16.892  1.00 19.77 ? 921  CYS A N   1 
ATOM   1269 C CA  . CYS A 1 158 ? 46.135  45.355 16.995  1.00 20.75 ? 921  CYS A CA  1 
ATOM   1270 C C   . CYS A 1 158 ? 45.512  45.760 15.688  1.00 21.76 ? 921  CYS A C   1 
ATOM   1271 O O   . CYS A 1 158 ? 44.285  45.642 15.522  1.00 22.71 ? 921  CYS A O   1 
ATOM   1272 C CB  . CYS A 1 158 ? 45.801  46.402 18.065  1.00 23.13 ? 921  CYS A CB  1 
ATOM   1273 S SG  . CYS A 1 158 ? 46.046  45.833 19.778  1.00 22.92 ? 921  CYS A SG  1 
ATOM   1274 N N   . ARG A 1 159 ? 46.336  46.233 14.756  1.00 22.99 ? 922  ARG A N   1 
ATOM   1275 C CA  . ARG A 1 159 ? 45.855  46.610 13.447  1.00 22.67 ? 922  ARG A CA  1 
ATOM   1276 C C   . ARG A 1 159 ? 44.688  47.613 13.533  1.00 21.94 ? 922  ARG A C   1 
ATOM   1277 O O   . ARG A 1 159 ? 43.719  47.447 12.849  1.00 19.08 ? 922  ARG A O   1 
ATOM   1278 C CB  . ARG A 1 159 ? 45.408  45.332 12.715  1.00 23.69 ? 922  ARG A CB  1 
ATOM   1279 C CG  . ARG A 1 159 ? 46.419  44.195 12.768  1.00 25.02 ? 922  ARG A CG  1 
ATOM   1280 C CD  . ARG A 1 159 ? 47.462  44.229 11.729  1.00 25.26 ? 922  ARG A CD  1 
ATOM   1281 N NE  . ARG A 1 159 ? 48.819  44.564 12.165  1.00 28.39 ? 922  ARG A NE  1 
ATOM   1282 C CZ  . ARG A 1 159 ? 49.832  43.698 12.389  1.00 33.32 ? 922  ARG A CZ  1 
ATOM   1283 N NH1 . ARG A 1 159 ? 49.680  42.360 12.317  1.00 34.23 ? 922  ARG A NH1 1 
ATOM   1284 N NH2 . ARG A 1 159 ? 51.035  44.192 12.706  1.00 35.30 ? 922  ARG A NH2 1 
ATOM   1285 N N   . ARG A 1 160 ? 44.773  48.619 14.420  1.00 25.05 ? 923  ARG A N   1 
ATOM   1286 C CA  . ARG A 1 160 ? 43.743  49.700 14.561  1.00 26.52 ? 923  ARG A CA  1 
ATOM   1287 C C   . ARG A 1 160 ? 42.397  49.194 15.060  1.00 26.21 ? 923  ARG A C   1 
ATOM   1288 O O   . ARG A 1 160 ? 41.387  49.811 14.812  1.00 27.43 ? 923  ARG A O   1 
ATOM   1289 C CB  . ARG A 1 160 ? 43.499  50.466 13.235  1.00 27.15 ? 923  ARG A CB  1 
ATOM   1290 C CG  . ARG A 1 160 ? 44.733  51.068 12.589  1.00 32.16 ? 923  ARG A CG  1 
ATOM   1291 C CD  . ARG A 1 160 ? 44.705  51.147 11.034  1.00 37.08 ? 923  ARG A CD  1 
ATOM   1292 N NE  . ARG A 1 160 ? 45.737  50.224 10.532  1.00 42.83 ? 923  ARG A NE  1 
ATOM   1293 C CZ  . ARG A 1 160 ? 45.556  49.140 9.770   1.00 45.21 ? 923  ARG A CZ  1 
ATOM   1294 N NH1 . ARG A 1 160 ? 44.367  48.805 9.274   1.00 46.41 ? 923  ARG A NH1 1 
ATOM   1295 N NH2 . ARG A 1 160 ? 46.612  48.395 9.472   1.00 47.38 ? 923  ARG A NH2 1 
ATOM   1296 N N   . LEU A 1 161 ? 42.390  48.088 15.778  1.00 27.25 ? 924  LEU A N   1 
ATOM   1297 C CA  . LEU A 1 161 ? 41.158  47.480 16.286  1.00 28.16 ? 924  LEU A CA  1 
ATOM   1298 C C   . LEU A 1 161 ? 41.142  47.558 17.808  1.00 26.90 ? 924  LEU A C   1 
ATOM   1299 O O   . LEU A 1 161 ? 42.176  47.469 18.445  1.00 27.40 ? 924  LEU A O   1 
ATOM   1300 C CB  . LEU A 1 161 ? 41.063  46.022 15.867  1.00 28.95 ? 924  LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 161 ? 40.499  45.752 14.479  1.00 30.34 ? 924  LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 161 ? 40.617  44.277 14.197  1.00 32.26 ? 924  LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 161 ? 39.035  46.210 14.337  1.00 30.99 ? 924  LEU A CD2 1 
ATOM   1304 N N   . GLN A 1 162 ? 39.972  47.769 18.386  1.00 24.91 ? 925  GLN A N   1 
ATOM   1305 C CA  . GLN A 1 162 ? 39.881  47.849 19.845  1.00 24.35 ? 925  GLN A CA  1 
ATOM   1306 C C   . GLN A 1 162 ? 39.745  46.452 20.464  1.00 21.80 ? 925  GLN A C   1 
ATOM   1307 O O   . GLN A 1 162 ? 39.351  45.519 19.799  1.00 18.78 ? 925  GLN A O   1 
ATOM   1308 C CB  . GLN A 1 162 ? 38.737  48.795 20.265  1.00 24.99 ? 925  GLN A CB  1 
ATOM   1309 C CG  . GLN A 1 162 ? 38.975  50.280 19.804  1.00 26.38 ? 925  GLN A CG  1 
ATOM   1310 C CD  . GLN A 1 162 ? 37.859  51.250 20.216  1.00 27.57 ? 925  GLN A CD  1 
ATOM   1311 O OE1 . GLN A 1 162 ? 37.601  51.453 21.395  1.00 27.37 ? 925  GLN A OE1 1 
ATOM   1312 N NE2 . GLN A 1 162 ? 37.217  51.845 19.246  1.00 27.13 ? 925  GLN A NE2 1 
ATOM   1313 N N   . LEU A 1 163 ? 40.110  46.338 21.741  1.00 22.94 ? 926  LEU A N   1 
ATOM   1314 C CA  . LEU A 1 163 ? 39.874  45.161 22.572  1.00 22.10 ? 926  LEU A CA  1 
ATOM   1315 C C   . LEU A 1 163 ? 38.498  44.607 22.288  1.00 22.21 ? 926  LEU A C   1 
ATOM   1316 O O   . LEU A 1 163 ? 38.344  43.443 21.968  1.00 22.95 ? 926  LEU A O   1 
ATOM   1317 C CB  . LEU A 1 163 ? 40.036  45.515 24.063  1.00 22.60 ? 926  LEU A CB  1 
ATOM   1318 C CG  . LEU A 1 163 ? 40.103  44.320 25.065  1.00 26.80 ? 926  LEU A CG  1 
ATOM   1319 C CD1 . LEU A 1 163 ? 41.171  43.307 24.637  1.00 24.05 ? 926  LEU A CD1 1 
ATOM   1320 C CD2 . LEU A 1 163 ? 40.377  44.710 26.516  1.00 23.90 ? 926  LEU A CD2 1 
ATOM   1321 N N   . LYS A 1 164 ? 37.490  45.442 22.381  1.00 22.33 ? 927  LYS A N   1 
ATOM   1322 C CA  . LYS A 1 164 ? 36.133  45.005 22.133  1.00 24.44 ? 927  LYS A CA  1 
ATOM   1323 C C   . LYS A 1 164 ? 35.965  44.335 20.767  1.00 24.06 ? 927  LYS A C   1 
ATOM   1324 O O   . LYS A 1 164 ? 35.102  43.521 20.616  1.00 25.42 ? 927  LYS A O   1 
ATOM   1325 C CB  . LYS A 1 164 ? 35.127  46.123 22.308  1.00 23.84 ? 927  LYS A CB  1 
ATOM   1326 C CG  . LYS A 1 164 ? 34.995  47.141 21.162  1.00 26.72 ? 927  LYS A CG  1 
ATOM   1327 C CD  . LYS A 1 164 ? 34.090  48.308 21.528  1.00 25.93 ? 927  LYS A CD  1 
ATOM   1328 C CE  . LYS A 1 164 ? 34.365  49.526 20.673  1.00 26.88 ? 927  LYS A CE  1 
ATOM   1329 N NZ  . LYS A 1 164 ? 34.057  49.177 19.231  1.00 34.50 ? 927  LYS A NZ  1 
ATOM   1330 N N   . ASP A 1 165 ? 36.777  44.716 19.783  1.00 23.12 ? 928  ASP A N   1 
ATOM   1331 C CA  . ASP A 1 165 ? 36.695  44.137 18.446  1.00 23.35 ? 928  ASP A CA  1 
ATOM   1332 C C   . ASP A 1 165 ? 37.556  42.898 18.254  1.00 21.30 ? 928  ASP A C   1 
ATOM   1333 O O   . ASP A 1 165 ? 37.364  42.193 17.318  1.00 22.32 ? 928  ASP A O   1 
ATOM   1334 C CB  . ASP A 1 165 ? 37.101  45.191 17.394  1.00 23.36 ? 928  ASP A CB  1 
ATOM   1335 C CG  . ASP A 1 165 ? 36.240  46.403 17.435  1.00 26.79 ? 928  ASP A CG  1 
ATOM   1336 O OD1 . ASP A 1 165 ? 36.828  47.527 17.440  1.00 28.31 ? 928  ASP A OD1 1 
ATOM   1337 O OD2 . ASP A 1 165 ? 34.984  46.317 17.453  1.00 25.42 ? 928  ASP A OD2 1 
ATOM   1338 N N   . ILE A 1 166 ? 38.533  42.645 19.120  1.00 20.16 ? 929  ILE A N   1 
ATOM   1339 C CA  . ILE A 1 166 ? 39.359  41.453 18.963  1.00 17.27 ? 929  ILE A CA  1 
ATOM   1340 C C   . ILE A 1 166 ? 38.725  40.256 19.667  1.00 14.02 ? 929  ILE A C   1 
ATOM   1341 O O   . ILE A 1 166 ? 38.786  39.113 19.234  1.00 16.13 ? 929  ILE A O   1 
ATOM   1342 C CB  . ILE A 1 166 ? 40.778  41.774 19.518  1.00 18.59 ? 929  ILE A CB  1 
ATOM   1343 C CG1 . ILE A 1 166 ? 41.362  43.002 18.822  1.00 20.06 ? 929  ILE A CG1 1 
ATOM   1344 C CG2 . ILE A 1 166 ? 41.654  40.532 19.380  1.00 20.05 ? 929  ILE A CG2 1 
ATOM   1345 C CD1 . ILE A 1 166 ? 42.790  43.327 19.248  1.00 21.53 ? 929  ILE A CD1 1 
ATOM   1346 N N   . ILE A 1 167 ? 38.107  40.500 20.794  1.00 12.02 ? 930  ILE A N   1 
ATOM   1347 C CA  . ILE A 1 167 ? 37.561  39.424 21.565  1.00 14.61 ? 930  ILE A CA  1 
ATOM   1348 C C   . ILE A 1 167 ? 36.581  38.536 20.838  1.00 19.46 ? 930  ILE A C   1 
ATOM   1349 O O   . ILE A 1 167 ? 36.658  37.327 20.931  1.00 21.64 ? 930  ILE A O   1 
ATOM   1350 C CB  . ILE A 1 167 ? 37.009  40.057 22.839  1.00 19.00 ? 930  ILE A CB  1 
ATOM   1351 C CG1 . ILE A 1 167 ? 38.119  40.097 23.883  1.00 17.64 ? 930  ILE A CG1 1 
ATOM   1352 C CG2 . ILE A 1 167 ? 35.788  39.339 23.446  1.00 22.47 ? 930  ILE A CG2 1 
ATOM   1353 C CD1 . ILE A 1 167 ? 37.772  41.149 24.854  1.00 22.86 ? 930  ILE A CD1 1 
ATOM   1354 N N   . PRO A 1 168 ? 35.712  39.146 20.039  1.00 14.98 ? 931  PRO A N   1 
ATOM   1355 C CA  . PRO A 1 168 ? 34.751  38.387 19.233  1.00 18.60 ? 931  PRO A CA  1 
ATOM   1356 C C   . PRO A 1 168 ? 35.362  37.462 18.112  1.00 20.34 ? 931  PRO A C   1 
ATOM   1357 O O   . PRO A 1 168 ? 34.572  36.920 17.274  1.00 17.06 ? 931  PRO A O   1 
ATOM   1358 C CB  . PRO A 1 168 ? 33.859  39.462 18.595  1.00 15.14 ? 931  PRO A CB  1 
ATOM   1359 C CG  . PRO A 1 168 ? 33.993  40.744 19.416  1.00 12.54 ? 931  PRO A CG  1 
ATOM   1360 C CD  . PRO A 1 168 ? 35.585  40.607 19.939  1.00 12.10 ? 931  PRO A CD  1 
ATOM   1361 N N   . THR A 1 169 ? 36.700  37.341 18.066  1.00 20.12 ? 932  THR A N   1 
ATOM   1362 C CA  . THR A 1 169 ? 37.345  36.508 17.069  1.00 21.67 ? 932  THR A CA  1 
ATOM   1363 C C   . THR A 1 169 ? 37.121  35.031 17.372  1.00 23.35 ? 932  THR A C   1 
ATOM   1364 O O   . THR A 1 169 ? 36.982  34.257 16.384  1.00 24.55 ? 932  THR A O   1 
ATOM   1365 C CB  . THR A 1 169 ? 38.831  36.784 16.886  1.00 22.68 ? 932  THR A CB  1 
ATOM   1366 O OG1 . THR A 1 169 ? 39.507  36.750 18.158  1.00 26.44 ? 932  THR A OG1 1 
ATOM   1367 C CG2 . THR A 1 169 ? 39.037  38.200 16.350  1.00 25.88 ? 932  THR A CG2 1 
ATOM   1368 N N   . GLN A 1 170 ? 37.020  34.635 18.664  1.00 20.38 ? 933  GLN A N   1 
ATOM   1369 C CA  . GLN A 1 170 ? 36.718  33.241 18.983  1.00 19.85 ? 933  GLN A CA  1 
ATOM   1370 C C   . GLN A 1 170 ? 35.354  32.777 18.412  1.00 20.70 ? 933  GLN A C   1 
ATOM   1371 O O   . GLN A 1 170 ? 35.277  31.744 17.726  1.00 21.16 ? 933  GLN A O   1 
ATOM   1372 C CB  . GLN A 1 170 ? 36.688  33.003 20.464  1.00 22.22 ? 933  GLN A CB  1 
ATOM   1373 C CG  . GLN A 1 170 ? 36.585  31.544 20.806  1.00 23.27 ? 933  GLN A CG  1 
ATOM   1374 C CD  . GLN A 1 170 ? 37.817  30.682 20.298  1.00 23.94 ? 933  GLN A CD  1 
ATOM   1375 O OE1 . GLN A 1 170 ? 38.919  31.209 19.988  1.00 24.66 ? 933  GLN A OE1 1 
ATOM   1376 N NE2 . GLN A 1 170 ? 37.608  29.373 20.227  1.00 23.37 ? 933  GLN A NE2 1 
ATOM   1377 N N   . MET A 1 171 ? 34.285  33.522 18.668  1.00 19.62 ? 934  MET A N   1 
ATOM   1378 C CA  . MET A 1 171 ? 32.970  33.138 18.129  1.00 19.48 ? 934  MET A CA  1 
ATOM   1379 C C   . MET A 1 171 ? 33.058  33.052 16.621  1.00 20.93 ? 934  MET A C   1 
ATOM   1380 O O   . MET A 1 171 ? 32.519  32.110 16.043  1.00 22.28 ? 934  MET A O   1 
ATOM   1381 C CB  . MET A 1 171 ? 31.884  34.126 18.591  1.00 20.97 ? 934  MET A CB  1 
ATOM   1382 C CG  . MET A 1 171 ? 30.440  33.909 18.050  1.00 24.41 ? 934  MET A CG  1 
ATOM   1383 S SD  . MET A 1 171 ? 29.553  32.565 18.919  1.00 27.61 ? 934  MET A SD  1 
ATOM   1384 C CE  . MET A 1 171 ? 29.586  31.352 17.699  1.00 26.01 ? 934  MET A CE  1 
ATOM   1385 N N   . GLN A 1 172 ? 33.739  33.995 15.958  1.00 22.00 ? 935  GLN A N   1 
ATOM   1386 C CA  . GLN A 1 172 ? 33.706  34.037 14.491  1.00 21.97 ? 935  GLN A CA  1 
ATOM   1387 C C   . GLN A 1 172 ? 34.340  32.754 13.927  1.00 21.48 ? 935  GLN A C   1 
ATOM   1388 O O   . GLN A 1 172 ? 33.823  32.140 13.007  1.00 20.03 ? 935  GLN A O   1 
ATOM   1389 C CB  . GLN A 1 172 ? 34.405  35.285 13.902  1.00 23.72 ? 935  GLN A CB  1 
ATOM   1390 C CG  . GLN A 1 172 ? 34.231  35.390 12.328  1.00 31.08 ? 935  GLN A CG  1 
ATOM   1391 C CD  . GLN A 1 172 ? 32.767  35.625 11.863  1.00 34.17 ? 935  GLN A CD  1 
ATOM   1392 O OE1 . GLN A 1 172 ? 31.862  35.800 12.700  1.00 38.25 ? 935  GLN A OE1 1 
ATOM   1393 N NE2 . GLN A 1 172 ? 32.535  35.654 10.528  1.00 37.56 ? 935  GLN A NE2 1 
ATOM   1394 N N   . ARG A 1 173 ? 35.467  32.372 14.515  1.00 20.40 ? 936  ARG A N   1 
ATOM   1395 C CA  . ARG A 1 173 ? 36.193  31.168 14.170  1.00 22.51 ? 936  ARG A CA  1 
ATOM   1396 C C   . ARG A 1 173 ? 35.310  29.924 14.185  1.00 21.37 ? 936  ARG A C   1 
ATOM   1397 O O   . ARG A 1 173 ? 35.339  29.085 13.275  1.00 20.14 ? 936  ARG A O   1 
ATOM   1398 C CB  . ARG A 1 173 ? 37.435  30.998 15.092  1.00 21.35 ? 936  ARG A CB  1 
ATOM   1399 C CG  . ARG A 1 173 ? 38.301  29.785 14.694  1.00 25.99 ? 936  ARG A CG  1 
ATOM   1400 C CD  . ARG A 1 173 ? 38.701  29.764 13.215  1.00 26.44 ? 936  ARG A CD  1 
ATOM   1401 N NE  . ARG A 1 173 ? 39.666  28.705 12.907  1.00 26.30 ? 936  ARG A NE  1 
ATOM   1402 C CZ  . ARG A 1 173 ? 40.006  28.355 11.662  1.00 26.58 ? 936  ARG A CZ  1 
ATOM   1403 N NH1 . ARG A 1 173 ? 39.544  29.042 10.677  1.00 28.86 ? 936  ARG A NH1 1 
ATOM   1404 N NH2 . ARG A 1 173 ? 40.843  27.347 11.392  1.00 26.09 ? 936  ARG A NH2 1 
ATOM   1405 N N   . LEU A 1 174 ? 34.496  29.822 15.207  1.00 22.32 ? 937  LEU A N   1 
ATOM   1406 C CA  . LEU A 1 174 ? 33.633  28.696 15.344  1.00 21.21 ? 937  LEU A CA  1 
ATOM   1407 C C   . LEU A 1 174 ? 32.542  28.687 14.266  1.00 22.44 ? 937  LEU A C   1 
ATOM   1408 O O   . LEU A 1 174 ? 32.096  27.631 13.916  1.00 23.50 ? 937  LEU A O   1 
ATOM   1409 C CB  . LEU A 1 174 ? 33.017  28.684 16.720  1.00 23.96 ? 937  LEU A CB  1 
ATOM   1410 C CG  . LEU A 1 174 ? 33.585  27.671 17.686  1.00 26.22 ? 937  LEU A CG  1 
ATOM   1411 C CD1 . LEU A 1 174 ? 34.984  28.066 18.076  1.00 28.85 ? 937  LEU A CD1 1 
ATOM   1412 C CD2 . LEU A 1 174 ? 32.716  27.728 18.855  1.00 30.24 ? 937  LEU A CD2 1 
ATOM   1413 N N   . THR A 1 175 ? 32.146  29.824 13.728  1.00 21.11 ? 938  THR A N   1 
ATOM   1414 C CA  . THR A 1 175 ? 31.185  29.840 12.595  1.00 24.19 ? 938  THR A CA  1 
ATOM   1415 C C   . THR A 1 175 ? 31.842  29.323 11.312  1.00 23.51 ? 938  THR A C   1 
ATOM   1416 O O   . THR A 1 175 ? 31.152  28.858 10.433  1.00 24.23 ? 938  THR A O   1 
ATOM   1417 C CB  . THR A 1 175 ? 30.648  31.257 12.313  1.00 25.16 ? 938  THR A CB  1 
ATOM   1418 O OG1 . THR A 1 175 ? 31.726  32.069 11.848  1.00 23.11 ? 938  THR A OG1 1 
ATOM   1419 C CG2 . THR A 1 175 ? 30.194  31.976 13.603  1.00 27.31 ? 938  THR A CG2 1 
ATOM   1420 N N   . LYS A 1 176 ? 33.183  29.355 11.253  1.00 24.63 ? 939  LYS A N   1 
ATOM   1421 C CA  . LYS A 1 176 ? 33.949  29.003 10.054  1.00 25.16 ? 939  LYS A CA  1 
ATOM   1422 C C   . LYS A 1 176 ? 34.211  27.494 9.895   1.00 24.50 ? 939  LYS A C   1 
ATOM   1423 O O   . LYS A 1 176 ? 34.260  26.971 8.791   1.00 25.00 ? 939  LYS A O   1 
ATOM   1424 C CB  . LYS A 1 176 ? 35.295  29.769 10.050  1.00 26.61 ? 939  LYS A CB  1 
ATOM   1425 C CG  . LYS A 1 176 ? 35.215  31.304 9.867   1.00 26.05 ? 939  LYS A CG  1 
ATOM   1426 C CD  . LYS A 1 176 ? 34.642  31.683 8.514   1.00 30.69 ? 939  LYS A CD  1 
ATOM   1427 C CE  . LYS A 1 176 ? 34.244  33.169 8.403   1.00 33.52 ? 939  LYS A CE  1 
ATOM   1428 N NZ  . LYS A 1 176 ? 35.378  34.129 8.528   1.00 37.34 ? 939  LYS A NZ  1 
ATOM   1429 N N   . TYR A 1 177 ? 34.357  26.762 10.989  1.00 23.63 ? 940  TYR A N   1 
ATOM   1430 C CA  . TYR A 1 177 ? 34.696  25.339 10.861  1.00 23.54 ? 940  TYR A CA  1 
ATOM   1431 C C   . TYR A 1 177 ? 33.751  24.543 9.971   1.00 25.39 ? 940  TYR A C   1 
ATOM   1432 O O   . TYR A 1 177 ? 34.212  23.771 9.130   1.00 25.92 ? 940  TYR A O   1 
ATOM   1433 C CB  . TYR A 1 177 ? 34.816  24.683 12.228  1.00 22.55 ? 940  TYR A CB  1 
ATOM   1434 C CG  . TYR A 1 177 ? 36.053  25.086 12.965  1.00 20.61 ? 940  TYR A CG  1 
ATOM   1435 C CD1 . TYR A 1 177 ? 37.321  24.925 12.394  1.00 20.28 ? 940  TYR A CD1 1 
ATOM   1436 C CD2 . TYR A 1 177 ? 35.985  25.587 14.245  1.00 19.92 ? 940  TYR A CD2 1 
ATOM   1437 C CE1 . TYR A 1 177 ? 38.468  25.258 13.099  1.00 21.09 ? 940  TYR A CE1 1 
ATOM   1438 C CE2 . TYR A 1 177 ? 37.145  25.937 14.935  1.00 18.09 ? 940  TYR A CE2 1 
ATOM   1439 C CZ  . TYR A 1 177 ? 38.346  25.775 14.368  1.00 19.51 ? 940  TYR A CZ  1 
ATOM   1440 O OH  . TYR A 1 177 ? 39.469  26.130 15.053  1.00 23.21 ? 940  TYR A OH  1 
ATOM   1441 N N   . PRO A 1 178 ? 32.438  24.730 10.096  1.00 25.21 ? 941  PRO A N   1 
ATOM   1442 C CA  . PRO A 1 178 ? 31.525  23.930 9.286   1.00 24.59 ? 941  PRO A CA  1 
ATOM   1443 C C   . PRO A 1 178 ? 31.746  24.092 7.783   1.00 26.88 ? 941  PRO A C   1 
ATOM   1444 O O   . PRO A 1 178 ? 31.656  23.109 7.044   1.00 25.85 ? 941  PRO A O   1 
ATOM   1445 C CB  . PRO A 1 178 ? 30.148  24.449 9.677   1.00 23.99 ? 941  PRO A CB  1 
ATOM   1446 C CG  . PRO A 1 178 ? 30.300  25.051 10.967  1.00 24.67 ? 941  PRO A CG  1 
ATOM   1447 C CD  . PRO A 1 178 ? 31.719  25.632 11.007  1.00 24.59 ? 941  PRO A CD  1 
ATOM   1448 N N   . LEU A 1 179 ? 32.026  25.315 7.348   1.00 27.80 ? 942  LEU A N   1 
ATOM   1449 C CA  . LEU A 1 179 ? 32.127  25.636 5.934   1.00 28.97 ? 942  LEU A CA  1 
ATOM   1450 C C   . LEU A 1 179 ? 33.458  25.092 5.400   1.00 28.04 ? 942  LEU A C   1 
ATOM   1451 O O   . LEU A 1 179 ? 33.522  24.461 4.344   1.00 28.58 ? 942  LEU A O   1 
ATOM   1452 C CB  . LEU A 1 179 ? 32.040  27.157 5.754   1.00 30.52 ? 942  LEU A CB  1 
ATOM   1453 C CG  . LEU A 1 179 ? 30.914  27.904 6.508   1.00 32.78 ? 942  LEU A CG  1 
ATOM   1454 C CD1 . LEU A 1 179 ? 31.161  29.447 6.601   1.00 33.26 ? 942  LEU A CD1 1 
ATOM   1455 C CD2 . LEU A 1 179 ? 29.545  27.558 5.829   1.00 32.88 ? 942  LEU A CD2 1 
ATOM   1456 N N   . LEU A 1 180 ? 34.510  25.298 6.167   1.00 27.09 ? 943  LEU A N   1 
ATOM   1457 C CA  . LEU A 1 180 ? 35.818  24.744 5.840   1.00 26.83 ? 943  LEU A CA  1 
ATOM   1458 C C   . LEU A 1 180 ? 35.791  23.229 5.636   1.00 25.70 ? 943  LEU A C   1 
ATOM   1459 O O   . LEU A 1 180 ? 36.374  22.730 4.678   1.00 25.50 ? 943  LEU A O   1 
ATOM   1460 C CB  . LEU A 1 180 ? 36.815  25.093 6.919   1.00 26.26 ? 943  LEU A CB  1 
ATOM   1461 C CG  . LEU A 1 180 ? 37.159  26.576 7.030   1.00 28.82 ? 943  LEU A CG  1 
ATOM   1462 C CD1 . LEU A 1 180 ? 37.744  26.908 8.395   1.00 26.80 ? 943  LEU A CD1 1 
ATOM   1463 C CD2 . LEU A 1 180 ? 38.112  27.023 5.919   1.00 28.76 ? 943  LEU A CD2 1 
ATOM   1464 N N   . LEU A 1 181 ? 35.090  22.513 6.517   1.00 23.87 ? 944  LEU A N   1 
ATOM   1465 C CA  . LEU A 1 181 ? 34.992  21.062 6.436   1.00 22.54 ? 944  LEU A CA  1 
ATOM   1466 C C   . LEU A 1 181 ? 34.056  20.630 5.297   1.00 22.82 ? 944  LEU A C   1 
ATOM   1467 O O   . LEU A 1 181 ? 34.341  19.666 4.615   1.00 23.08 ? 944  LEU A O   1 
ATOM   1468 C CB  . LEU A 1 181 ? 34.597  20.432 7.796   1.00 21.53 ? 944  LEU A CB  1 
ATOM   1469 C CG  . LEU A 1 181 ? 35.805  20.144 8.716   1.00 20.92 ? 944  LEU A CG  1 
ATOM   1470 C CD1 . LEU A 1 181 ? 36.402  21.410 9.170   1.00 21.49 ? 944  LEU A CD1 1 
ATOM   1471 C CD2 . LEU A 1 181 ? 35.472  19.342 9.958   1.00 19.12 ? 944  LEU A CD2 1 
ATOM   1472 N N   . ASP A 1 182 ? 32.956  21.340 5.082   1.00 23.17 ? 945  ASP A N   1 
ATOM   1473 C CA  . ASP A 1 182 ? 32.098  21.066 3.941   1.00 25.05 ? 945  ASP A CA  1 
ATOM   1474 C C   . ASP A 1 182 ? 32.878  21.146 2.619   1.00 25.75 ? 945  ASP A C   1 
ATOM   1475 O O   . ASP A 1 182 ? 32.616  20.392 1.684   1.00 25.79 ? 945  ASP A O   1 
ATOM   1476 C CB  . ASP A 1 182 ? 30.974  22.079 3.841   1.00 25.81 ? 945  ASP A CB  1 
ATOM   1477 C CG  . ASP A 1 182 ? 29.842  21.827 4.798   1.00 25.62 ? 945  ASP A CG  1 
ATOM   1478 O OD1 . ASP A 1 182 ? 29.770  20.773 5.452   1.00 20.84 ? 945  ASP A OD1 1 
ATOM   1479 O OD2 . ASP A 1 182 ? 28.939  22.683 4.919   1.00 28.05 ? 945  ASP A OD2 1 
ATOM   1480 N N   . ASN A 1 183 ? 33.840  22.061 2.546   1.00 26.98 ? 946  ASN A N   1 
ATOM   1481 C CA  . ASN A 1 183 ? 34.583  22.274 1.305   1.00 27.48 ? 946  ASN A CA  1 
ATOM   1482 C C   . ASN A 1 183 ? 35.604  21.179 1.100   1.00 26.77 ? 946  ASN A C   1 
ATOM   1483 O O   . ASN A 1 183 ? 35.845  20.747 -0.027  1.00 26.32 ? 946  ASN A O   1 
ATOM   1484 C CB  . ASN A 1 183 ? 35.265  23.635 1.290   1.00 27.83 ? 946  ASN A CB  1 
ATOM   1485 C CG  . ASN A 1 183 ? 34.437  24.680 0.601   1.00 30.31 ? 946  ASN A CG  1 
ATOM   1486 O OD1 . ASN A 1 183 ? 33.483  24.365 -0.128  1.00 32.87 ? 946  ASN A OD1 1 
ATOM   1487 N ND2 . ASN A 1 183 ? 34.794  25.935 0.806   1.00 31.22 ? 946  ASN A ND2 1 
ATOM   1488 N N   . ILE A 1 184 ? 36.193  20.715 2.189   1.00 25.64 ? 947  ILE A N   1 
ATOM   1489 C CA  . ILE A 1 184 ? 37.069  19.565 2.102   1.00 25.14 ? 947  ILE A CA  1 
ATOM   1490 C C   . ILE A 1 184 ? 36.221  18.391 1.595   1.00 25.22 ? 947  ILE A C   1 
ATOM   1491 O O   . ILE A 1 184 ? 36.616  17.724 0.660   1.00 26.00 ? 947  ILE A O   1 
ATOM   1492 C CB  . ILE A 1 184 ? 37.761  19.275 3.446   1.00 24.56 ? 947  ILE A CB  1 
ATOM   1493 C CG1 . ILE A 1 184 ? 38.657  20.459 3.850   1.00 23.21 ? 947  ILE A CG1 1 
ATOM   1494 C CG2 . ILE A 1 184 ? 38.603  18.029 3.324   1.00 24.62 ? 947  ILE A CG2 1 
ATOM   1495 C CD1 . ILE A 1 184 ? 39.121  20.445 5.286   1.00 22.19 ? 947  ILE A CD1 1 
ATOM   1496 N N   . ALA A 1 185 ? 35.028  18.198 2.150   1.00 24.42 ? 948  ALA A N   1 
ATOM   1497 C CA  . ALA A 1 185 ? 34.168  17.087 1.745   1.00 24.13 ? 948  ALA A CA  1 
ATOM   1498 C C   . ALA A 1 185 ? 33.827  17.153 0.256   1.00 24.38 ? 948  ALA A C   1 
ATOM   1499 O O   . ALA A 1 185 ? 33.815  16.145 -0.445  1.00 23.33 ? 948  ALA A O   1 
ATOM   1500 C CB  . ALA A 1 185 ? 32.885  17.091 2.540   1.00 23.95 ? 948  ALA A CB  1 
ATOM   1501 N N   . LYS A 1 186 ? 33.556  18.362 -0.200  1.00 23.96 ? 949  LYS A N   1 
ATOM   1502 C CA  . LYS A 1 186 ? 33.203  18.627 -1.577  1.00 24.14 ? 949  LYS A CA  1 
ATOM   1503 C C   . LYS A 1 186 ? 34.228  18.062 -2.564  1.00 25.08 ? 949  LYS A C   1 
ATOM   1504 O O   . LYS A 1 186 ? 33.850  17.545 -3.614  1.00 24.87 ? 949  LYS A O   1 
ATOM   1505 C CB  . LYS A 1 186 ? 33.066  20.141 -1.771  1.00 23.67 ? 949  LYS A CB  1 
ATOM   1506 C CG  . LYS A 1 186 ? 32.453  20.564 -3.072  1.00 24.10 ? 949  LYS A CG  1 
ATOM   1507 C CD  . LYS A 1 186 ? 32.490  22.078 -3.243  1.00 23.94 ? 949  LYS A CD  1 
ATOM   1508 C CE  . LYS A 1 186 ? 32.139  22.451 -4.705  1.00 24.01 ? 949  LYS A CE  1 
ATOM   1509 N NZ  . LYS A 1 186 ? 31.591  23.814 -4.796  1.00 23.44 ? 949  LYS A NZ  1 
ATOM   1510 N N   . TYR A 1 187 ? 35.517  18.201 -2.256  1.00 25.72 ? 950  TYR A N   1 
ATOM   1511 C CA  . TYR A 1 187 ? 36.578  17.728 -3.146  1.00 26.79 ? 950  TYR A CA  1 
ATOM   1512 C C   . TYR A 1 187 ? 37.206  16.430 -2.636  1.00 28.43 ? 950  TYR A C   1 
ATOM   1513 O O   . TYR A 1 187 ? 38.394  16.177 -2.797  1.00 28.84 ? 950  TYR A O   1 
ATOM   1514 C CB  . TYR A 1 187 ? 37.641  18.816 -3.316  1.00 26.83 ? 950  TYR A CB  1 
ATOM   1515 C CG  . TYR A 1 187 ? 37.088  20.102 -3.882  1.00 26.54 ? 950  TYR A CG  1 
ATOM   1516 C CD1 . TYR A 1 187 ? 36.611  20.162 -5.188  1.00 26.78 ? 950  TYR A CD1 1 
ATOM   1517 C CD2 . TYR A 1 187 ? 37.015  21.251 -3.101  1.00 26.58 ? 950  TYR A CD2 1 
ATOM   1518 C CE1 . TYR A 1 187 ? 36.094  21.349 -5.711  1.00 27.26 ? 950  TYR A CE1 1 
ATOM   1519 C CE2 . TYR A 1 187 ? 36.513  22.420 -3.606  1.00 27.39 ? 950  TYR A CE2 1 
ATOM   1520 C CZ  . TYR A 1 187 ? 36.052  22.467 -4.914  1.00 28.19 ? 950  TYR A CZ  1 
ATOM   1521 O OH  . TYR A 1 187 ? 35.547  23.643 -5.395  1.00 30.12 ? 950  TYR A OH  1 
ATOM   1522 N N   . THR A 1 188 ? 36.397  15.614 -1.991  1.00 29.53 ? 951  THR A N   1 
ATOM   1523 C CA  . THR A 1 188 ? 36.850  14.324 -1.524  1.00 31.24 ? 951  THR A CA  1 
ATOM   1524 C C   . THR A 1 188 ? 36.064  13.308 -2.339  1.00 32.24 ? 951  THR A C   1 
ATOM   1525 O O   . THR A 1 188 ? 34.833  13.274 -2.296  1.00 32.25 ? 951  THR A O   1 
ATOM   1526 C CB  . THR A 1 188 ? 36.606  14.161 -0.015  1.00 30.71 ? 951  THR A CB  1 
ATOM   1527 O OG1 . THR A 1 188 ? 37.490  15.023 0.734   1.00 29.86 ? 951  THR A OG1 1 
ATOM   1528 C CG2 . THR A 1 188 ? 36.966  12.759 0.425   1.00 29.34 ? 951  THR A CG2 1 
ATOM   1529 N N   . GLU A 1 189 ? 36.780  12.506 -3.108  1.00 33.90 ? 952  GLU A N   1 
ATOM   1530 C CA  . GLU A 1 189 ? 36.133  11.633 -4.081  1.00 35.28 ? 952  GLU A CA  1 
ATOM   1531 C C   . GLU A 1 189 ? 35.634  10.353 -3.443  1.00 35.72 ? 952  GLU A C   1 
ATOM   1532 O O   . GLU A 1 189 ? 34.481  9.968  -3.626  1.00 35.68 ? 952  GLU A O   1 
ATOM   1533 C CB  . GLU A 1 189 ? 37.096  11.308 -5.219  1.00 35.98 ? 952  GLU A CB  1 
ATOM   1534 C CG  . GLU A 1 189 ? 37.656  12.532 -5.900  1.00 37.32 ? 952  GLU A CG  1 
ATOM   1535 C CD  . GLU A 1 189 ? 37.295  12.565 -7.363  1.00 39.38 ? 952  GLU A CD  1 
ATOM   1536 O OE1 . GLU A 1 189 ? 37.824  11.716 -8.126  1.00 40.13 ? 952  GLU A OE1 1 
ATOM   1537 O OE2 . GLU A 1 189 ? 36.478  13.441 -7.739  1.00 41.38 ? 952  GLU A OE2 1 
ATOM   1538 N N   . TRP A 1 190 ? 36.487  9.734  -2.640  1.00 36.50 ? 953  TRP A N   1 
ATOM   1539 C CA  . TRP A 1 190 ? 36.304  8.347  -2.269  1.00 38.14 ? 953  TRP A CA  1 
ATOM   1540 C C   . TRP A 1 190 ? 35.491  8.223  -0.979  1.00 36.88 ? 953  TRP A C   1 
ATOM   1541 O O   . TRP A 1 190 ? 35.806  8.854  0.030   1.00 37.06 ? 953  TRP A O   1 
ATOM   1542 C CB  . TRP A 1 190 ? 37.644  7.596  -2.223  1.00 40.71 ? 953  TRP A CB  1 
ATOM   1543 C CG  . TRP A 1 190 ? 38.678  8.186  -1.366  1.00 44.65 ? 953  TRP A CG  1 
ATOM   1544 C CD1 . TRP A 1 190 ? 39.142  7.663  -0.203  1.00 47.56 ? 953  TRP A CD1 1 
ATOM   1545 C CD2 . TRP A 1 190 ? 39.423  9.409  -1.589  1.00 48.22 ? 953  TRP A CD2 1 
ATOM   1546 N NE1 . TRP A 1 190 ? 40.104  8.490  0.332   1.00 50.05 ? 953  TRP A NE1 1 
ATOM   1547 C CE2 . TRP A 1 190 ? 40.298  9.568  -0.496  1.00 50.00 ? 953  TRP A CE2 1 
ATOM   1548 C CE3 . TRP A 1 190 ? 39.422  10.397 -2.591  1.00 49.76 ? 953  TRP A CE3 1 
ATOM   1549 C CZ2 . TRP A 1 190 ? 41.166  10.678 -0.370  1.00 51.00 ? 953  TRP A CZ2 1 
ATOM   1550 C CZ3 . TRP A 1 190 ? 40.284  11.493 -2.473  1.00 50.20 ? 953  TRP A CZ3 1 
ATOM   1551 C CH2 . TRP A 1 190 ? 41.147  11.616 -1.376  1.00 51.14 ? 953  TRP A CH2 1 
ATOM   1552 N N   . PRO A 1 191 ? 34.441  7.403  -1.022  1.00 35.69 ? 954  PRO A N   1 
ATOM   1553 C CA  . PRO A 1 191 ? 33.280  7.559  -0.131  1.00 34.74 ? 954  PRO A CA  1 
ATOM   1554 C C   . PRO A 1 191 ? 33.556  7.418  1.365   1.00 33.53 ? 954  PRO A C   1 
ATOM   1555 O O   . PRO A 1 191 ? 32.891  8.094  2.139   1.00 32.95 ? 954  PRO A O   1 
ATOM   1556 C CB  . PRO A 1 191 ? 32.334  6.435  -0.586  1.00 34.87 ? 954  PRO A CB  1 
ATOM   1557 C CG  . PRO A 1 191 ? 32.809  6.057  -1.916  1.00 35.48 ? 954  PRO A CG  1 
ATOM   1558 C CD  . PRO A 1 191 ? 34.293  6.221  -1.893  1.00 35.54 ? 954  PRO A CD  1 
ATOM   1559 N N   . THR A 1 192 ? 34.480  6.543  1.753   1.00 32.03 ? 955  THR A N   1 
ATOM   1560 C CA  . THR A 1 192 ? 34.743  6.265  3.169   1.00 31.21 ? 955  THR A CA  1 
ATOM   1561 C C   . THR A 1 192 ? 35.426  7.472  3.809   1.00 29.59 ? 955  THR A C   1 
ATOM   1562 O O   . THR A 1 192 ? 35.159  7.822  4.970   1.00 30.12 ? 955  THR A O   1 
ATOM   1563 C CB  . THR A 1 192 ? 35.592  4.957  3.295   1.00 31.16 ? 955  THR A CB  1 
ATOM   1564 O OG1 . THR A 1 192 ? 34.853  3.850  2.763   1.00 32.18 ? 955  THR A OG1 1 
ATOM   1565 C CG2 . THR A 1 192 ? 35.812  4.552  4.739   1.00 31.10 ? 955  THR A CG2 1 
ATOM   1566 N N   . GLU A 1 193 ? 36.284  8.125  3.028   1.00 27.92 ? 956  GLU A N   1 
ATOM   1567 C CA  . GLU A 1 193 ? 36.982  9.319  3.474   1.00 26.38 ? 956  GLU A CA  1 
ATOM   1568 C C   . GLU A 1 193 ? 36.028  10.502 3.537   1.00 25.62 ? 956  GLU A C   1 
ATOM   1569 O O   . GLU A 1 193 ? 36.033  11.244 4.535   1.00 22.24 ? 956  GLU A O   1 
ATOM   1570 C CB  . GLU A 1 193 ? 38.169  9.631  2.569   1.00 26.55 ? 956  GLU A CB  1 
ATOM   1571 C CG  . GLU A 1 193 ? 38.760  11.022 2.719   1.00 26.52 ? 956  GLU A CG  1 
ATOM   1572 C CD  . GLU A 1 193 ? 39.594  11.189 3.969   1.00 28.46 ? 956  GLU A CD  1 
ATOM   1573 O OE1 . GLU A 1 193 ? 40.226  12.255 4.086   1.00 27.89 ? 956  GLU A OE1 1 
ATOM   1574 O OE2 . GLU A 1 193 ? 39.629  10.262 4.817   1.00 29.84 ? 956  GLU A OE2 1 
ATOM   1575 N N   . ARG A 1 194 ? 35.213  10.661 2.496   1.00 24.50 ? 957  ARG A N   1 
ATOM   1576 C CA  . ARG A 1 194 ? 34.234  11.738 2.430   1.00 25.82 ? 957  ARG A CA  1 
ATOM   1577 C C   . ARG A 1 194 ? 33.196  11.643 3.535   1.00 25.73 ? 957  ARG A C   1 
ATOM   1578 O O   . ARG A 1 194 ? 32.828  12.662 4.116   1.00 24.23 ? 957  ARG A O   1 
ATOM   1579 C CB  . ARG A 1 194 ? 33.521  11.793 1.081   1.00 26.76 ? 957  ARG A CB  1 
ATOM   1580 C CG  . ARG A 1 194 ? 32.384  12.839 0.980   1.00 28.87 ? 957  ARG A CG  1 
ATOM   1581 C CD  . ARG A 1 194 ? 31.257  12.465 0.009   1.00 32.48 ? 957  ARG A CD  1 
ATOM   1582 N NE  . ARG A 1 194 ? 31.584  12.879 -1.350  1.00 34.51 ? 957  ARG A NE  1 
ATOM   1583 C CZ  . ARG A 1 194 ? 31.716  12.060 -2.413  1.00 38.02 ? 957  ARG A CZ  1 
ATOM   1584 N NH1 . ARG A 1 194 ? 31.539  10.732 -2.325  1.00 38.56 ? 957  ARG A NH1 1 
ATOM   1585 N NH2 . ARG A 1 194 ? 32.020  12.583 -3.600  1.00 38.96 ? 957  ARG A NH2 1 
ATOM   1586 N N   . GLU A 1 195 ? 32.724  10.436 3.828   1.00 25.83 ? 958  GLU A N   1 
ATOM   1587 C CA  . GLU A 1 195 ? 31.741  10.271 4.903   1.00 26.12 ? 958  GLU A CA  1 
ATOM   1588 C C   . GLU A 1 195 ? 32.240  10.774 6.267   1.00 23.35 ? 958  GLU A C   1 
ATOM   1589 O O   . GLU A 1 195 ? 31.468  11.279 7.047   1.00 20.98 ? 958  GLU A O   1 
ATOM   1590 C CB  . GLU A 1 195 ? 31.282  8.817  5.034   1.00 27.78 ? 958  GLU A CB  1 
ATOM   1591 C CG  . GLU A 1 195 ? 29.775  8.639  5.249   1.00 31.88 ? 958  GLU A CG  1 
ATOM   1592 C CD  . GLU A 1 195 ? 28.919  9.723  4.585   1.00 34.59 ? 958  GLU A CD  1 
ATOM   1593 O OE1 . GLU A 1 195 ? 28.823  9.764  3.341   1.00 37.28 ? 958  GLU A OE1 1 
ATOM   1594 O OE2 . GLU A 1 195 ? 28.352  10.559 5.320   1.00 40.33 ? 958  GLU A OE2 1 
ATOM   1595 N N   . LYS A 1 196 ? 33.526  10.587 6.525   1.00 21.83 ? 959  LYS A N   1 
ATOM   1596 C CA  . LYS A 1 196 ? 34.155  10.996 7.753   1.00 21.59 ? 959  LYS A CA  1 
ATOM   1597 C C   . LYS A 1 196 ? 34.248  12.515 7.820   1.00 21.83 ? 959  LYS A C   1 
ATOM   1598 O O   . LYS A 1 196 ? 34.000  13.127 8.886   1.00 20.50 ? 959  LYS A O   1 
ATOM   1599 C CB  . LYS A 1 196 ? 35.560  10.417 7.839   1.00 21.68 ? 959  LYS A CB  1 
ATOM   1600 C CG  . LYS A 1 196 ? 35.586  8.945  8.166   1.00 23.24 ? 959  LYS A CG  1 
ATOM   1601 C CD  . LYS A 1 196 ? 36.921  8.332  7.772   1.00 23.49 ? 959  LYS A CD  1 
ATOM   1602 C CE  . LYS A 1 196 ? 36.854  6.802  7.804   1.00 24.48 ? 959  LYS A CE  1 
ATOM   1603 N NZ  . LYS A 1 196 ? 38.082  6.224  8.408   1.00 24.26 ? 959  LYS A NZ  1 
ATOM   1604 N N   . VAL A 1 197 ? 34.628  13.115 6.694   1.00 21.99 ? 960  VAL A N   1 
ATOM   1605 C CA  . VAL A 1 197 ? 34.769  14.559 6.608   1.00 22.92 ? 960  VAL A CA  1 
ATOM   1606 C C   . VAL A 1 197 ? 33.421  15.176 6.908   1.00 24.50 ? 960  VAL A C   1 
ATOM   1607 O O   . VAL A 1 197 ? 33.337  16.049 7.789   1.00 25.10 ? 960  VAL A O   1 
ATOM   1608 C CB  . VAL A 1 197 ? 35.309  15.039 5.242   1.00 22.80 ? 960  VAL A CB  1 
ATOM   1609 C CG1 . VAL A 1 197 ? 35.240  16.556 5.125   1.00 22.55 ? 960  VAL A CG1 1 
ATOM   1610 C CG2 . VAL A 1 197 ? 36.770  14.604 5.051   1.00 22.35 ? 960  VAL A CG2 1 
ATOM   1611 N N   . LYS A 1 198 ? 32.370  14.703 6.231   1.00 24.49 ? 961  LYS A N   1 
ATOM   1612 C CA  . LYS A 1 198 ? 31.019  15.245 6.444   1.00 26.48 ? 961  LYS A CA  1 
ATOM   1613 C C   . LYS A 1 198 ? 30.487  14.999 7.855   1.00 26.95 ? 961  LYS A C   1 
ATOM   1614 O O   . LYS A 1 198 ? 29.695  15.801 8.353   1.00 26.71 ? 961  LYS A O   1 
ATOM   1615 C CB  . LYS A 1 198 ? 30.021  14.693 5.433   1.00 27.21 ? 961  LYS A CB  1 
ATOM   1616 C CG  . LYS A 1 198 ? 30.202  15.273 4.050   1.00 29.28 ? 961  LYS A CG  1 
ATOM   1617 C CD  . LYS A 1 198 ? 29.248  14.644 3.028   1.00 32.78 ? 961  LYS A CD  1 
ATOM   1618 C CE  . LYS A 1 198 ? 27.863  15.310 3.029   1.00 34.13 ? 961  LYS A CE  1 
ATOM   1619 N NZ  . LYS A 1 198 ? 27.051  14.823 1.852   1.00 35.04 ? 961  LYS A NZ  1 
ATOM   1620 N N   . LYS A 1 199 ? 30.910  13.902 8.492   1.00 26.39 ? 962  LYS A N   1 
ATOM   1621 C CA  . LYS A 1 199 ? 30.491  13.618 9.862   1.00 26.70 ? 962  LYS A CA  1 
ATOM   1622 C C   . LYS A 1 199 ? 31.097  14.681 10.819  1.00 25.90 ? 962  LYS A C   1 
ATOM   1623 O O   . LYS A 1 199 ? 30.382  15.266 11.625  1.00 25.29 ? 962  LYS A O   1 
ATOM   1624 C CB  . LYS A 1 199 ? 30.878  12.184 10.270  1.00 27.78 ? 962  LYS A CB  1 
ATOM   1625 C CG  . LYS A 1 199 ? 30.662  11.805 11.772  1.00 27.59 ? 962  LYS A CG  1 
ATOM   1626 C CD  . LYS A 1 199 ? 30.453  10.291 11.939  1.00 29.73 ? 962  LYS A CD  1 
ATOM   1627 C CE  . LYS A 1 199 ? 31.110  9.691  13.208  1.00 30.09 ? 962  LYS A CE  1 
ATOM   1628 N NZ  . LYS A 1 199 ? 30.806  10.460 14.441  1.00 32.40 ? 962  LYS A NZ  1 
ATOM   1629 N N   . ALA A 1 200 ? 32.406  14.914 10.692  1.00 24.86 ? 963  ALA A N   1 
ATOM   1630 C CA  . ALA A 1 200 ? 33.122  15.956 11.408  1.00 24.42 ? 963  ALA A CA  1 
ATOM   1631 C C   . ALA A 1 200 ? 32.522  17.333 11.155  1.00 24.50 ? 963  ALA A C   1 
ATOM   1632 O O   . ALA A 1 200 ? 32.379  18.118 12.069  1.00 23.77 ? 963  ALA A O   1 
ATOM   1633 C CB  . ALA A 1 200 ? 34.614  15.940 11.025  1.00 24.81 ? 963  ALA A CB  1 
ATOM   1634 N N   . ALA A 1 201 ? 32.121  17.603 9.916   1.00 24.97 ? 964  ALA A N   1 
ATOM   1635 C CA  . ALA A 1 201 ? 31.460  18.860 9.590   1.00 23.82 ? 964  ALA A CA  1 
ATOM   1636 C C   . ALA A 1 201 ? 30.171  19.020 10.390  1.00 23.31 ? 964  ALA A C   1 
ATOM   1637 O O   . ALA A 1 201 ? 29.930  20.098 10.915  1.00 20.86 ? 964  ALA A O   1 
ATOM   1638 C CB  . ALA A 1 201 ? 31.168  18.957 8.074   1.00 22.97 ? 964  ALA A CB  1 
ATOM   1639 N N   . ASP A 1 202 ? 29.350  17.957 10.471  1.00 23.60 ? 965  ASP A N   1 
ATOM   1640 C CA  . ASP A 1 202 ? 28.115  17.999 11.259  1.00 23.98 ? 965  ASP A CA  1 
ATOM   1641 C C   . ASP A 1 202 ? 28.367  18.178 12.756  1.00 23.35 ? 965  ASP A C   1 
ATOM   1642 O O   . ASP A 1 202 ? 27.648  18.922 13.398  1.00 23.02 ? 965  ASP A O   1 
ATOM   1643 C CB  . ASP A 1 202 ? 27.251  16.751 11.068  1.00 25.28 ? 965  ASP A CB  1 
ATOM   1644 C CG  . ASP A 1 202 ? 26.606  16.696 9.722   1.00 27.58 ? 965  ASP A CG  1 
ATOM   1645 O OD1 . ASP A 1 202 ? 26.637  17.710 8.977   1.00 30.04 ? 965  ASP A OD1 1 
ATOM   1646 O OD2 . ASP A 1 202 ? 26.049  15.658 9.316   1.00 31.02 ? 965  ASP A OD2 1 
ATOM   1647 N N   . HIS A 1 203 ? 29.366  17.487 13.296  1.00 22.85 ? 966  HIS A N   1 
ATOM   1648 C CA  . HIS A 1 203 ? 29.831  17.761 14.658  1.00 22.46 ? 966  HIS A CA  1 
ATOM   1649 C C   . HIS A 1 203 ? 30.200  19.237 14.810  1.00 22.15 ? 966  HIS A C   1 
ATOM   1650 O O   . HIS A 1 203 ? 29.802  19.866 15.789  1.00 21.19 ? 966  HIS A O   1 
ATOM   1651 C CB  . HIS A 1 203 ? 31.004  16.869 15.058  1.00 21.41 ? 966  HIS A CB  1 
ATOM   1652 C CG  . HIS A 1 203 ? 30.612  15.463 15.414  1.00 24.01 ? 966  HIS A CG  1 
ATOM   1653 N ND1 . HIS A 1 203 ? 29.910  15.144 16.561  1.00 24.22 ? 966  HIS A ND1 1 
ATOM   1654 C CD2 . HIS A 1 203 ? 30.860  14.283 14.790  1.00 25.84 ? 966  HIS A CD2 1 
ATOM   1655 C CE1 . HIS A 1 203 ? 29.716  13.835 16.610  1.00 24.06 ? 966  HIS A CE1 1 
ATOM   1656 N NE2 . HIS A 1 203 ? 30.289  13.287 15.552  1.00 26.13 ? 966  HIS A NE2 1 
ATOM   1657 N N   . CYS A 1 204 ? 30.918  19.821 13.850  1.00 22.15 ? 967  CYS A N   1 
ATOM   1658 C CA  . CYS A 1 204 ? 31.300  21.238 14.006  1.00 22.57 ? 967  CYS A CA  1 
ATOM   1659 C C   . CYS A 1 204 ? 30.028  22.080 14.103  1.00 22.26 ? 967  CYS A C   1 
ATOM   1660 O O   . CYS A 1 204 ? 29.938  23.013 14.887  1.00 21.74 ? 967  CYS A O   1 
ATOM   1661 C CB  . CYS A 1 204 ? 32.197  21.732 12.880  1.00 21.02 ? 967  CYS A CB  1 
ATOM   1662 S SG  . CYS A 1 204 ? 33.877  21.157 13.008  1.00 22.37 ? 967  CYS A SG  1 
ATOM   1663 N N   . ARG A 1 205 ? 29.029  21.704 13.332  1.00 23.18 ? 968  ARG A N   1 
ATOM   1664 C CA  . ARG A 1 205 ? 27.731  22.358 13.403  1.00 24.62 ? 968  ARG A CA  1 
ATOM   1665 C C   . ARG A 1 205 ? 27.079  22.176 14.760  1.00 24.31 ? 968  ARG A C   1 
ATOM   1666 O O   . ARG A 1 205 ? 26.571  23.132 15.297  1.00 24.28 ? 968  ARG A O   1 
ATOM   1667 C CB  . ARG A 1 205 ? 26.807  21.861 12.286  1.00 26.04 ? 968  ARG A CB  1 
ATOM   1668 C CG  . ARG A 1 205 ? 26.548  22.923 11.228  1.00 28.42 ? 968  ARG A CG  1 
ATOM   1669 C CD  . ARG A 1 205 ? 25.766  22.438 10.024  1.00 31.78 ? 968  ARG A CD  1 
ATOM   1670 N NE  . ARG A 1 205 ? 26.583  22.780 8.877   1.00 34.69 ? 968  ARG A NE  1 
ATOM   1671 C CZ  . ARG A 1 205 ? 27.185  21.922 8.071   1.00 33.01 ? 968  ARG A CZ  1 
ATOM   1672 N NH1 . ARG A 1 205 ? 27.046  20.601 8.185   1.00 34.99 ? 968  ARG A NH1 1 
ATOM   1673 N NH2 . ARG A 1 205 ? 27.926  22.413 7.121   1.00 31.33 ? 968  ARG A NH2 1 
ATOM   1674 N N   . GLN A 1 206 ? 27.101  20.959 15.312  1.00 24.94 ? 969  GLN A N   1 
ATOM   1675 C CA  . GLN A 1 206 ? 26.632  20.712 16.691  1.00 25.80 ? 969  GLN A CA  1 
ATOM   1676 C C   . GLN A 1 206 ? 27.352  21.597 17.725  1.00 23.83 ? 969  GLN A C   1 
ATOM   1677 O O   . GLN A 1 206 ? 26.719  22.149 18.586  1.00 24.48 ? 969  GLN A O   1 
ATOM   1678 C CB  . GLN A 1 206 ? 26.850  19.252 17.099  1.00 27.41 ? 969  GLN A CB  1 
ATOM   1679 C CG  . GLN A 1 206 ? 25.737  18.265 16.720  1.00 32.17 ? 969  GLN A CG  1 
ATOM   1680 C CD  . GLN A 1 206 ? 26.005  16.860 17.283  1.00 33.99 ? 969  GLN A CD  1 
ATOM   1681 O OE1 . GLN A 1 206 ? 25.915  15.873 16.545  1.00 39.43 ? 969  GLN A OE1 1 
ATOM   1682 N NE2 . GLN A 1 206 ? 26.385  16.779 18.571  1.00 35.24 ? 969  GLN A NE2 1 
ATOM   1683 N N   . ILE A 1 207 ? 28.674  21.670 17.642  1.00 21.96 ? 970  ILE A N   1 
ATOM   1684 C CA  . ILE A 1 207 ? 29.493  22.514 18.512  1.00 23.24 ? 970  ILE A CA  1 
ATOM   1685 C C   . ILE A 1 207 ? 29.071  23.983 18.428  1.00 23.37 ? 970  ILE A C   1 
ATOM   1686 O O   . ILE A 1 207 ? 28.901  24.651 19.437  1.00 24.52 ? 970  ILE A O   1 
ATOM   1687 C CB  . ILE A 1 207 ? 30.962  22.407 18.125  1.00 21.64 ? 970  ILE A CB  1 
ATOM   1688 C CG1 . ILE A 1 207 ? 31.539  21.073 18.548  1.00 22.78 ? 970  ILE A CG1 1 
ATOM   1689 C CG2 . ILE A 1 207 ? 31.757  23.519 18.720  1.00 23.43 ? 970  ILE A CG2 1 
ATOM   1690 C CD1 . ILE A 1 207 ? 32.981  20.793 17.986  1.00 21.49 ? 970  ILE A CD1 1 
ATOM   1691 N N   . LEU A 1 208 ? 28.941  24.479 17.213  1.00 23.14 ? 971  LEU A N   1 
ATOM   1692 C CA  . LEU A 1 208 ? 28.534  25.835 16.993  1.00 23.74 ? 971  LEU A CA  1 
ATOM   1693 C C   . LEU A 1 208 ? 27.175  26.070 17.636  1.00 25.30 ? 971  LEU A C   1 
ATOM   1694 O O   . LEU A 1 208 ? 27.032  27.044 18.358  1.00 25.84 ? 971  LEU A O   1 
ATOM   1695 C CB  . LEU A 1 208 ? 28.473  26.147 15.494  1.00 24.09 ? 971  LEU A CB  1 
ATOM   1696 C CG  . LEU A 1 208 ? 27.875  27.476 15.063  1.00 24.03 ? 971  LEU A CG  1 
ATOM   1697 C CD1 . LEU A 1 208 ? 28.649  28.634 15.646  1.00 22.90 ? 971  LEU A CD1 1 
ATOM   1698 C CD2 . LEU A 1 208 ? 27.741  27.563 13.470  1.00 26.28 ? 971  LEU A CD2 1 
ATOM   1699 N N   . ASN A 1 209 ? 26.191  25.201 17.369  1.00 25.14 ? 972  ASN A N   1 
ATOM   1700 C CA  . ASN A 1 209 ? 24.872  25.334 17.976  1.00 26.09 ? 972  ASN A CA  1 
ATOM   1701 C C   . ASN A 1 209 ? 24.866  25.345 19.507  1.00 25.73 ? 972  ASN A C   1 
ATOM   1702 O O   . ASN A 1 209 ? 24.043  26.044 20.091  1.00 24.59 ? 972  ASN A O   1 
ATOM   1703 C CB  . ASN A 1 209 ? 23.914  24.238 17.479  1.00 27.47 ? 972  ASN A CB  1 
ATOM   1704 C CG  . ASN A 1 209 ? 23.582  24.383 16.011  1.00 30.31 ? 972  ASN A CG  1 
ATOM   1705 O OD1 . ASN A 1 209 ? 23.652  23.410 15.248  1.00 34.16 ? 972  ASN A OD1 1 
ATOM   1706 N ND2 . ASN A 1 209 ? 23.218  25.597 15.599  1.00 33.30 ? 972  ASN A ND2 1 
ATOM   1707 N N   . PHE A 1 210 ? 25.773  24.578 20.137  1.00 25.81 ? 973  PHE A N   1 
ATOM   1708 C CA  . PHE A 1 210 ? 25.909  24.518 21.603  1.00 25.89 ? 973  PHE A CA  1 
ATOM   1709 C C   . PHE A 1 210 ? 26.503  25.821 22.079  1.00 24.40 ? 973  PHE A C   1 
ATOM   1710 O O   . PHE A 1 210 ? 26.161  26.348 23.119  1.00 22.93 ? 973  PHE A O   1 
ATOM   1711 C CB  . PHE A 1 210 ? 26.844  23.353 22.005  1.00 26.85 ? 973  PHE A CB  1 
ATOM   1712 C CG  . PHE A 1 210 ? 27.097  23.207 23.520  1.00 26.82 ? 973  PHE A CG  1 
ATOM   1713 C CD1 . PHE A 1 210 ? 28.179  23.813 24.124  1.00 27.98 ? 973  PHE A CD1 1 
ATOM   1714 C CD2 . PHE A 1 210 ? 26.257  22.404 24.308  1.00 28.57 ? 973  PHE A CD2 1 
ATOM   1715 C CE1 . PHE A 1 210 ? 28.432  23.651 25.520  1.00 28.41 ? 973  PHE A CE1 1 
ATOM   1716 C CE2 . PHE A 1 210 ? 26.484  22.233 25.685  1.00 26.46 ? 973  PHE A CE2 1 
ATOM   1717 C CZ  . PHE A 1 210 ? 27.588  22.876 26.295  1.00 28.51 ? 973  PHE A CZ  1 
ATOM   1718 N N   . VAL A 1 211 ? 27.467  26.330 21.338  1.00 24.59 ? 974  VAL A N   1 
ATOM   1719 C CA  . VAL A 1 211 ? 28.060  27.592 21.726  1.00 21.26 ? 974  VAL A CA  1 
ATOM   1720 C C   . VAL A 1 211 ? 27.037  28.706 21.556  1.00 20.07 ? 974  VAL A C   1 
ATOM   1721 O O   . VAL A 1 211 ? 26.777  29.445 22.488  1.00 18.16 ? 974  VAL A O   1 
ATOM   1722 C CB  . VAL A 1 211 ? 29.312  27.854 21.006  1.00 19.05 ? 974  VAL A CB  1 
ATOM   1723 C CG1 . VAL A 1 211 ? 29.772  29.333 21.249  1.00 20.08 ? 974  VAL A CG1 1 
ATOM   1724 C CG2 . VAL A 1 211 ? 30.327  26.868 21.528  1.00 21.08 ? 974  VAL A CG2 1 
ATOM   1725 N N   . ASN A 1 212 ? 26.415  28.780 20.395  1.00 22.32 ? 975  ASN A N   1 
ATOM   1726 C CA  . ASN A 1 212 ? 25.363  29.777 20.153  1.00 24.30 ? 975  ASN A CA  1 
ATOM   1727 C C   . ASN A 1 212 ? 24.244  29.822 21.185  1.00 26.60 ? 975  ASN A C   1 
ATOM   1728 O O   . ASN A 1 212 ? 23.639  30.871 21.391  1.00 28.20 ? 975  ASN A O   1 
ATOM   1729 C CB  . ASN A 1 212 ? 24.721  29.605 18.761  1.00 22.91 ? 975  ASN A CB  1 
ATOM   1730 C CG  . ASN A 1 212 ? 25.553  30.239 17.645  1.00 23.05 ? 975  ASN A CG  1 
ATOM   1731 O OD1 . ASN A 1 212 ? 26.469  31.042 17.898  1.00 24.91 ? 975  ASN A OD1 1 
ATOM   1732 N ND2 . ASN A 1 212 ? 25.266  29.856 16.409  1.00 23.43 ? 975  ASN A ND2 1 
ATOM   1733 N N   . GLN A 1 213 ? 23.917  28.686 21.788  1.00 27.51 ? 976  GLN A N   1 
ATOM   1734 C CA  . GLN A 1 213 ? 22.755  28.616 22.672  1.00 26.92 ? 976  GLN A CA  1 
ATOM   1735 C C   . GLN A 1 213 ? 23.185  29.168 24.041  1.00 24.39 ? 976  GLN A C   1 
ATOM   1736 O O   . GLN A 1 213 ? 22.455  29.866 24.712  1.00 20.23 ? 976  GLN A O   1 
ATOM   1737 C CB  . GLN A 1 213 ? 22.242  27.158 22.711  1.00 28.65 ? 976  GLN A CB  1 
ATOM   1738 C CG  . GLN A 1 213 ? 20.984  26.873 23.494  1.00 31.24 ? 976  GLN A CG  1 
ATOM   1739 C CD  . GLN A 1 213 ? 19.936  27.968 23.374  1.00 33.87 ? 976  GLN A CD  1 
ATOM   1740 O OE1 . GLN A 1 213 ? 19.435  28.227 22.276  1.00 35.68 ? 976  GLN A OE1 1 
ATOM   1741 N NE2 . GLN A 1 213 ? 19.610  28.619 24.501  1.00 33.06 ? 976  GLN A NE2 1 
ATOM   1742 N N   . ALA A 1 214 ? 24.422  28.872 24.415  1.00 23.23 ? 977  ALA A N   1 
ATOM   1743 C CA  . ALA A 1 214 ? 25.004  29.400 25.620  1.00 22.34 ? 977  ALA A CA  1 
ATOM   1744 C C   . ALA A 1 214 ? 25.108  30.913 25.506  1.00 22.25 ? 977  ALA A C   1 
ATOM   1745 O O   . ALA A 1 214 ? 24.944  31.610 26.489  1.00 24.93 ? 977  ALA A O   1 
ATOM   1746 C CB  . ALA A 1 214 ? 26.409  28.772 25.857  1.00 22.63 ? 977  ALA A CB  1 
ATOM   1747 N N   . VAL A 1 215 ? 25.396  31.413 24.309  1.00 22.12 ? 978  VAL A N   1 
ATOM   1748 C CA  . VAL A 1 215 ? 25.573  32.845 24.076  1.00 21.63 ? 978  VAL A CA  1 
ATOM   1749 C C   . VAL A 1 215 ? 24.247  33.518 24.282  1.00 23.48 ? 978  VAL A C   1 
ATOM   1750 O O   . VAL A 1 215 ? 24.172  34.476 25.033  1.00 23.74 ? 978  VAL A O   1 
ATOM   1751 C CB  . VAL A 1 215 ? 26.216  33.176 22.639  1.00 22.92 ? 978  VAL A CB  1 
ATOM   1752 C CG1 . VAL A 1 215 ? 26.016  34.650 22.223  1.00 23.28 ? 978  VAL A CG1 1 
ATOM   1753 C CG2 . VAL A 1 215 ? 27.757  32.875 22.628  1.00 20.97 ? 978  VAL A CG2 1 
ATOM   1754 N N   . LYS A 1 216 ? 23.199  32.986 23.658  1.00 23.83 ? 979  LYS A N   1 
ATOM   1755 C CA  . LYS A 1 216 ? 21.837  33.477 23.848  1.00 25.34 ? 979  LYS A CA  1 
ATOM   1756 C C   . LYS A 1 216 ? 21.472  33.515 25.352  1.00 25.66 ? 979  LYS A C   1 
ATOM   1757 O O   . LYS A 1 216 ? 21.123  34.567 25.864  1.00 25.49 ? 979  LYS A O   1 
ATOM   1758 C CB  . LYS A 1 216 ? 20.855  32.618 23.041  1.00 25.43 ? 979  LYS A CB  1 
ATOM   1759 C CG  . LYS A 1 216 ? 19.383  33.089 23.026  1.00 26.70 ? 979  LYS A CG  1 
ATOM   1760 C CD  . LYS A 1 216 ? 18.589  32.415 21.912  1.00 30.48 ? 979  LYS A CD  1 
ATOM   1761 C CE  . LYS A 1 216 ? 17.059  32.568 22.101  1.00 31.43 ? 979  LYS A CE  1 
ATOM   1762 N NZ  . LYS A 1 216 ? 16.243  31.786 21.079  1.00 34.58 ? 979  LYS A NZ  1 
ATOM   1763 N N   . GLU A 1 217 ? 21.611  32.387 26.055  1.00 26.72 ? 980  GLU A N   1 
ATOM   1764 C CA  . GLU A 1 217 ? 21.330  32.321 27.499  1.00 27.59 ? 980  GLU A CA  1 
ATOM   1765 C C   . GLU A 1 217 ? 22.057  33.459 28.174  1.00 26.79 ? 980  GLU A C   1 
ATOM   1766 O O   . GLU A 1 217 ? 21.461  34.238 28.896  1.00 27.28 ? 980  GLU A O   1 
ATOM   1767 C CB  . GLU A 1 217 ? 21.662  30.924 28.123  1.00 29.47 ? 980  GLU A CB  1 
ATOM   1768 C CG  . GLU A 1 217 ? 20.424  30.015 28.369  1.00 33.86 ? 980  GLU A CG  1 
ATOM   1769 C CD  . GLU A 1 217 ? 20.595  28.507 28.067  1.00 36.43 ? 980  GLU A CD  1 
ATOM   1770 O OE1 . GLU A 1 217 ? 21.581  27.891 28.519  1.00 40.19 ? 980  GLU A OE1 1 
ATOM   1771 O OE2 . GLU A 1 217 ? 19.724  27.907 27.392  1.00 35.21 ? 980  GLU A OE2 1 
ATOM   1772 N N   . ALA A 1 218 ? 23.347  33.616 27.893  1.00 27.21 ? 981  ALA A N   1 
ATOM   1773 C CA  . ALA A 1 218 ? 24.130  34.658 28.523  1.00 25.02 ? 981  ALA A CA  1 
ATOM   1774 C C   . ALA A 1 218 ? 23.761  36.102 28.123  1.00 25.30 ? 981  ALA A C   1 
ATOM   1775 O O   . ALA A 1 218 ? 23.748  36.964 28.959  1.00 25.31 ? 981  ALA A O   1 
ATOM   1776 C CB  . ALA A 1 218 ? 25.625  34.411 28.308  1.00 24.96 ? 981  ALA A CB  1 
ATOM   1777 N N   . GLU A 1 219 ? 23.514  36.404 26.863  1.00 25.50 ? 982  GLU A N   1 
ATOM   1778 C CA  . GLU A 1 219 ? 23.043  37.747 26.530  1.00 28.59 ? 982  GLU A CA  1 
ATOM   1779 C C   . GLU A 1 219 ? 21.741  38.123 27.294  1.00 30.08 ? 982  GLU A C   1 
ATOM   1780 O O   . GLU A 1 219 ? 21.519  39.303 27.620  1.00 31.84 ? 982  GLU A O   1 
ATOM   1781 C CB  . GLU A 1 219 ? 22.753  37.848 25.017  1.00 29.39 ? 982  GLU A CB  1 
ATOM   1782 C CG  . GLU A 1 219 ? 24.034  37.830 24.174  1.00 32.55 ? 982  GLU A CG  1 
ATOM   1783 C CD  . GLU A 1 219 ? 23.738  37.766 22.687  1.00 33.76 ? 982  GLU A CD  1 
ATOM   1784 O OE1 . GLU A 1 219 ? 24.574  38.219 21.874  1.00 35.53 ? 982  GLU A OE1 1 
ATOM   1785 O OE2 . GLU A 1 219 ? 22.679  37.234 22.334  1.00 33.18 ? 982  GLU A OE2 1 
ATOM   1786 N N   . ASN A 1 220 ? 20.867  37.148 27.554  1.00 28.99 ? 983  ASN A N   1 
ATOM   1787 C CA  . ASN A 1 220 ? 19.646  37.421 28.307  1.00 27.90 ? 983  ASN A CA  1 
ATOM   1788 C C   . ASN A 1 220 ? 19.981  37.776 29.740  1.00 27.63 ? 983  ASN A C   1 
ATOM   1789 O O   . ASN A 1 220 ? 19.440  38.748 30.244  1.00 26.42 ? 983  ASN A O   1 
ATOM   1790 C CB  . ASN A 1 220 ? 18.637  36.248 28.236  1.00 28.35 ? 983  ASN A CB  1 
ATOM   1791 C CG  . ASN A 1 220 ? 17.218  36.626 28.769  1.00 28.45 ? 983  ASN A CG  1 
ATOM   1792 O OD1 . ASN A 1 220 ? 17.053  37.431 29.707  1.00 31.50 ? 983  ASN A OD1 1 
ATOM   1793 N ND2 . ASN A 1 220 ? 16.199  36.021 28.180  1.00 31.30 ? 983  ASN A ND2 1 
ATOM   1794 N N   . LYS A 1 221 ? 20.921  37.058 30.376  1.00 28.53 ? 984  LYS A N   1 
ATOM   1795 C CA  . LYS A 1 221 ? 21.311  37.352 31.758  1.00 29.85 ? 984  LYS A CA  1 
ATOM   1796 C C   . LYS A 1 221 ? 22.040  38.677 31.914  1.00 30.58 ? 984  LYS A C   1 
ATOM   1797 O O   . LYS A 1 221 ? 21.914  39.320 32.953  1.00 28.95 ? 984  LYS A O   1 
ATOM   1798 C CB  . LYS A 1 221 ? 22.231  36.264 32.361  1.00 32.30 ? 984  LYS A CB  1 
ATOM   1799 C CG  . LYS A 1 221 ? 21.515  34.921 32.550  1.00 35.47 ? 984  LYS A CG  1 
ATOM   1800 C CD  . LYS A 1 221 ? 22.507  33.776 32.845  1.00 37.41 ? 984  LYS A CD  1 
ATOM   1801 C CE  . LYS A 1 221 ? 21.904  32.412 32.513  1.00 37.90 ? 984  LYS A CE  1 
ATOM   1802 N NZ  . LYS A 1 221 ? 22.161  31.419 33.599  1.00 39.19 ? 984  LYS A NZ  1 
ATOM   1803 N N   . GLN A 1 222 ? 22.865  39.045 30.931  1.00 30.36 ? 985  GLN A N   1 
ATOM   1804 C CA  . GLN A 1 222 ? 23.666  40.261 31.038  1.00 28.53 ? 985  GLN A CA  1 
ATOM   1805 C C   . GLN A 1 222 ? 22.747  41.492 30.828  1.00 29.00 ? 985  GLN A C   1 
ATOM   1806 O O   . GLN A 1 222 ? 22.941  42.576 31.422  1.00 26.25 ? 985  GLN A O   1 
ATOM   1807 C CB  . GLN A 1 222 ? 24.851  40.202 30.070  1.00 28.07 ? 985  GLN A CB  1 
ATOM   1808 C CG  . GLN A 1 222 ? 25.928  41.295 30.282  1.00 26.70 ? 985  GLN A CG  1 
ATOM   1809 C CD  . GLN A 1 222 ? 25.466  42.643 29.720  1.00 29.03 ? 985  GLN A CD  1 
ATOM   1810 O OE1 . GLN A 1 222 ? 24.923  42.700 28.596  1.00 33.24 ? 985  GLN A OE1 1 
ATOM   1811 N NE2 . GLN A 1 222 ? 25.575  43.698 30.522  1.00 25.85 ? 985  GLN A NE2 1 
ATOM   1812 N N   . ARG A 1 223 ? 21.693  41.316 30.035  1.00 29.44 ? 986  ARG A N   1 
ATOM   1813 C CA  . ARG A 1 223 ? 20.708  42.381 29.884  1.00 30.35 ? 986  ARG A CA  1 
ATOM   1814 C C   . ARG A 1 223 ? 20.044  42.669 31.216  1.00 31.27 ? 986  ARG A C   1 
ATOM   1815 O O   . ARG A 1 223 ? 19.957  43.808 31.652  1.00 29.47 ? 986  ARG A O   1 
ATOM   1816 C CB  . ARG A 1 223 ? 19.660  41.994 28.881  1.00 31.38 ? 986  ARG A CB  1 
ATOM   1817 C CG  . ARG A 1 223 ? 19.995  42.401 27.476  1.00 33.36 ? 986  ARG A CG  1 
ATOM   1818 C CD  . ARG A 1 223 ? 18.754  42.362 26.572  1.00 33.62 ? 986  ARG A CD  1 
ATOM   1819 N NE  . ARG A 1 223 ? 18.164  41.016 26.557  1.00 36.19 ? 986  ARG A NE  1 
ATOM   1820 C CZ  . ARG A 1 223 ? 18.430  40.025 25.667  1.00 37.49 ? 986  ARG A CZ  1 
ATOM   1821 N NH1 . ARG A 1 223 ? 19.308  40.176 24.675  1.00 36.22 ? 986  ARG A NH1 1 
ATOM   1822 N NH2 . ARG A 1 223 ? 17.789  38.856 25.773  1.00 38.61 ? 986  ARG A NH2 1 
ATOM   1823 N N   . LEU A 1 224 ? 19.588  41.608 31.863  1.00 33.91 ? 987  LEU A N   1 
ATOM   1824 C CA  . LEU A 1 224 ? 19.044  41.699 33.209  1.00 35.62 ? 987  LEU A CA  1 
ATOM   1825 C C   . LEU A 1 224 ? 19.977  42.300 34.184  1.00 35.11 ? 987  LEU A C   1 
ATOM   1826 O O   . LEU A 1 224 ? 19.577  43.146 34.977  1.00 35.92 ? 987  LEU A O   1 
ATOM   1827 C CB  . LEU A 1 224 ? 18.650  40.307 33.707  1.00 38.12 ? 987  LEU A CB  1 
ATOM   1828 C CG  . LEU A 1 224 ? 17.217  39.898 33.390  1.00 40.86 ? 987  LEU A CG  1 
ATOM   1829 C CD1 . LEU A 1 224 ? 16.947  38.546 34.040  1.00 43.47 ? 987  LEU A CD1 1 
ATOM   1830 C CD2 . LEU A 1 224 ? 16.242  40.942 33.902  1.00 41.78 ? 987  LEU A CD2 1 
ATOM   1831 N N   . GLU A 1 225 ? 21.245  41.882 34.143  1.00 35.06 ? 988  GLU A N   1 
ATOM   1832 C CA  . GLU A 1 225 ? 22.227  42.355 35.129  1.00 33.70 ? 988  GLU A CA  1 
ATOM   1833 C C   . GLU A 1 225 ? 22.386  43.875 35.020  1.00 32.54 ? 988  GLU A C   1 
ATOM   1834 O O   . GLU A 1 225 ? 22.645  44.598 35.997  1.00 33.72 ? 988  GLU A O   1 
ATOM   1835 C CB  . GLU A 1 225 ? 23.563  41.652 34.842  1.00 35.30 ? 988  GLU A CB  1 
ATOM   1836 C CG  . GLU A 1 225 ? 24.610  41.842 35.880  1.00 36.58 ? 988  GLU A CG  1 
ATOM   1837 C CD  . GLU A 1 225 ? 25.804  40.930 35.608  1.00 39.49 ? 988  GLU A CD  1 
ATOM   1838 O OE1 . GLU A 1 225 ? 25.658  39.705 35.775  1.00 37.83 ? 988  GLU A OE1 1 
ATOM   1839 O OE2 . GLU A 1 225 ? 26.871  41.442 35.221  1.00 41.23 ? 988  GLU A OE2 1 
ATOM   1840 N N   . ASP A 1 226 ? 22.270  44.330 33.781  1.00 33.83 ? 989  ASP A N   1 
ATOM   1841 C CA  . ASP A 1 226 ? 22.239  45.745 33.419  1.00 34.48 ? 989  ASP A CA  1 
ATOM   1842 C C   . ASP A 1 226 ? 20.966  46.392 33.949  1.00 32.94 ? 989  ASP A C   1 
ATOM   1843 O O   . ASP A 1 226 ? 21.012  47.463 34.541  1.00 32.90 ? 989  ASP A O   1 
ATOM   1844 C CB  . ASP A 1 226 ? 22.265  45.903 31.883  1.00 34.42 ? 989  ASP A CB  1 
ATOM   1845 C CG  . ASP A 1 226 ? 22.522  47.346 31.455  1.00 36.68 ? 989  ASP A CG  1 
ATOM   1846 O OD1 . ASP A 1 226 ? 23.607  47.894 31.803  1.00 38.76 ? 989  ASP A OD1 1 
ATOM   1847 O OD2 . ASP A 1 226 ? 21.683  47.993 30.785  1.00 44.42 ? 989  ASP A OD2 1 
ATOM   1848 N N   . TYR A 1 227 ? 19.820  45.746 33.718  1.00 33.00 ? 990  TYR A N   1 
ATOM   1849 C CA  . TYR A 1 227 ? 18.571  46.295 34.229  1.00 32.76 ? 990  TYR A CA  1 
ATOM   1850 C C   . TYR A 1 227 ? 18.652  46.338 35.751  1.00 34.26 ? 990  TYR A C   1 
ATOM   1851 O O   . TYR A 1 227 ? 18.360  47.362 36.354  1.00 34.95 ? 990  TYR A O   1 
ATOM   1852 C CB  . TYR A 1 227 ? 17.401  45.459 33.748  1.00 31.13 ? 990  TYR A CB  1 
ATOM   1853 C CG  . TYR A 1 227 ? 17.169  45.509 32.262  1.00 30.48 ? 990  TYR A CG  1 
ATOM   1854 C CD1 . TYR A 1 227 ? 17.745  46.488 31.443  1.00 32.35 ? 990  TYR A CD1 1 
ATOM   1855 C CD2 . TYR A 1 227 ? 16.333  44.606 31.678  1.00 34.20 ? 990  TYR A CD2 1 
ATOM   1856 C CE1 . TYR A 1 227 ? 17.515  46.508 30.056  1.00 32.23 ? 990  TYR A CE1 1 
ATOM   1857 C CE2 . TYR A 1 227 ? 16.079  44.627 30.321  1.00 35.14 ? 990  TYR A CE2 1 
ATOM   1858 C CZ  . TYR A 1 227 ? 16.660  45.578 29.511  1.00 35.47 ? 990  TYR A CZ  1 
ATOM   1859 O OH  . TYR A 1 227 ? 16.352  45.545 28.153  1.00 38.72 ? 990  TYR A OH  1 
ATOM   1860 N N   . GLN A 1 228 ? 19.124  45.257 36.370  1.00 37.39 ? 991  GLN A N   1 
ATOM   1861 C CA  . GLN A 1 228 ? 19.234  45.197 37.837  1.00 39.48 ? 991  GLN A CA  1 
ATOM   1862 C C   . GLN A 1 228 ? 20.123  46.282 38.400  1.00 41.02 ? 991  GLN A C   1 
ATOM   1863 O O   . GLN A 1 228 ? 19.953  46.698 39.556  1.00 40.41 ? 991  GLN A O   1 
ATOM   1864 C CB  . GLN A 1 228 ? 19.757  43.828 38.317  1.00 39.84 ? 991  GLN A CB  1 
ATOM   1865 C CG  . GLN A 1 228 ? 19.875  43.659 39.879  1.00 40.22 ? 991  GLN A CG  1 
ATOM   1866 C CD  . GLN A 1 228 ? 18.523  43.791 40.621  1.00 41.66 ? 991  GLN A CD  1 
ATOM   1867 O OE1 . GLN A 1 228 ? 17.480  44.003 40.005  1.00 41.88 ? 991  GLN A OE1 1 
ATOM   1868 N NE2 . GLN A 1 228 ? 18.558  43.671 41.940  1.00 41.36 ? 991  GLN A NE2 1 
ATOM   1869 N N   . ARG A 1 229 ? 21.071  46.745 37.595  1.00 43.68 ? 992  ARG A N   1 
ATOM   1870 C CA  . ARG A 1 229 ? 21.999  47.798 38.037  1.00 46.61 ? 992  ARG A CA  1 
ATOM   1871 C C   . ARG A 1 229 ? 21.293  49.152 37.998  1.00 47.71 ? 992  ARG A C   1 
ATOM   1872 O O   . ARG A 1 229 ? 21.365  49.918 38.942  1.00 48.35 ? 992  ARG A O   1 
ATOM   1873 C CB  . ARG A 1 229 ? 23.249  47.810 37.147  1.00 47.08 ? 992  ARG A CB  1 
ATOM   1874 C CG  . ARG A 1 229 ? 24.443  48.564 37.702  1.00 48.74 ? 992  ARG A CG  1 
ATOM   1875 C CD  . ARG A 1 229 ? 25.630  48.648 36.720  1.00 50.76 ? 992  ARG A CD  1 
ATOM   1876 N NE  . ARG A 1 229 ? 25.190  48.914 35.348  1.00 52.56 ? 992  ARG A NE  1 
ATOM   1877 C CZ  . ARG A 1 229 ? 24.757  50.095 34.890  1.00 55.46 ? 992  ARG A CZ  1 
ATOM   1878 N NH1 . ARG A 1 229 ? 24.719  51.171 35.674  1.00 57.40 ? 992  ARG A NH1 1 
ATOM   1879 N NH2 . ARG A 1 229 ? 24.359  50.205 33.625  1.00 56.87 ? 992  ARG A NH2 1 
ATOM   1880 N N   . ARG A 1 230 ? 20.575  49.409 36.908  1.00 50.08 ? 993  ARG A N   1 
ATOM   1881 C CA  . ARG A 1 230 ? 19.868  50.682 36.697  1.00 51.60 ? 993  ARG A CA  1 
ATOM   1882 C C   . ARG A 1 230 ? 18.583  50.846 37.556  1.00 51.84 ? 993  ARG A C   1 
ATOM   1883 O O   . ARG A 1 230 ? 18.024  51.940 37.658  1.00 51.23 ? 993  ARG A O   1 
ATOM   1884 C CB  . ARG A 1 230 ? 19.559  50.842 35.194  1.00 52.29 ? 993  ARG A CB  1 
ATOM   1885 C CG  . ARG A 1 230 ? 20.837  50.827 34.316  1.00 53.33 ? 993  ARG A CG  1 
ATOM   1886 C CD  . ARG A 1 230 ? 20.636  51.299 32.882  1.00 54.14 ? 993  ARG A CD  1 
ATOM   1887 N NE  . ARG A 1 230 ? 19.669  50.463 32.161  1.00 55.19 ? 993  ARG A NE  1 
ATOM   1888 C CZ  . ARG A 1 230 ? 18.823  50.890 31.218  1.00 56.02 ? 993  ARG A CZ  1 
ATOM   1889 N NH1 . ARG A 1 230 ? 18.787  52.167 30.852  1.00 56.95 ? 993  ARG A NH1 1 
ATOM   1890 N NH2 . ARG A 1 230 ? 17.994  50.030 30.634  1.00 55.63 ? 993  ARG A NH2 1 
ATOM   1891 N N   . LEU A 1 231 ? 18.146  49.749 38.177  1.00 52.28 ? 994  LEU A N   1 
ATOM   1892 C CA  . LEU A 1 231 ? 16.962  49.712 39.040  1.00 51.71 ? 994  LEU A CA  1 
ATOM   1893 C C   . LEU A 1 231 ? 17.070  50.709 40.198  1.00 51.37 ? 994  LEU A C   1 
ATOM   1894 O O   . LEU A 1 231 ? 18.042  50.697 40.952  1.00 50.95 ? 994  LEU A O   1 
ATOM   1895 C CB  . LEU A 1 231 ? 16.761  48.277 39.575  1.00 51.70 ? 994  LEU A CB  1 
ATOM   1896 C CG  . LEU A 1 231 ? 15.449  47.860 40.259  1.00 51.35 ? 994  LEU A CG  1 
ATOM   1897 C CD1 . LEU A 1 231 ? 14.357  47.559 39.221  1.00 50.55 ? 994  LEU A CD1 1 
ATOM   1898 C CD2 . LEU A 1 231 ? 15.662  46.654 41.202  1.00 50.76 ? 994  LEU A CD2 1 
ATOM   1899 N N   . ASP A 1 232 ? 16.048  51.557 40.329  1.00 51.60 ? 995  ASP A N   1 
ATOM   1900 C CA  . ASP A 1 232 ? 16.022  52.660 41.298  1.00 51.16 ? 995  ASP A CA  1 
ATOM   1901 C C   . ASP A 1 232 ? 14.848  52.501 42.277  1.00 51.89 ? 995  ASP A C   1 
ATOM   1902 O O   . ASP A 1 232 ? 13.710  52.860 41.962  1.00 51.56 ? 995  ASP A O   1 
ATOM   1903 C CB  . ASP A 1 232 ? 15.923  54.010 40.559  1.00 50.62 ? 995  ASP A CB  1 
ATOM   1904 C CG  . ASP A 1 232 ? 15.852  55.210 41.504  1.00 49.48 ? 995  ASP A CG  1 
ATOM   1905 O OD1 . ASP A 1 232 ? 16.109  55.050 42.716  1.00 48.11 ? 995  ASP A OD1 1 
ATOM   1906 O OD2 . ASP A 1 232 ? 15.562  56.361 41.111  1.00 49.00 ? 995  ASP A OD2 1 
ATOM   1907 N N   . THR A 1 233 ? 15.144  51.964 43.461  1.00 52.68 ? 996  THR A N   1 
ATOM   1908 C CA  . THR A 1 233 ? 14.178  51.885 44.558  1.00 53.31 ? 996  THR A CA  1 
ATOM   1909 C C   . THR A 1 233 ? 14.415  53.038 45.549  1.00 53.66 ? 996  THR A C   1 
ATOM   1910 O O   . THR A 1 233 ? 14.896  52.821 46.665  1.00 54.23 ? 996  THR A O   1 
ATOM   1911 C CB  . THR A 1 233 ? 14.270  50.509 45.285  1.00 53.19 ? 996  THR A CB  1 
ATOM   1912 O OG1 . THR A 1 233 ? 15.605  50.275 45.751  1.00 53.12 ? 996  THR A OG1 1 
ATOM   1913 C CG2 . THR A 1 233 ? 14.020  49.369 44.338  1.00 52.73 ? 996  THR A CG2 1 
ATOM   1914 N N   . SER A 1 234 ? 14.077  54.258 45.129  1.00 53.81 ? 997  SER A N   1 
ATOM   1915 C CA  . SER A 1 234 ? 14.305  55.457 45.945  1.00 53.85 ? 997  SER A CA  1 
ATOM   1916 C C   . SER A 1 234 ? 13.099  55.771 46.833  1.00 53.93 ? 997  SER A C   1 
ATOM   1917 O O   . SER A 1 234 ? 13.257  56.294 47.936  1.00 53.66 ? 997  SER A O   1 
ATOM   1918 C CB  . SER A 1 234 ? 14.635  56.669 45.061  1.00 53.81 ? 997  SER A CB  1 
ATOM   1919 O OG  . SER A 1 234 ? 16.034  56.801 44.879  1.00 53.11 ? 997  SER A OG  1 
ATOM   1920 N N   . SER A 1 235 ? 11.903  55.443 46.345  1.00 54.41 ? 998  SER A N   1 
ATOM   1921 C CA  . SER A 1 235 ? 10.653  55.706 47.063  1.00 54.66 ? 998  SER A CA  1 
ATOM   1922 C C   . SER A 1 235 ? 10.466  54.797 48.290  1.00 55.07 ? 998  SER A C   1 
ATOM   1923 O O   . SER A 1 235 ? 10.019  55.261 49.336  1.00 54.72 ? 998  SER A O   1 
ATOM   1924 C CB  . SER A 1 235 ? 9.462   55.567 46.110  1.00 54.60 ? 998  SER A CB  1 
ATOM   1925 O OG  . SER A 1 235 ? 9.662   56.332 44.932  1.00 54.23 ? 998  SER A OG  1 
ATOM   1926 N N   . LEU A 1 236 ? 10.794  53.509 48.153  1.00 55.69 ? 999  LEU A N   1 
ATOM   1927 C CA  . LEU A 1 236 ? 10.838  52.583 49.299  1.00 55.87 ? 999  LEU A CA  1 
ATOM   1928 C C   . LEU A 1 236 ? 12.247  52.586 49.910  1.00 56.00 ? 999  LEU A C   1 
ATOM   1929 O O   . LEU A 1 236 ? 12.458  52.117 51.030  1.00 56.01 ? 999  LEU A O   1 
ATOM   1930 C CB  . LEU A 1 236 ? 10.446  51.151 48.883  1.00 55.71 ? 999  LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 236 ? 8.955   50.768 48.868  1.00 55.38 ? 999  LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 236 ? 8.799   49.342 48.342  1.00 55.29 ? 999  LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 236 ? 8.290   50.903 50.238  1.00 54.72 ? 999  LEU A CD2 1 
ATOM   1934 N N   . VAL A 1 244 ? 6.358   45.159 51.577  1.00 60.41 ? 1007 VAL A N   1 
ATOM   1935 C CA  . VAL A 1 244 ? 7.138   46.332 51.960  1.00 60.37 ? 1007 VAL A CA  1 
ATOM   1936 C C   . VAL A 1 244 ? 8.655   46.053 51.895  1.00 60.60 ? 1007 VAL A C   1 
ATOM   1937 O O   . VAL A 1 244 ? 9.414   46.859 51.346  1.00 60.83 ? 1007 VAL A O   1 
ATOM   1938 C CB  . VAL A 1 244 ? 6.702   46.899 53.372  1.00 60.43 ? 1007 VAL A CB  1 
ATOM   1939 C CG1 . VAL A 1 244 ? 5.223   47.340 53.354  1.00 59.81 ? 1007 VAL A CG1 1 
ATOM   1940 C CG2 . VAL A 1 244 ? 6.950   45.892 54.507  1.00 60.00 ? 1007 VAL A CG2 1 
ATOM   1941 N N   . GLU A 1 245 ? 9.087   44.906 52.421  1.00 60.63 ? 1008 GLU A N   1 
ATOM   1942 C CA  . GLU A 1 245 ? 10.515  44.555 52.475  1.00 60.51 ? 1008 GLU A CA  1 
ATOM   1943 C C   . GLU A 1 245 ? 10.976  43.751 51.249  1.00 60.93 ? 1008 GLU A C   1 
ATOM   1944 O O   . GLU A 1 245 ? 12.111  43.909 50.779  1.00 61.04 ? 1008 GLU A O   1 
ATOM   1945 C CB  . GLU A 1 245 ? 10.835  43.790 53.765  1.00 60.10 ? 1008 GLU A CB  1 
ATOM   1946 C CG  . GLU A 1 245 ? 11.202  44.695 54.928  1.00 59.78 ? 1008 GLU A CG  1 
ATOM   1947 C CD  . GLU A 1 245 ? 11.465  43.928 56.214  1.00 60.03 ? 1008 GLU A CD  1 
ATOM   1948 O OE1 . GLU A 1 245 ? 12.131  42.874 56.146  1.00 60.01 ? 1008 GLU A OE1 1 
ATOM   1949 O OE2 . GLU A 1 245 ? 11.012  44.379 57.296  1.00 59.57 ? 1008 GLU A OE2 1 
ATOM   1950 N N   . GLU A 1 246 ? 10.101  42.880 50.749  1.00 61.16 ? 1009 GLU A N   1 
ATOM   1951 C CA  . GLU A 1 246 ? 10.344  42.148 49.505  1.00 61.38 ? 1009 GLU A CA  1 
ATOM   1952 C C   . GLU A 1 246 ? 10.781  43.095 48.386  1.00 61.46 ? 1009 GLU A C   1 
ATOM   1953 O O   . GLU A 1 246 ? 11.780  42.849 47.697  1.00 61.88 ? 1009 GLU A O   1 
ATOM   1954 C CB  . GLU A 1 246 ? 9.061   41.436 49.041  1.00 61.61 ? 1009 GLU A CB  1 
ATOM   1955 C CG  . GLU A 1 246 ? 8.833   40.044 49.609  1.00 61.84 ? 1009 GLU A CG  1 
ATOM   1956 C CD  . GLU A 1 246 ? 7.537   39.427 49.104  1.00 61.71 ? 1009 GLU A CD  1 
ATOM   1957 O OE1 . GLU A 1 246 ? 7.490   39.030 47.918  1.00 62.38 ? 1009 GLU A OE1 1 
ATOM   1958 O OE2 . GLU A 1 246 ? 6.565   39.345 49.885  1.00 61.39 ? 1009 GLU A OE2 1 
ATOM   1959 N N   . LEU A 1 247 ? 10.027  44.182 48.231  1.00 61.04 ? 1010 LEU A N   1 
ATOM   1960 C CA  . LEU A 1 247 ? 10.064  44.994 47.018  1.00 60.61 ? 1010 LEU A CA  1 
ATOM   1961 C C   . LEU A 1 247 ? 11.348  45.795 46.824  1.00 60.17 ? 1010 LEU A C   1 
ATOM   1962 O O   . LEU A 1 247 ? 11.870  45.851 45.712  1.00 59.78 ? 1010 LEU A O   1 
ATOM   1963 C CB  . LEU A 1 247 ? 8.845   45.917 46.970  1.00 60.79 ? 1010 LEU A CB  1 
ATOM   1964 C CG  . LEU A 1 247 ? 7.500   45.172 46.900  1.00 61.12 ? 1010 LEU A CG  1 
ATOM   1965 C CD1 . LEU A 1 247 ? 6.326   46.125 47.148  1.00 61.00 ? 1010 LEU A CD1 1 
ATOM   1966 C CD2 . LEU A 1 247 ? 7.333   44.431 45.563  1.00 60.78 ? 1010 LEU A CD2 1 
ATOM   1967 N N   . ARG A 1 248 ? 11.857  46.408 47.890  1.00 59.44 ? 1011 ARG A N   1 
ATOM   1968 C CA  . ARG A 1 248 ? 13.049  47.259 47.780  1.00 58.73 ? 1011 ARG A CA  1 
ATOM   1969 C C   . ARG A 1 248 ? 14.347  46.466 47.568  1.00 57.05 ? 1011 ARG A C   1 
ATOM   1970 O O   . ARG A 1 248 ? 15.295  46.982 46.977  1.00 56.30 ? 1011 ARG A O   1 
ATOM   1971 C CB  . ARG A 1 248 ? 13.172  48.182 49.000  1.00 59.59 ? 1011 ARG A CB  1 
ATOM   1972 C CG  . ARG A 1 248 ? 13.753  47.522 50.227  1.00 60.86 ? 1011 ARG A CG  1 
ATOM   1973 C CD  . ARG A 1 248 ? 13.388  48.220 51.517  1.00 62.42 ? 1011 ARG A CD  1 
ATOM   1974 N NE  . ARG A 1 248 ? 13.955  47.533 52.675  1.00 63.32 ? 1011 ARG A NE  1 
ATOM   1975 C CZ  . ARG A 1 248 ? 13.647  47.808 53.932  1.00 64.18 ? 1011 ARG A CZ  1 
ATOM   1976 N NH1 . ARG A 1 248 ? 12.772  48.767 54.218  1.00 64.73 ? 1011 ARG A NH1 1 
ATOM   1977 N NH2 . ARG A 1 248 ? 14.220  47.120 54.914  1.00 64.54 ? 1011 ARG A NH2 1 
ATOM   1978 N N   . ASN A 1 249 ? 14.383  45.222 48.045  1.00 55.27 ? 1012 ASN A N   1 
ATOM   1979 C CA  . ASN A 1 249 ? 15.514  44.326 47.802  1.00 53.81 ? 1012 ASN A CA  1 
ATOM   1980 C C   . ASN A 1 249 ? 15.312  43.467 46.540  1.00 52.58 ? 1012 ASN A C   1 
ATOM   1981 O O   . ASN A 1 249 ? 15.947  42.425 46.380  1.00 52.34 ? 1012 ASN A O   1 
ATOM   1982 C CB  . ASN A 1 249 ? 15.755  43.432 49.026  1.00 53.78 ? 1012 ASN A CB  1 
ATOM   1983 C CG  . ASN A 1 249 ? 16.674  44.078 50.050  1.00 54.23 ? 1012 ASN A CG  1 
ATOM   1984 O OD1 . ASN A 1 249 ? 17.869  44.267 49.804  1.00 54.62 ? 1012 ASN A OD1 1 
ATOM   1985 N ND2 . ASN A 1 249 ? 16.122  44.410 51.209  1.00 54.10 ? 1012 ASN A ND2 1 
ATOM   1986 N N   . LEU A 1 250 ? 14.442  43.916 45.635  1.00 51.08 ? 1013 LEU A N   1 
ATOM   1987 C CA  . LEU A 1 250 ? 14.070  43.126 44.464  1.00 49.63 ? 1013 LEU A CA  1 
ATOM   1988 C C   . LEU A 1 250 ? 15.290  42.853 43.599  1.00 48.55 ? 1013 LEU A C   1 
ATOM   1989 O O   . LEU A 1 250 ? 16.001  43.779 43.195  1.00 47.59 ? 1013 LEU A O   1 
ATOM   1990 C CB  . LEU A 1 250 ? 13.004  43.832 43.619  1.00 48.84 ? 1013 LEU A CB  1 
ATOM   1991 C CG  . LEU A 1 250 ? 12.680  43.159 42.278  1.00 48.62 ? 1013 LEU A CG  1 
ATOM   1992 C CD1 . LEU A 1 250 ? 11.918  41.871 42.506  1.00 48.67 ? 1013 LEU A CD1 1 
ATOM   1993 C CD2 . LEU A 1 250 ? 11.918  44.094 41.357  1.00 48.04 ? 1013 LEU A CD2 1 
ATOM   1994 N N   . ASP A 1 251 ? 15.488  41.574 43.302  1.00 47.51 ? 1014 ASP A N   1 
ATOM   1995 C CA  . ASP A 1 251 ? 16.613  41.122 42.512  1.00 46.31 ? 1014 ASP A CA  1 
ATOM   1996 C C   . ASP A 1 251 ? 16.150  40.404 41.249  1.00 45.99 ? 1014 ASP A C   1 
ATOM   1997 O O   . ASP A 1 251 ? 15.894  39.198 41.272  1.00 45.80 ? 1014 ASP A O   1 
ATOM   1998 C CB  . ASP A 1 251 ? 17.502  40.206 43.347  1.00 45.85 ? 1014 ASP A CB  1 
ATOM   1999 C CG  . ASP A 1 251 ? 18.890  40.057 42.752  1.00 45.29 ? 1014 ASP A CG  1 
ATOM   2000 O OD1 . ASP A 1 251 ? 19.003  40.218 41.515  1.00 40.52 ? 1014 ASP A OD1 1 
ATOM   2001 O OD2 . ASP A 1 251 ? 19.911  39.807 43.443  1.00 42.88 ? 1014 ASP A OD2 1 
ATOM   2002 N N   . LEU A 1 252 ? 16.071  41.157 40.152  1.00 45.37 ? 1015 LEU A N   1 
ATOM   2003 C CA  . LEU A 1 252 ? 15.736  40.611 38.832  1.00 46.06 ? 1015 LEU A CA  1 
ATOM   2004 C C   . LEU A 1 252 ? 16.603  39.406 38.447  1.00 45.79 ? 1015 LEU A C   1 
ATOM   2005 O O   . LEU A 1 252 ? 16.099  38.447 37.869  1.00 45.04 ? 1015 LEU A O   1 
ATOM   2006 C CB  . LEU A 1 252 ? 15.838  41.697 37.739  1.00 46.56 ? 1015 LEU A CB  1 
ATOM   2007 C CG  . LEU A 1 252 ? 15.252  43.102 38.006  1.00 47.52 ? 1015 LEU A CG  1 
ATOM   2008 C CD1 . LEU A 1 252 ? 15.613  44.113 36.896  1.00 47.48 ? 1015 LEU A CD1 1 
ATOM   2009 C CD2 . LEU A 1 252 ? 13.744  43.032 38.194  1.00 48.13 ? 1015 LEU A CD2 1 
ATOM   2010 N N   . THR A 1 253 ? 17.892  39.440 38.804  1.00 45.84 ? 1016 THR A N   1 
ATOM   2011 C CA  . THR A 1 253 ? 18.857  38.427 38.345  1.00 46.54 ? 1016 THR A CA  1 
ATOM   2012 C C   . THR A 1 253 ? 18.620  37.012 38.879  1.00 47.70 ? 1016 THR A C   1 
ATOM   2013 O O   . THR A 1 253 ? 19.181  36.048 38.348  1.00 47.06 ? 1016 THR A O   1 
ATOM   2014 C CB  . THR A 1 253 ? 20.326  38.860 38.669  1.00 46.31 ? 1016 THR A CB  1 
ATOM   2015 O OG1 . THR A 1 253 ? 20.544  38.875 40.083  1.00 45.15 ? 1016 THR A OG1 1 
ATOM   2016 C CG2 . THR A 1 253 ? 20.604  40.307 38.234  1.00 45.98 ? 1016 THR A CG2 1 
ATOM   2017 N N   . LYS A 1 254 ? 17.800  36.874 39.921  1.00 49.36 ? 1017 LYS A N   1 
ATOM   2018 C CA  . LYS A 1 254 ? 17.528  35.547 40.496  1.00 50.83 ? 1017 LYS A CA  1 
ATOM   2019 C C   . LYS A 1 254 ? 16.357  34.835 39.810  1.00 51.18 ? 1017 LYS A C   1 
ATOM   2020 O O   . LYS A 1 254 ? 15.871  33.815 40.295  1.00 51.37 ? 1017 LYS A O   1 
ATOM   2021 C CB  . LYS A 1 254 ? 17.330  35.629 42.020  1.00 51.41 ? 1017 LYS A CB  1 
ATOM   2022 C CG  . LYS A 1 254 ? 18.636  35.589 42.827  1.00 52.37 ? 1017 LYS A CG  1 
ATOM   2023 C CD  . LYS A 1 254 ? 19.276  34.178 42.883  1.00 53.08 ? 1017 LYS A CD  1 
ATOM   2024 C CE  . LYS A 1 254 ? 20.427  33.991 41.885  1.00 52.88 ? 1017 LYS A CE  1 
ATOM   2025 N NZ  . LYS A 1 254 ? 21.390  35.116 41.897  1.00 52.76 ? 1017 LYS A NZ  1 
ATOM   2026 N N   . ARG A 1 255 ? 15.922  35.376 38.679  1.00 51.69 ? 1018 ARG A N   1 
ATOM   2027 C CA  . ARG A 1 255 ? 15.016  34.683 37.776  1.00 52.63 ? 1018 ARG A CA  1 
ATOM   2028 C C   . ARG A 1 255 ? 15.328  35.074 36.335  1.00 52.72 ? 1018 ARG A C   1 
ATOM   2029 O O   . ARG A 1 255 ? 15.856  36.151 36.077  1.00 51.58 ? 1018 ARG A O   1 
ATOM   2030 C CB  . ARG A 1 255 ? 13.560  35.030 38.117  1.00 53.58 ? 1018 ARG A CB  1 
ATOM   2031 C CG  . ARG A 1 255 ? 13.164  36.506 37.911  1.00 54.38 ? 1018 ARG A CG  1 
ATOM   2032 C CD  . ARG A 1 255 ? 13.281  37.367 39.166  1.00 55.83 ? 1018 ARG A CD  1 
ATOM   2033 N NE  . ARG A 1 255 ? 12.172  37.120 40.085  1.00 57.12 ? 1018 ARG A NE  1 
ATOM   2034 C CZ  . ARG A 1 255 ? 12.046  37.665 41.288  1.00 57.53 ? 1018 ARG A CZ  1 
ATOM   2035 N NH1 . ARG A 1 255 ? 12.973  38.487 41.767  1.00 57.49 ? 1018 ARG A NH1 1 
ATOM   2036 N NH2 . ARG A 1 255 ? 10.987  37.366 42.026  1.00 58.17 ? 1018 ARG A NH2 1 
ATOM   2037 N N   . LYS A 1 256 ? 14.980  34.211 35.393  1.00 54.09 ? 1019 LYS A N   1 
ATOM   2038 C CA  . LYS A 1 256 ? 15.252  34.493 33.987  1.00 55.46 ? 1019 LYS A CA  1 
ATOM   2039 C C   . LYS A 1 256 ? 14.162  35.378 33.391  1.00 55.89 ? 1019 LYS A C   1 
ATOM   2040 O O   . LYS A 1 256 ? 13.002  35.268 33.778  1.00 55.30 ? 1019 LYS A O   1 
ATOM   2041 C CB  . LYS A 1 256 ? 15.412  33.190 33.195  1.00 56.18 ? 1019 LYS A CB  1 
ATOM   2042 C CG  . LYS A 1 256 ? 16.769  32.505 33.442  1.00 56.72 ? 1019 LYS A CG  1 
ATOM   2043 C CD  . LYS A 1 256 ? 17.046  31.370 32.451  1.00 57.28 ? 1019 LYS A CD  1 
ATOM   2044 C CE  . LYS A 1 256 ? 18.520  31.302 32.086  1.00 57.65 ? 1019 LYS A CE  1 
ATOM   2045 N NZ  . LYS A 1 256 ? 18.868  30.061 31.337  1.00 57.47 ? 1019 LYS A NZ  1 
ATOM   2046 N N   . MET A 1 257 ? 14.561  36.271 32.479  1.00 56.59 ? 1020 MET A N   1 
ATOM   2047 C CA  . MET A 1 257 ? 13.637  37.139 31.732  1.00 56.98 ? 1020 MET A CA  1 
ATOM   2048 C C   . MET A 1 257 ? 13.123  36.421 30.499  1.00 57.45 ? 1020 MET A C   1 
ATOM   2049 O O   . MET A 1 257 ? 13.891  35.776 29.786  1.00 57.30 ? 1020 MET A O   1 
ATOM   2050 C CB  . MET A 1 257 ? 14.338  38.444 31.320  1.00 57.73 ? 1020 MET A CB  1 
ATOM   2051 C CG  . MET A 1 257 ? 13.619  39.341 30.273  1.00 58.18 ? 1020 MET A CG  1 
ATOM   2052 S SD  . MET A 1 257 ? 14.533  40.952 30.058  1.00 60.56 ? 1020 MET A SD  1 
ATOM   2053 C CE  . MET A 1 257 ? 14.029  41.749 31.450  1.00 60.95 ? 1020 MET A CE  1 
ATOM   2054 N N   . ILE A 1 258 ? 11.817  36.541 30.264  1.00 57.90 ? 1021 ILE A N   1 
ATOM   2055 C CA  . ILE A 1 258 ? 11.134  35.894 29.151  1.00 58.06 ? 1021 ILE A CA  1 
ATOM   2056 C C   . ILE A 1 258 ? 10.723  36.896 28.075  1.00 58.42 ? 1021 ILE A C   1 
ATOM   2057 O O   . ILE A 1 258 ? 10.767  36.582 26.883  1.00 58.18 ? 1021 ILE A O   1 
ATOM   2058 C CB  . ILE A 1 258 ? 9.918   35.120 29.693  1.00 58.47 ? 1021 ILE A CB  1 
ATOM   2059 C CG1 . ILE A 1 258 ? 10.397  33.796 30.301  1.00 59.04 ? 1021 ILE A CG1 1 
ATOM   2060 C CG2 . ILE A 1 258 ? 8.843   34.869 28.596  1.00 58.54 ? 1021 ILE A CG2 1 
ATOM   2061 C CD1 . ILE A 1 258 ? 10.898  33.908 31.724  1.00 59.13 ? 1021 ILE A CD1 1 
ATOM   2062 N N   . HIS A 1 259 ? 10.335  38.098 28.488  1.00 58.94 ? 1022 HIS A N   1 
ATOM   2063 C CA  . HIS A 1 259 ? 9.910   39.129 27.549  1.00 59.54 ? 1022 HIS A CA  1 
ATOM   2064 C C   . HIS A 1 259 ? 10.163  40.537 28.096  1.00 58.11 ? 1022 HIS A C   1 
ATOM   2065 O O   . HIS A 1 259 ? 10.318  40.730 29.298  1.00 56.05 ? 1022 HIS A O   1 
ATOM   2066 C CB  . HIS A 1 259 ? 8.416   38.941 27.210  1.00 61.45 ? 1022 HIS A CB  1 
ATOM   2067 C CG  . HIS A 1 259 ? 8.012   39.576 25.920  1.00 64.69 ? 1022 HIS A CG  1 
ATOM   2068 N ND1 . HIS A 1 259 ? 7.622   40.894 25.833  1.00 67.84 ? 1022 HIS A ND1 1 
ATOM   2069 C CD2 . HIS A 1 259 ? 7.977   39.089 24.659  1.00 67.49 ? 1022 HIS A CD2 1 
ATOM   2070 C CE1 . HIS A 1 259 ? 7.353   41.190 24.574  1.00 69.08 ? 1022 HIS A CE1 1 
ATOM   2071 N NE2 . HIS A 1 259 ? 7.559   40.112 23.840  1.00 69.21 ? 1022 HIS A NE2 1 
ATOM   2072 N N   . GLU A 1 260 ? 10.211  41.510 27.196  1.00 58.12 ? 1023 GLU A N   1 
ATOM   2073 C CA  . GLU A 1 260 ? 10.292  42.915 27.572  1.00 59.53 ? 1023 GLU A CA  1 
ATOM   2074 C C   . GLU A 1 260 ? 9.780   43.834 26.459  1.00 60.75 ? 1023 GLU A C   1 
ATOM   2075 O O   . GLU A 1 260 ? 9.844   43.495 25.270  1.00 61.84 ? 1023 GLU A O   1 
ATOM   2076 C CB  . GLU A 1 260 ? 11.739  43.292 27.903  1.00 60.18 ? 1023 GLU A CB  1 
ATOM   2077 C CG  . GLU A 1 260 ? 12.647  43.313 26.684  1.00 60.96 ? 1023 GLU A CG  1 
ATOM   2078 C CD  . GLU A 1 260 ? 14.107  43.444 27.036  1.00 61.25 ? 1023 GLU A CD  1 
ATOM   2079 O OE1 . GLU A 1 260 ? 14.476  44.442 27.680  1.00 62.43 ? 1023 GLU A OE1 1 
ATOM   2080 O OE2 . GLU A 1 260 ? 14.881  42.546 26.667  1.00 62.04 ? 1023 GLU A OE2 1 
ATOM   2081 N N   . GLY A 1 261 ? 9.277   45.005 26.844  1.00 61.28 ? 1024 GLY A N   1 
ATOM   2082 C CA  . GLY A 1 261 ? 8.886   46.017 25.873  1.00 60.80 ? 1024 GLY A CA  1 
ATOM   2083 C C   . GLY A 1 261 ? 8.306   47.295 26.459  1.00 60.24 ? 1024 GLY A C   1 
ATOM   2084 O O   . GLY A 1 261 ? 8.111   47.404 27.670  1.00 59.53 ? 1024 GLY A O   1 
ATOM   2085 N N   . PRO A 1 262 ? 8.031   48.269 25.595  1.00 59.96 ? 1025 PRO A N   1 
ATOM   2086 C CA  . PRO A 1 262 ? 7.268   49.457 25.997  1.00 60.36 ? 1025 PRO A CA  1 
ATOM   2087 C C   . PRO A 1 262 ? 5.743   49.192 26.120  1.00 60.28 ? 1025 PRO A C   1 
ATOM   2088 O O   . PRO A 1 262 ? 5.072   48.934 25.110  1.00 59.44 ? 1025 PRO A O   1 
ATOM   2089 C CB  . PRO A 1 262 ? 7.553   50.469 24.873  1.00 60.32 ? 1025 PRO A CB  1 
ATOM   2090 C CG  . PRO A 1 262 ? 8.404   49.759 23.856  1.00 60.25 ? 1025 PRO A CG  1 
ATOM   2091 C CD  . PRO A 1 262 ? 8.399   48.306 24.170  1.00 59.80 ? 1025 PRO A CD  1 
ATOM   2092 N N   . LEU A 1 263 ? 5.228   49.237 27.349  1.00 60.50 ? 1026 LEU A N   1 
ATOM   2093 C CA  . LEU A 1 263 ? 3.784   49.330 27.598  1.00 61.21 ? 1026 LEU A CA  1 
ATOM   2094 C C   . LEU A 1 263 ? 3.428   50.732 28.097  1.00 61.84 ? 1026 LEU A C   1 
ATOM   2095 O O   . LEU A 1 263 ? 4.298   51.498 28.490  1.00 62.15 ? 1026 LEU A O   1 
ATOM   2096 C CB  . LEU A 1 263 ? 3.316   48.297 28.635  1.00 60.70 ? 1026 LEU A CB  1 
ATOM   2097 C CG  . LEU A 1 263 ? 3.616   46.820 28.366  1.00 60.31 ? 1026 LEU A CG  1 
ATOM   2098 C CD1 . LEU A 1 263 ? 3.136   45.954 29.516  1.00 59.60 ? 1026 LEU A CD1 1 
ATOM   2099 C CD2 . LEU A 1 263 ? 3.007   46.358 27.052  1.00 60.40 ? 1026 LEU A CD2 1 
ATOM   2100 N N   . VAL A 1 264 ? 2.139   51.049 28.066  1.00 62.52 ? 1027 VAL A N   1 
ATOM   2101 C CA  . VAL A 1 264 ? 1.590   52.268 28.655  1.00 62.87 ? 1027 VAL A CA  1 
ATOM   2102 C C   . VAL A 1 264 ? 0.786   51.820 29.889  1.00 63.41 ? 1027 VAL A C   1 
ATOM   2103 O O   . VAL A 1 264 ? 0.477   50.632 30.024  1.00 63.71 ? 1027 VAL A O   1 
ATOM   2104 C CB  . VAL A 1 264 ? 0.730   53.022 27.602  1.00 62.83 ? 1027 VAL A CB  1 
ATOM   2105 C CG1 . VAL A 1 264 ? -0.185  54.076 28.230  1.00 62.77 ? 1027 VAL A CG1 1 
ATOM   2106 C CG2 . VAL A 1 264 ? 1.637   53.664 26.552  1.00 62.39 ? 1027 VAL A CG2 1 
ATOM   2107 N N   . TRP A 1 265 ? 0.491   52.735 30.812  1.00 63.79 ? 1028 TRP A N   1 
ATOM   2108 C CA  . TRP A 1 265 ? -0.321  52.391 31.985  1.00 64.36 ? 1028 TRP A CA  1 
ATOM   2109 C C   . TRP A 1 265 ? -1.403  53.430 32.244  1.00 64.15 ? 1028 TRP A C   1 
ATOM   2110 O O   . TRP A 1 265 ? -1.142  54.471 32.858  1.00 64.58 ? 1028 TRP A O   1 
ATOM   2111 C CB  . TRP A 1 265 ? 0.544   52.217 33.239  1.00 64.90 ? 1028 TRP A CB  1 
ATOM   2112 C CG  . TRP A 1 265 ? -0.243  51.802 34.468  1.00 66.16 ? 1028 TRP A CG  1 
ATOM   2113 C CD1 . TRP A 1 265 ? -1.546  51.369 34.513  1.00 67.18 ? 1028 TRP A CD1 1 
ATOM   2114 C CD2 . TRP A 1 265 ? 0.226   51.780 35.824  1.00 67.44 ? 1028 TRP A CD2 1 
ATOM   2115 N NE1 . TRP A 1 265 ? -1.909  51.085 35.808  1.00 67.73 ? 1028 TRP A NE1 1 
ATOM   2116 C CE2 . TRP A 1 265 ? -0.840  51.324 36.634  1.00 67.94 ? 1028 TRP A CE2 1 
ATOM   2117 C CE3 . TRP A 1 265 ? 1.446   52.099 36.442  1.00 68.21 ? 1028 TRP A CE3 1 
ATOM   2118 C CZ2 . TRP A 1 265 ? -0.725  51.181 38.024  1.00 68.18 ? 1028 TRP A CZ2 1 
ATOM   2119 C CZ3 . TRP A 1 265 ? 1.561   51.954 37.827  1.00 68.45 ? 1028 TRP A CZ3 1 
ATOM   2120 C CH2 . TRP A 1 265 ? 0.479   51.500 38.598  1.00 68.69 ? 1028 TRP A CH2 1 
ATOM   2121 N N   . LYS A 1 266 ? -2.616  53.132 31.772  1.00 63.49 ? 1029 LYS A N   1 
ATOM   2122 C CA  . LYS A 1 266 ? -3.802  53.949 32.050  1.00 62.57 ? 1029 LYS A CA  1 
ATOM   2123 C C   . LYS A 1 266 ? -4.171  53.786 33.531  1.00 62.32 ? 1029 LYS A C   1 
ATOM   2124 O O   . LYS A 1 266 ? -4.750  52.767 33.933  1.00 62.19 ? 1029 LYS A O   1 
ATOM   2125 C CB  . LYS A 1 266 ? -4.968  53.532 31.133  1.00 61.98 ? 1029 LYS A CB  1 
ATOM   2126 C CG  . LYS A 1 266 ? -6.144  54.495 31.090  1.00 61.21 ? 1029 LYS A CG  1 
ATOM   2127 C CD  . LYS A 1 266 ? -7.321  53.890 30.322  1.00 60.53 ? 1029 LYS A CD  1 
ATOM   2128 C CE  . LYS A 1 266 ? -8.496  54.855 30.200  1.00 60.28 ? 1029 LYS A CE  1 
ATOM   2129 N NZ  . LYS A 1 266 ? -9.465  54.735 31.330  1.00 59.58 ? 1029 LYS A NZ  1 
ATOM   2130 N N   . VAL A 1 267 ? -3.783  54.774 34.340  1.00 61.92 ? 1030 VAL A N   1 
ATOM   2131 C CA  . VAL A 1 267 ? -4.112  54.793 35.768  1.00 61.46 ? 1030 VAL A CA  1 
ATOM   2132 C C   . VAL A 1 267 ? -5.521  55.385 35.931  1.00 61.15 ? 1030 VAL A C   1 
ATOM   2133 O O   . VAL A 1 267 ? -6.358  54.824 36.641  1.00 60.80 ? 1030 VAL A O   1 
ATOM   2134 C CB  . VAL A 1 267 ? -3.014  55.530 36.626  1.00 61.35 ? 1030 VAL A CB  1 
ATOM   2135 C CG1 . VAL A 1 267 ? -2.974  57.047 36.377  1.00 60.95 ? 1030 VAL A CG1 1 
ATOM   2136 C CG2 . VAL A 1 267 ? -3.193  55.229 38.111  1.00 61.30 ? 1030 VAL A CG2 1 
ATOM   2137 N N   . ASN A 1 268 ? -5.762  56.512 35.257  1.00 60.80 ? 1031 ASN A N   1 
ATOM   2138 C CA  . ASN A 1 268 ? -7.099  57.076 35.059  1.00 60.61 ? 1031 ASN A CA  1 
ATOM   2139 C C   . ASN A 1 268 ? -7.300  57.376 33.573  1.00 60.37 ? 1031 ASN A C   1 
ATOM   2140 O O   . ASN A 1 268 ? -6.411  57.132 32.750  1.00 60.63 ? 1031 ASN A O   1 
ATOM   2141 C CB  . ASN A 1 268 ? -7.292  58.387 35.839  1.00 60.48 ? 1031 ASN A CB  1 
ATOM   2142 C CG  . ASN A 1 268 ? -6.772  58.321 37.267  1.00 60.50 ? 1031 ASN A CG  1 
ATOM   2143 O OD1 . ASN A 1 268 ? -6.807  57.275 37.917  1.00 60.50 ? 1031 ASN A OD1 1 
ATOM   2144 N ND2 . ASN A 1 268 ? -6.307  59.460 37.770  1.00 60.18 ? 1031 ASN A ND2 1 
ATOM   2145 N N   . ARG A 1 269 ? -8.465  57.917 33.236  1.00 59.89 ? 1032 ARG A N   1 
ATOM   2146 C CA  . ARG A 1 269 ? -8.700  58.457 31.901  1.00 59.65 ? 1032 ARG A CA  1 
ATOM   2147 C C   . ARG A 1 269 ? -7.797  59.670 31.667  1.00 59.61 ? 1032 ARG A C   1 
ATOM   2148 O O   . ARG A 1 269 ? -7.254  59.851 30.576  1.00 59.73 ? 1032 ARG A O   1 
ATOM   2149 C CB  . ARG A 1 269 ? -10.163 58.875 31.738  1.00 59.54 ? 1032 ARG A CB  1 
ATOM   2150 C CG  . ARG A 1 269 ? -11.168 57.732 31.833  1.00 59.26 ? 1032 ARG A CG  1 
ATOM   2151 C CD  . ARG A 1 269 ? -12.618 58.171 31.691  1.00 59.38 ? 1032 ARG A CD  1 
ATOM   2152 N NE  . ARG A 1 269 ? -12.988 59.182 32.685  1.00 59.30 ? 1032 ARG A NE  1 
ATOM   2153 C CZ  . ARG A 1 269 ? -12.965 60.506 32.494  1.00 59.27 ? 1032 ARG A CZ  1 
ATOM   2154 N NH1 . ARG A 1 269 ? -12.568 61.036 31.339  1.00 59.17 ? 1032 ARG A NH1 1 
ATOM   2155 N NH2 . ARG A 1 269 ? -13.333 61.314 33.485  1.00 59.39 ? 1032 ARG A NH2 1 
ATOM   2156 N N   . ASP A 1 270 ? -7.635  60.484 32.708  1.00 59.44 ? 1033 ASP A N   1 
ATOM   2157 C CA  . ASP A 1 270 ? -6.860  61.722 32.627  1.00 59.26 ? 1033 ASP A CA  1 
ATOM   2158 C C   . ASP A 1 270 ? -5.339  61.486 32.543  1.00 59.16 ? 1033 ASP A C   1 
ATOM   2159 O O   . ASP A 1 270 ? -4.640  62.226 31.848  1.00 59.20 ? 1033 ASP A O   1 
ATOM   2160 C CB  . ASP A 1 270 ? -7.182  62.625 33.828  1.00 59.11 ? 1033 ASP A CB  1 
ATOM   2161 C CG  . ASP A 1 270 ? -8.644  63.033 33.884  1.00 59.21 ? 1033 ASP A CG  1 
ATOM   2162 O OD1 . ASP A 1 270 ? -9.043  63.961 33.148  1.00 59.14 ? 1033 ASP A OD1 1 
ATOM   2163 O OD2 . ASP A 1 270 ? -9.469  62.483 34.642  1.00 59.44 ? 1033 ASP A OD2 1 
ATOM   2164 N N   . LYS A 1 271 ? -4.835  60.462 33.237  1.00 58.96 ? 1034 LYS A N   1 
ATOM   2165 C CA  . LYS A 1 271 ? -3.386  60.248 33.380  1.00 58.90 ? 1034 LYS A CA  1 
ATOM   2166 C C   . LYS A 1 271 ? -2.869  58.965 32.708  1.00 58.74 ? 1034 LYS A C   1 
ATOM   2167 O O   . LYS A 1 271 ? -3.617  58.001 32.521  1.00 58.72 ? 1034 LYS A O   1 
ATOM   2168 C CB  . LYS A 1 271 ? -3.007  60.244 34.868  1.00 58.93 ? 1034 LYS A CB  1 
ATOM   2169 C CG  . LYS A 1 271 ? -3.053  61.634 35.525  1.00 58.84 ? 1034 LYS A CG  1 
ATOM   2170 C CD  . LYS A 1 271 ? -3.797  61.645 36.872  1.00 58.68 ? 1034 LYS A CD  1 
ATOM   2171 C CE  . LYS A 1 271 ? -4.923  62.676 36.894  1.00 58.68 ? 1034 LYS A CE  1 
ATOM   2172 N NZ  . LYS A 1 271 ? -5.909  62.454 37.996  1.00 58.75 ? 1034 LYS A NZ  1 
ATOM   2173 N N   . THR A 1 272 ? -1.581  58.978 32.352  1.00 58.43 ? 1035 THR A N   1 
ATOM   2174 C CA  . THR A 1 272 ? -0.911  57.850 31.690  1.00 58.13 ? 1035 THR A CA  1 
ATOM   2175 C C   . THR A 1 272 ? 0.572   57.812 32.058  1.00 57.97 ? 1035 THR A C   1 
ATOM   2176 O O   . THR A 1 272 ? 1.279   58.807 31.875  1.00 57.79 ? 1035 THR A O   1 
ATOM   2177 C CB  . THR A 1 272 ? -1.022  57.971 30.148  1.00 58.12 ? 1035 THR A CB  1 
ATOM   2178 O OG1 . THR A 1 272 ? -0.577  59.268 29.721  1.00 57.95 ? 1035 THR A OG1 1 
ATOM   2179 C CG2 . THR A 1 272 ? -2.477  57.890 29.670  1.00 58.15 ? 1035 THR A CG2 1 
ATOM   2180 N N   . ILE A 1 273 ? 1.042   56.668 32.560  1.00 57.75 ? 1036 ILE A N   1 
ATOM   2181 C CA  . ILE A 1 273 ? 2.463   56.477 32.867  1.00 57.49 ? 1036 ILE A CA  1 
ATOM   2182 C C   . ILE A 1 273 ? 3.131   55.597 31.804  1.00 57.23 ? 1036 ILE A C   1 
ATOM   2183 O O   . ILE A 1 273 ? 2.881   54.390 31.742  1.00 57.38 ? 1036 ILE A O   1 
ATOM   2184 C CB  . ILE A 1 273 ? 2.663   55.864 34.286  1.00 57.48 ? 1036 ILE A CB  1 
ATOM   2185 C CG1 . ILE A 1 273 ? 1.853   56.640 35.334  1.00 57.40 ? 1036 ILE A CG1 1 
ATOM   2186 C CG2 . ILE A 1 273 ? 4.148   55.877 34.665  1.00 57.41 ? 1036 ILE A CG2 1 
ATOM   2187 C CD1 . ILE A 1 273 ? 2.242   56.347 36.787  1.00 57.34 ? 1036 ILE A CD1 1 
ATOM   2188 N N   . ASP A 1 274 ? 3.986   56.208 30.981  1.00 56.59 ? 1037 ASP A N   1 
ATOM   2189 C CA  . ASP A 1 274 ? 4.754   55.473 29.973  1.00 56.19 ? 1037 ASP A CA  1 
ATOM   2190 C C   . ASP A 1 274 ? 5.722   54.520 30.673  1.00 55.96 ? 1037 ASP A C   1 
ATOM   2191 O O   . ASP A 1 274 ? 6.552   54.951 31.469  1.00 55.54 ? 1037 ASP A O   1 
ATOM   2192 C CB  . ASP A 1 274 ? 5.544   56.424 29.067  1.00 56.03 ? 1037 ASP A CB  1 
ATOM   2193 C CG  . ASP A 1 274 ? 4.673   57.489 28.430  1.00 55.69 ? 1037 ASP A CG  1 
ATOM   2194 O OD1 . ASP A 1 274 ? 3.589   57.149 27.913  1.00 55.56 ? 1037 ASP A OD1 1 
ATOM   2195 O OD2 . ASP A 1 274 ? 4.997   58.694 28.401  1.00 55.30 ? 1037 ASP A OD2 1 
ATOM   2196 N N   . LEU A 1 275 ? 5.593   53.226 30.392  1.00 55.89 ? 1038 LEU A N   1 
ATOM   2197 C CA  . LEU A 1 275 ? 6.407   52.203 31.040  1.00 55.54 ? 1038 LEU A CA  1 
ATOM   2198 C C   . LEU A 1 275 ? 7.342   51.507 30.068  1.00 54.82 ? 1038 LEU A C   1 
ATOM   2199 O O   . LEU A 1 275 ? 7.146   51.529 28.844  1.00 54.47 ? 1038 LEU A O   1 
ATOM   2200 C CB  . LEU A 1 275 ? 5.531   51.105 31.666  1.00 56.02 ? 1038 LEU A CB  1 
ATOM   2201 C CG  . LEU A 1 275 ? 4.580   51.359 32.840  1.00 56.60 ? 1038 LEU A CG  1 
ATOM   2202 C CD1 . LEU A 1 275 ? 3.785   50.084 33.112  1.00 56.75 ? 1038 LEU A CD1 1 
ATOM   2203 C CD2 . LEU A 1 275 ? 5.314   51.795 34.095  1.00 56.66 ? 1038 LEU A CD2 1 
ATOM   2204 N N   . TYR A 1 276 ? 8.373   50.910 30.658  1.00 53.60 ? 1039 TYR A N   1 
ATOM   2205 C CA  . TYR A 1 276 ? 9.080   49.777 30.096  1.00 52.90 ? 1039 TYR A CA  1 
ATOM   2206 C C   . TYR A 1 276 ? 8.880   48.631 31.081  1.00 51.73 ? 1039 TYR A C   1 
ATOM   2207 O O   . TYR A 1 276 ? 9.123   48.780 32.281  1.00 52.24 ? 1039 TYR A O   1 
ATOM   2208 C CB  . TYR A 1 276 ? 10.575  50.088 29.939  1.00 53.35 ? 1039 TYR A CB  1 
ATOM   2209 C CG  . TYR A 1 276 ? 11.295  49.098 29.053  1.00 53.59 ? 1039 TYR A CG  1 
ATOM   2210 C CD1 . TYR A 1 276 ? 11.380  49.307 27.674  1.00 53.65 ? 1039 TYR A CD1 1 
ATOM   2211 C CD2 . TYR A 1 276 ? 11.875  47.941 29.589  1.00 54.38 ? 1039 TYR A CD2 1 
ATOM   2212 C CE1 . TYR A 1 276 ? 12.023  48.397 26.852  1.00 54.23 ? 1039 TYR A CE1 1 
ATOM   2213 C CE2 . TYR A 1 276 ? 12.530  47.026 28.772  1.00 54.55 ? 1039 TYR A CE2 1 
ATOM   2214 C CZ  . TYR A 1 276 ? 12.594  47.261 27.408  1.00 54.75 ? 1039 TYR A CZ  1 
ATOM   2215 O OH  . TYR A 1 276 ? 13.239  46.368 26.595  1.00 56.70 ? 1039 TYR A OH  1 
ATOM   2216 N N   . THR A 1 277 ? 8.463   47.486 30.565  1.00 50.14 ? 1040 THR A N   1 
ATOM   2217 C CA  . THR A 1 277 ? 7.912   46.419 31.387  1.00 48.87 ? 1040 THR A CA  1 
ATOM   2218 C C   . THR A 1 277 ? 8.687   45.154 31.161  1.00 47.98 ? 1040 THR A C   1 
ATOM   2219 O O   . THR A 1 277 ? 9.121   44.899 30.056  1.00 47.63 ? 1040 THR A O   1 
ATOM   2220 C CB  . THR A 1 277 ? 6.419   46.194 30.978  1.00 48.31 ? 1040 THR A CB  1 
ATOM   2221 O OG1 . THR A 1 277 ? 5.644   47.311 31.409  1.00 48.69 ? 1040 THR A OG1 1 
ATOM   2222 C CG2 . THR A 1 277 ? 5.806   44.992 31.690  1.00 46.68 ? 1040 THR A CG2 1 
ATOM   2223 N N   . LEU A 1 278 ? 8.825   44.337 32.191  1.00 48.23 ? 1041 LEU A N   1 
ATOM   2224 C CA  . LEU A 1 278 ? 9.593   43.124 32.067  1.00 49.40 ? 1041 LEU A CA  1 
ATOM   2225 C C   . LEU A 1 278 ? 8.818   41.955 32.571  1.00 50.32 ? 1041 LEU A C   1 
ATOM   2226 O O   . LEU A 1 278 ? 8.492   41.890 33.748  1.00 50.30 ? 1041 LEU A O   1 
ATOM   2227 C CB  . LEU A 1 278 ? 10.880  43.219 32.884  1.00 50.09 ? 1041 LEU A CB  1 
ATOM   2228 C CG  . LEU A 1 278 ? 11.723  44.499 32.837  1.00 49.60 ? 1041 LEU A CG  1 
ATOM   2229 C CD1 . LEU A 1 278 ? 12.846  44.330 33.832  1.00 48.79 ? 1041 LEU A CD1 1 
ATOM   2230 C CD2 . LEU A 1 278 ? 12.252  44.859 31.443  1.00 49.38 ? 1041 LEU A CD2 1 
ATOM   2231 N N   . LEU A 1 279 ? 8.520   41.028 31.670  1.00 52.19 ? 1042 LEU A N   1 
ATOM   2232 C CA  . LEU A 1 279 ? 7.999   39.714 32.043  1.00 52.81 ? 1042 LEU A CA  1 
ATOM   2233 C C   . LEU A 1 279 ? 9.137   38.760 32.417  1.00 52.49 ? 1042 LEU A C   1 
ATOM   2234 O O   . LEU A 1 279 ? 9.910   38.346 31.551  1.00 52.65 ? 1042 LEU A O   1 
ATOM   2235 C CB  . LEU A 1 279 ? 7.203   39.110 30.887  1.00 53.41 ? 1042 LEU A CB  1 
ATOM   2236 C CG  . LEU A 1 279 ? 6.745   37.663 31.055  1.00 54.11 ? 1042 LEU A CG  1 
ATOM   2237 C CD1 . LEU A 1 279 ? 6.049   37.444 32.401  1.00 54.30 ? 1042 LEU A CD1 1 
ATOM   2238 C CD2 . LEU A 1 279 ? 5.798   37.304 29.907  1.00 55.81 ? 1042 LEU A CD2 1 
ATOM   2239 N N   . LEU A 1 280 ? 9.213   38.410 33.698  1.00 52.53 ? 1043 LEU A N   1 
ATOM   2240 C CA  . LEU A 1 280 ? 10.174  37.437 34.214  1.00 52.92 ? 1043 LEU A CA  1 
ATOM   2241 C C   . LEU A 1 280 ? 9.486   36.109 34.507  1.00 53.57 ? 1043 LEU A C   1 
ATOM   2242 O O   . LEU A 1 280 ? 8.283   35.970 34.294  1.00 53.48 ? 1043 LEU A O   1 
ATOM   2243 C CB  . LEU A 1 280 ? 10.843  37.975 35.484  1.00 52.55 ? 1043 LEU A CB  1 
ATOM   2244 C CG  . LEU A 1 280 ? 11.317  39.425 35.421  1.00 53.06 ? 1043 LEU A CG  1 
ATOM   2245 C CD1 . LEU A 1 280 ? 12.091  39.791 36.700  1.00 53.90 ? 1043 LEU A CD1 1 
ATOM   2246 C CD2 . LEU A 1 280 ? 12.185  39.669 34.197  1.00 53.17 ? 1043 LEU A CD2 1 
ATOM   2247 N N   . GLU A 1 281 ? 10.250  35.136 35.007  1.00 54.44 ? 1044 GLU A N   1 
ATOM   2248 C CA  . GLU A 1 281 ? 9.742   33.776 35.233  1.00 55.21 ? 1044 GLU A CA  1 
ATOM   2249 C C   . GLU A 1 281 ? 8.454   33.765 36.054  1.00 54.82 ? 1044 GLU A C   1 
ATOM   2250 O O   . GLU A 1 281 ? 7.516   33.017 35.753  1.00 55.06 ? 1044 GLU A O   1 
ATOM   2251 C CB  . GLU A 1 281 ? 10.791  32.912 35.953  1.00 55.94 ? 1044 GLU A CB  1 
ATOM   2252 C CG  . GLU A 1 281 ? 11.473  31.866 35.076  1.00 57.77 ? 1044 GLU A CG  1 
ATOM   2253 C CD  . GLU A 1 281 ? 12.745  31.302 35.700  1.00 59.04 ? 1044 GLU A CD  1 
ATOM   2254 O OE1 . GLU A 1 281 ? 12.864  31.323 36.947  1.00 60.47 ? 1044 GLU A OE1 1 
ATOM   2255 O OE2 . GLU A 1 281 ? 13.632  30.837 34.946  1.00 59.79 ? 1044 GLU A OE2 1 
ATOM   2256 N N   . ASP A 1 282 ? 8.432   34.595 37.094  1.00 54.01 ? 1045 ASP A N   1 
ATOM   2257 C CA  . ASP A 1 282 ? 7.416   34.521 38.137  1.00 53.20 ? 1045 ASP A CA  1 
ATOM   2258 C C   . ASP A 1 282 ? 6.774   35.859 38.497  1.00 52.65 ? 1045 ASP A C   1 
ATOM   2259 O O   . ASP A 1 282 ? 5.849   35.886 39.296  1.00 53.13 ? 1045 ASP A O   1 
ATOM   2260 C CB  . ASP A 1 282 ? 8.017   33.866 39.391  1.00 53.18 ? 1045 ASP A CB  1 
ATOM   2261 C CG  . ASP A 1 282 ? 9.033   34.757 40.110  1.00 52.95 ? 1045 ASP A CG  1 
ATOM   2262 O OD1 . ASP A 1 282 ? 9.526   35.743 39.521  1.00 53.41 ? 1045 ASP A OD1 1 
ATOM   2263 O OD2 . ASP A 1 282 ? 9.400   34.538 41.281  1.00 52.23 ? 1045 ASP A OD2 1 
ATOM   2264 N N   . ILE A 1 283 ? 7.268   36.954 37.926  1.00 52.21 ? 1046 ILE A N   1 
ATOM   2265 C CA  . ILE A 1 283 ? 6.698   38.279 38.152  1.00 52.33 ? 1046 ILE A CA  1 
ATOM   2266 C C   . ILE A 1 283 ? 6.687   39.110 36.878  1.00 52.39 ? 1046 ILE A C   1 
ATOM   2267 O O   . ILE A 1 283 ? 7.537   38.949 36.008  1.00 52.40 ? 1046 ILE A O   1 
ATOM   2268 C CB  . ILE A 1 283 ? 7.467   39.053 39.262  1.00 52.64 ? 1046 ILE A CB  1 
ATOM   2269 C CG1 . ILE A 1 283 ? 8.978   39.116 38.969  1.00 52.98 ? 1046 ILE A CG1 1 
ATOM   2270 C CG2 . ILE A 1 283 ? 7.208   38.425 40.624  1.00 52.67 ? 1046 ILE A CG2 1 
ATOM   2271 C CD1 . ILE A 1 283 ? 9.750   40.079 39.866  1.00 53.16 ? 1046 ILE A CD1 1 
ATOM   2272 N N   . LEU A 1 284 ? 5.699   39.984 36.769  1.00 52.11 ? 1047 LEU A N   1 
ATOM   2273 C CA  . LEU A 1 284 ? 5.720   41.054 35.800  1.00 52.31 ? 1047 LEU A CA  1 
ATOM   2274 C C   . LEU A 1 284 ? 6.237   42.248 36.583  1.00 52.20 ? 1047 LEU A C   1 
ATOM   2275 O O   . LEU A 1 284 ? 5.909   42.405 37.757  1.00 52.15 ? 1047 LEU A O   1 
ATOM   2276 C CB  . LEU A 1 284 ? 4.315   41.300 35.264  1.00 53.13 ? 1047 LEU A CB  1 
ATOM   2277 C CG  . LEU A 1 284 ? 4.173   42.060 33.954  1.00 54.33 ? 1047 LEU A CG  1 
ATOM   2278 C CD1 . LEU A 1 284 ? 4.450   41.151 32.783  1.00 54.49 ? 1047 LEU A CD1 1 
ATOM   2279 C CD2 . LEU A 1 284 ? 2.760   42.637 33.844  1.00 55.88 ? 1047 LEU A CD2 1 
ATOM   2280 N N   . VAL A 1 285 ? 7.065   43.070 35.947  1.00 51.99 ? 1048 VAL A N   1 
ATOM   2281 C CA  . VAL A 1 285 ? 7.710   44.189 36.623  1.00 51.55 ? 1048 VAL A CA  1 
ATOM   2282 C C   . VAL A 1 285 ? 7.444   45.448 35.840  1.00 51.44 ? 1048 VAL A C   1 
ATOM   2283 O O   . VAL A 1 285 ? 7.681   45.510 34.639  1.00 50.78 ? 1048 VAL A O   1 
ATOM   2284 C CB  . VAL A 1 285 ? 9.243   44.002 36.759  1.00 51.74 ? 1048 VAL A CB  1 
ATOM   2285 C CG1 . VAL A 1 285 ? 9.868   45.210 37.450  1.00 51.13 ? 1048 VAL A CG1 1 
ATOM   2286 C CG2 . VAL A 1 285 ? 9.572   42.724 37.538  1.00 52.15 ? 1048 VAL A CG2 1 
ATOM   2287 N N   . LEU A 1 286 ? 6.977   46.468 36.540  1.00 52.28 ? 1049 LEU A N   1 
ATOM   2288 C CA  . LEU A 1 286 ? 6.572   47.699 35.904  1.00 53.53 ? 1049 LEU A CA  1 
ATOM   2289 C C   . LEU A 1 286 ? 7.596   48.762 36.265  1.00 53.65 ? 1049 LEU A C   1 
ATOM   2290 O O   . LEU A 1 286 ? 7.790   49.062 37.441  1.00 53.79 ? 1049 LEU A O   1 
ATOM   2291 C CB  . LEU A 1 286 ? 5.160   48.084 36.364  1.00 54.08 ? 1049 LEU A CB  1 
ATOM   2292 C CG  . LEU A 1 286 ? 4.091   47.002 36.131  1.00 54.75 ? 1049 LEU A CG  1 
ATOM   2293 C CD1 . LEU A 1 286 ? 2.730   47.474 36.639  1.00 55.49 ? 1049 LEU A CD1 1 
ATOM   2294 C CD2 . LEU A 1 286 ? 3.983   46.610 34.668  1.00 55.21 ? 1049 LEU A CD2 1 
ATOM   2295 N N   . LEU A 1 287 ? 8.259   49.303 35.244  1.00 53.99 ? 1050 LEU A N   1 
ATOM   2296 C CA  . LEU A 1 287 ? 9.339   50.272 35.426  1.00 54.26 ? 1050 LEU A CA  1 
ATOM   2297 C C   . LEU A 1 287 ? 9.111   51.512 34.566  1.00 54.87 ? 1050 LEU A C   1 
ATOM   2298 O O   . LEU A 1 287 ? 8.350   51.462 33.601  1.00 54.86 ? 1050 LEU A O   1 
ATOM   2299 C CB  . LEU A 1 287 ? 10.686  49.633 35.072  1.00 54.33 ? 1050 LEU A CB  1 
ATOM   2300 C CG  . LEU A 1 287 ? 11.034  48.299 35.740  1.00 54.05 ? 1050 LEU A CG  1 
ATOM   2301 C CD1 . LEU A 1 287 ? 12.154  47.605 34.991  1.00 54.39 ? 1050 LEU A CD1 1 
ATOM   2302 C CD2 . LEU A 1 287 ? 11.425  48.490 37.196  1.00 53.99 ? 1050 LEU A CD2 1 
ATOM   2303 N N   . GLN A 1 288 ? 9.778   52.614 34.924  1.00 55.89 ? 1051 GLN A N   1 
ATOM   2304 C CA  . GLN A 1 288 ? 9.656   53.901 34.222  1.00 56.52 ? 1051 GLN A CA  1 
ATOM   2305 C C   . GLN A 1 288 ? 11.015  54.400 33.724  1.00 57.10 ? 1051 GLN A C   1 
ATOM   2306 O O   . GLN A 1 288 ? 11.954  54.528 34.516  1.00 57.15 ? 1051 GLN A O   1 
ATOM   2307 C CB  . GLN A 1 288 ? 9.041   54.956 35.160  1.00 56.72 ? 1051 GLN A CB  1 
ATOM   2308 C CG  . GLN A 1 288 ? 7.680   55.510 34.712  1.00 56.74 ? 1051 GLN A CG  1 
ATOM   2309 C CD  . GLN A 1 288 ? 7.280   56.784 35.459  1.00 56.78 ? 1051 GLN A CD  1 
ATOM   2310 O OE1 . GLN A 1 288 ? 7.251   56.803 36.691  1.00 56.74 ? 1051 GLN A OE1 1 
ATOM   2311 N NE2 . GLN A 1 288 ? 6.970   57.842 34.715  1.00 55.99 ? 1051 GLN A NE2 1 
ATOM   2312 N N   . LYS A 1 289 ? 11.108  54.699 32.424  1.00 57.98 ? 1052 LYS A N   1 
ATOM   2313 C CA  . LYS A 1 289 ? 12.359  55.202 31.813  1.00 58.71 ? 1052 LYS A CA  1 
ATOM   2314 C C   . LYS A 1 289 ? 12.601  56.687 32.128  1.00 58.81 ? 1052 LYS A C   1 
ATOM   2315 O O   . LYS A 1 289 ? 12.156  57.565 31.384  1.00 58.54 ? 1052 LYS A O   1 
ATOM   2316 C CB  . LYS A 1 289 ? 12.362  54.985 30.278  1.00 59.03 ? 1052 LYS A CB  1 
ATOM   2317 C CG  . LYS A 1 289 ? 12.986  53.658 29.816  1.00 59.56 ? 1052 LYS A CG  1 
ATOM   2318 C CD  . LYS A 1 289 ? 13.133  53.556 28.286  1.00 59.41 ? 1052 LYS A CD  1 
ATOM   2319 C CE  . LYS A 1 289 ? 13.707  52.185 27.878  1.00 59.66 ? 1052 LYS A CE  1 
ATOM   2320 N NZ  . LYS A 1 289 ? 14.767  52.250 26.830  1.00 58.83 ? 1052 LYS A NZ  1 
ATOM   2321 N N   . GLN A 1 290 ? 13.317  56.955 33.221  1.00 59.23 ? 1053 GLN A N   1 
ATOM   2322 C CA  . GLN A 1 290 ? 13.648  58.323 33.635  1.00 59.51 ? 1053 GLN A CA  1 
ATOM   2323 C C   . GLN A 1 290 ? 15.146  58.585 33.478  1.00 59.54 ? 1053 GLN A C   1 
ATOM   2324 O O   . GLN A 1 290 ? 15.927  58.331 34.401  1.00 59.96 ? 1053 GLN A O   1 
ATOM   2325 C CB  . GLN A 1 290 ? 13.228  58.552 35.090  1.00 59.72 ? 1053 GLN A CB  1 
ATOM   2326 C CG  . GLN A 1 290 ? 11.713  58.715 35.284  1.00 59.87 ? 1053 GLN A CG  1 
ATOM   2327 C CD  . GLN A 1 290 ? 11.301  60.121 35.710  1.00 59.73 ? 1053 GLN A CD  1 
ATOM   2328 O OE1 . GLN A 1 290 ? 12.006  61.096 35.442  1.00 59.62 ? 1053 GLN A OE1 1 
ATOM   2329 N NE2 . GLN A 1 290 ? 10.155  60.222 36.372  1.00 59.56 ? 1053 GLN A NE2 1 
ATOM   2330 N N   . ASP A 1 291 ? 15.531  59.118 32.317  1.00 59.26 ? 1054 ASP A N   1 
ATOM   2331 C CA  . ASP A 1 291 ? 16.939  59.233 31.914  1.00 58.72 ? 1054 ASP A CA  1 
ATOM   2332 C C   . ASP A 1 291 ? 17.599  57.843 31.950  1.00 58.64 ? 1054 ASP A C   1 
ATOM   2333 O O   . ASP A 1 291 ? 17.134  56.929 31.256  1.00 58.02 ? 1054 ASP A O   1 
ATOM   2334 C CB  . ASP A 1 291 ? 17.702  60.265 32.768  1.00 58.67 ? 1054 ASP A CB  1 
ATOM   2335 C CG  . ASP A 1 291 ? 17.242  61.696 32.528  1.00 58.30 ? 1054 ASP A CG  1 
ATOM   2336 O OD1 . ASP A 1 291 ? 16.772  62.015 31.415  1.00 58.02 ? 1054 ASP A OD1 1 
ATOM   2337 O OD2 . ASP A 1 291 ? 17.333  62.580 33.402  1.00 57.74 ? 1054 ASP A OD2 1 
ATOM   2338 N N   . ASP A 1 292 ? 18.648  57.673 32.761  1.00 58.45 ? 1055 ASP A N   1 
ATOM   2339 C CA  . ASP A 1 292 ? 19.373  56.399 32.845  1.00 58.28 ? 1055 ASP A CA  1 
ATOM   2340 C C   . ASP A 1 292 ? 18.626  55.334 33.662  1.00 57.76 ? 1055 ASP A C   1 
ATOM   2341 O O   . ASP A 1 292 ? 18.708  54.146 33.359  1.00 57.70 ? 1055 ASP A O   1 
ATOM   2342 C CB  . ASP A 1 292 ? 20.770  56.610 33.455  1.00 58.29 ? 1055 ASP A CB  1 
ATOM   2343 C CG  . ASP A 1 292 ? 21.731  57.314 32.507  1.00 58.65 ? 1055 ASP A CG  1 
ATOM   2344 O OD1 . ASP A 1 292 ? 21.487  57.310 31.281  1.00 59.19 ? 1055 ASP A OD1 1 
ATOM   2345 O OD2 . ASP A 1 292 ? 22.766  57.897 32.902  1.00 59.17 ? 1055 ASP A OD2 1 
ATOM   2346 N N   . ARG A 1 293 ? 17.901  55.766 34.689  1.00 57.00 ? 1056 ARG A N   1 
ATOM   2347 C CA  . ARG A 1 293 ? 17.368  54.855 35.698  1.00 56.30 ? 1056 ARG A CA  1 
ATOM   2348 C C   . ARG A 1 293 ? 16.148  54.071 35.217  1.00 55.04 ? 1056 ARG A C   1 
ATOM   2349 O O   . ARG A 1 293 ? 15.575  54.347 34.162  1.00 54.63 ? 1056 ARG A O   1 
ATOM   2350 C CB  . ARG A 1 293 ? 17.002  55.625 36.977  1.00 56.81 ? 1056 ARG A CB  1 
ATOM   2351 C CG  . ARG A 1 293 ? 18.111  56.488 37.570  1.00 57.77 ? 1056 ARG A CG  1 
ATOM   2352 C CD  . ARG A 1 293 ? 17.598  57.566 38.528  1.00 58.64 ? 1056 ARG A CD  1 
ATOM   2353 N NE  . ARG A 1 293 ? 18.568  58.643 38.732  1.00 59.27 ? 1056 ARG A NE  1 
ATOM   2354 C CZ  . ARG A 1 293 ? 18.310  59.788 39.361  1.00 59.95 ? 1056 ARG A CZ  1 
ATOM   2355 N NH1 . ARG A 1 293 ? 17.102  60.043 39.868  1.00 60.14 ? 1056 ARG A NH1 1 
ATOM   2356 N NH2 . ARG A 1 293 ? 19.265  60.692 39.489  1.00 60.20 ? 1056 ARG A NH2 1 
ATOM   2357 N N   . LEU A 1 294 ? 15.776  53.082 36.021  1.00 53.85 ? 1057 LEU A N   1 
ATOM   2358 C CA  . LEU A 1 294 ? 14.568  52.295 35.826  1.00 53.34 ? 1057 LEU A CA  1 
ATOM   2359 C C   . LEU A 1 294 ? 13.880  52.213 37.180  1.00 52.90 ? 1057 LEU A C   1 
ATOM   2360 O O   . LEU A 1 294 ? 14.336  51.485 38.065  1.00 51.94 ? 1057 LEU A O   1 
ATOM   2361 C CB  . LEU A 1 294 ? 14.899  50.879 35.341  1.00 53.19 ? 1057 LEU A CB  1 
ATOM   2362 C CG  . LEU A 1 294 ? 15.480  50.720 33.937  1.00 53.25 ? 1057 LEU A CG  1 
ATOM   2363 C CD1 . LEU A 1 294 ? 15.775  49.241 33.684  1.00 53.09 ? 1057 LEU A CD1 1 
ATOM   2364 C CD2 . LEU A 1 294 ? 14.560  51.301 32.859  1.00 52.81 ? 1057 LEU A CD2 1 
ATOM   2365 N N   . VAL A 1 295 ? 12.772  52.939 37.332  1.00 52.73 ? 1058 VAL A N   1 
ATOM   2366 C CA  . VAL A 1 295 ? 12.209  53.203 38.656  1.00 52.04 ? 1058 VAL A CA  1 
ATOM   2367 C C   . VAL A 1 295 ? 11.157  52.176 39.070  1.00 51.31 ? 1058 VAL A C   1 
ATOM   2368 O O   . VAL A 1 295 ? 10.269  51.834 38.297  1.00 50.77 ? 1058 VAL A O   1 
ATOM   2369 C CB  . VAL A 1 295 ? 11.611  54.619 38.756  1.00 52.25 ? 1058 VAL A CB  1 
ATOM   2370 C CG1 . VAL A 1 295 ? 11.666  55.106 40.198  1.00 52.49 ? 1058 VAL A CG1 1 
ATOM   2371 C CG2 . VAL A 1 295 ? 12.346  55.599 37.838  1.00 52.25 ? 1058 VAL A CG2 1 
ATOM   2372 N N   . LEU A 1 296 ? 11.299  51.676 40.295  1.00 51.14 ? 1059 LEU A N   1 
ATOM   2373 C CA  . LEU A 1 296 ? 10.315  50.818 40.932  1.00 51.77 ? 1059 LEU A CA  1 
ATOM   2374 C C   . LEU A 1 296 ? 9.538   51.652 41.966  1.00 52.55 ? 1059 LEU A C   1 
ATOM   2375 O O   . LEU A 1 296 ? 10.048  51.923 43.059  1.00 52.31 ? 1059 LEU A O   1 
ATOM   2376 C CB  . LEU A 1 296 ? 11.009  49.635 41.607  1.00 51.57 ? 1059 LEU A CB  1 
ATOM   2377 C CG  . LEU A 1 296 ? 10.120  48.435 41.957  1.00 52.13 ? 1059 LEU A CG  1 
ATOM   2378 C CD1 . LEU A 1 296 ? 9.694   47.675 40.705  1.00 52.24 ? 1059 LEU A CD1 1 
ATOM   2379 C CD2 . LEU A 1 296 ? 10.819  47.501 42.947  1.00 51.94 ? 1059 LEU A CD2 1 
ATOM   2380 N N   . ARG A 1 297 ? 8.320   52.069 41.598  1.00 52.95 ? 1060 ARG A N   1 
ATOM   2381 C CA  . ARG A 1 297 ? 7.457   52.903 42.454  1.00 53.31 ? 1060 ARG A CA  1 
ATOM   2382 C C   . ARG A 1 297 ? 5.953   52.708 42.154  1.00 53.50 ? 1060 ARG A C   1 
ATOM   2383 O O   . ARG A 1 297 ? 5.579   51.845 41.356  1.00 52.93 ? 1060 ARG A O   1 
ATOM   2384 C CB  . ARG A 1 297 ? 7.853   54.380 42.311  1.00 53.44 ? 1060 ARG A CB  1 
ATOM   2385 C CG  . ARG A 1 297 ? 7.760   54.925 40.892  1.00 53.52 ? 1060 ARG A CG  1 
ATOM   2386 C CD  . ARG A 1 297 ? 7.663   56.437 40.828  1.00 53.70 ? 1060 ARG A CD  1 
ATOM   2387 N NE  . ARG A 1 297 ? 6.309   56.883 40.506  1.00 54.26 ? 1060 ARG A NE  1 
ATOM   2388 C CZ  . ARG A 1 297 ? 5.852   58.119 40.687  1.00 54.03 ? 1060 ARG A CZ  1 
ATOM   2389 N NH1 . ARG A 1 297 ? 6.634   59.071 41.189  1.00 54.26 ? 1060 ARG A NH1 1 
ATOM   2390 N NH2 . ARG A 1 297 ? 4.599   58.407 40.355  1.00 53.72 ? 1060 ARG A NH2 1 
ATOM   2391 N N   . CYS A 1 298 ? 5.094   53.502 42.802  1.00 54.33 ? 1061 CYS A N   1 
ATOM   2392 C CA  . CYS A 1 298 ? 3.635   53.403 42.609  1.00 54.47 ? 1061 CYS A CA  1 
ATOM   2393 C C   . CYS A 1 298 ? 3.023   54.696 42.064  1.00 54.20 ? 1061 CYS A C   1 
ATOM   2394 O O   . CYS A 1 298 ? 3.733   55.639 41.711  1.00 53.64 ? 1061 CYS A O   1 
ATOM   2395 C CB  . CYS A 1 298 ? 2.954   53.017 43.927  1.00 54.70 ? 1061 CYS A CB  1 
ATOM   2396 S SG  . CYS A 1 298 ? 3.705   51.594 44.772  1.00 55.49 ? 1061 CYS A SG  1 
ATOM   2397 N N   . THR A 1 312 ? -1.263  52.211 46.830  1.00 54.66 ? 1075 THR A N   1 
ATOM   2398 C CA  . THR A 1 312 ? -1.374  50.804 47.198  1.00 54.46 ? 1075 THR A CA  1 
ATOM   2399 C C   . THR A 1 312 ? -1.123  49.853 46.023  1.00 54.20 ? 1075 THR A C   1 
ATOM   2400 O O   . THR A 1 312 ? -1.022  48.649 46.239  1.00 54.43 ? 1075 THR A O   1 
ATOM   2401 C CB  . THR A 1 312 ? -2.771  50.510 47.822  1.00 54.62 ? 1075 THR A CB  1 
ATOM   2402 O OG1 . THR A 1 312 ? -3.818  50.992 46.967  1.00 54.36 ? 1075 THR A OG1 1 
ATOM   2403 C CG2 . THR A 1 312 ? -2.975  51.287 49.118  1.00 54.68 ? 1075 THR A CG2 1 
ATOM   2404 N N   . PHE A 1 313 ? -1.018  50.386 44.800  1.00 53.82 ? 1076 PHE A N   1 
ATOM   2405 C CA  . PHE A 1 313 ? -0.826  49.572 43.581  1.00 53.88 ? 1076 PHE A CA  1 
ATOM   2406 C C   . PHE A 1 313 ? 0.657   49.198 43.358  1.00 53.20 ? 1076 PHE A C   1 
ATOM   2407 O O   . PHE A 1 313 ? 1.463   50.055 42.982  1.00 52.64 ? 1076 PHE A O   1 
ATOM   2408 C CB  . PHE A 1 313 ? -1.315  50.330 42.333  1.00 54.34 ? 1076 PHE A CB  1 
ATOM   2409 C CG  . PHE A 1 313 ? -2.819  50.519 42.256  1.00 56.28 ? 1076 PHE A CG  1 
ATOM   2410 C CD1 . PHE A 1 313 ? -3.580  49.790 41.340  1.00 56.84 ? 1076 PHE A CD1 1 
ATOM   2411 C CD2 . PHE A 1 313 ? -3.468  51.454 43.068  1.00 56.87 ? 1076 PHE A CD2 1 
ATOM   2412 C CE1 . PHE A 1 313 ? -4.956  49.972 41.255  1.00 56.98 ? 1076 PHE A CE1 1 
ATOM   2413 C CE2 . PHE A 1 313 ? -4.850  51.644 42.987  1.00 57.29 ? 1076 PHE A CE2 1 
ATOM   2414 C CZ  . PHE A 1 313 ? -5.593  50.902 42.081  1.00 57.42 ? 1076 PHE A CZ  1 
ATOM   2415 N N   . SER A 1 314 ? 1.001   47.923 43.551  1.00 52.37 ? 1077 SER A N   1 
ATOM   2416 C CA  . SER A 1 314 ? 2.388   47.459 43.415  1.00 51.84 ? 1077 SER A CA  1 
ATOM   2417 C C   . SER A 1 314 ? 2.872   47.450 41.955  1.00 51.57 ? 1077 SER A C   1 
ATOM   2418 O O   . SER A 1 314 ? 2.128   47.047 41.058  1.00 51.19 ? 1077 SER A O   1 
ATOM   2419 C CB  . SER A 1 314 ? 2.537   46.050 44.005  1.00 51.75 ? 1077 SER A CB  1 
ATOM   2420 O OG  . SER A 1 314 ? 3.899   45.693 44.184  1.00 51.12 ? 1077 SER A OG  1 
ATOM   2421 N N   . PRO A 1 315 ? 4.115   47.883 41.713  1.00 51.54 ? 1078 PRO A N   1 
ATOM   2422 C CA  . PRO A 1 315 ? 4.738   47.749 40.381  1.00 51.16 ? 1078 PRO A CA  1 
ATOM   2423 C C   . PRO A 1 315 ? 5.243   46.334 40.096  1.00 50.04 ? 1078 PRO A C   1 
ATOM   2424 O O   . PRO A 1 315 ? 5.589   46.056 38.964  1.00 49.77 ? 1078 PRO A O   1 
ATOM   2425 C CB  . PRO A 1 315 ? 5.914   48.726 40.441  1.00 51.33 ? 1078 PRO A CB  1 
ATOM   2426 C CG  . PRO A 1 315 ? 6.297   48.740 41.872  1.00 51.49 ? 1078 PRO A CG  1 
ATOM   2427 C CD  . PRO A 1 315 ? 5.030   48.524 42.675  1.00 51.41 ? 1078 PRO A CD  1 
ATOM   2428 N N   . VAL A 1 316 ? 5.293   45.479 41.114  1.00 50.15 ? 1079 VAL A N   1 
ATOM   2429 C CA  . VAL A 1 316 ? 5.571   44.056 40.946  1.00 50.93 ? 1079 VAL A CA  1 
ATOM   2430 C C   . VAL A 1 316 ? 4.275   43.277 41.111  1.00 51.49 ? 1079 VAL A C   1 
ATOM   2431 O O   . VAL A 1 316 ? 3.673   43.280 42.191  1.00 51.00 ? 1079 VAL A O   1 
ATOM   2432 C CB  . VAL A 1 316 ? 6.605   43.547 41.995  1.00 50.92 ? 1079 VAL A CB  1 
ATOM   2433 C CG1 . VAL A 1 316 ? 6.496   42.021 42.245  1.00 50.44 ? 1079 VAL A CG1 1 
ATOM   2434 C CG2 . VAL A 1 316 ? 8.009   43.914 41.558  1.00 51.30 ? 1079 VAL A CG2 1 
ATOM   2435 N N   . ILE A 1 317 ? 3.877   42.591 40.044  1.00 52.08 ? 1080 ILE A N   1 
ATOM   2436 C CA  . ILE A 1 317 ? 2.688   41.755 40.045  1.00 53.05 ? 1080 ILE A CA  1 
ATOM   2437 C C   . ILE A 1 317 ? 3.072   40.278 40.041  1.00 53.30 ? 1080 ILE A C   1 
ATOM   2438 O O   . ILE A 1 317 ? 3.627   39.781 39.070  1.00 54.02 ? 1080 ILE A O   1 
ATOM   2439 C CB  . ILE A 1 317 ? 1.828   42.070 38.800  1.00 53.24 ? 1080 ILE A CB  1 
ATOM   2440 C CG1 . ILE A 1 317 ? 1.461   43.556 38.753  1.00 53.50 ? 1080 ILE A CG1 1 
ATOM   2441 C CG2 . ILE A 1 317 ? 0.587   41.198 38.783  1.00 53.24 ? 1080 ILE A CG2 1 
ATOM   2442 C CD1 . ILE A 1 317 ? 1.314   44.102 37.335  1.00 54.27 ? 1080 ILE A CD1 1 
ATOM   2443 N N   . LYS A 1 318 ? 2.762   39.576 41.118  1.00 54.15 ? 1081 LYS A N   1 
ATOM   2444 C CA  . LYS A 1 318 ? 3.039   38.148 41.200  1.00 55.19 ? 1081 LYS A CA  1 
ATOM   2445 C C   . LYS A 1 318 ? 2.179   37.374 40.195  1.00 56.10 ? 1081 LYS A C   1 
ATOM   2446 O O   . LYS A 1 318 ? 0.956   37.425 40.250  1.00 56.41 ? 1081 LYS A O   1 
ATOM   2447 C CB  . LYS A 1 318 ? 2.798   37.649 42.622  1.00 55.40 ? 1081 LYS A CB  1 
ATOM   2448 C CG  . LYS A 1 318 ? 3.666   38.362 43.668  1.00 56.25 ? 1081 LYS A CG  1 
ATOM   2449 C CD  . LYS A 1 318 ? 4.009   37.452 44.839  1.00 57.06 ? 1081 LYS A CD  1 
ATOM   2450 C CE  . LYS A 1 318 ? 5.107   38.041 45.724  1.00 57.66 ? 1081 LYS A CE  1 
ATOM   2451 N NZ  . LYS A 1 318 ? 5.062   37.492 47.121  1.00 57.67 ? 1081 LYS A NZ  1 
ATOM   2452 N N   . LEU A 1 319 ? 2.828   36.671 39.268  1.00 56.97 ? 1082 LEU A N   1 
ATOM   2453 C CA  . LEU A 1 319 ? 2.127   35.911 38.223  1.00 57.35 ? 1082 LEU A CA  1 
ATOM   2454 C C   . LEU A 1 319 ? 1.264   34.765 38.769  1.00 57.37 ? 1082 LEU A C   1 
ATOM   2455 O O   . LEU A 1 319 ? 0.363   34.278 38.081  1.00 57.66 ? 1082 LEU A O   1 
ATOM   2456 C CB  . LEU A 1 319 ? 3.133   35.349 37.201  1.00 57.45 ? 1082 LEU A CB  1 
ATOM   2457 C CG  . LEU A 1 319 ? 3.885   36.373 36.347  1.00 57.35 ? 1082 LEU A CG  1 
ATOM   2458 C CD1 . LEU A 1 319 ? 4.998   35.695 35.559  1.00 57.74 ? 1082 LEU A CD1 1 
ATOM   2459 C CD2 . LEU A 1 319 ? 2.940   37.115 35.404  1.00 57.09 ? 1082 LEU A CD2 1 
ATOM   2460 N N   . SER A 1 320 ? 1.546   34.341 39.998  1.00 57.33 ? 1083 SER A N   1 
ATOM   2461 C CA  . SER A 1 320 ? 0.796   33.276 40.660  1.00 57.36 ? 1083 SER A CA  1 
ATOM   2462 C C   . SER A 1 320 ? -0.685  33.621 40.869  1.00 58.18 ? 1083 SER A C   1 
ATOM   2463 O O   . SER A 1 320 ? -1.505  32.738 41.120  1.00 58.11 ? 1083 SER A O   1 
ATOM   2464 C CB  . SER A 1 320 ? 1.432   32.984 42.016  1.00 56.96 ? 1083 SER A CB  1 
ATOM   2465 O OG  . SER A 1 320 ? 0.863   31.835 42.606  1.00 56.62 ? 1083 SER A OG  1 
ATOM   2466 N N   . THR A 1 321 ? -1.006  34.907 40.772  1.00 58.99 ? 1084 THR A N   1 
ATOM   2467 C CA  . THR A 1 321 ? -2.333  35.427 41.057  1.00 59.77 ? 1084 THR A CA  1 
ATOM   2468 C C   . THR A 1 321 ? -2.992  36.072 39.841  1.00 60.47 ? 1084 THR A C   1 
ATOM   2469 O O   . THR A 1 321 ? -4.100  36.578 39.945  1.00 60.93 ? 1084 THR A O   1 
ATOM   2470 C CB  . THR A 1 321 ? -2.219  36.494 42.165  1.00 59.80 ? 1084 THR A CB  1 
ATOM   2471 O OG1 . THR A 1 321 ? -1.526  37.653 41.662  1.00 59.51 ? 1084 THR A OG1 1 
ATOM   2472 C CG2 . THR A 1 321 ? -1.356  36.002 43.334  1.00 59.33 ? 1084 THR A CG2 1 
ATOM   2473 N N   . VAL A 1 322 ? -2.319  36.061 38.694  1.00 61.46 ? 1085 VAL A N   1 
ATOM   2474 C CA  . VAL A 1 322 ? -2.753  36.868 37.559  1.00 62.05 ? 1085 VAL A CA  1 
ATOM   2475 C C   . VAL A 1 322 ? -3.795  36.170 36.696  1.00 62.48 ? 1085 VAL A C   1 
ATOM   2476 O O   . VAL A 1 322 ? -3.745  34.957 36.479  1.00 62.16 ? 1085 VAL A O   1 
ATOM   2477 C CB  . VAL A 1 322 ? -1.563  37.309 36.680  1.00 62.09 ? 1085 VAL A CB  1 
ATOM   2478 C CG1 . VAL A 1 322 ? -2.033  37.969 35.391  1.00 62.56 ? 1085 VAL A CG1 1 
ATOM   2479 C CG2 . VAL A 1 322 ? -0.705  38.282 37.438  1.00 62.75 ? 1085 VAL A CG2 1 
ATOM   2480 N N   . LEU A 1 323 ? -4.754  36.973 36.244  1.00 62.95 ? 1086 LEU A N   1 
ATOM   2481 C CA  . LEU A 1 323 ? -5.652  36.632 35.155  1.00 63.48 ? 1086 LEU A CA  1 
ATOM   2482 C C   . LEU A 1 323 ? -5.531  37.759 34.144  1.00 63.58 ? 1086 LEU A C   1 
ATOM   2483 O O   . LEU A 1 323 ? -5.417  38.924 34.511  1.00 63.15 ? 1086 LEU A O   1 
ATOM   2484 C CB  . LEU A 1 323 ? -7.103  36.516 35.655  1.00 63.97 ? 1086 LEU A CB  1 
ATOM   2485 C CG  . LEU A 1 323 ? -7.499  35.213 36.361  1.00 64.05 ? 1086 LEU A CG  1 
ATOM   2486 C CD1 . LEU A 1 323 ? -8.929  35.292 36.869  1.00 64.44 ? 1086 LEU A CD1 1 
ATOM   2487 C CD2 . LEU A 1 323 ? -7.323  34.009 35.425  1.00 64.46 ? 1086 LEU A CD2 1 
ATOM   2488 N N   . VAL A 1 324 ? -5.537  37.412 32.868  1.00 64.60 ? 1087 VAL A N   1 
ATOM   2489 C CA  . VAL A 1 324 ? -5.420  38.417 31.810  1.00 65.36 ? 1087 VAL A CA  1 
ATOM   2490 C C   . VAL A 1 324 ? -6.637  38.316 30.902  1.00 65.72 ? 1087 VAL A C   1 
ATOM   2491 O O   . VAL A 1 324 ? -7.186  37.235 30.735  1.00 65.65 ? 1087 VAL A O   1 
ATOM   2492 C CB  . VAL A 1 324 ? -4.129  38.227 31.001  1.00 65.23 ? 1087 VAL A CB  1 
ATOM   2493 C CG1 . VAL A 1 324 ? -4.009  39.272 29.892  1.00 65.48 ? 1087 VAL A CG1 1 
ATOM   2494 C CG2 . VAL A 1 324 ? -2.925  38.306 31.924  1.00 65.86 ? 1087 VAL A CG2 1 
ATOM   2495 N N   . ARG A 1 325 ? -7.058  39.450 30.348  1.00 66.00 ? 1088 ARG A N   1 
ATOM   2496 C CA  . ARG A 1 325 ? -8.157  39.500 29.389  1.00 66.27 ? 1088 ARG A CA  1 
ATOM   2497 C C   . ARG A 1 325 ? -7.948  40.671 28.436  1.00 67.32 ? 1088 ARG A C   1 
ATOM   2498 O O   . ARG A 1 325 ? -7.604  41.767 28.868  1.00 67.70 ? 1088 ARG A O   1 
ATOM   2499 C CB  . ARG A 1 325 ? -9.519  39.670 30.097  1.00 65.84 ? 1088 ARG A CB  1 
ATOM   2500 C CG  . ARG A 1 325 ? -10.048 38.452 30.889  1.00 64.48 ? 1088 ARG A CG  1 
ATOM   2501 C CD  . ARG A 1 325 ? -10.271 37.195 30.049  1.00 63.22 ? 1088 ARG A CD  1 
ATOM   2502 N NE  . ARG A 1 325 ? -10.967 36.130 30.785  1.00 62.31 ? 1088 ARG A NE  1 
ATOM   2503 C CZ  . ARG A 1 325 ? -10.397 35.308 31.666  1.00 61.65 ? 1088 ARG A CZ  1 
ATOM   2504 N NH1 . ARG A 1 325 ? -9.102  35.407 31.970  1.00 62.63 ? 1088 ARG A NH1 1 
ATOM   2505 N NH2 . ARG A 1 325 ? -11.123 34.369 32.247  1.00 61.32 ? 1088 ARG A NH2 1 
ATOM   2506 N N   . GLN A 1 326 ? -8.166  40.437 27.144  1.00 68.24 ? 1089 GLN A N   1 
ATOM   2507 C CA  . GLN A 1 326 ? -8.189  41.513 26.156  1.00 69.20 ? 1089 GLN A CA  1 
ATOM   2508 C C   . GLN A 1 326 ? -9.304  42.507 26.505  1.00 69.50 ? 1089 GLN A C   1 
ATOM   2509 O O   . GLN A 1 326 ? -10.255 42.162 27.222  1.00 70.31 ? 1089 GLN A O   1 
ATOM   2510 C CB  . GLN A 1 326 ? -8.386  40.940 24.741  1.00 69.73 ? 1089 GLN A CB  1 
ATOM   2511 C CG  . GLN A 1 326 ? -7.952  41.856 23.607  1.00 71.38 ? 1089 GLN A CG  1 
ATOM   2512 C CD  . GLN A 1 326 ? -8.483  41.411 22.253  1.00 72.96 ? 1089 GLN A CD  1 
ATOM   2513 O OE1 . GLN A 1 326 ? -7.815  40.673 21.534  1.00 74.92 ? 1089 GLN A OE1 1 
ATOM   2514 N NE2 . GLN A 1 326 ? -9.677  41.872 21.898  1.00 73.38 ? 1089 GLN A NE2 1 
ATOM   2515 N N   . VAL A 1 327 ? -9.170  43.739 26.018  1.00 70.08 ? 1090 VAL A N   1 
ATOM   2516 C CA  . VAL A 1 327 ? -10.156 44.798 26.251  1.00 70.63 ? 1090 VAL A CA  1 
ATOM   2517 C C   . VAL A 1 327 ? -10.951 45.101 24.967  1.00 71.05 ? 1090 VAL A C   1 
ATOM   2518 O O   . VAL A 1 327 ? -10.368 45.461 23.934  1.00 70.96 ? 1090 VAL A O   1 
ATOM   2519 C CB  . VAL A 1 327 ? -9.486  46.101 26.773  1.00 70.64 ? 1090 VAL A CB  1 
ATOM   2520 C CG1 . VAL A 1 327 ? -10.527 47.067 27.329  1.00 70.74 ? 1090 VAL A CG1 1 
ATOM   2521 C CG2 . VAL A 1 327 ? -8.447  45.784 27.847  1.00 70.81 ? 1090 VAL A CG2 1 
ATOM   2522 N N   . ALA A 1 328 ? -12.281 44.953 25.052  1.00 71.41 ? 1091 ALA A N   1 
ATOM   2523 C CA  . ALA A 1 328 ? -13.182 45.183 23.916  1.00 71.30 ? 1091 ALA A CA  1 
ATOM   2524 C C   . ALA A 1 328 ? -13.198 46.649 23.449  1.00 70.68 ? 1091 ALA A C   1 
ATOM   2525 O O   . ALA A 1 328 ? -13.069 46.926 22.256  1.00 70.80 ? 1091 ALA A O   1 
ATOM   2526 C CB  . ALA A 1 328 ? -14.609 44.718 24.284  1.00 72.03 ? 1091 ALA A CB  1 
ATOM   2527 N N   . THR A 1 329 ? -13.352 47.573 24.397  1.00 70.54 ? 1092 THR A N   1 
ATOM   2528 C CA  . THR A 1 329 ? -13.364 49.014 24.113  1.00 70.57 ? 1092 THR A CA  1 
ATOM   2529 C C   . THR A 1 329 ? -11.964 49.522 23.787  1.00 70.61 ? 1092 THR A C   1 
ATOM   2530 O O   . THR A 1 329 ? -11.511 49.442 22.645  1.00 70.78 ? 1092 THR A O   1 
ATOM   2531 C CB  . THR A 1 329 ? -13.955 49.840 25.309  1.00 70.67 ? 1092 THR A CB  1 
ATOM   2532 O OG1 . THR A 1 329 ? -13.711 49.185 26.564  1.00 70.53 ? 1092 THR A OG1 1 
ATOM   2533 C CG2 . THR A 1 329 ? -15.481 49.938 25.222  1.00 70.65 ? 1092 THR A CG2 1 
ATOM   2534 N N   . ASN A 1 331 ? -9.157  49.680 23.860  1.00 66.45 ? 1094 ASN A N   1 
ATOM   2535 C CA  . ASN A 1 331 ? -8.060  49.592 22.908  1.00 66.65 ? 1094 ASN A CA  1 
ATOM   2536 C C   . ASN A 1 331 ? -7.524  48.165 22.828  1.00 65.97 ? 1094 ASN A C   1 
ATOM   2537 O O   . ASN A 1 331 ? -8.091  47.245 23.431  1.00 64.63 ? 1094 ASN A O   1 
ATOM   2538 C CB  . ASN A 1 331 ? -6.935  50.566 23.317  1.00 67.02 ? 1094 ASN A CB  1 
ATOM   2539 C CG  . ASN A 1 331 ? -6.183  51.152 22.123  1.00 68.32 ? 1094 ASN A CG  1 
ATOM   2540 O OD1 . ASN A 1 331 ? -6.774  51.461 21.085  1.00 70.19 ? 1094 ASN A OD1 1 
ATOM   2541 N ND2 . ASN A 1 331 ? -4.867  51.315 22.272  1.00 68.76 ? 1094 ASN A ND2 1 
ATOM   2542 N N   . LYS A 1 332 ? -6.422  47.988 22.087  1.00 65.95 ? 1095 LYS A N   1 
ATOM   2543 C CA  . LYS A 1 332 ? -5.702  46.712 22.075  1.00 65.47 ? 1095 LYS A CA  1 
ATOM   2544 C C   . LYS A 1 332 ? -4.680  46.744 23.219  1.00 65.02 ? 1095 LYS A C   1 
ATOM   2545 O O   . LYS A 1 332 ? -3.431  46.829 23.046  1.00 65.12 ? 1095 LYS A O   1 
ATOM   2546 C CB  . LYS A 1 332 ? -5.134  46.399 20.690  1.00 65.98 ? 1095 LYS A CB  1 
ATOM   2547 C CG  . LYS A 1 332 ? -6.052  45.520 19.799  1.00 67.00 ? 1095 LYS A CG  1 
ATOM   2548 C CD  . LYS A 1 332 ? -7.586  45.690 20.041  1.00 68.80 ? 1095 LYS A CD  1 
ATOM   2549 C CE  . LYS A 1 332 ? -8.328  45.833 18.733  1.00 69.67 ? 1095 LYS A CE  1 
ATOM   2550 N NZ  . LYS A 1 332 ? -9.777  45.697 18.947  1.00 70.44 ? 1095 LYS A NZ  1 
ATOM   2551 N N   . ALA A 1 333 ? -5.296  46.711 24.397  1.00 63.88 ? 1096 ALA A N   1 
ATOM   2552 C CA  . ALA A 1 333 ? -4.673  46.735 25.694  1.00 64.26 ? 1096 ALA A CA  1 
ATOM   2553 C C   . ALA A 1 333 ? -5.087  45.445 26.383  1.00 64.27 ? 1096 ALA A C   1 
ATOM   2554 O O   . ALA A 1 333 ? -5.723  44.581 25.783  1.00 65.38 ? 1096 ALA A O   1 
ATOM   2555 C CB  . ALA A 1 333 ? -5.175  47.938 26.484  1.00 64.08 ? 1096 ALA A CB  1 
ATOM   2556 N N   . LEU A 1 334 ? -4.729  45.323 27.651  1.00 64.01 ? 1097 LEU A N   1 
ATOM   2557 C CA  . LEU A 1 334 ? -5.051  44.142 28.426  1.00 63.63 ? 1097 LEU A CA  1 
ATOM   2558 C C   . LEU A 1 334 ? -5.388  44.583 29.831  1.00 63.67 ? 1097 LEU A C   1 
ATOM   2559 O O   . LEU A 1 334 ? -4.953  45.641 30.286  1.00 63.38 ? 1097 LEU A O   1 
ATOM   2560 C CB  . LEU A 1 334 ? -3.860  43.174 28.476  1.00 63.90 ? 1097 LEU A CB  1 
ATOM   2561 C CG  . LEU A 1 334 ? -3.205  42.734 27.158  1.00 63.98 ? 1097 LEU A CG  1 
ATOM   2562 C CD1 . LEU A 1 334 ? -1.828  42.158 27.405  1.00 63.66 ? 1097 LEU A CD1 1 
ATOM   2563 C CD2 . LEU A 1 334 ? -4.074  41.709 26.447  1.00 64.86 ? 1097 LEU A CD2 1 
ATOM   2564 N N   . PHE A 1 335 ? -6.179  43.765 30.508  1.00 63.47 ? 1098 PHE A N   1 
ATOM   2565 C CA  . PHE A 1 335 ? -6.402  43.923 31.924  1.00 63.81 ? 1098 PHE A CA  1 
ATOM   2566 C C   . PHE A 1 335 ? -5.549  42.853 32.559  1.00 63.07 ? 1098 PHE A C   1 
ATOM   2567 O O   . PHE A 1 335 ? -5.766  41.663 32.350  1.00 63.53 ? 1098 PHE A O   1 
ATOM   2568 C CB  . PHE A 1 335 ? -7.882  43.723 32.294  1.00 64.37 ? 1098 PHE A CB  1 
ATOM   2569 C CG  . PHE A 1 335 ? -8.798  44.797 31.766  1.00 65.31 ? 1098 PHE A CG  1 
ATOM   2570 C CD1 . PHE A 1 335 ? -8.501  46.140 31.947  1.00 65.66 ? 1098 PHE A CD1 1 
ATOM   2571 C CD2 . PHE A 1 335 ? -9.969  44.460 31.097  1.00 66.29 ? 1098 PHE A CD2 1 
ATOM   2572 C CE1 . PHE A 1 335 ? -9.343  47.123 31.462  1.00 66.15 ? 1098 PHE A CE1 1 
ATOM   2573 C CE2 . PHE A 1 335 ? -10.815 45.442 30.610  1.00 66.49 ? 1098 PHE A CE2 1 
ATOM   2574 C CZ  . PHE A 1 335 ? -10.503 46.775 30.791  1.00 66.57 ? 1098 PHE A CZ  1 
ATOM   2575 N N   . VAL A 1 336 ? -4.532  43.279 33.283  1.00 61.98 ? 1099 VAL A N   1 
ATOM   2576 C CA  . VAL A 1 336 ? -3.807  42.365 34.119  1.00 61.22 ? 1099 VAL A CA  1 
ATOM   2577 C C   . VAL A 1 336 ? -4.493  42.515 35.446  1.00 60.39 ? 1099 VAL A C   1 
ATOM   2578 O O   . VAL A 1 336 ? -4.726  43.624 35.905  1.00 59.87 ? 1099 VAL A O   1 
ATOM   2579 C CB  . VAL A 1 336 ? -2.306  42.707 34.193  1.00 60.81 ? 1099 VAL A CB  1 
ATOM   2580 C CG1 . VAL A 1 336 ? -1.584  41.696 35.052  1.00 61.08 ? 1099 VAL A CG1 1 
ATOM   2581 C CG2 . VAL A 1 336 ? -1.707  42.741 32.795  1.00 61.30 ? 1099 VAL A CG2 1 
ATOM   2582 N N   . ILE A 1 337 ? -4.819  41.388 36.056  1.00 60.23 ? 1100 ILE A N   1 
ATOM   2583 C CA  . ILE A 1 337 ? -5.668  41.367 37.212  1.00 60.37 ? 1100 ILE A CA  1 
ATOM   2584 C C   . ILE A 1 337 ? -4.993  40.553 38.290  1.00 60.79 ? 1100 ILE A C   1 
ATOM   2585 O O   . ILE A 1 337 ? -4.913  39.333 38.173  1.00 61.12 ? 1100 ILE A O   1 
ATOM   2586 C CB  . ILE A 1 337 ? -7.041  40.735 36.841  1.00 60.75 ? 1100 ILE A CB  1 
ATOM   2587 C CG1 . ILE A 1 337 ? -7.639  41.406 35.589  1.00 60.56 ? 1100 ILE A CG1 1 
ATOM   2588 C CG2 . ILE A 1 337 ? -7.997  40.836 38.006  1.00 59.88 ? 1100 ILE A CG2 1 
ATOM   2589 C CD1 . ILE A 1 337 ? -9.099  41.028 35.329  1.00 61.22 ? 1100 ILE A CD1 1 
ATOM   2590 N N   . SER A 1 338 ? -4.526  41.218 39.345  1.00 61.09 ? 1101 SER A N   1 
ATOM   2591 C CA  . SER A 1 338 ? -3.879  40.524 40.458  1.00 61.35 ? 1101 SER A CA  1 
ATOM   2592 C C   . SER A 1 338 ? -4.857  40.210 41.588  1.00 61.71 ? 1101 SER A C   1 
ATOM   2593 O O   . SER A 1 338 ? -5.599  41.077 42.031  1.00 61.77 ? 1101 SER A O   1 
ATOM   2594 C CB  . SER A 1 338 ? -2.683  41.325 40.990  1.00 61.16 ? 1101 SER A CB  1 
ATOM   2595 O OG  . SER A 1 338 ? -1.605  40.450 41.281  1.00 61.51 ? 1101 SER A OG  1 
ATOM   2596 N N   . MET A 1 339 ? -4.813  38.964 42.058  1.00 62.48 ? 1102 MET A N   1 
ATOM   2597 C CA  . MET A 1 339 ? -5.708  38.444 43.088  1.00 63.20 ? 1102 MET A CA  1 
ATOM   2598 C C   . MET A 1 339 ? -5.012  38.271 44.443  1.00 63.07 ? 1102 MET A C   1 
ATOM   2599 O O   . MET A 1 339 ? -4.074  37.481 44.566  1.00 63.32 ? 1102 MET A O   1 
ATOM   2600 C CB  . MET A 1 339 ? -6.255  37.082 42.637  1.00 64.02 ? 1102 MET A CB  1 
ATOM   2601 C CG  . MET A 1 339 ? -7.248  37.158 41.476  1.00 65.46 ? 1102 MET A CG  1 
ATOM   2602 S SD  . MET A 1 339 ? -8.767  38.072 41.893  1.00 67.91 ? 1102 MET A SD  1 
ATOM   2603 C CE  . MET A 1 339 ? -9.241  37.300 43.483  1.00 66.90 ? 1102 MET A CE  1 
ATOM   2604 N N   . SER A 1 340 ? -5.468  39.015 45.450  1.00 62.26 ? 1103 SER A N   1 
ATOM   2605 C CA  . SER A 1 340 ? -5.070  38.766 46.833  1.00 61.91 ? 1103 SER A CA  1 
ATOM   2606 C C   . SER A 1 340 ? -6.245  38.132 47.566  1.00 61.95 ? 1103 SER A C   1 
ATOM   2607 O O   . SER A 1 340 ? -7.321  37.941 46.987  1.00 62.22 ? 1103 SER A O   1 
ATOM   2608 C CB  . SER A 1 340 ? -4.615  40.055 47.542  1.00 61.72 ? 1103 SER A CB  1 
ATOM   2609 O OG  . SER A 1 340 ? -5.203  41.219 46.995  1.00 61.61 ? 1103 SER A OG  1 
ATOM   2610 N N   . ASP A 1 341 ? -6.035  37.803 48.837  1.00 61.83 ? 1104 ASP A N   1 
ATOM   2611 C CA  . ASP A 1 341 ? -7.107  37.304 49.699  1.00 61.91 ? 1104 ASP A CA  1 
ATOM   2612 C C   . ASP A 1 341 ? -8.176  38.372 49.992  1.00 61.99 ? 1104 ASP A C   1 
ATOM   2613 O O   . ASP A 1 341 ? -9.216  38.059 50.575  1.00 61.68 ? 1104 ASP A O   1 
ATOM   2614 C CB  . ASP A 1 341 ? -6.532  36.764 51.015  1.00 61.76 ? 1104 ASP A CB  1 
ATOM   2615 C CG  . ASP A 1 341 ? -5.689  35.514 50.820  1.00 61.77 ? 1104 ASP A CG  1 
ATOM   2616 O OD1 . ASP A 1 341 ? -5.406  35.147 49.660  1.00 61.99 ? 1104 ASP A OD1 1 
ATOM   2617 O OD2 . ASP A 1 341 ? -5.259  34.835 51.774  1.00 61.35 ? 1104 ASP A OD2 1 
ATOM   2618 N N   . ASN A 1 342 ? -7.912  39.622 49.599  1.00 62.17 ? 1105 ASN A N   1 
ATOM   2619 C CA  . ASN A 1 342 ? -8.900  40.700 49.680  1.00 62.41 ? 1105 ASN A CA  1 
ATOM   2620 C C   . ASN A 1 342 ? -9.830  40.672 48.470  1.00 62.29 ? 1105 ASN A C   1 
ATOM   2621 O O   . ASN A 1 342 ? -11.011 40.356 48.594  1.00 62.45 ? 1105 ASN A O   1 
ATOM   2622 C CB  . ASN A 1 342 ? -8.215  42.076 49.779  1.00 62.42 ? 1105 ASN A CB  1 
ATOM   2623 C CG  . ASN A 1 342 ? -8.140  42.603 51.209  1.00 62.90 ? 1105 ASN A CG  1 
ATOM   2624 O OD1 . ASN A 1 342 ? -9.099  42.505 51.985  1.00 62.66 ? 1105 ASN A OD1 1 
ATOM   2625 N ND2 . ASN A 1 342 ? -6.995  43.179 51.558  1.00 63.09 ? 1105 ASN A ND2 1 
ATOM   2626 N N   . GLY A 1 343 ? -9.280  41.002 47.306  1.00 62.32 ? 1106 GLY A N   1 
ATOM   2627 C CA  . GLY A 1 343 ? -10.038 41.046 46.072  1.00 62.23 ? 1106 GLY A CA  1 
ATOM   2628 C C   . GLY A 1 343 ? -9.112  41.171 44.874  1.00 62.58 ? 1106 GLY A C   1 
ATOM   2629 O O   . GLY A 1 343 ? -8.210  40.345 44.688  1.00 63.31 ? 1106 GLY A O   1 
ATOM   2630 N N   . ALA A 1 344 ? -9.312  42.216 44.074  1.00 61.92 ? 1107 ALA A N   1 
ATOM   2631 C CA  . ALA A 1 344 ? -8.550  42.394 42.849  1.00 61.47 ? 1107 ALA A CA  1 
ATOM   2632 C C   . ALA A 1 344 ? -8.140  43.845 42.606  1.00 61.25 ? 1107 ALA A C   1 
ATOM   2633 O O   . ALA A 1 344 ? -8.903  44.775 42.859  1.00 61.14 ? 1107 ALA A O   1 
ATOM   2634 C CB  . ALA A 1 344 ? -9.344  41.872 41.658  1.00 61.43 ? 1107 ALA A CB  1 
ATOM   2635 N N   . GLN A 1 345 ? -6.909  44.020 42.132  1.00 60.69 ? 1108 GLN A N   1 
ATOM   2636 C CA  . GLN A 1 345 ? -6.464  45.279 41.559  1.00 60.03 ? 1108 GLN A CA  1 
ATOM   2637 C C   . GLN A 1 345 ? -6.416  45.040 40.057  1.00 59.48 ? 1108 GLN A C   1 
ATOM   2638 O O   . GLN A 1 345 ? -6.247  43.906 39.618  1.00 59.42 ? 1108 GLN A O   1 
ATOM   2639 C CB  . GLN A 1 345 ? -5.088  45.670 42.118  1.00 60.27 ? 1108 GLN A CB  1 
ATOM   2640 C CG  . GLN A 1 345 ? -4.960  45.500 43.644  1.00 60.13 ? 1108 GLN A CG  1 
ATOM   2641 C CD  . GLN A 1 345 ? -3.877  46.379 44.261  1.00 60.22 ? 1108 GLN A CD  1 
ATOM   2642 O OE1 . GLN A 1 345 ? -2.750  46.431 43.753  1.00 60.91 ? 1108 GLN A OE1 1 
ATOM   2643 N NE2 . GLN A 1 345 ? -4.210  47.062 45.358  1.00 59.22 ? 1108 GLN A NE2 1 
ATOM   2644 N N   . ILE A 1 346 ? -6.599  46.092 39.270  1.00 59.10 ? 1109 ILE A N   1 
ATOM   2645 C CA  . ILE A 1 346 ? -6.583  45.969 37.814  1.00 58.90 ? 1109 ILE A CA  1 
ATOM   2646 C C   . ILE A 1 346 ? -5.590  46.961 37.229  1.00 58.32 ? 1109 ILE A C   1 
ATOM   2647 O O   . ILE A 1 346 ? -5.628  48.155 37.525  1.00 57.70 ? 1109 ILE A O   1 
ATOM   2648 C CB  . ILE A 1 346 ? -8.004  46.198 37.201  1.00 59.28 ? 1109 ILE A CB  1 
ATOM   2649 C CG1 . ILE A 1 346 ? -8.949  45.054 37.585  1.00 59.69 ? 1109 ILE A CG1 1 
ATOM   2650 C CG2 . ILE A 1 346 ? -7.931  46.314 35.668  1.00 59.21 ? 1109 ILE A CG2 1 
ATOM   2651 C CD1 . ILE A 1 346 ? -10.410 45.413 37.497  1.00 60.29 ? 1109 ILE A CD1 1 
ATOM   2652 N N   . TYR A 1 347 ? -4.686  46.440 36.411  1.00 58.27 ? 1110 TYR A N   1 
ATOM   2653 C CA  . TYR A 1 347 ? -3.773  47.258 35.648  1.00 58.06 ? 1110 TYR A CA  1 
ATOM   2654 C C   . TYR A 1 347 ? -4.254  47.192 34.219  1.00 58.66 ? 1110 TYR A C   1 
ATOM   2655 O O   . TYR A 1 347 ? -4.367  46.106 33.661  1.00 58.62 ? 1110 TYR A O   1 
ATOM   2656 C CB  . TYR A 1 347 ? -2.335  46.716 35.744  1.00 57.52 ? 1110 TYR A CB  1 
ATOM   2657 C CG  . TYR A 1 347 ? -1.805  46.548 37.154  1.00 55.60 ? 1110 TYR A CG  1 
ATOM   2658 C CD1 . TYR A 1 347 ? -0.930  47.489 37.710  1.00 55.09 ? 1110 TYR A CD1 1 
ATOM   2659 C CD2 . TYR A 1 347 ? -2.161  45.443 37.924  1.00 54.62 ? 1110 TYR A CD2 1 
ATOM   2660 C CE1 . TYR A 1 347 ? -0.435  47.336 38.998  1.00 54.10 ? 1110 TYR A CE1 1 
ATOM   2661 C CE2 . TYR A 1 347 ? -1.677  45.284 39.214  1.00 54.34 ? 1110 TYR A CE2 1 
ATOM   2662 C CZ  . TYR A 1 347 ? -0.811  46.231 39.741  1.00 54.17 ? 1110 TYR A CZ  1 
ATOM   2663 O OH  . TYR A 1 347 ? -0.325  46.073 41.011  1.00 53.84 ? 1110 TYR A OH  1 
ATOM   2664 N N   . GLU A 1 348 ? -4.567  48.350 33.645  1.00 59.71 ? 1111 GLU A N   1 
ATOM   2665 C CA  . GLU A 1 348 ? -4.811  48.465 32.211  1.00 60.20 ? 1111 GLU A CA  1 
ATOM   2666 C C   . GLU A 1 348 ? -3.495  48.874 31.542  1.00 60.98 ? 1111 GLU A C   1 
ATOM   2667 O O   . GLU A 1 348 ? -3.005  49.982 31.757  1.00 61.09 ? 1111 GLU A O   1 
ATOM   2668 C CB  . GLU A 1 348 ? -5.907  49.500 31.943  1.00 60.15 ? 1111 GLU A CB  1 
ATOM   2669 C CG  . GLU A 1 348 ? -6.647  49.322 30.618  1.00 59.91 ? 1111 GLU A CG  1 
ATOM   2670 C CD  . GLU A 1 348 ? -7.816  50.290 30.449  1.00 58.65 ? 1111 GLU A CD  1 
ATOM   2671 O OE1 . GLU A 1 348 ? -8.440  50.658 31.464  1.00 57.11 ? 1111 GLU A OE1 1 
ATOM   2672 O OE2 . GLU A 1 348 ? -8.103  50.697 29.301  1.00 57.18 ? 1111 GLU A OE2 1 
ATOM   2673 N N   . LEU A 1 349 ? -2.919  47.963 30.755  1.00 61.82 ? 1112 LEU A N   1 
ATOM   2674 C CA  . LEU A 1 349 ? -1.640  48.186 30.075  1.00 62.31 ? 1112 LEU A CA  1 
ATOM   2675 C C   . LEU A 1 349 ? -1.807  48.108 28.560  1.00 63.11 ? 1112 LEU A C   1 
ATOM   2676 O O   . LEU A 1 349 ? -2.276  47.103 28.037  1.00 62.98 ? 1112 LEU A O   1 
ATOM   2677 C CB  . LEU A 1 349 ? -0.613  47.148 30.533  1.00 62.00 ? 1112 LEU A CB  1 
ATOM   2678 C CG  . LEU A 1 349 ? -0.512  46.977 32.048  1.00 61.32 ? 1112 LEU A CG  1 
ATOM   2679 C CD1 . LEU A 1 349 ? 0.285   45.735 32.408  1.00 61.23 ? 1112 LEU A CD1 1 
ATOM   2680 C CD2 . LEU A 1 349 ? 0.098   48.222 32.671  1.00 61.20 ? 1112 LEU A CD2 1 
ATOM   2681 N N   . VAL A 1 350 ? -1.395  49.165 27.866  1.00 64.10 ? 1113 VAL A N   1 
ATOM   2682 C CA  . VAL A 1 350 ? -1.637  49.318 26.434  1.00 65.02 ? 1113 VAL A CA  1 
ATOM   2683 C C   . VAL A 1 350 ? -0.344  49.229 25.631  1.00 66.19 ? 1113 VAL A C   1 
ATOM   2684 O O   . VAL A 1 350 ? 0.540   50.062 25.799  1.00 66.11 ? 1113 VAL A O   1 
ATOM   2685 C CB  . VAL A 1 350 ? -2.251  50.705 26.134  1.00 64.81 ? 1113 VAL A CB  1 
ATOM   2686 C CG1 . VAL A 1 350 ? -2.828  50.748 24.720  1.00 64.58 ? 1113 VAL A CG1 1 
ATOM   2687 C CG2 . VAL A 1 350 ? -3.294  51.074 27.184  1.00 65.04 ? 1113 VAL A CG2 1 
ATOM   2688 N N   . ALA A 1 351 ? -0.253  48.235 24.747  1.00 67.63 ? 1114 ALA A N   1 
ATOM   2689 C CA  . ALA A 1 351 ? 0.903   48.085 23.866  1.00 69.12 ? 1114 ALA A CA  1 
ATOM   2690 C C   . ALA A 1 351 ? 0.715   48.918 22.608  1.00 70.00 ? 1114 ALA A C   1 
ATOM   2691 O O   . ALA A 1 351 ? -0.365  49.459 22.361  1.00 69.32 ? 1114 ALA A O   1 
ATOM   2692 C CB  . ALA A 1 351 ? 1.127   46.618 23.507  1.00 69.42 ? 1114 ALA A CB  1 
ATOM   2693 N N   . GLN A 1 352 ? 1.773   48.989 21.809  1.00 70.76 ? 1115 GLN A N   1 
ATOM   2694 C CA  . GLN A 1 352 ? 1.837   49.900 20.665  1.00 72.08 ? 1115 GLN A CA  1 
ATOM   2695 C C   . GLN A 1 352 ? 1.169   49.332 19.408  1.00 73.67 ? 1115 GLN A C   1 
ATOM   2696 O O   . GLN A 1 352 ? 0.771   50.094 18.523  1.00 74.48 ? 1115 GLN A O   1 
ATOM   2697 C CB  . GLN A 1 352 ? 3.297   50.284 20.360  1.00 71.51 ? 1115 GLN A CB  1 
ATOM   2698 C CG  . GLN A 1 352 ? 4.153   50.528 21.609  1.00 70.79 ? 1115 GLN A CG  1 
ATOM   2699 C CD  . GLN A 1 352 ? 5.327   51.460 21.361  1.00 70.79 ? 1115 GLN A CD  1 
ATOM   2700 O OE1 . GLN A 1 352 ? 5.862   51.521 20.251  1.00 69.41 ? 1115 GLN A OE1 1 
ATOM   2701 N NE2 . GLN A 1 352 ? 5.731   52.186 22.396  1.00 70.38 ? 1115 GLN A NE2 1 
ATOM   2702 N N   . THR A 1 353 ? 1.072   48.007 19.315  1.00 74.95 ? 1116 THR A N   1 
ATOM   2703 C CA  . THR A 1 353 ? 0.375   47.361 18.198  1.00 76.00 ? 1116 THR A CA  1 
ATOM   2704 C C   . THR A 1 353 ? -0.442  46.166 18.671  1.00 77.12 ? 1116 THR A C   1 
ATOM   2705 O O   . THR A 1 353 ? -0.230  45.642 19.764  1.00 76.40 ? 1116 THR A O   1 
ATOM   2706 C CB  . THR A 1 353 ? 1.375   46.900 17.100  1.00 76.35 ? 1116 THR A CB  1 
ATOM   2707 O OG1 . THR A 1 353 ? 2.377   46.047 17.669  1.00 76.62 ? 1116 THR A OG1 1 
ATOM   2708 C CG2 . THR A 1 353 ? 2.165   48.071 16.521  1.00 75.83 ? 1116 THR A CG2 1 
ATOM   2709 N N   . VAL A 1 354 ? -1.383  45.741 17.833  1.00 78.69 ? 1117 VAL A N   1 
ATOM   2710 C CA  . VAL A 1 354 ? -2.156  44.536 18.106  1.00 79.72 ? 1117 VAL A CA  1 
ATOM   2711 C C   . VAL A 1 354 ? -1.217  43.334 18.191  1.00 80.60 ? 1117 VAL A C   1 
ATOM   2712 O O   . VAL A 1 354 ? -1.319  42.512 19.096  1.00 80.97 ? 1117 VAL A O   1 
ATOM   2713 C CB  . VAL A 1 354 ? -3.233  44.257 17.017  1.00 79.96 ? 1117 VAL A CB  1 
ATOM   2714 C CG1 . VAL A 1 354 ? -4.140  43.107 17.449  1.00 79.32 ? 1117 VAL A CG1 1 
ATOM   2715 C CG2 . VAL A 1 354 ? -4.062  45.511 16.718  1.00 80.46 ? 1117 VAL A CG2 1 
ATOM   2716 N N   . SER A 1 355 ? -0.288  43.247 17.252  1.00 81.85 ? 1118 SER A N   1 
ATOM   2717 C CA  . SER A 1 355 ? 0.580   42.082 17.169  1.00 82.48 ? 1118 SER A CA  1 
ATOM   2718 C C   . SER A 1 355 ? 1.352   41.823 18.469  1.00 82.43 ? 1118 SER A C   1 
ATOM   2719 O O   . SER A 1 355 ? 1.391   40.685 18.941  1.00 82.52 ? 1118 SER A O   1 
ATOM   2720 C CB  . SER A 1 355 ? 1.509   42.215 15.969  1.00 82.86 ? 1118 SER A CB  1 
ATOM   2721 O OG  . SER A 1 355 ? 0.719   42.278 14.790  1.00 84.12 ? 1118 SER A OG  1 
ATOM   2722 N N   . GLU A 1 356 ? 1.924   42.872 19.063  1.00 82.14 ? 1119 GLU A N   1 
ATOM   2723 C CA  . GLU A 1 356 ? 2.742   42.716 20.271  1.00 81.63 ? 1119 GLU A CA  1 
ATOM   2724 C C   . GLU A 1 356 ? 1.944   42.385 21.535  1.00 80.89 ? 1119 GLU A C   1 
ATOM   2725 O O   . GLU A 1 356 ? 2.416   41.610 22.359  1.00 80.61 ? 1119 GLU A O   1 
ATOM   2726 C CB  . GLU A 1 356 ? 3.624   43.949 20.513  1.00 82.16 ? 1119 GLU A CB  1 
ATOM   2727 C CG  . GLU A 1 356 ? 4.306   43.957 21.882  1.00 82.35 ? 1119 GLU A CG  1 
ATOM   2728 C CD  . GLU A 1 356 ? 5.486   44.896 21.967  1.00 81.79 ? 1119 GLU A CD  1 
ATOM   2729 O OE1 . GLU A 1 356 ? 5.645   45.731 21.052  1.00 81.71 ? 1119 GLU A OE1 1 
ATOM   2730 O OE2 . GLU A 1 356 ? 6.240   44.800 22.960  1.00 81.67 ? 1119 GLU A OE2 1 
ATOM   2731 N N   . LYS A 1 357 ? 0.750   42.959 21.696  1.00 80.11 ? 1120 LYS A N   1 
ATOM   2732 C CA  . LYS A 1 357 ? -0.077  42.648 22.864  1.00 79.34 ? 1120 LYS A CA  1 
ATOM   2733 C C   . LYS A 1 357 ? -0.586  41.207 22.843  1.00 78.51 ? 1120 LYS A C   1 
ATOM   2734 O O   . LYS A 1 357 ? -0.995  40.692 23.881  1.00 77.67 ? 1120 LYS A O   1 
ATOM   2735 C CB  . LYS A 1 357 ? -1.258  43.629 23.030  1.00 79.39 ? 1120 LYS A CB  1 
ATOM   2736 C CG  . LYS A 1 357 ? -2.394  43.457 22.043  1.00 79.11 ? 1120 LYS A CG  1 
ATOM   2737 C CD  . LYS A 1 357 ? -3.506  42.531 22.555  1.00 79.26 ? 1120 LYS A CD  1 
ATOM   2738 C CE  . LYS A 1 357 ? -4.783  42.705 21.753  1.00 79.06 ? 1120 LYS A CE  1 
ATOM   2739 N NZ  . LYS A 1 357 ? -5.411  41.400 21.412  1.00 79.86 ? 1120 LYS A NZ  1 
ATOM   2740 N N   . THR A 1 358 ? -0.565  40.559 21.677  1.00 77.43 ? 1121 THR A N   1 
ATOM   2741 C CA  . THR A 1 358 ? -0.962  39.150 21.602  1.00 77.02 ? 1121 THR A CA  1 
ATOM   2742 C C   . THR A 1 358 ? 0.190   38.275 22.072  1.00 75.22 ? 1121 THR A C   1 
ATOM   2743 O O   . THR A 1 358 ? -0.037  37.223 22.663  1.00 75.11 ? 1121 THR A O   1 
ATOM   2744 C CB  . THR A 1 358 ? -1.431  38.728 20.179  1.00 77.29 ? 1121 THR A CB  1 
ATOM   2745 O OG1 . THR A 1 358 ? -1.940  39.856 19.461  1.00 78.40 ? 1121 THR A OG1 1 
ATOM   2746 C CG2 . THR A 1 358 ? -2.635  37.795 20.267  1.00 77.36 ? 1121 THR A CG2 1 
ATOM   2747 N N   . VAL A 1 359 ? 1.418   38.716 21.807  1.00 73.75 ? 1122 VAL A N   1 
ATOM   2748 C CA  . VAL A 1 359 ? 2.610   38.108 22.399  1.00 71.90 ? 1122 VAL A CA  1 
ATOM   2749 C C   . VAL A 1 359 ? 2.599   38.314 23.926  1.00 69.73 ? 1122 VAL A C   1 
ATOM   2750 O O   . VAL A 1 359 ? 2.769   37.359 24.683  1.00 69.03 ? 1122 VAL A O   1 
ATOM   2751 C CB  . VAL A 1 359 ? 3.898   38.667 21.752  1.00 72.59 ? 1122 VAL A CB  1 
ATOM   2752 C CG1 . VAL A 1 359 ? 5.144   38.292 22.549  1.00 73.33 ? 1122 VAL A CG1 1 
ATOM   2753 C CG2 . VAL A 1 359 ? 4.029   38.172 20.313  1.00 73.17 ? 1122 VAL A CG2 1 
ATOM   2754 N N   . TRP A 1 360 ? 2.356   39.542 24.378  1.00 67.47 ? 1123 TRP A N   1 
ATOM   2755 C CA  . TRP A 1 360 ? 2.329   39.836 25.812  1.00 66.19 ? 1123 TRP A CA  1 
ATOM   2756 C C   . TRP A 1 360 ? 1.300   38.961 26.520  1.00 65.99 ? 1123 TRP A C   1 
ATOM   2757 O O   . TRP A 1 360 ? 1.604   38.351 27.545  1.00 65.08 ? 1123 TRP A O   1 
ATOM   2758 C CB  . TRP A 1 360 ? 2.026   41.318 26.080  1.00 65.69 ? 1123 TRP A CB  1 
ATOM   2759 C CG  . TRP A 1 360 ? 3.242   42.234 26.116  1.00 64.55 ? 1123 TRP A CG  1 
ATOM   2760 C CD1 . TRP A 1 360 ? 3.607   43.137 25.162  1.00 64.11 ? 1123 TRP A CD1 1 
ATOM   2761 C CD2 . TRP A 1 360 ? 4.218   42.353 27.166  1.00 63.50 ? 1123 TRP A CD2 1 
ATOM   2762 N NE1 . TRP A 1 360 ? 4.753   43.795 25.540  1.00 64.67 ? 1123 TRP A NE1 1 
ATOM   2763 C CE2 . TRP A 1 360 ? 5.150   43.331 26.767  1.00 63.63 ? 1123 TRP A CE2 1 
ATOM   2764 C CE3 . TRP A 1 360 ? 4.408   41.720 28.400  1.00 63.16 ? 1123 TRP A CE3 1 
ATOM   2765 C CZ2 . TRP A 1 360 ? 6.232   43.702 27.558  1.00 62.85 ? 1123 TRP A CZ2 1 
ATOM   2766 C CZ3 . TRP A 1 360 ? 5.497   42.089 29.185  1.00 62.52 ? 1123 TRP A CZ3 1 
ATOM   2767 C CH2 . TRP A 1 360 ? 6.389   43.066 28.759  1.00 62.48 ? 1123 TRP A CH2 1 
ATOM   2768 N N   . GLN A 1 361 ? 0.087   38.899 25.962  1.00 65.94 ? 1124 GLN A N   1 
ATOM   2769 C CA  . GLN A 1 361 ? -0.982  38.091 26.541  1.00 65.86 ? 1124 GLN A CA  1 
ATOM   2770 C C   . GLN A 1 361 ? -0.568  36.633 26.543  1.00 65.37 ? 1124 GLN A C   1 
ATOM   2771 O O   . GLN A 1 361 ? -0.675  35.961 27.561  1.00 66.04 ? 1124 GLN A O   1 
ATOM   2772 C CB  . GLN A 1 361 ? -2.318  38.253 25.789  1.00 65.99 ? 1124 GLN A CB  1 
ATOM   2773 C CG  . GLN A 1 361 ? -3.407  37.255 26.262  1.00 67.12 ? 1124 GLN A CG  1 
ATOM   2774 C CD  . GLN A 1 361 ? -4.826  37.594 25.787  1.00 66.98 ? 1124 GLN A CD  1 
ATOM   2775 O OE1 . GLN A 1 361 ? -5.003  38.246 24.764  1.00 68.62 ? 1124 GLN A OE1 1 
ATOM   2776 N NE2 . GLN A 1 361 ? -5.828  37.134 26.526  1.00 67.85 ? 1124 GLN A NE2 1 
ATOM   2777 N N   . ASP A 1 362 ? -0.097  36.146 25.404  1.00 64.94 ? 1125 ASP A N   1 
ATOM   2778 C CA  . ASP A 1 362 ? 0.220   34.729 25.264  1.00 65.47 ? 1125 ASP A CA  1 
ATOM   2779 C C   . ASP A 1 362 ? 1.323   34.307 26.232  1.00 65.40 ? 1125 ASP A C   1 
ATOM   2780 O O   . ASP A 1 362 ? 1.262   33.216 26.803  1.00 65.34 ? 1125 ASP A O   1 
ATOM   2781 C CB  . ASP A 1 362 ? 0.627   34.388 23.822  1.00 65.95 ? 1125 ASP A CB  1 
ATOM   2782 C CG  . ASP A 1 362 ? -0.565  34.022 22.936  1.00 66.81 ? 1125 ASP A CG  1 
ATOM   2783 O OD1 . ASP A 1 362 ? -1.710  34.416 23.244  1.00 68.51 ? 1125 ASP A OD1 1 
ATOM   2784 O OD2 . ASP A 1 362 ? -0.448  33.339 21.897  1.00 68.46 ? 1125 ASP A OD2 1 
ATOM   2785 N N   . LEU A 1 363 ? 2.315   35.177 26.426  1.00 65.08 ? 1126 LEU A N   1 
ATOM   2786 C CA  . LEU A 1 363 ? 3.453   34.848 27.267  1.00 64.80 ? 1126 LEU A CA  1 
ATOM   2787 C C   . LEU A 1 363 ? 3.140   35.003 28.748  1.00 64.19 ? 1126 LEU A C   1 
ATOM   2788 O O   . LEU A 1 363 ? 3.534   34.154 29.536  1.00 64.07 ? 1126 LEU A O   1 
ATOM   2789 C CB  . LEU A 1 363 ? 4.671   35.683 26.882  1.00 65.45 ? 1126 LEU A CB  1 
ATOM   2790 C CG  . LEU A 1 363 ? 5.242   35.337 25.509  1.00 65.66 ? 1126 LEU A CG  1 
ATOM   2791 C CD1 . LEU A 1 363 ? 6.300   36.363 25.127  1.00 66.32 ? 1126 LEU A CD1 1 
ATOM   2792 C CD2 . LEU A 1 363 ? 5.818   33.919 25.485  1.00 65.75 ? 1126 LEU A CD2 1 
ATOM   2793 N N   . ILE A 1 364 ? 2.430   36.062 29.132  1.00 63.61 ? 1127 ILE A N   1 
ATOM   2794 C CA  . ILE A 1 364 ? 2.074   36.242 30.540  1.00 63.80 ? 1127 ILE A CA  1 
ATOM   2795 C C   . ILE A 1 364 ? 1.285   35.025 31.025  1.00 64.63 ? 1127 ILE A C   1 
ATOM   2796 O O   . ILE A 1 364 ? 1.551   34.498 32.097  1.00 64.25 ? 1127 ILE A O   1 
ATOM   2797 C CB  . ILE A 1 364 ? 1.280   37.549 30.770  1.00 63.55 ? 1127 ILE A CB  1 
ATOM   2798 C CG1 . ILE A 1 364 ? 2.184   38.763 30.619  1.00 63.12 ? 1127 ILE A CG1 1 
ATOM   2799 C CG2 . ILE A 1 364 ? 0.662   37.582 32.177  1.00 63.83 ? 1127 ILE A CG2 1 
ATOM   2800 C CD1 . ILE A 1 364 ? 1.425   40.051 30.438  1.00 63.18 ? 1127 ILE A CD1 1 
ATOM   2801 N N   . CYS A 1 365 ? 0.325   34.582 30.214  1.00 66.18 ? 1128 CYS A N   1 
ATOM   2802 C CA  . CYS A 1 365 ? -0.501  33.410 30.513  1.00 66.86 ? 1128 CYS A CA  1 
ATOM   2803 C C   . CYS A 1 365 ? 0.298   32.105 30.520  1.00 67.76 ? 1128 CYS A C   1 
ATOM   2804 O O   . CYS A 1 365 ? 0.018   31.209 31.308  1.00 67.85 ? 1128 CYS A O   1 
ATOM   2805 C CB  . CYS A 1 365 ? -1.637  33.307 29.499  1.00 66.90 ? 1128 CYS A CB  1 
ATOM   2806 S SG  . CYS A 1 365 ? -2.769  34.713 29.549  1.00 66.84 ? 1128 CYS A SG  1 
ATOM   2807 N N   . ARG A 1 366 ? 1.281   31.996 29.633  1.00 69.05 ? 1129 ARG A N   1 
ATOM   2808 C CA  . ARG A 1 366 ? 2.181   30.844 29.632  1.00 70.35 ? 1129 ARG A CA  1 
ATOM   2809 C C   . ARG A 1 366 ? 2.926   30.755 30.966  1.00 70.11 ? 1129 ARG A C   1 
ATOM   2810 O O   . ARG A 1 366 ? 2.969   29.694 31.590  1.00 70.32 ? 1129 ARG A O   1 
ATOM   2811 C CB  . ARG A 1 366 ? 3.188   30.921 28.471  1.00 71.19 ? 1129 ARG A CB  1 
ATOM   2812 C CG  . ARG A 1 366 ? 2.718   30.209 27.200  1.00 72.94 ? 1129 ARG A CG  1 
ATOM   2813 C CD  . ARG A 1 366 ? 3.466   30.622 25.921  1.00 74.34 ? 1129 ARG A CD  1 
ATOM   2814 N NE  . ARG A 1 366 ? 2.552   30.881 24.805  1.00 76.13 ? 1129 ARG A NE  1 
ATOM   2815 C CZ  . ARG A 1 366 ? 2.918   31.311 23.595  1.00 77.11 ? 1129 ARG A CZ  1 
ATOM   2816 N NH1 . ARG A 1 366 ? 4.196   31.537 23.299  1.00 77.15 ? 1129 ARG A NH1 1 
ATOM   2817 N NH2 . ARG A 1 366 ? 1.984   31.506 22.663  1.00 77.96 ? 1129 ARG A NH2 1 
ATOM   2818 N N   . MET A 1 367 ? 3.481   31.882 31.404  1.00 69.61 ? 1130 MET A N   1 
ATOM   2819 C CA  . MET A 1 367 ? 4.244   31.948 32.646  1.00 69.55 ? 1130 MET A CA  1 
ATOM   2820 C C   . MET A 1 367 ? 3.353   31.862 33.879  1.00 69.40 ? 1130 MET A C   1 
ATOM   2821 O O   . MET A 1 367 ? 3.755   31.299 34.897  1.00 69.39 ? 1130 MET A O   1 
ATOM   2822 C CB  . MET A 1 367 ? 5.060   33.244 32.700  1.00 69.69 ? 1130 MET A CB  1 
ATOM   2823 C CG  . MET A 1 367 ? 6.134   33.348 31.630  1.00 70.21 ? 1130 MET A CG  1 
ATOM   2824 S SD  . MET A 1 367 ? 7.352   31.993 31.679  1.00 70.65 ? 1130 MET A SD  1 
ATOM   2825 C CE  . MET A 1 367 ? 7.027   31.159 30.089  1.00 70.81 ? 1130 MET A CE  1 
ATOM   2826 N N   . ALA A 1 368 ? 2.144   32.410 33.776  1.00 69.10 ? 1131 ALA A N   1 
ATOM   2827 C CA  . ALA A 1 368 ? 1.217   32.468 34.899  1.00 68.90 ? 1131 ALA A CA  1 
ATOM   2828 C C   . ALA A 1 368 ? 0.670   31.081 35.188  1.00 68.69 ? 1131 ALA A C   1 
ATOM   2829 O O   . ALA A 1 368 ? 0.527   30.689 36.346  1.00 68.74 ? 1131 ALA A O   1 
ATOM   2830 C CB  . ALA A 1 368 ? 0.077   33.437 34.604  1.00 68.86 ? 1131 ALA A CB  1 
ATOM   2831 N N   . ALA A 1 369 ? 0.381   30.342 34.121  1.00 68.40 ? 1132 ALA A N   1 
ATOM   2832 C CA  . ALA A 1 369 ? -0.151  28.991 34.228  1.00 68.22 ? 1132 ALA A CA  1 
ATOM   2833 C C   . ALA A 1 369 ? 0.938   27.987 34.591  1.00 67.76 ? 1132 ALA A C   1 
ATOM   2834 O O   . ALA A 1 369 ? 0.634   26.890 35.053  1.00 67.94 ? 1132 ALA A O   1 
ATOM   2835 C CB  . ALA A 1 369 ? -0.828  28.590 32.928  1.00 68.32 ? 1132 ALA A CB  1 
ATOM   2836 N N   . SER A 1 370 ? 2.197   28.360 34.375  1.00 67.26 ? 1133 SER A N   1 
ATOM   2837 C CA  . SER A 1 370 ? 3.332   27.508 34.731  1.00 66.82 ? 1133 SER A CA  1 
ATOM   2838 C C   . SER A 1 370 ? 3.576   27.494 36.242  1.00 66.51 ? 1133 SER A C   1 
ATOM   2839 O O   . SER A 1 370 ? 3.860   26.441 36.818  1.00 66.66 ? 1133 SER A O   1 
ATOM   2840 C CB  . SER A 1 370 ? 4.601   27.974 34.010  1.00 66.72 ? 1133 SER A CB  1 
ATOM   2841 O OG  . SER A 1 370 ? 5.680   27.087 34.252  1.00 66.02 ? 1133 SER A OG  1 
ATOM   2842 N N   . VAL A 1 371 ? 3.466   28.664 36.871  1.00 65.88 ? 1134 VAL A N   1 
ATOM   2843 C CA  . VAL A 1 371 ? 3.673   28.810 38.314  1.00 65.25 ? 1134 VAL A CA  1 
ATOM   2844 C C   . VAL A 1 371 ? 2.513   28.181 39.100  1.00 64.02 ? 1134 VAL A C   1 
ATOM   2845 O O   . VAL A 1 371 ? 2.729   27.510 40.116  1.00 63.88 ? 1134 VAL A O   1 
ATOM   2846 C CB  . VAL A 1 371 ? 3.840   30.305 38.714  1.00 65.65 ? 1134 VAL A CB  1 
ATOM   2847 C CG1 . VAL A 1 371 ? 3.913   30.462 40.233  1.00 66.15 ? 1134 VAL A CG1 1 
ATOM   2848 C CG2 . VAL A 1 371 ? 5.086   30.906 38.059  1.00 65.62 ? 1134 VAL A CG2 1 
ATOM   2849 N N   . LYS A 1 372 ? 1.290   28.403 38.616  1.00 62.58 ? 1135 LYS A N   1 
ATOM   2850 C CA  . LYS A 1 372 ? 0.083   27.809 39.208  1.00 61.52 ? 1135 LYS A CA  1 
ATOM   2851 C C   . LYS A 1 372 ? 0.065   26.278 39.057  1.00 59.74 ? 1135 LYS A C   1 
ATOM   2852 O O   . LYS A 1 372 ? -0.592  25.574 39.833  1.00 59.56 ? 1135 LYS A O   1 
ATOM   2853 C CB  . LYS A 1 372 ? -1.181  28.416 38.577  1.00 61.81 ? 1135 LYS A CB  1 
ATOM   2854 C CG  . LYS A 1 372 ? -1.397  29.899 38.892  1.00 62.50 ? 1135 LYS A CG  1 
ATOM   2855 C CD  . LYS A 1 372 ? -2.510  30.507 38.032  1.00 63.11 ? 1135 LYS A CD  1 
ATOM   2856 C CE  . LYS A 1 372 ? -2.795  31.963 38.408  1.00 63.40 ? 1135 LYS A CE  1 
ATOM   2857 N NZ  . LYS A 1 372 ? -3.606  32.685 37.381  1.00 63.39 ? 1135 LYS A NZ  1 
ATOM   2858 N N   . GLU A 1 373 ? 0.791   25.781 38.055  1.00 57.66 ? 1136 GLU A N   1 
ATOM   2859 C CA  . GLU A 1 373 ? 0.949   24.346 37.828  1.00 55.94 ? 1136 GLU A CA  1 
ATOM   2860 C C   . GLU A 1 373 ? 1.919   23.719 38.833  1.00 54.46 ? 1136 GLU A C   1 
ATOM   2861 O O   . GLU A 1 373 ? 1.667   22.617 39.335  1.00 54.13 ? 1136 GLU A O   1 
ATOM   2862 C CB  . GLU A 1 373 ? 1.454   24.069 36.400  1.00 55.77 ? 1136 GLU A CB  1 
ATOM   2863 C CG  . GLU A 1 373 ? 0.482   23.279 35.527  1.00 55.52 ? 1136 GLU A CG  1 
ATOM   2864 C CD  . GLU A 1 373 ? 1.178   22.211 34.698  1.00 55.31 ? 1136 GLU A CD  1 
ATOM   2865 O OE1 . GLU A 1 373 ? 2.206   22.530 34.055  1.00 55.06 ? 1136 GLU A OE1 1 
ATOM   2866 O OE2 . GLU A 1 373 ? 0.695   21.057 34.691  1.00 54.84 ? 1136 GLU A OE2 1 
ATOM   2867 N N   . GLN A 1 374 ? 3.021   24.419 39.118  1.00 52.59 ? 1137 GLN A N   1 
ATOM   2868 C CA  . GLN A 1 374 ? 4.081   23.890 39.991  1.00 51.21 ? 1137 GLN A CA  1 
ATOM   2869 C C   . GLN A 1 374 ? 3.632   23.727 41.456  1.00 50.68 ? 1137 GLN A C   1 
ATOM   2870 O O   . GLN A 1 374 ? 4.277   23.015 42.230  1.00 50.44 ? 1137 GLN A O   1 
ATOM   2871 C CB  . GLN A 1 374 ? 5.351   24.755 39.901  1.00 50.60 ? 1137 GLN A CB  1 
ATOM   2872 C CG  . GLN A 1 374 ? 6.193   24.499 38.642  1.00 49.85 ? 1137 GLN A CG  1 
ATOM   2873 C CD  . GLN A 1 374 ? 7.668   24.869 38.813  1.00 49.29 ? 1137 GLN A CD  1 
ATOM   2874 O OE1 . GLN A 1 374 ? 8.047   26.029 38.638  1.00 49.07 ? 1137 GLN A OE1 1 
ATOM   2875 N NE2 . GLN A 1 374 ? 8.496   23.884 39.147  1.00 48.28 ? 1137 GLN A NE2 1 
ATOM   2876 N N   . SER A 1 375 ? 2.532   24.389 41.824  1.00 50.05 ? 1138 SER A N   1 
ATOM   2877 C CA  . SER A 1 375 ? 1.865   24.163 43.111  1.00 49.52 ? 1138 SER A CA  1 
ATOM   2878 C C   . SER A 1 375 ? 1.284   22.743 43.172  1.00 49.46 ? 1138 SER A C   1 
ATOM   2879 O O   . SER A 1 375 ? 0.754   22.308 44.199  1.00 49.36 ? 1138 SER A O   1 
ATOM   2880 C CB  . SER A 1 375 ? 0.753   25.205 43.315  1.00 49.34 ? 1138 SER A CB  1 
ATOM   2881 O OG  . SER A 1 375 ? -0.051  24.905 44.443  1.00 49.20 ? 1138 SER A OG  1 
HETATM 2882 O O   . HOH B 2 .   ? 36.085  36.784 28.368  1.00 18.82 ? 1    HOH A O   1 
HETATM 2883 O O   . HOH B 2 .   ? 34.199  35.565 20.802  1.00 21.13 ? 2    HOH A O   1 
HETATM 2884 O O   . HOH B 2 .   ? 30.872  35.470 21.683  1.00 29.39 ? 3    HOH A O   1 
HETATM 2885 O O   . HOH B 2 .   ? 36.483  49.409 41.577  1.00 11.90 ? 4    HOH A O   1 
HETATM 2886 O O   . HOH B 2 .   ? 40.422  48.057 40.746  1.00 32.43 ? 5    HOH A O   1 
HETATM 2887 O O   . HOH B 2 .   ? 33.257  47.680 37.271  1.00 24.88 ? 6    HOH A O   1 
HETATM 2888 O O   . HOH B 2 .   ? 34.791  36.627 25.897  1.00 27.99 ? 7    HOH A O   1 
HETATM 2889 O O   . HOH B 2 .   ? 45.896  43.308 36.729  1.00 33.54 ? 8    HOH A O   1 
HETATM 2890 O O   . HOH B 2 .   ? 32.188  25.015 14.669  1.00 16.42 ? 9    HOH A O   1 
HETATM 2891 O O   . HOH B 2 .   ? 29.306  41.393 35.148  1.00 31.87 ? 10   HOH A O   1 
HETATM 2892 O O   . HOH B 2 .   ? 45.940  12.922 -7.887  1.00 20.80 ? 11   HOH A O   1 
HETATM 2893 O O   . HOH B 2 .   ? 50.445  37.020 17.762  1.00 21.66 ? 12   HOH A O   1 
HETATM 2894 O O   . HOH B 2 .   ? 48.181  41.017 14.764  1.00 25.21 ? 13   HOH A O   1 
HETATM 2895 O O   . HOH B 2 .   ? 39.545  20.600 20.363  1.00 43.71 ? 14   HOH A O   1 
HETATM 2896 O O   . HOH B 2 .   ? 38.235  40.444 43.130  1.00 16.43 ? 15   HOH A O   1 
HETATM 2897 O O   . HOH B 2 .   ? 36.714  43.030 42.509  1.00 22.02 ? 16   HOH A O   1 
HETATM 2898 O O   . HOH B 2 .   ? 34.763  45.844 40.175  1.00 24.15 ? 17   HOH A O   1 
HETATM 2899 O O   . HOH B 2 .   ? 37.168  45.474 43.765  1.00 18.09 ? 18   HOH A O   1 
HETATM 2900 O O   . HOH B 2 .   ? 33.317  47.052 25.263  1.00 22.50 ? 19   HOH A O   1 
HETATM 2901 O O   . HOH B 2 .   ? 31.251  47.139 23.901  1.00 19.44 ? 20   HOH A O   1 
HETATM 2902 O O   . HOH B 2 .   ? 35.331  49.280 25.102  1.00 19.16 ? 21   HOH A O   1 
HETATM 2903 O O   . HOH B 2 .   ? 37.894  47.889 23.813  1.00 20.43 ? 22   HOH A O   1 
HETATM 2904 O O   . HOH B 2 .   ? 34.694  46.366 43.217  1.00 22.98 ? 23   HOH A O   1 
HETATM 2905 O O   . HOH B 2 .   ? 27.207  43.219 32.861  1.00 16.00 ? 24   HOH A O   1 
HETATM 2906 O O   . HOH B 2 .   ? 41.041  35.915 38.140  1.00 25.41 ? 25   HOH A O   1 
HETATM 2907 O O   . HOH B 2 .   ? 38.619  31.866 10.498  1.00 20.75 ? 26   HOH A O   1 
HETATM 2908 O O   . HOH B 2 .   ? 41.220  32.504 11.067  1.00 26.53 ? 27   HOH A O   1 
HETATM 2909 O O   . HOH B 2 .   ? 37.927  34.548 13.675  1.00 28.07 ? 28   HOH A O   1 
HETATM 2910 O O   . HOH B 2 .   ? 51.560  38.415 15.449  1.00 28.07 ? 29   HOH A O   1 
HETATM 2911 O O   . HOH B 2 .   ? 38.312  47.136 41.861  1.00 25.81 ? 30   HOH A O   1 
HETATM 2912 O O   . HOH B 2 .   ? 31.174  31.972 30.558  1.00 31.44 ? 31   HOH A O   1 
HETATM 2913 O O   . HOH B 2 .   ? 31.907  37.075 16.584  1.00 27.08 ? 32   HOH A O   1 
HETATM 2914 O O   . HOH B 2 .   ? 28.856  36.411 20.237  1.00 26.42 ? 33   HOH A O   1 
HETATM 2915 O O   . HOH B 2 .   ? 23.409  41.076 26.693  1.00 22.63 ? 34   HOH A O   1 
HETATM 2916 O O   . HOH B 2 .   ? 39.540  14.569 2.221   1.00 33.74 ? 35   HOH A O   1 
HETATM 2917 O O   . HOH B 2 .   ? 53.163  40.427 27.042  1.00 23.55 ? 36   HOH A O   1 
HETATM 2918 O O   . HOH B 2 .   ? 46.792  41.386 38.210  1.00 30.55 ? 37   HOH A O   1 
HETATM 2919 O O   . HOH B 2 .   ? 44.179  40.806 40.311  1.00 32.73 ? 38   HOH A O   1 
HETATM 2920 O O   . HOH B 2 .   ? 29.998  38.252 18.490  1.00 23.88 ? 39   HOH A O   1 
HETATM 2921 O O   . HOH B 2 .   ? 40.491  34.194 13.791  1.00 26.92 ? 40   HOH A O   1 
HETATM 2922 O O   . HOH B 2 .   ? 34.451  43.284 41.050  1.00 39.77 ? 41   HOH A O   1 
HETATM 2923 O O   . HOH B 2 .   ? 29.025  33.256 30.579  1.00 27.36 ? 42   HOH A O   1 
HETATM 2924 O O   . HOH B 2 .   ? 32.953  32.860 32.558  1.00 41.53 ? 43   HOH A O   1 
HETATM 2925 O O   . HOH B 2 .   ? 29.733  43.009 33.167  1.00 23.76 ? 44   HOH A O   1 
HETATM 2926 O O   . HOH B 2 .   ? 29.911  34.350 32.514  1.00 23.17 ? 45   HOH A O   1 
HETATM 2927 O O   . HOH B 2 .   ? 47.086  49.312 16.000  1.00 26.36 ? 46   HOH A O   1 
HETATM 2928 O O   . HOH B 2 .   ? 43.812  49.513 17.845  1.00 29.02 ? 47   HOH A O   1 
HETATM 2929 O O   . HOH B 2 .   ? 31.200  46.109 21.379  1.00 32.00 ? 48   HOH A O   1 
HETATM 2930 O O   . HOH B 2 .   ? 30.446  35.694 14.781  1.00 20.31 ? 49   HOH A O   1 
HETATM 2931 O O   . HOH B 2 .   ? 30.489  45.634 34.213  1.00 28.79 ? 50   HOH A O   1 
HETATM 2932 O O   . HOH B 2 .   ? 43.600  35.911 48.277  1.00 30.72 ? 51   HOH A O   1 
HETATM 2933 O O   . HOH B 2 .   ? 41.592  35.253 47.367  1.00 25.97 ? 52   HOH A O   1 
HETATM 2934 O O   . HOH B 2 .   ? 32.633  43.999 19.968  1.00 32.32 ? 53   HOH A O   1 
HETATM 2935 O O   . HOH B 2 .   ? 43.443  36.173 38.824  1.00 33.33 ? 54   HOH A O   1 
HETATM 2936 O O   . HOH B 2 .   ? 44.693  38.084 39.617  1.00 31.07 ? 55   HOH A O   1 
HETATM 2937 O O   . HOH B 2 .   ? 38.581  13.346 20.202  1.00 13.01 ? 56   HOH A O   1 
HETATM 2938 O O   . HOH B 2 .   ? 29.159  17.676 27.250  1.00 31.45 ? 57   HOH A O   1 
HETATM 2939 O O   . HOH B 2 .   ? 42.248  32.941 31.303  1.00 26.62 ? 59   HOH A O   1 
HETATM 2940 O O   . HOH B 2 .   ? 47.766  52.527 33.255  1.00 15.26 ? 60   HOH A O   1 
HETATM 2941 O O   . HOH B 2 .   ? 47.998  24.523 10.916  1.00 24.96 ? 61   HOH A O   1 
HETATM 2942 O O   . HOH B 2 .   ? 50.231  46.334 26.165  1.00 22.63 ? 62   HOH A O   1 
HETATM 2943 O O   . HOH B 2 .   ? 43.666  21.329 21.289  1.00 17.82 ? 63   HOH A O   1 
HETATM 2944 O O   . HOH B 2 .   ? 50.764  14.153 4.775   1.00 39.93 ? 64   HOH A O   1 
HETATM 2945 O O   . HOH B 2 .   ? 40.846  9.369  7.211   1.00 24.79 ? 65   HOH A O   1 
HETATM 2946 O O   . HOH B 2 .   ? 27.009  37.755 35.539  1.00 34.31 ? 66   HOH A O   1 
HETATM 2947 O O   . HOH B 2 .   ? 51.573  38.188 19.803  1.00 33.71 ? 67   HOH A O   1 
HETATM 2948 O O   . HOH B 2 .   ? 23.278  32.794 20.177  1.00 26.43 ? 68   HOH A O   1 
HETATM 2949 O O   . HOH B 2 .   ? 38.332  24.406 3.814   1.00 26.60 ? 69   HOH A O   1 
HETATM 2950 O O   . HOH B 2 .   ? 37.152  33.504 11.835  1.00 30.65 ? 70   HOH A O   1 
HETATM 2951 O O   . HOH B 2 .   ? 28.231  35.084 34.577  1.00 41.24 ? 71   HOH A O   1 
HETATM 2952 O O   . HOH B 2 .   ? 28.105  33.708 37.115  1.00 40.46 ? 72   HOH A O   1 
HETATM 2953 O O   . HOH B 2 .   ? 52.944  19.868 15.371  1.00 33.02 ? 73   HOH A O   1 
HETATM 2954 O O   . HOH B 2 .   ? 25.667  33.329 18.846  1.00 32.02 ? 74   HOH A O   1 
HETATM 2955 O O   . HOH B 2 .   ? 51.336  47.084 23.798  1.00 32.15 ? 75   HOH A O   1 
HETATM 2956 O O   . HOH B 2 .   ? 24.976  46.658 29.787  1.00 30.83 ? 76   HOH A O   1 
HETATM 2957 O O   . HOH B 2 .   ? 40.385  35.548 33.419  1.00 27.80 ? 77   HOH A O   1 
HETATM 2958 O O   . HOH B 2 .   ? 49.232  51.503 31.229  1.00 39.75 ? 78   HOH A O   1 
HETATM 2959 O O   . HOH B 2 .   ? 34.083  41.832 39.047  1.00 32.26 ? 79   HOH A O   1 
HETATM 2960 O O   . HOH B 2 .   ? 54.401  45.353 18.355  1.00 25.60 ? 80   HOH A O   1 
HETATM 2961 O O   . HOH B 2 .   ? 27.365  35.584 18.693  1.00 29.52 ? 81   HOH A O   1 
HETATM 2962 O O   . HOH B 2 .   ? 51.366  48.508 29.081  1.00 31.75 ? 82   HOH A O   1 
HETATM 2963 O O   . HOH B 2 .   ? 49.452  49.041 27.691  1.00 28.93 ? 83   HOH A O   1 
HETATM 2964 O O   . HOH B 2 .   ? 40.576  48.830 37.431  1.00 36.80 ? 84   HOH A O   1 
HETATM 2965 O O   . HOH B 2 .   ? 42.578  49.937 39.277  1.00 29.46 ? 85   HOH A O   1 
HETATM 2966 O O   . HOH B 2 .   ? 53.414  45.038 13.240  1.00 44.52 ? 86   HOH A O   1 
HETATM 2967 O O   . HOH B 2 .   ? 33.437  36.062 33.387  1.00 37.82 ? 87   HOH A O   1 
HETATM 2968 O O   . HOH B 2 .   ? 42.001  16.207 19.580  1.00 34.38 ? 88   HOH A O   1 
HETATM 2969 O O   . HOH B 2 .   ? 31.215  25.051 29.691  1.00 38.06 ? 89   HOH A O   1 
HETATM 2970 O O   . HOH B 2 .   ? 32.592  58.081 35.849  1.00 35.69 ? 90   HOH A O   1 
HETATM 2971 O O   . HOH B 2 .   ? 47.061  38.503 37.617  1.00 43.71 ? 91   HOH A O   1 
HETATM 2972 O O   . HOH B 2 .   ? 39.753  16.020 -11.517 1.00 8.97  ? 92   HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   764  ?    ?   ?   A . n 
A 1 2   SER 2   765  ?    ?   ?   A . n 
A 1 3   PRO 3   766  766  PRO PRO A . n 
A 1 4   PRO 4   767  767  PRO PRO A . n 
A 1 5   ASN 5   768  768  ASN ASN A . n 
A 1 6   TRP 6   769  769  TRP TRP A . n 
A 1 7   GLN 7   770  770  GLN GLN A . n 
A 1 8   GLN 8   771  771  GLN GLN A . n 
A 1 9   LEU 9   772  772  LEU LEU A . n 
A 1 10  VAL 10  773  773  VAL VAL A . n 
A 1 11  SER 11  774  774  SER SER A . n 
A 1 12  ARG 12  775  775  ARG ARG A . n 
A 1 13  GLU 13  776  776  GLU GLU A . n 
A 1 14  VAL 14  777  777  VAL VAL A . n 
A 1 15  LEU 15  778  778  LEU LEU A . n 
A 1 16  LEU 16  779  779  LEU LEU A . n 
A 1 17  GLY 17  780  780  GLY GLY A . n 
A 1 18  LEU 18  781  781  LEU LEU A . n 
A 1 19  LYS 19  782  782  LYS LYS A . n 
A 1 20  PRO 20  783  783  PRO PRO A . n 
A 1 21  CYS 21  784  784  CYS CYS A . n 
A 1 22  GLU 22  785  785  GLU GLU A . n 
A 1 23  ILE 23  786  786  ILE ILE A . n 
A 1 24  LYS 24  787  787  LYS LYS A . n 
A 1 25  ARG 25  788  788  ARG ARG A . n 
A 1 26  GLN 26  789  789  GLN GLN A . n 
A 1 27  GLU 27  790  790  GLU GLU A . n 
A 1 28  VAL 28  791  791  VAL VAL A . n 
A 1 29  ILE 29  792  792  ILE ILE A . n 
A 1 30  ASN 30  793  793  ASN ASN A . n 
A 1 31  GLU 31  794  794  GLU GLU A . n 
A 1 32  LEU 32  795  795  LEU LEU A . n 
A 1 33  PHE 33  796  796  PHE PHE A . n 
A 1 34  TYR 34  797  797  TYR TYR A . n 
A 1 35  THR 35  798  798  THR THR A . n 
A 1 36  GLU 36  799  799  GLU GLU A . n 
A 1 37  ARG 37  800  800  ARG ARG A . n 
A 1 38  ALA 38  801  801  ALA ALA A . n 
A 1 39  HIS 39  802  802  HIS HIS A . n 
A 1 40  VAL 40  803  803  VAL VAL A . n 
A 1 41  ARG 41  804  804  ARG ARG A . n 
A 1 42  THR 42  805  805  THR THR A . n 
A 1 43  LEU 43  806  806  LEU LEU A . n 
A 1 44  LYS 44  807  807  LYS LYS A . n 
A 1 45  VAL 45  808  808  VAL VAL A . n 
A 1 46  LEU 46  809  809  LEU LEU A . n 
A 1 47  ASP 47  810  810  ASP ASP A . n 
A 1 48  GLN 48  811  811  GLN GLN A . n 
A 1 49  VAL 49  812  812  VAL VAL A . n 
A 1 50  PHE 50  813  813  PHE PHE A . n 
A 1 51  TYR 51  814  814  TYR TYR A . n 
A 1 52  GLN 52  815  815  GLN GLN A . n 
A 1 53  ARG 53  816  816  ARG ARG A . n 
A 1 54  VAL 54  817  817  VAL VAL A . n 
A 1 55  SER 55  818  818  SER SER A . n 
A 1 56  ARG 56  819  819  ARG ARG A . n 
A 1 57  GLU 57  820  820  GLU GLU A . n 
A 1 58  GLY 58  821  821  GLY GLY A . n 
A 1 59  ILE 59  822  822  ILE ILE A . n 
A 1 60  LEU 60  823  823  LEU LEU A . n 
A 1 61  SER 61  824  824  SER SER A . n 
A 1 62  PRO 62  825  825  PRO PRO A . n 
A 1 63  SER 63  826  826  SER SER A . n 
A 1 64  GLU 64  827  827  GLU GLU A . n 
A 1 65  LEU 65  828  828  LEU LEU A . n 
A 1 66  ARG 66  829  829  ARG ARG A . n 
A 1 67  LYS 67  830  830  LYS LYS A . n 
A 1 68  ILE 68  831  831  ILE ILE A . n 
A 1 69  PHE 69  832  832  PHE PHE A . n 
A 1 70  SER 70  833  833  SER SER A . n 
A 1 71  ASN 71  834  834  ASN ASN A . n 
A 1 72  LEU 72  835  835  LEU LEU A . n 
A 1 73  GLU 73  836  836  GLU GLU A . n 
A 1 74  ASP 74  837  837  ASP ASP A . n 
A 1 75  ILE 75  838  838  ILE ILE A . n 
A 1 76  LEU 76  839  839  LEU LEU A . n 
A 1 77  GLN 77  840  840  GLN GLN A . n 
A 1 78  LEU 78  841  841  LEU LEU A . n 
A 1 79  HIS 79  842  842  HIS HIS A . n 
A 1 80  ILE 80  843  843  ILE ILE A . n 
A 1 81  GLY 81  844  844  GLY GLY A . n 
A 1 82  LEU 82  845  845  LEU LEU A . n 
A 1 83  ASN 83  846  846  ASN ASN A . n 
A 1 84  GLU 84  847  847  GLU GLU A . n 
A 1 85  GLN 85  848  848  GLN GLN A . n 
A 1 86  MET 86  849  849  MET MET A . n 
A 1 87  LYS 87  850  850  LYS LYS A . n 
A 1 88  ALA 88  851  851  ALA ALA A . n 
A 1 89  VAL 89  852  852  VAL VAL A . n 
A 1 90  ARG 90  853  853  ARG ARG A . n 
A 1 91  LYS 91  854  854  LYS LYS A . n 
A 1 92  ARG 92  855  855  ARG ARG A . n 
A 1 93  ASN 93  856  856  ASN ASN A . n 
A 1 94  GLU 94  857  857  GLU GLU A . n 
A 1 95  THR 95  858  858  THR THR A . n 
A 1 96  SER 96  859  859  SER SER A . n 
A 1 97  VAL 97  860  860  VAL VAL A . n 
A 1 98  ILE 98  861  861  ILE ILE A . n 
A 1 99  ASP 99  862  862  ASP ASP A . n 
A 1 100 GLN 100 863  863  GLN GLN A . n 
A 1 101 ILE 101 864  864  ILE ILE A . n 
A 1 102 GLY 102 865  865  GLY GLY A . n 
A 1 103 GLU 103 866  866  GLU GLU A . n 
A 1 104 ASP 104 867  867  ASP ASP A . n 
A 1 105 LEU 105 868  868  LEU LEU A . n 
A 1 106 LEU 106 869  869  LEU LEU A . n 
A 1 107 THR 107 870  870  THR THR A . n 
A 1 108 TRP 108 871  871  TRP TRP A . n 
A 1 109 PHE 109 872  872  PHE PHE A . n 
A 1 110 SER 110 873  873  SER SER A . n 
A 1 111 GLY 111 874  874  GLY GLY A . n 
A 1 112 PRO 112 875  875  PRO PRO A . n 
A 1 113 GLY 113 876  876  GLY GLY A . n 
A 1 114 GLU 114 877  877  GLU GLU A . n 
A 1 115 GLU 115 878  878  GLU GLU A . n 
A 1 116 LYS 116 879  879  LYS LYS A . n 
A 1 117 LEU 117 880  880  LEU LEU A . n 
A 1 118 LYS 118 881  881  LYS LYS A . n 
A 1 119 HIS 119 882  882  HIS HIS A . n 
A 1 120 ALA 120 883  883  ALA ALA A . n 
A 1 121 ALA 121 884  884  ALA ALA A . n 
A 1 122 ALA 122 885  885  ALA ALA A . n 
A 1 123 THR 123 886  886  THR THR A . n 
A 1 124 PHE 124 887  887  PHE PHE A . n 
A 1 125 CYS 125 888  888  CYS CYS A . n 
A 1 126 SER 126 889  889  SER SER A . n 
A 1 127 ASN 127 890  890  ASN ASN A . n 
A 1 128 GLN 128 891  891  GLN GLN A . n 
A 1 129 PRO 129 892  892  PRO PRO A . n 
A 1 130 PHE 130 893  893  PHE PHE A . n 
A 1 131 ALA 131 894  894  ALA ALA A . n 
A 1 132 LEU 132 895  895  LEU LEU A . n 
A 1 133 GLU 133 896  896  GLU GLU A . n 
A 1 134 MET 134 897  897  MET MET A . n 
A 1 135 ILE 135 898  898  ILE ILE A . n 
A 1 136 LYS 136 899  899  LYS LYS A . n 
A 1 137 SER 137 900  900  SER SER A . n 
A 1 138 ARG 138 901  901  ARG ARG A . n 
A 1 139 GLN 139 902  902  GLN GLN A . n 
A 1 140 LYS 140 903  903  LYS LYS A . n 
A 1 141 LYS 141 904  904  LYS LYS A . n 
A 1 142 ASP 142 905  905  ASP ASP A . n 
A 1 143 SER 143 906  906  SER SER A . n 
A 1 144 ARG 144 907  907  ARG ARG A . n 
A 1 145 PHE 145 908  908  PHE PHE A . n 
A 1 146 GLN 146 909  909  GLN GLN A . n 
A 1 147 THR 147 910  910  THR THR A . n 
A 1 148 PHE 148 911  911  PHE PHE A . n 
A 1 149 VAL 149 912  912  VAL VAL A . n 
A 1 150 GLN 150 913  913  GLN GLN A . n 
A 1 151 ASP 151 914  914  ASP ASP A . n 
A 1 152 ALA 152 915  915  ALA ALA A . n 
A 1 153 GLU 153 916  916  GLU GLU A . n 
A 1 154 SER 154 917  917  SER SER A . n 
A 1 155 ASN 155 918  918  ASN ASN A . n 
A 1 156 PRO 156 919  919  PRO PRO A . n 
A 1 157 LEU 157 920  920  LEU LEU A . n 
A 1 158 CYS 158 921  921  CYS CYS A . n 
A 1 159 ARG 159 922  922  ARG ARG A . n 
A 1 160 ARG 160 923  923  ARG ARG A . n 
A 1 161 LEU 161 924  924  LEU LEU A . n 
A 1 162 GLN 162 925  925  GLN GLN A . n 
A 1 163 LEU 163 926  926  LEU LEU A . n 
A 1 164 LYS 164 927  927  LYS LYS A . n 
A 1 165 ASP 165 928  928  ASP ASP A . n 
A 1 166 ILE 166 929  929  ILE ILE A . n 
A 1 167 ILE 167 930  930  ILE ILE A . n 
A 1 168 PRO 168 931  931  PRO PRO A . n 
A 1 169 THR 169 932  932  THR THR A . n 
A 1 170 GLN 170 933  933  GLN GLN A . n 
A 1 171 MET 171 934  934  MET MET A . n 
A 1 172 GLN 172 935  935  GLN GLN A . n 
A 1 173 ARG 173 936  936  ARG ARG A . n 
A 1 174 LEU 174 937  937  LEU LEU A . n 
A 1 175 THR 175 938  938  THR THR A . n 
A 1 176 LYS 176 939  939  LYS LYS A . n 
A 1 177 TYR 177 940  940  TYR TYR A . n 
A 1 178 PRO 178 941  941  PRO PRO A . n 
A 1 179 LEU 179 942  942  LEU LEU A . n 
A 1 180 LEU 180 943  943  LEU LEU A . n 
A 1 181 LEU 181 944  944  LEU LEU A . n 
A 1 182 ASP 182 945  945  ASP ASP A . n 
A 1 183 ASN 183 946  946  ASN ASN A . n 
A 1 184 ILE 184 947  947  ILE ILE A . n 
A 1 185 ALA 185 948  948  ALA ALA A . n 
A 1 186 LYS 186 949  949  LYS LYS A . n 
A 1 187 TYR 187 950  950  TYR TYR A . n 
A 1 188 THR 188 951  951  THR THR A . n 
A 1 189 GLU 189 952  952  GLU GLU A . n 
A 1 190 TRP 190 953  953  TRP TRP A . n 
A 1 191 PRO 191 954  954  PRO PRO A . n 
A 1 192 THR 192 955  955  THR THR A . n 
A 1 193 GLU 193 956  956  GLU GLU A . n 
A 1 194 ARG 194 957  957  ARG ARG A . n 
A 1 195 GLU 195 958  958  GLU GLU A . n 
A 1 196 LYS 196 959  959  LYS LYS A . n 
A 1 197 VAL 197 960  960  VAL VAL A . n 
A 1 198 LYS 198 961  961  LYS LYS A . n 
A 1 199 LYS 199 962  962  LYS LYS A . n 
A 1 200 ALA 200 963  963  ALA ALA A . n 
A 1 201 ALA 201 964  964  ALA ALA A . n 
A 1 202 ASP 202 965  965  ASP ASP A . n 
A 1 203 HIS 203 966  966  HIS HIS A . n 
A 1 204 CYS 204 967  967  CYS CYS A . n 
A 1 205 ARG 205 968  968  ARG ARG A . n 
A 1 206 GLN 206 969  969  GLN GLN A . n 
A 1 207 ILE 207 970  970  ILE ILE A . n 
A 1 208 LEU 208 971  971  LEU LEU A . n 
A 1 209 ASN 209 972  972  ASN ASN A . n 
A 1 210 PHE 210 973  973  PHE PHE A . n 
A 1 211 VAL 211 974  974  VAL VAL A . n 
A 1 212 ASN 212 975  975  ASN ASN A . n 
A 1 213 GLN 213 976  976  GLN GLN A . n 
A 1 214 ALA 214 977  977  ALA ALA A . n 
A 1 215 VAL 215 978  978  VAL VAL A . n 
A 1 216 LYS 216 979  979  LYS LYS A . n 
A 1 217 GLU 217 980  980  GLU GLU A . n 
A 1 218 ALA 218 981  981  ALA ALA A . n 
A 1 219 GLU 219 982  982  GLU GLU A . n 
A 1 220 ASN 220 983  983  ASN ASN A . n 
A 1 221 LYS 221 984  984  LYS LYS A . n 
A 1 222 GLN 222 985  985  GLN GLN A . n 
A 1 223 ARG 223 986  986  ARG ARG A . n 
A 1 224 LEU 224 987  987  LEU LEU A . n 
A 1 225 GLU 225 988  988  GLU GLU A . n 
A 1 226 ASP 226 989  989  ASP ASP A . n 
A 1 227 TYR 227 990  990  TYR TYR A . n 
A 1 228 GLN 228 991  991  GLN GLN A . n 
A 1 229 ARG 229 992  992  ARG ARG A . n 
A 1 230 ARG 230 993  993  ARG ARG A . n 
A 1 231 LEU 231 994  994  LEU LEU A . n 
A 1 232 ASP 232 995  995  ASP ASP A . n 
A 1 233 THR 233 996  996  THR THR A . n 
A 1 234 SER 234 997  997  SER SER A . n 
A 1 235 SER 235 998  998  SER SER A . n 
A 1 236 LEU 236 999  999  LEU LEU A . n 
A 1 237 LYS 237 1000 ?    ?   ?   A . n 
A 1 238 LEU 238 1001 ?    ?   ?   A . n 
A 1 239 SER 239 1002 ?    ?   ?   A . n 
A 1 240 GLU 240 1003 ?    ?   ?   A . n 
A 1 241 TYR 241 1004 ?    ?   ?   A . n 
A 1 242 PRO 242 1005 ?    ?   ?   A . n 
A 1 243 ASN 243 1006 ?    ?   ?   A . n 
A 1 244 VAL 244 1007 1007 VAL VAL A . n 
A 1 245 GLU 245 1008 1008 GLU GLU A . n 
A 1 246 GLU 246 1009 1009 GLU GLU A . n 
A 1 247 LEU 247 1010 1010 LEU LEU A . n 
A 1 248 ARG 248 1011 1011 ARG ARG A . n 
A 1 249 ASN 249 1012 1012 ASN ASN A . n 
A 1 250 LEU 250 1013 1013 LEU LEU A . n 
A 1 251 ASP 251 1014 1014 ASP ASP A . n 
A 1 252 LEU 252 1015 1015 LEU LEU A . n 
A 1 253 THR 253 1016 1016 THR THR A . n 
A 1 254 LYS 254 1017 1017 LYS LYS A . n 
A 1 255 ARG 255 1018 1018 ARG ARG A . n 
A 1 256 LYS 256 1019 1019 LYS LYS A . n 
A 1 257 MET 257 1020 1020 MET MET A . n 
A 1 258 ILE 258 1021 1021 ILE ILE A . n 
A 1 259 HIS 259 1022 1022 HIS HIS A . n 
A 1 260 GLU 260 1023 1023 GLU GLU A . n 
A 1 261 GLY 261 1024 1024 GLY GLY A . n 
A 1 262 PRO 262 1025 1025 PRO PRO A . n 
A 1 263 LEU 263 1026 1026 LEU LEU A . n 
A 1 264 VAL 264 1027 1027 VAL VAL A . n 
A 1 265 TRP 265 1028 1028 TRP TRP A . n 
A 1 266 LYS 266 1029 1029 LYS LYS A . n 
A 1 267 VAL 267 1030 1030 VAL VAL A . n 
A 1 268 ASN 268 1031 1031 ASN ASN A . n 
A 1 269 ARG 269 1032 1032 ARG ARG A . n 
A 1 270 ASP 270 1033 1033 ASP ASP A . n 
A 1 271 LYS 271 1034 1034 LYS LYS A . n 
A 1 272 THR 272 1035 1035 THR THR A . n 
A 1 273 ILE 273 1036 1036 ILE ILE A . n 
A 1 274 ASP 274 1037 1037 ASP ASP A . n 
A 1 275 LEU 275 1038 1038 LEU LEU A . n 
A 1 276 TYR 276 1039 1039 TYR TYR A . n 
A 1 277 THR 277 1040 1040 THR THR A . n 
A 1 278 LEU 278 1041 1041 LEU LEU A . n 
A 1 279 LEU 279 1042 1042 LEU LEU A . n 
A 1 280 LEU 280 1043 1043 LEU LEU A . n 
A 1 281 GLU 281 1044 1044 GLU GLU A . n 
A 1 282 ASP 282 1045 1045 ASP ASP A . n 
A 1 283 ILE 283 1046 1046 ILE ILE A . n 
A 1 284 LEU 284 1047 1047 LEU LEU A . n 
A 1 285 VAL 285 1048 1048 VAL VAL A . n 
A 1 286 LEU 286 1049 1049 LEU LEU A . n 
A 1 287 LEU 287 1050 1050 LEU LEU A . n 
A 1 288 GLN 288 1051 1051 GLN GLN A . n 
A 1 289 LYS 289 1052 1052 LYS LYS A . n 
A 1 290 GLN 290 1053 1053 GLN GLN A . n 
A 1 291 ASP 291 1054 1054 ASP ASP A . n 
A 1 292 ASP 292 1055 1055 ASP ASP A . n 
A 1 293 ARG 293 1056 1056 ARG ARG A . n 
A 1 294 LEU 294 1057 1057 LEU LEU A . n 
A 1 295 VAL 295 1058 1058 VAL VAL A . n 
A 1 296 LEU 296 1059 1059 LEU LEU A . n 
A 1 297 ARG 297 1060 1060 ARG ARG A . n 
A 1 298 CYS 298 1061 1061 CYS CYS A . n 
A 1 299 HIS 299 1062 ?    ?   ?   A . n 
A 1 300 SER 300 1063 ?    ?   ?   A . n 
A 1 301 LYS 301 1064 ?    ?   ?   A . n 
A 1 302 ILE 302 1065 ?    ?   ?   A . n 
A 1 303 LEU 303 1066 ?    ?   ?   A . n 
A 1 304 ALA 304 1067 ?    ?   ?   A . n 
A 1 305 SER 305 1068 ?    ?   ?   A . n 
A 1 306 THR 306 1069 ?    ?   ?   A . n 
A 1 307 ALA 307 1070 ?    ?   ?   A . n 
A 1 308 ASP 308 1071 ?    ?   ?   A . n 
A 1 309 SER 309 1072 ?    ?   ?   A . n 
A 1 310 LYS 310 1073 ?    ?   ?   A . n 
A 1 311 HIS 311 1074 ?    ?   ?   A . n 
A 1 312 THR 312 1075 1075 THR THR A . n 
A 1 313 PHE 313 1076 1076 PHE PHE A . n 
A 1 314 SER 314 1077 1077 SER SER A . n 
A 1 315 PRO 315 1078 1078 PRO PRO A . n 
A 1 316 VAL 316 1079 1079 VAL VAL A . n 
A 1 317 ILE 317 1080 1080 ILE ILE A . n 
A 1 318 LYS 318 1081 1081 LYS LYS A . n 
A 1 319 LEU 319 1082 1082 LEU LEU A . n 
A 1 320 SER 320 1083 1083 SER SER A . n 
A 1 321 THR 321 1084 1084 THR THR A . n 
A 1 322 VAL 322 1085 1085 VAL VAL A . n 
A 1 323 LEU 323 1086 1086 LEU LEU A . n 
A 1 324 VAL 324 1087 1087 VAL VAL A . n 
A 1 325 ARG 325 1088 1088 ARG ARG A . n 
A 1 326 GLN 326 1089 1089 GLN GLN A . n 
A 1 327 VAL 327 1090 1090 VAL VAL A . n 
A 1 328 ALA 328 1091 1091 ALA ALA A . n 
A 1 329 THR 329 1092 1092 THR THR A . n 
A 1 330 ASP 330 1093 ?    ?   ?   A . n 
A 1 331 ASN 331 1094 1094 ASN ASN A . n 
A 1 332 LYS 332 1095 1095 LYS LYS A . n 
A 1 333 ALA 333 1096 1096 ALA ALA A . n 
A 1 334 LEU 334 1097 1097 LEU LEU A . n 
A 1 335 PHE 335 1098 1098 PHE PHE A . n 
A 1 336 VAL 336 1099 1099 VAL VAL A . n 
A 1 337 ILE 337 1100 1100 ILE ILE A . n 
A 1 338 SER 338 1101 1101 SER SER A . n 
A 1 339 MET 339 1102 1102 MET MET A . n 
A 1 340 SER 340 1103 1103 SER SER A . n 
A 1 341 ASP 341 1104 1104 ASP ASP A . n 
A 1 342 ASN 342 1105 1105 ASN ASN A . n 
A 1 343 GLY 343 1106 1106 GLY GLY A . n 
A 1 344 ALA 344 1107 1107 ALA ALA A . n 
A 1 345 GLN 345 1108 1108 GLN GLN A . n 
A 1 346 ILE 346 1109 1109 ILE ILE A . n 
A 1 347 TYR 347 1110 1110 TYR TYR A . n 
A 1 348 GLU 348 1111 1111 GLU GLU A . n 
A 1 349 LEU 349 1112 1112 LEU LEU A . n 
A 1 350 VAL 350 1113 1113 VAL VAL A . n 
A 1 351 ALA 351 1114 1114 ALA ALA A . n 
A 1 352 GLN 352 1115 1115 GLN GLN A . n 
A 1 353 THR 353 1116 1116 THR THR A . n 
A 1 354 VAL 354 1117 1117 VAL VAL A . n 
A 1 355 SER 355 1118 1118 SER SER A . n 
A 1 356 GLU 356 1119 1119 GLU GLU A . n 
A 1 357 LYS 357 1120 1120 LYS LYS A . n 
A 1 358 THR 358 1121 1121 THR THR A . n 
A 1 359 VAL 359 1122 1122 VAL VAL A . n 
A 1 360 TRP 360 1123 1123 TRP TRP A . n 
A 1 361 GLN 361 1124 1124 GLN GLN A . n 
A 1 362 ASP 362 1125 1125 ASP ASP A . n 
A 1 363 LEU 363 1126 1126 LEU LEU A . n 
A 1 364 ILE 364 1127 1127 ILE ILE A . n 
A 1 365 CYS 365 1128 1128 CYS CYS A . n 
A 1 366 ARG 366 1129 1129 ARG ARG A . n 
A 1 367 MET 367 1130 1130 MET MET A . n 
A 1 368 ALA 368 1131 1131 ALA ALA A . n 
A 1 369 ALA 369 1132 1132 ALA ALA A . n 
A 1 370 SER 370 1133 1133 SER SER A . n 
A 1 371 VAL 371 1134 1134 VAL VAL A . n 
A 1 372 LYS 372 1135 1135 LYS LYS A . n 
A 1 373 GLU 373 1136 1136 GLU GLU A . n 
A 1 374 GLN 374 1137 1137 GLN GLN A . n 
A 1 375 SER 375 1138 1138 SER SER A . n 
A 1 376 VAL 376 1139 ?    ?   ?   A . n 
A 1 377 ASP 377 1140 ?    ?   ?   A . n 
A 1 378 GLY 378 1141 ?    ?   ?   A . n 
A 1 379 GLY 379 1142 ?    ?   ?   A . n 
A 1 380 HIS 380 1143 ?    ?   ?   A . n 
A 1 381 HIS 381 1144 ?    ?   ?   A . n 
A 1 382 HIS 382 1145 ?    ?   ?   A . n 
A 1 383 HIS 383 1146 ?    ?   ?   A . n 
A 1 384 HIS 384 1147 ?    ?   ?   A . n 
A 1 385 HIS 385 1148 ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  1  1  HOH HOH A . 
B 2 HOH 2  2  2  HOH HOH A . 
B 2 HOH 3  3  3  HOH HOH A . 
B 2 HOH 4  4  4  HOH HOH A . 
B 2 HOH 5  5  5  HOH HOH A . 
B 2 HOH 6  6  6  HOH HOH A . 
B 2 HOH 7  7  7  HOH HOH A . 
B 2 HOH 8  8  8  HOH HOH A . 
B 2 HOH 9  9  9  HOH HOH A . 
B 2 HOH 10 10 10 HOH HOH A . 
B 2 HOH 11 11 11 HOH HOH A . 
B 2 HOH 12 12 12 HOH HOH A . 
B 2 HOH 13 13 13 HOH HOH A . 
B 2 HOH 14 14 14 HOH HOH A . 
B 2 HOH 15 15 15 HOH HOH A . 
B 2 HOH 16 16 16 HOH HOH A . 
B 2 HOH 17 17 17 HOH HOH A . 
B 2 HOH 18 18 18 HOH HOH A . 
B 2 HOH 19 19 19 HOH HOH A . 
B 2 HOH 20 20 20 HOH HOH A . 
B 2 HOH 21 21 21 HOH HOH A . 
B 2 HOH 22 22 22 HOH HOH A . 
B 2 HOH 23 23 23 HOH HOH A . 
B 2 HOH 24 24 24 HOH HOH A . 
B 2 HOH 25 25 25 HOH HOH A . 
B 2 HOH 26 26 26 HOH HOH A . 
B 2 HOH 27 27 27 HOH HOH A . 
B 2 HOH 28 28 28 HOH HOH A . 
B 2 HOH 29 29 29 HOH HOH A . 
B 2 HOH 30 30 30 HOH HOH A . 
B 2 HOH 31 31 31 HOH HOH A . 
B 2 HOH 32 32 32 HOH HOH A . 
B 2 HOH 33 33 33 HOH HOH A . 
B 2 HOH 34 34 34 HOH HOH A . 
B 2 HOH 35 35 35 HOH HOH A . 
B 2 HOH 36 36 36 HOH HOH A . 
B 2 HOH 37 37 37 HOH HOH A . 
B 2 HOH 38 38 38 HOH HOH A . 
B 2 HOH 39 39 39 HOH HOH A . 
B 2 HOH 40 40 40 HOH HOH A . 
B 2 HOH 41 41 41 HOH HOH A . 
B 2 HOH 42 42 42 HOH HOH A . 
B 2 HOH 43 43 43 HOH HOH A . 
B 2 HOH 44 44 44 HOH HOH A . 
B 2 HOH 45 45 45 HOH HOH A . 
B 2 HOH 46 46 46 HOH HOH A . 
B 2 HOH 47 47 47 HOH HOH A . 
B 2 HOH 48 48 48 HOH HOH A . 
B 2 HOH 49 49 49 HOH HOH A . 
B 2 HOH 50 50 50 HOH HOH A . 
B 2 HOH 51 51 51 HOH HOH A . 
B 2 HOH 52 52 52 HOH HOH A . 
B 2 HOH 53 53 53 HOH HOH A . 
B 2 HOH 54 54 54 HOH HOH A . 
B 2 HOH 55 55 55 HOH HOH A . 
B 2 HOH 56 56 56 HOH HOH A . 
B 2 HOH 57 57 57 HOH HOH A . 
B 2 HOH 58 59 59 HOH HOH A . 
B 2 HOH 59 60 60 HOH HOH A . 
B 2 HOH 60 61 61 HOH HOH A . 
B 2 HOH 61 62 62 HOH HOH A . 
B 2 HOH 62 63 63 HOH HOH A . 
B 2 HOH 63 64 64 HOH HOH A . 
B 2 HOH 64 65 65 HOH HOH A . 
B 2 HOH 65 66 66 HOH HOH A . 
B 2 HOH 66 67 67 HOH HOH A . 
B 2 HOH 67 68 68 HOH HOH A . 
B 2 HOH 68 69 69 HOH HOH A . 
B 2 HOH 69 70 70 HOH HOH A . 
B 2 HOH 70 71 71 HOH HOH A . 
B 2 HOH 71 72 72 HOH HOH A . 
B 2 HOH 72 73 73 HOH HOH A . 
B 2 HOH 73 74 74 HOH HOH A . 
B 2 HOH 74 75 75 HOH HOH A . 
B 2 HOH 75 76 76 HOH HOH A . 
B 2 HOH 76 77 77 HOH HOH A . 
B 2 HOH 77 78 78 HOH HOH A . 
B 2 HOH 78 79 79 HOH HOH A . 
B 2 HOH 79 80 80 HOH HOH A . 
B 2 HOH 80 81 81 HOH HOH A . 
B 2 HOH 81 82 82 HOH HOH A . 
B 2 HOH 82 83 83 HOH HOH A . 
B 2 HOH 83 84 84 HOH HOH A . 
B 2 HOH 84 85 85 HOH HOH A . 
B 2 HOH 85 86 86 HOH HOH A . 
B 2 HOH 86 87 87 HOH HOH A . 
B 2 HOH 87 88 88 HOH HOH A . 
B 2 HOH 88 89 89 HOH HOH A . 
B 2 HOH 89 90 90 HOH HOH A . 
B 2 HOH 90 91 91 HOH HOH A . 
B 2 HOH 91 92 92 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-09-21 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 40.2866 29.9049 16.2992 0.1196 0.1036 0.0752 0.0549  -0.0566 0.0176  0.7372  2.9169  4.0720 -0.0003 -0.8522 1.9243 
-0.0396 0.1204  0.0056 -0.4201 -0.0922 -0.0664 0.2446  -0.0953 0.1318  'X-RAY DIFFRACTION' 
2 ? refined 4.5865  44.3659 34.8649 0.0153 0.3296 0.2052 -0.0017 0.0511  -0.0537 25.9284 -0.2768 4.6215 0.9870  -2.1410 0.4026 
-0.7018 -0.0102 1.5445 0.6901  1.0275  -0.1524 -0.1348 -0.2380 -0.3257 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 B 1   1   B 91  92   ? A A 'X-RAY DIFFRACTION' ? 
2 1 A 3   766 A 223 986  ? A A 'X-RAY DIFFRACTION' ? 
3 2 A 224 987 A 375 1138 ? A A 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
MLPHARE   phasing          .      ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
In the GB (accession code BAA20836), it clearly shows that 973 is a PHE, not TYR. 
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 810 ? ? CG A ASP 810 ? ? OD2 A ASP 810 ? ? 124.11 118.30 5.81 0.90 N 
2 1 CB A ASP 837 ? ? CG A ASP 837 ? ? OD1 A ASP 837 ? ? 124.95 118.30 6.65 0.90 N 
3 1 CB A ASP 914 ? ? CG A ASP 914 ? ? OD2 A ASP 914 ? ? 123.93 118.30 5.63 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 772  ? ? -54.36  -71.37  
2 1 PHE A 813  ? ? -103.63 -65.49  
3 1 SER A 833  ? ? 40.38   -118.60 
4 1 SER A 859  ? ? 65.77   -0.77   
5 1 ASP A 862  ? ? -94.66  -119.11 
6 1 PRO A 931  ? ? -64.88  6.24    
7 1 ASP A 1054 ? ? 56.14   -120.25 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 764  ? A GLY 1   
2  1 Y 1 A SER 765  ? A SER 2   
3  1 Y 1 A LYS 1000 ? A LYS 237 
4  1 Y 1 A LEU 1001 ? A LEU 238 
5  1 Y 1 A SER 1002 ? A SER 239 
6  1 Y 1 A GLU 1003 ? A GLU 240 
7  1 Y 1 A TYR 1004 ? A TYR 241 
8  1 Y 1 A PRO 1005 ? A PRO 242 
9  1 Y 1 A ASN 1006 ? A ASN 243 
10 1 Y 1 A HIS 1062 ? A HIS 299 
11 1 Y 1 A SER 1063 ? A SER 300 
12 1 Y 1 A LYS 1064 ? A LYS 301 
13 1 Y 1 A ILE 1065 ? A ILE 302 
14 1 Y 1 A LEU 1066 ? A LEU 303 
15 1 Y 1 A ALA 1067 ? A ALA 304 
16 1 Y 1 A SER 1068 ? A SER 305 
17 1 Y 1 A THR 1069 ? A THR 306 
18 1 Y 1 A ALA 1070 ? A ALA 307 
19 1 Y 1 A ASP 1071 ? A ASP 308 
20 1 Y 1 A SER 1072 ? A SER 309 
21 1 Y 1 A LYS 1073 ? A LYS 310 
22 1 Y 1 A HIS 1074 ? A HIS 311 
23 1 Y 1 A ASP 1093 ? A ASP 330 
24 1 Y 1 A VAL 1139 ? A VAL 376 
25 1 Y 1 A ASP 1140 ? A ASP 377 
26 1 Y 1 A GLY 1141 ? A GLY 378 
27 1 Y 1 A GLY 1142 ? A GLY 379 
28 1 Y 1 A HIS 1143 ? A HIS 380 
29 1 Y 1 A HIS 1144 ? A HIS 381 
30 1 Y 1 A HIS 1145 ? A HIS 382 
31 1 Y 1 A HIS 1146 ? A HIS 383 
32 1 Y 1 A HIS 1147 ? A HIS 384 
33 1 Y 1 A HIS 1148 ? A HIS 385 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#